data_2COK
# 
_entry.id   2COK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2COK         
RCSB  RCSB024452   
WWPDB D_1000024452 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001003531.3 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2COK 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagashima, T.'                                          1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of BRCT domain of poly(ADP-ribose) polymerase-1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nagashima, T.' 1 
primary 'Hayashi, F.'   2 
primary 'Yokoyama, S.'  3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Poly [ADP-ribose] polymerase-1' 
_entity.formula_weight             12089.899 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.4.2.30 
_entity.pdbx_mutation              P101S 
_entity.pdbx_fragment              'BRCA1 C-turminus (BRCT) domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PARP-1, ADPRT, NAD(+) ADP-ribosyltransferase-1, Poly[ADP-ribose] synthetase-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFL
QDVSASTKSLQELFLAHILSSWGAEVKSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFL
QDVSASTKSLQELFLAHILSSWGAEVKSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001003531.3 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASP n 
1 9   LYS n 
1 10  PRO n 
1 11  LEU n 
1 12  SER n 
1 13  ASN n 
1 14  MET n 
1 15  LYS n 
1 16  ILE n 
1 17  LEU n 
1 18  THR n 
1 19  LEU n 
1 20  GLY n 
1 21  LYS n 
1 22  LEU n 
1 23  SER n 
1 24  ARG n 
1 25  ASN n 
1 26  LYS n 
1 27  ASP n 
1 28  GLU n 
1 29  VAL n 
1 30  LYS n 
1 31  ALA n 
1 32  MET n 
1 33  ILE n 
1 34  GLU n 
1 35  LYS n 
1 36  LEU n 
1 37  GLY n 
1 38  GLY n 
1 39  LYS n 
1 40  LEU n 
1 41  THR n 
1 42  GLY n 
1 43  THR n 
1 44  ALA n 
1 45  ASN n 
1 46  LYS n 
1 47  ALA n 
1 48  SER n 
1 49  LEU n 
1 50  CYS n 
1 51  ILE n 
1 52  SER n 
1 53  THR n 
1 54  LYS n 
1 55  LYS n 
1 56  GLU n 
1 57  VAL n 
1 58  GLU n 
1 59  LYS n 
1 60  MET n 
1 61  ASN n 
1 62  LYS n 
1 63  LYS n 
1 64  MET n 
1 65  GLU n 
1 66  GLU n 
1 67  VAL n 
1 68  LYS n 
1 69  GLU n 
1 70  ALA n 
1 71  ASN n 
1 72  ILE n 
1 73  ARG n 
1 74  VAL n 
1 75  VAL n 
1 76  SER n 
1 77  GLU n 
1 78  ASP n 
1 79  PHE n 
1 80  LEU n 
1 81  GLN n 
1 82  ASP n 
1 83  VAL n 
1 84  SER n 
1 85  ALA n 
1 86  SER n 
1 87  THR n 
1 88  LYS n 
1 89  SER n 
1 90  LEU n 
1 91  GLN n 
1 92  GLU n 
1 93  LEU n 
1 94  PHE n 
1 95  LEU n 
1 96  ALA n 
1 97  HIS n 
1 98  ILE n 
1 99  LEU n 
1 100 SER n 
1 101 SER n 
1 102 TRP n 
1 103 GLY n 
1 104 ALA n 
1 105 GLU n 
1 106 VAL n 
1 107 LYS n 
1 108 SER n 
1 109 GLY n 
1 110 PRO n 
1 111 SER n 
1 112 SER n 
1 113 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PARP1, ADPRT, PPOL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040809-01 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARP1_HUMAN 
_struct_ref.pdbx_db_accession          P09874 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSAST
KSLQELFLAHILSPWGAEVK
;
_struct_ref.pdbx_align_begin           386 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2COK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 107 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P09874 
_struct_ref_seq.db_align_beg                  386 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  485 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       107 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2COK GLY A 1   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 1   1  
1 2COK SER A 2   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 2   2  
1 2COK SER A 3   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 3   3  
1 2COK GLY A 4   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 4   4  
1 2COK SER A 5   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 5   5  
1 2COK SER A 6   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 6   6  
1 2COK GLY A 7   ? UNP P09874 ?   ?   'CLONING ARTIFACT' 7   7  
1 2COK SER A 101 ? UNP P09874 PRO 479 ENGINEERED         101 8  
1 2COK SER A 108 ? UNP P09874 ?   ?   'CLONING ARTIFACT' 108 9  
1 2COK GLY A 109 ? UNP P09874 ?   ?   'CLONING ARTIFACT' 109 10 
1 2COK PRO A 110 ? UNP P09874 ?   ?   'CLONING ARTIFACT' 110 11 
1 2COK SER A 111 ? UNP P09874 ?   ?   'CLONING ARTIFACT' 111 12 
1 2COK SER A 112 ? UNP P09874 ?   ?   'CLONING ARTIFACT' 112 13 
1 2COK GLY A 113 ? UNP P09874 ?   ?   'CLONING ARTIFACT' 113 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.19mM BRCT domain U-13C,15N; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2COK 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2COK 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function,structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2COK 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.901    'Kobayashi, N.' 4 
'structure solution' CYANA   1.0.7    'Guntert, P.'   5 
refinement           CYANA   1.0.7    'Guntert, P.'   6 
# 
_exptl.entry_id          2COK 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2COK 
_struct.title                     'Solution structure of BRCT domain of poly(ADP-ribose) polymerase-1' 
_struct.pdbx_descriptor           'Poly [ADP-ribose] polymerase-1 (E.C.2.4.2.30)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2COK 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;BRCT domain, DNA repair, Poly (ADP-ribose) polymerase-1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 25 ? LEU A 36 ? ASN A 25 LEU A 36 1 ? 12 
HELX_P HELX_P2 2 THR A 53 ? MET A 60 ? THR A 53 MET A 60 1 ? 8  
HELX_P HELX_P3 3 ASN A 61 ? ALA A 70 ? ASN A 61 ALA A 70 1 ? 10 
HELX_P HELX_P4 4 GLU A 77 ? ALA A 85 ? GLU A 77 ALA A 85 1 ? 9  
HELX_P HELX_P5 5 SER A 89 ? HIS A 97 ? SER A 89 HIS A 97 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 39 ? THR A 41 ? LYS A 39 THR A 41 
A 2 LYS A 15 ? THR A 18 ? LYS A 15 THR A 18 
A 3 LEU A 49 ? ILE A 51 ? LEU A 49 ILE A 51 
A 4 VAL A 74 ? VAL A 75 ? VAL A 74 VAL A 75 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 41 ? O THR A 41 N ILE A 16 ? N ILE A 16 
A 2 3 N LEU A 17 ? N LEU A 17 O ILE A 51 ? O ILE A 51 
A 3 4 N CYS A 50 ? N CYS A 50 O VAL A 75 ? O VAL A 75 
# 
_database_PDB_matrix.entry_id          2COK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2COK 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -17.784 23.766  -11.926 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -16.565 24.479  -12.267 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -15.586 23.567  -13.010 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -15.984 22.544  -13.565 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -18.035 23.798  -10.958 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -16.806 25.342  -12.888 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -16.095 24.859  -11.360 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -14.324 23.971  -12.998 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -13.286 23.203  -13.664 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -11.923 23.860  -13.438 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -11.509 24.722  -14.212 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -13.571 23.074  -15.161 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -12.527 22.387  -15.846 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -14.009 24.805  -12.544 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -13.316 22.216  -13.202 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -14.511 22.542  -15.307 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -13.696 24.067  -15.594 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -12.573 22.583  -16.825 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -11.263 23.429  -12.373 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -9.955  23.964  -12.035 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -9.346  23.169  -10.879 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -10.066 22.682  -10.009 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -10.045 25.447  -11.670 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -8.761  26.017  -11.430 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -11.606 22.728  -11.748 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -9.354  23.849  -12.937 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -10.537 25.990  -12.476 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -10.666 25.565  -10.781 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -8.386  25.666  -10.571 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -8.026  23.061  -10.908 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -7.312  22.333  -9.873  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -6.899  20.944  -10.365 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -7.633  19.974  -10.182 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -7.447  23.460  -11.619 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -6.427  22.894  -9.573  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -7.943  22.237  -8.989  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -5.727  20.893  -10.980 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -5.208  19.640  -11.500 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -3.698  19.750  -11.721 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -3.140  20.845  -11.684 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -5.909  19.252  -12.804 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -7.141  18.576  -12.567 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -5.137  21.688  -11.125 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -5.430  18.896  -10.734 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -6.094  20.149  -13.396 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -5.251  18.612  -13.392 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -7.867  18.987  -13.118 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -3.080  18.600  -11.946 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -1.646  18.553  -12.173 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -0.903  19.041  -10.928 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -0.880  20.238  -10.643 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -1.253  19.394  -13.389 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -1.470  18.697  -14.613 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -3.541  17.713  -11.975 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -1.418  17.505  -12.368 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -1.829  20.319  -13.392 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -0.202  19.674  -13.313 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -0.647  18.735  -15.179 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -0.313  18.090  -10.219 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 0.429   18.408  -9.011  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 1.242   17.203  -8.534  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 1.444   16.249  -9.284  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -0.336  17.119  -10.457 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 1.096   19.249  -9.200  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -0.261  18.719  -8.227  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ASP A 1 8   ? 1.688   17.286  -7.288  1.00 0.00 ? 8   ASP A N    1  
ATOM 67    C CA   . ASP A 1 8   ? 2.475   16.214  -6.702  1.00 0.00 ? 8   ASP A CA   1  
ATOM 68    C C    . ASP A 1 8   ? 1.566   15.015  -6.423  1.00 0.00 ? 8   ASP A C    1  
ATOM 69    O O    . ASP A 1 8   ? 0.940   14.939  -5.367  1.00 0.00 ? 8   ASP A O    1  
ATOM 70    C CB   . ASP A 1 8   ? 3.101   16.652  -5.377  1.00 0.00 ? 8   ASP A CB   1  
ATOM 71    C CG   . ASP A 1 8   ? 4.516   16.126  -5.125  1.00 0.00 ? 8   ASP A CG   1  
ATOM 72    O OD1  . ASP A 1 8   ? 5.349   16.278  -6.044  1.00 0.00 ? 8   ASP A OD1  1  
ATOM 73    O OD2  . ASP A 1 8   ? 4.731   15.584  -4.020  1.00 0.00 ? 8   ASP A OD2  1  
ATOM 74    H H    . ASP A 1 8   ? 1.519   18.065  -6.685  1.00 0.00 ? 8   ASP A H    1  
ATOM 75    H HA   . ASP A 1 8   ? 3.246   15.990  -7.438  1.00 0.00 ? 8   ASP A HA   1  
ATOM 76    H HB2  . ASP A 1 8   ? 3.123   17.741  -5.345  1.00 0.00 ? 8   ASP A HB2  1  
ATOM 77    H HB3  . ASP A 1 8   ? 2.457   16.323  -4.562  1.00 0.00 ? 8   ASP A HB3  1  
ATOM 78    N N    . LYS A 1 9   ? 1.525   14.107  -7.387  1.00 0.00 ? 9   LYS A N    1  
ATOM 79    C CA   . LYS A 1 9   ? 0.704   12.915  -7.258  1.00 0.00 ? 9   LYS A CA   1  
ATOM 80    C C    . LYS A 1 9   ? 1.535   11.686  -7.629  1.00 0.00 ? 9   LYS A C    1  
ATOM 81    O O    . LYS A 1 9   ? 1.613   11.315  -8.799  1.00 0.00 ? 9   LYS A O    1  
ATOM 82    C CB   . LYS A 1 9   ? -0.581  13.058  -8.076  1.00 0.00 ? 9   LYS A CB   1  
ATOM 83    C CG   . LYS A 1 9   ? -1.223  14.429  -7.853  1.00 0.00 ? 9   LYS A CG   1  
ATOM 84    C CD   . LYS A 1 9   ? -2.749  14.338  -7.919  1.00 0.00 ? 9   LYS A CD   1  
ATOM 85    C CE   . LYS A 1 9   ? -3.283  14.995  -9.193  1.00 0.00 ? 9   LYS A CE   1  
ATOM 86    N NZ   . LYS A 1 9   ? -4.731  15.274  -9.064  1.00 0.00 ? 9   LYS A NZ   1  
ATOM 87    H H    . LYS A 1 9   ? 2.038   14.176  -8.242  1.00 0.00 ? 9   LYS A H    1  
ATOM 88    H HA   . LYS A 1 9   ? 0.412   12.831  -6.211  1.00 0.00 ? 9   LYS A HA   1  
ATOM 89    H HB2  . LYS A 1 9   ? -0.360  12.924  -9.134  1.00 0.00 ? 9   LYS A HB2  1  
ATOM 90    H HB3  . LYS A 1 9   ? -1.284  12.274  -7.795  1.00 0.00 ? 9   LYS A HB3  1  
ATOM 91    H HG2  . LYS A 1 9   ? -0.920  14.823  -6.883  1.00 0.00 ? 9   LYS A HG2  1  
ATOM 92    H HG3  . LYS A 1 9   ? -0.864  15.129  -8.608  1.00 0.00 ? 9   LYS A HG3  1  
ATOM 93    H HD2  . LYS A 1 9   ? -3.056  13.292  -7.889  1.00 0.00 ? 9   LYS A HD2  1  
ATOM 94    H HD3  . LYS A 1 9   ? -3.184  14.823  -7.045  1.00 0.00 ? 9   LYS A HD3  1  
ATOM 95    H HE2  . LYS A 1 9   ? -2.744  15.922  -9.384  1.00 0.00 ? 9   LYS A HE2  1  
ATOM 96    H HE3  . LYS A 1 9   ? -3.108  14.342  -10.047 1.00 0.00 ? 9   LYS A HE3  1  
ATOM 97    H HZ1  . LYS A 1 9   ? -4.912  16.222  -9.326  1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 98    H HZ2  . LYS A 1 9   ? -5.244  14.659  -9.662  1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 99    H HZ3  . LYS A 1 9   ? -5.015  15.131  -8.115  1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 100   N N    . PRO A 1 10  ? 2.152   11.072  -6.584  1.00 0.00 ? 10  PRO A N    1  
ATOM 101   C CA   . PRO A 1 10  ? 2.975   9.892   -6.788  1.00 0.00 ? 10  PRO A CA   1  
ATOM 102   C C    . PRO A 1 10  ? 2.109   8.658   -7.047  1.00 0.00 ? 10  PRO A C    1  
ATOM 103   O O    . PRO A 1 10  ? 2.264   7.988   -8.067  1.00 0.00 ? 10  PRO A O    1  
ATOM 104   C CB   . PRO A 1 10  ? 3.815   9.774   -5.527  1.00 0.00 ? 10  PRO A CB   1  
ATOM 105   C CG   . PRO A 1 10  ? 3.106   10.613  -4.475  1.00 0.00 ? 10  PRO A CG   1  
ATOM 106   C CD   . PRO A 1 10  ? 2.083   11.483  -5.185  1.00 0.00 ? 10  PRO A CD   1  
ATOM 107   H HA   . PRO A 1 10  ? 3.544   10.002  -7.603  1.00 0.00 ? 10  PRO A HA   1  
ATOM 108   H HB2  . PRO A 1 10  ? 3.897   8.735   -5.208  1.00 0.00 ? 10  PRO A HB2  1  
ATOM 109   H HB3  . PRO A 1 10  ? 4.829   10.137  -5.697  1.00 0.00 ? 10  PRO A HB3  1  
ATOM 110   H HG2  . PRO A 1 10  ? 2.619   9.971   -3.741  1.00 0.00 ? 10  PRO A HG2  1  
ATOM 111   H HG3  . PRO A 1 10  ? 3.823   11.230  -3.933  1.00 0.00 ? 10  PRO A HG3  1  
ATOM 112   H HD2  . PRO A 1 10  ? 1.083   11.332  -4.777  1.00 0.00 ? 10  PRO A HD2  1  
ATOM 113   H HD3  . PRO A 1 10  ? 2.316   12.542  -5.071  1.00 0.00 ? 10  PRO A HD3  1  
ATOM 114   N N    . LEU A 1 11  ? 1.215   8.393   -6.105  1.00 0.00 ? 11  LEU A N    1  
ATOM 115   C CA   . LEU A 1 11  ? 0.324   7.251   -6.218  1.00 0.00 ? 11  LEU A CA   1  
ATOM 116   C C    . LEU A 1 11  ? -0.652  7.484   -7.373  1.00 0.00 ? 11  LEU A C    1  
ATOM 117   O O    . LEU A 1 11  ? -1.380  6.574   -7.769  1.00 0.00 ? 11  LEU A O    1  
ATOM 118   C CB   . LEU A 1 11  ? -0.362  6.972   -4.879  1.00 0.00 ? 11  LEU A CB   1  
ATOM 119   C CG   . LEU A 1 11  ? 0.535   6.426   -3.767  1.00 0.00 ? 11  LEU A CG   1  
ATOM 120   C CD1  . LEU A 1 11  ? 1.571   5.449   -4.328  1.00 0.00 ? 11  LEU A CD1  1  
ATOM 121   C CD2  . LEU A 1 11  ? 1.188   7.565   -2.980  1.00 0.00 ? 11  LEU A CD2  1  
ATOM 122   H H    . LEU A 1 11  ? 1.095   8.943   -5.278  1.00 0.00 ? 11  LEU A H    1  
ATOM 123   H HA   . LEU A 1 11  ? 0.937   6.381   -6.454  1.00 0.00 ? 11  LEU A HA   1  
ATOM 124   H HB2  . LEU A 1 11  ? -0.820  7.897   -4.529  1.00 0.00 ? 11  LEU A HB2  1  
ATOM 125   H HB3  . LEU A 1 11  ? -1.170  6.261   -5.049  1.00 0.00 ? 11  LEU A HB3  1  
ATOM 126   H HG   . LEU A 1 11  ? -0.088  5.868   -3.068  1.00 0.00 ? 11  LEU A HG   1  
ATOM 127   H HD11 . LEU A 1 11  ? 2.359   6.007   -4.833  1.00 0.00 ? 11  LEU A HD11 1  
ATOM 128   H HD12 . LEU A 1 11  ? 2.002   4.869   -3.512  1.00 0.00 ? 11  LEU A HD12 1  
ATOM 129   H HD13 . LEU A 1 11  ? 1.089   4.776   -5.037  1.00 0.00 ? 11  LEU A HD13 1  
ATOM 130   H HD21 . LEU A 1 11  ? 1.802   8.165   -3.652  1.00 0.00 ? 11  LEU A HD21 1  
ATOM 131   H HD22 . LEU A 1 11  ? 0.414   8.192   -2.539  1.00 0.00 ? 11  LEU A HD22 1  
ATOM 132   H HD23 . LEU A 1 11  ? 1.813   7.149   -2.190  1.00 0.00 ? 11  LEU A HD23 1  
ATOM 133   N N    . SER A 1 12  ? -0.637  8.708   -7.881  1.00 0.00 ? 12  SER A N    1  
ATOM 134   C CA   . SER A 1 12  ? -1.513  9.071   -8.982  1.00 0.00 ? 12  SER A CA   1  
ATOM 135   C C    . SER A 1 12  ? -1.629  7.905   -9.965  1.00 0.00 ? 12  SER A C    1  
ATOM 136   O O    . SER A 1 12  ? -0.694  7.622   -10.712 1.00 0.00 ? 12  SER A O    1  
ATOM 137   C CB   . SER A 1 12  ? -1.003  10.322  -9.701  1.00 0.00 ? 12  SER A CB   1  
ATOM 138   O OG   . SER A 1 12  ? -2.067  11.088  -10.260 1.00 0.00 ? 12  SER A OG   1  
ATOM 139   H H    . SER A 1 12  ? -0.043  9.442   -7.553  1.00 0.00 ? 12  SER A H    1  
ATOM 140   H HA   . SER A 1 12  ? -2.479  9.284   -8.525  1.00 0.00 ? 12  SER A HA   1  
ATOM 141   H HB2  . SER A 1 12  ? -0.442  10.940  -8.999  1.00 0.00 ? 12  SER A HB2  1  
ATOM 142   H HB3  . SER A 1 12  ? -0.312  10.030  -10.491 1.00 0.00 ? 12  SER A HB3  1  
ATOM 143   H HG   . SER A 1 12  ? -1.795  12.047  -10.335 1.00 0.00 ? 12  SER A HG   1  
ATOM 144   N N    . ASN A 1 13  ? -2.786  7.259   -9.933  1.00 0.00 ? 13  ASN A N    1  
ATOM 145   C CA   . ASN A 1 13  ? -3.037  6.130   -10.813 1.00 0.00 ? 13  ASN A CA   1  
ATOM 146   C C    . ASN A 1 13  ? -2.416  4.870   -10.206 1.00 0.00 ? 13  ASN A C    1  
ATOM 147   O O    . ASN A 1 13  ? -1.622  4.190   -10.856 1.00 0.00 ? 13  ASN A O    1  
ATOM 148   C CB   . ASN A 1 13  ? -2.406  6.352   -12.189 1.00 0.00 ? 13  ASN A CB   1  
ATOM 149   C CG   . ASN A 1 13  ? -3.295  5.784   -13.297 1.00 0.00 ? 13  ASN A CG   1  
ATOM 150   O OD1  . ASN A 1 13  ? -3.807  4.680   -13.213 1.00 0.00 ? 13  ASN A OD1  1  
ATOM 151   N ND2  . ASN A 1 13  ? -3.448  6.597   -14.338 1.00 0.00 ? 13  ASN A ND2  1  
ATOM 152   H H    . ASN A 1 13  ? -3.541  7.496   -9.323  1.00 0.00 ? 13  ASN A H    1  
ATOM 153   H HA   . ASN A 1 13  ? -4.122  6.064   -10.891 1.00 0.00 ? 13  ASN A HA   1  
ATOM 154   H HB2  . ASN A 1 13  ? -2.251  7.419   -12.353 1.00 0.00 ? 13  ASN A HB2  1  
ATOM 155   H HB3  . ASN A 1 13  ? -1.425  5.878   -12.225 1.00 0.00 ? 13  ASN A HB3  1  
ATOM 156   H HD21 . ASN A 1 13  ? -2.999  7.491   -14.345 1.00 0.00 ? 13  ASN A HD21 1  
ATOM 157   H HD22 . ASN A 1 13  ? -4.011  6.315   -15.115 1.00 0.00 ? 13  ASN A HD22 1  
ATOM 158   N N    . MET A 1 14  ? -2.801  4.595   -8.969  1.00 0.00 ? 14  MET A N    1  
ATOM 159   C CA   . MET A 1 14  ? -2.292  3.429   -8.268  1.00 0.00 ? 14  MET A CA   1  
ATOM 160   C C    . MET A 1 14  ? -3.261  2.982   -7.171  1.00 0.00 ? 14  MET A C    1  
ATOM 161   O O    . MET A 1 14  ? -3.673  3.787   -6.337  1.00 0.00 ? 14  MET A O    1  
ATOM 162   C CB   . MET A 1 14  ? -0.934  3.759   -7.646  1.00 0.00 ? 14  MET A CB   1  
ATOM 163   C CG   . MET A 1 14  ? 0.086   4.132   -8.723  1.00 0.00 ? 14  MET A CG   1  
ATOM 164   S SD   . MET A 1 14  ? 1.721   4.220   -8.012  1.00 0.00 ? 14  MET A SD   1  
ATOM 165   C CE   . MET A 1 14  ? 1.798   2.625   -7.214  1.00 0.00 ? 14  MET A CE   1  
ATOM 166   H H    . MET A 1 14  ? -3.447  5.153   -8.448  1.00 0.00 ? 14  MET A H    1  
ATOM 167   H HA   . MET A 1 14  ? -2.204  2.649   -9.024  1.00 0.00 ? 14  MET A HA   1  
ATOM 168   H HB2  . MET A 1 14  ? -1.043  4.584   -6.942  1.00 0.00 ? 14  MET A HB2  1  
ATOM 169   H HB3  . MET A 1 14  ? -0.572  2.901   -7.079  1.00 0.00 ? 14  MET A HB3  1  
ATOM 170   H HG2  . MET A 1 14  ? 0.069   3.393   -9.524  1.00 0.00 ? 14  MET A HG2  1  
ATOM 171   H HG3  . MET A 1 14  ? -0.178  5.092   -9.169  1.00 0.00 ? 14  MET A HG3  1  
ATOM 172   H HE1  . MET A 1 14  ? 2.823   2.255   -7.240  1.00 0.00 ? 14  MET A HE1  1  
ATOM 173   H HE2  . MET A 1 14  ? 1.473   2.721   -6.178  1.00 0.00 ? 14  MET A HE2  1  
ATOM 174   H HE3  . MET A 1 14  ? 1.146   1.926   -7.737  1.00 0.00 ? 14  MET A HE3  1  
ATOM 175   N N    . LYS A 1 15  ? -3.597  1.701   -7.208  1.00 0.00 ? 15  LYS A N    1  
ATOM 176   C CA   . LYS A 1 15  ? -4.509  1.138   -6.228  1.00 0.00 ? 15  LYS A CA   1  
ATOM 177   C C    . LYS A 1 15  ? -3.707  0.596   -5.043  1.00 0.00 ? 15  LYS A C    1  
ATOM 178   O O    . LYS A 1 15  ? -3.030  -0.424  -5.162  1.00 0.00 ? 15  LYS A O    1  
ATOM 179   C CB   . LYS A 1 15  ? -5.422  0.097   -6.881  1.00 0.00 ? 15  LYS A CB   1  
ATOM 180   C CG   . LYS A 1 15  ? -6.690  0.750   -7.434  1.00 0.00 ? 15  LYS A CG   1  
ATOM 181   C CD   . LYS A 1 15  ? -7.107  0.103   -8.756  1.00 0.00 ? 15  LYS A CD   1  
ATOM 182   C CE   . LYS A 1 15  ? -8.517  0.538   -9.159  1.00 0.00 ? 15  LYS A CE   1  
ATOM 183   N NZ   . LYS A 1 15  ? -8.853  0.028   -10.507 1.00 0.00 ? 15  LYS A NZ   1  
ATOM 184   H H    . LYS A 1 15  ? -3.257  1.053   -7.890  1.00 0.00 ? 15  LYS A H    1  
ATOM 185   H HA   . LYS A 1 15  ? -5.147  1.947   -5.872  1.00 0.00 ? 15  LYS A HA   1  
ATOM 186   H HB2  . LYS A 1 15  ? -4.887  -0.407  -7.685  1.00 0.00 ? 15  LYS A HB2  1  
ATOM 187   H HB3  . LYS A 1 15  ? -5.690  -0.665  -6.150  1.00 0.00 ? 15  LYS A HB3  1  
ATOM 188   H HG2  . LYS A 1 15  ? -7.498  0.657   -6.709  1.00 0.00 ? 15  LYS A HG2  1  
ATOM 189   H HG3  . LYS A 1 15  ? -6.518  1.816   -7.585  1.00 0.00 ? 15  LYS A HG3  1  
ATOM 190   H HD2  . LYS A 1 15  ? -6.400  0.378   -9.539  1.00 0.00 ? 15  LYS A HD2  1  
ATOM 191   H HD3  . LYS A 1 15  ? -7.071  -0.982  -8.662  1.00 0.00 ? 15  LYS A HD3  1  
ATOM 192   H HE2  . LYS A 1 15  ? -9.240  0.166   -8.433  1.00 0.00 ? 15  LYS A HE2  1  
ATOM 193   H HE3  . LYS A 1 15  ? -8.586  1.626   -9.148  1.00 0.00 ? 15  LYS A HE3  1  
ATOM 194   H HZ1  . LYS A 1 15  ? -9.215  -0.901  -10.431 1.00 0.00 ? 15  LYS A HZ1  1  
ATOM 195   H HZ2  . LYS A 1 15  ? -9.540  0.621   -10.927 1.00 0.00 ? 15  LYS A HZ2  1  
ATOM 196   H HZ3  . LYS A 1 15  ? -8.029  0.019   -11.074 1.00 0.00 ? 15  LYS A HZ3  1  
ATOM 197   N N    . ILE A 1 16  ? -3.811  1.302   -3.927  1.00 0.00 ? 16  ILE A N    1  
ATOM 198   C CA   . ILE A 1 16  ? -3.104  0.904   -2.721  1.00 0.00 ? 16  ILE A CA   1  
ATOM 199   C C    . ILE A 1 16  ? -4.044  0.093   -1.827  1.00 0.00 ? 16  ILE A C    1  
ATOM 200   O O    . ILE A 1 16  ? -5.221  0.427   -1.694  1.00 0.00 ? 16  ILE A O    1  
ATOM 201   C CB   . ILE A 1 16  ? -2.497  2.126   -2.028  1.00 0.00 ? 16  ILE A CB   1  
ATOM 202   C CG1  . ILE A 1 16  ? -1.481  2.822   -2.935  1.00 0.00 ? 16  ILE A CG1  1  
ATOM 203   C CG2  . ILE A 1 16  ? -1.892  1.745   -0.675  1.00 0.00 ? 16  ILE A CG2  1  
ATOM 204   C CD1  . ILE A 1 16  ? -2.164  3.425   -4.164  1.00 0.00 ? 16  ILE A CD1  1  
ATOM 205   H H    . ILE A 1 16  ? -4.364  2.130   -3.838  1.00 0.00 ? 16  ILE A H    1  
ATOM 206   H HA   . ILE A 1 16  ? -2.277  0.262   -3.025  1.00 0.00 ? 16  ILE A HA   1  
ATOM 207   H HB   . ILE A 1 16  ? -3.297  2.840   -1.833  1.00 0.00 ? 16  ILE A HB   1  
ATOM 208   H HG12 . ILE A 1 16  ? -0.969  3.607   -2.378  1.00 0.00 ? 16  ILE A HG12 1  
ATOM 209   H HG13 . ILE A 1 16  ? -0.720  2.108   -3.251  1.00 0.00 ? 16  ILE A HG13 1  
ATOM 210   H HG21 . ILE A 1 16  ? -2.104  2.529   0.051   1.00 0.00 ? 16  ILE A HG21 1  
ATOM 211   H HG22 . ILE A 1 16  ? -2.328  0.806   -0.334  1.00 0.00 ? 16  ILE A HG22 1  
ATOM 212   H HG23 . ILE A 1 16  ? -0.814  1.628   -0.780  1.00 0.00 ? 16  ILE A HG23 1  
ATOM 213   H HD11 . ILE A 1 16  ? -2.153  2.700   -4.978  1.00 0.00 ? 16  ILE A HD11 1  
ATOM 214   H HD12 . ILE A 1 16  ? -3.195  3.679   -3.918  1.00 0.00 ? 16  ILE A HD12 1  
ATOM 215   H HD13 . ILE A 1 16  ? -1.632  4.325   -4.471  1.00 0.00 ? 16  ILE A HD13 1  
ATOM 216   N N    . LEU A 1 17  ? -3.490  -0.956  -1.238  1.00 0.00 ? 17  LEU A N    1  
ATOM 217   C CA   . LEU A 1 17  ? -4.265  -1.817  -0.360  1.00 0.00 ? 17  LEU A CA   1  
ATOM 218   C C    . LEU A 1 17  ? -3.735  -1.690  1.070   1.00 0.00 ? 17  LEU A C    1  
ATOM 219   O O    . LEU A 1 17  ? -2.555  -1.411  1.275   1.00 0.00 ? 17  LEU A O    1  
ATOM 220   C CB   . LEU A 1 17  ? -4.273  -3.253  -0.888  1.00 0.00 ? 17  LEU A CB   1  
ATOM 221   C CG   . LEU A 1 17  ? -5.153  -4.243  -0.124  1.00 0.00 ? 17  LEU A CG   1  
ATOM 222   C CD1  . LEU A 1 17  ? -6.439  -4.543  -0.897  1.00 0.00 ? 17  LEU A CD1  1  
ATOM 223   C CD2  . LEU A 1 17  ? -4.378  -5.518  0.215   1.00 0.00 ? 17  LEU A CD2  1  
ATOM 224   H H    . LEU A 1 17  ? -2.533  -1.220  -1.351  1.00 0.00 ? 17  LEU A H    1  
ATOM 225   H HA   . LEU A 1 17  ? -5.295  -1.461  -0.379  1.00 0.00 ? 17  LEU A HA   1  
ATOM 226   H HB2  . LEU A 1 17  ? -4.598  -3.235  -1.928  1.00 0.00 ? 17  LEU A HB2  1  
ATOM 227   H HB3  . LEU A 1 17  ? -3.249  -3.627  -0.881  1.00 0.00 ? 17  LEU A HB3  1  
ATOM 228   H HG   . LEU A 1 17  ? -5.445  -3.784  0.820   1.00 0.00 ? 17  LEU A HG   1  
ATOM 229   H HD11 . LEU A 1 17  ? -6.679  -5.602  -0.807  1.00 0.00 ? 17  LEU A HD11 1  
ATOM 230   H HD12 . LEU A 1 17  ? -7.256  -3.949  -0.487  1.00 0.00 ? 17  LEU A HD12 1  
ATOM 231   H HD13 . LEU A 1 17  ? -6.299  -4.290  -1.948  1.00 0.00 ? 17  LEU A HD13 1  
ATOM 232   H HD21 . LEU A 1 17  ? -5.036  -6.381  0.112   1.00 0.00 ? 17  LEU A HD21 1  
ATOM 233   H HD22 . LEU A 1 17  ? -3.534  -5.622  -0.467  1.00 0.00 ? 17  LEU A HD22 1  
ATOM 234   H HD23 . LEU A 1 17  ? -4.013  -5.459  1.240   1.00 0.00 ? 17  LEU A HD23 1  
ATOM 235   N N    . THR A 1 18  ? -4.633  -1.901  2.021   1.00 0.00 ? 18  THR A N    1  
ATOM 236   C CA   . THR A 1 18  ? -4.270  -1.814  3.425   1.00 0.00 ? 18  THR A CA   1  
ATOM 237   C C    . THR A 1 18  ? -4.750  -3.056  4.178   1.00 0.00 ? 18  THR A C    1  
ATOM 238   O O    . THR A 1 18  ? -5.781  -3.633  3.837   1.00 0.00 ? 18  THR A O    1  
ATOM 239   C CB   . THR A 1 18  ? -4.842  -0.508  3.981   1.00 0.00 ? 18  THR A CB   1  
ATOM 240   O OG1  . THR A 1 18  ? -6.242  -0.609  3.734   1.00 0.00 ? 18  THR A OG1  1  
ATOM 241   C CG2  . THR A 1 18  ? -4.408  0.714   3.169   1.00 0.00 ? 18  THR A CG2  1  
ATOM 242   H H    . THR A 1 18  ? -5.591  -2.127  1.845   1.00 0.00 ? 18  THR A H    1  
ATOM 243   H HA   . THR A 1 18  ? -3.183  -1.795  3.499   1.00 0.00 ? 18  THR A HA   1  
ATOM 244   H HB   . THR A 1 18  ? -4.586  -0.387  5.033   1.00 0.00 ? 18  THR A HB   1  
ATOM 245   H HG1  . THR A 1 18  ? -6.423  -0.527  2.754   1.00 0.00 ? 18  THR A HG1  1  
ATOM 246   H HG21 . THR A 1 18  ? -4.926  1.599   3.539   1.00 0.00 ? 18  THR A HG21 1  
ATOM 247   H HG22 . THR A 1 18  ? -3.332  0.854   3.270   1.00 0.00 ? 18  THR A HG22 1  
ATOM 248   H HG23 . THR A 1 18  ? -4.657  0.560   2.119   1.00 0.00 ? 18  THR A HG23 1  
ATOM 249   N N    . LEU A 1 19  ? -3.979  -3.431  5.188   1.00 0.00 ? 19  LEU A N    1  
ATOM 250   C CA   . LEU A 1 19  ? -4.312  -4.595  5.992   1.00 0.00 ? 19  LEU A CA   1  
ATOM 251   C C    . LEU A 1 19  ? -4.002  -4.300  7.461   1.00 0.00 ? 19  LEU A C    1  
ATOM 252   O O    . LEU A 1 19  ? -3.416  -3.267  7.780   1.00 0.00 ? 19  LEU A O    1  
ATOM 253   C CB   . LEU A 1 19  ? -3.606  -5.840  5.451   1.00 0.00 ? 19  LEU A CB   1  
ATOM 254   C CG   . LEU A 1 19  ? -4.514  -6.942  4.904   1.00 0.00 ? 19  LEU A CG   1  
ATOM 255   C CD1  . LEU A 1 19  ? -3.696  -8.037  4.217   1.00 0.00 ? 19  LEU A CD1  1  
ATOM 256   C CD2  . LEU A 1 19  ? -5.416  -7.506  6.004   1.00 0.00 ? 19  LEU A CD2  1  
ATOM 257   H H    . LEU A 1 19  ? -3.142  -2.956  5.458   1.00 0.00 ? 19  LEU A H    1  
ATOM 258   H HA   . LEU A 1 19  ? -5.384  -4.764  5.892   1.00 0.00 ? 19  LEU A HA   1  
ATOM 259   H HB2  . LEU A 1 19  ? -2.924  -5.531  4.659   1.00 0.00 ? 19  LEU A HB2  1  
ATOM 260   H HB3  . LEU A 1 19  ? -2.996  -6.262  6.250   1.00 0.00 ? 19  LEU A HB3  1  
ATOM 261   H HG   . LEU A 1 19  ? -5.165  -6.504  4.147   1.00 0.00 ? 19  LEU A HG   1  
ATOM 262   H HD11 . LEU A 1 19  ? -3.793  -8.968  4.775   1.00 0.00 ? 19  LEU A HD11 1  
ATOM 263   H HD12 . LEU A 1 19  ? -4.064  -8.182  3.201   1.00 0.00 ? 19  LEU A HD12 1  
ATOM 264   H HD13 . LEU A 1 19  ? -2.647  -7.740  4.184   1.00 0.00 ? 19  LEU A HD13 1  
ATOM 265   H HD21 . LEU A 1 19  ? -6.161  -8.167  5.560   1.00 0.00 ? 19  LEU A HD21 1  
ATOM 266   H HD22 . LEU A 1 19  ? -4.812  -8.066  6.717   1.00 0.00 ? 19  LEU A HD22 1  
ATOM 267   H HD23 . LEU A 1 19  ? -5.918  -6.686  6.518   1.00 0.00 ? 19  LEU A HD23 1  
ATOM 268   N N    . GLY A 1 20  ? -4.408  -5.227  8.316   1.00 0.00 ? 20  GLY A N    1  
ATOM 269   C CA   . GLY A 1 20  ? -4.181  -5.080  9.743   1.00 0.00 ? 20  GLY A CA   1  
ATOM 270   C C    . GLY A 1 20  ? -4.583  -3.683  10.221  1.00 0.00 ? 20  GLY A C    1  
ATOM 271   O O    . GLY A 1 20  ? -5.512  -3.083  9.683   1.00 0.00 ? 20  GLY A O    1  
ATOM 272   H H    . GLY A 1 20  ? -4.884  -6.065  8.048   1.00 0.00 ? 20  GLY A H    1  
ATOM 273   H HA2  . GLY A 1 20  ? -4.752  -5.833  10.286  1.00 0.00 ? 20  GLY A HA2  1  
ATOM 274   H HA3  . GLY A 1 20  ? -3.129  -5.256  9.967   1.00 0.00 ? 20  GLY A HA3  1  
ATOM 275   N N    . LYS A 1 21  ? -3.865  -3.207  11.227  1.00 0.00 ? 21  LYS A N    1  
ATOM 276   C CA   . LYS A 1 21  ? -4.135  -1.893  11.784  1.00 0.00 ? 21  LYS A CA   1  
ATOM 277   C C    . LYS A 1 21  ? -2.900  -1.007  11.613  1.00 0.00 ? 21  LYS A C    1  
ATOM 278   O O    . LYS A 1 21  ? -1.789  -1.413  11.952  1.00 0.00 ? 21  LYS A O    1  
ATOM 279   C CB   . LYS A 1 21  ? -4.610  -2.012  13.234  1.00 0.00 ? 21  LYS A CB   1  
ATOM 280   C CG   . LYS A 1 21  ? -4.854  -0.632  13.847  1.00 0.00 ? 21  LYS A CG   1  
ATOM 281   C CD   . LYS A 1 21  ? -6.189  -0.051  13.377  1.00 0.00 ? 21  LYS A CD   1  
ATOM 282   C CE   . LYS A 1 21  ? -6.408  1.351   13.949  1.00 0.00 ? 21  LYS A CE   1  
ATOM 283   N NZ   . LYS A 1 21  ? -6.526  1.298   15.423  1.00 0.00 ? 21  LYS A NZ   1  
ATOM 284   H H    . LYS A 1 21  ? -3.111  -3.703  11.660  1.00 0.00 ? 21  LYS A H    1  
ATOM 285   H HA   . LYS A 1 21  ? -4.954  -1.458  11.212  1.00 0.00 ? 21  LYS A HA   1  
ATOM 286   H HB2  . LYS A 1 21  ? -5.529  -2.598  13.273  1.00 0.00 ? 21  LYS A HB2  1  
ATOM 287   H HB3  . LYS A 1 21  ? -3.866  -2.549  13.821  1.00 0.00 ? 21  LYS A HB3  1  
ATOM 288   H HG2  . LYS A 1 21  ? -4.848  -0.706  14.934  1.00 0.00 ? 21  LYS A HG2  1  
ATOM 289   H HG3  . LYS A 1 21  ? -4.043  0.041   13.569  1.00 0.00 ? 21  LYS A HG3  1  
ATOM 290   H HD2  . LYS A 1 21  ? -6.210  -0.011  12.288  1.00 0.00 ? 21  LYS A HD2  1  
ATOM 291   H HD3  . LYS A 1 21  ? -7.004  -0.705  13.688  1.00 0.00 ? 21  LYS A HD3  1  
ATOM 292   H HE2  . LYS A 1 21  ? -5.578  1.999   13.667  1.00 0.00 ? 21  LYS A HE2  1  
ATOM 293   H HE3  . LYS A 1 21  ? -7.311  1.787   13.522  1.00 0.00 ? 21  LYS A HE3  1  
ATOM 294   H HZ1  . LYS A 1 21  ? -7.238  0.643   15.677  1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 295   H HZ2  . LYS A 1 21  ? -5.653  1.009   15.817  1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 296   H HZ3  . LYS A 1 21  ? -6.766  2.204   15.771  1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 297   N N    . LEU A 1 22  ? -3.135  0.187   11.088  1.00 0.00 ? 22  LEU A N    1  
ATOM 298   C CA   . LEU A 1 22  ? -2.054  1.133   10.868  1.00 0.00 ? 22  LEU A CA   1  
ATOM 299   C C    . LEU A 1 22  ? -2.197  2.299   11.848  1.00 0.00 ? 22  LEU A C    1  
ATOM 300   O O    . LEU A 1 22  ? -3.193  2.397   12.563  1.00 0.00 ? 22  LEU A O    1  
ATOM 301   C CB   . LEU A 1 22  ? -2.010  1.565   9.401   1.00 0.00 ? 22  LEU A CB   1  
ATOM 302   C CG   . LEU A 1 22  ? -1.975  0.434   8.370   1.00 0.00 ? 22  LEU A CG   1  
ATOM 303   C CD1  . LEU A 1 22  ? -2.739  0.823   7.104   1.00 0.00 ? 22  LEU A CD1  1  
ATOM 304   C CD2  . LEU A 1 22  ? -0.535  0.016   8.065   1.00 0.00 ? 22  LEU A CD2  1  
ATOM 305   H H    . LEU A 1 22  ? -4.041  0.509   10.816  1.00 0.00 ? 22  LEU A H    1  
ATOM 306   H HA   . LEU A 1 22  ? -1.119  0.616   11.080  1.00 0.00 ? 22  LEU A HA   1  
ATOM 307   H HB2  . LEU A 1 22  ? -2.883  2.186   9.199   1.00 0.00 ? 22  LEU A HB2  1  
ATOM 308   H HB3  . LEU A 1 22  ? -1.132  2.192   9.254   1.00 0.00 ? 22  LEU A HB3  1  
ATOM 309   H HG   . LEU A 1 22  ? -2.478  -0.433  8.797   1.00 0.00 ? 22  LEU A HG   1  
ATOM 310   H HD11 . LEU A 1 22  ? -2.734  1.907   6.994   1.00 0.00 ? 22  LEU A HD11 1  
ATOM 311   H HD12 . LEU A 1 22  ? -2.261  0.368   6.236   1.00 0.00 ? 22  LEU A HD12 1  
ATOM 312   H HD13 . LEU A 1 22  ? -3.768  0.470   7.178   1.00 0.00 ? 22  LEU A HD13 1  
ATOM 313   H HD21 . LEU A 1 22  ? -0.508  -0.536  7.126   1.00 0.00 ? 22  LEU A HD21 1  
ATOM 314   H HD22 . LEU A 1 22  ? 0.092   0.904   7.982   1.00 0.00 ? 22  LEU A HD22 1  
ATOM 315   H HD23 . LEU A 1 22  ? -0.162  -0.617  8.870   1.00 0.00 ? 22  LEU A HD23 1  
ATOM 316   N N    . SER A 1 23  ? -1.185  3.155   11.850  1.00 0.00 ? 23  SER A N    1  
ATOM 317   C CA   . SER A 1 23  ? -1.185  4.311   12.731  1.00 0.00 ? 23  SER A CA   1  
ATOM 318   C C    . SER A 1 23  ? -2.456  5.134   12.514  1.00 0.00 ? 23  SER A C    1  
ATOM 319   O O    . SER A 1 23  ? -3.097  5.558   13.475  1.00 0.00 ? 23  SER A O    1  
ATOM 320   C CB   . SER A 1 23  ? 0.054   5.178   12.501  1.00 0.00 ? 23  SER A CB   1  
ATOM 321   O OG   . SER A 1 23  ? 0.086   6.306   13.373  1.00 0.00 ? 23  SER A OG   1  
ATOM 322   H H    . SER A 1 23  ? -0.378  3.069   11.266  1.00 0.00 ? 23  SER A H    1  
ATOM 323   H HA   . SER A 1 23  ? -1.161  3.904   13.742  1.00 0.00 ? 23  SER A HA   1  
ATOM 324   H HB2  . SER A 1 23  ? 0.951   4.577   12.654  1.00 0.00 ? 23  SER A HB2  1  
ATOM 325   H HB3  . SER A 1 23  ? 0.072   5.520   11.466  1.00 0.00 ? 23  SER A HB3  1  
ATOM 326   H HG   . SER A 1 23  ? 0.133   6.001   14.324  1.00 0.00 ? 23  SER A HG   1  
ATOM 327   N N    . ARG A 1 24  ? -2.783  5.336   11.246  1.00 0.00 ? 24  ARG A N    1  
ATOM 328   C CA   . ARG A 1 24  ? -3.966  6.101   10.891  1.00 0.00 ? 24  ARG A CA   1  
ATOM 329   C C    . ARG A 1 24  ? -5.157  5.166   10.670  1.00 0.00 ? 24  ARG A C    1  
ATOM 330   O O    . ARG A 1 24  ? -5.019  3.947   10.763  1.00 0.00 ? 24  ARG A O    1  
ATOM 331   C CB   . ARG A 1 24  ? -3.731  6.924   9.623   1.00 0.00 ? 24  ARG A CB   1  
ATOM 332   C CG   . ARG A 1 24  ? -2.834  8.130   9.910   1.00 0.00 ? 24  ARG A CG   1  
ATOM 333   C CD   . ARG A 1 24  ? -3.417  9.404   9.296   1.00 0.00 ? 24  ARG A CD   1  
ATOM 334   N NE   . ARG A 1 24  ? -2.418  10.495  9.352   1.00 0.00 ? 24  ARG A NE   1  
ATOM 335   C CZ   . ARG A 1 24  ? -2.579  11.692  8.771   1.00 0.00 ? 24  ARG A CZ   1  
ATOM 336   N NH1  . ARG A 1 24  ? -3.700  11.959  8.087   1.00 0.00 ? 24  ARG A NH1  1  
ATOM 337   N NH2  . ARG A 1 24  ? -1.620  12.621  8.874   1.00 0.00 ? 24  ARG A NH2  1  
ATOM 338   H H    . ARG A 1 24  ? -2.256  4.988   10.471  1.00 0.00 ? 24  ARG A H    1  
ATOM 339   H HA   . ARG A 1 24  ? -4.138  6.760   11.742  1.00 0.00 ? 24  ARG A HA   1  
ATOM 340   H HB2  . ARG A 1 24  ? -3.270  6.297   8.859   1.00 0.00 ? 24  ARG A HB2  1  
ATOM 341   H HB3  . ARG A 1 24  ? -4.686  7.263   9.222   1.00 0.00 ? 24  ARG A HB3  1  
ATOM 342   H HG2  . ARG A 1 24  ? -2.724  8.257   10.987  1.00 0.00 ? 24  ARG A HG2  1  
ATOM 343   H HG3  . ARG A 1 24  ? -1.837  7.951   9.507   1.00 0.00 ? 24  ARG A HG3  1  
ATOM 344   H HD2  . ARG A 1 24  ? -3.709  9.220   8.262   1.00 0.00 ? 24  ARG A HD2  1  
ATOM 345   H HD3  . ARG A 1 24  ? -4.318  9.698   9.834   1.00 0.00 ? 24  ARG A HD3  1  
ATOM 346   H HE   . ARG A 1 24  ? -1.569  10.329  9.854   1.00 0.00 ? 24  ARG A HE   1  
ATOM 347   H HH11 . ARG A 1 24  ? -4.417  11.265  8.010   1.00 0.00 ? 24  ARG A HH11 1  
ATOM 348   H HH12 . ARG A 1 24  ? -3.821  12.852  7.654   1.00 0.00 ? 24  ARG A HH12 1  
ATOM 349   H HH21 . ARG A 1 24  ? -0.783  12.422  9.384   1.00 0.00 ? 24  ARG A HH21 1  
ATOM 350   H HH22 . ARG A 1 24  ? -1.740  13.515  8.440   1.00 0.00 ? 24  ARG A HH22 1  
ATOM 351   N N    . ASN A 1 25  ? -6.299  5.772   10.382  1.00 0.00 ? 25  ASN A N    1  
ATOM 352   C CA   . ASN A 1 25  ? -7.513  5.008   10.147  1.00 0.00 ? 25  ASN A CA   1  
ATOM 353   C C    . ASN A 1 25  ? -7.647  4.719   8.650   1.00 0.00 ? 25  ASN A C    1  
ATOM 354   O O    . ASN A 1 25  ? -7.006  5.372   7.828   1.00 0.00 ? 25  ASN A O    1  
ATOM 355   C CB   . ASN A 1 25  ? -8.750  5.791   10.589  1.00 0.00 ? 25  ASN A CB   1  
ATOM 356   C CG   . ASN A 1 25  ? -10.019 4.951   10.425  1.00 0.00 ? 25  ASN A CG   1  
ATOM 357   O OD1  . ASN A 1 25  ? -10.103 3.815   10.862  1.00 0.00 ? 25  ASN A OD1  1  
ATOM 358   N ND2  . ASN A 1 25  ? -10.997 5.570   9.770   1.00 0.00 ? 25  ASN A ND2  1  
ATOM 359   H H    . ASN A 1 25  ? -6.403  6.763   10.308  1.00 0.00 ? 25  ASN A H    1  
ATOM 360   H HA   . ASN A 1 25  ? -7.399  4.100   10.738  1.00 0.00 ? 25  ASN A HA   1  
ATOM 361   H HB2  . ASN A 1 25  ? -8.642  6.091   11.632  1.00 0.00 ? 25  ASN A HB2  1  
ATOM 362   H HB3  . ASN A 1 25  ? -8.837  6.705   10.002  1.00 0.00 ? 25  ASN A HB3  1  
ATOM 363   H HD21 . ASN A 1 25  ? -10.862 6.504   9.437   1.00 0.00 ? 25  ASN A HD21 1  
ATOM 364   H HD22 . ASN A 1 25  ? -11.867 5.103   9.612   1.00 0.00 ? 25  ASN A HD22 1  
ATOM 365   N N    . LYS A 1 26  ? -8.483  3.739   8.342   1.00 0.00 ? 26  LYS A N    1  
ATOM 366   C CA   . LYS A 1 26  ? -8.709  3.355   6.959   1.00 0.00 ? 26  LYS A CA   1  
ATOM 367   C C    . LYS A 1 26  ? -9.069  4.598   6.142   1.00 0.00 ? 26  LYS A C    1  
ATOM 368   O O    . LYS A 1 26  ? -8.586  4.770   5.023   1.00 0.00 ? 26  LYS A O    1  
ATOM 369   C CB   . LYS A 1 26  ? -9.755  2.241   6.876   1.00 0.00 ? 26  LYS A CB   1  
ATOM 370   C CG   . LYS A 1 26  ? -9.985  1.813   5.425   1.00 0.00 ? 26  LYS A CG   1  
ATOM 371   C CD   . LYS A 1 26  ? -9.755  0.310   5.254   1.00 0.00 ? 26  LYS A CD   1  
ATOM 372   C CE   . LYS A 1 26  ? -10.655 -0.261  4.156   1.00 0.00 ? 26  LYS A CE   1  
ATOM 373   N NZ   . LYS A 1 26  ? -11.683 -1.152  4.740   1.00 0.00 ? 26  LYS A NZ   1  
ATOM 374   H H    . LYS A 1 26  ? -9.000  3.212   9.016   1.00 0.00 ? 26  LYS A H    1  
ATOM 375   H HA   . LYS A 1 26  ? -7.774  2.948   6.576   1.00 0.00 ? 26  LYS A HA   1  
ATOM 376   H HB2  . LYS A 1 26  ? -9.426  1.384   7.464   1.00 0.00 ? 26  LYS A HB2  1  
ATOM 377   H HB3  . LYS A 1 26  ? -10.693 2.585   7.311   1.00 0.00 ? 26  LYS A HB3  1  
ATOM 378   H HG2  . LYS A 1 26  ? -11.003 2.065   5.125   1.00 0.00 ? 26  LYS A HG2  1  
ATOM 379   H HG3  . LYS A 1 26  ? -9.313  2.364   4.768   1.00 0.00 ? 26  LYS A HG3  1  
ATOM 380   H HD2  . LYS A 1 26  ? -8.710  0.124   5.006   1.00 0.00 ? 26  LYS A HD2  1  
ATOM 381   H HD3  . LYS A 1 26  ? -9.955  -0.202  6.196   1.00 0.00 ? 26  LYS A HD3  1  
ATOM 382   H HE2  . LYS A 1 26  ? -11.136 0.552   3.612   1.00 0.00 ? 26  LYS A HE2  1  
ATOM 383   H HE3  . LYS A 1 26  ? -10.053 -0.814  3.436   1.00 0.00 ? 26  LYS A HE3  1  
ATOM 384   H HZ1  . LYS A 1 26  ? -11.651 -2.041  4.284   1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 385   H HZ2  . LYS A 1 26  ? -11.505 -1.271  5.716   1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 386   H HZ3  . LYS A 1 26  ? -12.588 -0.745  4.613   1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 387   N N    . ASP A 1 27  ? -9.913  5.431   6.732   1.00 0.00 ? 27  ASP A N    1  
ATOM 388   C CA   . ASP A 1 27  ? -10.342 6.653   6.072   1.00 0.00 ? 27  ASP A CA   1  
ATOM 389   C C    . ASP A 1 27  ? -9.143  7.588   5.910   1.00 0.00 ? 27  ASP A C    1  
ATOM 390   O O    . ASP A 1 27  ? -8.752  7.914   4.790   1.00 0.00 ? 27  ASP A O    1  
ATOM 391   C CB   . ASP A 1 27  ? -11.402 7.382   6.900   1.00 0.00 ? 27  ASP A CB   1  
ATOM 392   C CG   . ASP A 1 27  ? -12.303 8.330   6.106   1.00 0.00 ? 27  ASP A CG   1  
ATOM 393   O OD1  . ASP A 1 27  ? -11.746 9.280   5.514   1.00 0.00 ? 27  ASP A OD1  1  
ATOM 394   O OD2  . ASP A 1 27  ? -13.529 8.085   6.109   1.00 0.00 ? 27  ASP A OD2  1  
ATOM 395   H H    . ASP A 1 27  ? -10.301 5.283   7.641   1.00 0.00 ? 27  ASP A H    1  
ATOM 396   H HA   . ASP A 1 27  ? -10.754 6.332   5.115   1.00 0.00 ? 27  ASP A HA   1  
ATOM 397   H HB2  . ASP A 1 27  ? -12.029 6.640   7.395   1.00 0.00 ? 27  ASP A HB2  1  
ATOM 398   H HB3  . ASP A 1 27  ? -10.902 7.951   7.684   1.00 0.00 ? 27  ASP A HB3  1  
ATOM 399   N N    . GLU A 1 28  ? -8.592  7.995   7.045   1.00 0.00 ? 28  GLU A N    1  
ATOM 400   C CA   . GLU A 1 28  ? -7.445  8.887   7.043   1.00 0.00 ? 28  GLU A CA   1  
ATOM 401   C C    . GLU A 1 28  ? -6.436  8.451   5.979   1.00 0.00 ? 28  GLU A C    1  
ATOM 402   O O    . GLU A 1 28  ? -5.799  9.288   5.342   1.00 0.00 ? 28  GLU A O    1  
ATOM 403   C CB   . GLU A 1 28  ? -6.794  8.946   8.426   1.00 0.00 ? 28  GLU A CB   1  
ATOM 404   C CG   . GLU A 1 28  ? -7.744  9.562   9.454   1.00 0.00 ? 28  GLU A CG   1  
ATOM 405   C CD   . GLU A 1 28  ? -6.992  10.494  10.407  1.00 0.00 ? 28  GLU A CD   1  
ATOM 406   O OE1  . GLU A 1 28  ? -6.506  9.979   11.437  1.00 0.00 ? 28  GLU A OE1  1  
ATOM 407   O OE2  . GLU A 1 28  ? -6.920  11.699  10.083  1.00 0.00 ? 28  GLU A OE2  1  
ATOM 408   H H    . GLU A 1 28  ? -8.917  7.726   7.952   1.00 0.00 ? 28  GLU A H    1  
ATOM 409   H HA   . GLU A 1 28  ? -7.844  9.871   6.793   1.00 0.00 ? 28  GLU A HA   1  
ATOM 410   H HB2  . GLU A 1 28  ? -6.512  7.941   8.742   1.00 0.00 ? 28  GLU A HB2  1  
ATOM 411   H HB3  . GLU A 1 28  ? -5.877  9.533   8.375   1.00 0.00 ? 28  GLU A HB3  1  
ATOM 412   H HG2  . GLU A 1 28  ? -8.530  10.117  8.941   1.00 0.00 ? 28  GLU A HG2  1  
ATOM 413   H HG3  . GLU A 1 28  ? -8.233  8.771   10.023  1.00 0.00 ? 28  GLU A HG3  1  
ATOM 414   N N    . VAL A 1 29  ? -6.321  7.141   5.819   1.00 0.00 ? 29  VAL A N    1  
ATOM 415   C CA   . VAL A 1 29  ? -5.400  6.583   4.844   1.00 0.00 ? 29  VAL A CA   1  
ATOM 416   C C    . VAL A 1 29  ? -6.039  6.639   3.455   1.00 0.00 ? 29  VAL A C    1  
ATOM 417   O O    . VAL A 1 29  ? -5.443  7.160   2.513   1.00 0.00 ? 29  VAL A O    1  
ATOM 418   C CB   . VAL A 1 29  ? -4.993  5.168   5.258   1.00 0.00 ? 29  VAL A CB   1  
ATOM 419   C CG1  . VAL A 1 29  ? -4.121  4.512   4.185   1.00 0.00 ? 29  VAL A CG1  1  
ATOM 420   C CG2  . VAL A 1 29  ? -4.282  5.176   6.613   1.00 0.00 ? 29  VAL A CG2  1  
ATOM 421   H H    . VAL A 1 29  ? -6.843  6.466   6.341   1.00 0.00 ? 29  VAL A H    1  
ATOM 422   H HA   . VAL A 1 29  ? -4.505  7.205   4.843   1.00 0.00 ? 29  VAL A HA   1  
ATOM 423   H HB   . VAL A 1 29  ? -5.901  4.574   5.360   1.00 0.00 ? 29  VAL A HB   1  
ATOM 424   H HG11 . VAL A 1 29  ? -3.124  4.333   4.587   1.00 0.00 ? 29  VAL A HG11 1  
ATOM 425   H HG12 . VAL A 1 29  ? -4.566  3.564   3.884   1.00 0.00 ? 29  VAL A HG12 1  
ATOM 426   H HG13 . VAL A 1 29  ? -4.051  5.172   3.320   1.00 0.00 ? 29  VAL A HG13 1  
ATOM 427   H HG21 . VAL A 1 29  ? -4.510  4.254   7.148   1.00 0.00 ? 29  VAL A HG21 1  
ATOM 428   H HG22 . VAL A 1 29  ? -3.206  5.249   6.458   1.00 0.00 ? 29  VAL A HG22 1  
ATOM 429   H HG23 . VAL A 1 29  ? -4.625  6.029   7.197   1.00 0.00 ? 29  VAL A HG23 1  
ATOM 430   N N    . LYS A 1 30  ? -7.245  6.096   3.371   1.00 0.00 ? 30  LYS A N    1  
ATOM 431   C CA   . LYS A 1 30  ? -7.972  6.077   2.113   1.00 0.00 ? 30  LYS A CA   1  
ATOM 432   C C    . LYS A 1 30  ? -7.937  7.474   1.488   1.00 0.00 ? 30  LYS A C    1  
ATOM 433   O O    . LYS A 1 30  ? -7.900  7.611   0.267   1.00 0.00 ? 30  LYS A O    1  
ATOM 434   C CB   . LYS A 1 30  ? -9.386  5.530   2.319   1.00 0.00 ? 30  LYS A CB   1  
ATOM 435   C CG   . LYS A 1 30  ? -10.286 5.877   1.131   1.00 0.00 ? 30  LYS A CG   1  
ATOM 436   C CD   . LYS A 1 30  ? -11.750 5.559   1.442   1.00 0.00 ? 30  LYS A CD   1  
ATOM 437   C CE   . LYS A 1 30  ? -12.330 4.587   0.412   1.00 0.00 ? 30  LYS A CE   1  
ATOM 438   N NZ   . LYS A 1 30  ? -13.800 4.497   0.555   1.00 0.00 ? 30  LYS A NZ   1  
ATOM 439   H H    . LYS A 1 30  ? -7.723  5.674   4.141   1.00 0.00 ? 30  LYS A H    1  
ATOM 440   H HA   . LYS A 1 30  ? -7.453  5.388   1.446   1.00 0.00 ? 30  LYS A HA   1  
ATOM 441   H HB2  . LYS A 1 30  ? -9.347  4.449   2.446   1.00 0.00 ? 30  LYS A HB2  1  
ATOM 442   H HB3  . LYS A 1 30  ? -9.810  5.943   3.234   1.00 0.00 ? 30  LYS A HB3  1  
ATOM 443   H HG2  . LYS A 1 30  ? -10.183 6.935   0.889   1.00 0.00 ? 30  LYS A HG2  1  
ATOM 444   H HG3  . LYS A 1 30  ? -9.967  5.317   0.252   1.00 0.00 ? 30  LYS A HG3  1  
ATOM 445   H HD2  . LYS A 1 30  ? -11.828 5.127   2.439   1.00 0.00 ? 30  LYS A HD2  1  
ATOM 446   H HD3  . LYS A 1 30  ? -12.333 6.480   1.447   1.00 0.00 ? 30  LYS A HD3  1  
ATOM 447   H HE2  . LYS A 1 30  ? -12.077 4.921   -0.594  1.00 0.00 ? 30  LYS A HE2  1  
ATOM 448   H HE3  . LYS A 1 30  ? -11.885 3.601   0.543   1.00 0.00 ? 30  LYS A HE3  1  
ATOM 449   H HZ1  . LYS A 1 30  ? -14.234 5.199   -0.010  1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 450   H HZ2  . LYS A 1 30  ? -14.109 3.593   0.260   1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 451   H HZ3  . LYS A 1 30  ? -14.051 4.639   1.513   1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 452   N N    . ALA A 1 31  ? -7.951  8.475   2.356   1.00 0.00 ? 31  ALA A N    1  
ATOM 453   C CA   . ALA A 1 31  ? -7.922  9.856   1.905   1.00 0.00 ? 31  ALA A CA   1  
ATOM 454   C C    . ALA A 1 31  ? -6.548  10.163  1.304   1.00 0.00 ? 31  ALA A C    1  
ATOM 455   O O    . ALA A 1 31  ? -6.454  10.668  0.187   1.00 0.00 ? 31  ALA A O    1  
ATOM 456   C CB   . ALA A 1 31  ? -8.268  10.782  3.072   1.00 0.00 ? 31  ALA A CB   1  
ATOM 457   H H    . ALA A 1 31  ? -7.981  8.355   3.348   1.00 0.00 ? 31  ALA A H    1  
ATOM 458   H HA   . ALA A 1 31  ? -8.681  9.969   1.131   1.00 0.00 ? 31  ALA A HA   1  
ATOM 459   H HB1  . ALA A 1 31  ? -8.602  10.187  3.922   1.00 0.00 ? 31  ALA A HB1  1  
ATOM 460   H HB2  . ALA A 1 31  ? -7.385  11.355  3.355   1.00 0.00 ? 31  ALA A HB2  1  
ATOM 461   H HB3  . ALA A 1 31  ? -9.063  11.465  2.772   1.00 0.00 ? 31  ALA A HB3  1  
ATOM 462   N N    . MET A 1 32  ? -5.517  9.845   2.073   1.00 0.00 ? 32  MET A N    1  
ATOM 463   C CA   . MET A 1 32  ? -4.153  10.081  1.631   1.00 0.00 ? 32  MET A CA   1  
ATOM 464   C C    . MET A 1 32  ? -3.899  9.432   0.269   1.00 0.00 ? 32  MET A C    1  
ATOM 465   O O    . MET A 1 32  ? -3.601  10.122  -0.705  1.00 0.00 ? 32  MET A O    1  
ATOM 466   C CB   . MET A 1 32  ? -3.177  9.508   2.660   1.00 0.00 ? 32  MET A CB   1  
ATOM 467   C CG   . MET A 1 32  ? -2.599  10.616  3.543   1.00 0.00 ? 32  MET A CG   1  
ATOM 468   S SD   . MET A 1 32  ? -1.475  11.628  2.596   1.00 0.00 ? 32  MET A SD   1  
ATOM 469   C CE   . MET A 1 32  ? 0.069   11.196  3.380   1.00 0.00 ? 32  MET A CE   1  
ATOM 470   H H    . MET A 1 32  ? -5.602  9.435   2.981   1.00 0.00 ? 32  MET A H    1  
ATOM 471   H HA   . MET A 1 32  ? -4.055  11.164  1.550   1.00 0.00 ? 32  MET A HA   1  
ATOM 472   H HB2  . MET A 1 32  ? -3.688  8.772   3.282   1.00 0.00 ? 32  MET A HB2  1  
ATOM 473   H HB3  . MET A 1 32  ? -2.368  8.987   2.149   1.00 0.00 ? 32  MET A HB3  1  
ATOM 474   H HG2  . MET A 1 32  ? -3.404  11.230  3.945   1.00 0.00 ? 32  MET A HG2  1  
ATOM 475   H HG3  . MET A 1 32  ? -2.077  10.179  4.395   1.00 0.00 ? 32  MET A HG3  1  
ATOM 476   H HE1  . MET A 1 32  ? 0.285   11.911  4.175   1.00 0.00 ? 32  MET A HE1  1  
ATOM 477   H HE2  . MET A 1 32  ? -0.007  10.194  3.803   1.00 0.00 ? 32  MET A HE2  1  
ATOM 478   H HE3  . MET A 1 32  ? 0.871   11.219  2.642   1.00 0.00 ? 32  MET A HE3  1  
ATOM 479   N N    . ILE A 1 33  ? -4.025  8.114   0.245   1.00 0.00 ? 33  ILE A N    1  
ATOM 480   C CA   . ILE A 1 33  ? -3.812  7.364   -0.982  1.00 0.00 ? 33  ILE A CA   1  
ATOM 481   C C    . ILE A 1 33  ? -4.540  8.061   -2.133  1.00 0.00 ? 33  ILE A C    1  
ATOM 482   O O    . ILE A 1 33  ? -4.126  7.959   -3.287  1.00 0.00 ? 33  ILE A O    1  
ATOM 483   C CB   . ILE A 1 33  ? -4.218  5.901   -0.793  1.00 0.00 ? 33  ILE A CB   1  
ATOM 484   C CG1  . ILE A 1 33  ? -3.377  5.235   0.298   1.00 0.00 ? 33  ILE A CG1  1  
ATOM 485   C CG2  . ILE A 1 33  ? -4.148  5.137   -2.117  1.00 0.00 ? 33  ILE A CG2  1  
ATOM 486   C CD1  . ILE A 1 33  ? -4.110  4.034   0.898   1.00 0.00 ? 33  ILE A CD1  1  
ATOM 487   H H    . ILE A 1 33  ? -4.268  7.560   1.041   1.00 0.00 ? 33  ILE A H    1  
ATOM 488   H HA   . ILE A 1 33  ? -2.743  7.377   -1.191  1.00 0.00 ? 33  ILE A HA   1  
ATOM 489   H HB   . ILE A 1 33  ? -5.256  5.875   -0.461  1.00 0.00 ? 33  ILE A HB   1  
ATOM 490   H HG12 . ILE A 1 33  ? -2.424  4.912   -0.119  1.00 0.00 ? 33  ILE A HG12 1  
ATOM 491   H HG13 . ILE A 1 33  ? -3.154  5.958   1.082   1.00 0.00 ? 33  ILE A HG13 1  
ATOM 492   H HG21 . ILE A 1 33  ? -4.541  5.763   -2.918  1.00 0.00 ? 33  ILE A HG21 1  
ATOM 493   H HG22 . ILE A 1 33  ? -3.112  4.879   -2.333  1.00 0.00 ? 33  ILE A HG22 1  
ATOM 494   H HG23 . ILE A 1 33  ? -4.742  4.226   -2.043  1.00 0.00 ? 33  ILE A HG23 1  
ATOM 495   H HD11 . ILE A 1 33  ? -4.643  3.502   0.110   1.00 0.00 ? 33  ILE A HD11 1  
ATOM 496   H HD12 . ILE A 1 33  ? -3.388  3.364   1.365   1.00 0.00 ? 33  ILE A HD12 1  
ATOM 497   H HD13 . ILE A 1 33  ? -4.822  4.380   1.648   1.00 0.00 ? 33  ILE A HD13 1  
ATOM 498   N N    . GLU A 1 34  ? -5.613  8.753   -1.779  1.00 0.00 ? 34  GLU A N    1  
ATOM 499   C CA   . GLU A 1 34  ? -6.403  9.467   -2.769  1.00 0.00 ? 34  GLU A CA   1  
ATOM 500   C C    . GLU A 1 34  ? -5.833  10.869  -2.993  1.00 0.00 ? 34  GLU A C    1  
ATOM 501   O O    . GLU A 1 34  ? -5.891  11.397  -4.102  1.00 0.00 ? 34  GLU A O    1  
ATOM 502   C CB   . GLU A 1 34  ? -7.874  9.533   -2.352  1.00 0.00 ? 34  GLU A CB   1  
ATOM 503   C CG   . GLU A 1 34  ? -8.594  8.222   -2.672  1.00 0.00 ? 34  GLU A CG   1  
ATOM 504   C CD   . GLU A 1 34  ? -9.914  8.485   -3.399  1.00 0.00 ? 34  GLU A CD   1  
ATOM 505   O OE1  . GLU A 1 34  ? -9.908  9.365   -4.286  1.00 0.00 ? 34  GLU A OE1  1  
ATOM 506   O OE2  . GLU A 1 34  ? -10.900 7.799   -3.050  1.00 0.00 ? 34  GLU A OE2  1  
ATOM 507   H H    . GLU A 1 34  ? -5.944  8.831   -0.839  1.00 0.00 ? 34  GLU A H    1  
ATOM 508   H HA   . GLU A 1 34  ? -6.317  8.882   -3.684  1.00 0.00 ? 34  GLU A HA   1  
ATOM 509   H HB2  . GLU A 1 34  ? -7.944  9.740   -1.284  1.00 0.00 ? 34  GLU A HB2  1  
ATOM 510   H HB3  . GLU A 1 34  ? -8.365  10.358  -2.869  1.00 0.00 ? 34  GLU A HB3  1  
ATOM 511   H HG2  . GLU A 1 34  ? -7.954  7.592   -3.289  1.00 0.00 ? 34  GLU A HG2  1  
ATOM 512   H HG3  . GLU A 1 34  ? -8.785  7.674   -1.749  1.00 0.00 ? 34  GLU A HG3  1  
ATOM 513   N N    . LYS A 1 35  ? -5.293  11.432  -1.921  1.00 0.00 ? 35  LYS A N    1  
ATOM 514   C CA   . LYS A 1 35  ? -4.713  12.762  -1.987  1.00 0.00 ? 35  LYS A CA   1  
ATOM 515   C C    . LYS A 1 35  ? -3.432  12.714  -2.822  1.00 0.00 ? 35  LYS A C    1  
ATOM 516   O O    . LYS A 1 35  ? -3.112  13.669  -3.529  1.00 0.00 ? 35  LYS A O    1  
ATOM 517   C CB   . LYS A 1 35  ? -4.509  13.328  -0.580  1.00 0.00 ? 35  LYS A CB   1  
ATOM 518   C CG   . LYS A 1 35  ? -3.088  13.056  -0.081  1.00 0.00 ? 35  LYS A CG   1  
ATOM 519   C CD   . LYS A 1 35  ? -2.140  14.187  -0.484  1.00 0.00 ? 35  LYS A CD   1  
ATOM 520   C CE   . LYS A 1 35  ? -2.550  15.507  0.173   1.00 0.00 ? 35  LYS A CE   1  
ATOM 521   N NZ   . LYS A 1 35  ? -3.141  16.422  -0.828  1.00 0.00 ? 35  LYS A NZ   1  
ATOM 522   H H    . LYS A 1 35  ? -5.250  10.995  -1.023  1.00 0.00 ? 35  LYS A H    1  
ATOM 523   H HA   . LYS A 1 35  ? -5.431  13.407  -2.493  1.00 0.00 ? 35  LYS A HA   1  
ATOM 524   H HB2  . LYS A 1 35  ? -4.698  14.401  -0.584  1.00 0.00 ? 35  LYS A HB2  1  
ATOM 525   H HB3  . LYS A 1 35  ? -5.230  12.881  0.104   1.00 0.00 ? 35  LYS A HB3  1  
ATOM 526   H HG2  . LYS A 1 35  ? -3.094  12.951  1.004   1.00 0.00 ? 35  LYS A HG2  1  
ATOM 527   H HG3  . LYS A 1 35  ? -2.729  12.112  -0.490  1.00 0.00 ? 35  LYS A HG3  1  
ATOM 528   H HD2  . LYS A 1 35  ? -1.121  13.933  -0.192  1.00 0.00 ? 35  LYS A HD2  1  
ATOM 529   H HD3  . LYS A 1 35  ? -2.143  14.300  -1.568  1.00 0.00 ? 35  LYS A HD3  1  
ATOM 530   H HE2  . LYS A 1 35  ? -3.269  15.315  0.969   1.00 0.00 ? 35  LYS A HE2  1  
ATOM 531   H HE3  . LYS A 1 35  ? -1.681  15.975  0.634   1.00 0.00 ? 35  LYS A HE3  1  
ATOM 532   H HZ1  . LYS A 1 35  ? -4.072  16.662  -0.552  1.00 0.00 ? 35  LYS A HZ1  1  
ATOM 533   H HZ2  . LYS A 1 35  ? -2.587  17.252  -0.889  1.00 0.00 ? 35  LYS A HZ2  1  
ATOM 534   H HZ3  . LYS A 1 35  ? -3.164  15.971  -1.720  1.00 0.00 ? 35  LYS A HZ3  1  
ATOM 535   N N    . LEU A 1 36  ? -2.734  11.593  -2.714  1.00 0.00 ? 36  LEU A N    1  
ATOM 536   C CA   . LEU A 1 36  ? -1.496  11.409  -3.450  1.00 0.00 ? 36  LEU A CA   1  
ATOM 537   C C    . LEU A 1 36  ? -1.818  11.135  -4.921  1.00 0.00 ? 36  LEU A C    1  
ATOM 538   O O    . LEU A 1 36  ? -0.935  11.197  -5.775  1.00 0.00 ? 36  LEU A O    1  
ATOM 539   C CB   . LEU A 1 36  ? -0.640  10.322  -2.796  1.00 0.00 ? 36  LEU A CB   1  
ATOM 540   C CG   . LEU A 1 36  ? 0.259   10.778  -1.645  1.00 0.00 ? 36  LEU A CG   1  
ATOM 541   C CD1  . LEU A 1 36  ? 0.998   12.069  -2.005  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 542   C CD2  . LEU A 1 36  ? -0.539  10.918  -0.348  1.00 0.00 ? 36  LEU A CD2  1  
ATOM 543   H H    . LEU A 1 36  ? -3.002  10.822  -2.137  1.00 0.00 ? 36  LEU A H    1  
ATOM 544   H HA   . LEU A 1 36  ? -0.935  12.341  -3.387  1.00 0.00 ? 36  LEU A HA   1  
ATOM 545   H HB2  . LEU A 1 36  ? -1.303  9.540   -2.425  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 546   H HB3  . LEU A 1 36  ? -0.012  9.870   -3.564  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 547   H HG   . LEU A 1 36  ? 1.015   10.011  -1.477  1.00 0.00 ? 36  LEU A HG   1  
ATOM 548   H HD11 . LEU A 1 36  ? 2.030   12.005  -1.661  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 549   H HD12 . LEU A 1 36  ? 0.983   12.206  -3.087  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 550   H HD13 . LEU A 1 36  ? 0.506   12.915  -1.525  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 551   H HD21 . LEU A 1 36  ? -1.461  10.341  -0.425  1.00 0.00 ? 36  LEU A HD21 1  
ATOM 552   H HD22 . LEU A 1 36  ? 0.055   10.544  0.486   1.00 0.00 ? 36  LEU A HD22 1  
ATOM 553   H HD23 . LEU A 1 36  ? -0.780  11.967  -0.181  1.00 0.00 ? 36  LEU A HD23 1  
ATOM 554   N N    . GLY A 1 37  ? -3.085  10.840  -5.171  1.00 0.00 ? 37  GLY A N    1  
ATOM 555   C CA   . GLY A 1 37  ? -3.534  10.557  -6.524  1.00 0.00 ? 37  GLY A CA   1  
ATOM 556   C C    . GLY A 1 37  ? -3.938  9.089   -6.672  1.00 0.00 ? 37  GLY A C    1  
ATOM 557   O O    . GLY A 1 37  ? -4.610  8.720   -7.633  1.00 0.00 ? 37  GLY A O    1  
ATOM 558   H H    . GLY A 1 37  ? -3.797  10.792  -4.471  1.00 0.00 ? 37  GLY A H    1  
ATOM 559   H HA2  . GLY A 1 37  ? -4.381  11.197  -6.771  1.00 0.00 ? 37  GLY A HA2  1  
ATOM 560   H HA3  . GLY A 1 37  ? -2.739  10.792  -7.231  1.00 0.00 ? 37  GLY A HA3  1  
ATOM 561   N N    . GLY A 1 38  ? -3.511  8.290   -5.704  1.00 0.00 ? 38  GLY A N    1  
ATOM 562   C CA   . GLY A 1 38  ? -3.820  6.871   -5.715  1.00 0.00 ? 38  GLY A CA   1  
ATOM 563   C C    . GLY A 1 38  ? -5.280  6.624   -5.331  1.00 0.00 ? 38  GLY A C    1  
ATOM 564   O O    . GLY A 1 38  ? -6.105  7.534   -5.396  1.00 0.00 ? 38  GLY A O    1  
ATOM 565   H H    . GLY A 1 38  ? -2.965  8.598   -4.925  1.00 0.00 ? 38  GLY A H    1  
ATOM 566   H HA2  . GLY A 1 38  ? -3.626  6.460   -6.706  1.00 0.00 ? 38  GLY A HA2  1  
ATOM 567   H HA3  . GLY A 1 38  ? -3.164  6.347   -5.019  1.00 0.00 ? 38  GLY A HA3  1  
ATOM 568   N N    . LYS A 1 39  ? -5.555  5.389   -4.939  1.00 0.00 ? 39  LYS A N    1  
ATOM 569   C CA   . LYS A 1 39  ? -6.902  5.011   -4.545  1.00 0.00 ? 39  LYS A CA   1  
ATOM 570   C C    . LYS A 1 39  ? -6.845  3.724   -3.720  1.00 0.00 ? 39  LYS A C    1  
ATOM 571   O O    . LYS A 1 39  ? -6.231  2.742   -4.136  1.00 0.00 ? 39  LYS A O    1  
ATOM 572   C CB   . LYS A 1 39  ? -7.812  4.916   -5.771  1.00 0.00 ? 39  LYS A CB   1  
ATOM 573   C CG   . LYS A 1 39  ? -8.528  6.244   -6.026  1.00 0.00 ? 39  LYS A CG   1  
ATOM 574   C CD   . LYS A 1 39  ? -8.224  6.769   -7.431  1.00 0.00 ? 39  LYS A CD   1  
ATOM 575   C CE   . LYS A 1 39  ? -9.448  6.643   -8.340  1.00 0.00 ? 39  LYS A CE   1  
ATOM 576   N NZ   . LYS A 1 39  ? -9.045  6.202   -9.694  1.00 0.00 ? 39  LYS A NZ   1  
ATOM 577   H H    . LYS A 1 39  ? -4.879  4.654   -4.889  1.00 0.00 ? 39  LYS A H    1  
ATOM 578   H HA   . LYS A 1 39  ? -7.293  5.809   -3.914  1.00 0.00 ? 39  LYS A HA   1  
ATOM 579   H HB2  . LYS A 1 39  ? -7.223  4.642   -6.646  1.00 0.00 ? 39  LYS A HB2  1  
ATOM 580   H HB3  . LYS A 1 39  ? -8.547  4.125   -5.622  1.00 0.00 ? 39  LYS A HB3  1  
ATOM 581   H HG2  . LYS A 1 39  ? -9.604  6.109   -5.909  1.00 0.00 ? 39  LYS A HG2  1  
ATOM 582   H HG3  . LYS A 1 39  ? -8.216  6.978   -5.284  1.00 0.00 ? 39  LYS A HG3  1  
ATOM 583   H HD2  . LYS A 1 39  ? -7.915  7.813   -7.374  1.00 0.00 ? 39  LYS A HD2  1  
ATOM 584   H HD3  . LYS A 1 39  ? -7.390  6.213   -7.859  1.00 0.00 ? 39  LYS A HD3  1  
ATOM 585   H HE2  . LYS A 1 39  ? -10.154 5.930   -7.914  1.00 0.00 ? 39  LYS A HE2  1  
ATOM 586   H HE3  . LYS A 1 39  ? -9.963  7.602   -8.402  1.00 0.00 ? 39  LYS A HE3  1  
ATOM 587   H HZ1  . LYS A 1 39  ? -8.692  5.267   -9.649  1.00 0.00 ? 39  LYS A HZ1  1  
ATOM 588   H HZ2  . LYS A 1 39  ? -9.837  6.229   -10.304 1.00 0.00 ? 39  LYS A HZ2  1  
ATOM 589   H HZ3  . LYS A 1 39  ? -8.333  6.811   -10.045 1.00 0.00 ? 39  LYS A HZ3  1  
ATOM 590   N N    . LEU A 1 40  ? -7.493  3.770   -2.565  1.00 0.00 ? 40  LEU A N    1  
ATOM 591   C CA   . LEU A 1 40  ? -7.524  2.620   -1.678  1.00 0.00 ? 40  LEU A CA   1  
ATOM 592   C C    . LEU A 1 40  ? -8.483  1.570   -2.244  1.00 0.00 ? 40  LEU A C    1  
ATOM 593   O O    . LEU A 1 40  ? -9.564  1.907   -2.724  1.00 0.00 ? 40  LEU A O    1  
ATOM 594   C CB   . LEU A 1 40  ? -7.860  3.053   -0.250  1.00 0.00 ? 40  LEU A CB   1  
ATOM 595   C CG   . LEU A 1 40  ? -7.633  2.004   0.841   1.00 0.00 ? 40  LEU A CG   1  
ATOM 596   C CD1  . LEU A 1 40  ? -6.676  2.527   1.914   1.00 0.00 ? 40  LEU A CD1  1  
ATOM 597   C CD2  . LEU A 1 40  ? -8.963  1.537   1.437   1.00 0.00 ? 40  LEU A CD2  1  
ATOM 598   H H    . LEU A 1 40  ? -7.990  4.572   -2.234  1.00 0.00 ? 40  LEU A H    1  
ATOM 599   H HA   . LEU A 1 40  ? -6.520  2.195   -1.658  1.00 0.00 ? 40  LEU A HA   1  
ATOM 600   H HB2  . LEU A 1 40  ? -7.264  3.934   -0.009  1.00 0.00 ? 40  LEU A HB2  1  
ATOM 601   H HB3  . LEU A 1 40  ? -8.906  3.359   -0.220  1.00 0.00 ? 40  LEU A HB3  1  
ATOM 602   H HG   . LEU A 1 40  ? -7.162  1.134   0.385   1.00 0.00 ? 40  LEU A HG   1  
ATOM 603   H HD11 . LEU A 1 40  ? -5.647  2.335   1.607   1.00 0.00 ? 40  LEU A HD11 1  
ATOM 604   H HD12 . LEU A 1 40  ? -6.823  3.599   2.041   1.00 0.00 ? 40  LEU A HD12 1  
ATOM 605   H HD13 . LEU A 1 40  ? -6.875  2.019   2.857   1.00 0.00 ? 40  LEU A HD13 1  
ATOM 606   H HD21 . LEU A 1 40  ? -9.621  1.200   0.637   1.00 0.00 ? 40  LEU A HD21 1  
ATOM 607   H HD22 . LEU A 1 40  ? -8.781  0.715   2.130   1.00 0.00 ? 40  LEU A HD22 1  
ATOM 608   H HD23 . LEU A 1 40  ? -9.432  2.364   1.970   1.00 0.00 ? 40  LEU A HD23 1  
ATOM 609   N N    . THR A 1 41  ? -8.053  0.320   -2.168  1.00 0.00 ? 41  THR A N    1  
ATOM 610   C CA   . THR A 1 41  ? -8.860  -0.781  -2.666  1.00 0.00 ? 41  THR A CA   1  
ATOM 611   C C    . THR A 1 41  ? -8.995  -1.870  -1.599  1.00 0.00 ? 41  THR A C    1  
ATOM 612   O O    . THR A 1 41  ? -8.308  -1.833  -0.579  1.00 0.00 ? 41  THR A O    1  
ATOM 613   C CB   . THR A 1 41  ? -8.228  -1.280  -3.967  1.00 0.00 ? 41  THR A CB   1  
ATOM 614   O OG1  . THR A 1 41  ? -9.081  -2.342  -4.383  1.00 0.00 ? 41  THR A OG1  1  
ATOM 615   C CG2  . THR A 1 41  ? -6.875  -1.957  -3.738  1.00 0.00 ? 41  THR A CG2  1  
ATOM 616   H H    . THR A 1 41  ? -7.173  0.054   -1.775  1.00 0.00 ? 41  THR A H    1  
ATOM 617   H HA   . THR A 1 41  ? -9.864  -0.407  -2.869  1.00 0.00 ? 41  THR A HA   1  
ATOM 618   H HB   . THR A 1 41  ? -8.141  -0.471  -4.693  1.00 0.00 ? 41  THR A HB   1  
ATOM 619   H HG1  . THR A 1 41  ? -8.988  -2.491  -5.367  1.00 0.00 ? 41  THR A HG1  1  
ATOM 620   H HG21 . THR A 1 41  ? -7.029  -2.930  -3.272  1.00 0.00 ? 41  THR A HG21 1  
ATOM 621   H HG22 . THR A 1 41  ? -6.368  -2.088  -4.694  1.00 0.00 ? 41  THR A HG22 1  
ATOM 622   H HG23 . THR A 1 41  ? -6.263  -1.334  -3.085  1.00 0.00 ? 41  THR A HG23 1  
ATOM 623   N N    . GLY A 1 42  ? -9.884  -2.813  -1.871  1.00 0.00 ? 42  GLY A N    1  
ATOM 624   C CA   . GLY A 1 42  ? -10.117 -3.910  -0.948  1.00 0.00 ? 42  GLY A CA   1  
ATOM 625   C C    . GLY A 1 42  ? -9.439  -5.192  -1.436  1.00 0.00 ? 42  GLY A C    1  
ATOM 626   O O    . GLY A 1 42  ? -8.996  -6.010  -0.631  1.00 0.00 ? 42  GLY A O    1  
ATOM 627   H H    . GLY A 1 42  ? -10.438 -2.836  -2.703  1.00 0.00 ? 42  GLY A H    1  
ATOM 628   H HA2  . GLY A 1 42  ? -9.737  -3.647  0.039   1.00 0.00 ? 42  GLY A HA2  1  
ATOM 629   H HA3  . GLY A 1 42  ? -11.189 -4.080  -0.842  1.00 0.00 ? 42  GLY A HA3  1  
ATOM 630   N N    . THR A 1 43  ? -9.380  -5.327  -2.753  1.00 0.00 ? 43  THR A N    1  
ATOM 631   C CA   . THR A 1 43  ? -8.763  -6.495  -3.358  1.00 0.00 ? 43  THR A CA   1  
ATOM 632   C C    . THR A 1 43  ? -7.257  -6.279  -3.522  1.00 0.00 ? 43  THR A C    1  
ATOM 633   O O    . THR A 1 43  ? -6.819  -5.189  -3.885  1.00 0.00 ? 43  THR A O    1  
ATOM 634   C CB   . THR A 1 43  ? -9.483  -6.780  -4.678  1.00 0.00 ? 43  THR A CB   1  
ATOM 635   O OG1  . THR A 1 43  ? -10.854 -6.900  -4.307  1.00 0.00 ? 43  THR A OG1  1  
ATOM 636   C CG2  . THR A 1 43  ? -9.131  -8.153  -5.253  1.00 0.00 ? 43  THR A CG2  1  
ATOM 637   H H    . THR A 1 43  ? -9.743  -4.658  -3.401  1.00 0.00 ? 43  THR A H    1  
ATOM 638   H HA   . THR A 1 43  ? -8.893  -7.341  -2.683  1.00 0.00 ? 43  THR A HA   1  
ATOM 639   H HB   . THR A 1 43  ? -9.288  -5.991  -5.405  1.00 0.00 ? 43  THR A HB   1  
ATOM 640   H HG1  . THR A 1 43  ? -11.394 -7.206  -5.090  1.00 0.00 ? 43  THR A HG1  1  
ATOM 641   H HG21 . THR A 1 43  ? -8.395  -8.036  -6.049  1.00 0.00 ? 43  THR A HG21 1  
ATOM 642   H HG22 . THR A 1 43  ? -8.717  -8.782  -4.465  1.00 0.00 ? 43  THR A HG22 1  
ATOM 643   H HG23 . THR A 1 43  ? -10.030 -8.620  -5.656  1.00 0.00 ? 43  THR A HG23 1  
ATOM 644   N N    . ALA A 1 44  ? -6.507  -7.336  -3.246  1.00 0.00 ? 44  ALA A N    1  
ATOM 645   C CA   . ALA A 1 44  ? -5.059  -7.275  -3.358  1.00 0.00 ? 44  ALA A CA   1  
ATOM 646   C C    . ALA A 1 44  ? -4.654  -7.519  -4.813  1.00 0.00 ? 44  ALA A C    1  
ATOM 647   O O    . ALA A 1 44  ? -3.790  -6.825  -5.346  1.00 0.00 ? 44  ALA A O    1  
ATOM 648   C CB   . ALA A 1 44  ? -4.430  -8.289  -2.400  1.00 0.00 ? 44  ALA A CB   1  
ATOM 649   H H    . ALA A 1 44  ? -6.871  -8.219  -2.952  1.00 0.00 ? 44  ALA A H    1  
ATOM 650   H HA   . ALA A 1 44  ? -4.746  -6.273  -3.066  1.00 0.00 ? 44  ALA A HA   1  
ATOM 651   H HB1  . ALA A 1 44  ? -3.473  -8.621  -2.800  1.00 0.00 ? 44  ALA A HB1  1  
ATOM 652   H HB2  . ALA A 1 44  ? -4.275  -7.821  -1.428  1.00 0.00 ? 44  ALA A HB2  1  
ATOM 653   H HB3  . ALA A 1 44  ? -5.095  -9.145  -2.289  1.00 0.00 ? 44  ALA A HB3  1  
ATOM 654   N N    . ASN A 1 45  ? -5.298  -8.508  -5.415  1.00 0.00 ? 45  ASN A N    1  
ATOM 655   C CA   . ASN A 1 45  ? -5.016  -8.853  -6.799  1.00 0.00 ? 45  ASN A CA   1  
ATOM 656   C C    . ASN A 1 45  ? -5.288  -7.638  -7.688  1.00 0.00 ? 45  ASN A C    1  
ATOM 657   O O    . ASN A 1 45  ? -4.831  -7.585  -8.829  1.00 0.00 ? 45  ASN A O    1  
ATOM 658   C CB   . ASN A 1 45  ? -5.912  -9.998  -7.275  1.00 0.00 ? 45  ASN A CB   1  
ATOM 659   C CG   . ASN A 1 45  ? -5.661  -11.267 -6.458  1.00 0.00 ? 45  ASN A CG   1  
ATOM 660   O OD1  . ASN A 1 45  ? -5.454  -11.231 -5.256  1.00 0.00 ? 45  ASN A OD1  1  
ATOM 661   N ND2  . ASN A 1 45  ? -5.692  -12.386 -7.175  1.00 0.00 ? 45  ASN A ND2  1  
ATOM 662   H H    . ASN A 1 45  ? -6.000  -9.068  -4.976  1.00 0.00 ? 45  ASN A H    1  
ATOM 663   H HA   . ASN A 1 45  ? -3.968  -9.152  -6.811  1.00 0.00 ? 45  ASN A HA   1  
ATOM 664   H HB2  . ASN A 1 45  ? -6.958  -9.706  -7.188  1.00 0.00 ? 45  ASN A HB2  1  
ATOM 665   H HB3  . ASN A 1 45  ? -5.723  -10.197 -8.330  1.00 0.00 ? 45  ASN A HB3  1  
ATOM 666   H HD21 . ASN A 1 45  ? -5.867  -12.346 -8.159  1.00 0.00 ? 45  ASN A HD21 1  
ATOM 667   H HD22 . ASN A 1 45  ? -5.539  -13.269 -6.731  1.00 0.00 ? 45  ASN A HD22 1  
ATOM 668   N N    . LYS A 1 46  ? -6.030  -6.692  -7.132  1.00 0.00 ? 46  LYS A N    1  
ATOM 669   C CA   . LYS A 1 46  ? -6.368  -5.481  -7.860  1.00 0.00 ? 46  LYS A CA   1  
ATOM 670   C C    . LYS A 1 46  ? -5.751  -4.274  -7.150  1.00 0.00 ? 46  LYS A C    1  
ATOM 671   O O    . LYS A 1 46  ? -6.413  -3.254  -6.963  1.00 0.00 ? 46  LYS A O    1  
ATOM 672   C CB   . LYS A 1 46  ? -7.883  -5.375  -8.049  1.00 0.00 ? 46  LYS A CB   1  
ATOM 673   C CG   . LYS A 1 46  ? -8.411  -6.528  -8.904  1.00 0.00 ? 46  LYS A CG   1  
ATOM 674   C CD   . LYS A 1 46  ? -9.164  -6.003  -10.128 1.00 0.00 ? 46  LYS A CD   1  
ATOM 675   C CE   . LYS A 1 46  ? -9.693  -7.157  -10.983 1.00 0.00 ? 46  LYS A CE   1  
ATOM 676   N NZ   . LYS A 1 46  ? -8.609  -7.725  -11.816 1.00 0.00 ? 46  LYS A NZ   1  
ATOM 677   H H    . LYS A 1 46  ? -6.398  -6.743  -6.203  1.00 0.00 ? 46  LYS A H    1  
ATOM 678   H HA   . LYS A 1 46  ? -5.925  -5.562  -8.852  1.00 0.00 ? 46  LYS A HA   1  
ATOM 679   H HB2  . LYS A 1 46  ? -8.376  -5.382  -7.077  1.00 0.00 ? 46  LYS A HB2  1  
ATOM 680   H HB3  . LYS A 1 46  ? -8.128  -4.424  -8.523  1.00 0.00 ? 46  LYS A HB3  1  
ATOM 681   H HG2  . LYS A 1 46  ? -7.581  -7.157  -9.226  1.00 0.00 ? 46  LYS A HG2  1  
ATOM 682   H HG3  . LYS A 1 46  ? -9.073  -7.155  -8.307  1.00 0.00 ? 46  LYS A HG3  1  
ATOM 683   H HD2  . LYS A 1 46  ? -9.994  -5.374  -9.807  1.00 0.00 ? 46  LYS A HD2  1  
ATOM 684   H HD3  . LYS A 1 46  ? -8.502  -5.377  -10.726 1.00 0.00 ? 46  LYS A HD3  1  
ATOM 685   H HE2  . LYS A 1 46  ? -10.110 -7.932  -10.340 1.00 0.00 ? 46  LYS A HE2  1  
ATOM 686   H HE3  . LYS A 1 46  ? -10.502 -6.803  -11.621 1.00 0.00 ? 46  LYS A HE3  1  
ATOM 687   H HZ1  . LYS A 1 46  ? -7.724  -7.517  -11.398 1.00 0.00 ? 46  LYS A HZ1  1  
ATOM 688   H HZ2  . LYS A 1 46  ? -8.723  -8.716  -11.880 1.00 0.00 ? 46  LYS A HZ2  1  
ATOM 689   H HZ3  . LYS A 1 46  ? -8.648  -7.324  -12.731 1.00 0.00 ? 46  LYS A HZ3  1  
ATOM 690   N N    . ALA A 1 47  ? -4.491  -4.431  -6.773  1.00 0.00 ? 47  ALA A N    1  
ATOM 691   C CA   . ALA A 1 47  ? -3.777  -3.367  -6.088  1.00 0.00 ? 47  ALA A CA   1  
ATOM 692   C C    . ALA A 1 47  ? -2.341  -3.303  -6.611  1.00 0.00 ? 47  ALA A C    1  
ATOM 693   O O    . ALA A 1 47  ? -1.832  -4.280  -7.159  1.00 0.00 ? 47  ALA A O    1  
ATOM 694   C CB   . ALA A 1 47  ? -3.838  -3.602  -4.577  1.00 0.00 ? 47  ALA A CB   1  
ATOM 695   H H    . ALA A 1 47  ? -3.960  -5.264  -6.929  1.00 0.00 ? 47  ALA A H    1  
ATOM 696   H HA   . ALA A 1 47  ? -4.281  -2.428  -6.317  1.00 0.00 ? 47  ALA A HA   1  
ATOM 697   H HB1  . ALA A 1 47  ? -4.018  -2.655  -4.069  1.00 0.00 ? 47  ALA A HB1  1  
ATOM 698   H HB2  . ALA A 1 47  ? -4.647  -4.296  -4.350  1.00 0.00 ? 47  ALA A HB2  1  
ATOM 699   H HB3  . ALA A 1 47  ? -2.892  -4.023  -4.237  1.00 0.00 ? 47  ALA A HB3  1  
ATOM 700   N N    . SER A 1 48  ? -1.727  -2.144  -6.423  1.00 0.00 ? 48  SER A N    1  
ATOM 701   C CA   . SER A 1 48  ? -0.360  -1.940  -6.869  1.00 0.00 ? 48  SER A CA   1  
ATOM 702   C C    . SER A 1 48  ? 0.585   -1.914  -5.665  1.00 0.00 ? 48  SER A C    1  
ATOM 703   O O    . SER A 1 48  ? 1.756   -2.270  -5.783  1.00 0.00 ? 48  SER A O    1  
ATOM 704   C CB   . SER A 1 48  ? -0.230  -0.645  -7.673  1.00 0.00 ? 48  SER A CB   1  
ATOM 705   O OG   . SER A 1 48  ? 1.127   -0.347  -7.990  1.00 0.00 ? 48  SER A OG   1  
ATOM 706   H H    . SER A 1 48  ? -2.148  -1.354  -5.976  1.00 0.00 ? 48  SER A H    1  
ATOM 707   H HA   . SER A 1 48  ? -0.136  -2.790  -7.512  1.00 0.00 ? 48  SER A HA   1  
ATOM 708   H HB2  . SER A 1 48  ? -0.807  -0.731  -8.594  1.00 0.00 ? 48  SER A HB2  1  
ATOM 709   H HB3  . SER A 1 48  ? -0.659  0.180   -7.104  1.00 0.00 ? 48  SER A HB3  1  
ATOM 710   H HG   . SER A 1 48  ? 1.694   -0.419  -7.170  1.00 0.00 ? 48  SER A HG   1  
ATOM 711   N N    . LEU A 1 49  ? 0.040   -1.488  -4.535  1.00 0.00 ? 49  LEU A N    1  
ATOM 712   C CA   . LEU A 1 49  ? 0.819   -1.411  -3.311  1.00 0.00 ? 49  LEU A CA   1  
ATOM 713   C C    . LEU A 1 49  ? 0.017   -2.023  -2.161  1.00 0.00 ? 49  LEU A C    1  
ATOM 714   O O    . LEU A 1 49  ? -1.169  -2.314  -2.313  1.00 0.00 ? 49  LEU A O    1  
ATOM 715   C CB   . LEU A 1 49  ? 1.267   0.029   -3.051  1.00 0.00 ? 49  LEU A CB   1  
ATOM 716   C CG   . LEU A 1 49  ? 2.732   0.343   -3.365  1.00 0.00 ? 49  LEU A CG   1  
ATOM 717   C CD1  . LEU A 1 49  ? 3.065   1.797   -3.028  1.00 0.00 ? 49  LEU A CD1  1  
ATOM 718   C CD2  . LEU A 1 49  ? 3.667   -0.638  -2.655  1.00 0.00 ? 49  LEU A CD2  1  
ATOM 719   H H    . LEU A 1 49  ? -0.914  -1.200  -4.448  1.00 0.00 ? 49  LEU A H    1  
ATOM 720   H HA   . LEU A 1 49  ? 1.720   -2.007  -3.459  1.00 0.00 ? 49  LEU A HA   1  
ATOM 721   H HB2  . LEU A 1 49  ? 0.639   0.696   -3.641  1.00 0.00 ? 49  LEU A HB2  1  
ATOM 722   H HB3  . LEU A 1 49  ? 1.083   0.262   -2.002  1.00 0.00 ? 49  LEU A HB3  1  
ATOM 723   H HG   . LEU A 1 49  ? 2.886   0.217   -4.436  1.00 0.00 ? 49  LEU A HG   1  
ATOM 724   H HD11 . LEU A 1 49  ? 3.800   1.825   -2.224  1.00 0.00 ? 49  LEU A HD11 1  
ATOM 725   H HD12 . LEU A 1 49  ? 3.472   2.290   -3.911  1.00 0.00 ? 49  LEU A HD12 1  
ATOM 726   H HD13 . LEU A 1 49  ? 2.159   2.313   -2.710  1.00 0.00 ? 49  LEU A HD13 1  
ATOM 727   H HD21 . LEU A 1 49  ? 4.304   -1.130  -3.391  1.00 0.00 ? 49  LEU A HD21 1  
ATOM 728   H HD22 . LEU A 1 49  ? 4.287   -0.097  -1.941  1.00 0.00 ? 49  LEU A HD22 1  
ATOM 729   H HD23 . LEU A 1 49  ? 3.076   -1.387  -2.128  1.00 0.00 ? 49  LEU A HD23 1  
ATOM 730   N N    . CYS A 1 50  ? 0.695   -2.199  -1.036  1.00 0.00 ? 50  CYS A N    1  
ATOM 731   C CA   . CYS A 1 50  ? 0.060   -2.770  0.139   1.00 0.00 ? 50  CYS A CA   1  
ATOM 732   C C    . CYS A 1 50  ? 0.654   -2.101  1.380   1.00 0.00 ? 50  CYS A C    1  
ATOM 733   O O    . CYS A 1 50  ? 1.862   -2.163  1.605   1.00 0.00 ? 50  CYS A O    1  
ATOM 734   C CB   . CYS A 1 50  ? 0.215   -4.292  0.182   1.00 0.00 ? 50  CYS A CB   1  
ATOM 735   S SG   . CYS A 1 50  ? -0.667  -4.970  1.635   1.00 0.00 ? 50  CYS A SG   1  
ATOM 736   H H    . CYS A 1 50  ? 1.659   -1.959  -0.921  1.00 0.00 ? 50  CYS A H    1  
ATOM 737   H HA   . CYS A 1 50  ? -1.005  -2.555  0.055   1.00 0.00 ? 50  CYS A HA   1  
ATOM 738   H HB2  . CYS A 1 50  ? -0.182  -4.732  -0.733  1.00 0.00 ? 50  CYS A HB2  1  
ATOM 739   H HB3  . CYS A 1 50  ? 1.271   -4.557  0.231   1.00 0.00 ? 50  CYS A HB3  1  
ATOM 740   H HG   . CYS A 1 50  ? -1.402  -3.886  1.870   1.00 0.00 ? 50  CYS A HG   1  
ATOM 741   N N    . ILE A 1 51  ? -0.222  -1.475  2.152   1.00 0.00 ? 51  ILE A N    1  
ATOM 742   C CA   . ILE A 1 51  ? 0.201   -0.795  3.364   1.00 0.00 ? 51  ILE A CA   1  
ATOM 743   C C    . ILE A 1 51  ? -0.285  -1.583  4.582   1.00 0.00 ? 51  ILE A C    1  
ATOM 744   O O    . ILE A 1 51  ? -1.425  -1.422  5.016   1.00 0.00 ? 51  ILE A O    1  
ATOM 745   C CB   . ILE A 1 51  ? -0.263  0.663   3.350   1.00 0.00 ? 51  ILE A CB   1  
ATOM 746   C CG1  . ILE A 1 51  ? 0.344   1.420   2.166   1.00 0.00 ? 51  ILE A CG1  1  
ATOM 747   C CG2  . ILE A 1 51  ? 0.040   1.348   4.684   1.00 0.00 ? 51  ILE A CG2  1  
ATOM 748   C CD1  . ILE A 1 51  ? 0.002   2.910   2.235   1.00 0.00 ? 51  ILE A CD1  1  
ATOM 749   H H    . ILE A 1 51  ? -1.203  -1.429  1.962   1.00 0.00 ? 51  ILE A H    1  
ATOM 750   H HA   . ILE A 1 51  ? 1.291   -0.786  3.371   1.00 0.00 ? 51  ILE A HA   1  
ATOM 751   H HB   . ILE A 1 51  ? -1.345  0.676   3.220   1.00 0.00 ? 51  ILE A HB   1  
ATOM 752   H HG12 . ILE A 1 51  ? 1.426   1.291   2.164   1.00 0.00 ? 51  ILE A HG12 1  
ATOM 753   H HG13 . ILE A 1 51  ? -0.029  1.000   1.232   1.00 0.00 ? 51  ILE A HG13 1  
ATOM 754   H HG21 . ILE A 1 51  ? -0.891  1.696   5.133   1.00 0.00 ? 51  ILE A HG21 1  
ATOM 755   H HG22 . ILE A 1 51  ? 0.524   0.638   5.355   1.00 0.00 ? 51  ILE A HG22 1  
ATOM 756   H HG23 . ILE A 1 51  ? 0.701   2.197   4.515   1.00 0.00 ? 51  ILE A HG23 1  
ATOM 757   H HD11 . ILE A 1 51  ? -1.009  3.033   2.624   1.00 0.00 ? 51  ILE A HD11 1  
ATOM 758   H HD12 . ILE A 1 51  ? 0.708   3.415   2.893   1.00 0.00 ? 51  ILE A HD12 1  
ATOM 759   H HD13 . ILE A 1 51  ? 0.062   3.343   1.236   1.00 0.00 ? 51  ILE A HD13 1  
ATOM 760   N N    . SER A 1 52  ? 0.604   -2.418  5.100   1.00 0.00 ? 52  SER A N    1  
ATOM 761   C CA   . SER A 1 52  ? 0.279   -3.231  6.260   1.00 0.00 ? 52  SER A CA   1  
ATOM 762   C C    . SER A 1 52  ? 1.368   -3.081  7.325   1.00 0.00 ? 52  SER A C    1  
ATOM 763   O O    . SER A 1 52  ? 2.261   -2.246  7.191   1.00 0.00 ? 52  SER A O    1  
ATOM 764   C CB   . SER A 1 52  ? 0.115   -4.702  5.872   1.00 0.00 ? 52  SER A CB   1  
ATOM 765   O OG   . SER A 1 52  ? -0.787  -5.385  6.739   1.00 0.00 ? 52  SER A OG   1  
ATOM 766   H H    . SER A 1 52  ? 1.529   -2.543  4.742   1.00 0.00 ? 52  SER A H    1  
ATOM 767   H HA   . SER A 1 52  ? -0.671  -2.844  6.627   1.00 0.00 ? 52  SER A HA   1  
ATOM 768   H HB2  . SER A 1 52  ? -0.248  -4.768  4.846   1.00 0.00 ? 52  SER A HB2  1  
ATOM 769   H HB3  . SER A 1 52  ? 1.086   -5.195  5.899   1.00 0.00 ? 52  SER A HB3  1  
ATOM 770   H HG   . SER A 1 52  ? -1.349  -4.724  7.237   1.00 0.00 ? 52  SER A HG   1  
ATOM 771   N N    . THR A 1 53  ? 1.257   -3.904  8.358   1.00 0.00 ? 53  THR A N    1  
ATOM 772   C CA   . THR A 1 53  ? 2.221   -3.873  9.445   1.00 0.00 ? 53  THR A CA   1  
ATOM 773   C C    . THR A 1 53  ? 3.029   -5.172  9.478   1.00 0.00 ? 53  THR A C    1  
ATOM 774   O O    . THR A 1 53  ? 2.573   -6.204  8.987   1.00 0.00 ? 53  THR A O    1  
ATOM 775   C CB   . THR A 1 53  ? 1.460   -3.598  10.743  1.00 0.00 ? 53  THR A CB   1  
ATOM 776   O OG1  . THR A 1 53  ? 0.360   -4.502  10.700  1.00 0.00 ? 53  THR A OG1  1  
ATOM 777   C CG2  . THR A 1 53  ? 0.805   -2.215  10.756  1.00 0.00 ? 53  THR A CG2  1  
ATOM 778   H H    . THR A 1 53  ? 0.527   -4.580  8.459   1.00 0.00 ? 53  THR A H    1  
ATOM 779   H HA   . THR A 1 53  ? 2.925   -3.063  9.257   1.00 0.00 ? 53  THR A HA   1  
ATOM 780   H HB   . THR A 1 53  ? 2.108   -3.730  11.610  1.00 0.00 ? 53  THR A HB   1  
ATOM 781   H HG1  . THR A 1 53  ? -0.081  -4.548  11.596  1.00 0.00 ? 53  THR A HG1  1  
ATOM 782   H HG21 . THR A 1 53  ? -0.131  -2.251  10.198  1.00 0.00 ? 53  THR A HG21 1  
ATOM 783   H HG22 . THR A 1 53  ? 0.603   -1.918  11.785  1.00 0.00 ? 53  THR A HG22 1  
ATOM 784   H HG23 . THR A 1 53  ? 1.476   -1.491  10.294  1.00 0.00 ? 53  THR A HG23 1  
ATOM 785   N N    . LYS A 1 54  ? 4.214   -5.079  10.062  1.00 0.00 ? 54  LYS A N    1  
ATOM 786   C CA   . LYS A 1 54  ? 5.090   -6.234  10.165  1.00 0.00 ? 54  LYS A CA   1  
ATOM 787   C C    . LYS A 1 54  ? 4.293   -7.427  10.697  1.00 0.00 ? 54  LYS A C    1  
ATOM 788   O O    . LYS A 1 54  ? 4.411   -8.537  10.180  1.00 0.00 ? 54  LYS A O    1  
ATOM 789   C CB   . LYS A 1 54  ? 6.324   -5.897  11.004  1.00 0.00 ? 54  LYS A CB   1  
ATOM 790   C CG   . LYS A 1 54  ? 7.105   -7.163  11.364  1.00 0.00 ? 54  LYS A CG   1  
ATOM 791   C CD   . LYS A 1 54  ? 8.598   -6.987  11.078  1.00 0.00 ? 54  LYS A CD   1  
ATOM 792   C CE   . LYS A 1 54  ? 8.902   -7.212  9.595   1.00 0.00 ? 54  LYS A CE   1  
ATOM 793   N NZ   . LYS A 1 54  ? 9.797   -6.150  9.083   1.00 0.00 ? 54  LYS A NZ   1  
ATOM 794   H H    . LYS A 1 54  ? 4.578   -4.236  10.459  1.00 0.00 ? 54  LYS A H    1  
ATOM 795   H HA   . LYS A 1 54  ? 5.438   -6.471  9.160   1.00 0.00 ? 54  LYS A HA   1  
ATOM 796   H HB2  . LYS A 1 54  ? 6.969   -5.213  10.451  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 797   H HB3  . LYS A 1 54  ? 6.020   -5.381  11.915  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 798   H HG2  . LYS A 1 54  ? 6.958   -7.397  12.419  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 799   H HG3  . LYS A 1 54  ? 6.719   -8.007  10.794  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 800   H HD2  . LYS A 1 54  ? 8.912   -5.984  11.369  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 801   H HD3  . LYS A 1 54  ? 9.173   -7.689  11.681  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 802   H HE2  . LYS A 1 54  ? 9.368   -8.187  9.458   1.00 0.00 ? 54  LYS A HE2  1  
ATOM 803   H HE3  . LYS A 1 54  ? 7.973   -7.219  9.025   1.00 0.00 ? 54  LYS A HE3  1  
ATOM 804   H HZ1  . LYS A 1 54  ? 9.248   -5.389  8.738   1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 805   H HZ2  . LYS A 1 54  ? 10.388  -5.827  9.822   1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 806   H HZ3  . LYS A 1 54  ? 10.360  -6.518  8.343   1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 807   N N    . LYS A 1 55  ? 3.499   -7.158  11.723  1.00 0.00 ? 55  LYS A N    1  
ATOM 808   C CA   . LYS A 1 55  ? 2.683   -8.195  12.330  1.00 0.00 ? 55  LYS A CA   1  
ATOM 809   C C    . LYS A 1 55  ? 1.843   -8.876  11.248  1.00 0.00 ? 55  LYS A C    1  
ATOM 810   O O    . LYS A 1 55  ? 1.834   -10.102 11.144  1.00 0.00 ? 55  LYS A O    1  
ATOM 811   C CB   . LYS A 1 55  ? 1.854   -7.620  13.480  1.00 0.00 ? 55  LYS A CB   1  
ATOM 812   C CG   . LYS A 1 55  ? 2.579   -7.789  14.817  1.00 0.00 ? 55  LYS A CG   1  
ATOM 813   C CD   . LYS A 1 55  ? 2.335   -6.585  15.729  1.00 0.00 ? 55  LYS A CD   1  
ATOM 814   C CE   . LYS A 1 55  ? 1.910   -7.035  17.129  1.00 0.00 ? 55  LYS A CE   1  
ATOM 815   N NZ   . LYS A 1 55  ? 2.687   -6.315  18.162  1.00 0.00 ? 55  LYS A NZ   1  
ATOM 816   H H    . LYS A 1 55  ? 3.409   -6.252  12.138  1.00 0.00 ? 55  LYS A H    1  
ATOM 817   H HA   . LYS A 1 55  ? 3.360   -8.934  12.759  1.00 0.00 ? 55  LYS A HA   1  
ATOM 818   H HB2  . LYS A 1 55  ? 1.658   -6.563  13.300  1.00 0.00 ? 55  LYS A HB2  1  
ATOM 819   H HB3  . LYS A 1 55  ? 0.886   -8.120  13.521  1.00 0.00 ? 55  LYS A HB3  1  
ATOM 820   H HG2  . LYS A 1 55  ? 2.234   -8.699  15.309  1.00 0.00 ? 55  LYS A HG2  1  
ATOM 821   H HG3  . LYS A 1 55  ? 3.648   -7.907  14.642  1.00 0.00 ? 55  LYS A HG3  1  
ATOM 822   H HD2  . LYS A 1 55  ? 3.243   -5.986  15.796  1.00 0.00 ? 55  LYS A HD2  1  
ATOM 823   H HD3  . LYS A 1 55  ? 1.563   -5.948  15.298  1.00 0.00 ? 55  LYS A HD3  1  
ATOM 824   H HE2  . LYS A 1 55  ? 0.846   -6.848  17.270  1.00 0.00 ? 55  LYS A HE2  1  
ATOM 825   H HE3  . LYS A 1 55  ? 2.062   -8.109  17.234  1.00 0.00 ? 55  LYS A HE3  1  
ATOM 826   H HZ1  . LYS A 1 55  ? 2.064   -5.797  18.748  1.00 0.00 ? 55  LYS A HZ1  1  
ATOM 827   H HZ2  . LYS A 1 55  ? 3.195   -6.975  18.717  1.00 0.00 ? 55  LYS A HZ2  1  
ATOM 828   H HZ3  . LYS A 1 55  ? 3.329   -5.688  17.721  1.00 0.00 ? 55  LYS A HZ3  1  
ATOM 829   N N    . GLU A 1 56  ? 1.159   -8.052  10.469  1.00 0.00 ? 56  GLU A N    1  
ATOM 830   C CA   . GLU A 1 56  ? 0.318   -8.560  9.398   1.00 0.00 ? 56  GLU A CA   1  
ATOM 831   C C    . GLU A 1 56  ? 1.123   -9.486  8.484   1.00 0.00 ? 56  GLU A C    1  
ATOM 832   O O    . GLU A 1 56  ? 0.853   -10.683 8.414   1.00 0.00 ? 56  GLU A O    1  
ATOM 833   C CB   . GLU A 1 56  ? -0.308  -7.413  8.602   1.00 0.00 ? 56  GLU A CB   1  
ATOM 834   C CG   . GLU A 1 56  ? -1.836  -7.483  8.648   1.00 0.00 ? 56  GLU A CG   1  
ATOM 835   C CD   . GLU A 1 56  ? -2.340  -8.820  8.100   1.00 0.00 ? 56  GLU A CD   1  
ATOM 836   O OE1  . GLU A 1 56  ? -2.288  -9.804  8.869   1.00 0.00 ? 56  GLU A OE1  1  
ATOM 837   O OE2  . GLU A 1 56  ? -2.766  -8.827  6.925   1.00 0.00 ? 56  GLU A OE2  1  
ATOM 838   H H    . GLU A 1 56  ? 1.172   -7.056  10.560  1.00 0.00 ? 56  GLU A H    1  
ATOM 839   H HA   . GLU A 1 56  ? -0.473  -9.124  9.892   1.00 0.00 ? 56  GLU A HA   1  
ATOM 840   H HB2  . GLU A 1 56  ? 0.028   -6.458  9.006   1.00 0.00 ? 56  GLU A HB2  1  
ATOM 841   H HB3  . GLU A 1 56  ? 0.030   -7.457  7.566   1.00 0.00 ? 56  GLU A HB3  1  
ATOM 842   H HG2  . GLU A 1 56  ? -2.178  -7.354  9.675   1.00 0.00 ? 56  GLU A HG2  1  
ATOM 843   H HG3  . GLU A 1 56  ? -2.259  -6.664  8.066   1.00 0.00 ? 56  GLU A HG3  1  
ATOM 844   N N    . VAL A 1 57  ? 2.097   -8.895  7.806   1.00 0.00 ? 57  VAL A N    1  
ATOM 845   C CA   . VAL A 1 57  ? 2.944   -9.652  6.900   1.00 0.00 ? 57  VAL A CA   1  
ATOM 846   C C    . VAL A 1 57  ? 3.398   -10.940 7.590   1.00 0.00 ? 57  VAL A C    1  
ATOM 847   O O    . VAL A 1 57  ? 3.673   -11.939 6.927   1.00 0.00 ? 57  VAL A O    1  
ATOM 848   C CB   . VAL A 1 57  ? 4.111   -8.784  6.426   1.00 0.00 ? 57  VAL A CB   1  
ATOM 849   C CG1  . VAL A 1 57  ? 5.077   -9.591  5.557   1.00 0.00 ? 57  VAL A CG1  1  
ATOM 850   C CG2  . VAL A 1 57  ? 3.607   -7.546  5.682   1.00 0.00 ? 57  VAL A CG2  1  
ATOM 851   H H    . VAL A 1 57  ? 2.310   -7.920  7.869   1.00 0.00 ? 57  VAL A H    1  
ATOM 852   H HA   . VAL A 1 57  ? 2.342   -9.914  6.029   1.00 0.00 ? 57  VAL A HA   1  
ATOM 853   H HB   . VAL A 1 57  ? 4.656   -8.446  7.308   1.00 0.00 ? 57  VAL A HB   1  
ATOM 854   H HG11 . VAL A 1 57  ? 5.982   -9.009  5.382   1.00 0.00 ? 57  VAL A HG11 1  
ATOM 855   H HG12 . VAL A 1 57  ? 5.335   -10.520 6.066   1.00 0.00 ? 57  VAL A HG12 1  
ATOM 856   H HG13 . VAL A 1 57  ? 4.602   -9.819  4.602   1.00 0.00 ? 57  VAL A HG13 1  
ATOM 857   H HG21 . VAL A 1 57  ? 4.323   -6.733  5.803   1.00 0.00 ? 57  VAL A HG21 1  
ATOM 858   H HG22 . VAL A 1 57  ? 3.497   -7.778  4.623   1.00 0.00 ? 57  VAL A HG22 1  
ATOM 859   H HG23 . VAL A 1 57  ? 2.642   -7.244  6.090   1.00 0.00 ? 57  VAL A HG23 1  
ATOM 860   N N    . GLU A 1 58  ? 3.463   -10.875 8.911   1.00 0.00 ? 58  GLU A N    1  
ATOM 861   C CA   . GLU A 1 58  ? 3.879   -12.024 9.698   1.00 0.00 ? 58  GLU A CA   1  
ATOM 862   C C    . GLU A 1 58  ? 2.737   -13.036 9.805   1.00 0.00 ? 58  GLU A C    1  
ATOM 863   O O    . GLU A 1 58  ? 2.965   -14.243 9.752   1.00 0.00 ? 58  GLU A O    1  
ATOM 864   C CB   . GLU A 1 58  ? 4.361   -11.593 11.084  1.00 0.00 ? 58  GLU A CB   1  
ATOM 865   C CG   . GLU A 1 58  ? 5.890   -11.583 11.154  1.00 0.00 ? 58  GLU A CG   1  
ATOM 866   C CD   . GLU A 1 58  ? 6.373   -11.640 12.605  1.00 0.00 ? 58  GLU A CD   1  
ATOM 867   O OE1  . GLU A 1 58  ? 5.890   -12.537 13.329  1.00 0.00 ? 58  GLU A OE1  1  
ATOM 868   O OE2  . GLU A 1 58  ? 7.214   -10.785 12.957  1.00 0.00 ? 58  GLU A OE2  1  
ATOM 869   H H    . GLU A 1 58  ? 3.237   -10.058 9.443   1.00 0.00 ? 58  GLU A H    1  
ATOM 870   H HA   . GLU A 1 58  ? 4.713   -12.463 9.150   1.00 0.00 ? 58  GLU A HA   1  
ATOM 871   H HB2  . GLU A 1 58  ? 3.977   -10.600 11.315  1.00 0.00 ? 58  GLU A HB2  1  
ATOM 872   H HB3  . GLU A 1 58  ? 3.964   -12.272 11.839  1.00 0.00 ? 58  GLU A HB3  1  
ATOM 873   H HG2  . GLU A 1 58  ? 6.288   -12.433 10.601  1.00 0.00 ? 58  GLU A HG2  1  
ATOM 874   H HG3  . GLU A 1 58  ? 6.273   -10.682 10.675  1.00 0.00 ? 58  GLU A HG3  1  
ATOM 875   N N    . LYS A 1 59  ? 1.531   -12.506 9.953   1.00 0.00 ? 59  LYS A N    1  
ATOM 876   C CA   . LYS A 1 59  ? 0.353   -13.349 10.068  1.00 0.00 ? 59  LYS A CA   1  
ATOM 877   C C    . LYS A 1 59  ? 0.222   -14.210 8.811   1.00 0.00 ? 59  LYS A C    1  
ATOM 878   O O    . LYS A 1 59  ? 0.046   -15.424 8.901   1.00 0.00 ? 59  LYS A O    1  
ATOM 879   C CB   . LYS A 1 59  ? -0.886  -12.500 10.363  1.00 0.00 ? 59  LYS A CB   1  
ATOM 880   C CG   . LYS A 1 59  ? -1.162  -12.437 11.867  1.00 0.00 ? 59  LYS A CG   1  
ATOM 881   C CD   . LYS A 1 59  ? -0.693  -11.105 12.455  1.00 0.00 ? 59  LYS A CD   1  
ATOM 882   C CE   . LYS A 1 59  ? 0.476   -11.313 13.420  1.00 0.00 ? 59  LYS A CE   1  
ATOM 883   N NZ   . LYS A 1 59  ? 0.017   -11.198 14.823  1.00 0.00 ? 59  LYS A NZ   1  
ATOM 884   H H    . LYS A 1 59  ? 1.354   -11.523 9.996   1.00 0.00 ? 59  LYS A H    1  
ATOM 885   H HA   . LYS A 1 59  ? 0.504   -14.007 10.924  1.00 0.00 ? 59  LYS A HA   1  
ATOM 886   H HB2  . LYS A 1 59  ? -0.742  -11.492 9.974   1.00 0.00 ? 59  LYS A HB2  1  
ATOM 887   H HB3  . LYS A 1 59  ? -1.750  -12.920 9.848   1.00 0.00 ? 59  LYS A HB3  1  
ATOM 888   H HG2  . LYS A 1 59  ? -2.229  -12.564 12.050  1.00 0.00 ? 59  LYS A HG2  1  
ATOM 889   H HG3  . LYS A 1 59  ? -0.652  -13.260 12.368  1.00 0.00 ? 59  LYS A HG3  1  
ATOM 890   H HD2  . LYS A 1 59  ? -0.390  -10.434 11.651  1.00 0.00 ? 59  LYS A HD2  1  
ATOM 891   H HD3  . LYS A 1 59  ? -1.519  -10.623 12.977  1.00 0.00 ? 59  LYS A HD3  1  
ATOM 892   H HE2  . LYS A 1 59  ? 0.920   -12.295 13.257  1.00 0.00 ? 59  LYS A HE2  1  
ATOM 893   H HE3  . LYS A 1 59  ? 1.253   -10.574 13.224  1.00 0.00 ? 59  LYS A HE3  1  
ATOM 894   H HZ1  . LYS A 1 59  ? 0.738   -10.781 15.376  1.00 0.00 ? 59  LYS A HZ1  1  
ATOM 895   H HZ2  . LYS A 1 59  ? -0.803  -10.626 14.859  1.00 0.00 ? 59  LYS A HZ2  1  
ATOM 896   H HZ3  . LYS A 1 59  ? -0.195  -12.107 15.180  1.00 0.00 ? 59  LYS A HZ3  1  
ATOM 897   N N    . MET A 1 60  ? 0.315   -13.548 7.666   1.00 0.00 ? 60  MET A N    1  
ATOM 898   C CA   . MET A 1 60  ? 0.209   -14.239 6.392   1.00 0.00 ? 60  MET A CA   1  
ATOM 899   C C    . MET A 1 60  ? -1.168  -14.885 6.231   1.00 0.00 ? 60  MET A C    1  
ATOM 900   O O    . MET A 1 60  ? -1.280  -15.996 5.715   1.00 0.00 ? 60  MET A O    1  
ATOM 901   C CB   . MET A 1 60  ? 1.293   -15.316 6.304   1.00 0.00 ? 60  MET A CB   1  
ATOM 902   C CG   . MET A 1 60  ? 2.593   -14.741 5.738   1.00 0.00 ? 60  MET A CG   1  
ATOM 903   S SD   . MET A 1 60  ? 2.644   -14.973 3.969   1.00 0.00 ? 60  MET A SD   1  
ATOM 904   C CE   . MET A 1 60  ? 2.150   -13.346 3.428   1.00 0.00 ? 60  MET A CE   1  
ATOM 905   H H    . MET A 1 60  ? 0.459   -12.561 7.602   1.00 0.00 ? 60  MET A H    1  
ATOM 906   H HA   . MET A 1 60  ? 0.350   -13.471 5.631   1.00 0.00 ? 60  MET A HA   1  
ATOM 907   H HB2  . MET A 1 60  ? 1.476   -15.734 7.293   1.00 0.00 ? 60  MET A HB2  1  
ATOM 908   H HB3  . MET A 1 60  ? 0.947   -16.133 5.671   1.00 0.00 ? 60  MET A HB3  1  
ATOM 909   H HG2  . MET A 1 60  ? 2.664   -13.679 5.976   1.00 0.00 ? 60  MET A HG2  1  
ATOM 910   H HG3  . MET A 1 60  ? 3.449   -15.230 6.202   1.00 0.00 ? 60  MET A HG3  1  
ATOM 911   H HE1  . MET A 1 60  ? 1.167   -13.402 2.959   1.00 0.00 ? 60  MET A HE1  1  
ATOM 912   H HE2  . MET A 1 60  ? 2.105   -12.675 4.286   1.00 0.00 ? 60  MET A HE2  1  
ATOM 913   H HE3  . MET A 1 60  ? 2.875   -12.967 2.707   1.00 0.00 ? 60  MET A HE3  1  
ATOM 914   N N    . ASN A 1 61  ? -2.182  -14.162 6.682   1.00 0.00 ? 61  ASN A N    1  
ATOM 915   C CA   . ASN A 1 61  ? -3.547  -14.651 6.594   1.00 0.00 ? 61  ASN A CA   1  
ATOM 916   C C    . ASN A 1 61  ? -3.985  -14.670 5.128   1.00 0.00 ? 61  ASN A C    1  
ATOM 917   O O    . ASN A 1 61  ? -3.180  -14.414 4.233   1.00 0.00 ? 61  ASN A O    1  
ATOM 918   C CB   . ASN A 1 61  ? -4.509  -13.742 7.362   1.00 0.00 ? 61  ASN A CB   1  
ATOM 919   C CG   . ASN A 1 61  ? -5.693  -14.538 7.915   1.00 0.00 ? 61  ASN A CG   1  
ATOM 920   O OD1  . ASN A 1 61  ? -5.654  -15.751 8.040   1.00 0.00 ? 61  ASN A OD1  1  
ATOM 921   N ND2  . ASN A 1 61  ? -6.744  -13.790 8.238   1.00 0.00 ? 61  ASN A ND2  1  
ATOM 922   H H    . ASN A 1 61  ? -2.083  -13.259 7.100   1.00 0.00 ? 61  ASN A H    1  
ATOM 923   H HA   . ASN A 1 61  ? -3.524  -15.647 7.035   1.00 0.00 ? 61  ASN A HA   1  
ATOM 924   H HB2  . ASN A 1 61  ? -3.979  -13.255 8.181   1.00 0.00 ? 61  ASN A HB2  1  
ATOM 925   H HB3  . ASN A 1 61  ? -4.872  -12.952 6.705   1.00 0.00 ? 61  ASN A HB3  1  
ATOM 926   H HD21 . ASN A 1 61  ? -6.710  -12.798 8.111   1.00 0.00 ? 61  ASN A HD21 1  
ATOM 927   H HD22 . ASN A 1 61  ? -7.568  -14.219 8.609   1.00 0.00 ? 61  ASN A HD22 1  
ATOM 928   N N    . LYS A 1 62  ? -5.258  -14.975 4.927   1.00 0.00 ? 62  LYS A N    1  
ATOM 929   C CA   . LYS A 1 62  ? -5.812  -15.030 3.585   1.00 0.00 ? 62  LYS A CA   1  
ATOM 930   C C    . LYS A 1 62  ? -5.652  -13.664 2.915   1.00 0.00 ? 62  LYS A C    1  
ATOM 931   O O    . LYS A 1 62  ? -5.332  -13.583 1.730   1.00 0.00 ? 62  LYS A O    1  
ATOM 932   C CB   . LYS A 1 62  ? -7.257  -15.532 3.622   1.00 0.00 ? 62  LYS A CB   1  
ATOM 933   C CG   . LYS A 1 62  ? -8.033  -14.885 4.771   1.00 0.00 ? 62  LYS A CG   1  
ATOM 934   C CD   . LYS A 1 62  ? -8.186  -15.855 5.944   1.00 0.00 ? 62  LYS A CD   1  
ATOM 935   C CE   . LYS A 1 62  ? -9.635  -16.328 6.078   1.00 0.00 ? 62  LYS A CE   1  
ATOM 936   N NZ   . LYS A 1 62  ? -10.510 -15.209 6.493   1.00 0.00 ? 62  LYS A NZ   1  
ATOM 937   H H    . LYS A 1 62  ? -5.906  -15.182 5.661   1.00 0.00 ? 62  LYS A H    1  
ATOM 938   H HA   . LYS A 1 62  ? -5.231  -15.761 3.022   1.00 0.00 ? 62  LYS A HA   1  
ATOM 939   H HB2  . LYS A 1 62  ? -7.748  -15.308 2.675   1.00 0.00 ? 62  LYS A HB2  1  
ATOM 940   H HB3  . LYS A 1 62  ? -7.267  -16.616 3.737   1.00 0.00 ? 62  LYS A HB3  1  
ATOM 941   H HG2  . LYS A 1 62  ? -7.515  -13.985 5.103   1.00 0.00 ? 62  LYS A HG2  1  
ATOM 942   H HG3  . LYS A 1 62  ? -9.017  -14.574 4.420   1.00 0.00 ? 62  LYS A HG3  1  
ATOM 943   H HD2  . LYS A 1 62  ? -7.531  -16.714 5.798   1.00 0.00 ? 62  LYS A HD2  1  
ATOM 944   H HD3  . LYS A 1 62  ? -7.873  -15.367 6.867   1.00 0.00 ? 62  LYS A HD3  1  
ATOM 945   H HE2  . LYS A 1 62  ? -9.980  -16.735 5.127   1.00 0.00 ? 62  LYS A HE2  1  
ATOM 946   H HE3  . LYS A 1 62  ? -9.694  -17.134 6.809   1.00 0.00 ? 62  LYS A HE3  1  
ATOM 947   H HZ1  . LYS A 1 62  ? -11.466 -15.498 6.444   1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 948   H HZ2  . LYS A 1 62  ? -10.290 -14.944 7.431   1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 949   H HZ3  . LYS A 1 62  ? -10.365 -14.429 5.883   1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 950   N N    . LYS A 1 63  ? -5.883  -12.624 3.703   1.00 0.00 ? 63  LYS A N    1  
ATOM 951   C CA   . LYS A 1 63  ? -5.769  -11.265 3.201   1.00 0.00 ? 63  LYS A CA   1  
ATOM 952   C C    . LYS A 1 63  ? -4.349  -11.038 2.676   1.00 0.00 ? 63  LYS A C    1  
ATOM 953   O O    . LYS A 1 63  ? -4.160  -10.744 1.497   1.00 0.00 ? 63  LYS A O    1  
ATOM 954   C CB   . LYS A 1 63  ? -6.197  -10.260 4.273   1.00 0.00 ? 63  LYS A CB   1  
ATOM 955   C CG   . LYS A 1 63  ? -7.639  -10.512 4.715   1.00 0.00 ? 63  LYS A CG   1  
ATOM 956   C CD   . LYS A 1 63  ? -7.682  -11.198 6.082   1.00 0.00 ? 63  LYS A CD   1  
ATOM 957   C CE   . LYS A 1 63  ? -8.629  -10.466 7.034   1.00 0.00 ? 63  LYS A CE   1  
ATOM 958   N NZ   . LYS A 1 63  ? -9.947  -11.139 7.073   1.00 0.00 ? 63  LYS A NZ   1  
ATOM 959   H H    . LYS A 1 63  ? -6.143  -12.698 4.666   1.00 0.00 ? 63  LYS A H    1  
ATOM 960   H HA   . LYS A 1 63  ? -6.465  -11.165 2.369   1.00 0.00 ? 63  LYS A HA   1  
ATOM 961   H HB2  . LYS A 1 63  ? -5.531  -10.334 5.132   1.00 0.00 ? 63  LYS A HB2  1  
ATOM 962   H HB3  . LYS A 1 63  ? -6.103  -9.247  3.883   1.00 0.00 ? 63  LYS A HB3  1  
ATOM 963   H HG2  . LYS A 1 63  ? -8.179  -9.566  4.762   1.00 0.00 ? 63  LYS A HG2  1  
ATOM 964   H HG3  . LYS A 1 63  ? -8.147  -11.133 3.977   1.00 0.00 ? 63  LYS A HG3  1  
ATOM 965   H HD2  . LYS A 1 63  ? -8.006  -12.232 5.964   1.00 0.00 ? 63  LYS A HD2  1  
ATOM 966   H HD3  . LYS A 1 63  ? -6.680  -11.226 6.511   1.00 0.00 ? 63  LYS A HD3  1  
ATOM 967   H HE2  . LYS A 1 63  ? -8.199  -10.438 8.035   1.00 0.00 ? 63  LYS A HE2  1  
ATOM 968   H HE3  . LYS A 1 63  ? -8.752  -9.432  6.711   1.00 0.00 ? 63  LYS A HE3  1  
ATOM 969   H HZ1  . LYS A 1 63  ? -9.907  -11.913 7.705   1.00 0.00 ? 63  LYS A HZ1  1  
ATOM 970   H HZ2  . LYS A 1 63  ? -10.643 -10.491 7.382   1.00 0.00 ? 63  LYS A HZ2  1  
ATOM 971   H HZ3  . LYS A 1 63  ? -10.181 -11.468 6.158   1.00 0.00 ? 63  LYS A HZ3  1  
ATOM 972   N N    . MET A 1 64  ? -3.389  -11.182 3.578   1.00 0.00 ? 64  MET A N    1  
ATOM 973   C CA   . MET A 1 64  ? -1.993  -10.996 3.220   1.00 0.00 ? 64  MET A CA   1  
ATOM 974   C C    . MET A 1 64  ? -1.582  -11.952 2.100   1.00 0.00 ? 64  MET A C    1  
ATOM 975   O O    . MET A 1 64  ? -0.687  -11.645 1.314   1.00 0.00 ? 64  MET A O    1  
ATOM 976   C CB   . MET A 1 64  ? -1.115  -11.241 4.449   1.00 0.00 ? 64  MET A CB   1  
ATOM 977   C CG   . MET A 1 64  ? 0.328   -10.802 4.188   1.00 0.00 ? 64  MET A CG   1  
ATOM 978   S SD   . MET A 1 64  ? 0.367   -9.078  3.727   1.00 0.00 ? 64  MET A SD   1  
ATOM 979   C CE   . MET A 1 64  ? -0.048  -8.329  5.293   1.00 0.00 ? 64  MET A CE   1  
ATOM 980   H H    . MET A 1 64  ? -3.552  -11.421 4.535   1.00 0.00 ? 64  MET A H    1  
ATOM 981   H HA   . MET A 1 64  ? -1.915  -9.965  2.875   1.00 0.00 ? 64  MET A HA   1  
ATOM 982   H HB2  . MET A 1 64  ? -1.516  -10.694 5.302   1.00 0.00 ? 64  MET A HB2  1  
ATOM 983   H HB3  . MET A 1 64  ? -1.135  -12.299 4.710   1.00 0.00 ? 64  MET A HB3  1  
ATOM 984   H HG2  . MET A 1 64  ? 0.933   -10.962 5.080   1.00 0.00 ? 64  MET A HG2  1  
ATOM 985   H HG3  . MET A 1 64  ? 0.763   -11.409 3.394   1.00 0.00 ? 64  MET A HG3  1  
ATOM 986   H HE1  . MET A 1 64  ? -1.079  -8.571  5.549   1.00 0.00 ? 64  MET A HE1  1  
ATOM 987   H HE2  . MET A 1 64  ? 0.618   -8.711  6.066   1.00 0.00 ? 64  MET A HE2  1  
ATOM 988   H HE3  . MET A 1 64  ? 0.064   -7.247  5.219   1.00 0.00 ? 64  MET A HE3  1  
ATOM 989   N N    . GLU A 1 65  ? -2.256  -13.093 2.061   1.00 0.00 ? 65  GLU A N    1  
ATOM 990   C CA   . GLU A 1 65  ? -1.971  -14.096 1.050   1.00 0.00 ? 65  GLU A CA   1  
ATOM 991   C C    . GLU A 1 65  ? -2.218  -13.525 -0.348  1.00 0.00 ? 65  GLU A C    1  
ATOM 992   O O    . GLU A 1 65  ? -1.397  -13.699 -1.248  1.00 0.00 ? 65  GLU A O    1  
ATOM 993   C CB   . GLU A 1 65  ? -2.803  -15.359 1.281   1.00 0.00 ? 65  GLU A CB   1  
ATOM 994   C CG   . GLU A 1 65  ? -1.999  -16.413 2.044   1.00 0.00 ? 65  GLU A CG   1  
ATOM 995   C CD   . GLU A 1 65  ? -1.648  -17.596 1.140   1.00 0.00 ? 65  GLU A CD   1  
ATOM 996   O OE1  . GLU A 1 65  ? -1.026  -17.340 0.086   1.00 0.00 ? 65  GLU A OE1  1  
ATOM 997   O OE2  . GLU A 1 65  ? -2.010  -18.730 1.522   1.00 0.00 ? 65  GLU A OE2  1  
ATOM 998   H H    . GLU A 1 65  ? -2.982  -13.335 2.704   1.00 0.00 ? 65  GLU A H    1  
ATOM 999   H HA   . GLU A 1 65  ? -0.915  -14.338 1.169   1.00 0.00 ? 65  GLU A HA   1  
ATOM 1000  H HB2  . GLU A 1 65  ? -3.704  -15.108 1.841   1.00 0.00 ? 65  GLU A HB2  1  
ATOM 1001  H HB3  . GLU A 1 65  ? -3.127  -15.766 0.323   1.00 0.00 ? 65  GLU A HB3  1  
ATOM 1002  H HG2  . GLU A 1 65  ? -1.086  -15.966 2.435   1.00 0.00 ? 65  GLU A HG2  1  
ATOM 1003  H HG3  . GLU A 1 65  ? -2.575  -16.764 2.901   1.00 0.00 ? 65  GLU A HG3  1  
ATOM 1004  N N    . GLU A 1 66  ? -3.353  -12.855 -0.487  1.00 0.00 ? 66  GLU A N    1  
ATOM 1005  C CA   . GLU A 1 66  ? -3.718  -12.258 -1.761  1.00 0.00 ? 66  GLU A CA   1  
ATOM 1006  C C    . GLU A 1 66  ? -2.597  -11.343 -2.258  1.00 0.00 ? 66  GLU A C    1  
ATOM 1007  O O    . GLU A 1 66  ? -2.310  -11.301 -3.454  1.00 0.00 ? 66  GLU A O    1  
ATOM 1008  C CB   . GLU A 1 66  ? -5.040  -11.495 -1.649  1.00 0.00 ? 66  GLU A CB   1  
ATOM 1009  C CG   . GLU A 1 66  ? -6.154  -12.403 -1.124  1.00 0.00 ? 66  GLU A CG   1  
ATOM 1010  C CD   . GLU A 1 66  ? -6.976  -12.985 -2.276  1.00 0.00 ? 66  GLU A CD   1  
ATOM 1011  O OE1  . GLU A 1 66  ? -6.478  -13.948 -2.899  1.00 0.00 ? 66  GLU A OE1  1  
ATOM 1012  O OE2  . GLU A 1 66  ? -8.083  -12.454 -2.508  1.00 0.00 ? 66  GLU A OE2  1  
ATOM 1013  H H    . GLU A 1 66  ? -4.015  -12.718 0.249   1.00 0.00 ? 66  GLU A H    1  
ATOM 1014  H HA   . GLU A 1 66  ? -3.845  -13.095 -2.447  1.00 0.00 ? 66  GLU A HA   1  
ATOM 1015  H HB2  . GLU A 1 66  ? -4.916  -10.642 -0.983  1.00 0.00 ? 66  GLU A HB2  1  
ATOM 1016  H HB3  . GLU A 1 66  ? -5.318  -11.099 -2.626  1.00 0.00 ? 66  GLU A HB3  1  
ATOM 1017  H HG2  . GLU A 1 66  ? -5.721  -13.212 -0.536  1.00 0.00 ? 66  GLU A HG2  1  
ATOM 1018  H HG3  . GLU A 1 66  ? -6.805  -11.837 -0.458  1.00 0.00 ? 66  GLU A HG3  1  
ATOM 1019  N N    . VAL A 1 67  ? -1.994  -10.632 -1.316  1.00 0.00 ? 67  VAL A N    1  
ATOM 1020  C CA   . VAL A 1 67  ? -0.912  -9.720  -1.644  1.00 0.00 ? 67  VAL A CA   1  
ATOM 1021  C C    . VAL A 1 67  ? 0.313   -10.526 -2.081  1.00 0.00 ? 67  VAL A C    1  
ATOM 1022  O O    . VAL A 1 67  ? 1.012   -10.143 -3.018  1.00 0.00 ? 67  VAL A O    1  
ATOM 1023  C CB   . VAL A 1 67  ? -0.628  -8.796  -0.458  1.00 0.00 ? 67  VAL A CB   1  
ATOM 1024  C CG1  . VAL A 1 67  ? 0.404   -7.729  -0.829  1.00 0.00 ? 67  VAL A CG1  1  
ATOM 1025  C CG2  . VAL A 1 67  ? -1.918  -8.156  0.058   1.00 0.00 ? 67  VAL A CG2  1  
ATOM 1026  H H    . VAL A 1 67  ? -2.234  -10.672 -0.346  1.00 0.00 ? 67  VAL A H    1  
ATOM 1027  H HA   . VAL A 1 67  ? -1.242  -9.104  -2.481  1.00 0.00 ? 67  VAL A HA   1  
ATOM 1028  H HB   . VAL A 1 67  ? -0.210  -9.402  0.346   1.00 0.00 ? 67  VAL A HB   1  
ATOM 1029  H HG11 . VAL A 1 67  ? -0.103  -6.870  -1.266  1.00 0.00 ? 67  VAL A HG11 1  
ATOM 1030  H HG12 . VAL A 1 67  ? 0.941   -7.417  0.067   1.00 0.00 ? 67  VAL A HG12 1  
ATOM 1031  H HG13 . VAL A 1 67  ? 1.109   -8.141  -1.551  1.00 0.00 ? 67  VAL A HG13 1  
ATOM 1032  H HG21 . VAL A 1 67  ? -2.039  -7.169  -0.390  1.00 0.00 ? 67  VAL A HG21 1  
ATOM 1033  H HG22 . VAL A 1 67  ? -2.768  -8.783  -0.210  1.00 0.00 ? 67  VAL A HG22 1  
ATOM 1034  H HG23 . VAL A 1 67  ? -1.866  -8.058  1.143   1.00 0.00 ? 67  VAL A HG23 1  
ATOM 1035  N N    . LYS A 1 68  ? 0.537   -11.629 -1.380  1.00 0.00 ? 68  LYS A N    1  
ATOM 1036  C CA   . LYS A 1 68  ? 1.666   -12.492 -1.683  1.00 0.00 ? 68  LYS A CA   1  
ATOM 1037  C C    . LYS A 1 68  ? 1.439   -13.163 -3.040  1.00 0.00 ? 68  LYS A C    1  
ATOM 1038  O O    . LYS A 1 68  ? 2.391   -13.425 -3.773  1.00 0.00 ? 68  LYS A O    1  
ATOM 1039  C CB   . LYS A 1 68  ? 1.906   -13.481 -0.541  1.00 0.00 ? 68  LYS A CB   1  
ATOM 1040  C CG   . LYS A 1 68  ? 3.165   -14.313 -0.792  1.00 0.00 ? 68  LYS A CG   1  
ATOM 1041  C CD   . LYS A 1 68  ? 3.781   -14.787 0.526   1.00 0.00 ? 68  LYS A CD   1  
ATOM 1042  C CE   . LYS A 1 68  ? 5.186   -15.350 0.304   1.00 0.00 ? 68  LYS A CE   1  
ATOM 1043  N NZ   . LYS A 1 68  ? 5.134   -16.543 -0.570  1.00 0.00 ? 68  LYS A NZ   1  
ATOM 1044  H H    . LYS A 1 68  ? -0.036  -11.934 -0.619  1.00 0.00 ? 68  LYS A H    1  
ATOM 1045  H HA   . LYS A 1 68  ? 2.551   -11.860 -1.754  1.00 0.00 ? 68  LYS A HA   1  
ATOM 1046  H HB2  . LYS A 1 68  ? 2.005   -12.939 0.400   1.00 0.00 ? 68  LYS A HB2  1  
ATOM 1047  H HB3  . LYS A 1 68  ? 1.044   -14.140 -0.439  1.00 0.00 ? 68  LYS A HB3  1  
ATOM 1048  H HG2  . LYS A 1 68  ? 2.918   -15.174 -1.413  1.00 0.00 ? 68  LYS A HG2  1  
ATOM 1049  H HG3  . LYS A 1 68  ? 3.893   -13.720 -1.344  1.00 0.00 ? 68  LYS A HG3  1  
ATOM 1050  H HD2  . LYS A 1 68  ? 3.825   -13.956 1.231   1.00 0.00 ? 68  LYS A HD2  1  
ATOM 1051  H HD3  . LYS A 1 68  ? 3.145   -15.551 0.975   1.00 0.00 ? 68  LYS A HD3  1  
ATOM 1052  H HE2  . LYS A 1 68  ? 5.822   -14.589 -0.147  1.00 0.00 ? 68  LYS A HE2  1  
ATOM 1053  H HE3  . LYS A 1 68  ? 5.634   -15.613 1.262   1.00 0.00 ? 68  LYS A HE3  1  
ATOM 1054  H HZ1  . LYS A 1 68  ? 5.846   -16.476 -1.269  1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 1055  H HZ2  . LYS A 1 68  ? 5.283   -17.366 -0.021  1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 1056  H HZ3  . LYS A 1 68  ? 4.238   -16.595 -1.011  1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 1057  N N    . GLU A 1 69  ? 0.173   -13.421 -3.332  1.00 0.00 ? 69  GLU A N    1  
ATOM 1058  C CA   . GLU A 1 69  ? -0.191  -14.056 -4.587  1.00 0.00 ? 69  GLU A CA   1  
ATOM 1059  C C    . GLU A 1 69  ? 0.051   -13.099 -5.756  1.00 0.00 ? 69  GLU A C    1  
ATOM 1060  O O    . GLU A 1 69  ? 0.593   -13.496 -6.787  1.00 0.00 ? 69  GLU A O    1  
ATOM 1061  C CB   . GLU A 1 69  ? -1.644  -14.533 -4.560  1.00 0.00 ? 69  GLU A CB   1  
ATOM 1062  C CG   . GLU A 1 69  ? -1.911  -15.411 -3.336  1.00 0.00 ? 69  GLU A CG   1  
ATOM 1063  C CD   . GLU A 1 69  ? -2.495  -16.764 -3.749  1.00 0.00 ? 69  GLU A CD   1  
ATOM 1064  O OE1  . GLU A 1 69  ? -1.703  -17.598 -4.238  1.00 0.00 ? 69  GLU A OE1  1  
ATOM 1065  O OE2  . GLU A 1 69  ? -3.719  -16.933 -3.565  1.00 0.00 ? 69  GLU A OE2  1  
ATOM 1066  H H    . GLU A 1 69  ? -0.596  -13.204 -2.730  1.00 0.00 ? 69  GLU A H    1  
ATOM 1067  H HA   . GLU A 1 69  ? 0.467   -14.921 -4.676  1.00 0.00 ? 69  GLU A HA   1  
ATOM 1068  H HB2  . GLU A 1 69  ? -2.313  -13.672 -4.547  1.00 0.00 ? 69  GLU A HB2  1  
ATOM 1069  H HB3  . GLU A 1 69  ? -1.864  -15.093 -5.469  1.00 0.00 ? 69  GLU A HB3  1  
ATOM 1070  H HG2  . GLU A 1 69  ? -0.983  -15.564 -2.785  1.00 0.00 ? 69  GLU A HG2  1  
ATOM 1071  H HG3  . GLU A 1 69  ? -2.601  -14.903 -2.663  1.00 0.00 ? 69  GLU A HG3  1  
ATOM 1072  N N    . ALA A 1 70  ? -0.363  -11.856 -5.557  1.00 0.00 ? 70  ALA A N    1  
ATOM 1073  C CA   . ALA A 1 70  ? -0.198  -10.839 -6.581  1.00 0.00 ? 70  ALA A CA   1  
ATOM 1074  C C    . ALA A 1 70  ? 1.196   -10.220 -6.460  1.00 0.00 ? 70  ALA A C    1  
ATOM 1075  O O    . ALA A 1 70  ? 1.498   -9.228  -7.122  1.00 0.00 ? 70  ALA A O    1  
ATOM 1076  C CB   . ALA A 1 70  ? -1.312  -9.798  -6.451  1.00 0.00 ? 70  ALA A CB   1  
ATOM 1077  H H    . ALA A 1 70  ? -0.803  -11.541 -4.716  1.00 0.00 ? 70  ALA A H    1  
ATOM 1078  H HA   . ALA A 1 70  ? -0.287  -11.328 -7.552  1.00 0.00 ? 70  ALA A HA   1  
ATOM 1079  H HB1  . ALA A 1 70  ? -1.466  -9.309  -7.413  1.00 0.00 ? 70  ALA A HB1  1  
ATOM 1080  H HB2  . ALA A 1 70  ? -2.234  -10.289 -6.141  1.00 0.00 ? 70  ALA A HB2  1  
ATOM 1081  H HB3  . ALA A 1 70  ? -1.029  -9.054  -5.706  1.00 0.00 ? 70  ALA A HB3  1  
ATOM 1082  N N    . ASN A 1 71  ? 2.008   -10.832 -5.610  1.00 0.00 ? 71  ASN A N    1  
ATOM 1083  C CA   . ASN A 1 71  ? 3.363   -10.353 -5.394  1.00 0.00 ? 71  ASN A CA   1  
ATOM 1084  C C    . ASN A 1 71  ? 3.350   -8.826  -5.296  1.00 0.00 ? 71  ASN A C    1  
ATOM 1085  O O    . ASN A 1 71  ? 3.920   -8.141  -6.145  1.00 0.00 ? 71  ASN A O    1  
ATOM 1086  C CB   . ASN A 1 71  ? 4.277   -10.745 -6.556  1.00 0.00 ? 71  ASN A CB   1  
ATOM 1087  C CG   . ASN A 1 71  ? 5.610   -11.294 -6.044  1.00 0.00 ? 71  ASN A CG   1  
ATOM 1088  O OD1  . ASN A 1 71  ? 5.666   -12.148 -5.174  1.00 0.00 ? 71  ASN A OD1  1  
ATOM 1089  N ND2  . ASN A 1 71  ? 6.677   -10.759 -6.630  1.00 0.00 ? 71  ASN A ND2  1  
ATOM 1090  H H    . ASN A 1 71  ? 1.754   -11.638 -5.076  1.00 0.00 ? 71  ASN A H    1  
ATOM 1091  H HA   . ASN A 1 71  ? 3.690   -10.827 -4.469  1.00 0.00 ? 71  ASN A HA   1  
ATOM 1092  H HB2  . ASN A 1 71  ? 3.784   -11.494 -7.175  1.00 0.00 ? 71  ASN A HB2  1  
ATOM 1093  H HB3  . ASN A 1 71  ? 4.457   -9.877  -7.191  1.00 0.00 ? 71  ASN A HB3  1  
ATOM 1094  H HD21 . ASN A 1 71  ? 6.562   -10.062 -7.338  1.00 0.00 ? 71  ASN A HD21 1  
ATOM 1095  H HD22 . ASN A 1 71  ? 7.595   -11.053 -6.364  1.00 0.00 ? 71  ASN A HD22 1  
ATOM 1096  N N    . ILE A 1 72  ? 2.694   -8.337  -4.254  1.00 0.00 ? 72  ILE A N    1  
ATOM 1097  C CA   . ILE A 1 72  ? 2.600   -6.904  -4.034  1.00 0.00 ? 72  ILE A CA   1  
ATOM 1098  C C    . ILE A 1 72  ? 3.421   -6.527  -2.800  1.00 0.00 ? 72  ILE A C    1  
ATOM 1099  O O    . ILE A 1 72  ? 3.108   -6.950  -1.688  1.00 0.00 ? 72  ILE A O    1  
ATOM 1100  C CB   . ILE A 1 72  ? 1.135   -6.469  -3.955  1.00 0.00 ? 72  ILE A CB   1  
ATOM 1101  C CG1  . ILE A 1 72  ? 0.361   -6.923  -5.194  1.00 0.00 ? 72  ILE A CG1  1  
ATOM 1102  C CG2  . ILE A 1 72  ? 1.022   -4.960  -3.730  1.00 0.00 ? 72  ILE A CG2  1  
ATOM 1103  C CD1  . ILE A 1 72  ? -1.148  -6.781  -4.981  1.00 0.00 ? 72  ILE A CD1  1  
ATOM 1104  H H    . ILE A 1 72  ? 2.233   -8.901  -3.569  1.00 0.00 ? 72  ILE A H    1  
ATOM 1105  H HA   . ILE A 1 72  ? 3.036   -6.411  -4.903  1.00 0.00 ? 72  ILE A HA   1  
ATOM 1106  H HB   . ILE A 1 72  ? 0.680   -6.958  -3.094  1.00 0.00 ? 72  ILE A HB   1  
ATOM 1107  H HG12 . ILE A 1 72  ? 0.667   -6.330  -6.056  1.00 0.00 ? 72  ILE A HG12 1  
ATOM 1108  H HG13 . ILE A 1 72  ? 0.603   -7.962  -5.419  1.00 0.00 ? 72  ILE A HG13 1  
ATOM 1109  H HG21 . ILE A 1 72  ? 0.201   -4.564  -4.328  1.00 0.00 ? 72  ILE A HG21 1  
ATOM 1110  H HG22 . ILE A 1 72  ? 0.831   -4.764  -2.675  1.00 0.00 ? 72  ILE A HG22 1  
ATOM 1111  H HG23 . ILE A 1 72  ? 1.954   -4.478  -4.026  1.00 0.00 ? 72  ILE A HG23 1  
ATOM 1112  H HD11 . ILE A 1 72  ? -1.355  -5.844  -4.463  1.00 0.00 ? 72  ILE A HD11 1  
ATOM 1113  H HD12 . ILE A 1 72  ? -1.653  -6.780  -5.947  1.00 0.00 ? 72  ILE A HD12 1  
ATOM 1114  H HD13 . ILE A 1 72  ? -1.510  -7.616  -4.382  1.00 0.00 ? 72  ILE A HD13 1  
ATOM 1115  N N    . ARG A 1 73  ? 4.456   -5.734  -3.037  1.00 0.00 ? 73  ARG A N    1  
ATOM 1116  C CA   . ARG A 1 73  ? 5.324   -5.294  -1.958  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1117  C C    . ARG A 1 73  ? 4.510   -4.572  -0.882  1.00 0.00 ? 73  ARG A C    1  
ATOM 1118  O O    . ARG A 1 73  ? 3.757   -3.648  -1.184  1.00 0.00 ? 73  ARG A O    1  
ATOM 1119  C CB   . ARG A 1 73  ? 6.416   -4.357  -2.477  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1120  C CG   . ARG A 1 73  ? 5.859   -2.955  -2.732  1.00 0.00 ? 73  ARG A CG   1  
ATOM 1121  C CD   . ARG A 1 73  ? 6.771   -2.166  -3.675  1.00 0.00 ? 73  ARG A CD   1  
ATOM 1122  N NE   . ARG A 1 73  ? 8.180   -2.571  -3.472  1.00 0.00 ? 73  ARG A NE   1  
ATOM 1123  C CZ   . ARG A 1 73  ? 9.151   -2.390  -4.378  1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1124  N NH1  . ARG A 1 73  ? 8.871   -1.811  -5.554  1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1125  N NH2  . ARG A 1 73  ? 10.401  -2.789  -4.108  1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1126  H H    . ARG A 1 73  ? 4.704   -5.394  -3.944  1.00 0.00 ? 73  ARG A H    1  
ATOM 1127  H HA   . ARG A 1 73  ? 5.767   -6.210  -1.566  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1128  H HB2  . ARG A 1 73  ? 7.229   -4.303  -1.752  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1129  H HB3  . ARG A 1 73  ? 6.837   -4.758  -3.398  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1130  H HG2  . ARG A 1 73  ? 4.861   -3.029  -3.163  1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1131  H HG3  . ARG A 1 73  ? 5.759   -2.422  -1.787  1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1132  H HD2  . ARG A 1 73  ? 6.478   -2.343  -4.710  1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1133  H HD3  . ARG A 1 73  ? 6.661   -1.098  -3.491  1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1134  H HE   . ARG A 1 73  ? 8.423   -3.007  -2.606  1.00 0.00 ? 73  ARG A HE   1  
ATOM 1135  H HH11 . ARG A 1 73  ? 7.938   -1.513  -5.755  1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1136  H HH12 . ARG A 1 73  ? 9.596   -1.676  -6.229  1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1137  H HH21 . ARG A 1 73  ? 10.610  -3.222  -3.231  1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1138  H HH22 . ARG A 1 73  ? 11.126  -2.655  -4.784  1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1139  N N    . VAL A 1 74  ? 4.690   -5.021  0.352   1.00 0.00 ? 74  VAL A N    1  
ATOM 1140  C CA   . VAL A 1 74  ? 3.982   -4.429  1.474   1.00 0.00 ? 74  VAL A CA   1  
ATOM 1141  C C    . VAL A 1 74  ? 4.903   -3.437  2.187   1.00 0.00 ? 74  VAL A C    1  
ATOM 1142  O O    . VAL A 1 74  ? 6.020   -3.785  2.566   1.00 0.00 ? 74  VAL A O    1  
ATOM 1143  C CB   . VAL A 1 74  ? 3.455   -5.528  2.399   1.00 0.00 ? 74  VAL A CB   1  
ATOM 1144  C CG1  . VAL A 1 74  ? 2.479   -4.957  3.429   1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1145  C CG2  . VAL A 1 74  ? 2.807   -6.657  1.596   1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1146  H H    . VAL A 1 74  ? 5.305   -5.773  0.589   1.00 0.00 ? 74  VAL A H    1  
ATOM 1147  H HA   . VAL A 1 74  ? 3.125   -3.886  1.073   1.00 0.00 ? 74  VAL A HA   1  
ATOM 1148  H HB   . VAL A 1 74  ? 4.305   -5.946  2.939   1.00 0.00 ? 74  VAL A HB   1  
ATOM 1149  H HG11 . VAL A 1 74  ? 1.690   -4.407  2.915   1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1150  H HG12 . VAL A 1 74  ? 2.039   -5.772  4.004   1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1151  H HG13 . VAL A 1 74  ? 3.012   -4.284  4.101   1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1152  H HG21 . VAL A 1 74  ? 2.518   -6.284  0.613   1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1153  H HG22 . VAL A 1 74  ? 3.518   -7.475  1.480   1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1154  H HG23 . VAL A 1 74  ? 1.923   -7.016  2.122   1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1155  N N    . VAL A 1 75  ? 4.400   -2.222  2.348   1.00 0.00 ? 75  VAL A N    1  
ATOM 1156  C CA   . VAL A 1 75  ? 5.164   -1.178  3.009   1.00 0.00 ? 75  VAL A CA   1  
ATOM 1157  C C    . VAL A 1 75  ? 4.402   -0.700  4.247   1.00 0.00 ? 75  VAL A C    1  
ATOM 1158  O O    . VAL A 1 75  ? 3.268   -1.114  4.480   1.00 0.00 ? 75  VAL A O    1  
ATOM 1159  C CB   . VAL A 1 75  ? 5.470   -0.049  2.023   1.00 0.00 ? 75  VAL A CB   1  
ATOM 1160  C CG1  . VAL A 1 75  ? 6.232   -0.576  0.805   1.00 0.00 ? 75  VAL A CG1  1  
ATOM 1161  C CG2  . VAL A 1 75  ? 4.188   0.670   1.599   1.00 0.00 ? 75  VAL A CG2  1  
ATOM 1162  H H    . VAL A 1 75  ? 3.491   -1.948  2.037   1.00 0.00 ? 75  VAL A H    1  
ATOM 1163  H HA   . VAL A 1 75  ? 6.111   -1.614  3.327   1.00 0.00 ? 75  VAL A HA   1  
ATOM 1164  H HB   . VAL A 1 75  ? 6.108   0.675   2.530   1.00 0.00 ? 75  VAL A HB   1  
ATOM 1165  H HG11 . VAL A 1 75  ? 7.303   -0.460  0.969   1.00 0.00 ? 75  VAL A HG11 1  
ATOM 1166  H HG12 . VAL A 1 75  ? 5.999   -1.631  0.660   1.00 0.00 ? 75  VAL A HG12 1  
ATOM 1167  H HG13 . VAL A 1 75  ? 5.936   -0.013  -0.080  1.00 0.00 ? 75  VAL A HG13 1  
ATOM 1168  H HG21 . VAL A 1 75  ? 4.270   1.730   1.839   1.00 0.00 ? 75  VAL A HG21 1  
ATOM 1169  H HG22 . VAL A 1 75  ? 4.043   0.551   0.525   1.00 0.00 ? 75  VAL A HG22 1  
ATOM 1170  H HG23 . VAL A 1 75  ? 3.338   0.242   2.130   1.00 0.00 ? 75  VAL A HG23 1  
ATOM 1171  N N    . SER A 1 76  ? 5.057   0.164   5.009   1.00 0.00 ? 76  SER A N    1  
ATOM 1172  C CA   . SER A 1 76  ? 4.455   0.703   6.217   1.00 0.00 ? 76  SER A CA   1  
ATOM 1173  C C    . SER A 1 76  ? 3.642   1.955   5.883   1.00 0.00 ? 76  SER A C    1  
ATOM 1174  O O    . SER A 1 76  ? 3.580   2.369   4.726   1.00 0.00 ? 76  SER A O    1  
ATOM 1175  C CB   . SER A 1 76  ? 5.521   1.026   7.266   1.00 0.00 ? 76  SER A CB   1  
ATOM 1176  O OG   . SER A 1 76  ? 6.071   2.327   7.084   1.00 0.00 ? 76  SER A OG   1  
ATOM 1177  H H    . SER A 1 76  ? 5.980   0.496   4.812   1.00 0.00 ? 76  SER A H    1  
ATOM 1178  H HA   . SER A 1 76  ? 3.804   -0.087  6.592   1.00 0.00 ? 76  SER A HA   1  
ATOM 1179  H HB2  . SER A 1 76  ? 5.083   0.953   8.262   1.00 0.00 ? 76  SER A HB2  1  
ATOM 1180  H HB3  . SER A 1 76  ? 6.318   0.284   7.214   1.00 0.00 ? 76  SER A HB3  1  
ATOM 1181  H HG   . SER A 1 76  ? 6.540   2.381   6.202   1.00 0.00 ? 76  SER A HG   1  
ATOM 1182  N N    . GLU A 1 77  ? 3.039   2.523   6.917   1.00 0.00 ? 77  GLU A N    1  
ATOM 1183  C CA   . GLU A 1 77  ? 2.232   3.720   6.748   1.00 0.00 ? 77  GLU A CA   1  
ATOM 1184  C C    . GLU A 1 77  ? 3.131   4.942   6.552   1.00 0.00 ? 77  GLU A C    1  
ATOM 1185  O O    . GLU A 1 77  ? 2.768   5.876   5.837   1.00 0.00 ? 77  GLU A O    1  
ATOM 1186  C CB   . GLU A 1 77  ? 1.289   3.917   7.936   1.00 0.00 ? 77  GLU A CB   1  
ATOM 1187  C CG   . GLU A 1 77  ? -0.098  4.362   7.467   1.00 0.00 ? 77  GLU A CG   1  
ATOM 1188  C CD   . GLU A 1 77  ? -0.252  5.881   7.575   1.00 0.00 ? 77  GLU A CD   1  
ATOM 1189  O OE1  . GLU A 1 77  ? -0.385  6.358   8.722   1.00 0.00 ? 77  GLU A OE1  1  
ATOM 1190  O OE2  . GLU A 1 77  ? -0.232  6.530   6.507   1.00 0.00 ? 77  GLU A OE2  1  
ATOM 1191  H H    . GLU A 1 77  ? 3.094   2.180   7.854   1.00 0.00 ? 77  GLU A H    1  
ATOM 1192  H HA   . GLU A 1 77  ? 1.642   3.547   5.848   1.00 0.00 ? 77  GLU A HA   1  
ATOM 1193  H HB2  . GLU A 1 77  ? 1.206   2.987   8.498   1.00 0.00 ? 77  GLU A HB2  1  
ATOM 1194  H HB3  . GLU A 1 77  ? 1.704   4.663   8.615   1.00 0.00 ? 77  GLU A HB3  1  
ATOM 1195  H HG2  . GLU A 1 77  ? -0.254  4.050   6.435   1.00 0.00 ? 77  GLU A HG2  1  
ATOM 1196  H HG3  . GLU A 1 77  ? -0.864  3.872   8.068   1.00 0.00 ? 77  GLU A HG3  1  
ATOM 1197  N N    . ASP A 1 78  ? 4.286   4.898   7.199   1.00 0.00 ? 78  ASP A N    1  
ATOM 1198  C CA   . ASP A 1 78  ? 5.240   5.990   7.105   1.00 0.00 ? 78  ASP A CA   1  
ATOM 1199  C C    . ASP A 1 78  ? 5.470   6.335   5.633   1.00 0.00 ? 78  ASP A C    1  
ATOM 1200  O O    . ASP A 1 78  ? 5.830   7.465   5.305   1.00 0.00 ? 78  ASP A O    1  
ATOM 1201  C CB   . ASP A 1 78  ? 6.587   5.599   7.715   1.00 0.00 ? 78  ASP A CB   1  
ATOM 1202  C CG   . ASP A 1 78  ? 6.522   5.096   9.159   1.00 0.00 ? 78  ASP A CG   1  
ATOM 1203  O OD1  . ASP A 1 78  ? 5.985   5.850   9.999   1.00 0.00 ? 78  ASP A OD1  1  
ATOM 1204  O OD2  . ASP A 1 78  ? 7.010   3.969   9.389   1.00 0.00 ? 78  ASP A OD2  1  
ATOM 1205  H H    . ASP A 1 78  ? 4.574   4.135   7.778   1.00 0.00 ? 78  ASP A H    1  
ATOM 1206  H HA   . ASP A 1 78  ? 4.789   6.812   7.661   1.00 0.00 ? 78  ASP A HA   1  
ATOM 1207  H HB2  . ASP A 1 78  ? 7.038   4.824   7.096   1.00 0.00 ? 78  ASP A HB2  1  
ATOM 1208  H HB3  . ASP A 1 78  ? 7.250   6.463   7.677   1.00 0.00 ? 78  ASP A HB3  1  
ATOM 1209  N N    . PHE A 1 79  ? 5.253   5.341   4.784   1.00 0.00 ? 79  PHE A N    1  
ATOM 1210  C CA   . PHE A 1 79  ? 5.432   5.525   3.354   1.00 0.00 ? 79  PHE A CA   1  
ATOM 1211  C C    . PHE A 1 79  ? 4.567   6.676   2.837   1.00 0.00 ? 79  PHE A C    1  
ATOM 1212  O O    . PHE A 1 79  ? 5.034   7.507   2.059   1.00 0.00 ? 79  PHE A O    1  
ATOM 1213  C CB   . PHE A 1 79  ? 4.990   4.226   2.677   1.00 0.00 ? 79  PHE A CB   1  
ATOM 1214  C CG   . PHE A 1 79  ? 4.672   4.378   1.188   1.00 0.00 ? 79  PHE A CG   1  
ATOM 1215  C CD1  . PHE A 1 79  ? 5.682   4.430   0.279   1.00 0.00 ? 79  PHE A CD1  1  
ATOM 1216  C CD2  . PHE A 1 79  ? 3.379   4.460   0.774   1.00 0.00 ? 79  PHE A CD2  1  
ATOM 1217  C CE1  . PHE A 1 79  ? 5.386   4.571   -1.103  1.00 0.00 ? 79  PHE A CE1  1  
ATOM 1218  C CE2  . PHE A 1 79  ? 3.084   4.600   -0.608  1.00 0.00 ? 79  PHE A CE2  1  
ATOM 1219  C CZ   . PHE A 1 79  ? 4.094   4.653   -1.517  1.00 0.00 ? 79  PHE A CZ   1  
ATOM 1220  H H    . PHE A 1 79  ? 4.960   4.425   5.059   1.00 0.00 ? 79  PHE A H    1  
ATOM 1221  H HA   . PHE A 1 79  ? 6.483   5.759   3.187   1.00 0.00 ? 79  PHE A HA   1  
ATOM 1222  H HB2  . PHE A 1 79  ? 5.775   3.480   2.796   1.00 0.00 ? 79  PHE A HB2  1  
ATOM 1223  H HB3  . PHE A 1 79  ? 4.107   3.844   3.189   1.00 0.00 ? 79  PHE A HB3  1  
ATOM 1224  H HD1  . PHE A 1 79  ? 6.718   4.364   0.611   1.00 0.00 ? 79  PHE A HD1  1  
ATOM 1225  H HD2  . PHE A 1 79  ? 2.569   4.417   1.502   1.00 0.00 ? 79  PHE A HD2  1  
ATOM 1226  H HE1  . PHE A 1 79  ? 6.196   4.613   -1.832  1.00 0.00 ? 79  PHE A HE1  1  
ATOM 1227  H HE2  . PHE A 1 79  ? 2.047   4.666   -0.940  1.00 0.00 ? 79  PHE A HE2  1  
ATOM 1228  H HZ   . PHE A 1 79  ? 3.867   4.761   -2.578  1.00 0.00 ? 79  PHE A HZ   1  
ATOM 1229  N N    . LEU A 1 80  ? 3.322   6.688   3.289   1.00 0.00 ? 80  LEU A N    1  
ATOM 1230  C CA   . LEU A 1 80  ? 2.388   7.724   2.882   1.00 0.00 ? 80  LEU A CA   1  
ATOM 1231  C C    . LEU A 1 80  ? 2.875   9.078   3.403   1.00 0.00 ? 80  LEU A C    1  
ATOM 1232  O O    . LEU A 1 80  ? 2.758   10.090  2.714   1.00 0.00 ? 80  LEU A O    1  
ATOM 1233  C CB   . LEU A 1 80  ? 0.967   7.369   3.326   1.00 0.00 ? 80  LEU A CB   1  
ATOM 1234  C CG   . LEU A 1 80  ? 0.293   6.225   2.566   1.00 0.00 ? 80  LEU A CG   1  
ATOM 1235  C CD1  . LEU A 1 80  ? -0.862  5.634   3.376   1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1236  C CD2  . LEU A 1 80  ? -0.156  6.680   1.176   1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1237  H H    . LEU A 1 80  ? 2.950   6.009   3.922   1.00 0.00 ? 80  LEU A H    1  
ATOM 1238  H HA   . LEU A 1 80  ? 2.387   7.753   1.792   1.00 0.00 ? 80  LEU A HA   1  
ATOM 1239  H HB2  . LEU A 1 80  ? 0.993   7.110   4.384   1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1240  H HB3  . LEU A 1 80  ? 0.345   8.259   3.230   1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1241  H HG   . LEU A 1 80  ? 1.026   5.431   2.423   1.00 0.00 ? 80  LEU A HG   1  
ATOM 1242  H HD11 . LEU A 1 80  ? -1.134  6.322   4.176   1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1243  H HD12 . LEU A 1 80  ? -1.721  5.477   2.724   1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1244  H HD13 . LEU A 1 80  ? -0.554  4.681   3.806   1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1245  H HD21 . LEU A 1 80  ? 0.715   6.985   0.595   1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1246  H HD22 . LEU A 1 80  ? -0.661  5.857   0.670   1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1247  H HD23 . LEU A 1 80  ? -0.841  7.522   1.273   1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1248  N N    . GLN A 1 81  ? 3.410   9.052   4.615   1.00 0.00 ? 81  GLN A N    1  
ATOM 1249  C CA   . GLN A 1 81  ? 3.915   10.264  5.236   1.00 0.00 ? 81  GLN A CA   1  
ATOM 1250  C C    . GLN A 1 81  ? 5.182   10.739  4.521   1.00 0.00 ? 81  GLN A C    1  
ATOM 1251  O O    . GLN A 1 81  ? 5.545   11.911  4.606   1.00 0.00 ? 81  GLN A O    1  
ATOM 1252  C CB   . GLN A 1 81  ? 4.176   10.048  6.728   1.00 0.00 ? 81  GLN A CB   1  
ATOM 1253  C CG   . GLN A 1 81  ? 5.007   11.193  7.310   1.00 0.00 ? 81  GLN A CG   1  
ATOM 1254  C CD   . GLN A 1 81  ? 4.189   12.484  7.379   1.00 0.00 ? 81  GLN A CD   1  
ATOM 1255  O OE1  . GLN A 1 81  ? 3.502   12.763  8.348   1.00 0.00 ? 81  GLN A OE1  1  
ATOM 1256  N NE2  . GLN A 1 81  ? 4.301   13.254  6.300   1.00 0.00 ? 81  GLN A NE2  1  
ATOM 1257  H H    . GLN A 1 81  ? 3.501   8.224   5.168   1.00 0.00 ? 81  GLN A H    1  
ATOM 1258  H HA   . GLN A 1 81  ? 3.123   11.003  5.115   1.00 0.00 ? 81  GLN A HA   1  
ATOM 1259  H HB2  . GLN A 1 81  ? 3.227   9.975   7.260   1.00 0.00 ? 81  GLN A HB2  1  
ATOM 1260  H HB3  . GLN A 1 81  ? 4.698   9.103   6.876   1.00 0.00 ? 81  GLN A HB3  1  
ATOM 1261  H HG2  . GLN A 1 81  ? 5.354   10.924  8.308   1.00 0.00 ? 81  GLN A HG2  1  
ATOM 1262  H HG3  . GLN A 1 81  ? 5.894   11.352  6.697   1.00 0.00 ? 81  GLN A HG3  1  
ATOM 1263  H HE21 . GLN A 1 81  ? 4.882   12.966  5.539   1.00 0.00 ? 81  GLN A HE21 1  
ATOM 1264  H HE22 . GLN A 1 81  ? 3.804   14.120  6.250   1.00 0.00 ? 81  GLN A HE22 1  
ATOM 1265  N N    . ASP A 1 82  ? 5.820   9.804   3.832   1.00 0.00 ? 82  ASP A N    1  
ATOM 1266  C CA   . ASP A 1 82  ? 7.038   10.112  3.103   1.00 0.00 ? 82  ASP A CA   1  
ATOM 1267  C C    . ASP A 1 82  ? 6.685   10.474  1.658   1.00 0.00 ? 82  ASP A C    1  
ATOM 1268  O O    . ASP A 1 82  ? 7.053   11.544  1.175   1.00 0.00 ? 82  ASP A O    1  
ATOM 1269  C CB   . ASP A 1 82  ? 7.981   8.908   3.071   1.00 0.00 ? 82  ASP A CB   1  
ATOM 1270  C CG   . ASP A 1 82  ? 9.161   8.985   4.041   1.00 0.00 ? 82  ASP A CG   1  
ATOM 1271  O OD1  . ASP A 1 82  ? 8.891   9.119   5.254   1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1272  O OD2  . ASP A 1 82  ? 10.307  8.908   3.548   1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1273  H H    . ASP A 1 82  ? 5.518   8.853   3.767   1.00 0.00 ? 82  ASP A H    1  
ATOM 1274  H HA   . ASP A 1 82  ? 7.492   10.944  3.642   1.00 0.00 ? 82  ASP A HA   1  
ATOM 1275  H HB2  . ASP A 1 82  ? 7.405   8.009   3.293   1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1276  H HB3  . ASP A 1 82  ? 8.369   8.795   2.059   1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1277  N N    . VAL A 1 83  ? 5.976   9.562   1.010   1.00 0.00 ? 83  VAL A N    1  
ATOM 1278  C CA   . VAL A 1 83  ? 5.569   9.772   -0.369  1.00 0.00 ? 83  VAL A CA   1  
ATOM 1279  C C    . VAL A 1 83  ? 5.051   11.202  -0.531  1.00 0.00 ? 83  VAL A C    1  
ATOM 1280  O O    . VAL A 1 83  ? 5.177   11.795  -1.602  1.00 0.00 ? 83  VAL A O    1  
ATOM 1281  C CB   . VAL A 1 83  ? 4.543   8.714   -0.779  1.00 0.00 ? 83  VAL A CB   1  
ATOM 1282  C CG1  . VAL A 1 83  ? 3.116   9.220   -0.559  1.00 0.00 ? 83  VAL A CG1  1  
ATOM 1283  C CG2  . VAL A 1 83  ? 4.753   8.279   -2.231  1.00 0.00 ? 83  VAL A CG2  1  
ATOM 1284  H H    . VAL A 1 83  ? 5.681   8.695   1.410   1.00 0.00 ? 83  VAL A H    1  
ATOM 1285  H HA   . VAL A 1 83  ? 6.452   9.646   -0.995  1.00 0.00 ? 83  VAL A HA   1  
ATOM 1286  H HB   . VAL A 1 83  ? 4.690   7.841   -0.143  1.00 0.00 ? 83  VAL A HB   1  
ATOM 1287  H HG11 . VAL A 1 83  ? 2.973   9.457   0.495   1.00 0.00 ? 83  VAL A HG11 1  
ATOM 1288  H HG12 . VAL A 1 83  ? 2.952   10.116  -1.158  1.00 0.00 ? 83  VAL A HG12 1  
ATOM 1289  H HG13 . VAL A 1 83  ? 2.406   8.448   -0.857  1.00 0.00 ? 83  VAL A HG13 1  
ATOM 1290  H HG21 . VAL A 1 83  ? 3.879   7.726   -2.574  1.00 0.00 ? 83  VAL A HG21 1  
ATOM 1291  H HG22 . VAL A 1 83  ? 4.895   9.160   -2.857  1.00 0.00 ? 83  VAL A HG22 1  
ATOM 1292  H HG23 . VAL A 1 83  ? 5.635   7.642   -2.295  1.00 0.00 ? 83  VAL A HG23 1  
ATOM 1293  N N    . SER A 1 84  ? 4.477   11.716  0.547   1.00 0.00 ? 84  SER A N    1  
ATOM 1294  C CA   . SER A 1 84  ? 3.939   13.065  0.538   1.00 0.00 ? 84  SER A CA   1  
ATOM 1295  C C    . SER A 1 84  ? 5.025   14.065  0.942   1.00 0.00 ? 84  SER A C    1  
ATOM 1296  O O    . SER A 1 84  ? 5.069   15.181  0.426   1.00 0.00 ? 84  SER A O    1  
ATOM 1297  C CB   . SER A 1 84  ? 2.734   13.184  1.473   1.00 0.00 ? 84  SER A CB   1  
ATOM 1298  O OG   . SER A 1 84  ? 1.592   13.716  0.807   1.00 0.00 ? 84  SER A OG   1  
ATOM 1299  H H    . SER A 1 84  ? 4.378   11.227  1.414   1.00 0.00 ? 84  SER A H    1  
ATOM 1300  H HA   . SER A 1 84  ? 3.620   13.242  -0.490  1.00 0.00 ? 84  SER A HA   1  
ATOM 1301  H HB2  . SER A 1 84  ? 2.492   12.202  1.879   1.00 0.00 ? 84  SER A HB2  1  
ATOM 1302  H HB3  . SER A 1 84  ? 2.992   13.824  2.317   1.00 0.00 ? 84  SER A HB3  1  
ATOM 1303  H HG   . SER A 1 84  ? 1.728   14.689  0.618   1.00 0.00 ? 84  SER A HG   1  
ATOM 1304  N N    . ALA A 1 85  ? 5.874   13.628  1.860   1.00 0.00 ? 85  ALA A N    1  
ATOM 1305  C CA   . ALA A 1 85  ? 6.957   14.470  2.339   1.00 0.00 ? 85  ALA A CA   1  
ATOM 1306  C C    . ALA A 1 85  ? 8.289   13.750  2.128   1.00 0.00 ? 85  ALA A C    1  
ATOM 1307  O O    . ALA A 1 85  ? 9.003   13.462  3.088   1.00 0.00 ? 85  ALA A O    1  
ATOM 1308  C CB   . ALA A 1 85  ? 6.714   14.829  3.807   1.00 0.00 ? 85  ALA A CB   1  
ATOM 1309  H H    . ALA A 1 85  ? 5.831   12.719  2.274   1.00 0.00 ? 85  ALA A H    1  
ATOM 1310  H HA   . ALA A 1 85  ? 6.951   15.386  1.749   1.00 0.00 ? 85  ALA A HA   1  
ATOM 1311  H HB1  . ALA A 1 85  ? 7.670   14.912  4.324   1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1312  H HB2  . ALA A 1 85  ? 6.185   15.780  3.866   1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1313  H HB3  . ALA A 1 85  ? 6.113   14.050  4.277   1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1314  N N    . SER A 1 86  ? 8.585   13.478  0.866   1.00 0.00 ? 86  SER A N    1  
ATOM 1315  C CA   . SER A 1 86  ? 9.820   12.796  0.516   1.00 0.00 ? 86  SER A CA   1  
ATOM 1316  C C    . SER A 1 86  ? 10.044  12.861  -0.996  1.00 0.00 ? 86  SER A C    1  
ATOM 1317  O O    . SER A 1 86  ? 9.177   12.463  -1.773  1.00 0.00 ? 86  SER A O    1  
ATOM 1318  C CB   . SER A 1 86  ? 9.798   11.341  0.988   1.00 0.00 ? 86  SER A CB   1  
ATOM 1319  O OG   . SER A 1 86  ? 11.108  10.842  1.242   1.00 0.00 ? 86  SER A OG   1  
ATOM 1320  H H    . SER A 1 86  ? 7.999   13.715  0.091   1.00 0.00 ? 86  SER A H    1  
ATOM 1321  H HA   . SER A 1 86  ? 10.607  13.336  1.043   1.00 0.00 ? 86  SER A HA   1  
ATOM 1322  H HB2  . SER A 1 86  ? 9.197   11.262  1.894   1.00 0.00 ? 86  SER A HB2  1  
ATOM 1323  H HB3  . SER A 1 86  ? 9.315   10.722  0.231   1.00 0.00 ? 86  SER A HB3  1  
ATOM 1324  H HG   . SER A 1 86  ? 11.318  10.094  0.613   1.00 0.00 ? 86  SER A HG   1  
ATOM 1325  N N    . THR A 1 87  ? 11.211  13.365  -1.368  1.00 0.00 ? 87  THR A N    1  
ATOM 1326  C CA   . THR A 1 87  ? 11.559  13.487  -2.774  1.00 0.00 ? 87  THR A CA   1  
ATOM 1327  C C    . THR A 1 87  ? 12.354  12.263  -3.234  1.00 0.00 ? 87  THR A C    1  
ATOM 1328  O O    . THR A 1 87  ? 13.312  12.391  -3.995  1.00 0.00 ? 87  THR A O    1  
ATOM 1329  C CB   . THR A 1 87  ? 12.312  14.806  -2.961  1.00 0.00 ? 87  THR A CB   1  
ATOM 1330  O OG1  . THR A 1 87  ? 13.619  14.534  -2.462  1.00 0.00 ? 87  THR A OG1  1  
ATOM 1331  C CG2  . THR A 1 87  ? 11.787  15.915  -2.047  1.00 0.00 ? 87  THR A CG2  1  
ATOM 1332  H H    . THR A 1 87  ? 11.911  13.686  -0.730  1.00 0.00 ? 87  THR A H    1  
ATOM 1333  H HA   . THR A 1 87  ? 10.638  13.508  -3.356  1.00 0.00 ? 87  THR A HA   1  
ATOM 1334  H HB   . THR A 1 87  ? 12.293  15.120  -4.005  1.00 0.00 ? 87  THR A HB   1  
ATOM 1335  H HG1  . THR A 1 87  ? 13.590  14.425  -1.469  1.00 0.00 ? 87  THR A HG1  1  
ATOM 1336  H HG21 . THR A 1 87  ? 10.698  15.906  -2.054  1.00 0.00 ? 87  THR A HG21 1  
ATOM 1337  H HG22 . THR A 1 87  ? 12.146  15.748  -1.031  1.00 0.00 ? 87  THR A HG22 1  
ATOM 1338  H HG23 . THR A 1 87  ? 12.145  16.880  -2.405  1.00 0.00 ? 87  THR A HG23 1  
ATOM 1339  N N    . LYS A 1 88  ? 11.926  11.105  -2.753  1.00 0.00 ? 88  LYS A N    1  
ATOM 1340  C CA   . LYS A 1 88  ? 12.586  9.859   -3.106  1.00 0.00 ? 88  LYS A CA   1  
ATOM 1341  C C    . LYS A 1 88  ? 11.725  9.100   -4.118  1.00 0.00 ? 88  LYS A C    1  
ATOM 1342  O O    . LYS A 1 88  ? 10.511  9.291   -4.172  1.00 0.00 ? 88  LYS A O    1  
ATOM 1343  C CB   . LYS A 1 88  ? 12.913  9.051   -1.849  1.00 0.00 ? 88  LYS A CB   1  
ATOM 1344  C CG   . LYS A 1 88  ? 13.867  9.822   -0.934  1.00 0.00 ? 88  LYS A CG   1  
ATOM 1345  C CD   . LYS A 1 88  ? 15.087  8.973   -0.574  1.00 0.00 ? 88  LYS A CD   1  
ATOM 1346  C CE   . LYS A 1 88  ? 16.089  8.933   -1.729  1.00 0.00 ? 88  LYS A CE   1  
ATOM 1347  N NZ   . LYS A 1 88  ? 17.443  9.296   -1.254  1.00 0.00 ? 88  LYS A NZ   1  
ATOM 1348  H H    . LYS A 1 88  ? 11.146  11.010  -2.135  1.00 0.00 ? 88  LYS A H    1  
ATOM 1349  H HA   . LYS A 1 88  ? 13.533  10.114  -3.581  1.00 0.00 ? 88  LYS A HA   1  
ATOM 1350  H HB2  . LYS A 1 88  ? 11.994  8.821   -1.310  1.00 0.00 ? 88  LYS A HB2  1  
ATOM 1351  H HB3  . LYS A 1 88  ? 13.363  8.099   -2.131  1.00 0.00 ? 88  LYS A HB3  1  
ATOM 1352  H HG2  . LYS A 1 88  ? 14.190  10.738  -1.430  1.00 0.00 ? 88  LYS A HG2  1  
ATOM 1353  H HG3  . LYS A 1 88  ? 13.344  10.119  -0.025  1.00 0.00 ? 88  LYS A HG3  1  
ATOM 1354  H HD2  . LYS A 1 88  ? 15.568  9.380   0.316   1.00 0.00 ? 88  LYS A HD2  1  
ATOM 1355  H HD3  . LYS A 1 88  ? 14.770  7.959   -0.328  1.00 0.00 ? 88  LYS A HD3  1  
ATOM 1356  H HE2  . LYS A 1 88  ? 16.106  7.936   -2.170  1.00 0.00 ? 88  LYS A HE2  1  
ATOM 1357  H HE3  . LYS A 1 88  ? 15.776  9.623   -2.514  1.00 0.00 ? 88  LYS A HE3  1  
ATOM 1358  H HZ1  . LYS A 1 88  ? 17.557  10.288  -1.299  1.00 0.00 ? 88  LYS A HZ1  1  
ATOM 1359  H HZ2  . LYS A 1 88  ? 17.558  8.989   -0.309  1.00 0.00 ? 88  LYS A HZ2  1  
ATOM 1360  H HZ3  . LYS A 1 88  ? 18.129  8.855   -1.834  1.00 0.00 ? 88  LYS A HZ3  1  
ATOM 1361  N N    . SER A 1 89  ? 12.387  8.255   -4.894  1.00 0.00 ? 89  SER A N    1  
ATOM 1362  C CA   . SER A 1 89  ? 11.697  7.466   -5.901  1.00 0.00 ? 89  SER A CA   1  
ATOM 1363  C C    . SER A 1 89  ? 10.869  6.369   -5.230  1.00 0.00 ? 89  SER A C    1  
ATOM 1364  O O    . SER A 1 89  ? 11.303  5.773   -4.246  1.00 0.00 ? 89  SER A O    1  
ATOM 1365  C CB   . SER A 1 89  ? 12.687  6.852   -6.893  1.00 0.00 ? 89  SER A CB   1  
ATOM 1366  O OG   . SER A 1 89  ? 13.596  7.820   -7.409  1.00 0.00 ? 89  SER A OG   1  
ATOM 1367  H H    . SER A 1 89  ? 13.375  8.106   -4.844  1.00 0.00 ? 89  SER A H    1  
ATOM 1368  H HA   . SER A 1 89  ? 11.049  8.169   -6.424  1.00 0.00 ? 89  SER A HA   1  
ATOM 1369  H HB2  . SER A 1 89  ? 13.247  6.056   -6.401  1.00 0.00 ? 89  SER A HB2  1  
ATOM 1370  H HB3  . SER A 1 89  ? 12.139  6.394   -7.716  1.00 0.00 ? 89  SER A HB3  1  
ATOM 1371  H HG   . SER A 1 89  ? 14.067  8.283   -6.658  1.00 0.00 ? 89  SER A HG   1  
ATOM 1372  N N    . LEU A 1 90  ? 9.691   6.136   -5.789  1.00 0.00 ? 90  LEU A N    1  
ATOM 1373  C CA   . LEU A 1 90  ? 8.797   5.121   -5.257  1.00 0.00 ? 90  LEU A CA   1  
ATOM 1374  C C    . LEU A 1 90  ? 9.600   3.859   -4.935  1.00 0.00 ? 90  LEU A C    1  
ATOM 1375  O O    . LEU A 1 90  ? 9.644   3.423   -3.786  1.00 0.00 ? 90  LEU A O    1  
ATOM 1376  C CB   . LEU A 1 90  ? 7.629   4.880   -6.215  1.00 0.00 ? 90  LEU A CB   1  
ATOM 1377  C CG   . LEU A 1 90  ? 6.417   5.796   -6.039  1.00 0.00 ? 90  LEU A CG   1  
ATOM 1378  C CD1  . LEU A 1 90  ? 5.943   5.805   -4.584  1.00 0.00 ? 90  LEU A CD1  1  
ATOM 1379  C CD2  . LEU A 1 90  ? 6.715   7.206   -6.553  1.00 0.00 ? 90  LEU A CD2  1  
ATOM 1380  H H    . LEU A 1 90  ? 9.345   6.626   -6.590  1.00 0.00 ? 90  LEU A H    1  
ATOM 1381  H HA   . LEU A 1 90  ? 8.378   5.510   -4.329  1.00 0.00 ? 90  LEU A HA   1  
ATOM 1382  H HB2  . LEU A 1 90  ? 7.995   4.986   -7.236  1.00 0.00 ? 90  LEU A HB2  1  
ATOM 1383  H HB3  . LEU A 1 90  ? 7.299   3.847   -6.101  1.00 0.00 ? 90  LEU A HB3  1  
ATOM 1384  H HG   . LEU A 1 90  ? 5.599   5.400   -6.641  1.00 0.00 ? 90  LEU A HG   1  
ATOM 1385  H HD11 . LEU A 1 90  ? 6.214   4.862   -4.108  1.00 0.00 ? 90  LEU A HD11 1  
ATOM 1386  H HD12 . LEU A 1 90  ? 6.417   6.630   -4.053  1.00 0.00 ? 90  LEU A HD12 1  
ATOM 1387  H HD13 . LEU A 1 90  ? 4.860   5.929   -4.555  1.00 0.00 ? 90  LEU A HD13 1  
ATOM 1388  H HD21 . LEU A 1 90  ? 5.818   7.819   -6.473  1.00 0.00 ? 90  LEU A HD21 1  
ATOM 1389  H HD22 . LEU A 1 90  ? 7.513   7.648   -5.957  1.00 0.00 ? 90  LEU A HD22 1  
ATOM 1390  H HD23 . LEU A 1 90  ? 7.028   7.153   -7.596  1.00 0.00 ? 90  LEU A HD23 1  
ATOM 1391  N N    . GLN A 1 91  ? 10.216  3.308   -5.971  1.00 0.00 ? 91  GLN A N    1  
ATOM 1392  C CA   . GLN A 1 91  ? 11.015  2.105   -5.813  1.00 0.00 ? 91  GLN A CA   1  
ATOM 1393  C C    . GLN A 1 91  ? 11.838  2.179   -4.526  1.00 0.00 ? 91  GLN A C    1  
ATOM 1394  O O    . GLN A 1 91  ? 11.842  1.239   -3.732  1.00 0.00 ? 91  GLN A O    1  
ATOM 1395  C CB   . GLN A 1 91  ? 11.918  1.883   -7.029  1.00 0.00 ? 91  GLN A CB   1  
ATOM 1396  C CG   . GLN A 1 91  ? 11.362  0.779   -7.930  1.00 0.00 ? 91  GLN A CG   1  
ATOM 1397  C CD   . GLN A 1 91  ? 10.184  1.291   -8.762  1.00 0.00 ? 91  GLN A CD   1  
ATOM 1398  O OE1  . GLN A 1 91  ? 10.262  2.306   -9.436  1.00 0.00 ? 91  GLN A OE1  1  
ATOM 1399  N NE2  . GLN A 1 91  ? 9.093   0.535   -8.678  1.00 0.00 ? 91  GLN A NE2  1  
ATOM 1400  H H    . GLN A 1 91  ? 10.176  3.670   -6.903  1.00 0.00 ? 91  GLN A H    1  
ATOM 1401  H HA   . GLN A 1 91  ? 10.298  1.287   -5.747  1.00 0.00 ? 91  GLN A HA   1  
ATOM 1402  H HB2  . GLN A 1 91  ? 12.006  2.810   -7.595  1.00 0.00 ? 91  GLN A HB2  1  
ATOM 1403  H HB3  . GLN A 1 91  ? 12.921  1.616   -6.697  1.00 0.00 ? 91  GLN A HB3  1  
ATOM 1404  H HG2  . GLN A 1 91  ? 12.148  0.415   -8.592  1.00 0.00 ? 91  GLN A HG2  1  
ATOM 1405  H HG3  . GLN A 1 91  ? 11.041  -0.066  -7.321  1.00 0.00 ? 91  GLN A HG3  1  
ATOM 1406  H HE21 . GLN A 1 91  ? 9.096   -0.285  -8.107  1.00 0.00 ? 91  GLN A HE21 1  
ATOM 1407  H HE22 . GLN A 1 91  ? 8.270   0.788   -9.186  1.00 0.00 ? 91  GLN A HE22 1  
ATOM 1408  N N    . GLU A 1 92  ? 12.515  3.306   -4.357  1.00 0.00 ? 92  GLU A N    1  
ATOM 1409  C CA   . GLU A 1 92  ? 13.339  3.515   -3.180  1.00 0.00 ? 92  GLU A CA   1  
ATOM 1410  C C    . GLU A 1 92  ? 12.464  3.604   -1.928  1.00 0.00 ? 92  GLU A C    1  
ATOM 1411  O O    . GLU A 1 92  ? 12.687  2.883   -0.957  1.00 0.00 ? 92  GLU A O    1  
ATOM 1412  C CB   . GLU A 1 92  ? 14.206  4.766   -3.332  1.00 0.00 ? 92  GLU A CB   1  
ATOM 1413  C CG   . GLU A 1 92  ? 15.218  4.597   -4.468  1.00 0.00 ? 92  GLU A CG   1  
ATOM 1414  C CD   . GLU A 1 92  ? 16.622  4.338   -3.917  1.00 0.00 ? 92  GLU A CD   1  
ATOM 1415  O OE1  . GLU A 1 92  ? 17.129  5.236   -3.210  1.00 0.00 ? 92  GLU A OE1  1  
ATOM 1416  O OE2  . GLU A 1 92  ? 17.157  3.248   -4.215  1.00 0.00 ? 92  GLU A OE2  1  
ATOM 1417  H H    . GLU A 1 92  ? 12.506  4.066   -5.008  1.00 0.00 ? 92  GLU A H    1  
ATOM 1418  H HA   . GLU A 1 92  ? 13.984  2.639   -3.118  1.00 0.00 ? 92  GLU A HA   1  
ATOM 1419  H HB2  . GLU A 1 92  ? 13.573  5.630   -3.532  1.00 0.00 ? 92  GLU A HB2  1  
ATOM 1420  H HB3  . GLU A 1 92  ? 14.732  4.965   -2.399  1.00 0.00 ? 92  GLU A HB3  1  
ATOM 1421  H HG2  . GLU A 1 92  ? 14.917  3.768   -5.108  1.00 0.00 ? 92  GLU A HG2  1  
ATOM 1422  H HG3  . GLU A 1 92  ? 15.227  5.492   -5.089  1.00 0.00 ? 92  GLU A HG3  1  
ATOM 1423  N N    . LEU A 1 93  ? 11.486  4.496   -1.991  1.00 0.00 ? 93  LEU A N    1  
ATOM 1424  C CA   . LEU A 1 93  ? 10.576  4.689   -0.875  1.00 0.00 ? 93  LEU A CA   1  
ATOM 1425  C C    . LEU A 1 93  ? 10.086  3.327   -0.380  1.00 0.00 ? 93  LEU A C    1  
ATOM 1426  O O    . LEU A 1 93  ? 10.123  3.047   0.817   1.00 0.00 ? 93  LEU A O    1  
ATOM 1427  C CB   . LEU A 1 93  ? 9.446   5.645   -1.263  1.00 0.00 ? 93  LEU A CB   1  
ATOM 1428  C CG   . LEU A 1 93  ? 9.787   7.136   -1.227  1.00 0.00 ? 93  LEU A CG   1  
ATOM 1429  C CD1  . LEU A 1 93  ? 8.582   7.984   -1.640  1.00 0.00 ? 93  LEU A CD1  1  
ATOM 1430  C CD2  . LEU A 1 93  ? 10.331  7.541   0.144   1.00 0.00 ? 93  LEU A CD2  1  
ATOM 1431  H H    . LEU A 1 93  ? 11.311  5.079   -2.784  1.00 0.00 ? 93  LEU A H    1  
ATOM 1432  H HA   . LEU A 1 93  ? 11.140  5.165   -0.072  1.00 0.00 ? 93  LEU A HA   1  
ATOM 1433  H HB2  . LEU A 1 93  ? 9.114   5.393   -2.270  1.00 0.00 ? 93  LEU A HB2  1  
ATOM 1434  H HB3  . LEU A 1 93  ? 8.603   5.469   -0.596  1.00 0.00 ? 93  LEU A HB3  1  
ATOM 1435  H HG   . LEU A 1 93  ? 10.577  7.324   -1.955  1.00 0.00 ? 93  LEU A HG   1  
ATOM 1436  H HD11 . LEU A 1 93  ? 8.845   9.040   -1.584  1.00 0.00 ? 93  LEU A HD11 1  
ATOM 1437  H HD12 . LEU A 1 93  ? 8.295   7.734   -2.661  1.00 0.00 ? 93  LEU A HD12 1  
ATOM 1438  H HD13 . LEU A 1 93  ? 7.748   7.781   -0.967  1.00 0.00 ? 93  LEU A HD13 1  
ATOM 1439  H HD21 . LEU A 1 93  ? 10.005  8.554   0.380   1.00 0.00 ? 93  LEU A HD21 1  
ATOM 1440  H HD22 . LEU A 1 93  ? 9.956   6.853   0.901   1.00 0.00 ? 93  LEU A HD22 1  
ATOM 1441  H HD23 . LEU A 1 93  ? 11.420  7.505   0.128   1.00 0.00 ? 93  LEU A HD23 1  
ATOM 1442  N N    . PHE A 1 94  ? 9.638   2.515   -1.327  1.00 0.00 ? 94  PHE A N    1  
ATOM 1443  C CA   . PHE A 1 94  ? 9.142   1.189   -1.003  1.00 0.00 ? 94  PHE A CA   1  
ATOM 1444  C C    . PHE A 1 94  ? 10.178  0.395   -0.205  1.00 0.00 ? 94  PHE A C    1  
ATOM 1445  O O    . PHE A 1 94  ? 9.877   -0.119  0.871   1.00 0.00 ? 94  PHE A O    1  
ATOM 1446  C CB   . PHE A 1 94  ? 8.880   0.473   -2.330  1.00 0.00 ? 94  PHE A CB   1  
ATOM 1447  C CG   . PHE A 1 94  ? 7.830   1.155   -3.209  1.00 0.00 ? 94  PHE A CG   1  
ATOM 1448  C CD1  . PHE A 1 94  ? 6.849   1.905   -2.639  1.00 0.00 ? 94  PHE A CD1  1  
ATOM 1449  C CD2  . PHE A 1 94  ? 7.879   1.013   -4.561  1.00 0.00 ? 94  PHE A CD2  1  
ATOM 1450  C CE1  . PHE A 1 94  ? 5.874   2.538   -3.455  1.00 0.00 ? 94  PHE A CE1  1  
ATOM 1451  C CE2  . PHE A 1 94  ? 6.904   1.647   -5.377  1.00 0.00 ? 94  PHE A CE2  1  
ATOM 1452  C CZ   . PHE A 1 94  ? 5.923   2.396   -4.806  1.00 0.00 ? 94  PHE A CZ   1  
ATOM 1453  H H    . PHE A 1 94  ? 9.612   2.751   -2.299  1.00 0.00 ? 94  PHE A H    1  
ATOM 1454  H HA   . PHE A 1 94  ? 8.243   1.318   -0.401  1.00 0.00 ? 94  PHE A HA   1  
ATOM 1455  H HB2  . PHE A 1 94  ? 9.815   0.405   -2.885  1.00 0.00 ? 94  PHE A HB2  1  
ATOM 1456  H HB3  . PHE A 1 94  ? 8.557   -0.548  -2.122  1.00 0.00 ? 94  PHE A HB3  1  
ATOM 1457  H HD1  . PHE A 1 94  ? 6.810   2.019   -1.555  1.00 0.00 ? 94  PHE A HD1  1  
ATOM 1458  H HD2  . PHE A 1 94  ? 8.665   0.413   -5.017  1.00 0.00 ? 94  PHE A HD2  1  
ATOM 1459  H HE1  . PHE A 1 94  ? 5.088   3.139   -2.998  1.00 0.00 ? 94  PHE A HE1  1  
ATOM 1460  H HE2  . PHE A 1 94  ? 6.943   1.532   -6.460  1.00 0.00 ? 94  PHE A HE2  1  
ATOM 1461  H HZ   . PHE A 1 94  ? 5.175   2.882   -5.433  1.00 0.00 ? 94  PHE A HZ   1  
ATOM 1462  N N    . LEU A 1 95  ? 11.377  0.321   -0.762  1.00 0.00 ? 95  LEU A N    1  
ATOM 1463  C CA   . LEU A 1 95  ? 12.460  -0.401  -0.116  1.00 0.00 ? 95  LEU A CA   1  
ATOM 1464  C C    . LEU A 1 95  ? 12.838  0.312   1.184   1.00 0.00 ? 95  LEU A C    1  
ATOM 1465  O O    . LEU A 1 95  ? 13.328  -0.316  2.121   1.00 0.00 ? 95  LEU A O    1  
ATOM 1466  C CB   . LEU A 1 95  ? 13.633  -0.585  -1.081  1.00 0.00 ? 95  LEU A CB   1  
ATOM 1467  C CG   . LEU A 1 95  ? 13.580  -1.829  -1.971  1.00 0.00 ? 95  LEU A CG   1  
ATOM 1468  C CD1  . LEU A 1 95  ? 14.123  -1.525  -3.369  1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1469  C CD2  . LEU A 1 95  ? 14.310  -3.003  -1.316  1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1470  H H    . LEU A 1 95  ? 11.614  0.742   -1.638  1.00 0.00 ? 95  LEU A H    1  
ATOM 1471  H HA   . LEU A 1 95  ? 12.087  -1.395  0.132   1.00 0.00 ? 95  LEU A HA   1  
ATOM 1472  H HB2  . LEU A 1 95  ? 13.691  0.294   -1.722  1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1473  H HB3  . LEU A 1 95  ? 14.554  -0.618  -0.499  1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1474  H HG   . LEU A 1 95  ? 12.537  -2.122  -2.087  1.00 0.00 ? 95  LEU A HG   1  
ATOM 1475  H HD11 . LEU A 1 95  ? 13.697  -0.588  -3.728  1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1476  H HD12 . LEU A 1 95  ? 15.208  -1.438  -3.327  1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1477  H HD13 . LEU A 1 95  ? 13.849  -2.333  -4.048  1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1478  H HD21 . LEU A 1 95  ? 14.022  -3.931  -1.809  1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1479  H HD22 . LEU A 1 95  ? 15.387  -2.860  -1.410  1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1480  H HD23 . LEU A 1 95  ? 14.042  -3.055  -0.260  1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1481  N N    . ALA A 1 96  ? 12.597  1.615   1.198   1.00 0.00 ? 96  ALA A N    1  
ATOM 1482  C CA   . ALA A 1 96  ? 12.907  2.420   2.367   1.00 0.00 ? 96  ALA A CA   1  
ATOM 1483  C C    . ALA A 1 96  ? 11.835  2.194   3.435   1.00 0.00 ? 96  ALA A C    1  
ATOM 1484  O O    . ALA A 1 96  ? 11.986  2.634   4.574   1.00 0.00 ? 96  ALA A O    1  
ATOM 1485  C CB   . ALA A 1 96  ? 13.021  3.890   1.958   1.00 0.00 ? 96  ALA A CB   1  
ATOM 1486  H H    . ALA A 1 96  ? 12.199  2.118   0.431   1.00 0.00 ? 96  ALA A H    1  
ATOM 1487  H HA   . ALA A 1 96  ? 13.870  2.088   2.754   1.00 0.00 ? 96  ALA A HA   1  
ATOM 1488  H HB1  . ALA A 1 96  ? 13.854  4.351   2.490   1.00 0.00 ? 96  ALA A HB1  1  
ATOM 1489  H HB2  . ALA A 1 96  ? 13.195  3.956   0.884   1.00 0.00 ? 96  ALA A HB2  1  
ATOM 1490  H HB3  . ALA A 1 96  ? 12.097  4.411   2.209   1.00 0.00 ? 96  ALA A HB3  1  
ATOM 1491  N N    . HIS A 1 97  ? 10.776  1.509   3.030   1.00 0.00 ? 97  HIS A N    1  
ATOM 1492  C CA   . HIS A 1 97  ? 9.680   1.219   3.938   1.00 0.00 ? 97  HIS A CA   1  
ATOM 1493  C C    . HIS A 1 97  ? 9.022   -0.105  3.543   1.00 0.00 ? 97  HIS A C    1  
ATOM 1494  O O    . HIS A 1 97  ? 7.800   -0.234  3.593   1.00 0.00 ? 97  HIS A O    1  
ATOM 1495  C CB   . HIS A 1 97  ? 8.689   2.383   3.982   1.00 0.00 ? 97  HIS A CB   1  
ATOM 1496  C CG   . HIS A 1 97  ? 9.313   3.708   4.350   1.00 0.00 ? 97  HIS A CG   1  
ATOM 1497  N ND1  . HIS A 1 97  ? 9.646   4.044   5.651   1.00 0.00 ? 97  HIS A ND1  1  
ATOM 1498  C CD2  . HIS A 1 97  ? 9.663   4.775   3.575   1.00 0.00 ? 97  HIS A CD2  1  
ATOM 1499  C CE1  . HIS A 1 97  ? 10.170  5.261   5.647   1.00 0.00 ? 97  HIS A CE1  1  
ATOM 1500  N NE2  . HIS A 1 97  ? 10.179  5.712   4.360   1.00 0.00 ? 97  HIS A NE2  1  
ATOM 1501  H H    . HIS A 1 97  ? 10.661  1.155   2.102   1.00 0.00 ? 97  HIS A H    1  
ATOM 1502  H HA   . HIS A 1 97  ? 10.116  1.116   4.932   1.00 0.00 ? 97  HIS A HA   1  
ATOM 1503  H HB2  . HIS A 1 97  ? 8.210   2.477   3.007   1.00 0.00 ? 97  HIS A HB2  1  
ATOM 1504  H HB3  . HIS A 1 97  ? 7.903   2.151   4.701   1.00 0.00 ? 97  HIS A HB3  1  
ATOM 1505  H HD1  . HIS A 1 97  ? 9.513   3.467   6.457   1.00 0.00 ? 97  HIS A HD1  1  
ATOM 1506  H HD2  . HIS A 1 97  ? 9.538   4.845   2.495   1.00 0.00 ? 97  HIS A HD2  1  
ATOM 1507  H HE1  . HIS A 1 97  ? 10.531  5.806   6.519   1.00 0.00 ? 97  HIS A HE1  1  
ATOM 1508  N N    . ILE A 1 98  ? 9.862   -1.054  3.158   1.00 0.00 ? 98  ILE A N    1  
ATOM 1509  C CA   . ILE A 1 98  ? 9.378   -2.363  2.754   1.00 0.00 ? 98  ILE A CA   1  
ATOM 1510  C C    . ILE A 1 98  ? 9.207   -3.244  3.994   1.00 0.00 ? 98  ILE A C    1  
ATOM 1511  O O    . ILE A 1 98  ? 10.163  -3.474  4.733   1.00 0.00 ? 98  ILE A O    1  
ATOM 1512  C CB   . ILE A 1 98  ? 10.296  -2.970  1.691   1.00 0.00 ? 98  ILE A CB   1  
ATOM 1513  C CG1  . ILE A 1 98  ? 9.639   -4.180  1.025   1.00 0.00 ? 98  ILE A CG1  1  
ATOM 1514  C CG2  . ILE A 1 98  ? 11.666  -3.313  2.280   1.00 0.00 ? 98  ILE A CG2  1  
ATOM 1515  C CD1  . ILE A 1 98  ? 9.293   -3.882  -0.435  1.00 0.00 ? 98  ILE A CD1  1  
ATOM 1516  H H    . ILE A 1 98  ? 10.855  -0.941  3.120   1.00 0.00 ? 98  ILE A H    1  
ATOM 1517  H HA   . ILE A 1 98  ? 8.401   -2.222  2.293   1.00 0.00 ? 98  ILE A HA   1  
ATOM 1518  H HB   . ILE A 1 98  ? 10.458  -2.223  0.914   1.00 0.00 ? 98  ILE A HB   1  
ATOM 1519  H HG12 . ILE A 1 98  ? 10.311  -5.037  1.075   1.00 0.00 ? 98  ILE A HG12 1  
ATOM 1520  H HG13 . ILE A 1 98  ? 8.734   -4.453  1.569   1.00 0.00 ? 98  ILE A HG13 1  
ATOM 1521  H HG21 . ILE A 1 98  ? 12.431  -3.200  1.512   1.00 0.00 ? 98  ILE A HG21 1  
ATOM 1522  H HG22 . ILE A 1 98  ? 11.883  -2.642  3.111   1.00 0.00 ? 98  ILE A HG22 1  
ATOM 1523  H HG23 . ILE A 1 98  ? 11.660  -4.343  2.638   1.00 0.00 ? 98  ILE A HG23 1  
ATOM 1524  H HD11 . ILE A 1 98  ? 9.150   -4.819  -0.974  1.00 0.00 ? 98  ILE A HD11 1  
ATOM 1525  H HD12 . ILE A 1 98  ? 8.375   -3.295  -0.478  1.00 0.00 ? 98  ILE A HD12 1  
ATOM 1526  H HD13 . ILE A 1 98  ? 10.106  -3.319  -0.894  1.00 0.00 ? 98  ILE A HD13 1  
ATOM 1527  N N    . LEU A 1 99  ? 7.983   -3.712  4.183   1.00 0.00 ? 99  LEU A N    1  
ATOM 1528  C CA   . LEU A 1 99  ? 7.674   -4.562  5.321   1.00 0.00 ? 99  LEU A CA   1  
ATOM 1529  C C    . LEU A 1 99  ? 7.757   -6.029  4.893   1.00 0.00 ? 99  LEU A C    1  
ATOM 1530  O O    . LEU A 1 99  ? 8.028   -6.904  5.713   1.00 0.00 ? 99  LEU A O    1  
ATOM 1531  C CB   . LEU A 1 99  ? 6.325   -4.174  5.930   1.00 0.00 ? 99  LEU A CB   1  
ATOM 1532  C CG   . LEU A 1 99  ? 6.244   -2.774  6.542   1.00 0.00 ? 99  LEU A CG   1  
ATOM 1533  C CD1  . LEU A 1 99  ? 4.836   -2.487  7.068   1.00 0.00 ? 99  LEU A CD1  1  
ATOM 1534  C CD2  . LEU A 1 99  ? 7.309   -2.586  7.624   1.00 0.00 ? 99  LEU A CD2  1  
ATOM 1535  H H    . LEU A 1 99  ? 7.210   -3.520  3.578   1.00 0.00 ? 99  LEU A H    1  
ATOM 1536  H HA   . LEU A 1 99  ? 8.435   -4.381  6.080   1.00 0.00 ? 99  LEU A HA   1  
ATOM 1537  H HB2  . LEU A 1 99  ? 5.563   -4.255  5.155   1.00 0.00 ? 99  LEU A HB2  1  
ATOM 1538  H HB3  . LEU A 1 99  ? 6.075   -4.902  6.701   1.00 0.00 ? 99  LEU A HB3  1  
ATOM 1539  H HG   . LEU A 1 99  ? 6.449   -2.046  5.758   1.00 0.00 ? 99  LEU A HG   1  
ATOM 1540  H HD11 . LEU A 1 99  ? 4.246   -2.011  6.285   1.00 0.00 ? 99  LEU A HD11 1  
ATOM 1541  H HD12 . LEU A 1 99  ? 4.360   -3.423  7.363   1.00 0.00 ? 99  LEU A HD12 1  
ATOM 1542  H HD13 . LEU A 1 99  ? 4.898   -1.823  7.930   1.00 0.00 ? 99  LEU A HD13 1  
ATOM 1543  H HD21 . LEU A 1 99  ? 7.409   -3.507  8.199   1.00 0.00 ? 99  LEU A HD21 1  
ATOM 1544  H HD22 . LEU A 1 99  ? 8.263   -2.345  7.156   1.00 0.00 ? 99  LEU A HD22 1  
ATOM 1545  H HD23 . LEU A 1 99  ? 7.013   -1.774  8.287   1.00 0.00 ? 99  LEU A HD23 1  
ATOM 1546  N N    . SER A 1 100 ? 7.517   -6.252  3.609   1.00 0.00 ? 100 SER A N    1  
ATOM 1547  C CA   . SER A 1 100 ? 7.561   -7.598  3.063   1.00 0.00 ? 100 SER A CA   1  
ATOM 1548  C C    . SER A 1 100 ? 8.885   -7.822  2.330   1.00 0.00 ? 100 SER A C    1  
ATOM 1549  O O    . SER A 1 100 ? 9.626   -6.874  2.076   1.00 0.00 ? 100 SER A O    1  
ATOM 1550  C CB   . SER A 1 100 ? 6.383   -7.847  2.118   1.00 0.00 ? 100 SER A CB   1  
ATOM 1551  O OG   . SER A 1 100 ? 6.482   -7.075  0.925   1.00 0.00 ? 100 SER A OG   1  
ATOM 1552  H H    . SER A 1 100 ? 7.297   -5.535  2.948   1.00 0.00 ? 100 SER A H    1  
ATOM 1553  H HA   . SER A 1 100 ? 7.482   -8.262  3.923   1.00 0.00 ? 100 SER A HA   1  
ATOM 1554  H HB2  . SER A 1 100 ? 6.341   -8.906  1.863   1.00 0.00 ? 100 SER A HB2  1  
ATOM 1555  H HB3  . SER A 1 100 ? 5.451   -7.606  2.630   1.00 0.00 ? 100 SER A HB3  1  
ATOM 1556  H HG   . SER A 1 100 ? 7.208   -6.393  1.018   1.00 0.00 ? 100 SER A HG   1  
ATOM 1557  N N    . SER A 1 101 ? 9.142   -9.082  2.011   1.00 0.00 ? 101 SER A N    1  
ATOM 1558  C CA   . SER A 1 101 ? 10.364  -9.443  1.312   1.00 0.00 ? 101 SER A CA   1  
ATOM 1559  C C    . SER A 1 101 ? 10.073  -9.657  -0.175  1.00 0.00 ? 101 SER A C    1  
ATOM 1560  O O    . SER A 1 101 ? 10.993  -9.708  -0.990  1.00 0.00 ? 101 SER A O    1  
ATOM 1561  C CB   . SER A 1 101 ? 10.992  -10.701 1.916   1.00 0.00 ? 101 SER A CB   1  
ATOM 1562  O OG   . SER A 1 101 ? 12.364  -10.505 2.248   1.00 0.00 ? 101 SER A OG   1  
ATOM 1563  H H    . SER A 1 101 ? 8.533   -9.847  2.221   1.00 0.00 ? 101 SER A H    1  
ATOM 1564  H HA   . SER A 1 101 ? 11.037  -8.598  1.453   1.00 0.00 ? 101 SER A HA   1  
ATOM 1565  H HB2  . SER A 1 101 ? 10.440  -10.988 2.811   1.00 0.00 ? 101 SER A HB2  1  
ATOM 1566  H HB3  . SER A 1 101 ? 10.905  -11.525 1.209   1.00 0.00 ? 101 SER A HB3  1  
ATOM 1567  H HG   . SER A 1 101 ? 12.858  -11.372 2.189   1.00 0.00 ? 101 SER A HG   1  
ATOM 1568  N N    . TRP A 1 102 ? 8.790   -9.776  -0.483  1.00 0.00 ? 102 TRP A N    1  
ATOM 1569  C CA   . TRP A 1 102 ? 8.366   -9.982  -1.857  1.00 0.00 ? 102 TRP A CA   1  
ATOM 1570  C C    . TRP A 1 102 ? 7.910   -8.635  -2.419  1.00 0.00 ? 102 TRP A C    1  
ATOM 1571  O O    . TRP A 1 102 ? 8.196   -7.588  -1.841  1.00 0.00 ? 102 TRP A O    1  
ATOM 1572  C CB   . TRP A 1 102 ? 7.286   -11.062 -1.942  1.00 0.00 ? 102 TRP A CB   1  
ATOM 1573  C CG   . TRP A 1 102 ? 5.903   -10.597 -1.480  1.00 0.00 ? 102 TRP A CG   1  
ATOM 1574  C CD1  . TRP A 1 102 ? 4.948   -10.003 -2.208  1.00 0.00 ? 102 TRP A CD1  1  
ATOM 1575  C CD2  . TRP A 1 102 ? 5.357   -10.712 -0.150  1.00 0.00 ? 102 TRP A CD2  1  
ATOM 1576  N NE1  . TRP A 1 102 ? 3.830   -9.728  -1.446  1.00 0.00 ? 102 TRP A NE1  1  
ATOM 1577  C CE2  . TRP A 1 102 ? 4.087   -10.173 -0.155  1.00 0.00 ? 102 TRP A CE2  1  
ATOM 1578  C CE3  . TRP A 1 102 ? 5.918   -11.255 1.020   1.00 0.00 ? 102 TRP A CE3  1  
ATOM 1579  C CZ2  . TRP A 1 102 ? 3.271   -10.123 0.981   1.00 0.00 ? 102 TRP A CZ2  1  
ATOM 1580  C CZ3  . TRP A 1 102 ? 5.089   -11.197 2.147   1.00 0.00 ? 102 TRP A CZ3  1  
ATOM 1581  C CH2  . TRP A 1 102 ? 3.808   -10.658 2.158   1.00 0.00 ? 102 TRP A CH2  1  
ATOM 1582  H H    . TRP A 1 102 ? 8.048   -9.733  0.186   1.00 0.00 ? 102 TRP A H    1  
ATOM 1583  H HA   . TRP A 1 102 ? 9.226   -10.349 -2.419  1.00 0.00 ? 102 TRP A HA   1  
ATOM 1584  H HB2  . TRP A 1 102 ? 7.215   -11.412 -2.972  1.00 0.00 ? 102 TRP A HB2  1  
ATOM 1585  H HB3  . TRP A 1 102 ? 7.592   -11.916 -1.336  1.00 0.00 ? 102 TRP A HB3  1  
ATOM 1586  H HD1  . TRP A 1 102 ? 5.041   -9.766  -3.268  1.00 0.00 ? 102 TRP A HD1  1  
ATOM 1587  H HE1  . TRP A 1 102 ? 2.914   -9.249  -1.794  1.00 0.00 ? 102 TRP A HE1  1  
ATOM 1588  H HE3  . TRP A 1 102 ? 6.918   -11.686 1.050   1.00 0.00 ? 102 TRP A HE3  1  
ATOM 1589  H HZ2  . TRP A 1 102 ? 2.270   -9.692  0.951   1.00 0.00 ? 102 TRP A HZ2  1  
ATOM 1590  H HZ3  . TRP A 1 102 ? 5.476   -11.604 3.082   1.00 0.00 ? 102 TRP A HZ3  1  
ATOM 1591  H HH2  . TRP A 1 102 ? 3.225   -10.651 3.079   1.00 0.00 ? 102 TRP A HH2  1  
ATOM 1592  N N    . GLY A 1 103 ? 7.206   -8.705  -3.540  1.00 0.00 ? 103 GLY A N    1  
ATOM 1593  C CA   . GLY A 1 103 ? 6.707   -7.503  -4.187  1.00 0.00 ? 103 GLY A CA   1  
ATOM 1594  C C    . GLY A 1 103 ? 7.695   -6.995  -5.239  1.00 0.00 ? 103 GLY A C    1  
ATOM 1595  O O    . GLY A 1 103 ? 8.234   -5.897  -5.111  1.00 0.00 ? 103 GLY A O    1  
ATOM 1596  H H    . GLY A 1 103 ? 6.977   -9.560  -4.004  1.00 0.00 ? 103 GLY A H    1  
ATOM 1597  H HA2  . GLY A 1 103 ? 5.746   -7.711  -4.656  1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1598  H HA3  . GLY A 1 103 ? 6.536   -6.728  -3.439  1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1599  N N    . ALA A 1 104 ? 7.903   -7.819  -6.255  1.00 0.00 ? 104 ALA A N    1  
ATOM 1600  C CA   . ALA A 1 104 ? 8.817   -7.468  -7.329  1.00 0.00 ? 104 ALA A CA   1  
ATOM 1601  C C    . ALA A 1 104 ? 8.186   -7.840  -8.672  1.00 0.00 ? 104 ALA A C    1  
ATOM 1602  O O    . ALA A 1 104 ? 7.031   -8.259  -8.724  1.00 0.00 ? 104 ALA A O    1  
ATOM 1603  C CB   . ALA A 1 104 ? 10.161  -8.163  -7.104  1.00 0.00 ? 104 ALA A CB   1  
ATOM 1604  H H    . ALA A 1 104 ? 7.461   -8.711  -6.352  1.00 0.00 ? 104 ALA A H    1  
ATOM 1605  H HA   . ALA A 1 104 ? 8.970   -6.389  -7.295  1.00 0.00 ? 104 ALA A HA   1  
ATOM 1606  H HB1  . ALA A 1 104 ? 10.733  -8.158  -8.032  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1607  H HB2  . ALA A 1 104 ? 10.718  -7.635  -6.330  1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1608  H HB3  . ALA A 1 104 ? 9.989   -9.192  -6.788  1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1609  N N    . GLU A 1 105 ? 8.972   -7.673  -9.725  1.00 0.00 ? 105 GLU A N    1  
ATOM 1610  C CA   . GLU A 1 105 ? 8.505   -7.986  -11.065 1.00 0.00 ? 105 GLU A CA   1  
ATOM 1611  C C    . GLU A 1 105 ? 7.896   -9.389  -11.101 1.00 0.00 ? 105 GLU A C    1  
ATOM 1612  O O    . GLU A 1 105 ? 8.584   -10.375 -10.840 1.00 0.00 ? 105 GLU A O    1  
ATOM 1613  C CB   . GLU A 1 105 ? 9.637   -7.853  -12.086 1.00 0.00 ? 105 GLU A CB   1  
ATOM 1614  C CG   . GLU A 1 105 ? 9.984   -6.383  -12.331 1.00 0.00 ? 105 GLU A CG   1  
ATOM 1615  C CD   . GLU A 1 105 ? 11.474  -6.216  -12.639 1.00 0.00 ? 105 GLU A CD   1  
ATOM 1616  O OE1  . GLU A 1 105 ? 11.923  -6.841  -13.624 1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1617  O OE2  . GLU A 1 105 ? 12.129  -5.468  -11.882 1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1618  H H    . GLU A 1 105 ? 9.910   -7.331  -9.674  1.00 0.00 ? 105 GLU A H    1  
ATOM 1619  H HA   . GLU A 1 105 ? 7.737   -7.243  -11.285 1.00 0.00 ? 105 GLU A HA   1  
ATOM 1620  H HB2  . GLU A 1 105 ? 10.519  -8.384  -11.727 1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1621  H HB3  . GLU A 1 105 ? 9.342   -8.323  -13.024 1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1622  H HG2  . GLU A 1 105 ? 9.392   -6.000  -13.162 1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1623  H HG3  . GLU A 1 105 ? 9.722   -5.792  -11.454 1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1624  N N    . VAL A 1 106 ? 6.612   -9.434  -11.426 1.00 0.00 ? 106 VAL A N    1  
ATOM 1625  C CA   . VAL A 1 106 ? 5.903   -10.700 -11.499 1.00 0.00 ? 106 VAL A CA   1  
ATOM 1626  C C    . VAL A 1 106 ? 4.648   -10.528 -12.357 1.00 0.00 ? 106 VAL A C    1  
ATOM 1627  O O    . VAL A 1 106 ? 4.155   -9.414  -12.525 1.00 0.00 ? 106 VAL A O    1  
ATOM 1628  C CB   . VAL A 1 106 ? 5.597   -11.211 -10.089 1.00 0.00 ? 106 VAL A CB   1  
ATOM 1629  C CG1  . VAL A 1 106 ? 4.405   -12.169 -10.100 1.00 0.00 ? 106 VAL A CG1  1  
ATOM 1630  C CG2  . VAL A 1 106 ? 6.828   -11.874 -9.467  1.00 0.00 ? 106 VAL A CG2  1  
ATOM 1631  H H    . VAL A 1 106 ? 6.060   -8.628  -11.636 1.00 0.00 ? 106 VAL A H    1  
ATOM 1632  H HA   . VAL A 1 106 ? 6.563   -11.420 -11.983 1.00 0.00 ? 106 VAL A HA   1  
ATOM 1633  H HB   . VAL A 1 106 ? 5.332   -10.353 -9.472  1.00 0.00 ? 106 VAL A HB   1  
ATOM 1634  H HG11 . VAL A 1 106 ? 4.596   -12.979 -10.804 1.00 0.00 ? 106 VAL A HG11 1  
ATOM 1635  H HG12 . VAL A 1 106 ? 4.262   -12.583 -9.101  1.00 0.00 ? 106 VAL A HG12 1  
ATOM 1636  H HG13 . VAL A 1 106 ? 3.507   -11.629 -10.401 1.00 0.00 ? 106 VAL A HG13 1  
ATOM 1637  H HG21 . VAL A 1 106 ? 7.481   -11.108 -9.049  1.00 0.00 ? 106 VAL A HG21 1  
ATOM 1638  H HG22 . VAL A 1 106 ? 6.514   -12.554 -8.676  1.00 0.00 ? 106 VAL A HG22 1  
ATOM 1639  H HG23 . VAL A 1 106 ? 7.366   -12.432 -10.234 1.00 0.00 ? 106 VAL A HG23 1  
ATOM 1640  N N    . LYS A 1 107 ? 4.168   -11.648 -12.878 1.00 0.00 ? 107 LYS A N    1  
ATOM 1641  C CA   . LYS A 1 107 ? 2.980   -11.635 -13.714 1.00 0.00 ? 107 LYS A CA   1  
ATOM 1642  C C    . LYS A 1 107 ? 1.952   -10.672 -13.119 1.00 0.00 ? 107 LYS A C    1  
ATOM 1643  O O    . LYS A 1 107 ? 1.303   -10.989 -12.123 1.00 0.00 ? 107 LYS A O    1  
ATOM 1644  C CB   . LYS A 1 107 ? 2.449   -13.056 -13.912 1.00 0.00 ? 107 LYS A CB   1  
ATOM 1645  C CG   . LYS A 1 107 ? 2.396   -13.420 -15.397 1.00 0.00 ? 107 LYS A CG   1  
ATOM 1646  C CD   . LYS A 1 107 ? 1.317   -12.613 -16.122 1.00 0.00 ? 107 LYS A CD   1  
ATOM 1647  C CE   . LYS A 1 107 ? 0.412   -13.527 -16.950 1.00 0.00 ? 107 LYS A CE   1  
ATOM 1648  N NZ   . LYS A 1 107 ? -0.962  -13.533 -16.398 1.00 0.00 ? 107 LYS A NZ   1  
ATOM 1649  H H    . LYS A 1 107 ? 4.575   -12.550 -12.736 1.00 0.00 ? 107 LYS A H    1  
ATOM 1650  H HA   . LYS A 1 107 ? 3.276   -11.262 -14.695 1.00 0.00 ? 107 LYS A HA   1  
ATOM 1651  H HB2  . LYS A 1 107 ? 3.087   -13.764 -13.383 1.00 0.00 ? 107 LYS A HB2  1  
ATOM 1652  H HB3  . LYS A 1 107 ? 1.453   -13.140 -13.478 1.00 0.00 ? 107 LYS A HB3  1  
ATOM 1653  H HG2  . LYS A 1 107 ? 3.367   -13.231 -15.856 1.00 0.00 ? 107 LYS A HG2  1  
ATOM 1654  H HG3  . LYS A 1 107 ? 2.194   -14.486 -15.507 1.00 0.00 ? 107 LYS A HG3  1  
ATOM 1655  H HD2  . LYS A 1 107 ? 0.719   -12.064 -15.395 1.00 0.00 ? 107 LYS A HD2  1  
ATOM 1656  H HD3  . LYS A 1 107 ? 1.786   -11.874 -16.772 1.00 0.00 ? 107 LYS A HD3  1  
ATOM 1657  H HE2  . LYS A 1 107 ? 0.392   -13.188 -17.986 1.00 0.00 ? 107 LYS A HE2  1  
ATOM 1658  H HE3  . LYS A 1 107 ? 0.814   -14.540 -16.954 1.00 0.00 ? 107 LYS A HE3  1  
ATOM 1659  H HZ1  . LYS A 1 107 ? -0.926  -13.362 -15.414 1.00 0.00 ? 107 LYS A HZ1  1  
ATOM 1660  H HZ2  . LYS A 1 107 ? -1.502  -12.819 -16.842 1.00 0.00 ? 107 LYS A HZ2  1  
ATOM 1661  H HZ3  . LYS A 1 107 ? -1.384  -14.424 -16.567 1.00 0.00 ? 107 LYS A HZ3  1  
ATOM 1662  N N    . SER A 1 108 ? 1.836   -9.514  -13.753 1.00 0.00 ? 108 SER A N    1  
ATOM 1663  C CA   . SER A 1 108 ? 0.898   -8.502  -13.298 1.00 0.00 ? 108 SER A CA   1  
ATOM 1664  C C    . SER A 1 108 ? -0.162  -8.251  -14.372 1.00 0.00 ? 108 SER A C    1  
ATOM 1665  O O    . SER A 1 108 ? -0.072  -8.787  -15.475 1.00 0.00 ? 108 SER A O    1  
ATOM 1666  C CB   . SER A 1 108 ? 1.620   -7.199  -12.949 1.00 0.00 ? 108 SER A CB   1  
ATOM 1667  O OG   . SER A 1 108 ? 1.699   -6.993  -11.541 1.00 0.00 ? 108 SER A OG   1  
ATOM 1668  H H    . SER A 1 108 ? 2.368   -9.264  -14.562 1.00 0.00 ? 108 SER A H    1  
ATOM 1669  H HA   . SER A 1 108 ? 0.441   -8.916  -12.399 1.00 0.00 ? 108 SER A HA   1  
ATOM 1670  H HB2  . SER A 1 108 ? 2.625   -7.218  -13.370 1.00 0.00 ? 108 SER A HB2  1  
ATOM 1671  H HB3  . SER A 1 108 ? 1.097   -6.361  -13.409 1.00 0.00 ? 108 SER A HB3  1  
ATOM 1672  H HG   . SER A 1 108 ? 0.945   -7.463  -11.084 1.00 0.00 ? 108 SER A HG   1  
ATOM 1673  N N    . GLY A 1 109 ? -1.142  -7.435  -14.011 1.00 0.00 ? 109 GLY A N    1  
ATOM 1674  C CA   . GLY A 1 109 ? -2.218  -7.106  -14.931 1.00 0.00 ? 109 GLY A CA   1  
ATOM 1675  C C    . GLY A 1 109 ? -1.895  -5.836  -15.721 1.00 0.00 ? 109 GLY A C    1  
ATOM 1676  O O    . GLY A 1 109 ? -0.736  -5.575  -16.037 1.00 0.00 ? 109 GLY A O    1  
ATOM 1677  H H    . GLY A 1 109 ? -1.208  -7.003  -13.112 1.00 0.00 ? 109 GLY A H    1  
ATOM 1678  H HA2  . GLY A 1 109 ? -2.380  -7.936  -15.619 1.00 0.00 ? 109 GLY A HA2  1  
ATOM 1679  H HA3  . GLY A 1 109 ? -3.146  -6.967  -14.375 1.00 0.00 ? 109 GLY A HA3  1  
ATOM 1680  N N    . PRO A 1 110 ? -2.970  -5.060  -16.024 1.00 0.00 ? 110 PRO A N    1  
ATOM 1681  C CA   . PRO A 1 110 ? -2.813  -3.823  -16.771 1.00 0.00 ? 110 PRO A CA   1  
ATOM 1682  C C    . PRO A 1 110 ? -2.222  -2.721  -15.889 1.00 0.00 ? 110 PRO A C    1  
ATOM 1683  O O    . PRO A 1 110 ? -1.919  -2.953  -14.720 1.00 0.00 ? 110 PRO A O    1  
ATOM 1684  C CB   . PRO A 1 110 ? -4.205  -3.492  -17.282 1.00 0.00 ? 110 PRO A CB   1  
ATOM 1685  C CG   . PRO A 1 110 ? -5.167  -4.295  -16.421 1.00 0.00 ? 110 PRO A CG   1  
ATOM 1686  C CD   . PRO A 1 110 ? -4.358  -5.337  -15.666 1.00 0.00 ? 110 PRO A CD   1  
ATOM 1687  H HA   . PRO A 1 110 ? -2.163  -3.951  -17.521 1.00 0.00 ? 110 PRO A HA   1  
ATOM 1688  H HB2  . PRO A 1 110 ? -4.407  -2.424  -17.202 1.00 0.00 ? 110 PRO A HB2  1  
ATOM 1689  H HB3  . PRO A 1 110 ? -4.309  -3.758  -18.334 1.00 0.00 ? 110 PRO A HB3  1  
ATOM 1690  H HG2  . PRO A 1 110 ? -5.692  -3.641  -15.724 1.00 0.00 ? 110 PRO A HG2  1  
ATOM 1691  H HG3  . PRO A 1 110 ? -5.924  -4.775  -17.040 1.00 0.00 ? 110 PRO A HG3  1  
ATOM 1692  H HD2  . PRO A 1 110 ? -4.513  -5.256  -14.590 1.00 0.00 ? 110 PRO A HD2  1  
ATOM 1693  H HD3  . PRO A 1 110 ? -4.647  -6.348  -15.954 1.00 0.00 ? 110 PRO A HD3  1  
ATOM 1694  N N    . SER A 1 111 ? -2.076  -1.546  -16.484 1.00 0.00 ? 111 SER A N    1  
ATOM 1695  C CA   . SER A 1 111 ? -1.527  -0.408  -15.767 1.00 0.00 ? 111 SER A CA   1  
ATOM 1696  C C    . SER A 1 111 ? -0.057  -0.663  -15.428 1.00 0.00 ? 111 SER A C    1  
ATOM 1697  O O    . SER A 1 111 ? 0.294   -1.736  -14.941 1.00 0.00 ? 111 SER A O    1  
ATOM 1698  C CB   . SER A 1 111 ? -2.324  -0.123  -14.493 1.00 0.00 ? 111 SER A CB   1  
ATOM 1699  O OG   . SER A 1 111 ? -2.543  1.272   -14.301 1.00 0.00 ? 111 SER A OG   1  
ATOM 1700  H H    . SER A 1 111 ? -2.325  -1.366  -17.436 1.00 0.00 ? 111 SER A H    1  
ATOM 1701  H HA   . SER A 1 111 ? -1.621  0.436   -16.451 1.00 0.00 ? 111 SER A HA   1  
ATOM 1702  H HB2  . SER A 1 111 ? -3.284  -0.637  -14.543 1.00 0.00 ? 111 SER A HB2  1  
ATOM 1703  H HB3  . SER A 1 111 ? -1.791  -0.528  -13.633 1.00 0.00 ? 111 SER A HB3  1  
ATOM 1704  H HG   . SER A 1 111 ? -2.219  1.782   -15.098 1.00 0.00 ? 111 SER A HG   1  
ATOM 1705  N N    . SER A 1 112 ? 0.763   0.343   -15.698 1.00 0.00 ? 112 SER A N    1  
ATOM 1706  C CA   . SER A 1 112 ? 2.187   0.241   -15.428 1.00 0.00 ? 112 SER A CA   1  
ATOM 1707  C C    . SER A 1 112 ? 2.765   1.628   -15.140 1.00 0.00 ? 112 SER A C    1  
ATOM 1708  O O    . SER A 1 112 ? 2.130   2.641   -15.428 1.00 0.00 ? 112 SER A O    1  
ATOM 1709  C CB   . SER A 1 112 ? 2.925   -0.410  -16.599 1.00 0.00 ? 112 SER A CB   1  
ATOM 1710  O OG   . SER A 1 112 ? 3.115   0.498   -17.681 1.00 0.00 ? 112 SER A OG   1  
ATOM 1711  H H    . SER A 1 112 ? 0.469   1.213   -16.094 1.00 0.00 ? 112 SER A H    1  
ATOM 1712  H HA   . SER A 1 112 ? 2.268   -0.398  -14.548 1.00 0.00 ? 112 SER A HA   1  
ATOM 1713  H HB2  . SER A 1 112 ? 3.894   -0.776  -16.259 1.00 0.00 ? 112 SER A HB2  1  
ATOM 1714  H HB3  . SER A 1 112 ? 2.362   -1.276  -16.947 1.00 0.00 ? 112 SER A HB3  1  
ATOM 1715  H HG   . SER A 1 112 ? 2.518   1.293   -17.569 1.00 0.00 ? 112 SER A HG   1  
ATOM 1716  N N    . GLY A 1 113 ? 3.963   1.629   -14.575 1.00 0.00 ? 113 GLY A N    1  
ATOM 1717  C CA   . GLY A 1 113 ? 4.635   2.874   -14.245 1.00 0.00 ? 113 GLY A CA   1  
ATOM 1718  C C    . GLY A 1 113 ? 6.150   2.740   -14.406 1.00 0.00 ? 113 GLY A C    1  
ATOM 1719  O O    . GLY A 1 113 ? 6.702   1.654   -14.233 1.00 0.00 ? 113 GLY A O    1  
ATOM 1720  H H    . GLY A 1 113 ? 4.473   0.800   -14.344 1.00 0.00 ? 113 GLY A H    1  
ATOM 1721  H HA2  . GLY A 1 113 ? 4.266   3.672   -14.891 1.00 0.00 ? 113 GLY A HA2  1  
ATOM 1722  H HA3  . GLY A 1 113 ? 4.398   3.159   -13.220 1.00 0.00 ? 113 GLY A HA3  1  
ATOM 1723  N N    . GLY A 1 1   ? -9.353  12.138  -24.022 1.00 0.00 ? 1   GLY A N    2  
ATOM 1724  C CA   . GLY A 1 1   ? -9.966  13.451  -23.916 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1725  C C    . GLY A 1 1   ? -9.245  14.310  -22.875 1.00 0.00 ? 1   GLY A C    2  
ATOM 1726  O O    . GLY A 1 1   ? -8.715  15.371  -23.199 1.00 0.00 ? 1   GLY A O    2  
ATOM 1727  H H1   . GLY A 1 1   ? -8.367  12.117  -23.862 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1728  H HA2  . GLY A 1 1   ? -9.937  13.949  -24.885 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1729  H HA3  . GLY A 1 1   ? -11.015 13.346  -23.642 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1730  N N    . SER A 1 2   ? -9.248  13.818  -21.644 1.00 0.00 ? 2   SER A N    2  
ATOM 1731  C CA   . SER A 1 2   ? -8.600  14.527  -20.553 1.00 0.00 ? 2   SER A CA   2  
ATOM 1732  C C    . SER A 1 2   ? -7.080  14.458  -20.713 1.00 0.00 ? 2   SER A C    2  
ATOM 1733  O O    . SER A 1 2   ? -6.507  13.371  -20.770 1.00 0.00 ? 2   SER A O    2  
ATOM 1734  C CB   . SER A 1 2   ? -9.018  13.952  -19.198 1.00 0.00 ? 2   SER A CB   2  
ATOM 1735  O OG   . SER A 1 2   ? -8.793  14.874  -18.135 1.00 0.00 ? 2   SER A OG   2  
ATOM 1736  H H    . SER A 1 2   ? -9.681  12.954  -21.388 1.00 0.00 ? 2   SER A H    2  
ATOM 1737  H HA   . SER A 1 2   ? -8.947  15.557  -20.633 1.00 0.00 ? 2   SER A HA   2  
ATOM 1738  H HB2  . SER A 1 2   ? -10.074 13.684  -19.228 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1739  H HB3  . SER A 1 2   ? -8.462  13.035  -19.007 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1740  H HG   . SER A 1 2   ? -8.551  14.381  -17.300 1.00 0.00 ? 2   SER A HG   2  
ATOM 1741  N N    . SER A 1 3   ? -6.471  15.632  -20.781 1.00 0.00 ? 3   SER A N    2  
ATOM 1742  C CA   . SER A 1 3   ? -5.028  15.719  -20.933 1.00 0.00 ? 3   SER A CA   2  
ATOM 1743  C C    . SER A 1 3   ? -4.461  16.756  -19.962 1.00 0.00 ? 3   SER A C    2  
ATOM 1744  O O    . SER A 1 3   ? -4.924  17.894  -19.923 1.00 0.00 ? 3   SER A O    2  
ATOM 1745  C CB   . SER A 1 3   ? -4.646  16.074  -22.371 1.00 0.00 ? 3   SER A CB   2  
ATOM 1746  O OG   . SER A 1 3   ? -4.840  17.459  -22.649 1.00 0.00 ? 3   SER A OG   2  
ATOM 1747  H H    . SER A 1 3   ? -6.944  16.512  -20.734 1.00 0.00 ? 3   SER A H    2  
ATOM 1748  H HA   . SER A 1 3   ? -4.653  14.724  -20.693 1.00 0.00 ? 3   SER A HA   2  
ATOM 1749  H HB2  . SER A 1 3   ? -3.602  15.813  -22.545 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1750  H HB3  . SER A 1 3   ? -5.243  15.479  -23.063 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1751  H HG   . SER A 1 3   ? -5.715  17.763  -22.273 1.00 0.00 ? 3   SER A HG   2  
ATOM 1752  N N    . GLY A 1 4   ? -3.466  16.324  -19.200 1.00 0.00 ? 4   GLY A N    2  
ATOM 1753  C CA   . GLY A 1 4   ? -2.830  17.201  -18.232 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1754  C C    . GLY A 1 4   ? -1.785  16.444  -17.410 1.00 0.00 ? 4   GLY A C    2  
ATOM 1755  O O    . GLY A 1 4   ? -2.096  15.905  -16.349 1.00 0.00 ? 4   GLY A O    2  
ATOM 1756  H H    . GLY A 1 4   ? -3.095  15.396  -19.238 1.00 0.00 ? 4   GLY A H    2  
ATOM 1757  H HA2  . GLY A 1 4   ? -2.357  18.037  -18.747 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1758  H HA3  . GLY A 1 4   ? -3.585  17.623  -17.567 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1759  N N    . SER A 1 5   ? -0.567  16.428  -17.931 1.00 0.00 ? 5   SER A N    2  
ATOM 1760  C CA   . SER A 1 5   ? 0.526   15.746  -17.259 1.00 0.00 ? 5   SER A CA   2  
ATOM 1761  C C    . SER A 1 5   ? 1.579   16.761  -16.810 1.00 0.00 ? 5   SER A C    2  
ATOM 1762  O O    . SER A 1 5   ? 1.807   17.764  -17.485 1.00 0.00 ? 5   SER A O    2  
ATOM 1763  C CB   . SER A 1 5   ? 1.159   14.691  -18.168 1.00 0.00 ? 5   SER A CB   2  
ATOM 1764  O OG   . SER A 1 5   ? 1.437   15.204  -19.468 1.00 0.00 ? 5   SER A OG   2  
ATOM 1765  H H    . SER A 1 5   ? -0.323  16.869  -18.794 1.00 0.00 ? 5   SER A H    2  
ATOM 1766  H HA   . SER A 1 5   ? 0.074   15.257  -16.396 1.00 0.00 ? 5   SER A HA   2  
ATOM 1767  H HB2  . SER A 1 5   ? 2.083   14.330  -17.716 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1768  H HB3  . SER A 1 5   ? 0.489   13.835  -18.252 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1769  H HG   . SER A 1 5   ? 1.292   14.492  -20.155 1.00 0.00 ? 5   SER A HG   2  
ATOM 1770  N N    . SER A 1 6   ? 2.193   16.466  -15.674 1.00 0.00 ? 6   SER A N    2  
ATOM 1771  C CA   . SER A 1 6   ? 3.216   17.340  -15.127 1.00 0.00 ? 6   SER A CA   2  
ATOM 1772  C C    . SER A 1 6   ? 4.150   16.545  -14.212 1.00 0.00 ? 6   SER A C    2  
ATOM 1773  O O    . SER A 1 6   ? 5.351   16.465  -14.464 1.00 0.00 ? 6   SER A O    2  
ATOM 1774  C CB   . SER A 1 6   ? 2.591   18.508  -14.361 1.00 0.00 ? 6   SER A CB   2  
ATOM 1775  O OG   . SER A 1 6   ? 3.563   19.481  -13.985 1.00 0.00 ? 6   SER A OG   2  
ATOM 1776  H H    . SER A 1 6   ? 2.001   15.648  -15.131 1.00 0.00 ? 6   SER A H    2  
ATOM 1777  H HA   . SER A 1 6   ? 3.761   17.723  -15.990 1.00 0.00 ? 6   SER A HA   2  
ATOM 1778  H HB2  . SER A 1 6   ? 1.827   18.980  -14.979 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1779  H HB3  . SER A 1 6   ? 2.092   18.131  -13.469 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1780  H HG   . SER A 1 6   ? 3.577   19.584  -12.991 1.00 0.00 ? 6   SER A HG   2  
ATOM 1781  N N    . GLY A 1 7   ? 3.562   15.977  -13.169 1.00 0.00 ? 7   GLY A N    2  
ATOM 1782  C CA   . GLY A 1 7   ? 4.327   15.191  -12.216 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1783  C C    . GLY A 1 7   ? 3.589   15.081  -10.880 1.00 0.00 ? 7   GLY A C    2  
ATOM 1784  O O    . GLY A 1 7   ? 2.365   15.192  -10.831 1.00 0.00 ? 7   GLY A O    2  
ATOM 1785  H H    . GLY A 1 7   ? 2.585   16.048  -12.972 1.00 0.00 ? 7   GLY A H    2  
ATOM 1786  H HA2  . GLY A 1 7   ? 4.505   14.195  -12.621 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1787  H HA3  . GLY A 1 7   ? 5.303   15.651  -12.060 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1788  N N    . ASP A 1 8   ? 4.366   14.864  -9.828  1.00 0.00 ? 8   ASP A N    2  
ATOM 1789  C CA   . ASP A 1 8   ? 3.802   14.738  -8.495  1.00 0.00 ? 8   ASP A CA   2  
ATOM 1790  C C    . ASP A 1 8   ? 2.893   13.508  -8.445  1.00 0.00 ? 8   ASP A C    2  
ATOM 1791  O O    . ASP A 1 8   ? 2.801   12.760  -9.417  1.00 0.00 ? 8   ASP A O    2  
ATOM 1792  C CB   . ASP A 1 8   ? 2.959   15.963  -8.135  1.00 0.00 ? 8   ASP A CB   2  
ATOM 1793  C CG   . ASP A 1 8   ? 3.675   17.307  -8.284  1.00 0.00 ? 8   ASP A CG   2  
ATOM 1794  O OD1  . ASP A 1 8   ? 4.551   17.580  -7.435  1.00 0.00 ? 8   ASP A OD1  2  
ATOM 1795  O OD2  . ASP A 1 8   ? 3.331   18.030  -9.244  1.00 0.00 ? 8   ASP A OD2  2  
ATOM 1796  H H    . ASP A 1 8   ? 5.360   14.775  -9.876  1.00 0.00 ? 8   ASP A H    2  
ATOM 1797  H HA   . ASP A 1 8   ? 4.659   14.650  -7.828  1.00 0.00 ? 8   ASP A HA   2  
ATOM 1798  H HB2  . ASP A 1 8   ? 2.069   15.971  -8.764  1.00 0.00 ? 8   ASP A HB2  2  
ATOM 1799  H HB3  . ASP A 1 8   ? 2.619   15.862  -7.104  1.00 0.00 ? 8   ASP A HB3  2  
ATOM 1800  N N    . LYS A 1 9   ? 2.244   13.337  -7.302  1.00 0.00 ? 9   LYS A N    2  
ATOM 1801  C CA   . LYS A 1 9   ? 1.346   12.211  -7.113  1.00 0.00 ? 9   LYS A CA   2  
ATOM 1802  C C    . LYS A 1 9   ? 2.118   10.907  -7.326  1.00 0.00 ? 9   LYS A C    2  
ATOM 1803  O O    . LYS A 1 9   ? 2.243   10.432  -8.454  1.00 0.00 ? 9   LYS A O    2  
ATOM 1804  C CB   . LYS A 1 9   ? 0.115   12.350  -8.011  1.00 0.00 ? 9   LYS A CB   2  
ATOM 1805  C CG   . LYS A 1 9   ? -0.625  13.659  -7.727  1.00 0.00 ? 9   LYS A CG   2  
ATOM 1806  C CD   . LYS A 1 9   ? -2.140  13.445  -7.733  1.00 0.00 ? 9   LYS A CD   2  
ATOM 1807  C CE   . LYS A 1 9   ? -2.849  14.565  -8.497  1.00 0.00 ? 9   LYS A CE   2  
ATOM 1808  N NZ   . LYS A 1 9   ? -4.240  14.719  -8.017  1.00 0.00 ? 9   LYS A NZ   2  
ATOM 1809  H H    . LYS A 1 9   ? 2.325   13.950  -6.517  1.00 0.00 ? 9   LYS A H    2  
ATOM 1810  H HA   . LYS A 1 9   ? 0.997   12.241  -6.081  1.00 0.00 ? 9   LYS A HA   2  
ATOM 1811  H HB2  . LYS A 1 9   ? 0.418   12.319  -9.057  1.00 0.00 ? 9   LYS A HB2  2  
ATOM 1812  H HB3  . LYS A 1 9   ? -0.555  11.506  -7.848  1.00 0.00 ? 9   LYS A HB3  2  
ATOM 1813  H HG2  . LYS A 1 9   ? -0.314  14.055  -6.760  1.00 0.00 ? 9   LYS A HG2  2  
ATOM 1814  H HG3  . LYS A 1 9   ? -0.356  14.403  -8.477  1.00 0.00 ? 9   LYS A HG3  2  
ATOM 1815  H HD2  . LYS A 1 9   ? -2.373  12.483  -8.191  1.00 0.00 ? 9   LYS A HD2  2  
ATOM 1816  H HD3  . LYS A 1 9   ? -2.509  13.408  -6.708  1.00 0.00 ? 9   LYS A HD3  2  
ATOM 1817  H HE2  . LYS A 1 9   ? -2.307  15.501  -8.367  1.00 0.00 ? 9   LYS A HE2  2  
ATOM 1818  H HE3  . LYS A 1 9   ? -2.849  14.342  -9.564  1.00 0.00 ? 9   LYS A HE3  2  
ATOM 1819  H HZ1  . LYS A 1 9   ? -4.875  14.466  -8.747  1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 1820  H HZ2  . LYS A 1 9   ? -4.388  14.125  -7.226  1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 1821  H HZ3  . LYS A 1 9   ? -4.398  15.671  -7.753  1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 1822  N N    . PRO A 1 10  ? 2.629   10.351  -6.195  1.00 0.00 ? 10  PRO A N    2  
ATOM 1823  C CA   . PRO A 1 10  ? 3.386   9.111   -6.247  1.00 0.00 ? 10  PRO A CA   2  
ATOM 1824  C C    . PRO A 1 10  ? 2.459   7.912   -6.459  1.00 0.00 ? 10  PRO A C    2  
ATOM 1825  O O    . PRO A 1 10  ? 2.916   6.824   -6.805  1.00 0.00 ? 10  PRO A O    2  
ATOM 1826  C CB   . PRO A 1 10  ? 4.138   9.054   -4.927  1.00 0.00 ? 10  PRO A CB   2  
ATOM 1827  C CG   . PRO A 1 10  ? 3.422   10.020  -3.997  1.00 0.00 ? 10  PRO A CG   2  
ATOM 1828  C CD   . PRO A 1 10  ? 2.502   10.885  -4.842  1.00 0.00 ? 10  PRO A CD   2  
ATOM 1829  H HA   . PRO A 1 10  ? 4.009   9.117   -7.029  1.00 0.00 ? 10  PRO A HA   2  
ATOM 1830  H HB2  . PRO A 1 10  ? 4.134   8.043   -4.519  1.00 0.00 ? 10  PRO A HB2  2  
ATOM 1831  H HB3  . PRO A 1 10  ? 5.181   9.340   -5.060  1.00 0.00 ? 10  PRO A HB3  2  
ATOM 1832  H HG2  . PRO A 1 10  ? 2.851   9.474   -3.246  1.00 0.00 ? 10  PRO A HG2  2  
ATOM 1833  H HG3  . PRO A 1 10  ? 4.143   10.639  -3.462  1.00 0.00 ? 10  PRO A HG3  2  
ATOM 1834  H HD2  . PRO A 1 10  ? 1.472   10.829  -4.490  1.00 0.00 ? 10  PRO A HD2  2  
ATOM 1835  H HD3  . PRO A 1 10  ? 2.796   11.934  -4.801  1.00 0.00 ? 10  PRO A HD3  2  
ATOM 1836  N N    . LEU A 1 11  ? 1.174   8.152   -6.244  1.00 0.00 ? 11  LEU A N    2  
ATOM 1837  C CA   . LEU A 1 11  ? 0.180   7.106   -6.407  1.00 0.00 ? 11  LEU A CA   2  
ATOM 1838  C C    . LEU A 1 11  ? -0.725  7.449   -7.592  1.00 0.00 ? 11  LEU A C    2  
ATOM 1839  O O    . LEU A 1 11  ? -1.575  6.649   -7.981  1.00 0.00 ? 11  LEU A O    2  
ATOM 1840  C CB   . LEU A 1 11  ? -0.580  6.879   -5.099  1.00 0.00 ? 11  LEU A CB   2  
ATOM 1841  C CG   . LEU A 1 11  ? 0.275   6.795   -3.833  1.00 0.00 ? 11  LEU A CG   2  
ATOM 1842  C CD1  . LEU A 1 11  ? -0.589  6.931   -2.577  1.00 0.00 ? 11  LEU A CD1  2  
ATOM 1843  C CD2  . LEU A 1 11  ? 1.109   5.513   -3.818  1.00 0.00 ? 11  LEU A CD2  2  
ATOM 1844  H H    . LEU A 1 11  ? 0.811   9.040   -5.963  1.00 0.00 ? 11  LEU A H    2  
ATOM 1845  H HA   . LEU A 1 11  ? 0.712   6.182   -6.635  1.00 0.00 ? 11  LEU A HA   2  
ATOM 1846  H HB2  . LEU A 1 11  ? -1.299  7.688   -4.974  1.00 0.00 ? 11  LEU A HB2  2  
ATOM 1847  H HB3  . LEU A 1 11  ? -1.152  5.956   -5.189  1.00 0.00 ? 11  LEU A HB3  2  
ATOM 1848  H HG   . LEU A 1 11  ? 0.973   7.633   -3.835  1.00 0.00 ? 11  LEU A HG   2  
ATOM 1849  H HD11 . LEU A 1 11  ? -1.143  6.006   -2.416  1.00 0.00 ? 11  LEU A HD11 2  
ATOM 1850  H HD12 . LEU A 1 11  ? 0.050   7.127   -1.716  1.00 0.00 ? 11  LEU A HD12 2  
ATOM 1851  H HD13 . LEU A 1 11  ? -1.289  7.757   -2.706  1.00 0.00 ? 11  LEU A HD13 2  
ATOM 1852  H HD21 . LEU A 1 11  ? 1.379   5.266   -2.791  1.00 0.00 ? 11  LEU A HD21 2  
ATOM 1853  H HD22 . LEU A 1 11  ? 0.528   4.696   -4.247  1.00 0.00 ? 11  LEU A HD22 2  
ATOM 1854  H HD23 . LEU A 1 11  ? 2.015   5.662   -4.406  1.00 0.00 ? 11  LEU A HD23 2  
ATOM 1855  N N    . SER A 1 12  ? -0.512  8.640   -8.133  1.00 0.00 ? 12  SER A N    2  
ATOM 1856  C CA   . SER A 1 12  ? -1.298  9.098   -9.266  1.00 0.00 ? 12  SER A CA   2  
ATOM 1857  C C    . SER A 1 12  ? -1.497  7.955   -10.262 1.00 0.00 ? 12  SER A C    2  
ATOM 1858  O O    . SER A 1 12  ? -0.636  7.703   -11.104 1.00 0.00 ? 12  SER A O    2  
ATOM 1859  C CB   . SER A 1 12  ? -0.630  10.291  -9.953  1.00 0.00 ? 12  SER A CB   2  
ATOM 1860  O OG   . SER A 1 12  ? -0.581  10.133  -11.368 1.00 0.00 ? 12  SER A OG   2  
ATOM 1861  H H    . SER A 1 12  ? 0.181   9.284   -7.811  1.00 0.00 ? 12  SER A H    2  
ATOM 1862  H HA   . SER A 1 12  ? -2.254  9.411   -8.846  1.00 0.00 ? 12  SER A HA   2  
ATOM 1863  H HB2  . SER A 1 12  ? -1.176  11.202  -9.708  1.00 0.00 ? 12  SER A HB2  2  
ATOM 1864  H HB3  . SER A 1 12  ? 0.382   10.412  -9.566  1.00 0.00 ? 12  SER A HB3  2  
ATOM 1865  H HG   . SER A 1 12  ? 0.367   10.168  -11.684 1.00 0.00 ? 12  SER A HG   2  
ATOM 1866  N N    . ASN A 1 13  ? -2.637  7.292   -10.134 1.00 0.00 ? 13  ASN A N    2  
ATOM 1867  C CA   . ASN A 1 13  ? -2.960  6.181   -11.013 1.00 0.00 ? 13  ASN A CA   2  
ATOM 1868  C C    . ASN A 1 13  ? -2.383  4.890   -10.430 1.00 0.00 ? 13  ASN A C    2  
ATOM 1869  O O    . ASN A 1 13  ? -1.682  4.151   -11.120 1.00 0.00 ? 13  ASN A O    2  
ATOM 1870  C CB   . ASN A 1 13  ? -2.354  6.384   -12.403 1.00 0.00 ? 13  ASN A CB   2  
ATOM 1871  C CG   . ASN A 1 13  ? -3.230  5.746   -13.483 1.00 0.00 ? 13  ASN A CG   2  
ATOM 1872  O OD1  . ASN A 1 13  ? -4.278  5.182   -13.215 1.00 0.00 ? 13  ASN A OD1  2  
ATOM 1873  N ND2  . ASN A 1 13  ? -2.743  5.864   -14.715 1.00 0.00 ? 13  ASN A ND2  2  
ATOM 1874  H H    . ASN A 1 13  ? -3.332  7.503   -9.447  1.00 0.00 ? 13  ASN A H    2  
ATOM 1875  H HA   . ASN A 1 13  ? -4.049  6.165   -11.066 1.00 0.00 ? 13  ASN A HA   2  
ATOM 1876  H HB2  . ASN A 1 13  ? -2.243  7.450   -12.604 1.00 0.00 ? 13  ASN A HB2  2  
ATOM 1877  H HB3  . ASN A 1 13  ? -1.355  5.949   -12.436 1.00 0.00 ? 13  ASN A HB3  2  
ATOM 1878  H HD21 . ASN A 1 13  ? -1.877  6.339   -14.866 1.00 0.00 ? 13  ASN A HD21 2  
ATOM 1879  H HD22 . ASN A 1 13  ? -3.244  5.479   -15.490 1.00 0.00 ? 13  ASN A HD22 2  
ATOM 1880  N N    . MET A 1 14  ? -2.698  4.658   -9.164  1.00 0.00 ? 14  MET A N    2  
ATOM 1881  C CA   . MET A 1 14  ? -2.219  3.469   -8.480  1.00 0.00 ? 14  MET A CA   2  
ATOM 1882  C C    . MET A 1 14  ? -3.150  3.087   -7.327  1.00 0.00 ? 14  MET A C    2  
ATOM 1883  O O    . MET A 1 14  ? -3.517  3.934   -6.514  1.00 0.00 ? 14  MET A O    2  
ATOM 1884  C CB   . MET A 1 14  ? -0.812  3.725   -7.936  1.00 0.00 ? 14  MET A CB   2  
ATOM 1885  C CG   . MET A 1 14  ? 0.244   3.500   -9.020  1.00 0.00 ? 14  MET A CG   2  
ATOM 1886  S SD   . MET A 1 14  ? 1.522   2.412   -8.412  1.00 0.00 ? 14  MET A SD   2  
ATOM 1887  C CE   . MET A 1 14  ? 1.751   3.088   -6.775  1.00 0.00 ? 14  MET A CE   2  
ATOM 1888  H H    . MET A 1 14  ? -3.268  5.264   -8.609  1.00 0.00 ? 14  MET A H    2  
ATOM 1889  H HA   . MET A 1 14  ? -2.217  2.680   -9.231  1.00 0.00 ? 14  MET A HA   2  
ATOM 1890  H HB2  . MET A 1 14  ? -0.743  4.746   -7.562  1.00 0.00 ? 14  MET A HB2  2  
ATOM 1891  H HB3  . MET A 1 14  ? -0.618  3.063   -7.092  1.00 0.00 ? 14  MET A HB3  2  
ATOM 1892  H HG2  . MET A 1 14  ? -0.219  3.070   -9.907  1.00 0.00 ? 14  MET A HG2  2  
ATOM 1893  H HG3  . MET A 1 14  ? 0.679   4.454   -9.318  1.00 0.00 ? 14  MET A HG3  2  
ATOM 1894  H HE1  . MET A 1 14  ? 1.334   2.402   -6.037  1.00 0.00 ? 14  MET A HE1  2  
ATOM 1895  H HE2  . MET A 1 14  ? 2.815   3.224   -6.584  1.00 0.00 ? 14  MET A HE2  2  
ATOM 1896  H HE3  . MET A 1 14  ? 1.243   4.049   -6.705  1.00 0.00 ? 14  MET A HE3  2  
ATOM 1897  N N    . LYS A 1 15  ? -3.506  1.811   -7.295  1.00 0.00 ? 15  LYS A N    2  
ATOM 1898  C CA   . LYS A 1 15  ? -4.388  1.307   -6.255  1.00 0.00 ? 15  LYS A CA   2  
ATOM 1899  C C    . LYS A 1 15  ? -3.548  0.822   -5.072  1.00 0.00 ? 15  LYS A C    2  
ATOM 1900  O O    . LYS A 1 15  ? -2.586  0.077   -5.252  1.00 0.00 ? 15  LYS A O    2  
ATOM 1901  C CB   . LYS A 1 15  ? -5.327  0.240   -6.821  1.00 0.00 ? 15  LYS A CB   2  
ATOM 1902  C CG   . LYS A 1 15  ? -6.579  0.877   -7.428  1.00 0.00 ? 15  LYS A CG   2  
ATOM 1903  C CD   . LYS A 1 15  ? -6.985  0.165   -8.720  1.00 0.00 ? 15  LYS A CD   2  
ATOM 1904  C CE   . LYS A 1 15  ? -8.488  0.301   -8.971  1.00 0.00 ? 15  LYS A CE   2  
ATOM 1905  N NZ   . LYS A 1 15  ? -8.751  1.342   -9.990  1.00 0.00 ? 15  LYS A NZ   2  
ATOM 1906  H H    . LYS A 1 15  ? -3.203  1.129   -7.960  1.00 0.00 ? 15  LYS A H    2  
ATOM 1907  H HA   . LYS A 1 15  ? -5.008  2.138   -5.922  1.00 0.00 ? 15  LYS A HA   2  
ATOM 1908  H HB2  . LYS A 1 15  ? -4.806  -0.343  -7.581  1.00 0.00 ? 15  LYS A HB2  2  
ATOM 1909  H HB3  . LYS A 1 15  ? -5.614  -0.453  -6.031  1.00 0.00 ? 15  LYS A HB3  2  
ATOM 1910  H HG2  . LYS A 1 15  ? -7.398  0.832   -6.710  1.00 0.00 ? 15  LYS A HG2  2  
ATOM 1911  H HG3  . LYS A 1 15  ? -6.392  1.931   -7.632  1.00 0.00 ? 15  LYS A HG3  2  
ATOM 1912  H HD2  . LYS A 1 15  ? -6.433  0.586   -9.560  1.00 0.00 ? 15  LYS A HD2  2  
ATOM 1913  H HD3  . LYS A 1 15  ? -6.716  -0.889  -8.658  1.00 0.00 ? 15  LYS A HD3  2  
ATOM 1914  H HE2  . LYS A 1 15  ? -8.894  -0.654  -9.305  1.00 0.00 ? 15  LYS A HE2  2  
ATOM 1915  H HE3  . LYS A 1 15  ? -8.996  0.556   -8.041  1.00 0.00 ? 15  LYS A HE3  2  
ATOM 1916  H HZ1  . LYS A 1 15  ? -8.051  2.053   -9.929  1.00 0.00 ? 15  LYS A HZ1  2  
ATOM 1917  H HZ2  . LYS A 1 15  ? -8.730  0.930   -10.901 1.00 0.00 ? 15  LYS A HZ2  2  
ATOM 1918  H HZ3  . LYS A 1 15  ? -9.652  1.746   -9.828  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM 1919  N N    . ILE A 1 16  ? -3.943  1.265   -3.887  1.00 0.00 ? 16  ILE A N    2  
ATOM 1920  C CA   . ILE A 1 16  ? -3.240  0.885   -2.674  1.00 0.00 ? 16  ILE A CA   2  
ATOM 1921  C C    . ILE A 1 16  ? -4.178  0.074   -1.777  1.00 0.00 ? 16  ILE A C    2  
ATOM 1922  O O    . ILE A 1 16  ? -5.372  0.358   -1.705  1.00 0.00 ? 16  ILE A O    2  
ATOM 1923  C CB   . ILE A 1 16  ? -2.649  2.119   -1.989  1.00 0.00 ? 16  ILE A CB   2  
ATOM 1924  C CG1  . ILE A 1 16  ? -1.700  2.866   -2.928  1.00 0.00 ? 16  ILE A CG1  2  
ATOM 1925  C CG2  . ILE A 1 16  ? -1.972  1.743   -0.669  1.00 0.00 ? 16  ILE A CG2  2  
ATOM 1926  C CD1  . ILE A 1 16  ? -2.466  3.502   -4.090  1.00 0.00 ? 16  ILE A CD1  2  
ATOM 1927  H H    . ILE A 1 16  ? -4.727  1.870   -3.749  1.00 0.00 ? 16  ILE A H    2  
ATOM 1928  H HA   . ILE A 1 16  ? -2.405  0.248   -2.966  1.00 0.00 ? 16  ILE A HA   2  
ATOM 1929  H HB   . ILE A 1 16  ? -3.466  2.800   -1.748  1.00 0.00 ? 16  ILE A HB   2  
ATOM 1930  H HG12 . ILE A 1 16  ? -1.167  3.639   -2.373  1.00 0.00 ? 16  ILE A HG12 2  
ATOM 1931  H HG13 . ILE A 1 16  ? -0.950  2.177   -3.316  1.00 0.00 ? 16  ILE A HG13 2  
ATOM 1932  H HG21 . ILE A 1 16  ? -0.972  2.177   -0.637  1.00 0.00 ? 16  ILE A HG21 2  
ATOM 1933  H HG22 . ILE A 1 16  ? -2.561  2.126   0.164   1.00 0.00 ? 16  ILE A HG22 2  
ATOM 1934  H HG23 . ILE A 1 16  ? -1.899  0.658   -0.595  1.00 0.00 ? 16  ILE A HG23 2  
ATOM 1935  H HD11 . ILE A 1 16  ? -2.294  2.924   -4.998  1.00 0.00 ? 16  ILE A HD11 2  
ATOM 1936  H HD12 . ILE A 1 16  ? -3.531  3.511   -3.861  1.00 0.00 ? 16  ILE A HD12 2  
ATOM 1937  H HD13 . ILE A 1 16  ? -2.118  4.524   -4.238  1.00 0.00 ? 16  ILE A HD13 2  
ATOM 1938  N N    . LEU A 1 17  ? -3.601  -0.919  -1.117  1.00 0.00 ? 17  LEU A N    2  
ATOM 1939  C CA   . LEU A 1 17  ? -4.371  -1.773  -0.229  1.00 0.00 ? 17  LEU A CA   2  
ATOM 1940  C C    . LEU A 1 17  ? -3.815  -1.657  1.192   1.00 0.00 ? 17  LEU A C    2  
ATOM 1941  O O    . LEU A 1 17  ? -2.632  -1.377  1.378   1.00 0.00 ? 17  LEU A O    2  
ATOM 1942  C CB   . LEU A 1 17  ? -4.404  -3.208  -0.760  1.00 0.00 ? 17  LEU A CB   2  
ATOM 1943  C CG   . LEU A 1 17  ? -5.357  -4.167  -0.043  1.00 0.00 ? 17  LEU A CG   2  
ATOM 1944  C CD1  . LEU A 1 17  ? -6.605  -4.432  -0.886  1.00 0.00 ? 17  LEU A CD1  2  
ATOM 1945  C CD2  . LEU A 1 17  ? -4.641  -5.462  0.345   1.00 0.00 ? 17  LEU A CD2  2  
ATOM 1946  H H    . LEU A 1 17  ? -2.629  -1.144  -1.182  1.00 0.00 ? 17  LEU A H    2  
ATOM 1947  H HA   . LEU A 1 17  ? -5.397  -1.405  -0.229  1.00 0.00 ? 17  LEU A HA   2  
ATOM 1948  H HB2  . LEU A 1 17  ? -4.678  -3.177  -1.815  1.00 0.00 ? 17  LEU A HB2  2  
ATOM 1949  H HB3  . LEU A 1 17  ? -3.396  -3.619  -0.704  1.00 0.00 ? 17  LEU A HB3  2  
ATOM 1950  H HG   . LEU A 1 17  ? -5.687  -3.692  0.881   1.00 0.00 ? 17  LEU A HG   2  
ATOM 1951  H HD11 . LEU A 1 17  ? -6.386  -4.227  -1.934  1.00 0.00 ? 17  LEU A HD11 2  
ATOM 1952  H HD12 . LEU A 1 17  ? -6.904  -5.474  -0.775  1.00 0.00 ? 17  LEU A HD12 2  
ATOM 1953  H HD13 . LEU A 1 17  ? -7.415  -3.784  -0.551  1.00 0.00 ? 17  LEU A HD13 2  
ATOM 1954  H HD21 . LEU A 1 17  ? -3.772  -5.604  -0.298  1.00 0.00 ? 17  LEU A HD21 2  
ATOM 1955  H HD22 . LEU A 1 17  ? -4.317  -5.401  1.384   1.00 0.00 ? 17  LEU A HD22 2  
ATOM 1956  H HD23 . LEU A 1 17  ? -5.323  -6.304  0.225   1.00 0.00 ? 17  LEU A HD23 2  
ATOM 1957  N N    . THR A 1 18  ? -4.695  -1.877  2.158   1.00 0.00 ? 18  THR A N    2  
ATOM 1958  C CA   . THR A 1 18  ? -4.307  -1.801  3.556   1.00 0.00 ? 18  THR A CA   2  
ATOM 1959  C C    . THR A 1 18  ? -4.696  -3.086  4.289   1.00 0.00 ? 18  THR A C    2  
ATOM 1960  O O    . THR A 1 18  ? -5.726  -3.688  3.989   1.00 0.00 ? 18  THR A O    2  
ATOM 1961  C CB   . THR A 1 18  ? -4.941  -0.544  4.154   1.00 0.00 ? 18  THR A CB   2  
ATOM 1962  O OG1  . THR A 1 18  ? -6.335  -0.708  3.910   1.00 0.00 ? 18  THR A OG1  2  
ATOM 1963  C CG2  . THR A 1 18  ? -4.574  0.723   3.379   1.00 0.00 ? 18  THR A CG2  2  
ATOM 1964  H H    . THR A 1 18  ? -5.655  -2.105  1.998   1.00 0.00 ? 18  THR A H    2  
ATOM 1965  H HA   . THR A 1 18  ? -3.221  -1.720  3.607   1.00 0.00 ? 18  THR A HA   2  
ATOM 1966  H HB   . THR A 1 18  ? -4.685  -0.443  5.209   1.00 0.00 ? 18  THR A HB   2  
ATOM 1967  H HG1  . THR A 1 18  ? -6.728  -1.339  4.578   1.00 0.00 ? 18  THR A HG1  2  
ATOM 1968  H HG21 . THR A 1 18  ? -3.489  0.802   3.304   1.00 0.00 ? 18  THR A HG21 2  
ATOM 1969  H HG22 . THR A 1 18  ? -5.005  0.676   2.379   1.00 0.00 ? 18  THR A HG22 2  
ATOM 1970  H HG23 . THR A 1 18  ? -4.965  1.596   3.902   1.00 0.00 ? 18  THR A HG23 2  
ATOM 1971  N N    . LEU A 1 19  ? -3.852  -3.468  5.236   1.00 0.00 ? 19  LEU A N    2  
ATOM 1972  C CA   . LEU A 1 19  ? -4.095  -4.671  6.014   1.00 0.00 ? 19  LEU A CA   2  
ATOM 1973  C C    . LEU A 1 19  ? -3.842  -4.376  7.493   1.00 0.00 ? 19  LEU A C    2  
ATOM 1974  O O    . LEU A 1 19  ? -3.096  -3.456  7.828   1.00 0.00 ? 19  LEU A O    2  
ATOM 1975  C CB   . LEU A 1 19  ? -3.269  -5.838  5.469   1.00 0.00 ? 19  LEU A CB   2  
ATOM 1976  C CG   . LEU A 1 19  ? -4.044  -6.900  4.686   1.00 0.00 ? 19  LEU A CG   2  
ATOM 1977  C CD1  . LEU A 1 19  ? -3.092  -7.807  3.903   1.00 0.00 ? 19  LEU A CD1  2  
ATOM 1978  C CD2  . LEU A 1 19  ? -4.965  -7.699  5.610   1.00 0.00 ? 19  LEU A CD2  2  
ATOM 1979  H H    . LEU A 1 19  ? -3.017  -2.973  5.473   1.00 0.00 ? 19  LEU A H    2  
ATOM 1980  H HA   . LEU A 1 19  ? -5.146  -4.934  5.889   1.00 0.00 ? 19  LEU A HA   2  
ATOM 1981  H HB2  . LEU A 1 19  ? -2.490  -5.435  4.822   1.00 0.00 ? 19  LEU A HB2  2  
ATOM 1982  H HB3  . LEU A 1 19  ? -2.769  -6.325  6.306   1.00 0.00 ? 19  LEU A HB3  2  
ATOM 1983  H HG   . LEU A 1 19  ? -4.678  -6.394  3.959   1.00 0.00 ? 19  LEU A HG   2  
ATOM 1984  H HD11 . LEU A 1 19  ? -2.863  -8.692  4.496   1.00 0.00 ? 19  LEU A HD11 2  
ATOM 1985  H HD12 . LEU A 1 19  ? -3.565  -8.108  2.968   1.00 0.00 ? 19  LEU A HD12 2  
ATOM 1986  H HD13 . LEU A 1 19  ? -2.171  -7.266  3.686   1.00 0.00 ? 19  LEU A HD13 2  
ATOM 1987  H HD21 . LEU A 1 19  ? -5.975  -7.705  5.200   1.00 0.00 ? 19  LEU A HD21 2  
ATOM 1988  H HD22 . LEU A 1 19  ? -4.600  -8.723  5.691   1.00 0.00 ? 19  LEU A HD22 2  
ATOM 1989  H HD23 . LEU A 1 19  ? -4.977  -7.238  6.598   1.00 0.00 ? 19  LEU A HD23 2  
ATOM 1990  N N    . GLY A 1 20  ? -4.476  -5.174  8.340   1.00 0.00 ? 20  GLY A N    2  
ATOM 1991  C CA   . GLY A 1 20  ? -4.328  -5.009  9.776   1.00 0.00 ? 20  GLY A CA   2  
ATOM 1992  C C    . GLY A 1 20  ? -4.656  -3.576  10.201  1.00 0.00 ? 20  GLY A C    2  
ATOM 1993  O O    . GLY A 1 20  ? -5.269  -2.826  9.444   1.00 0.00 ? 20  GLY A O    2  
ATOM 1994  H H    . GLY A 1 20  ? -5.080  -5.919  8.060   1.00 0.00 ? 20  GLY A H    2  
ATOM 1995  H HA2  . GLY A 1 20  ? -4.987  -5.706  10.295  1.00 0.00 ? 20  GLY A HA2  2  
ATOM 1996  H HA3  . GLY A 1 20  ? -3.308  -5.256  10.071  1.00 0.00 ? 20  GLY A HA3  2  
ATOM 1997  N N    . LYS A 1 21  ? -4.231  -3.240  11.410  1.00 0.00 ? 21  LYS A N    2  
ATOM 1998  C CA   . LYS A 1 21  ? -4.472  -1.910  11.944  1.00 0.00 ? 21  LYS A CA   2  
ATOM 1999  C C    . LYS A 1 21  ? -3.230  -1.044  11.723  1.00 0.00 ? 21  LYS A C    2  
ATOM 2000  O O    . LYS A 1 21  ? -2.105  -1.535  11.801  1.00 0.00 ? 21  LYS A O    2  
ATOM 2001  C CB   . LYS A 1 21  ? -4.912  -1.992  13.408  1.00 0.00 ? 21  LYS A CB   2  
ATOM 2002  C CG   . LYS A 1 21  ? -5.203  -0.600  13.971  1.00 0.00 ? 21  LYS A CG   2  
ATOM 2003  C CD   . LYS A 1 21  ? -6.686  -0.251  13.830  1.00 0.00 ? 21  LYS A CD   2  
ATOM 2004  C CE   . LYS A 1 21  ? -6.907  0.756   12.700  1.00 0.00 ? 21  LYS A CE   2  
ATOM 2005  N NZ   . LYS A 1 21  ? -7.339  0.063   11.465  1.00 0.00 ? 21  LYS A NZ   2  
ATOM 2006  H H    . LYS A 1 21  ? -3.733  -3.857  12.019  1.00 0.00 ? 21  LYS A H    2  
ATOM 2007  H HA   . LYS A 1 21  ? -5.300  -1.477  11.383  1.00 0.00 ? 21  LYS A HA   2  
ATOM 2008  H HB2  . LYS A 1 21  ? -5.802  -2.616  13.490  1.00 0.00 ? 21  LYS A HB2  2  
ATOM 2009  H HB3  . LYS A 1 21  ? -4.132  -2.472  13.999  1.00 0.00 ? 21  LYS A HB3  2  
ATOM 2010  H HG2  . LYS A 1 21  ? -4.915  -0.562  15.022  1.00 0.00 ? 21  LYS A HG2  2  
ATOM 2011  H HG3  . LYS A 1 21  ? -4.600  0.142   13.448  1.00 0.00 ? 21  LYS A HG3  2  
ATOM 2012  H HD2  . LYS A 1 21  ? -7.259  -1.157  13.632  1.00 0.00 ? 21  LYS A HD2  2  
ATOM 2013  H HD3  . LYS A 1 21  ? -7.057  0.162   14.768  1.00 0.00 ? 21  LYS A HD3  2  
ATOM 2014  H HE2  . LYS A 1 21  ? -7.660  1.486   12.997  1.00 0.00 ? 21  LYS A HE2  2  
ATOM 2015  H HE3  . LYS A 1 21  ? -5.986  1.307   12.511  1.00 0.00 ? 21  LYS A HE3  2  
ATOM 2016  H HZ1  . LYS A 1 21  ? -6.692  0.260   10.729  1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 2017  H HZ2  . LYS A 1 21  ? -7.368  -0.923  11.629  1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 2018  H HZ3  . LYS A 1 21  ? -8.250  0.384   11.204  1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 2019  N N    . LEU A 1 22  ? -3.476  0.229   11.452  1.00 0.00 ? 22  LEU A N    2  
ATOM 2020  C CA   . LEU A 1 22  ? -2.392  1.168   11.219  1.00 0.00 ? 22  LEU A CA   2  
ATOM 2021  C C    . LEU A 1 22  ? -2.490  2.313   12.229  1.00 0.00 ? 22  LEU A C    2  
ATOM 2022  O O    . LEU A 1 22  ? -3.444  2.385   13.002  1.00 0.00 ? 22  LEU A O    2  
ATOM 2023  C CB   . LEU A 1 22  ? -2.389  1.632   9.761   1.00 0.00 ? 22  LEU A CB   2  
ATOM 2024  C CG   . LEU A 1 22  ? -2.293  0.528   8.706   1.00 0.00 ? 22  LEU A CG   2  
ATOM 2025  C CD1  . LEU A 1 22  ? -2.876  0.994   7.371   1.00 0.00 ? 22  LEU A CD1  2  
ATOM 2026  C CD2  . LEU A 1 22  ? -0.853  0.032   8.561   1.00 0.00 ? 22  LEU A CD2  2  
ATOM 2027  H H    . LEU A 1 22  ? -4.395  0.620   11.391  1.00 0.00 ? 22  LEU A H    2  
ATOM 2028  H HA   . LEU A 1 22  ? -1.457  0.635   11.390  1.00 0.00 ? 22  LEU A HA   2  
ATOM 2029  H HB2  . LEU A 1 22  ? -3.301  2.202   9.580   1.00 0.00 ? 22  LEU A HB2  2  
ATOM 2030  H HB3  . LEU A 1 22  ? -1.553  2.316   9.620   1.00 0.00 ? 22  LEU A HB3  2  
ATOM 2031  H HG   . LEU A 1 22  ? -2.893  -0.318  9.041   1.00 0.00 ? 22  LEU A HG   2  
ATOM 2032  H HD11 . LEU A 1 22  ? -2.689  2.061   7.245   1.00 0.00 ? 22  LEU A HD11 2  
ATOM 2033  H HD12 . LEU A 1 22  ? -2.404  0.444   6.557   1.00 0.00 ? 22  LEU A HD12 2  
ATOM 2034  H HD13 . LEU A 1 22  ? -3.950  0.810   7.359   1.00 0.00 ? 22  LEU A HD13 2  
ATOM 2035  H HD21 . LEU A 1 22  ? -0.735  -0.463  7.598   1.00 0.00 ? 22  LEU A HD21 2  
ATOM 2036  H HD22 . LEU A 1 22  ? -0.170  0.879   8.621   1.00 0.00 ? 22  LEU A HD22 2  
ATOM 2037  H HD23 . LEU A 1 22  ? -0.629  -0.673  9.362   1.00 0.00 ? 22  LEU A HD23 2  
ATOM 2038  N N    . SER A 1 23  ? -1.489  3.181   12.190  1.00 0.00 ? 23  SER A N    2  
ATOM 2039  C CA   . SER A 1 23  ? -1.450  4.319   13.092  1.00 0.00 ? 23  SER A CA   2  
ATOM 2040  C C    . SER A 1 23  ? -2.617  5.262   12.796  1.00 0.00 ? 23  SER A C    2  
ATOM 2041  O O    . SER A 1 23  ? -3.280  5.743   13.714  1.00 0.00 ? 23  SER A O    2  
ATOM 2042  C CB   . SER A 1 23  ? -0.120  5.068   12.976  1.00 0.00 ? 23  SER A CB   2  
ATOM 2043  O OG   . SER A 1 23  ? -0.150  6.317   13.662  1.00 0.00 ? 23  SER A OG   2  
ATOM 2044  H H    . SER A 1 23  ? -0.716  3.115   11.558  1.00 0.00 ? 23  SER A H    2  
ATOM 2045  H HA   . SER A 1 23  ? -1.543  3.898   14.093  1.00 0.00 ? 23  SER A HA   2  
ATOM 2046  H HB2  . SER A 1 23  ? 0.680   4.450   13.383  1.00 0.00 ? 23  SER A HB2  2  
ATOM 2047  H HB3  . SER A 1 23  ? 0.110   5.237   11.925  1.00 0.00 ? 23  SER A HB3  2  
ATOM 2048  H HG   . SER A 1 23  ? 0.651   6.400   14.255  1.00 0.00 ? 23  SER A HG   2  
ATOM 2049  N N    . ARG A 1 24  ? -2.834  5.498   11.510  1.00 0.00 ? 24  ARG A N    2  
ATOM 2050  C CA   . ARG A 1 24  ? -3.910  6.375   11.081  1.00 0.00 ? 24  ARG A CA   2  
ATOM 2051  C C    . ARG A 1 24  ? -5.190  5.570   10.847  1.00 0.00 ? 24  ARG A C    2  
ATOM 2052  O O    . ARG A 1 24  ? -5.197  4.350   11.004  1.00 0.00 ? 24  ARG A O    2  
ATOM 2053  C CB   . ARG A 1 24  ? -3.539  7.115   9.794   1.00 0.00 ? 24  ARG A CB   2  
ATOM 2054  C CG   . ARG A 1 24  ? -2.454  8.162   10.057  1.00 0.00 ? 24  ARG A CG   2  
ATOM 2055  C CD   . ARG A 1 24  ? -2.774  9.475   9.340   1.00 0.00 ? 24  ARG A CD   2  
ATOM 2056  N NE   . ARG A 1 24  ? -3.095  10.527  10.330  1.00 0.00 ? 24  ARG A NE   2  
ATOM 2057  C CZ   . ARG A 1 24  ? -2.183  11.144  11.093  1.00 0.00 ? 24  ARG A CZ   2  
ATOM 2058  N NH1  . ARG A 1 24  ? -0.887  10.817  10.985  1.00 0.00 ? 24  ARG A NH1  2  
ATOM 2059  N NH2  . ARG A 1 24  ? -2.565  12.087  11.965  1.00 0.00 ? 24  ARG A NH2  2  
ATOM 2060  H H    . ARG A 1 24  ? -2.290  5.103   10.769  1.00 0.00 ? 24  ARG A H    2  
ATOM 2061  H HA   . ARG A 1 24  ? -4.037  7.083   11.901  1.00 0.00 ? 24  ARG A HA   2  
ATOM 2062  H HB2  . ARG A 1 24  ? -3.188  6.401   9.049   1.00 0.00 ? 24  ARG A HB2  2  
ATOM 2063  H HB3  . ARG A 1 24  ? -4.423  7.599   9.380   1.00 0.00 ? 24  ARG A HB3  2  
ATOM 2064  H HG2  . ARG A 1 24  ? -2.368  8.340   11.129  1.00 0.00 ? 24  ARG A HG2  2  
ATOM 2065  H HG3  . ARG A 1 24  ? -1.489  7.784   9.719   1.00 0.00 ? 24  ARG A HG3  2  
ATOM 2066  H HD2  . ARG A 1 24  ? -1.924  9.783   8.732   1.00 0.00 ? 24  ARG A HD2  2  
ATOM 2067  H HD3  . ARG A 1 24  ? -3.616  9.333   8.662   1.00 0.00 ? 24  ARG A HD3  2  
ATOM 2068  H HE   . ARG A 1 24  ? -4.053  10.795  10.436  1.00 0.00 ? 24  ARG A HE   2  
ATOM 2069  H HH11 . ARG A 1 24  ? -0.602  10.113  10.335  1.00 0.00 ? 24  ARG A HH11 2  
ATOM 2070  H HH12 . ARG A 1 24  ? -0.207  11.277  11.555  1.00 0.00 ? 24  ARG A HH12 2  
ATOM 2071  H HH21 . ARG A 1 24  ? -3.532  12.331  12.045  1.00 0.00 ? 24  ARG A HH21 2  
ATOM 2072  H HH22 . ARG A 1 24  ? -1.884  12.547  12.534  1.00 0.00 ? 24  ARG A HH22 2  
ATOM 2073  N N    . ASN A 1 25  ? -6.242  6.285   10.475  1.00 0.00 ? 25  ASN A N    2  
ATOM 2074  C CA   . ASN A 1 25  ? -7.524  5.651   10.217  1.00 0.00 ? 25  ASN A CA   2  
ATOM 2075  C C    . ASN A 1 25  ? -7.654  5.364   8.720   1.00 0.00 ? 25  ASN A C    2  
ATOM 2076  O O    . ASN A 1 25  ? -7.199  6.150   7.892   1.00 0.00 ? 25  ASN A O    2  
ATOM 2077  C CB   . ASN A 1 25  ? -8.681  6.565   10.626  1.00 0.00 ? 25  ASN A CB   2  
ATOM 2078  C CG   . ASN A 1 25  ? -8.795  6.658   12.149  1.00 0.00 ? 25  ASN A CG   2  
ATOM 2079  O OD1  . ASN A 1 25  ? -8.089  5.996   12.892  1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2080  N ND2  . ASN A 1 25  ? -9.722  7.514   12.570  1.00 0.00 ? 25  ASN A ND2  2  
ATOM 2081  H H    . ASN A 1 25  ? -6.227  7.277   10.349  1.00 0.00 ? 25  ASN A H    2  
ATOM 2082  H HA   . ASN A 1 25  ? -7.520  4.742   10.818  1.00 0.00 ? 25  ASN A HA   2  
ATOM 2083  H HB2  . ASN A 1 25  ? -8.529  7.560   10.208  1.00 0.00 ? 25  ASN A HB2  2  
ATOM 2084  H HB3  . ASN A 1 25  ? -9.614  6.184   10.210  1.00 0.00 ? 25  ASN A HB3  2  
ATOM 2085  H HD21 . ASN A 1 25  ? -10.267 8.027   11.908  1.00 0.00 ? 25  ASN A HD21 2  
ATOM 2086  H HD22 . ASN A 1 25  ? -9.872  7.645   13.550  1.00 0.00 ? 25  ASN A HD22 2  
ATOM 2087  N N    . LYS A 1 26  ? -8.278  4.234   8.419   1.00 0.00 ? 26  LYS A N    2  
ATOM 2088  C CA   . LYS A 1 26  ? -8.474  3.833   7.037   1.00 0.00 ? 26  LYS A CA   2  
ATOM 2089  C C    . LYS A 1 26  ? -8.852  5.059   6.203   1.00 0.00 ? 26  LYS A C    2  
ATOM 2090  O O    . LYS A 1 26  ? -8.360  5.232   5.089   1.00 0.00 ? 26  LYS A O    2  
ATOM 2091  C CB   . LYS A 1 26  ? -9.490  2.693   6.949   1.00 0.00 ? 26  LYS A CB   2  
ATOM 2092  C CG   . LYS A 1 26  ? -9.642  2.204   5.507   1.00 0.00 ? 26  LYS A CG   2  
ATOM 2093  C CD   . LYS A 1 26  ? -10.169 0.768   5.468   1.00 0.00 ? 26  LYS A CD   2  
ATOM 2094  C CE   . LYS A 1 26  ? -10.458 0.329   4.031   1.00 0.00 ? 26  LYS A CE   2  
ATOM 2095  N NZ   . LYS A 1 26  ? -11.683 -0.500  3.978   1.00 0.00 ? 26  LYS A NZ   2  
ATOM 2096  H H    . LYS A 1 26  ? -8.646  3.600   9.100   1.00 0.00 ? 26  LYS A H    2  
ATOM 2097  H HA   . LYS A 1 26  ? -7.523  3.446   6.671   1.00 0.00 ? 26  LYS A HA   2  
ATOM 2098  H HB2  . LYS A 1 26  ? -9.172  1.867   7.585   1.00 0.00 ? 26  LYS A HB2  2  
ATOM 2099  H HB3  . LYS A 1 26  ? -10.456 3.031   7.325   1.00 0.00 ? 26  LYS A HB3  2  
ATOM 2100  H HG2  . LYS A 1 26  ? -10.324 2.860   4.966   1.00 0.00 ? 26  LYS A HG2  2  
ATOM 2101  H HG3  . LYS A 1 26  ? -8.679  2.255   4.998   1.00 0.00 ? 26  LYS A HG3  2  
ATOM 2102  H HD2  . LYS A 1 26  ? -9.438  0.096   5.917   1.00 0.00 ? 26  LYS A HD2  2  
ATOM 2103  H HD3  . LYS A 1 26  ? -11.079 0.694   6.064   1.00 0.00 ? 26  LYS A HD3  2  
ATOM 2104  H HE2  . LYS A 1 26  ? -10.578 1.205   3.394   1.00 0.00 ? 26  LYS A HE2  2  
ATOM 2105  H HE3  . LYS A 1 26  ? -9.612  -0.236  3.640   1.00 0.00 ? 26  LYS A HE3  2  
ATOM 2106  H HZ1  . LYS A 1 26  ? -12.196 -0.392  4.830   1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 2107  H HZ2  . LYS A 1 26  ? -12.250 -0.209  3.208   1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 2108  H HZ3  . LYS A 1 26  ? -11.430 -1.461  3.862   1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 2109  N N    . ASP A 1 27  ? -9.722  5.879   6.775   1.00 0.00 ? 27  ASP A N    2  
ATOM 2110  C CA   . ASP A 1 27  ? -10.171 7.084   6.098   1.00 0.00 ? 27  ASP A CA   2  
ATOM 2111  C C    . ASP A 1 27  ? -8.967  7.985   5.818   1.00 0.00 ? 27  ASP A C    2  
ATOM 2112  O O    . ASP A 1 27  ? -8.632  8.237   4.662   1.00 0.00 ? 27  ASP A O    2  
ATOM 2113  C CB   . ASP A 1 27  ? -11.156 7.868   6.967   1.00 0.00 ? 27  ASP A CB   2  
ATOM 2114  C CG   . ASP A 1 27  ? -11.871 9.019   6.256   1.00 0.00 ? 27  ASP A CG   2  
ATOM 2115  O OD1  . ASP A 1 27  ? -11.894 8.987   5.006   1.00 0.00 ? 27  ASP A OD1  2  
ATOM 2116  O OD2  . ASP A 1 27  ? -12.379 9.904   6.978   1.00 0.00 ? 27  ASP A OD2  2  
ATOM 2117  H H    . ASP A 1 27  ? -10.117 5.731   7.682   1.00 0.00 ? 27  ASP A H    2  
ATOM 2118  H HA   . ASP A 1 27  ? -10.654 6.736   5.185   1.00 0.00 ? 27  ASP A HA   2  
ATOM 2119  H HB2  . ASP A 1 27  ? -11.906 7.178   7.353   1.00 0.00 ? 27  ASP A HB2  2  
ATOM 2120  H HB3  . ASP A 1 27  ? -10.620 8.269   7.827   1.00 0.00 ? 27  ASP A HB3  2  
ATOM 2121  N N    . GLU A 1 28  ? -8.349  8.446   6.896   1.00 0.00 ? 28  GLU A N    2  
ATOM 2122  C CA   . GLU A 1 28  ? -7.190  9.314   6.780   1.00 0.00 ? 28  GLU A CA   2  
ATOM 2123  C C    . GLU A 1 28  ? -6.278  8.834   5.649   1.00 0.00 ? 28  GLU A C    2  
ATOM 2124  O O    . GLU A 1 28  ? -5.773  9.640   4.869   1.00 0.00 ? 28  GLU A O    2  
ATOM 2125  C CB   . GLU A 1 28  ? -6.427  9.389   8.104   1.00 0.00 ? 28  GLU A CB   2  
ATOM 2126  C CG   . GLU A 1 28  ? -7.234  10.147  9.160   1.00 0.00 ? 28  GLU A CG   2  
ATOM 2127  C CD   . GLU A 1 28  ? -6.349  11.132  9.924   1.00 0.00 ? 28  GLU A CD   2  
ATOM 2128  O OE1  . GLU A 1 28  ? -5.937  12.131  9.296   1.00 0.00 ? 28  GLU A OE1  2  
ATOM 2129  O OE2  . GLU A 1 28  ? -6.103  10.865  11.120  1.00 0.00 ? 28  GLU A OE2  2  
ATOM 2130  H H    . GLU A 1 28  ? -8.628  8.236   7.833   1.00 0.00 ? 28  GLU A H    2  
ATOM 2131  H HA   . GLU A 1 28  ? -7.588  10.299  6.541   1.00 0.00 ? 28  GLU A HA   2  
ATOM 2132  H HB2  . GLU A 1 28  ? -6.210  8.382   8.461   1.00 0.00 ? 28  GLU A HB2  2  
ATOM 2133  H HB3  . GLU A 1 28  ? -5.469  9.885   7.949   1.00 0.00 ? 28  GLU A HB3  2  
ATOM 2134  H HG2  . GLU A 1 28  ? -8.053  10.684  8.680   1.00 0.00 ? 28  GLU A HG2  2  
ATOM 2135  H HG3  . GLU A 1 28  ? -7.683  9.439   9.857   1.00 0.00 ? 28  GLU A HG3  2  
ATOM 2136  N N    . VAL A 1 29  ? -6.096  7.522   5.595   1.00 0.00 ? 29  VAL A N    2  
ATOM 2137  C CA   . VAL A 1 29  ? -5.254  6.925   4.572   1.00 0.00 ? 29  VAL A CA   2  
ATOM 2138  C C    . VAL A 1 29  ? -5.987  6.961   3.229   1.00 0.00 ? 29  VAL A C    2  
ATOM 2139  O O    . VAL A 1 29  ? -5.454  7.461   2.240   1.00 0.00 ? 29  VAL A O    2  
ATOM 2140  C CB   . VAL A 1 29  ? -4.843  5.513   4.991   1.00 0.00 ? 29  VAL A CB   2  
ATOM 2141  C CG1  . VAL A 1 29  ? -4.094  4.802   3.862   1.00 0.00 ? 29  VAL A CG1  2  
ATOM 2142  C CG2  . VAL A 1 29  ? -4.006  5.542   6.271   1.00 0.00 ? 29  VAL A CG2  2  
ATOM 2143  H H    . VAL A 1 29  ? -6.511  6.873   6.232   1.00 0.00 ? 29  VAL A H    2  
ATOM 2144  H HA   . VAL A 1 29  ? -4.351  7.531   4.494   1.00 0.00 ? 29  VAL A HA   2  
ATOM 2145  H HB   . VAL A 1 29  ? -5.752  4.947   5.198   1.00 0.00 ? 29  VAL A HB   2  
ATOM 2146  H HG11 . VAL A 1 29  ? -3.129  4.452   4.231   1.00 0.00 ? 29  VAL A HG11 2  
ATOM 2147  H HG12 . VAL A 1 29  ? -4.681  3.951   3.516   1.00 0.00 ? 29  VAL A HG12 2  
ATOM 2148  H HG13 . VAL A 1 29  ? -3.937  5.496   3.037   1.00 0.00 ? 29  VAL A HG13 2  
ATOM 2149  H HG21 . VAL A 1 29  ? -3.722  4.526   6.543   1.00 0.00 ? 29  VAL A HG21 2  
ATOM 2150  H HG22 . VAL A 1 29  ? -3.109  6.138   6.105   1.00 0.00 ? 29  VAL A HG22 2  
ATOM 2151  H HG23 . VAL A 1 29  ? -4.591  5.984   7.078   1.00 0.00 ? 29  VAL A HG23 2  
ATOM 2152  N N    . LYS A 1 30  ? -7.198  6.424   3.238   1.00 0.00 ? 30  LYS A N    2  
ATOM 2153  C CA   . LYS A 1 30  ? -8.010  6.388   2.034   1.00 0.00 ? 30  LYS A CA   2  
ATOM 2154  C C    . LYS A 1 30  ? -7.949  7.751   1.342   1.00 0.00 ? 30  LYS A C    2  
ATOM 2155  O O    . LYS A 1 30  ? -7.851  7.827   0.118   1.00 0.00 ? 30  LYS A O    2  
ATOM 2156  C CB   . LYS A 1 30  ? -9.432  5.927   2.359   1.00 0.00 ? 30  LYS A CB   2  
ATOM 2157  C CG   . LYS A 1 30  ? -10.286 5.845   1.092   1.00 0.00 ? 30  LYS A CG   2  
ATOM 2158  C CD   . LYS A 1 30  ? -11.774 5.764   1.438   1.00 0.00 ? 30  LYS A CD   2  
ATOM 2159  C CE   . LYS A 1 30  ? -12.523 4.885   0.434   1.00 0.00 ? 30  LYS A CE   2  
ATOM 2160  N NZ   . LYS A 1 30  ? -13.943 4.746   0.825   1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2161  H H    . LYS A 1 30  ? -7.625  6.019   4.047   1.00 0.00 ? 30  LYS A H    2  
ATOM 2162  H HA   . LYS A 1 30  ? -7.574  5.643   1.368   1.00 0.00 ? 30  LYS A HA   2  
ATOM 2163  H HB2  . LYS A 1 30  ? -9.400  4.951   2.844   1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2164  H HB3  . LYS A 1 30  ? -9.890  6.619   3.066   1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2165  H HG2  . LYS A 1 30  ? -10.101 6.719   0.468   1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2166  H HG3  . LYS A 1 30  ? -9.995  4.970   0.510   1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2167  H HD2  . LYS A 1 30  ? -11.896 5.359   2.443   1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2168  H HD3  . LYS A 1 30  ? -12.205 6.765   1.442   1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2169  H HE2  . LYS A 1 30  ? -12.455 5.321   -0.562  1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2170  H HE3  . LYS A 1 30  ? -12.056 3.901   0.384   1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2171  H HZ1  . LYS A 1 30  ? -14.070 3.888   1.323   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2172  H HZ2  . LYS A 1 30  ? -14.204 5.513   1.411   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2173  H HZ3  . LYS A 1 30  ? -14.516 4.743   0.005   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2174  N N    . ALA A 1 31  ? -8.010  8.795   2.156   1.00 0.00 ? 31  ALA A N    2  
ATOM 2175  C CA   . ALA A 1 31  ? -7.962  10.152  1.637   1.00 0.00 ? 31  ALA A CA   2  
ATOM 2176  C C    . ALA A 1 31  ? -6.547  10.455  1.141   1.00 0.00 ? 31  ALA A C    2  
ATOM 2177  O O    . ALA A 1 31  ? -6.372  11.089  0.101   1.00 0.00 ? 31  ALA A O    2  
ATOM 2178  C CB   . ALA A 1 31  ? -8.421  11.129  2.721   1.00 0.00 ? 31  ALA A CB   2  
ATOM 2179  H H    . ALA A 1 31  ? -8.089  8.726   3.150   1.00 0.00 ? 31  ALA A H    2  
ATOM 2180  H HA   . ALA A 1 31  ? -8.654  10.210  0.797   1.00 0.00 ? 31  ALA A HA   2  
ATOM 2181  H HB1  . ALA A 1 31  ? -7.553  11.619  3.160   1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2182  H HB2  . ALA A 1 31  ? -9.077  11.879  2.280   1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2183  H HB3  . ALA A 1 31  ? -8.962  10.585  3.496   1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2184  N N    . MET A 1 32  ? -5.573  9.987   1.907   1.00 0.00 ? 32  MET A N    2  
ATOM 2185  C CA   . MET A 1 32  ? -4.179  10.200  1.558   1.00 0.00 ? 32  MET A CA   2  
ATOM 2186  C C    . MET A 1 32  ? -3.841  9.537   0.221   1.00 0.00 ? 32  MET A C    2  
ATOM 2187  O O    . MET A 1 32  ? -3.313  10.186  -0.681  1.00 0.00 ? 32  MET A O    2  
ATOM 2188  C CB   . MET A 1 32  ? -3.283  9.621   2.656   1.00 0.00 ? 32  MET A CB   2  
ATOM 2189  C CG   . MET A 1 32  ? -2.457  10.720  3.326   1.00 0.00 ? 32  MET A CG   2  
ATOM 2190  S SD   . MET A 1 32  ? -1.680  10.086  4.802   1.00 0.00 ? 32  MET A SD   2  
ATOM 2191  C CE   . MET A 1 32  ? 0.014   10.549  4.485   1.00 0.00 ? 32  MET A CE   2  
ATOM 2192  H H    . MET A 1 32  ? -5.723  9.472   2.751   1.00 0.00 ? 32  MET A H    2  
ATOM 2193  H HA   . MET A 1 32  ? -4.059  11.280  1.477   1.00 0.00 ? 32  MET A HA   2  
ATOM 2194  H HB2  . MET A 1 32  ? -3.897  9.116   3.402   1.00 0.00 ? 32  MET A HB2  2  
ATOM 2195  H HB3  . MET A 1 32  ? -2.618  8.870   2.229   1.00 0.00 ? 32  MET A HB3  2  
ATOM 2196  H HG2  . MET A 1 32  ? -1.699  11.089  2.636   1.00 0.00 ? 32  MET A HG2  2  
ATOM 2197  H HG3  . MET A 1 32  ? -3.097  11.566  3.577   1.00 0.00 ? 32  MET A HG3  2  
ATOM 2198  H HE1  . MET A 1 32  ? 0.683   9.848   4.984   1.00 0.00 ? 32  MET A HE1  2  
ATOM 2199  H HE2  . MET A 1 32  ? 0.202   10.528  3.411   1.00 0.00 ? 32  MET A HE2  2  
ATOM 2200  H HE3  . MET A 1 32  ? 0.193   11.555  4.865   1.00 0.00 ? 32  MET A HE3  2  
ATOM 2201  N N    . ILE A 1 33  ? -4.159  8.254   0.136   1.00 0.00 ? 33  ILE A N    2  
ATOM 2202  C CA   . ILE A 1 33  ? -3.896  7.497   -1.076  1.00 0.00 ? 33  ILE A CA   2  
ATOM 2203  C C    . ILE A 1 33  ? -4.608  8.165   -2.254  1.00 0.00 ? 33  ILE A C    2  
ATOM 2204  O O    . ILE A 1 33  ? -4.168  8.047   -3.397  1.00 0.00 ? 33  ILE A O    2  
ATOM 2205  C CB   . ILE A 1 33  ? -4.275  6.027   -0.882  1.00 0.00 ? 33  ILE A CB   2  
ATOM 2206  C CG1  . ILE A 1 33  ? -3.527  5.421   0.307   1.00 0.00 ? 33  ILE A CG1  2  
ATOM 2207  C CG2  . ILE A 1 33  ? -4.050  5.229   -2.168  1.00 0.00 ? 33  ILE A CG2  2  
ATOM 2208  C CD1  . ILE A 1 33  ? -4.293  4.229   0.887   1.00 0.00 ? 33  ILE A CD1  2  
ATOM 2209  H H    . ILE A 1 33  ? -4.589  7.734   0.874   1.00 0.00 ? 33  ILE A H    2  
ATOM 2210  H HA   . ILE A 1 33  ? -2.822  7.532   -1.256  1.00 0.00 ? 33  ILE A HA   2  
ATOM 2211  H HB   . ILE A 1 33  ? -5.339  5.976   -0.653  1.00 0.00 ? 33  ILE A HB   2  
ATOM 2212  H HG12 . ILE A 1 33  ? -2.534  5.101   -0.007  1.00 0.00 ? 33  ILE A HG12 2  
ATOM 2213  H HG13 . ILE A 1 33  ? -3.389  6.178   1.079   1.00 0.00 ? 33  ILE A HG13 2  
ATOM 2214  H HG21 . ILE A 1 33  ? -4.106  5.899   -3.026  1.00 0.00 ? 33  ILE A HG21 2  
ATOM 2215  H HG22 . ILE A 1 33  ? -3.067  4.759   -2.137  1.00 0.00 ? 33  ILE A HG22 2  
ATOM 2216  H HG23 . ILE A 1 33  ? -4.817  4.460   -2.257  1.00 0.00 ? 33  ILE A HG23 2  
ATOM 2217  H HD11 . ILE A 1 33  ? -4.823  3.714   0.085   1.00 0.00 ? 33  ILE A HD11 2  
ATOM 2218  H HD12 . ILE A 1 33  ? -3.592  3.542   1.360   1.00 0.00 ? 33  ILE A HD12 2  
ATOM 2219  H HD13 . ILE A 1 33  ? -5.010  4.584   1.627   1.00 0.00 ? 33  ILE A HD13 2  
ATOM 2220  N N    . GLU A 1 34  ? -5.695  8.851   -1.936  1.00 0.00 ? 34  GLU A N    2  
ATOM 2221  C CA   . GLU A 1 34  ? -6.472  9.538   -2.954  1.00 0.00 ? 34  GLU A CA   2  
ATOM 2222  C C    . GLU A 1 34  ? -5.852  10.902  -3.264  1.00 0.00 ? 34  GLU A C    2  
ATOM 2223  O O    . GLU A 1 34  ? -5.593  11.221  -4.423  1.00 0.00 ? 34  GLU A O    2  
ATOM 2224  C CB   . GLU A 1 34  ? -7.933  9.684   -2.523  1.00 0.00 ? 34  GLU A CB   2  
ATOM 2225  C CG   . GLU A 1 34  ? -8.720  8.404   -2.810  1.00 0.00 ? 34  GLU A CG   2  
ATOM 2226  C CD   . GLU A 1 34  ? -10.214 8.701   -2.957  1.00 0.00 ? 34  GLU A CD   2  
ATOM 2227  O OE1  . GLU A 1 34  ? -10.619 9.027   -4.093  1.00 0.00 ? 34  GLU A OE1  2  
ATOM 2228  O OE2  . GLU A 1 34  ? -10.917 8.595   -1.928  1.00 0.00 ? 34  GLU A OE2  2  
ATOM 2229  H H    . GLU A 1 34  ? -6.046  8.941   -1.004  1.00 0.00 ? 34  GLU A H    2  
ATOM 2230  H HA   . GLU A 1 34  ? -6.422  8.899   -3.836  1.00 0.00 ? 34  GLU A HA   2  
ATOM 2231  H HB2  . GLU A 1 34  ? -7.980  9.914   -1.459  1.00 0.00 ? 34  GLU A HB2  2  
ATOM 2232  H HB3  . GLU A 1 34  ? -8.389  10.522  -3.050  1.00 0.00 ? 34  GLU A HB3  2  
ATOM 2233  H HG2  . GLU A 1 34  ? -8.347  7.940   -3.723  1.00 0.00 ? 34  GLU A HG2  2  
ATOM 2234  H HG3  . GLU A 1 34  ? -8.565  7.689   -2.003  1.00 0.00 ? 34  GLU A HG3  2  
ATOM 2235  N N    . LYS A 1 35  ? -5.632  11.670  -2.207  1.00 0.00 ? 35  LYS A N    2  
ATOM 2236  C CA   . LYS A 1 35  ? -5.047  12.992  -2.352  1.00 0.00 ? 35  LYS A CA   2  
ATOM 2237  C C    . LYS A 1 35  ? -3.740  12.883  -3.140  1.00 0.00 ? 35  LYS A C    2  
ATOM 2238  O O    . LYS A 1 35  ? -3.504  13.655  -4.069  1.00 0.00 ? 35  LYS A O    2  
ATOM 2239  C CB   . LYS A 1 35  ? -4.888  13.661  -0.985  1.00 0.00 ? 35  LYS A CB   2  
ATOM 2240  C CG   . LYS A 1 35  ? -3.756  14.690  -1.007  1.00 0.00 ? 35  LYS A CG   2  
ATOM 2241  C CD   . LYS A 1 35  ? -2.463  14.095  -0.445  1.00 0.00 ? 35  LYS A CD   2  
ATOM 2242  C CE   . LYS A 1 35  ? -2.427  14.203  1.080   1.00 0.00 ? 35  LYS A CE   2  
ATOM 2243  N NZ   . LYS A 1 35  ? -1.329  13.378  1.632   1.00 0.00 ? 35  LYS A NZ   2  
ATOM 2244  H H    . LYS A 1 35  ? -5.845  11.403  -1.268  1.00 0.00 ? 35  LYS A H    2  
ATOM 2245  H HA   . LYS A 1 35  ? -5.747  13.598  -2.928  1.00 0.00 ? 35  LYS A HA   2  
ATOM 2246  H HB2  . LYS A 1 35  ? -5.822  14.147  -0.703  1.00 0.00 ? 35  LYS A HB2  2  
ATOM 2247  H HB3  . LYS A 1 35  ? -4.682  12.904  -0.228  1.00 0.00 ? 35  LYS A HB3  2  
ATOM 2248  H HG2  . LYS A 1 35  ? -3.590  15.032  -2.028  1.00 0.00 ? 35  LYS A HG2  2  
ATOM 2249  H HG3  . LYS A 1 35  ? -4.043  15.563  -0.421  1.00 0.00 ? 35  LYS A HG3  2  
ATOM 2250  H HD2  . LYS A 1 35  ? -2.382  13.049  -0.741  1.00 0.00 ? 35  LYS A HD2  2  
ATOM 2251  H HD3  . LYS A 1 35  ? -1.605  14.614  -0.871  1.00 0.00 ? 35  LYS A HD3  2  
ATOM 2252  H HE2  . LYS A 1 35  ? -2.289  15.244  1.373   1.00 0.00 ? 35  LYS A HE2  2  
ATOM 2253  H HE3  . LYS A 1 35  ? -3.380  13.878  1.497   1.00 0.00 ? 35  LYS A HE3  2  
ATOM 2254  H HZ1  . LYS A 1 35  ? -1.500  13.202  2.602   1.00 0.00 ? 35  LYS A HZ1  2  
ATOM 2255  H HZ2  . LYS A 1 35  ? -1.285  12.509  1.139   1.00 0.00 ? 35  LYS A HZ2  2  
ATOM 2256  H HZ3  . LYS A 1 35  ? -0.462  13.864  1.530   1.00 0.00 ? 35  LYS A HZ3  2  
ATOM 2257  N N    . LEU A 1 36  ? -2.923  11.920  -2.739  1.00 0.00 ? 36  LEU A N    2  
ATOM 2258  C CA   . LEU A 1 36  ? -1.646  11.700  -3.395  1.00 0.00 ? 36  LEU A CA   2  
ATOM 2259  C C    . LEU A 1 36  ? -1.875  11.503  -4.895  1.00 0.00 ? 36  LEU A C    2  
ATOM 2260  O O    . LEU A 1 36  ? -1.116  12.015  -5.716  1.00 0.00 ? 36  LEU A O    2  
ATOM 2261  C CB   . LEU A 1 36  ? -0.893  10.546  -2.731  1.00 0.00 ? 36  LEU A CB   2  
ATOM 2262  C CG   . LEU A 1 36  ? -0.225  10.863  -1.392  1.00 0.00 ? 36  LEU A CG   2  
ATOM 2263  C CD1  . LEU A 1 36  ? -0.068  9.599   -0.544  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2264  C CD2  . LEU A 1 36  ? 1.109   11.582  -1.601  1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2265  H H    . LEU A 1 36  ? -3.122  11.297  -1.982  1.00 0.00 ? 36  LEU A H    2  
ATOM 2266  H HA   . LEU A 1 36  ? -1.047  12.600  -3.253  1.00 0.00 ? 36  LEU A HA   2  
ATOM 2267  H HB2  . LEU A 1 36  ? -1.591  9.722   -2.580  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2268  H HB3  . LEU A 1 36  ? -0.128  10.192  -3.421  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2269  H HG   . LEU A 1 36  ? -0.874  11.543  -0.839  1.00 0.00 ? 36  LEU A HG   2  
ATOM 2270  H HD11 . LEU A 1 36  ? -0.711  8.813   -0.941  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 2271  H HD12 . LEU A 1 36  ? 0.970   9.269   -0.572  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 2272  H HD13 . LEU A 1 36  ? -0.353  9.815   0.486   1.00 0.00 ? 36  LEU A HD13 2  
ATOM 2273  H HD21 . LEU A 1 36  ? 1.240   12.339  -0.828  1.00 0.00 ? 36  LEU A HD21 2  
ATOM 2274  H HD22 . LEU A 1 36  ? 1.924   10.860  -1.544  1.00 0.00 ? 36  LEU A HD22 2  
ATOM 2275  H HD23 . LEU A 1 36  ? 1.115   12.059  -2.581  1.00 0.00 ? 36  LEU A HD23 2  
ATOM 2276  N N    . GLY A 1 37  ? -2.926  10.758  -5.207  1.00 0.00 ? 37  GLY A N    2  
ATOM 2277  C CA   . GLY A 1 37  ? -3.264  10.486  -6.594  1.00 0.00 ? 37  GLY A CA   2  
ATOM 2278  C C    . GLY A 1 37  ? -3.644  9.017   -6.788  1.00 0.00 ? 37  GLY A C    2  
ATOM 2279  O O    . GLY A 1 37  ? -4.126  8.631   -7.852  1.00 0.00 ? 37  GLY A O    2  
ATOM 2280  H H    . GLY A 1 37  ? -3.538  10.344  -4.534  1.00 0.00 ? 37  GLY A H    2  
ATOM 2281  H HA2  . GLY A 1 37  ? -4.094  11.123  -6.901  1.00 0.00 ? 37  GLY A HA2  2  
ATOM 2282  H HA3  . GLY A 1 37  ? -2.418  10.734  -7.234  1.00 0.00 ? 37  GLY A HA3  2  
ATOM 2283  N N    . GLY A 1 38  ? -3.413  8.236   -5.742  1.00 0.00 ? 38  GLY A N    2  
ATOM 2284  C CA   . GLY A 1 38  ? -3.725  6.817   -5.784  1.00 0.00 ? 38  GLY A CA   2  
ATOM 2285  C C    . GLY A 1 38  ? -5.205  6.572   -5.484  1.00 0.00 ? 38  GLY A C    2  
ATOM 2286  O O    . GLY A 1 38  ? -6.033  7.465   -5.656  1.00 0.00 ? 38  GLY A O    2  
ATOM 2287  H H    . GLY A 1 38  ? -3.021  8.557   -4.880  1.00 0.00 ? 38  GLY A H    2  
ATOM 2288  H HA2  . GLY A 1 38  ? -3.478  6.416   -6.767  1.00 0.00 ? 38  GLY A HA2  2  
ATOM 2289  H HA3  . GLY A 1 38  ? -3.110  6.285   -5.059  1.00 0.00 ? 38  GLY A HA3  2  
ATOM 2290  N N    . LYS A 1 39  ? -5.492  5.358   -5.040  1.00 0.00 ? 39  LYS A N    2  
ATOM 2291  C CA   . LYS A 1 39  ? -6.858  4.984   -4.714  1.00 0.00 ? 39  LYS A CA   2  
ATOM 2292  C C    . LYS A 1 39  ? -6.844  3.724   -3.847  1.00 0.00 ? 39  LYS A C    2  
ATOM 2293  O O    . LYS A 1 39  ? -6.238  2.719   -4.215  1.00 0.00 ? 39  LYS A O    2  
ATOM 2294  C CB   . LYS A 1 39  ? -7.694  4.844   -5.988  1.00 0.00 ? 39  LYS A CB   2  
ATOM 2295  C CG   . LYS A 1 39  ? -8.504  6.114   -6.255  1.00 0.00 ? 39  LYS A CG   2  
ATOM 2296  C CD   . LYS A 1 39  ? -10.006 5.830   -6.192  1.00 0.00 ? 39  LYS A CD   2  
ATOM 2297  C CE   . LYS A 1 39  ? -10.638 5.909   -7.583  1.00 0.00 ? 39  LYS A CE   2  
ATOM 2298  N NZ   . LYS A 1 39  ? -11.675 6.964   -7.622  1.00 0.00 ? 39  LYS A NZ   2  
ATOM 2299  H H    . LYS A 1 39  ? -4.813  4.637   -4.903  1.00 0.00 ? 39  LYS A H    2  
ATOM 2300  H HA   . LYS A 1 39  ? -7.290  5.798   -4.133  1.00 0.00 ? 39  LYS A HA   2  
ATOM 2301  H HB2  . LYS A 1 39  ? -7.040  4.641   -6.836  1.00 0.00 ? 39  LYS A HB2  2  
ATOM 2302  H HB3  . LYS A 1 39  ? -8.367  3.992   -5.894  1.00 0.00 ? 39  LYS A HB3  2  
ATOM 2303  H HG2  . LYS A 1 39  ? -8.244  6.876   -5.520  1.00 0.00 ? 39  LYS A HG2  2  
ATOM 2304  H HG3  . LYS A 1 39  ? -8.247  6.515   -7.235  1.00 0.00 ? 39  LYS A HG3  2  
ATOM 2305  H HD2  . LYS A 1 39  ? -10.175 4.840   -5.768  1.00 0.00 ? 39  LYS A HD2  2  
ATOM 2306  H HD3  . LYS A 1 39  ? -10.489 6.547   -5.528  1.00 0.00 ? 39  LYS A HD3  2  
ATOM 2307  H HE2  . LYS A 1 39  ? -9.869  6.119   -8.327  1.00 0.00 ? 39  LYS A HE2  2  
ATOM 2308  H HE3  . LYS A 1 39  ? -11.079 4.947   -7.844  1.00 0.00 ? 39  LYS A HE3  2  
ATOM 2309  H HZ1  . LYS A 1 39  ? -12.252 6.835   -8.428  1.00 0.00 ? 39  LYS A HZ1  2  
ATOM 2310  H HZ2  . LYS A 1 39  ? -12.237 6.910   -6.797  1.00 0.00 ? 39  LYS A HZ2  2  
ATOM 2311  H HZ3  . LYS A 1 39  ? -11.236 7.862   -7.667  1.00 0.00 ? 39  LYS A HZ3  2  
ATOM 2312  N N    . LEU A 1 40  ? -7.519  3.818   -2.711  1.00 0.00 ? 40  LEU A N    2  
ATOM 2313  C CA   . LEU A 1 40  ? -7.592  2.699   -1.787  1.00 0.00 ? 40  LEU A CA   2  
ATOM 2314  C C    . LEU A 1 40  ? -8.545  1.641   -2.349  1.00 0.00 ? 40  LEU A C    2  
ATOM 2315  O O    . LEU A 1 40  ? -9.615  1.972   -2.858  1.00 0.00 ? 40  LEU A O    2  
ATOM 2316  C CB   . LEU A 1 40  ? -7.969  3.183   -0.386  1.00 0.00 ? 40  LEU A CB   2  
ATOM 2317  C CG   . LEU A 1 40  ? -7.754  2.181   0.750   1.00 0.00 ? 40  LEU A CG   2  
ATOM 2318  C CD1  . LEU A 1 40  ? -6.792  2.741   1.800   1.00 0.00 ? 40  LEU A CD1  2  
ATOM 2319  C CD2  . LEU A 1 40  ? -9.088  1.755   1.366   1.00 0.00 ? 40  LEU A CD2  2  
ATOM 2320  H H    . LEU A 1 40  ? -8.010  4.640   -2.418  1.00 0.00 ? 40  LEU A H    2  
ATOM 2321  H HA   . LEU A 1 40  ? -6.595  2.265   -1.721  1.00 0.00 ? 40  LEU A HA   2  
ATOM 2322  H HB2  . LEU A 1 40  ? -7.392  4.081   -0.166  1.00 0.00 ? 40  LEU A HB2  2  
ATOM 2323  H HB3  . LEU A 1 40  ? -9.020  3.473   -0.394  1.00 0.00 ? 40  LEU A HB3  2  
ATOM 2324  H HG   . LEU A 1 40  ? -7.291  1.287   0.334   1.00 0.00 ? 40  LEU A HG   2  
ATOM 2325  H HD11 . LEU A 1 40  ? -6.869  3.828   1.820   1.00 0.00 ? 40  LEU A HD11 2  
ATOM 2326  H HD12 . LEU A 1 40  ? -7.050  2.340   2.780   1.00 0.00 ? 40  LEU A HD12 2  
ATOM 2327  H HD13 . LEU A 1 40  ? -5.771  2.454   1.547   1.00 0.00 ? 40  LEU A HD13 2  
ATOM 2328  H HD21 . LEU A 1 40  ? -9.778  1.466   0.573   1.00 0.00 ? 40  LEU A HD21 2  
ATOM 2329  H HD22 . LEU A 1 40  ? -8.927  0.909   2.033   1.00 0.00 ? 40  LEU A HD22 2  
ATOM 2330  H HD23 . LEU A 1 40  ? -9.511  2.587   1.929   1.00 0.00 ? 40  LEU A HD23 2  
ATOM 2331  N N    . THR A 1 41  ? -8.122  0.391   -2.238  1.00 0.00 ? 41  THR A N    2  
ATOM 2332  C CA   . THR A 1 41  ? -8.924  -0.717  -2.729  1.00 0.00 ? 41  THR A CA   2  
ATOM 2333  C C    . THR A 1 41  ? -9.056  -1.797  -1.653  1.00 0.00 ? 41  THR A C    2  
ATOM 2334  O O    . THR A 1 41  ? -8.364  -1.754  -0.637  1.00 0.00 ? 41  THR A O    2  
ATOM 2335  C CB   . THR A 1 41  ? -8.288  -1.224  -4.024  1.00 0.00 ? 41  THR A CB   2  
ATOM 2336  O OG1  . THR A 1 41  ? -9.122  -2.309  -4.420  1.00 0.00 ? 41  THR A OG1  2  
ATOM 2337  C CG2  . THR A 1 41  ? -6.921  -1.871  -3.792  1.00 0.00 ? 41  THR A CG2  2  
ATOM 2338  H H    . THR A 1 41  ? -7.250  0.130   -1.823  1.00 0.00 ? 41  THR A H    2  
ATOM 2339  H HA   . THR A 1 41  ? -9.928  -0.348  -2.937  1.00 0.00 ? 41  THR A HA   2  
ATOM 2340  H HB   . THR A 1 41  ? -8.220  -0.426  -4.763  1.00 0.00 ? 41  THR A HB   2  
ATOM 2341  H HG1  . THR A 1 41  ? -9.537  -2.115  -5.309  1.00 0.00 ? 41  THR A HG1  2  
ATOM 2342  H HG21 . THR A 1 41  ? -7.044  -2.779  -3.202  1.00 0.00 ? 41  THR A HG21 2  
ATOM 2343  H HG22 . THR A 1 41  ? -6.468  -2.120  -4.752  1.00 0.00 ? 41  THR A HG22 2  
ATOM 2344  H HG23 . THR A 1 41  ? -6.276  -1.174  -3.255  1.00 0.00 ? 41  THR A HG23 2  
ATOM 2345  N N    . GLY A 1 42  ? -9.949  -2.741  -1.914  1.00 0.00 ? 42  GLY A N    2  
ATOM 2346  C CA   . GLY A 1 42  ? -10.180 -3.830  -0.981  1.00 0.00 ? 42  GLY A CA   2  
ATOM 2347  C C    . GLY A 1 42  ? -9.520  -5.121  -1.471  1.00 0.00 ? 42  GLY A C    2  
ATOM 2348  O O    . GLY A 1 42  ? -9.093  -5.948  -0.666  1.00 0.00 ? 42  GLY A O    2  
ATOM 2349  H H    . GLY A 1 42  ? -10.508 -2.768  -2.743  1.00 0.00 ? 42  GLY A H    2  
ATOM 2350  H HA2  . GLY A 1 42  ? -9.785  -3.564  -0.001  1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2351  H HA3  . GLY A 1 42  ? -11.252 -3.989  -0.860  1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2352  N N    . THR A 1 43  ? -9.457  -5.253  -2.787  1.00 0.00 ? 43  THR A N    2  
ATOM 2353  C CA   . THR A 1 43  ? -8.856  -6.428  -3.394  1.00 0.00 ? 43  THR A CA   2  
ATOM 2354  C C    . THR A 1 43  ? -7.351  -6.223  -3.579  1.00 0.00 ? 43  THR A C    2  
ATOM 2355  O O    . THR A 1 43  ? -6.904  -5.116  -3.875  1.00 0.00 ? 43  THR A O    2  
ATOM 2356  C CB   . THR A 1 43  ? -9.595  -6.716  -4.702  1.00 0.00 ? 43  THR A CB   2  
ATOM 2357  O OG1  . THR A 1 43  ? -10.968 -6.761  -4.322  1.00 0.00 ? 43  THR A OG1  2  
ATOM 2358  C CG2  . THR A 1 43  ? -9.311  -8.121  -5.238  1.00 0.00 ? 43  THR A CG2  2  
ATOM 2359  H H    . THR A 1 43  ? -9.806  -4.575  -3.435  1.00 0.00 ? 43  THR A H    2  
ATOM 2360  H HA   . THR A 1 43  ? -8.982  -7.269  -2.712  1.00 0.00 ? 43  THR A HA   2  
ATOM 2361  H HB   . THR A 1 43  ? -9.367  -5.959  -5.452  1.00 0.00 ? 43  THR A HB   2  
ATOM 2362  H HG1  . THR A 1 43  ? -11.455 -5.976  -4.706  1.00 0.00 ? 43  THR A HG1  2  
ATOM 2363  H HG21 . THR A 1 43  ? -9.980  -8.333  -6.072  1.00 0.00 ? 43  THR A HG21 2  
ATOM 2364  H HG22 . THR A 1 43  ? -8.277  -8.178  -5.578  1.00 0.00 ? 43  THR A HG22 2  
ATOM 2365  H HG23 . THR A 1 43  ? -9.475  -8.852  -4.446  1.00 0.00 ? 43  THR A HG23 2  
ATOM 2366  N N    . ALA A 1 44  ? -6.611  -7.307  -3.397  1.00 0.00 ? 44  ALA A N    2  
ATOM 2367  C CA   . ALA A 1 44  ? -5.166  -7.259  -3.540  1.00 0.00 ? 44  ALA A CA   2  
ATOM 2368  C C    . ALA A 1 44  ? -4.800  -7.398  -5.019  1.00 0.00 ? 44  ALA A C    2  
ATOM 2369  O O    . ALA A 1 44  ? -4.083  -6.561  -5.566  1.00 0.00 ? 44  ALA A O    2  
ATOM 2370  C CB   . ALA A 1 44  ? -4.531  -8.352  -2.677  1.00 0.00 ? 44  ALA A CB   2  
ATOM 2371  H H    . ALA A 1 44  ? -6.983  -8.203  -3.156  1.00 0.00 ? 44  ALA A H    2  
ATOM 2372  H HA   . ALA A 1 44  ? -4.829  -6.287  -3.180  1.00 0.00 ? 44  ALA A HA   2  
ATOM 2373  H HB1  . ALA A 1 44  ? -5.061  -9.291  -2.832  1.00 0.00 ? 44  ALA A HB1  2  
ATOM 2374  H HB2  . ALA A 1 44  ? -3.485  -8.474  -2.958  1.00 0.00 ? 44  ALA A HB2  2  
ATOM 2375  H HB3  . ALA A 1 44  ? -4.595  -8.068  -1.627  1.00 0.00 ? 44  ALA A HB3  2  
ATOM 2376  N N    . ASN A 1 45  ? -5.308  -8.461  -5.625  1.00 0.00 ? 45  ASN A N    2  
ATOM 2377  C CA   . ASN A 1 45  ? -5.043  -8.720  -7.030  1.00 0.00 ? 45  ASN A CA   2  
ATOM 2378  C C    . ASN A 1 45  ? -5.320  -7.451  -7.838  1.00 0.00 ? 45  ASN A C    2  
ATOM 2379  O O    . ASN A 1 45  ? -4.774  -7.272  -8.926  1.00 0.00 ? 45  ASN A O    2  
ATOM 2380  C CB   . ASN A 1 45  ? -5.950  -9.829  -7.566  1.00 0.00 ? 45  ASN A CB   2  
ATOM 2381  C CG   . ASN A 1 45  ? -5.124  -10.991 -8.121  1.00 0.00 ? 45  ASN A CG   2  
ATOM 2382  O OD1  . ASN A 1 45  ? -4.033  -11.287 -7.662  1.00 0.00 ? 45  ASN A OD1  2  
ATOM 2383  N ND2  . ASN A 1 45  ? -5.704  -11.632 -9.133  1.00 0.00 ? 45  ASN A ND2  2  
ATOM 2384  H H    . ASN A 1 45  ? -5.890  -9.137  -5.173  1.00 0.00 ? 45  ASN A H    2  
ATOM 2385  H HA   . ASN A 1 45  ? -3.997  -9.022  -7.073  1.00 0.00 ? 45  ASN A HA   2  
ATOM 2386  H HB2  . ASN A 1 45  ? -6.600  -10.189 -6.769  1.00 0.00 ? 45  ASN A HB2  2  
ATOM 2387  H HB3  . ASN A 1 45  ? -6.595  -9.430  -8.348  1.00 0.00 ? 45  ASN A HB3  2  
ATOM 2388  H HD21 . ASN A 1 45  ? -6.601  -11.338 -9.462  1.00 0.00 ? 45  ASN A HD21 2  
ATOM 2389  H HD22 . ASN A 1 45  ? -5.242  -12.407 -9.564  1.00 0.00 ? 45  ASN A HD22 2  
ATOM 2390  N N    . LYS A 1 46  ? -6.169  -6.603  -7.277  1.00 0.00 ? 46  LYS A N    2  
ATOM 2391  C CA   . LYS A 1 46  ? -6.526  -5.356  -7.932  1.00 0.00 ? 46  LYS A CA   2  
ATOM 2392  C C    . LYS A 1 46  ? -5.919  -4.185  -7.156  1.00 0.00 ? 46  LYS A C    2  
ATOM 2393  O O    . LYS A 1 46  ? -6.601  -3.200  -6.879  1.00 0.00 ? 46  LYS A O    2  
ATOM 2394  C CB   . LYS A 1 46  ? -8.042  -5.257  -8.108  1.00 0.00 ? 46  LYS A CB   2  
ATOM 2395  C CG   . LYS A 1 46  ? -8.574  -6.422  -8.946  1.00 0.00 ? 46  LYS A CG   2  
ATOM 2396  C CD   . LYS A 1 46  ? -9.329  -5.913  -10.175 1.00 0.00 ? 46  LYS A CD   2  
ATOM 2397  C CE   . LYS A 1 46  ? -9.922  -7.076  -10.974 1.00 0.00 ? 46  LYS A CE   2  
ATOM 2398  N NZ   . LYS A 1 46  ? -9.066  -7.393  -12.139 1.00 0.00 ? 46  LYS A NZ   2  
ATOM 2399  H H    . LYS A 1 46  ? -6.610  -6.756  -6.392  1.00 0.00 ? 46  LYS A H    2  
ATOM 2400  H HA   . LYS A 1 46  ? -6.086  -5.374  -8.929  1.00 0.00 ? 46  LYS A HA   2  
ATOM 2401  H HB2  . LYS A 1 46  ? -8.526  -5.256  -7.131  1.00 0.00 ? 46  LYS A HB2  2  
ATOM 2402  H HB3  . LYS A 1 46  ? -8.296  -4.313  -8.590  1.00 0.00 ? 46  LYS A HB3  2  
ATOM 2403  H HG2  . LYS A 1 46  ? -7.745  -7.056  -9.260  1.00 0.00 ? 46  LYS A HG2  2  
ATOM 2404  H HG3  . LYS A 1 46  ? -9.235  -7.040  -8.338  1.00 0.00 ? 46  LYS A HG3  2  
ATOM 2405  H HD2  . LYS A 1 46  ? -10.126 -5.238  -9.863  1.00 0.00 ? 46  LYS A HD2  2  
ATOM 2406  H HD3  . LYS A 1 46  ? -8.654  -5.338  -10.809 1.00 0.00 ? 46  LYS A HD3  2  
ATOM 2407  H HE2  . LYS A 1 46  ? -10.017 -7.953  -10.335 1.00 0.00 ? 46  LYS A HE2  2  
ATOM 2408  H HE3  . LYS A 1 46  ? -10.925 -6.818  -11.313 1.00 0.00 ? 46  LYS A HE3  2  
ATOM 2409  H HZ1  . LYS A 1 46  ? -8.434  -8.130  -11.898 1.00 0.00 ? 46  LYS A HZ1  2  
ATOM 2410  H HZ2  . LYS A 1 46  ? -9.639  -7.684  -12.905 1.00 0.00 ? 46  LYS A HZ2  2  
ATOM 2411  H HZ3  . LYS A 1 46  ? -8.545  -6.581  -12.402 1.00 0.00 ? 46  LYS A HZ3  2  
ATOM 2412  N N    . ALA A 1 47  ? -4.644  -4.332  -6.826  1.00 0.00 ? 47  ALA A N    2  
ATOM 2413  C CA   . ALA A 1 47  ? -3.939  -3.299  -6.087  1.00 0.00 ? 47  ALA A CA   2  
ATOM 2414  C C    . ALA A 1 47  ? -2.503  -3.197  -6.606  1.00 0.00 ? 47  ALA A C    2  
ATOM 2415  O O    . ALA A 1 47  ? -2.003  -4.123  -7.244  1.00 0.00 ? 47  ALA A O    2  
ATOM 2416  C CB   . ALA A 1 47  ? -3.997  -3.612  -4.591  1.00 0.00 ? 47  ALA A CB   2  
ATOM 2417  H H    . ALA A 1 47  ? -4.097  -5.137  -7.055  1.00 0.00 ? 47  ALA A H    2  
ATOM 2418  H HA   . ALA A 1 47  ? -4.450  -2.354  -6.268  1.00 0.00 ? 47  ALA A HA   2  
ATOM 2419  H HB1  . ALA A 1 47  ? -4.930  -4.127  -4.363  1.00 0.00 ? 47  ALA A HB1  2  
ATOM 2420  H HB2  . ALA A 1 47  ? -3.155  -4.249  -4.320  1.00 0.00 ? 47  ALA A HB2  2  
ATOM 2421  H HB3  . ALA A 1 47  ? -3.946  -2.683  -4.023  1.00 0.00 ? 47  ALA A HB3  2  
ATOM 2422  N N    . SER A 1 48  ? -1.881  -2.065  -6.314  1.00 0.00 ? 48  SER A N    2  
ATOM 2423  C CA   . SER A 1 48  ? -0.512  -1.830  -6.743  1.00 0.00 ? 48  SER A CA   2  
ATOM 2424  C C    . SER A 1 48  ? 0.413   -1.759  -5.527  1.00 0.00 ? 48  SER A C    2  
ATOM 2425  O O    . SER A 1 48  ? 1.598   -2.074  -5.624  1.00 0.00 ? 48  SER A O    2  
ATOM 2426  C CB   . SER A 1 48  ? -0.406  -0.545  -7.567  1.00 0.00 ? 48  SER A CB   2  
ATOM 2427  O OG   . SER A 1 48  ? -1.180  -0.612  -8.762  1.00 0.00 ? 48  SER A OG   2  
ATOM 2428  H H    . SER A 1 48  ? -2.295  -1.317  -5.795  1.00 0.00 ? 48  SER A H    2  
ATOM 2429  H HA   . SER A 1 48  ? -0.256  -2.685  -7.369  1.00 0.00 ? 48  SER A HA   2  
ATOM 2430  H HB2  . SER A 1 48  ? -0.741  0.300   -6.965  1.00 0.00 ? 48  SER A HB2  2  
ATOM 2431  H HB3  . SER A 1 48  ? 0.638   -0.362  -7.820  1.00 0.00 ? 48  SER A HB3  2  
ATOM 2432  H HG   . SER A 1 48  ? -1.357  0.310   -9.106  1.00 0.00 ? 48  SER A HG   2  
ATOM 2433  N N    . LEU A 1 49  ? -0.164  -1.342  -4.409  1.00 0.00 ? 49  LEU A N    2  
ATOM 2434  C CA   . LEU A 1 49  ? 0.595   -1.226  -3.175  1.00 0.00 ? 49  LEU A CA   2  
ATOM 2435  C C    . LEU A 1 49  ? -0.194  -1.872  -2.034  1.00 0.00 ? 49  LEU A C    2  
ATOM 2436  O O    . LEU A 1 49  ? -1.392  -2.118  -2.164  1.00 0.00 ? 49  LEU A O    2  
ATOM 2437  C CB   . LEU A 1 49  ? 0.970   0.234   -2.912  1.00 0.00 ? 49  LEU A CB   2  
ATOM 2438  C CG   . LEU A 1 49  ? 2.340   0.470   -2.273  1.00 0.00 ? 49  LEU A CG   2  
ATOM 2439  C CD1  . LEU A 1 49  ? 3.417   -0.371  -2.960  1.00 0.00 ? 49  LEU A CD1  2  
ATOM 2440  C CD2  . LEU A 1 49  ? 2.692   1.959   -2.267  1.00 0.00 ? 49  LEU A CD2  2  
ATOM 2441  H H    . LEU A 1 49  ? -1.128  -1.088  -4.338  1.00 0.00 ? 49  LEU A H    2  
ATOM 2442  H HA   . LEU A 1 49  ? 1.524   -1.778  -3.309  1.00 0.00 ? 49  LEU A HA   2  
ATOM 2443  H HB2  . LEU A 1 49  ? 0.935   0.773   -3.859  1.00 0.00 ? 49  LEU A HB2  2  
ATOM 2444  H HB3  . LEU A 1 49  ? 0.209   0.674   -2.267  1.00 0.00 ? 49  LEU A HB3  2  
ATOM 2445  H HG   . LEU A 1 49  ? 2.292   0.146   -1.234  1.00 0.00 ? 49  LEU A HG   2  
ATOM 2446  H HD11 . LEU A 1 49  ? 3.183   -0.466  -4.020  1.00 0.00 ? 49  LEU A HD11 2  
ATOM 2447  H HD12 . LEU A 1 49  ? 4.386   0.115   -2.844  1.00 0.00 ? 49  LEU A HD12 2  
ATOM 2448  H HD13 . LEU A 1 49  ? 3.451   -1.361  -2.505  1.00 0.00 ? 49  LEU A HD13 2  
ATOM 2449  H HD21 . LEU A 1 49  ? 2.341   2.420   -3.190  1.00 0.00 ? 49  LEU A HD21 2  
ATOM 2450  H HD22 . LEU A 1 49  ? 2.214   2.442   -1.414  1.00 0.00 ? 49  LEU A HD22 2  
ATOM 2451  H HD23 . LEU A 1 49  ? 3.774   2.076   -2.191  1.00 0.00 ? 49  LEU A HD23 2  
ATOM 2452  N N    . CYS A 1 50  ? 0.511   -2.129  -0.941  1.00 0.00 ? 50  CYS A N    2  
ATOM 2453  C CA   . CYS A 1 50  ? -0.108  -2.743  0.221   1.00 0.00 ? 50  CYS A CA   2  
ATOM 2454  C C    . CYS A 1 50  ? 0.519   -2.133  1.477   1.00 0.00 ? 50  CYS A C    2  
ATOM 2455  O O    . CYS A 1 50  ? 1.728   -2.232  1.682   1.00 0.00 ? 50  CYS A O    2  
ATOM 2456  C CB   . CYS A 1 50  ? 0.030   -4.266  0.198   1.00 0.00 ? 50  CYS A CB   2  
ATOM 2457  S SG   . CYS A 1 50  ? -1.236  -5.025  1.280   1.00 0.00 ? 50  CYS A SG   2  
ATOM 2458  H H    . CYS A 1 50  ? 1.486   -1.926  -0.844  1.00 0.00 ? 50  CYS A H    2  
ATOM 2459  H HA   . CYS A 1 50  ? -1.171  -2.511  0.168   1.00 0.00 ? 50  CYS A HA   2  
ATOM 2460  H HB2  . CYS A 1 50  ? -0.084  -4.634  -0.822  1.00 0.00 ? 50  CYS A HB2  2  
ATOM 2461  H HB3  . CYS A 1 50  ? 1.026   -4.555  0.531   1.00 0.00 ? 50  CYS A HB3  2  
ATOM 2462  H HG   . CYS A 1 50  ? -0.799  -4.477  2.410   1.00 0.00 ? 50  CYS A HG   2  
ATOM 2463  N N    . ILE A 1 51  ? -0.331  -1.515  2.284   1.00 0.00 ? 51  ILE A N    2  
ATOM 2464  C CA   . ILE A 1 51  ? 0.124   -0.890  3.513   1.00 0.00 ? 51  ILE A CA   2  
ATOM 2465  C C    . ILE A 1 51  ? -0.342  -1.724  4.708   1.00 0.00 ? 51  ILE A C    2  
ATOM 2466  O O    . ILE A 1 51  ? -1.472  -1.574  5.171   1.00 0.00 ? 51  ILE A O    2  
ATOM 2467  C CB   . ILE A 1 51  ? -0.327  0.571   3.570   1.00 0.00 ? 51  ILE A CB   2  
ATOM 2468  C CG1  . ILE A 1 51  ? 0.290   1.380   2.427   1.00 0.00 ? 51  ILE A CG1  2  
ATOM 2469  C CG2  . ILE A 1 51  ? -0.022  1.187   4.937   1.00 0.00 ? 51  ILE A CG2  2  
ATOM 2470  C CD1  . ILE A 1 51  ? -0.025  2.870   2.577   1.00 0.00 ? 51  ILE A CD1  2  
ATOM 2471  H H    . ILE A 1 51  ? -1.313  -1.439  2.109   1.00 0.00 ? 51  ILE A H    2  
ATOM 2472  H HA   . ILE A 1 51  ? 1.214   -0.890  3.496   1.00 0.00 ? 51  ILE A HA   2  
ATOM 2473  H HB   . ILE A 1 51  ? -1.408  0.600   3.438   1.00 0.00 ? 51  ILE A HB   2  
ATOM 2474  H HG12 . ILE A 1 51  ? 1.370   1.233   2.414   1.00 0.00 ? 51  ILE A HG12 2  
ATOM 2475  H HG13 . ILE A 1 51  ? -0.093  1.018   1.473   1.00 0.00 ? 51  ILE A HG13 2  
ATOM 2476  H HG21 . ILE A 1 51  ? 0.469   0.446   5.568   1.00 0.00 ? 51  ILE A HG21 2  
ATOM 2477  H HG22 . ILE A 1 51  ? 0.635   2.047   4.810   1.00 0.00 ? 51  ILE A HG22 2  
ATOM 2478  H HG23 . ILE A 1 51  ? -0.952  1.506   5.408   1.00 0.00 ? 51  ILE A HG23 2  
ATOM 2479  H HD11 . ILE A 1 51  ? -1.009  2.989   3.030   1.00 0.00 ? 51  ILE A HD11 2  
ATOM 2480  H HD12 . ILE A 1 51  ? 0.726   3.338   3.213   1.00 0.00 ? 51  ILE A HD12 2  
ATOM 2481  H HD13 . ILE A 1 51  ? -0.017  3.344   1.596   1.00 0.00 ? 51  ILE A HD13 2  
ATOM 2482  N N    . SER A 1 52  ? 0.552   -2.584  5.173   1.00 0.00 ? 52  SER A N    2  
ATOM 2483  C CA   . SER A 1 52  ? 0.246   -3.442  6.305   1.00 0.00 ? 52  SER A CA   2  
ATOM 2484  C C    . SER A 1 52  ? 1.307   -3.270  7.394   1.00 0.00 ? 52  SER A C    2  
ATOM 2485  O O    . SER A 1 52  ? 2.166   -2.395  7.296   1.00 0.00 ? 52  SER A O    2  
ATOM 2486  C CB   . SER A 1 52  ? 0.159   -4.909  5.877   1.00 0.00 ? 52  SER A CB   2  
ATOM 2487  O OG   . SER A 1 52  ? -0.660  -5.674  6.757   1.00 0.00 ? 52  SER A OG   2  
ATOM 2488  H H    . SER A 1 52  ? 1.469   -2.700  4.791   1.00 0.00 ? 52  SER A H    2  
ATOM 2489  H HA   . SER A 1 52  ? -0.728  -3.111  6.664   1.00 0.00 ? 52  SER A HA   2  
ATOM 2490  H HB2  . SER A 1 52  ? -0.243  -4.968  4.865   1.00 0.00 ? 52  SER A HB2  2  
ATOM 2491  H HB3  . SER A 1 52  ? 1.160   -5.338  5.848   1.00 0.00 ? 52  SER A HB3  2  
ATOM 2492  H HG   . SER A 1 52  ? -1.130  -5.069  7.400   1.00 0.00 ? 52  SER A HG   2  
ATOM 2493  N N    . THR A 1 53  ? 1.211   -4.117  8.408   1.00 0.00 ? 53  THR A N    2  
ATOM 2494  C CA   . THR A 1 53  ? 2.152   -4.069  9.515   1.00 0.00 ? 53  THR A CA   2  
ATOM 2495  C C    . THR A 1 53  ? 3.046   -5.311  9.509   1.00 0.00 ? 53  THR A C    2  
ATOM 2496  O O    . THR A 1 53  ? 2.650   -6.363  9.010   1.00 0.00 ? 53  THR A O    2  
ATOM 2497  C CB   . THR A 1 53  ? 1.352   -3.903  10.808  1.00 0.00 ? 53  THR A CB   2  
ATOM 2498  O OG1  . THR A 1 53  ? 0.296   -4.852  10.688  1.00 0.00 ? 53  THR A OG1  2  
ATOM 2499  C CG2  . THR A 1 53  ? 0.634   -2.554  10.883  1.00 0.00 ? 53  THR A CG2  2  
ATOM 2500  H H    . THR A 1 53  ? 0.509   -4.826  8.481   1.00 0.00 ? 53  THR A H    2  
ATOM 2501  H HA   . THR A 1 53  ? 2.803   -3.206  9.375   1.00 0.00 ? 53  THR A HA   2  
ATOM 2502  H HB   . THR A 1 53  ? 1.987   -4.055  11.681  1.00 0.00 ? 53  THR A HB   2  
ATOM 2503  H HG1  . THR A 1 53  ? -0.179  -4.947  11.563  1.00 0.00 ? 53  THR A HG1  2  
ATOM 2504  H HG21 . THR A 1 53  ? -0.366  -2.651  10.461  1.00 0.00 ? 53  THR A HG21 2  
ATOM 2505  H HG22 . THR A 1 53  ? 0.560   -2.240  11.924  1.00 0.00 ? 53  THR A HG22 2  
ATOM 2506  H HG23 . THR A 1 53  ? 1.197   -1.811  10.319  1.00 0.00 ? 53  THR A HG23 2  
ATOM 2507  N N    . LYS A 1 54  ? 4.236   -5.147  10.069  1.00 0.00 ? 54  LYS A N    2  
ATOM 2508  C CA   . LYS A 1 54  ? 5.189   -6.241  10.134  1.00 0.00 ? 54  LYS A CA   2  
ATOM 2509  C C    . LYS A 1 54  ? 4.479   -7.502  10.630  1.00 0.00 ? 54  LYS A C    2  
ATOM 2510  O O    . LYS A 1 54  ? 4.578   -8.560  10.009  1.00 0.00 ? 54  LYS A O    2  
ATOM 2511  C CB   . LYS A 1 54  ? 6.402   -5.846  10.980  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2512  C CG   . LYS A 1 54  ? 7.321   -7.046  11.215  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2513  C CD   . LYS A 1 54  ? 8.792   -6.643  11.090  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2514  C CE   . LYS A 1 54  ? 9.291   -6.828  9.655   1.00 0.00 ? 54  LYS A CE   2  
ATOM 2515  N NZ   . LYS A 1 54  ? 10.468  -7.724  9.628   1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2516  H H    . LYS A 1 54  ? 4.550   -4.288  10.472  1.00 0.00 ? 54  LYS A H    2  
ATOM 2517  H HA   . LYS A 1 54  ? 5.548   -6.423  9.121   1.00 0.00 ? 54  LYS A HA   2  
ATOM 2518  H HB2  . LYS A 1 54  ? 6.956   -5.051  10.479  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2519  H HB3  . LYS A 1 54  ? 6.067   -5.446  11.937  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2520  H HG2  . LYS A 1 54  ? 7.137   -7.460  12.206  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2521  H HG3  . LYS A 1 54  ? 7.092   -7.830  10.494  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2522  H HD2  . LYS A 1 54  ? 8.914   -5.602  11.390  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2523  H HD3  . LYS A 1 54  ? 9.396   -7.244  11.769  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2524  H HE2  . LYS A 1 54  ? 8.494   -7.244  9.038   1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2525  H HE3  . LYS A 1 54  ? 9.553   -5.860  9.228   1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2526  H HZ1  . LYS A 1 54  ? 10.199  -8.617  9.264   1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2527  H HZ2  . LYS A 1 54  ? 11.176  -7.327  9.044   1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2528  H HZ3  . LYS A 1 54  ? 10.824  -7.836  10.555  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2529  N N    . LYS A 1 55  ? 3.778   -7.349  11.744  1.00 0.00 ? 55  LYS A N    2  
ATOM 2530  C CA   . LYS A 1 55  ? 3.051   -8.462  12.330  1.00 0.00 ? 55  LYS A CA   2  
ATOM 2531  C C    . LYS A 1 55  ? 2.193   -9.129  11.253  1.00 0.00 ? 55  LYS A C    2  
ATOM 2532  O O    . LYS A 1 55  ? 2.271   -10.341 11.055  1.00 0.00 ? 55  LYS A O    2  
ATOM 2533  C CB   . LYS A 1 55  ? 2.255   -7.998  13.551  1.00 0.00 ? 55  LYS A CB   2  
ATOM 2534  C CG   . LYS A 1 55  ? 3.162   -7.852  14.775  1.00 0.00 ? 55  LYS A CG   2  
ATOM 2535  C CD   . LYS A 1 55  ? 3.329   -6.382  15.162  1.00 0.00 ? 55  LYS A CD   2  
ATOM 2536  C CE   . LYS A 1 55  ? 4.684   -5.843  14.697  1.00 0.00 ? 55  LYS A CE   2  
ATOM 2537  N NZ   . LYS A 1 55  ? 5.454   -5.318  15.847  1.00 0.00 ? 55  LYS A NZ   2  
ATOM 2538  H H    . LYS A 1 55  ? 3.703   -6.485  12.243  1.00 0.00 ? 55  LYS A H    2  
ATOM 2539  H HA   . LYS A 1 55  ? 3.788   -9.184  12.682  1.00 0.00 ? 55  LYS A HA   2  
ATOM 2540  H HB2  . LYS A 1 55  ? 1.773   -7.044  13.336  1.00 0.00 ? 55  LYS A HB2  2  
ATOM 2541  H HB3  . LYS A 1 55  ? 1.461   -8.714  13.766  1.00 0.00 ? 55  LYS A HB3  2  
ATOM 2542  H HG2  . LYS A 1 55  ? 2.739   -8.407  15.613  1.00 0.00 ? 55  LYS A HG2  2  
ATOM 2543  H HG3  . LYS A 1 55  ? 4.137   -8.290  14.563  1.00 0.00 ? 55  LYS A HG3  2  
ATOM 2544  H HD2  . LYS A 1 55  ? 2.527   -5.792  14.717  1.00 0.00 ? 55  LYS A HD2  2  
ATOM 2545  H HD3  . LYS A 1 55  ? 3.242   -6.274  16.243  1.00 0.00 ? 55  LYS A HD3  2  
ATOM 2546  H HE2  . LYS A 1 55  ? 5.248   -6.636  14.206  1.00 0.00 ? 55  LYS A HE2  2  
ATOM 2547  H HE3  . LYS A 1 55  ? 4.535   -5.054  13.960  1.00 0.00 ? 55  LYS A HE3  2  
ATOM 2548  H HZ1  . LYS A 1 55  ? 6.083   -6.022  16.176  1.00 0.00 ? 55  LYS A HZ1  2  
ATOM 2549  H HZ2  . LYS A 1 55  ? 5.974   -4.514  15.560  1.00 0.00 ? 55  LYS A HZ2  2  
ATOM 2550  H HZ3  . LYS A 1 55  ? 4.825   -5.063  16.581  1.00 0.00 ? 55  LYS A HZ3  2  
ATOM 2551  N N    . GLU A 1 56  ? 1.395   -8.309  10.586  1.00 0.00 ? 56  GLU A N    2  
ATOM 2552  C CA   . GLU A 1 56  ? 0.524   -8.805  9.534   1.00 0.00 ? 56  GLU A CA   2  
ATOM 2553  C C    . GLU A 1 56  ? 1.314   -9.679  8.558   1.00 0.00 ? 56  GLU A C    2  
ATOM 2554  O O    . GLU A 1 56  ? 1.089   -10.885 8.477   1.00 0.00 ? 56  GLU A O    2  
ATOM 2555  C CB   . GLU A 1 56  ? -0.164  -7.650  8.803   1.00 0.00 ? 56  GLU A CB   2  
ATOM 2556  C CG   . GLU A 1 56  ? -1.686  -7.762  8.912   1.00 0.00 ? 56  GLU A CG   2  
ATOM 2557  C CD   . GLU A 1 56  ? -2.196  -9.018  8.202   1.00 0.00 ? 56  GLU A CD   2  
ATOM 2558  O OE1  . GLU A 1 56  ? -1.857  -10.120 8.685   1.00 0.00 ? 56  GLU A OE1  2  
ATOM 2559  O OE2  . GLU A 1 56  ? -2.913  -8.848  7.192   1.00 0.00 ? 56  GLU A OE2  2  
ATOM 2560  H H    . GLU A 1 56  ? 1.338   -7.325  10.753  1.00 0.00 ? 56  GLU A H    2  
ATOM 2561  H HA   . GLU A 1 56  ? -0.230  -9.406  10.042  1.00 0.00 ? 56  GLU A HA   2  
ATOM 2562  H HB2  . GLU A 1 56  ? 0.165   -6.700  9.224   1.00 0.00 ? 56  GLU A HB2  2  
ATOM 2563  H HB3  . GLU A 1 56  ? 0.130   -7.653  7.753   1.00 0.00 ? 56  GLU A HB3  2  
ATOM 2564  H HG2  . GLU A 1 56  ? -1.979  -7.789  9.961   1.00 0.00 ? 56  GLU A HG2  2  
ATOM 2565  H HG3  . GLU A 1 56  ? -2.152  -6.879  8.474   1.00 0.00 ? 56  GLU A HG3  2  
ATOM 2566  N N    . VAL A 1 57  ? 2.223   -9.035  7.840   1.00 0.00 ? 57  VAL A N    2  
ATOM 2567  C CA   . VAL A 1 57  ? 3.048   -9.739  6.873   1.00 0.00 ? 57  VAL A CA   2  
ATOM 2568  C C    . VAL A 1 57  ? 3.533   -11.055 7.484   1.00 0.00 ? 57  VAL A C    2  
ATOM 2569  O O    . VAL A 1 57  ? 3.560   -12.084 6.810   1.00 0.00 ? 57  VAL A O    2  
ATOM 2570  C CB   . VAL A 1 57  ? 4.193   -8.838  6.408   1.00 0.00 ? 57  VAL A CB   2  
ATOM 2571  C CG1  . VAL A 1 57  ? 5.216   -9.629  5.590   1.00 0.00 ? 57  VAL A CG1  2  
ATOM 2572  C CG2  . VAL A 1 57  ? 3.663   -7.642  5.613   1.00 0.00 ? 57  VAL A CG2  2  
ATOM 2573  H H    . VAL A 1 57  ? 2.400   -8.054  7.912   1.00 0.00 ? 57  VAL A H    2  
ATOM 2574  H HA   . VAL A 1 57  ? 2.422   -9.963  6.009   1.00 0.00 ? 57  VAL A HA   2  
ATOM 2575  H HB   . VAL A 1 57  ? 4.698   -8.453  7.294   1.00 0.00 ? 57  VAL A HB   2  
ATOM 2576  H HG11 . VAL A 1 57  ? 5.977   -8.950  5.205   1.00 0.00 ? 57  VAL A HG11 2  
ATOM 2577  H HG12 . VAL A 1 57  ? 5.687   -10.379 6.225   1.00 0.00 ? 57  VAL A HG12 2  
ATOM 2578  H HG13 . VAL A 1 57  ? 4.713   -10.121 4.757   1.00 0.00 ? 57  VAL A HG13 2  
ATOM 2579  H HG21 . VAL A 1 57  ? 2.652   -7.857  5.267   1.00 0.00 ? 57  VAL A HG21 2  
ATOM 2580  H HG22 . VAL A 1 57  ? 3.648   -6.759  6.252   1.00 0.00 ? 57  VAL A HG22 2  
ATOM 2581  H HG23 . VAL A 1 57  ? 4.310   -7.460  4.756   1.00 0.00 ? 57  VAL A HG23 2  
ATOM 2582  N N    . GLU A 1 58  ? 3.904   -10.979 8.754   1.00 0.00 ? 58  GLU A N    2  
ATOM 2583  C CA   . GLU A 1 58  ? 4.387   -12.152 9.463   1.00 0.00 ? 58  GLU A CA   2  
ATOM 2584  C C    . GLU A 1 58  ? 3.278   -13.201 9.572   1.00 0.00 ? 58  GLU A C    2  
ATOM 2585  O O    . GLU A 1 58  ? 3.533   -14.395 9.428   1.00 0.00 ? 58  GLU A O    2  
ATOM 2586  C CB   . GLU A 1 58  ? 4.922   -11.774 10.846  1.00 0.00 ? 58  GLU A CB   2  
ATOM 2587  C CG   . GLU A 1 58  ? 6.448   -11.663 10.832  1.00 0.00 ? 58  GLU A CG   2  
ATOM 2588  C CD   . GLU A 1 58  ? 7.032   -11.969 12.213  1.00 0.00 ? 58  GLU A CD   2  
ATOM 2589  O OE1  . GLU A 1 58  ? 7.150   -13.173 12.525  1.00 0.00 ? 58  GLU A OE1  2  
ATOM 2590  O OE2  . GLU A 1 58  ? 7.348   -10.991 12.925  1.00 0.00 ? 58  GLU A OE2  2  
ATOM 2591  H H    . GLU A 1 58  ? 3.879   -10.139 9.295   1.00 0.00 ? 58  GLU A H    2  
ATOM 2592  H HA   . GLU A 1 58  ? 5.206   -12.540 8.857   1.00 0.00 ? 58  GLU A HA   2  
ATOM 2593  H HB2  . GLU A 1 58  ? 4.487   -10.826 11.161  1.00 0.00 ? 58  GLU A HB2  2  
ATOM 2594  H HB3  . GLU A 1 58  ? 4.615   -12.524 11.576  1.00 0.00 ? 58  GLU A HB3  2  
ATOM 2595  H HG2  . GLU A 1 58  ? 6.860   -12.355 10.098  1.00 0.00 ? 58  GLU A HG2  2  
ATOM 2596  H HG3  . GLU A 1 58  ? 6.740   -10.659 10.524  1.00 0.00 ? 58  GLU A HG3  2  
ATOM 2597  N N    . LYS A 1 59  ? 2.072   -12.716 9.824   1.00 0.00 ? 59  LYS A N    2  
ATOM 2598  C CA   . LYS A 1 59  ? 0.923   -13.596 9.954   1.00 0.00 ? 59  LYS A CA   2  
ATOM 2599  C C    . LYS A 1 59  ? 0.765   -14.413 8.670   1.00 0.00 ? 59  LYS A C    2  
ATOM 2600  O O    . LYS A 1 59  ? 0.574   -15.627 8.722   1.00 0.00 ? 59  LYS A O    2  
ATOM 2601  C CB   . LYS A 1 59  ? -0.325  -12.797 10.331  1.00 0.00 ? 59  LYS A CB   2  
ATOM 2602  C CG   . LYS A 1 59  ? -0.563  -12.831 11.842  1.00 0.00 ? 59  LYS A CG   2  
ATOM 2603  C CD   . LYS A 1 59  ? -0.535  -11.420 12.434  1.00 0.00 ? 59  LYS A CD   2  
ATOM 2604  C CE   . LYS A 1 59  ? -1.953  -10.874 12.614  1.00 0.00 ? 59  LYS A CE   2  
ATOM 2605  N NZ   . LYS A 1 59  ? -2.570  -11.428 13.840  1.00 0.00 ? 59  LYS A NZ   2  
ATOM 2606  H H    . LYS A 1 59  ? 1.873   -11.742 9.940   1.00 0.00 ? 59  LYS A H    2  
ATOM 2607  H HA   . LYS A 1 59  ? 1.128   -14.281 10.776  1.00 0.00 ? 59  LYS A HA   2  
ATOM 2608  H HB2  . LYS A 1 59  ? -0.215  -11.764 10.000  1.00 0.00 ? 59  LYS A HB2  2  
ATOM 2609  H HB3  . LYS A 1 59  ? -1.194  -13.205 9.814   1.00 0.00 ? 59  LYS A HB3  2  
ATOM 2610  H HG2  . LYS A 1 59  ? -1.524  -13.299 12.053  1.00 0.00 ? 59  LYS A HG2  2  
ATOM 2611  H HG3  . LYS A 1 59  ? 0.201   -13.444 12.320  1.00 0.00 ? 59  LYS A HG3  2  
ATOM 2612  H HD2  . LYS A 1 59  ? -0.022  -11.435 13.396  1.00 0.00 ? 59  LYS A HD2  2  
ATOM 2613  H HD3  . LYS A 1 59  ? 0.033   -10.759 11.780  1.00 0.00 ? 59  LYS A HD3  2  
ATOM 2614  H HE2  . LYS A 1 59  ? -1.925  -9.786  12.674  1.00 0.00 ? 59  LYS A HE2  2  
ATOM 2615  H HE3  . LYS A 1 59  ? -2.561  -11.130 11.747  1.00 0.00 ? 59  LYS A HE3  2  
ATOM 2616  H HZ1  . LYS A 1 59  ? -2.371  -10.827 14.614  1.00 0.00 ? 59  LYS A HZ1  2  
ATOM 2617  H HZ2  . LYS A 1 59  ? -3.560  -11.494 13.715  1.00 0.00 ? 59  LYS A HZ2  2  
ATOM 2618  H HZ3  . LYS A 1 59  ? -2.195  -12.338 14.020  1.00 0.00 ? 59  LYS A HZ3  2  
ATOM 2619  N N    . MET A 1 60  ? 0.851   -13.715 7.547   1.00 0.00 ? 60  MET A N    2  
ATOM 2620  C CA   . MET A 1 60  ? 0.720   -14.360 6.252   1.00 0.00 ? 60  MET A CA   2  
ATOM 2621  C C    . MET A 1 60  ? -0.674  -14.966 6.080   1.00 0.00 ? 60  MET A C    2  
ATOM 2622  O O    . MET A 1 60  ? -0.827  -16.012 5.450   1.00 0.00 ? 60  MET A O    2  
ATOM 2623  C CB   . MET A 1 60  ? 1.775   -15.460 6.121   1.00 0.00 ? 60  MET A CB   2  
ATOM 2624  C CG   . MET A 1 60  ? 3.035   -14.932 5.433   1.00 0.00 ? 60  MET A CG   2  
ATOM 2625  S SD   . MET A 1 60  ? 2.901   -15.146 3.666   1.00 0.00 ? 60  MET A SD   2  
ATOM 2626  C CE   . MET A 1 60  ? 2.472   -13.482 3.184   1.00 0.00 ? 60  MET A CE   2  
ATOM 2627  H H    . MET A 1 60  ? 1.007   -12.727 7.514   1.00 0.00 ? 60  MET A H    2  
ATOM 2628  H HA   . MET A 1 60  ? 0.875   -13.572 5.515   1.00 0.00 ? 60  MET A HA   2  
ATOM 2629  H HB2  . MET A 1 60  ? 2.029   -15.845 7.109   1.00 0.00 ? 60  MET A HB2  2  
ATOM 2630  H HB3  . MET A 1 60  ? 1.367   -16.294 5.550   1.00 0.00 ? 60  MET A HB3  2  
ATOM 2631  H HG2  . MET A 1 60  ? 3.174   -13.877 5.670   1.00 0.00 ? 60  MET A HG2  2  
ATOM 2632  H HG3  . MET A 1 60  ? 3.912   -15.461 5.806   1.00 0.00 ? 60  MET A HG3  2  
ATOM 2633  H HE1  . MET A 1 60  ? 2.421   -12.849 4.069   1.00 0.00 ? 60  MET A HE1  2  
ATOM 2634  H HE2  . MET A 1 60  ? 3.230   -13.094 2.503   1.00 0.00 ? 60  MET A HE2  2  
ATOM 2635  H HE3  . MET A 1 60  ? 1.503   -13.487 2.684   1.00 0.00 ? 60  MET A HE3  2  
ATOM 2636  N N    . ASN A 1 61  ? -1.656  -14.284 6.652   1.00 0.00 ? 61  ASN A N    2  
ATOM 2637  C CA   . ASN A 1 61  ? -3.032  -14.742 6.570   1.00 0.00 ? 61  ASN A CA   2  
ATOM 2638  C C    . ASN A 1 61  ? -3.516  -14.634 5.122   1.00 0.00 ? 61  ASN A C    2  
ATOM 2639  O O    . ASN A 1 61  ? -2.833  -14.056 4.277   1.00 0.00 ? 61  ASN A O    2  
ATOM 2640  C CB   . ASN A 1 61  ? -3.952  -13.884 7.440   1.00 0.00 ? 61  ASN A CB   2  
ATOM 2641  C CG   . ASN A 1 61  ? -5.311  -14.558 7.633   1.00 0.00 ? 61  ASN A CG   2  
ATOM 2642  O OD1  . ASN A 1 61  ? -5.414  -15.753 7.858   1.00 0.00 ? 61  ASN A OD1  2  
ATOM 2643  N ND2  . ASN A 1 61  ? -6.346  -13.728 7.534   1.00 0.00 ? 61  ASN A ND2  2  
ATOM 2644  H H    . ASN A 1 61  ? -1.523  -13.435 7.163   1.00 0.00 ? 61  ASN A H    2  
ATOM 2645  H HA   . ASN A 1 61  ? -3.013  -15.772 6.927   1.00 0.00 ? 61  ASN A HA   2  
ATOM 2646  H HB2  . ASN A 1 61  ? -3.485  -13.714 8.411   1.00 0.00 ? 61  ASN A HB2  2  
ATOM 2647  H HB3  . ASN A 1 61  ? -4.089  -12.906 6.977   1.00 0.00 ? 61  ASN A HB3  2  
ATOM 2648  H HD21 . ASN A 1 61  ? -6.192  -12.757 7.348   1.00 0.00 ? 61  ASN A HD21 2  
ATOM 2649  H HD22 . ASN A 1 61  ? -7.277  -14.074 7.645   1.00 0.00 ? 61  ASN A HD22 2  
ATOM 2650  N N    . LYS A 1 62  ? -4.689  -15.199 4.880   1.00 0.00 ? 62  LYS A N    2  
ATOM 2651  C CA   . LYS A 1 62  ? -5.272  -15.173 3.549   1.00 0.00 ? 62  LYS A CA   2  
ATOM 2652  C C    . LYS A 1 62  ? -5.192  -13.752 2.989   1.00 0.00 ? 62  LYS A C    2  
ATOM 2653  O O    . LYS A 1 62  ? -4.676  -13.541 1.893   1.00 0.00 ? 62  LYS A O    2  
ATOM 2654  C CB   . LYS A 1 62  ? -6.691  -15.745 3.574   1.00 0.00 ? 62  LYS A CB   2  
ATOM 2655  C CG   . LYS A 1 62  ? -6.665  -17.273 3.660   1.00 0.00 ? 62  LYS A CG   2  
ATOM 2656  C CD   . LYS A 1 62  ? -6.849  -17.744 5.104   1.00 0.00 ? 62  LYS A CD   2  
ATOM 2657  C CE   . LYS A 1 62  ? -7.464  -19.144 5.150   1.00 0.00 ? 62  LYS A CE   2  
ATOM 2658  N NZ   . LYS A 1 62  ? -8.000  -19.430 6.499   1.00 0.00 ? 62  LYS A NZ   2  
ATOM 2659  H H    . LYS A 1 62  ? -5.238  -15.667 5.573   1.00 0.00 ? 62  LYS A H    2  
ATOM 2660  H HA   . LYS A 1 62  ? -4.672  -15.828 2.917   1.00 0.00 ? 62  LYS A HA   2  
ATOM 2661  H HB2  . LYS A 1 62  ? -7.236  -15.339 4.426   1.00 0.00 ? 62  LYS A HB2  2  
ATOM 2662  H HB3  . LYS A 1 62  ? -7.227  -15.437 2.677   1.00 0.00 ? 62  LYS A HB3  2  
ATOM 2663  H HG2  . LYS A 1 62  ? -7.455  -17.689 3.035   1.00 0.00 ? 62  LYS A HG2  2  
ATOM 2664  H HG3  . LYS A 1 62  ? -5.719  -17.646 3.269   1.00 0.00 ? 62  LYS A HG3  2  
ATOM 2665  H HD2  . LYS A 1 62  ? -5.885  -17.749 5.614   1.00 0.00 ? 62  LYS A HD2  2  
ATOM 2666  H HD3  . LYS A 1 62  ? -7.489  -17.044 5.640   1.00 0.00 ? 62  LYS A HD3  2  
ATOM 2667  H HE2  . LYS A 1 62  ? -8.261  -19.222 4.411   1.00 0.00 ? 62  LYS A HE2  2  
ATOM 2668  H HE3  . LYS A 1 62  ? -6.711  -19.887 4.886   1.00 0.00 ? 62  LYS A HE3  2  
ATOM 2669  H HZ1  . LYS A 1 62  ? -8.571  -20.251 6.464   1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 2670  H HZ2  . LYS A 1 62  ? -7.242  -19.578 7.135   1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 2671  H HZ3  . LYS A 1 62  ? -8.550  -18.655 6.811   1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 2672  N N    . LYS A 1 63  ? -5.709  -12.813 3.768   1.00 0.00 ? 63  LYS A N    2  
ATOM 2673  C CA   . LYS A 1 63  ? -5.703  -11.418 3.363   1.00 0.00 ? 63  LYS A CA   2  
ATOM 2674  C C    . LYS A 1 63  ? -4.283  -11.015 2.961   1.00 0.00 ? 63  LYS A C    2  
ATOM 2675  O O    . LYS A 1 63  ? -4.096  -10.090 2.172   1.00 0.00 ? 63  LYS A O    2  
ATOM 2676  C CB   . LYS A 1 63  ? -6.304  -10.539 4.462   1.00 0.00 ? 63  LYS A CB   2  
ATOM 2677  C CG   . LYS A 1 63  ? -7.811  -10.771 4.587   1.00 0.00 ? 63  LYS A CG   2  
ATOM 2678  C CD   . LYS A 1 63  ? -8.594  -9.516  4.198   1.00 0.00 ? 63  LYS A CD   2  
ATOM 2679  C CE   . LYS A 1 63  ? -9.545  -9.802  3.034   1.00 0.00 ? 63  LYS A CE   2  
ATOM 2680  N NZ   . LYS A 1 63  ? -10.774 -10.467 3.521   1.00 0.00 ? 63  LYS A NZ   2  
ATOM 2681  H H    . LYS A 1 63  ? -6.127  -12.993 4.658   1.00 0.00 ? 63  LYS A H    2  
ATOM 2682  H HA   . LYS A 1 63  ? -6.348  -11.328 2.489   1.00 0.00 ? 63  LYS A HA   2  
ATOM 2683  H HB2  . LYS A 1 63  ? -5.818  -10.756 5.413   1.00 0.00 ? 63  LYS A HB2  2  
ATOM 2684  H HB3  . LYS A 1 63  ? -6.111  -9.489  4.239   1.00 0.00 ? 63  LYS A HB3  2  
ATOM 2685  H HG2  . LYS A 1 63  ? -8.108  -11.602 3.948   1.00 0.00 ? 63  LYS A HG2  2  
ATOM 2686  H HG3  . LYS A 1 63  ? -8.055  -11.054 5.611   1.00 0.00 ? 63  LYS A HG3  2  
ATOM 2687  H HD2  . LYS A 1 63  ? -9.161  -9.156  5.056   1.00 0.00 ? 63  LYS A HD2  2  
ATOM 2688  H HD3  . LYS A 1 63  ? -7.900  -8.722  3.919   1.00 0.00 ? 63  LYS A HD3  2  
ATOM 2689  H HE2  . LYS A 1 63  ? -9.804  -8.870  2.531   1.00 0.00 ? 63  LYS A HE2  2  
ATOM 2690  H HE3  . LYS A 1 63  ? -9.049  -10.434 2.298   1.00 0.00 ? 63  LYS A HE3  2  
ATOM 2691  H HZ1  . LYS A 1 63  ? -11.059 -10.050 4.385   1.00 0.00 ? 63  LYS A HZ1  2  
ATOM 2692  H HZ2  . LYS A 1 63  ? -11.502 -10.360 2.844   1.00 0.00 ? 63  LYS A HZ2  2  
ATOM 2693  H HZ3  . LYS A 1 63  ? -10.592 -11.440 3.665   1.00 0.00 ? 63  LYS A HZ3  2  
ATOM 2694  N N    . MET A 1 64  ? -3.318  -11.728 3.523   1.00 0.00 ? 64  MET A N    2  
ATOM 2695  C CA   . MET A 1 64  ? -1.920  -11.456 3.233   1.00 0.00 ? 64  MET A CA   2  
ATOM 2696  C C    . MET A 1 64  ? -1.426  -12.312 2.065   1.00 0.00 ? 64  MET A C    2  
ATOM 2697  O O    . MET A 1 64  ? -0.593  -11.870 1.275   1.00 0.00 ? 64  MET A O    2  
ATOM 2698  C CB   . MET A 1 64  ? -1.075  -11.749 4.474   1.00 0.00 ? 64  MET A CB   2  
ATOM 2699  C CG   . MET A 1 64  ? 0.353   -11.226 4.301   1.00 0.00 ? 64  MET A CG   2  
ATOM 2700  S SD   . MET A 1 64  ? 0.323   -9.476  3.949   1.00 0.00 ? 64  MET A SD   2  
ATOM 2701  C CE   . MET A 1 64  ? -0.150  -8.846  5.551   1.00 0.00 ? 64  MET A CE   2  
ATOM 2702  H H    . MET A 1 64  ? -3.478  -12.479 4.164   1.00 0.00 ? 64  MET A H    2  
ATOM 2703  H HA   . MET A 1 64  ? -1.877  -10.401 2.963   1.00 0.00 ? 64  MET A HA   2  
ATOM 2704  H HB2  . MET A 1 64  ? -1.532  -11.285 5.348   1.00 0.00 ? 64  MET A HB2  2  
ATOM 2705  H HB3  . MET A 1 64  ? -1.052  -12.823 4.658   1.00 0.00 ? 64  MET A HB3  2  
ATOM 2706  H HG2  . MET A 1 64  ? 0.930   -11.414 5.206   1.00 0.00 ? 64  MET A HG2  2  
ATOM 2707  H HG3  . MET A 1 64  ? 0.849   -11.760 3.490   1.00 0.00 ? 64  MET A HG3  2  
ATOM 2708  H HE1  . MET A 1 64  ? -0.730  -7.932  5.425   1.00 0.00 ? 64  MET A HE1  2  
ATOM 2709  H HE2  . MET A 1 64  ? -0.755  -9.590  6.070   1.00 0.00 ? 64  MET A HE2  2  
ATOM 2710  H HE3  . MET A 1 64  ? 0.744   -8.632  6.136   1.00 0.00 ? 64  MET A HE3  2  
ATOM 2711  N N    . GLU A 1 65  ? -1.960  -13.523 1.992   1.00 0.00 ? 65  GLU A N    2  
ATOM 2712  C CA   . GLU A 1 65  ? -1.584  -14.444 0.934   1.00 0.00 ? 65  GLU A CA   2  
ATOM 2713  C C    . GLU A 1 65  ? -1.996  -13.884 -0.429  1.00 0.00 ? 65  GLU A C    2  
ATOM 2714  O O    . GLU A 1 65  ? -1.238  -13.971 -1.394  1.00 0.00 ? 65  GLU A O    2  
ATOM 2715  C CB   . GLU A 1 65  ? -2.198  -15.826 1.167   1.00 0.00 ? 65  GLU A CB   2  
ATOM 2716  C CG   . GLU A 1 65  ? -1.223  -16.741 1.910   1.00 0.00 ? 65  GLU A CG   2  
ATOM 2717  C CD   . GLU A 1 65  ? -0.516  -17.692 0.941   1.00 0.00 ? 65  GLU A CD   2  
ATOM 2718  O OE1  . GLU A 1 65  ? -1.182  -18.111 -0.030  1.00 0.00 ? 65  GLU A OE1  2  
ATOM 2719  O OE2  . GLU A 1 65  ? 0.674   -17.977 1.193   1.00 0.00 ? 65  GLU A OE2  2  
ATOM 2720  H H    . GLU A 1 65  ? -2.637  -13.875 2.639   1.00 0.00 ? 65  GLU A H    2  
ATOM 2721  H HA   . GLU A 1 65  ? -0.498  -14.522 0.990   1.00 0.00 ? 65  GLU A HA   2  
ATOM 2722  H HB2  . GLU A 1 65  ? -3.119  -15.727 1.741   1.00 0.00 ? 65  GLU A HB2  2  
ATOM 2723  H HB3  . GLU A 1 65  ? -2.466  -16.275 0.210   1.00 0.00 ? 65  GLU A HB3  2  
ATOM 2724  H HG2  . GLU A 1 65  ? -0.484  -16.139 2.438   1.00 0.00 ? 65  GLU A HG2  2  
ATOM 2725  H HG3  . GLU A 1 65  ? -1.761  -17.318 2.662   1.00 0.00 ? 65  GLU A HG3  2  
ATOM 2726  N N    . GLU A 1 66  ? -3.195  -13.322 -0.465  1.00 0.00 ? 66  GLU A N    2  
ATOM 2727  C CA   . GLU A 1 66  ? -3.716  -12.748 -1.694  1.00 0.00 ? 66  GLU A CA   2  
ATOM 2728  C C    . GLU A 1 66  ? -2.757  -11.683 -2.230  1.00 0.00 ? 66  GLU A C    2  
ATOM 2729  O O    . GLU A 1 66  ? -2.541  -11.590 -3.437  1.00 0.00 ? 66  GLU A O    2  
ATOM 2730  C CB   . GLU A 1 66  ? -5.115  -12.167 -1.477  1.00 0.00 ? 66  GLU A CB   2  
ATOM 2731  C CG   . GLU A 1 66  ? -5.049  -10.859 -0.686  1.00 0.00 ? 66  GLU A CG   2  
ATOM 2732  C CD   . GLU A 1 66  ? -6.433  -10.217 -0.573  1.00 0.00 ? 66  GLU A CD   2  
ATOM 2733  O OE1  . GLU A 1 66  ? -7.222  -10.397 -1.525  1.00 0.00 ? 66  GLU A OE1  2  
ATOM 2734  O OE2  . GLU A 1 66  ? -6.671  -9.560  0.464   1.00 0.00 ? 66  GLU A OE2  2  
ATOM 2735  H H    . GLU A 1 66  ? -3.805  -13.256 0.325   1.00 0.00 ? 66  GLU A H    2  
ATOM 2736  H HA   . GLU A 1 66  ? -3.779  -13.578 -2.397  1.00 0.00 ? 66  GLU A HA   2  
ATOM 2737  H HB2  . GLU A 1 66  ? -5.592  -11.990 -2.441  1.00 0.00 ? 66  GLU A HB2  2  
ATOM 2738  H HB3  . GLU A 1 66  ? -5.734  -12.889 -0.943  1.00 0.00 ? 66  GLU A HB3  2  
ATOM 2739  H HG2  . GLU A 1 66  ? -4.651  -11.052 0.310   1.00 0.00 ? 66  GLU A HG2  2  
ATOM 2740  H HG3  . GLU A 1 66  ? -4.363  -10.168 -1.175  1.00 0.00 ? 66  GLU A HG3  2  
ATOM 2741  N N    . VAL A 1 67  ? -2.209  -10.907 -1.307  1.00 0.00 ? 67  VAL A N    2  
ATOM 2742  C CA   . VAL A 1 67  ? -1.279  -9.852  -1.672  1.00 0.00 ? 67  VAL A CA   2  
ATOM 2743  C C    . VAL A 1 67  ? 0.030   -10.478 -2.159  1.00 0.00 ? 67  VAL A C    2  
ATOM 2744  O O    . VAL A 1 67  ? 0.665   -9.963  -3.077  1.00 0.00 ? 67  VAL A O    2  
ATOM 2745  C CB   . VAL A 1 67  ? -1.082  -8.896  -0.494  1.00 0.00 ? 67  VAL A CB   2  
ATOM 2746  C CG1  . VAL A 1 67  ? -0.189  -7.718  -0.887  1.00 0.00 ? 67  VAL A CG1  2  
ATOM 2747  C CG2  . VAL A 1 67  ? -2.428  -8.409  0.046   1.00 0.00 ? 67  VAL A CG2  2  
ATOM 2748  H H    . VAL A 1 67  ? -2.391  -10.989 -0.327  1.00 0.00 ? 67  VAL A H    2  
ATOM 2749  H HA   . VAL A 1 67  ? -1.725  -9.290  -2.493  1.00 0.00 ? 67  VAL A HA   2  
ATOM 2750  H HB   . VAL A 1 67  ? -0.581  -9.445  0.303   1.00 0.00 ? 67  VAL A HB   2  
ATOM 2751  H HG11 . VAL A 1 67  ? 0.208   -7.247  0.012   1.00 0.00 ? 67  VAL A HG11 2  
ATOM 2752  H HG12 . VAL A 1 67  ? 0.634   -8.076  -1.504  1.00 0.00 ? 67  VAL A HG12 2  
ATOM 2753  H HG13 . VAL A 1 67  ? -0.775  -6.990  -1.449  1.00 0.00 ? 67  VAL A HG13 2  
ATOM 2754  H HG21 . VAL A 1 67  ? -2.303  -8.062  1.072   1.00 0.00 ? 67  VAL A HG21 2  
ATOM 2755  H HG22 . VAL A 1 67  ? -2.792  -7.588  -0.572  1.00 0.00 ? 67  VAL A HG22 2  
ATOM 2756  H HG23 . VAL A 1 67  ? -3.147  -9.227  0.024   1.00 0.00 ? 67  VAL A HG23 2  
ATOM 2757  N N    . LYS A 1 68  ? 0.394   -11.581 -1.521  1.00 0.00 ? 68  LYS A N    2  
ATOM 2758  C CA   . LYS A 1 68  ? 1.615   -12.283 -1.877  1.00 0.00 ? 68  LYS A CA   2  
ATOM 2759  C C    . LYS A 1 68  ? 1.467   -12.876 -3.280  1.00 0.00 ? 68  LYS A C    2  
ATOM 2760  O O    . LYS A 1 68  ? 2.414   -12.866 -4.065  1.00 0.00 ? 68  LYS A O    2  
ATOM 2761  C CB   . LYS A 1 68  ? 1.970   -13.317 -0.807  1.00 0.00 ? 68  LYS A CB   2  
ATOM 2762  C CG   . LYS A 1 68  ? 3.275   -14.037 -1.152  1.00 0.00 ? 68  LYS A CG   2  
ATOM 2763  C CD   . LYS A 1 68  ? 4.020   -14.460 0.116   1.00 0.00 ? 68  LYS A CD   2  
ATOM 2764  C CE   . LYS A 1 68  ? 5.408   -15.008 -0.221  1.00 0.00 ? 68  LYS A CE   2  
ATOM 2765  N NZ   . LYS A 1 68  ? 5.327   -16.442 -0.579  1.00 0.00 ? 68  LYS A NZ   2  
ATOM 2766  H H    . LYS A 1 68  ? -0.128  -11.994 -0.775  1.00 0.00 ? 68  LYS A H    2  
ATOM 2767  H HA   . LYS A 1 68  ? 2.421   -11.549 -1.895  1.00 0.00 ? 68  LYS A HA   2  
ATOM 2768  H HB2  . LYS A 1 68  ? 2.067   -12.826 0.162   1.00 0.00 ? 68  LYS A HB2  2  
ATOM 2769  H HB3  . LYS A 1 68  ? 1.163   -14.044 -0.716  1.00 0.00 ? 68  LYS A HB3  2  
ATOM 2770  H HG2  . LYS A 1 68  ? 3.060   -14.915 -1.761  1.00 0.00 ? 68  LYS A HG2  2  
ATOM 2771  H HG3  . LYS A 1 68  ? 3.910   -13.382 -1.749  1.00 0.00 ? 68  LYS A HG3  2  
ATOM 2772  H HD2  . LYS A 1 68  ? 4.115   -13.607 0.788   1.00 0.00 ? 68  LYS A HD2  2  
ATOM 2773  H HD3  . LYS A 1 68  ? 3.444   -15.220 0.644   1.00 0.00 ? 68  LYS A HD3  2  
ATOM 2774  H HE2  . LYS A 1 68  ? 5.838   -14.444 -1.049  1.00 0.00 ? 68  LYS A HE2  2  
ATOM 2775  H HE3  . LYS A 1 68  ? 6.074   -14.878 0.633   1.00 0.00 ? 68  LYS A HE3  2  
ATOM 2776  H HZ1  . LYS A 1 68  ? 5.960   -16.635 -1.329  1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 2777  H HZ2  . LYS A 1 68  ? 5.571   -16.999 0.215   1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 2778  H HZ3  . LYS A 1 68  ? 4.394   -16.661 -0.866  1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 2779  N N    . GLU A 1 69  ? 0.272   -13.378 -3.552  1.00 0.00 ? 69  GLU A N    2  
ATOM 2780  C CA   . GLU A 1 69  ? -0.012  -13.973 -4.847  1.00 0.00 ? 69  GLU A CA   2  
ATOM 2781  C C    . GLU A 1 69  ? 0.200   -12.947 -5.961  1.00 0.00 ? 69  GLU A C    2  
ATOM 2782  O O    . GLU A 1 69  ? 0.834   -13.246 -6.972  1.00 0.00 ? 69  GLU A O    2  
ATOM 2783  C CB   . GLU A 1 69  ? -1.432  -14.543 -4.889  1.00 0.00 ? 69  GLU A CB   2  
ATOM 2784  C CG   . GLU A 1 69  ? -1.677  -15.493 -3.714  1.00 0.00 ? 69  GLU A CG   2  
ATOM 2785  C CD   . GLU A 1 69  ? -2.283  -16.813 -4.195  1.00 0.00 ? 69  GLU A CD   2  
ATOM 2786  O OE1  . GLU A 1 69  ? -1.974  -17.194 -5.344  1.00 0.00 ? 69  GLU A OE1  2  
ATOM 2787  O OE2  . GLU A 1 69  ? -3.041  -17.411 -3.401  1.00 0.00 ? 69  GLU A OE2  2  
ATOM 2788  H H    . GLU A 1 69  ? -0.493  -13.382 -2.908  1.00 0.00 ? 69  GLU A H    2  
ATOM 2789  H HA   . GLU A 1 69  ? 0.703   -14.789 -4.953  1.00 0.00 ? 69  GLU A HA   2  
ATOM 2790  H HB2  . GLU A 1 69  ? -2.155  -13.728 -4.858  1.00 0.00 ? 69  GLU A HB2  2  
ATOM 2791  H HB3  . GLU A 1 69  ? -1.588  -15.072 -5.828  1.00 0.00 ? 69  GLU A HB3  2  
ATOM 2792  H HG2  . GLU A 1 69  ? -0.737  -15.687 -3.197  1.00 0.00 ? 69  GLU A HG2  2  
ATOM 2793  H HG3  . GLU A 1 69  ? -2.346  -15.022 -2.994  1.00 0.00 ? 69  GLU A HG3  2  
ATOM 2794  N N    . ALA A 1 70  ? -0.343  -11.759 -5.739  1.00 0.00 ? 70  ALA A N    2  
ATOM 2795  C CA   . ALA A 1 70  ? -0.220  -10.687 -6.713  1.00 0.00 ? 70  ALA A CA   2  
ATOM 2796  C C    . ALA A 1 70  ? 1.153   -10.028 -6.570  1.00 0.00 ? 70  ALA A C    2  
ATOM 2797  O O    . ALA A 1 70  ? 1.456   -9.059  -7.263  1.00 0.00 ? 70  ALA A O    2  
ATOM 2798  C CB   . ALA A 1 70  ? -1.367  -9.692  -6.523  1.00 0.00 ? 70  ALA A CB   2  
ATOM 2799  H H    . ALA A 1 70  ? -0.857  -11.524 -4.915  1.00 0.00 ? 70  ALA A H    2  
ATOM 2800  H HA   . ALA A 1 70  ? -0.300  -11.130 -7.706  1.00 0.00 ? 70  ALA A HA   2  
ATOM 2801  H HB1  . ALA A 1 70  ? -2.064  -9.778  -7.356  1.00 0.00 ? 70  ALA A HB1  2  
ATOM 2802  H HB2  . ALA A 1 70  ? -1.887  -9.910  -5.590  1.00 0.00 ? 70  ALA A HB2  2  
ATOM 2803  H HB3  . ALA A 1 70  ? -0.966  -8.679  -6.488  1.00 0.00 ? 70  ALA A HB3  2  
ATOM 2804  N N    . ASN A 1 71  ? 1.948   -10.581 -5.665  1.00 0.00 ? 71  ASN A N    2  
ATOM 2805  C CA   . ASN A 1 71  ? 3.282   -10.060 -5.422  1.00 0.00 ? 71  ASN A CA   2  
ATOM 2806  C C    . ASN A 1 71  ? 3.214   -8.536  -5.296  1.00 0.00 ? 71  ASN A C    2  
ATOM 2807  O O    . ASN A 1 71  ? 3.792   -7.816  -6.108  1.00 0.00 ? 71  ASN A O    2  
ATOM 2808  C CB   . ASN A 1 71  ? 4.224   -10.396 -6.580  1.00 0.00 ? 71  ASN A CB   2  
ATOM 2809  C CG   . ASN A 1 71  ? 5.663   -10.559 -6.086  1.00 0.00 ? 71  ASN A CG   2  
ATOM 2810  O OD1  . ASN A 1 71  ? 5.920   -10.930 -4.952  1.00 0.00 ? 71  ASN A OD1  2  
ATOM 2811  N ND2  . ASN A 1 71  ? 6.585   -10.262 -6.998  1.00 0.00 ? 71  ASN A ND2  2  
ATOM 2812  H H    . ASN A 1 71  ? 1.694   -11.370 -5.105  1.00 0.00 ? 71  ASN A H    2  
ATOM 2813  H HA   . ASN A 1 71  ? 3.614   -10.540 -4.502  1.00 0.00 ? 71  ASN A HA   2  
ATOM 2814  H HB2  . ASN A 1 71  ? 3.896   -11.316 -7.065  1.00 0.00 ? 71  ASN A HB2  2  
ATOM 2815  H HB3  . ASN A 1 71  ? 4.181   -9.607  -7.330  1.00 0.00 ? 71  ASN A HB3  2  
ATOM 2816  H HD21 . ASN A 1 71  ? 6.307   -9.963  -7.911  1.00 0.00 ? 71  ASN A HD21 2  
ATOM 2817  H HD22 . ASN A 1 71  ? 7.556   -10.337 -6.770  1.00 0.00 ? 71  ASN A HD22 2  
ATOM 2818  N N    . ILE A 1 72  ? 2.503   -8.091  -4.271  1.00 0.00 ? 72  ILE A N    2  
ATOM 2819  C CA   . ILE A 1 72  ? 2.352   -6.666  -4.028  1.00 0.00 ? 72  ILE A CA   2  
ATOM 2820  C C    . ILE A 1 72  ? 3.201   -6.267  -2.819  1.00 0.00 ? 72  ILE A C    2  
ATOM 2821  O O    . ILE A 1 72  ? 2.871   -6.608  -1.684  1.00 0.00 ? 72  ILE A O    2  
ATOM 2822  C CB   . ILE A 1 72  ? 0.873   -6.300  -3.888  1.00 0.00 ? 72  ILE A CB   2  
ATOM 2823  C CG1  . ILE A 1 72  ? 0.045   -6.920  -5.016  1.00 0.00 ? 72  ILE A CG1  2  
ATOM 2824  C CG2  . ILE A 1 72  ? 0.688   -4.784  -3.809  1.00 0.00 ? 72  ILE A CG2  2  
ATOM 2825  C CD1  . ILE A 1 72  ? -1.450  -6.697  -4.785  1.00 0.00 ? 72  ILE A CD1  2  
ATOM 2826  H H    . ILE A 1 72  ? 2.036   -8.683  -3.615  1.00 0.00 ? 72  ILE A H    2  
ATOM 2827  H HA   . ILE A 1 72  ? 2.732   -6.143  -4.905  1.00 0.00 ? 72  ILE A HA   2  
ATOM 2828  H HB   . ILE A 1 72  ? 0.505   -6.719  -2.951  1.00 0.00 ? 72  ILE A HB   2  
ATOM 2829  H HG12 . ILE A 1 72  ? 0.339   -6.483  -5.970  1.00 0.00 ? 72  ILE A HG12 2  
ATOM 2830  H HG13 . ILE A 1 72  ? 0.252   -7.989  -5.078  1.00 0.00 ? 72  ILE A HG13 2  
ATOM 2831  H HG21 . ILE A 1 72  ? 1.664   -4.299  -3.788  1.00 0.00 ? 72  ILE A HG21 2  
ATOM 2832  H HG22 . ILE A 1 72  ? 0.131   -4.439  -4.680  1.00 0.00 ? 72  ILE A HG22 2  
ATOM 2833  H HG23 . ILE A 1 72  ? 0.138   -4.531  -2.902  1.00 0.00 ? 72  ILE A HG23 2  
ATOM 2834  H HD11 . ILE A 1 72  ? -1.592  -6.060  -3.913  1.00 0.00 ? 72  ILE A HD11 2  
ATOM 2835  H HD12 . ILE A 1 72  ? -1.885  -6.215  -5.661  1.00 0.00 ? 72  ILE A HD12 2  
ATOM 2836  H HD13 . ILE A 1 72  ? -1.940  -7.657  -4.618  1.00 0.00 ? 72  ILE A HD13 2  
ATOM 2837  N N    . ARG A 1 73  ? 4.278   -5.549  -3.104  1.00 0.00 ? 73  ARG A N    2  
ATOM 2838  C CA   . ARG A 1 73  ? 5.176   -5.099  -2.055  1.00 0.00 ? 73  ARG A CA   2  
ATOM 2839  C C    . ARG A 1 73  ? 4.384   -4.441  -0.924  1.00 0.00 ? 73  ARG A C    2  
ATOM 2840  O O    . ARG A 1 73  ? 3.599   -3.525  -1.162  1.00 0.00 ? 73  ARG A O    2  
ATOM 2841  C CB   . ARG A 1 73  ? 6.202   -4.102  -2.598  1.00 0.00 ? 73  ARG A CB   2  
ATOM 2842  C CG   . ARG A 1 73  ? 5.569   -2.726  -2.811  1.00 0.00 ? 73  ARG A CG   2  
ATOM 2843  C CD   . ARG A 1 73  ? 6.482   -1.826  -3.646  1.00 0.00 ? 73  ARG A CD   2  
ATOM 2844  N NE   . ARG A 1 73  ? 6.795   -2.480  -4.936  1.00 0.00 ? 73  ARG A NE   2  
ATOM 2845  C CZ   . ARG A 1 73  ? 5.982   -2.470  -6.000  1.00 0.00 ? 73  ARG A CZ   2  
ATOM 2846  N NH1  . ARG A 1 73  ? 4.801   -1.840  -5.936  1.00 0.00 ? 73  ARG A NH1  2  
ATOM 2847  N NH2  . ARG A 1 73  ? 6.348   -3.091  -7.130  1.00 0.00 ? 73  ARG A NH2  2  
ATOM 2848  H H    . ARG A 1 73  ? 4.538   -5.276  -4.030  1.00 0.00 ? 73  ARG A H    2  
ATOM 2849  H HA   . ARG A 1 73  ? 5.676   -6.005  -1.709  1.00 0.00 ? 73  ARG A HA   2  
ATOM 2850  H HB2  . ARG A 1 73  ? 7.037   -4.019  -1.902  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 2851  H HB3  . ARG A 1 73  ? 6.608   -4.470  -3.540  1.00 0.00 ? 73  ARG A HB3  2  
ATOM 2852  H HG2  . ARG A 1 73  ? 4.607   -2.837  -3.310  1.00 0.00 ? 73  ARG A HG2  2  
ATOM 2853  H HG3  . ARG A 1 73  ? 5.375   -2.258  -1.846  1.00 0.00 ? 73  ARG A HG3  2  
ATOM 2854  H HD2  . ARG A 1 73  ? 5.996   -0.866  -3.824  1.00 0.00 ? 73  ARG A HD2  2  
ATOM 2855  H HD3  . ARG A 1 73  ? 7.403   -1.621  -3.100  1.00 0.00 ? 73  ARG A HD3  2  
ATOM 2856  H HE   . ARG A 1 73  ? 7.669   -2.960  -5.018  1.00 0.00 ? 73  ARG A HE   2  
ATOM 2857  H HH11 . ARG A 1 73  ? 4.527   -1.377  -5.093  1.00 0.00 ? 73  ARG A HH11 2  
ATOM 2858  H HH12 . ARG A 1 73  ? 4.194   -1.832  -6.730  1.00 0.00 ? 73  ARG A HH12 2  
ATOM 2859  H HH21 . ARG A 1 73  ? 7.229   -3.561  -7.178  1.00 0.00 ? 73  ARG A HH21 2  
ATOM 2860  H HH22 . ARG A 1 73  ? 5.741   -3.083  -7.924  1.00 0.00 ? 73  ARG A HH22 2  
ATOM 2861  N N    . VAL A 1 74  ? 4.618   -4.933  0.284   1.00 0.00 ? 74  VAL A N    2  
ATOM 2862  C CA   . VAL A 1 74  ? 3.937   -4.403  1.453   1.00 0.00 ? 74  VAL A CA   2  
ATOM 2863  C C    . VAL A 1 74  ? 4.847   -3.395  2.156   1.00 0.00 ? 74  VAL A C    2  
ATOM 2864  O O    . VAL A 1 74  ? 6.024   -3.671  2.386   1.00 0.00 ? 74  VAL A O    2  
ATOM 2865  C CB   . VAL A 1 74  ? 3.497   -5.549  2.366   1.00 0.00 ? 74  VAL A CB   2  
ATOM 2866  C CG1  . VAL A 1 74  ? 2.623   -5.034  3.511   1.00 0.00 ? 74  VAL A CG1  2  
ATOM 2867  C CG2  . VAL A 1 74  ? 2.772   -6.637  1.571   1.00 0.00 ? 74  VAL A CG2  2  
ATOM 2868  H H    . VAL A 1 74  ? 5.259   -5.678  0.470   1.00 0.00 ? 74  VAL A H    2  
ATOM 2869  H HA   . VAL A 1 74  ? 3.042   -3.886  1.106   1.00 0.00 ? 74  VAL A HA   2  
ATOM 2870  H HB   . VAL A 1 74  ? 4.392   -5.994  2.801   1.00 0.00 ? 74  VAL A HB   2  
ATOM 2871  H HG11 . VAL A 1 74  ? 1.885   -4.334  3.119   1.00 0.00 ? 74  VAL A HG11 2  
ATOM 2872  H HG12 . VAL A 1 74  ? 2.112   -5.872  3.985   1.00 0.00 ? 74  VAL A HG12 2  
ATOM 2873  H HG13 . VAL A 1 74  ? 3.249   -4.527  4.246   1.00 0.00 ? 74  VAL A HG13 2  
ATOM 2874  H HG21 . VAL A 1 74  ? 3.423   -7.505  1.465   1.00 0.00 ? 74  VAL A HG21 2  
ATOM 2875  H HG22 . VAL A 1 74  ? 1.862   -6.927  2.097   1.00 0.00 ? 74  VAL A HG22 2  
ATOM 2876  H HG23 . VAL A 1 74  ? 2.514   -6.254  0.583   1.00 0.00 ? 74  VAL A HG23 2  
ATOM 2877  N N    . VAL A 1 75  ? 4.269   -2.247  2.477   1.00 0.00 ? 75  VAL A N    2  
ATOM 2878  C CA   . VAL A 1 75  ? 5.014   -1.196  3.149   1.00 0.00 ? 75  VAL A CA   2  
ATOM 2879  C C    . VAL A 1 75  ? 4.241   -0.742  4.389   1.00 0.00 ? 75  VAL A C    2  
ATOM 2880  O O    . VAL A 1 75  ? 3.102   -1.155  4.601   1.00 0.00 ? 75  VAL A O    2  
ATOM 2881  C CB   . VAL A 1 75  ? 5.302   -0.053  2.174   1.00 0.00 ? 75  VAL A CB   2  
ATOM 2882  C CG1  . VAL A 1 75  ? 6.173   -0.532  1.011   1.00 0.00 ? 75  VAL A CG1  2  
ATOM 2883  C CG2  . VAL A 1 75  ? 4.003   0.574   1.664   1.00 0.00 ? 75  VAL A CG2  2  
ATOM 2884  H H    . VAL A 1 75  ? 3.311   -2.030  2.286   1.00 0.00 ? 75  VAL A H    2  
ATOM 2885  H HA   . VAL A 1 75  ? 5.967   -1.619  3.465   1.00 0.00 ? 75  VAL A HA   2  
ATOM 2886  H HB   . VAL A 1 75  ? 5.856   0.716   2.712   1.00 0.00 ? 75  VAL A HB   2  
ATOM 2887  H HG11 . VAL A 1 75  ? 5.980   -1.589  0.823   1.00 0.00 ? 75  VAL A HG11 2  
ATOM 2888  H HG12 . VAL A 1 75  ? 5.936   0.045   0.117   1.00 0.00 ? 75  VAL A HG12 2  
ATOM 2889  H HG13 . VAL A 1 75  ? 7.225   -0.395  1.263   1.00 0.00 ? 75  VAL A HG13 2  
ATOM 2890  H HG21 . VAL A 1 75  ? 3.847   0.290   0.623   1.00 0.00 ? 75  VAL A HG21 2  
ATOM 2891  H HG22 . VAL A 1 75  ? 3.168   0.219   2.266   1.00 0.00 ? 75  VAL A HG22 2  
ATOM 2892  H HG23 . VAL A 1 75  ? 4.070   1.659   1.739   1.00 0.00 ? 75  VAL A HG23 2  
ATOM 2893  N N    . SER A 1 76  ? 4.891   0.102   5.177   1.00 0.00 ? 76  SER A N    2  
ATOM 2894  C CA   . SER A 1 76  ? 4.279   0.617   6.390   1.00 0.00 ? 76  SER A CA   2  
ATOM 2895  C C    . SER A 1 76  ? 3.472   1.878   6.075   1.00 0.00 ? 76  SER A C    2  
ATOM 2896  O O    . SER A 1 76  ? 3.384   2.290   4.920   1.00 0.00 ? 76  SER A O    2  
ATOM 2897  C CB   . SER A 1 76  ? 5.336   0.915   7.456   1.00 0.00 ? 76  SER A CB   2  
ATOM 2898  O OG   . SER A 1 76  ? 5.689   2.295   7.486   1.00 0.00 ? 76  SER A OG   2  
ATOM 2899  H H    . SER A 1 76  ? 5.817   0.434   4.997   1.00 0.00 ? 76  SER A H    2  
ATOM 2900  H HA   . SER A 1 76  ? 3.623   -0.179  6.742   1.00 0.00 ? 76  SER A HA   2  
ATOM 2901  H HB2  . SER A 1 76  ? 4.958   0.616   8.434   1.00 0.00 ? 76  SER A HB2  2  
ATOM 2902  H HB3  . SER A 1 76  ? 6.226   0.316   7.262   1.00 0.00 ? 76  SER A HB3  2  
ATOM 2903  H HG   . SER A 1 76  ? 5.799   2.640   6.554   1.00 0.00 ? 76  SER A HG   2  
ATOM 2904  N N    . GLU A 1 77  ? 2.904   2.455   7.123   1.00 0.00 ? 77  GLU A N    2  
ATOM 2905  C CA   . GLU A 1 77  ? 2.107   3.661   6.973   1.00 0.00 ? 77  GLU A CA   2  
ATOM 2906  C C    . GLU A 1 77  ? 3.016   4.877   6.782   1.00 0.00 ? 77  GLU A C    2  
ATOM 2907  O O    . GLU A 1 77  ? 2.684   5.792   6.029   1.00 0.00 ? 77  GLU A O    2  
ATOM 2908  C CB   . GLU A 1 77  ? 1.176   3.856   8.171   1.00 0.00 ? 77  GLU A CB   2  
ATOM 2909  C CG   . GLU A 1 77  ? -0.247  4.180   7.712   1.00 0.00 ? 77  GLU A CG   2  
ATOM 2910  C CD   . GLU A 1 77  ? -0.693  5.548   8.233   1.00 0.00 ? 77  GLU A CD   2  
ATOM 2911  O OE1  . GLU A 1 77  ? -0.516  5.778   9.448   1.00 0.00 ? 77  GLU A OE1  2  
ATOM 2912  O OE2  . GLU A 1 77  ? -1.201  6.332   7.403   1.00 0.00 ? 77  GLU A OE2  2  
ATOM 2913  H H    . GLU A 1 77  ? 2.980   2.113   8.060   1.00 0.00 ? 77  GLU A H    2  
ATOM 2914  H HA   . GLU A 1 77  ? 1.508   3.502   6.077   1.00 0.00 ? 77  GLU A HA   2  
ATOM 2915  H HB2  . GLU A 1 77  ? 1.168   2.952   8.781   1.00 0.00 ? 77  GLU A HB2  2  
ATOM 2916  H HB3  . GLU A 1 77  ? 1.551   4.662   8.801   1.00 0.00 ? 77  GLU A HB3  2  
ATOM 2917  H HG2  . GLU A 1 77  ? -0.294  4.168   6.623   1.00 0.00 ? 77  GLU A HG2  2  
ATOM 2918  H HG3  . GLU A 1 77  ? -0.932  3.410   8.069   1.00 0.00 ? 77  GLU A HG3  2  
ATOM 2919  N N    . ASP A 1 78  ? 4.144   4.848   7.476   1.00 0.00 ? 78  ASP A N    2  
ATOM 2920  C CA   . ASP A 1 78  ? 5.103   5.937   7.392   1.00 0.00 ? 78  ASP A CA   2  
ATOM 2921  C C    . ASP A 1 78  ? 5.380   6.254   5.921   1.00 0.00 ? 78  ASP A C    2  
ATOM 2922  O O    . ASP A 1 78  ? 5.723   7.385   5.580   1.00 0.00 ? 78  ASP A O    2  
ATOM 2923  C CB   . ASP A 1 78  ? 6.429   5.554   8.051   1.00 0.00 ? 78  ASP A CB   2  
ATOM 2924  C CG   . ASP A 1 78  ? 6.337   5.216   9.541   1.00 0.00 ? 78  ASP A CG   2  
ATOM 2925  O OD1  . ASP A 1 78  ? 5.205   5.273   10.067  1.00 0.00 ? 78  ASP A OD1  2  
ATOM 2926  O OD2  . ASP A 1 78  ? 7.401   4.907   10.119  1.00 0.00 ? 78  ASP A OD2  2  
ATOM 2927  H H    . ASP A 1 78  ? 4.406   4.100   8.086   1.00 0.00 ? 78  ASP A H    2  
ATOM 2928  H HA   . ASP A 1 78  ? 4.637   6.770   7.918   1.00 0.00 ? 78  ASP A HA   2  
ATOM 2929  H HB2  . ASP A 1 78  ? 6.846   4.696   7.524   1.00 0.00 ? 78  ASP A HB2  2  
ATOM 2930  H HB3  . ASP A 1 78  ? 7.132   6.378   7.924   1.00 0.00 ? 78  ASP A HB3  2  
ATOM 2931  N N    . PHE A 1 79  ? 5.221   5.235   5.089   1.00 0.00 ? 79  PHE A N    2  
ATOM 2932  C CA   . PHE A 1 79  ? 5.450   5.391   3.663   1.00 0.00 ? 79  PHE A CA   2  
ATOM 2933  C C    . PHE A 1 79  ? 4.710   6.615   3.119   1.00 0.00 ? 79  PHE A C    2  
ATOM 2934  O O    . PHE A 1 79  ? 5.299   7.443   2.425   1.00 0.00 ? 79  PHE A O    2  
ATOM 2935  C CB   . PHE A 1 79  ? 4.902   4.135   2.982   1.00 0.00 ? 79  PHE A CB   2  
ATOM 2936  C CG   . PHE A 1 79  ? 4.610   4.313   1.490   1.00 0.00 ? 79  PHE A CG   2  
ATOM 2937  C CD1  . PHE A 1 79  ? 5.637   4.412   0.604   1.00 0.00 ? 79  PHE A CD1  2  
ATOM 2938  C CD2  . PHE A 1 79  ? 3.324   4.373   1.051   1.00 0.00 ? 79  PHE A CD2  2  
ATOM 2939  C CE1  . PHE A 1 79  ? 5.366   4.577   -0.780  1.00 0.00 ? 79  PHE A CE1  2  
ATOM 2940  C CE2  . PHE A 1 79  ? 3.054   4.538   -0.333  1.00 0.00 ? 79  PHE A CE2  2  
ATOM 2941  C CZ   . PHE A 1 79  ? 4.081   4.637   -1.220  1.00 0.00 ? 79  PHE A CZ   2  
ATOM 2942  H H    . PHE A 1 79  ? 4.942   4.318   5.374   1.00 0.00 ? 79  PHE A H    2  
ATOM 2943  H HA   . PHE A 1 79  ? 6.522   5.523   3.520   1.00 0.00 ? 79  PHE A HA   2  
ATOM 2944  H HB2  . PHE A 1 79  ? 5.618   3.324   3.107   1.00 0.00 ? 79  PHE A HB2  2  
ATOM 2945  H HB3  . PHE A 1 79  ? 3.985   3.832   3.487   1.00 0.00 ? 79  PHE A HB3  2  
ATOM 2946  H HD1  . PHE A 1 79  ? 6.667   4.364   0.956   1.00 0.00 ? 79  PHE A HD1  2  
ATOM 2947  H HD2  . PHE A 1 79  ? 2.502   4.294   1.761   1.00 0.00 ? 79  PHE A HD2  2  
ATOM 2948  H HE1  . PHE A 1 79  ? 6.189   4.656   -1.491  1.00 0.00 ? 79  PHE A HE1  2  
ATOM 2949  H HE2  . PHE A 1 79  ? 2.024   4.586   -0.685  1.00 0.00 ? 79  PHE A HE2  2  
ATOM 2950  H HZ   . PHE A 1 79  ? 3.873   4.764   -2.282  1.00 0.00 ? 79  PHE A HZ   2  
ATOM 2951  N N    . LEU A 1 80  ? 3.431   6.692   3.457   1.00 0.00 ? 80  LEU A N    2  
ATOM 2952  C CA   . LEU A 1 80  ? 2.606   7.802   3.011   1.00 0.00 ? 80  LEU A CA   2  
ATOM 2953  C C    . LEU A 1 80  ? 3.204   9.114   3.521   1.00 0.00 ? 80  LEU A C    2  
ATOM 2954  O O    . LEU A 1 80  ? 3.199   10.120  2.812   1.00 0.00 ? 80  LEU A O    2  
ATOM 2955  C CB   . LEU A 1 80  ? 1.149   7.587   3.429   1.00 0.00 ? 80  LEU A CB   2  
ATOM 2956  C CG   . LEU A 1 80  ? 0.393   6.485   2.684   1.00 0.00 ? 80  LEU A CG   2  
ATOM 2957  C CD1  . LEU A 1 80  ? -0.880  6.091   3.435   1.00 0.00 ? 80  LEU A CD1  2  
ATOM 2958  C CD2  . LEU A 1 80  ? 0.103   6.899   1.240   1.00 0.00 ? 80  LEU A CD2  2  
ATOM 2959  H H    . LEU A 1 80  ? 2.960   6.015   4.022   1.00 0.00 ? 80  LEU A H    2  
ATOM 2960  H HA   . LEU A 1 80  ? 2.630   7.811   1.922   1.00 0.00 ? 80  LEU A HA   2  
ATOM 2961  H HB2  . LEU A 1 80  ? 1.128   7.359   4.495   1.00 0.00 ? 80  LEU A HB2  2  
ATOM 2962  H HB3  . LEU A 1 80  ? 0.611   8.525   3.293   1.00 0.00 ? 80  LEU A HB3  2  
ATOM 2963  H HG   . LEU A 1 80  ? 1.030   5.601   2.644   1.00 0.00 ? 80  LEU A HG   2  
ATOM 2964  H HD11 . LEU A 1 80  ? -1.750  6.317   2.818   1.00 0.00 ? 80  LEU A HD11 2  
ATOM 2965  H HD12 . LEU A 1 80  ? -0.857  5.023   3.653   1.00 0.00 ? 80  LEU A HD12 2  
ATOM 2966  H HD13 . LEU A 1 80  ? -0.941  6.652   4.367   1.00 0.00 ? 80  LEU A HD13 2  
ATOM 2967  H HD21 . LEU A 1 80  ? 1.043   7.058   0.712   1.00 0.00 ? 80  LEU A HD21 2  
ATOM 2968  H HD22 . LEU A 1 80  ? -0.464  6.111   0.744   1.00 0.00 ? 80  LEU A HD22 2  
ATOM 2969  H HD23 . LEU A 1 80  ? -0.477  7.822   1.236   1.00 0.00 ? 80  LEU A HD23 2  
ATOM 2970  N N    . GLN A 1 81  ? 3.707   9.063   4.746   1.00 0.00 ? 81  GLN A N    2  
ATOM 2971  C CA   . GLN A 1 81  ? 4.308   10.235  5.358   1.00 0.00 ? 81  GLN A CA   2  
ATOM 2972  C C    . GLN A 1 81  ? 5.550   10.665  4.575   1.00 0.00 ? 81  GLN A C    2  
ATOM 2973  O O    . GLN A 1 81  ? 5.932   11.833  4.603   1.00 0.00 ? 81  GLN A O    2  
ATOM 2974  C CB   . GLN A 1 81  ? 4.649   9.972   6.827   1.00 0.00 ? 81  GLN A CB   2  
ATOM 2975  C CG   . GLN A 1 81  ? 5.716   10.949  7.325   1.00 0.00 ? 81  GLN A CG   2  
ATOM 2976  C CD   . GLN A 1 81  ? 5.197   12.389  7.296   1.00 0.00 ? 81  GLN A CD   2  
ATOM 2977  O OE1  . GLN A 1 81  ? 4.104   12.673  6.836   1.00 0.00 ? 81  GLN A OE1  2  
ATOM 2978  N NE2  . GLN A 1 81  ? 6.041   13.278  7.812   1.00 0.00 ? 81  GLN A NE2  2  
ATOM 2979  H H    . GLN A 1 81  ? 3.707   8.241   5.316   1.00 0.00 ? 81  GLN A H    2  
ATOM 2980  H HA   . GLN A 1 81  ? 3.547   11.014  5.302   1.00 0.00 ? 81  GLN A HA   2  
ATOM 2981  H HB2  . GLN A 1 81  ? 3.750   10.069  7.435   1.00 0.00 ? 81  GLN A HB2  2  
ATOM 2982  H HB3  . GLN A 1 81  ? 5.005   8.949   6.944   1.00 0.00 ? 81  GLN A HB3  2  
ATOM 2983  H HG2  . GLN A 1 81  ? 6.010   10.685  8.341   1.00 0.00 ? 81  GLN A HG2  2  
ATOM 2984  H HG3  . GLN A 1 81  ? 6.607   10.868  6.703   1.00 0.00 ? 81  GLN A HG3  2  
ATOM 2985  H HE21 . GLN A 1 81  ? 6.924   12.978  8.174   1.00 0.00 ? 81  GLN A HE21 2  
ATOM 2986  H HE22 . GLN A 1 81  ? 5.792   14.246  7.839   1.00 0.00 ? 81  GLN A HE22 2  
ATOM 2987  N N    . ASP A 1 82  ? 6.146   9.696   3.895   1.00 0.00 ? 82  ASP A N    2  
ATOM 2988  C CA   . ASP A 1 82  ? 7.337   9.960   3.106   1.00 0.00 ? 82  ASP A CA   2  
ATOM 2989  C C    . ASP A 1 82  ? 6.931   10.261  1.662   1.00 0.00 ? 82  ASP A C    2  
ATOM 2990  O O    . ASP A 1 82  ? 7.286   11.306  1.119   1.00 0.00 ? 82  ASP A O    2  
ATOM 2991  C CB   . ASP A 1 82  ? 8.268   8.745   3.091   1.00 0.00 ? 82  ASP A CB   2  
ATOM 2992  C CG   . ASP A 1 82  ? 9.610   8.951   3.796   1.00 0.00 ? 82  ASP A CG   2  
ATOM 2993  O OD1  . ASP A 1 82  ? 9.576   9.382   4.969   1.00 0.00 ? 82  ASP A OD1  2  
ATOM 2994  O OD2  . ASP A 1 82  ? 10.641  8.672   3.146   1.00 0.00 ? 82  ASP A OD2  2  
ATOM 2995  H H    . ASP A 1 82  ? 5.829   8.748   3.878   1.00 0.00 ? 82  ASP A H    2  
ATOM 2996  H HA   . ASP A 1 82  ? 7.819   10.809  3.590   1.00 0.00 ? 82  ASP A HA   2  
ATOM 2997  H HB2  . ASP A 1 82  ? 7.753   7.906   3.560   1.00 0.00 ? 82  ASP A HB2  2  
ATOM 2998  H HB3  . ASP A 1 82  ? 8.458   8.465   2.055   1.00 0.00 ? 82  ASP A HB3  2  
ATOM 2999  N N    . VAL A 1 83  ? 6.192   9.327   1.082   1.00 0.00 ? 83  VAL A N    2  
ATOM 3000  C CA   . VAL A 1 83  ? 5.733   9.480   -0.288  1.00 0.00 ? 83  VAL A CA   2  
ATOM 3001  C C    . VAL A 1 83  ? 5.039   10.835  -0.441  1.00 0.00 ? 83  VAL A C    2  
ATOM 3002  O O    . VAL A 1 83  ? 5.143   11.476  -1.486  1.00 0.00 ? 83  VAL A O    2  
ATOM 3003  C CB   . VAL A 1 83  ? 4.837   8.302   -0.675  1.00 0.00 ? 83  VAL A CB   2  
ATOM 3004  C CG1  . VAL A 1 83  ? 3.374   8.591   -0.332  1.00 0.00 ? 83  VAL A CG1  2  
ATOM 3005  C CG2  . VAL A 1 83  ? 4.995   7.956   -2.157  1.00 0.00 ? 83  VAL A CG2  2  
ATOM 3006  H H    . VAL A 1 83  ? 5.908   8.480   1.531   1.00 0.00 ? 83  VAL A H    2  
ATOM 3007  H HA   . VAL A 1 83  ? 6.612   9.462   -0.933  1.00 0.00 ? 83  VAL A HA   2  
ATOM 3008  H HB   . VAL A 1 83  ? 5.153   7.436   -0.093  1.00 0.00 ? 83  VAL A HB   2  
ATOM 3009  H HG11 . VAL A 1 83  ? 2.839   7.650   -0.204  1.00 0.00 ? 83  VAL A HG11 2  
ATOM 3010  H HG12 . VAL A 1 83  ? 3.324   9.165   0.593   1.00 0.00 ? 83  VAL A HG12 2  
ATOM 3011  H HG13 . VAL A 1 83  ? 2.917   9.162   -1.140  1.00 0.00 ? 83  VAL A HG13 2  
ATOM 3012  H HG21 . VAL A 1 83  ? 4.112   7.415   -2.499  1.00 0.00 ? 83  VAL A HG21 2  
ATOM 3013  H HG22 . VAL A 1 83  ? 5.105   8.874   -2.734  1.00 0.00 ? 83  VAL A HG22 2  
ATOM 3014  H HG23 . VAL A 1 83  ? 5.878   7.333   -2.292  1.00 0.00 ? 83  VAL A HG23 2  
ATOM 3015  N N    . SER A 1 84  ? 4.346   11.231  0.616   1.00 0.00 ? 84  SER A N    2  
ATOM 3016  C CA   . SER A 1 84  ? 3.634   12.498  0.613   1.00 0.00 ? 84  SER A CA   2  
ATOM 3017  C C    . SER A 1 84  ? 4.600   13.642  0.930   1.00 0.00 ? 84  SER A C    2  
ATOM 3018  O O    . SER A 1 84  ? 4.412   14.765  0.466   1.00 0.00 ? 84  SER A O    2  
ATOM 3019  C CB   . SER A 1 84  ? 2.480   12.484  1.617   1.00 0.00 ? 84  SER A CB   2  
ATOM 3020  O OG   . SER A 1 84  ? 1.568   13.557  1.397   1.00 0.00 ? 84  SER A OG   2  
ATOM 3021  H H    . SER A 1 84  ? 4.266   10.704  1.462   1.00 0.00 ? 84  SER A H    2  
ATOM 3022  H HA   . SER A 1 84  ? 3.236   12.603  -0.396  1.00 0.00 ? 84  SER A HA   2  
ATOM 3023  H HB2  . SER A 1 84  ? 1.948   11.536  1.545   1.00 0.00 ? 84  SER A HB2  2  
ATOM 3024  H HB3  . SER A 1 84  ? 2.879   12.550  2.629   1.00 0.00 ? 84  SER A HB3  2  
ATOM 3025  H HG   . SER A 1 84  ? 1.606   14.201  2.161   1.00 0.00 ? 84  SER A HG   2  
ATOM 3026  N N    . ALA A 1 85  ? 5.614   13.316  1.719   1.00 0.00 ? 85  ALA A N    2  
ATOM 3027  C CA   . ALA A 1 85  ? 6.609   14.302  2.104   1.00 0.00 ? 85  ALA A CA   2  
ATOM 3028  C C    . ALA A 1 85  ? 8.007   13.720  1.885   1.00 0.00 ? 85  ALA A C    2  
ATOM 3029  O O    . ALA A 1 85  ? 8.738   13.472  2.843   1.00 0.00 ? 85  ALA A O    2  
ATOM 3030  C CB   . ALA A 1 85  ? 6.375   14.725  3.555   1.00 0.00 ? 85  ALA A CB   2  
ATOM 3031  H H    . ALA A 1 85  ? 5.759   12.400  2.093   1.00 0.00 ? 85  ALA A H    2  
ATOM 3032  H HA   . ALA A 1 85  ? 6.481   15.172  1.460   1.00 0.00 ? 85  ALA A HA   2  
ATOM 3033  H HB1  . ALA A 1 85  ? 5.422   14.323  3.902   1.00 0.00 ? 85  ALA A HB1  2  
ATOM 3034  H HB2  . ALA A 1 85  ? 7.180   14.339  4.181   1.00 0.00 ? 85  ALA A HB2  2  
ATOM 3035  H HB3  . ALA A 1 85  ? 6.355   15.813  3.618   1.00 0.00 ? 85  ALA A HB3  2  
ATOM 3036  N N    . SER A 1 86  ? 8.338   13.520  0.618   1.00 0.00 ? 86  SER A N    2  
ATOM 3037  C CA   . SER A 1 86  ? 9.636   12.972  0.260   1.00 0.00 ? 86  SER A CA   2  
ATOM 3038  C C    . SER A 1 86  ? 9.756   12.860  -1.261  1.00 0.00 ? 86  SER A C    2  
ATOM 3039  O O    . SER A 1 86  ? 8.929   12.219  -1.907  1.00 0.00 ? 86  SER A O    2  
ATOM 3040  C CB   . SER A 1 86  ? 9.855   11.605  0.912   1.00 0.00 ? 86  SER A CB   2  
ATOM 3041  O OG   . SER A 1 86  ? 11.239  11.296  1.051   1.00 0.00 ? 86  SER A OG   2  
ATOM 3042  H H    . SER A 1 86  ? 7.738   13.724  -0.156  1.00 0.00 ? 86  SER A H    2  
ATOM 3043  H HA   . SER A 1 86  ? 10.366  13.681  0.651   1.00 0.00 ? 86  SER A HA   2  
ATOM 3044  H HB2  . SER A 1 86  ? 9.380   11.591  1.893   1.00 0.00 ? 86  SER A HB2  2  
ATOM 3045  H HB3  . SER A 1 86  ? 9.370   10.836  0.312   1.00 0.00 ? 86  SER A HB3  2  
ATOM 3046  H HG   . SER A 1 86  ? 11.375  10.674  1.822   1.00 0.00 ? 86  SER A HG   2  
ATOM 3047  N N    . THR A 1 87  ? 10.792  13.495  -1.789  1.00 0.00 ? 87  THR A N    2  
ATOM 3048  C CA   . THR A 1 87  ? 11.031  13.474  -3.222  1.00 0.00 ? 87  THR A CA   2  
ATOM 3049  C C    . THR A 1 87  ? 11.926  12.291  -3.597  1.00 0.00 ? 87  THR A C    2  
ATOM 3050  O O    . THR A 1 87  ? 12.881  12.446  -4.356  1.00 0.00 ? 87  THR A O    2  
ATOM 3051  C CB   . THR A 1 87  ? 11.617  14.830  -3.623  1.00 0.00 ? 87  THR A CB   2  
ATOM 3052  O OG1  . THR A 1 87  ? 12.782  14.958  -2.811  1.00 0.00 ? 87  THR A OG1  2  
ATOM 3053  C CG2  . THR A 1 87  ? 10.732  16.001  -3.192  1.00 0.00 ? 87  THR A CG2  2  
ATOM 3054  H H    . THR A 1 87  ? 11.461  14.014  -1.256  1.00 0.00 ? 87  THR A H    2  
ATOM 3055  H HA   . THR A 1 87  ? 10.077  13.327  -3.727  1.00 0.00 ? 87  THR A HA   2  
ATOM 3056  H HB   . THR A 1 87  ? 11.818  14.866  -4.693  1.00 0.00 ? 87  THR A HB   2  
ATOM 3057  H HG1  . THR A 1 87  ? 13.573  15.180  -3.381  1.00 0.00 ? 87  THR A HG1  2  
ATOM 3058  H HG21 . THR A 1 87  ? 9.997   15.653  -2.466  1.00 0.00 ? 87  THR A HG21 2  
ATOM 3059  H HG22 . THR A 1 87  ? 11.350  16.777  -2.741  1.00 0.00 ? 87  THR A HG22 2  
ATOM 3060  H HG23 . THR A 1 87  ? 10.217  16.407  -4.063  1.00 0.00 ? 87  THR A HG23 2  
ATOM 3061  N N    . LYS A 1 88  ? 11.584  11.135  -3.047  1.00 0.00 ? 88  LYS A N    2  
ATOM 3062  C CA   . LYS A 1 88  ? 12.344  9.926   -3.315  1.00 0.00 ? 88  LYS A CA   2  
ATOM 3063  C C    . LYS A 1 88  ? 11.559  9.039   -4.283  1.00 0.00 ? 88  LYS A C    2  
ATOM 3064  O O    . LYS A 1 88  ? 10.334  9.122   -4.353  1.00 0.00 ? 88  LYS A O    2  
ATOM 3065  C CB   . LYS A 1 88  ? 12.716  9.227   -2.006  1.00 0.00 ? 88  LYS A CB   2  
ATOM 3066  C CG   . LYS A 1 88  ? 13.625  10.112  -1.151  1.00 0.00 ? 88  LYS A CG   2  
ATOM 3067  C CD   . LYS A 1 88  ? 15.092  9.705   -1.307  1.00 0.00 ? 88  LYS A CD   2  
ATOM 3068  C CE   . LYS A 1 88  ? 15.651  9.157   0.008   1.00 0.00 ? 88  LYS A CE   2  
ATOM 3069  N NZ   . LYS A 1 88  ? 16.254  10.246  0.808   1.00 0.00 ? 88  LYS A NZ   2  
ATOM 3070  H H    . LYS A 1 88  ? 10.805  11.017  -2.431  1.00 0.00 ? 88  LYS A H    2  
ATOM 3071  H HA   . LYS A 1 88  ? 13.275  10.224  -3.797  1.00 0.00 ? 88  LYS A HA   2  
ATOM 3072  H HB2  . LYS A 1 88  ? 11.812  8.983   -1.448  1.00 0.00 ? 88  LYS A HB2  2  
ATOM 3073  H HB3  . LYS A 1 88  ? 13.220  8.285   -2.223  1.00 0.00 ? 88  LYS A HB3  2  
ATOM 3074  H HG2  . LYS A 1 88  ? 13.501  11.155  -1.442  1.00 0.00 ? 88  LYS A HG2  2  
ATOM 3075  H HG3  . LYS A 1 88  ? 13.333  10.036  -0.104  1.00 0.00 ? 88  LYS A HG3  2  
ATOM 3076  H HD2  . LYS A 1 88  ? 15.182  8.950   -2.088  1.00 0.00 ? 88  LYS A HD2  2  
ATOM 3077  H HD3  . LYS A 1 88  ? 15.680  10.565  -1.626  1.00 0.00 ? 88  LYS A HD3  2  
ATOM 3078  H HE2  . LYS A 1 88  ? 14.855  8.677   0.577   1.00 0.00 ? 88  LYS A HE2  2  
ATOM 3079  H HE3  . LYS A 1 88  ? 16.400  8.392   -0.200  1.00 0.00 ? 88  LYS A HE3  2  
ATOM 3080  H HZ1  . LYS A 1 88  ? 16.742  10.874  0.203   1.00 0.00 ? 88  LYS A HZ1  2  
ATOM 3081  H HZ2  . LYS A 1 88  ? 15.533  10.741  1.293   1.00 0.00 ? 88  LYS A HZ2  2  
ATOM 3082  H HZ3  . LYS A 1 88  ? 16.895  9.857   1.471   1.00 0.00 ? 88  LYS A HZ3  2  
ATOM 3083  N N    . SER A 1 89  ? 12.297  8.209   -5.006  1.00 0.00 ? 89  SER A N    2  
ATOM 3084  C CA   . SER A 1 89  ? 11.685  7.308   -5.968  1.00 0.00 ? 89  SER A CA   2  
ATOM 3085  C C    . SER A 1 89  ? 10.857  6.248   -5.238  1.00 0.00 ? 89  SER A C    2  
ATOM 3086  O O    . SER A 1 89  ? 11.306  5.681   -4.244  1.00 0.00 ? 89  SER A O    2  
ATOM 3087  C CB   . SER A 1 89  ? 12.744  6.641   -6.848  1.00 0.00 ? 89  SER A CB   2  
ATOM 3088  O OG   . SER A 1 89  ? 13.763  7.555   -7.243  1.00 0.00 ? 89  SER A OG   2  
ATOM 3089  H H    . SER A 1 89  ? 13.293  8.147   -4.943  1.00 0.00 ? 89  SER A H    2  
ATOM 3090  H HA   . SER A 1 89  ? 11.044  7.937   -6.585  1.00 0.00 ? 89  SER A HA   2  
ATOM 3091  H HB2  . SER A 1 89  ? 13.194  5.808   -6.307  1.00 0.00 ? 89  SER A HB2  2  
ATOM 3092  H HB3  . SER A 1 89  ? 12.267  6.223   -7.735  1.00 0.00 ? 89  SER A HB3  2  
ATOM 3093  H HG   . SER A 1 89  ? 14.395  7.110   -7.877  1.00 0.00 ? 89  SER A HG   2  
ATOM 3094  N N    . LEU A 1 90  ? 9.662   6.014   -5.761  1.00 0.00 ? 90  LEU A N    2  
ATOM 3095  C CA   . LEU A 1 90  ? 8.767   5.032   -5.172  1.00 0.00 ? 90  LEU A CA   2  
ATOM 3096  C C    . LEU A 1 90  ? 9.564   3.780   -4.800  1.00 0.00 ? 90  LEU A C    2  
ATOM 3097  O O    . LEU A 1 90  ? 9.658   3.426   -3.625  1.00 0.00 ? 90  LEU A O    2  
ATOM 3098  C CB   . LEU A 1 90  ? 7.587   4.755   -6.106  1.00 0.00 ? 90  LEU A CB   2  
ATOM 3099  C CG   . LEU A 1 90  ? 6.381   5.684   -5.956  1.00 0.00 ? 90  LEU A CG   2  
ATOM 3100  C CD1  . LEU A 1 90  ? 5.978   5.828   -4.487  1.00 0.00 ? 90  LEU A CD1  2  
ATOM 3101  C CD2  . LEU A 1 90  ? 6.649   7.040   -6.612  1.00 0.00 ? 90  LEU A CD2  2  
ATOM 3102  H H    . LEU A 1 90  ? 9.305   6.480   -6.570  1.00 0.00 ? 90  LEU A H    2  
ATOM 3103  H HA   . LEU A 1 90  ? 8.361   5.467   -4.259  1.00 0.00 ? 90  LEU A HA   2  
ATOM 3104  H HB2  . LEU A 1 90  ? 7.942   4.815   -7.135  1.00 0.00 ? 90  LEU A HB2  2  
ATOM 3105  H HB3  . LEU A 1 90  ? 7.254   3.730   -5.942  1.00 0.00 ? 90  LEU A HB3  2  
ATOM 3106  H HG   . LEU A 1 90  ? 5.537   5.235   -6.479  1.00 0.00 ? 90  LEU A HG   2  
ATOM 3107  H HD11 . LEU A 1 90  ? 6.091   4.867   -3.984  1.00 0.00 ? 90  LEU A HD11 2  
ATOM 3108  H HD12 . LEU A 1 90  ? 6.617   6.568   -4.006  1.00 0.00 ? 90  LEU A HD12 2  
ATOM 3109  H HD13 . LEU A 1 90  ? 4.939   6.150   -4.426  1.00 0.00 ? 90  LEU A HD13 2  
ATOM 3110  H HD21 . LEU A 1 90  ? 7.188   7.681   -5.914  1.00 0.00 ? 90  LEU A HD21 2  
ATOM 3111  H HD22 . LEU A 1 90  ? 7.250   6.897   -7.511  1.00 0.00 ? 90  LEU A HD22 2  
ATOM 3112  H HD23 . LEU A 1 90  ? 5.702   7.508   -6.879  1.00 0.00 ? 90  LEU A HD23 2  
ATOM 3113  N N    . GLN A 1 91  ? 10.119  3.145   -5.821  1.00 0.00 ? 91  GLN A N    2  
ATOM 3114  C CA   . GLN A 1 91  ? 10.905  1.940   -5.616  1.00 0.00 ? 91  GLN A CA   2  
ATOM 3115  C C    . GLN A 1 91  ? 11.766  2.076   -4.359  1.00 0.00 ? 91  GLN A C    2  
ATOM 3116  O O    . GLN A 1 91  ? 11.841  1.151   -3.551  1.00 0.00 ? 91  GLN A O    2  
ATOM 3117  C CB   . GLN A 1 91  ? 11.768  1.633   -6.841  1.00 0.00 ? 91  GLN A CB   2  
ATOM 3118  C CG   . GLN A 1 91  ? 11.254  0.396   -7.579  1.00 0.00 ? 91  GLN A CG   2  
ATOM 3119  C CD   . GLN A 1 91  ? 9.924   0.687   -8.277  1.00 0.00 ? 91  GLN A CD   2  
ATOM 3120  O OE1  . GLN A 1 91  ? 8.878   0.173   -7.916  1.00 0.00 ? 91  GLN A OE1  2  
ATOM 3121  N NE2  . GLN A 1 91  ? 10.021  1.539   -9.294  1.00 0.00 ? 91  GLN A NE2  2  
ATOM 3122  H H    . GLN A 1 91  ? 10.038  3.440   -6.774  1.00 0.00 ? 91  GLN A H    2  
ATOM 3123  H HA   . GLN A 1 91  ? 10.178  1.139   -5.482  1.00 0.00 ? 91  GLN A HA   2  
ATOM 3124  H HB2  . GLN A 1 91  ? 11.767  2.490   -7.516  1.00 0.00 ? 91  GLN A HB2  2  
ATOM 3125  H HB3  . GLN A 1 91  ? 12.801  1.473   -6.532  1.00 0.00 ? 91  GLN A HB3  2  
ATOM 3126  H HG2  . GLN A 1 91  ? 11.991  0.073   -8.314  1.00 0.00 ? 91  GLN A HG2  2  
ATOM 3127  H HG3  . GLN A 1 91  ? 11.126  -0.425  -6.874  1.00 0.00 ? 91  GLN A HG3  2  
ATOM 3128  H HE21 . GLN A 1 91  ? 10.911  1.926   -9.538  1.00 0.00 ? 91  GLN A HE21 2  
ATOM 3129  H HE22 . GLN A 1 91  ? 9.206   1.793   -9.814  1.00 0.00 ? 91  GLN A HE22 2  
ATOM 3130  N N    . GLU A 1 92  ? 12.393  3.236   -4.232  1.00 0.00 ? 92  GLU A N    2  
ATOM 3131  C CA   . GLU A 1 92  ? 13.245  3.504   -3.086  1.00 0.00 ? 92  GLU A CA   2  
ATOM 3132  C C    . GLU A 1 92  ? 12.409  3.577   -1.807  1.00 0.00 ? 92  GLU A C    2  
ATOM 3133  O O    . GLU A 1 92  ? 12.632  2.811   -0.871  1.00 0.00 ? 92  GLU A O    2  
ATOM 3134  C CB   . GLU A 1 92  ? 14.048  4.791   -3.290  1.00 0.00 ? 92  GLU A CB   2  
ATOM 3135  C CG   . GLU A 1 92  ? 15.059  4.632   -4.428  1.00 0.00 ? 92  GLU A CG   2  
ATOM 3136  C CD   . GLU A 1 92  ? 16.452  4.313   -3.883  1.00 0.00 ? 92  GLU A CD   2  
ATOM 3137  O OE1  . GLU A 1 92  ? 16.591  3.226   -3.281  1.00 0.00 ? 92  GLU A OE1  2  
ATOM 3138  O OE2  . GLU A 1 92  ? 17.347  5.163   -4.080  1.00 0.00 ? 92  GLU A OE2  2  
ATOM 3139  H H    . GLU A 1 92  ? 12.326  3.983   -4.893  1.00 0.00 ? 92  GLU A H    2  
ATOM 3140  H HA   . GLU A 1 92  ? 13.932  2.660   -3.032  1.00 0.00 ? 92  GLU A HA   2  
ATOM 3141  H HB2  . GLU A 1 92  ? 13.371  5.615   -3.513  1.00 0.00 ? 92  GLU A HB2  2  
ATOM 3142  H HB3  . GLU A 1 92  ? 14.570  5.048   -2.368  1.00 0.00 ? 92  GLU A HB3  2  
ATOM 3143  H HG2  . GLU A 1 92  ? 14.735  3.836   -5.098  1.00 0.00 ? 92  GLU A HG2  2  
ATOM 3144  H HG3  . GLU A 1 92  ? 15.096  5.549   -5.016  1.00 0.00 ? 92  GLU A HG3  2  
ATOM 3145  N N    . LEU A 1 93  ? 11.463  4.505   -1.809  1.00 0.00 ? 93  LEU A N    2  
ATOM 3146  C CA   . LEU A 1 93  ? 10.592  4.687   -0.660  1.00 0.00 ? 93  LEU A CA   2  
ATOM 3147  C C    . LEU A 1 93  ? 10.117  3.320   -0.164  1.00 0.00 ? 93  LEU A C    2  
ATOM 3148  O O    . LEU A 1 93  ? 10.185  3.031   1.030   1.00 0.00 ? 93  LEU A O    2  
ATOM 3149  C CB   . LEU A 1 93  ? 9.451   5.649   -1.000  1.00 0.00 ? 93  LEU A CB   2  
ATOM 3150  C CG   . LEU A 1 93  ? 9.821   7.132   -1.065  1.00 0.00 ? 93  LEU A CG   2  
ATOM 3151  C CD1  . LEU A 1 93  ? 8.627   7.975   -1.515  1.00 0.00 ? 93  LEU A CD1  2  
ATOM 3152  C CD2  . LEU A 1 93  ? 10.392  7.613   0.271   1.00 0.00 ? 93  LEU A CD2  2  
ATOM 3153  H H    . LEU A 1 93  ? 11.288  5.124   -2.574  1.00 0.00 ? 93  LEU A H    2  
ATOM 3154  H HA   . LEU A 1 93  ? 11.183  5.154   0.127   1.00 0.00 ? 93  LEU A HA   2  
ATOM 3155  H HB2  . LEU A 1 93  ? 9.032   5.357   -1.963  1.00 0.00 ? 93  LEU A HB2  2  
ATOM 3156  H HB3  . LEU A 1 93  ? 8.663   5.523   -0.258  1.00 0.00 ? 93  LEU A HB3  2  
ATOM 3157  H HG   . LEU A 1 93  ? 10.603  7.257   -1.813  1.00 0.00 ? 93  LEU A HG   2  
ATOM 3158  H HD11 . LEU A 1 93  ? 8.399   7.756   -2.558  1.00 0.00 ? 93  LEU A HD11 2  
ATOM 3159  H HD12 . LEU A 1 93  ? 7.761   7.738   -0.897  1.00 0.00 ? 93  LEU A HD12 2  
ATOM 3160  H HD13 . LEU A 1 93  ? 8.869   9.033   -1.410  1.00 0.00 ? 93  LEU A HD13 2  
ATOM 3161  H HD21 . LEU A 1 93  ? 9.966   7.023   1.082   1.00 0.00 ? 93  LEU A HD21 2  
ATOM 3162  H HD22 . LEU A 1 93  ? 11.476  7.496   0.266   1.00 0.00 ? 93  LEU A HD22 2  
ATOM 3163  H HD23 . LEU A 1 93  ? 10.141  8.664   0.415   1.00 0.00 ? 93  LEU A HD23 2  
ATOM 3164  N N    . PHE A 1 94  ? 9.646   2.515   -1.105  1.00 0.00 ? 94  PHE A N    2  
ATOM 3165  C CA   . PHE A 1 94  ? 9.160   1.186   -0.778  1.00 0.00 ? 94  PHE A CA   2  
ATOM 3166  C C    . PHE A 1 94  ? 10.208  0.396   0.008   1.00 0.00 ? 94  PHE A C    2  
ATOM 3167  O O    . PHE A 1 94  ? 9.934   -0.083  1.108   1.00 0.00 ? 94  PHE A O    2  
ATOM 3168  C CB   . PHE A 1 94  ? 8.888   0.470   -2.103  1.00 0.00 ? 94  PHE A CB   2  
ATOM 3169  C CG   . PHE A 1 94  ? 7.832   1.153   -2.974  1.00 0.00 ? 94  PHE A CG   2  
ATOM 3170  C CD1  . PHE A 1 94  ? 6.930   2.001   -2.410  1.00 0.00 ? 94  PHE A CD1  2  
ATOM 3171  C CD2  . PHE A 1 94  ? 7.794   0.912   -4.312  1.00 0.00 ? 94  PHE A CD2  2  
ATOM 3172  C CE1  . PHE A 1 94  ? 5.949   2.635   -3.218  1.00 0.00 ? 94  PHE A CE1  2  
ATOM 3173  C CE2  . PHE A 1 94  ? 6.814   1.546   -5.120  1.00 0.00 ? 94  PHE A CE2  2  
ATOM 3174  C CZ   . PHE A 1 94  ? 5.912   2.394   -4.556  1.00 0.00 ? 94  PHE A CZ   2  
ATOM 3175  H H    . PHE A 1 94  ? 9.594   2.758   -2.074  1.00 0.00 ? 94  PHE A H    2  
ATOM 3176  H HA   . PHE A 1 94  ? 8.266   1.309   -0.166  1.00 0.00 ? 94  PHE A HA   2  
ATOM 3177  H HB2  . PHE A 1 94  ? 9.820   0.403   -2.666  1.00 0.00 ? 94  PHE A HB2  2  
ATOM 3178  H HB3  . PHE A 1 94  ? 8.568   -0.550  -1.894  1.00 0.00 ? 94  PHE A HB3  2  
ATOM 3179  H HD1  . PHE A 1 94  ? 6.960   2.194   -1.338  1.00 0.00 ? 94  PHE A HD1  2  
ATOM 3180  H HD2  . PHE A 1 94  ? 8.517   0.233   -4.764  1.00 0.00 ? 94  PHE A HD2  2  
ATOM 3181  H HE1  . PHE A 1 94  ? 5.227   3.314   -2.766  1.00 0.00 ? 94  PHE A HE1  2  
ATOM 3182  H HE2  . PHE A 1 94  ? 6.783   1.353   -6.193  1.00 0.00 ? 94  PHE A HE2  2  
ATOM 3183  H HZ   . PHE A 1 94  ? 5.159   2.880   -5.177  1.00 0.00 ? 94  PHE A HZ   2  
ATOM 3184  N N    . LEU A 1 95  ? 11.387  0.285   -0.585  1.00 0.00 ? 95  LEU A N    2  
ATOM 3185  C CA   . LEU A 1 95  ? 12.478  -0.438  0.046   1.00 0.00 ? 95  LEU A CA   2  
ATOM 3186  C C    . LEU A 1 95  ? 12.836  0.242   1.369   1.00 0.00 ? 95  LEU A C    2  
ATOM 3187  O O    . LEU A 1 95  ? 13.337  -0.404  2.288   1.00 0.00 ? 95  LEU A O    2  
ATOM 3188  C CB   . LEU A 1 95  ? 13.660  -0.572  -0.916  1.00 0.00 ? 95  LEU A CB   2  
ATOM 3189  C CG   . LEU A 1 95  ? 13.667  -1.821  -1.800  1.00 0.00 ? 95  LEU A CG   2  
ATOM 3190  C CD1  . LEU A 1 95  ? 14.186  -1.498  -3.202  1.00 0.00 ? 95  LEU A CD1  2  
ATOM 3191  C CD2  . LEU A 1 95  ? 14.458  -2.953  -1.142  1.00 0.00 ? 95  LEU A CD2  2  
ATOM 3192  H H    . LEU A 1 95  ? 11.602  0.678   -1.480  1.00 0.00 ? 95  LEU A H    2  
ATOM 3193  H HA   . LEU A 1 95  ? 12.121  -1.445  0.261   1.00 0.00 ? 95  LEU A HA   2  
ATOM 3194  H HB2  . LEU A 1 95  ? 13.678  0.306   -1.562  1.00 0.00 ? 95  LEU A HB2  2  
ATOM 3195  H HB3  . LEU A 1 95  ? 14.581  -0.558  -0.333  1.00 0.00 ? 95  LEU A HB3  2  
ATOM 3196  H HG   . LEU A 1 95  ? 12.639  -2.168  -1.909  1.00 0.00 ? 95  LEU A HG   2  
ATOM 3197  H HD11 . LEU A 1 95  ? 13.668  -2.119  -3.933  1.00 0.00 ? 95  LEU A HD11 2  
ATOM 3198  H HD12 . LEU A 1 95  ? 14.004  -0.447  -3.424  1.00 0.00 ? 95  LEU A HD12 2  
ATOM 3199  H HD13 . LEU A 1 95  ? 15.257  -1.699  -3.248  1.00 0.00 ? 95  LEU A HD13 2  
ATOM 3200  H HD21 . LEU A 1 95  ? 14.159  -3.907  -1.578  1.00 0.00 ? 95  LEU A HD21 2  
ATOM 3201  H HD22 . LEU A 1 95  ? 15.524  -2.796  -1.308  1.00 0.00 ? 95  LEU A HD22 2  
ATOM 3202  H HD23 . LEU A 1 95  ? 14.255  -2.964  -0.071  1.00 0.00 ? 95  LEU A HD23 2  
ATOM 3203  N N    . ALA A 1 96  ? 12.566  1.538   1.424   1.00 0.00 ? 96  ALA A N    2  
ATOM 3204  C CA   . ALA A 1 96  ? 12.854  2.313   2.619   1.00 0.00 ? 96  ALA A CA   2  
ATOM 3205  C C    . ALA A 1 96  ? 11.748  2.081   3.651   1.00 0.00 ? 96  ALA A C    2  
ATOM 3206  O O    . ALA A 1 96  ? 11.882  2.473   4.809   1.00 0.00 ? 96  ALA A O    2  
ATOM 3207  C CB   . ALA A 1 96  ? 13.003  3.789   2.247   1.00 0.00 ? 96  ALA A CB   2  
ATOM 3208  H H    . ALA A 1 96  ? 12.159  2.057   0.672   1.00 0.00 ? 96  ALA A H    2  
ATOM 3209  H HA   . ALA A 1 96  ? 13.800  1.956   3.026   1.00 0.00 ? 96  ALA A HA   2  
ATOM 3210  H HB1  . ALA A 1 96  ? 13.518  4.316   3.050   1.00 0.00 ? 96  ALA A HB1  2  
ATOM 3211  H HB2  . ALA A 1 96  ? 13.582  3.875   1.327   1.00 0.00 ? 96  ALA A HB2  2  
ATOM 3212  H HB3  . ALA A 1 96  ? 12.017  4.228   2.098   1.00 0.00 ? 96  ALA A HB3  2  
ATOM 3213  N N    . HIS A 1 97  ? 10.680  1.444   3.193   1.00 0.00 ? 97  HIS A N    2  
ATOM 3214  C CA   . HIS A 1 97  ? 9.552   1.155   4.062   1.00 0.00 ? 97  HIS A CA   2  
ATOM 3215  C C    . HIS A 1 97  ? 8.882   -0.147  3.617   1.00 0.00 ? 97  HIS A C    2  
ATOM 3216  O O    . HIS A 1 97  ? 7.657   -0.228  3.550   1.00 0.00 ? 97  HIS A O    2  
ATOM 3217  C CB   . HIS A 1 97  ? 8.581   2.337   4.103   1.00 0.00 ? 97  HIS A CB   2  
ATOM 3218  C CG   . HIS A 1 97  ? 9.206   3.628   4.574   1.00 0.00 ? 97  HIS A CG   2  
ATOM 3219  N ND1  . HIS A 1 97  ? 9.510   3.874   5.901   1.00 0.00 ? 97  HIS A ND1  2  
ATOM 3220  C CD2  . HIS A 1 97  ? 9.581   4.742   3.880   1.00 0.00 ? 97  HIS A CD2  2  
ATOM 3221  C CE1  . HIS A 1 97  ? 10.042  5.083   5.992   1.00 0.00 ? 97  HIS A CE1  2  
ATOM 3222  N NE2  . HIS A 1 97  ? 10.085  5.620   4.738   1.00 0.00 ? 97  HIS A NE2  2  
ATOM 3223  H H    . HIS A 1 97  ? 10.579  1.128   2.249   1.00 0.00 ? 97  HIS A H    2  
ATOM 3224  H HA   . HIS A 1 97  ? 9.956   1.021   5.065   1.00 0.00 ? 97  HIS A HA   2  
ATOM 3225  H HB2  . HIS A 1 97  ? 8.166   2.488   3.106   1.00 0.00 ? 97  HIS A HB2  2  
ATOM 3226  H HB3  . HIS A 1 97  ? 7.748   2.087   4.760   1.00 0.00 ? 97  HIS A HB3  2  
ATOM 3227  H HD1  . HIS A 1 97  ? 9.354   3.245   6.663   1.00 0.00 ? 97  HIS A HD1  2  
ATOM 3228  H HD2  . HIS A 1 97  ? 9.483   4.885   2.804   1.00 0.00 ? 97  HIS A HD2  2  
ATOM 3229  H HE1  . HIS A 1 97  ? 10.386  5.566   6.907   1.00 0.00 ? 97  HIS A HE1  2  
ATOM 3230  N N    . ILE A 1 98  ? 9.716   -1.134  3.325   1.00 0.00 ? 98  ILE A N    2  
ATOM 3231  C CA   . ILE A 1 98  ? 9.220   -2.429  2.889   1.00 0.00 ? 98  ILE A CA   2  
ATOM 3232  C C    . ILE A 1 98  ? 9.071   -3.348  4.103   1.00 0.00 ? 98  ILE A C    2  
ATOM 3233  O O    . ILE A 1 98  ? 10.040  -3.603  4.816   1.00 0.00 ? 98  ILE A O    2  
ATOM 3234  C CB   . ILE A 1 98  ? 10.116  -3.003  1.789   1.00 0.00 ? 98  ILE A CB   2  
ATOM 3235  C CG1  . ILE A 1 98  ? 9.426   -4.163  1.070   1.00 0.00 ? 98  ILE A CG1  2  
ATOM 3236  C CG2  . ILE A 1 98  ? 11.482  -3.406  2.349   1.00 0.00 ? 98  ILE A CG2  2  
ATOM 3237  C CD1  . ILE A 1 98  ? 9.045   -3.774  -0.360  1.00 0.00 ? 98  ILE A CD1  2  
ATOM 3238  H H    . ILE A 1 98  ? 10.712  -1.061  3.382   1.00 0.00 ? 98  ILE A H    2  
ATOM 3239  H HA   . ILE A 1 98  ? 8.235   -2.270  2.452   1.00 0.00 ? 98  ILE A HA   2  
ATOM 3240  H HB   . ILE A 1 98  ? 10.290  -2.222  1.048   1.00 0.00 ? 98  ILE A HB   2  
ATOM 3241  H HG12 . ILE A 1 98  ? 10.088  -5.029  1.051   1.00 0.00 ? 98  ILE A HG12 2  
ATOM 3242  H HG13 . ILE A 1 98  ? 8.533   -4.458  1.621   1.00 0.00 ? 98  ILE A HG13 2  
ATOM 3243  H HG21 . ILE A 1 98  ? 11.427  -4.420  2.745   1.00 0.00 ? 98  ILE A HG21 2  
ATOM 3244  H HG22 . ILE A 1 98  ? 12.226  -3.366  1.554   1.00 0.00 ? 98  ILE A HG22 2  
ATOM 3245  H HG23 . ILE A 1 98  ? 11.765  -2.719  3.147   1.00 0.00 ? 98  ILE A HG23 2  
ATOM 3246  H HD11 . ILE A 1 98  ? 8.101   -3.228  -0.348  1.00 0.00 ? 98  ILE A HD11 2  
ATOM 3247  H HD12 . ILE A 1 98  ? 9.825   -3.141  -0.784  1.00 0.00 ? 98  ILE A HD12 2  
ATOM 3248  H HD13 . ILE A 1 98  ? 8.937   -4.674  -0.965  1.00 0.00 ? 98  ILE A HD13 2  
ATOM 3249  N N    . LEU A 1 99  ? 7.849   -3.820  4.300   1.00 0.00 ? 99  LEU A N    2  
ATOM 3250  C CA   . LEU A 1 99  ? 7.560   -4.706  5.415   1.00 0.00 ? 99  LEU A CA   2  
ATOM 3251  C C    . LEU A 1 99  ? 7.643   -6.159  4.942   1.00 0.00 ? 99  LEU A C    2  
ATOM 3252  O O    . LEU A 1 99  ? 7.935   -7.056  5.731   1.00 0.00 ? 99  LEU A O    2  
ATOM 3253  C CB   . LEU A 1 99  ? 6.217   -4.343  6.053   1.00 0.00 ? 99  LEU A CB   2  
ATOM 3254  C CG   . LEU A 1 99  ? 6.157   -2.991  6.766   1.00 0.00 ? 99  LEU A CG   2  
ATOM 3255  C CD1  . LEU A 1 99  ? 4.867   -2.855  7.577   1.00 0.00 ? 99  LEU A CD1  2  
ATOM 3256  C CD2  . LEU A 1 99  ? 7.402   -2.770  7.629   1.00 0.00 ? 99  LEU A CD2  2  
ATOM 3257  H H    . LEU A 1 99  ? 7.066   -3.608  3.715   1.00 0.00 ? 99  LEU A H    2  
ATOM 3258  H HA   . LEU A 1 99  ? 8.330   -4.544  6.169   1.00 0.00 ? 99  LEU A HA   2  
ATOM 3259  H HB2  . LEU A 1 99  ? 5.453   -4.356  5.277   1.00 0.00 ? 99  LEU A HB2  2  
ATOM 3260  H HB3  . LEU A 1 99  ? 5.957   -5.122  6.770   1.00 0.00 ? 99  LEU A HB3  2  
ATOM 3261  H HG   . LEU A 1 99  ? 6.146   -2.206  6.010   1.00 0.00 ? 99  LEU A HG   2  
ATOM 3262  H HD11 . LEU A 1 99  ? 5.112   -2.735  8.632   1.00 0.00 ? 99  LEU A HD11 2  
ATOM 3263  H HD12 . LEU A 1 99  ? 4.311   -1.984  7.231   1.00 0.00 ? 99  LEU A HD12 2  
ATOM 3264  H HD13 . LEU A 1 99  ? 4.259   -3.750  7.444   1.00 0.00 ? 99  LEU A HD13 2  
ATOM 3265  H HD21 . LEU A 1 99  ? 7.239   -1.919  8.290   1.00 0.00 ? 99  LEU A HD21 2  
ATOM 3266  H HD22 . LEU A 1 99  ? 7.594   -3.662  8.225   1.00 0.00 ? 99  LEU A HD22 2  
ATOM 3267  H HD23 . LEU A 1 99  ? 8.259   -2.572  6.985   1.00 0.00 ? 99  LEU A HD23 2  
ATOM 3268  N N    . SER A 1 100 ? 7.382   -6.345  3.656   1.00 0.00 ? 100 SER A N    2  
ATOM 3269  C CA   . SER A 1 100 ? 7.424   -7.673  3.069   1.00 0.00 ? 100 SER A CA   2  
ATOM 3270  C C    . SER A 1 100 ? 8.730   -7.862  2.296   1.00 0.00 ? 100 SER A C    2  
ATOM 3271  O O    . SER A 1 100 ? 9.431   -6.893  2.008   1.00 0.00 ? 100 SER A O    2  
ATOM 3272  C CB   . SER A 1 100 ? 6.224   -7.906  2.149   1.00 0.00 ? 100 SER A CB   2  
ATOM 3273  O OG   . SER A 1 100 ? 6.228   -7.022  1.032   1.00 0.00 ? 100 SER A OG   2  
ATOM 3274  H H    . SER A 1 100 ? 7.145   -5.609  3.022   1.00 0.00 ? 100 SER A H    2  
ATOM 3275  H HA   . SER A 1 100 ? 7.374   -8.363  3.911   1.00 0.00 ? 100 SER A HA   2  
ATOM 3276  H HB2  . SER A 1 100 ? 6.234   -8.937  1.795   1.00 0.00 ? 100 SER A HB2  2  
ATOM 3277  H HB3  . SER A 1 100 ? 5.302   -7.772  2.714   1.00 0.00 ? 100 SER A HB3  2  
ATOM 3278  H HG   . SER A 1 100 ? 5.899   -7.499  0.216   1.00 0.00 ? 100 SER A HG   2  
ATOM 3279  N N    . SER A 1 101 ? 9.019   -9.117  1.982   1.00 0.00 ? 101 SER A N    2  
ATOM 3280  C CA   . SER A 1 101 ? 10.229  -9.446  1.248   1.00 0.00 ? 101 SER A CA   2  
ATOM 3281  C C    . SER A 1 101 ? 9.914   -9.589  -0.243  1.00 0.00 ? 101 SER A C    2  
ATOM 3282  O O    . SER A 1 101 ? 10.819  -9.584  -1.075  1.00 0.00 ? 101 SER A O    2  
ATOM 3283  C CB   . SER A 1 101 ? 10.865  -10.730 1.782   1.00 0.00 ? 101 SER A CB   2  
ATOM 3284  O OG   . SER A 1 101 ? 12.182  -10.507 2.279   1.00 0.00 ? 101 SER A OG   2  
ATOM 3285  H H    . SER A 1 101 ? 8.443   -9.899  2.220   1.00 0.00 ? 101 SER A H    2  
ATOM 3286  H HA   . SER A 1 101 ? 10.905  -8.608  1.417   1.00 0.00 ? 101 SER A HA   2  
ATOM 3287  H HB2  . SER A 1 101 ? 10.242  -11.140 2.577   1.00 0.00 ? 101 SER A HB2  2  
ATOM 3288  H HB3  . SER A 1 101 ? 10.899  -11.476 0.987   1.00 0.00 ? 101 SER A HB3  2  
ATOM 3289  H HG   . SER A 1 101 ? 12.208  -10.677 3.264   1.00 0.00 ? 101 SER A HG   2  
ATOM 3290  N N    . TRP A 1 102 ? 8.627   -9.714  -0.534  1.00 0.00 ? 102 TRP A N    2  
ATOM 3291  C CA   . TRP A 1 102 ? 8.182   -9.858  -1.909  1.00 0.00 ? 102 TRP A CA   2  
ATOM 3292  C C    . TRP A 1 102 ? 7.787   -8.473  -2.426  1.00 0.00 ? 102 TRP A C    2  
ATOM 3293  O O    . TRP A 1 102 ? 8.033   -7.466  -1.765  1.00 0.00 ? 102 TRP A O    2  
ATOM 3294  C CB   . TRP A 1 102 ? 7.048   -10.881 -2.014  1.00 0.00 ? 102 TRP A CB   2  
ATOM 3295  C CG   . TRP A 1 102 ? 5.686   -10.347 -1.568  1.00 0.00 ? 102 TRP A CG   2  
ATOM 3296  C CD1  . TRP A 1 102 ? 4.805   -9.634  -2.283  1.00 0.00 ? 102 TRP A CD1  2  
ATOM 3297  C CD2  . TRP A 1 102 ? 5.080   -10.515 -0.269  1.00 0.00 ? 102 TRP A CD2  2  
ATOM 3298  N NE1  . TRP A 1 102 ? 3.680   -9.331  -1.543  1.00 0.00 ? 102 TRP A NE1  2  
ATOM 3299  C CE2  . TRP A 1 102 ? 3.853   -9.883  -0.280  1.00 0.00 ? 102 TRP A CE2  2  
ATOM 3300  C CE3  . TRP A 1 102 ? 5.553   -11.178 0.877   1.00 0.00 ? 102 TRP A CE3  2  
ATOM 3301  C CZ2  . TRP A 1 102 ? 2.997   -9.853  0.828   1.00 0.00 ? 102 TRP A CZ2  2  
ATOM 3302  C CZ3  . TRP A 1 102 ? 4.685   -11.138 1.975   1.00 0.00 ? 102 TRP A CZ3  2  
ATOM 3303  C CH2  . TRP A 1 102 ? 3.447   -10.507 1.981   1.00 0.00 ? 102 TRP A CH2  2  
ATOM 3304  H H    . TRP A 1 102 ? 7.897   -9.717  0.149   1.00 0.00 ? 102 TRP A H    2  
ATOM 3305  H HA   . TRP A 1 102 ? 9.017   -10.249 -2.491  1.00 0.00 ? 102 TRP A HA   2  
ATOM 3306  H HB2  . TRP A 1 102 ? 6.974   -11.221 -3.047  1.00 0.00 ? 102 TRP A HB2  2  
ATOM 3307  H HB3  . TRP A 1 102 ? 7.302   -11.752 -1.409  1.00 0.00 ? 102 TRP A HB3  2  
ATOM 3308  H HD1  . TRP A 1 102 ? 4.958   -9.331  -3.319  1.00 0.00 ? 102 TRP A HD1  2  
ATOM 3309  H HE1  . TRP A 1 102 ? 2.816   -8.762  -1.887  1.00 0.00 ? 102 TRP A HE1  2  
ATOM 3310  H HE3  . TRP A 1 102 ? 6.517   -11.684 0.910   1.00 0.00 ? 102 TRP A HE3  2  
ATOM 3311  H HZ2  . TRP A 1 102 ? 2.032   -9.347  0.794   1.00 0.00 ? 102 TRP A HZ2  2  
ATOM 3312  H HZ3  . TRP A 1 102 ? 5.004   -11.637 2.890   1.00 0.00 ? 102 TRP A HZ3  2  
ATOM 3313  H HH2  . TRP A 1 102 ? 2.830   -10.521 2.879   1.00 0.00 ? 102 TRP A HH2  2  
ATOM 3314  N N    . GLY A 1 103 ? 7.181   -8.468  -3.605  1.00 0.00 ? 103 GLY A N    2  
ATOM 3315  C CA   . GLY A 1 103 ? 6.750   -7.223  -4.218  1.00 0.00 ? 103 GLY A CA   2  
ATOM 3316  C C    . GLY A 1 103 ? 7.777   -6.731  -5.240  1.00 0.00 ? 103 GLY A C    2  
ATOM 3317  O O    . GLY A 1 103 ? 8.256   -5.601  -5.148  1.00 0.00 ? 103 GLY A O    2  
ATOM 3318  H H    . GLY A 1 103 ? 6.984   -9.291  -4.136  1.00 0.00 ? 103 GLY A H    2  
ATOM 3319  H HA2  . GLY A 1 103 ? 5.786   -7.369  -4.707  1.00 0.00 ? 103 GLY A HA2  2  
ATOM 3320  H HA3  . GLY A 1 103 ? 6.605   -6.465  -3.448  1.00 0.00 ? 103 GLY A HA3  2  
ATOM 3321  N N    . ALA A 1 104 ? 8.084   -7.602  -6.189  1.00 0.00 ? 104 ALA A N    2  
ATOM 3322  C CA   . ALA A 1 104 ? 9.046   -7.270  -7.227  1.00 0.00 ? 104 ALA A CA   2  
ATOM 3323  C C    . ALA A 1 104 ? 10.462  -7.511  -6.700  1.00 0.00 ? 104 ALA A C    2  
ATOM 3324  O O    . ALA A 1 104 ? 10.769  -7.173  -5.558  1.00 0.00 ? 104 ALA A O    2  
ATOM 3325  C CB   . ALA A 1 104 ? 8.831   -5.824  -7.679  1.00 0.00 ? 104 ALA A CB   2  
ATOM 3326  H H    . ALA A 1 104 ? 7.690   -8.518  -6.256  1.00 0.00 ? 104 ALA A H    2  
ATOM 3327  H HA   . ALA A 1 104 ? 8.864   -7.933  -8.072  1.00 0.00 ? 104 ALA A HA   2  
ATOM 3328  H HB1  . ALA A 1 104 ? 7.829   -5.501  -7.396  1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3329  H HB2  . ALA A 1 104 ? 9.569   -5.180  -7.201  1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3330  H HB3  . ALA A 1 104 ? 8.940   -5.762  -8.761  1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3331  N N    . GLU A 1 105 ? 11.286  -8.094  -7.558  1.00 0.00 ? 105 GLU A N    2  
ATOM 3332  C CA   . GLU A 1 105 ? 12.663  -8.385  -7.193  1.00 0.00 ? 105 GLU A CA   2  
ATOM 3333  C C    . GLU A 1 105 ? 13.517  -7.120  -7.294  1.00 0.00 ? 105 GLU A C    2  
ATOM 3334  O O    . GLU A 1 105 ? 13.113  -6.142  -7.921  1.00 0.00 ? 105 GLU A O    2  
ATOM 3335  C CB   . GLU A 1 105 ? 13.236  -9.505  -8.064  1.00 0.00 ? 105 GLU A CB   2  
ATOM 3336  C CG   . GLU A 1 105 ? 13.439  -9.030  -9.504  1.00 0.00 ? 105 GLU A CG   2  
ATOM 3337  C CD   . GLU A 1 105 ? 14.901  -9.180  -9.930  1.00 0.00 ? 105 GLU A CD   2  
ATOM 3338  O OE1  . GLU A 1 105 ? 15.386  -10.332 -9.897  1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3339  O OE2  . GLU A 1 105 ? 15.501  -8.140  -10.278 1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3340  H H    . GLU A 1 105 ? 11.029  -8.366  -8.485  1.00 0.00 ? 105 GLU A H    2  
ATOM 3341  H HA   . GLU A 1 105 ? 12.623  -8.723  -6.157  1.00 0.00 ? 105 GLU A HA   2  
ATOM 3342  H HB2  . GLU A 1 105 ? 14.187  -9.841  -7.651  1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3343  H HB3  . GLU A 1 105 ? 12.562  -10.361 -8.052  1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3344  H HG2  . GLU A 1 105 ? 12.801  -9.605  -10.174 1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3345  H HG3  . GLU A 1 105 ? 13.137  -7.986  -9.593  1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3346  N N    . VAL A 1 106 ? 14.683  -7.180  -6.667  1.00 0.00 ? 106 VAL A N    2  
ATOM 3347  C CA   . VAL A 1 106 ? 15.598  -6.051  -6.679  1.00 0.00 ? 106 VAL A CA   2  
ATOM 3348  C C    . VAL A 1 106 ? 16.924  -6.469  -6.040  1.00 0.00 ? 106 VAL A C    2  
ATOM 3349  O O    . VAL A 1 106 ? 17.235  -6.060  -4.922  1.00 0.00 ? 106 VAL A O    2  
ATOM 3350  C CB   . VAL A 1 106 ? 14.953  -4.848  -5.987  1.00 0.00 ? 106 VAL A CB   2  
ATOM 3351  C CG1  . VAL A 1 106 ? 14.576  -5.185  -4.543  1.00 0.00 ? 106 VAL A CG1  2  
ATOM 3352  C CG2  . VAL A 1 106 ? 15.872  -3.626  -6.043  1.00 0.00 ? 106 VAL A CG2  2  
ATOM 3353  H H    . VAL A 1 106 ? 15.004  -7.979  -6.160  1.00 0.00 ? 106 VAL A H    2  
ATOM 3354  H HA   . VAL A 1 106 ? 15.778  -5.784  -7.720  1.00 0.00 ? 106 VAL A HA   2  
ATOM 3355  H HB   . VAL A 1 106 ? 14.037  -4.603  -6.524  1.00 0.00 ? 106 VAL A HB   2  
ATOM 3356  H HG11 . VAL A 1 106 ? 15.149  -6.050  -4.209  1.00 0.00 ? 106 VAL A HG11 2  
ATOM 3357  H HG12 . VAL A 1 106 ? 14.798  -4.332  -3.901  1.00 0.00 ? 106 VAL A HG12 2  
ATOM 3358  H HG13 . VAL A 1 106 ? 13.511  -5.412  -4.489  1.00 0.00 ? 106 VAL A HG13 2  
ATOM 3359  H HG21 . VAL A 1 106 ? 16.867  -3.934  -6.366  1.00 0.00 ? 106 VAL A HG21 2  
ATOM 3360  H HG22 . VAL A 1 106 ? 15.469  -2.901  -6.749  1.00 0.00 ? 106 VAL A HG22 2  
ATOM 3361  H HG23 . VAL A 1 106 ? 15.935  -3.173  -5.053  1.00 0.00 ? 106 VAL A HG23 2  
ATOM 3362  N N    . LYS A 1 107 ? 17.671  -7.277  -6.778  1.00 0.00 ? 107 LYS A N    2  
ATOM 3363  C CA   . LYS A 1 107 ? 18.956  -7.754  -6.298  1.00 0.00 ? 107 LYS A CA   2  
ATOM 3364  C C    . LYS A 1 107 ? 20.012  -6.668  -6.514  1.00 0.00 ? 107 LYS A C    2  
ATOM 3365  O O    . LYS A 1 107 ? 19.983  -5.961  -7.520  1.00 0.00 ? 107 LYS A O    2  
ATOM 3366  C CB   . LYS A 1 107 ? 19.309  -9.092  -6.951  1.00 0.00 ? 107 LYS A CB   2  
ATOM 3367  C CG   . LYS A 1 107 ? 19.718  -8.898  -8.412  1.00 0.00 ? 107 LYS A CG   2  
ATOM 3368  C CD   . LYS A 1 107 ? 21.112  -9.474  -8.672  1.00 0.00 ? 107 LYS A CD   2  
ATOM 3369  C CE   . LYS A 1 107 ? 21.726  -8.873  -9.938  1.00 0.00 ? 107 LYS A CE   2  
ATOM 3370  N NZ   . LYS A 1 107 ? 23.016  -9.527  -10.250 1.00 0.00 ? 107 LYS A NZ   2  
ATOM 3371  H H    . LYS A 1 107 ? 17.411  -7.605  -7.687  1.00 0.00 ? 107 LYS A H    2  
ATOM 3372  H HA   . LYS A 1 107 ? 18.859  -7.934  -5.228  1.00 0.00 ? 107 LYS A HA   2  
ATOM 3373  H HB2  . LYS A 1 107 ? 20.122  -9.566  -6.402  1.00 0.00 ? 107 LYS A HB2  2  
ATOM 3374  H HB3  . LYS A 1 107 ? 18.453  -9.765  -6.895  1.00 0.00 ? 107 LYS A HB3  2  
ATOM 3375  H HG2  . LYS A 1 107 ? 18.993  -9.385  -9.065  1.00 0.00 ? 107 LYS A HG2  2  
ATOM 3376  H HG3  . LYS A 1 107 ? 19.707  -7.837  -8.659  1.00 0.00 ? 107 LYS A HG3  2  
ATOM 3377  H HD2  . LYS A 1 107 ? 21.758  -9.271  -7.819  1.00 0.00 ? 107 LYS A HD2  2  
ATOM 3378  H HD3  . LYS A 1 107 ? 21.049  -10.557 -8.774  1.00 0.00 ? 107 LYS A HD3  2  
ATOM 3379  H HE2  . LYS A 1 107 ? 21.039  -8.994  -10.776 1.00 0.00 ? 107 LYS A HE2  2  
ATOM 3380  H HE3  . LYS A 1 107 ? 21.878  -7.802  -9.803  1.00 0.00 ? 107 LYS A HE3  2  
ATOM 3381  H HZ1  . LYS A 1 107 ? 22.845  -10.426 -10.654 1.00 0.00 ? 107 LYS A HZ1  2  
ATOM 3382  H HZ2  . LYS A 1 107 ? 23.529  -8.963  -10.897 1.00 0.00 ? 107 LYS A HZ2  2  
ATOM 3383  H HZ3  . LYS A 1 107 ? 23.547  -9.635  -9.409  1.00 0.00 ? 107 LYS A HZ3  2  
ATOM 3384  N N    . SER A 1 108 ? 20.918  -6.568  -5.553  1.00 0.00 ? 108 SER A N    2  
ATOM 3385  C CA   . SER A 1 108 ? 21.980  -5.580  -5.625  1.00 0.00 ? 108 SER A CA   2  
ATOM 3386  C C    . SER A 1 108 ? 23.230  -6.200  -6.252  1.00 0.00 ? 108 SER A C    2  
ATOM 3387  O O    . SER A 1 108 ? 23.558  -7.354  -5.981  1.00 0.00 ? 108 SER A O    2  
ATOM 3388  C CB   . SER A 1 108 ? 22.305  -5.018  -4.239  1.00 0.00 ? 108 SER A CB   2  
ATOM 3389  O OG   . SER A 1 108 ? 22.894  -3.723  -4.313  1.00 0.00 ? 108 SER A OG   2  
ATOM 3390  H H    . SER A 1 108 ? 20.934  -7.147  -4.737  1.00 0.00 ? 108 SER A H    2  
ATOM 3391  H HA   . SER A 1 108 ? 21.590  -4.783  -6.257  1.00 0.00 ? 108 SER A HA   2  
ATOM 3392  H HB2  . SER A 1 108 ? 21.392  -4.968  -3.645  1.00 0.00 ? 108 SER A HB2  2  
ATOM 3393  H HB3  . SER A 1 108 ? 22.984  -5.697  -3.723  1.00 0.00 ? 108 SER A HB3  2  
ATOM 3394  H HG   . SER A 1 108 ? 23.886  -3.803  -4.410  1.00 0.00 ? 108 SER A HG   2  
ATOM 3395  N N    . GLY A 1 109 ? 23.895  -5.406  -7.079  1.00 0.00 ? 109 GLY A N    2  
ATOM 3396  C CA   . GLY A 1 109 ? 25.101  -5.863  -7.747  1.00 0.00 ? 109 GLY A CA   2  
ATOM 3397  C C    . GLY A 1 109 ? 25.813  -4.703  -8.447  1.00 0.00 ? 109 GLY A C    2  
ATOM 3398  O O    . GLY A 1 109 ? 25.789  -3.572  -7.963  1.00 0.00 ? 109 GLY A O    2  
ATOM 3399  H H    . GLY A 1 109 ? 23.621  -4.468  -7.294  1.00 0.00 ? 109 GLY A H    2  
ATOM 3400  H HA2  . GLY A 1 109 ? 25.772  -6.321  -7.021  1.00 0.00 ? 109 GLY A HA2  2  
ATOM 3401  H HA3  . GLY A 1 109 ? 24.848  -6.632  -8.477  1.00 0.00 ? 109 GLY A HA3  2  
ATOM 3402  N N    . PRO A 1 110 ? 26.445  -5.031  -9.605  1.00 0.00 ? 110 PRO A N    2  
ATOM 3403  C CA   . PRO A 1 110 ? 27.162  -4.030  -10.377 1.00 0.00 ? 110 PRO A CA   2  
ATOM 3404  C C    . PRO A 1 110 ? 26.191  -3.116  -11.126 1.00 0.00 ? 110 PRO A C    2  
ATOM 3405  O O    . PRO A 1 110 ? 24.994  -3.392  -11.186 1.00 0.00 ? 110 PRO A O    2  
ATOM 3406  C CB   . PRO A 1 110 ? 28.068  -4.823  -11.305 1.00 0.00 ? 110 PRO A CB   2  
ATOM 3407  C CG   . PRO A 1 110 ? 27.492  -6.229  -11.349 1.00 0.00 ? 110 PRO A CG   2  
ATOM 3408  C CD   . PRO A 1 110 ? 26.494  -6.360  -10.209 1.00 0.00 ? 110 PRO A CD   2  
ATOM 3409  H HA   . PRO A 1 110 ? 27.686  -3.433  -9.769  1.00 0.00 ? 110 PRO A HA   2  
ATOM 3410  H HB2  . PRO A 1 110 ? 28.092  -4.380  -12.300 1.00 0.00 ? 110 PRO A HB2  2  
ATOM 3411  H HB3  . PRO A 1 110 ? 29.094  -4.833  -10.936 1.00 0.00 ? 110 PRO A HB3  2  
ATOM 3412  H HG2  . PRO A 1 110 ? 27.004  -6.412  -12.306 1.00 0.00 ? 110 PRO A HG2  2  
ATOM 3413  H HG3  . PRO A 1 110 ? 28.285  -6.970  -11.248 1.00 0.00 ? 110 PRO A HG3  2  
ATOM 3414  H HD2  . PRO A 1 110 ? 25.514  -6.665  -10.574 1.00 0.00 ? 110 PRO A HD2  2  
ATOM 3415  H HD3  . PRO A 1 110 ? 26.814  -7.111  -9.487  1.00 0.00 ? 110 PRO A HD3  2  
ATOM 3416  N N    . SER A 1 111 ? 26.743  -2.046  -11.679 1.00 0.00 ? 111 SER A N    2  
ATOM 3417  C CA   . SER A 1 111 ? 25.940  -1.089  -12.422 1.00 0.00 ? 111 SER A CA   2  
ATOM 3418  C C    . SER A 1 111 ? 26.495  -0.930  -13.839 1.00 0.00 ? 111 SER A C    2  
ATOM 3419  O O    . SER A 1 111 ? 27.335  -0.066  -14.087 1.00 0.00 ? 111 SER A O    2  
ATOM 3420  C CB   . SER A 1 111 ? 25.900  0.265   -11.712 1.00 0.00 ? 111 SER A CB   2  
ATOM 3421  O OG   . SER A 1 111 ? 25.172  1.237   -12.457 1.00 0.00 ? 111 SER A OG   2  
ATOM 3422  H H    . SER A 1 111 ? 27.718  -1.829  -11.625 1.00 0.00 ? 111 SER A H    2  
ATOM 3423  H HA   . SER A 1 111 ? 24.937  -1.514  -12.449 1.00 0.00 ? 111 SER A HA   2  
ATOM 3424  H HB2  . SER A 1 111 ? 25.444  0.146   -10.729 1.00 0.00 ? 111 SER A HB2  2  
ATOM 3425  H HB3  . SER A 1 111 ? 26.918  0.620   -11.550 1.00 0.00 ? 111 SER A HB3  2  
ATOM 3426  H HG   . SER A 1 111 ? 24.539  0.784   -13.084 1.00 0.00 ? 111 SER A HG   2  
ATOM 3427  N N    . SER A 1 112 ? 26.003  -1.776  -14.731 1.00 0.00 ? 112 SER A N    2  
ATOM 3428  C CA   . SER A 1 112 ? 26.439  -1.740  -16.117 1.00 0.00 ? 112 SER A CA   2  
ATOM 3429  C C    . SER A 1 112 ? 25.236  -1.529  -17.039 1.00 0.00 ? 112 SER A C    2  
ATOM 3430  O O    . SER A 1 112 ? 25.188  -0.555  -17.789 1.00 0.00 ? 112 SER A O    2  
ATOM 3431  C CB   . SER A 1 112 ? 27.179  -3.025  -16.495 1.00 0.00 ? 112 SER A CB   2  
ATOM 3432  O OG   . SER A 1 112 ? 28.561  -2.789  -16.750 1.00 0.00 ? 112 SER A OG   2  
ATOM 3433  H H    . SER A 1 112 ? 25.320  -2.476  -14.521 1.00 0.00 ? 112 SER A H    2  
ATOM 3434  H HA   . SER A 1 112 ? 27.124  -0.894  -16.182 1.00 0.00 ? 112 SER A HA   2  
ATOM 3435  H HB2  . SER A 1 112 ? 27.077  -3.752  -15.690 1.00 0.00 ? 112 SER A HB2  2  
ATOM 3436  H HB3  . SER A 1 112 ? 26.717  -3.462  -17.380 1.00 0.00 ? 112 SER A HB3  2  
ATOM 3437  H HG   . SER A 1 112 ? 29.121  -3.407  -16.197 1.00 0.00 ? 112 SER A HG   2  
ATOM 3438  N N    . GLY A 1 113 ? 24.295  -2.457  -16.952 1.00 0.00 ? 113 GLY A N    2  
ATOM 3439  C CA   . GLY A 1 113 ? 23.095  -2.385  -17.769 1.00 0.00 ? 113 GLY A CA   2  
ATOM 3440  C C    . GLY A 1 113 ? 21.839  -2.352  -16.896 1.00 0.00 ? 113 GLY A C    2  
ATOM 3441  O O    . GLY A 1 113 ? 21.144  -3.359  -16.765 1.00 0.00 ? 113 GLY A O    2  
ATOM 3442  H H    . GLY A 1 113 ? 24.342  -3.246  -16.339 1.00 0.00 ? 113 GLY A H    2  
ATOM 3443  H HA2  . GLY A 1 113 ? 23.131  -1.493  -18.395 1.00 0.00 ? 113 GLY A HA2  2  
ATOM 3444  H HA3  . GLY A 1 113 ? 23.055  -3.243  -18.439 1.00 0.00 ? 113 GLY A HA3  2  
ATOM 3445  N N    . GLY A 1 1   ? -15.319 9.580   -12.682 1.00 0.00 ? 1   GLY A N    3  
ATOM 3446  C CA   . GLY A 1 1   ? -14.349 10.603  -13.036 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3447  C C    . GLY A 1 1   ? -14.040 11.502  -11.837 1.00 0.00 ? 1   GLY A C    3  
ATOM 3448  O O    . GLY A 1 1   ? -14.594 11.314  -10.756 1.00 0.00 ? 1   GLY A O    3  
ATOM 3449  H H1   . GLY A 1 1   ? -16.276 9.862   -12.753 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3450  H HA2  . GLY A 1 1   ? -13.432 10.133  -13.389 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3451  H HA3  . GLY A 1 1   ? -14.735 11.206  -13.858 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3452  N N    . SER A 1 2   ? -13.154 12.460  -12.070 1.00 0.00 ? 2   SER A N    3  
ATOM 3453  C CA   . SER A 1 2   ? -12.764 13.389  -11.024 1.00 0.00 ? 2   SER A CA   3  
ATOM 3454  C C    . SER A 1 2   ? -11.702 14.356  -11.551 1.00 0.00 ? 2   SER A C    3  
ATOM 3455  O O    . SER A 1 2   ? -10.869 13.980  -12.374 1.00 0.00 ? 2   SER A O    3  
ATOM 3456  C CB   . SER A 1 2   ? -12.240 12.645  -9.794  1.00 0.00 ? 2   SER A CB   3  
ATOM 3457  O OG   . SER A 1 2   ? -12.938 13.016  -8.608  1.00 0.00 ? 2   SER A OG   3  
ATOM 3458  H H    . SER A 1 2   ? -12.708 12.606  -12.953 1.00 0.00 ? 2   SER A H    3  
ATOM 3459  H HA   . SER A 1 2   ? -13.675 13.927  -10.761 1.00 0.00 ? 2   SER A HA   3  
ATOM 3460  H HB2  . SER A 1 2   ? -12.338 11.571  -9.951  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3461  H HB3  . SER A 1 2   ? -11.177 12.853  -9.670  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3462  H HG   . SER A 1 2   ? -13.444 13.865  -8.760  1.00 0.00 ? 2   SER A HG   3  
ATOM 3463  N N    . SER A 1 3   ? -11.766 15.583  -11.056 1.00 0.00 ? 3   SER A N    3  
ATOM 3464  C CA   . SER A 1 3   ? -10.821 16.607  -11.467 1.00 0.00 ? 3   SER A CA   3  
ATOM 3465  C C    . SER A 1 3   ? -9.756  16.801  -10.385 1.00 0.00 ? 3   SER A C    3  
ATOM 3466  O O    . SER A 1 3   ? -9.884  16.273  -9.282  1.00 0.00 ? 3   SER A O    3  
ATOM 3467  C CB   . SER A 1 3   ? -11.532 17.930  -11.755 1.00 0.00 ? 3   SER A CB   3  
ATOM 3468  O OG   . SER A 1 3   ? -12.562 17.782  -12.728 1.00 0.00 ? 3   SER A OG   3  
ATOM 3469  H H    . SER A 1 3   ? -12.447 15.881  -10.387 1.00 0.00 ? 3   SER A H    3  
ATOM 3470  H HA   . SER A 1 3   ? -10.369 16.231  -12.385 1.00 0.00 ? 3   SER A HA   3  
ATOM 3471  H HB2  . SER A 1 3   ? -11.960 18.320  -10.831 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3472  H HB3  . SER A 1 3   ? -10.805 18.664  -12.104 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3473  H HG   . SER A 1 3   ? -12.231 17.233  -13.496 1.00 0.00 ? 3   SER A HG   3  
ATOM 3474  N N    . GLY A 1 4   ? -8.729  17.559  -10.740 1.00 0.00 ? 4   GLY A N    3  
ATOM 3475  C CA   . GLY A 1 4   ? -7.643  17.829  -9.813  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3476  C C    . GLY A 1 4   ? -6.574  18.710  -10.463 1.00 0.00 ? 4   GLY A C    3  
ATOM 3477  O O    . GLY A 1 4   ? -6.712  19.111  -11.618 1.00 0.00 ? 4   GLY A O    3  
ATOM 3478  H H    . GLY A 1 4   ? -8.633  17.985  -11.639 1.00 0.00 ? 4   GLY A H    3  
ATOM 3479  H HA2  . GLY A 1 4   ? -8.034  18.322  -8.923  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3480  H HA3  . GLY A 1 4   ? -7.196  16.890  -9.487  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3481  N N    . SER A 1 5   ? -5.532  18.987  -9.692  1.00 0.00 ? 5   SER A N    3  
ATOM 3482  C CA   . SER A 1 5   ? -4.440  19.813  -10.178 1.00 0.00 ? 5   SER A CA   3  
ATOM 3483  C C    . SER A 1 5   ? -3.280  19.786  -9.182  1.00 0.00 ? 5   SER A C    3  
ATOM 3484  O O    . SER A 1 5   ? -3.389  20.327  -8.082  1.00 0.00 ? 5   SER A O    3  
ATOM 3485  C CB   . SER A 1 5   ? -4.903  21.252  -10.416 1.00 0.00 ? 5   SER A CB   3  
ATOM 3486  O OG   . SER A 1 5   ? -5.600  21.782  -9.292  1.00 0.00 ? 5   SER A OG   3  
ATOM 3487  H H    . SER A 1 5   ? -5.428  18.657  -8.754  1.00 0.00 ? 5   SER A H    3  
ATOM 3488  H HA   . SER A 1 5   ? -4.141  19.367  -11.126 1.00 0.00 ? 5   SER A HA   3  
ATOM 3489  H HB2  . SER A 1 5   ? -4.038  21.879  -10.635 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3490  H HB3  . SER A 1 5   ? -5.550  21.285  -11.293 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3491  H HG   . SER A 1 5   ? -5.297  21.325  -8.456  1.00 0.00 ? 5   SER A HG   3  
ATOM 3492  N N    . SER A 1 6   ? -2.196  19.151  -9.602  1.00 0.00 ? 6   SER A N    3  
ATOM 3493  C CA   . SER A 1 6   ? -1.016  19.047  -8.759  1.00 0.00 ? 6   SER A CA   3  
ATOM 3494  C C    . SER A 1 6   ? 0.103   18.325  -9.513  1.00 0.00 ? 6   SER A C    3  
ATOM 3495  O O    . SER A 1 6   ? -0.154  17.623  -10.489 1.00 0.00 ? 6   SER A O    3  
ATOM 3496  C CB   . SER A 1 6   ? -1.335  18.316  -7.454  1.00 0.00 ? 6   SER A CB   3  
ATOM 3497  O OG   . SER A 1 6   ? -1.457  19.215  -6.355  1.00 0.00 ? 6   SER A OG   3  
ATOM 3498  H H    . SER A 1 6   ? -2.115  18.714  -10.498 1.00 0.00 ? 6   SER A H    3  
ATOM 3499  H HA   . SER A 1 6   ? -0.727  20.075  -8.539  1.00 0.00 ? 6   SER A HA   3  
ATOM 3500  H HB2  . SER A 1 6   ? -2.263  17.756  -7.569  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3501  H HB3  . SER A 1 6   ? -0.549  17.591  -7.243  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3502  H HG   . SER A 1 6   ? -0.563  19.600  -6.127  1.00 0.00 ? 6   SER A HG   3  
ATOM 3503  N N    . GLY A 1 7   ? 1.321   18.523  -9.031  1.00 0.00 ? 7   GLY A N    3  
ATOM 3504  C CA   . GLY A 1 7   ? 2.480   17.899  -9.646  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3505  C C    . GLY A 1 7   ? 3.278   17.092  -8.621  1.00 0.00 ? 7   GLY A C    3  
ATOM 3506  O O    . GLY A 1 7   ? 4.433   17.407  -8.340  1.00 0.00 ? 7   GLY A O    3  
ATOM 3507  H H    . GLY A 1 7   ? 1.521   19.096  -8.236  1.00 0.00 ? 7   GLY A H    3  
ATOM 3508  H HA2  . GLY A 1 7   ? 2.158   17.246  -10.458 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3509  H HA3  . GLY A 1 7   ? 3.118   18.665  -10.088 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3510  N N    . ASP A 1 8   ? 2.629   16.066  -8.089  1.00 0.00 ? 8   ASP A N    3  
ATOM 3511  C CA   . ASP A 1 8   ? 3.264   15.211  -7.100  1.00 0.00 ? 8   ASP A CA   3  
ATOM 3512  C C    . ASP A 1 8   ? 2.299   14.091  -6.706  1.00 0.00 ? 8   ASP A C    3  
ATOM 3513  O O    . ASP A 1 8   ? 1.819   14.051  -5.574  1.00 0.00 ? 8   ASP A O    3  
ATOM 3514  C CB   . ASP A 1 8   ? 3.617   15.998  -5.837  1.00 0.00 ? 8   ASP A CB   3  
ATOM 3515  C CG   . ASP A 1 8   ? 4.809   15.453  -5.047  1.00 0.00 ? 8   ASP A CG   3  
ATOM 3516  O OD1  . ASP A 1 8   ? 5.412   14.472  -5.535  1.00 0.00 ? 8   ASP A OD1  3  
ATOM 3517  O OD2  . ASP A 1 8   ? 5.090   16.029  -3.974  1.00 0.00 ? 8   ASP A OD2  3  
ATOM 3518  H H    . ASP A 1 8   ? 1.690   15.816  -8.323  1.00 0.00 ? 8   ASP A H    3  
ATOM 3519  H HA   . ASP A 1 8   ? 4.165   14.833  -7.584  1.00 0.00 ? 8   ASP A HA   3  
ATOM 3520  H HB2  . ASP A 1 8   ? 3.827   17.030  -6.117  1.00 0.00 ? 8   ASP A HB2  3  
ATOM 3521  H HB3  . ASP A 1 8   ? 2.745   16.016  -5.183  1.00 0.00 ? 8   ASP A HB3  3  
ATOM 3522  N N    . LYS A 1 9   ? 2.043   13.209  -7.661  1.00 0.00 ? 9   LYS A N    3  
ATOM 3523  C CA   . LYS A 1 9   ? 1.144   12.093  -7.427  1.00 0.00 ? 9   LYS A CA   3  
ATOM 3524  C C    . LYS A 1 9   ? 1.894   10.781  -7.665  1.00 0.00 ? 9   LYS A C    3  
ATOM 3525  O O    . LYS A 1 9   ? 1.961   10.295  -8.793  1.00 0.00 ? 9   LYS A O    3  
ATOM 3526  C CB   . LYS A 1 9   ? -0.123  12.238  -8.274  1.00 0.00 ? 9   LYS A CB   3  
ATOM 3527  C CG   . LYS A 1 9   ? -0.847  13.548  -7.956  1.00 0.00 ? 9   LYS A CG   3  
ATOM 3528  C CD   . LYS A 1 9   ? -2.355  13.406  -8.168  1.00 0.00 ? 9   LYS A CD   3  
ATOM 3529  C CE   . LYS A 1 9   ? -2.821  14.238  -9.364  1.00 0.00 ? 9   LYS A CE   3  
ATOM 3530  N NZ   . LYS A 1 9   ? -3.561  13.392  -10.328 1.00 0.00 ? 9   LYS A NZ   3  
ATOM 3531  H H    . LYS A 1 9   ? 2.438   13.250  -8.579  1.00 0.00 ? 9   LYS A H    3  
ATOM 3532  H HA   . LYS A 1 9   ? 0.839   12.132  -6.382  1.00 0.00 ? 9   LYS A HA   3  
ATOM 3533  H HB2  . LYS A 1 9   ? 0.137   12.209  -9.332  1.00 0.00 ? 9   LYS A HB2  3  
ATOM 3534  H HB3  . LYS A 1 9   ? -0.788  11.396  -8.086  1.00 0.00 ? 9   LYS A HB3  3  
ATOM 3535  H HG2  . LYS A 1 9   ? -0.647  13.837  -6.924  1.00 0.00 ? 9   LYS A HG2  3  
ATOM 3536  H HG3  . LYS A 1 9   ? -0.460  14.345  -8.591  1.00 0.00 ? 9   LYS A HG3  3  
ATOM 3537  H HD2  . LYS A 1 9   ? -2.606  12.358  -8.330  1.00 0.00 ? 9   LYS A HD2  3  
ATOM 3538  H HD3  . LYS A 1 9   ? -2.884  13.725  -7.270  1.00 0.00 ? 9   LYS A HD3  3  
ATOM 3539  H HE2  . LYS A 1 9   ? -3.460  15.053  -9.022  1.00 0.00 ? 9   LYS A HE2  3  
ATOM 3540  H HE3  . LYS A 1 9   ? -1.961  14.692  -9.856  1.00 0.00 ? 9   LYS A HE3  3  
ATOM 3541  H HZ1  . LYS A 1 9   ? -2.932  12.740  -10.750 1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 3542  H HZ2  . LYS A 1 9   ? -4.284  12.895  -9.848  1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 3543  H HZ3  . LYS A 1 9   ? -3.967  13.970  -11.036 1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 3544  N N    . PRO A 1 10  ? 2.455   10.230  -6.555  1.00 0.00 ? 10  PRO A N    3  
ATOM 3545  C CA   . PRO A 1 10  ? 3.199   8.984   -6.631  1.00 0.00 ? 10  PRO A CA   3  
ATOM 3546  C C    . PRO A 1 10  ? 2.254   7.791   -6.788  1.00 0.00 ? 10  PRO A C    3  
ATOM 3547  O O    . PRO A 1 10  ? 2.656   6.736   -7.275  1.00 0.00 ? 10  PRO A O    3  
ATOM 3548  C CB   . PRO A 1 10  ? 4.013   8.933   -5.349  1.00 0.00 ? 10  PRO A CB   3  
ATOM 3549  C CG   . PRO A 1 10  ? 3.350   9.913   -4.394  1.00 0.00 ? 10  PRO A CG   3  
ATOM 3550  C CD   . PRO A 1 10  ? 2.397   10.778  -5.203  1.00 0.00 ? 10  PRO A CD   3  
ATOM 3551  H HA   . PRO A 1 10  ? 3.783   8.978   -7.442  1.00 0.00 ? 10  PRO A HA   3  
ATOM 3552  H HB2  . PRO A 1 10  ? 4.021   7.926   -4.931  1.00 0.00 ? 10  PRO A HB2  3  
ATOM 3553  H HB3  . PRO A 1 10  ? 5.051   9.209   -5.534  1.00 0.00 ? 10  PRO A HB3  3  
ATOM 3554  H HG2  . PRO A 1 10  ? 2.812   9.379   -3.612  1.00 0.00 ? 10  PRO A HG2  3  
ATOM 3555  H HG3  . PRO A 1 10  ? 4.100   10.531  -3.900  1.00 0.00 ? 10  PRO A HG3  3  
ATOM 3556  H HD2  . PRO A 1 10  ? 1.385   10.733  -4.801  1.00 0.00 ? 10  PRO A HD2  3  
ATOM 3557  H HD3  . PRO A 1 10  ? 2.700   11.824  -5.186  1.00 0.00 ? 10  PRO A HD3  3  
ATOM 3558  N N    . LEU A 1 11  ? 1.015   7.998   -6.365  1.00 0.00 ? 11  LEU A N    3  
ATOM 3559  C CA   . LEU A 1 11  ? 0.010   6.952   -6.452  1.00 0.00 ? 11  LEU A CA   3  
ATOM 3560  C C    . LEU A 1 11  ? -0.958  7.276   -7.591  1.00 0.00 ? 11  LEU A C    3  
ATOM 3561  O O    . LEU A 1 11  ? -1.831  6.472   -7.916  1.00 0.00 ? 11  LEU A O    3  
ATOM 3562  C CB   . LEU A 1 11  ? -0.676  6.755   -5.099  1.00 0.00 ? 11  LEU A CB   3  
ATOM 3563  C CG   . LEU A 1 11  ? 0.251   6.633   -3.888  1.00 0.00 ? 11  LEU A CG   3  
ATOM 3564  C CD1  . LEU A 1 11  ? -0.537  6.740   -2.581  1.00 0.00 ? 11  LEU A CD1  3  
ATOM 3565  C CD2  . LEU A 1 11  ? 1.075   5.346   -3.956  1.00 0.00 ? 11  LEU A CD2  3  
ATOM 3566  H H    . LEU A 1 11  ? 0.696   8.859   -5.969  1.00 0.00 ? 11  LEU A H    3  
ATOM 3567  H HA   . LEU A 1 11  ? 0.526   6.022   -6.690  1.00 0.00 ? 11  LEU A HA   3  
ATOM 3568  H HB2  . LEU A 1 11  ? -1.352  7.594   -4.931  1.00 0.00 ? 11  LEU A HB2  3  
ATOM 3569  H HB3  . LEU A 1 11  ? -1.291  5.856   -5.153  1.00 0.00 ? 11  LEU A HB3  3  
ATOM 3570  H HG   . LEU A 1 11  ? 0.953   7.466   -3.910  1.00 0.00 ? 11  LEU A HG   3  
ATOM 3571  H HD11 . LEU A 1 11  ? -1.151  5.849   -2.453  1.00 0.00 ? 11  LEU A HD11 3  
ATOM 3572  H HD12 . LEU A 1 11  ? 0.157   6.827   -1.744  1.00 0.00 ? 11  LEU A HD12 3  
ATOM 3573  H HD13 . LEU A 1 11  ? -1.178  7.622   -2.614  1.00 0.00 ? 11  LEU A HD13 3  
ATOM 3574  H HD21 . LEU A 1 11  ? 1.312   5.012   -2.946  1.00 0.00 ? 11  LEU A HD21 3  
ATOM 3575  H HD22 . LEU A 1 11  ? 0.501   4.573   -4.468  1.00 0.00 ? 11  LEU A HD22 3  
ATOM 3576  H HD23 . LEU A 1 11  ? 1.999   5.534   -4.503  1.00 0.00 ? 11  LEU A HD23 3  
ATOM 3577  N N    . SER A 1 12  ? -0.772  8.454   -8.167  1.00 0.00 ? 12  SER A N    3  
ATOM 3578  C CA   . SER A 1 12  ? -1.618  8.893   -9.264  1.00 0.00 ? 12  SER A CA   3  
ATOM 3579  C C    . SER A 1 12  ? -1.917  7.719   -10.197 1.00 0.00 ? 12  SER A C    3  
ATOM 3580  O O    . SER A 1 12  ? -1.134  7.421   -11.097 1.00 0.00 ? 12  SER A O    3  
ATOM 3581  C CB   . SER A 1 12  ? -0.962  10.036  -10.042 1.00 0.00 ? 12  SER A CB   3  
ATOM 3582  O OG   . SER A 1 12  ? -1.764  11.214  -10.037 1.00 0.00 ? 12  SER A OG   3  
ATOM 3583  H H    . SER A 1 12  ? -0.060  9.102   -7.897  1.00 0.00 ? 12  SER A H    3  
ATOM 3584  H HA   . SER A 1 12  ? -2.534  9.253   -8.795  1.00 0.00 ? 12  SER A HA   3  
ATOM 3585  H HB2  . SER A 1 12  ? 0.012   10.258  -9.607  1.00 0.00 ? 12  SER A HB2  3  
ATOM 3586  H HB3  . SER A 1 12  ? -0.788  9.720   -11.071 1.00 0.00 ? 12  SER A HB3  3  
ATOM 3587  H HG   . SER A 1 12  ? -2.708  10.985  -9.801  1.00 0.00 ? 12  SER A HG   3  
ATOM 3588  N N    . ASN A 1 13  ? -3.053  7.083   -9.950  1.00 0.00 ? 13  ASN A N    3  
ATOM 3589  C CA   . ASN A 1 13  ? -3.465  5.947   -10.757 1.00 0.00 ? 13  ASN A CA   3  
ATOM 3590  C C    . ASN A 1 13  ? -2.850  4.669   -10.184 1.00 0.00 ? 13  ASN A C    3  
ATOM 3591  O O    . ASN A 1 13  ? -2.256  3.879   -10.917 1.00 0.00 ? 13  ASN A O    3  
ATOM 3592  C CB   . ASN A 1 13  ? -2.987  6.096   -12.203 1.00 0.00 ? 13  ASN A CB   3  
ATOM 3593  C CG   . ASN A 1 13  ? -3.952  5.412   -13.173 1.00 0.00 ? 13  ASN A CG   3  
ATOM 3594  O OD1  . ASN A 1 13  ? -4.895  4.744   -12.784 1.00 0.00 ? 13  ASN A OD1  3  
ATOM 3595  N ND2  . ASN A 1 13  ? -3.664  5.616   -14.456 1.00 0.00 ? 13  ASN A ND2  3  
ATOM 3596  H H    . ASN A 1 13  ? -3.685  7.331   -9.216  1.00 0.00 ? 13  ASN A H    3  
ATOM 3597  H HA   . ASN A 1 13  ? -4.554  5.943   -10.710 1.00 0.00 ? 13  ASN A HA   3  
ATOM 3598  H HB2  . ASN A 1 13  ? -2.900  7.153   -12.454 1.00 0.00 ? 13  ASN A HB2  3  
ATOM 3599  H HB3  . ASN A 1 13  ? -1.992  5.661   -12.307 1.00 0.00 ? 13  ASN A HB3  3  
ATOM 3600  H HD21 . ASN A 1 13  ? -2.874  6.175   -14.708 1.00 0.00 ? 13  ASN A HD21 3  
ATOM 3601  H HD22 . ASN A 1 13  ? -4.237  5.210   -15.167 1.00 0.00 ? 13  ASN A HD22 3  
ATOM 3602  N N    . MET A 1 14  ? -3.012  4.506   -8.879  1.00 0.00 ? 14  MET A N    3  
ATOM 3603  C CA   . MET A 1 14  ? -2.479  3.337   -8.200  1.00 0.00 ? 14  MET A CA   3  
ATOM 3604  C C    . MET A 1 14  ? -3.413  2.883   -7.076  1.00 0.00 ? 14  MET A C    3  
ATOM 3605  O O    . MET A 1 14  ? -3.754  3.668   -6.192  1.00 0.00 ? 14  MET A O    3  
ATOM 3606  C CB   . MET A 1 14  ? -1.103  3.668   -7.618  1.00 0.00 ? 14  MET A CB   3  
ATOM 3607  C CG   . MET A 1 14  ? -0.027  3.640   -8.705  1.00 0.00 ? 14  MET A CG   3  
ATOM 3608  S SD   . MET A 1 14  ? 0.993   2.187   -8.518  1.00 0.00 ? 14  MET A SD   3  
ATOM 3609  C CE   . MET A 1 14  ? 1.442   2.344   -6.797  1.00 0.00 ? 14  MET A CE   3  
ATOM 3610  H H    . MET A 1 14  ? -3.496  5.153   -8.291  1.00 0.00 ? 14  MET A H    3  
ATOM 3611  H HA   . MET A 1 14  ? -2.412  2.561   -8.962  1.00 0.00 ? 14  MET A HA   3  
ATOM 3612  H HB2  . MET A 1 14  ? -1.129  4.653   -7.151  1.00 0.00 ? 14  MET A HB2  3  
ATOM 3613  H HB3  . MET A 1 14  ? -0.854  2.951   -6.836  1.00 0.00 ? 14  MET A HB3  3  
ATOM 3614  H HG2  . MET A 1 14  ? -0.494  3.642   -9.690  1.00 0.00 ? 14  MET A HG2  3  
ATOM 3615  H HG3  . MET A 1 14  ? 0.588   4.537   -8.642  1.00 0.00 ? 14  MET A HG3  3  
ATOM 3616  H HE1  . MET A 1 14  ? 2.456   1.972   -6.651  1.00 0.00 ? 14  MET A HE1  3  
ATOM 3617  H HE2  . MET A 1 14  ? 1.393   3.392   -6.503  1.00 0.00 ? 14  MET A HE2  3  
ATOM 3618  H HE3  . MET A 1 14  ? 0.750   1.763   -6.187  1.00 0.00 ? 14  MET A HE3  3  
ATOM 3619  N N    . LYS A 1 15  ? -3.801  1.618   -7.146  1.00 0.00 ? 15  LYS A N    3  
ATOM 3620  C CA   . LYS A 1 15  ? -4.688  1.051   -6.146  1.00 0.00 ? 15  LYS A CA   3  
ATOM 3621  C C    . LYS A 1 15  ? -3.857  0.498   -4.987  1.00 0.00 ? 15  LYS A C    3  
ATOM 3622  O O    . LYS A 1 15  ? -3.195  -0.529  -5.128  1.00 0.00 ? 15  LYS A O    3  
ATOM 3623  C CB   . LYS A 1 15  ? -5.621  0.017   -6.782  1.00 0.00 ? 15  LYS A CB   3  
ATOM 3624  C CG   . LYS A 1 15  ? -6.981  0.635   -7.110  1.00 0.00 ? 15  LYS A CG   3  
ATOM 3625  C CD   . LYS A 1 15  ? -7.535  0.076   -8.422  1.00 0.00 ? 15  LYS A CD   3  
ATOM 3626  C CE   . LYS A 1 15  ? -9.016  -0.281  -8.284  1.00 0.00 ? 15  LYS A CE   3  
ATOM 3627  N NZ   . LYS A 1 15  ? -9.662  -0.338  -9.615  1.00 0.00 ? 15  LYS A NZ   3  
ATOM 3628  H H    . LYS A 1 15  ? -3.519  0.987   -7.868  1.00 0.00 ? 15  LYS A H    3  
ATOM 3629  H HA   . LYS A 1 15  ? -5.314  1.859   -5.768  1.00 0.00 ? 15  LYS A HA   3  
ATOM 3630  H HB2  . LYS A 1 15  ? -5.167  -0.377  -7.691  1.00 0.00 ? 15  LYS A HB2  3  
ATOM 3631  H HB3  . LYS A 1 15  ? -5.754  -0.824  -6.102  1.00 0.00 ? 15  LYS A HB3  3  
ATOM 3632  H HG2  . LYS A 1 15  ? -7.682  0.433   -6.300  1.00 0.00 ? 15  LYS A HG2  3  
ATOM 3633  H HG3  . LYS A 1 15  ? -6.884  1.718   -7.185  1.00 0.00 ? 15  LYS A HG3  3  
ATOM 3634  H HD2  . LYS A 1 15  ? -7.407  0.810   -9.218  1.00 0.00 ? 15  LYS A HD2  3  
ATOM 3635  H HD3  . LYS A 1 15  ? -6.969  -0.809  -8.712  1.00 0.00 ? 15  LYS A HD3  3  
ATOM 3636  H HE2  . LYS A 1 15  ? -9.119  -1.243  -7.782  1.00 0.00 ? 15  LYS A HE2  3  
ATOM 3637  H HE3  . LYS A 1 15  ? -9.519  0.459   -7.661  1.00 0.00 ? 15  LYS A HE3  3  
ATOM 3638  H HZ1  . LYS A 1 15  ? -9.524  0.531   -10.090 1.00 0.00 ? 15  LYS A HZ1  3  
ATOM 3639  H HZ2  . LYS A 1 15  ? -9.257  -1.079  -10.151 1.00 0.00 ? 15  LYS A HZ2  3  
ATOM 3640  H HZ3  . LYS A 1 15  ? -10.642 -0.505  -9.503  1.00 0.00 ? 15  LYS A HZ3  3  
ATOM 3641  N N    . ILE A 1 16  ? -3.918  1.203   -3.867  1.00 0.00 ? 16  ILE A N    3  
ATOM 3642  C CA   . ILE A 1 16  ? -3.179  0.796   -2.685  1.00 0.00 ? 16  ILE A CA   3  
ATOM 3643  C C    . ILE A 1 16  ? -4.092  -0.030  -1.777  1.00 0.00 ? 16  ILE A C    3  
ATOM 3644  O O    . ILE A 1 16  ? -5.271  0.285   -1.625  1.00 0.00 ? 16  ILE A O    3  
ATOM 3645  C CB   . ILE A 1 16  ? -2.562  2.013   -1.993  1.00 0.00 ? 16  ILE A CB   3  
ATOM 3646  C CG1  . ILE A 1 16  ? -1.510  2.676   -2.885  1.00 0.00 ? 16  ILE A CG1  3  
ATOM 3647  C CG2  . ILE A 1 16  ? -1.995  1.636   -0.622  1.00 0.00 ? 16  ILE A CG2  3  
ATOM 3648  C CD1  . ILE A 1 16  ? -2.140  3.200   -4.177  1.00 0.00 ? 16  ILE A CD1  3  
ATOM 3649  H H    . ILE A 1 16  ? -4.459  2.037   -3.761  1.00 0.00 ? 16  ILE A H    3  
ATOM 3650  H HA   . ILE A 1 16  ? -2.356  0.162   -3.016  1.00 0.00 ? 16  ILE A HA   3  
ATOM 3651  H HB   . ILE A 1 16  ? -3.350  2.746   -1.824  1.00 0.00 ? 16  ILE A HB   3  
ATOM 3652  H HG12 . ILE A 1 16  ? -1.038  3.498   -2.347  1.00 0.00 ? 16  ILE A HG12 3  
ATOM 3653  H HG13 . ILE A 1 16  ? -0.725  1.959   -3.123  1.00 0.00 ? 16  ILE A HG13 3  
ATOM 3654  H HG21 . ILE A 1 16  ? -2.814  1.394   0.055   1.00 0.00 ? 16  ILE A HG21 3  
ATOM 3655  H HG22 . ILE A 1 16  ? -1.341  0.770   -0.725  1.00 0.00 ? 16  ILE A HG22 3  
ATOM 3656  H HG23 . ILE A 1 16  ? -1.427  2.475   -0.221  1.00 0.00 ? 16  ILE A HG23 3  
ATOM 3657  H HD11 . ILE A 1 16  ? -1.499  3.969   -4.608  1.00 0.00 ? 16  ILE A HD11 3  
ATOM 3658  H HD12 . ILE A 1 16  ? -2.249  2.380   -4.887  1.00 0.00 ? 16  ILE A HD12 3  
ATOM 3659  H HD13 . ILE A 1 16  ? -3.120  3.624   -3.958  1.00 0.00 ? 16  ILE A HD13 3  
ATOM 3660  N N    . LEU A 1 17  ? -3.513  -1.071  -1.197  1.00 0.00 ? 17  LEU A N    3  
ATOM 3661  C CA   . LEU A 1 17  ? -4.260  -1.945  -0.308  1.00 0.00 ? 17  LEU A CA   3  
ATOM 3662  C C    . LEU A 1 17  ? -3.749  -1.766  1.123   1.00 0.00 ? 17  LEU A C    3  
ATOM 3663  O O    . LEU A 1 17  ? -2.648  -1.260  1.334   1.00 0.00 ? 17  LEU A O    3  
ATOM 3664  C CB   . LEU A 1 17  ? -4.203  -3.390  -0.806  1.00 0.00 ? 17  LEU A CB   3  
ATOM 3665  C CG   . LEU A 1 17  ? -5.362  -4.293  -0.377  1.00 0.00 ? 17  LEU A CG   3  
ATOM 3666  C CD1  . LEU A 1 17  ? -5.083  -4.933  0.985   1.00 0.00 ? 17  LEU A CD1  3  
ATOM 3667  C CD2  . LEU A 1 17  ? -6.687  -3.529  -0.390  1.00 0.00 ? 17  LEU A CD2  3  
ATOM 3668  H H    . LEU A 1 17  ? -2.553  -1.321  -1.326  1.00 0.00 ? 17  LEU A H    3  
ATOM 3669  H HA   . LEU A 1 17  ? -5.303  -1.632  -0.344  1.00 0.00 ? 17  LEU A HA   3  
ATOM 3670  H HB2  . LEU A 1 17  ? -4.163  -3.378  -1.895  1.00 0.00 ? 17  LEU A HB2  3  
ATOM 3671  H HB3  . LEU A 1 17  ? -3.272  -3.837  -0.458  1.00 0.00 ? 17  LEU A HB3  3  
ATOM 3672  H HG   . LEU A 1 17  ? -5.450  -5.103  -1.101  1.00 0.00 ? 17  LEU A HG   3  
ATOM 3673  H HD11 . LEU A 1 17  ? -5.137  -6.018  0.895   1.00 0.00 ? 17  LEU A HD11 3  
ATOM 3674  H HD12 . LEU A 1 17  ? -4.088  -4.646  1.324   1.00 0.00 ? 17  LEU A HD12 3  
ATOM 3675  H HD13 . LEU A 1 17  ? -5.826  -4.591  1.706   1.00 0.00 ? 17  LEU A HD13 3  
ATOM 3676  H HD21 . LEU A 1 17  ? -6.819  -3.014  0.562   1.00 0.00 ? 17  LEU A HD21 3  
ATOM 3677  H HD22 . LEU A 1 17  ? -6.677  -2.799  -1.200  1.00 0.00 ? 17  LEU A HD22 3  
ATOM 3678  H HD23 . LEU A 1 17  ? -7.509  -4.228  -0.542  1.00 0.00 ? 17  LEU A HD23 3  
ATOM 3679  N N    . THR A 1 18  ? -4.574  -2.192  2.069   1.00 0.00 ? 18  THR A N    3  
ATOM 3680  C CA   . THR A 1 18  ? -4.220  -2.086  3.474   1.00 0.00 ? 18  THR A CA   3  
ATOM 3681  C C    . THR A 1 18  ? -4.622  -3.358  4.223   1.00 0.00 ? 18  THR A C    3  
ATOM 3682  O O    . THR A 1 18  ? -5.564  -4.043  3.829   1.00 0.00 ? 18  THR A O    3  
ATOM 3683  C CB   . THR A 1 18  ? -4.873  -0.820  4.032   1.00 0.00 ? 18  THR A CB   3  
ATOM 3684  O OG1  . THR A 1 18  ? -6.270  -1.047  3.863   1.00 0.00 ? 18  THR A OG1  3  
ATOM 3685  C CG2  . THR A 1 18  ? -4.589  0.413   3.172   1.00 0.00 ? 18  THR A CG2  3  
ATOM 3686  H H    . THR A 1 18  ? -5.468  -2.603  1.888   1.00 0.00 ? 18  THR A H    3  
ATOM 3687  H HA   . THR A 1 18  ? -3.136  -2.000  3.549   1.00 0.00 ? 18  THR A HA   3  
ATOM 3688  H HB   . THR A 1 18  ? -4.573  -0.651  5.066   1.00 0.00 ? 18  THR A HB   3  
ATOM 3689  H HG1  . THR A 1 18  ? -6.712  -1.133  4.755   1.00 0.00 ? 18  THR A HG1  3  
ATOM 3690  H HG21 . THR A 1 18  ? -5.135  1.268   3.571   1.00 0.00 ? 18  THR A HG21 3  
ATOM 3691  H HG22 . THR A 1 18  ? -3.520  0.627   3.184   1.00 0.00 ? 18  THR A HG22 3  
ATOM 3692  H HG23 . THR A 1 18  ? -4.910  0.223   2.147   1.00 0.00 ? 18  THR A HG23 3  
ATOM 3693  N N    . LEU A 1 19  ? -3.887  -3.635  5.290   1.00 0.00 ? 19  LEU A N    3  
ATOM 3694  C CA   . LEU A 1 19  ? -4.155  -4.813  6.098   1.00 0.00 ? 19  LEU A CA   3  
ATOM 3695  C C    . LEU A 1 19  ? -3.878  -4.491  7.568   1.00 0.00 ? 19  LEU A C    3  
ATOM 3696  O O    . LEU A 1 19  ? -3.181  -3.526  7.875   1.00 0.00 ? 19  LEU A O    3  
ATOM 3697  C CB   . LEU A 1 19  ? -3.367  -6.014  5.572   1.00 0.00 ? 19  LEU A CB   3  
ATOM 3698  C CG   . LEU A 1 19  ? -4.172  -7.053  4.788   1.00 0.00 ? 19  LEU A CG   3  
ATOM 3699  C CD1  . LEU A 1 19  ? -3.245  -8.018  4.046   1.00 0.00 ? 19  LEU A CD1  3  
ATOM 3700  C CD2  . LEU A 1 19  ? -5.154  -7.789  5.702   1.00 0.00 ? 19  LEU A CD2  3  
ATOM 3701  H H    . LEU A 1 19  ? -3.122  -3.072  5.604   1.00 0.00 ? 19  LEU A H    3  
ATOM 3702  H HA   . LEU A 1 19  ? -5.214  -5.049  5.990   1.00 0.00 ? 19  LEU A HA   3  
ATOM 3703  H HB2  . LEU A 1 19  ? -2.566  -5.646  4.932   1.00 0.00 ? 19  LEU A HB2  3  
ATOM 3704  H HB3  . LEU A 1 19  ? -2.895  -6.512  6.419   1.00 0.00 ? 19  LEU A HB3  3  
ATOM 3705  H HG   . LEU A 1 19  ? -4.762  -6.531  4.035   1.00 0.00 ? 19  LEU A HG   3  
ATOM 3706  H HD11 . LEU A 1 19  ? -3.734  -8.362  3.135   1.00 0.00 ? 19  LEU A HD11 3  
ATOM 3707  H HD12 . LEU A 1 19  ? -2.318  -7.506  3.790   1.00 0.00 ? 19  LEU A HD12 3  
ATOM 3708  H HD13 . LEU A 1 19  ? -3.024  -8.873  4.685   1.00 0.00 ? 19  LEU A HD13 3  
ATOM 3709  H HD21 . LEU A 1 19  ? -4.757  -8.776  5.941   1.00 0.00 ? 19  LEU A HD21 3  
ATOM 3710  H HD22 . LEU A 1 19  ? -5.291  -7.220  6.621   1.00 0.00 ? 19  LEU A HD22 3  
ATOM 3711  H HD23 . LEU A 1 19  ? -6.112  -7.896  5.194   1.00 0.00 ? 19  LEU A HD23 3  
ATOM 3712  N N    . GLY A 1 20  ? -4.440  -5.319  8.437   1.00 0.00 ? 20  GLY A N    3  
ATOM 3713  C CA   . GLY A 1 20  ? -4.262  -5.135  9.868   1.00 0.00 ? 20  GLY A CA   3  
ATOM 3714  C C    . GLY A 1 20  ? -4.753  -3.754  10.308  1.00 0.00 ? 20  GLY A C    3  
ATOM 3715  O O    . GLY A 1 20  ? -5.710  -3.224  9.747   1.00 0.00 ? 20  GLY A O    3  
ATOM 3716  H H    . GLY A 1 20  ? -5.006  -6.101  8.179   1.00 0.00 ? 20  GLY A H    3  
ATOM 3717  H HA2  . GLY A 1 20  ? -4.808  -5.908  10.408  1.00 0.00 ? 20  GLY A HA2  3  
ATOM 3718  H HA3  . GLY A 1 20  ? -3.209  -5.249  10.125  1.00 0.00 ? 20  GLY A HA3  3  
ATOM 3719  N N    . LYS A 1 21  ? -4.074  -3.211  11.308  1.00 0.00 ? 21  LYS A N    3  
ATOM 3720  C CA   . LYS A 1 21  ? -4.429  -1.903  11.831  1.00 0.00 ? 21  LYS A CA   3  
ATOM 3721  C C    . LYS A 1 21  ? -3.210  -0.982  11.759  1.00 0.00 ? 21  LYS A C    3  
ATOM 3722  O O    . LYS A 1 21  ? -2.088  -1.409  12.026  1.00 0.00 ? 21  LYS A O    3  
ATOM 3723  C CB   . LYS A 1 21  ? -5.022  -2.029  13.235  1.00 0.00 ? 21  LYS A CB   3  
ATOM 3724  C CG   . LYS A 1 21  ? -5.632  -0.703  13.694  1.00 0.00 ? 21  LYS A CG   3  
ATOM 3725  C CD   . LYS A 1 21  ? -7.016  -0.492  13.076  1.00 0.00 ? 21  LYS A CD   3  
ATOM 3726  C CE   . LYS A 1 21  ? -6.998  0.664   12.074  1.00 0.00 ? 21  LYS A CE   3  
ATOM 3727  N NZ   . LYS A 1 21  ? -8.157  1.558   12.294  1.00 0.00 ? 21  LYS A NZ   3  
ATOM 3728  H H    . LYS A 1 21  ? -3.296  -3.649  11.759  1.00 0.00 ? 21  LYS A H    3  
ATOM 3729  H HA   . LYS A 1 21  ? -5.209  -1.495  11.187  1.00 0.00 ? 21  LYS A HA   3  
ATOM 3730  H HB2  . LYS A 1 21  ? -5.786  -2.807  13.243  1.00 0.00 ? 21  LYS A HB2  3  
ATOM 3731  H HB3  . LYS A 1 21  ? -4.246  -2.338  13.935  1.00 0.00 ? 21  LYS A HB3  3  
ATOM 3732  H HG2  . LYS A 1 21  ? -5.710  -0.692  14.782  1.00 0.00 ? 21  LYS A HG2  3  
ATOM 3733  H HG3  . LYS A 1 21  ? -4.975  0.120   13.414  1.00 0.00 ? 21  LYS A HG3  3  
ATOM 3734  H HD2  . LYS A 1 21  ? -7.338  -1.406  12.577  1.00 0.00 ? 21  LYS A HD2  3  
ATOM 3735  H HD3  . LYS A 1 21  ? -7.742  -0.286  13.862  1.00 0.00 ? 21  LYS A HD3  3  
ATOM 3736  H HE2  . LYS A 1 21  ? -6.071  1.228   12.177  1.00 0.00 ? 21  LYS A HE2  3  
ATOM 3737  H HE3  . LYS A 1 21  ? -7.021  0.272   11.057  1.00 0.00 ? 21  LYS A HE3  3  
ATOM 3738  H HZ1  . LYS A 1 21  ? -8.135  1.908   13.230  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 3739  H HZ2  . LYS A 1 21  ? -8.114  2.323   11.651  1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 3740  H HZ3  . LYS A 1 21  ? -9.004  1.047   12.148  1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 3741  N N    . LEU A 1 22  ? -3.471  0.266   11.396  1.00 0.00 ? 22  LEU A N    3  
ATOM 3742  C CA   . LEU A 1 22  ? -2.408  1.251   11.286  1.00 0.00 ? 22  LEU A CA   3  
ATOM 3743  C C    . LEU A 1 22  ? -2.617  2.340   12.339  1.00 0.00 ? 22  LEU A C    3  
ATOM 3744  O O    . LEU A 1 22  ? -3.587  2.300   13.095  1.00 0.00 ? 22  LEU A O    3  
ATOM 3745  C CB   . LEU A 1 22  ? -2.322  1.787   9.855   1.00 0.00 ? 22  LEU A CB   3  
ATOM 3746  C CG   . LEU A 1 22  ? -2.343  0.737   8.743   1.00 0.00 ? 22  LEU A CG   3  
ATOM 3747  C CD1  . LEU A 1 22  ? -2.972  1.302   7.468   1.00 0.00 ? 22  LEU A CD1  3  
ATOM 3748  C CD2  . LEU A 1 22  ? -0.942  0.177   8.491   1.00 0.00 ? 22  LEU A CD2  3  
ATOM 3749  H H    . LEU A 1 22  ? -4.386  0.606   11.180  1.00 0.00 ? 22  LEU A H    3  
ATOM 3750  H HA   . LEU A 1 22  ? -1.468  0.742   11.496  1.00 0.00 ? 22  LEU A HA   3  
ATOM 3751  H HB2  . LEU A 1 22  ? -3.153  2.474   9.695   1.00 0.00 ? 22  LEU A HB2  3  
ATOM 3752  H HB3  . LEU A 1 22  ? -1.405  2.369   9.762   1.00 0.00 ? 22  LEU A HB3  3  
ATOM 3753  H HG   . LEU A 1 22  ? -2.968  -0.094  9.069   1.00 0.00 ? 22  LEU A HG   3  
ATOM 3754  H HD11 . LEU A 1 22  ? -3.588  0.537   6.996   1.00 0.00 ? 22  LEU A HD11 3  
ATOM 3755  H HD12 . LEU A 1 22  ? -3.591  2.164   7.719   1.00 0.00 ? 22  LEU A HD12 3  
ATOM 3756  H HD13 . LEU A 1 22  ? -2.185  1.609   6.779   1.00 0.00 ? 22  LEU A HD13 3  
ATOM 3757  H HD21 . LEU A 1 22  ? -0.898  -0.257  7.492   1.00 0.00 ? 22  LEU A HD21 3  
ATOM 3758  H HD22 . LEU A 1 22  ? -0.209  0.981   8.570   1.00 0.00 ? 22  LEU A HD22 3  
ATOM 3759  H HD23 . LEU A 1 22  ? -0.719  -0.591  9.231   1.00 0.00 ? 22  LEU A HD23 3  
ATOM 3760  N N    . SER A 1 23  ? -1.691  3.288   12.356  1.00 0.00 ? 23  SER A N    3  
ATOM 3761  C CA   . SER A 1 23  ? -1.762  4.386   13.305  1.00 0.00 ? 23  SER A CA   3  
ATOM 3762  C C    . SER A 1 23  ? -2.952  5.289   12.973  1.00 0.00 ? 23  SER A C    3  
ATOM 3763  O O    . SER A 1 23  ? -3.661  5.742   13.870  1.00 0.00 ? 23  SER A O    3  
ATOM 3764  C CB   . SER A 1 23  ? -0.464  5.197   13.306  1.00 0.00 ? 23  SER A CB   3  
ATOM 3765  O OG   . SER A 1 23  ? 0.156   5.209   14.589  1.00 0.00 ? 23  SER A OG   3  
ATOM 3766  H H    . SER A 1 23  ? -0.905  3.313   11.739  1.00 0.00 ? 23  SER A H    3  
ATOM 3767  H HA   . SER A 1 23  ? -1.898  3.917   14.280  1.00 0.00 ? 23  SER A HA   3  
ATOM 3768  H HB2  . SER A 1 23  ? 0.226   4.778   12.574  1.00 0.00 ? 23  SER A HB2  3  
ATOM 3769  H HB3  . SER A 1 23  ? -0.676  6.220   12.996  1.00 0.00 ? 23  SER A HB3  3  
ATOM 3770  H HG   . SER A 1 23  ? -0.480  5.564   15.274  1.00 0.00 ? 23  SER A HG   3  
ATOM 3771  N N    . ARG A 1 24  ? -3.133  5.523   11.682  1.00 0.00 ? 24  ARG A N    3  
ATOM 3772  C CA   . ARG A 1 24  ? -4.225  6.364   11.220  1.00 0.00 ? 24  ARG A CA   3  
ATOM 3773  C C    . ARG A 1 24  ? -5.467  5.515   10.941  1.00 0.00 ? 24  ARG A C    3  
ATOM 3774  O O    . ARG A 1 24  ? -5.454  4.303   11.147  1.00 0.00 ? 24  ARG A O    3  
ATOM 3775  C CB   . ARG A 1 24  ? -3.837  7.122   9.949   1.00 0.00 ? 24  ARG A CB   3  
ATOM 3776  C CG   . ARG A 1 24  ? -2.760  8.168   10.241  1.00 0.00 ? 24  ARG A CG   3  
ATOM 3777  C CD   . ARG A 1 24  ? -3.052  9.477   9.505   1.00 0.00 ? 24  ARG A CD   3  
ATOM 3778  N NE   . ARG A 1 24  ? -1.828  10.306  9.441   1.00 0.00 ? 24  ARG A NE   3  
ATOM 3779  C CZ   . ARG A 1 24  ? -0.878  10.171  8.505   1.00 0.00 ? 24  ARG A CZ   3  
ATOM 3780  N NH1  . ARG A 1 24  ? -1.005  9.240   7.551   1.00 0.00 ? 24  ARG A NH1  3  
ATOM 3781  N NH2  . ARG A 1 24  ? 0.199   10.968  8.525   1.00 0.00 ? 24  ARG A NH2  3  
ATOM 3782  H H    . ARG A 1 24  ? -2.552  5.151   10.959  1.00 0.00 ? 24  ARG A H    3  
ATOM 3783  H HA   . ARG A 1 24  ? -4.403  7.063   12.037  1.00 0.00 ? 24  ARG A HA   3  
ATOM 3784  H HB2  . ARG A 1 24  ? -3.473  6.419   9.199   1.00 0.00 ? 24  ARG A HB2  3  
ATOM 3785  H HB3  . ARG A 1 24  ? -4.717  7.608   9.529   1.00 0.00 ? 24  ARG A HB3  3  
ATOM 3786  H HG2  . ARG A 1 24  ? -2.709  8.353   11.314  1.00 0.00 ? 24  ARG A HG2  3  
ATOM 3787  H HG3  . ARG A 1 24  ? -1.785  7.786   9.937   1.00 0.00 ? 24  ARG A HG3  3  
ATOM 3788  H HD2  . ARG A 1 24  ? -3.412  9.265   8.498   1.00 0.00 ? 24  ARG A HD2  3  
ATOM 3789  H HD3  . ARG A 1 24  ? -3.845  10.023  10.018  1.00 0.00 ? 24  ARG A HD3  3  
ATOM 3790  H HE   . ARG A 1 24  ? -1.702  11.011  10.139  1.00 0.00 ? 24  ARG A HE   3  
ATOM 3791  H HH11 . ARG A 1 24  ? -1.809  8.645   7.536   1.00 0.00 ? 24  ARG A HH11 3  
ATOM 3792  H HH12 . ARG A 1 24  ? -0.296  9.139   6.853   1.00 0.00 ? 24  ARG A HH12 3  
ATOM 3793  H HH21 . ARG A 1 24  ? 0.294   11.663  9.237   1.00 0.00 ? 24  ARG A HH21 3  
ATOM 3794  H HH22 . ARG A 1 24  ? 0.908   10.867  7.827   1.00 0.00 ? 24  ARG A HH22 3  
ATOM 3795  N N    . ASN A 1 25  ? -6.511  6.186   10.477  1.00 0.00 ? 25  ASN A N    3  
ATOM 3796  C CA   . ASN A 1 25  ? -7.758  5.509   10.167  1.00 0.00 ? 25  ASN A CA   3  
ATOM 3797  C C    . ASN A 1 25  ? -7.828  5.240   8.663   1.00 0.00 ? 25  ASN A C    3  
ATOM 3798  O O    . ASN A 1 25  ? -7.296  6.011   7.866   1.00 0.00 ? 25  ASN A O    3  
ATOM 3799  C CB   . ASN A 1 25  ? -8.963  6.371   10.550  1.00 0.00 ? 25  ASN A CB   3  
ATOM 3800  C CG   . ASN A 1 25  ? -10.263 5.571   10.452  1.00 0.00 ? 25  ASN A CG   3  
ATOM 3801  O OD1  . ASN A 1 25  ? -10.273 4.351   10.447  1.00 0.00 ? 25  ASN A OD1  3  
ATOM 3802  N ND2  . ASN A 1 25  ? -11.357 6.323   10.374  1.00 0.00 ? 25  ASN A ND2  3  
ATOM 3803  H H    . ASN A 1 25  ? -6.514  7.173   10.312  1.00 0.00 ? 25  ASN A H    3  
ATOM 3804  H HA   . ASN A 1 25  ? -7.739  4.591   10.755  1.00 0.00 ? 25  ASN A HA   3  
ATOM 3805  H HB2  . ASN A 1 25  ? -8.838  6.746   11.566  1.00 0.00 ? 25  ASN A HB2  3  
ATOM 3806  H HB3  . ASN A 1 25  ? -9.016  7.240   9.894   1.00 0.00 ? 25  ASN A HB3  3  
ATOM 3807  H HD21 . ASN A 1 25  ? -11.280 7.320   10.383  1.00 0.00 ? 25  ASN A HD21 3  
ATOM 3808  H HD22 . ASN A 1 25  ? -12.257 5.892   10.306  1.00 0.00 ? 25  ASN A HD22 3  
ATOM 3809  N N    . LYS A 1 26  ? -8.489  4.144   8.320   1.00 0.00 ? 26  LYS A N    3  
ATOM 3810  C CA   . LYS A 1 26  ? -8.635  3.764   6.925   1.00 0.00 ? 26  LYS A CA   3  
ATOM 3811  C C    . LYS A 1 26  ? -9.009  4.997   6.101   1.00 0.00 ? 26  LYS A C    3  
ATOM 3812  O O    . LYS A 1 26  ? -8.617  5.115   4.941   1.00 0.00 ? 26  LYS A O    3  
ATOM 3813  C CB   . LYS A 1 26  ? -9.628  2.608   6.786   1.00 0.00 ? 26  LYS A CB   3  
ATOM 3814  C CG   . LYS A 1 26  ? -8.996  1.430   6.041   1.00 0.00 ? 26  LYS A CG   3  
ATOM 3815  C CD   . LYS A 1 26  ? -10.017 0.748   5.128   1.00 0.00 ? 26  LYS A CD   3  
ATOM 3816  C CE   . LYS A 1 26  ? -9.430  -0.515  4.495   1.00 0.00 ? 26  LYS A CE   3  
ATOM 3817  N NZ   . LYS A 1 26  ? -10.432 -1.175  3.629   1.00 0.00 ? 26  LYS A NZ   3  
ATOM 3818  H H    . LYS A 1 26  ? -8.919  3.522   8.975   1.00 0.00 ? 26  LYS A H    3  
ATOM 3819  H HA   . LYS A 1 26  ? -7.666  3.400   6.582   1.00 0.00 ? 26  LYS A HA   3  
ATOM 3820  H HB2  . LYS A 1 26  ? -9.956  2.284   7.774   1.00 0.00 ? 26  LYS A HB2  3  
ATOM 3821  H HB3  . LYS A 1 26  ? -10.515 2.947   6.252   1.00 0.00 ? 26  LYS A HB3  3  
ATOM 3822  H HG2  . LYS A 1 26  ? -8.151  1.780   5.449   1.00 0.00 ? 26  LYS A HG2  3  
ATOM 3823  H HG3  . LYS A 1 26  ? -8.606  0.708   6.758   1.00 0.00 ? 26  LYS A HG3  3  
ATOM 3824  H HD2  . LYS A 1 26  ? -10.909 0.491   5.701   1.00 0.00 ? 26  LYS A HD2  3  
ATOM 3825  H HD3  . LYS A 1 26  ? -10.330 1.439   4.345   1.00 0.00 ? 26  LYS A HD3  3  
ATOM 3826  H HE2  . LYS A 1 26  ? -8.547  -0.259  3.910   1.00 0.00 ? 26  LYS A HE2  3  
ATOM 3827  H HE3  . LYS A 1 26  ? -9.106  -1.203  5.276   1.00 0.00 ? 26  LYS A HE3  3  
ATOM 3828  H HZ1  . LYS A 1 26  ? -10.381 -0.790  2.707   1.00 0.00 ? 26  LYS A HZ1  3  
ATOM 3829  H HZ2  . LYS A 1 26  ? -10.245 -2.157  3.591   1.00 0.00 ? 26  LYS A HZ2  3  
ATOM 3830  H HZ3  . LYS A 1 26  ? -11.347 -1.025  4.003   1.00 0.00 ? 26  LYS A HZ3  3  
ATOM 3831  N N    . ASP A 1 27  ? -9.761  5.886   6.733   1.00 0.00 ? 27  ASP A N    3  
ATOM 3832  C CA   . ASP A 1 27  ? -10.192 7.106   6.073   1.00 0.00 ? 27  ASP A CA   3  
ATOM 3833  C C    . ASP A 1 27  ? -8.983  8.020   5.860   1.00 0.00 ? 27  ASP A C    3  
ATOM 3834  O O    . ASP A 1 27  ? -8.607  8.302   4.724   1.00 0.00 ? 27  ASP A O    3  
ATOM 3835  C CB   . ASP A 1 27  ? -11.212 7.863   6.926   1.00 0.00 ? 27  ASP A CB   3  
ATOM 3836  C CG   . ASP A 1 27  ? -12.495 7.090   7.238   1.00 0.00 ? 27  ASP A CG   3  
ATOM 3837  O OD1  . ASP A 1 27  ? -12.376 5.872   7.493   1.00 0.00 ? 27  ASP A OD1  3  
ATOM 3838  O OD2  . ASP A 1 27  ? -13.566 7.735   7.214   1.00 0.00 ? 27  ASP A OD2  3  
ATOM 3839  H H    . ASP A 1 27  ? -10.075 5.782   7.677   1.00 0.00 ? 27  ASP A H    3  
ATOM 3840  H HA   . ASP A 1 27  ? -10.640 6.781   5.134   1.00 0.00 ? 27  ASP A HA   3  
ATOM 3841  H HB2  . ASP A 1 27  ? -10.739 8.146   7.866   1.00 0.00 ? 27  ASP A HB2  3  
ATOM 3842  H HB3  . ASP A 1 27  ? -11.478 8.787   6.413   1.00 0.00 ? 27  ASP A HB3  3  
ATOM 3843  N N    . GLU A 1 28  ? -8.409  8.457   6.971   1.00 0.00 ? 28  GLU A N    3  
ATOM 3844  C CA   . GLU A 1 28  ? -7.251  9.332   6.920   1.00 0.00 ? 28  GLU A CA   3  
ATOM 3845  C C    . GLU A 1 28  ? -6.263  8.845   5.858   1.00 0.00 ? 28  GLU A C    3  
ATOM 3846  O O    . GLU A 1 28  ? -5.607  9.651   5.200   1.00 0.00 ? 28  GLU A O    3  
ATOM 3847  C CB   . GLU A 1 28  ? -6.577  9.431   8.291   1.00 0.00 ? 28  GLU A CB   3  
ATOM 3848  C CG   . GLU A 1 28  ? -7.499  10.106  9.308   1.00 0.00 ? 28  GLU A CG   3  
ATOM 3849  C CD   . GLU A 1 28  ? -6.717  11.069  10.203  1.00 0.00 ? 28  GLU A CD   3  
ATOM 3850  O OE1  . GLU A 1 28  ? -6.406  12.175  9.711   1.00 0.00 ? 28  GLU A OE1  3  
ATOM 3851  O OE2  . GLU A 1 28  ? -6.448  10.677  11.359  1.00 0.00 ? 28  GLU A OE2  3  
ATOM 3852  H H    . GLU A 1 28  ? -8.722  8.222   7.892   1.00 0.00 ? 28  GLU A H    3  
ATOM 3853  H HA   . GLU A 1 28  ? -7.640  10.312  6.642   1.00 0.00 ? 28  GLU A HA   3  
ATOM 3854  H HB2  . GLU A 1 28  ? -6.311  8.434   8.641   1.00 0.00 ? 28  GLU A HB2  3  
ATOM 3855  H HB3  . GLU A 1 28  ? -5.649  9.997   8.204   1.00 0.00 ? 28  GLU A HB3  3  
ATOM 3856  H HG2  . GLU A 1 28  ? -8.287  10.648  8.785   1.00 0.00 ? 28  GLU A HG2  3  
ATOM 3857  H HG3  . GLU A 1 28  ? -7.987  9.348   9.921   1.00 0.00 ? 28  GLU A HG3  3  
ATOM 3858  N N    . VAL A 1 29  ? -6.189  7.529   5.723   1.00 0.00 ? 29  VAL A N    3  
ATOM 3859  C CA   . VAL A 1 29  ? -5.293  6.925   4.752   1.00 0.00 ? 29  VAL A CA   3  
ATOM 3860  C C    . VAL A 1 29  ? -5.967  6.917   3.379   1.00 0.00 ? 29  VAL A C    3  
ATOM 3861  O O    . VAL A 1 29  ? -5.378  7.356   2.392   1.00 0.00 ? 29  VAL A O    3  
ATOM 3862  C CB   . VAL A 1 29  ? -4.876  5.530   5.222   1.00 0.00 ? 29  VAL A CB   3  
ATOM 3863  C CG1  . VAL A 1 29  ? -3.971  4.852   4.190   1.00 0.00 ? 29  VAL A CG1  3  
ATOM 3864  C CG2  . VAL A 1 29  ? -4.196  5.593   6.591   1.00 0.00 ? 29  VAL A CG2  3  
ATOM 3865  H H    . VAL A 1 29  ? -6.727  6.881   6.263   1.00 0.00 ? 29  VAL A H    3  
ATOM 3866  H HA   . VAL A 1 29  ? -4.398  7.545   4.700   1.00 0.00 ? 29  VAL A HA   3  
ATOM 3867  H HB   . VAL A 1 29  ? -5.779  4.927   5.323   1.00 0.00 ? 29  VAL A HB   3  
ATOM 3868  H HG11 . VAL A 1 29  ? -2.989  4.678   4.628   1.00 0.00 ? 29  VAL A HG11 3  
ATOM 3869  H HG12 . VAL A 1 29  ? -4.410  3.900   3.892   1.00 0.00 ? 29  VAL A HG12 3  
ATOM 3870  H HG13 . VAL A 1 29  ? -3.871  5.496   3.317   1.00 0.00 ? 29  VAL A HG13 3  
ATOM 3871  H HG21 . VAL A 1 29  ? -3.160  5.907   6.468   1.00 0.00 ? 29  VAL A HG21 3  
ATOM 3872  H HG22 . VAL A 1 29  ? -4.720  6.309   7.224   1.00 0.00 ? 29  VAL A HG22 3  
ATOM 3873  H HG23 . VAL A 1 29  ? -4.225  4.607   7.056   1.00 0.00 ? 29  VAL A HG23 3  
ATOM 3874  N N    . LYS A 1 30  ? -7.193  6.414   3.359   1.00 0.00 ? 30  LYS A N    3  
ATOM 3875  C CA   . LYS A 1 30  ? -7.953  6.344   2.123   1.00 0.00 ? 30  LYS A CA   3  
ATOM 3876  C C    . LYS A 1 30  ? -7.944  7.715   1.445   1.00 0.00 ? 30  LYS A C    3  
ATOM 3877  O O    . LYS A 1 30  ? -8.015  7.806   0.220   1.00 0.00 ? 30  LYS A O    3  
ATOM 3878  C CB   . LYS A 1 30  ? -9.358  5.798   2.389   1.00 0.00 ? 30  LYS A CB   3  
ATOM 3879  C CG   . LYS A 1 30  ? -10.239 5.924   1.144   1.00 0.00 ? 30  LYS A CG   3  
ATOM 3880  C CD   . LYS A 1 30  ? -11.722 5.861   1.514   1.00 0.00 ? 30  LYS A CD   3  
ATOM 3881  C CE   . LYS A 1 30  ? -12.591 5.676   0.268   1.00 0.00 ? 30  LYS A CE   3  
ATOM 3882  N NZ   . LYS A 1 30  ? -13.875 5.032   0.623   1.00 0.00 ? 30  LYS A NZ   3  
ATOM 3883  H H    . LYS A 1 30  ? -7.664  6.060   4.167   1.00 0.00 ? 30  LYS A H    3  
ATOM 3884  H HA   . LYS A 1 30  ? -7.449  5.631   1.470   1.00 0.00 ? 30  LYS A HA   3  
ATOM 3885  H HB2  . LYS A 1 30  ? -9.295  4.753   2.691   1.00 0.00 ? 30  LYS A HB2  3  
ATOM 3886  H HB3  . LYS A 1 30  ? -9.812  6.342   3.217   1.00 0.00 ? 30  LYS A HB3  3  
ATOM 3887  H HG2  . LYS A 1 30  ? -10.026 6.864   0.637   1.00 0.00 ? 30  LYS A HG2  3  
ATOM 3888  H HG3  . LYS A 1 30  ? -10.001 5.123   0.444   1.00 0.00 ? 30  LYS A HG3  3  
ATOM 3889  H HD2  . LYS A 1 30  ? -11.894 5.038   2.207   1.00 0.00 ? 30  LYS A HD2  3  
ATOM 3890  H HD3  . LYS A 1 30  ? -12.011 6.777   2.030   1.00 0.00 ? 30  LYS A HD3  3  
ATOM 3891  H HE2  . LYS A 1 30  ? -12.778 6.642   -0.199  1.00 0.00 ? 30  LYS A HE2  3  
ATOM 3892  H HE3  . LYS A 1 30  ? -12.061 5.065   -0.464  1.00 0.00 ? 30  LYS A HE3  3  
ATOM 3893  H HZ1  . LYS A 1 30  ? -14.486 5.711   1.031   1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 3894  H HZ2  . LYS A 1 30  ? -14.299 4.656   -0.201  1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 3895  H HZ3  . LYS A 1 30  ? -13.709 4.296   1.279   1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 3896  N N    . ALA A 1 31  ? -7.856  8.747   2.270   1.00 0.00 ? 31  ALA A N    3  
ATOM 3897  C CA   . ALA A 1 31  ? -7.836  10.110  1.765   1.00 0.00 ? 31  ALA A CA   3  
ATOM 3898  C C    . ALA A 1 31  ? -6.449  10.419  1.198   1.00 0.00 ? 31  ALA A C    3  
ATOM 3899  O O    . ALA A 1 31  ? -6.331  11.016  0.129   1.00 0.00 ? 31  ALA A O    3  
ATOM 3900  C CB   . ALA A 1 31  ? -8.238  11.074  2.882   1.00 0.00 ? 31  ALA A CB   3  
ATOM 3901  H H    . ALA A 1 31  ? -7.798  8.665   3.265   1.00 0.00 ? 31  ALA A H    3  
ATOM 3902  H HA   . ALA A 1 31  ? -8.571  10.177  0.962   1.00 0.00 ? 31  ALA A HA   3  
ATOM 3903  H HB1  . ALA A 1 31  ? -7.364  11.640  3.206   1.00 0.00 ? 31  ALA A HB1  3  
ATOM 3904  H HB2  . ALA A 1 31  ? -8.999  11.762  2.513   1.00 0.00 ? 31  ALA A HB2  3  
ATOM 3905  H HB3  . ALA A 1 31  ? -8.637  10.509  3.725   1.00 0.00 ? 31  ALA A HB3  3  
ATOM 3906  N N    . MET A 1 32  ? -5.435  9.999   1.940   1.00 0.00 ? 32  MET A N    3  
ATOM 3907  C CA   . MET A 1 32  ? -4.061  10.224  1.524   1.00 0.00 ? 32  MET A CA   3  
ATOM 3908  C C    . MET A 1 32  ? -3.778  9.553   0.179   1.00 0.00 ? 32  MET A C    3  
ATOM 3909  O O    . MET A 1 32  ? -3.354  10.211  -0.771  1.00 0.00 ? 32  MET A O    3  
ATOM 3910  C CB   . MET A 1 32  ? -3.109  9.665   2.584   1.00 0.00 ? 32  MET A CB   3  
ATOM 3911  C CG   . MET A 1 32  ? -2.277  10.782  3.218   1.00 0.00 ? 32  MET A CG   3  
ATOM 3912  S SD   . MET A 1 32  ? -1.009  11.319  2.082   1.00 0.00 ? 32  MET A SD   3  
ATOM 3913  C CE   . MET A 1 32  ? 0.447   10.815  2.983   1.00 0.00 ? 32  MET A CE   3  
ATOM 3914  H H    . MET A 1 32  ? -5.540  9.514   2.808   1.00 0.00 ? 32  MET A H    3  
ATOM 3915  H HA   . MET A 1 32  ? -3.957  11.305  1.428   1.00 0.00 ? 32  MET A HA   3  
ATOM 3916  H HB2  . MET A 1 32  ? -3.680  9.150   3.355   1.00 0.00 ? 32  MET A HB2  3  
ATOM 3917  H HB3  . MET A 1 32  ? -2.447  8.927   2.130   1.00 0.00 ? 32  MET A HB3  3  
ATOM 3918  H HG2  . MET A 1 32  ? -2.921  11.622  3.480   1.00 0.00 ? 32  MET A HG2  3  
ATOM 3919  H HG3  . MET A 1 32  ? -1.823  10.428  4.143   1.00 0.00 ? 32  MET A HG3  3  
ATOM 3920  H HE1  . MET A 1 32  ? 1.038   10.137  2.368   1.00 0.00 ? 32  MET A HE1  3  
ATOM 3921  H HE2  . MET A 1 32  ? 1.043   11.693  3.232   1.00 0.00 ? 32  MET A HE2  3  
ATOM 3922  H HE3  . MET A 1 32  ? 0.149   10.306  3.900   1.00 0.00 ? 32  MET A HE3  3  
ATOM 3923  N N    . ILE A 1 33  ? -4.023  8.251   0.140   1.00 0.00 ? 33  ILE A N    3  
ATOM 3924  C CA   . ILE A 1 33  ? -3.801  7.484   -1.074  1.00 0.00 ? 33  ILE A CA   3  
ATOM 3925  C C    . ILE A 1 33  ? -4.549  8.143   -2.234  1.00 0.00 ? 33  ILE A C    3  
ATOM 3926  O O    . ILE A 1 33  ? -4.143  8.021   -3.389  1.00 0.00 ? 33  ILE A O    3  
ATOM 3927  C CB   . ILE A 1 33  ? -4.174  6.016   -0.856  1.00 0.00 ? 33  ILE A CB   3  
ATOM 3928  C CG1  . ILE A 1 33  ? -3.364  5.408   0.290   1.00 0.00 ? 33  ILE A CG1  3  
ATOM 3929  C CG2  . ILE A 1 33  ? -4.027  5.215   -2.151  1.00 0.00 ? 33  ILE A CG2  3  
ATOM 3930  C CD1  . ILE A 1 33  ? -4.058  4.168   0.855   1.00 0.00 ? 33  ILE A CD1  3  
ATOM 3931  H H    . ILE A 1 33  ? -4.368  7.724   0.916   1.00 0.00 ? 33  ILE A H    3  
ATOM 3932  H HA   . ILE A 1 33  ? -2.732  7.516   -1.289  1.00 0.00 ? 33  ILE A HA   3  
ATOM 3933  H HB   . ILE A 1 33  ? -5.225  5.971   -0.567  1.00 0.00 ? 33  ILE A HB   3  
ATOM 3934  H HG12 . ILE A 1 33  ? -2.368  5.142   -0.066  1.00 0.00 ? 33  ILE A HG12 3  
ATOM 3935  H HG13 . ILE A 1 33  ? -3.232  6.148   1.080   1.00 0.00 ? 33  ILE A HG13 3  
ATOM 3936  H HG21 . ILE A 1 33  ? -4.213  5.866   -3.005  1.00 0.00 ? 33  ILE A HG21 3  
ATOM 3937  H HG22 . ILE A 1 33  ? -3.017  4.811   -2.215  1.00 0.00 ? 33  ILE A HG22 3  
ATOM 3938  H HG23 . ILE A 1 33  ? -4.747  4.396   -2.155  1.00 0.00 ? 33  ILE A HG23 3  
ATOM 3939  H HD11 . ILE A 1 33  ? -4.776  3.790   0.128   1.00 0.00 ? 33  ILE A HD11 3  
ATOM 3940  H HD12 . ILE A 1 33  ? -3.315  3.399   1.065   1.00 0.00 ? 33  ILE A HD12 3  
ATOM 3941  H HD13 . ILE A 1 33  ? -4.578  4.431   1.777   1.00 0.00 ? 33  ILE A HD13 3  
ATOM 3942  N N    . GLU A 1 34  ? -5.628  8.828   -1.887  1.00 0.00 ? 34  GLU A N    3  
ATOM 3943  C CA   . GLU A 1 34  ? -6.437  9.507   -2.885  1.00 0.00 ? 34  GLU A CA   3  
ATOM 3944  C C    . GLU A 1 34  ? -5.833  10.873  -3.218  1.00 0.00 ? 34  GLU A C    3  
ATOM 3945  O O    . GLU A 1 34  ? -5.604  11.187  -4.385  1.00 0.00 ? 34  GLU A O    3  
ATOM 3946  C CB   . GLU A 1 34  ? -7.885  9.649   -2.413  1.00 0.00 ? 34  GLU A CB   3  
ATOM 3947  C CG   . GLU A 1 34  ? -8.691  8.387   -2.731  1.00 0.00 ? 34  GLU A CG   3  
ATOM 3948  C CD   . GLU A 1 34  ? -10.148 8.732   -3.045  1.00 0.00 ? 34  GLU A CD   3  
ATOM 3949  O OE1  . GLU A 1 34  ? -10.353 9.523   -3.990  1.00 0.00 ? 34  GLU A OE1  3  
ATOM 3950  O OE2  . GLU A 1 34  ? -11.024 8.196   -2.332  1.00 0.00 ? 34  GLU A OE2  3  
ATOM 3951  H H    . GLU A 1 34  ? -5.952  8.923   -0.945  1.00 0.00 ? 34  GLU A H    3  
ATOM 3952  H HA   . GLU A 1 34  ? -6.409  8.866   -3.766  1.00 0.00 ? 34  GLU A HA   3  
ATOM 3953  H HB2  . GLU A 1 34  ? -7.906  9.837   -1.340  1.00 0.00 ? 34  GLU A HB2  3  
ATOM 3954  H HB3  . GLU A 1 34  ? -8.347  10.510  -2.897  1.00 0.00 ? 34  GLU A HB3  3  
ATOM 3955  H HG2  . GLU A 1 34  ? -8.245  7.871   -3.580  1.00 0.00 ? 34  GLU A HG2  3  
ATOM 3956  H HG3  . GLU A 1 34  ? -8.650  7.703   -1.884  1.00 0.00 ? 34  GLU A HG3  3  
ATOM 3957  N N    . LYS A 1 35  ? -5.592  11.649  -2.171  1.00 0.00 ? 35  LYS A N    3  
ATOM 3958  C CA   . LYS A 1 35  ? -5.019  12.974  -2.338  1.00 0.00 ? 35  LYS A CA   3  
ATOM 3959  C C    . LYS A 1 35  ? -3.744  12.871  -3.177  1.00 0.00 ? 35  LYS A C    3  
ATOM 3960  O O    . LYS A 1 35  ? -3.536  13.663  -4.096  1.00 0.00 ? 35  LYS A O    3  
ATOM 3961  C CB   . LYS A 1 35  ? -4.807  13.641  -0.977  1.00 0.00 ? 35  LYS A CB   3  
ATOM 3962  C CG   . LYS A 1 35  ? -3.640  14.630  -1.027  1.00 0.00 ? 35  LYS A CG   3  
ATOM 3963  C CD   . LYS A 1 35  ? -2.331  13.953  -0.616  1.00 0.00 ? 35  LYS A CD   3  
ATOM 3964  C CE   . LYS A 1 35  ? -1.150  14.516  -1.410  1.00 0.00 ? 35  LYS A CE   3  
ATOM 3965  N NZ   . LYS A 1 35  ? -0.826  15.887  -0.955  1.00 0.00 ? 35  LYS A NZ   3  
ATOM 3966  H H    . LYS A 1 35  ? -5.781  11.386  -1.225  1.00 0.00 ? 35  LYS A H    3  
ATOM 3967  H HA   . LYS A 1 35  ? -5.744  13.577  -2.883  1.00 0.00 ? 35  LYS A HA   3  
ATOM 3968  H HB2  . LYS A 1 35  ? -5.717  14.161  -0.677  1.00 0.00 ? 35  LYS A HB2  3  
ATOM 3969  H HB3  . LYS A 1 35  ? -4.612  12.880  -0.221  1.00 0.00 ? 35  LYS A HB3  3  
ATOM 3970  H HG2  . LYS A 1 35  ? -3.544  15.034  -2.035  1.00 0.00 ? 35  LYS A HG2  3  
ATOM 3971  H HG3  . LYS A 1 35  ? -3.843  15.471  -0.364  1.00 0.00 ? 35  LYS A HG3  3  
ATOM 3972  H HD2  . LYS A 1 35  ? -2.160  14.101  0.450   1.00 0.00 ? 35  LYS A HD2  3  
ATOM 3973  H HD3  . LYS A 1 35  ? -2.405  12.879  -0.781  1.00 0.00 ? 35  LYS A HD3  3  
ATOM 3974  H HE2  . LYS A 1 35  ? -0.281  13.871  -1.288  1.00 0.00 ? 35  LYS A HE2  3  
ATOM 3975  H HE3  . LYS A 1 35  ? -1.392  14.527  -2.473  1.00 0.00 ? 35  LYS A HE3  3  
ATOM 3976  H HZ1  . LYS A 1 35  ? -0.069  16.248  -1.499  1.00 0.00 ? 35  LYS A HZ1  3  
ATOM 3977  H HZ2  . LYS A 1 35  ? -1.628  16.474  -1.069  1.00 0.00 ? 35  LYS A HZ2  3  
ATOM 3978  H HZ3  . LYS A 1 35  ? -0.563  15.864  0.009   1.00 0.00 ? 35  LYS A HZ3  3  
ATOM 3979  N N    . LEU A 1 36  ? -2.923  11.890  -2.832  1.00 0.00 ? 36  LEU A N    3  
ATOM 3980  C CA   . LEU A 1 36  ? -1.674  11.674  -3.543  1.00 0.00 ? 36  LEU A CA   3  
ATOM 3981  C C    . LEU A 1 36  ? -1.969  11.455  -5.028  1.00 0.00 ? 36  LEU A C    3  
ATOM 3982  O O    . LEU A 1 36  ? -1.239  11.946  -5.888  1.00 0.00 ? 36  LEU A O    3  
ATOM 3983  C CB   . LEU A 1 36  ? -0.882  10.535  -2.899  1.00 0.00 ? 36  LEU A CB   3  
ATOM 3984  C CG   . LEU A 1 36  ? -0.141  10.881  -1.605  1.00 0.00 ? 36  LEU A CG   3  
ATOM 3985  C CD1  . LEU A 1 36  ? 0.042   9.639   -0.730  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 3986  C CD2  . LEU A 1 36  ? 1.189   11.574  -1.903  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 3987  H H    . LEU A 1 36  ? -3.100  11.251  -2.084  1.00 0.00 ? 36  LEU A H    3  
ATOM 3988  H HA   . LEU A 1 36  ? -1.078  12.580  -3.439  1.00 0.00 ? 36  LEU A HA   3  
ATOM 3989  H HB2  . LEU A 1 36  ? -1.567  9.713   -2.693  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 3990  H HB3  . LEU A 1 36  ? -0.154  10.170  -3.624  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 3991  H HG   . LEU A 1 36  ? -0.752  11.585  -1.040  1.00 0.00 ? 36  LEU A HG   3  
ATOM 3992  H HD11 . LEU A 1 36  ? -0.649  9.682   0.111   1.00 0.00 ? 36  LEU A HD11 3  
ATOM 3993  H HD12 . LEU A 1 36  ? -0.158  8.745   -1.321  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 3994  H HD13 . LEU A 1 36  ? 1.066   9.606   -0.357  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 3995  H HD21 . LEU A 1 36  ? 1.404   12.301  -1.120  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 3996  H HD22 . LEU A 1 36  ? 1.986   10.831  -1.937  1.00 0.00 ? 36  LEU A HD22 3  
ATOM 3997  H HD23 . LEU A 1 36  ? 1.126   12.083  -2.865  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 3998  N N    . GLY A 1 37  ? -3.040  10.718  -5.284  1.00 0.00 ? 37  GLY A N    3  
ATOM 3999  C CA   . GLY A 1 37  ? -3.440  10.428  -6.650  1.00 0.00 ? 37  GLY A CA   3  
ATOM 4000  C C    . GLY A 1 37  ? -3.866  8.966   -6.798  1.00 0.00 ? 37  GLY A C    3  
ATOM 4001  O O    . GLY A 1 37  ? -4.459  8.587   -7.808  1.00 0.00 ? 37  GLY A O    3  
ATOM 4002  H H    . GLY A 1 37  ? -3.628  10.322  -4.578  1.00 0.00 ? 37  GLY A H    3  
ATOM 4003  H HA2  . GLY A 1 37  ? -4.263  11.081  -6.938  1.00 0.00 ? 37  GLY A HA2  3  
ATOM 4004  H HA3  . GLY A 1 37  ? -2.613  10.639  -7.328  1.00 0.00 ? 37  GLY A HA3  3  
ATOM 4005  N N    . GLY A 1 38  ? -3.548  8.184   -5.777  1.00 0.00 ? 38  GLY A N    3  
ATOM 4006  C CA   . GLY A 1 38  ? -3.891  6.772   -5.781  1.00 0.00 ? 38  GLY A CA   3  
ATOM 4007  C C    . GLY A 1 38  ? -5.362  6.563   -5.412  1.00 0.00 ? 38  GLY A C    3  
ATOM 4008  O O    . GLY A 1 38  ? -6.173  7.479   -5.540  1.00 0.00 ? 38  GLY A O    3  
ATOM 4009  H H    . GLY A 1 38  ? -3.067  8.499   -4.960  1.00 0.00 ? 38  GLY A H    3  
ATOM 4010  H HA2  . GLY A 1 38  ? -3.696  6.349   -6.766  1.00 0.00 ? 38  GLY A HA2  3  
ATOM 4011  H HA3  . GLY A 1 38  ? -3.256  6.238   -5.074  1.00 0.00 ? 38  GLY A HA3  3  
ATOM 4012  N N    . LYS A 1 39  ? -5.660  5.354   -4.962  1.00 0.00 ? 39  LYS A N    3  
ATOM 4013  C CA   . LYS A 1 39  ? -7.018  5.013   -4.574  1.00 0.00 ? 39  LYS A CA   3  
ATOM 4014  C C    . LYS A 1 39  ? -6.997  3.745   -3.718  1.00 0.00 ? 39  LYS A C    3  
ATOM 4015  O O    . LYS A 1 39  ? -6.416  2.736   -4.112  1.00 0.00 ? 39  LYS A O    3  
ATOM 4016  C CB   . LYS A 1 39  ? -7.917  4.908   -5.808  1.00 0.00 ? 39  LYS A CB   3  
ATOM 4017  C CG   . LYS A 1 39  ? -8.715  6.197   -6.017  1.00 0.00 ? 39  LYS A CG   3  
ATOM 4018  C CD   . LYS A 1 39  ? -10.203 5.971   -5.744  1.00 0.00 ? 39  LYS A CD   3  
ATOM 4019  C CE   . LYS A 1 39  ? -11.007 5.977   -7.046  1.00 0.00 ? 39  LYS A CE   3  
ATOM 4020  N NZ   . LYS A 1 39  ? -11.969 7.101   -7.056  1.00 0.00 ? 39  LYS A NZ   3  
ATOM 4021  H H    . LYS A 1 39  ? -4.994  4.614   -4.861  1.00 0.00 ? 39  LYS A H    3  
ATOM 4022  H HA   . LYS A 1 39  ? -7.400  5.834   -3.967  1.00 0.00 ? 39  LYS A HA   3  
ATOM 4023  H HB2  . LYS A 1 39  ? -7.309  4.705   -6.690  1.00 0.00 ? 39  LYS A HB2  3  
ATOM 4024  H HB3  . LYS A 1 39  ? -8.602  4.067   -5.693  1.00 0.00 ? 39  LYS A HB3  3  
ATOM 4025  H HG2  . LYS A 1 39  ? -8.334  6.975   -5.357  1.00 0.00 ? 39  LYS A HG2  3  
ATOM 4026  H HG3  . LYS A 1 39  ? -8.579  6.551   -7.039  1.00 0.00 ? 39  LYS A HG3  3  
ATOM 4027  H HD2  . LYS A 1 39  ? -10.342 5.020   -5.230  1.00 0.00 ? 39  LYS A HD2  3  
ATOM 4028  H HD3  . LYS A 1 39  ? -10.576 6.750   -5.078  1.00 0.00 ? 39  LYS A HD3  3  
ATOM 4029  H HE2  . LYS A 1 39  ? -10.331 6.061   -7.897  1.00 0.00 ? 39  LYS A HE2  3  
ATOM 4030  H HE3  . LYS A 1 39  ? -11.541 5.033   -7.154  1.00 0.00 ? 39  LYS A HE3  3  
ATOM 4031  H HZ1  . LYS A 1 39  ? -12.844 6.795   -6.679  1.00 0.00 ? 39  LYS A HZ1  3  
ATOM 4032  H HZ2  . LYS A 1 39  ? -11.611 7.851   -6.499  1.00 0.00 ? 39  LYS A HZ2  3  
ATOM 4033  H HZ3  . LYS A 1 39  ? -12.103 7.417   -7.995  1.00 0.00 ? 39  LYS A HZ3  3  
ATOM 4034  N N    . LEU A 1 40  ? -7.639  3.839   -2.563  1.00 0.00 ? 40  LEU A N    3  
ATOM 4035  C CA   . LEU A 1 40  ? -7.701  2.712   -1.648  1.00 0.00 ? 40  LEU A CA   3  
ATOM 4036  C C    . LEU A 1 40  ? -8.688  1.676   -2.189  1.00 0.00 ? 40  LEU A C    3  
ATOM 4037  O O    . LEU A 1 40  ? -9.781  2.026   -2.631  1.00 0.00 ? 40  LEU A O    3  
ATOM 4038  C CB   . LEU A 1 40  ? -8.026  3.190   -0.231  1.00 0.00 ? 40  LEU A CB   3  
ATOM 4039  C CG   . LEU A 1 40  ? -7.754  2.188   0.893   1.00 0.00 ? 40  LEU A CG   3  
ATOM 4040  C CD1  . LEU A 1 40  ? -6.703  2.727   1.865   1.00 0.00 ? 40  LEU A CD1  3  
ATOM 4041  C CD2  . LEU A 1 40  ? -9.051  1.802   1.608   1.00 0.00 ? 40  LEU A CD2  3  
ATOM 4042  H H    . LEU A 1 40  ? -8.109  4.665   -2.250  1.00 0.00 ? 40  LEU A H    3  
ATOM 4043  H HA   . LEU A 1 40  ? -6.709  2.262   -1.616  1.00 0.00 ? 40  LEU A HA   3  
ATOM 4044  H HB2  . LEU A 1 40  ? -7.450  4.094   -0.032  1.00 0.00 ? 40  LEU A HB2  3  
ATOM 4045  H HB3  . LEU A 1 40  ? -9.079  3.469   -0.196  1.00 0.00 ? 40  LEU A HB3  3  
ATOM 4046  H HG   . LEU A 1 40  ? -7.348  1.279   0.450   1.00 0.00 ? 40  LEU A HG   3  
ATOM 4047  H HD11 . LEU A 1 40  ? -6.670  3.814   1.799   1.00 0.00 ? 40  LEU A HD11 3  
ATOM 4048  H HD12 . LEU A 1 40  ? -6.963  2.432   2.882   1.00 0.00 ? 40  LEU A HD12 3  
ATOM 4049  H HD13 . LEU A 1 40  ? -5.726  2.318   1.607   1.00 0.00 ? 40  LEU A HD13 3  
ATOM 4050  H HD21 . LEU A 1 40  ? -9.818  1.569   0.869   1.00 0.00 ? 40  LEU A HD21 3  
ATOM 4051  H HD22 . LEU A 1 40  ? -8.873  0.928   2.235   1.00 0.00 ? 40  LEU A HD22 3  
ATOM 4052  H HD23 . LEU A 1 40  ? -9.385  2.633   2.229   1.00 0.00 ? 40  LEU A HD23 3  
ATOM 4053  N N    . THR A 1 41  ? -8.266  0.421   -2.135  1.00 0.00 ? 41  THR A N    3  
ATOM 4054  C CA   . THR A 1 41  ? -9.099  -0.669  -2.614  1.00 0.00 ? 41  THR A CA   3  
ATOM 4055  C C    . THR A 1 41  ? -9.284  -1.721  -1.519  1.00 0.00 ? 41  THR A C    3  
ATOM 4056  O O    . THR A 1 41  ? -8.619  -1.669  -0.485  1.00 0.00 ? 41  THR A O    3  
ATOM 4057  C CB   . THR A 1 41  ? -8.463  -1.226  -3.889  1.00 0.00 ? 41  THR A CB   3  
ATOM 4058  O OG1  . THR A 1 41  ? -9.300  -2.323  -4.245  1.00 0.00 ? 41  THR A OG1  3  
ATOM 4059  C CG2  . THR A 1 41  ? -7.098  -1.867  -3.631  1.00 0.00 ? 41  THR A CG2  3  
ATOM 4060  H H    . THR A 1 41  ? -7.376  0.145   -1.774  1.00 0.00 ? 41  THR A H    3  
ATOM 4061  H HA   . THR A 1 41  ? -10.087 -0.271  -2.845  1.00 0.00 ? 41  THR A HA   3  
ATOM 4062  H HB   . THR A 1 41  ? -8.392  -0.455  -4.657  1.00 0.00 ? 41  THR A HB   3  
ATOM 4063  H HG1  . THR A 1 41  ? -8.850  -2.885  -4.940  1.00 0.00 ? 41  THR A HG1  3  
ATOM 4064  H HG21 . THR A 1 41  ? -6.580  -1.316  -2.845  1.00 0.00 ? 41  THR A HG21 3  
ATOM 4065  H HG22 . THR A 1 41  ? -7.236  -2.902  -3.317  1.00 0.00 ? 41  THR A HG22 3  
ATOM 4066  H HG23 . THR A 1 41  ? -6.505  -1.840  -4.545  1.00 0.00 ? 41  THR A HG23 3  
ATOM 4067  N N    . GLY A 1 42  ? -10.191 -2.650  -1.782  1.00 0.00 ? 42  GLY A N    3  
ATOM 4068  C CA   . GLY A 1 42  ? -10.471 -3.713  -0.831  1.00 0.00 ? 42  GLY A CA   3  
ATOM 4069  C C    . GLY A 1 42  ? -9.691  -4.981  -1.180  1.00 0.00 ? 42  GLY A C    3  
ATOM 4070  O O    . GLY A 1 42  ? -9.235  -5.699  -0.291  1.00 0.00 ? 42  GLY A O    3  
ATOM 4071  H H    . GLY A 1 42  ? -10.727 -2.685  -2.625  1.00 0.00 ? 42  GLY A H    3  
ATOM 4072  H HA2  . GLY A 1 42  ? -10.208 -3.384  0.175   1.00 0.00 ? 42  GLY A HA2  3  
ATOM 4073  H HA3  . GLY A 1 42  ? -11.540 -3.928  -0.826  1.00 0.00 ? 42  GLY A HA3  3  
ATOM 4074  N N    . THR A 1 43  ? -9.561  -5.220  -2.477  1.00 0.00 ? 43  THR A N    3  
ATOM 4075  C CA   . THR A 1 43  ? -8.844  -6.389  -2.955  1.00 0.00 ? 43  THR A CA   3  
ATOM 4076  C C    . THR A 1 43  ? -7.334  -6.140  -2.921  1.00 0.00 ? 43  THR A C    3  
ATOM 4077  O O    . THR A 1 43  ? -6.893  -5.007  -2.737  1.00 0.00 ? 43  THR A O    3  
ATOM 4078  C CB   . THR A 1 43  ? -9.372  -6.731  -4.349  1.00 0.00 ? 43  THR A CB   3  
ATOM 4079  O OG1  . THR A 1 43  ? -10.778 -6.521  -4.249  1.00 0.00 ? 43  THR A OG1  3  
ATOM 4080  C CG2  . THR A 1 43  ? -9.241  -8.220  -4.676  1.00 0.00 ? 43  THR A CG2  3  
ATOM 4081  H H    . THR A 1 43  ? -9.934  -4.631  -3.194  1.00 0.00 ? 43  THR A H    3  
ATOM 4082  H HA   . THR A 1 43  ? -9.046  -7.218  -2.276  1.00 0.00 ? 43  THR A HA   3  
ATOM 4083  H HB   . THR A 1 43  ? -8.886  -6.121  -5.110  1.00 0.00 ? 43  THR A HB   3  
ATOM 4084  H HG1  . THR A 1 43  ? -11.224 -6.778  -5.106  1.00 0.00 ? 43  THR A HG1  3  
ATOM 4085  H HG21 . THR A 1 43  ? -10.056 -8.521  -5.334  1.00 0.00 ? 43  THR A HG21 3  
ATOM 4086  H HG22 . THR A 1 43  ? -8.287  -8.400  -5.174  1.00 0.00 ? 43  THR A HG22 3  
ATOM 4087  H HG23 . THR A 1 43  ? -9.285  -8.800  -3.755  1.00 0.00 ? 43  THR A HG23 3  
ATOM 4088  N N    . ALA A 1 44  ? -6.585  -7.218  -3.102  1.00 0.00 ? 44  ALA A N    3  
ATOM 4089  C CA   . ALA A 1 44  ? -5.134  -7.130  -3.095  1.00 0.00 ? 44  ALA A CA   3  
ATOM 4090  C C    . ALA A 1 44  ? -4.610  -7.298  -4.522  1.00 0.00 ? 44  ALA A C    3  
ATOM 4091  O O    . ALA A 1 44  ? -3.758  -6.531  -4.969  1.00 0.00 ? 44  ALA A O    3  
ATOM 4092  C CB   . ALA A 1 44  ? -4.564  -8.179  -2.137  1.00 0.00 ? 44  ALA A CB   3  
ATOM 4093  H H    . ALA A 1 44  ? -6.952  -8.136  -3.251  1.00 0.00 ? 44  ALA A H    3  
ATOM 4094  H HA   . ALA A 1 44  ? -4.864  -6.139  -2.731  1.00 0.00 ? 44  ALA A HA   3  
ATOM 4095  H HB1  . ALA A 1 44  ? -3.645  -8.590  -2.555  1.00 0.00 ? 44  ALA A HB1  3  
ATOM 4096  H HB2  . ALA A 1 44  ? -4.350  -7.714  -1.175  1.00 0.00 ? 44  ALA A HB2  3  
ATOM 4097  H HB3  . ALA A 1 44  ? -5.291  -8.979  -2.001  1.00 0.00 ? 44  ALA A HB3  3  
ATOM 4098  N N    . ASN A 1 45  ? -5.142  -8.305  -5.199  1.00 0.00 ? 45  ASN A N    3  
ATOM 4099  C CA   . ASN A 1 45  ? -4.739  -8.583  -6.567  1.00 0.00 ? 45  ASN A CA   3  
ATOM 4100  C C    . ASN A 1 45  ? -5.049  -7.368  -7.443  1.00 0.00 ? 45  ASN A C    3  
ATOM 4101  O O    . ASN A 1 45  ? -4.496  -7.225  -8.532  1.00 0.00 ? 45  ASN A O    3  
ATOM 4102  C CB   . ASN A 1 45  ? -5.503  -9.782  -7.134  1.00 0.00 ? 45  ASN A CB   3  
ATOM 4103  C CG   . ASN A 1 45  ? -4.553  -10.941 -7.443  1.00 0.00 ? 45  ASN A CG   3  
ATOM 4104  O OD1  . ASN A 1 45  ? -3.653  -10.839 -8.261  1.00 0.00 ? 45  ASN A OD1  3  
ATOM 4105  N ND2  . ASN A 1 45  ? -4.803  -12.045 -6.745  1.00 0.00 ? 45  ASN A ND2  3  
ATOM 4106  H H    . ASN A 1 45  ? -5.835  -8.924  -4.829  1.00 0.00 ? 45  ASN A H    3  
ATOM 4107  H HA   . ASN A 1 45  ? -3.671  -8.797  -6.513  1.00 0.00 ? 45  ASN A HA   3  
ATOM 4108  H HB2  . ASN A 1 45  ? -6.259  -10.107 -6.419  1.00 0.00 ? 45  ASN A HB2  3  
ATOM 4109  H HB3  . ASN A 1 45  ? -6.029  -9.486  -8.042  1.00 0.00 ? 45  ASN A HB3  3  
ATOM 4110  H HD21 . ASN A 1 45  ? -5.557  -12.062 -6.089  1.00 0.00 ? 45  ASN A HD21 3  
ATOM 4111  H HD22 . ASN A 1 45  ? -4.236  -12.858 -6.877  1.00 0.00 ? 45  ASN A HD22 3  
ATOM 4112  N N    . LYS A 1 46  ? -5.933  -6.522  -6.934  1.00 0.00 ? 46  LYS A N    3  
ATOM 4113  C CA   . LYS A 1 46  ? -6.324  -5.323  -7.656  1.00 0.00 ? 46  LYS A CA   3  
ATOM 4114  C C    . LYS A 1 46  ? -5.700  -4.100  -6.981  1.00 0.00 ? 46  LYS A C    3  
ATOM 4115  O O    . LYS A 1 46  ? -6.343  -3.059  -6.859  1.00 0.00 ? 46  LYS A O    3  
ATOM 4116  C CB   . LYS A 1 46  ? -7.846  -5.246  -7.783  1.00 0.00 ? 46  LYS A CB   3  
ATOM 4117  C CG   . LYS A 1 46  ? -8.388  -6.419  -8.602  1.00 0.00 ? 46  LYS A CG   3  
ATOM 4118  C CD   . LYS A 1 46  ? -8.907  -7.532  -7.690  1.00 0.00 ? 46  LYS A CD   3  
ATOM 4119  C CE   . LYS A 1 46  ? -9.961  -8.380  -8.404  1.00 0.00 ? 46  LYS A CE   3  
ATOM 4120  N NZ   . LYS A 1 46  ? -9.452  -9.750  -8.638  1.00 0.00 ? 46  LYS A NZ   3  
ATOM 4121  H H    . LYS A 1 46  ? -6.378  -6.645  -6.047  1.00 0.00 ? 46  LYS A H    3  
ATOM 4122  H HA   . LYS A 1 46  ? -5.920  -5.403  -8.665  1.00 0.00 ? 46  LYS A HA   3  
ATOM 4123  H HB2  . LYS A 1 46  ? -8.299  -5.251  -6.791  1.00 0.00 ? 46  LYS A HB2  3  
ATOM 4124  H HB3  . LYS A 1 46  ? -8.128  -4.306  -8.256  1.00 0.00 ? 46  LYS A HB3  3  
ATOM 4125  H HG2  . LYS A 1 46  ? -9.192  -6.072  -9.252  1.00 0.00 ? 46  LYS A HG2  3  
ATOM 4126  H HG3  . LYS A 1 46  ? -7.602  -6.810  -9.248  1.00 0.00 ? 46  LYS A HG3  3  
ATOM 4127  H HD2  . LYS A 1 46  ? -8.078  -8.165  -7.375  1.00 0.00 ? 46  LYS A HD2  3  
ATOM 4128  H HD3  . LYS A 1 46  ? -9.336  -7.097  -6.787  1.00 0.00 ? 46  LYS A HD3  3  
ATOM 4129  H HE2  . LYS A 1 46  ? -10.871 -8.421  -7.805  1.00 0.00 ? 46  LYS A HE2  3  
ATOM 4130  H HE3  . LYS A 1 46  ? -10.226 -7.917  -9.355  1.00 0.00 ? 46  LYS A HE3  3  
ATOM 4131  H HZ1  . LYS A 1 46  ? -8.932  -10.053 -7.840  1.00 0.00 ? 46  LYS A HZ1  3  
ATOM 4132  H HZ2  . LYS A 1 46  ? -10.222 -10.371 -8.790  1.00 0.00 ? 46  LYS A HZ2  3  
ATOM 4133  H HZ3  . LYS A 1 46  ? -8.859  -9.753  -9.443  1.00 0.00 ? 46  LYS A HZ3  3  
ATOM 4134  N N    . ALA A 1 47  ? -4.455  -4.267  -6.559  1.00 0.00 ? 47  ALA A N    3  
ATOM 4135  C CA   . ALA A 1 47  ? -3.738  -3.189  -5.899  1.00 0.00 ? 47  ALA A CA   3  
ATOM 4136  C C    . ALA A 1 47  ? -2.272  -3.214  -6.339  1.00 0.00 ? 47  ALA A C    3  
ATOM 4137  O O    . ALA A 1 47  ? -1.739  -4.270  -6.677  1.00 0.00 ? 47  ALA A O    3  
ATOM 4138  C CB   . ALA A 1 47  ? -3.894  -3.325  -4.384  1.00 0.00 ? 47  ALA A CB   3  
ATOM 4139  H H    . ALA A 1 47  ? -3.939  -5.117  -6.663  1.00 0.00 ? 47  ALA A H    3  
ATOM 4140  H HA   . ALA A 1 47  ? -4.187  -2.248  -6.216  1.00 0.00 ? 47  ALA A HA   3  
ATOM 4141  H HB1  . ALA A 1 47  ? -3.429  -4.253  -4.052  1.00 0.00 ? 47  ALA A HB1  3  
ATOM 4142  H HB2  . ALA A 1 47  ? -3.412  -2.480  -3.892  1.00 0.00 ? 47  ALA A HB2  3  
ATOM 4143  H HB3  . ALA A 1 47  ? -4.954  -3.338  -4.128  1.00 0.00 ? 47  ALA A HB3  3  
ATOM 4144  N N    . SER A 1 48  ? -1.662  -2.038  -6.319  1.00 0.00 ? 48  SER A N    3  
ATOM 4145  C CA   . SER A 1 48  ? -0.268  -1.912  -6.711  1.00 0.00 ? 48  SER A CA   3  
ATOM 4146  C C    . SER A 1 48  ? 0.627   -1.918  -5.471  1.00 0.00 ? 48  SER A C    3  
ATOM 4147  O O    . SER A 1 48  ? 1.769   -2.372  -5.527  1.00 0.00 ? 48  SER A O    3  
ATOM 4148  C CB   . SER A 1 48  ? -0.039  -0.637  -7.526  1.00 0.00 ? 48  SER A CB   3  
ATOM 4149  O OG   . SER A 1 48  ? 1.303   -0.538  -7.995  1.00 0.00 ? 48  SER A OG   3  
ATOM 4150  H H    . SER A 1 48  ? -2.102  -1.184  -6.043  1.00 0.00 ? 48  SER A H    3  
ATOM 4151  H HA   . SER A 1 48  ? -0.064  -2.782  -7.335  1.00 0.00 ? 48  SER A HA   3  
ATOM 4152  H HB2  . SER A 1 48  ? -0.722  -0.622  -8.375  1.00 0.00 ? 48  SER A HB2  3  
ATOM 4153  H HB3  . SER A 1 48  ? -0.273  0.232   -6.912  1.00 0.00 ? 48  SER A HB3  3  
ATOM 4154  H HG   . SER A 1 48  ? 1.912   -0.293  -7.241  1.00 0.00 ? 48  SER A HG   3  
ATOM 4155  N N    . LEU A 1 49  ? 0.075   -1.408  -4.379  1.00 0.00 ? 49  LEU A N    3  
ATOM 4156  C CA   . LEU A 1 49  ? 0.809   -1.349  -3.127  1.00 0.00 ? 49  LEU A CA   3  
ATOM 4157  C C    . LEU A 1 49  ? -0.037  -1.972  -2.015  1.00 0.00 ? 49  LEU A C    3  
ATOM 4158  O O    . LEU A 1 49  ? -1.254  -2.093  -2.149  1.00 0.00 ? 49  LEU A O    3  
ATOM 4159  C CB   . LEU A 1 49  ? 1.252   0.086   -2.833  1.00 0.00 ? 49  LEU A CB   3  
ATOM 4160  C CG   . LEU A 1 49  ? 2.635   0.244   -2.199  1.00 0.00 ? 49  LEU A CG   3  
ATOM 4161  C CD1  . LEU A 1 49  ? 3.673   -0.614  -2.925  1.00 0.00 ? 49  LEU A CD1  3  
ATOM 4162  C CD2  . LEU A 1 49  ? 3.047   1.716   -2.141  1.00 0.00 ? 49  LEU A CD2  3  
ATOM 4163  H H    . LEU A 1 49  ? -0.855  -1.041  -4.342  1.00 0.00 ? 49  LEU A H    3  
ATOM 4164  H HA   . LEU A 1 49  ? 1.712   -1.947  -3.249  1.00 0.00 ? 49  LEU A HA   3  
ATOM 4165  H HB2  . LEU A 1 49  ? 1.236   0.648   -3.766  1.00 0.00 ? 49  LEU A HB2  3  
ATOM 4166  H HB3  . LEU A 1 49  ? 0.517   0.543   -2.172  1.00 0.00 ? 49  LEU A HB3  3  
ATOM 4167  H HG   . LEU A 1 49  ? 2.583   -0.116  -1.171  1.00 0.00 ? 49  LEU A HG   3  
ATOM 4168  H HD11 . LEU A 1 49  ? 3.458   -0.617  -3.994  1.00 0.00 ? 49  LEU A HD11 3  
ATOM 4169  H HD12 . LEU A 1 49  ? 4.668   -0.202  -2.756  1.00 0.00 ? 49  LEU A HD12 3  
ATOM 4170  H HD13 . LEU A 1 49  ? 3.633   -1.634  -2.544  1.00 0.00 ? 49  LEU A HD13 3  
ATOM 4171  H HD21 . LEU A 1 49  ? 4.056   1.796   -1.736  1.00 0.00 ? 49  LEU A HD21 3  
ATOM 4172  H HD22 . LEU A 1 49  ? 3.025   2.139   -3.146  1.00 0.00 ? 49  LEU A HD22 3  
ATOM 4173  H HD23 . LEU A 1 49  ? 2.354   2.263   -1.502  1.00 0.00 ? 49  LEU A HD23 3  
ATOM 4174  N N    . CYS A 1 50  ? 0.640   -2.350  -0.941  1.00 0.00 ? 50  CYS A N    3  
ATOM 4175  C CA   . CYS A 1 50  ? -0.034  -2.957  0.194   1.00 0.00 ? 50  CYS A CA   3  
ATOM 4176  C C    . CYS A 1 50  ? 0.527   -2.336  1.475   1.00 0.00 ? 50  CYS A C    3  
ATOM 4177  O O    . CYS A 1 50  ? 1.680   -2.573  1.830   1.00 0.00 ? 50  CYS A O    3  
ATOM 4178  C CB   . CYS A 1 50  ? 0.108   -4.480  0.189   1.00 0.00 ? 50  CYS A CB   3  
ATOM 4179  S SG   . CYS A 1 50  ? -0.804  -5.199  1.602   1.00 0.00 ? 50  CYS A SG   3  
ATOM 4180  H H    . CYS A 1 50  ? 1.630   -2.248  -0.839  1.00 0.00 ? 50  CYS A H    3  
ATOM 4181  H HA   . CYS A 1 50  ? -1.095  -2.729  0.086   1.00 0.00 ? 50  CYS A HA   3  
ATOM 4182  H HB2  . CYS A 1 50  ? -0.276  -4.886  -0.747  1.00 0.00 ? 50  CYS A HB2  3  
ATOM 4183  H HB3  . CYS A 1 50  ? 1.161   -4.755  0.247   1.00 0.00 ? 50  CYS A HB3  3  
ATOM 4184  H HG   . CYS A 1 50  ? -1.664  -4.194  1.739   1.00 0.00 ? 50  CYS A HG   3  
ATOM 4185  N N    . ILE A 1 51  ? -0.315  -1.552  2.133   1.00 0.00 ? 51  ILE A N    3  
ATOM 4186  C CA   . ILE A 1 51  ? 0.083   -0.896  3.367   1.00 0.00 ? 51  ILE A CA   3  
ATOM 4187  C C    . ILE A 1 51  ? -0.376  -1.738  4.559   1.00 0.00 ? 51  ILE A C    3  
ATOM 4188  O O    . ILE A 1 51  ? -1.525  -1.637  4.988   1.00 0.00 ? 51  ILE A O    3  
ATOM 4189  C CB   . ILE A 1 51  ? -0.431  0.545   3.397   1.00 0.00 ? 51  ILE A CB   3  
ATOM 4190  C CG1  . ILE A 1 51  ? 0.094   1.340   2.199   1.00 0.00 ? 51  ILE A CG1  3  
ATOM 4191  C CG2  . ILE A 1 51  ? -0.092  1.221   4.726   1.00 0.00 ? 51  ILE A CG2  3  
ATOM 4192  C CD1  . ILE A 1 51  ? -0.228  2.828   2.345   1.00 0.00 ? 51  ILE A CD1  3  
ATOM 4193  H H    . ILE A 1 51  ? -1.251  -1.364  1.837   1.00 0.00 ? 51  ILE A H    3  
ATOM 4194  H HA   . ILE A 1 51  ? 1.172   -0.849  3.376   1.00 0.00 ? 51  ILE A HA   3  
ATOM 4195  H HB   . ILE A 1 51  ? -1.518  0.521   3.316   1.00 0.00 ? 51  ILE A HB   3  
ATOM 4196  H HG12 . ILE A 1 51  ? 1.171   1.203   2.112   1.00 0.00 ? 51  ILE A HG12 3  
ATOM 4197  H HG13 . ILE A 1 51  ? -0.351  0.956   1.281   1.00 0.00 ? 51  ILE A HG13 3  
ATOM 4198  H HG21 . ILE A 1 51  ? 0.694   1.960   4.568   1.00 0.00 ? 51  ILE A HG21 3  
ATOM 4199  H HG22 . ILE A 1 51  ? -0.980  1.714   5.121   1.00 0.00 ? 51  ILE A HG22 3  
ATOM 4200  H HG23 . ILE A 1 51  ? 0.254   0.471   5.438   1.00 0.00 ? 51  ILE A HG23 3  
ATOM 4201  H HD11 . ILE A 1 51  ? 0.507   3.296   3.000   1.00 0.00 ? 51  ILE A HD11 3  
ATOM 4202  H HD12 . ILE A 1 51  ? -0.197  3.305   1.365   1.00 0.00 ? 51  ILE A HD12 3  
ATOM 4203  H HD13 . ILE A 1 51  ? -1.223  2.945   2.775   1.00 0.00 ? 51  ILE A HD13 3  
ATOM 4204  N N    . SER A 1 52  ? 0.544   -2.549  5.059   1.00 0.00 ? 52  SER A N    3  
ATOM 4205  C CA   . SER A 1 52  ? 0.248   -3.407  6.193   1.00 0.00 ? 52  SER A CA   3  
ATOM 4206  C C    . SER A 1 52  ? 1.322   -3.242  7.270   1.00 0.00 ? 52  SER A C    3  
ATOM 4207  O O    . SER A 1 52  ? 2.183   -2.370  7.164   1.00 0.00 ? 52  SER A O    3  
ATOM 4208  C CB   . SER A 1 52  ? 0.148   -4.872  5.763   1.00 0.00 ? 52  SER A CB   3  
ATOM 4209  O OG   . SER A 1 52  ? -0.734  -5.616  6.601   1.00 0.00 ? 52  SER A OG   3  
ATOM 4210  H H    . SER A 1 52  ? 1.476   -2.624  4.704   1.00 0.00 ? 52  SER A H    3  
ATOM 4211  H HA   . SER A 1 52  ? -0.721  -3.072  6.564   1.00 0.00 ? 52  SER A HA   3  
ATOM 4212  H HB2  . SER A 1 52  ? -0.202  -4.925  4.732   1.00 0.00 ? 52  SER A HB2  3  
ATOM 4213  H HB3  . SER A 1 52  ? 1.139   -5.326  5.787   1.00 0.00 ? 52  SER A HB3  3  
ATOM 4214  H HG   . SER A 1 52  ? -1.420  -5.008  7.000   1.00 0.00 ? 52  SER A HG   3  
ATOM 4215  N N    . THR A 1 53  ? 1.237   -4.094  8.281   1.00 0.00 ? 53  THR A N    3  
ATOM 4216  C CA   . THR A 1 53  ? 2.192   -4.053  9.376   1.00 0.00 ? 53  THR A CA   3  
ATOM 4217  C C    . THR A 1 53  ? 3.046   -5.322  9.386   1.00 0.00 ? 53  THR A C    3  
ATOM 4218  O O    . THR A 1 53  ? 2.645   -6.349  8.842   1.00 0.00 ? 53  THR A O    3  
ATOM 4219  C CB   . THR A 1 53  ? 1.413   -3.835  10.675  1.00 0.00 ? 53  THR A CB   3  
ATOM 4220  O OG1  . THR A 1 53  ? 0.439   -4.876  10.675  1.00 0.00 ? 53  THR A OG1  3  
ATOM 4221  C CG2  . THR A 1 53  ? 0.583   -2.549  10.651  1.00 0.00 ? 53  THR A CG2  3  
ATOM 4222  H H    . THR A 1 53  ? 0.534   -4.800  8.360   1.00 0.00 ? 53  THR A H    3  
ATOM 4223  H HA   . THR A 1 53  ? 2.867   -3.214  9.212   1.00 0.00 ? 53  THR A HA   3  
ATOM 4224  H HB   . THR A 1 53  ? 2.080   -3.852  11.536  1.00 0.00 ? 53  THR A HB   3  
ATOM 4225  H HG1  . THR A 1 53  ? 0.114   -5.040  11.606  1.00 0.00 ? 53  THR A HG1  3  
ATOM 4226  H HG21 . THR A 1 53  ? 1.190   -1.732  10.261  1.00 0.00 ? 53  THR A HG21 3  
ATOM 4227  H HG22 . THR A 1 53  ? -0.289  -2.691  10.012  1.00 0.00 ? 53  THR A HG22 3  
ATOM 4228  H HG23 . THR A 1 53  ? 0.257   -2.309  11.663  1.00 0.00 ? 53  THR A HG23 3  
ATOM 4229  N N    . LYS A 1 54  ? 4.210   -5.209  10.010  1.00 0.00 ? 54  LYS A N    3  
ATOM 4230  C CA   . LYS A 1 54  ? 5.124   -6.334  10.098  1.00 0.00 ? 54  LYS A CA   3  
ATOM 4231  C C    . LYS A 1 54  ? 4.367   -7.563  10.606  1.00 0.00 ? 54  LYS A C    3  
ATOM 4232  O O    . LYS A 1 54  ? 4.437   -8.632  10.003  1.00 0.00 ? 54  LYS A O    3  
ATOM 4233  C CB   . LYS A 1 54  ? 6.344   -5.968  10.947  1.00 0.00 ? 54  LYS A CB   3  
ATOM 4234  C CG   . LYS A 1 54  ? 7.217   -7.197  11.210  1.00 0.00 ? 54  LYS A CG   3  
ATOM 4235  C CD   . LYS A 1 54  ? 7.975   -7.611  9.948   1.00 0.00 ? 54  LYS A CD   3  
ATOM 4236  C CE   . LYS A 1 54  ? 9.132   -6.651  9.663   1.00 0.00 ? 54  LYS A CE   3  
ATOM 4237  N NZ   . LYS A 1 54  ? 8.865   -5.869  8.435   1.00 0.00 ? 54  LYS A NZ   3  
ATOM 4238  H H    . LYS A 1 54  ? 4.529   -4.369  10.450  1.00 0.00 ? 54  LYS A H    3  
ATOM 4239  H HA   . LYS A 1 54  ? 5.484   -6.542  9.090   1.00 0.00 ? 54  LYS A HA   3  
ATOM 4240  H HB2  . LYS A 1 54  ? 6.930   -5.203  10.438  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 4241  H HB3  . LYS A 1 54  ? 6.016   -5.540  11.894  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 4242  H HG2  . LYS A 1 54  ? 7.925   -6.979  12.010  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 4243  H HG3  . LYS A 1 54  ? 6.594   -8.023  11.552  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 4244  H HD2  . LYS A 1 54  ? 8.360   -8.624  10.066  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 4245  H HD3  . LYS A 1 54  ? 7.293   -7.627  9.098   1.00 0.00 ? 54  LYS A HD3  3  
ATOM 4246  H HE2  . LYS A 1 54  ? 9.269   -5.976  10.508  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 4247  H HE3  . LYS A 1 54  ? 10.059  -7.212  9.549   1.00 0.00 ? 54  LYS A HE3  3  
ATOM 4248  H HZ1  . LYS A 1 54  ? 7.898   -5.950  8.191   1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 4249  H HZ2  . LYS A 1 54  ? 9.089   -4.908  8.596   1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 4250  H HZ3  . LYS A 1 54  ? 9.428   -6.221  7.687   1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 4251  N N    . LYS A 1 55  ? 3.662   -7.368  11.710  1.00 0.00 ? 55  LYS A N    3  
ATOM 4252  C CA   . LYS A 1 55  ? 2.892   -8.447  12.306  1.00 0.00 ? 55  LYS A CA   3  
ATOM 4253  C C    . LYS A 1 55  ? 2.086   -9.156  11.216  1.00 0.00 ? 55  LYS A C    3  
ATOM 4254  O O    . LYS A 1 55  ? 2.254   -10.354 10.994  1.00 0.00 ? 55  LYS A O    3  
ATOM 4255  C CB   . LYS A 1 55  ? 2.036   -7.921  13.460  1.00 0.00 ? 55  LYS A CB   3  
ATOM 4256  C CG   . LYS A 1 55  ? 2.737   -8.134  14.804  1.00 0.00 ? 55  LYS A CG   3  
ATOM 4257  C CD   . LYS A 1 55  ? 2.123   -7.246  15.888  1.00 0.00 ? 55  LYS A CD   3  
ATOM 4258  C CE   . LYS A 1 55  ? 2.806   -7.479  17.238  1.00 0.00 ? 55  LYS A CE   3  
ATOM 4259  N NZ   . LYS A 1 55  ? 2.429   -6.418  18.199  1.00 0.00 ? 55  LYS A NZ   3  
ATOM 4260  H H    . LYS A 1 55  ? 3.610   -6.495  12.195  1.00 0.00 ? 55  LYS A H    3  
ATOM 4261  H HA   . LYS A 1 55  ? 3.601   -9.159  12.729  1.00 0.00 ? 55  LYS A HA   3  
ATOM 4262  H HB2  . LYS A 1 55  ? 1.836   -6.860  13.315  1.00 0.00 ? 55  LYS A HB2  3  
ATOM 4263  H HB3  . LYS A 1 55  ? 1.072   -8.430  13.464  1.00 0.00 ? 55  LYS A HB3  3  
ATOM 4264  H HG2  . LYS A 1 55  ? 2.658   -9.181  15.097  1.00 0.00 ? 55  LYS A HG2  3  
ATOM 4265  H HG3  . LYS A 1 55  ? 3.799   -7.911  14.704  1.00 0.00 ? 55  LYS A HG3  3  
ATOM 4266  H HD2  . LYS A 1 55  ? 2.220   -6.199  15.604  1.00 0.00 ? 55  LYS A HD2  3  
ATOM 4267  H HD3  . LYS A 1 55  ? 1.057   -7.456  15.975  1.00 0.00 ? 55  LYS A HD3  3  
ATOM 4268  H HE2  . LYS A 1 55  ? 2.520   -8.454  17.633  1.00 0.00 ? 55  LYS A HE2  3  
ATOM 4269  H HE3  . LYS A 1 55  ? 3.888   -7.492  17.107  1.00 0.00 ? 55  LYS A HE3  3  
ATOM 4270  H HZ1  . LYS A 1 55  ? 3.069   -5.653  18.119  1.00 0.00 ? 55  LYS A HZ1  3  
ATOM 4271  H HZ2  . LYS A 1 55  ? 1.503   -6.100  17.998  1.00 0.00 ? 55  LYS A HZ2  3  
ATOM 4272  H HZ3  . LYS A 1 55  ? 2.462   -6.784  19.129  1.00 0.00 ? 55  LYS A HZ3  3  
ATOM 4273  N N    . GLU A 1 56  ? 1.228   -8.385  10.564  1.00 0.00 ? 56  GLU A N    3  
ATOM 4274  C CA   . GLU A 1 56  ? 0.396   -8.924  9.502   1.00 0.00 ? 56  GLU A CA   3  
ATOM 4275  C C    . GLU A 1 56  ? 1.232   -9.794  8.561   1.00 0.00 ? 56  GLU A C    3  
ATOM 4276  O O    . GLU A 1 56  ? 0.981   -10.991 8.429   1.00 0.00 ? 56  GLU A O    3  
ATOM 4277  C CB   . GLU A 1 56  ? -0.306  -7.803  8.733   1.00 0.00 ? 56  GLU A CB   3  
ATOM 4278  C CG   . GLU A 1 56  ? -1.815  -7.826  8.985   1.00 0.00 ? 56  GLU A CG   3  
ATOM 4279  C CD   . GLU A 1 56  ? -2.121  -7.766  10.483  1.00 0.00 ? 56  GLU A CD   3  
ATOM 4280  O OE1  . GLU A 1 56  ? -1.188  -7.423  11.240  1.00 0.00 ? 56  GLU A OE1  3  
ATOM 4281  O OE2  . GLU A 1 56  ? -3.282  -8.066  10.837  1.00 0.00 ? 56  GLU A OE2  3  
ATOM 4282  H H    . GLU A 1 56  ? 1.098   -7.411  10.750  1.00 0.00 ? 56  GLU A H    3  
ATOM 4283  H HA   . GLU A 1 56  ? -0.354  -9.536  10.004  1.00 0.00 ? 56  GLU A HA   3  
ATOM 4284  H HB2  . GLU A 1 56  ? 0.102   -6.839  9.036   1.00 0.00 ? 56  GLU A HB2  3  
ATOM 4285  H HB3  . GLU A 1 56  ? -0.110  -7.911  7.666   1.00 0.00 ? 56  GLU A HB3  3  
ATOM 4286  H HG2  . GLU A 1 56  ? -2.285  -6.982  8.480   1.00 0.00 ? 56  GLU A HG2  3  
ATOM 4287  H HG3  . GLU A 1 56  ? -2.245  -8.732  8.558   1.00 0.00 ? 56  GLU A HG3  3  
ATOM 4288  N N    . VAL A 1 57  ? 2.209   -9.158  7.931   1.00 0.00 ? 57  VAL A N    3  
ATOM 4289  C CA   . VAL A 1 57  ? 3.084   -9.859  7.007   1.00 0.00 ? 57  VAL A CA   3  
ATOM 4290  C C    . VAL A 1 57  ? 3.595   -11.141 7.668   1.00 0.00 ? 57  VAL A C    3  
ATOM 4291  O O    . VAL A 1 57  ? 3.779   -12.157 6.999   1.00 0.00 ? 57  VAL A O    3  
ATOM 4292  C CB   . VAL A 1 57  ? 4.212   -8.932  6.548   1.00 0.00 ? 57  VAL A CB   3  
ATOM 4293  C CG1  . VAL A 1 57  ? 5.052   -9.591  5.453   1.00 0.00 ? 57  VAL A CG1  3  
ATOM 4294  C CG2  . VAL A 1 57  ? 3.658   -7.586  6.079   1.00 0.00 ? 57  VAL A CG2  3  
ATOM 4295  H H    . VAL A 1 57  ? 2.407   -8.185  8.044   1.00 0.00 ? 57  VAL A H    3  
ATOM 4296  H HA   . VAL A 1 57  ? 2.491   -10.128 6.132   1.00 0.00 ? 57  VAL A HA   3  
ATOM 4297  H HB   . VAL A 1 57  ? 4.862   -8.747  7.404   1.00 0.00 ? 57  VAL A HB   3  
ATOM 4298  H HG11 . VAL A 1 57  ? 4.463   -9.667  4.539   1.00 0.00 ? 57  VAL A HG11 3  
ATOM 4299  H HG12 . VAL A 1 57  ? 5.940   -8.988  5.264   1.00 0.00 ? 57  VAL A HG12 3  
ATOM 4300  H HG13 . VAL A 1 57  ? 5.352   -10.588 5.776   1.00 0.00 ? 57  VAL A HG13 3  
ATOM 4301  H HG21 . VAL A 1 57  ? 4.123   -6.782  6.650   1.00 0.00 ? 57  VAL A HG21 3  
ATOM 4302  H HG22 . VAL A 1 57  ? 3.876   -7.452  5.019   1.00 0.00 ? 57  VAL A HG22 3  
ATOM 4303  H HG23 . VAL A 1 57  ? 2.579   -7.563  6.233   1.00 0.00 ? 57  VAL A HG23 3  
ATOM 4304  N N    . GLU A 1 58  ? 3.810   -11.051 8.972   1.00 0.00 ? 58  GLU A N    3  
ATOM 4305  C CA   . GLU A 1 58  ? 4.297   -12.191 9.730   1.00 0.00 ? 58  GLU A CA   3  
ATOM 4306  C C    . GLU A 1 58  ? 3.180   -13.219 9.919   1.00 0.00 ? 58  GLU A C    3  
ATOM 4307  O O    . GLU A 1 58  ? 3.444   -14.415 10.035  1.00 0.00 ? 58  GLU A O    3  
ATOM 4308  C CB   . GLU A 1 58  ? 4.868   -11.749 11.079  1.00 0.00 ? 58  GLU A CB   3  
ATOM 4309  C CG   . GLU A 1 58  ? 6.366   -11.458 10.971  1.00 0.00 ? 58  GLU A CG   3  
ATOM 4310  C CD   . GLU A 1 58  ? 7.090   -11.821 12.269  1.00 0.00 ? 58  GLU A CD   3  
ATOM 4311  O OE1  . GLU A 1 58  ? 6.545   -12.673 13.004  1.00 0.00 ? 58  GLU A OE1  3  
ATOM 4312  O OE2  . GLU A 1 58  ? 8.173   -11.239 12.497  1.00 0.00 ? 58  GLU A OE2  3  
ATOM 4313  H H    . GLU A 1 58  ? 3.658   -10.221 9.508   1.00 0.00 ? 58  GLU A H    3  
ATOM 4314  H HA   . GLU A 1 58  ? 5.097   -12.620 9.127   1.00 0.00 ? 58  GLU A HA   3  
ATOM 4315  H HB2  . GLU A 1 58  ? 4.345   -10.858 11.425  1.00 0.00 ? 58  GLU A HB2  3  
ATOM 4316  H HB3  . GLU A 1 58  ? 4.698   -12.527 11.823  1.00 0.00 ? 58  GLU A HB3  3  
ATOM 4317  H HG2  . GLU A 1 58  ? 6.792   -12.024 10.143  1.00 0.00 ? 58  GLU A HG2  3  
ATOM 4318  H HG3  . GLU A 1 58  ? 6.520   -10.402 10.748  1.00 0.00 ? 58  GLU A HG3  3  
ATOM 4319  N N    . LYS A 1 59  ? 1.954   -12.716 9.943   1.00 0.00 ? 59  LYS A N    3  
ATOM 4320  C CA   . LYS A 1 59  ? 0.795   -13.576 10.115  1.00 0.00 ? 59  LYS A CA   3  
ATOM 4321  C C    . LYS A 1 59  ? 0.504   -14.301 8.800   1.00 0.00 ? 59  LYS A C    3  
ATOM 4322  O O    . LYS A 1 59  ? 0.136   -15.475 8.803   1.00 0.00 ? 59  LYS A O    3  
ATOM 4323  C CB   . LYS A 1 59  ? -0.392  -12.774 10.651  1.00 0.00 ? 59  LYS A CB   3  
ATOM 4324  C CG   . LYS A 1 59  ? -1.573  -12.827 9.680   1.00 0.00 ? 59  LYS A CG   3  
ATOM 4325  C CD   . LYS A 1 59  ? -2.836  -12.247 10.320  1.00 0.00 ? 59  LYS A CD   3  
ATOM 4326  C CE   . LYS A 1 59  ? -3.047  -10.792 9.896   1.00 0.00 ? 59  LYS A CE   3  
ATOM 4327  N NZ   . LYS A 1 59  ? -4.467  -10.406 10.060  1.00 0.00 ? 59  LYS A NZ   3  
ATOM 4328  H H    . LYS A 1 59  ? 1.747   -11.743 9.848   1.00 0.00 ? 59  LYS A H    3  
ATOM 4329  H HA   . LYS A 1 59  ? 1.050   -14.319 10.871  1.00 0.00 ? 59  LYS A HA   3  
ATOM 4330  H HB2  . LYS A 1 59  ? -0.696  -13.170 11.620  1.00 0.00 ? 59  LYS A HB2  3  
ATOM 4331  H HB3  . LYS A 1 59  ? -0.093  -11.738 10.811  1.00 0.00 ? 59  LYS A HB3  3  
ATOM 4332  H HG2  . LYS A 1 59  ? -1.330  -12.268 8.776   1.00 0.00 ? 59  LYS A HG2  3  
ATOM 4333  H HG3  . LYS A 1 59  ? -1.754  -13.858 9.378   1.00 0.00 ? 59  LYS A HG3  3  
ATOM 4334  H HD2  . LYS A 1 59  ? -3.701  -12.844 10.030  1.00 0.00 ? 59  LYS A HD2  3  
ATOM 4335  H HD3  . LYS A 1 59  ? -2.757  -12.306 11.405  1.00 0.00 ? 59  LYS A HD3  3  
ATOM 4336  H HE2  . LYS A 1 59  ? -2.414  -10.137 10.494  1.00 0.00 ? 59  LYS A HE2  3  
ATOM 4337  H HE3  . LYS A 1 59  ? -2.747  -10.663 8.856   1.00 0.00 ? 59  LYS A HE3  3  
ATOM 4338  H HZ1  . LYS A 1 59  ? -4.697  -9.693  9.398   1.00 0.00 ? 59  LYS A HZ1  3  
ATOM 4339  H HZ2  . LYS A 1 59  ? -5.049  -11.204 9.908   1.00 0.00 ? 59  LYS A HZ2  3  
ATOM 4340  H HZ3  . LYS A 1 59  ? -4.612  -10.059 10.987  1.00 0.00 ? 59  LYS A HZ3  3  
ATOM 4341  N N    . MET A 1 60  ? 0.680   -13.572 7.708   1.00 0.00 ? 60  MET A N    3  
ATOM 4342  C CA   . MET A 1 60  ? 0.440   -14.132 6.388   1.00 0.00 ? 60  MET A CA   3  
ATOM 4343  C C    . MET A 1 60  ? -0.993  -14.654 6.266   1.00 0.00 ? 60  MET A C    3  
ATOM 4344  O O    . MET A 1 60  ? -1.207  -15.812 5.912   1.00 0.00 ? 60  MET A O    3  
ATOM 4345  C CB   . MET A 1 60  ? 1.424   -15.275 6.132   1.00 0.00 ? 60  MET A CB   3  
ATOM 4346  C CG   . MET A 1 60  ? 2.687   -14.765 5.435   1.00 0.00 ? 60  MET A CG   3  
ATOM 4347  S SD   . MET A 1 60  ? 2.467   -14.810 3.664   1.00 0.00 ? 60  MET A SD   3  
ATOM 4348  C CE   . MET A 1 60  ? 2.110   -13.089 3.352   1.00 0.00 ? 60  MET A CE   3  
ATOM 4349  H H    . MET A 1 60  ? 0.979   -12.618 7.714   1.00 0.00 ? 60  MET A H    3  
ATOM 4350  H HA   . MET A 1 60  ? 0.596   -13.310 5.689   1.00 0.00 ? 60  MET A HA   3  
ATOM 4351  H HB2  . MET A 1 60  ? 1.692   -15.748 7.077   1.00 0.00 ? 60  MET A HB2  3  
ATOM 4352  H HB3  . MET A 1 60  ? 0.948   -16.038 5.517   1.00 0.00 ? 60  MET A HB3  3  
ATOM 4353  H HG2  . MET A 1 60  ? 2.904   -13.747 5.756   1.00 0.00 ? 60  MET A HG2  3  
ATOM 4354  H HG3  . MET A 1 60  ? 3.542   -15.378 5.719   1.00 0.00 ? 60  MET A HG3  3  
ATOM 4355  H HE1  . MET A 1 60  ? 2.068   -12.549 4.298   1.00 0.00 ? 60  MET A HE1  3  
ATOM 4356  H HE2  . MET A 1 60  ? 2.894   -12.663 2.725   1.00 0.00 ? 60  MET A HE2  3  
ATOM 4357  H HE3  . MET A 1 60  ? 1.150   -13.004 2.842   1.00 0.00 ? 60  MET A HE3  3  
ATOM 4358  N N    . ASN A 1 61  ? -1.937  -13.775 6.566   1.00 0.00 ? 61  ASN A N    3  
ATOM 4359  C CA   . ASN A 1 61  ? -3.343  -14.133 6.495   1.00 0.00 ? 61  ASN A CA   3  
ATOM 4360  C C    . ASN A 1 61  ? -3.772  -14.207 5.028   1.00 0.00 ? 61  ASN A C    3  
ATOM 4361  O O    . ASN A 1 61  ? -2.993  -13.885 4.132   1.00 0.00 ? 61  ASN A O    3  
ATOM 4362  C CB   . ASN A 1 61  ? -4.215  -13.084 7.189   1.00 0.00 ? 61  ASN A CB   3  
ATOM 4363  C CG   . ASN A 1 61  ? -5.539  -13.693 7.656   1.00 0.00 ? 61  ASN A CG   3  
ATOM 4364  O OD1  . ASN A 1 61  ? -5.588  -14.532 8.540   1.00 0.00 ? 61  ASN A OD1  3  
ATOM 4365  N ND2  . ASN A 1 61  ? -6.605  -13.225 7.014   1.00 0.00 ? 61  ASN A ND2  3  
ATOM 4366  H H    . ASN A 1 61  ? -1.754  -12.834 6.854   1.00 0.00 ? 61  ASN A H    3  
ATOM 4367  H HA   . ASN A 1 61  ? -3.420  -15.095 7.001   1.00 0.00 ? 61  ASN A HA   3  
ATOM 4368  H HB2  . ASN A 1 61  ? -3.680  -12.670 8.044   1.00 0.00 ? 61  ASN A HB2  3  
ATOM 4369  H HB3  . ASN A 1 61  ? -4.411  -12.258 6.505   1.00 0.00 ? 61  ASN A HB3  3  
ATOM 4370  H HD21 . ASN A 1 61  ? -6.495  -12.536 6.297   1.00 0.00 ? 61  ASN A HD21 3  
ATOM 4371  H HD22 . ASN A 1 61  ? -7.517  -13.562 7.247   1.00 0.00 ? 61  ASN A HD22 3  
ATOM 4372  N N    . LYS A 1 62  ? -5.010  -14.635 4.827   1.00 0.00 ? 62  LYS A N    3  
ATOM 4373  C CA   . LYS A 1 62  ? -5.551  -14.756 3.484   1.00 0.00 ? 62  LYS A CA   3  
ATOM 4374  C C    . LYS A 1 62  ? -5.373  -13.428 2.746   1.00 0.00 ? 62  LYS A C    3  
ATOM 4375  O O    . LYS A 1 62  ? -4.980  -13.410 1.580   1.00 0.00 ? 62  LYS A O    3  
ATOM 4376  C CB   . LYS A 1 62  ? -7.001  -15.242 3.533   1.00 0.00 ? 62  LYS A CB   3  
ATOM 4377  C CG   . LYS A 1 62  ? -7.732  -14.920 2.228   1.00 0.00 ? 62  LYS A CG   3  
ATOM 4378  C CD   . LYS A 1 62  ? -7.205  -15.779 1.077   1.00 0.00 ? 62  LYS A CD   3  
ATOM 4379  C CE   . LYS A 1 62  ? -8.342  -16.206 0.147   1.00 0.00 ? 62  LYS A CE   3  
ATOM 4380  N NZ   . LYS A 1 62  ? -7.879  -16.233 -1.259  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 4381  H H    . LYS A 1 62  ? -5.637  -14.895 5.561   1.00 0.00 ? 62  LYS A H    3  
ATOM 4382  H HA   . LYS A 1 62  ? -4.972  -15.520 2.966   1.00 0.00 ? 62  LYS A HA   3  
ATOM 4383  H HB2  . LYS A 1 62  ? -7.022  -16.318 3.709   1.00 0.00 ? 62  LYS A HB2  3  
ATOM 4384  H HB3  . LYS A 1 62  ? -7.518  -14.773 4.370   1.00 0.00 ? 62  LYS A HB3  3  
ATOM 4385  H HG2  . LYS A 1 62  ? -8.801  -15.091 2.354   1.00 0.00 ? 62  LYS A HG2  3  
ATOM 4386  H HG3  . LYS A 1 62  ? -7.604  -13.864 1.987   1.00 0.00 ? 62  LYS A HG3  3  
ATOM 4387  H HD2  . LYS A 1 62  ? -6.459  -15.219 0.513   1.00 0.00 ? 62  LYS A HD2  3  
ATOM 4388  H HD3  . LYS A 1 62  ? -6.706  -16.662 1.477   1.00 0.00 ? 62  LYS A HD3  3  
ATOM 4389  H HE2  . LYS A 1 62  ? -8.705  -17.193 0.435   1.00 0.00 ? 62  LYS A HE2  3  
ATOM 4390  H HE3  . LYS A 1 62  ? -9.180  -15.517 0.247   1.00 0.00 ? 62  LYS A HE3  3  
ATOM 4391  H HZ1  . LYS A 1 62  ? -8.075  -17.129 -1.657  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 4392  H HZ2  . LYS A 1 62  ? -8.355  -15.525 -1.780  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 4393  H HZ3  . LYS A 1 62  ? -6.894  -16.063 -1.288  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 4394  N N    . LYS A 1 63  ? -5.671  -12.348 3.454   1.00 0.00 ? 63  LYS A N    3  
ATOM 4395  C CA   . LYS A 1 63  ? -5.549  -11.019 2.880   1.00 0.00 ? 63  LYS A CA   3  
ATOM 4396  C C    . LYS A 1 63  ? -4.121  -10.818 2.370   1.00 0.00 ? 63  LYS A C    3  
ATOM 4397  O O    . LYS A 1 63  ? -3.913  -10.521 1.195   1.00 0.00 ? 63  LYS A O    3  
ATOM 4398  C CB   . LYS A 1 63  ? -5.998  -9.958  3.886   1.00 0.00 ? 63  LYS A CB   3  
ATOM 4399  C CG   . LYS A 1 63  ? -7.523  -9.838  3.912   1.00 0.00 ? 63  LYS A CG   3  
ATOM 4400  C CD   . LYS A 1 63  ? -7.996  -8.661  3.057   1.00 0.00 ? 63  LYS A CD   3  
ATOM 4401  C CE   . LYS A 1 63  ? -9.300  -8.075  3.602   1.00 0.00 ? 63  LYS A CE   3  
ATOM 4402  N NZ   . LYS A 1 63  ? -9.949  -7.219  2.584   1.00 0.00 ? 63  LYS A NZ   3  
ATOM 4403  H H    . LYS A 1 63  ? -5.991  -12.372 4.401   1.00 0.00 ? 63  LYS A H    3  
ATOM 4404  H HA   . LYS A 1 63  ? -6.230  -10.966 2.030   1.00 0.00 ? 63  LYS A HA   3  
ATOM 4405  H HB2  . LYS A 1 63  ? -5.633  -10.215 4.880   1.00 0.00 ? 63  LYS A HB2  3  
ATOM 4406  H HB3  . LYS A 1 63  ? -5.559  -8.995  3.625   1.00 0.00 ? 63  LYS A HB3  3  
ATOM 4407  H HG2  . LYS A 1 63  ? -7.971  -10.761 3.545   1.00 0.00 ? 63  LYS A HG2  3  
ATOM 4408  H HG3  . LYS A 1 63  ? -7.864  -9.705  4.939   1.00 0.00 ? 63  LYS A HG3  3  
ATOM 4409  H HD2  . LYS A 1 63  ? -7.226  -7.889  3.038   1.00 0.00 ? 63  LYS A HD2  3  
ATOM 4410  H HD3  . LYS A 1 63  ? -8.143  -8.990  2.028   1.00 0.00 ? 63  LYS A HD3  3  
ATOM 4411  H HE2  . LYS A 1 63  ? -9.974  -8.881  3.892   1.00 0.00 ? 63  LYS A HE2  3  
ATOM 4412  H HE3  . LYS A 1 63  ? -9.096  -7.492  4.500   1.00 0.00 ? 63  LYS A HE3  3  
ATOM 4413  H HZ1  . LYS A 1 63  ? -9.945  -7.689  1.702   1.00 0.00 ? 63  LYS A HZ1  3  
ATOM 4414  H HZ2  . LYS A 1 63  ? -10.892 -7.032  2.858   1.00 0.00 ? 63  LYS A HZ2  3  
ATOM 4415  H HZ3  . LYS A 1 63  ? -9.448  -6.357  2.506   1.00 0.00 ? 63  LYS A HZ3  3  
ATOM 4416  N N    . MET A 1 64  ? -3.172  -10.988 3.280   1.00 0.00 ? 64  MET A N    3  
ATOM 4417  C CA   . MET A 1 64  ? -1.769  -10.829 2.937   1.00 0.00 ? 64  MET A CA   3  
ATOM 4418  C C    . MET A 1 64  ? -1.342  -11.856 1.887   1.00 0.00 ? 64  MET A C    3  
ATOM 4419  O O    . MET A 1 64  ? -0.325  -11.678 1.217   1.00 0.00 ? 64  MET A O    3  
ATOM 4420  C CB   . MET A 1 64  ? -0.914  -10.998 4.195   1.00 0.00 ? 64  MET A CB   3  
ATOM 4421  C CG   . MET A 1 64  ? 0.516   -10.509 3.955   1.00 0.00 ? 64  MET A CG   3  
ATOM 4422  S SD   . MET A 1 64  ? 0.520   -8.746  3.674   1.00 0.00 ? 64  MET A SD   3  
ATOM 4423  C CE   . MET A 1 64  ? 0.028   -8.174  5.292   1.00 0.00 ? 64  MET A CE   3  
ATOM 4424  H H    . MET A 1 64  ? -3.349  -11.230 4.234   1.00 0.00 ? 64  MET A H    3  
ATOM 4425  H HA   . MET A 1 64  ? -1.680  -9.822  2.529   1.00 0.00 ? 64  MET A HA   3  
ATOM 4426  H HB2  . MET A 1 64  ? -1.359  -10.441 5.019   1.00 0.00 ? 64  MET A HB2  3  
ATOM 4427  H HB3  . MET A 1 64  ? -0.899  -12.047 4.490   1.00 0.00 ? 64  MET A HB3  3  
ATOM 4428  H HG2  . MET A 1 64  ? 1.140   -10.750 4.815   1.00 0.00 ? 64  MET A HG2  3  
ATOM 4429  H HG3  . MET A 1 64  ? 0.945   -11.024 3.095   1.00 0.00 ? 64  MET A HG3  3  
ATOM 4430  H HE1  . MET A 1 64  ? 0.085   -8.999  6.002   1.00 0.00 ? 64  MET A HE1  3  
ATOM 4431  H HE2  . MET A 1 64  ? 0.694   -7.372  5.611   1.00 0.00 ? 64  MET A HE2  3  
ATOM 4432  H HE3  . MET A 1 64  ? -0.996  -7.801  5.249   1.00 0.00 ? 64  MET A HE3  3  
ATOM 4433  N N    . GLU A 1 65  ? -2.139  -12.908 1.775   1.00 0.00 ? 65  GLU A N    3  
ATOM 4434  C CA   . GLU A 1 65  ? -1.855  -13.963 0.818   1.00 0.00 ? 65  GLU A CA   3  
ATOM 4435  C C    . GLU A 1 65  ? -2.264  -13.526 -0.590  1.00 0.00 ? 65  GLU A C    3  
ATOM 4436  O O    . GLU A 1 65  ? -1.669  -13.959 -1.576  1.00 0.00 ? 65  GLU A O    3  
ATOM 4437  C CB   . GLU A 1 65  ? -2.556  -15.265 1.213   1.00 0.00 ? 65  GLU A CB   3  
ATOM 4438  C CG   . GLU A 1 65  ? -1.714  -16.060 2.212   1.00 0.00 ? 65  GLU A CG   3  
ATOM 4439  C CD   . GLU A 1 65  ? -1.352  -17.437 1.651   1.00 0.00 ? 65  GLU A CD   3  
ATOM 4440  O OE1  . GLU A 1 65  ? -0.359  -17.498 0.894   1.00 0.00 ? 65  GLU A OE1  3  
ATOM 4441  O OE2  . GLU A 1 65  ? -2.078  -18.397 1.991   1.00 0.00 ? 65  GLU A OE2  3  
ATOM 4442  H H    . GLU A 1 65  ? -2.964  -13.045 2.324   1.00 0.00 ? 65  GLU A H    3  
ATOM 4443  H HA   . GLU A 1 65  ? -0.776  -14.112 0.861   1.00 0.00 ? 65  GLU A HA   3  
ATOM 4444  H HB2  . GLU A 1 65  ? -3.529  -15.040 1.650   1.00 0.00 ? 65  GLU A HB2  3  
ATOM 4445  H HB3  . GLU A 1 65  ? -2.739  -15.868 0.323   1.00 0.00 ? 65  GLU A HB3  3  
ATOM 4446  H HG2  . GLU A 1 65  ? -0.804  -15.508 2.446   1.00 0.00 ? 65  GLU A HG2  3  
ATOM 4447  H HG3  . GLU A 1 65  ? -2.264  -16.177 3.145   1.00 0.00 ? 65  GLU A HG3  3  
ATOM 4448  N N    . GLU A 1 66  ? -3.276  -12.673 -0.640  1.00 0.00 ? 66  GLU A N    3  
ATOM 4449  C CA   . GLU A 1 66  ? -3.771  -12.172 -1.912  1.00 0.00 ? 66  GLU A CA   3  
ATOM 4450  C C    . GLU A 1 66  ? -2.745  -11.233 -2.548  1.00 0.00 ? 66  GLU A C    3  
ATOM 4451  O O    . GLU A 1 66  ? -2.725  -11.063 -3.766  1.00 0.00 ? 66  GLU A O    3  
ATOM 4452  C CB   . GLU A 1 66  ? -5.121  -11.473 -1.737  1.00 0.00 ? 66  GLU A CB   3  
ATOM 4453  C CG   . GLU A 1 66  ? -6.195  -12.460 -1.277  1.00 0.00 ? 66  GLU A CG   3  
ATOM 4454  C CD   . GLU A 1 66  ? -7.199  -12.740 -2.398  1.00 0.00 ? 66  GLU A CD   3  
ATOM 4455  O OE1  . GLU A 1 66  ? -6.798  -13.433 -3.358  1.00 0.00 ? 66  GLU A OE1  3  
ATOM 4456  O OE2  . GLU A 1 66  ? -8.343  -12.255 -2.269  1.00 0.00 ? 66  GLU A OE2  3  
ATOM 4457  H H    . GLU A 1 66  ? -3.755  -12.326 0.166   1.00 0.00 ? 66  GLU A H    3  
ATOM 4458  H HA   . GLU A 1 66  ? -3.904  -13.054 -2.538  1.00 0.00 ? 66  GLU A HA   3  
ATOM 4459  H HB2  . GLU A 1 66  ? -5.026  -10.668 -1.009  1.00 0.00 ? 66  GLU A HB2  3  
ATOM 4460  H HB3  . GLU A 1 66  ? -5.422  -11.016 -2.680  1.00 0.00 ? 66  GLU A HB3  3  
ATOM 4461  H HG2  . GLU A 1 66  ? -5.726  -13.393 -0.963  1.00 0.00 ? 66  GLU A HG2  3  
ATOM 4462  H HG3  . GLU A 1 66  ? -6.717  -12.057 -0.409  1.00 0.00 ? 66  GLU A HG3  3  
ATOM 4463  N N    . VAL A 1 67  ? -1.916  -10.648 -1.695  1.00 0.00 ? 67  VAL A N    3  
ATOM 4464  C CA   . VAL A 1 67  ? -0.890  -9.731  -2.159  1.00 0.00 ? 67  VAL A CA   3  
ATOM 4465  C C    . VAL A 1 67  ? 0.403   -10.507 -2.419  1.00 0.00 ? 67  VAL A C    3  
ATOM 4466  O O    . VAL A 1 67  ? 1.225   -10.095 -3.235  1.00 0.00 ? 67  VAL A O    3  
ATOM 4467  C CB   . VAL A 1 67  ? -0.711  -8.593  -1.152  1.00 0.00 ? 67  VAL A CB   3  
ATOM 4468  C CG1  . VAL A 1 67  ? -1.520  -8.855  0.121   1.00 0.00 ? 67  VAL A CG1  3  
ATOM 4469  C CG2  . VAL A 1 67  ? 0.768   -8.376  -0.826  1.00 0.00 ? 67  VAL A CG2  3  
ATOM 4470  H H    . VAL A 1 67  ? -1.939  -10.792 -0.706  1.00 0.00 ? 67  VAL A H    3  
ATOM 4471  H HA   . VAL A 1 67  ? -1.235  -9.299  -3.098  1.00 0.00 ? 67  VAL A HA   3  
ATOM 4472  H HB   . VAL A 1 67  ? -1.091  -7.679  -1.608  1.00 0.00 ? 67  VAL A HB   3  
ATOM 4473  H HG11 . VAL A 1 67  ? -2.556  -9.067  -0.145  1.00 0.00 ? 67  VAL A HG11 3  
ATOM 4474  H HG12 . VAL A 1 67  ? -1.098  -9.710  0.650   1.00 0.00 ? 67  VAL A HG12 3  
ATOM 4475  H HG13 . VAL A 1 67  ? -1.482  -7.975  0.763   1.00 0.00 ? 67  VAL A HG13 3  
ATOM 4476  H HG21 . VAL A 1 67  ? 1.290   -8.034  -1.720  1.00 0.00 ? 67  VAL A HG21 3  
ATOM 4477  H HG22 . VAL A 1 67  ? 0.861   -7.625  -0.042  1.00 0.00 ? 67  VAL A HG22 3  
ATOM 4478  H HG23 . VAL A 1 67  ? 1.207   -9.314  -0.485  1.00 0.00 ? 67  VAL A HG23 3  
ATOM 4479  N N    . LYS A 1 68  ? 0.541   -11.617 -1.709  1.00 0.00 ? 68  LYS A N    3  
ATOM 4480  C CA   . LYS A 1 68  ? 1.720   -12.455 -1.852  1.00 0.00 ? 68  LYS A CA   3  
ATOM 4481  C C    . LYS A 1 68  ? 1.669   -13.172 -3.203  1.00 0.00 ? 68  LYS A C    3  
ATOM 4482  O O    . LYS A 1 68  ? 2.695   -13.620 -3.711  1.00 0.00 ? 68  LYS A O    3  
ATOM 4483  C CB   . LYS A 1 68  ? 1.852   -13.402 -0.658  1.00 0.00 ? 68  LYS A CB   3  
ATOM 4484  C CG   . LYS A 1 68  ? 3.134   -14.233 -0.757  1.00 0.00 ? 68  LYS A CG   3  
ATOM 4485  C CD   . LYS A 1 68  ? 3.684   -14.560 0.633   1.00 0.00 ? 68  LYS A CD   3  
ATOM 4486  C CE   . LYS A 1 68  ? 5.057   -15.227 0.537   1.00 0.00 ? 68  LYS A CE   3  
ATOM 4487  N NZ   . LYS A 1 68  ? 4.957   -16.515 -0.187  1.00 0.00 ? 68  LYS A NZ   3  
ATOM 4488  H H    . LYS A 1 68  ? -0.132  -11.945 -1.046  1.00 0.00 ? 68  LYS A H    3  
ATOM 4489  H HA   . LYS A 1 68  ? 2.590   -11.799 -1.842  1.00 0.00 ? 68  LYS A HA   3  
ATOM 4490  H HB2  . LYS A 1 68  ? 1.857   -12.828 0.268   1.00 0.00 ? 68  LYS A HB2  3  
ATOM 4491  H HB3  . LYS A 1 68  ? 0.988   -14.065 -0.617  1.00 0.00 ? 68  LYS A HB3  3  
ATOM 4492  H HG2  . LYS A 1 68  ? 2.932   -15.157 -1.298  1.00 0.00 ? 68  LYS A HG2  3  
ATOM 4493  H HG3  . LYS A 1 68  ? 3.883   -13.685 -1.329  1.00 0.00 ? 68  LYS A HG3  3  
ATOM 4494  H HD2  . LYS A 1 68  ? 3.760   -13.646 1.222   1.00 0.00 ? 68  LYS A HD2  3  
ATOM 4495  H HD3  . LYS A 1 68  ? 2.991   -15.218 1.157   1.00 0.00 ? 68  LYS A HD3  3  
ATOM 4496  H HE2  . LYS A 1 68  ? 5.754   -14.566 0.021   1.00 0.00 ? 68  LYS A HE2  3  
ATOM 4497  H HE3  . LYS A 1 68  ? 5.457   -15.396 1.536   1.00 0.00 ? 68  LYS A HE3  3  
ATOM 4498  H HZ1  . LYS A 1 68  ? 5.344   -17.245 0.377   1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 4499  H HZ2  . LYS A 1 68  ? 3.997   -16.715 -0.380  1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 4500  H HZ3  . LYS A 1 68  ? 5.464   -16.454 -1.047  1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 4501  N N    . GLU A 1 69  ? 0.463   -13.259 -3.746  1.00 0.00 ? 69  GLU A N    3  
ATOM 4502  C CA   . GLU A 1 69  ? 0.265   -13.914 -5.028  1.00 0.00 ? 69  GLU A CA   3  
ATOM 4503  C C    . GLU A 1 69  ? 0.525   -12.931 -6.172  1.00 0.00 ? 69  GLU A C    3  
ATOM 4504  O O    . GLU A 1 69  ? 1.142   -13.289 -7.174  1.00 0.00 ? 69  GLU A O    3  
ATOM 4505  C CB   . GLU A 1 69  ? -1.140  -14.511 -5.127  1.00 0.00 ? 69  GLU A CB   3  
ATOM 4506  C CG   . GLU A 1 69  ? -1.503  -15.274 -3.851  1.00 0.00 ? 69  GLU A CG   3  
ATOM 4507  C CD   . GLU A 1 69  ? -1.742  -16.755 -4.148  1.00 0.00 ? 69  GLU A CD   3  
ATOM 4508  O OE1  . GLU A 1 69  ? -0.864  -17.351 -4.809  1.00 0.00 ? 69  GLU A OE1  3  
ATOM 4509  O OE2  . GLU A 1 69  ? -2.798  -17.259 -3.706  1.00 0.00 ? 69  GLU A OE2  3  
ATOM 4510  H H    . GLU A 1 69  ? -0.367  -12.892 -3.326  1.00 0.00 ? 69  GLU A H    3  
ATOM 4511  H HA   . GLU A 1 69  ? 0.999   -14.719 -5.058  1.00 0.00 ? 69  GLU A HA   3  
ATOM 4512  H HB2  . GLU A 1 69  ? -1.866  -13.716 -5.299  1.00 0.00 ? 69  GLU A HB2  3  
ATOM 4513  H HB3  . GLU A 1 69  ? -1.194  -15.182 -5.984  1.00 0.00 ? 69  GLU A HB3  3  
ATOM 4514  H HG2  . GLU A 1 69  ? -0.700  -15.170 -3.121  1.00 0.00 ? 69  GLU A HG2  3  
ATOM 4515  H HG3  . GLU A 1 69  ? -2.398  -14.839 -3.406  1.00 0.00 ? 69  GLU A HG3  3  
ATOM 4516  N N    . ALA A 1 70  ? 0.041   -11.712 -5.984  1.00 0.00 ? 70  ALA A N    3  
ATOM 4517  C CA   . ALA A 1 70  ? 0.214   -10.675 -6.987  1.00 0.00 ? 70  ALA A CA   3  
ATOM 4518  C C    . ALA A 1 70  ? 1.563   -9.986  -6.775  1.00 0.00 ? 70  ALA A C    3  
ATOM 4519  O O    . ALA A 1 70  ? 1.843   -8.960  -7.393  1.00 0.00 ? 70  ALA A O    3  
ATOM 4520  C CB   . ALA A 1 70  ? -0.960  -9.696  -6.916  1.00 0.00 ? 70  ALA A CB   3  
ATOM 4521  H H    . ALA A 1 70  ? -0.460  -11.429 -5.166  1.00 0.00 ? 70  ALA A H    3  
ATOM 4522  H HA   . ALA A 1 70  ? 0.211   -11.157 -7.965  1.00 0.00 ? 70  ALA A HA   3  
ATOM 4523  H HB1  . ALA A 1 70  ? -1.534  -9.882  -6.009  1.00 0.00 ? 70  ALA A HB1  3  
ATOM 4524  H HB2  . ALA A 1 70  ? -0.580  -8.674  -6.902  1.00 0.00 ? 70  ALA A HB2  3  
ATOM 4525  H HB3  . ALA A 1 70  ? -1.601  -9.834  -7.787  1.00 0.00 ? 70  ALA A HB3  3  
ATOM 4526  N N    . ASN A 1 71  ? 2.362   -10.576 -5.898  1.00 0.00 ? 71  ASN A N    3  
ATOM 4527  C CA   . ASN A 1 71  ? 3.674   -10.031 -5.597  1.00 0.00 ? 71  ASN A CA   3  
ATOM 4528  C C    . ASN A 1 71  ? 3.566   -8.513  -5.433  1.00 0.00 ? 71  ASN A C    3  
ATOM 4529  O O    . ASN A 1 71  ? 4.189   -7.759  -6.179  1.00 0.00 ? 71  ASN A O    3  
ATOM 4530  C CB   . ASN A 1 71  ? 4.662   -10.314 -6.730  1.00 0.00 ? 71  ASN A CB   3  
ATOM 4531  C CG   . ASN A 1 71  ? 6.065   -10.581 -6.181  1.00 0.00 ? 71  ASN A CG   3  
ATOM 4532  O OD1  . ASN A 1 71  ? 6.257   -10.877 -5.013  1.00 0.00 ? 71  ASN A OD1  3  
ATOM 4533  N ND2  . ASN A 1 71  ? 7.032   -10.460 -7.086  1.00 0.00 ? 71  ASN A ND2  3  
ATOM 4534  H H    . ASN A 1 71  ? 2.126   -11.410 -5.399  1.00 0.00 ? 71  ASN A H    3  
ATOM 4535  H HA   . ASN A 1 71  ? 3.987   -10.528 -4.679  1.00 0.00 ? 71  ASN A HA   3  
ATOM 4536  H HB2  . ASN A 1 71  ? 4.323   -11.176 -7.306  1.00 0.00 ? 71  ASN A HB2  3  
ATOM 4537  H HB3  . ASN A 1 71  ? 4.690   -9.466  -7.414  1.00 0.00 ? 71  ASN A HB3  3  
ATOM 4538  H HD21 . ASN A 1 71  ? 6.807   -10.214 -8.029  1.00 0.00 ? 71  ASN A HD21 3  
ATOM 4539  H HD22 . ASN A 1 71  ? 7.985   -10.615 -6.824  1.00 0.00 ? 71  ASN A HD22 3  
ATOM 4540  N N    . ILE A 1 72  ? 2.772   -8.112  -4.451  1.00 0.00 ? 72  ILE A N    3  
ATOM 4541  C CA   . ILE A 1 72  ? 2.575   -6.698  -4.180  1.00 0.00 ? 72  ILE A CA   3  
ATOM 4542  C C    . ILE A 1 72  ? 3.364   -6.309  -2.928  1.00 0.00 ? 72  ILE A C    3  
ATOM 4543  O O    . ILE A 1 72  ? 2.956   -6.621  -1.810  1.00 0.00 ? 72  ILE A O    3  
ATOM 4544  C CB   . ILE A 1 72  ? 1.082   -6.373  -4.092  1.00 0.00 ? 72  ILE A CB   3  
ATOM 4545  C CG1  . ILE A 1 72  ? 0.332   -6.904  -5.315  1.00 0.00 ? 72  ILE A CG1  3  
ATOM 4546  C CG2  . ILE A 1 72  ? 0.859   -4.872  -3.890  1.00 0.00 ? 72  ILE A CG2  3  
ATOM 4547  C CD1  . ILE A 1 72  ? -1.175  -6.681  -5.174  1.00 0.00 ? 72  ILE A CD1  3  
ATOM 4548  H H    . ILE A 1 72  ? 2.270   -8.732  -3.849  1.00 0.00 ? 72  ILE A H    3  
ATOM 4549  H HA   . ILE A 1 72  ? 2.976   -6.143  -5.028  1.00 0.00 ? 72  ILE A HA   3  
ATOM 4550  H HB   . ILE A 1 72  ? 0.673   -6.879  -3.218  1.00 0.00 ? 72  ILE A HB   3  
ATOM 4551  H HG12 . ILE A 1 72  ? 0.695   -6.405  -6.213  1.00 0.00 ? 72  ILE A HG12 3  
ATOM 4552  H HG13 . ILE A 1 72  ? 0.536   -7.968  -5.437  1.00 0.00 ? 72  ILE A HG13 3  
ATOM 4553  H HG21 . ILE A 1 72  ? 0.240   -4.485  -4.699  1.00 0.00 ? 72  ILE A HG21 3  
ATOM 4554  H HG22 . ILE A 1 72  ? 0.358   -4.705  -2.936  1.00 0.00 ? 72  ILE A HG22 3  
ATOM 4555  H HG23 . ILE A 1 72  ? 1.821   -4.359  -3.890  1.00 0.00 ? 72  ILE A HG23 3  
ATOM 4556  H HD11 . ILE A 1 72  ? -1.592  -6.395  -6.139  1.00 0.00 ? 72  ILE A HD11 3  
ATOM 4557  H HD12 . ILE A 1 72  ? -1.648  -7.602  -4.832  1.00 0.00 ? 72  ILE A HD12 3  
ATOM 4558  H HD13 . ILE A 1 72  ? -1.358  -5.888  -4.449  1.00 0.00 ? 72  ILE A HD13 3  
ATOM 4559  N N    . ARG A 1 73  ? 4.479   -5.632  -3.157  1.00 0.00 ? 73  ARG A N    3  
ATOM 4560  C CA   . ARG A 1 73  ? 5.329   -5.196  -2.062  1.00 0.00 ? 73  ARG A CA   3  
ATOM 4561  C C    . ARG A 1 73  ? 4.483   -4.576  -0.948  1.00 0.00 ? 73  ARG A C    3  
ATOM 4562  O O    . ARG A 1 73  ? 3.631   -3.728  -1.210  1.00 0.00 ? 73  ARG A O    3  
ATOM 4563  C CB   . ARG A 1 73  ? 6.361   -4.173  -2.539  1.00 0.00 ? 73  ARG A CB   3  
ATOM 4564  C CG   . ARG A 1 73  ? 5.699   -2.828  -2.846  1.00 0.00 ? 73  ARG A CG   3  
ATOM 4565  C CD   . ARG A 1 73  ? 6.654   -1.909  -3.612  1.00 0.00 ? 73  ARG A CD   3  
ATOM 4566  N NE   . ARG A 1 73  ? 5.969   -1.340  -4.794  1.00 0.00 ? 73  ARG A NE   3  
ATOM 4567  C CZ   . ARG A 1 73  ? 5.883   -1.955  -5.981  1.00 0.00 ? 73  ARG A CZ   3  
ATOM 4568  N NH1  . ARG A 1 73  ? 6.439   -3.163  -6.151  1.00 0.00 ? 73  ARG A NH1  3  
ATOM 4569  N NH2  . ARG A 1 73  ? 5.242   -1.363  -6.998  1.00 0.00 ? 73  ARG A NH2  3  
ATOM 4570  H H    . ARG A 1 73  ? 4.804   -5.381  -4.069  1.00 0.00 ? 73  ARG A H    3  
ATOM 4571  H HA   . ARG A 1 73  ? 5.827   -6.103  -1.718  1.00 0.00 ? 73  ARG A HA   3  
ATOM 4572  H HB2  . ARG A 1 73  ? 7.126   -4.039  -1.774  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 4573  H HB3  . ARG A 1 73  ? 6.864   -4.547  -3.431  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 4574  H HG2  . ARG A 1 73  ? 4.795   -2.990  -3.434  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 4575  H HG3  . ARG A 1 73  ? 5.394   -2.348  -1.917  1.00 0.00 ? 73  ARG A HG3  3  
ATOM 4576  H HD2  . ARG A 1 73  ? 7.000   -1.107  -2.960  1.00 0.00 ? 73  ARG A HD2  3  
ATOM 4577  H HD3  . ARG A 1 73  ? 7.535   -2.468  -3.926  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 4578  H HE   . ARG A 1 73  ? 5.543   -0.440  -4.701  1.00 0.00 ? 73  ARG A HE   3  
ATOM 4579  H HH11 . ARG A 1 73  ? 6.917   -3.605  -5.393  1.00 0.00 ? 73  ARG A HH11 3  
ATOM 4580  H HH12 . ARG A 1 73  ? 6.375   -3.622  -7.038  1.00 0.00 ? 73  ARG A HH12 3  
ATOM 4581  H HH21 . ARG A 1 73  ? 4.828   -0.462  -6.871  1.00 0.00 ? 73  ARG A HH21 3  
ATOM 4582  H HH22 . ARG A 1 73  ? 5.178   -1.822  -7.884  1.00 0.00 ? 73  ARG A HH22 3  
ATOM 4583  N N    . VAL A 1 74  ? 4.748   -5.023  0.271   1.00 0.00 ? 74  VAL A N    3  
ATOM 4584  C CA   . VAL A 1 74  ? 4.021   -4.522  1.425   1.00 0.00 ? 74  VAL A CA   3  
ATOM 4585  C C    . VAL A 1 74  ? 4.878   -3.481  2.149   1.00 0.00 ? 74  VAL A C    3  
ATOM 4586  O O    . VAL A 1 74  ? 6.038   -3.739  2.466   1.00 0.00 ? 74  VAL A O    3  
ATOM 4587  C CB   . VAL A 1 74  ? 3.606   -5.686  2.327   1.00 0.00 ? 74  VAL A CB   3  
ATOM 4588  C CG1  . VAL A 1 74  ? 2.577   -5.235  3.366   1.00 0.00 ? 74  VAL A CG1  3  
ATOM 4589  C CG2  . VAL A 1 74  ? 3.072   -6.857  1.500   1.00 0.00 ? 74  VAL A CG2  3  
ATOM 4590  H H    . VAL A 1 74  ? 5.442   -5.713  0.475   1.00 0.00 ? 74  VAL A H    3  
ATOM 4591  H HA   . VAL A 1 74  ? 3.116   -4.038  1.060   1.00 0.00 ? 74  VAL A HA   3  
ATOM 4592  H HB   . VAL A 1 74  ? 4.492   -6.030  2.861   1.00 0.00 ? 74  VAL A HB   3  
ATOM 4593  H HG11 . VAL A 1 74  ? 1.846   -4.579  2.892   1.00 0.00 ? 74  VAL A HG11 3  
ATOM 4594  H HG12 . VAL A 1 74  ? 2.070   -6.107  3.778   1.00 0.00 ? 74  VAL A HG12 3  
ATOM 4595  H HG13 . VAL A 1 74  ? 3.083   -4.696  4.167   1.00 0.00 ? 74  VAL A HG13 3  
ATOM 4596  H HG21 . VAL A 1 74  ? 3.005   -6.562  0.453   1.00 0.00 ? 74  VAL A HG21 3  
ATOM 4597  H HG22 . VAL A 1 74  ? 3.748   -7.707  1.595   1.00 0.00 ? 74  VAL A HG22 3  
ATOM 4598  H HG23 . VAL A 1 74  ? 2.083   -7.137  1.862   1.00 0.00 ? 74  VAL A HG23 3  
ATOM 4599  N N    . VAL A 1 75  ? 4.273   -2.327  2.390   1.00 0.00 ? 75  VAL A N    3  
ATOM 4600  C CA   . VAL A 1 75  ? 4.965   -1.247  3.070   1.00 0.00 ? 75  VAL A CA   3  
ATOM 4601  C C    . VAL A 1 75  ? 4.155   -0.818  4.295   1.00 0.00 ? 75  VAL A C    3  
ATOM 4602  O O    . VAL A 1 75  ? 3.027   -1.270  4.486   1.00 0.00 ? 75  VAL A O    3  
ATOM 4603  C CB   . VAL A 1 75  ? 5.228   -0.097  2.095   1.00 0.00 ? 75  VAL A CB   3  
ATOM 4604  C CG1  . VAL A 1 75  ? 6.137   -0.546  0.950   1.00 0.00 ? 75  VAL A CG1  3  
ATOM 4605  C CG2  . VAL A 1 75  ? 3.915   0.478   1.560   1.00 0.00 ? 75  VAL A CG2  3  
ATOM 4606  H H    . VAL A 1 75  ? 3.329   -2.126  2.129   1.00 0.00 ? 75  VAL A H    3  
ATOM 4607  H HA   . VAL A 1 75  ? 5.929   -1.632  3.404   1.00 0.00 ? 75  VAL A HA   3  
ATOM 4608  H HB   . VAL A 1 75  ? 5.742   0.694   2.640   1.00 0.00 ? 75  VAL A HB   3  
ATOM 4609  H HG11 . VAL A 1 75  ? 6.104   -1.633  0.864   1.00 0.00 ? 75  VAL A HG11 3  
ATOM 4610  H HG12 . VAL A 1 75  ? 5.795   -0.098  0.017   1.00 0.00 ? 75  VAL A HG12 3  
ATOM 4611  H HG13 . VAL A 1 75  ? 7.160   -0.229  1.152   1.00 0.00 ? 75  VAL A HG13 3  
ATOM 4612  H HG21 . VAL A 1 75  ? 3.220   -0.336  1.351   1.00 0.00 ? 75  VAL A HG21 3  
ATOM 4613  H HG22 . VAL A 1 75  ? 3.480   1.145   2.304   1.00 0.00 ? 75  VAL A HG22 3  
ATOM 4614  H HG23 . VAL A 1 75  ? 4.109   1.034   0.643   1.00 0.00 ? 75  VAL A HG23 3  
ATOM 4615  N N    . SER A 1 76  ? 4.761   0.048   5.093   1.00 0.00 ? 76  SER A N    3  
ATOM 4616  C CA   . SER A 1 76  ? 4.110   0.543   6.294   1.00 0.00 ? 76  SER A CA   3  
ATOM 4617  C C    . SER A 1 76  ? 3.401   1.866   5.998   1.00 0.00 ? 76  SER A C    3  
ATOM 4618  O O    . SER A 1 76  ? 3.476   2.378   4.882   1.00 0.00 ? 76  SER A O    3  
ATOM 4619  C CB   . SER A 1 76  ? 5.116   0.723   7.432   1.00 0.00 ? 76  SER A CB   3  
ATOM 4620  O OG   . SER A 1 76  ? 4.534   0.458   8.706   1.00 0.00 ? 76  SER A OG   3  
ATOM 4621  H H    . SER A 1 76  ? 5.679   0.411   4.930   1.00 0.00 ? 76  SER A H    3  
ATOM 4622  H HA   . SER A 1 76  ? 3.387   -0.226  6.567   1.00 0.00 ? 76  SER A HA   3  
ATOM 4623  H HB2  . SER A 1 76  ? 5.964   0.055   7.275   1.00 0.00 ? 76  SER A HB2  3  
ATOM 4624  H HB3  . SER A 1 76  ? 5.504   1.741   7.415   1.00 0.00 ? 76  SER A HB3  3  
ATOM 4625  H HG   . SER A 1 76  ? 4.657   1.247   9.308   1.00 0.00 ? 76  SER A HG   3  
ATOM 4626  N N    . GLU A 1 77  ? 2.729   2.382   7.017   1.00 0.00 ? 77  GLU A N    3  
ATOM 4627  C CA   . GLU A 1 77  ? 2.008   3.635   6.880   1.00 0.00 ? 77  GLU A CA   3  
ATOM 4628  C C    . GLU A 1 77  ? 2.989   4.806   6.800   1.00 0.00 ? 77  GLU A C    3  
ATOM 4629  O O    . GLU A 1 77  ? 2.609   5.914   6.424   1.00 0.00 ? 77  GLU A O    3  
ATOM 4630  C CB   . GLU A 1 77  ? 1.018   3.827   8.031   1.00 0.00 ? 77  GLU A CB   3  
ATOM 4631  C CG   . GLU A 1 77  ? -0.333  4.326   7.515   1.00 0.00 ? 77  GLU A CG   3  
ATOM 4632  C CD   . GLU A 1 77  ? -0.759  5.604   8.239   1.00 0.00 ? 77  GLU A CD   3  
ATOM 4633  O OE1  . GLU A 1 77  ? -0.510  5.673   9.462   1.00 0.00 ? 77  GLU A OE1  3  
ATOM 4634  O OE2  . GLU A 1 77  ? -1.323  6.484   7.553   1.00 0.00 ? 77  GLU A OE2  3  
ATOM 4635  H H    . GLU A 1 77  ? 2.673   1.958   7.921   1.00 0.00 ? 77  GLU A H    3  
ATOM 4636  H HA   . GLU A 1 77  ? 1.455   3.551   5.944   1.00 0.00 ? 77  GLU A HA   3  
ATOM 4637  H HB2  . GLU A 1 77  ? 0.883   2.884   8.561   1.00 0.00 ? 77  GLU A HB2  3  
ATOM 4638  H HB3  . GLU A 1 77  ? 1.423   4.540   8.749   1.00 0.00 ? 77  GLU A HB3  3  
ATOM 4639  H HG2  . GLU A 1 77  ? -0.270  4.514   6.443   1.00 0.00 ? 77  GLU A HG2  3  
ATOM 4640  H HG3  . GLU A 1 77  ? -1.089  3.553   7.659   1.00 0.00 ? 77  GLU A HG3  3  
ATOM 4641  N N    . ASP A 1 78  ? 4.232   4.521   7.160   1.00 0.00 ? 78  ASP A N    3  
ATOM 4642  C CA   . ASP A 1 78  ? 5.270   5.537   7.134   1.00 0.00 ? 78  ASP A CA   3  
ATOM 4643  C C    . ASP A 1 78  ? 5.612   5.873   5.681   1.00 0.00 ? 78  ASP A C    3  
ATOM 4644  O O    . ASP A 1 78  ? 6.214   6.910   5.405   1.00 0.00 ? 78  ASP A O    3  
ATOM 4645  C CB   . ASP A 1 78  ? 6.546   5.038   7.816   1.00 0.00 ? 78  ASP A CB   3  
ATOM 4646  C CG   . ASP A 1 78  ? 6.452   4.894   9.336   1.00 0.00 ? 78  ASP A CG   3  
ATOM 4647  O OD1  . ASP A 1 78  ? 6.462   5.948   10.008  1.00 0.00 ? 78  ASP A OD1  3  
ATOM 4648  O OD2  . ASP A 1 78  ? 6.372   3.733   9.792   1.00 0.00 ? 78  ASP A OD2  3  
ATOM 4649  H H    . ASP A 1 78  ? 4.532   3.617   7.464   1.00 0.00 ? 78  ASP A H    3  
ATOM 4650  H HA   . ASP A 1 78  ? 4.853   6.388   7.672   1.00 0.00 ? 78  ASP A HA   3  
ATOM 4651  H HB2  . ASP A 1 78  ? 6.814   4.071   7.390   1.00 0.00 ? 78  ASP A HB2  3  
ATOM 4652  H HB3  . ASP A 1 78  ? 7.358   5.726   7.581   1.00 0.00 ? 78  ASP A HB3  3  
ATOM 4653  N N    . PHE A 1 79  ? 5.212   4.978   4.790   1.00 0.00 ? 79  PHE A N    3  
ATOM 4654  C CA   . PHE A 1 79  ? 5.469   5.167   3.372   1.00 0.00 ? 79  PHE A CA   3  
ATOM 4655  C C    . PHE A 1 79  ? 4.710   6.382   2.835   1.00 0.00 ? 79  PHE A C    3  
ATOM 4656  O O    . PHE A 1 79  ? 5.252   7.159   2.050   1.00 0.00 ? 79  PHE A O    3  
ATOM 4657  C CB   . PHE A 1 79  ? 4.968   3.911   2.656   1.00 0.00 ? 79  PHE A CB   3  
ATOM 4658  C CG   . PHE A 1 79  ? 4.673   4.119   1.169   1.00 0.00 ? 79  PHE A CG   3  
ATOM 4659  C CD1  . PHE A 1 79  ? 5.697   4.270   0.287   1.00 0.00 ? 79  PHE A CD1  3  
ATOM 4660  C CD2  . PHE A 1 79  ? 3.386   4.153   0.729   1.00 0.00 ? 79  PHE A CD2  3  
ATOM 4661  C CE1  . PHE A 1 79  ? 5.423   4.463   -1.093  1.00 0.00 ? 79  PHE A CE1  3  
ATOM 4662  C CE2  . PHE A 1 79  ? 3.112   4.345   -0.650  1.00 0.00 ? 79  PHE A CE2  3  
ATOM 4663  C CZ   . PHE A 1 79  ? 4.136   4.497   -1.533  1.00 0.00 ? 79  PHE A CZ   3  
ATOM 4664  H H    . PHE A 1 79  ? 4.723   4.137   5.022   1.00 0.00 ? 79  PHE A H    3  
ATOM 4665  H HA   . PHE A 1 79  ? 6.540   5.329   3.256   1.00 0.00 ? 79  PHE A HA   3  
ATOM 4666  H HB2  . PHE A 1 79  ? 5.714   3.123   2.761   1.00 0.00 ? 79  PHE A HB2  3  
ATOM 4667  H HB3  . PHE A 1 79  ? 4.062   3.560   3.150   1.00 0.00 ? 79  PHE A HB3  3  
ATOM 4668  H HD1  . PHE A 1 79  ? 6.728   4.243   0.639   1.00 0.00 ? 79  PHE A HD1  3  
ATOM 4669  H HD2  . PHE A 1 79  ? 2.565   4.031   1.436   1.00 0.00 ? 79  PHE A HD2  3  
ATOM 4670  H HE1  . PHE A 1 79  ? 6.243   4.584   -1.800  1.00 0.00 ? 79  PHE A HE1  3  
ATOM 4671  H HE2  . PHE A 1 79  ? 2.081   4.372   -1.003  1.00 0.00 ? 79  PHE A HE2  3  
ATOM 4672  H HZ   . PHE A 1 79  ? 3.925   4.645   -2.592  1.00 0.00 ? 79  PHE A HZ   3  
ATOM 4673  N N    . LEU A 1 80  ? 3.469   6.509   3.280   1.00 0.00 ? 80  LEU A N    3  
ATOM 4674  C CA   . LEU A 1 80  ? 2.631   7.617   2.854   1.00 0.00 ? 80  LEU A CA   3  
ATOM 4675  C C    . LEU A 1 80  ? 3.231   8.930   3.361   1.00 0.00 ? 80  LEU A C    3  
ATOM 4676  O O    . LEU A 1 80  ? 3.251   9.927   2.641   1.00 0.00 ? 80  LEU A O    3  
ATOM 4677  C CB   . LEU A 1 80  ? 1.182   7.393   3.293   1.00 0.00 ? 80  LEU A CB   3  
ATOM 4678  C CG   . LEU A 1 80  ? 0.440   6.250   2.598   1.00 0.00 ? 80  LEU A CG   3  
ATOM 4679  C CD1  . LEU A 1 80  ? -0.777  5.810   3.415   1.00 0.00 ? 80  LEU A CD1  3  
ATOM 4680  C CD2  . LEU A 1 80  ? 0.061   6.632   1.166   1.00 0.00 ? 80  LEU A CD2  3  
ATOM 4681  H H    . LEU A 1 80  ? 3.036   5.873   3.918   1.00 0.00 ? 80  LEU A H    3  
ATOM 4682  H HA   . LEU A 1 80  ? 2.638   7.632   1.764   1.00 0.00 ? 80  LEU A HA   3  
ATOM 4683  H HB2  . LEU A 1 80  ? 1.174   7.206   4.367   1.00 0.00 ? 80  LEU A HB2  3  
ATOM 4684  H HB3  . LEU A 1 80  ? 0.626   8.315   3.126   1.00 0.00 ? 80  LEU A HB3  3  
ATOM 4685  H HG   . LEU A 1 80  ? 1.112   5.394   2.536   1.00 0.00 ? 80  LEU A HG   3  
ATOM 4686  H HD11 . LEU A 1 80  ? -0.670  4.760   3.689   1.00 0.00 ? 80  LEU A HD11 3  
ATOM 4687  H HD12 . LEU A 1 80  ? -0.847  6.416   4.318   1.00 0.00 ? 80  LEU A HD12 3  
ATOM 4688  H HD13 . LEU A 1 80  ? -1.680  5.940   2.819   1.00 0.00 ? 80  LEU A HD13 3  
ATOM 4689  H HD21 . LEU A 1 80  ? 0.964   6.706   0.559   1.00 0.00 ? 80  LEU A HD21 3  
ATOM 4690  H HD22 . LEU A 1 80  ? -0.596  5.869   0.748   1.00 0.00 ? 80  LEU A HD22 3  
ATOM 4691  H HD23 . LEU A 1 80  ? -0.454  7.593   1.170   1.00 0.00 ? 80  LEU A HD23 3  
ATOM 4692  N N    . GLN A 1 81  ? 3.706   8.887   4.597   1.00 0.00 ? 81  GLN A N    3  
ATOM 4693  C CA   . GLN A 1 81  ? 4.305   10.061  5.210   1.00 0.00 ? 81  GLN A CA   3  
ATOM 4694  C C    . GLN A 1 81  ? 5.543   10.496  4.423   1.00 0.00 ? 81  GLN A C    3  
ATOM 4695  O O    . GLN A 1 81  ? 5.866   11.682  4.372   1.00 0.00 ? 81  GLN A O    3  
ATOM 4696  C CB   . GLN A 1 81  ? 4.651   9.798   6.676   1.00 0.00 ? 81  GLN A CB   3  
ATOM 4697  C CG   . GLN A 1 81  ? 5.728   10.768  7.168   1.00 0.00 ? 81  GLN A CG   3  
ATOM 4698  C CD   . GLN A 1 81  ? 5.225   12.212  7.126   1.00 0.00 ? 81  GLN A CD   3  
ATOM 4699  O OE1  . GLN A 1 81  ? 4.076   12.505  7.413   1.00 0.00 ? 81  GLN A OE1  3  
ATOM 4700  N NE2  . GLN A 1 81  ? 6.147   13.095  6.753   1.00 0.00 ? 81  GLN A NE2  3  
ATOM 4701  H H    . GLN A 1 81  ? 3.685   8.072   5.177   1.00 0.00 ? 81  GLN A H    3  
ATOM 4702  H HA   . GLN A 1 81  ? 3.541   10.837  5.157   1.00 0.00 ? 81  GLN A HA   3  
ATOM 4703  H HB2  . GLN A 1 81  ? 3.756   9.902   7.289   1.00 0.00 ? 81  GLN A HB2  3  
ATOM 4704  H HB3  . GLN A 1 81  ? 5.000   8.772   6.793   1.00 0.00 ? 81  GLN A HB3  3  
ATOM 4705  H HG2  . GLN A 1 81  ? 6.018   10.509  8.186   1.00 0.00 ? 81  GLN A HG2  3  
ATOM 4706  H HG3  . GLN A 1 81  ? 6.619   10.671  6.549   1.00 0.00 ? 81  GLN A HG3  3  
ATOM 4707  H HE21 . GLN A 1 81  ? 7.072   12.788  6.531   1.00 0.00 ? 81  GLN A HE21 3  
ATOM 4708  H HE22 . GLN A 1 81  ? 5.915   14.066  6.695   1.00 0.00 ? 81  GLN A HE22 3  
ATOM 4709  N N    . ASP A 1 82  ? 6.203   9.513   3.829   1.00 0.00 ? 82  ASP A N    3  
ATOM 4710  C CA   . ASP A 1 82  ? 7.399   9.779   3.048   1.00 0.00 ? 82  ASP A CA   3  
ATOM 4711  C C    . ASP A 1 82  ? 7.000   10.099  1.606   1.00 0.00 ? 82  ASP A C    3  
ATOM 4712  O O    . ASP A 1 82  ? 7.367   11.146  1.075   1.00 0.00 ? 82  ASP A O    3  
ATOM 4713  C CB   . ASP A 1 82  ? 8.323   8.560   3.023   1.00 0.00 ? 82  ASP A CB   3  
ATOM 4714  C CG   . ASP A 1 82  ? 9.607   8.705   3.843   1.00 0.00 ? 82  ASP A CG   3  
ATOM 4715  O OD1  . ASP A 1 82  ? 9.499   8.618   5.086   1.00 0.00 ? 82  ASP A OD1  3  
ATOM 4716  O OD2  . ASP A 1 82  ? 10.667  8.899   3.210   1.00 0.00 ? 82  ASP A OD2  3  
ATOM 4717  H H    . ASP A 1 82  ? 5.934   8.551   3.876   1.00 0.00 ? 82  ASP A H    3  
ATOM 4718  H HA   . ASP A 1 82  ? 7.883   10.620  3.543   1.00 0.00 ? 82  ASP A HA   3  
ATOM 4719  H HB2  . ASP A 1 82  ? 7.770   7.696   3.391   1.00 0.00 ? 82  ASP A HB2  3  
ATOM 4720  H HB3  . ASP A 1 82  ? 8.594   8.349   1.988   1.00 0.00 ? 82  ASP A HB3  3  
ATOM 4721  N N    . VAL A 1 83  ? 6.253   9.179   1.014   1.00 0.00 ? 83  VAL A N    3  
ATOM 4722  C CA   . VAL A 1 83  ? 5.801   9.350   -0.356  1.00 0.00 ? 83  VAL A CA   3  
ATOM 4723  C C    . VAL A 1 83  ? 5.128   10.717  -0.499  1.00 0.00 ? 83  VAL A C    3  
ATOM 4724  O O    . VAL A 1 83  ? 5.130   11.303  -1.580  1.00 0.00 ? 83  VAL A O    3  
ATOM 4725  C CB   . VAL A 1 83  ? 4.887   8.189   -0.754  1.00 0.00 ? 83  VAL A CB   3  
ATOM 4726  C CG1  . VAL A 1 83  ? 3.421   8.520   -0.463  1.00 0.00 ? 83  VAL A CG1  3  
ATOM 4727  C CG2  . VAL A 1 83  ? 5.083   7.817   -2.225  1.00 0.00 ? 83  VAL A CG2  3  
ATOM 4728  H H    . VAL A 1 83  ? 5.959   8.330   1.453   1.00 0.00 ? 83  VAL A H    3  
ATOM 4729  H HA   . VAL A 1 83  ? 6.680   9.323   -0.999  1.00 0.00 ? 83  VAL A HA   3  
ATOM 4730  H HB   . VAL A 1 83  ? 5.161   7.324   -0.150  1.00 0.00 ? 83  VAL A HB   3  
ATOM 4731  H HG11 . VAL A 1 83  ? 3.012   9.108   -1.284  1.00 0.00 ? 83  VAL A HG11 3  
ATOM 4732  H HG12 . VAL A 1 83  ? 2.854   7.596   -0.359  1.00 0.00 ? 83  VAL A HG12 3  
ATOM 4733  H HG13 . VAL A 1 83  ? 3.356   9.094   0.462   1.00 0.00 ? 83  VAL A HG13 3  
ATOM 4734  H HG21 . VAL A 1 83  ? 4.517   8.506   -2.853  1.00 0.00 ? 83  VAL A HG21 3  
ATOM 4735  H HG22 . VAL A 1 83  ? 6.141   7.880   -2.478  1.00 0.00 ? 83  VAL A HG22 3  
ATOM 4736  H HG23 . VAL A 1 83  ? 4.729   6.799   -2.392  1.00 0.00 ? 83  VAL A HG23 3  
ATOM 4737  N N    . SER A 1 84  ? 4.569   11.185  0.608   1.00 0.00 ? 84  SER A N    3  
ATOM 4738  C CA   . SER A 1 84  ? 3.895   12.471  0.619   1.00 0.00 ? 84  SER A CA   3  
ATOM 4739  C C    . SER A 1 84  ? 4.879   13.575  1.011   1.00 0.00 ? 84  SER A C    3  
ATOM 4740  O O    . SER A 1 84  ? 4.747   14.715  0.570   1.00 0.00 ? 84  SER A O    3  
ATOM 4741  C CB   . SER A 1 84  ? 2.702   12.459  1.577   1.00 0.00 ? 84  SER A CB   3  
ATOM 4742  O OG   . SER A 1 84  ? 1.847   13.582  1.379   1.00 0.00 ? 84  SER A OG   3  
ATOM 4743  H H    . SER A 1 84  ? 4.573   10.701  1.483   1.00 0.00 ? 84  SER A H    3  
ATOM 4744  H HA   . SER A 1 84  ? 3.540   12.620  -0.401  1.00 0.00 ? 84  SER A HA   3  
ATOM 4745  H HB2  . SER A 1 84  ? 2.132   11.541  1.435   1.00 0.00 ? 84  SER A HB2  3  
ATOM 4746  H HB3  . SER A 1 84  ? 3.062   12.455  2.605   1.00 0.00 ? 84  SER A HB3  3  
ATOM 4747  H HG   . SER A 1 84  ? 1.477   13.571  0.449   1.00 0.00 ? 84  SER A HG   3  
ATOM 4748  N N    . ALA A 1 85  ? 5.844   13.197  1.837   1.00 0.00 ? 85  ALA A N    3  
ATOM 4749  C CA   . ALA A 1 85  ? 6.851   14.140  2.293   1.00 0.00 ? 85  ALA A CA   3  
ATOM 4750  C C    . ALA A 1 85  ? 8.242   13.555  2.045   1.00 0.00 ? 85  ALA A C    3  
ATOM 4751  O O    . ALA A 1 85  ? 9.002   13.330  2.985   1.00 0.00 ? 85  ALA A O    3  
ATOM 4752  C CB   . ALA A 1 85  ? 6.611   14.467  3.769   1.00 0.00 ? 85  ALA A CB   3  
ATOM 4753  H H    . ALA A 1 85  ? 5.945   12.267  2.191   1.00 0.00 ? 85  ALA A H    3  
ATOM 4754  H HA   . ALA A 1 85  ? 6.739   15.053  1.709   1.00 0.00 ? 85  ALA A HA   3  
ATOM 4755  H HB1  . ALA A 1 85  ? 6.675   15.545  3.917   1.00 0.00 ? 85  ALA A HB1  3  
ATOM 4756  H HB2  . ALA A 1 85  ? 5.621   14.118  4.062   1.00 0.00 ? 85  ALA A HB2  3  
ATOM 4757  H HB3  . ALA A 1 85  ? 7.367   13.972  4.378   1.00 0.00 ? 85  ALA A HB3  3  
ATOM 4758  N N    . SER A 1 86  ? 8.534   13.326  0.773   1.00 0.00 ? 86  SER A N    3  
ATOM 4759  C CA   . SER A 1 86  ? 9.821   12.771  0.388   1.00 0.00 ? 86  SER A CA   3  
ATOM 4760  C C    . SER A 1 86  ? 9.964   12.789  -1.135  1.00 0.00 ? 86  SER A C    3  
ATOM 4761  O O    . SER A 1 86  ? 9.130   12.232  -1.847  1.00 0.00 ? 86  SER A O    3  
ATOM 4762  C CB   . SER A 1 86  ? 9.988   11.347  0.921   1.00 0.00 ? 86  SER A CB   3  
ATOM 4763  O OG   . SER A 1 86  ? 11.360  10.976  1.033   1.00 0.00 ? 86  SER A OG   3  
ATOM 4764  H H    . SER A 1 86  ? 7.910   13.512  0.013   1.00 0.00 ? 86  SER A H    3  
ATOM 4765  H HA   . SER A 1 86  ? 10.564  13.421  0.850   1.00 0.00 ? 86  SER A HA   3  
ATOM 4766  H HB2  . SER A 1 86  ? 9.510   11.266  1.897   1.00 0.00 ? 86  SER A HB2  3  
ATOM 4767  H HB3  . SER A 1 86  ? 9.477   10.649  0.257   1.00 0.00 ? 86  SER A HB3  3  
ATOM 4768  H HG   . SER A 1 86  ? 11.465  9.998   0.855   1.00 0.00 ? 86  SER A HG   3  
ATOM 4769  N N    . THR A 1 87  ? 11.028  13.434  -1.590  1.00 0.00 ? 87  THR A N    3  
ATOM 4770  C CA   . THR A 1 87  ? 11.291  13.531  -3.016  1.00 0.00 ? 87  THR A CA   3  
ATOM 4771  C C    . THR A 1 87  ? 12.153  12.355  -3.480  1.00 0.00 ? 87  THR A C    3  
ATOM 4772  O O    . THR A 1 87  ? 13.108  12.540  -4.233  1.00 0.00 ? 87  THR A O    3  
ATOM 4773  C CB   . THR A 1 87  ? 11.929  14.896  -3.287  1.00 0.00 ? 87  THR A CB   3  
ATOM 4774  O OG1  . THR A 1 87  ? 13.078  14.915  -2.445  1.00 0.00 ? 87  THR A OG1  3  
ATOM 4775  C CG2  . THR A 1 87  ? 11.072  16.055  -2.774  1.00 0.00 ? 87  THR A CG2  3  
ATOM 4776  H H    . THR A 1 87  ? 11.702  13.884  -1.004  1.00 0.00 ? 87  THR A H    3  
ATOM 4777  H HA   . THR A 1 87  ? 10.342  13.461  -3.546  1.00 0.00 ? 87  THR A HA   3  
ATOM 4778  H HB   . THR A 1 87  ? 12.153  15.017  -4.347  1.00 0.00 ? 87  THR A HB   3  
ATOM 4779  H HG1  . THR A 1 87  ? 13.893  15.130  -2.984  1.00 0.00 ? 87  THR A HG1  3  
ATOM 4780  H HG21 . THR A 1 87  ? 11.675  16.961  -2.731  1.00 0.00 ? 87  THR A HG21 3  
ATOM 4781  H HG22 . THR A 1 87  ? 10.229  16.210  -3.448  1.00 0.00 ? 87  THR A HG22 3  
ATOM 4782  H HG23 . THR A 1 87  ? 10.700  15.818  -1.777  1.00 0.00 ? 87  THR A HG23 3  
ATOM 4783  N N    . LYS A 1 88  ? 11.783  11.172  -3.013  1.00 0.00 ? 88  LYS A N    3  
ATOM 4784  C CA   . LYS A 1 88  ? 12.510  9.966   -3.371  1.00 0.00 ? 88  LYS A CA   3  
ATOM 4785  C C    . LYS A 1 88  ? 11.679  9.150   -4.363  1.00 0.00 ? 88  LYS A C    3  
ATOM 4786  O O    . LYS A 1 88  ? 10.478  9.376   -4.506  1.00 0.00 ? 88  LYS A O    3  
ATOM 4787  C CB   . LYS A 1 88  ? 12.908  9.187   -2.116  1.00 0.00 ? 88  LYS A CB   3  
ATOM 4788  C CG   . LYS A 1 88  ? 13.843  10.013  -1.231  1.00 0.00 ? 88  LYS A CG   3  
ATOM 4789  C CD   . LYS A 1 88  ? 15.069  9.197   -0.816  1.00 0.00 ? 88  LYS A CD   3  
ATOM 4790  C CE   . LYS A 1 88  ? 15.010  8.838   0.670   1.00 0.00 ? 88  LYS A CE   3  
ATOM 4791  N NZ   . LYS A 1 88  ? 16.365  8.875   1.266   1.00 0.00 ? 88  LYS A NZ   3  
ATOM 4792  H H    . LYS A 1 88  ? 11.005  11.030  -2.401  1.00 0.00 ? 88  LYS A H    3  
ATOM 4793  H HA   . LYS A 1 88  ? 13.432  10.274  -3.865  1.00 0.00 ? 88  LYS A HA   3  
ATOM 4794  H HB2  . LYS A 1 88  ? 12.014  8.916   -1.553  1.00 0.00 ? 88  LYS A HB2  3  
ATOM 4795  H HB3  . LYS A 1 88  ? 13.399  8.256   -2.401  1.00 0.00 ? 88  LYS A HB3  3  
ATOM 4796  H HG2  . LYS A 1 88  ? 14.162  10.907  -1.768  1.00 0.00 ? 88  LYS A HG2  3  
ATOM 4797  H HG3  . LYS A 1 88  ? 13.307  10.349  -0.343  1.00 0.00 ? 88  LYS A HG3  3  
ATOM 4798  H HD2  . LYS A 1 88  ? 15.122  8.286   -1.412  1.00 0.00 ? 88  LYS A HD2  3  
ATOM 4799  H HD3  . LYS A 1 88  ? 15.975  9.766   -1.021  1.00 0.00 ? 88  LYS A HD3  3  
ATOM 4800  H HE2  . LYS A 1 88  ? 14.357  9.535   1.194   1.00 0.00 ? 88  LYS A HE2  3  
ATOM 4801  H HE3  . LYS A 1 88  ? 14.580  7.844   0.793   1.00 0.00 ? 88  LYS A HE3  3  
ATOM 4802  H HZ1  . LYS A 1 88  ? 16.610  9.822   1.475   1.00 0.00 ? 88  LYS A HZ1  3  
ATOM 4803  H HZ2  . LYS A 1 88  ? 16.374  8.335   2.107   1.00 0.00 ? 88  LYS A HZ2  3  
ATOM 4804  H HZ3  . LYS A 1 88  ? 17.025  8.495   0.618   1.00 0.00 ? 88  LYS A HZ3  3  
ATOM 4805  N N    . SER A 1 89  ? 12.350  8.218   -5.024  1.00 0.00 ? 89  SER A N    3  
ATOM 4806  C CA   . SER A 1 89  ? 11.688  7.368   -5.998  1.00 0.00 ? 89  SER A CA   3  
ATOM 4807  C C    . SER A 1 89  ? 10.885  6.280   -5.283  1.00 0.00 ? 89  SER A C    3  
ATOM 4808  O O    . SER A 1 89  ? 11.328  5.741   -4.271  1.00 0.00 ? 89  SER A O    3  
ATOM 4809  C CB   . SER A 1 89  ? 12.701  6.737   -6.956  1.00 0.00 ? 89  SER A CB   3  
ATOM 4810  O OG   . SER A 1 89  ? 13.583  7.706   -7.516  1.00 0.00 ? 89  SER A OG   3  
ATOM 4811  H H    . SER A 1 89  ? 13.327  8.041   -4.902  1.00 0.00 ? 89  SER A H    3  
ATOM 4812  H HA   . SER A 1 89  ? 11.025  8.030   -6.556  1.00 0.00 ? 89  SER A HA   3  
ATOM 4813  H HB2  . SER A 1 89  ? 13.281  5.982   -6.425  1.00 0.00 ? 89  SER A HB2  3  
ATOM 4814  H HB3  . SER A 1 89  ? 12.170  6.224   -7.759  1.00 0.00 ? 89  SER A HB3  3  
ATOM 4815  H HG   . SER A 1 89  ? 13.923  8.313   -6.798  1.00 0.00 ? 89  SER A HG   3  
ATOM 4816  N N    . LEU A 1 90  ? 9.717   5.990   -5.839  1.00 0.00 ? 90  LEU A N    3  
ATOM 4817  C CA   . LEU A 1 90  ? 8.848   4.976   -5.267  1.00 0.00 ? 90  LEU A CA   3  
ATOM 4818  C C    . LEU A 1 90  ? 9.679   3.744   -4.904  1.00 0.00 ? 90  LEU A C    3  
ATOM 4819  O O    . LEU A 1 90  ? 9.727   3.344   -3.741  1.00 0.00 ? 90  LEU A O    3  
ATOM 4820  C CB   . LEU A 1 90  ? 7.682   4.675   -6.211  1.00 0.00 ? 90  LEU A CB   3  
ATOM 4821  C CG   . LEU A 1 90  ? 6.374   5.413   -5.918  1.00 0.00 ? 90  LEU A CG   3  
ATOM 4822  C CD1  . LEU A 1 90  ? 5.882   5.115   -4.500  1.00 0.00 ? 90  LEU A CD1  3  
ATOM 4823  C CD2  . LEU A 1 90  ? 6.523   6.915   -6.169  1.00 0.00 ? 90  LEU A CD2  3  
ATOM 4824  H H    . LEU A 1 90  ? 9.364   6.433   -6.663  1.00 0.00 ? 90  LEU A H    3  
ATOM 4825  H HA   . LEU A 1 90  ? 8.423   5.388   -4.352  1.00 0.00 ? 90  LEU A HA   3  
ATOM 4826  H HB2  . LEU A 1 90  ? 7.992   4.917   -7.228  1.00 0.00 ? 90  LEU A HB2  3  
ATOM 4827  H HB3  . LEU A 1 90  ? 7.486   3.603   -6.184  1.00 0.00 ? 90  LEU A HB3  3  
ATOM 4828  H HG   . LEU A 1 90  ? 5.613   5.045   -6.606  1.00 0.00 ? 90  LEU A HG   3  
ATOM 4829  H HD11 . LEU A 1 90  ? 6.648   4.558   -3.960  1.00 0.00 ? 90  LEU A HD11 3  
ATOM 4830  H HD12 . LEU A 1 90  ? 5.681   6.052   -3.981  1.00 0.00 ? 90  LEU A HD12 3  
ATOM 4831  H HD13 . LEU A 1 90  ? 4.968   4.523   -4.549  1.00 0.00 ? 90  LEU A HD13 3  
ATOM 4832  H HD21 . LEU A 1 90  ? 7.004   7.381   -5.309  1.00 0.00 ? 90  LEU A HD21 3  
ATOM 4833  H HD22 . LEU A 1 90  ? 7.133   7.075   -7.058  1.00 0.00 ? 90  LEU A HD22 3  
ATOM 4834  H HD23 . LEU A 1 90  ? 5.538   7.357   -6.319  1.00 0.00 ? 90  LEU A HD23 3  
ATOM 4835  N N    . GLN A 1 91  ? 10.311  3.176   -5.920  1.00 0.00 ? 91  GLN A N    3  
ATOM 4836  C CA   . GLN A 1 91  ? 11.138  1.997   -5.722  1.00 0.00 ? 91  GLN A CA   3  
ATOM 4837  C C    . GLN A 1 91  ? 11.926  2.114   -4.416  1.00 0.00 ? 91  GLN A C    3  
ATOM 4838  O O    . GLN A 1 91  ? 11.944  1.184   -3.612  1.00 0.00 ? 91  GLN A O    3  
ATOM 4839  C CB   . GLN A 1 91  ? 12.076  1.779   -6.911  1.00 0.00 ? 91  GLN A CB   3  
ATOM 4840  C CG   . GLN A 1 91  ? 11.779  0.449   -7.607  1.00 0.00 ? 91  GLN A CG   3  
ATOM 4841  C CD   . GLN A 1 91  ? 12.139  -0.733  -6.705  1.00 0.00 ? 91  GLN A CD   3  
ATOM 4842  O OE1  . GLN A 1 91  ? 11.386  -1.133  -5.832  1.00 0.00 ? 91  GLN A OE1  3  
ATOM 4843  N NE2  . GLN A 1 91  ? 13.328  -1.269  -6.964  1.00 0.00 ? 91  GLN A NE2  3  
ATOM 4844  H H    . GLN A 1 91  ? 10.266  3.507   -6.862  1.00 0.00 ? 91  GLN A H    3  
ATOM 4845  H HA   . GLN A 1 91  ? 10.440  1.161   -5.659  1.00 0.00 ? 91  GLN A HA   3  
ATOM 4846  H HB2  . GLN A 1 91  ? 11.964  2.598   -7.621  1.00 0.00 ? 91  GLN A HB2  3  
ATOM 4847  H HB3  . GLN A 1 91  ? 13.111  1.792   -6.569  1.00 0.00 ? 91  GLN A HB3  3  
ATOM 4848  H HG2  . GLN A 1 91  ? 10.724  0.401   -7.872  1.00 0.00 ? 91  GLN A HG2  3  
ATOM 4849  H HG3  . GLN A 1 91  ? 12.345  0.387   -8.536  1.00 0.00 ? 91  GLN A HG3  3  
ATOM 4850  H HE21 . GLN A 1 91  ? 13.897  -0.894  -7.695  1.00 0.00 ? 91  GLN A HE21 3  
ATOM 4851  H HE22 . GLN A 1 91  ? 13.653  -2.048  -6.427  1.00 0.00 ? 91  GLN A HE22 3  
ATOM 4852  N N    . GLU A 1 92  ? 12.559  3.266   -4.245  1.00 0.00 ? 92  GLU A N    3  
ATOM 4853  C CA   . GLU A 1 92  ? 13.346  3.517   -3.050  1.00 0.00 ? 92  GLU A CA   3  
ATOM 4854  C C    . GLU A 1 92  ? 12.436  3.609   -1.824  1.00 0.00 ? 92  GLU A C    3  
ATOM 4855  O O    . GLU A 1 92  ? 12.607  2.860   -0.863  1.00 0.00 ? 92  GLU A O    3  
ATOM 4856  C CB   . GLU A 1 92  ? 14.188  4.785   -3.205  1.00 0.00 ? 92  GLU A CB   3  
ATOM 4857  C CG   . GLU A 1 92  ? 15.257  4.606   -4.285  1.00 0.00 ? 92  GLU A CG   3  
ATOM 4858  C CD   . GLU A 1 92  ? 16.557  4.066   -3.685  1.00 0.00 ? 92  GLU A CD   3  
ATOM 4859  O OE1  . GLU A 1 92  ? 16.451  3.239   -2.753  1.00 0.00 ? 92  GLU A OE1  3  
ATOM 4860  O OE2  . GLU A 1 92  ? 17.626  4.491   -4.171  1.00 0.00 ? 92  GLU A OE2  3  
ATOM 4861  H H    . GLU A 1 92  ? 12.539  4.018   -4.904  1.00 0.00 ? 92  GLU A H    3  
ATOM 4862  H HA   . GLU A 1 92  ? 14.010  2.658   -2.955  1.00 0.00 ? 92  GLU A HA   3  
ATOM 4863  H HB2  . GLU A 1 92  ? 13.542  5.625   -3.463  1.00 0.00 ? 92  GLU A HB2  3  
ATOM 4864  H HB3  . GLU A 1 92  ? 14.663  5.029   -2.255  1.00 0.00 ? 92  GLU A HB3  3  
ATOM 4865  H HG2  . GLU A 1 92  ? 14.894  3.921   -5.051  1.00 0.00 ? 92  GLU A HG2  3  
ATOM 4866  H HG3  . GLU A 1 92  ? 15.448  5.561   -4.774  1.00 0.00 ? 92  GLU A HG3  3  
ATOM 4867  N N    . LEU A 1 93  ? 11.490  4.533   -1.897  1.00 0.00 ? 93  LEU A N    3  
ATOM 4868  C CA   . LEU A 1 93  ? 10.552  4.732   -0.805  1.00 0.00 ? 93  LEU A CA   3  
ATOM 4869  C C    . LEU A 1 93  ? 10.069  3.371   -0.299  1.00 0.00 ? 93  LEU A C    3  
ATOM 4870  O O    . LEU A 1 93  ? 10.101  3.105   0.902   1.00 0.00 ? 93  LEU A O    3  
ATOM 4871  C CB   . LEU A 1 93  ? 9.420   5.666   -1.234  1.00 0.00 ? 93  LEU A CB   3  
ATOM 4872  C CG   . LEU A 1 93  ? 9.769   7.154   -1.308  1.00 0.00 ? 93  LEU A CG   3  
ATOM 4873  C CD1  . LEU A 1 93  ? 8.541   7.988   -1.678  1.00 0.00 ? 93  LEU A CD1  3  
ATOM 4874  C CD2  . LEU A 1 93  ? 10.415  7.631   -0.006  1.00 0.00 ? 93  LEU A CD2  3  
ATOM 4875  H H    . LEU A 1 93  ? 11.358  5.137   -2.682  1.00 0.00 ? 93  LEU A H    3  
ATOM 4876  H HA   . LEU A 1 93  ? 11.092  5.229   0.002   1.00 0.00 ? 93  LEU A HA   3  
ATOM 4877  H HB2  . LEU A 1 93  ? 9.064   5.348   -2.214  1.00 0.00 ? 93  LEU A HB2  3  
ATOM 4878  H HB3  . LEU A 1 93  ? 8.590   5.542   -0.539  1.00 0.00 ? 93  LEU A HB3  3  
ATOM 4879  H HG   . LEU A 1 93  ? 10.503  7.294   -2.101  1.00 0.00 ? 93  LEU A HG   3  
ATOM 4880  H HD11 . LEU A 1 93  ? 8.672   9.008   -1.317  1.00 0.00 ? 93  LEU A HD11 3  
ATOM 4881  H HD12 . LEU A 1 93  ? 8.421   7.998   -2.761  1.00 0.00 ? 93  LEU A HD12 3  
ATOM 4882  H HD13 . LEU A 1 93  ? 7.654   7.552   -1.218  1.00 0.00 ? 93  LEU A HD13 3  
ATOM 4883  H HD21 . LEU A 1 93  ? 10.068  8.639   0.224   1.00 0.00 ? 93  LEU A HD21 3  
ATOM 4884  H HD22 . LEU A 1 93  ? 10.137  6.958   0.805   1.00 0.00 ? 93  LEU A HD22 3  
ATOM 4885  H HD23 . LEU A 1 93  ? 11.499  7.636   -0.118  1.00 0.00 ? 93  LEU A HD23 3  
ATOM 4886  N N    . PHE A 1 94  ? 9.633   2.547   -1.239  1.00 0.00 ? 94  PHE A N    3  
ATOM 4887  C CA   . PHE A 1 94  ? 9.143   1.221   -0.904  1.00 0.00 ? 94  PHE A CA   3  
ATOM 4888  C C    . PHE A 1 94  ? 10.158  0.462   -0.047  1.00 0.00 ? 94  PHE A C    3  
ATOM 4889  O O    . PHE A 1 94  ? 9.830   -0.005  1.043   1.00 0.00 ? 94  PHE A O    3  
ATOM 4890  C CB   . PHE A 1 94  ? 8.945   0.470   -2.222  1.00 0.00 ? 94  PHE A CB   3  
ATOM 4891  C CG   . PHE A 1 94  ? 7.888   1.090   -3.138  1.00 0.00 ? 94  PHE A CG   3  
ATOM 4892  C CD1  . PHE A 1 94  ? 6.866   1.813   -2.606  1.00 0.00 ? 94  PHE A CD1  3  
ATOM 4893  C CD2  . PHE A 1 94  ? 7.969   0.918   -4.485  1.00 0.00 ? 94  PHE A CD2  3  
ATOM 4894  C CE1  . PHE A 1 94  ? 5.885   2.389   -3.456  1.00 0.00 ? 94  PHE A CE1  3  
ATOM 4895  C CE2  . PHE A 1 94  ? 6.988   1.493   -5.335  1.00 0.00 ? 94  PHE A CE2  3  
ATOM 4896  C CZ   . PHE A 1 94  ? 5.967   2.216   -4.803  1.00 0.00 ? 94  PHE A CZ   3  
ATOM 4897  H H    . PHE A 1 94  ? 9.610   2.772   -2.213  1.00 0.00 ? 94  PHE A H    3  
ATOM 4898  H HA   . PHE A 1 94  ? 8.219   1.350   -0.340  1.00 0.00 ? 94  PHE A HA   3  
ATOM 4899  H HB2  . PHE A 1 94  ? 9.895   0.434   -2.754  1.00 0.00 ? 94  PHE A HB2  3  
ATOM 4900  H HB3  . PHE A 1 94  ? 8.662   -0.560  -2.004  1.00 0.00 ? 94  PHE A HB3  3  
ATOM 4901  H HD1  . PHE A 1 94  ? 6.801   1.951   -1.527  1.00 0.00 ? 94  PHE A HD1  3  
ATOM 4902  H HD2  . PHE A 1 94  ? 8.788   0.338   -4.912  1.00 0.00 ? 94  PHE A HD2  3  
ATOM 4903  H HE1  . PHE A 1 94  ? 5.067   2.968   -3.030  1.00 0.00 ? 94  PHE A HE1  3  
ATOM 4904  H HE2  . PHE A 1 94  ? 7.054   1.355   -6.414  1.00 0.00 ? 94  PHE A HE2  3  
ATOM 4905  H HZ   . PHE A 1 94  ? 5.214   2.658   -5.455  1.00 0.00 ? 94  PHE A HZ   3  
ATOM 4906  N N    . LEU A 1 95  ? 11.371  0.363   -0.571  1.00 0.00 ? 95  LEU A N    3  
ATOM 4907  C CA   . LEU A 1 95  ? 12.436  -0.331  0.132   1.00 0.00 ? 95  LEU A CA   3  
ATOM 4908  C C    . LEU A 1 95  ? 12.731  0.395   1.446   1.00 0.00 ? 95  LEU A C    3  
ATOM 4909  O O    . LEU A 1 95  ? 13.182  -0.219  2.412   1.00 0.00 ? 95  LEU A O    3  
ATOM 4910  C CB   . LEU A 1 95  ? 13.661  -0.489  -0.771  1.00 0.00 ? 95  LEU A CB   3  
ATOM 4911  C CG   . LEU A 1 95  ? 13.710  -1.763  -1.618  1.00 0.00 ? 95  LEU A CG   3  
ATOM 4912  C CD1  . LEU A 1 95  ? 14.296  -1.479  -3.002  1.00 0.00 ? 95  LEU A CD1  3  
ATOM 4913  C CD2  . LEU A 1 95  ? 14.468  -2.875  -0.892  1.00 0.00 ? 95  LEU A CD2  3  
ATOM 4914  H H    . LEU A 1 95  ? 11.629  0.745   -1.458  1.00 0.00 ? 95  LEU A H    3  
ATOM 4915  H HA   . LEU A 1 95  ? 12.076  -1.333  0.365   1.00 0.00 ? 95  LEU A HA   3  
ATOM 4916  H HB2  . LEU A 1 95  ? 13.707  0.370   -1.440  1.00 0.00 ? 95  LEU A HB2  3  
ATOM 4917  H HB3  . LEU A 1 95  ? 14.554  -0.457  -0.148  1.00 0.00 ? 95  LEU A HB3  3  
ATOM 4918  H HG   . LEU A 1 95  ? 12.688  -2.113  -1.767  1.00 0.00 ? 95  LEU A HG   3  
ATOM 4919  H HD11 . LEU A 1 95  ? 14.029  -2.287  -3.683  1.00 0.00 ? 95  LEU A HD11 3  
ATOM 4920  H HD12 . LEU A 1 95  ? 13.895  -0.538  -3.381  1.00 0.00 ? 95  LEU A HD12 3  
ATOM 4921  H HD13 . LEU A 1 95  ? 15.381  -1.408  -2.930  1.00 0.00 ? 95  LEU A HD13 3  
ATOM 4922  H HD21 . LEU A 1 95  ? 14.199  -3.840  -1.323  1.00 0.00 ? 95  LEU A HD21 3  
ATOM 4923  H HD22 . LEU A 1 95  ? 15.541  -2.715  -1.000  1.00 0.00 ? 95  LEU A HD22 3  
ATOM 4924  H HD23 . LEU A 1 95  ? 14.204  -2.864  0.166   1.00 0.00 ? 95  LEU A HD23 3  
ATOM 4925  N N    . ALA A 1 96  ? 12.465  1.693   1.440   1.00 0.00 ? 96  ALA A N    3  
ATOM 4926  C CA   . ALA A 1 96  ? 12.697  2.510   2.620   1.00 0.00 ? 96  ALA A CA   3  
ATOM 4927  C C    . ALA A 1 96  ? 11.564  2.282   3.623   1.00 0.00 ? 96  ALA A C    3  
ATOM 4928  O O    . ALA A 1 96  ? 11.653  2.709   4.773   1.00 0.00 ? 96  ALA A O    3  
ATOM 4929  C CB   . ALA A 1 96  ? 12.824  3.978   2.208   1.00 0.00 ? 96  ALA A CB   3  
ATOM 4930  H H    . ALA A 1 96  ? 12.099  2.186   0.651   1.00 0.00 ? 96  ALA A H    3  
ATOM 4931  H HA   . ALA A 1 96  ? 13.637  2.188   3.067   1.00 0.00 ? 96  ALA A HA   3  
ATOM 4932  H HB1  . ALA A 1 96  ? 13.878  4.254   2.170   1.00 0.00 ? 96  ALA A HB1  3  
ATOM 4933  H HB2  . ALA A 1 96  ? 12.376  4.119   1.224   1.00 0.00 ? 96  ALA A HB2  3  
ATOM 4934  H HB3  . ALA A 1 96  ? 12.309  4.605   2.935   1.00 0.00 ? 96  ALA A HB3  3  
ATOM 4935  N N    . HIS A 1 97  ? 10.525  1.610   3.150   1.00 0.00 ? 97  HIS A N    3  
ATOM 4936  C CA   . HIS A 1 97  ? 9.376   1.320   3.991   1.00 0.00 ? 97  HIS A CA   3  
ATOM 4937  C C    . HIS A 1 97  ? 8.770   -0.026  3.588   1.00 0.00 ? 97  HIS A C    3  
ATOM 4938  O O    . HIS A 1 97  ? 7.550   -0.171  3.535   1.00 0.00 ? 97  HIS A O    3  
ATOM 4939  C CB   . HIS A 1 97  ? 8.362   2.465   3.940   1.00 0.00 ? 97  HIS A CB   3  
ATOM 4940  C CG   . HIS A 1 97  ? 8.960   3.827   4.203   1.00 0.00 ? 97  HIS A CG   3  
ATOM 4941  N ND1  . HIS A 1 97  ? 9.310   4.260   5.470   1.00 0.00 ? 97  HIS A ND1  3  
ATOM 4942  C CD2  . HIS A 1 97  ? 9.267   4.845   3.349   1.00 0.00 ? 97  HIS A CD2  3  
ATOM 4943  C CE1  . HIS A 1 97  ? 9.803   5.486   5.371   1.00 0.00 ? 97  HIS A CE1  3  
ATOM 4944  N NE2  . HIS A 1 97  ? 9.775   5.847   4.056   1.00 0.00 ? 97  HIS A NE2  3  
ATOM 4945  H H    . HIS A 1 97  ? 10.460  1.266   2.213   1.00 0.00 ? 97  HIS A H    3  
ATOM 4946  H HA   . HIS A 1 97  ? 9.746   1.250   5.014   1.00 0.00 ? 97  HIS A HA   3  
ATOM 4947  H HB2  . HIS A 1 97  ? 7.886   2.472   2.960   1.00 0.00 ? 97  HIS A HB2  3  
ATOM 4948  H HB3  . HIS A 1 97  ? 7.579   2.276   4.674   1.00 0.00 ? 97  HIS A HB3  3  
ATOM 4949  H HD1  . HIS A 1 97  ? 9.208   3.737   6.316   1.00 0.00 ? 97  HIS A HD1  3  
ATOM 4950  H HD2  . HIS A 1 97  ? 9.120   4.837   2.269   1.00 0.00 ? 97  HIS A HD2  3  
ATOM 4951  H HE1  . HIS A 1 97  ? 10.168  6.098   6.196   1.00 0.00 ? 97  HIS A HE1  3  
ATOM 4952  N N    . ILE A 1 98  ? 9.652   -0.976  3.313   1.00 0.00 ? 98  ILE A N    3  
ATOM 4953  C CA   . ILE A 1 98  ? 9.220   -2.305  2.916   1.00 0.00 ? 98  ILE A CA   3  
ATOM 4954  C C    . ILE A 1 98  ? 9.071   -3.182  4.161   1.00 0.00 ? 98  ILE A C    3  
ATOM 4955  O O    . ILE A 1 98  ? 10.027  -3.366  4.913   1.00 0.00 ? 98  ILE A O    3  
ATOM 4956  C CB   . ILE A 1 98  ? 10.168  -2.886  1.865   1.00 0.00 ? 98  ILE A CB   3  
ATOM 4957  C CG1  . ILE A 1 98  ? 9.557   -4.117  1.194   1.00 0.00 ? 98  ILE A CG1  3  
ATOM 4958  C CG2  . ILE A 1 98  ? 11.541  -3.185  2.471   1.00 0.00 ? 98  ILE A CG2  3  
ATOM 4959  C CD1  . ILE A 1 98  ? 9.195   -3.824  -0.263  1.00 0.00 ? 98  ILE A CD1  3  
ATOM 4960  H H    . ILE A 1 98  ? 10.643  -0.850  3.359   1.00 0.00 ? 98  ILE A H    3  
ATOM 4961  H HA   . ILE A 1 98  ? 8.241   -2.204  2.446   1.00 0.00 ? 98  ILE A HA   3  
ATOM 4962  H HB   . ILE A 1 98  ? 10.317  -2.136  1.088   1.00 0.00 ? 98  ILE A HB   3  
ATOM 4963  H HG12 . ILE A 1 98  ? 10.261  -4.947  1.238   1.00 0.00 ? 98  ILE A HG12 3  
ATOM 4964  H HG13 . ILE A 1 98  ? 8.665   -4.427  1.739   1.00 0.00 ? 98  ILE A HG13 3  
ATOM 4965  H HG21 . ILE A 1 98  ? 12.291  -3.207  1.681   1.00 0.00 ? 98  ILE A HG21 3  
ATOM 4966  H HG22 . ILE A 1 98  ? 11.796  -2.410  3.194   1.00 0.00 ? 98  ILE A HG22 3  
ATOM 4967  H HG23 . ILE A 1 98  ? 11.513  -4.153  2.972   1.00 0.00 ? 98  ILE A HG23 3  
ATOM 4968  H HD11 . ILE A 1 98  ? 10.080  -3.472  -0.794  1.00 0.00 ? 98  ILE A HD11 3  
ATOM 4969  H HD12 . ILE A 1 98  ? 8.827   -4.735  -0.736  1.00 0.00 ? 98  ILE A HD12 3  
ATOM 4970  H HD13 . ILE A 1 98  ? 8.420   -3.058  -0.299  1.00 0.00 ? 98  ILE A HD13 3  
ATOM 4971  N N    . LEU A 1 99  ? 7.865   -3.700  4.340   1.00 0.00 ? 99  LEU A N    3  
ATOM 4972  C CA   . LEU A 1 99  ? 7.579   -4.553  5.481   1.00 0.00 ? 99  LEU A CA   3  
ATOM 4973  C C    . LEU A 1 99  ? 7.757   -6.017  5.075   1.00 0.00 ? 99  LEU A C    3  
ATOM 4974  O O    . LEU A 1 99  ? 8.084   -6.861  5.909   1.00 0.00 ? 99  LEU A O    3  
ATOM 4975  C CB   . LEU A 1 99  ? 6.195   -4.237  6.053   1.00 0.00 ? 99  LEU A CB   3  
ATOM 4976  C CG   . LEU A 1 99  ? 6.051   -2.885  6.754   1.00 0.00 ? 99  LEU A CG   3  
ATOM 4977  C CD1  . LEU A 1 99  ? 4.722   -2.795  7.505   1.00 0.00 ? 99  LEU A CD1  3  
ATOM 4978  C CD2  . LEU A 1 99  ? 7.247   -2.612  7.669   1.00 0.00 ? 99  LEU A CD2  3  
ATOM 4979  H H    . LEU A 1 99  ? 7.093   -3.546  3.724   1.00 0.00 ? 99  LEU A H    3  
ATOM 4980  H HA   . LEU A 1 99  ? 8.309   -4.318  6.256   1.00 0.00 ? 99  LEU A HA   3  
ATOM 4981  H HB2  . LEU A 1 99  ? 5.469   -4.282  5.241   1.00 0.00 ? 99  LEU A HB2  3  
ATOM 4982  H HB3  . LEU A 1 99  ? 5.929   -5.021  6.761   1.00 0.00 ? 99  LEU A HB3  3  
ATOM 4983  H HG   . LEU A 1 99  ? 6.044   -2.105  5.993   1.00 0.00 ? 99  LEU A HG   3  
ATOM 4984  H HD11 . LEU A 1 99  ? 4.892   -2.975  8.567   1.00 0.00 ? 99  LEU A HD11 3  
ATOM 4985  H HD12 . LEU A 1 99  ? 4.293   -1.802  7.369   1.00 0.00 ? 99  LEU A HD12 3  
ATOM 4986  H HD13 . LEU A 1 99  ? 4.033   -3.545  7.116   1.00 0.00 ? 99  LEU A HD13 3  
ATOM 4987  H HD21 . LEU A 1 99  ? 8.148   -2.502  7.066   1.00 0.00 ? 99  LEU A HD21 3  
ATOM 4988  H HD22 . LEU A 1 99  ? 7.072   -1.695  8.232   1.00 0.00 ? 99  LEU A HD22 3  
ATOM 4989  H HD23 . LEU A 1 99  ? 7.372   -3.445  8.361   1.00 0.00 ? 99  LEU A HD23 3  
ATOM 4990  N N    . SER A 1 100 ? 7.533   -6.275  3.795   1.00 0.00 ? 100 SER A N    3  
ATOM 4991  C CA   . SER A 1 100 ? 7.665   -7.622  3.268   1.00 0.00 ? 100 SER A CA   3  
ATOM 4992  C C    . SER A 1 100 ? 8.988   -7.762  2.513   1.00 0.00 ? 100 SER A C    3  
ATOM 4993  O O    . SER A 1 100 ? 9.735   -6.794  2.378   1.00 0.00 ? 100 SER A O    3  
ATOM 4994  C CB   . SER A 1 100 ? 6.491   -7.973  2.352   1.00 0.00 ? 100 SER A CB   3  
ATOM 4995  O OG   . SER A 1 100 ? 6.223   -6.938  1.409   1.00 0.00 ? 100 SER A OG   3  
ATOM 4996  H H    . SER A 1 100 ? 7.267   -5.583  3.124   1.00 0.00 ? 100 SER A H    3  
ATOM 4997  H HA   . SER A 1 100 ? 7.651   -8.276  4.141   1.00 0.00 ? 100 SER A HA   3  
ATOM 4998  H HB2  . SER A 1 100 ? 6.710   -8.899  1.821   1.00 0.00 ? 100 SER A HB2  3  
ATOM 4999  H HB3  . SER A 1 100 ? 5.602   -8.153  2.955   1.00 0.00 ? 100 SER A HB3  3  
ATOM 5000  H HG   . SER A 1 100 ? 7.041   -6.752  0.863   1.00 0.00 ? 100 SER A HG   3  
ATOM 5001  N N    . SER A 1 101 ? 9.239   -8.975  2.042   1.00 0.00 ? 101 SER A N    3  
ATOM 5002  C CA   . SER A 1 101 ? 10.459  -9.254  1.304   1.00 0.00 ? 101 SER A CA   3  
ATOM 5003  C C    . SER A 1 101 ? 10.140  -9.452  -0.179  1.00 0.00 ? 101 SER A C    3  
ATOM 5004  O O    . SER A 1 101 ? 11.038  -9.427  -1.020  1.00 0.00 ? 101 SER A O    3  
ATOM 5005  C CB   . SER A 1 101 ? 11.171  -10.487 1.863   1.00 0.00 ? 101 SER A CB   3  
ATOM 5006  O OG   . SER A 1 101 ? 12.533  -10.216 2.186   1.00 0.00 ? 101 SER A OG   3  
ATOM 5007  H H    . SER A 1 101 ? 8.626   -9.757  2.156   1.00 0.00 ? 101 SER A H    3  
ATOM 5008  H HA   . SER A 1 101 ? 11.089  -8.376  1.445   1.00 0.00 ? 101 SER A HA   3  
ATOM 5009  H HB2  . SER A 1 101 ? 10.649  -10.833 2.755   1.00 0.00 ? 101 SER A HB2  3  
ATOM 5010  H HB3  . SER A 1 101 ? 11.125  -11.294 1.133   1.00 0.00 ? 101 SER A HB3  3  
ATOM 5011  H HG   . SER A 1 101 ? 13.003  -9.831  1.392   1.00 0.00 ? 101 SER A HG   3  
ATOM 5012  N N    . TRP A 1 102 ? 8.859   -9.646  -0.455  1.00 0.00 ? 102 TRP A N    3  
ATOM 5013  C CA   . TRP A 1 102 ? 8.410   -9.849  -1.822  1.00 0.00 ? 102 TRP A CA   3  
ATOM 5014  C C    . TRP A 1 102 ? 7.969   -8.495  -2.381  1.00 0.00 ? 102 TRP A C    3  
ATOM 5015  O O    . TRP A 1 102 ? 8.219   -7.456  -1.771  1.00 0.00 ? 102 TRP A O    3  
ATOM 5016  C CB   . TRP A 1 102 ? 7.309   -10.909 -1.886  1.00 0.00 ? 102 TRP A CB   3  
ATOM 5017  C CG   . TRP A 1 102 ? 5.945   -10.421 -1.394  1.00 0.00 ? 102 TRP A CG   3  
ATOM 5018  C CD1  . TRP A 1 102 ? 5.002   -9.771  -2.090  1.00 0.00 ? 102 TRP A CD1  3  
ATOM 5019  C CD2  . TRP A 1 102 ? 5.407   -10.571 -0.064  1.00 0.00 ? 102 TRP A CD2  3  
ATOM 5020  N NE1  . TRP A 1 102 ? 3.899   -9.492  -1.307  1.00 0.00 ? 102 TRP A NE1  3  
ATOM 5021  C CE2  . TRP A 1 102 ? 4.154   -9.994  -0.036  1.00 0.00 ? 102 TRP A CE2  3  
ATOM 5022  C CE3  . TRP A 1 102 ? 5.961   -11.174 1.079   1.00 0.00 ? 102 TRP A CE3  3  
ATOM 5023  C CZ2  . TRP A 1 102 ? 3.348   -9.963  1.108   1.00 0.00 ? 102 TRP A CZ2  3  
ATOM 5024  C CZ3  . TRP A 1 102 ? 5.143   -11.135 2.215   1.00 0.00 ? 102 TRP A CZ3  3  
ATOM 5025  C CH2  . TRP A 1 102 ? 3.880   -10.558 2.259   1.00 0.00 ? 102 TRP A CH2  3  
ATOM 5026  H H    . TRP A 1 102 ? 8.135   -9.665  0.234   1.00 0.00 ? 102 TRP A H    3  
ATOM 5027  H HA   . TRP A 1 102 ? 9.254   -10.232 -2.396  1.00 0.00 ? 102 TRP A HA   3  
ATOM 5028  H HB2  . TRP A 1 102 ? 7.210   -11.254 -2.916  1.00 0.00 ? 102 TRP A HB2  3  
ATOM 5029  H HB3  . TRP A 1 102 ? 7.612   -11.770 -1.290  1.00 0.00 ? 102 TRP A HB3  3  
ATOM 5030  H HD1  . TRP A 1 102 ? 5.094   -9.497  -3.140  1.00 0.00 ? 102 TRP A HD1  3  
ATOM 5031  H HE1  . TRP A 1 102 ? 2.996   -8.973  -1.628  1.00 0.00 ? 102 TRP A HE1  3  
ATOM 5032  H HE3  . TRP A 1 102 ? 6.948   -11.636 1.083   1.00 0.00 ? 102 TRP A HE3  3  
ATOM 5033  H HZ2  . TRP A 1 102 ? 2.361   -9.501  1.104   1.00 0.00 ? 102 TRP A HZ2  3  
ATOM 5034  H HZ3  . TRP A 1 102 ? 5.525   -11.589 3.130   1.00 0.00 ? 102 TRP A HZ3  3  
ATOM 5035  H HH2  . TRP A 1 102 ? 3.305   -10.569 3.185   1.00 0.00 ? 102 TRP A HH2  3  
ATOM 5036  N N    . GLY A 1 103 ? 7.321   -8.550  -3.535  1.00 0.00 ? 103 GLY A N    3  
ATOM 5037  C CA   . GLY A 1 103 ? 6.842   -7.340  -4.183  1.00 0.00 ? 103 GLY A CA   3  
ATOM 5038  C C    . GLY A 1 103 ? 7.782   -6.916  -5.314  1.00 0.00 ? 103 GLY A C    3  
ATOM 5039  O O    . GLY A 1 103 ? 8.387   -5.847  -5.254  1.00 0.00 ? 103 GLY A O    3  
ATOM 5040  H H    . GLY A 1 103 ? 7.121   -9.399  -4.025  1.00 0.00 ? 103 GLY A H    3  
ATOM 5041  H HA2  . GLY A 1 103 ? 5.841   -7.508  -4.581  1.00 0.00 ? 103 GLY A HA2  3  
ATOM 5042  H HA3  . GLY A 1 103 ? 6.764   -6.537  -3.450  1.00 0.00 ? 103 GLY A HA3  3  
ATOM 5043  N N    . ALA A 1 104 ? 7.874   -7.776  -6.318  1.00 0.00 ? 104 ALA A N    3  
ATOM 5044  C CA   . ALA A 1 104 ? 8.730   -7.503  -7.460  1.00 0.00 ? 104 ALA A CA   3  
ATOM 5045  C C    . ALA A 1 104 ? 8.076   -8.060  -8.726  1.00 0.00 ? 104 ALA A C    3  
ATOM 5046  O O    . ALA A 1 104 ? 6.916   -8.471  -8.701  1.00 0.00 ? 104 ALA A O    3  
ATOM 5047  C CB   . ALA A 1 104 ? 10.118  -8.097  -7.211  1.00 0.00 ? 104 ALA A CB   3  
ATOM 5048  H H    . ALA A 1 104 ? 7.379   -8.643  -6.358  1.00 0.00 ? 104 ALA A H    3  
ATOM 5049  H HA   . ALA A 1 104 ? 8.822   -6.421  -7.555  1.00 0.00 ? 104 ALA A HA   3  
ATOM 5050  H HB1  . ALA A 1 104 ? 10.611  -7.545  -6.410  1.00 0.00 ? 104 ALA A HB1  3  
ATOM 5051  H HB2  . ALA A 1 104 ? 10.019  -9.144  -6.925  1.00 0.00 ? 104 ALA A HB2  3  
ATOM 5052  H HB3  . ALA A 1 104 ? 10.713  -8.023  -8.122  1.00 0.00 ? 104 ALA A HB3  3  
ATOM 5053  N N    . GLU A 1 105 ? 8.847   -8.057  -9.803  1.00 0.00 ? 105 GLU A N    3  
ATOM 5054  C CA   . GLU A 1 105 ? 8.357   -8.557  -11.076 1.00 0.00 ? 105 GLU A CA   3  
ATOM 5055  C C    . GLU A 1 105 ? 7.675   -9.913  -10.887 1.00 0.00 ? 105 GLU A C    3  
ATOM 5056  O O    . GLU A 1 105 ? 8.088   -10.707 -10.043 1.00 0.00 ? 105 GLU A O    3  
ATOM 5057  C CB   . GLU A 1 105 ? 9.490   -8.651  -12.101 1.00 0.00 ? 105 GLU A CB   3  
ATOM 5058  C CG   . GLU A 1 105 ? 10.022  -7.262  -12.459 1.00 0.00 ? 105 GLU A CG   3  
ATOM 5059  C CD   . GLU A 1 105 ? 9.044   -6.519  -13.373 1.00 0.00 ? 105 GLU A CD   3  
ATOM 5060  O OE1  . GLU A 1 105 ? 8.124   -5.881  -12.819 1.00 0.00 ? 105 GLU A OE1  3  
ATOM 5061  O OE2  . GLU A 1 105 ? 9.240   -6.607  -14.604 1.00 0.00 ? 105 GLU A OE2  3  
ATOM 5062  H H    . GLU A 1 105 ? 9.789   -7.721  -9.815  1.00 0.00 ? 105 GLU A H    3  
ATOM 5063  H HA   . GLU A 1 105 ? 7.629   -7.820  -11.416 1.00 0.00 ? 105 GLU A HA   3  
ATOM 5064  H HB2  . GLU A 1 105 ? 10.299  -9.261  -11.699 1.00 0.00 ? 105 GLU A HB2  3  
ATOM 5065  H HB3  . GLU A 1 105 ? 9.131   -9.150  -13.001 1.00 0.00 ? 105 GLU A HB3  3  
ATOM 5066  H HG2  . GLU A 1 105 ? 10.184  -6.685  -11.549 1.00 0.00 ? 105 GLU A HG2  3  
ATOM 5067  H HG3  . GLU A 1 105 ? 10.988  -7.355  -12.954 1.00 0.00 ? 105 GLU A HG3  3  
ATOM 5068  N N    . VAL A 1 106 ? 6.643   -10.137 -11.686 1.00 0.00 ? 106 VAL A N    3  
ATOM 5069  C CA   . VAL A 1 106 ? 5.899   -11.384 -11.617 1.00 0.00 ? 106 VAL A CA   3  
ATOM 5070  C C    . VAL A 1 106 ? 4.893   -11.437 -12.769 1.00 0.00 ? 106 VAL A C    3  
ATOM 5071  O O    . VAL A 1 106 ? 4.805   -10.503 -13.564 1.00 0.00 ? 106 VAL A O    3  
ATOM 5072  C CB   . VAL A 1 106 ? 5.243   -11.526 -10.243 1.00 0.00 ? 106 VAL A CB   3  
ATOM 5073  C CG1  . VAL A 1 106 ? 3.987   -10.658 -10.142 1.00 0.00 ? 106 VAL A CG1  3  
ATOM 5074  C CG2  . VAL A 1 106 ? 4.923   -12.991 -9.937  1.00 0.00 ? 106 VAL A CG2  3  
ATOM 5075  H H    . VAL A 1 106 ? 6.313   -9.486  -12.370 1.00 0.00 ? 106 VAL A H    3  
ATOM 5076  H HA   . VAL A 1 106 ? 6.613   -12.199 -11.737 1.00 0.00 ? 106 VAL A HA   3  
ATOM 5077  H HB   . VAL A 1 106 ? 5.954   -11.176 -9.494  1.00 0.00 ? 106 VAL A HB   3  
ATOM 5078  H HG11 . VAL A 1 106 ? 3.860   -10.095 -11.067 1.00 0.00 ? 106 VAL A HG11 3  
ATOM 5079  H HG12 . VAL A 1 106 ? 3.117   -11.295 -9.982  1.00 0.00 ? 106 VAL A HG12 3  
ATOM 5080  H HG13 . VAL A 1 106 ? 4.090   -9.966  -9.306  1.00 0.00 ? 106 VAL A HG13 3  
ATOM 5081  H HG21 . VAL A 1 106 ? 5.094   -13.187 -8.878  1.00 0.00 ? 106 VAL A HG21 3  
ATOM 5082  H HG22 . VAL A 1 106 ? 3.880   -13.193 -10.181 1.00 0.00 ? 106 VAL A HG22 3  
ATOM 5083  H HG23 . VAL A 1 106 ? 5.568   -13.636 -10.534 1.00 0.00 ? 106 VAL A HG23 3  
ATOM 5084  N N    . LYS A 1 107 ? 4.160   -12.539 -12.821 1.00 0.00 ? 107 LYS A N    3  
ATOM 5085  C CA   . LYS A 1 107 ? 3.163   -12.726 -13.862 1.00 0.00 ? 107 LYS A CA   3  
ATOM 5086  C C    . LYS A 1 107 ? 1.814   -12.199 -13.370 1.00 0.00 ? 107 LYS A C    3  
ATOM 5087  O O    . LYS A 1 107 ? 0.924   -12.979 -13.033 1.00 0.00 ? 107 LYS A O    3  
ATOM 5088  C CB   . LYS A 1 107 ? 3.126   -14.188 -14.311 1.00 0.00 ? 107 LYS A CB   3  
ATOM 5089  C CG   . LYS A 1 107 ? 2.842   -14.294 -15.811 1.00 0.00 ? 107 LYS A CG   3  
ATOM 5090  C CD   . LYS A 1 107 ? 1.386   -13.940 -16.119 1.00 0.00 ? 107 LYS A CD   3  
ATOM 5091  C CE   . LYS A 1 107 ? 1.240   -13.413 -17.548 1.00 0.00 ? 107 LYS A CE   3  
ATOM 5092  N NZ   . LYS A 1 107 ? -0.141  -12.937 -17.787 1.00 0.00 ? 107 LYS A NZ   3  
ATOM 5093  H H    . LYS A 1 107 ? 4.238   -13.294 -12.170 1.00 0.00 ? 107 LYS A H    3  
ATOM 5094  H HA   . LYS A 1 107 ? 3.473   -12.132 -14.722 1.00 0.00 ? 107 LYS A HA   3  
ATOM 5095  H HB2  . LYS A 1 107 ? 4.078   -14.668 -14.083 1.00 0.00 ? 107 LYS A HB2  3  
ATOM 5096  H HB3  . LYS A 1 107 ? 2.358   -14.724 -13.753 1.00 0.00 ? 107 LYS A HB3  3  
ATOM 5097  H HG2  . LYS A 1 107 ? 3.506   -13.625 -16.358 1.00 0.00 ? 107 LYS A HG2  3  
ATOM 5098  H HG3  . LYS A 1 107 ? 3.055   -15.306 -16.155 1.00 0.00 ? 107 LYS A HG3  3  
ATOM 5099  H HD2  . LYS A 1 107 ? 0.758   -14.822 -15.988 1.00 0.00 ? 107 LYS A HD2  3  
ATOM 5100  H HD3  . LYS A 1 107 ? 1.032   -13.189 -15.413 1.00 0.00 ? 107 LYS A HD3  3  
ATOM 5101  H HE2  . LYS A 1 107 ? 1.946   -12.599 -17.715 1.00 0.00 ? 107 LYS A HE2  3  
ATOM 5102  H HE3  . LYS A 1 107 ? 1.488   -14.201 -18.260 1.00 0.00 ? 107 LYS A HE3  3  
ATOM 5103  H HZ1  . LYS A 1 107 ? -0.426  -12.348 -17.031 1.00 0.00 ? 107 LYS A HZ1  3  
ATOM 5104  H HZ2  . LYS A 1 107 ? -0.172  -12.420 -18.643 1.00 0.00 ? 107 LYS A HZ2  3  
ATOM 5105  H HZ3  . LYS A 1 107 ? -0.758  -13.722 -17.849 1.00 0.00 ? 107 LYS A HZ3  3  
ATOM 5106  N N    . SER A 1 108 ? 1.703   -10.879 -13.345 1.00 0.00 ? 108 SER A N    3  
ATOM 5107  C CA   . SER A 1 108 ? 0.477   -10.239 -12.900 1.00 0.00 ? 108 SER A CA   3  
ATOM 5108  C C    . SER A 1 108 ? -0.125  -9.413  -14.038 1.00 0.00 ? 108 SER A C    3  
ATOM 5109  O O    . SER A 1 108 ? -1.264  -9.642  -14.441 1.00 0.00 ? 108 SER A O    3  
ATOM 5110  C CB   . SER A 1 108 ? 0.730   -9.353  -11.678 1.00 0.00 ? 108 SER A CB   3  
ATOM 5111  O OG   . SER A 1 108 ? 1.799   -8.436  -11.896 1.00 0.00 ? 108 SER A OG   3  
ATOM 5112  H H    . SER A 1 108 ? 2.432   -10.252 -13.621 1.00 0.00 ? 108 SER A H    3  
ATOM 5113  H HA   . SER A 1 108 ? -0.191  -11.055 -12.624 1.00 0.00 ? 108 SER A HA   3  
ATOM 5114  H HB2  . SER A 1 108 ? -0.178  -8.801  -11.437 1.00 0.00 ? 108 SER A HB2  3  
ATOM 5115  H HB3  . SER A 1 108 ? 0.960   -9.981  -10.817 1.00 0.00 ? 108 SER A HB3  3  
ATOM 5116  H HG   . SER A 1 108 ? 2.179   -8.140  -11.020 1.00 0.00 ? 108 SER A HG   3  
ATOM 5117  N N    . GLY A 1 109 ? 0.668   -8.469  -14.526 1.00 0.00 ? 109 GLY A N    3  
ATOM 5118  C CA   . GLY A 1 109 ? 0.227   -7.608  -15.610 1.00 0.00 ? 109 GLY A CA   3  
ATOM 5119  C C    . GLY A 1 109 ? 1.278   -6.542  -15.925 1.00 0.00 ? 109 GLY A C    3  
ATOM 5120  O O    . GLY A 1 109 ? 2.181   -6.299  -15.125 1.00 0.00 ? 109 GLY A O    3  
ATOM 5121  H H    . GLY A 1 109 ? 1.593   -8.289  -14.192 1.00 0.00 ? 109 GLY A H    3  
ATOM 5122  H HA2  . GLY A 1 109 ? 0.033   -8.208  -16.499 1.00 0.00 ? 109 GLY A HA2  3  
ATOM 5123  H HA3  . GLY A 1 109 ? -0.713  -7.128  -15.338 1.00 0.00 ? 109 GLY A HA3  3  
ATOM 5124  N N    . PRO A 1 110 ? 1.123   -5.919  -17.124 1.00 0.00 ? 110 PRO A N    3  
ATOM 5125  C CA   . PRO A 1 110 ? 2.048   -4.884  -17.555 1.00 0.00 ? 110 PRO A CA   3  
ATOM 5126  C C    . PRO A 1 110 ? 1.797   -3.576  -16.802 1.00 0.00 ? 110 PRO A C    3  
ATOM 5127  O O    . PRO A 1 110 ? 2.737   -2.934  -16.335 1.00 0.00 ? 110 PRO A O    3  
ATOM 5128  C CB   . PRO A 1 110 ? 1.827   -4.759  -19.053 1.00 0.00 ? 110 PRO A CB   3  
ATOM 5129  C CG   . PRO A 1 110 ? 0.472   -5.390  -19.330 1.00 0.00 ? 110 PRO A CG   3  
ATOM 5130  C CD   . PRO A 1 110 ? 0.066   -6.181  -18.097 1.00 0.00 ? 110 PRO A CD   3  
ATOM 5131  H HA   . PRO A 1 110 ? 2.988   -5.148  -17.339 1.00 0.00 ? 110 PRO A HA   3  
ATOM 5132  H HB2  . PRO A 1 110 ? 1.843   -3.715  -19.365 1.00 0.00 ? 110 PRO A HB2  3  
ATOM 5133  H HB3  . PRO A 1 110 ? 2.616   -5.269  -19.608 1.00 0.00 ? 110 PRO A HB3  3  
ATOM 5134  H HG2  . PRO A 1 110 ? -0.268  -4.622  -19.552 1.00 0.00 ? 110 PRO A HG2  3  
ATOM 5135  H HG3  . PRO A 1 110 ? 0.525   -6.043  -20.201 1.00 0.00 ? 110 PRO A HG3  3  
ATOM 5136  H HD2  . PRO A 1 110 ? -0.906  -5.859  -17.722 1.00 0.00 ? 110 PRO A HD2  3  
ATOM 5137  H HD3  . PRO A 1 110 ? -0.014  -7.245  -18.317 1.00 0.00 ? 110 PRO A HD3  3  
ATOM 5138  N N    . SER A 1 111 ? 0.524   -3.220  -16.708 1.00 0.00 ? 111 SER A N    3  
ATOM 5139  C CA   . SER A 1 111 ? 0.138   -2.000  -16.020 1.00 0.00 ? 111 SER A CA   3  
ATOM 5140  C C    . SER A 1 111 ? 0.978   -1.824  -14.754 1.00 0.00 ? 111 SER A C    3  
ATOM 5141  O O    . SER A 1 111 ? 1.159   -2.770  -13.988 1.00 0.00 ? 111 SER A O    3  
ATOM 5142  C CB   . SER A 1 111 ? -1.352  -2.012  -15.671 1.00 0.00 ? 111 SER A CB   3  
ATOM 5143  O OG   . SER A 1 111 ? -1.746  -3.236  -15.057 1.00 0.00 ? 111 SER A OG   3  
ATOM 5144  H H    . SER A 1 111 ? -0.234  -3.748  -17.090 1.00 0.00 ? 111 SER A H    3  
ATOM 5145  H HA   . SER A 1 111 ? 0.338   -1.194  -16.727 1.00 0.00 ? 111 SER A HA   3  
ATOM 5146  H HB2  . SER A 1 111 ? -1.574  -1.182  -15.000 1.00 0.00 ? 111 SER A HB2  3  
ATOM 5147  H HB3  . SER A 1 111 ? -1.938  -1.856  -16.576 1.00 0.00 ? 111 SER A HB3  3  
ATOM 5148  H HG   . SER A 1 111 ? -1.964  -3.916  -15.757 1.00 0.00 ? 111 SER A HG   3  
ATOM 5149  N N    . SER A 1 112 ? 1.470   -0.607  -14.573 1.00 0.00 ? 112 SER A N    3  
ATOM 5150  C CA   . SER A 1 112 ? 2.288   -0.296  -13.412 1.00 0.00 ? 112 SER A CA   3  
ATOM 5151  C C    . SER A 1 112 ? 2.387   1.221   -13.234 1.00 0.00 ? 112 SER A C    3  
ATOM 5152  O O    . SER A 1 112 ? 2.032   1.980   -14.135 1.00 0.00 ? 112 SER A O    3  
ATOM 5153  C CB   . SER A 1 112 ? 3.684   -0.908  -13.542 1.00 0.00 ? 112 SER A CB   3  
ATOM 5154  O OG   . SER A 1 112 ? 4.006   -1.742  -12.432 1.00 0.00 ? 112 SER A OG   3  
ATOM 5155  H H    . SER A 1 112 ? 1.319   0.156   -15.200 1.00 0.00 ? 112 SER A H    3  
ATOM 5156  H HA   . SER A 1 112 ? 1.771   -0.747  -12.566 1.00 0.00 ? 112 SER A HA   3  
ATOM 5157  H HB2  . SER A 1 112 ? 3.741   -1.490  -14.462 1.00 0.00 ? 112 SER A HB2  3  
ATOM 5158  H HB3  . SER A 1 112 ? 4.423   -0.111  -13.622 1.00 0.00 ? 112 SER A HB3  3  
ATOM 5159  H HG   . SER A 1 112 ? 3.904   -2.704  -12.687 1.00 0.00 ? 112 SER A HG   3  
ATOM 5160  N N    . GLY A 1 113 ? 2.873   1.617   -12.067 1.00 0.00 ? 113 GLY A N    3  
ATOM 5161  C CA   . GLY A 1 113 ? 3.023   3.029   -11.759 1.00 0.00 ? 113 GLY A CA   3  
ATOM 5162  C C    . GLY A 1 113 ? 4.238   3.620   -12.477 1.00 0.00 ? 113 GLY A C    3  
ATOM 5163  O O    . GLY A 1 113 ? 4.303   3.611   -13.706 1.00 0.00 ? 113 GLY A O    3  
ATOM 5164  H H    . GLY A 1 113 ? 3.159   0.993   -11.340 1.00 0.00 ? 113 GLY A H    3  
ATOM 5165  H HA2  . GLY A 1 113 ? 2.124   3.567   -12.056 1.00 0.00 ? 113 GLY A HA2  3  
ATOM 5166  H HA3  . GLY A 1 113 ? 3.133   3.160   -10.683 1.00 0.00 ? 113 GLY A HA3  3  
ATOM 5167  N N    . GLY A 1 1   ? 6.216   16.909  -28.564 1.00 0.00 ? 1   GLY A N    4  
ATOM 5168  C CA   . GLY A 1 1   ? 4.814   17.294  -28.575 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5169  C C    . GLY A 1 1   ? 4.466   18.134  -27.345 1.00 0.00 ? 1   GLY A C    4  
ATOM 5170  O O    . GLY A 1 1   ? 5.302   18.326  -26.463 1.00 0.00 ? 1   GLY A O    4  
ATOM 5171  H H1   . GLY A 1 1   ? 6.595   16.720  -27.658 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5172  H HA2  . GLY A 1 1   ? 4.596   17.860  -29.480 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5173  H HA3  . GLY A 1 1   ? 4.189   16.401  -28.599 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5174  N N    . SER A 1 2   ? 3.231   18.612  -27.325 1.00 0.00 ? 2   SER A N    4  
ATOM 5175  C CA   . SER A 1 2   ? 2.762   19.427  -26.217 1.00 0.00 ? 2   SER A CA   4  
ATOM 5176  C C    . SER A 1 2   ? 2.925   18.665  -24.900 1.00 0.00 ? 2   SER A C    4  
ATOM 5177  O O    . SER A 1 2   ? 2.598   17.482  -24.819 1.00 0.00 ? 2   SER A O    4  
ATOM 5178  C CB   . SER A 1 2   ? 1.301   19.838  -26.415 1.00 0.00 ? 2   SER A CB   4  
ATOM 5179  O OG   . SER A 1 2   ? 0.404   18.764  -26.145 1.00 0.00 ? 2   SER A OG   4  
ATOM 5180  H H    . SER A 1 2   ? 2.557   18.451  -28.046 1.00 0.00 ? 2   SER A H    4  
ATOM 5181  H HA   . SER A 1 2   ? 3.393   20.316  -26.225 1.00 0.00 ? 2   SER A HA   4  
ATOM 5182  H HB2  . SER A 1 2   ? 1.069   20.678  -25.760 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5183  H HB3  . SER A 1 2   ? 1.157   20.182  -27.439 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5184  H HG   . SER A 1 2   ? -0.081  18.505  -26.980 1.00 0.00 ? 2   SER A HG   4  
ATOM 5185  N N    . SER A 1 3   ? 3.432   19.374  -23.902 1.00 0.00 ? 3   SER A N    4  
ATOM 5186  C CA   . SER A 1 3   ? 3.642   18.779  -22.593 1.00 0.00 ? 3   SER A CA   4  
ATOM 5187  C C    . SER A 1 3   ? 3.870   19.876  -21.551 1.00 0.00 ? 3   SER A C    4  
ATOM 5188  O O    . SER A 1 3   ? 4.609   20.828  -21.797 1.00 0.00 ? 3   SER A O    4  
ATOM 5189  C CB   . SER A 1 3   ? 4.827   17.811  -22.613 1.00 0.00 ? 3   SER A CB   4  
ATOM 5190  O OG   . SER A 1 3   ? 4.735   16.835  -21.579 1.00 0.00 ? 3   SER A OG   4  
ATOM 5191  H H    . SER A 1 3   ? 3.695   20.336  -23.977 1.00 0.00 ? 3   SER A H    4  
ATOM 5192  H HA   . SER A 1 3   ? 2.727   18.229  -22.376 1.00 0.00 ? 3   SER A HA   4  
ATOM 5193  H HB2  . SER A 1 3   ? 4.870   17.311  -23.580 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5194  H HB3  . SER A 1 3   ? 5.755   18.371  -22.501 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5195  H HG   . SER A 1 3   ? 4.468   17.271  -20.719 1.00 0.00 ? 3   SER A HG   4  
ATOM 5196  N N    . GLY A 1 4   ? 3.222   19.705  -20.408 1.00 0.00 ? 4   GLY A N    4  
ATOM 5197  C CA   . GLY A 1 4   ? 3.345   20.668  -19.327 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5198  C C    . GLY A 1 4   ? 2.632   20.173  -18.067 1.00 0.00 ? 4   GLY A C    4  
ATOM 5199  O O    . GLY A 1 4   ? 2.767   19.010  -17.690 1.00 0.00 ? 4   GLY A O    4  
ATOM 5200  H H    . GLY A 1 4   ? 2.623   18.928  -20.215 1.00 0.00 ? 4   GLY A H    4  
ATOM 5201  H HA2  . GLY A 1 4   ? 4.398   20.842  -19.108 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5202  H HA3  . GLY A 1 4   ? 2.921   21.624  -19.637 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5203  N N    . SER A 1 5   ? 1.888   21.080  -17.451 1.00 0.00 ? 5   SER A N    4  
ATOM 5204  C CA   . SER A 1 5   ? 1.153   20.749  -16.242 1.00 0.00 ? 5   SER A CA   4  
ATOM 5205  C C    . SER A 1 5   ? 2.116   20.239  -15.168 1.00 0.00 ? 5   SER A C    4  
ATOM 5206  O O    . SER A 1 5   ? 3.286   19.982  -15.449 1.00 0.00 ? 5   SER A O    4  
ATOM 5207  C CB   . SER A 1 5   ? 0.071   19.705  -16.523 1.00 0.00 ? 5   SER A CB   4  
ATOM 5208  O OG   . SER A 1 5   ? 0.600   18.382  -16.554 1.00 0.00 ? 5   SER A OG   4  
ATOM 5209  H H    . SER A 1 5   ? 1.783   22.023  -17.765 1.00 0.00 ? 5   SER A H    4  
ATOM 5210  H HA   . SER A 1 5   ? 0.685   21.681  -15.925 1.00 0.00 ? 5   SER A HA   4  
ATOM 5211  H HB2  . SER A 1 5   ? -0.702  19.769  -15.757 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5212  H HB3  . SER A 1 5   ? -0.407  19.927  -17.477 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5213  H HG   . SER A 1 5   ? 0.270   17.901  -17.365 1.00 0.00 ? 5   SER A HG   4  
ATOM 5214  N N    . SER A 1 6   ? 1.589   20.109  -13.959 1.00 0.00 ? 6   SER A N    4  
ATOM 5215  C CA   . SER A 1 6   ? 2.387   19.634  -12.842 1.00 0.00 ? 6   SER A CA   4  
ATOM 5216  C C    . SER A 1 6   ? 1.474   19.098  -11.738 1.00 0.00 ? 6   SER A C    4  
ATOM 5217  O O    . SER A 1 6   ? 0.269   19.346  -11.748 1.00 0.00 ? 6   SER A O    4  
ATOM 5218  C CB   . SER A 1 6   ? 3.284   20.746  -12.295 1.00 0.00 ? 6   SER A CB   4  
ATOM 5219  O OG   . SER A 1 6   ? 2.545   21.713  -11.554 1.00 0.00 ? 6   SER A OG   4  
ATOM 5220  H H    . SER A 1 6   ? 0.636   20.321  -13.739 1.00 0.00 ? 6   SER A H    4  
ATOM 5221  H HA   . SER A 1 6   ? 3.006   18.835  -13.248 1.00 0.00 ? 6   SER A HA   4  
ATOM 5222  H HB2  . SER A 1 6   ? 4.053   20.310  -11.656 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5223  H HB3  . SER A 1 6   ? 3.797   21.237  -13.121 1.00 0.00 ? 6   SER A HB3  4  
ATOM 5224  H HG   . SER A 1 6   ? 2.601   21.511  -10.576 1.00 0.00 ? 6   SER A HG   4  
ATOM 5225  N N    . GLY A 1 7   ? 2.083   18.371  -10.812 1.00 0.00 ? 7   GLY A N    4  
ATOM 5226  C CA   . GLY A 1 7   ? 1.340   17.797  -9.703  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5227  C C    . GLY A 1 7   ? 2.153   16.705  -9.005  1.00 0.00 ? 7   GLY A C    4  
ATOM 5228  O O    . GLY A 1 7   ? 2.776   15.874  -9.664  1.00 0.00 ? 7   GLY A O    4  
ATOM 5229  H H    . GLY A 1 7   ? 3.063   18.173  -10.811 1.00 0.00 ? 7   GLY A H    4  
ATOM 5230  H HA2  . GLY A 1 7   ? 1.085   18.579  -8.987  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5231  H HA3  . GLY A 1 7   ? 0.401   17.380  -10.067 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5232  N N    . ASP A 1 8   ? 2.120   16.741  -7.681  1.00 0.00 ? 8   ASP A N    4  
ATOM 5233  C CA   . ASP A 1 8   ? 2.846   15.765  -6.887  1.00 0.00 ? 8   ASP A CA   4  
ATOM 5234  C C    . ASP A 1 8   ? 1.915   14.601  -6.542  1.00 0.00 ? 8   ASP A C    4  
ATOM 5235  O O    . ASP A 1 8   ? 1.359   14.550  -5.446  1.00 0.00 ? 8   ASP A O    4  
ATOM 5236  C CB   . ASP A 1 8   ? 3.341   16.379  -5.576  1.00 0.00 ? 8   ASP A CB   4  
ATOM 5237  C CG   . ASP A 1 8   ? 4.527   17.335  -5.717  1.00 0.00 ? 8   ASP A CG   4  
ATOM 5238  O OD1  . ASP A 1 8   ? 4.323   18.407  -6.326  1.00 0.00 ? 8   ASP A OD1  4  
ATOM 5239  O OD2  . ASP A 1 8   ? 5.612   16.971  -5.213  1.00 0.00 ? 8   ASP A OD2  4  
ATOM 5240  H H    . ASP A 1 8   ? 1.610   17.421  -7.153  1.00 0.00 ? 8   ASP A H    4  
ATOM 5241  H HA   . ASP A 1 8   ? 3.685   15.457  -7.510  1.00 0.00 ? 8   ASP A HA   4  
ATOM 5242  H HB2  . ASP A 1 8   ? 2.515   16.916  -5.109  1.00 0.00 ? 8   ASP A HB2  4  
ATOM 5243  H HB3  . ASP A 1 8   ? 3.621   15.573  -4.898  1.00 0.00 ? 8   ASP A HB3  4  
ATOM 5244  N N    . LYS A 1 9   ? 1.773   13.694  -7.498  1.00 0.00 ? 9   LYS A N    4  
ATOM 5245  C CA   . LYS A 1 9   ? 0.919   12.534  -7.309  1.00 0.00 ? 9   LYS A CA   4  
ATOM 5246  C C    . LYS A 1 9   ? 1.717   11.264  -7.610  1.00 0.00 ? 9   LYS A C    4  
ATOM 5247  O O    . LYS A 1 9   ? 1.766   10.814  -8.754  1.00 0.00 ? 9   LYS A O    4  
ATOM 5248  C CB   . LYS A 1 9   ? -0.359  12.669  -8.139  1.00 0.00 ? 9   LYS A CB   4  
ATOM 5249  C CG   . LYS A 1 9   ? -1.002  14.042  -7.937  1.00 0.00 ? 9   LYS A CG   4  
ATOM 5250  C CD   . LYS A 1 9   ? -2.528  13.946  -7.987  1.00 0.00 ? 9   LYS A CD   4  
ATOM 5251  C CE   . LYS A 1 9   ? -3.079  14.626  -9.242  1.00 0.00 ? 9   LYS A CE   4  
ATOM 5252  N NZ   . LYS A 1 9   ? -4.401  15.231  -8.966  1.00 0.00 ? 9   LYS A NZ   4  
ATOM 5253  H H    . LYS A 1 9   ? 2.229   13.743  -8.387  1.00 0.00 ? 9   LYS A H    4  
ATOM 5254  H HA   . LYS A 1 9   ? 0.622   12.515  -6.260  1.00 0.00 ? 9   LYS A HA   4  
ATOM 5255  H HB2  . LYS A 1 9   ? -0.129  12.523  -9.194  1.00 0.00 ? 9   LYS A HB2  4  
ATOM 5256  H HB3  . LYS A 1 9   ? -1.064  11.888  -7.856  1.00 0.00 ? 9   LYS A HB3  4  
ATOM 5257  H HG2  . LYS A 1 9   ? -0.691  14.455  -6.977  1.00 0.00 ? 9   LYS A HG2  4  
ATOM 5258  H HG3  . LYS A 1 9   ? -0.651  14.729  -8.707  1.00 0.00 ? 9   LYS A HG3  4  
ATOM 5259  H HD2  . LYS A 1 9   ? -2.831  12.899  -7.974  1.00 0.00 ? 9   LYS A HD2  4  
ATOM 5260  H HD3  . LYS A 1 9   ? -2.955  14.412  -7.099  1.00 0.00 ? 9   LYS A HD3  4  
ATOM 5261  H HE2  . LYS A 1 9   ? -2.384  15.394  -9.582  1.00 0.00 ? 9   LYS A HE2  4  
ATOM 5262  H HE3  . LYS A 1 9   ? -3.167  13.897  -10.048 1.00 0.00 ? 9   LYS A HE3  4  
ATOM 5263  H HZ1  . LYS A 1 9   ? -5.081  14.845  -9.588  1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 5264  H HZ2  . LYS A 1 9   ? -4.665  15.038  -8.021  1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 5265  H HZ3  . LYS A 1 9   ? -4.349  16.221  -9.101  1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 5266  N N    . PRO A 1 10  ? 2.340   10.708  -6.536  1.00 0.00 ? 10  PRO A N    4  
ATOM 5267  C CA   . PRO A 1 10  ? 3.133   9.499   -6.675  1.00 0.00 ? 10  PRO A CA   4  
ATOM 5268  C C    . PRO A 1 10  ? 2.236   8.270   -6.835  1.00 0.00 ? 10  PRO A C    4  
ATOM 5269  O O    . PRO A 1 10  ? 2.530   7.383   -7.635  1.00 0.00 ? 10  PRO A O    4  
ATOM 5270  C CB   . PRO A 1 10  ? 3.993   9.447   -5.422  1.00 0.00 ? 10  PRO A CB   4  
ATOM 5271  C CG   . PRO A 1 10  ? 3.323   10.370  -4.418  1.00 0.00 ? 10  PRO A CG   4  
ATOM 5272  C CD   . PRO A 1 10  ? 2.305   11.214  -5.167  1.00 0.00 ? 10  PRO A CD   4  
ATOM 5273  H HA   . PRO A 1 10  ? 3.689   9.541   -7.505  1.00 0.00 ? 10  PRO A HA   4  
ATOM 5274  H HB2  . PRO A 1 10  ? 4.060   8.430   -5.036  1.00 0.00 ? 10  PRO A HB2  4  
ATOM 5275  H HB3  . PRO A 1 10  ? 5.012   9.774   -5.634  1.00 0.00 ? 10  PRO A HB3  4  
ATOM 5276  H HG2  . PRO A 1 10  ? 2.835   9.790   -3.634  1.00 0.00 ? 10  PRO A HG2  4  
ATOM 5277  H HG3  . PRO A 1 10  ? 4.062   11.006  -3.931  1.00 0.00 ? 10  PRO A HG3  4  
ATOM 5278  H HD2  . PRO A 1 10  ? 1.310   11.113  -4.733  1.00 0.00 ? 10  PRO A HD2  4  
ATOM 5279  H HD3  . PRO A 1 10  ? 2.563   12.272  -5.129  1.00 0.00 ? 10  PRO A HD3  4  
ATOM 5280  N N    . LEU A 1 11  ? 1.161   8.256   -6.061  1.00 0.00 ? 11  LEU A N    4  
ATOM 5281  C CA   . LEU A 1 11  ? 0.220   7.151   -6.106  1.00 0.00 ? 11  LEU A CA   4  
ATOM 5282  C C    . LEU A 1 11  ? -0.709  7.327   -7.309  1.00 0.00 ? 11  LEU A C    4  
ATOM 5283  O O    . LEU A 1 11  ? -1.303  6.361   -7.787  1.00 0.00 ? 11  LEU A O    4  
ATOM 5284  C CB   . LEU A 1 11  ? -0.519  7.020   -4.773  1.00 0.00 ? 11  LEU A CB   4  
ATOM 5285  C CG   . LEU A 1 11  ? 0.321   6.545   -3.585  1.00 0.00 ? 11  LEU A CG   4  
ATOM 5286  C CD1  . LEU A 1 11  ? 1.359   5.512   -4.026  1.00 0.00 ? 11  LEU A CD1  4  
ATOM 5287  C CD2  . LEU A 1 11  ? 0.962   7.729   -2.859  1.00 0.00 ? 11  LEU A CD2  4  
ATOM 5288  H H    . LEU A 1 11  ? 0.930   8.982   -5.412  1.00 0.00 ? 11  LEU A H    4  
ATOM 5289  H HA   . LEU A 1 11  ? 0.796   6.236   -6.246  1.00 0.00 ? 11  LEU A HA   4  
ATOM 5290  H HB2  . LEU A 1 11  ? -0.951  7.989   -4.523  1.00 0.00 ? 11  LEU A HB2  4  
ATOM 5291  H HB3  . LEU A 1 11  ? -1.349  6.326   -4.906  1.00 0.00 ? 11  LEU A HB3  4  
ATOM 5292  H HG   . LEU A 1 11  ? -0.342  6.052   -2.874  1.00 0.00 ? 11  LEU A HG   4  
ATOM 5293  H HD11 . LEU A 1 11  ? 2.234   6.025   -4.428  1.00 0.00 ? 11  LEU A HD11 4  
ATOM 5294  H HD12 . LEU A 1 11  ? 1.655   4.906   -3.169  1.00 0.00 ? 11  LEU A HD12 4  
ATOM 5295  H HD13 . LEU A 1 11  ? 0.930   4.870   -4.794  1.00 0.00 ? 11  LEU A HD13 4  
ATOM 5296  H HD21 . LEU A 1 11  ? 1.316   8.456   -3.590  1.00 0.00 ? 11  LEU A HD21 4  
ATOM 5297  H HD22 . LEU A 1 11  ? 0.224   8.199   -2.208  1.00 0.00 ? 11  LEU A HD22 4  
ATOM 5298  H HD23 . LEU A 1 11  ? 1.802   7.377   -2.260  1.00 0.00 ? 11  LEU A HD23 4  
ATOM 5299  N N    . SER A 1 12  ? -0.807  8.568   -7.764  1.00 0.00 ? 12  SER A N    4  
ATOM 5300  C CA   . SER A 1 12  ? -1.653  8.883   -8.902  1.00 0.00 ? 12  SER A CA   4  
ATOM 5301  C C    . SER A 1 12  ? -1.670  7.710   -9.883  1.00 0.00 ? 12  SER A C    4  
ATOM 5302  O O    . SER A 1 12  ? -0.682  7.457   -10.571 1.00 0.00 ? 12  SER A O    4  
ATOM 5303  C CB   . SER A 1 12  ? -1.179  10.157  -9.605  1.00 0.00 ? 12  SER A CB   4  
ATOM 5304  O OG   . SER A 1 12  ? -2.190  11.161  -9.630  1.00 0.00 ? 12  SER A OG   4  
ATOM 5305  H H    . SER A 1 12  ? -0.321  9.348   -7.370  1.00 0.00 ? 12  SER A H    4  
ATOM 5306  H HA   . SER A 1 12  ? -2.647  9.048   -8.485  1.00 0.00 ? 12  SER A HA   4  
ATOM 5307  H HB2  . SER A 1 12  ? -0.296  10.544  -9.097  1.00 0.00 ? 12  SER A HB2  4  
ATOM 5308  H HB3  . SER A 1 12  ? -0.880  9.917   -10.626 1.00 0.00 ? 12  SER A HB3  4  
ATOM 5309  H HG   . SER A 1 12  ? -2.587  11.223  -10.546 1.00 0.00 ? 12  SER A HG   4  
ATOM 5310  N N    . ASN A 1 13  ? -2.803  7.024   -9.917  1.00 0.00 ? 13  ASN A N    4  
ATOM 5311  C CA   . ASN A 1 13  ? -2.962  5.883   -10.802 1.00 0.00 ? 13  ASN A CA   4  
ATOM 5312  C C    . ASN A 1 13  ? -2.330  4.649   -10.155 1.00 0.00 ? 13  ASN A C    4  
ATOM 5313  O O    . ASN A 1 13  ? -1.473  4.000   -10.753 1.00 0.00 ? 13  ASN A O    4  
ATOM 5314  C CB   . ASN A 1 13  ? -2.263  6.124   -12.142 1.00 0.00 ? 13  ASN A CB   4  
ATOM 5315  C CG   . ASN A 1 13  ? -2.972  5.377   -13.273 1.00 0.00 ? 13  ASN A CG   4  
ATOM 5316  O OD1  . ASN A 1 13  ? -3.819  5.912   -13.969 1.00 0.00 ? 13  ASN A OD1  4  
ATOM 5317  N ND2  . ASN A 1 13  ? -2.580  4.114   -13.416 1.00 0.00 ? 13  ASN A ND2  4  
ATOM 5318  H H    . ASN A 1 13  ? -3.602  7.236   -9.354  1.00 0.00 ? 13  ASN A H    4  
ATOM 5319  H HA   . ASN A 1 13  ? -4.037  5.776   -10.942 1.00 0.00 ? 13  ASN A HA   4  
ATOM 5320  H HB2  . ASN A 1 13  ? -2.247  7.192   -12.360 1.00 0.00 ? 13  ASN A HB2  4  
ATOM 5321  H HB3  . ASN A 1 13  ? -1.225  5.796   -12.079 1.00 0.00 ? 13  ASN A HB3  4  
ATOM 5322  H HD21 . ASN A 1 13  ? -1.880  3.736   -12.810 1.00 0.00 ? 13  ASN A HD21 4  
ATOM 5323  H HD22 . ASN A 1 13  ? -2.986  3.542   -14.129 1.00 0.00 ? 13  ASN A HD22 4  
ATOM 5324  N N    . MET A 1 14  ? -2.778  4.362   -8.942  1.00 0.00 ? 14  MET A N    4  
ATOM 5325  C CA   . MET A 1 14  ? -2.268  3.217   -8.207  1.00 0.00 ? 14  MET A CA   4  
ATOM 5326  C C    . MET A 1 14  ? -3.248  2.784   -7.115  1.00 0.00 ? 14  MET A C    4  
ATOM 5327  O O    . MET A 1 14  ? -3.647  3.592   -6.278  1.00 0.00 ? 14  MET A O    4  
ATOM 5328  C CB   . MET A 1 14  ? -0.923  3.576   -7.572  1.00 0.00 ? 14  MET A CB   4  
ATOM 5329  C CG   . MET A 1 14  ? 0.095   3.986   -8.638  1.00 0.00 ? 14  MET A CG   4  
ATOM 5330  S SD   . MET A 1 14  ? 1.716   4.141   -7.907  1.00 0.00 ? 14  MET A SD   4  
ATOM 5331  C CE   . MET A 1 14  ? 1.843   2.557   -7.094  1.00 0.00 ? 14  MET A CE   4  
ATOM 5332  H H    . MET A 1 14  ? -3.476  4.894   -8.463  1.00 0.00 ? 14  MET A H    4  
ATOM 5333  H HA   . MET A 1 14  ? -2.158  2.421   -8.944  1.00 0.00 ? 14  MET A HA   4  
ATOM 5334  H HB2  . MET A 1 14  ? -1.059  4.392   -6.861  1.00 0.00 ? 14  MET A HB2  4  
ATOM 5335  H HB3  . MET A 1 14  ? -0.543  2.723   -7.009  1.00 0.00 ? 14  MET A HB3  4  
ATOM 5336  H HG2  . MET A 1 14  ? 0.117   3.244   -9.436  1.00 0.00 ? 14  MET A HG2  4  
ATOM 5337  H HG3  . MET A 1 14  ? -0.201  4.932   -9.091  1.00 0.00 ? 14  MET A HG3  4  
ATOM 5338  H HE1  . MET A 1 14  ? 1.419   1.784   -7.736  1.00 0.00 ? 14  MET A HE1  4  
ATOM 5339  H HE2  . MET A 1 14  ? 2.891   2.332   -6.898  1.00 0.00 ? 14  MET A HE2  4  
ATOM 5340  H HE3  . MET A 1 14  ? 1.295   2.587   -6.152  1.00 0.00 ? 14  MET A HE3  4  
ATOM 5341  N N    . LYS A 1 15  ? -3.609  1.510   -7.160  1.00 0.00 ? 15  LYS A N    4  
ATOM 5342  C CA   . LYS A 1 15  ? -4.536  0.960   -6.185  1.00 0.00 ? 15  LYS A CA   4  
ATOM 5343  C C    . LYS A 1 15  ? -3.751  0.436   -4.981  1.00 0.00 ? 15  LYS A C    4  
ATOM 5344  O O    . LYS A 1 15  ? -3.105  -0.607  -5.062  1.00 0.00 ? 15  LYS A O    4  
ATOM 5345  C CB   . LYS A 1 15  ? -5.436  -0.092  -6.836  1.00 0.00 ? 15  LYS A CB   4  
ATOM 5346  C CG   . LYS A 1 15  ? -6.571  0.569   -7.622  1.00 0.00 ? 15  LYS A CG   4  
ATOM 5347  C CD   . LYS A 1 15  ? -7.359  -0.468  -8.424  1.00 0.00 ? 15  LYS A CD   4  
ATOM 5348  C CE   . LYS A 1 15  ? -6.590  -0.893  -9.677  1.00 0.00 ? 15  LYS A CE   4  
ATOM 5349  N NZ   . LYS A 1 15  ? -6.980  -0.056  -10.833 1.00 0.00 ? 15  LYS A NZ   4  
ATOM 5350  H H    . LYS A 1 15  ? -3.280  0.859   -7.844  1.00 0.00 ? 15  LYS A H    4  
ATOM 5351  H HA   . LYS A 1 15  ? -5.179  1.773   -5.851  1.00 0.00 ? 15  LYS A HA   4  
ATOM 5352  H HB2  . LYS A 1 15  ? -4.846  -0.720  -7.503  1.00 0.00 ? 15  LYS A HB2  4  
ATOM 5353  H HB3  . LYS A 1 15  ? -5.852  -0.745  -6.069  1.00 0.00 ? 15  LYS A HB3  4  
ATOM 5354  H HG2  . LYS A 1 15  ? -7.240  1.087   -6.935  1.00 0.00 ? 15  LYS A HG2  4  
ATOM 5355  H HG3  . LYS A 1 15  ? -6.162  1.321   -8.296  1.00 0.00 ? 15  LYS A HG3  4  
ATOM 5356  H HD2  . LYS A 1 15  ? -7.557  -1.341  -7.802  1.00 0.00 ? 15  LYS A HD2  4  
ATOM 5357  H HD3  . LYS A 1 15  ? -8.326  -0.055  -8.710  1.00 0.00 ? 15  LYS A HD3  4  
ATOM 5358  H HE2  . LYS A 1 15  ? -5.518  -0.802  -9.500  1.00 0.00 ? 15  LYS A HE2  4  
ATOM 5359  H HE3  . LYS A 1 15  ? -6.789  -1.942  -9.895  1.00 0.00 ? 15  LYS A HE3  4  
ATOM 5360  H HZ1  . LYS A 1 15  ? -7.631  0.642   -10.535 1.00 0.00 ? 15  LYS A HZ1  4  
ATOM 5361  H HZ2  . LYS A 1 15  ? -6.168  0.387   -11.214 1.00 0.00 ? 15  LYS A HZ2  4  
ATOM 5362  H HZ3  . LYS A 1 15  ? -7.405  -0.631  -11.533 1.00 0.00 ? 15  LYS A HZ3  4  
ATOM 5363  N N    . ILE A 1 16  ? -3.833  1.185   -3.891  1.00 0.00 ? 16  ILE A N    4  
ATOM 5364  C CA   . ILE A 1 16  ? -3.138  0.810   -2.671  1.00 0.00 ? 16  ILE A CA   4  
ATOM 5365  C C    . ILE A 1 16  ? -4.110  0.085   -1.738  1.00 0.00 ? 16  ILE A C    4  
ATOM 5366  O O    . ILE A 1 16  ? -5.238  0.536   -1.540  1.00 0.00 ? 16  ILE A O    4  
ATOM 5367  C CB   . ILE A 1 16  ? -2.472  2.032   -2.036  1.00 0.00 ? 16  ILE A CB   4  
ATOM 5368  C CG1  . ILE A 1 16  ? -1.432  2.642   -2.979  1.00 0.00 ? 16  ILE A CG1  4  
ATOM 5369  C CG2  . ILE A 1 16  ? -1.873  1.683   -0.672  1.00 0.00 ? 16  ILE A CG2  4  
ATOM 5370  C CD1  . ILE A 1 16  ? -2.097  3.557   -4.010  1.00 0.00 ? 16  ILE A CD1  4  
ATOM 5371  H H    . ILE A 1 16  ? -4.360  2.033   -3.833  1.00 0.00 ? 16  ILE A H    4  
ATOM 5372  H HA   . ILE A 1 16  ? -2.344  0.117   -2.948  1.00 0.00 ? 16  ILE A HA   4  
ATOM 5373  H HB   . ILE A 1 16  ? -3.237  2.789   -1.868  1.00 0.00 ? 16  ILE A HB   4  
ATOM 5374  H HG12 . ILE A 1 16  ? -0.701  3.208   -2.403  1.00 0.00 ? 16  ILE A HG12 4  
ATOM 5375  H HG13 . ILE A 1 16  ? -0.889  1.847   -3.490  1.00 0.00 ? 16  ILE A HG13 4  
ATOM 5376  H HG21 . ILE A 1 16  ? -0.788  1.622   -0.756  1.00 0.00 ? 16  ILE A HG21 4  
ATOM 5377  H HG22 . ILE A 1 16  ? -2.138  2.456   0.049   1.00 0.00 ? 16  ILE A HG22 4  
ATOM 5378  H HG23 . ILE A 1 16  ? -2.266  0.723   -0.337  1.00 0.00 ? 16  ILE A HG23 4  
ATOM 5379  H HD11 . ILE A 1 16  ? -3.173  3.580   -3.834  1.00 0.00 ? 16  ILE A HD11 4  
ATOM 5380  H HD12 . ILE A 1 16  ? -1.692  4.564   -3.916  1.00 0.00 ? 16  ILE A HD12 4  
ATOM 5381  H HD13 . ILE A 1 16  ? -1.900  3.178   -5.013  1.00 0.00 ? 16  ILE A HD13 4  
ATOM 5382  N N    . LEU A 1 17  ? -3.639  -1.025  -1.190  1.00 0.00 ? 17  LEU A N    4  
ATOM 5383  C CA   . LEU A 1 17  ? -4.452  -1.816  -0.283  1.00 0.00 ? 17  LEU A CA   4  
ATOM 5384  C C    . LEU A 1 17  ? -3.877  -1.715  1.131   1.00 0.00 ? 17  LEU A C    4  
ATOM 5385  O O    . LEU A 1 17  ? -2.673  -1.528  1.304   1.00 0.00 ? 17  LEU A O    4  
ATOM 5386  C CB   . LEU A 1 17  ? -4.581  -3.253  -0.793  1.00 0.00 ? 17  LEU A CB   4  
ATOM 5387  C CG   . LEU A 1 17  ? -5.452  -4.188  0.049   1.00 0.00 ? 17  LEU A CG   4  
ATOM 5388  C CD1  . LEU A 1 17  ? -6.758  -4.521  -0.676  1.00 0.00 ? 17  LEU A CD1  4  
ATOM 5389  C CD2  . LEU A 1 17  ? -4.680  -5.447  0.446   1.00 0.00 ? 17  LEU A CD2  4  
ATOM 5390  H H    . LEU A 1 17  ? -2.720  -1.384  -1.357  1.00 0.00 ? 17  LEU A H    4  
ATOM 5391  H HA   . LEU A 1 17  ? -5.453  -1.384  -0.280  1.00 0.00 ? 17  LEU A HA   4  
ATOM 5392  H HB2  . LEU A 1 17  ? -4.986  -3.223  -1.804  1.00 0.00 ? 17  LEU A HB2  4  
ATOM 5393  H HB3  . LEU A 1 17  ? -3.582  -3.683  -0.862  1.00 0.00 ? 17  LEU A HB3  4  
ATOM 5394  H HG   . LEU A 1 17  ? -5.719  -3.669  0.970   1.00 0.00 ? 17  LEU A HG   4  
ATOM 5395  H HD11 . LEU A 1 17  ? -6.630  -4.361  -1.747  1.00 0.00 ? 17  LEU A HD11 4  
ATOM 5396  H HD12 . LEU A 1 17  ? -7.019  -5.563  -0.493  1.00 0.00 ? 17  LEU A HD12 4  
ATOM 5397  H HD13 . LEU A 1 17  ? -7.554  -3.876  -0.305  1.00 0.00 ? 17  LEU A HD13 4  
ATOM 5398  H HD21 . LEU A 1 17  ? -5.334  -6.315  0.365   1.00 0.00 ? 17  LEU A HD21 4  
ATOM 5399  H HD22 . LEU A 1 17  ? -3.824  -5.573  -0.217  1.00 0.00 ? 17  LEU A HD22 4  
ATOM 5400  H HD23 . LEU A 1 17  ? -4.331  -5.350  1.475   1.00 0.00 ? 17  LEU A HD23 4  
ATOM 5401  N N    . THR A 1 18  ? -4.764  -1.842  2.107   1.00 0.00 ? 18  THR A N    4  
ATOM 5402  C CA   . THR A 1 18  ? -4.359  -1.767  3.501   1.00 0.00 ? 18  THR A CA   4  
ATOM 5403  C C    . THR A 1 18  ? -4.822  -3.014  4.258   1.00 0.00 ? 18  THR A C    4  
ATOM 5404  O O    . THR A 1 18  ? -5.836  -3.616  3.909   1.00 0.00 ? 18  THR A O    4  
ATOM 5405  C CB   . THR A 1 18  ? -4.908  -0.464  4.083   1.00 0.00 ? 18  THR A CB   4  
ATOM 5406  O OG1  . THR A 1 18  ? -6.316  -0.562  3.888   1.00 0.00 ? 18  THR A OG1  4  
ATOM 5407  C CG2  . THR A 1 18  ? -4.503  0.762   3.261   1.00 0.00 ? 18  THR A CG2  4  
ATOM 5408  H H    . THR A 1 18  ? -5.741  -1.994  1.959   1.00 0.00 ? 18  THR A H    4  
ATOM 5409  H HA   . THR A 1 18  ? -3.270  -1.754  3.542   1.00 0.00 ? 18  THR A HA   4  
ATOM 5410  H HB   . THR A 1 18  ? -4.613  -0.348  5.126   1.00 0.00 ? 18  THR A HB   4  
ATOM 5411  H HG1  . THR A 1 18  ? -6.704  -1.230  4.522   1.00 0.00 ? 18  THR A HG1  4  
ATOM 5412  H HG21 . THR A 1 18  ? -5.101  1.619   3.568   1.00 0.00 ? 18  THR A HG21 4  
ATOM 5413  H HG22 . THR A 1 18  ? -3.447  0.977   3.427   1.00 0.00 ? 18  THR A HG22 4  
ATOM 5414  H HG23 . THR A 1 18  ? -4.671  0.561   2.203   1.00 0.00 ? 18  THR A HG23 4  
ATOM 5415  N N    . LEU A 1 19  ? -4.057  -3.363  5.282   1.00 0.00 ? 19  LEU A N    4  
ATOM 5416  C CA   . LEU A 1 19  ? -4.375  -4.527  6.091   1.00 0.00 ? 19  LEU A CA   4  
ATOM 5417  C C    . LEU A 1 19  ? -4.186  -4.182  7.570   1.00 0.00 ? 19  LEU A C    4  
ATOM 5418  O O    . LEU A 1 19  ? -3.720  -3.092  7.902   1.00 0.00 ? 19  LEU A O    4  
ATOM 5419  C CB   . LEU A 1 19  ? -3.561  -5.738  5.633   1.00 0.00 ? 19  LEU A CB   4  
ATOM 5420  C CG   . LEU A 1 19  ? -4.322  -6.793  4.828   1.00 0.00 ? 19  LEU A CG   4  
ATOM 5421  C CD1  . LEU A 1 19  ? -3.356  -7.736  4.108   1.00 0.00 ? 19  LEU A CD1  4  
ATOM 5422  C CD2  . LEU A 1 19  ? -5.310  -7.553  5.715   1.00 0.00 ? 19  LEU A CD2  4  
ATOM 5423  H H    . LEU A 1 19  ? -3.234  -2.868  5.559   1.00 0.00 ? 19  LEU A H    4  
ATOM 5424  H HA   . LEU A 1 19  ? -5.426  -4.763  5.924   1.00 0.00 ? 19  LEU A HA   4  
ATOM 5425  H HB2  . LEU A 1 19  ? -2.726  -5.382  5.030   1.00 0.00 ? 19  LEU A HB2  4  
ATOM 5426  H HB3  . LEU A 1 19  ? -3.136  -6.219  6.514   1.00 0.00 ? 19  LEU A HB3  4  
ATOM 5427  H HG   . LEU A 1 19  ? -4.905  -6.282  4.061   1.00 0.00 ? 19  LEU A HG   4  
ATOM 5428  H HD11 . LEU A 1 19  ? -2.349  -7.321  4.144   1.00 0.00 ? 19  LEU A HD11 4  
ATOM 5429  H HD12 . LEU A 1 19  ? -3.366  -8.709  4.597   1.00 0.00 ? 19  LEU A HD12 4  
ATOM 5430  H HD13 . LEU A 1 19  ? -3.666  -7.848  3.068   1.00 0.00 ? 19  LEU A HD13 4  
ATOM 5431  H HD21 . LEU A 1 19  ? -4.843  -8.469  6.077   1.00 0.00 ? 19  LEU A HD21 4  
ATOM 5432  H HD22 . LEU A 1 19  ? -5.591  -6.929  6.564   1.00 0.00 ? 19  LEU A HD22 4  
ATOM 5433  H HD23 . LEU A 1 19  ? -6.200  -7.802  5.137   1.00 0.00 ? 19  LEU A HD23 4  
ATOM 5434  N N    . GLY A 1 20  ? -4.555  -5.130  8.418   1.00 0.00 ? 20  GLY A N    4  
ATOM 5435  C CA   . GLY A 1 20  ? -4.432  -4.939  9.853   1.00 0.00 ? 20  GLY A CA   4  
ATOM 5436  C C    . GLY A 1 20  ? -4.919  -3.549  10.266  1.00 0.00 ? 20  GLY A C    4  
ATOM 5437  O O    . GLY A 1 20  ? -5.814  -2.989  9.636   1.00 0.00 ? 20  GLY A O    4  
ATOM 5438  H H    . GLY A 1 20  ? -4.933  -6.013  8.140   1.00 0.00 ? 20  GLY A H    4  
ATOM 5439  H HA2  . GLY A 1 20  ? -5.010  -5.701  10.376  1.00 0.00 ? 20  GLY A HA2  4  
ATOM 5440  H HA3  . GLY A 1 20  ? -3.391  -5.068  10.152  1.00 0.00 ? 20  GLY A HA3  4  
ATOM 5441  N N    . LYS A 1 21  ? -4.308  -3.032  11.323  1.00 0.00 ? 21  LYS A N    4  
ATOM 5442  C CA   . LYS A 1 21  ? -4.669  -1.718  11.827  1.00 0.00 ? 21  LYS A CA   4  
ATOM 5443  C C    . LYS A 1 21  ? -3.430  -0.821  11.831  1.00 0.00 ? 21  LYS A C    4  
ATOM 5444  O O    . LYS A 1 21  ? -2.398  -1.184  12.394  1.00 0.00 ? 21  LYS A O    4  
ATOM 5445  C CB   . LYS A 1 21  ? -5.347  -1.837  13.193  1.00 0.00 ? 21  LYS A CB   4  
ATOM 5446  C CG   . LYS A 1 21  ? -5.747  -0.460  13.728  1.00 0.00 ? 21  LYS A CG   4  
ATOM 5447  C CD   . LYS A 1 21  ? -4.786  0.002   14.826  1.00 0.00 ? 21  LYS A CD   4  
ATOM 5448  C CE   . LYS A 1 21  ? -5.368  -0.270  16.214  1.00 0.00 ? 21  LYS A CE   4  
ATOM 5449  N NZ   . LYS A 1 21  ? -4.369  0.032   17.264  1.00 0.00 ? 21  LYS A NZ   4  
ATOM 5450  H H    . LYS A 1 21  ? -3.581  -3.495  11.830  1.00 0.00 ? 21  LYS A H    4  
ATOM 5451  H HA   . LYS A 1 21  ? -5.401  -1.294  11.140  1.00 0.00 ? 21  LYS A HA   4  
ATOM 5452  H HB2  . LYS A 1 21  ? -6.231  -2.469  13.112  1.00 0.00 ? 21  LYS A HB2  4  
ATOM 5453  H HB3  . LYS A 1 21  ? -4.672  -2.323  13.898  1.00 0.00 ? 21  LYS A HB3  4  
ATOM 5454  H HG2  . LYS A 1 21  ? -5.749  0.264   12.914  1.00 0.00 ? 21  LYS A HG2  4  
ATOM 5455  H HG3  . LYS A 1 21  ? -6.762  -0.499  14.122  1.00 0.00 ? 21  LYS A HG3  4  
ATOM 5456  H HD2  . LYS A 1 21  ? -3.832  -0.515  14.720  1.00 0.00 ? 21  LYS A HD2  4  
ATOM 5457  H HD3  . LYS A 1 21  ? -4.585  1.067   14.714  1.00 0.00 ? 21  LYS A HD3  4  
ATOM 5458  H HE2  . LYS A 1 21  ? -6.260  0.339   16.367  1.00 0.00 ? 21  LYS A HE2  4  
ATOM 5459  H HE3  . LYS A 1 21  ? -5.678  -1.312  16.288  1.00 0.00 ? 21  LYS A HE3  4  
ATOM 5460  H HZ1  . LYS A 1 21  ? -3.517  -0.451  17.062  1.00 0.00 ? 21  LYS A HZ1  4  
ATOM 5461  H HZ2  . LYS A 1 21  ? -4.197  1.017   17.286  1.00 0.00 ? 21  LYS A HZ2  4  
ATOM 5462  H HZ3  . LYS A 1 21  ? -4.719  -0.265  18.152  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM 5463  N N    . LEU A 1 22  ? -3.573  0.334   11.197  1.00 0.00 ? 22  LEU A N    4  
ATOM 5464  C CA   . LEU A 1 22  ? -2.478  1.286   11.121  1.00 0.00 ? 22  LEU A CA   4  
ATOM 5465  C C    . LEU A 1 22  ? -2.692  2.387   12.161  1.00 0.00 ? 22  LEU A C    4  
ATOM 5466  O O    . LEU A 1 22  ? -3.742  2.448   12.798  1.00 0.00 ? 22  LEU A O    4  
ATOM 5467  C CB   . LEU A 1 22  ? -2.323  1.811   9.692   1.00 0.00 ? 22  LEU A CB   4  
ATOM 5468  C CG   . LEU A 1 22  ? -2.200  0.749   8.597   1.00 0.00 ? 22  LEU A CG   4  
ATOM 5469  C CD1  . LEU A 1 22  ? -2.833  1.234   7.290   1.00 0.00 ? 22  LEU A CD1  4  
ATOM 5470  C CD2  . LEU A 1 22  ? -0.743  0.325   8.405   1.00 0.00 ? 22  LEU A CD2  4  
ATOM 5471  H H    . LEU A 1 22  ? -4.415  0.621   10.742  1.00 0.00 ? 22  LEU A H    4  
ATOM 5472  H HA   . LEU A 1 22  ? -1.561  0.750   11.368  1.00 0.00 ? 22  LEU A HA   4  
ATOM 5473  H HB2  . LEU A 1 22  ? -3.181  2.443   9.463   1.00 0.00 ? 22  LEU A HB2  4  
ATOM 5474  H HB3  . LEU A 1 22  ? -1.439  2.448   9.654   1.00 0.00 ? 22  LEU A HB3  4  
ATOM 5475  H HG   . LEU A 1 22  ? -2.754  -0.134  8.914   1.00 0.00 ? 22  LEU A HG   4  
ATOM 5476  H HD11 . LEU A 1 22  ? -3.849  1.576   7.484   1.00 0.00 ? 22  LEU A HD11 4  
ATOM 5477  H HD12 . LEU A 1 22  ? -2.244  2.056   6.885   1.00 0.00 ? 22  LEU A HD12 4  
ATOM 5478  H HD13 . LEU A 1 22  ? -2.855  0.414   6.572   1.00 0.00 ? 22  LEU A HD13 4  
ATOM 5479  H HD21 . LEU A 1 22  ? -0.092  1.188   8.545   1.00 0.00 ? 22  LEU A HD21 4  
ATOM 5480  H HD22 . LEU A 1 22  ? -0.489  -0.443  9.136   1.00 0.00 ? 22  LEU A HD22 4  
ATOM 5481  H HD23 . LEU A 1 22  ? -0.609  -0.072  7.399   1.00 0.00 ? 22  LEU A HD23 4  
ATOM 5482  N N    . SER A 1 23  ? -1.679  3.230   12.301  1.00 0.00 ? 23  SER A N    4  
ATOM 5483  C CA   . SER A 1 23  ? -1.743  4.326   13.253  1.00 0.00 ? 23  SER A CA   4  
ATOM 5484  C C    . SER A 1 23  ? -2.984  5.180   12.984  1.00 0.00 ? 23  SER A C    4  
ATOM 5485  O O    . SER A 1 23  ? -3.679  5.581   13.916  1.00 0.00 ? 23  SER A O    4  
ATOM 5486  C CB   . SER A 1 23  ? -0.481  5.188   13.186  1.00 0.00 ? 23  SER A CB   4  
ATOM 5487  O OG   . SER A 1 23  ? -0.016  5.554   14.482  1.00 0.00 ? 23  SER A OG   4  
ATOM 5488  H H    . SER A 1 23  ? -0.828  3.173   11.778  1.00 0.00 ? 23  SER A H    4  
ATOM 5489  H HA   . SER A 1 23  ? -1.809  3.853   14.233  1.00 0.00 ? 23  SER A HA   4  
ATOM 5490  H HB2  . SER A 1 23  ? 0.303   4.643   12.660  1.00 0.00 ? 23  SER A HB2  4  
ATOM 5491  H HB3  . SER A 1 23  ? -0.687  6.088   12.607  1.00 0.00 ? 23  SER A HB3  4  
ATOM 5492  H HG   . SER A 1 23  ? 0.889   5.161   14.644  1.00 0.00 ? 23  SER A HG   4  
ATOM 5493  N N    . ARG A 1 24  ? -3.224  5.433   11.706  1.00 0.00 ? 24  ARG A N    4  
ATOM 5494  C CA   . ARG A 1 24  ? -4.368  6.233   11.303  1.00 0.00 ? 24  ARG A CA   4  
ATOM 5495  C C    . ARG A 1 24  ? -5.570  5.331   11.014  1.00 0.00 ? 24  ARG A C    4  
ATOM 5496  O O    . ARG A 1 24  ? -5.452  4.107   11.039  1.00 0.00 ? 24  ARG A O    4  
ATOM 5497  C CB   . ARG A 1 24  ? -4.050  7.062   10.058  1.00 0.00 ? 24  ARG A CB   4  
ATOM 5498  C CG   . ARG A 1 24  ? -3.184  8.273   10.412  1.00 0.00 ? 24  ARG A CG   4  
ATOM 5499  C CD   . ARG A 1 24  ? -3.758  9.554   9.803   1.00 0.00 ? 24  ARG A CD   4  
ATOM 5500  N NE   . ARG A 1 24  ? -2.748  10.635  9.854   1.00 0.00 ? 24  ARG A NE   4  
ATOM 5501  C CZ   . ARG A 1 24  ? -2.391  11.278  10.975  1.00 0.00 ? 24  ARG A CZ   4  
ATOM 5502  N NH1  . ARG A 1 24  ? -2.960  10.953  12.143  1.00 0.00 ? 24  ARG A NH1  4  
ATOM 5503  N NH2  . ARG A 1 24  ? -1.466  12.246  10.926  1.00 0.00 ? 24  ARG A NH2  4  
ATOM 5504  H H    . ARG A 1 24  ? -2.653  5.104   10.954  1.00 0.00 ? 24  ARG A H    4  
ATOM 5505  H HA   . ARG A 1 24  ? -4.564  6.887   12.153  1.00 0.00 ? 24  ARG A HA   4  
ATOM 5506  H HB2  . ARG A 1 24  ? -3.533  6.442   9.326   1.00 0.00 ? 24  ARG A HB2  4  
ATOM 5507  H HB3  . ARG A 1 24  ? -4.977  7.397   9.593   1.00 0.00 ? 24  ARG A HB3  4  
ATOM 5508  H HG2  . ARG A 1 24  ? -3.122  8.376   11.495  1.00 0.00 ? 24  ARG A HG2  4  
ATOM 5509  H HG3  . ARG A 1 24  ? -2.168  8.116   10.048  1.00 0.00 ? 24  ARG A HG3  4  
ATOM 5510  H HD2  . ARG A 1 24  ? -4.058  9.374   8.771   1.00 0.00 ? 24  ARG A HD2  4  
ATOM 5511  H HD3  . ARG A 1 24  ? -4.653  9.855   10.348  1.00 0.00 ? 24  ARG A HD3  4  
ATOM 5512  H HE   . ARG A 1 24  ? -2.304  10.902  8.999   1.00 0.00 ? 24  ARG A HE   4  
ATOM 5513  H HH11 . ARG A 1 24  ? -3.651  10.231  12.180  1.00 0.00 ? 24  ARG A HH11 4  
ATOM 5514  H HH12 . ARG A 1 24  ? -2.694  11.433  12.980  1.00 0.00 ? 24  ARG A HH12 4  
ATOM 5515  H HH21 . ARG A 1 24  ? -1.041  12.488  10.054  1.00 0.00 ? 24  ARG A HH21 4  
ATOM 5516  H HH22 . ARG A 1 24  ? -1.200  12.725  11.762  1.00 0.00 ? 24  ARG A HH22 4  
ATOM 5517  N N    . ASN A 1 25  ? -6.699  5.971   10.746  1.00 0.00 ? 25  ASN A N    4  
ATOM 5518  C CA   . ASN A 1 25  ? -7.921  5.242   10.452  1.00 0.00 ? 25  ASN A CA   4  
ATOM 5519  C C    . ASN A 1 25  ? -7.998  4.969   8.949   1.00 0.00 ? 25  ASN A C    4  
ATOM 5520  O O    . ASN A 1 25  ? -7.463  5.734   8.147   1.00 0.00 ? 25  ASN A O    4  
ATOM 5521  C CB   . ASN A 1 25  ? -9.155  6.054   10.849  1.00 0.00 ? 25  ASN A CB   4  
ATOM 5522  C CG   . ASN A 1 25  ? -9.340  6.065   12.368  1.00 0.00 ? 25  ASN A CG   4  
ATOM 5523  O OD1  . ASN A 1 25  ? -8.723  5.308   13.099  1.00 0.00 ? 25  ASN A OD1  4  
ATOM 5524  N ND2  . ASN A 1 25  ? -10.221 6.962   12.800  1.00 0.00 ? 25  ASN A ND2  4  
ATOM 5525  H H    . ASN A 1 25  ? -6.786  6.967   10.728  1.00 0.00 ? 25  ASN A H    4  
ATOM 5526  H HA   . ASN A 1 25  ? -7.856  4.326   11.040  1.00 0.00 ? 25  ASN A HA   4  
ATOM 5527  H HB2  . ASN A 1 25  ? -9.056  7.076   10.484  1.00 0.00 ? 25  ASN A HB2  4  
ATOM 5528  H HB3  . ASN A 1 25  ? -10.041 5.631   10.375  1.00 0.00 ? 25  ASN A HB3  4  
ATOM 5529  H HD21 . ASN A 1 25  ? -10.694 7.553   12.146  1.00 0.00 ? 25  ASN A HD21 4  
ATOM 5530  H HD22 . ASN A 1 25  ? -10.411 7.046   13.778  1.00 0.00 ? 25  ASN A HD22 4  
ATOM 5531  N N    . LYS A 1 26  ? -8.667  3.876   8.612   1.00 0.00 ? 26  LYS A N    4  
ATOM 5532  C CA   . LYS A 1 26  ? -8.821  3.493   7.219   1.00 0.00 ? 26  LYS A CA   4  
ATOM 5533  C C    . LYS A 1 26  ? -9.104  4.740   6.379   1.00 0.00 ? 26  LYS A C    4  
ATOM 5534  O O    . LYS A 1 26  ? -8.351  5.058   5.460   1.00 0.00 ? 26  LYS A O    4  
ATOM 5535  C CB   . LYS A 1 26  ? -9.884  2.402   7.078   1.00 0.00 ? 26  LYS A CB   4  
ATOM 5536  C CG   . LYS A 1 26  ? -9.268  1.099   6.564   1.00 0.00 ? 26  LYS A CG   4  
ATOM 5537  C CD   . LYS A 1 26  ? -10.354 0.119   6.113   1.00 0.00 ? 26  LYS A CD   4  
ATOM 5538  C CE   . LYS A 1 26  ? -10.069 -0.405  4.705   1.00 0.00 ? 26  LYS A CE   4  
ATOM 5539  N NZ   . LYS A 1 26  ? -10.429 -1.837  4.602   1.00 0.00 ? 26  LYS A NZ   4  
ATOM 5540  H H    . LYS A 1 26  ? -9.099  3.260   9.270   1.00 0.00 ? 26  LYS A H    4  
ATOM 5541  H HA   . LYS A 1 26  ? -7.874  3.064   6.892   1.00 0.00 ? 26  LYS A HA   4  
ATOM 5542  H HB2  . LYS A 1 26  ? -10.362 2.227   8.042   1.00 0.00 ? 26  LYS A HB2  4  
ATOM 5543  H HB3  . LYS A 1 26  ? -10.664 2.735   6.392   1.00 0.00 ? 26  LYS A HB3  4  
ATOM 5544  H HG2  . LYS A 1 26  ? -8.599  1.313   5.731   1.00 0.00 ? 26  LYS A HG2  4  
ATOM 5545  H HG3  . LYS A 1 26  ? -8.665  0.643   7.349   1.00 0.00 ? 26  LYS A HG3  4  
ATOM 5546  H HD2  . LYS A 1 26  ? -10.408 -0.716  6.812   1.00 0.00 ? 26  LYS A HD2  4  
ATOM 5547  H HD3  . LYS A 1 26  ? -11.325 0.614   6.132   1.00 0.00 ? 26  LYS A HD3  4  
ATOM 5548  H HE2  . LYS A 1 26  ? -10.637 0.172   3.974   1.00 0.00 ? 26  LYS A HE2  4  
ATOM 5549  H HE3  . LYS A 1 26  ? -9.014  -0.271  4.467   1.00 0.00 ? 26  LYS A HE3  4  
ATOM 5550  H HZ1  . LYS A 1 26  ? -10.463 -2.104  3.639   1.00 0.00 ? 26  LYS A HZ1  4  
ATOM 5551  H HZ2  . LYS A 1 26  ? -9.742  -2.388  5.077   1.00 0.00 ? 26  LYS A HZ2  4  
ATOM 5552  H HZ3  . LYS A 1 26  ? -11.324 -1.987  5.022   1.00 0.00 ? 26  LYS A HZ3  4  
ATOM 5553  N N    . ASP A 1 27  ? -10.192 5.413   6.725   1.00 0.00 ? 27  ASP A N    4  
ATOM 5554  C CA   . ASP A 1 27  ? -10.584 6.618   6.015   1.00 0.00 ? 27  ASP A CA   4  
ATOM 5555  C C    . ASP A 1 27  ? -9.368  7.534   5.864   1.00 0.00 ? 27  ASP A C    4  
ATOM 5556  O O    . ASP A 1 27  ? -8.908  7.783   4.751   1.00 0.00 ? 27  ASP A O    4  
ATOM 5557  C CB   . ASP A 1 27  ? -11.661 7.385   6.784   1.00 0.00 ? 27  ASP A CB   4  
ATOM 5558  C CG   . ASP A 1 27  ? -12.494 8.352   5.940   1.00 0.00 ? 27  ASP A CG   4  
ATOM 5559  O OD1  . ASP A 1 27  ? -12.894 7.938   4.831   1.00 0.00 ? 27  ASP A OD1  4  
ATOM 5560  O OD2  . ASP A 1 27  ? -12.711 9.485   6.424   1.00 0.00 ? 27  ASP A OD2  4  
ATOM 5561  H H    . ASP A 1 27  ? -10.799 5.147   7.474   1.00 0.00 ? 27  ASP A H    4  
ATOM 5562  H HA   . ASP A 1 27  ? -10.967 6.273   5.055   1.00 0.00 ? 27  ASP A HA   4  
ATOM 5563  H HB2  . ASP A 1 27  ? -12.333 6.666   7.254   1.00 0.00 ? 27  ASP A HB2  4  
ATOM 5564  H HB3  . ASP A 1 27  ? -11.183 7.946   7.588   1.00 0.00 ? 27  ASP A HB3  4  
ATOM 5565  N N    . GLU A 1 28  ? -8.882  8.012   7.001   1.00 0.00 ? 28  GLU A N    4  
ATOM 5566  C CA   . GLU A 1 28  ? -7.729  8.895   7.009   1.00 0.00 ? 28  GLU A CA   4  
ATOM 5567  C C    . GLU A 1 28  ? -6.703  8.439   5.970   1.00 0.00 ? 28  GLU A C    4  
ATOM 5568  O O    . GLU A 1 28  ? -6.100  9.263   5.284   1.00 0.00 ? 28  GLU A O    4  
ATOM 5569  C CB   . GLU A 1 28  ? -7.103  8.966   8.404   1.00 0.00 ? 28  GLU A CB   4  
ATOM 5570  C CG   . GLU A 1 28  ? -8.033  9.680   9.387   1.00 0.00 ? 28  GLU A CG   4  
ATOM 5571  C CD   . GLU A 1 28  ? -7.255  10.668  10.259  1.00 0.00 ? 28  GLU A CD   4  
ATOM 5572  O OE1  . GLU A 1 28  ? -6.489  11.462  9.671   1.00 0.00 ? 28  GLU A OE1  4  
ATOM 5573  O OE2  . GLU A 1 28  ? -7.444  10.606  11.493  1.00 0.00 ? 28  GLU A OE2  4  
ATOM 5574  H H    . GLU A 1 28  ? -9.263  7.805   7.902   1.00 0.00 ? 28  GLU A H    4  
ATOM 5575  H HA   . GLU A 1 28  ? -8.115  9.879   6.741   1.00 0.00 ? 28  GLU A HA   4  
ATOM 5576  H HB2  . GLU A 1 28  ? -6.891  7.959   8.763   1.00 0.00 ? 28  GLU A HB2  4  
ATOM 5577  H HB3  . GLU A 1 28  ? -6.149  9.492   8.352   1.00 0.00 ? 28  GLU A HB3  4  
ATOM 5578  H HG2  . GLU A 1 28  ? -8.812  10.209  8.838   1.00 0.00 ? 28  GLU A HG2  4  
ATOM 5579  H HG3  . GLU A 1 28  ? -8.531  8.945   10.019  1.00 0.00 ? 28  GLU A HG3  4  
ATOM 5580  N N    . VAL A 1 29  ? -6.536  7.127   5.887   1.00 0.00 ? 29  VAL A N    4  
ATOM 5581  C CA   . VAL A 1 29  ? -5.594  6.551   4.943   1.00 0.00 ? 29  VAL A CA   4  
ATOM 5582  C C    . VAL A 1 29  ? -6.186  6.616   3.533   1.00 0.00 ? 29  VAL A C    4  
ATOM 5583  O O    . VAL A 1 29  ? -5.544  7.114   2.609   1.00 0.00 ? 29  VAL A O    4  
ATOM 5584  C CB   . VAL A 1 29  ? -5.227  5.129   5.371   1.00 0.00 ? 29  VAL A CB   4  
ATOM 5585  C CG1  . VAL A 1 29  ? -4.315  4.463   4.339   1.00 0.00 ? 29  VAL A CG1  4  
ATOM 5586  C CG2  . VAL A 1 29  ? -4.580  5.124   6.758   1.00 0.00 ? 29  VAL A CG2  4  
ATOM 5587  H H    . VAL A 1 29  ? -7.031  6.463   6.448   1.00 0.00 ? 29  VAL A H    4  
ATOM 5588  H HA   . VAL A 1 29  ? -4.688  7.156   4.971   1.00 0.00 ? 29  VAL A HA   4  
ATOM 5589  H HB   . VAL A 1 29  ? -6.147  4.548   5.429   1.00 0.00 ? 29  VAL A HB   4  
ATOM 5590  H HG11 . VAL A 1 29  ? -3.363  4.209   4.805   1.00 0.00 ? 29  VAL A HG11 4  
ATOM 5591  H HG12 . VAL A 1 29  ? -4.791  3.556   3.966   1.00 0.00 ? 29  VAL A HG12 4  
ATOM 5592  H HG13 . VAL A 1 29  ? -4.143  5.150   3.510   1.00 0.00 ? 29  VAL A HG13 4  
ATOM 5593  H HG21 . VAL A 1 29  ? -5.002  4.314   7.353   1.00 0.00 ? 29  VAL A HG21 4  
ATOM 5594  H HG22 . VAL A 1 29  ? -3.505  4.978   6.657   1.00 0.00 ? 29  VAL A HG22 4  
ATOM 5595  H HG23 . VAL A 1 29  ? -4.772  6.076   7.252   1.00 0.00 ? 29  VAL A HG23 4  
ATOM 5596  N N    . LYS A 1 30  ? -7.403  6.107   3.413   1.00 0.00 ? 30  LYS A N    4  
ATOM 5597  C CA   . LYS A 1 30  ? -8.089  6.101   2.132   1.00 0.00 ? 30  LYS A CA   4  
ATOM 5598  C C    . LYS A 1 30  ? -8.016  7.498   1.513   1.00 0.00 ? 30  LYS A C    4  
ATOM 5599  O O    . LYS A 1 30  ? -7.913  7.637   0.295   1.00 0.00 ? 30  LYS A O    4  
ATOM 5600  C CB   . LYS A 1 30  ? -9.515  5.572   2.290   1.00 0.00 ? 30  LYS A CB   4  
ATOM 5601  C CG   . LYS A 1 30  ? -10.390 5.992   1.107   1.00 0.00 ? 30  LYS A CG   4  
ATOM 5602  C CD   . LYS A 1 30  ? -11.860 5.657   1.366   1.00 0.00 ? 30  LYS A CD   4  
ATOM 5603  C CE   . LYS A 1 30  ? -12.423 4.765   0.258   1.00 0.00 ? 30  LYS A CE   4  
ATOM 5604  N NZ   . LYS A 1 30  ? -13.405 3.806   0.812   1.00 0.00 ? 30  LYS A NZ   4  
ATOM 5605  H H    . LYS A 1 30  ? -7.918  5.704   4.170   1.00 0.00 ? 30  LYS A H    4  
ATOM 5606  H HA   . LYS A 1 30  ? -7.558  5.407   1.480   1.00 0.00 ? 30  LYS A HA   4  
ATOM 5607  H HB2  . LYS A 1 30  ? -9.498  4.485   2.366   1.00 0.00 ? 30  LYS A HB2  4  
ATOM 5608  H HB3  . LYS A 1 30  ? -9.946  5.949   3.218   1.00 0.00 ? 30  LYS A HB3  4  
ATOM 5609  H HG2  . LYS A 1 30  ? -10.283 7.062   0.933   1.00 0.00 ? 30  LYS A HG2  4  
ATOM 5610  H HG3  . LYS A 1 30  ? -10.052 5.486   0.203   1.00 0.00 ? 30  LYS A HG3  4  
ATOM 5611  H HD2  . LYS A 1 30  ? -11.958 5.153   2.328   1.00 0.00 ? 30  LYS A HD2  4  
ATOM 5612  H HD3  . LYS A 1 30  ? -12.441 6.577   1.428   1.00 0.00 ? 30  LYS A HD3  4  
ATOM 5613  H HE2  . LYS A 1 30  ? -12.898 5.381   -0.506  1.00 0.00 ? 30  LYS A HE2  4  
ATOM 5614  H HE3  . LYS A 1 30  ? -11.612 4.223   -0.229  1.00 0.00 ? 30  LYS A HE3  4  
ATOM 5615  H HZ1  . LYS A 1 30  ? -13.376 3.840   1.811   1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 5616  H HZ2  . LYS A 1 30  ? -14.323 4.049   0.497   1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 5617  H HZ3  . LYS A 1 30  ? -13.180 2.882   0.503   1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 5618  N N    . ALA A 1 31  ? -8.072  8.498   2.381   1.00 0.00 ? 31  ALA A N    4  
ATOM 5619  C CA   . ALA A 1 31  ? -8.014  9.880   1.935   1.00 0.00 ? 31  ALA A CA   4  
ATOM 5620  C C    . ALA A 1 31  ? -6.607  10.186  1.417   1.00 0.00 ? 31  ALA A C    4  
ATOM 5621  O O    . ALA A 1 31  ? -6.449  10.775  0.349   1.00 0.00 ? 31  ALA A O    4  
ATOM 5622  C CB   . ALA A 1 31  ? -8.428  10.805  3.082   1.00 0.00 ? 31  ALA A CB   4  
ATOM 5623  H H    . ALA A 1 31  ? -8.156  8.377   3.370   1.00 0.00 ? 31  ALA A H    4  
ATOM 5624  H HA   . ALA A 1 31  ? -8.726  9.995   1.117   1.00 0.00 ? 31  ALA A HA   4  
ATOM 5625  H HB1  . ALA A 1 31  ? -7.571  11.403  3.393   1.00 0.00 ? 31  ALA A HB1  4  
ATOM 5626  H HB2  . ALA A 1 31  ? -9.228  11.464  2.746   1.00 0.00 ? 31  ALA A HB2  4  
ATOM 5627  H HB3  . ALA A 1 31  ? -8.777  10.206  3.923   1.00 0.00 ? 31  ALA A HB3  4  
ATOM 5628  N N    . MET A 1 32  ? -5.621  9.772   2.199   1.00 0.00 ? 32  MET A N    4  
ATOM 5629  C CA   . MET A 1 32  ? -4.233  9.994   1.833   1.00 0.00 ? 32  MET A CA   4  
ATOM 5630  C C    . MET A 1 32  ? -3.935  9.430   0.442   1.00 0.00 ? 32  MET A C    4  
ATOM 5631  O O    . MET A 1 32  ? -3.580  10.174  -0.470  1.00 0.00 ? 32  MET A O    4  
ATOM 5632  C CB   . MET A 1 32  ? -3.320  9.324   2.862   1.00 0.00 ? 32  MET A CB   4  
ATOM 5633  C CG   . MET A 1 32  ? -2.527  10.366  3.653   1.00 0.00 ? 32  MET A CG   4  
ATOM 5634  S SD   . MET A 1 32  ? -1.405  11.232  2.567   1.00 0.00 ? 32  MET A SD   4  
ATOM 5635  C CE   . MET A 1 32  ? 0.125   11.004  3.457   1.00 0.00 ? 32  MET A CE   4  
ATOM 5636  H H    . MET A 1 32  ? -5.758  9.293   3.066   1.00 0.00 ? 32  MET A H    4  
ATOM 5637  H HA   . MET A 1 32  ? -4.100  11.076  1.830   1.00 0.00 ? 32  MET A HA   4  
ATOM 5638  H HB2  . MET A 1 32  ? -3.918  8.721   3.546   1.00 0.00 ? 32  MET A HB2  4  
ATOM 5639  H HB3  . MET A 1 32  ? -2.633  8.645   2.357   1.00 0.00 ? 32  MET A HB3  4  
ATOM 5640  H HG2  . MET A 1 32  ? -3.209  11.074  4.124   1.00 0.00 ? 32  MET A HG2  4  
ATOM 5641  H HG3  . MET A 1 32  ? -1.968  9.880   4.453   1.00 0.00 ? 32  MET A HG3  4  
ATOM 5642  H HE1  . MET A 1 32  ? 0.015   10.183  4.165   1.00 0.00 ? 32  MET A HE1  4  
ATOM 5643  H HE2  . MET A 1 32  ? 0.924   10.771  2.752   1.00 0.00 ? 32  MET A HE2  4  
ATOM 5644  H HE3  . MET A 1 32  ? 0.372   11.919  3.996   1.00 0.00 ? 32  MET A HE3  4  
ATOM 5645  N N    . ILE A 1 33  ? -4.091  8.119   0.325   1.00 0.00 ? 33  ILE A N    4  
ATOM 5646  C CA   . ILE A 1 33  ? -3.843  7.447   -0.940  1.00 0.00 ? 33  ILE A CA   4  
ATOM 5647  C C    . ILE A 1 33  ? -4.574  8.190   -2.059  1.00 0.00 ? 33  ILE A C    4  
ATOM 5648  O O    . ILE A 1 33  ? -4.060  8.307   -3.171  1.00 0.00 ? 33  ILE A O    4  
ATOM 5649  C CB   . ILE A 1 33  ? -4.214  5.966   -0.840  1.00 0.00 ? 33  ILE A CB   4  
ATOM 5650  C CG1  . ILE A 1 33  ? -3.370  5.260   0.223   1.00 0.00 ? 33  ILE A CG1  4  
ATOM 5651  C CG2  . ILE A 1 33  ? -4.108  5.282   -2.204  1.00 0.00 ? 33  ILE A CG2  4  
ATOM 5652  C CD1  . ILE A 1 33  ? -4.080  4.009   0.745   1.00 0.00 ? 33  ILE A CD1  4  
ATOM 5653  H H    . ILE A 1 33  ? -4.380  7.521   1.072   1.00 0.00 ? 33  ILE A H    4  
ATOM 5654  H HA   . ILE A 1 33  ? -2.771  7.499   -1.133  1.00 0.00 ? 33  ILE A HA   4  
ATOM 5655  H HB   . ILE A 1 33  ? -5.255  5.895   -0.525  1.00 0.00 ? 33  ILE A HB   4  
ATOM 5656  H HG12 . ILE A 1 33  ? -2.403  4.984   -0.199  1.00 0.00 ? 33  ILE A HG12 4  
ATOM 5657  H HG13 . ILE A 1 33  ? -3.174  5.942   1.049   1.00 0.00 ? 33  ILE A HG13 4  
ATOM 5658  H HG21 . ILE A 1 33  ? -4.658  4.341   -2.183  1.00 0.00 ? 33  ILE A HG21 4  
ATOM 5659  H HG22 . ILE A 1 33  ? -4.529  5.932   -2.971  1.00 0.00 ? 33  ILE A HG22 4  
ATOM 5660  H HG23 . ILE A 1 33  ? -3.060  5.084   -2.431  1.00 0.00 ? 33  ILE A HG23 4  
ATOM 5661  H HD11 . ILE A 1 33  ? -4.935  4.304   1.352   1.00 0.00 ? 33  ILE A HD11 4  
ATOM 5662  H HD12 . ILE A 1 33  ? -4.423  3.408   -0.098  1.00 0.00 ? 33  ILE A HD12 4  
ATOM 5663  H HD13 . ILE A 1 33  ? -3.388  3.424   1.350   1.00 0.00 ? 33  ILE A HD13 4  
ATOM 5664  N N    . GLU A 1 34  ? -5.762  8.674   -1.728  1.00 0.00 ? 34  GLU A N    4  
ATOM 5665  C CA   . GLU A 1 34  ? -6.569  9.403   -2.691  1.00 0.00 ? 34  GLU A CA   4  
ATOM 5666  C C    . GLU A 1 34  ? -5.998  10.805  -2.910  1.00 0.00 ? 34  GLU A C    4  
ATOM 5667  O O    . GLU A 1 34  ? -6.121  11.367  -3.997  1.00 0.00 ? 34  GLU A O    4  
ATOM 5668  C CB   . GLU A 1 34  ? -8.031  9.470   -2.244  1.00 0.00 ? 34  GLU A CB   4  
ATOM 5669  C CG   . GLU A 1 34  ? -8.776  8.185   -2.609  1.00 0.00 ? 34  GLU A CG   4  
ATOM 5670  C CD   . GLU A 1 34  ? -10.180 8.495   -3.132  1.00 0.00 ? 34  GLU A CD   4  
ATOM 5671  O OE1  . GLU A 1 34  ? -11.101 8.547   -2.288  1.00 0.00 ? 34  GLU A OE1  4  
ATOM 5672  O OE2  . GLU A 1 34  ? -10.301 8.672   -4.363  1.00 0.00 ? 34  GLU A OE2  4  
ATOM 5673  H H    . GLU A 1 34  ? -6.173  8.575   -0.821  1.00 0.00 ? 34  GLU A H    4  
ATOM 5674  H HA   . GLU A 1 34  ? -6.505  8.829   -3.616  1.00 0.00 ? 34  GLU A HA   4  
ATOM 5675  H HB2  . GLU A 1 34  ? -8.078  9.628   -1.166  1.00 0.00 ? 34  GLU A HB2  4  
ATOM 5676  H HB3  . GLU A 1 34  ? -8.520  10.324  -2.713  1.00 0.00 ? 34  GLU A HB3  4  
ATOM 5677  H HG2  . GLU A 1 34  ? -8.214  7.638   -3.367  1.00 0.00 ? 34  GLU A HG2  4  
ATOM 5678  H HG3  . GLU A 1 34  ? -8.844  7.538   -1.734  1.00 0.00 ? 34  GLU A HG3  4  
ATOM 5679  N N    . LYS A 1 35  ? -5.384  11.330  -1.859  1.00 0.00 ? 35  LYS A N    4  
ATOM 5680  C CA   . LYS A 1 35  ? -4.793  12.656  -1.923  1.00 0.00 ? 35  LYS A CA   4  
ATOM 5681  C C    . LYS A 1 35  ? -3.565  12.619  -2.834  1.00 0.00 ? 35  LYS A C    4  
ATOM 5682  O O    . LYS A 1 35  ? -3.393  13.489  -3.686  1.00 0.00 ? 35  LYS A O    4  
ATOM 5683  C CB   . LYS A 1 35  ? -4.499  13.179  -0.515  1.00 0.00 ? 35  LYS A CB   4  
ATOM 5684  C CG   . LYS A 1 35  ? -3.479  14.318  -0.556  1.00 0.00 ? 35  LYS A CG   4  
ATOM 5685  C CD   . LYS A 1 35  ? -2.136  13.873  0.026   1.00 0.00 ? 35  LYS A CD   4  
ATOM 5686  C CE   . LYS A 1 35  ? -1.852  14.581  1.353   1.00 0.00 ? 35  LYS A CE   4  
ATOM 5687  N NZ   . LYS A 1 35  ? -0.793  15.600  1.180   1.00 0.00 ? 35  LYS A NZ   4  
ATOM 5688  H H    . LYS A 1 35  ? -5.288  10.866  -0.979  1.00 0.00 ? 35  LYS A H    4  
ATOM 5689  H HA   . LYS A 1 35  ? -5.533  13.322  -2.366  1.00 0.00 ? 35  LYS A HA   4  
ATOM 5690  H HB2  . LYS A 1 35  ? -5.422  13.529  -0.053  1.00 0.00 ? 35  LYS A HB2  4  
ATOM 5691  H HB3  . LYS A 1 35  ? -4.120  12.368  0.106   1.00 0.00 ? 35  LYS A HB3  4  
ATOM 5692  H HG2  . LYS A 1 35  ? -3.341  14.651  -1.585  1.00 0.00 ? 35  LYS A HG2  4  
ATOM 5693  H HG3  . LYS A 1 35  ? -3.859  15.171  0.007   1.00 0.00 ? 35  LYS A HG3  4  
ATOM 5694  H HD2  . LYS A 1 35  ? -2.142  12.794  0.180   1.00 0.00 ? 35  LYS A HD2  4  
ATOM 5695  H HD3  . LYS A 1 35  ? -1.338  14.090  -0.684  1.00 0.00 ? 35  LYS A HD3  4  
ATOM 5696  H HE2  . LYS A 1 35  ? -2.763  15.053  1.722   1.00 0.00 ? 35  LYS A HE2  4  
ATOM 5697  H HE3  . LYS A 1 35  ? -1.545  13.852  2.102   1.00 0.00 ? 35  LYS A HE3  4  
ATOM 5698  H HZ1  . LYS A 1 35  ? -0.934  16.085  0.317   1.00 0.00 ? 35  LYS A HZ1  4  
ATOM 5699  H HZ2  . LYS A 1 35  ? -0.830  16.251  1.938   1.00 0.00 ? 35  LYS A HZ2  4  
ATOM 5700  H HZ3  . LYS A 1 35  ? 0.101   15.153  1.169   1.00 0.00 ? 35  LYS A HZ3  4  
ATOM 5701  N N    . LEU A 1 36  ? -2.742  11.602  -2.623  1.00 0.00 ? 36  LEU A N    4  
ATOM 5702  C CA   . LEU A 1 36  ? -1.534  11.440  -3.415  1.00 0.00 ? 36  LEU A CA   4  
ATOM 5703  C C    . LEU A 1 36  ? -1.916  11.201  -4.877  1.00 0.00 ? 36  LEU A C    4  
ATOM 5704  O O    . LEU A 1 36  ? -1.063  11.247  -5.761  1.00 0.00 ? 36  LEU A O    4  
ATOM 5705  C CB   . LEU A 1 36  ? -0.649  10.342  -2.823  1.00 0.00 ? 36  LEU A CB   4  
ATOM 5706  C CG   . LEU A 1 36  ? 0.326   10.783  -1.729  1.00 0.00 ? 36  LEU A CG   4  
ATOM 5707  C CD1  . LEU A 1 36  ? 1.330   11.804  -2.267  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 5708  C CD2  . LEU A 1 36  ? -0.427  11.309  -0.505  1.00 0.00 ? 36  LEU A CD2  4  
ATOM 5709  H H    . LEU A 1 36  ? -2.889  10.898  -1.928  1.00 0.00 ? 36  LEU A H    4  
ATOM 5710  H HA   . LEU A 1 36  ? -0.975  12.374  -3.353  1.00 0.00 ? 36  LEU A HA   4  
ATOM 5711  H HB2  . LEU A 1 36  ? -1.293  9.563   -2.416  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 5712  H HB3  . LEU A 1 36  ? -0.075  9.890   -3.633  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 5713  H HG   . LEU A 1 36  ? 0.895   9.911   -1.407  1.00 0.00 ? 36  LEU A HG   4  
ATOM 5714  H HD11 . LEU A 1 36  ? 0.942   12.245  -3.185  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 5715  H HD12 . LEU A 1 36  ? 1.485   12.587  -1.525  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 5716  H HD13 . LEU A 1 36  ? 2.277   11.307  -2.475  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 5717  H HD21 . LEU A 1 36  ? -1.486  11.068  -0.598  1.00 0.00 ? 36  LEU A HD21 4  
ATOM 5718  H HD22 . LEU A 1 36  ? -0.026  10.843  0.396   1.00 0.00 ? 36  LEU A HD22 4  
ATOM 5719  H HD23 . LEU A 1 36  ? -0.304  12.390  -0.440  1.00 0.00 ? 36  LEU A HD23 4  
ATOM 5720  N N    . GLY A 1 37  ? -3.201  10.951  -5.086  1.00 0.00 ? 37  GLY A N    4  
ATOM 5721  C CA   . GLY A 1 37  ? -3.706  10.704  -6.426  1.00 0.00 ? 37  GLY A CA   4  
ATOM 5722  C C    . GLY A 1 37  ? -4.080  9.232   -6.608  1.00 0.00 ? 37  GLY A C    4  
ATOM 5723  O O    . GLY A 1 37  ? -4.712  8.866   -7.599  1.00 0.00 ? 37  GLY A O    4  
ATOM 5724  H H    . GLY A 1 37  ? -3.889  10.915  -4.362  1.00 0.00 ? 37  GLY A H    4  
ATOM 5725  H HA2  . GLY A 1 37  ? -4.579  11.330  -6.610  1.00 0.00 ? 37  GLY A HA2  4  
ATOM 5726  H HA3  . GLY A 1 37  ? -2.952  10.985  -7.161  1.00 0.00 ? 37  GLY A HA3  4  
ATOM 5727  N N    . GLY A 1 38  ? -3.675  8.426   -5.638  1.00 0.00 ? 38  GLY A N    4  
ATOM 5728  C CA   . GLY A 1 38  ? -3.959  7.002   -5.679  1.00 0.00 ? 38  GLY A CA   4  
ATOM 5729  C C    . GLY A 1 38  ? -5.420  6.724   -5.319  1.00 0.00 ? 38  GLY A C    4  
ATOM 5730  O O    . GLY A 1 38  ? -6.267  7.612   -5.416  1.00 0.00 ? 38  GLY A O    4  
ATOM 5731  H H    . GLY A 1 38  ? -3.161  8.732   -4.836  1.00 0.00 ? 38  GLY A H    4  
ATOM 5732  H HA2  . GLY A 1 38  ? -3.746  6.614   -6.674  1.00 0.00 ? 38  GLY A HA2  4  
ATOM 5733  H HA3  . GLY A 1 38  ? -3.304  6.477   -4.984  1.00 0.00 ? 38  GLY A HA3  4  
ATOM 5734  N N    . LYS A 1 39  ? -5.672  5.489   -4.912  1.00 0.00 ? 39  LYS A N    4  
ATOM 5735  C CA   . LYS A 1 39  ? -7.016  5.083   -4.538  1.00 0.00 ? 39  LYS A CA   4  
ATOM 5736  C C    . LYS A 1 39  ? -6.945  3.792   -3.720  1.00 0.00 ? 39  LYS A C    4  
ATOM 5737  O O    . LYS A 1 39  ? -6.326  2.817   -4.145  1.00 0.00 ? 39  LYS A O    4  
ATOM 5738  C CB   . LYS A 1 39  ? -7.908  4.979   -5.776  1.00 0.00 ? 39  LYS A CB   4  
ATOM 5739  C CG   . LYS A 1 39  ? -8.661  6.289   -6.021  1.00 0.00 ? 39  LYS A CG   4  
ATOM 5740  C CD   . LYS A 1 39  ? -10.174 6.063   -6.007  1.00 0.00 ? 39  LYS A CD   4  
ATOM 5741  C CE   . LYS A 1 39  ? -10.848 6.797   -7.168  1.00 0.00 ? 39  LYS A CE   4  
ATOM 5742  N NZ   . LYS A 1 39  ? -12.145 6.165   -7.497  1.00 0.00 ? 39  LYS A NZ   4  
ATOM 5743  H H    . LYS A 1 39  ? -4.978  4.773   -4.836  1.00 0.00 ? 39  LYS A H    4  
ATOM 5744  H HA   . LYS A 1 39  ? -7.430  5.869   -3.907  1.00 0.00 ? 39  LYS A HA   4  
ATOM 5745  H HB2  . LYS A 1 39  ? -7.301  4.736   -6.648  1.00 0.00 ? 39  LYS A HB2  4  
ATOM 5746  H HB3  . LYS A 1 39  ? -8.621  4.165   -5.647  1.00 0.00 ? 39  LYS A HB3  4  
ATOM 5747  H HG2  . LYS A 1 39  ? -8.391  7.016   -5.256  1.00 0.00 ? 39  LYS A HG2  4  
ATOM 5748  H HG3  . LYS A 1 39  ? -8.361  6.710   -6.981  1.00 0.00 ? 39  LYS A HG3  4  
ATOM 5749  H HD2  . LYS A 1 39  ? -10.386 4.996   -6.074  1.00 0.00 ? 39  LYS A HD2  4  
ATOM 5750  H HD3  . LYS A 1 39  ? -10.588 6.412   -5.061  1.00 0.00 ? 39  LYS A HD3  4  
ATOM 5751  H HE2  . LYS A 1 39  ? -11.003 7.843   -6.904  1.00 0.00 ? 39  LYS A HE2  4  
ATOM 5752  H HE3  . LYS A 1 39  ? -10.198 6.782   -8.042  1.00 0.00 ? 39  LYS A HE3  4  
ATOM 5753  H HZ1  . LYS A 1 39  ? -12.830 6.875   -7.662  1.00 0.00 ? 39  LYS A HZ1  4  
ATOM 5754  H HZ2  . LYS A 1 39  ? -12.044 5.602   -8.317  1.00 0.00 ? 39  LYS A HZ2  4  
ATOM 5755  H HZ3  . LYS A 1 39  ? -12.439 5.590   -6.733  1.00 0.00 ? 39  LYS A HZ3  4  
ATOM 5756  N N    . LEU A 1 40  ? -7.587  3.826   -2.562  1.00 0.00 ? 40  LEU A N    4  
ATOM 5757  C CA   . LEU A 1 40  ? -7.605  2.671   -1.681  1.00 0.00 ? 40  LEU A CA   4  
ATOM 5758  C C    . LEU A 1 40  ? -8.549  1.612   -2.256  1.00 0.00 ? 40  LEU A C    4  
ATOM 5759  O O    . LEU A 1 40  ? -9.635  1.936   -2.732  1.00 0.00 ? 40  LEU A O    4  
ATOM 5760  C CB   . LEU A 1 40  ? -7.950  3.092   -0.252  1.00 0.00 ? 40  LEU A CB   4  
ATOM 5761  C CG   . LEU A 1 40  ? -7.724  2.035   0.832   1.00 0.00 ? 40  LEU A CG   4  
ATOM 5762  C CD1  . LEU A 1 40  ? -6.786  2.559   1.921   1.00 0.00 ? 40  LEU A CD1  4  
ATOM 5763  C CD2  . LEU A 1 40  ? -9.055  1.547   1.408   1.00 0.00 ? 40  LEU A CD2  4  
ATOM 5764  H H    . LEU A 1 40  ? -8.088  4.623   -2.224  1.00 0.00 ? 40  LEU A H    4  
ATOM 5765  H HA   . LEU A 1 40  ? -6.596  2.260   -1.661  1.00 0.00 ? 40  LEU A HA   4  
ATOM 5766  H HB2  . LEU A 1 40  ? -7.360  3.973   -0.001  1.00 0.00 ? 40  LEU A HB2  4  
ATOM 5767  H HB3  . LEU A 1 40  ? -8.998  3.392   -0.226  1.00 0.00 ? 40  LEU A HB3  4  
ATOM 5768  H HG   . LEU A 1 40  ? -7.237  1.175   0.374   1.00 0.00 ? 40  LEU A HG   4  
ATOM 5769  H HD11 . LEU A 1 40  ? -6.916  1.968   2.827   1.00 0.00 ? 40  LEU A HD11 4  
ATOM 5770  H HD12 . LEU A 1 40  ? -5.754  2.481   1.580   1.00 0.00 ? 40  LEU A HD12 4  
ATOM 5771  H HD13 . LEU A 1 40  ? -7.021  3.603   2.132   1.00 0.00 ? 40  LEU A HD13 4  
ATOM 5772  H HD21 . LEU A 1 40  ? -9.503  2.338   2.009   1.00 0.00 ? 40  LEU A HD21 4  
ATOM 5773  H HD22 . LEU A 1 40  ? -9.729  1.285   0.592   1.00 0.00 ? 40  LEU A HD22 4  
ATOM 5774  H HD23 . LEU A 1 40  ? -8.881  0.670   2.031   1.00 0.00 ? 40  LEU A HD23 4  
ATOM 5775  N N    . THR A 1 41  ? -8.099  0.367   -2.191  1.00 0.00 ? 41  THR A N    4  
ATOM 5776  C CA   . THR A 1 41  ? -8.889  -0.741  -2.699  1.00 0.00 ? 41  THR A CA   4  
ATOM 5777  C C    . THR A 1 41  ? -9.112  -1.784  -1.601  1.00 0.00 ? 41  THR A C    4  
ATOM 5778  O O    . THR A 1 41  ? -8.497  -1.713  -0.539  1.00 0.00 ? 41  THR A O    4  
ATOM 5779  C CB   . THR A 1 41  ? -8.181  -1.301  -3.934  1.00 0.00 ? 41  THR A CB   4  
ATOM 5780  O OG1  . THR A 1 41  ? -8.958  -2.440  -4.294  1.00 0.00 ? 41  THR A OG1  4  
ATOM 5781  C CG2  . THR A 1 41  ? -6.802  -1.879  -3.607  1.00 0.00 ? 41  THR A CG2  4  
ATOM 5782  H H    . THR A 1 41  ? -7.214  0.112   -1.802  1.00 0.00 ? 41  THR A H    4  
ATOM 5783  H HA   . THR A 1 41  ? -9.871  -0.362  -2.983  1.00 0.00 ? 41  THR A HA   4  
ATOM 5784  H HB   . THR A 1 41  ? -8.111  -0.547  -4.718  1.00 0.00 ? 41  THR A HB   4  
ATOM 5785  H HG1  . THR A 1 41  ? -9.359  -2.308  -5.200  1.00 0.00 ? 41  THR A HG1  4  
ATOM 5786  H HG21 . THR A 1 41  ? -6.216  -1.136  -3.066  1.00 0.00 ? 41  THR A HG21 4  
ATOM 5787  H HG22 . THR A 1 41  ? -6.919  -2.769  -2.990  1.00 0.00 ? 41  THR A HG22 4  
ATOM 5788  H HG23 . THR A 1 41  ? -6.290  -2.142  -4.532  1.00 0.00 ? 41  THR A HG23 4  
ATOM 5789  N N    . GLY A 1 42  ? -9.993  -2.728  -1.897  1.00 0.00 ? 42  GLY A N    4  
ATOM 5790  C CA   . GLY A 1 42  ? -10.304 -3.784  -0.949  1.00 0.00 ? 42  GLY A CA   4  
ATOM 5791  C C    . GLY A 1 42  ? -9.655  -5.105  -1.367  1.00 0.00 ? 42  GLY A C    4  
ATOM 5792  O O    . GLY A 1 42  ? -9.200  -5.873  -0.520  1.00 0.00 ? 42  GLY A O    4  
ATOM 5793  H H    . GLY A 1 42  ? -10.489 -2.779  -2.764  1.00 0.00 ? 42  GLY A H    4  
ATOM 5794  H HA2  . GLY A 1 42  ? -9.955  -3.501  0.044   1.00 0.00 ? 42  GLY A HA2  4  
ATOM 5795  H HA3  . GLY A 1 42  ? -11.385 -3.911  -0.882  1.00 0.00 ? 42  GLY A HA3  4  
ATOM 5796  N N    . THR A 1 43  ? -9.634  -5.330  -2.672  1.00 0.00 ? 43  THR A N    4  
ATOM 5797  C CA   . THR A 1 43  ? -9.049  -6.545  -3.213  1.00 0.00 ? 43  THR A CA   4  
ATOM 5798  C C    . THR A 1 43  ? -7.544  -6.364  -3.424  1.00 0.00 ? 43  THR A C    4  
ATOM 5799  O O    . THR A 1 43  ? -7.104  -5.330  -3.925  1.00 0.00 ? 43  THR A O    4  
ATOM 5800  C CB   . THR A 1 43  ? -9.803  -6.904  -4.494  1.00 0.00 ? 43  THR A CB   4  
ATOM 5801  O OG1  . THR A 1 43  ? -11.175 -6.879  -4.108  1.00 0.00 ? 43  THR A OG1  4  
ATOM 5802  C CG2  . THR A 1 43  ? -9.565  -8.352  -4.928  1.00 0.00 ? 43  THR A CG2  4  
ATOM 5803  H H    . THR A 1 43  ? -10.007 -4.701  -3.354  1.00 0.00 ? 43  THR A H    4  
ATOM 5804  H HA   . THR A 1 43  ? -9.175  -7.343  -2.481  1.00 0.00 ? 43  THR A HA   4  
ATOM 5805  H HB   . THR A 1 43  ? -9.556  -6.211  -5.298  1.00 0.00 ? 43  THR A HB   4  
ATOM 5806  H HG1  . THR A 1 43  ? -11.377 -7.657  -3.514  1.00 0.00 ? 43  THR A HG1  4  
ATOM 5807  H HG21 . THR A 1 43  ? -9.081  -8.899  -4.119  1.00 0.00 ? 43  THR A HG21 4  
ATOM 5808  H HG22 . THR A 1 43  ? -10.520 -8.822  -5.164  1.00 0.00 ? 43  THR A HG22 4  
ATOM 5809  H HG23 . THR A 1 43  ? -8.925  -8.367  -5.810  1.00 0.00 ? 43  THR A HG23 4  
ATOM 5810  N N    . ALA A 1 44  ? -6.797  -7.385  -3.032  1.00 0.00 ? 44  ALA A N    4  
ATOM 5811  C CA   . ALA A 1 44  ? -5.351  -7.351  -3.172  1.00 0.00 ? 44  ALA A CA   4  
ATOM 5812  C C    . ALA A 1 44  ? -4.980  -7.569  -4.641  1.00 0.00 ? 44  ALA A C    4  
ATOM 5813  O O    . ALA A 1 44  ? -4.288  -6.746  -5.238  1.00 0.00 ? 44  ALA A O    4  
ATOM 5814  C CB   . ALA A 1 44  ? -4.724  -8.400  -2.252  1.00 0.00 ? 44  ALA A CB   4  
ATOM 5815  H H    . ALA A 1 44  ? -7.162  -8.222  -2.626  1.00 0.00 ? 44  ALA A H    4  
ATOM 5816  H HA   . ALA A 1 44  ? -5.010  -6.364  -2.862  1.00 0.00 ? 44  ALA A HA   4  
ATOM 5817  H HB1  . ALA A 1 44  ? -3.881  -8.871  -2.758  1.00 0.00 ? 44  ALA A HB1  4  
ATOM 5818  H HB2  . ALA A 1 44  ? -4.376  -7.919  -1.337  1.00 0.00 ? 44  ALA A HB2  4  
ATOM 5819  H HB3  . ALA A 1 44  ? -5.468  -9.157  -2.004  1.00 0.00 ? 44  ALA A HB3  4  
ATOM 5820  N N    . ASN A 1 45  ? -5.457  -8.681  -5.180  1.00 0.00 ? 45  ASN A N    4  
ATOM 5821  C CA   . ASN A 1 45  ? -5.185  -9.016  -6.568  1.00 0.00 ? 45  ASN A CA   4  
ATOM 5822  C C    . ASN A 1 45  ? -5.407  -7.779  -7.440  1.00 0.00 ? 45  ASN A C    4  
ATOM 5823  O O    . ASN A 1 45  ? -4.665  -7.546  -8.393  1.00 0.00 ? 45  ASN A O    4  
ATOM 5824  C CB   . ASN A 1 45  ? -6.123  -10.118 -7.062  1.00 0.00 ? 45  ASN A CB   4  
ATOM 5825  C CG   . ASN A 1 45  ? -5.387  -11.092 -7.985  1.00 0.00 ? 45  ASN A CG   4  
ATOM 5826  O OD1  . ASN A 1 45  ? -4.526  -10.719 -8.764  1.00 0.00 ? 45  ASN A OD1  4  
ATOM 5827  N ND2  . ASN A 1 45  ? -5.773  -12.358 -7.854  1.00 0.00 ? 45  ASN A ND2  4  
ATOM 5828  H H    . ASN A 1 45  ? -6.020  -9.344  -4.688  1.00 0.00 ? 45  ASN A H    4  
ATOM 5829  H HA   . ASN A 1 45  ? -4.149  -9.356  -6.582  1.00 0.00 ? 45  ASN A HA   4  
ATOM 5830  H HB2  . ASN A 1 45  ? -6.535  -10.660 -6.211  1.00 0.00 ? 45  ASN A HB2  4  
ATOM 5831  H HB3  . ASN A 1 45  ? -6.964  -9.673  -7.594  1.00 0.00 ? 45  ASN A HB3  4  
ATOM 5832  H HD21 . ASN A 1 45  ? -6.487  -12.598 -7.196  1.00 0.00 ? 45  ASN A HD21 4  
ATOM 5833  H HD22 . ASN A 1 45  ? -5.351  -13.070 -8.415  1.00 0.00 ? 45  ASN A HD22 4  
ATOM 5834  N N    . LYS A 1 46  ? -6.432  -7.019  -7.084  1.00 0.00 ? 46  LYS A N    4  
ATOM 5835  C CA   . LYS A 1 46  ? -6.761  -5.812  -7.822  1.00 0.00 ? 46  LYS A CA   4  
ATOM 5836  C C    . LYS A 1 46  ? -6.138  -4.604  -7.121  1.00 0.00 ? 46  LYS A C    4  
ATOM 5837  O O    . LYS A 1 46  ? -6.794  -3.579  -6.942  1.00 0.00 ? 46  LYS A O    4  
ATOM 5838  C CB   . LYS A 1 46  ? -8.275  -5.698  -8.015  1.00 0.00 ? 46  LYS A CB   4  
ATOM 5839  C CG   . LYS A 1 46  ? -8.816  -6.881  -8.821  1.00 0.00 ? 46  LYS A CG   4  
ATOM 5840  C CD   . LYS A 1 46  ? -9.594  -6.399  -10.047 1.00 0.00 ? 46  LYS A CD   4  
ATOM 5841  C CE   . LYS A 1 46  ? -10.138 -7.582  -10.850 1.00 0.00 ? 46  LYS A CE   4  
ATOM 5842  N NZ   . LYS A 1 46  ? -10.239 -7.232  -12.285 1.00 0.00 ? 46  LYS A NZ   4  
ATOM 5843  H H    . LYS A 1 46  ? -7.031  -7.216  -6.307  1.00 0.00 ? 46  LYS A H    4  
ATOM 5844  H HA   . LYS A 1 46  ? -6.316  -5.904  -8.813  1.00 0.00 ? 46  LYS A HA   4  
ATOM 5845  H HB2  . LYS A 1 46  ? -8.767  -5.659  -7.044  1.00 0.00 ? 46  LYS A HB2  4  
ATOM 5846  H HB3  . LYS A 1 46  ? -8.510  -4.766  -8.529  1.00 0.00 ? 46  LYS A HB3  4  
ATOM 5847  H HG2  . LYS A 1 46  ? -7.990  -7.518  -9.137  1.00 0.00 ? 46  LYS A HG2  4  
ATOM 5848  H HG3  . LYS A 1 46  ? -9.464  -7.489  -8.190  1.00 0.00 ? 46  LYS A HG3  4  
ATOM 5849  H HD2  . LYS A 1 46  ? -10.418 -5.760  -9.731  1.00 0.00 ? 46  LYS A HD2  4  
ATOM 5850  H HD3  . LYS A 1 46  ? -8.945  -5.794  -10.679 1.00 0.00 ? 46  LYS A HD3  4  
ATOM 5851  H HE2  . LYS A 1 46  ? -9.484  -8.446  -10.726 1.00 0.00 ? 46  LYS A HE2  4  
ATOM 5852  H HE3  . LYS A 1 46  ? -11.119 -7.868  -10.470 1.00 0.00 ? 46  LYS A HE3  4  
ATOM 5853  H HZ1  . LYS A 1 46  ? -9.689  -7.871  -12.823 1.00 0.00 ? 46  LYS A HZ1  4  
ATOM 5854  H HZ2  . LYS A 1 46  ? -11.194 -7.288  -12.575 1.00 0.00 ? 46  LYS A HZ2  4  
ATOM 5855  H HZ3  . LYS A 1 46  ? -9.901  -6.301  -12.425 1.00 0.00 ? 46  LYS A HZ3  4  
ATOM 5856  N N    . ALA A 1 47  ? -4.879  -4.765  -6.742  1.00 0.00 ? 47  ALA A N    4  
ATOM 5857  C CA   . ALA A 1 47  ? -4.159  -3.700  -6.063  1.00 0.00 ? 47  ALA A CA   4  
ATOM 5858  C C    . ALA A 1 47  ? -2.745  -3.599  -6.637  1.00 0.00 ? 47  ALA A C    4  
ATOM 5859  O O    . ALA A 1 47  ? -2.227  -4.566  -7.195  1.00 0.00 ? 47  ALA A O    4  
ATOM 5860  C CB   . ALA A 1 47  ? -4.160  -3.963  -4.556  1.00 0.00 ? 47  ALA A CB   4  
ATOM 5861  H H    . ALA A 1 47  ? -4.352  -5.602  -6.891  1.00 0.00 ? 47  ALA A H    4  
ATOM 5862  H HA   . ALA A 1 47  ? -4.688  -2.766  -6.257  1.00 0.00 ? 47  ALA A HA   4  
ATOM 5863  H HB1  . ALA A 1 47  ? -4.346  -3.030  -4.024  1.00 0.00 ? 47  ALA A HB1  4  
ATOM 5864  H HB2  . ALA A 1 47  ? -4.942  -4.682  -4.313  1.00 0.00 ? 47  ALA A HB2  4  
ATOM 5865  H HB3  . ALA A 1 47  ? -3.192  -4.364  -4.257  1.00 0.00 ? 47  ALA A HB3  4  
ATOM 5866  N N    . SER A 1 48  ? -2.159  -2.421  -6.481  1.00 0.00 ? 48  SER A N    4  
ATOM 5867  C CA   . SER A 1 48  ? -0.815  -2.182  -6.977  1.00 0.00 ? 48  SER A CA   4  
ATOM 5868  C C    . SER A 1 48  ? 0.175   -2.149  -5.811  1.00 0.00 ? 48  SER A C    4  
ATOM 5869  O O    . SER A 1 48  ? 1.336   -2.524  -5.967  1.00 0.00 ? 48  SER A O    4  
ATOM 5870  C CB   . SER A 1 48  ? -0.744  -0.875  -7.769  1.00 0.00 ? 48  SER A CB   4  
ATOM 5871  O OG   . SER A 1 48  ? -1.394  -0.981  -9.033  1.00 0.00 ? 48  SER A OG   4  
ATOM 5872  H H    . SER A 1 48  ? -2.587  -1.640  -6.027  1.00 0.00 ? 48  SER A H    4  
ATOM 5873  H HA   . SER A 1 48  ? -0.598  -3.020  -7.640  1.00 0.00 ? 48  SER A HA   4  
ATOM 5874  H HB2  . SER A 1 48  ? -1.206  -0.075  -7.191  1.00 0.00 ? 48  SER A HB2  4  
ATOM 5875  H HB3  . SER A 1 48  ? 0.299   -0.598  -7.920  1.00 0.00 ? 48  SER A HB3  4  
ATOM 5876  H HG   . SER A 1 48  ? -0.713  -1.037  -9.764  1.00 0.00 ? 48  SER A HG   4  
ATOM 5877  N N    . LEU A 1 49  ? -0.321  -1.698  -4.668  1.00 0.00 ? 49  LEU A N    4  
ATOM 5878  C CA   . LEU A 1 49  ? 0.506   -1.612  -3.476  1.00 0.00 ? 49  LEU A CA   4  
ATOM 5879  C C    . LEU A 1 49  ? -0.284  -2.135  -2.274  1.00 0.00 ? 49  LEU A C    4  
ATOM 5880  O O    . LEU A 1 49  ? -1.491  -2.353  -2.368  1.00 0.00 ? 49  LEU A O    4  
ATOM 5881  C CB   . LEU A 1 49  ? 1.034   -0.188  -3.292  1.00 0.00 ? 49  LEU A CB   4  
ATOM 5882  C CG   . LEU A 1 49  ? 2.536   0.005   -3.513  1.00 0.00 ? 49  LEU A CG   4  
ATOM 5883  C CD1  . LEU A 1 49  ? 2.923   1.480   -3.394  1.00 0.00 ? 49  LEU A CD1  4  
ATOM 5884  C CD2  . LEU A 1 49  ? 3.347   -0.879  -2.564  1.00 0.00 ? 49  LEU A CD2  4  
ATOM 5885  H H    . LEU A 1 49  ? -1.266  -1.395  -4.550  1.00 0.00 ? 49  LEU A H    4  
ATOM 5886  H HA   . LEU A 1 49  ? 1.369   -2.258  -3.630  1.00 0.00 ? 49  LEU A HA   4  
ATOM 5887  H HB2  . LEU A 1 49  ? 0.499   0.469   -3.978  1.00 0.00 ? 49  LEU A HB2  4  
ATOM 5888  H HB3  . LEU A 1 49  ? 0.790   0.141   -2.282  1.00 0.00 ? 49  LEU A HB3  4  
ATOM 5889  H HG   . LEU A 1 49  ? 2.775   -0.310  -4.529  1.00 0.00 ? 49  LEU A HG   4  
ATOM 5890  H HD11 . LEU A 1 49  ? 3.927   1.559   -2.977  1.00 0.00 ? 49  LEU A HD11 4  
ATOM 5891  H HD12 . LEU A 1 49  ? 2.902   1.942   -4.381  1.00 0.00 ? 49  LEU A HD12 4  
ATOM 5892  H HD13 . LEU A 1 49  ? 2.216   1.989   -2.739  1.00 0.00 ? 49  LEU A HD13 4  
ATOM 5893  H HD21 . LEU A 1 49  ? 4.411   -0.699  -2.719  1.00 0.00 ? 49  LEU A HD21 4  
ATOM 5894  H HD22 . LEU A 1 49  ? 3.085   -0.642  -1.533  1.00 0.00 ? 49  LEU A HD22 4  
ATOM 5895  H HD23 . LEU A 1 49  ? 3.124   -1.928  -2.763  1.00 0.00 ? 49  LEU A HD23 4  
ATOM 5896  N N    . CYS A 1 50  ? 0.429   -2.321  -1.174  1.00 0.00 ? 50  CYS A N    4  
ATOM 5897  C CA   . CYS A 1 50  ? -0.190  -2.814  0.045   1.00 0.00 ? 50  CYS A CA   4  
ATOM 5898  C C    . CYS A 1 50  ? 0.479   -2.125  1.236   1.00 0.00 ? 50  CYS A C    4  
ATOM 5899  O O    . CYS A 1 50  ? 1.702   -2.151  1.366   1.00 0.00 ? 50  CYS A O    4  
ATOM 5900  C CB   . CYS A 1 50  ? -0.105  -4.338  0.145   1.00 0.00 ? 50  CYS A CB   4  
ATOM 5901  S SG   . CYS A 1 50  ? -1.372  -4.960  1.310   1.00 0.00 ? 50  CYS A SG   4  
ATOM 5902  H H    . CYS A 1 50  ? 1.411   -2.141  -1.106  1.00 0.00 ? 50  CYS A H    4  
ATOM 5903  H HA   . CYS A 1 50  ? -1.246  -2.550  -0.011  1.00 0.00 ? 50  CYS A HA   4  
ATOM 5904  H HB2  . CYS A 1 50  ? -0.253  -4.785  -0.838  1.00 0.00 ? 50  CYS A HB2  4  
ATOM 5905  H HB3  . CYS A 1 50  ? 0.888   -4.634  0.483   1.00 0.00 ? 50  CYS A HB3  4  
ATOM 5906  H HG   . CYS A 1 50  ? -1.706  -3.770  1.801   1.00 0.00 ? 50  CYS A HG   4  
ATOM 5907  N N    . ILE A 1 51  ? -0.352  -1.526  2.076   1.00 0.00 ? 51  ILE A N    4  
ATOM 5908  C CA   . ILE A 1 51  ? 0.143   -0.832  3.252   1.00 0.00 ? 51  ILE A CA   4  
ATOM 5909  C C    . ILE A 1 51  ? -0.334  -1.562  4.509   1.00 0.00 ? 51  ILE A C    4  
ATOM 5910  O O    . ILE A 1 51  ? -1.444  -1.328  4.983   1.00 0.00 ? 51  ILE A O    4  
ATOM 5911  C CB   . ILE A 1 51  ? -0.255  0.645   3.210   1.00 0.00 ? 51  ILE A CB   4  
ATOM 5912  C CG1  . ILE A 1 51  ? 0.350   1.342   1.990   1.00 0.00 ? 51  ILE A CG1  4  
ATOM 5913  C CG2  . ILE A 1 51  ? 0.117   1.350   4.516   1.00 0.00 ? 51  ILE A CG2  4  
ATOM 5914  C CD1  . ILE A 1 51  ? 0.009   2.833   1.985   1.00 0.00 ? 51  ILE A CD1  4  
ATOM 5915  H H    . ILE A 1 51  ? -1.346  -1.510  1.963   1.00 0.00 ? 51  ILE A H    4  
ATOM 5916  H HA   . ILE A 1 51  ? 1.232   -0.873  3.221   1.00 0.00 ? 51  ILE A HA   4  
ATOM 5917  H HB   . ILE A 1 51  ? -1.339  0.704   3.110   1.00 0.00 ? 51  ILE A HB   4  
ATOM 5918  H HG12 . ILE A 1 51  ? 1.433   1.213   1.993   1.00 0.00 ? 51  ILE A HG12 4  
ATOM 5919  H HG13 . ILE A 1 51  ? -0.024  0.877   1.078   1.00 0.00 ? 51  ILE A HG13 4  
ATOM 5920  H HG21 . ILE A 1 51  ? 0.778   2.190   4.300   1.00 0.00 ? 51  ILE A HG21 4  
ATOM 5921  H HG22 . ILE A 1 51  ? -0.788  1.716   5.002   1.00 0.00 ? 51  ILE A HG22 4  
ATOM 5922  H HG23 . ILE A 1 51  ? 0.625   0.648   5.177   1.00 0.00 ? 51  ILE A HG23 4  
ATOM 5923  H HD11 . ILE A 1 51  ? -1.013  2.973   2.337   1.00 0.00 ? 51  ILE A HD11 4  
ATOM 5924  H HD12 . ILE A 1 51  ? 0.696   3.365   2.644   1.00 0.00 ? 51  ILE A HD12 4  
ATOM 5925  H HD13 . ILE A 1 51  ? 0.102   3.224   0.972   1.00 0.00 ? 51  ILE A HD13 4  
ATOM 5926  N N    . SER A 1 52  ? 0.529   -2.433  5.012   1.00 0.00 ? 52  SER A N    4  
ATOM 5927  C CA   . SER A 1 52  ? 0.209   -3.199  6.205   1.00 0.00 ? 52  SER A CA   4  
ATOM 5928  C C    . SER A 1 52  ? 1.317   -3.031  7.247   1.00 0.00 ? 52  SER A C    4  
ATOM 5929  O O    . SER A 1 52  ? 2.218   -2.212  7.074   1.00 0.00 ? 52  SER A O    4  
ATOM 5930  C CB   . SER A 1 52  ? 0.014   -4.679  5.872   1.00 0.00 ? 52  SER A CB   4  
ATOM 5931  O OG   . SER A 1 52  ? -0.862  -5.322  6.794   1.00 0.00 ? 52  SER A OG   4  
ATOM 5932  H H    . SER A 1 52  ? 1.430   -2.617  4.620   1.00 0.00 ? 52  SER A H    4  
ATOM 5933  H HA   . SER A 1 52  ? -0.728  -2.783  6.572   1.00 0.00 ? 52  SER A HA   4  
ATOM 5934  H HB2  . SER A 1 52  ? -0.388  -4.774  4.864   1.00 0.00 ? 52  SER A HB2  4  
ATOM 5935  H HB3  . SER A 1 52  ? 0.980   -5.183  5.879   1.00 0.00 ? 52  SER A HB3  4  
ATOM 5936  H HG   . SER A 1 52  ? -1.547  -4.673  7.124   1.00 0.00 ? 52  SER A HG   4  
ATOM 5937  N N    . THR A 1 53  ? 1.213   -3.819  8.307   1.00 0.00 ? 53  THR A N    4  
ATOM 5938  C CA   . THR A 1 53  ? 2.194   -3.768  9.377   1.00 0.00 ? 53  THR A CA   4  
ATOM 5939  C C    . THR A 1 53  ? 3.016   -5.058  9.409   1.00 0.00 ? 53  THR A C    4  
ATOM 5940  O O    . THR A 1 53  ? 2.582   -6.088  8.895   1.00 0.00 ? 53  THR A O    4  
ATOM 5941  C CB   . THR A 1 53  ? 1.453   -3.487  10.685  1.00 0.00 ? 53  THR A CB   4  
ATOM 5942  O OG1  . THR A 1 53  ? 0.452   -4.500  10.742  1.00 0.00 ? 53  THR A OG1  4  
ATOM 5943  C CG2  . THR A 1 53  ? 0.658   -2.181  10.639  1.00 0.00 ? 53  THR A CG2  4  
ATOM 5944  H H    . THR A 1 53  ? 0.477   -4.483  8.440   1.00 0.00 ? 53  THR A H    4  
ATOM 5945  H HA   . THR A 1 53  ? 2.887   -2.953  9.169   1.00 0.00 ? 53  THR A HA   4  
ATOM 5946  H HB   . THR A 1 53  ? 2.140   -3.495  11.531  1.00 0.00 ? 53  THR A HB   4  
ATOM 5947  H HG1  . THR A 1 53  ? 0.840   -5.380  10.465  1.00 0.00 ? 53  THR A HG1  4  
ATOM 5948  H HG21 . THR A 1 53  ? -0.306  -2.359  10.163  1.00 0.00 ? 53  THR A HG21 4  
ATOM 5949  H HG22 . THR A 1 53  ? 0.500   -1.815  11.654  1.00 0.00 ? 53  THR A HG22 4  
ATOM 5950  H HG23 . THR A 1 53  ? 1.214   -1.437  10.067  1.00 0.00 ? 53  THR A HG23 4  
ATOM 5951  N N    . LYS A 1 54  ? 4.189   -4.960  10.018  1.00 0.00 ? 54  LYS A N    4  
ATOM 5952  C CA   . LYS A 1 54  ? 5.075   -6.106  10.124  1.00 0.00 ? 54  LYS A CA   4  
ATOM 5953  C C    . LYS A 1 54  ? 4.269   -7.330  10.564  1.00 0.00 ? 54  LYS A C    4  
ATOM 5954  O O    . LYS A 1 54  ? 4.271   -8.356  9.884   1.00 0.00 ? 54  LYS A O    4  
ATOM 5955  C CB   . LYS A 1 54  ? 6.257   -5.787  11.042  1.00 0.00 ? 54  LYS A CB   4  
ATOM 5956  C CG   . LYS A 1 54  ? 6.939   -7.068  11.524  1.00 0.00 ? 54  LYS A CG   4  
ATOM 5957  C CD   . LYS A 1 54  ? 8.443   -6.854  11.706  1.00 0.00 ? 54  LYS A CD   4  
ATOM 5958  C CE   . LYS A 1 54  ? 9.211   -7.247  10.443  1.00 0.00 ? 54  LYS A CE   4  
ATOM 5959  N NZ   . LYS A 1 54  ? 10.644  -6.902  10.578  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 5960  H H    . LYS A 1 54  ? 4.534   -4.119  10.434  1.00 0.00 ? 54  LYS A H    4  
ATOM 5961  H HA   . LYS A 1 54  ? 5.481   -6.298  9.131   1.00 0.00 ? 54  LYS A HA   4  
ATOM 5962  H HB2  . LYS A 1 54  ? 6.978   -5.165  10.510  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 5963  H HB3  . LYS A 1 54  ? 5.911   -5.210  11.899  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 5964  H HG2  . LYS A 1 54  ? 6.497   -7.387  12.467  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 5965  H HG3  . LYS A 1 54  ? 6.767   -7.869  10.804  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 5966  H HD2  . LYS A 1 54  ? 8.639   -5.808  11.944  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 5967  H HD3  . LYS A 1 54  ? 8.799   -7.445  12.551  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 5968  H HE2  . LYS A 1 54  ? 9.103   -8.317  10.263  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 5969  H HE3  . LYS A 1 54  ? 8.787   -6.735  9.579   1.00 0.00 ? 54  LYS A HE3  4  
ATOM 5970  H HZ1  . LYS A 1 54  ? 11.192  -7.737  10.540  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 5971  H HZ2  . LYS A 1 54  ? 10.911  -6.293  9.832   1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 5972  H HZ3  . LYS A 1 54  ? 10.795  -6.444  11.454  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 5973  N N    . LYS A 1 55  ? 3.600   -7.182  11.697  1.00 0.00 ? 55  LYS A N    4  
ATOM 5974  C CA   . LYS A 1 55  ? 2.791   -8.263  12.235  1.00 0.00 ? 55  LYS A CA   4  
ATOM 5975  C C    . LYS A 1 55  ? 2.027   -8.939  11.095  1.00 0.00 ? 55  LYS A C    4  
ATOM 5976  O O    . LYS A 1 55  ? 2.307   -10.086 10.750  1.00 0.00 ? 55  LYS A O    4  
ATOM 5977  C CB   . LYS A 1 55  ? 1.889   -7.749  13.359  1.00 0.00 ? 55  LYS A CB   4  
ATOM 5978  C CG   . LYS A 1 55  ? 2.562   -7.919  14.723  1.00 0.00 ? 55  LYS A CG   4  
ATOM 5979  C CD   . LYS A 1 55  ? 3.009   -6.568  15.286  1.00 0.00 ? 55  LYS A CD   4  
ATOM 5980  C CE   . LYS A 1 55  ? 4.121   -6.747  16.322  1.00 0.00 ? 55  LYS A CE   4  
ATOM 5981  N NZ   . LYS A 1 55  ? 3.913   -5.834  17.468  1.00 0.00 ? 55  LYS A NZ   4  
ATOM 5982  H H    . LYS A 1 55  ? 3.604   -6.345  12.244  1.00 0.00 ? 55  LYS A H    4  
ATOM 5983  H HA   . LYS A 1 55  ? 3.471   -8.992  12.676  1.00 0.00 ? 55  LYS A HA   4  
ATOM 5984  H HB2  . LYS A 1 55  ? 1.658   -6.697  13.193  1.00 0.00 ? 55  LYS A HB2  4  
ATOM 5985  H HB3  . LYS A 1 55  ? 0.943   -8.289  13.347  1.00 0.00 ? 55  LYS A HB3  4  
ATOM 5986  H HG2  . LYS A 1 55  ? 1.870   -8.395  15.417  1.00 0.00 ? 55  LYS A HG2  4  
ATOM 5987  H HG3  . LYS A 1 55  ? 3.423   -8.580  14.628  1.00 0.00 ? 55  LYS A HG3  4  
ATOM 5988  H HD2  . LYS A 1 55  ? 3.361   -5.931  14.475  1.00 0.00 ? 55  LYS A HD2  4  
ATOM 5989  H HD3  . LYS A 1 55  ? 2.159   -6.062  15.744  1.00 0.00 ? 55  LYS A HD3  4  
ATOM 5990  H HE2  . LYS A 1 55  ? 4.139   -7.780  16.670  1.00 0.00 ? 55  LYS A HE2  4  
ATOM 5991  H HE3  . LYS A 1 55  ? 5.089   -6.549  15.862  1.00 0.00 ? 55  LYS A HE3  4  
ATOM 5992  H HZ1  . LYS A 1 55  ? 4.772   -5.367  17.682  1.00 0.00 ? 55  LYS A HZ1  4  
ATOM 5993  H HZ2  . LYS A 1 55  ? 3.216   -5.157  17.233  1.00 0.00 ? 55  LYS A HZ2  4  
ATOM 5994  H HZ3  . LYS A 1 55  ? 3.613   -6.360  18.263  1.00 0.00 ? 55  LYS A HZ3  4  
ATOM 5995  N N    . GLU A 1 56  ? 1.078   -8.199  10.541  1.00 0.00 ? 56  GLU A N    4  
ATOM 5996  C CA   . GLU A 1 56  ? 0.272   -8.713  9.447   1.00 0.00 ? 56  GLU A CA   4  
ATOM 5997  C C    . GLU A 1 56  ? 1.131   -9.561  8.507   1.00 0.00 ? 56  GLU A C    4  
ATOM 5998  O O    . GLU A 1 56  ? 0.911   -10.764 8.376   1.00 0.00 ? 56  GLU A O    4  
ATOM 5999  C CB   . GLU A 1 56  ? -0.411  -7.574  8.687   1.00 0.00 ? 56  GLU A CB   4  
ATOM 6000  C CG   . GLU A 1 56  ? -1.934  -7.692  8.774   1.00 0.00 ? 56  GLU A CG   4  
ATOM 6001  C CD   . GLU A 1 56  ? -2.425  -8.968  8.088   1.00 0.00 ? 56  GLU A CD   4  
ATOM 6002  O OE1  . GLU A 1 56  ? -1.871  -9.283  7.013   1.00 0.00 ? 56  GLU A OE1  4  
ATOM 6003  O OE2  . GLU A 1 56  ? -3.344  -9.599  8.654   1.00 0.00 ? 56  GLU A OE2  4  
ATOM 6004  H H    . GLU A 1 56  ? 0.857   -7.267  10.827  1.00 0.00 ? 56  GLU A H    4  
ATOM 6005  H HA   . GLU A 1 56  ? -0.490  -9.336  9.916   1.00 0.00 ? 56  GLU A HA   4  
ATOM 6006  H HB2  . GLU A 1 56  ? -0.093  -6.616  9.098   1.00 0.00 ? 56  GLU A HB2  4  
ATOM 6007  H HB3  . GLU A 1 56  ? -0.101  -7.591  7.642   1.00 0.00 ? 56  GLU A HB3  4  
ATOM 6008  H HG2  . GLU A 1 56  ? -2.243  -7.695  9.820   1.00 0.00 ? 56  GLU A HG2  4  
ATOM 6009  H HG3  . GLU A 1 56  ? -2.397  -6.822  8.308   1.00 0.00 ? 56  GLU A HG3  4  
ATOM 6010  N N    . VAL A 1 57  ? 2.092   -8.901  7.878   1.00 0.00 ? 57  VAL A N    4  
ATOM 6011  C CA   . VAL A 1 57  ? 2.985   -9.579  6.954   1.00 0.00 ? 57  VAL A CA   4  
ATOM 6012  C C    . VAL A 1 57  ? 3.529   -10.847 7.616   1.00 0.00 ? 57  VAL A C    4  
ATOM 6013  O O    . VAL A 1 57  ? 3.640   -11.889 6.971   1.00 0.00 ? 57  VAL A O    4  
ATOM 6014  C CB   . VAL A 1 57  ? 4.089   -8.623  6.496   1.00 0.00 ? 57  VAL A CB   4  
ATOM 6015  C CG1  . VAL A 1 57  ? 4.940   -9.257  5.395   1.00 0.00 ? 57  VAL A CG1  4  
ATOM 6016  C CG2  . VAL A 1 57  ? 3.501   -7.288  6.036   1.00 0.00 ? 57  VAL A CG2  4  
ATOM 6017  H H    . VAL A 1 57  ? 2.264   -7.922  7.990   1.00 0.00 ? 57  VAL A H    4  
ATOM 6018  H HA   . VAL A 1 57  ? 2.400   -9.863  6.079   1.00 0.00 ? 57  VAL A HA   4  
ATOM 6019  H HB   . VAL A 1 57  ? 4.737   -8.427  7.350   1.00 0.00 ? 57  VAL A HB   4  
ATOM 6020  H HG11 . VAL A 1 57  ? 5.815   -8.634  5.207   1.00 0.00 ? 57  VAL A HG11 4  
ATOM 6021  H HG12 . VAL A 1 57  ? 5.263   -10.250 5.710   1.00 0.00 ? 57  VAL A HG12 4  
ATOM 6022  H HG13 . VAL A 1 57  ? 4.351   -9.339  4.482   1.00 0.00 ? 57  VAL A HG13 4  
ATOM 6023  H HG21 . VAL A 1 57  ? 3.302   -6.660  6.904   1.00 0.00 ? 57  VAL A HG21 4  
ATOM 6024  H HG22 . VAL A 1 57  ? 4.212   -6.785  5.380   1.00 0.00 ? 57  VAL A HG22 4  
ATOM 6025  H HG23 . VAL A 1 57  ? 2.572   -7.467  5.495   1.00 0.00 ? 57  VAL A HG23 4  
ATOM 6026  N N    . GLU A 1 58  ? 3.852   -10.717 8.894   1.00 0.00 ? 58  GLU A N    4  
ATOM 6027  C CA   . GLU A 1 58  ? 4.382   -11.839 9.650   1.00 0.00 ? 58  GLU A CA   4  
ATOM 6028  C C    . GLU A 1 58  ? 3.295   -12.895 9.863   1.00 0.00 ? 58  GLU A C    4  
ATOM 6029  O O    . GLU A 1 58  ? 3.597   -14.072 10.054  1.00 0.00 ? 58  GLU A O    4  
ATOM 6030  C CB   . GLU A 1 58  ? 4.964   -11.375 10.986  1.00 0.00 ? 58  GLU A CB   4  
ATOM 6031  C CG   . GLU A 1 58  ? 6.430   -10.963 10.832  1.00 0.00 ? 58  GLU A CG   4  
ATOM 6032  C CD   . GLU A 1 58  ? 7.222   -11.269 12.105  1.00 0.00 ? 58  GLU A CD   4  
ATOM 6033  O OE1  . GLU A 1 58  ? 7.245   -10.382 12.985  1.00 0.00 ? 58  GLU A OE1  4  
ATOM 6034  O OE2  . GLU A 1 58  ? 7.787   -12.382 12.168  1.00 0.00 ? 58  GLU A OE2  4  
ATOM 6035  H H    . GLU A 1 58  ? 3.758   -9.866  9.411   1.00 0.00 ? 58  GLU A H    4  
ATOM 6036  H HA   . GLU A 1 58  ? 5.182   -12.251 9.035   1.00 0.00 ? 58  GLU A HA   4  
ATOM 6037  H HB2  . GLU A 1 58  ? 4.385   -10.533 11.367  1.00 0.00 ? 58  GLU A HB2  4  
ATOM 6038  H HB3  . GLU A 1 58  ? 4.883   -12.176 11.721  1.00 0.00 ? 58  GLU A HB3  4  
ATOM 6039  H HG2  . GLU A 1 58  ? 6.873   -11.492 9.988   1.00 0.00 ? 58  GLU A HG2  4  
ATOM 6040  H HG3  . GLU A 1 58  ? 6.491   -9.898  10.608  1.00 0.00 ? 58  GLU A HG3  4  
ATOM 6041  N N    . LYS A 1 59  ? 2.053   -12.436 9.824   1.00 0.00 ? 59  LYS A N    4  
ATOM 6042  C CA   . LYS A 1 59  ? 0.920   -13.326 10.011  1.00 0.00 ? 59  LYS A CA   4  
ATOM 6043  C C    . LYS A 1 59  ? 0.658   -14.091 8.712   1.00 0.00 ? 59  LYS A C    4  
ATOM 6044  O O    . LYS A 1 59  ? 0.222   -15.241 8.742   1.00 0.00 ? 59  LYS A O    4  
ATOM 6045  C CB   . LYS A 1 59  ? -0.295  -12.548 10.522  1.00 0.00 ? 59  LYS A CB   4  
ATOM 6046  C CG   . LYS A 1 59  ? 0.069   -11.707 11.748  1.00 0.00 ? 59  LYS A CG   4  
ATOM 6047  C CD   . LYS A 1 59  ? -0.583  -12.270 13.012  1.00 0.00 ? 59  LYS A CD   4  
ATOM 6048  C CE   . LYS A 1 59  ? -0.523  -11.257 14.157  1.00 0.00 ? 59  LYS A CE   4  
ATOM 6049  N NZ   . LYS A 1 59  ? 0.179   -11.836 15.325  1.00 0.00 ? 59  LYS A NZ   4  
ATOM 6050  H H    . LYS A 1 59  ? 1.816   -11.477 9.669   1.00 0.00 ? 59  LYS A H    4  
ATOM 6051  H HA   . LYS A 1 59  ? 1.192   -14.043 10.786  1.00 0.00 ? 59  LYS A HA   4  
ATOM 6052  H HB2  . LYS A 1 59  ? -0.675  -11.900 9.732   1.00 0.00 ? 59  LYS A HB2  4  
ATOM 6053  H HB3  . LYS A 1 59  ? -1.095  -13.242 10.778  1.00 0.00 ? 59  LYS A HB3  4  
ATOM 6054  H HG2  . LYS A 1 59  ? 1.152   -11.687 11.871  1.00 0.00 ? 59  LYS A HG2  4  
ATOM 6055  H HG3  . LYS A 1 59  ? -0.254  -10.677 11.595  1.00 0.00 ? 59  LYS A HG3  4  
ATOM 6056  H HD2  . LYS A 1 59  ? -1.621  -12.529 12.805  1.00 0.00 ? 59  LYS A HD2  4  
ATOM 6057  H HD3  . LYS A 1 59  ? -0.078  -13.189 13.308  1.00 0.00 ? 59  LYS A HD3  4  
ATOM 6058  H HE2  . LYS A 1 59  ? -0.008  -10.355 13.826  1.00 0.00 ? 59  LYS A HE2  4  
ATOM 6059  H HE3  . LYS A 1 59  ? -1.533  -10.962 14.443  1.00 0.00 ? 59  LYS A HE3  4  
ATOM 6060  H HZ1  . LYS A 1 59  ? -0.491  -12.210 15.965  1.00 0.00 ? 59  LYS A HZ1  4  
ATOM 6061  H HZ2  . LYS A 1 59  ? 0.791   -12.565 15.018  1.00 0.00 ? 59  LYS A HZ2  4  
ATOM 6062  H HZ3  . LYS A 1 59  ? 0.713   -11.123 15.780  1.00 0.00 ? 59  LYS A HZ3  4  
ATOM 6063  N N    . MET A 1 60  ? 0.934   -13.421 7.603   1.00 0.00 ? 60  MET A N    4  
ATOM 6064  C CA   . MET A 1 60  ? 0.734   -14.023 6.296   1.00 0.00 ? 60  MET A CA   4  
ATOM 6065  C C    . MET A 1 60  ? -0.707  -14.512 6.132   1.00 0.00 ? 60  MET A C    4  
ATOM 6066  O O    . MET A 1 60  ? -0.951  -15.527 5.482   1.00 0.00 ? 60  MET A O    4  
ATOM 6067  C CB   . MET A 1 60  ? 1.696   -15.201 6.123   1.00 0.00 ? 60  MET A CB   4  
ATOM 6068  C CG   . MET A 1 60  ? 3.016   -14.743 5.501   1.00 0.00 ? 60  MET A CG   4  
ATOM 6069  S SD   . MET A 1 60  ? 2.885   -14.742 3.721   1.00 0.00 ? 60  MET A SD   4  
ATOM 6070  C CE   . MET A 1 60  ? 2.352   -13.060 3.450   1.00 0.00 ? 60  MET A CE   4  
ATOM 6071  H H    . MET A 1 60  ? 1.288   -12.486 7.588   1.00 0.00 ? 60  MET A H    4  
ATOM 6072  H HA   . MET A 1 60  ? 0.941   -13.233 5.574   1.00 0.00 ? 60  MET A HA   4  
ATOM 6073  H HB2  . MET A 1 60  ? 1.887   -15.664 7.091   1.00 0.00 ? 60  MET A HB2  4  
ATOM 6074  H HB3  . MET A 1 60  ? 1.236   -15.961 5.491   1.00 0.00 ? 60  MET A HB3  4  
ATOM 6075  H HG2  . MET A 1 60  ? 3.268   -13.744 5.856   1.00 0.00 ? 60  MET A HG2  4  
ATOM 6076  H HG3  . MET A 1 60  ? 3.824   -15.405 5.814   1.00 0.00 ? 60  MET A HG3  4  
ATOM 6077  H HE1  . MET A 1 60  ? 2.851   -12.658 2.568   1.00 0.00 ? 60  MET A HE1  4  
ATOM 6078  H HE2  . MET A 1 60  ? 1.273   -13.041 3.298   1.00 0.00 ? 60  MET A HE2  4  
ATOM 6079  H HE3  . MET A 1 60  ? 2.608   -12.454 4.319   1.00 0.00 ? 60  MET A HE3  4  
ATOM 6080  N N    . ASN A 1 61  ? -1.622  -13.767 6.733   1.00 0.00 ? 61  ASN A N    4  
ATOM 6081  C CA   . ASN A 1 61  ? -3.032  -14.112 6.662   1.00 0.00 ? 61  ASN A CA   4  
ATOM 6082  C C    . ASN A 1 61  ? -3.457  -14.205 5.196   1.00 0.00 ? 61  ASN A C    4  
ATOM 6083  O O    . ASN A 1 61  ? -2.677  -13.888 4.299   1.00 0.00 ? 61  ASN A O    4  
ATOM 6084  C CB   . ASN A 1 61  ? -3.895  -13.044 7.338   1.00 0.00 ? 61  ASN A CB   4  
ATOM 6085  C CG   . ASN A 1 61  ? -5.210  -13.641 7.844   1.00 0.00 ? 61  ASN A CG   4  
ATOM 6086  O OD1  . ASN A 1 61  ? -6.224  -13.638 7.166   1.00 0.00 ? 61  ASN A OD1  4  
ATOM 6087  N ND2  . ASN A 1 61  ? -5.136  -14.151 9.069   1.00 0.00 ? 61  ASN A ND2  4  
ATOM 6088  H H    . ASN A 1 61  ? -1.415  -12.943 7.260   1.00 0.00 ? 61  ASN A H    4  
ATOM 6089  H HA   . ASN A 1 61  ? -3.120  -15.065 7.183   1.00 0.00 ? 61  ASN A HA   4  
ATOM 6090  H HB2  . ASN A 1 61  ? -3.348  -12.603 8.171   1.00 0.00 ? 61  ASN A HB2  4  
ATOM 6091  H HB3  . ASN A 1 61  ? -4.104  -12.240 6.632   1.00 0.00 ? 61  ASN A HB3  4  
ATOM 6092  H HD21 . ASN A 1 61  ? -4.272  -14.122 9.572   1.00 0.00 ? 61  ASN A HD21 4  
ATOM 6093  H HD22 . ASN A 1 61  ? -5.945  -14.565 9.488   1.00 0.00 ? 61  ASN A HD22 4  
ATOM 6094  N N    . LYS A 1 62  ? -4.693  -14.640 4.997   1.00 0.00 ? 62  LYS A N    4  
ATOM 6095  C CA   . LYS A 1 62  ? -5.230  -14.778 3.654   1.00 0.00 ? 62  LYS A CA   4  
ATOM 6096  C C    . LYS A 1 62  ? -5.092  -13.446 2.914   1.00 0.00 ? 62  LYS A C    4  
ATOM 6097  O O    . LYS A 1 62  ? -4.677  -13.415 1.756   1.00 0.00 ? 62  LYS A O    4  
ATOM 6098  C CB   . LYS A 1 62  ? -6.665  -15.308 3.703   1.00 0.00 ? 62  LYS A CB   4  
ATOM 6099  C CG   . LYS A 1 62  ? -6.685  -16.838 3.708   1.00 0.00 ? 62  LYS A CG   4  
ATOM 6100  C CD   . LYS A 1 62  ? -6.633  -17.382 5.137   1.00 0.00 ? 62  LYS A CD   4  
ATOM 6101  C CE   . LYS A 1 62  ? -5.230  -17.886 5.481   1.00 0.00 ? 62  LYS A CE   4  
ATOM 6102  N NZ   . LYS A 1 62  ? -5.170  -19.361 5.385   1.00 0.00 ? 62  LYS A NZ   4  
ATOM 6103  H H    . LYS A 1 62  ? -5.320  -14.895 5.732   1.00 0.00 ? 62  LYS A H    4  
ATOM 6104  H HA   . LYS A 1 62  ? -4.629  -15.525 3.136   1.00 0.00 ? 62  LYS A HA   4  
ATOM 6105  H HB2  . LYS A 1 62  ? -7.165  -14.931 4.596   1.00 0.00 ? 62  LYS A HB2  4  
ATOM 6106  H HB3  . LYS A 1 62  ? -7.223  -14.936 2.844   1.00 0.00 ? 62  LYS A HB3  4  
ATOM 6107  H HG2  . LYS A 1 62  ? -7.587  -17.195 3.211   1.00 0.00 ? 62  LYS A HG2  4  
ATOM 6108  H HG3  . LYS A 1 62  ? -5.836  -17.218 3.139   1.00 0.00 ? 62  LYS A HG3  4  
ATOM 6109  H HD2  . LYS A 1 62  ? -6.925  -16.601 5.839   1.00 0.00 ? 62  LYS A HD2  4  
ATOM 6110  H HD3  . LYS A 1 62  ? -7.352  -18.194 5.247   1.00 0.00 ? 62  LYS A HD3  4  
ATOM 6111  H HE2  . LYS A 1 62  ? -4.501  -17.441 4.804   1.00 0.00 ? 62  LYS A HE2  4  
ATOM 6112  H HE3  . LYS A 1 62  ? -4.961  -17.570 6.490   1.00 0.00 ? 62  LYS A HE3  4  
ATOM 6113  H HZ1  . LYS A 1 62  ? -4.819  -19.623 4.486   1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 6114  H HZ2  . LYS A 1 62  ? -4.564  -19.718 6.096   1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 6115  H HZ3  . LYS A 1 62  ? -6.087  -19.741 5.508   1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 6116  N N    . LYS A 1 63  ? -5.446  -12.378 3.613   1.00 0.00 ? 63  LYS A N    4  
ATOM 6117  C CA   . LYS A 1 63  ? -5.367  -11.046 3.037   1.00 0.00 ? 63  LYS A CA   4  
ATOM 6118  C C    . LYS A 1 63  ? -3.951  -10.808 2.509   1.00 0.00 ? 63  LYS A C    4  
ATOM 6119  O O    . LYS A 1 63  ? -3.770  -10.448 1.347   1.00 0.00 ? 63  LYS A O    4  
ATOM 6120  C CB   . LYS A 1 63  ? -5.831  -9.996  4.048   1.00 0.00 ? 63  LYS A CB   4  
ATOM 6121  C CG   . LYS A 1 63  ? -7.351  -9.826  4.002   1.00 0.00 ? 63  LYS A CG   4  
ATOM 6122  C CD   . LYS A 1 63  ? -7.740  -8.601  3.172   1.00 0.00 ? 63  LYS A CD   4  
ATOM 6123  C CE   . LYS A 1 63  ? -8.989  -7.926  3.743   1.00 0.00 ? 63  LYS A CE   4  
ATOM 6124  N NZ   . LYS A 1 63  ? -8.958  -6.470  3.479   1.00 0.00 ? 63  LYS A NZ   4  
ATOM 6125  H H    . LYS A 1 63  ? -5.782  -12.412 4.554   1.00 0.00 ? 63  LYS A H    4  
ATOM 6126  H HA   . LYS A 1 63  ? -6.059  -11.012 2.196   1.00 0.00 ? 63  LYS A HA   4  
ATOM 6127  H HB2  . LYS A 1 63  ? -5.525  -10.291 5.052   1.00 0.00 ? 63  LYS A HB2  4  
ATOM 6128  H HB3  . LYS A 1 63  ? -5.348  -9.043  3.835   1.00 0.00 ? 63  LYS A HB3  4  
ATOM 6129  H HG2  . LYS A 1 63  ? -7.808  -10.718 3.576   1.00 0.00 ? 63  LYS A HG2  4  
ATOM 6130  H HG3  . LYS A 1 63  ? -7.740  -9.721  5.015   1.00 0.00 ? 63  LYS A HG3  4  
ATOM 6131  H HD2  . LYS A 1 63  ? -6.914  -7.890  3.156   1.00 0.00 ? 63  LYS A HD2  4  
ATOM 6132  H HD3  . LYS A 1 63  ? -7.924  -8.900  2.140   1.00 0.00 ? 63  LYS A HD3  4  
ATOM 6133  H HE2  . LYS A 1 63  ? -9.882  -8.363  3.297   1.00 0.00 ? 63  LYS A HE2  4  
ATOM 6134  H HE3  . LYS A 1 63  ? -9.048  -8.105  4.817   1.00 0.00 ? 63  LYS A HE3  4  
ATOM 6135  H HZ1  . LYS A 1 63  ? -9.384  -6.282  2.594   1.00 0.00 ? 63  LYS A HZ1  4  
ATOM 6136  H HZ2  . LYS A 1 63  ? -9.459  -5.990  4.199   1.00 0.00 ? 63  LYS A HZ2  4  
ATOM 6137  H HZ3  . LYS A 1 63  ? -8.009  -6.154  3.465   1.00 0.00 ? 63  LYS A HZ3  4  
ATOM 6138  N N    . MET A 1 64  ? -2.982  -11.018 3.389   1.00 0.00 ? 64  MET A N    4  
ATOM 6139  C CA   . MET A 1 64  ? -1.588  -10.830 3.026   1.00 0.00 ? 64  MET A CA   4  
ATOM 6140  C C    . MET A 1 64  ? -1.158  -11.838 1.959   1.00 0.00 ? 64  MET A C    4  
ATOM 6141  O O    . MET A 1 64  ? -0.155  -11.636 1.276   1.00 0.00 ? 64  MET A O    4  
ATOM 6142  C CB   . MET A 1 64  ? -0.710  -10.996 4.268   1.00 0.00 ? 64  MET A CB   4  
ATOM 6143  C CG   . MET A 1 64  ? 0.737   -10.595 3.975   1.00 0.00 ? 64  MET A CG   4  
ATOM 6144  S SD   . MET A 1 64  ? 0.860   -8.821  3.823   1.00 0.00 ? 64  MET A SD   4  
ATOM 6145  C CE   . MET A 1 64  ? 0.139   -8.326  5.380   1.00 0.00 ? 64  MET A CE   4  
ATOM 6146  H H    . MET A 1 64  ? -3.138  -11.310 4.332   1.00 0.00 ? 64  MET A H    4  
ATOM 6147  H HA   . MET A 1 64  ? -1.523  -9.817  2.627   1.00 0.00 ? 64  MET A HA   4  
ATOM 6148  H HB2  . MET A 1 64  ? -1.103  -10.384 5.080   1.00 0.00 ? 64  MET A HB2  4  
ATOM 6149  H HB3  . MET A 1 64  ? -0.743  -12.032 4.605   1.00 0.00 ? 64  MET A HB3  4  
ATOM 6150  H HG2  . MET A 1 64  ? 1.390   -10.946 4.774   1.00 0.00 ? 64  MET A HG2  4  
ATOM 6151  H HG3  . MET A 1 64  ? 1.075   -11.071 3.054   1.00 0.00 ? 64  MET A HG3  4  
ATOM 6152  H HE1  . MET A 1 64  ? 0.542   -7.357  5.675   1.00 0.00 ? 64  MET A HE1  4  
ATOM 6153  H HE2  . MET A 1 64  ? -0.943  -8.252  5.271   1.00 0.00 ? 64  MET A HE2  4  
ATOM 6154  H HE3  . MET A 1 64  ? 0.378   -9.067  6.143   1.00 0.00 ? 64  MET A HE3  4  
ATOM 6155  N N    . GLU A 1 65  ? -1.939  -12.903 1.848   1.00 0.00 ? 65  GLU A N    4  
ATOM 6156  C CA   . GLU A 1 65  ? -1.652  -13.943 0.875   1.00 0.00 ? 65  GLU A CA   4  
ATOM 6157  C C    . GLU A 1 65  ? -2.111  -13.509 -0.518  1.00 0.00 ? 65  GLU A C    4  
ATOM 6158  O O    . GLU A 1 65  ? -1.519  -13.902 -1.522  1.00 0.00 ? 65  GLU A O    4  
ATOM 6159  C CB   . GLU A 1 65  ? -2.304  -15.267 1.279   1.00 0.00 ? 65  GLU A CB   4  
ATOM 6160  C CG   . GLU A 1 65  ? -1.394  -16.063 2.216   1.00 0.00 ? 65  GLU A CG   4  
ATOM 6161  C CD   . GLU A 1 65  ? -0.990  -17.397 1.585   1.00 0.00 ? 65  GLU A CD   4  
ATOM 6162  O OE1  . GLU A 1 65  ? -0.805  -17.407 0.349   1.00 0.00 ? 65  GLU A OE1  4  
ATOM 6163  O OE2  . GLU A 1 65  ? -0.874  -18.376 2.353   1.00 0.00 ? 65  GLU A OE2  4  
ATOM 6164  H H    . GLU A 1 65  ? -2.753  -13.060 2.407   1.00 0.00 ? 65  GLU A H    4  
ATOM 6165  H HA   . GLU A 1 65  ? -0.569  -14.061 0.887   1.00 0.00 ? 65  GLU A HA   4  
ATOM 6166  H HB2  . GLU A 1 65  ? -3.257  -15.071 1.771   1.00 0.00 ? 65  GLU A HB2  4  
ATOM 6167  H HB3  . GLU A 1 65  ? -2.521  -15.857 0.388   1.00 0.00 ? 65  GLU A HB3  4  
ATOM 6168  H HG2  . GLU A 1 65  ? -0.502  -15.480 2.445   1.00 0.00 ? 65  GLU A HG2  4  
ATOM 6169  H HG3  . GLU A 1 65  ? -1.908  -16.245 3.160   1.00 0.00 ? 65  GLU A HG3  4  
ATOM 6170  N N    . GLU A 1 66  ? -3.163  -12.702 -0.535  1.00 0.00 ? 66  GLU A N    4  
ATOM 6171  C CA   . GLU A 1 66  ? -3.708  -12.210 -1.789  1.00 0.00 ? 66  GLU A CA   4  
ATOM 6172  C C    . GLU A 1 66  ? -2.732  -11.231 -2.445  1.00 0.00 ? 66  GLU A C    4  
ATOM 6173  O O    . GLU A 1 66  ? -2.767  -11.034 -3.658  1.00 0.00 ? 66  GLU A O    4  
ATOM 6174  C CB   . GLU A 1 66  ? -5.075  -11.558 -1.573  1.00 0.00 ? 66  GLU A CB   4  
ATOM 6175  C CG   . GLU A 1 66  ? -6.102  -12.585 -1.089  1.00 0.00 ? 66  GLU A CG   4  
ATOM 6176  C CD   . GLU A 1 66  ? -7.167  -12.840 -2.157  1.00 0.00 ? 66  GLU A CD   4  
ATOM 6177  O OE1  . GLU A 1 66  ? -6.916  -13.717 -3.011  1.00 0.00 ? 66  GLU A OE1  4  
ATOM 6178  O OE2  . GLU A 1 66  ? -8.209  -12.152 -2.095  1.00 0.00 ? 66  GLU A OE2  4  
ATOM 6179  H H    . GLU A 1 66  ? -3.638  -12.387 0.286   1.00 0.00 ? 66  GLU A H    4  
ATOM 6180  H HA   . GLU A 1 66  ? -3.828  -13.091 -2.419  1.00 0.00 ? 66  GLU A HA   4  
ATOM 6181  H HB2  . GLU A 1 66  ? -4.988  -10.754 -0.843  1.00 0.00 ? 66  GLU A HB2  4  
ATOM 6182  H HB3  . GLU A 1 66  ? -5.418  -11.107 -2.505  1.00 0.00 ? 66  GLU A HB3  4  
ATOM 6183  H HG2  . GLU A 1 66  ? -5.598  -13.519 -0.842  1.00 0.00 ? 66  GLU A HG2  4  
ATOM 6184  H HG3  . GLU A 1 66  ? -6.576  -12.227 -0.175  1.00 0.00 ? 66  GLU A HG3  4  
ATOM 6185  N N    . VAL A 1 67  ? -1.883  -10.645 -1.613  1.00 0.00 ? 67  VAL A N    4  
ATOM 6186  C CA   . VAL A 1 67  ? -0.899  -9.692  -2.097  1.00 0.00 ? 67  VAL A CA   4  
ATOM 6187  C C    . VAL A 1 67  ? 0.410   -10.425 -2.396  1.00 0.00 ? 67  VAL A C    4  
ATOM 6188  O O    . VAL A 1 67  ? 1.205   -9.973  -3.219  1.00 0.00 ? 67  VAL A O    4  
ATOM 6189  C CB   . VAL A 1 67  ? -0.730  -8.555  -1.086  1.00 0.00 ? 67  VAL A CB   4  
ATOM 6190  C CG1  . VAL A 1 67  ? -1.487  -8.857  0.209   1.00 0.00 ? 67  VAL A CG1  4  
ATOM 6191  C CG2  . VAL A 1 67  ? 0.750   -8.285  -0.807  1.00 0.00 ? 67  VAL A CG2  4  
ATOM 6192  H H    . VAL A 1 67  ? -1.861  -10.812 -0.627  1.00 0.00 ? 67  VAL A H    4  
ATOM 6193  H HA   . VAL A 1 67  ? -1.282  -9.266  -3.024  1.00 0.00 ? 67  VAL A HA   4  
ATOM 6194  H HB   . VAL A 1 67  ? -1.159  -7.653  -1.523  1.00 0.00 ? 67  VAL A HB   4  
ATOM 6195  H HG11 . VAL A 1 67  ? -2.522  -9.106  -0.025  1.00 0.00 ? 67  VAL A HG11 4  
ATOM 6196  H HG12 . VAL A 1 67  ? -1.016  -9.698  0.717   1.00 0.00 ? 67  VAL A HG12 4  
ATOM 6197  H HG13 . VAL A 1 67  ? -1.461  -7.980  0.857   1.00 0.00 ? 67  VAL A HG13 4  
ATOM 6198  H HG21 . VAL A 1 67  ? 1.223   -9.197  -0.443  1.00 0.00 ? 67  VAL A HG21 4  
ATOM 6199  H HG22 . VAL A 1 67  ? 1.240   -7.963  -1.726  1.00 0.00 ? 67  VAL A HG22 4  
ATOM 6200  H HG23 . VAL A 1 67  ? 0.840   -7.503  -0.053  1.00 0.00 ? 67  VAL A HG23 4  
ATOM 6201  N N    . LYS A 1 68  ? 0.594   -11.545 -1.711  1.00 0.00 ? 68  LYS A N    4  
ATOM 6202  C CA   . LYS A 1 68  ? 1.794   -12.345 -1.893  1.00 0.00 ? 68  LYS A CA   4  
ATOM 6203  C C    . LYS A 1 68  ? 1.728   -13.053 -3.248  1.00 0.00 ? 68  LYS A C    4  
ATOM 6204  O O    . LYS A 1 68  ? 2.751   -13.489 -3.774  1.00 0.00 ? 68  LYS A O    4  
ATOM 6205  C CB   . LYS A 1 68  ? 1.988   -13.296 -0.711  1.00 0.00 ? 68  LYS A CB   4  
ATOM 6206  C CG   . LYS A 1 68  ? 3.331   -14.022 -0.806  1.00 0.00 ? 68  LYS A CG   4  
ATOM 6207  C CD   . LYS A 1 68  ? 3.894   -14.320 0.586   1.00 0.00 ? 68  LYS A CD   4  
ATOM 6208  C CE   . LYS A 1 68  ? 5.229   -15.060 0.490   1.00 0.00 ? 68  LYS A CE   4  
ATOM 6209  N NZ   . LYS A 1 68  ? 5.028   -16.424 -0.049  1.00 0.00 ? 68  LYS A NZ   4  
ATOM 6210  H H    . LYS A 1 68  ? -0.057  -11.905 -1.044  1.00 0.00 ? 68  LYS A H    4  
ATOM 6211  H HA   . LYS A 1 68  ? 2.644   -11.662 -1.901  1.00 0.00 ? 68  LYS A HA   4  
ATOM 6212  H HB2  . LYS A 1 68  ? 1.939   -12.736 0.224   1.00 0.00 ? 68  LYS A HB2  4  
ATOM 6213  H HB3  . LYS A 1 68  ? 1.177   -14.024 -0.688  1.00 0.00 ? 68  LYS A HB3  4  
ATOM 6214  H HG2  . LYS A 1 68  ? 3.206   -14.954 -1.358  1.00 0.00 ? 68  LYS A HG2  4  
ATOM 6215  H HG3  . LYS A 1 68  ? 4.040   -13.412 -1.366  1.00 0.00 ? 68  LYS A HG3  4  
ATOM 6216  H HD2  . LYS A 1 68  ? 4.029   -13.387 1.134   1.00 0.00 ? 68  LYS A HD2  4  
ATOM 6217  H HD3  . LYS A 1 68  ? 3.180   -14.920 1.150   1.00 0.00 ? 68  LYS A HD3  4  
ATOM 6218  H HE2  . LYS A 1 68  ? 5.914   -14.506 -0.152  1.00 0.00 ? 68  LYS A HE2  4  
ATOM 6219  H HE3  . LYS A 1 68  ? 5.691   -15.117 1.476   1.00 0.00 ? 68  LYS A HE3  4  
ATOM 6220  H HZ1  . LYS A 1 68  ? 4.557   -16.368 -0.930  1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 6221  H HZ2  . LYS A 1 68  ? 5.916   -16.867 -0.173  1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 6222  H HZ3  . LYS A 1 68  ? 4.476   -16.957 0.591   1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 6223  N N    . GLU A 1 69  ? 0.515   -13.146 -3.773  1.00 0.00 ? 69  GLU A N    4  
ATOM 6224  C CA   . GLU A 1 69  ? 0.303   -13.794 -5.056  1.00 0.00 ? 69  GLU A CA   4  
ATOM 6225  C C    . GLU A 1 69  ? 0.507   -12.794 -6.196  1.00 0.00 ? 69  GLU A C    4  
ATOM 6226  O O    . GLU A 1 69  ? 1.156   -13.107 -7.193  1.00 0.00 ? 69  GLU A O    4  
ATOM 6227  C CB   . GLU A 1 69  ? -1.087  -14.429 -5.126  1.00 0.00 ? 69  GLU A CB   4  
ATOM 6228  C CG   . GLU A 1 69  ? -1.366  -15.276 -3.883  1.00 0.00 ? 69  GLU A CG   4  
ATOM 6229  C CD   . GLU A 1 69  ? -1.658  -16.729 -4.264  1.00 0.00 ? 69  GLU A CD   4  
ATOM 6230  O OE1  . GLU A 1 69  ? -2.839  -17.011 -4.561  1.00 0.00 ? 69  GLU A OE1  4  
ATOM 6231  O OE2  . GLU A 1 69  ? -0.694  -17.525 -4.250  1.00 0.00 ? 69  GLU A OE2  4  
ATOM 6232  H H    . GLU A 1 69  ? -0.311  -12.788 -3.338  1.00 0.00 ? 69  GLU A H    4  
ATOM 6233  H HA   . GLU A 1 69  ? 1.058   -14.578 -5.113  1.00 0.00 ? 69  GLU A HA   4  
ATOM 6234  H HB2  . GLU A 1 69  ? -1.843  -13.649 -5.217  1.00 0.00 ? 69  GLU A HB2  4  
ATOM 6235  H HB3  . GLU A 1 69  ? -1.162  -15.051 -6.018  1.00 0.00 ? 69  GLU A HB3  4  
ATOM 6236  H HG2  . GLU A 1 69  ? -0.507  -15.238 -3.212  1.00 0.00 ? 69  GLU A HG2  4  
ATOM 6237  H HG3  . GLU A 1 69  ? -2.214  -14.861 -3.339  1.00 0.00 ? 69  GLU A HG3  4  
ATOM 6238  N N    . ALA A 1 70  ? -0.060  -11.611 -6.011  1.00 0.00 ? 70  ALA A N    4  
ATOM 6239  C CA   . ALA A 1 70  ? 0.052   -10.563 -7.011  1.00 0.00 ? 70  ALA A CA   4  
ATOM 6240  C C    . ALA A 1 70  ? 1.371   -9.813  -6.814  1.00 0.00 ? 70  ALA A C    4  
ATOM 6241  O O    . ALA A 1 70  ? 1.619   -8.803  -7.470  1.00 0.00 ? 70  ALA A O    4  
ATOM 6242  C CB   . ALA A 1 70  ? -1.164  -9.638  -6.919  1.00 0.00 ? 70  ALA A CB   4  
ATOM 6243  H H    . ALA A 1 70  ? -0.586  -11.364 -5.197  1.00 0.00 ? 70  ALA A H    4  
ATOM 6244  H HA   . ALA A 1 70  ? 0.057   -11.039 -7.992  1.00 0.00 ? 70  ALA A HA   4  
ATOM 6245  H HB1  . ALA A 1 70  ? -1.716  -9.669  -7.859  1.00 0.00 ? 70  ALA A HB1  4  
ATOM 6246  H HB2  . ALA A 1 70  ? -1.811  -9.967  -6.106  1.00 0.00 ? 70  ALA A HB2  4  
ATOM 6247  H HB3  . ALA A 1 70  ? -0.830  -8.618  -6.728  1.00 0.00 ? 70  ALA A HB3  4  
ATOM 6248  N N    . ASN A 1 71  ? 2.182   -10.337 -5.907  1.00 0.00 ? 71  ASN A N    4  
ATOM 6249  C CA   . ASN A 1 71  ? 3.470   -9.731  -5.615  1.00 0.00 ? 71  ASN A CA   4  
ATOM 6250  C C    . ASN A 1 71  ? 3.285   -8.225  -5.411  1.00 0.00 ? 71  ASN A C    4  
ATOM 6251  O O    . ASN A 1 71  ? 3.840   -7.421  -6.159  1.00 0.00 ? 71  ASN A O    4  
ATOM 6252  C CB   . ASN A 1 71  ? 4.450   -9.934  -6.772  1.00 0.00 ? 71  ASN A CB   4  
ATOM 6253  C CG   . ASN A 1 71  ? 5.731   -10.617 -6.292  1.00 0.00 ? 71  ASN A CG   4  
ATOM 6254  O OD1  . ASN A 1 71  ? 5.944   -10.835 -5.110  1.00 0.00 ? 71  ASN A OD1  4  
ATOM 6255  N ND2  . ASN A 1 71  ? 6.571   -10.942 -7.271  1.00 0.00 ? 71  ASN A ND2  4  
ATOM 6256  H H    . ASN A 1 71  ? 1.973   -11.160 -5.378  1.00 0.00 ? 71  ASN A H    4  
ATOM 6257  H HA   . ASN A 1 71  ? 3.826   -10.233 -4.716  1.00 0.00 ? 71  ASN A HA   4  
ATOM 6258  H HB2  . ASN A 1 71  ? 3.981   -10.538 -7.549  1.00 0.00 ? 71  ASN A HB2  4  
ATOM 6259  H HB3  . ASN A 1 71  ? 4.693   -8.971  -7.221  1.00 0.00 ? 71  ASN A HB3  4  
ATOM 6260  H HD21 . ASN A 1 71  ? 6.336   -10.735 -8.220  1.00 0.00 ? 71  ASN A HD21 4  
ATOM 6261  H HD22 . ASN A 1 71  ? 7.437   -11.393 -7.057  1.00 0.00 ? 71  ASN A HD22 4  
ATOM 6262  N N    . ILE A 1 72  ? 2.503   -7.890  -4.396  1.00 0.00 ? 72  ILE A N    4  
ATOM 6263  C CA   . ILE A 1 72  ? 2.238   -6.496  -4.084  1.00 0.00 ? 72  ILE A CA   4  
ATOM 6264  C C    . ILE A 1 72  ? 3.040   -6.093  -2.845  1.00 0.00 ? 72  ILE A C    4  
ATOM 6265  O O    . ILE A 1 72  ? 2.559   -6.225  -1.720  1.00 0.00 ? 72  ILE A O    4  
ATOM 6266  C CB   . ILE A 1 72  ? 0.733   -6.253  -3.949  1.00 0.00 ? 72  ILE A CB   4  
ATOM 6267  C CG1  . ILE A 1 72  ? -0.029  -6.865  -5.126  1.00 0.00 ? 72  ILE A CG1  4  
ATOM 6268  C CG2  . ILE A 1 72  ? 0.431   -4.763  -3.783  1.00 0.00 ? 72  ILE A CG2  4  
ATOM 6269  C CD1  . ILE A 1 72  ? -1.538  -6.839  -4.875  1.00 0.00 ? 72  ILE A CD1  4  
ATOM 6270  H H    . ILE A 1 72  ? 2.055   -8.550  -3.793  1.00 0.00 ? 72  ILE A H    4  
ATOM 6271  H HA   . ILE A 1 72  ? 2.586   -5.900  -4.929  1.00 0.00 ? 72  ILE A HA   4  
ATOM 6272  H HB   . ILE A 1 72  ? 0.387   -6.755  -3.045  1.00 0.00 ? 72  ILE A HB   4  
ATOM 6273  H HG12 . ILE A 1 72  ? 0.202   -6.315  -6.038  1.00 0.00 ? 72  ILE A HG12 4  
ATOM 6274  H HG13 . ILE A 1 72  ? 0.300   -7.893  -5.282  1.00 0.00 ? 72  ILE A HG13 4  
ATOM 6275  H HG21 . ILE A 1 72  ? -0.350  -4.632  -3.033  1.00 0.00 ? 72  ILE A HG21 4  
ATOM 6276  H HG22 . ILE A 1 72  ? 1.333   -4.242  -3.462  1.00 0.00 ? 72  ILE A HG22 4  
ATOM 6277  H HG23 . ILE A 1 72  ? 0.093   -4.352  -4.734  1.00 0.00 ? 72  ILE A HG23 4  
ATOM 6278  H HD11 . ILE A 1 72  ? -1.742  -6.313  -3.943  1.00 0.00 ? 72  ILE A HD11 4  
ATOM 6279  H HD12 . ILE A 1 72  ? -2.034  -6.326  -5.699  1.00 0.00 ? 72  ILE A HD12 4  
ATOM 6280  H HD13 . ILE A 1 72  ? -1.912  -7.861  -4.806  1.00 0.00 ? 72  ILE A HD13 4  
ATOM 6281  N N    . ARG A 1 73  ? 4.249   -5.610  -3.092  1.00 0.00 ? 73  ARG A N    4  
ATOM 6282  C CA   . ARG A 1 73  ? 5.121   -5.188  -2.010  1.00 0.00 ? 73  ARG A CA   4  
ATOM 6283  C C    . ARG A 1 73  ? 4.306   -4.523  -0.899  1.00 0.00 ? 73  ARG A C    4  
ATOM 6284  O O    . ARG A 1 73  ? 3.508   -3.624  -1.163  1.00 0.00 ? 73  ARG A O    4  
ATOM 6285  C CB   . ARG A 1 73  ? 6.184   -4.208  -2.510  1.00 0.00 ? 73  ARG A CB   4  
ATOM 6286  C CG   . ARG A 1 73  ? 5.566   -2.844  -2.827  1.00 0.00 ? 73  ARG A CG   4  
ATOM 6287  C CD   . ARG A 1 73  ? 6.569   -1.942  -3.550  1.00 0.00 ? 73  ARG A CD   4  
ATOM 6288  N NE   . ARG A 1 73  ? 6.014   -1.510  -4.852  1.00 0.00 ? 73  ARG A NE   4  
ATOM 6289  C CZ   . ARG A 1 73  ? 6.115   -2.220  -5.984  1.00 0.00 ? 73  ARG A CZ   4  
ATOM 6290  N NH1  . ARG A 1 73  ? 6.749   -3.400  -5.981  1.00 0.00 ? 73  ARG A NH1  4  
ATOM 6291  N NH2  . ARG A 1 73  ? 5.581   -1.750  -7.120  1.00 0.00 ? 73  ARG A NH2  4  
ATOM 6292  H H    . ARG A 1 73  ? 4.632   -5.507  -4.010  1.00 0.00 ? 73  ARG A H    4  
ATOM 6293  H HA   . ARG A 1 73  ? 5.591   -6.106  -1.656  1.00 0.00 ? 73  ARG A HA   4  
ATOM 6294  H HB2  . ARG A 1 73  ? 6.962   -4.092  -1.756  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 6295  H HB3  . ARG A 1 73  ? 6.664   -4.609  -3.403  1.00 0.00 ? 73  ARG A HB3  4  
ATOM 6296  H HG2  . ARG A 1 73  ? 4.679   -2.978  -3.447  1.00 0.00 ? 73  ARG A HG2  4  
ATOM 6297  H HG3  . ARG A 1 73  ? 5.241   -2.365  -1.904  1.00 0.00 ? 73  ARG A HG3  4  
ATOM 6298  H HD2  . ARG A 1 73  ? 6.796   -1.071  -2.935  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 6299  H HD3  . ARG A 1 73  ? 7.506   -2.477  -3.704  1.00 0.00 ? 73  ARG A HD3  4  
ATOM 6300  H HE   . ARG A 1 73  ? 5.534   -0.634  -4.890  1.00 0.00 ? 73  ARG A HE   4  
ATOM 6301  H HH11 . ARG A 1 73  ? 7.148   -3.751  -5.134  1.00 0.00 ? 73  ARG A HH11 4  
ATOM 6302  H HH12 . ARG A 1 73  ? 6.825   -3.930  -6.826  1.00 0.00 ? 73  ARG A HH12 4  
ATOM 6303  H HH21 . ARG A 1 73  ? 5.107   -0.869  -7.122  1.00 0.00 ? 73  ARG A HH21 4  
ATOM 6304  H HH22 . ARG A 1 73  ? 5.656   -2.279  -7.964  1.00 0.00 ? 73  ARG A HH22 4  
ATOM 6305  N N    . VAL A 1 74  ? 4.535   -4.989  0.319   1.00 0.00 ? 74  VAL A N    4  
ATOM 6306  C CA   . VAL A 1 74  ? 3.832   -4.451  1.471   1.00 0.00 ? 74  VAL A CA   4  
ATOM 6307  C C    . VAL A 1 74  ? 4.745   -3.470  2.208   1.00 0.00 ? 74  VAL A C    4  
ATOM 6308  O O    . VAL A 1 74  ? 5.808   -3.852  2.696   1.00 0.00 ? 74  VAL A O    4  
ATOM 6309  C CB   . VAL A 1 74  ? 3.336   -5.592  2.362   1.00 0.00 ? 74  VAL A CB   4  
ATOM 6310  C CG1  . VAL A 1 74  ? 2.259   -5.102  3.332   1.00 0.00 ? 74  VAL A CG1  4  
ATOM 6311  C CG2  . VAL A 1 74  ? 2.825   -6.763  1.521   1.00 0.00 ? 74  VAL A CG2  4  
ATOM 6312  H H    . VAL A 1 74  ? 5.186   -5.720  0.525   1.00 0.00 ? 74  VAL A H    4  
ATOM 6313  H HA   . VAL A 1 74  ? 2.961   -3.909  1.101   1.00 0.00 ? 74  VAL A HA   4  
ATOM 6314  H HB   . VAL A 1 74  ? 4.181   -5.947  2.952   1.00 0.00 ? 74  VAL A HB   4  
ATOM 6315  H HG11 . VAL A 1 74  ? 1.625   -4.371  2.831   1.00 0.00 ? 74  VAL A HG11 4  
ATOM 6316  H HG12 . VAL A 1 74  ? 1.652   -5.947  3.658   1.00 0.00 ? 74  VAL A HG12 4  
ATOM 6317  H HG13 . VAL A 1 74  ? 2.733   -4.639  4.198   1.00 0.00 ? 74  VAL A HG13 4  
ATOM 6318  H HG21 . VAL A 1 74  ? 3.637   -7.470  1.352   1.00 0.00 ? 74  VAL A HG21 4  
ATOM 6319  H HG22 . VAL A 1 74  ? 2.012   -7.262  2.048   1.00 0.00 ? 74  VAL A HG22 4  
ATOM 6320  H HG23 . VAL A 1 74  ? 2.462   -6.391  0.563   1.00 0.00 ? 74  VAL A HG23 4  
ATOM 6321  N N    . VAL A 1 75  ? 4.298   -2.224  2.267   1.00 0.00 ? 75  VAL A N    4  
ATOM 6322  C CA   . VAL A 1 75  ? 5.062   -1.185  2.937   1.00 0.00 ? 75  VAL A CA   4  
ATOM 6323  C C    . VAL A 1 75  ? 4.282   -0.691  4.157   1.00 0.00 ? 75  VAL A C    4  
ATOM 6324  O O    . VAL A 1 75  ? 3.125   -1.061  4.350   1.00 0.00 ? 75  VAL A O    4  
ATOM 6325  C CB   . VAL A 1 75  ? 5.401   -0.067  1.950   1.00 0.00 ? 75  VAL A CB   4  
ATOM 6326  C CG1  . VAL A 1 75  ? 6.152   -0.616  0.735   1.00 0.00 ? 75  VAL A CG1  4  
ATOM 6327  C CG2  . VAL A 1 75  ? 4.140   0.687   1.520   1.00 0.00 ? 75  VAL A CG2  4  
ATOM 6328  H H    . VAL A 1 75  ? 3.432   -1.921  1.868   1.00 0.00 ? 75  VAL A H    4  
ATOM 6329  H HA   . VAL A 1 75  ? 5.997   -1.632  3.275   1.00 0.00 ? 75  VAL A HA   4  
ATOM 6330  H HB   . VAL A 1 75  ? 6.057   0.641   2.457   1.00 0.00 ? 75  VAL A HB   4  
ATOM 6331  H HG11 . VAL A 1 75  ? 5.809   -1.629  0.523   1.00 0.00 ? 75  VAL A HG11 4  
ATOM 6332  H HG12 . VAL A 1 75  ? 5.961   0.021   -0.129  1.00 0.00 ? 75  VAL A HG12 4  
ATOM 6333  H HG13 . VAL A 1 75  ? 7.222   -0.631  0.946   1.00 0.00 ? 75  VAL A HG13 4  
ATOM 6334  H HG21 . VAL A 1 75  ? 3.935   0.481   0.470   1.00 0.00 ? 75  VAL A HG21 4  
ATOM 6335  H HG22 . VAL A 1 75  ? 3.296   0.357   2.127   1.00 0.00 ? 75  VAL A HG22 4  
ATOM 6336  H HG23 . VAL A 1 75  ? 4.292   1.757   1.659   1.00 0.00 ? 75  VAL A HG23 4  
ATOM 6337  N N    . SER A 1 76  ? 4.947   0.139   4.947   1.00 0.00 ? 76  SER A N    4  
ATOM 6338  C CA   . SER A 1 76  ? 4.330   0.688   6.143   1.00 0.00 ? 76  SER A CA   4  
ATOM 6339  C C    . SER A 1 76  ? 3.580   1.977   5.800   1.00 0.00 ? 76  SER A C    4  
ATOM 6340  O O    . SER A 1 76  ? 3.516   2.371   4.636   1.00 0.00 ? 76  SER A O    4  
ATOM 6341  C CB   . SER A 1 76  ? 5.375   0.956   7.228   1.00 0.00 ? 76  SER A CB   4  
ATOM 6342  O OG   . SER A 1 76  ? 4.785   1.075   8.519   1.00 0.00 ? 76  SER A OG   4  
ATOM 6343  H H    . SER A 1 76  ? 5.888   0.435   4.783   1.00 0.00 ? 76  SER A H    4  
ATOM 6344  H HA   . SER A 1 76  ? 3.637   -0.078  6.488   1.00 0.00 ? 76  SER A HA   4  
ATOM 6345  H HB2  . SER A 1 76  ? 6.105   0.146   7.236   1.00 0.00 ? 76  SER A HB2  4  
ATOM 6346  H HB3  . SER A 1 76  ? 5.918   1.871   6.991   1.00 0.00 ? 76  SER A HB3  4  
ATOM 6347  H HG   . SER A 1 76  ? 4.509   0.174   8.854   1.00 0.00 ? 76  SER A HG   4  
ATOM 6348  N N    . GLU A 1 77  ? 3.030   2.597   6.834   1.00 0.00 ? 77  GLU A N    4  
ATOM 6349  C CA   . GLU A 1 77  ? 2.287   3.833   6.656   1.00 0.00 ? 77  GLU A CA   4  
ATOM 6350  C C    . GLU A 1 77  ? 3.247   5.002   6.426   1.00 0.00 ? 77  GLU A C    4  
ATOM 6351  O O    . GLU A 1 77  ? 2.931   5.932   5.687   1.00 0.00 ? 77  GLU A O    4  
ATOM 6352  C CB   . GLU A 1 77  ? 1.374   4.100   7.855   1.00 0.00 ? 77  GLU A CB   4  
ATOM 6353  C CG   . GLU A 1 77  ? -0.007  4.574   7.398   1.00 0.00 ? 77  GLU A CG   4  
ATOM 6354  C CD   . GLU A 1 77  ? -0.534  5.685   8.308   1.00 0.00 ? 77  GLU A CD   4  
ATOM 6355  O OE1  . GLU A 1 77  ? -0.880  5.356   9.463   1.00 0.00 ? 77  GLU A OE1  4  
ATOM 6356  O OE2  . GLU A 1 77  ? -0.580  6.838   7.828   1.00 0.00 ? 77  GLU A OE2  4  
ATOM 6357  H H    . GLU A 1 77  ? 3.087   2.270   7.777   1.00 0.00 ? 77  GLU A H    4  
ATOM 6358  H HA   . GLU A 1 77  ? 1.674   3.677   5.768   1.00 0.00 ? 77  GLU A HA   4  
ATOM 6359  H HB2  . GLU A 1 77  ? 1.272   3.192   8.449   1.00 0.00 ? 77  GLU A HB2  4  
ATOM 6360  H HB3  . GLU A 1 77  ? 1.826   4.854   8.500   1.00 0.00 ? 77  GLU A HB3  4  
ATOM 6361  H HG2  . GLU A 1 77  ? 0.051   4.937   6.371   1.00 0.00 ? 77  GLU A HG2  4  
ATOM 6362  H HG3  . GLU A 1 77  ? -0.703  3.735   7.401   1.00 0.00 ? 77  GLU A HG3  4  
ATOM 6363  N N    . ASP A 1 78  ? 4.400   4.915   7.073   1.00 0.00 ? 78  ASP A N    4  
ATOM 6364  C CA   . ASP A 1 78  ? 5.407   5.954   6.949   1.00 0.00 ? 78  ASP A CA   4  
ATOM 6365  C C    . ASP A 1 78  ? 5.619   6.278   5.468   1.00 0.00 ? 78  ASP A C    4  
ATOM 6366  O O    . ASP A 1 78  ? 5.956   7.408   5.118   1.00 0.00 ? 78  ASP A O    4  
ATOM 6367  C CB   . ASP A 1 78  ? 6.747   5.495   7.528   1.00 0.00 ? 78  ASP A CB   4  
ATOM 6368  C CG   . ASP A 1 78  ? 6.682   4.961   8.961   1.00 0.00 ? 78  ASP A CG   4  
ATOM 6369  O OD1  . ASP A 1 78  ? 5.596   5.090   9.566   1.00 0.00 ? 78  ASP A OD1  4  
ATOM 6370  O OD2  . ASP A 1 78  ? 7.720   4.437   9.418   1.00 0.00 ? 78  ASP A OD2  4  
ATOM 6371  H H    . ASP A 1 78  ? 4.649   4.155   7.673   1.00 0.00 ? 78  ASP A H    4  
ATOM 6372  H HA   . ASP A 1 78  ? 5.015   6.803   7.509   1.00 0.00 ? 78  ASP A HA   4  
ATOM 6373  H HB2  . ASP A 1 78  ? 7.157   4.716   6.885   1.00 0.00 ? 78  ASP A HB2  4  
ATOM 6374  H HB3  . ASP A 1 78  ? 7.444   6.332   7.500   1.00 0.00 ? 78  ASP A HB3  4  
ATOM 6375  N N    . PHE A 1 79  ? 5.414   5.265   4.639   1.00 0.00 ? 79  PHE A N    4  
ATOM 6376  C CA   . PHE A 1 79  ? 5.579   5.428   3.204   1.00 0.00 ? 79  PHE A CA   4  
ATOM 6377  C C    . PHE A 1 79  ? 4.712   6.575   2.680   1.00 0.00 ? 79  PHE A C    4  
ATOM 6378  O O    . PHE A 1 79  ? 5.182   7.409   1.907   1.00 0.00 ? 79  PHE A O    4  
ATOM 6379  C CB   . PHE A 1 79  ? 5.124   4.121   2.551   1.00 0.00 ? 79  PHE A CB   4  
ATOM 6380  C CG   . PHE A 1 79  ? 4.769   4.257   1.069   1.00 0.00 ? 79  PHE A CG   4  
ATOM 6381  C CD1  . PHE A 1 79  ? 5.747   4.487   0.153   1.00 0.00 ? 79  PHE A CD1  4  
ATOM 6382  C CD2  . PHE A 1 79  ? 3.474   4.149   0.668   1.00 0.00 ? 79  PHE A CD2  4  
ATOM 6383  C CE1  . PHE A 1 79  ? 5.417   4.613   -1.222  1.00 0.00 ? 79  PHE A CE1  4  
ATOM 6384  C CE2  . PHE A 1 79  ? 3.143   4.275   -0.707  1.00 0.00 ? 79  PHE A CE2  4  
ATOM 6385  C CZ   . PHE A 1 79  ? 4.122   4.505   -1.624  1.00 0.00 ? 79  PHE A CZ   4  
ATOM 6386  H H    . PHE A 1 79  ? 5.141   4.349   4.932   1.00 0.00 ? 79  PHE A H    4  
ATOM 6387  H HA   . PHE A 1 79  ? 6.629   5.656   3.023   1.00 0.00 ? 79  PHE A HA   4  
ATOM 6388  H HB2  . PHE A 1 79  ? 5.916   3.379   2.657   1.00 0.00 ? 79  PHE A HB2  4  
ATOM 6389  H HB3  . PHE A 1 79  ? 4.256   3.741   3.089   1.00 0.00 ? 79  PHE A HB3  4  
ATOM 6390  H HD1  . PHE A 1 79  ? 6.785   4.573   0.474   1.00 0.00 ? 79  PHE A HD1  4  
ATOM 6391  H HD2  . PHE A 1 79  ? 2.689   3.965   1.402   1.00 0.00 ? 79  PHE A HD2  4  
ATOM 6392  H HE1  . PHE A 1 79  ? 6.202   4.797   -1.956  1.00 0.00 ? 79  PHE A HE1  4  
ATOM 6393  H HE2  . PHE A 1 79  ? 2.106   4.189   -1.029  1.00 0.00 ? 79  PHE A HE2  4  
ATOM 6394  H HZ   . PHE A 1 79  ? 3.869   4.602   -2.679  1.00 0.00 ? 79  PHE A HZ   4  
ATOM 6395  N N    . LEU A 1 80  ? 3.463   6.580   3.120   1.00 0.00 ? 80  LEU A N    4  
ATOM 6396  C CA   . LEU A 1 80  ? 2.527   7.610   2.705   1.00 0.00 ? 80  LEU A CA   4  
ATOM 6397  C C    . LEU A 1 80  ? 3.063   8.980   3.126   1.00 0.00 ? 80  LEU A C    4  
ATOM 6398  O O    . LEU A 1 80  ? 2.931   9.956   2.388   1.00 0.00 ? 80  LEU A O    4  
ATOM 6399  C CB   . LEU A 1 80  ? 1.125   7.308   3.239   1.00 0.00 ? 80  LEU A CB   4  
ATOM 6400  C CG   . LEU A 1 80  ? 0.371   6.175   2.540   1.00 0.00 ? 80  LEU A CG   4  
ATOM 6401  C CD1  . LEU A 1 80  ? -0.752  5.636   3.427   1.00 0.00 ? 80  LEU A CD1  4  
ATOM 6402  C CD2  . LEU A 1 80  ? -0.145  6.623   1.171   1.00 0.00 ? 80  LEU A CD2  4  
ATOM 6403  H H    . LEU A 1 80  ? 3.089   5.897   3.749   1.00 0.00 ? 80  LEU A H    4  
ATOM 6404  H HA   . LEU A 1 80  ? 2.470   7.581   1.617   1.00 0.00 ? 80  LEU A HA   4  
ATOM 6405  H HB2  . LEU A 1 80  ? 1.207   7.064   4.298   1.00 0.00 ? 80  LEU A HB2  4  
ATOM 6406  H HB3  . LEU A 1 80  ? 0.527   8.216   3.166   1.00 0.00 ? 80  LEU A HB3  4  
ATOM 6407  H HG   . LEU A 1 80  ? 1.068   5.355   2.369   1.00 0.00 ? 80  LEU A HG   4  
ATOM 6408  H HD11 . LEU A 1 80  ? -0.799  6.216   4.349   1.00 0.00 ? 80  LEU A HD11 4  
ATOM 6409  H HD12 . LEU A 1 80  ? -1.703  5.716   2.899   1.00 0.00 ? 80  LEU A HD12 4  
ATOM 6410  H HD13 . LEU A 1 80  ? -0.557  4.590   3.666   1.00 0.00 ? 80  LEU A HD13 4  
ATOM 6411  H HD21 . LEU A 1 80  ? -0.872  7.425   1.301   1.00 0.00 ? 80  LEU A HD21 4  
ATOM 6412  H HD22 . LEU A 1 80  ? 0.689   6.984   0.569   1.00 0.00 ? 80  LEU A HD22 4  
ATOM 6413  H HD23 . LEU A 1 80  ? -0.619  5.781   0.668   1.00 0.00 ? 80  LEU A HD23 4  
ATOM 6414  N N    . GLN A 1 81  ? 3.657   9.009   4.310   1.00 0.00 ? 81  GLN A N    4  
ATOM 6415  C CA   . GLN A 1 81  ? 4.214   10.243  4.837   1.00 0.00 ? 81  GLN A CA   4  
ATOM 6416  C C    . GLN A 1 81  ? 5.396   10.702  3.980   1.00 0.00 ? 81  GLN A C    4  
ATOM 6417  O O    . GLN A 1 81  ? 5.570   11.896  3.745   1.00 0.00 ? 81  GLN A O    4  
ATOM 6418  C CB   . GLN A 1 81  ? 4.630   10.075  6.300   1.00 0.00 ? 81  GLN A CB   4  
ATOM 6419  C CG   . GLN A 1 81  ? 5.654   11.138  6.704   1.00 0.00 ? 81  GLN A CG   4  
ATOM 6420  C CD   . GLN A 1 81  ? 5.050   12.541  6.621   1.00 0.00 ? 81  GLN A CD   4  
ATOM 6421  O OE1  . GLN A 1 81  ? 3.991   12.822  7.158   1.00 0.00 ? 81  GLN A OE1  4  
ATOM 6422  N NE2  . GLN A 1 81  ? 5.780   13.404  5.920   1.00 0.00 ? 81  GLN A NE2  4  
ATOM 6423  H H    . GLN A 1 81  ? 3.760   8.211   4.903   1.00 0.00 ? 81  GLN A H    4  
ATOM 6424  H HA   . GLN A 1 81  ? 3.408   10.974  4.777   1.00 0.00 ? 81  GLN A HA   4  
ATOM 6425  H HB2  . GLN A 1 81  ? 3.753   10.148  6.942   1.00 0.00 ? 81  GLN A HB2  4  
ATOM 6426  H HB3  . GLN A 1 81  ? 5.053   9.082   6.450   1.00 0.00 ? 81  GLN A HB3  4  
ATOM 6427  H HG2  . GLN A 1 81  ? 6.000   10.947  7.720   1.00 0.00 ? 81  GLN A HG2  4  
ATOM 6428  H HG3  . GLN A 1 81  ? 6.526   11.074  6.053   1.00 0.00 ? 81  GLN A HG3  4  
ATOM 6429  H HE21 . GLN A 1 81  ? 6.641   13.109  5.505   1.00 0.00 ? 81  GLN A HE21 4  
ATOM 6430  H HE22 . GLN A 1 81  ? 5.469   14.348  5.808   1.00 0.00 ? 81  GLN A HE22 4  
ATOM 6431  N N    . ASP A 1 82  ? 6.177   9.728   3.537   1.00 0.00 ? 82  ASP A N    4  
ATOM 6432  C CA   . ASP A 1 82  ? 7.337   10.016  2.711   1.00 0.00 ? 82  ASP A CA   4  
ATOM 6433  C C    . ASP A 1 82  ? 6.878   10.324  1.284   1.00 0.00 ? 82  ASP A C    4  
ATOM 6434  O O    . ASP A 1 82  ? 7.185   11.386  0.745   1.00 0.00 ? 82  ASP A O    4  
ATOM 6435  C CB   . ASP A 1 82  ? 8.285   8.817   2.655   1.00 0.00 ? 82  ASP A CB   4  
ATOM 6436  C CG   . ASP A 1 82  ? 9.546   8.948   3.512   1.00 0.00 ? 82  ASP A CG   4  
ATOM 6437  O OD1  . ASP A 1 82  ? 9.385   9.249   4.714   1.00 0.00 ? 82  ASP A OD1  4  
ATOM 6438  O OD2  . ASP A 1 82  ? 10.641  8.743   2.945   1.00 0.00 ? 82  ASP A OD2  4  
ATOM 6439  H H    . ASP A 1 82  ? 6.028   8.758   3.733   1.00 0.00 ? 82  ASP A H    4  
ATOM 6440  H HA   . ASP A 1 82  ? 7.822   10.869  3.186   1.00 0.00 ? 82  ASP A HA   4  
ATOM 6441  H HB2  . ASP A 1 82  ? 7.740   7.927   2.970   1.00 0.00 ? 82  ASP A HB2  4  
ATOM 6442  H HB3  . ASP A 1 82  ? 8.584   8.657   1.619   1.00 0.00 ? 82  ASP A HB3  4  
ATOM 6443  N N    . VAL A 1 83  ? 6.150   9.375   0.714   1.00 0.00 ? 83  VAL A N    4  
ATOM 6444  C CA   . VAL A 1 83  ? 5.646   9.532   -0.640  1.00 0.00 ? 83  VAL A CA   4  
ATOM 6445  C C    . VAL A 1 83  ? 4.962   10.894  -0.771  1.00 0.00 ? 83  VAL A C    4  
ATOM 6446  O O    . VAL A 1 83  ? 4.882   11.450  -1.865  1.00 0.00 ? 83  VAL A O    4  
ATOM 6447  C CB   . VAL A 1 83  ? 4.723   8.363   -0.993  1.00 0.00 ? 83  VAL A CB   4  
ATOM 6448  C CG1  . VAL A 1 83  ? 3.276   8.669   -0.601  1.00 0.00 ? 83  VAL A CG1  4  
ATOM 6449  C CG2  . VAL A 1 83  ? 4.827   8.013   -2.479  1.00 0.00 ? 83  VAL A CG2  4  
ATOM 6450  H H    . VAL A 1 83  ? 5.905   8.514   1.159   1.00 0.00 ? 83  VAL A H    4  
ATOM 6451  H HA   . VAL A 1 83  ? 6.501   9.502   -1.315  1.00 0.00 ? 83  VAL A HA   4  
ATOM 6452  H HB   . VAL A 1 83  ? 5.049   7.494   -0.421  1.00 0.00 ? 83  VAL A HB   4  
ATOM 6453  H HG11 . VAL A 1 83  ? 3.262   9.186   0.359   1.00 0.00 ? 83  VAL A HG11 4  
ATOM 6454  H HG12 . VAL A 1 83  ? 2.820   9.303   -1.361  1.00 0.00 ? 83  VAL A HG12 4  
ATOM 6455  H HG13 . VAL A 1 83  ? 2.717   7.737   -0.520  1.00 0.00 ? 83  VAL A HG13 4  
ATOM 6456  H HG21 . VAL A 1 83  ? 5.308   8.832   -3.013  1.00 0.00 ? 83  VAL A HG21 4  
ATOM 6457  H HG22 . VAL A 1 83  ? 5.418   7.105   -2.597  1.00 0.00 ? 83  VAL A HG22 4  
ATOM 6458  H HG23 . VAL A 1 83  ? 3.828   7.851   -2.884  1.00 0.00 ? 83  VAL A HG23 4  
ATOM 6459  N N    . SER A 1 84  ? 4.486   11.392  0.361   1.00 0.00 ? 84  SER A N    4  
ATOM 6460  C CA   . SER A 1 84  ? 3.811   12.679  0.387   1.00 0.00 ? 84  SER A CA   4  
ATOM 6461  C C    . SER A 1 84  ? 4.832   13.801  0.587   1.00 0.00 ? 84  SER A C    4  
ATOM 6462  O O    . SER A 1 84  ? 4.645   14.911  0.090   1.00 0.00 ? 84  SER A O    4  
ATOM 6463  C CB   . SER A 1 84  ? 2.751   12.723  1.489   1.00 0.00 ? 84  SER A CB   4  
ATOM 6464  O OG   . SER A 1 84  ? 1.877   13.839  1.345   1.00 0.00 ? 84  SER A OG   4  
ATOM 6465  H H    . SER A 1 84  ? 4.555   10.934  1.247   1.00 0.00 ? 84  SER A H    4  
ATOM 6466  H HA   . SER A 1 84  ? 3.327   12.771  -0.586  1.00 0.00 ? 84  SER A HA   4  
ATOM 6467  H HB2  . SER A 1 84  ? 2.169   11.802  1.469   1.00 0.00 ? 84  SER A HB2  4  
ATOM 6468  H HB3  . SER A 1 84  ? 3.241   12.769  2.462   1.00 0.00 ? 84  SER A HB3  4  
ATOM 6469  H HG   . SER A 1 84  ? 1.369   13.767  0.487   1.00 0.00 ? 84  SER A HG   4  
ATOM 6470  N N    . ALA A 1 85  ? 5.889   13.473  1.316   1.00 0.00 ? 85  ALA A N    4  
ATOM 6471  C CA   . ALA A 1 85  ? 6.939   14.440  1.588   1.00 0.00 ? 85  ALA A CA   4  
ATOM 6472  C C    . ALA A 1 85  ? 8.280   13.711  1.701   1.00 0.00 ? 85  ALA A C    4  
ATOM 6473  O O    . ALA A 1 85  ? 8.802   13.532  2.801   1.00 0.00 ? 85  ALA A O    4  
ATOM 6474  C CB   . ALA A 1 85  ? 6.594   15.227  2.853   1.00 0.00 ? 85  ALA A CB   4  
ATOM 6475  H H    . ALA A 1 85  ? 6.033   12.568  1.716   1.00 0.00 ? 85  ALA A H    4  
ATOM 6476  H HA   . ALA A 1 85  ? 6.981   15.130  0.745   1.00 0.00 ? 85  ALA A HA   4  
ATOM 6477  H HB1  . ALA A 1 85  ? 5.540   15.504  2.833   1.00 0.00 ? 85  ALA A HB1  4  
ATOM 6478  H HB2  . ALA A 1 85  ? 6.789   14.609  3.730   1.00 0.00 ? 85  ALA A HB2  4  
ATOM 6479  H HB3  . ALA A 1 85  ? 7.206   16.127  2.900   1.00 0.00 ? 85  ALA A HB3  4  
ATOM 6480  N N    . SER A 1 86  ? 8.799   13.310  0.550   1.00 0.00 ? 86  SER A N    4  
ATOM 6481  C CA   . SER A 1 86  ? 10.068  12.605  0.507   1.00 0.00 ? 86  SER A CA   4  
ATOM 6482  C C    . SER A 1 86  ? 10.772  12.876  -0.824  1.00 0.00 ? 86  SER A C    4  
ATOM 6483  O O    . SER A 1 86  ? 10.120  13.027  -1.856  1.00 0.00 ? 86  SER A O    4  
ATOM 6484  C CB   . SER A 1 86  ? 9.870   11.101  0.705   1.00 0.00 ? 86  SER A CB   4  
ATOM 6485  O OG   . SER A 1 86  ? 11.108  10.418  0.884   1.00 0.00 ? 86  SER A OG   4  
ATOM 6486  H H    . SER A 1 86  ? 8.368   13.459  -0.340  1.00 0.00 ? 86  SER A H    4  
ATOM 6487  H HA   . SER A 1 86  ? 10.650  13.006  1.337   1.00 0.00 ? 86  SER A HA   4  
ATOM 6488  H HB2  . SER A 1 86  ? 9.233   10.930  1.574   1.00 0.00 ? 86  SER A HB2  4  
ATOM 6489  H HB3  . SER A 1 86  ? 9.349   10.687  -0.158  1.00 0.00 ? 86  SER A HB3  4  
ATOM 6490  H HG   . SER A 1 86  ? 11.864  10.994  0.574   1.00 0.00 ? 86  SER A HG   4  
ATOM 6491  N N    . THR A 1 87  ? 12.095  12.930  -0.757  1.00 0.00 ? 87  THR A N    4  
ATOM 6492  C CA   . THR A 1 87  ? 12.894  13.181  -1.944  1.00 0.00 ? 87  THR A CA   4  
ATOM 6493  C C    . THR A 1 87  ? 13.574  11.892  -2.411  1.00 0.00 ? 87  THR A C    4  
ATOM 6494  O O    . THR A 1 87  ? 14.747  11.903  -2.781  1.00 0.00 ? 87  THR A O    4  
ATOM 6495  C CB   . THR A 1 87  ? 13.881  14.305  -1.621  1.00 0.00 ? 87  THR A CB   4  
ATOM 6496  O OG1  . THR A 1 87  ? 14.358  14.725  -2.896  1.00 0.00 ? 87  THR A OG1  4  
ATOM 6497  C CG2  . THR A 1 87  ? 15.133  13.797  -0.903  1.00 0.00 ? 87  THR A CG2  4  
ATOM 6498  H H    . THR A 1 87  ? 12.617  12.807  0.087   1.00 0.00 ? 87  THR A H    4  
ATOM 6499  H HA   . THR A 1 87  ? 12.229  13.500  -2.746  1.00 0.00 ? 87  THR A HA   4  
ATOM 6500  H HB   . THR A 1 87  ? 13.396  15.095  -1.047  1.00 0.00 ? 87  THR A HB   4  
ATOM 6501  H HG1  . THR A 1 87  ? 14.330  15.723  -2.960  1.00 0.00 ? 87  THR A HG1  4  
ATOM 6502  H HG21 . THR A 1 87  ? 16.010  13.991  -1.520  1.00 0.00 ? 87  THR A HG21 4  
ATOM 6503  H HG22 . THR A 1 87  ? 15.239  14.313  0.051   1.00 0.00 ? 87  THR A HG22 4  
ATOM 6504  H HG23 . THR A 1 87  ? 15.042  12.725  -0.728  1.00 0.00 ? 87  THR A HG23 4  
ATOM 6505  N N    . LYS A 1 88  ? 12.807  10.812  -2.379  1.00 0.00 ? 88  LYS A N    4  
ATOM 6506  C CA   . LYS A 1 88  ? 13.320  9.518   -2.795  1.00 0.00 ? 88  LYS A CA   4  
ATOM 6507  C C    . LYS A 1 88  ? 12.395  8.925   -3.860  1.00 0.00 ? 88  LYS A C    4  
ATOM 6508  O O    . LYS A 1 88  ? 11.216  9.271   -3.925  1.00 0.00 ? 88  LYS A O    4  
ATOM 6509  C CB   . LYS A 1 88  ? 13.525  8.608   -1.582  1.00 0.00 ? 88  LYS A CB   4  
ATOM 6510  C CG   . LYS A 1 88  ? 14.823  8.954   -0.850  1.00 0.00 ? 88  LYS A CG   4  
ATOM 6511  C CD   . LYS A 1 88  ? 15.936  7.968   -1.212  1.00 0.00 ? 88  LYS A CD   4  
ATOM 6512  C CE   . LYS A 1 88  ? 16.320  7.108   -0.006  1.00 0.00 ? 88  LYS A CE   4  
ATOM 6513  N NZ   . LYS A 1 88  ? 17.756  6.752   -0.060  1.00 0.00 ? 88  LYS A NZ   4  
ATOM 6514  H H    . LYS A 1 88  ? 11.854  10.812  -2.077  1.00 0.00 ? 88  LYS A H    4  
ATOM 6515  H HA   . LYS A 1 88  ? 14.300  9.683   -3.243  1.00 0.00 ? 88  LYS A HA   4  
ATOM 6516  H HB2  . LYS A 1 88  ? 12.681  8.709   -0.900  1.00 0.00 ? 88  LYS A HB2  4  
ATOM 6517  H HB3  . LYS A 1 88  ? 13.551  7.567   -1.904  1.00 0.00 ? 88  LYS A HB3  4  
ATOM 6518  H HG2  . LYS A 1 88  ? 15.131  9.967   -1.108  1.00 0.00 ? 88  LYS A HG2  4  
ATOM 6519  H HG3  . LYS A 1 88  ? 14.653  8.937   0.226   1.00 0.00 ? 88  LYS A HG3  4  
ATOM 6520  H HD2  . LYS A 1 88  ? 15.607  7.327   -2.031  1.00 0.00 ? 88  LYS A HD2  4  
ATOM 6521  H HD3  . LYS A 1 88  ? 16.810  8.514   -1.567  1.00 0.00 ? 88  LYS A HD3  4  
ATOM 6522  H HE2  . LYS A 1 88  ? 16.107  7.648   0.916   1.00 0.00 ? 88  LYS A HE2  4  
ATOM 6523  H HE3  . LYS A 1 88  ? 15.715  6.201   0.008   1.00 0.00 ? 88  LYS A HE3  4  
ATOM 6524  H HZ1  . LYS A 1 88  ? 18.268  7.340   0.566   1.00 0.00 ? 88  LYS A HZ1  4  
ATOM 6525  H HZ2  . LYS A 1 88  ? 17.872  5.796   0.210   1.00 0.00 ? 88  LYS A HZ2  4  
ATOM 6526  H HZ3  . LYS A 1 88  ? 18.096  6.879   -0.992  1.00 0.00 ? 88  LYS A HZ3  4  
ATOM 6527  N N    . SER A 1 89  ? 12.963  8.042   -4.667  1.00 0.00 ? 89  SER A N    4  
ATOM 6528  C CA   . SER A 1 89  ? 12.204  7.397   -5.725  1.00 0.00 ? 89  SER A CA   4  
ATOM 6529  C C    . SER A 1 89  ? 11.186  6.428   -5.122  1.00 0.00 ? 89  SER A C    4  
ATOM 6530  O O    . SER A 1 89  ? 11.409  5.877   -4.045  1.00 0.00 ? 89  SER A O    4  
ATOM 6531  C CB   . SER A 1 89  ? 13.129  6.660   -6.696  1.00 0.00 ? 89  SER A CB   4  
ATOM 6532  O OG   . SER A 1 89  ? 14.286  7.427   -7.017  1.00 0.00 ? 89  SER A OG   4  
ATOM 6533  H H    . SER A 1 89  ? 13.923  7.765   -4.607  1.00 0.00 ? 89  SER A H    4  
ATOM 6534  H HA   . SER A 1 89  ? 11.697  8.207   -6.250  1.00 0.00 ? 89  SER A HA   4  
ATOM 6535  H HB2  . SER A 1 89  ? 13.434  5.711   -6.256  1.00 0.00 ? 89  SER A HB2  4  
ATOM 6536  H HB3  . SER A 1 89  ? 12.583  6.427   -7.610  1.00 0.00 ? 89  SER A HB3  4  
ATOM 6537  H HG   . SER A 1 89  ? 15.009  7.250   -6.350  1.00 0.00 ? 89  SER A HG   4  
ATOM 6538  N N    . LEU A 1 90  ? 10.088  6.249   -5.843  1.00 0.00 ? 90  LEU A N    4  
ATOM 6539  C CA   . LEU A 1 90  ? 9.035   5.355   -5.393  1.00 0.00 ? 90  LEU A CA   4  
ATOM 6540  C C    . LEU A 1 90  ? 9.648   4.012   -4.992  1.00 0.00 ? 90  LEU A C    4  
ATOM 6541  O O    . LEU A 1 90  ? 9.447   3.543   -3.873  1.00 0.00 ? 90  LEU A O    4  
ATOM 6542  C CB   . LEU A 1 90  ? 7.941   5.238   -6.456  1.00 0.00 ? 90  LEU A CB   4  
ATOM 6543  C CG   . LEU A 1 90  ? 6.680   6.071   -6.215  1.00 0.00 ? 90  LEU A CG   4  
ATOM 6544  C CD1  . LEU A 1 90  ? 6.639   7.287   -7.142  1.00 0.00 ? 90  LEU A CD1  4  
ATOM 6545  C CD2  . LEU A 1 90  ? 5.422   5.210   -6.344  1.00 0.00 ? 90  LEU A CD2  4  
ATOM 6546  H H    . LEU A 1 90  ? 9.914   6.700   -6.718  1.00 0.00 ? 90  LEU A H    4  
ATOM 6547  H HA   . LEU A 1 90  ? 8.580   5.804   -4.511  1.00 0.00 ? 90  LEU A HA   4  
ATOM 6548  H HB2  . LEU A 1 90  ? 8.364   5.527   -7.418  1.00 0.00 ? 90  LEU A HB2  4  
ATOM 6549  H HB3  . LEU A 1 90  ? 7.651   4.191   -6.537  1.00 0.00 ? 90  LEU A HB3  4  
ATOM 6550  H HG   . LEU A 1 90  ? 6.709   6.447   -5.192  1.00 0.00 ? 90  LEU A HG   4  
ATOM 6551  H HD11 . LEU A 1 90  ? 7.294   8.065   -6.750  1.00 0.00 ? 90  LEU A HD11 4  
ATOM 6552  H HD12 . LEU A 1 90  ? 6.977   6.996   -8.137  1.00 0.00 ? 90  LEU A HD12 4  
ATOM 6553  H HD13 . LEU A 1 90  ? 5.619   7.666   -7.201  1.00 0.00 ? 90  LEU A HD13 4  
ATOM 6554  H HD21 . LEU A 1 90  ? 4.583   5.835   -6.648  1.00 0.00 ? 90  LEU A HD21 4  
ATOM 6555  H HD22 . LEU A 1 90  ? 5.587   4.434   -7.092  1.00 0.00 ? 90  LEU A HD22 4  
ATOM 6556  H HD23 . LEU A 1 90  ? 5.199   4.746   -5.383  1.00 0.00 ? 90  LEU A HD23 4  
ATOM 6557  N N    . GLN A 1 91  ? 10.383  3.430   -5.928  1.00 0.00 ? 91  GLN A N    4  
ATOM 6558  C CA   . GLN A 1 91  ? 11.027  2.150   -5.686  1.00 0.00 ? 91  GLN A CA   4  
ATOM 6559  C C    . GLN A 1 91  ? 11.822  2.194   -4.380  1.00 0.00 ? 91  GLN A C    4  
ATOM 6560  O O    . GLN A 1 91  ? 11.661  1.328   -3.521  1.00 0.00 ? 91  GLN A O    4  
ATOM 6561  C CB   . GLN A 1 91  ? 11.925  1.757   -6.861  1.00 0.00 ? 91  GLN A CB   4  
ATOM 6562  C CG   . GLN A 1 91  ? 11.466  0.438   -7.485  1.00 0.00 ? 91  GLN A CG   4  
ATOM 6563  C CD   . GLN A 1 91  ? 11.870  -0.752  -6.611  1.00 0.00 ? 91  GLN A CD   4  
ATOM 6564  O OE1  . GLN A 1 91  ? 12.371  -0.603  -5.509  1.00 0.00 ? 91  GLN A OE1  4  
ATOM 6565  N NE2  . GLN A 1 91  ? 11.624  -1.936  -7.163  1.00 0.00 ? 91  GLN A NE2  4  
ATOM 6566  H H    . GLN A 1 91  ? 10.542  3.818   -6.836  1.00 0.00 ? 91  GLN A H    4  
ATOM 6567  H HA   . GLN A 1 91  ? 10.215  1.429   -5.601  1.00 0.00 ? 91  GLN A HA   4  
ATOM 6568  H HB2  . GLN A 1 91  ? 11.909  2.545   -7.615  1.00 0.00 ? 91  GLN A HB2  4  
ATOM 6569  H HB3  . GLN A 1 91  ? 12.956  1.663   -6.520  1.00 0.00 ? 91  GLN A HB3  4  
ATOM 6570  H HG2  . GLN A 1 91  ? 10.383  0.449   -7.612  1.00 0.00 ? 91  GLN A HG2  4  
ATOM 6571  H HG3  . GLN A 1 91  ? 11.903  0.329   -8.477  1.00 0.00 ? 91  GLN A HG3  4  
ATOM 6572  H HE21 . GLN A 1 91  ? 11.210  -1.989  -8.072  1.00 0.00 ? 91  GLN A HE21 4  
ATOM 6573  H HE22 . GLN A 1 91  ? 11.853  -2.775  -6.669  1.00 0.00 ? 91  GLN A HE22 4  
ATOM 6574  N N    . GLU A 1 92  ? 12.663  3.212   -4.270  1.00 0.00 ? 92  GLU A N    4  
ATOM 6575  C CA   . GLU A 1 92  ? 13.484  3.380   -3.083  1.00 0.00 ? 92  GLU A CA   4  
ATOM 6576  C C    . GLU A 1 92  ? 12.599  3.518   -1.842  1.00 0.00 ? 92  GLU A C    4  
ATOM 6577  O O    . GLU A 1 92  ? 12.867  2.899   -0.813  1.00 0.00 ? 92  GLU A O    4  
ATOM 6578  C CB   . GLU A 1 92  ? 14.417  4.584   -3.227  1.00 0.00 ? 92  GLU A CB   4  
ATOM 6579  C CG   . GLU A 1 92  ? 15.333  4.425   -4.442  1.00 0.00 ? 92  GLU A CG   4  
ATOM 6580  C CD   . GLU A 1 92  ? 16.798  4.320   -4.014  1.00 0.00 ? 92  GLU A CD   4  
ATOM 6581  O OE1  . GLU A 1 92  ? 17.032  3.747   -2.928  1.00 0.00 ? 92  GLU A OE1  4  
ATOM 6582  O OE2  . GLU A 1 92  ? 17.651  4.815   -4.782  1.00 0.00 ? 92  GLU A OE2  4  
ATOM 6583  H H    . GLU A 1 92  ? 12.789  3.912   -4.973  1.00 0.00 ? 92  GLU A H    4  
ATOM 6584  H HA   . GLU A 1 92  ? 14.081  2.472   -3.012  1.00 0.00 ? 92  GLU A HA   4  
ATOM 6585  H HB2  . GLU A 1 92  ? 13.828  5.496   -3.329  1.00 0.00 ? 92  GLU A HB2  4  
ATOM 6586  H HB3  . GLU A 1 92  ? 15.019  4.693   -2.325  1.00 0.00 ? 92  GLU A HB3  4  
ATOM 6587  H HG2  . GLU A 1 92  ? 15.049  3.534   -5.002  1.00 0.00 ? 92  GLU A HG2  4  
ATOM 6588  H HG3  . GLU A 1 92  ? 15.207  5.276   -5.111  1.00 0.00 ? 92  GLU A HG3  4  
ATOM 6589  N N    . LEU A 1 93  ? 11.564  4.333   -1.980  1.00 0.00 ? 93  LEU A N    4  
ATOM 6590  C CA   . LEU A 1 93  ? 10.639  4.559   -0.883  1.00 0.00 ? 93  LEU A CA   4  
ATOM 6591  C C    . LEU A 1 93  ? 10.113  3.214   -0.378  1.00 0.00 ? 93  LEU A C    4  
ATOM 6592  O O    . LEU A 1 93  ? 10.115  2.954   0.824   1.00 0.00 ? 93  LEU A O    4  
ATOM 6593  C CB   . LEU A 1 93  ? 9.535   5.531   -1.304  1.00 0.00 ? 93  LEU A CB   4  
ATOM 6594  C CG   . LEU A 1 93  ? 9.958   6.990   -1.484  1.00 0.00 ? 93  LEU A CG   4  
ATOM 6595  C CD1  . LEU A 1 93  ? 8.766   7.862   -1.883  1.00 0.00 ? 93  LEU A CD1  4  
ATOM 6596  C CD2  . LEU A 1 93  ? 10.658  7.516   -0.229  1.00 0.00 ? 93  LEU A CD2  4  
ATOM 6597  H H    . LEU A 1 93  ? 11.353  4.832   -2.820  1.00 0.00 ? 93  LEU A H    4  
ATOM 6598  H HA   . LEU A 1 93  ? 11.197  5.036   -0.077  1.00 0.00 ? 93  LEU A HA   4  
ATOM 6599  H HB2  . LEU A 1 93  ? 9.108   5.179   -2.244  1.00 0.00 ? 93  LEU A HB2  4  
ATOM 6600  H HB3  . LEU A 1 93  ? 8.740   5.493   -0.559  1.00 0.00 ? 93  LEU A HB3  4  
ATOM 6601  H HG   . LEU A 1 93  ? 10.680  7.039   -2.299  1.00 0.00 ? 93  LEU A HG   4  
ATOM 6602  H HD11 . LEU A 1 93  ? 9.006   8.910   -1.701  1.00 0.00 ? 93  LEU A HD11 4  
ATOM 6603  H HD12 . LEU A 1 93  ? 8.549   7.717   -2.941  1.00 0.00 ? 93  LEU A HD12 4  
ATOM 6604  H HD13 . LEU A 1 93  ? 7.895   7.580   -1.291  1.00 0.00 ? 93  LEU A HD13 4  
ATOM 6605  H HD21 . LEU A 1 93  ? 10.070  7.255   0.651   1.00 0.00 ? 93  LEU A HD21 4  
ATOM 6606  H HD22 . LEU A 1 93  ? 11.649  7.068   -0.150  1.00 0.00 ? 93  LEU A HD22 4  
ATOM 6607  H HD23 . LEU A 1 93  ? 10.754  8.600   -0.293  1.00 0.00 ? 93  LEU A HD23 4  
ATOM 6608  N N    . PHE A 1 94  ? 9.676   2.393   -1.322  1.00 0.00 ? 94  PHE A N    4  
ATOM 6609  C CA   . PHE A 1 94  ? 9.149   1.081   -0.988  1.00 0.00 ? 94  PHE A CA   4  
ATOM 6610  C C    . PHE A 1 94  ? 10.149  0.287   -0.146  1.00 0.00 ? 94  PHE A C    4  
ATOM 6611  O O    . PHE A 1 94  ? 9.813   -0.190  0.937   1.00 0.00 ? 94  PHE A O    4  
ATOM 6612  C CB   . PHE A 1 94  ? 8.915   0.344   -2.309  1.00 0.00 ? 94  PHE A CB   4  
ATOM 6613  C CG   . PHE A 1 94  ? 7.907   1.030   -3.233  1.00 0.00 ? 94  PHE A CG   4  
ATOM 6614  C CD1  . PHE A 1 94  ? 6.946   1.839   -2.711  1.00 0.00 ? 94  PHE A CD1  4  
ATOM 6615  C CD2  . PHE A 1 94  ? 7.972   0.831   -4.577  1.00 0.00 ? 94  PHE A CD2  4  
ATOM 6616  C CE1  . PHE A 1 94  ? 6.010   2.475   -3.569  1.00 0.00 ? 94  PHE A CE1  4  
ATOM 6617  C CE2  . PHE A 1 94  ? 7.036   1.468   -5.435  1.00 0.00 ? 94  PHE A CE2  4  
ATOM 6618  C CZ   . PHE A 1 94  ? 6.075   2.276   -4.913  1.00 0.00 ? 94  PHE A CZ   4  
ATOM 6619  H H    . PHE A 1 94  ? 9.678   2.612   -2.298  1.00 0.00 ? 94  PHE A H    4  
ATOM 6620  H HA   . PHE A 1 94  ? 8.236   1.236   -0.415  1.00 0.00 ? 94  PHE A HA   4  
ATOM 6621  H HB2  . PHE A 1 94  ? 9.865   0.247   -2.833  1.00 0.00 ? 94  PHE A HB2  4  
ATOM 6622  H HB3  . PHE A 1 94  ? 8.565   -0.665  -2.092  1.00 0.00 ? 94  PHE A HB3  4  
ATOM 6623  H HD1  . PHE A 1 94  ? 6.893   1.998   -1.634  1.00 0.00 ? 94  PHE A HD1  4  
ATOM 6624  H HD2  . PHE A 1 94  ? 8.742   0.183   -4.995  1.00 0.00 ? 94  PHE A HD2  4  
ATOM 6625  H HE1  . PHE A 1 94  ? 5.240   3.123   -3.151  1.00 0.00 ? 94  PHE A HE1  4  
ATOM 6626  H HE2  . PHE A 1 94  ? 7.088   1.308   -6.512  1.00 0.00 ? 94  PHE A HE2  4  
ATOM 6627  H HZ   . PHE A 1 94  ? 5.357   2.765   -5.572  1.00 0.00 ? 94  PHE A HZ   4  
ATOM 6628  N N    . LEU A 1 95  ? 11.358  0.169   -0.675  1.00 0.00 ? 95  LEU A N    4  
ATOM 6629  C CA   . LEU A 1 95  ? 12.409  -0.560  0.015   1.00 0.00 ? 95  LEU A CA   4  
ATOM 6630  C C    . LEU A 1 95  ? 12.760  0.168   1.314   1.00 0.00 ? 95  LEU A C    4  
ATOM 6631  O O    . LEU A 1 95  ? 13.192  -0.456  2.282   1.00 0.00 ? 95  LEU A O    4  
ATOM 6632  C CB   . LEU A 1 95  ? 13.608  -0.776  -0.911  1.00 0.00 ? 95  LEU A CB   4  
ATOM 6633  C CG   . LEU A 1 95  ? 13.587  -2.058  -1.747  1.00 0.00 ? 95  LEU A CG   4  
ATOM 6634  C CD1  . LEU A 1 95  ? 14.167  -1.813  -3.141  1.00 0.00 ? 95  LEU A CD1  4  
ATOM 6635  C CD2  . LEU A 1 95  ? 14.303  -3.198  -1.020  1.00 0.00 ? 95  LEU A CD2  4  
ATOM 6636  H H    . LEU A 1 95  ? 11.623  0.559   -1.557  1.00 0.00 ? 95  LEU A H    4  
ATOM 6637  H HA   . LEU A 1 95  ? 12.014  -1.544  0.266   1.00 0.00 ? 95  LEU A HA   4  
ATOM 6638  H HB2  . LEU A 1 95  ? 13.677  0.075   -1.589  1.00 0.00 ? 95  LEU A HB2  4  
ATOM 6639  H HB3  . LEU A 1 95  ? 14.514  -0.776  -0.306  1.00 0.00 ? 95  LEU A HB3  4  
ATOM 6640  H HG   . LEU A 1 95  ? 12.549  -2.362  -1.879  1.00 0.00 ? 95  LEU A HG   4  
ATOM 6641  H HD11 . LEU A 1 95  ? 13.834  -2.600  -3.817  1.00 0.00 ? 95  LEU A HD11 4  
ATOM 6642  H HD12 . LEU A 1 95  ? 13.825  -0.847  -3.512  1.00 0.00 ? 95  LEU A HD12 4  
ATOM 6643  H HD13 . LEU A 1 95  ? 15.256  -1.816  -3.087  1.00 0.00 ? 95  LEU A HD13 4  
ATOM 6644  H HD21 . LEU A 1 95  ? 14.000  -4.152  -1.453  1.00 0.00 ? 95  LEU A HD21 4  
ATOM 6645  H HD22 . LEU A 1 95  ? 15.381  -3.077  -1.127  1.00 0.00 ? 95  LEU A HD22 4  
ATOM 6646  H HD23 . LEU A 1 95  ? 14.038  -3.178  0.037   1.00 0.00 ? 95  LEU A HD23 4  
ATOM 6647  N N    . ALA A 1 96  ? 12.560  1.477   1.294   1.00 0.00 ? 96  ALA A N    4  
ATOM 6648  C CA   . ALA A 1 96  ? 12.849  2.297   2.459   1.00 0.00 ? 96  ALA A CA   4  
ATOM 6649  C C    . ALA A 1 96  ? 11.732  2.123   3.490   1.00 0.00 ? 96  ALA A C    4  
ATOM 6650  O O    . ALA A 1 96  ? 11.830  2.627   4.607   1.00 0.00 ? 96  ALA A O    4  
ATOM 6651  C CB   . ALA A 1 96  ? 13.023  3.754   2.027   1.00 0.00 ? 96  ALA A CB   4  
ATOM 6652  H H    . ALA A 1 96  ? 12.207  1.977   0.503   1.00 0.00 ? 96  ALA A H    4  
ATOM 6653  H HA   . ALA A 1 96  ? 13.787  1.943   2.888   1.00 0.00 ? 96  ALA A HA   4  
ATOM 6654  H HB1  . ALA A 1 96  ? 12.063  4.153   1.698   1.00 0.00 ? 96  ALA A HB1  4  
ATOM 6655  H HB2  . ALA A 1 96  ? 13.391  4.341   2.869   1.00 0.00 ? 96  ALA A HB2  4  
ATOM 6656  H HB3  . ALA A 1 96  ? 13.739  3.807   1.207   1.00 0.00 ? 96  ALA A HB3  4  
ATOM 6657  N N    . HIS A 1 97  ? 10.695  1.409   3.077   1.00 0.00 ? 97  HIS A N    4  
ATOM 6658  C CA   . HIS A 1 97  ? 9.561   1.162   3.950   1.00 0.00 ? 97  HIS A CA   4  
ATOM 6659  C C    . HIS A 1 97  ? 8.902   -0.167  3.574   1.00 0.00 ? 97  HIS A C    4  
ATOM 6660  O O    . HIS A 1 97  ? 7.679   -0.291  3.613   1.00 0.00 ? 97  HIS A O    4  
ATOM 6661  C CB   . HIS A 1 97  ? 8.583   2.339   3.916   1.00 0.00 ? 97  HIS A CB   4  
ATOM 6662  C CG   . HIS A 1 97  ? 9.190   3.654   4.343   1.00 0.00 ? 97  HIS A CG   4  
ATOM 6663  N ND1  . HIS A 1 97  ? 9.339   4.015   5.671   1.00 0.00 ? 97  HIS A ND1  4  
ATOM 6664  C CD2  . HIS A 1 97  ? 9.683   4.689   3.605   1.00 0.00 ? 97  HIS A CD2  4  
ATOM 6665  C CE1  . HIS A 1 97  ? 9.897   5.215   5.718   1.00 0.00 ? 97  HIS A CE1  4  
ATOM 6666  N NE2  . HIS A 1 97  ? 10.110  5.632   4.437   1.00 0.00 ? 97  HIS A NE2  4  
ATOM 6667  H H    . HIS A 1 97  ? 10.623  1.002   2.166   1.00 0.00 ? 97  HIS A H    4  
ATOM 6668  H HA   . HIS A 1 97  ? 9.956   1.088   4.963   1.00 0.00 ? 97  HIS A HA   4  
ATOM 6669  H HB2  . HIS A 1 97  ? 8.191   2.443   2.904   1.00 0.00 ? 97  HIS A HB2  4  
ATOM 6670  H HB3  . HIS A 1 97  ? 7.736   2.113   4.564   1.00 0.00 ? 97  HIS A HB3  4  
ATOM 6671  H HD1  . HIS A 1 97  ? 9.071   3.463   6.461   1.00 0.00 ? 97  HIS A HD1  4  
ATOM 6672  H HD2  . HIS A 1 97  ? 9.721   4.735   2.517   1.00 0.00 ? 97  HIS A HD2  4  
ATOM 6673  H HE1  . HIS A 1 97  ? 10.144  5.772   6.622   1.00 0.00 ? 97  HIS A HE1  4  
ATOM 6674  N N    . ILE A 1 98  ? 9.743   -1.127  3.219   1.00 0.00 ? 98  ILE A N    4  
ATOM 6675  C CA   . ILE A 1 98  ? 9.258   -2.442  2.836   1.00 0.00 ? 98  ILE A CA   4  
ATOM 6676  C C    . ILE A 1 98  ? 9.115   -3.312  4.086   1.00 0.00 ? 98  ILE A C    4  
ATOM 6677  O O    . ILE A 1 98  ? 10.086  -3.530  4.809   1.00 0.00 ? 98  ILE A O    4  
ATOM 6678  C CB   . ILE A 1 98  ? 10.160  -3.054  1.761   1.00 0.00 ? 98  ILE A CB   4  
ATOM 6679  C CG1  . ILE A 1 98  ? 9.498   -4.275  1.121   1.00 0.00 ? 98  ILE A CG1  4  
ATOM 6680  C CG2  . ILE A 1 98  ? 11.543  -3.382  2.327   1.00 0.00 ? 98  ILE A CG2  4  
ATOM 6681  C CD1  . ILE A 1 98  ? 9.113   -3.992  -0.333  1.00 0.00 ? 98  ILE A CD1  4  
ATOM 6682  H H    . ILE A 1 98  ? 10.737  -1.018  3.189   1.00 0.00 ? 98  ILE A H    4  
ATOM 6683  H HA   . ILE A 1 98  ? 8.272   -2.310  2.392   1.00 0.00 ? 98  ILE A HA   4  
ATOM 6684  H HB   . ILE A 1 98  ? 10.302  -2.314  0.973   1.00 0.00 ? 98  ILE A HB   4  
ATOM 6685  H HG12 . ILE A 1 98  ? 10.179  -5.125  1.161   1.00 0.00 ? 98  ILE A HG12 4  
ATOM 6686  H HG13 . ILE A 1 98  ? 8.609   -4.552  1.688   1.00 0.00 ? 98  ILE A HG13 4  
ATOM 6687  H HG21 . ILE A 1 98  ? 11.508  -4.345  2.837   1.00 0.00 ? 98  ILE A HG21 4  
ATOM 6688  H HG22 . ILE A 1 98  ? 12.267  -3.427  1.514   1.00 0.00 ? 98  ILE A HG22 4  
ATOM 6689  H HG23 . ILE A 1 98  ? 11.839  -2.607  3.035   1.00 0.00 ? 98  ILE A HG23 4  
ATOM 6690  H HD11 . ILE A 1 98  ? 8.843   -4.925  -0.826  1.00 0.00 ? 98  ILE A HD11 4  
ATOM 6691  H HD12 . ILE A 1 98  ? 8.264   -3.309  -0.357  1.00 0.00 ? 98  ILE A HD12 4  
ATOM 6692  H HD13 . ILE A 1 98  ? 9.959   -3.538  -0.850  1.00 0.00 ? 98  ILE A HD13 4  
ATOM 6693  N N    . LEU A 1 99  ? 7.897   -3.785  4.303   1.00 0.00 ? 99  LEU A N    4  
ATOM 6694  C CA   . LEU A 1 99  ? 7.614   -4.626  5.454   1.00 0.00 ? 99  LEU A CA   4  
ATOM 6695  C C    . LEU A 1 99  ? 7.681   -6.096  5.034   1.00 0.00 ? 99  LEU A C    4  
ATOM 6696  O O    . LEU A 1 99  ? 7.888   -6.975  5.870   1.00 0.00 ? 99  LEU A O    4  
ATOM 6697  C CB   . LEU A 1 99  ? 6.282   -4.230  6.093   1.00 0.00 ? 99  LEU A CB   4  
ATOM 6698  C CG   . LEU A 1 99  ? 6.221   -2.827  6.700   1.00 0.00 ? 99  LEU A CG   4  
ATOM 6699  C CD1  . LEU A 1 99  ? 4.910   -2.616  7.462   1.00 0.00 ? 99  LEU A CD1  4  
ATOM 6700  C CD2  . LEU A 1 99  ? 7.444   -2.556  7.578   1.00 0.00 ? 99  LEU A CD2  4  
ATOM 6701  H H    . LEU A 1 99  ? 7.112   -3.603  3.710   1.00 0.00 ? 99  LEU A H    4  
ATOM 6702  H HA   . LEU A 1 99  ? 8.394   -4.442  6.193   1.00 0.00 ? 99  LEU A HA   4  
ATOM 6703  H HB2  . LEU A 1 99  ? 5.500   -4.311  5.337   1.00 0.00 ? 99  LEU A HB2  4  
ATOM 6704  H HB3  . LEU A 1 99  ? 6.047   -4.953  6.874   1.00 0.00 ? 99  LEU A HB3  4  
ATOM 6705  H HG   . LEU A 1 99  ? 6.240   -2.101  5.887   1.00 0.00 ? 99  LEU A HG   4  
ATOM 6706  H HD11 . LEU A 1 99  ? 4.136   -3.254  7.037   1.00 0.00 ? 99  LEU A HD11 4  
ATOM 6707  H HD12 . LEU A 1 99  ? 5.055   -2.871  8.512   1.00 0.00 ? 99  LEU A HD12 4  
ATOM 6708  H HD13 . LEU A 1 99  ? 4.607   -1.572  7.380   1.00 0.00 ? 99  LEU A HD13 4  
ATOM 6709  H HD21 . LEU A 1 99  ? 8.346   -2.602  6.968   1.00 0.00 ? 99  LEU A HD21 4  
ATOM 6710  H HD22 . LEU A 1 99  ? 7.358   -1.565  8.025   1.00 0.00 ? 99  LEU A HD22 4  
ATOM 6711  H HD23 . LEU A 1 99  ? 7.499   -3.306  8.366   1.00 0.00 ? 99  LEU A HD23 4  
ATOM 6712  N N    . SER A 1 100 ? 7.504   -6.318  3.740   1.00 0.00 ? 100 SER A N    4  
ATOM 6713  C CA   . SER A 1 100 ? 7.542   -7.666  3.200   1.00 0.00 ? 100 SER A CA   4  
ATOM 6714  C C    . SER A 1 100 ? 8.869   -7.902  2.476   1.00 0.00 ? 100 SER A C    4  
ATOM 6715  O O    . SER A 1 100 ? 9.637   -6.966  2.258   1.00 0.00 ? 100 SER A O    4  
ATOM 6716  C CB   . SER A 1 100 ? 6.368   -7.912  2.250   1.00 0.00 ? 100 SER A CB   4  
ATOM 6717  O OG   . SER A 1 100 ? 6.801   -8.109  0.907   1.00 0.00 ? 100 SER A OG   4  
ATOM 6718  H H    . SER A 1 100 ? 7.336   -5.597  3.067   1.00 0.00 ? 100 SER A H    4  
ATOM 6719  H HA   . SER A 1 100 ? 7.454   -8.326  4.063   1.00 0.00 ? 100 SER A HA   4  
ATOM 6720  H HB2  . SER A 1 100 ? 5.809   -8.787  2.583   1.00 0.00 ? 100 SER A HB2  4  
ATOM 6721  H HB3  . SER A 1 100 ? 5.685   -7.064  2.290   1.00 0.00 ? 100 SER A HB3  4  
ATOM 6722  H HG   . SER A 1 100 ? 6.050   -7.920  0.274   1.00 0.00 ? 100 SER A HG   4  
ATOM 6723  N N    . SER A 1 101 ? 9.098   -9.159  2.123   1.00 0.00 ? 101 SER A N    4  
ATOM 6724  C CA   . SER A 1 101 ? 10.319  -9.530  1.428   1.00 0.00 ? 101 SER A CA   4  
ATOM 6725  C C    . SER A 1 101 ? 10.024  -9.778  -0.052  1.00 0.00 ? 101 SER A C    4  
ATOM 6726  O O    . SER A 1 101 ? 10.936  -10.038 -0.835  1.00 0.00 ? 101 SER A O    4  
ATOM 6727  C CB   . SER A 1 101 ? 10.956  -10.771 2.058   1.00 0.00 ? 101 SER A CB   4  
ATOM 6728  O OG   . SER A 1 101 ? 12.218  -10.481 2.651   1.00 0.00 ? 101 SER A OG   4  
ATOM 6729  H H    . SER A 1 101 ? 8.469   -9.914  2.304   1.00 0.00 ? 101 SER A H    4  
ATOM 6730  H HA   . SER A 1 101 ? 10.990  -8.679  1.548   1.00 0.00 ? 101 SER A HA   4  
ATOM 6731  H HB2  . SER A 1 101 ? 10.285  -11.179 2.814   1.00 0.00 ? 101 SER A HB2  4  
ATOM 6732  H HB3  . SER A 1 101 ? 11.081  -11.540 1.296   1.00 0.00 ? 101 SER A HB3  4  
ATOM 6733  H HG   . SER A 1 101 ? 12.929  -10.457 1.949   1.00 0.00 ? 101 SER A HG   4  
ATOM 6734  N N    . TRP A 1 102 ? 8.747   -9.688  -0.391  1.00 0.00 ? 102 TRP A N    4  
ATOM 6735  C CA   . TRP A 1 102 ? 8.320   -9.899  -1.764  1.00 0.00 ? 102 TRP A CA   4  
ATOM 6736  C C    . TRP A 1 102 ? 7.920   -8.543  -2.349  1.00 0.00 ? 102 TRP A C    4  
ATOM 6737  O O    . TRP A 1 102 ? 8.263   -7.499  -1.796  1.00 0.00 ? 102 TRP A O    4  
ATOM 6738  C CB   . TRP A 1 102 ? 7.197   -10.936 -1.836  1.00 0.00 ? 102 TRP A CB   4  
ATOM 6739  C CG   . TRP A 1 102 ? 5.845   -10.426 -1.333  1.00 0.00 ? 102 TRP A CG   4  
ATOM 6740  C CD1  . TRP A 1 102 ? 4.902   -9.771  -2.024  1.00 0.00 ? 102 TRP A CD1  4  
ATOM 6741  C CD2  . TRP A 1 102 ? 5.321   -10.556 0.005   1.00 0.00 ? 102 TRP A CD2  4  
ATOM 6742  N NE1  . TRP A 1 102 ? 3.813   -9.471  -1.232  1.00 0.00 ? 102 TRP A NE1  4  
ATOM 6743  C CE2  . TRP A 1 102 ? 4.075   -9.963  0.040   1.00 0.00 ? 102 TRP A CE2  4  
ATOM 6744  C CE3  . TRP A 1 102 ? 5.880   -11.155 1.147   1.00 0.00 ? 102 TRP A CE3  4  
ATOM 6745  C CZ2  . TRP A 1 102 ? 3.284   -9.912  1.194   1.00 0.00 ? 102 TRP A CZ2  4  
ATOM 6746  C CZ3  . TRP A 1 102 ? 5.077   -11.095 2.292   1.00 0.00 ? 102 TRP A CZ3  4  
ATOM 6747  C CH2  . TRP A 1 102 ? 3.821   -10.502 2.344   1.00 0.00 ? 102 TRP A CH2  4  
ATOM 6748  H H    . TRP A 1 102 ? 8.011   -9.476  0.252   1.00 0.00 ? 102 TRP A H    4  
ATOM 6749  H HA   . TRP A 1 102 ? 9.166   -10.308 -2.317  1.00 0.00 ? 102 TRP A HA   4  
ATOM 6750  H HB2  . TRP A 1 102 ? 7.088   -11.267 -2.869  1.00 0.00 ? 102 TRP A HB2  4  
ATOM 6751  H HB3  . TRP A 1 102 ? 7.485   -11.810 -1.250  1.00 0.00 ? 102 TRP A HB3  4  
ATOM 6752  H HD1  . TRP A 1 102 ? 4.986   -9.508  -3.079  1.00 0.00 ? 102 TRP A HD1  4  
ATOM 6753  H HE1  . TRP A 1 102 ? 2.912   -8.944  -1.547  1.00 0.00 ? 102 TRP A HE1  4  
ATOM 6754  H HE3  . TRP A 1 102 ? 6.862   -11.630 1.145   1.00 0.00 ? 102 TRP A HE3  4  
ATOM 6755  H HZ2  . TRP A 1 102 ? 2.302   -9.437  1.197   1.00 0.00 ? 102 TRP A HZ2  4  
ATOM 6756  H HZ3  . TRP A 1 102 ? 5.463   -11.545 3.207   1.00 0.00 ? 102 TRP A HZ3  4  
ATOM 6757  H HH2  . TRP A 1 102 ? 3.256   -10.496 3.277   1.00 0.00 ? 102 TRP A HH2  4  
ATOM 6758  N N    . GLY A 1 103 ? 7.199   -8.603  -3.459  1.00 0.00 ? 103 GLY A N    4  
ATOM 6759  C CA   . GLY A 1 103 ? 6.748   -7.393  -4.124  1.00 0.00 ? 103 GLY A CA   4  
ATOM 6760  C C    . GLY A 1 103 ? 7.738   -6.962  -5.208  1.00 0.00 ? 103 GLY A C    4  
ATOM 6761  O O    . GLY A 1 103 ? 8.320   -5.881  -5.128  1.00 0.00 ? 103 GLY A O    4  
ATOM 6762  H H    . GLY A 1 103 ? 6.924   -9.456  -3.902  1.00 0.00 ? 103 GLY A H    4  
ATOM 6763  H HA2  . GLY A 1 103 ? 5.767   -7.561  -4.569  1.00 0.00 ? 103 GLY A HA2  4  
ATOM 6764  H HA3  . GLY A 1 103 ? 6.633   -6.593  -3.393  1.00 0.00 ? 103 GLY A HA3  4  
ATOM 6765  N N    . ALA A 1 104 ? 7.899   -7.829  -6.196  1.00 0.00 ? 104 ALA A N    4  
ATOM 6766  C CA   . ALA A 1 104 ? 8.808   -7.552  -7.295  1.00 0.00 ? 104 ALA A CA   4  
ATOM 6767  C C    . ALA A 1 104 ? 8.153   -7.973  -8.612  1.00 0.00 ? 104 ALA A C    4  
ATOM 6768  O O    . ALA A 1 104 ? 6.963   -8.282  -8.647  1.00 0.00 ? 104 ALA A O    4  
ATOM 6769  C CB   . ALA A 1 104 ? 10.138  -8.268  -7.050  1.00 0.00 ? 104 ALA A CB   4  
ATOM 6770  H H    . ALA A 1 104 ? 7.422   -8.706  -6.254  1.00 0.00 ? 104 ALA A H    4  
ATOM 6771  H HA   . ALA A 1 104 ? 8.987   -6.477  -7.315  1.00 0.00 ? 104 ALA A HA   4  
ATOM 6772  H HB1  . ALA A 1 104 ? 9.976   -9.346  -7.053  1.00 0.00 ? 104 ALA A HB1  4  
ATOM 6773  H HB2  . ALA A 1 104 ? 10.843  -8.005  -7.839  1.00 0.00 ? 104 ALA A HB2  4  
ATOM 6774  H HB3  . ALA A 1 104 ? 10.542  -7.963  -6.085  1.00 0.00 ? 104 ALA A HB3  4  
ATOM 6775  N N    . GLU A 1 105 ? 8.959   -7.972  -9.664  1.00 0.00 ? 105 GLU A N    4  
ATOM 6776  C CA   . GLU A 1 105 ? 8.473   -8.350  -10.980 1.00 0.00 ? 105 GLU A CA   4  
ATOM 6777  C C    . GLU A 1 105 ? 7.561   -9.573  -10.877 1.00 0.00 ? 105 GLU A C    4  
ATOM 6778  O O    . GLU A 1 105 ? 8.020   -10.669 -10.559 1.00 0.00 ? 105 GLU A O    4  
ATOM 6779  C CB   . GLU A 1 105 ? 9.635   -8.611  -11.940 1.00 0.00 ? 105 GLU A CB   4  
ATOM 6780  C CG   . GLU A 1 105 ? 10.275  -7.299  -12.397 1.00 0.00 ? 105 GLU A CG   4  
ATOM 6781  C CD   . GLU A 1 105 ? 11.779  -7.470  -12.622 1.00 0.00 ? 105 GLU A CD   4  
ATOM 6782  O OE1  . GLU A 1 105 ? 12.460  -7.842  -11.642 1.00 0.00 ? 105 GLU A OE1  4  
ATOM 6783  O OE2  . GLU A 1 105 ? 12.212  -7.227  -13.768 1.00 0.00 ? 105 GLU A OE2  4  
ATOM 6784  H H    . GLU A 1 105 ? 9.926   -7.719  -9.627  1.00 0.00 ? 105 GLU A H    4  
ATOM 6785  H HA   . GLU A 1 105 ? 7.903   -7.491  -11.335 1.00 0.00 ? 105 GLU A HA   4  
ATOM 6786  H HB2  . GLU A 1 105 ? 10.384  -9.233  -11.449 1.00 0.00 ? 105 GLU A HB2  4  
ATOM 6787  H HB3  . GLU A 1 105 ? 9.278   -9.167  -12.807 1.00 0.00 ? 105 GLU A HB3  4  
ATOM 6788  H HG2  . GLU A 1 105 ? 9.802   -6.961  -13.319 1.00 0.00 ? 105 GLU A HG2  4  
ATOM 6789  H HG3  . GLU A 1 105 ? 10.102  -6.525  -11.648 1.00 0.00 ? 105 GLU A HG3  4  
ATOM 6790  N N    . VAL A 1 106 ? 6.285   -9.346  -11.153 1.00 0.00 ? 106 VAL A N    4  
ATOM 6791  C CA   . VAL A 1 106 ? 5.304   -10.416 -11.096 1.00 0.00 ? 106 VAL A CA   4  
ATOM 6792  C C    . VAL A 1 106 ? 5.581   -11.416 -12.221 1.00 0.00 ? 106 VAL A C    4  
ATOM 6793  O O    . VAL A 1 106 ? 6.291   -11.102 -13.175 1.00 0.00 ? 106 VAL A O    4  
ATOM 6794  C CB   . VAL A 1 106 ? 3.890   -9.834  -11.148 1.00 0.00 ? 106 VAL A CB   4  
ATOM 6795  C CG1  . VAL A 1 106 ? 3.698   -8.762  -10.073 1.00 0.00 ? 106 VAL A CG1  4  
ATOM 6796  C CG2  . VAL A 1 106 ? 3.578   -9.277  -12.539 1.00 0.00 ? 106 VAL A CG2  4  
ATOM 6797  H H    . VAL A 1 106 ? 5.920   -8.451  -11.412 1.00 0.00 ? 106 VAL A H    4  
ATOM 6798  H HA   . VAL A 1 106 ? 5.425   -10.922 -10.139 1.00 0.00 ? 106 VAL A HA   4  
ATOM 6799  H HB   . VAL A 1 106 ? 3.187   -10.642 -10.946 1.00 0.00 ? 106 VAL A HB   4  
ATOM 6800  H HG11 . VAL A 1 106 ? 3.581   -9.241  -9.101  1.00 0.00 ? 106 VAL A HG11 4  
ATOM 6801  H HG12 . VAL A 1 106 ? 4.570   -8.108  -10.052 1.00 0.00 ? 106 VAL A HG12 4  
ATOM 6802  H HG13 . VAL A 1 106 ? 2.808   -8.176  -10.299 1.00 0.00 ? 106 VAL A HG13 4  
ATOM 6803  H HG21 . VAL A 1 106 ? 2.715   -9.799  -12.954 1.00 0.00 ? 106 VAL A HG21 4  
ATOM 6804  H HG22 . VAL A 1 106 ? 3.356   -8.212  -12.462 1.00 0.00 ? 106 VAL A HG22 4  
ATOM 6805  H HG23 . VAL A 1 106 ? 4.439   -9.423  -13.191 1.00 0.00 ? 106 VAL A HG23 4  
ATOM 6806  N N    . LYS A 1 107 ? 5.005   -12.600 -12.072 1.00 0.00 ? 107 LYS A N    4  
ATOM 6807  C CA   . LYS A 1 107 ? 5.180   -13.648 -13.063 1.00 0.00 ? 107 LYS A CA   4  
ATOM 6808  C C    . LYS A 1 107 ? 3.822   -13.998 -13.674 1.00 0.00 ? 107 LYS A C    4  
ATOM 6809  O O    . LYS A 1 107 ? 3.244   -15.036 -13.357 1.00 0.00 ? 107 LYS A O    4  
ATOM 6810  C CB   . LYS A 1 107 ? 5.907   -14.847 -12.452 1.00 0.00 ? 107 LYS A CB   4  
ATOM 6811  C CG   . LYS A 1 107 ? 6.101   -15.956 -13.487 1.00 0.00 ? 107 LYS A CG   4  
ATOM 6812  C CD   . LYS A 1 107 ? 7.230   -15.608 -14.459 1.00 0.00 ? 107 LYS A CD   4  
ATOM 6813  C CE   . LYS A 1 107 ? 6.673   -15.224 -15.832 1.00 0.00 ? 107 LYS A CE   4  
ATOM 6814  N NZ   . LYS A 1 107 ? 7.391   -14.049 -16.373 1.00 0.00 ? 107 LYS A NZ   4  
ATOM 6815  H H    . LYS A 1 107 ? 4.428   -12.847 -11.293 1.00 0.00 ? 107 LYS A H    4  
ATOM 6816  H HA   . LYS A 1 107 ? 5.821   -13.249 -13.850 1.00 0.00 ? 107 LYS A HA   4  
ATOM 6817  H HB2  . LYS A 1 107 ? 6.877   -14.532 -12.065 1.00 0.00 ? 107 LYS A HB2  4  
ATOM 6818  H HB3  . LYS A 1 107 ? 5.337   -15.230 -11.605 1.00 0.00 ? 107 LYS A HB3  4  
ATOM 6819  H HG2  . LYS A 1 107 ? 6.329   -16.895 -12.981 1.00 0.00 ? 107 LYS A HG2  4  
ATOM 6820  H HG3  . LYS A 1 107 ? 5.175   -16.109 -14.040 1.00 0.00 ? 107 LYS A HG3  4  
ATOM 6821  H HD2  . LYS A 1 107 ? 7.818   -14.782 -14.058 1.00 0.00 ? 107 LYS A HD2  4  
ATOM 6822  H HD3  . LYS A 1 107 ? 7.903   -16.459 -14.561 1.00 0.00 ? 107 LYS A HD3  4  
ATOM 6823  H HE2  . LYS A 1 107 ? 6.770   -16.066 -16.518 1.00 0.00 ? 107 LYS A HE2  4  
ATOM 6824  H HE3  . LYS A 1 107 ? 5.609   -15.002 -15.750 1.00 0.00 ? 107 LYS A HE3  4  
ATOM 6825  H HZ1  . LYS A 1 107 ? 8.080   -13.747 -15.714 1.00 0.00 ? 107 LYS A HZ1  4  
ATOM 6826  H HZ2  . LYS A 1 107 ? 7.838   -14.298 -17.232 1.00 0.00 ? 107 LYS A HZ2  4  
ATOM 6827  H HZ3  . LYS A 1 107 ? 6.741   -13.308 -16.538 1.00 0.00 ? 107 LYS A HZ3  4  
ATOM 6828  N N    . SER A 1 108 ? 3.353   -13.112 -14.540 1.00 0.00 ? 108 SER A N    4  
ATOM 6829  C CA   . SER A 1 108 ? 2.073   -13.315 -15.199 1.00 0.00 ? 108 SER A CA   4  
ATOM 6830  C C    . SER A 1 108 ? 1.764   -12.130 -16.117 1.00 0.00 ? 108 SER A C    4  
ATOM 6831  O O    . SER A 1 108 ? 1.532   -12.311 -17.311 1.00 0.00 ? 108 SER A O    4  
ATOM 6832  C CB   . SER A 1 108 ? 0.951   -13.501 -14.176 1.00 0.00 ? 108 SER A CB   4  
ATOM 6833  O OG   . SER A 1 108 ? 0.223   -14.706 -14.396 1.00 0.00 ? 108 SER A OG   4  
ATOM 6834  H H    . SER A 1 108 ? 3.829   -12.270 -14.793 1.00 0.00 ? 108 SER A H    4  
ATOM 6835  H HA   . SER A 1 108 ? 2.190   -14.229 -15.780 1.00 0.00 ? 108 SER A HA   4  
ATOM 6836  H HB2  . SER A 1 108 ? 1.373   -13.510 -13.171 1.00 0.00 ? 108 SER A HB2  4  
ATOM 6837  H HB3  . SER A 1 108 ? 0.270   -12.651 -14.227 1.00 0.00 ? 108 SER A HB3  4  
ATOM 6838  H HG   . SER A 1 108 ? -0.491  -14.555 -15.080 1.00 0.00 ? 108 SER A HG   4  
ATOM 6839  N N    . GLY A 1 109 ? 1.771   -10.945 -15.524 1.00 0.00 ? 109 GLY A N    4  
ATOM 6840  C CA   . GLY A 1 109 ? 1.494   -9.732  -16.274 1.00 0.00 ? 109 GLY A CA   4  
ATOM 6841  C C    . GLY A 1 109 ? 1.385   -8.524  -15.341 1.00 0.00 ? 109 GLY A C    4  
ATOM 6842  O O    . GLY A 1 109 ? 1.104   -8.676  -14.154 1.00 0.00 ? 109 GLY A O    4  
ATOM 6843  H H    . GLY A 1 109 ? 1.961   -10.808 -14.552 1.00 0.00 ? 109 GLY A H    4  
ATOM 6844  H HA2  . GLY A 1 109 ? 2.286   -9.562  -17.004 1.00 0.00 ? 109 GLY A HA2  4  
ATOM 6845  H HA3  . GLY A 1 109 ? 0.566   -9.849  -16.833 1.00 0.00 ? 109 GLY A HA3  4  
ATOM 6846  N N    . PRO A 1 110 ? 1.619   -7.321  -15.930 1.00 0.00 ? 110 PRO A N    4  
ATOM 6847  C CA   . PRO A 1 110 ? 1.550   -6.087  -15.165 1.00 0.00 ? 110 PRO A CA   4  
ATOM 6848  C C    . PRO A 1 110 ? 0.098   -5.702  -14.875 1.00 0.00 ? 110 PRO A C    4  
ATOM 6849  O O    . PRO A 1 110 ? -0.825  -6.427  -15.243 1.00 0.00 ? 110 PRO A O    4  
ATOM 6850  C CB   . PRO A 1 110 ? 2.281   -5.058  -16.011 1.00 0.00 ? 110 PRO A CB   4  
ATOM 6851  C CG   . PRO A 1 110 ? 2.326   -5.631  -17.418 1.00 0.00 ? 110 PRO A CG   4  
ATOM 6852  C CD   . PRO A 1 110 ? 1.955   -7.103  -17.334 1.00 0.00 ? 110 PRO A CD   4  
ATOM 6853  H HA   . PRO A 1 110 ? 1.984   -6.208  -14.272 1.00 0.00 ? 110 PRO A HA   4  
ATOM 6854  H HB2  . PRO A 1 110 ? 1.761   -4.100  -15.996 1.00 0.00 ? 110 PRO A HB2  4  
ATOM 6855  H HB3  . PRO A 1 110 ? 3.286   -4.880  -15.629 1.00 0.00 ? 110 PRO A HB3  4  
ATOM 6856  H HG2  . PRO A 1 110 ? 1.632   -5.099  -18.069 1.00 0.00 ? 110 PRO A HG2  4  
ATOM 6857  H HG3  . PRO A 1 110 ? 3.321   -5.512  -17.847 1.00 0.00 ? 110 PRO A HG3  4  
ATOM 6858  H HD2  . PRO A 1 110 ? 1.112   -7.337  -17.983 1.00 0.00 ? 110 PRO A HD2  4  
ATOM 6859  H HD3  . PRO A 1 110 ? 2.784   -7.738  -17.646 1.00 0.00 ? 110 PRO A HD3  4  
ATOM 6860  N N    . SER A 1 111 ? -0.058  -4.562  -14.219 1.00 0.00 ? 111 SER A N    4  
ATOM 6861  C CA   . SER A 1 111 ? -1.383  -4.071  -13.876 1.00 0.00 ? 111 SER A CA   4  
ATOM 6862  C C    . SER A 1 111 ? -1.909  -3.164  -14.990 1.00 0.00 ? 111 SER A C    4  
ATOM 6863  O O    . SER A 1 111 ? -2.953  -3.440  -15.579 1.00 0.00 ? 111 SER A O    4  
ATOM 6864  C CB   . SER A 1 111 ? -1.364  -3.320  -12.544 1.00 0.00 ? 111 SER A CB   4  
ATOM 6865  O OG   . SER A 1 111 ? -2.677  -3.109  -12.031 1.00 0.00 ? 111 SER A OG   4  
ATOM 6866  H H    . SER A 1 111 ? 0.698   -3.978  -13.923 1.00 0.00 ? 111 SER A H    4  
ATOM 6867  H HA   . SER A 1 111 ? -2.004  -4.962  -13.782 1.00 0.00 ? 111 SER A HA   4  
ATOM 6868  H HB2  . SER A 1 111 ? -0.777  -3.884  -11.818 1.00 0.00 ? 111 SER A HB2  4  
ATOM 6869  H HB3  . SER A 1 111 ? -0.868  -2.359  -12.676 1.00 0.00 ? 111 SER A HB3  4  
ATOM 6870  H HG   . SER A 1 111 ? -2.877  -3.780  -11.317 1.00 0.00 ? 111 SER A HG   4  
ATOM 6871  N N    . SER A 1 112 ? -1.162  -2.100  -15.245 1.00 0.00 ? 112 SER A N    4  
ATOM 6872  C CA   . SER A 1 112 ? -1.540  -1.150  -16.277 1.00 0.00 ? 112 SER A CA   4  
ATOM 6873  C C    . SER A 1 112 ? -2.820  -0.417  -15.871 1.00 0.00 ? 112 SER A C    4  
ATOM 6874  O O    . SER A 1 112 ? -3.531  -0.856  -14.968 1.00 0.00 ? 112 SER A O    4  
ATOM 6875  C CB   . SER A 1 112 ? -1.734  -1.849  -17.625 1.00 0.00 ? 112 SER A CB   4  
ATOM 6876  O OG   . SER A 1 112 ? -0.618  -2.666  -17.968 1.00 0.00 ? 112 SER A OG   4  
ATOM 6877  H H    . SER A 1 112 ? -0.314  -1.883  -14.761 1.00 0.00 ? 112 SER A H    4  
ATOM 6878  H HA   . SER A 1 112 ? -0.706  -0.452  -16.348 1.00 0.00 ? 112 SER A HA   4  
ATOM 6879  H HB2  . SER A 1 112 ? -2.635  -2.462  -17.589 1.00 0.00 ? 112 SER A HB2  4  
ATOM 6880  H HB3  . SER A 1 112 ? -1.889  -1.101  -18.402 1.00 0.00 ? 112 SER A HB3  4  
ATOM 6881  H HG   . SER A 1 112 ? -0.420  -3.305  -17.224 1.00 0.00 ? 112 SER A HG   4  
ATOM 6882  N N    . GLY A 1 113 ? -3.076  0.687   -16.557 1.00 0.00 ? 113 GLY A N    4  
ATOM 6883  C CA   . GLY A 1 113 ? -4.258  1.485   -16.279 1.00 0.00 ? 113 GLY A CA   4  
ATOM 6884  C C    . GLY A 1 113 ? -4.258  2.772   -17.106 1.00 0.00 ? 113 GLY A C    4  
ATOM 6885  O O    . GLY A 1 113 ? -3.907  3.838   -16.602 1.00 0.00 ? 113 GLY A O    4  
ATOM 6886  H H    . GLY A 1 113 ? -2.493  1.037   -17.291 1.00 0.00 ? 113 GLY A H    4  
ATOM 6887  H HA2  . GLY A 1 113 ? -5.153  0.905   -16.502 1.00 0.00 ? 113 GLY A HA2  4  
ATOM 6888  H HA3  . GLY A 1 113 ? -4.294  1.730   -15.218 1.00 0.00 ? 113 GLY A HA3  4  
ATOM 6889  N N    . GLY A 1 1   ? -13.019 17.975  -19.793 1.00 0.00 ? 1   GLY A N    5  
ATOM 6890  C CA   . GLY A 1 1   ? -11.623 17.697  -19.501 1.00 0.00 ? 1   GLY A CA   5  
ATOM 6891  C C    . GLY A 1 1   ? -11.078 16.603  -20.421 1.00 0.00 ? 1   GLY A C    5  
ATOM 6892  O O    . GLY A 1 1   ? -11.845 15.832  -20.997 1.00 0.00 ? 1   GLY A O    5  
ATOM 6893  H H1   . GLY A 1 1   ? -13.390 17.492  -20.586 1.00 0.00 ? 1   GLY A H1   5  
ATOM 6894  H HA2  . GLY A 1 1   ? -11.035 18.607  -19.623 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6895  H HA3  . GLY A 1 1   ? -11.520 17.388  -18.461 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6896  N N    . SER A 1 2   ? -9.758  16.570  -20.531 1.00 0.00 ? 2   SER A N    5  
ATOM 6897  C CA   . SER A 1 2   ? -9.102  15.584  -21.372 1.00 0.00 ? 2   SER A CA   5  
ATOM 6898  C C    . SER A 1 2   ? -7.942  14.938  -20.611 1.00 0.00 ? 2   SER A C    5  
ATOM 6899  O O    . SER A 1 2   ? -7.924  13.724  -20.413 1.00 0.00 ? 2   SER A O    5  
ATOM 6900  C CB   . SER A 1 2   ? -8.598  16.214  -22.672 1.00 0.00 ? 2   SER A CB   5  
ATOM 6901  O OG   . SER A 1 2   ? -9.201  15.623  -23.820 1.00 0.00 ? 2   SER A OG   5  
ATOM 6902  H H    . SER A 1 2   ? -9.142  17.201  -20.060 1.00 0.00 ? 2   SER A H    5  
ATOM 6903  H HA   . SER A 1 2   ? -9.868  14.843  -21.601 1.00 0.00 ? 2   SER A HA   5  
ATOM 6904  H HB2  . SER A 1 2   ? -8.810  17.284  -22.661 1.00 0.00 ? 2   SER A HB2  5  
ATOM 6905  H HB3  . SER A 1 2   ? -7.516  16.104  -22.733 1.00 0.00 ? 2   SER A HB3  5  
ATOM 6906  H HG   . SER A 1 2   ? -8.515  15.489  -24.535 1.00 0.00 ? 2   SER A HG   5  
ATOM 6907  N N    . SER A 1 3   ? -7.000  15.778  -20.207 1.00 0.00 ? 3   SER A N    5  
ATOM 6908  C CA   . SER A 1 3   ? -5.839  15.304  -19.473 1.00 0.00 ? 3   SER A CA   5  
ATOM 6909  C C    . SER A 1 3   ? -4.948  16.485  -19.085 1.00 0.00 ? 3   SER A C    5  
ATOM 6910  O O    . SER A 1 3   ? -5.066  17.570  -19.653 1.00 0.00 ? 3   SER A O    5  
ATOM 6911  C CB   . SER A 1 3   ? -5.045  14.287  -20.295 1.00 0.00 ? 3   SER A CB   5  
ATOM 6912  O OG   . SER A 1 3   ? -4.759  13.106  -19.551 1.00 0.00 ? 3   SER A OG   5  
ATOM 6913  H H    . SER A 1 3   ? -7.022  16.764  -20.372 1.00 0.00 ? 3   SER A H    5  
ATOM 6914  H HA   . SER A 1 3   ? -6.239  14.818  -18.583 1.00 0.00 ? 3   SER A HA   5  
ATOM 6915  H HB2  . SER A 1 3   ? -5.610  14.024  -21.190 1.00 0.00 ? 3   SER A HB2  5  
ATOM 6916  H HB3  . SER A 1 3   ? -4.112  14.740  -20.629 1.00 0.00 ? 3   SER A HB3  5  
ATOM 6917  H HG   . SER A 1 3   ? -4.948  12.297  -20.107 1.00 0.00 ? 3   SER A HG   5  
ATOM 6918  N N    . GLY A 1 4   ? -4.075  16.234  -18.120 1.00 0.00 ? 4   GLY A N    5  
ATOM 6919  C CA   . GLY A 1 4   ? -3.163  17.263  -17.650 1.00 0.00 ? 4   GLY A CA   5  
ATOM 6920  C C    . GLY A 1 4   ? -2.805  17.047  -16.178 1.00 0.00 ? 4   GLY A C    5  
ATOM 6921  O O    . GLY A 1 4   ? -3.610  17.327  -15.292 1.00 0.00 ? 4   GLY A O    5  
ATOM 6922  H H    . GLY A 1 4   ? -3.985  15.349  -17.664 1.00 0.00 ? 4   GLY A H    5  
ATOM 6923  H HA2  . GLY A 1 4   ? -2.256  17.255  -18.254 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6924  H HA3  . GLY A 1 4   ? -3.621  18.245  -17.776 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6925  N N    . SER A 1 5   ? -1.595  16.551  -15.964 1.00 0.00 ? 5   SER A N    5  
ATOM 6926  C CA   . SER A 1 5   ? -1.120  16.294  -14.615 1.00 0.00 ? 5   SER A CA   5  
ATOM 6927  C C    . SER A 1 5   ? 0.302   15.731  -14.659 1.00 0.00 ? 5   SER A C    5  
ATOM 6928  O O    . SER A 1 5   ? 0.631   14.937  -15.539 1.00 0.00 ? 5   SER A O    5  
ATOM 6929  C CB   . SER A 1 5   ? -2.051  15.329  -13.877 1.00 0.00 ? 5   SER A CB   5  
ATOM 6930  O OG   . SER A 1 5   ? -2.860  15.999  -12.914 1.00 0.00 ? 5   SER A OG   5  
ATOM 6931  H H    . SER A 1 5   ? -0.946  16.326  -16.690 1.00 0.00 ? 5   SER A H    5  
ATOM 6932  H HA   . SER A 1 5   ? -1.132  17.263  -14.115 1.00 0.00 ? 5   SER A HA   5  
ATOM 6933  H HB2  . SER A 1 5   ? -2.691  14.821  -14.598 1.00 0.00 ? 5   SER A HB2  5  
ATOM 6934  H HB3  . SER A 1 5   ? -1.458  14.561  -13.381 1.00 0.00 ? 5   SER A HB3  5  
ATOM 6935  H HG   . SER A 1 5   ? -3.764  15.574  -12.873 1.00 0.00 ? 5   SER A HG   5  
ATOM 6936  N N    . SER A 1 6   ? 1.105   16.163  -13.698 1.00 0.00 ? 6   SER A N    5  
ATOM 6937  C CA   . SER A 1 6   ? 2.484   15.711  -13.616 1.00 0.00 ? 6   SER A CA   5  
ATOM 6938  C C    . SER A 1 6   ? 3.152   16.293  -12.369 1.00 0.00 ? 6   SER A C    5  
ATOM 6939  O O    . SER A 1 6   ? 2.813   17.393  -11.935 1.00 0.00 ? 6   SER A O    5  
ATOM 6940  C CB   . SER A 1 6   ? 3.268   16.105  -14.870 1.00 0.00 ? 6   SER A CB   5  
ATOM 6941  O OG   . SER A 1 6   ? 4.591   15.576  -14.861 1.00 0.00 ? 6   SER A OG   5  
ATOM 6942  H H    . SER A 1 6   ? 0.829   16.808  -12.986 1.00 0.00 ? 6   SER A H    5  
ATOM 6943  H HA   . SER A 1 6   ? 2.428   14.625  -13.549 1.00 0.00 ? 6   SER A HA   5  
ATOM 6944  H HB2  . SER A 1 6   ? 2.740   15.746  -15.755 1.00 0.00 ? 6   SER A HB2  5  
ATOM 6945  H HB3  . SER A 1 6   ? 3.311   17.191  -14.945 1.00 0.00 ? 6   SER A HB3  5  
ATOM 6946  H HG   . SER A 1 6   ? 5.169   16.113  -14.246 1.00 0.00 ? 6   SER A HG   5  
ATOM 6947  N N    . GLY A 1 7   ? 4.089   15.529  -11.828 1.00 0.00 ? 7   GLY A N    5  
ATOM 6948  C CA   . GLY A 1 7   ? 4.808   15.955  -10.639 1.00 0.00 ? 7   GLY A CA   5  
ATOM 6949  C C    . GLY A 1 7   ? 4.213   15.318  -9.381  1.00 0.00 ? 7   GLY A C    5  
ATOM 6950  O O    . GLY A 1 7   ? 4.329   14.110  -9.179  1.00 0.00 ? 7   GLY A O    5  
ATOM 6951  H H    . GLY A 1 7   ? 4.359   14.636  -12.187 1.00 0.00 ? 7   GLY A H    5  
ATOM 6952  H HA2  . GLY A 1 7   ? 5.859   15.681  -10.727 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6953  H HA3  . GLY A 1 7   ? 4.767   17.041  -10.555 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6954  N N    . ASP A 1 8   ? 3.590   16.158  -8.569  1.00 0.00 ? 8   ASP A N    5  
ATOM 6955  C CA   . ASP A 1 8   ? 2.978   15.692  -7.336  1.00 0.00 ? 8   ASP A CA   5  
ATOM 6956  C C    . ASP A 1 8   ? 2.131   14.452  -7.630  1.00 0.00 ? 8   ASP A C    5  
ATOM 6957  O O    . ASP A 1 8   ? 1.954   14.077  -8.788  1.00 0.00 ? 8   ASP A O    5  
ATOM 6958  C CB   . ASP A 1 8   ? 2.060   16.761  -6.739  1.00 0.00 ? 8   ASP A CB   5  
ATOM 6959  C CG   . ASP A 1 8   ? 2.662   18.166  -6.671  1.00 0.00 ? 8   ASP A CG   5  
ATOM 6960  O OD1  . ASP A 1 8   ? 3.814   18.267  -6.197  1.00 0.00 ? 8   ASP A OD1  5  
ATOM 6961  O OD2  . ASP A 1 8   ? 1.956   19.107  -7.094  1.00 0.00 ? 8   ASP A OD2  5  
ATOM 6962  H H    . ASP A 1 8   ? 3.501   17.139  -8.740  1.00 0.00 ? 8   ASP A H    5  
ATOM 6963  H HA   . ASP A 1 8   ? 3.810   15.480  -6.665  1.00 0.00 ? 8   ASP A HA   5  
ATOM 6964  H HB2  . ASP A 1 8   ? 1.144   16.802  -7.329  1.00 0.00 ? 8   ASP A HB2  5  
ATOM 6965  H HB3  . ASP A 1 8   ? 1.777   16.454  -5.732  1.00 0.00 ? 8   ASP A HB3  5  
ATOM 6966  N N    . LYS A 1 9   ? 1.631   13.850  -6.561  1.00 0.00 ? 9   LYS A N    5  
ATOM 6967  C CA   . LYS A 1 9   ? 0.807   12.660  -6.689  1.00 0.00 ? 9   LYS A CA   5  
ATOM 6968  C C    . LYS A 1 9   ? 1.692   11.471  -7.068  1.00 0.00 ? 9   LYS A C    5  
ATOM 6969  O O    . LYS A 1 9   ? 1.774   11.101  -8.238  1.00 0.00 ? 9   LYS A O    5  
ATOM 6970  C CB   . LYS A 1 9   ? -0.343  12.907  -7.668  1.00 0.00 ? 9   LYS A CB   5  
ATOM 6971  C CG   . LYS A 1 9   ? -1.099  14.189  -7.314  1.00 0.00 ? 9   LYS A CG   5  
ATOM 6972  C CD   . LYS A 1 9   ? -2.593  14.044  -7.610  1.00 0.00 ? 9   LYS A CD   5  
ATOM 6973  C CE   . LYS A 1 9   ? -2.944  14.651  -8.970  1.00 0.00 ? 9   LYS A CE   5  
ATOM 6974  N NZ   . LYS A 1 9   ? -4.057  15.618  -8.834  1.00 0.00 ? 9   LYS A NZ   5  
ATOM 6975  H H    . LYS A 1 9   ? 1.780   14.162  -5.622  1.00 0.00 ? 9   LYS A H    5  
ATOM 6976  H HA   . LYS A 1 9   ? 0.363   12.463  -5.714  1.00 0.00 ? 9   LYS A HA   5  
ATOM 6977  H HB2  . LYS A 1 9   ? 0.048   12.980  -8.683  1.00 0.00 ? 9   LYS A HB2  5  
ATOM 6978  H HB3  . LYS A 1 9   ? -1.028  12.060  -7.651  1.00 0.00 ? 9   LYS A HB3  5  
ATOM 6979  H HG2  . LYS A 1 9   ? -0.954  14.421  -6.259  1.00 0.00 ? 9   LYS A HG2  5  
ATOM 6980  H HG3  . LYS A 1 9   ? -0.691  15.025  -7.882  1.00 0.00 ? 9   LYS A HG3  5  
ATOM 6981  H HD2  . LYS A 1 9   ? -2.869  12.990  -7.596  1.00 0.00 ? 9   LYS A HD2  5  
ATOM 6982  H HD3  . LYS A 1 9   ? -3.171  14.536  -6.828  1.00 0.00 ? 9   LYS A HD3  5  
ATOM 6983  H HE2  . LYS A 1 9   ? -2.070  15.151  -9.388  1.00 0.00 ? 9   LYS A HE2  5  
ATOM 6984  H HE3  . LYS A 1 9   ? -3.223  13.861  -9.666  1.00 0.00 ? 9   LYS A HE3  5  
ATOM 6985  H HZ1  . LYS A 1 9   ? -3.839  16.451  -9.343  1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 6986  H HZ2  . LYS A 1 9   ? -4.895  15.213  -9.200  1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 6987  H HZ3  . LYS A 1 9   ? -4.188  15.841  -7.868  1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 6988  N N    . PRO A 1 10  ? 2.349   10.890  -6.029  1.00 0.00 ? 10  PRO A N    5  
ATOM 6989  C CA   . PRO A 1 10  ? 3.225   9.750   -6.241  1.00 0.00 ? 10  PRO A CA   5  
ATOM 6990  C C    . PRO A 1 10  ? 2.416   8.475   -6.487  1.00 0.00 ? 10  PRO A C    5  
ATOM 6991  O O    . PRO A 1 10  ? 2.944   7.490   -7.003  1.00 0.00 ? 10  PRO A O    5  
ATOM 6992  C CB   . PRO A 1 10  ? 4.084   9.675   -4.989  1.00 0.00 ? 10  PRO A CB   5  
ATOM 6993  C CG   . PRO A 1 10  ? 3.348   10.481  -3.930  1.00 0.00 ? 10  PRO A CG   5  
ATOM 6994  C CD   . PRO A 1 10  ? 2.276   11.300  -4.630  1.00 0.00 ? 10  PRO A CD   5  
ATOM 6995  H HA   . PRO A 1 10  ? 3.779   9.886   -7.062  1.00 0.00 ? 10  PRO A HA   5  
ATOM 6996  H HB2  . PRO A 1 10  ? 4.219   8.642   -4.669  1.00 0.00 ? 10  PRO A HB2  5  
ATOM 6997  H HB3  . PRO A 1 10  ? 5.077   10.086  -5.171  1.00 0.00 ? 10  PRO A HB3  5  
ATOM 6998  H HG2  . PRO A 1 10  ? 2.900   9.819   -3.189  1.00 0.00 ? 10  PRO A HG2  5  
ATOM 6999  H HG3  . PRO A 1 10  ? 4.040   11.133  -3.397  1.00 0.00 ? 10  PRO A HG3  5  
ATOM 7000  H HD2  . PRO A 1 10  ? 1.289   11.103  -4.210  1.00 0.00 ? 10  PRO A HD2  5  
ATOM 7001  H HD3  . PRO A 1 10  ? 2.460   12.369  -4.521  1.00 0.00 ? 10  PRO A HD3  5  
ATOM 7002  N N    . LEU A 1 11  ? 1.148   8.534   -6.108  1.00 0.00 ? 11  LEU A N    5  
ATOM 7003  C CA   . LEU A 1 11  ? 0.261   7.397   -6.282  1.00 0.00 ? 11  LEU A CA   5  
ATOM 7004  C C    . LEU A 1 11  ? -0.722  7.691   -7.416  1.00 0.00 ? 11  LEU A C    5  
ATOM 7005  O O    . LEU A 1 11  ? -1.590  6.873   -7.718  1.00 0.00 ? 11  LEU A O    5  
ATOM 7006  C CB   . LEU A 1 11  ? -0.417  7.039   -4.958  1.00 0.00 ? 11  LEU A CB   5  
ATOM 7007  C CG   . LEU A 1 11  ? 0.518   6.709   -3.793  1.00 0.00 ? 11  LEU A CG   5  
ATOM 7008  C CD1  . LEU A 1 11  ? 1.742   5.929   -4.277  1.00 0.00 ? 11  LEU A CD1  5  
ATOM 7009  C CD2  . LEU A 1 11  ? 0.910   7.975   -3.028  1.00 0.00 ? 11  LEU A CD2  5  
ATOM 7010  H H    . LEU A 1 11  ? 0.726   9.339   -5.690  1.00 0.00 ? 11  LEU A H    5  
ATOM 7011  H HA   . LEU A 1 11  ? 0.876   6.544   -6.569  1.00 0.00 ? 11  LEU A HA   5  
ATOM 7012  H HB2  . LEU A 1 11  ? -1.054  7.873   -4.661  1.00 0.00 ? 11  LEU A HB2  5  
ATOM 7013  H HB3  . LEU A 1 11  ? -1.071  6.184   -5.127  1.00 0.00 ? 11  LEU A HB3  5  
ATOM 7014  H HG   . LEU A 1 11  ? -0.019  6.065   -3.096  1.00 0.00 ? 11  LEU A HG   5  
ATOM 7015  H HD11 . LEU A 1 11  ? 2.514   6.628   -4.598  1.00 0.00 ? 11  LEU A HD11 5  
ATOM 7016  H HD12 . LEU A 1 11  ? 2.125   5.313   -3.463  1.00 0.00 ? 11  LEU A HD12 5  
ATOM 7017  H HD13 . LEU A 1 11  ? 1.459   5.291   -5.113  1.00 0.00 ? 11  LEU A HD13 5  
ATOM 7018  H HD21 . LEU A 1 11  ? 0.089   8.274   -2.377  1.00 0.00 ? 11  LEU A HD21 5  
ATOM 7019  H HD22 . LEU A 1 11  ? 1.797   7.776   -2.427  1.00 0.00 ? 11  LEU A HD22 5  
ATOM 7020  H HD23 . LEU A 1 11  ? 1.123   8.775   -3.736  1.00 0.00 ? 11  LEU A HD23 5  
ATOM 7021  N N    . SER A 1 12  ? -0.554  8.861   -8.014  1.00 0.00 ? 12  SER A N    5  
ATOM 7022  C CA   . SER A 1 12  ? -1.415  9.273   -9.109  1.00 0.00 ? 12  SER A CA   5  
ATOM 7023  C C    . SER A 1 12  ? -1.544  8.139   -10.129 1.00 0.00 ? 12  SER A C    5  
ATOM 7024  O O    . SER A 1 12  ? -0.660  7.944   -10.961 1.00 0.00 ? 12  SER A O    5  
ATOM 7025  C CB   . SER A 1 12  ? -0.880  10.537  -9.786  1.00 0.00 ? 12  SER A CB   5  
ATOM 7026  O OG   . SER A 1 12  ? -1.925  11.445  -10.122 1.00 0.00 ? 12  SER A OG   5  
ATOM 7027  H H    . SER A 1 12  ? 0.155   9.521   -7.763  1.00 0.00 ? 12  SER A H    5  
ATOM 7028  H HA   . SER A 1 12  ? -2.381  9.488   -8.651  1.00 0.00 ? 12  SER A HA   5  
ATOM 7029  H HB2  . SER A 1 12  ? -0.171  11.030  -9.122  1.00 0.00 ? 12  SER A HB2  5  
ATOM 7030  H HB3  . SER A 1 12  ? -0.334  10.261  -10.688 1.00 0.00 ? 12  SER A HB3  5  
ATOM 7031  H HG   . SER A 1 12  ? -1.696  12.364  -9.802  1.00 0.00 ? 12  SER A HG   5  
ATOM 7032  N N    . ASN A 1 13  ? -2.654  7.422   -10.031 1.00 0.00 ? 13  ASN A N    5  
ATOM 7033  C CA   . ASN A 1 13  ? -2.910  6.313   -10.934 1.00 0.00 ? 13  ASN A CA   5  
ATOM 7034  C C    . ASN A 1 13  ? -2.299  5.036   -10.353 1.00 0.00 ? 13  ASN A C    5  
ATOM 7035  O O    . ASN A 1 13  ? -1.561  4.329   -11.039 1.00 0.00 ? 13  ASN A O    5  
ATOM 7036  C CB   . ASN A 1 13  ? -2.276  6.560   -12.304 1.00 0.00 ? 13  ASN A CB   5  
ATOM 7037  C CG   . ASN A 1 13  ? -3.031  5.809   -13.402 1.00 0.00 ? 13  ASN A CG   5  
ATOM 7038  O OD1  . ASN A 1 13  ? -3.088  4.590   -13.429 1.00 0.00 ? 13  ASN A OD1  5  
ATOM 7039  N ND2  . ASN A 1 13  ? -3.605  6.601   -14.303 1.00 0.00 ? 13  ASN A ND2  5  
ATOM 7040  H H    . ASN A 1 13  ? -3.369  7.587   -9.351  1.00 0.00 ? 13  ASN A H    5  
ATOM 7041  H HA   . ASN A 1 13  ? -3.995  6.255   -11.016 1.00 0.00 ? 13  ASN A HA   5  
ATOM 7042  H HB2  . ASN A 1 13  ? -2.277  7.628   -12.522 1.00 0.00 ? 13  ASN A HB2  5  
ATOM 7043  H HB3  . ASN A 1 13  ? -1.234  6.240   -12.289 1.00 0.00 ? 13  ASN A HB3  5  
ATOM 7044  H HD21 . ASN A 1 13  ? -3.520  7.594   -14.222 1.00 0.00 ? 13  ASN A HD21 5  
ATOM 7045  H HD22 . ASN A 1 13  ? -4.123  6.203   -15.060 1.00 0.00 ? 13  ASN A HD22 5  
ATOM 7046  N N    . MET A 1 14  ? -2.628  4.779   -9.096  1.00 0.00 ? 14  MET A N    5  
ATOM 7047  C CA   . MET A 1 14  ? -2.120  3.600   -8.415  1.00 0.00 ? 14  MET A CA   5  
ATOM 7048  C C    . MET A 1 14  ? -3.055  3.176   -7.281  1.00 0.00 ? 14  MET A C    5  
ATOM 7049  O O    . MET A 1 14  ? -3.467  4.004   -6.470  1.00 0.00 ? 14  MET A O    5  
ATOM 7050  C CB   . MET A 1 14  ? -0.730  3.896   -7.848  1.00 0.00 ? 14  MET A CB   5  
ATOM 7051  C CG   . MET A 1 14  ? 0.359   3.591   -8.879  1.00 0.00 ? 14  MET A CG   5  
ATOM 7052  S SD   . MET A 1 14  ? 1.416   2.283   -8.282  1.00 0.00 ? 14  MET A SD   5  
ATOM 7053  C CE   . MET A 1 14  ? 1.775   2.897   -6.644  1.00 0.00 ? 14  MET A CE   5  
ATOM 7054  H H    . MET A 1 14  ? -3.228  5.359   -8.545  1.00 0.00 ? 14  MET A H    5  
ATOM 7055  H HA   . MET A 1 14  ? -2.081  2.818   -9.174  1.00 0.00 ? 14  MET A HA   5  
ATOM 7056  H HB2  . MET A 1 14  ? -0.671  4.943   -7.550  1.00 0.00 ? 14  MET A HB2  5  
ATOM 7057  H HB3  . MET A 1 14  ? -0.565  3.299   -6.952  1.00 0.00 ? 14  MET A HB3  5  
ATOM 7058  H HG2  . MET A 1 14  ? -0.096  3.299   -9.825  1.00 0.00 ? 14  MET A HG2  5  
ATOM 7059  H HG3  . MET A 1 14  ? 0.949   4.487   -9.072  1.00 0.00 ? 14  MET A HG3  5  
ATOM 7060  H HE1  . MET A 1 14  ? 1.392   2.197   -5.902  1.00 0.00 ? 14  MET A HE1  5  
ATOM 7061  H HE2  . MET A 1 14  ? 2.853   3.002   -6.524  1.00 0.00 ? 14  MET A HE2  5  
ATOM 7062  H HE3  . MET A 1 14  ? 1.298   3.868   -6.508  1.00 0.00 ? 14  MET A HE3  5  
ATOM 7063  N N    . LYS A 1 15  ? -3.363  1.888   -7.260  1.00 0.00 ? 15  LYS A N    5  
ATOM 7064  C CA   . LYS A 1 15  ? -4.241  1.344   -6.239  1.00 0.00 ? 15  LYS A CA   5  
ATOM 7065  C C    . LYS A 1 15  ? -3.400  0.829   -5.069  1.00 0.00 ? 15  LYS A C    5  
ATOM 7066  O O    . LYS A 1 15  ? -2.464  0.056   -5.267  1.00 0.00 ? 15  LYS A O    5  
ATOM 7067  C CB   . LYS A 1 15  ? -5.172  0.289   -6.838  1.00 0.00 ? 15  LYS A CB   5  
ATOM 7068  C CG   . LYS A 1 15  ? -6.267  0.940   -7.686  1.00 0.00 ? 15  LYS A CG   5  
ATOM 7069  C CD   . LYS A 1 15  ? -7.000  -0.103  -8.532  1.00 0.00 ? 15  LYS A CD   5  
ATOM 7070  C CE   . LYS A 1 15  ? -8.510  -0.039  -8.294  1.00 0.00 ? 15  LYS A CE   5  
ATOM 7071  N NZ   . LYS A 1 15  ? -9.152  0.857   -9.282  1.00 0.00 ? 15  LYS A NZ   5  
ATOM 7072  H H    . LYS A 1 15  ? -3.023  1.221   -7.924  1.00 0.00 ? 15  LYS A H    5  
ATOM 7073  H HA   . LYS A 1 15  ? -4.869  2.160   -5.879  1.00 0.00 ? 15  LYS A HA   5  
ATOM 7074  H HB2  . LYS A 1 15  ? -4.596  -0.404  -7.452  1.00 0.00 ? 15  LYS A HB2  5  
ATOM 7075  H HB3  . LYS A 1 15  ? -5.626  -0.297  -6.039  1.00 0.00 ? 15  LYS A HB3  5  
ATOM 7076  H HG2  . LYS A 1 15  ? -6.977  1.452   -7.037  1.00 0.00 ? 15  LYS A HG2  5  
ATOM 7077  H HG3  . LYS A 1 15  ? -5.826  1.697   -8.336  1.00 0.00 ? 15  LYS A HG3  5  
ATOM 7078  H HD2  . LYS A 1 15  ? -6.787  0.065   -9.588  1.00 0.00 ? 15  LYS A HD2  5  
ATOM 7079  H HD3  . LYS A 1 15  ? -6.631  -1.099  -8.287  1.00 0.00 ? 15  LYS A HD3  5  
ATOM 7080  H HE2  . LYS A 1 15  ? -8.938  -1.038  -8.368  1.00 0.00 ? 15  LYS A HE2  5  
ATOM 7081  H HE3  . LYS A 1 15  ? -8.710  0.320   -7.285  1.00 0.00 ? 15  LYS A HE3  5  
ATOM 7082  H HZ1  . LYS A 1 15  ? -10.044 1.148   -8.937  1.00 0.00 ? 15  LYS A HZ1  5  
ATOM 7083  H HZ2  . LYS A 1 15  ? -8.574  1.659   -9.431  1.00 0.00 ? 15  LYS A HZ2  5  
ATOM 7084  H HZ3  . LYS A 1 15  ? -9.273  0.368   -10.146 1.00 0.00 ? 15  LYS A HZ3  5  
ATOM 7085  N N    . ILE A 1 16  ? -3.763  1.278   -3.877  1.00 0.00 ? 16  ILE A N    5  
ATOM 7086  C CA   . ILE A 1 16  ? -3.053  0.872   -2.676  1.00 0.00 ? 16  ILE A CA   5  
ATOM 7087  C C    . ILE A 1 16  ? -4.009  0.111   -1.756  1.00 0.00 ? 16  ILE A C    5  
ATOM 7088  O O    . ILE A 1 16  ? -5.161  0.507   -1.587  1.00 0.00 ? 16  ILE A O    5  
ATOM 7089  C CB   . ILE A 1 16  ? -2.391  2.080   -2.011  1.00 0.00 ? 16  ILE A CB   5  
ATOM 7090  C CG1  . ILE A 1 16  ? -1.473  2.812   -2.992  1.00 0.00 ? 16  ILE A CG1  5  
ATOM 7091  C CG2  . ILE A 1 16  ? -1.654  1.668   -0.735  1.00 0.00 ? 16  ILE A CG2  5  
ATOM 7092  C CD1  . ILE A 1 16  ? -2.285  3.516   -4.081  1.00 0.00 ? 16  ILE A CD1  5  
ATOM 7093  H H    . ILE A 1 16  ? -4.526  1.907   -3.725  1.00 0.00 ? 16  ILE A H    5  
ATOM 7094  H HA   . ILE A 1 16  ? -2.255  0.195   -2.982  1.00 0.00 ? 16  ILE A HA   5  
ATOM 7095  H HB   . ILE A 1 16  ? -3.174  2.780   -1.718  1.00 0.00 ? 16  ILE A HB   5  
ATOM 7096  H HG12 . ILE A 1 16  ? -0.869  3.543   -2.454  1.00 0.00 ? 16  ILE A HG12 5  
ATOM 7097  H HG13 . ILE A 1 16  ? -0.783  2.102   -3.449  1.00 0.00 ? 16  ILE A HG13 5  
ATOM 7098  H HG21 . ILE A 1 16  ? -1.939  2.333   0.080   1.00 0.00 ? 16  ILE A HG21 5  
ATOM 7099  H HG22 . ILE A 1 16  ? -1.920  0.643   -0.477  1.00 0.00 ? 16  ILE A HG22 5  
ATOM 7100  H HG23 . ILE A 1 16  ? -0.579  1.734   -0.899  1.00 0.00 ? 16  ILE A HG23 5  
ATOM 7101  H HD11 . ILE A 1 16  ? -3.337  3.530   -3.798  1.00 0.00 ? 16  ILE A HD11 5  
ATOM 7102  H HD12 . ILE A 1 16  ? -1.926  4.539   -4.197  1.00 0.00 ? 16  ILE A HD12 5  
ATOM 7103  H HD13 . ILE A 1 16  ? -2.169  2.981   -5.024  1.00 0.00 ? 16  ILE A HD13 5  
ATOM 7104  N N    . LEU A 1 17  ? -3.496  -0.970  -1.186  1.00 0.00 ? 17  LEU A N    5  
ATOM 7105  C CA   . LEU A 1 17  ? -4.291  -1.790  -0.287  1.00 0.00 ? 17  LEU A CA   5  
ATOM 7106  C C    . LEU A 1 17  ? -3.714  -1.696  1.127   1.00 0.00 ? 17  LEU A C    5  
ATOM 7107  O O    . LEU A 1 17  ? -2.512  -1.494  1.298   1.00 0.00 ? 17  LEU A O    5  
ATOM 7108  C CB   . LEU A 1 17  ? -4.391  -3.222  -0.817  1.00 0.00 ? 17  LEU A CB   5  
ATOM 7109  C CG   . LEU A 1 17  ? -5.259  -4.180  0.000   1.00 0.00 ? 17  LEU A CG   5  
ATOM 7110  C CD1  . LEU A 1 17  ? -6.531  -4.554  -0.764  1.00 0.00 ? 17  LEU A CD1  5  
ATOM 7111  C CD2  . LEU A 1 17  ? -4.463  -5.415  0.426   1.00 0.00 ? 17  LEU A CD2  5  
ATOM 7112  H H    . LEU A 1 17  ? -2.559  -1.286  -1.329  1.00 0.00 ? 17  LEU A H    5  
ATOM 7113  H HA   . LEU A 1 17  ? -5.300  -1.380  -0.276  1.00 0.00 ? 17  LEU A HA   5  
ATOM 7114  H HB2  . LEU A 1 17  ? -4.782  -3.186  -1.834  1.00 0.00 ? 17  LEU A HB2  5  
ATOM 7115  H HB3  . LEU A 1 17  ? -3.384  -3.637  -0.877  1.00 0.00 ? 17  LEU A HB3  5  
ATOM 7116  H HG   . LEU A 1 17  ? -5.570  -3.668  0.911   1.00 0.00 ? 17  LEU A HG   5  
ATOM 7117  H HD11 . LEU A 1 17  ? -6.384  -4.368  -1.827  1.00 0.00 ? 17  LEU A HD11 5  
ATOM 7118  H HD12 . LEU A 1 17  ? -6.752  -5.610  -0.607  1.00 0.00 ? 17  LEU A HD12 5  
ATOM 7119  H HD13 . LEU A 1 17  ? -7.364  -3.952  -0.401  1.00 0.00 ? 17  LEU A HD13 5  
ATOM 7120  H HD21 . LEU A 1 17  ? -4.681  -6.240  -0.251  1.00 0.00 ? 17  LEU A HD21 5  
ATOM 7121  H HD22 . LEU A 1 17  ? -3.397  -5.189  0.392   1.00 0.00 ? 17  LEU A HD22 5  
ATOM 7122  H HD23 . LEU A 1 17  ? -4.742  -5.695  1.442   1.00 0.00 ? 17  LEU A HD23 5  
ATOM 7123  N N    . THR A 1 18  ? -4.596  -1.847  2.103   1.00 0.00 ? 18  THR A N    5  
ATOM 7124  C CA   . THR A 1 18  ? -4.190  -1.782  3.496   1.00 0.00 ? 18  THR A CA   5  
ATOM 7125  C C    . THR A 1 18  ? -4.696  -3.009  4.258   1.00 0.00 ? 18  THR A C    5  
ATOM 7126  O O    . THR A 1 18  ? -5.721  -3.587  3.899   1.00 0.00 ? 18  THR A O    5  
ATOM 7127  C CB   . THR A 1 18  ? -4.693  -0.458  4.074   1.00 0.00 ? 18  THR A CB   5  
ATOM 7128  O OG1  . THR A 1 18  ? -6.108  -0.527  3.921   1.00 0.00 ? 18  THR A OG1  5  
ATOM 7129  C CG2  . THR A 1 18  ? -4.285  0.746   3.222   1.00 0.00 ? 18  THR A CG2  5  
ATOM 7130  H H    . THR A 1 18  ? -5.572  -2.011  1.955   1.00 0.00 ? 18  THR A H    5  
ATOM 7131  H HA   . THR A 1 18  ? -3.101  -1.807  3.538   1.00 0.00 ? 18  THR A HA   5  
ATOM 7132  H HB   . THR A 1 18  ? -4.365  -0.334  5.106   1.00 0.00 ? 18  THR A HB   5  
ATOM 7133  H HG1  . THR A 1 18  ? -6.557  -0.302  4.785   1.00 0.00 ? 18  THR A HG1  5  
ATOM 7134  H HG21 . THR A 1 18  ? -4.321  0.474   2.168   1.00 0.00 ? 18  THR A HG21 5  
ATOM 7135  H HG22 . THR A 1 18  ? -4.971  1.572   3.408   1.00 0.00 ? 18  THR A HG22 5  
ATOM 7136  H HG23 . THR A 1 18  ? -3.272  1.050   3.485   1.00 0.00 ? 18  THR A HG23 5  
ATOM 7137  N N    . LEU A 1 19  ? -3.954  -3.370  5.294   1.00 0.00 ? 19  LEU A N    5  
ATOM 7138  C CA   . LEU A 1 19  ? -4.314  -4.517  6.109   1.00 0.00 ? 19  LEU A CA   5  
ATOM 7139  C C    . LEU A 1 19  ? -4.033  -4.202  7.580   1.00 0.00 ? 19  LEU A C    5  
ATOM 7140  O O    . LEU A 1 19  ? -3.493  -3.144  7.899   1.00 0.00 ? 19  LEU A O    5  
ATOM 7141  C CB   . LEU A 1 19  ? -3.607  -5.776  5.604   1.00 0.00 ? 19  LEU A CB   5  
ATOM 7142  C CG   . LEU A 1 19  ? -4.505  -6.843  4.973   1.00 0.00 ? 19  LEU A CG   5  
ATOM 7143  C CD1  . LEU A 1 19  ? -3.674  -7.886  4.225   1.00 0.00 ? 19  LEU A CD1  5  
ATOM 7144  C CD2  . LEU A 1 19  ? -5.417  -7.482  6.022   1.00 0.00 ? 19  LEU A CD2  5  
ATOM 7145  H H    . LEU A 1 19  ? -3.122  -2.894  5.579   1.00 0.00 ? 19  LEU A H    5  
ATOM 7146  H HA   . LEU A 1 19  ? -5.386  -4.679  5.989   1.00 0.00 ? 19  LEU A HA   5  
ATOM 7147  H HB2  . LEU A 1 19  ? -2.859  -5.479  4.870   1.00 0.00 ? 19  LEU A HB2  5  
ATOM 7148  H HB3  . LEU A 1 19  ? -3.072  -6.228  6.440   1.00 0.00 ? 19  LEU A HB3  5  
ATOM 7149  H HG   . LEU A 1 19  ? -5.148  -6.357  4.240   1.00 0.00 ? 19  LEU A HG   5  
ATOM 7150  H HD11 . LEU A 1 19  ? -4.121  -8.075  3.249   1.00 0.00 ? 19  LEU A HD11 5  
ATOM 7151  H HD12 . LEU A 1 19  ? -2.657  -7.515  4.093   1.00 0.00 ? 19  LEU A HD12 5  
ATOM 7152  H HD13 . LEU A 1 19  ? -3.650  -8.812  4.799   1.00 0.00 ? 19  LEU A HD13 5  
ATOM 7153  H HD21 . LEU A 1 19  ? -4.841  -8.183  6.626   1.00 0.00 ? 19  LEU A HD21 5  
ATOM 7154  H HD22 . LEU A 1 19  ? -5.832  -6.705  6.664   1.00 0.00 ? 19  LEU A HD22 5  
ATOM 7155  H HD23 . LEU A 1 19  ? -6.228  -8.013  5.523   1.00 0.00 ? 19  LEU A HD23 5  
ATOM 7156  N N    . GLY A 1 20  ? -4.413  -5.139  8.436   1.00 0.00 ? 20  GLY A N    5  
ATOM 7157  C CA   . GLY A 1 20  ? -4.208  -4.974  9.865   1.00 0.00 ? 20  GLY A CA   5  
ATOM 7158  C C    . GLY A 1 20  ? -4.691  -3.599  10.333  1.00 0.00 ? 20  GLY A C    5  
ATOM 7159  O O    . GLY A 1 20  ? -5.614  -3.030  9.751   1.00 0.00 ? 20  GLY A O    5  
ATOM 7160  H H    . GLY A 1 20  ? -4.852  -5.996  8.168   1.00 0.00 ? 20  GLY A H    5  
ATOM 7161  H HA2  . GLY A 1 20  ? -4.744  -5.754  10.405  1.00 0.00 ? 20  GLY A HA2  5  
ATOM 7162  H HA3  . GLY A 1 20  ? -3.151  -5.091  10.101  1.00 0.00 ? 20  GLY A HA3  5  
ATOM 7163  N N    . LYS A 1 21  ? -4.046  -3.106  11.380  1.00 0.00 ? 21  LYS A N    5  
ATOM 7164  C CA   . LYS A 1 21  ? -4.398  -1.809  11.932  1.00 0.00 ? 21  LYS A CA   5  
ATOM 7165  C C    . LYS A 1 21  ? -3.198  -0.867  11.818  1.00 0.00 ? 21  LYS A C    5  
ATOM 7166  O O    . LYS A 1 21  ? -2.083  -1.229  12.191  1.00 0.00 ? 21  LYS A O    5  
ATOM 7167  C CB   . LYS A 1 21  ? -4.927  -1.960  13.360  1.00 0.00 ? 21  LYS A CB   5  
ATOM 7168  C CG   . LYS A 1 21  ? -5.201  -0.594  13.991  1.00 0.00 ? 21  LYS A CG   5  
ATOM 7169  C CD   . LYS A 1 21  ? -6.627  -0.128  13.691  1.00 0.00 ? 21  LYS A CD   5  
ATOM 7170  C CE   . LYS A 1 21  ? -7.639  -0.848  14.584  1.00 0.00 ? 21  LYS A CE   5  
ATOM 7171  N NZ   . LYS A 1 21  ? -8.005  -0.001  15.741  1.00 0.00 ? 21  LYS A NZ   5  
ATOM 7172  H H    . LYS A 1 21  ? -3.297  -3.575  11.847  1.00 0.00 ? 21  LYS A H    5  
ATOM 7173  H HA   . LYS A 1 21  ? -5.212  -1.406  11.329  1.00 0.00 ? 21  LYS A HA   5  
ATOM 7174  H HB2  . LYS A 1 21  ? -5.842  -2.552  13.352  1.00 0.00 ? 21  LYS A HB2  5  
ATOM 7175  H HB3  . LYS A 1 21  ? -4.201  -2.505  13.964  1.00 0.00 ? 21  LYS A HB3  5  
ATOM 7176  H HG2  . LYS A 1 21  ? -5.053  -0.651  15.070  1.00 0.00 ? 21  LYS A HG2  5  
ATOM 7177  H HG3  . LYS A 1 21  ? -4.488  0.137   13.610  1.00 0.00 ? 21  LYS A HG3  5  
ATOM 7178  H HD2  . LYS A 1 21  ? -6.702  0.949   13.845  1.00 0.00 ? 21  LYS A HD2  5  
ATOM 7179  H HD3  . LYS A 1 21  ? -6.862  -0.316  12.643  1.00 0.00 ? 21  LYS A HD3  5  
ATOM 7180  H HE2  . LYS A 1 21  ? -8.532  -1.093  14.008  1.00 0.00 ? 21  LYS A HE2  5  
ATOM 7181  H HE3  . LYS A 1 21  ? -7.218  -1.791  14.934  1.00 0.00 ? 21  LYS A HE3  5  
ATOM 7182  H HZ1  . LYS A 1 21  ? -7.174  0.306   16.205  1.00 0.00 ? 21  LYS A HZ1  5  
ATOM 7183  H HZ2  . LYS A 1 21  ? -8.522  0.794   15.422  1.00 0.00 ? 21  LYS A HZ2  5  
ATOM 7184  H HZ3  . LYS A 1 21  ? -8.567  -0.530  16.377  1.00 0.00 ? 21  LYS A HZ3  5  
ATOM 7185  N N    . LEU A 1 22  ? -3.466  0.322   11.300  1.00 0.00 ? 22  LEU A N    5  
ATOM 7186  C CA   . LEU A 1 22  ? -2.422  1.318   11.132  1.00 0.00 ? 22  LEU A CA   5  
ATOM 7187  C C    . LEU A 1 22  ? -2.636  2.451   12.138  1.00 0.00 ? 22  LEU A C    5  
ATOM 7188  O O    . LEU A 1 22  ? -3.698  2.550   12.750  1.00 0.00 ? 22  LEU A O    5  
ATOM 7189  C CB   . LEU A 1 22  ? -2.362  1.791   9.678   1.00 0.00 ? 22  LEU A CB   5  
ATOM 7190  C CG   . LEU A 1 22  ? -2.178  0.697   8.624   1.00 0.00 ? 22  LEU A CG   5  
ATOM 7191  C CD1  . LEU A 1 22  ? -2.865  1.080   7.311   1.00 0.00 ? 22  LEU A CD1  5  
ATOM 7192  C CD2  . LEU A 1 22  ? -0.697  0.372   8.423   1.00 0.00 ? 22  LEU A CD2  5  
ATOM 7193  H H    . LEU A 1 22  ? -4.376  0.609   10.999  1.00 0.00 ? 22  LEU A H    5  
ATOM 7194  H HA   . LEU A 1 22  ? -1.470  0.835   11.353  1.00 0.00 ? 22  LEU A HA   5  
ATOM 7195  H HB2  . LEU A 1 22  ? -3.281  2.333   9.454   1.00 0.00 ? 22  LEU A HB2  5  
ATOM 7196  H HB3  . LEU A 1 22  ? -1.541  2.502   9.581   1.00 0.00 ? 22  LEU A HB3  5  
ATOM 7197  H HG   . LEU A 1 22  ? -2.661  -0.211  8.986   1.00 0.00 ? 22  LEU A HG   5  
ATOM 7198  H HD11 . LEU A 1 22  ? -2.206  1.727   6.732   1.00 0.00 ? 22  LEU A HD11 5  
ATOM 7199  H HD12 . LEU A 1 22  ? -3.084  0.179   6.739   1.00 0.00 ? 22  LEU A HD12 5  
ATOM 7200  H HD13 . LEU A 1 22  ? -3.794  1.608   7.527   1.00 0.00 ? 22  LEU A HD13 5  
ATOM 7201  H HD21 . LEU A 1 22  ? -0.497  0.233   7.360   1.00 0.00 ? 22  LEU A HD21 5  
ATOM 7202  H HD22 . LEU A 1 22  ? -0.090  1.195   8.802   1.00 0.00 ? 22  LEU A HD22 5  
ATOM 7203  H HD23 . LEU A 1 22  ? -0.449  -0.541  8.962   1.00 0.00 ? 22  LEU A HD23 5  
ATOM 7204  N N    . SER A 1 23  ? -1.610  3.277   12.279  1.00 0.00 ? 23  SER A N    5  
ATOM 7205  C CA   . SER A 1 23  ? -1.672  4.398   13.200  1.00 0.00 ? 23  SER A CA   5  
ATOM 7206  C C    . SER A 1 23  ? -2.934  5.222   12.937  1.00 0.00 ? 23  SER A C    5  
ATOM 7207  O O    . SER A 1 23  ? -3.651  5.581   13.870  1.00 0.00 ? 23  SER A O    5  
ATOM 7208  C CB   . SER A 1 23  ? -0.428  5.280   13.080  1.00 0.00 ? 23  SER A CB   5  
ATOM 7209  O OG   . SER A 1 23  ? -0.334  6.220   14.147  1.00 0.00 ? 23  SER A OG   5  
ATOM 7210  H H    . SER A 1 23  ? -0.749  3.189   11.777  1.00 0.00 ? 23  SER A H    5  
ATOM 7211  H HA   . SER A 1 23  ? -1.706  3.953   14.195  1.00 0.00 ? 23  SER A HA   5  
ATOM 7212  H HB2  . SER A 1 23  ? 0.463   4.651   13.072  1.00 0.00 ? 23  SER A HB2  5  
ATOM 7213  H HB3  . SER A 1 23  ? -0.451  5.812   12.129  1.00 0.00 ? 23  SER A HB3  5  
ATOM 7214  H HG   . SER A 1 23  ? 0.319   6.940   13.912  1.00 0.00 ? 23  SER A HG   5  
ATOM 7215  N N    . ARG A 1 24  ? -3.167  5.498   11.662  1.00 0.00 ? 24  ARG A N    5  
ATOM 7216  C CA   . ARG A 1 24  ? -4.330  6.273   11.265  1.00 0.00 ? 24  ARG A CA   5  
ATOM 7217  C C    . ARG A 1 24  ? -5.509  5.345   10.964  1.00 0.00 ? 24  ARG A C    5  
ATOM 7218  O O    . ARG A 1 24  ? -5.378  4.124   11.041  1.00 0.00 ? 24  ARG A O    5  
ATOM 7219  C CB   . ARG A 1 24  ? -4.030  7.121   10.028  1.00 0.00 ? 24  ARG A CB   5  
ATOM 7220  C CG   . ARG A 1 24  ? -3.093  8.281   10.373  1.00 0.00 ? 24  ARG A CG   5  
ATOM 7221  C CD   . ARG A 1 24  ? -3.540  9.571   9.682   1.00 0.00 ? 24  ARG A CD   5  
ATOM 7222  N NE   . ARG A 1 24  ? -2.622  10.677  10.032  1.00 0.00 ? 24  ARG A NE   5  
ATOM 7223  C CZ   . ARG A 1 24  ? -2.571  11.257  11.239  1.00 0.00 ? 24  ARG A CZ   5  
ATOM 7224  N NH1  . ARG A 1 24  ? -3.384  10.840  12.218  1.00 0.00 ? 24  ARG A NH1  5  
ATOM 7225  N NH2  . ARG A 1 24  ? -1.705  12.255  11.467  1.00 0.00 ? 24  ARG A NH2  5  
ATOM 7226  H H    . ARG A 1 24  ? -2.579  5.202   10.910  1.00 0.00 ? 24  ARG A H    5  
ATOM 7227  H HA   . ARG A 1 24  ? -4.543  6.914   12.120  1.00 0.00 ? 24  ARG A HA   5  
ATOM 7228  H HB2  . ARG A 1 24  ? -3.575  6.499   9.257   1.00 0.00 ? 24  ARG A HB2  5  
ATOM 7229  H HB3  . ARG A 1 24  ? -4.960  7.511   9.615   1.00 0.00 ? 24  ARG A HB3  5  
ATOM 7230  H HG2  . ARG A 1 24  ? -3.075  8.430   11.452  1.00 0.00 ? 24  ARG A HG2  5  
ATOM 7231  H HG3  . ARG A 1 24  ? -2.076  8.035   10.067  1.00 0.00 ? 24  ARG A HG3  5  
ATOM 7232  H HD2  . ARG A 1 24  ? -3.556  9.428   8.601   1.00 0.00 ? 24  ARG A HD2  5  
ATOM 7233  H HD3  . ARG A 1 24  ? -4.557  9.822   9.985   1.00 0.00 ? 24  ARG A HD3  5  
ATOM 7234  H HE   . ARG A 1 24  ? -2.001  11.013  9.324   1.00 0.00 ? 24  ARG A HE   5  
ATOM 7235  H HH11 . ARG A 1 24  ? -4.030  10.096  12.048  1.00 0.00 ? 24  ARG A HH11 5  
ATOM 7236  H HH12 . ARG A 1 24  ? -3.346  11.273  13.119  1.00 0.00 ? 24  ARG A HH12 5  
ATOM 7237  H HH21 . ARG A 1 24  ? -1.098  12.566  10.736  1.00 0.00 ? 24  ARG A HH21 5  
ATOM 7238  H HH22 . ARG A 1 24  ? -1.667  12.688  12.367  1.00 0.00 ? 24  ARG A HH22 5  
ATOM 7239  N N    . ASN A 1 25  ? -6.634  5.959   10.629  1.00 0.00 ? 25  ASN A N    5  
ATOM 7240  C CA   . ASN A 1 25  ? -7.835  5.203   10.317  1.00 0.00 ? 25  ASN A CA   5  
ATOM 7241  C C    . ASN A 1 25  ? -7.897  4.953   8.809   1.00 0.00 ? 25  ASN A C    5  
ATOM 7242  O O    . ASN A 1 25  ? -7.345  5.723   8.025   1.00 0.00 ? 25  ASN A O    5  
ATOM 7243  C CB   . ASN A 1 25  ? -9.092  5.976   10.721  1.00 0.00 ? 25  ASN A CB   5  
ATOM 7244  C CG   . ASN A 1 25  ? -9.246  6.018   12.242  1.00 0.00 ? 25  ASN A CG   5  
ATOM 7245  O OD1  . ASN A 1 25  ? -8.478  5.430   12.986  1.00 0.00 ? 25  ASN A OD1  5  
ATOM 7246  N ND2  . ASN A 1 25  ? -10.278 6.743   12.662  1.00 0.00 ? 25  ASN A ND2  5  
ATOM 7247  H H    . ASN A 1 25  ? -6.732  6.952   10.570  1.00 0.00 ? 25  ASN A H    5  
ATOM 7248  H HA   . ASN A 1 25  ? -7.749  4.280   10.890  1.00 0.00 ? 25  ASN A HA   5  
ATOM 7249  H HB2  . ASN A 1 25  ? -9.041  6.992   10.329  1.00 0.00 ? 25  ASN A HB2  5  
ATOM 7250  H HB3  . ASN A 1 25  ? -9.970  5.507   10.275  1.00 0.00 ? 25  ASN A HB3  5  
ATOM 7251  H HD21 . ASN A 1 25  ? -10.871 7.201   11.999  1.00 0.00 ? 25  ASN A HD21 5  
ATOM 7252  H HD22 . ASN A 1 25  ? -10.462 6.832   13.641  1.00 0.00 ? 25  ASN A HD22 5  
ATOM 7253  N N    . LYS A 1 26  ? -8.574  3.873   8.448   1.00 0.00 ? 26  LYS A N    5  
ATOM 7254  C CA   . LYS A 1 26  ? -8.716  3.511   7.048   1.00 0.00 ? 26  LYS A CA   5  
ATOM 7255  C C    . LYS A 1 26  ? -9.054  4.762   6.235   1.00 0.00 ? 26  LYS A C    5  
ATOM 7256  O O    . LYS A 1 26  ? -8.312  5.137   5.328   1.00 0.00 ? 26  LYS A O    5  
ATOM 7257  C CB   . LYS A 1 26  ? -9.733  2.380   6.887   1.00 0.00 ? 26  LYS A CB   5  
ATOM 7258  C CG   . LYS A 1 26  ? -9.305  1.411   5.783   1.00 0.00 ? 26  LYS A CG   5  
ATOM 7259  C CD   . LYS A 1 26  ? -10.349 0.310   5.584   1.00 0.00 ? 26  LYS A CD   5  
ATOM 7260  C CE   . LYS A 1 26  ? -9.966  -0.605  4.419   1.00 0.00 ? 26  LYS A CE   5  
ATOM 7261  N NZ   . LYS A 1 26  ? -10.893 -0.411  3.282   1.00 0.00 ? 26  LYS A NZ   5  
ATOM 7262  H H    . LYS A 1 26  ? -9.020  3.251   9.092   1.00 0.00 ? 26  LYS A H    5  
ATOM 7263  H HA   . LYS A 1 26  ? -7.753  3.129   6.710   1.00 0.00 ? 26  LYS A HA   5  
ATOM 7264  H HB2  . LYS A 1 26  ? -9.836  1.841   7.829   1.00 0.00 ? 26  LYS A HB2  5  
ATOM 7265  H HB3  . LYS A 1 26  ? -10.712 2.797   6.650   1.00 0.00 ? 26  LYS A HB3  5  
ATOM 7266  H HG2  . LYS A 1 26  ? -9.164  1.956   4.850   1.00 0.00 ? 26  LYS A HG2  5  
ATOM 7267  H HG3  . LYS A 1 26  ? -8.344  0.964   6.039   1.00 0.00 ? 26  LYS A HG3  5  
ATOM 7268  H HD2  . LYS A 1 26  ? -10.441 -0.278  6.498   1.00 0.00 ? 26  LYS A HD2  5  
ATOM 7269  H HD3  . LYS A 1 26  ? -11.323 0.759   5.394   1.00 0.00 ? 26  LYS A HD3  5  
ATOM 7270  H HE2  . LYS A 1 26  ? -8.944  -0.393  4.103   1.00 0.00 ? 26  LYS A HE2  5  
ATOM 7271  H HE3  . LYS A 1 26  ? -9.990  -1.645  4.743   1.00 0.00 ? 26  LYS A HE3  5  
ATOM 7272  H HZ1  . LYS A 1 26  ? -11.016 0.567   3.115   1.00 0.00 ? 26  LYS A HZ1  5  
ATOM 7273  H HZ2  . LYS A 1 26  ? -10.512 -0.843  2.464   1.00 0.00 ? 26  LYS A HZ2  5  
ATOM 7274  H HZ3  . LYS A 1 26  ? -11.777 -0.826  3.498   1.00 0.00 ? 26  LYS A HZ3  5  
ATOM 7275  N N    . ASP A 1 27  ? -10.175 5.374   6.588   1.00 0.00 ? 27  ASP A N    5  
ATOM 7276  C CA   . ASP A 1 27  ? -10.620 6.575   5.902   1.00 0.00 ? 27  ASP A CA   5  
ATOM 7277  C C    . ASP A 1 27  ? -9.444  7.545   5.765   1.00 0.00 ? 27  ASP A C    5  
ATOM 7278  O O    . ASP A 1 27  ? -9.008  7.844   4.655   1.00 0.00 ? 27  ASP A O    5  
ATOM 7279  C CB   . ASP A 1 27  ? -11.726 7.281   6.690   1.00 0.00 ? 27  ASP A CB   5  
ATOM 7280  C CG   . ASP A 1 27  ? -12.975 6.438   6.948   1.00 0.00 ? 27  ASP A CG   5  
ATOM 7281  O OD1  . ASP A 1 27  ? -13.408 5.758   5.993   1.00 0.00 ? 27  ASP A OD1  5  
ATOM 7282  O OD2  . ASP A 1 27  ? -13.470 6.492   8.095   1.00 0.00 ? 27  ASP A OD2  5  
ATOM 7283  H H    . ASP A 1 27  ? -10.772 5.063   7.327   1.00 0.00 ? 27  ASP A H    5  
ATOM 7284  H HA   . ASP A 1 27  ? -10.993 6.232   4.937   1.00 0.00 ? 27  ASP A HA   5  
ATOM 7285  H HB2  . ASP A 1 27  ? -11.319 7.604   7.648   1.00 0.00 ? 27  ASP A HB2  5  
ATOM 7286  H HB3  . ASP A 1 27  ? -12.018 8.181   6.149   1.00 0.00 ? 27  ASP A HB3  5  
ATOM 7287  N N    . GLU A 1 28  ? -8.965  8.009   6.910   1.00 0.00 ? 28  GLU A N    5  
ATOM 7288  C CA   . GLU A 1 28  ? -7.848  8.938   6.931   1.00 0.00 ? 28  GLU A CA   5  
ATOM 7289  C C    . GLU A 1 28  ? -6.819  8.556   5.866   1.00 0.00 ? 28  GLU A C    5  
ATOM 7290  O O    . GLU A 1 28  ? -6.290  9.421   5.169   1.00 0.00 ? 28  GLU A O    5  
ATOM 7291  C CB   . GLU A 1 28  ? -7.206  8.992   8.319   1.00 0.00 ? 28  GLU A CB   5  
ATOM 7292  C CG   . GLU A 1 28  ? -8.139  9.664   9.329   1.00 0.00 ? 28  GLU A CG   5  
ATOM 7293  C CD   . GLU A 1 28  ? -7.375  10.665  10.199  1.00 0.00 ? 28  GLU A CD   5  
ATOM 7294  O OE1  . GLU A 1 28  ? -7.252  11.826  9.753   1.00 0.00 ? 28  GLU A OE1  5  
ATOM 7295  O OE2  . GLU A 1 28  ? -6.931  10.246  11.289  1.00 0.00 ? 28  GLU A OE2  5  
ATOM 7296  H H    . GLU A 1 28  ? -9.325  7.760   7.809   1.00 0.00 ? 28  GLU A H    5  
ATOM 7297  H HA   . GLU A 1 28  ? -8.277  9.912   6.698   1.00 0.00 ? 28  GLU A HA   5  
ATOM 7298  H HB2  . GLU A 1 28  ? -6.970  7.982   8.654   1.00 0.00 ? 28  GLU A HB2  5  
ATOM 7299  H HB3  . GLU A 1 28  ? -6.265  9.539   8.267   1.00 0.00 ? 28  GLU A HB3  5  
ATOM 7300  H HG2  . GLU A 1 28  ? -8.943  10.176  8.801   1.00 0.00 ? 28  GLU A HG2  5  
ATOM 7301  H HG3  . GLU A 1 28  ? -8.603  8.907   9.961   1.00 0.00 ? 28  GLU A HG3  5  
ATOM 7302  N N    . VAL A 1 29  ? -6.565  7.259   5.772   1.00 0.00 ? 29  VAL A N    5  
ATOM 7303  C CA   . VAL A 1 29  ? -5.608  6.752   4.803   1.00 0.00 ? 29  VAL A CA   5  
ATOM 7304  C C    . VAL A 1 29  ? -6.224  6.816   3.404   1.00 0.00 ? 29  VAL A C    5  
ATOM 7305  O O    . VAL A 1 29  ? -5.646  7.410   2.494   1.00 0.00 ? 29  VAL A O    5  
ATOM 7306  C CB   . VAL A 1 29  ? -5.163  5.342   5.196   1.00 0.00 ? 29  VAL A CB   5  
ATOM 7307  C CG1  . VAL A 1 29  ? -4.304  4.712   4.098   1.00 0.00 ? 29  VAL A CG1  5  
ATOM 7308  C CG2  . VAL A 1 29  ? -4.420  5.354   6.533   1.00 0.00 ? 29  VAL A CG2  5  
ATOM 7309  H H    . VAL A 1 29  ? -6.999  6.562   6.342   1.00 0.00 ? 29  VAL A H    5  
ATOM 7310  H HA   . VAL A 1 29  ? -4.734  7.402   4.832   1.00 0.00 ? 29  VAL A HA   5  
ATOM 7311  H HB   . VAL A 1 29  ? -6.056  4.729   5.315   1.00 0.00 ? 29  VAL A HB   5  
ATOM 7312  H HG11 . VAL A 1 29  ? -3.332  4.439   4.508   1.00 0.00 ? 29  VAL A HG11 5  
ATOM 7313  H HG12 . VAL A 1 29  ? -4.801  3.820   3.714   1.00 0.00 ? 29  VAL A HG12 5  
ATOM 7314  H HG13 . VAL A 1 29  ? -4.168  5.428   3.287   1.00 0.00 ? 29  VAL A HG13 5  
ATOM 7315  H HG21 . VAL A 1 29  ? -4.753  6.206   7.126   1.00 0.00 ? 29  VAL A HG21 5  
ATOM 7316  H HG22 . VAL A 1 29  ? -4.629  4.431   7.074   1.00 0.00 ? 29  VAL A HG22 5  
ATOM 7317  H HG23 . VAL A 1 29  ? -3.348  5.435   6.353   1.00 0.00 ? 29  VAL A HG23 5  
ATOM 7318  N N    . LYS A 1 30  ? -7.388  6.197   3.275   1.00 0.00 ? 30  LYS A N    5  
ATOM 7319  C CA   . LYS A 1 30  ? -8.088  6.176   2.002   1.00 0.00 ? 30  LYS A CA   5  
ATOM 7320  C C    . LYS A 1 30  ? -8.070  7.580   1.392   1.00 0.00 ? 30  LYS A C    5  
ATOM 7321  O O    . LYS A 1 30  ? -8.047  7.730   0.172   1.00 0.00 ? 30  LYS A O    5  
ATOM 7322  C CB   . LYS A 1 30  ? -9.494  5.597   2.173   1.00 0.00 ? 30  LYS A CB   5  
ATOM 7323  C CG   . LYS A 1 30  ? -10.332 5.811   0.910   1.00 0.00 ? 30  LYS A CG   5  
ATOM 7324  C CD   . LYS A 1 30  ? -11.817 5.578   1.192   1.00 0.00 ? 30  LYS A CD   5  
ATOM 7325  C CE   . LYS A 1 30  ? -12.387 4.496   0.273   1.00 0.00 ? 30  LYS A CE   5  
ATOM 7326  N NZ   . LYS A 1 30  ? -13.253 3.570   1.036   1.00 0.00 ? 30  LYS A NZ   5  
ATOM 7327  H H    . LYS A 1 30  ? -7.851  5.717   4.020   1.00 0.00 ? 30  LYS A H    5  
ATOM 7328  H HA   . LYS A 1 30  ? -7.541  5.505   1.339   1.00 0.00 ? 30  LYS A HA   5  
ATOM 7329  H HB2  . LYS A 1 30  ? -9.428  4.532   2.394   1.00 0.00 ? 30  LYS A HB2  5  
ATOM 7330  H HB3  . LYS A 1 30  ? -9.985  6.070   3.023   1.00 0.00 ? 30  LYS A HB3  5  
ATOM 7331  H HG2  . LYS A 1 30  ? -10.183 6.824   0.538   1.00 0.00 ? 30  LYS A HG2  5  
ATOM 7332  H HG3  . LYS A 1 30  ? -9.995  5.131   0.127   1.00 0.00 ? 30  LYS A HG3  5  
ATOM 7333  H HD2  . LYS A 1 30  ? -11.951 5.283   2.233   1.00 0.00 ? 30  LYS A HD2  5  
ATOM 7334  H HD3  . LYS A 1 30  ? -12.368 6.507   1.051   1.00 0.00 ? 30  LYS A HD3  5  
ATOM 7335  H HE2  . LYS A 1 30  ? -12.958 4.958   -0.532  1.00 0.00 ? 30  LYS A HE2  5  
ATOM 7336  H HE3  . LYS A 1 30  ? -11.573 3.940   -0.193  1.00 0.00 ? 30  LYS A HE3  5  
ATOM 7337  H HZ1  . LYS A 1 30  ? -13.812 4.092   1.680   1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 7338  H HZ2  . LYS A 1 30  ? -13.849 3.074   0.404   1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 7339  H HZ3  . LYS A 1 30  ? -12.685 2.919   1.539   1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 7340  N N    . ALA A 1 31  ? -8.083  8.572   2.271   1.00 0.00 ? 31  ALA A N    5  
ATOM 7341  C CA   . ALA A 1 31  ? -8.069  9.957   1.834   1.00 0.00 ? 31  ALA A CA   5  
ATOM 7342  C C    . ALA A 1 31  ? -6.659  10.327  1.369   1.00 0.00 ? 31  ALA A C    5  
ATOM 7343  O O    . ALA A 1 31  ? -6.488  10.921  0.305   1.00 0.00 ? 31  ALA A O    5  
ATOM 7344  C CB   . ALA A 1 31  ? -8.562  10.856  2.971   1.00 0.00 ? 31  ALA A CB   5  
ATOM 7345  H H    . ALA A 1 31  ? -8.102  8.441   3.262   1.00 0.00 ? 31  ALA A H    5  
ATOM 7346  H HA   . ALA A 1 31  ? -8.756  10.047  0.993   1.00 0.00 ? 31  ALA A HA   5  
ATOM 7347  H HB1  . ALA A 1 31  ? -9.281  11.576  2.579   1.00 0.00 ? 31  ALA A HB1  5  
ATOM 7348  H HB2  . ALA A 1 31  ? -9.040  10.244  3.736   1.00 0.00 ? 31  ALA A HB2  5  
ATOM 7349  H HB3  . ALA A 1 31  ? -7.716  11.387  3.407   1.00 0.00 ? 31  ALA A HB3  5  
ATOM 7350  N N    . MET A 1 32  ? -5.685  9.960   2.188   1.00 0.00 ? 32  MET A N    5  
ATOM 7351  C CA   . MET A 1 32  ? -4.295  10.246  1.874   1.00 0.00 ? 32  MET A CA   5  
ATOM 7352  C C    . MET A 1 32  ? -3.882  9.580   0.560   1.00 0.00 ? 32  MET A C    5  
ATOM 7353  O O    . MET A 1 32  ? -3.269  10.214  -0.296  1.00 0.00 ? 32  MET A O    5  
ATOM 7354  C CB   . MET A 1 32  ? -3.401  9.739   3.007   1.00 0.00 ? 32  MET A CB   5  
ATOM 7355  C CG   . MET A 1 32  ? -2.641  10.893  3.664   1.00 0.00 ? 32  MET A CG   5  
ATOM 7356  S SD   . MET A 1 32  ? -1.509  11.624  2.492   1.00 0.00 ? 32  MET A SD   5  
ATOM 7357  C CE   . MET A 1 32  ? 0.046   11.109  3.201   1.00 0.00 ? 32  MET A CE   5  
ATOM 7358  H H    . MET A 1 32  ? -5.832  9.478   3.052   1.00 0.00 ? 32  MET A H    5  
ATOM 7359  H HA   . MET A 1 32  ? -4.234  11.330  1.775   1.00 0.00 ? 32  MET A HA   5  
ATOM 7360  H HB2  . MET A 1 32  ? -4.008  9.228   3.754   1.00 0.00 ? 32  MET A HB2  5  
ATOM 7361  H HB3  . MET A 1 32  ? -2.693  9.008   2.617   1.00 0.00 ? 32  MET A HB3  5  
ATOM 7362  H HG2  . MET A 1 32  ? -3.343  11.646  4.021   1.00 0.00 ? 32  MET A HG2  5  
ATOM 7363  H HG3  . MET A 1 32  ? -2.093  10.531  4.533   1.00 0.00 ? 32  MET A HG3  5  
ATOM 7364  H HE1  . MET A 1 32  ? 0.621   10.560  2.455   1.00 0.00 ? 32  MET A HE1  5  
ATOM 7365  H HE2  . MET A 1 32  ? 0.609   11.987  3.519   1.00 0.00 ? 32  MET A HE2  5  
ATOM 7366  H HE3  . MET A 1 32  ? -0.142  10.466  4.061   1.00 0.00 ? 32  MET A HE3  5  
ATOM 7367  N N    . ILE A 1 33  ? -4.235  8.308   0.442   1.00 0.00 ? 33  ILE A N    5  
ATOM 7368  C CA   . ILE A 1 33  ? -3.909  7.548   -0.753  1.00 0.00 ? 33  ILE A CA   5  
ATOM 7369  C C    . ILE A 1 33  ? -4.554  8.216   -1.968  1.00 0.00 ? 33  ILE A C    5  
ATOM 7370  O O    . ILE A 1 33  ? -3.983  8.216   -3.057  1.00 0.00 ? 33  ILE A O    5  
ATOM 7371  C CB   . ILE A 1 33  ? -4.301  6.080   -0.578  1.00 0.00 ? 33  ILE A CB   5  
ATOM 7372  C CG1  . ILE A 1 33  ? -3.560  5.451   0.604   1.00 0.00 ? 33  ILE A CG1  5  
ATOM 7373  C CG2  . ILE A 1 33  ? -4.082  5.296   -1.873  1.00 0.00 ? 33  ILE A CG2  5  
ATOM 7374  C CD1  . ILE A 1 33  ? -4.198  4.120   1.007   1.00 0.00 ? 33  ILE A CD1  5  
ATOM 7375  H H    . ILE A 1 33  ? -4.734  7.799   1.144   1.00 0.00 ? 33  ILE A H    5  
ATOM 7376  H HA   . ILE A 1 33  ? -2.826  7.580   -0.875  1.00 0.00 ? 33  ILE A HA   5  
ATOM 7377  H HB   . ILE A 1 33  ? -5.366  6.035   -0.350  1.00 0.00 ? 33  ILE A HB   5  
ATOM 7378  H HG12 . ILE A 1 33  ? -2.514  5.293   0.340   1.00 0.00 ? 33  ILE A HG12 5  
ATOM 7379  H HG13 . ILE A 1 33  ? -3.573  6.136   1.452   1.00 0.00 ? 33  ILE A HG13 5  
ATOM 7380  H HG21 . ILE A 1 33  ? -3.091  4.843   -1.861  1.00 0.00 ? 33  ILE A HG21 5  
ATOM 7381  H HG22 . ILE A 1 33  ? -4.838  4.514   -1.957  1.00 0.00 ? 33  ILE A HG22 5  
ATOM 7382  H HG23 . ILE A 1 33  ? -4.163  5.971   -2.725  1.00 0.00 ? 33  ILE A HG23 5  
ATOM 7383  H HD11 . ILE A 1 33  ? -3.432  3.457   1.407   1.00 0.00 ? 33  ILE A HD11 5  
ATOM 7384  H HD12 . ILE A 1 33  ? -4.959  4.297   1.767   1.00 0.00 ? 33  ILE A HD12 5  
ATOM 7385  H HD13 . ILE A 1 33  ? -4.658  3.659   0.133   1.00 0.00 ? 33  ILE A HD13 5  
ATOM 7386  N N    . GLU A 1 34  ? -5.737  8.769   -1.741  1.00 0.00 ? 34  GLU A N    5  
ATOM 7387  C CA   . GLU A 1 34  ? -6.466  9.439   -2.805  1.00 0.00 ? 34  GLU A CA   5  
ATOM 7388  C C    . GLU A 1 34  ? -5.893  10.838  -3.042  1.00 0.00 ? 34  GLU A C    5  
ATOM 7389  O O    . GLU A 1 34  ? -5.763  11.274  -4.185  1.00 0.00 ? 34  GLU A O    5  
ATOM 7390  C CB   . GLU A 1 34  ? -7.961  9.506   -2.487  1.00 0.00 ? 34  GLU A CB   5  
ATOM 7391  C CG   . GLU A 1 34  ? -8.655  8.188   -2.834  1.00 0.00 ? 34  GLU A CG   5  
ATOM 7392  C CD   . GLU A 1 34  ? -10.007 8.440   -3.503  1.00 0.00 ? 34  GLU A CD   5  
ATOM 7393  O OE1  . GLU A 1 34  ? -10.054 9.344   -4.364  1.00 0.00 ? 34  GLU A OE1  5  
ATOM 7394  O OE2  . GLU A 1 34  ? -10.964 7.722   -3.139  1.00 0.00 ? 34  GLU A OE2  5  
ATOM 7395  H H    . GLU A 1 34  ? -6.195  8.765   -0.853  1.00 0.00 ? 34  GLU A H    5  
ATOM 7396  H HA   . GLU A 1 34  ? -6.317  8.823   -3.691  1.00 0.00 ? 34  GLU A HA   5  
ATOM 7397  H HB2  . GLU A 1 34  ? -8.102  9.728   -1.429  1.00 0.00 ? 34  GLU A HB2  5  
ATOM 7398  H HB3  . GLU A 1 34  ? -8.420  10.321  -3.047  1.00 0.00 ? 34  GLU A HB3  5  
ATOM 7399  H HG2  . GLU A 1 34  ? -8.019  7.602   -3.498  1.00 0.00 ? 34  GLU A HG2  5  
ATOM 7400  H HG3  . GLU A 1 34  ? -8.798  7.599   -1.928  1.00 0.00 ? 34  GLU A HG3  5  
ATOM 7401  N N    . LYS A 1 35  ? -5.565  11.503  -1.944  1.00 0.00 ? 35  LYS A N    5  
ATOM 7402  C CA   . LYS A 1 35  ? -5.009  12.843  -2.018  1.00 0.00 ? 35  LYS A CA   5  
ATOM 7403  C C    . LYS A 1 35  ? -3.633  12.783  -2.683  1.00 0.00 ? 35  LYS A C    5  
ATOM 7404  O O    . LYS A 1 35  ? -3.206  13.744  -3.322  1.00 0.00 ? 35  LYS A O    5  
ATOM 7405  C CB   . LYS A 1 35  ? -4.995  13.495  -0.633  1.00 0.00 ? 35  LYS A CB   5  
ATOM 7406  C CG   . LYS A 1 35  ? -3.630  13.326  0.038   1.00 0.00 ? 35  LYS A CG   5  
ATOM 7407  C CD   . LYS A 1 35  ? -2.734  14.537  -0.230  1.00 0.00 ? 35  LYS A CD   5  
ATOM 7408  C CE   . LYS A 1 35  ? -3.004  15.653  0.782   1.00 0.00 ? 35  LYS A CE   5  
ATOM 7409  N NZ   . LYS A 1 35  ? -2.664  16.972  0.202   1.00 0.00 ? 35  LYS A NZ   5  
ATOM 7410  H H    . LYS A 1 35  ? -5.674  11.141  -1.018  1.00 0.00 ? 35  LYS A H    5  
ATOM 7411  H HA   . LYS A 1 35  ? -5.671  13.437  -2.647  1.00 0.00 ? 35  LYS A HA   5  
ATOM 7412  H HB2  . LYS A 1 35  ? -5.231  14.555  -0.724  1.00 0.00 ? 35  LYS A HB2  5  
ATOM 7413  H HB3  . LYS A 1 35  ? -5.769  13.048  -0.009  1.00 0.00 ? 35  LYS A HB3  5  
ATOM 7414  H HG2  . LYS A 1 35  ? -3.763  13.198  1.112   1.00 0.00 ? 35  LYS A HG2  5  
ATOM 7415  H HG3  . LYS A 1 35  ? -3.147  12.423  -0.334  1.00 0.00 ? 35  LYS A HG3  5  
ATOM 7416  H HD2  . LYS A 1 35  ? -1.687  14.239  -0.177  1.00 0.00 ? 35  LYS A HD2  5  
ATOM 7417  H HD3  . LYS A 1 35  ? -2.910  14.908  -1.240  1.00 0.00 ? 35  LYS A HD3  5  
ATOM 7418  H HE2  . LYS A 1 35  ? -4.053  15.638  1.078   1.00 0.00 ? 35  LYS A HE2  5  
ATOM 7419  H HE3  . LYS A 1 35  ? -2.416  15.483  1.684   1.00 0.00 ? 35  LYS A HE3  5  
ATOM 7420  H HZ1  . LYS A 1 35  ? -2.616  16.896  -0.794  1.00 0.00 ? 35  LYS A HZ1  5  
ATOM 7421  H HZ2  . LYS A 1 35  ? -3.367  17.637  0.453   1.00 0.00 ? 35  LYS A HZ2  5  
ATOM 7422  H HZ3  . LYS A 1 35  ? -1.779  17.273  0.557   1.00 0.00 ? 35  LYS A HZ3  5  
ATOM 7423  N N    . LEU A 1 36  ? -2.976  11.645  -2.511  1.00 0.00 ? 36  LEU A N    5  
ATOM 7424  C CA   . LEU A 1 36  ? -1.657  11.447  -3.087  1.00 0.00 ? 36  LEU A CA   5  
ATOM 7425  C C    . LEU A 1 36  ? -1.803  10.995  -4.541  1.00 0.00 ? 36  LEU A C    5  
ATOM 7426  O O    . LEU A 1 36  ? -0.818  10.635  -5.185  1.00 0.00 ? 36  LEU A O    5  
ATOM 7427  C CB   . LEU A 1 36  ? -0.834  10.489  -2.224  1.00 0.00 ? 36  LEU A CB   5  
ATOM 7428  C CG   . LEU A 1 36  ? -0.435  11.006  -0.841  1.00 0.00 ? 36  LEU A CG   5  
ATOM 7429  C CD1  . LEU A 1 36  ? -0.030  9.853   0.079   1.00 0.00 ? 36  LEU A CD1  5  
ATOM 7430  C CD2  . LEU A 1 36  ? 0.662   12.067  -0.947  1.00 0.00 ? 36  LEU A CD2  5  
ATOM 7431  H H    . LEU A 1 36  ? -3.331  10.868  -1.990  1.00 0.00 ? 36  LEU A H    5  
ATOM 7432  H HA   . LEU A 1 36  ? -1.147  12.411  -3.075  1.00 0.00 ? 36  LEU A HA   5  
ATOM 7433  H HB2  . LEU A 1 36  ? -1.402  9.568   -2.096  1.00 0.00 ? 36  LEU A HB2  5  
ATOM 7434  H HB3  . LEU A 1 36  ? 0.074   10.230  -2.769  1.00 0.00 ? 36  LEU A HB3  5  
ATOM 7435  H HG   . LEU A 1 36  ? -1.305  11.485  -0.392  1.00 0.00 ? 36  LEU A HG   5  
ATOM 7436  H HD11 . LEU A 1 36  ? 0.031   8.931   -0.498  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 7437  H HD12 . LEU A 1 36  ? 0.942   10.067  0.524   1.00 0.00 ? 36  LEU A HD12 5  
ATOM 7438  H HD13 . LEU A 1 36  ? -0.773  9.739   0.869   1.00 0.00 ? 36  LEU A HD13 5  
ATOM 7439  H HD21 . LEU A 1 36  ? 0.676   12.667  -0.037  1.00 0.00 ? 36  LEU A HD21 5  
ATOM 7440  H HD22 . LEU A 1 36  ? 1.628   11.580  -1.076  1.00 0.00 ? 36  LEU A HD22 5  
ATOM 7441  H HD23 . LEU A 1 36  ? 0.462   12.711  -1.804  1.00 0.00 ? 36  LEU A HD23 5  
ATOM 7442  N N    . GLY A 1 37  ? -3.039  11.028  -5.017  1.00 0.00 ? 37  GLY A N    5  
ATOM 7443  C CA   . GLY A 1 37  ? -3.327  10.625  -6.383  1.00 0.00 ? 37  GLY A CA   5  
ATOM 7444  C C    . GLY A 1 37  ? -3.646  9.131   -6.459  1.00 0.00 ? 37  GLY A C    5  
ATOM 7445  O O    . GLY A 1 37  ? -4.210  8.663   -7.447  1.00 0.00 ? 37  GLY A O    5  
ATOM 7446  H H    . GLY A 1 37  ? -3.835  11.322  -4.487  1.00 0.00 ? 37  GLY A H    5  
ATOM 7447  H HA2  . GLY A 1 37  ? -4.169  11.201  -6.766  1.00 0.00 ? 37  GLY A HA2  5  
ATOM 7448  H HA3  . GLY A 1 37  ? -2.471  10.851  -7.020  1.00 0.00 ? 37  GLY A HA3  5  
ATOM 7449  N N    . GLY A 1 38  ? -3.272  8.424   -5.403  1.00 0.00 ? 38  GLY A N    5  
ATOM 7450  C CA   . GLY A 1 38  ? -3.511  6.993   -5.337  1.00 0.00 ? 38  GLY A CA   5  
ATOM 7451  C C    . GLY A 1 38  ? -5.003  6.693   -5.175  1.00 0.00 ? 38  GLY A C    5  
ATOM 7452  O O    . GLY A 1 38  ? -5.843  7.562   -5.404  1.00 0.00 ? 38  GLY A O    5  
ATOM 7453  H H    . GLY A 1 38  ? -2.813  8.813   -4.604  1.00 0.00 ? 38  GLY A H    5  
ATOM 7454  H HA2  . GLY A 1 38  ? -3.138  6.516   -6.244  1.00 0.00 ? 38  GLY A HA2  5  
ATOM 7455  H HA3  . GLY A 1 38  ? -2.958  6.565   -4.501  1.00 0.00 ? 38  GLY A HA3  5  
ATOM 7456  N N    . LYS A 1 39  ? -5.287  5.461   -4.779  1.00 0.00 ? 39  LYS A N    5  
ATOM 7457  C CA   . LYS A 1 39  ? -6.662  5.036   -4.583  1.00 0.00 ? 39  LYS A CA   5  
ATOM 7458  C C    . LYS A 1 39  ? -6.681  3.754   -3.748  1.00 0.00 ? 39  LYS A C    5  
ATOM 7459  O O    . LYS A 1 39  ? -6.065  2.757   -4.121  1.00 0.00 ? 39  LYS A O    5  
ATOM 7460  C CB   . LYS A 1 39  ? -7.380  4.905   -5.928  1.00 0.00 ? 39  LYS A CB   5  
ATOM 7461  C CG   . LYS A 1 39  ? -8.120  6.196   -6.283  1.00 0.00 ? 39  LYS A CG   5  
ATOM 7462  C CD   . LYS A 1 39  ? -9.489  5.893   -6.894  1.00 0.00 ? 39  LYS A CD   5  
ATOM 7463  C CE   . LYS A 1 39  ? -9.575  6.409   -8.332  1.00 0.00 ? 39  LYS A CE   5  
ATOM 7464  N NZ   . LYS A 1 39  ? -10.126 5.366   -9.225  1.00 0.00 ? 39  LYS A NZ   5  
ATOM 7465  H H    . LYS A 1 39  ? -4.597  4.760   -4.595  1.00 0.00 ? 39  LYS A H    5  
ATOM 7466  H HA   . LYS A 1 39  ? -7.170  5.821   -4.022  1.00 0.00 ? 39  LYS A HA   5  
ATOM 7467  H HB2  . LYS A 1 39  ? -6.657  4.669   -6.709  1.00 0.00 ? 39  LYS A HB2  5  
ATOM 7468  H HB3  . LYS A 1 39  ? -8.086  4.076   -5.888  1.00 0.00 ? 39  LYS A HB3  5  
ATOM 7469  H HG2  . LYS A 1 39  ? -8.243  6.806   -5.388  1.00 0.00 ? 39  LYS A HG2  5  
ATOM 7470  H HG3  . LYS A 1 39  ? -7.525  6.779   -6.986  1.00 0.00 ? 39  LYS A HG3  5  
ATOM 7471  H HD2  . LYS A 1 39  ? -9.668  4.818   -6.878  1.00 0.00 ? 39  LYS A HD2  5  
ATOM 7472  H HD3  . LYS A 1 39  ? -10.271 6.355   -6.291  1.00 0.00 ? 39  LYS A HD3  5  
ATOM 7473  H HE2  . LYS A 1 39  ? -10.204 7.298   -8.368  1.00 0.00 ? 39  LYS A HE2  5  
ATOM 7474  H HE3  . LYS A 1 39  ? -8.584  6.706   -8.677  1.00 0.00 ? 39  LYS A HE3  5  
ATOM 7475  H HZ1  . LYS A 1 39  ? -9.391  4.982   -9.783  1.00 0.00 ? 39  LYS A HZ1  5  
ATOM 7476  H HZ2  . LYS A 1 39  ? -10.541 4.641   -8.675  1.00 0.00 ? 39  LYS A HZ2  5  
ATOM 7477  H HZ3  . LYS A 1 39  ? -10.820 5.770   -9.821  1.00 0.00 ? 39  LYS A HZ3  5  
ATOM 7478  N N    . LEU A 1 40  ? -7.396  3.821   -2.635  1.00 0.00 ? 40  LEU A N    5  
ATOM 7479  C CA   . LEU A 1 40  ? -7.503  2.678   -1.744  1.00 0.00 ? 40  LEU A CA   5  
ATOM 7480  C C    . LEU A 1 40  ? -8.437  1.638   -2.366  1.00 0.00 ? 40  LEU A C    5  
ATOM 7481  O O    . LEU A 1 40  ? -9.490  1.985   -2.899  1.00 0.00 ? 40  LEU A O    5  
ATOM 7482  C CB   . LEU A 1 40  ? -7.928  3.127   -0.345  1.00 0.00 ? 40  LEU A CB   5  
ATOM 7483  C CG   . LEU A 1 40  ? -7.748  2.099   0.774   1.00 0.00 ? 40  LEU A CG   5  
ATOM 7484  C CD1  . LEU A 1 40  ? -6.808  2.628   1.859   1.00 0.00 ? 40  LEU A CD1  5  
ATOM 7485  C CD2  . LEU A 1 40  ? -9.100  1.668   1.346   1.00 0.00 ? 40  LEU A CD2  5  
ATOM 7486  H H    . LEU A 1 40  ? -7.894  4.636   -2.339  1.00 0.00 ? 40  LEU A H    5  
ATOM 7487  H HA   . LEU A 1 40  ? -6.509  2.240   -1.654  1.00 0.00 ? 40  LEU A HA   5  
ATOM 7488  H HB2  . LEU A 1 40  ? -7.362  4.022   -0.084  1.00 0.00 ? 40  LEU A HB2  5  
ATOM 7489  H HB3  . LEU A 1 40  ? -8.979  3.415   -0.381  1.00 0.00 ? 40  LEU A HB3  5  
ATOM 7490  H HG   . LEU A 1 40  ? -7.281  1.211   0.349   1.00 0.00 ? 40  LEU A HG   5  
ATOM 7491  H HD11 . LEU A 1 40  ? -5.776  2.413   1.582   1.00 0.00 ? 40  LEU A HD11 5  
ATOM 7492  H HD12 . LEU A 1 40  ? -6.940  3.706   1.960   1.00 0.00 ? 40  LEU A HD12 5  
ATOM 7493  H HD13 . LEU A 1 40  ? -7.039  2.144   2.808   1.00 0.00 ? 40  LEU A HD13 5  
ATOM 7494  H HD21 . LEU A 1 40  ? -8.955  0.834   2.032   1.00 0.00 ? 40  LEU A HD21 5  
ATOM 7495  H HD22 . LEU A 1 40  ? -9.550  2.504   1.881   1.00 0.00 ? 40  LEU A HD22 5  
ATOM 7496  H HD23 . LEU A 1 40  ? -9.757  1.360   0.533   1.00 0.00 ? 40  LEU A HD23 5  
ATOM 7497  N N    . THR A 1 41  ? -8.018  0.385   -2.278  1.00 0.00 ? 41  THR A N    5  
ATOM 7498  C CA   . THR A 1 41  ? -8.804  -0.708  -2.826  1.00 0.00 ? 41  THR A CA   5  
ATOM 7499  C C    . THR A 1 41  ? -9.020  -1.792  -1.768  1.00 0.00 ? 41  THR A C    5  
ATOM 7500  O O    . THR A 1 41  ? -8.394  -1.765  -0.709  1.00 0.00 ? 41  THR A O    5  
ATOM 7501  C CB   . THR A 1 41  ? -8.094  -1.217  -4.082  1.00 0.00 ? 41  THR A CB   5  
ATOM 7502  O OG1  . THR A 1 41  ? -8.840  -2.372  -4.458  1.00 0.00 ? 41  THR A OG1  5  
ATOM 7503  C CG2  . THR A 1 41  ? -6.694  -1.759  -3.785  1.00 0.00 ? 41  THR A CG2  5  
ATOM 7504  H H    . THR A 1 41  ? -7.160  0.112   -1.843  1.00 0.00 ? 41  THR A H    5  
ATOM 7505  H HA   . THR A 1 41  ? -9.787  -0.323  -3.094  1.00 0.00 ? 41  THR A HA   5  
ATOM 7506  H HB   . THR A 1 41  ? -8.058  -0.444  -4.849  1.00 0.00 ? 41  THR A HB   5  
ATOM 7507  H HG1  . THR A 1 41  ? -8.673  -3.113  -3.808  1.00 0.00 ? 41  THR A HG1  5  
ATOM 7508  H HG21 . THR A 1 41  ? -6.775  -2.673  -3.197  1.00 0.00 ? 41  THR A HG21 5  
ATOM 7509  H HG22 . THR A 1 41  ? -6.181  -1.973  -4.722  1.00 0.00 ? 41  THR A HG22 5  
ATOM 7510  H HG23 . THR A 1 41  ? -6.129  -1.015  -3.223  1.00 0.00 ? 41  THR A HG23 5  
ATOM 7511  N N    . GLY A 1 42  ? -9.907  -2.721  -2.091  1.00 0.00 ? 42  GLY A N    5  
ATOM 7512  C CA   . GLY A 1 42  ? -10.214 -3.812  -1.182  1.00 0.00 ? 42  GLY A CA   5  
ATOM 7513  C C    . GLY A 1 42  ? -9.489  -5.093  -1.600  1.00 0.00 ? 42  GLY A C    5  
ATOM 7514  O O    . GLY A 1 42  ? -8.971  -5.821  -0.755  1.00 0.00 ? 42  GLY A O    5  
ATOM 7515  H H    . GLY A 1 42  ? -10.412 -2.735  -2.955  1.00 0.00 ? 42  GLY A H    5  
ATOM 7516  H HA2  . GLY A 1 42  ? -9.921  -3.538  -0.169  1.00 0.00 ? 42  GLY A HA2  5  
ATOM 7517  H HA3  . GLY A 1 42  ? -11.290 -3.987  -1.168  1.00 0.00 ? 42  GLY A HA3  5  
ATOM 7518  N N    . THR A 1 43  ? -9.477  -5.330  -2.903  1.00 0.00 ? 43  THR A N    5  
ATOM 7519  C CA   . THR A 1 43  ? -8.824  -6.511  -3.443  1.00 0.00 ? 43  THR A CA   5  
ATOM 7520  C C    . THR A 1 43  ? -7.314  -6.287  -3.544  1.00 0.00 ? 43  THR A C    5  
ATOM 7521  O O    . THR A 1 43  ? -6.865  -5.174  -3.812  1.00 0.00 ? 43  THR A O    5  
ATOM 7522  C CB   . THR A 1 43  ? -9.480  -6.841  -4.785  1.00 0.00 ? 43  THR A CB   5  
ATOM 7523  O OG1  . THR A 1 43  ? -10.835 -7.128  -4.448  1.00 0.00 ? 43  THR A OG1  5  
ATOM 7524  C CG2  . THR A 1 43  ? -8.961  -8.150  -5.385  1.00 0.00 ? 43  THR A CG2  5  
ATOM 7525  H H    . THR A 1 43  ? -9.901  -4.733  -3.584  1.00 0.00 ? 43  THR A H    5  
ATOM 7526  H HA   . THR A 1 43  ? -8.980  -7.337  -2.749  1.00 0.00 ? 43  THR A HA   5  
ATOM 7527  H HB   . THR A 1 43  ? -9.364  -6.017  -5.489  1.00 0.00 ? 43  THR A HB   5  
ATOM 7528  H HG1  . THR A 1 43  ? -10.877 -7.931  -3.854  1.00 0.00 ? 43  THR A HG1  5  
ATOM 7529  H HG21 . THR A 1 43  ? -9.611  -8.458  -6.204  1.00 0.00 ? 43  THR A HG21 5  
ATOM 7530  H HG22 . THR A 1 43  ? -7.948  -8.000  -5.761  1.00 0.00 ? 43  THR A HG22 5  
ATOM 7531  H HG23 . THR A 1 43  ? -8.952  -8.923  -4.617  1.00 0.00 ? 43  THR A HG23 5  
ATOM 7532  N N    . ALA A 1 44  ? -6.573  -7.362  -3.324  1.00 0.00 ? 44  ALA A N    5  
ATOM 7533  C CA   . ALA A 1 44  ? -5.123  -7.297  -3.386  1.00 0.00 ? 44  ALA A CA   5  
ATOM 7534  C C    . ALA A 1 44  ? -4.667  -7.547  -4.825  1.00 0.00 ? 44  ALA A C    5  
ATOM 7535  O O    . ALA A 1 44  ? -3.850  -6.799  -5.360  1.00 0.00 ? 44  ALA A O    5  
ATOM 7536  C CB   . ALA A 1 44  ? -4.523  -8.304  -2.402  1.00 0.00 ? 44  ALA A CB   5  
ATOM 7537  H H    . ALA A 1 44  ? -6.946  -8.264  -3.106  1.00 0.00 ? 44  ALA A H    5  
ATOM 7538  H HA   . ALA A 1 44  ? -4.822  -6.293  -3.088  1.00 0.00 ? 44  ALA A HA   5  
ATOM 7539  H HB1  . ALA A 1 44  ? -3.506  -8.550  -2.708  1.00 0.00 ? 44  ALA A HB1  5  
ATOM 7540  H HB2  . ALA A 1 44  ? -4.507  -7.869  -1.402  1.00 0.00 ? 44  ALA A HB2  5  
ATOM 7541  H HB3  . ALA A 1 44  ? -5.129  -9.210  -2.394  1.00 0.00 ? 44  ALA A HB3  5  
ATOM 7542  N N    . ASN A 1 45  ? -5.215  -8.601  -5.411  1.00 0.00 ? 45  ASN A N    5  
ATOM 7543  C CA   . ASN A 1 45  ? -4.875  -8.959  -6.778  1.00 0.00 ? 45  ASN A CA   5  
ATOM 7544  C C    . ASN A 1 45  ? -5.202  -7.785  -7.704  1.00 0.00 ? 45  ASN A C    5  
ATOM 7545  O O    . ASN A 1 45  ? -4.720  -7.730  -8.834  1.00 0.00 ? 45  ASN A O    5  
ATOM 7546  C CB   . ASN A 1 45  ? -5.682  -10.171 -7.247  1.00 0.00 ? 45  ASN A CB   5  
ATOM 7547  C CG   . ASN A 1 45  ? -7.130  -10.087 -6.760  1.00 0.00 ? 45  ASN A CG   5  
ATOM 7548  O OD1  . ASN A 1 45  ? -7.427  -10.237 -5.586  1.00 0.00 ? 45  ASN A OD1  5  
ATOM 7549  N ND2  . ASN A 1 45  ? -8.012  -9.840  -7.724  1.00 0.00 ? 45  ASN A ND2  5  
ATOM 7550  H H    . ASN A 1 45  ? -5.879  -9.205  -4.969  1.00 0.00 ? 45  ASN A H    5  
ATOM 7551  H HA   . ASN A 1 45  ? -3.810  -9.189  -6.757  1.00 0.00 ? 45  ASN A HA   5  
ATOM 7552  H HB2  . ASN A 1 45  ? -5.663  -10.225 -8.336  1.00 0.00 ? 45  ASN A HB2  5  
ATOM 7553  H HB3  . ASN A 1 45  ? -5.221  -11.085 -6.875  1.00 0.00 ? 45  ASN A HB3  5  
ATOM 7554  H HD21 . ASN A 1 45  ? -7.702  -9.727  -8.668  1.00 0.00 ? 45  ASN A HD21 5  
ATOM 7555  H HD22 . ASN A 1 45  ? -8.985  -9.767  -7.505  1.00 0.00 ? 45  ASN A HD22 5  
ATOM 7556  N N    . LYS A 1 46  ? -6.017  -6.877  -7.190  1.00 0.00 ? 46  LYS A N    5  
ATOM 7557  C CA   . LYS A 1 46  ? -6.414  -5.708  -7.956  1.00 0.00 ? 46  LYS A CA   5  
ATOM 7558  C C    . LYS A 1 46  ? -5.866  -4.450  -7.280  1.00 0.00 ? 46  LYS A C    5  
ATOM 7559  O O    . LYS A 1 46  ? -6.572  -3.450  -7.157  1.00 0.00 ? 46  LYS A O    5  
ATOM 7560  C CB   . LYS A 1 46  ? -7.931  -5.688  -8.156  1.00 0.00 ? 46  LYS A CB   5  
ATOM 7561  C CG   . LYS A 1 46  ? -8.405  -6.946  -8.887  1.00 0.00 ? 46  LYS A CG   5  
ATOM 7562  C CD   . LYS A 1 46  ? -9.132  -6.586  -10.184 1.00 0.00 ? 46  LYS A CD   5  
ATOM 7563  C CE   . LYS A 1 46  ? -9.589  -7.844  -10.924 1.00 0.00 ? 46  LYS A CE   5  
ATOM 7564  N NZ   . LYS A 1 46  ? -10.536 -7.494  -12.006 1.00 0.00 ? 46  LYS A NZ   5  
ATOM 7565  H H    . LYS A 1 46  ? -6.404  -6.930  -6.269  1.00 0.00 ? 46  LYS A H    5  
ATOM 7566  H HA   . LYS A 1 46  ? -5.960  -5.795  -8.944  1.00 0.00 ? 46  LYS A HA   5  
ATOM 7567  H HB2  . LYS A 1 46  ? -8.428  -5.616  -7.189  1.00 0.00 ? 46  LYS A HB2  5  
ATOM 7568  H HB3  . LYS A 1 46  ? -8.215  -4.803  -8.726  1.00 0.00 ? 46  LYS A HB3  5  
ATOM 7569  H HG2  . LYS A 1 46  ? -7.550  -7.584  -9.111  1.00 0.00 ? 46  LYS A HG2  5  
ATOM 7570  H HG3  . LYS A 1 46  ? -9.069  -7.518  -8.240  1.00 0.00 ? 46  LYS A HG3  5  
ATOM 7571  H HD2  . LYS A 1 46  ? -9.995  -5.958  -9.959  1.00 0.00 ? 46  LYS A HD2  5  
ATOM 7572  H HD3  . LYS A 1 46  ? -8.472  -6.001  -10.825 1.00 0.00 ? 46  LYS A HD3  5  
ATOM 7573  H HE2  . LYS A 1 46  ? -8.725  -8.361  -11.342 1.00 0.00 ? 46  LYS A HE2  5  
ATOM 7574  H HE3  . LYS A 1 46  ? -10.064 -8.532  -10.225 1.00 0.00 ? 46  LYS A HE3  5  
ATOM 7575  H HZ1  . LYS A 1 46  ? -10.032 -7.356  -12.859 1.00 0.00 ? 46  LYS A HZ1  5  
ATOM 7576  H HZ2  . LYS A 1 46  ? -11.196 -8.236  -12.125 1.00 0.00 ? 46  LYS A HZ2  5  
ATOM 7577  H HZ3  . LYS A 1 46  ? -11.021 -6.653  -11.765 1.00 0.00 ? 46  LYS A HZ3  5  
ATOM 7578  N N    . ALA A 1 47  ? -4.613  -4.541  -6.859  1.00 0.00 ? 47  ALA A N    5  
ATOM 7579  C CA   . ALA A 1 47  ? -3.963  -3.422  -6.198  1.00 0.00 ? 47  ALA A CA   5  
ATOM 7580  C C    . ALA A 1 47  ? -2.585  -3.197  -6.824  1.00 0.00 ? 47  ALA A C    5  
ATOM 7581  O O    . ALA A 1 47  ? -2.057  -4.076  -7.503  1.00 0.00 ? 47  ALA A O    5  
ATOM 7582  C CB   . ALA A 1 47  ? -3.883  -3.693  -4.695  1.00 0.00 ? 47  ALA A CB   5  
ATOM 7583  H H    . ALA A 1 47  ? -4.046  -5.358  -6.963  1.00 0.00 ? 47  ALA A H    5  
ATOM 7584  H HA   . ALA A 1 47  ? -4.577  -2.537  -6.363  1.00 0.00 ? 47  ALA A HA   5  
ATOM 7585  H HB1  . ALA A 1 47  ? -4.612  -4.457  -4.424  1.00 0.00 ? 47  ALA A HB1  5  
ATOM 7586  H HB2  . ALA A 1 47  ? -2.881  -4.040  -4.441  1.00 0.00 ? 47  ALA A HB2  5  
ATOM 7587  H HB3  . ALA A 1 47  ? -4.099  -2.775  -4.148  1.00 0.00 ? 47  ALA A HB3  5  
ATOM 7588  N N    . SER A 1 48  ? -2.042  -2.015  -6.573  1.00 0.00 ? 48  SER A N    5  
ATOM 7589  C CA   . SER A 1 48  ? -0.736  -1.663  -7.103  1.00 0.00 ? 48  SER A CA   5  
ATOM 7590  C C    . SER A 1 48  ? 0.309   -1.700  -5.987  1.00 0.00 ? 48  SER A C    5  
ATOM 7591  O O    . SER A 1 48  ? 1.493   -1.915  -6.246  1.00 0.00 ? 48  SER A O    5  
ATOM 7592  C CB   . SER A 1 48  ? -0.762  -0.281  -7.760  1.00 0.00 ? 48  SER A CB   5  
ATOM 7593  O OG   . SER A 1 48  ? -1.821  -0.160  -8.706  1.00 0.00 ? 48  SER A OG   5  
ATOM 7594  H H    . SER A 1 48  ? -2.479  -1.305  -6.020  1.00 0.00 ? 48  SER A H    5  
ATOM 7595  H HA   . SER A 1 48  ? -0.517  -2.419  -7.857  1.00 0.00 ? 48  SER A HA   5  
ATOM 7596  H HB2  . SER A 1 48  ? -0.873  0.484   -6.992  1.00 0.00 ? 48  SER A HB2  5  
ATOM 7597  H HB3  . SER A 1 48  ? 0.191   -0.098  -8.257  1.00 0.00 ? 48  SER A HB3  5  
ATOM 7598  H HG   . SER A 1 48  ? -2.472  -0.909  -8.589  1.00 0.00 ? 48  SER A HG   5  
ATOM 7599  N N    . LEU A 1 49  ? -0.165  -1.487  -4.768  1.00 0.00 ? 49  LEU A N    5  
ATOM 7600  C CA   . LEU A 1 49  ? 0.714   -1.494  -3.611  1.00 0.00 ? 49  LEU A CA   5  
ATOM 7601  C C    . LEU A 1 49  ? -0.085  -1.899  -2.371  1.00 0.00 ? 49  LEU A C    5  
ATOM 7602  O O    . LEU A 1 49  ? -1.312  -1.812  -2.363  1.00 0.00 ? 49  LEU A O    5  
ATOM 7603  C CB   . LEU A 1 49  ? 1.425   -0.147  -3.471  1.00 0.00 ? 49  LEU A CB   5  
ATOM 7604  C CG   . LEU A 1 49  ? 2.040   0.148   -2.102  1.00 0.00 ? 49  LEU A CG   5  
ATOM 7605  C CD1  . LEU A 1 49  ? 3.304   -0.685  -1.877  1.00 0.00 ? 49  LEU A CD1  5  
ATOM 7606  C CD2  . LEU A 1 49  ? 2.303   1.646   -1.929  1.00 0.00 ? 49  LEU A CD2  5  
ATOM 7607  H H    . LEU A 1 49  ? -1.129  -1.313  -4.566  1.00 0.00 ? 49  LEU A H    5  
ATOM 7608  H HA   . LEU A 1 49  ? 1.482   -2.247  -3.788  1.00 0.00 ? 49  LEU A HA   5  
ATOM 7609  H HB2  . LEU A 1 49  ? 2.215   -0.096  -4.221  1.00 0.00 ? 49  LEU A HB2  5  
ATOM 7610  H HB3  . LEU A 1 49  ? 0.713   0.644   -3.706  1.00 0.00 ? 49  LEU A HB3  5  
ATOM 7611  H HG   . LEU A 1 49  ? 1.322   -0.143  -1.335  1.00 0.00 ? 49  LEU A HG   5  
ATOM 7612  H HD11 . LEU A 1 49  ? 4.161   -0.021  -1.763  1.00 0.00 ? 49  LEU A HD11 5  
ATOM 7613  H HD12 . LEU A 1 49  ? 3.187   -1.286  -0.975  1.00 0.00 ? 49  LEU A HD12 5  
ATOM 7614  H HD13 . LEU A 1 49  ? 3.463   -1.341  -2.733  1.00 0.00 ? 49  LEU A HD13 5  
ATOM 7615  H HD21 . LEU A 1 49  ? 1.673   2.035   -1.129  1.00 0.00 ? 49  LEU A HD21 5  
ATOM 7616  H HD22 . LEU A 1 49  ? 3.351   1.804   -1.676  1.00 0.00 ? 49  LEU A HD22 5  
ATOM 7617  H HD23 . LEU A 1 49  ? 2.071   2.165   -2.860  1.00 0.00 ? 49  LEU A HD23 5  
ATOM 7618  N N    . CYS A 1 50  ? 0.643   -2.332  -1.352  1.00 0.00 ? 50  CYS A N    5  
ATOM 7619  C CA   . CYS A 1 50  ? 0.017   -2.751  -0.110  1.00 0.00 ? 50  CYS A CA   5  
ATOM 7620  C C    . CYS A 1 50  ? 0.680   -1.992  1.042   1.00 0.00 ? 50  CYS A C    5  
ATOM 7621  O O    . CYS A 1 50  ? 1.897   -1.812  1.051   1.00 0.00 ? 50  CYS A O    5  
ATOM 7622  C CB   . CYS A 1 50  ? 0.099   -4.266  0.083   1.00 0.00 ? 50  CYS A CB   5  
ATOM 7623  S SG   . CYS A 1 50  ? -1.043  -4.791  1.413   1.00 0.00 ? 50  CYS A SG   5  
ATOM 7624  H H    . CYS A 1 50  ? 1.640   -2.400  -1.367  1.00 0.00 ? 50  CYS A H    5  
ATOM 7625  H HA   . CYS A 1 50  ? -1.039  -2.490  -0.188  1.00 0.00 ? 50  CYS A HA   5  
ATOM 7626  H HB2  . CYS A 1 50  ? -0.156  -4.774  -0.848  1.00 0.00 ? 50  CYS A HB2  5  
ATOM 7627  H HB3  . CYS A 1 50  ? 1.120   -4.554  0.334   1.00 0.00 ? 50  CYS A HB3  5  
ATOM 7628  H HG   . CYS A 1 50  ? -1.672  -3.625  1.524   1.00 0.00 ? 50  CYS A HG   5  
ATOM 7629  N N    . ILE A 1 51  ? -0.149  -1.569  1.984   1.00 0.00 ? 51  ILE A N    5  
ATOM 7630  C CA   . ILE A 1 51  ? 0.342   -0.834  3.138   1.00 0.00 ? 51  ILE A CA   5  
ATOM 7631  C C    . ILE A 1 51  ? -0.137  -1.522  4.417   1.00 0.00 ? 51  ILE A C    5  
ATOM 7632  O O    . ILE A 1 51  ? -1.251  -1.278  4.878   1.00 0.00 ? 51  ILE A O    5  
ATOM 7633  C CB   . ILE A 1 51  ? -0.059  0.640   3.045   1.00 0.00 ? 51  ILE A CB   5  
ATOM 7634  C CG1  . ILE A 1 51  ? 0.531   1.291   1.792   1.00 0.00 ? 51  ILE A CG1  5  
ATOM 7635  C CG2  . ILE A 1 51  ? 0.326   1.394   4.319   1.00 0.00 ? 51  ILE A CG2  5  
ATOM 7636  C CD1  . ILE A 1 51  ? 0.161   2.774   1.719   1.00 0.00 ? 51  ILE A CD1  5  
ATOM 7637  H H    . ILE A 1 51  ? -1.137  -1.720  1.969   1.00 0.00 ? 51  ILE A H    5  
ATOM 7638  H HA   . ILE A 1 51  ? 1.431   -0.873  3.111   1.00 0.00 ? 51  ILE A HA   5  
ATOM 7639  H HB   . ILE A 1 51  ? -1.144  0.693   2.954   1.00 0.00 ? 51  ILE A HB   5  
ATOM 7640  H HG12 . ILE A 1 51  ? 1.616   1.183   1.799   1.00 0.00 ? 51  ILE A HG12 5  
ATOM 7641  H HG13 . ILE A 1 51  ? 0.165   0.777   0.904   1.00 0.00 ? 51  ILE A HG13 5  
ATOM 7642  H HG21 . ILE A 1 51  ? 0.985   2.224   4.064   1.00 0.00 ? 51  ILE A HG21 5  
ATOM 7643  H HG22 . ILE A 1 51  ? -0.574  1.779   4.799   1.00 0.00 ? 51  ILE A HG22 5  
ATOM 7644  H HG23 . ILE A 1 51  ? 0.840   0.717   5.001   1.00 0.00 ? 51  ILE A HG23 5  
ATOM 7645  H HD11 . ILE A 1 51  ? -0.839  2.919   2.128   1.00 0.00 ? 51  ILE A HD11 5  
ATOM 7646  H HD12 . ILE A 1 51  ? 0.879   3.356   2.297   1.00 0.00 ? 51  ILE A HD12 5  
ATOM 7647  H HD13 . ILE A 1 51  ? 0.180   3.102   0.680   1.00 0.00 ? 51  ILE A HD13 5  
ATOM 7648  N N    . SER A 1 52  ? 0.728   -2.369  4.956   1.00 0.00 ? 52  SER A N    5  
ATOM 7649  C CA   . SER A 1 52  ? 0.408   -3.094  6.173   1.00 0.00 ? 52  SER A CA   5  
ATOM 7650  C C    . SER A 1 52  ? 1.550   -2.955  7.181   1.00 0.00 ? 52  SER A C    5  
ATOM 7651  O O    . SER A 1 52  ? 2.485   -2.187  6.963   1.00 0.00 ? 52  SER A O    5  
ATOM 7652  C CB   . SER A 1 52  ? 0.136   -4.571  5.879   1.00 0.00 ? 52  SER A CB   5  
ATOM 7653  O OG   . SER A 1 52  ? -0.761  -5.147  6.824   1.00 0.00 ? 52  SER A OG   5  
ATOM 7654  H H    . SER A 1 52  ? 1.633   -2.561  4.575   1.00 0.00 ? 52  SER A H    5  
ATOM 7655  H HA   . SER A 1 52  ? -0.500  -2.628  6.556   1.00 0.00 ? 52  SER A HA   5  
ATOM 7656  H HB2  . SER A 1 52  ? -0.280  -4.670  4.876   1.00 0.00 ? 52  SER A HB2  5  
ATOM 7657  H HB3  . SER A 1 52  ? 1.077   -5.121  5.890   1.00 0.00 ? 52  SER A HB3  5  
ATOM 7658  H HG   . SER A 1 52  ? -1.276  -4.427  7.290   1.00 0.00 ? 52  SER A HG   5  
ATOM 7659  N N    . THR A 1 53  ? 1.436   -3.709  8.264   1.00 0.00 ? 53  THR A N    5  
ATOM 7660  C CA   . THR A 1 53  ? 2.447   -3.680  9.307   1.00 0.00 ? 53  THR A CA   5  
ATOM 7661  C C    . THR A 1 53  ? 3.209   -5.006  9.349   1.00 0.00 ? 53  THR A C    5  
ATOM 7662  O O    . THR A 1 53  ? 2.707   -6.029  8.888   1.00 0.00 ? 53  THR A O    5  
ATOM 7663  C CB   . THR A 1 53  ? 1.755   -3.335  10.627  1.00 0.00 ? 53  THR A CB   5  
ATOM 7664  O OG1  . THR A 1 53  ? 0.633   -4.212  10.671  1.00 0.00 ? 53  THR A OG1  5  
ATOM 7665  C CG2  . THR A 1 53  ? 1.135   -1.936  10.615  1.00 0.00 ? 53  THR A CG2  5  
ATOM 7666  H H    . THR A 1 53  ? 0.672   -4.332  8.434   1.00 0.00 ? 53  THR A H    5  
ATOM 7667  H HA   . THR A 1 53  ? 3.171   -2.903  9.062   1.00 0.00 ? 53  THR A HA   5  
ATOM 7668  H HB   . THR A 1 53  ? 2.440   -3.449  11.467  1.00 0.00 ? 53  THR A HB   5  
ATOM 7669  H HG1  . THR A 1 53  ? 0.915   -5.140  10.430  1.00 0.00 ? 53  THR A HG1  5  
ATOM 7670  H HG21 . THR A 1 53  ? 1.686   -1.300  9.923   1.00 0.00 ? 53  THR A HG21 5  
ATOM 7671  H HG22 . THR A 1 53  ? 0.094   -2.003  10.297  1.00 0.00 ? 53  THR A HG22 5  
ATOM 7672  H HG23 . THR A 1 53  ? 1.182   -1.509  11.617  1.00 0.00 ? 53  THR A HG23 5  
ATOM 7673  N N    . LYS A 1 54  ? 4.409   -4.945  9.907   1.00 0.00 ? 54  LYS A N    5  
ATOM 7674  C CA   . LYS A 1 54  ? 5.245   -6.128  10.015  1.00 0.00 ? 54  LYS A CA   5  
ATOM 7675  C C    . LYS A 1 54  ? 4.387   -7.315  10.458  1.00 0.00 ? 54  LYS A C    5  
ATOM 7676  O O    . LYS A 1 54  ? 4.323   -8.331  9.768   1.00 0.00 ? 54  LYS A O    5  
ATOM 7677  C CB   . LYS A 1 54  ? 6.440   -5.858  10.931  1.00 0.00 ? 54  LYS A CB   5  
ATOM 7678  C CG   . LYS A 1 54  ? 7.151   -7.160  11.305  1.00 0.00 ? 54  LYS A CG   5  
ATOM 7679  C CD   . LYS A 1 54  ? 8.621   -7.123  10.884  1.00 0.00 ? 54  LYS A CD   5  
ATOM 7680  C CE   . LYS A 1 54  ? 8.788   -7.580  9.434   1.00 0.00 ? 54  LYS A CE   5  
ATOM 7681  N NZ   . LYS A 1 54  ? 10.174  -8.038  9.191   1.00 0.00 ? 54  LYS A NZ   5  
ATOM 7682  H H    . LYS A 1 54  ? 4.810   -4.108  10.280  1.00 0.00 ? 54  LYS A H    5  
ATOM 7683  H HA   . LYS A 1 54  ? 5.642   -6.340  9.022   1.00 0.00 ? 54  LYS A HA   5  
ATOM 7684  H HB2  . LYS A 1 54  ? 7.141   -5.187  10.434  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 7685  H HB3  . LYS A 1 54  ? 6.103   -5.351  11.835  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 7686  H HG2  . LYS A 1 54  ? 7.080   -7.321  12.381  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 7687  H HG3  . LYS A 1 54  ? 6.652   -8.002  10.824  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 7688  H HD2  . LYS A 1 54  ? 9.010   -6.112  10.998  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 7689  H HD3  . LYS A 1 54  ? 9.207   -7.766  11.541  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 7690  H HE2  . LYS A 1 54  ? 8.089   -8.388  9.218   1.00 0.00 ? 54  LYS A HE2  5  
ATOM 7691  H HE3  . LYS A 1 54  ? 8.546   -6.760  8.758   1.00 0.00 ? 54  LYS A HE3  5  
ATOM 7692  H HZ1  . LYS A 1 54  ? 10.639  -7.389  8.589   1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 7693  H HZ2  . LYS A 1 54  ? 10.664  -8.095  10.061  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 7694  H HZ3  . LYS A 1 54  ? 10.157  -8.940  8.759   1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 7695  N N    . LYS A 1 55  ? 3.749   -7.147  11.607  1.00 0.00 ? 55  LYS A N    5  
ATOM 7696  C CA   . LYS A 1 55  ? 2.898   -8.191  12.150  1.00 0.00 ? 55  LYS A CA   5  
ATOM 7697  C C    . LYS A 1 55  ? 2.062   -8.800  11.022  1.00 0.00 ? 55  LYS A C    5  
ATOM 7698  O O    . LYS A 1 55  ? 2.208   -9.978  10.702  1.00 0.00 ? 55  LYS A O    5  
ATOM 7699  C CB   . LYS A 1 55  ? 2.062   -7.651  13.312  1.00 0.00 ? 55  LYS A CB   5  
ATOM 7700  C CG   . LYS A 1 55  ? 2.218   -8.530  14.555  1.00 0.00 ? 55  LYS A CG   5  
ATOM 7701  C CD   . LYS A 1 55  ? 3.039   -7.817  15.631  1.00 0.00 ? 55  LYS A CD   5  
ATOM 7702  C CE   . LYS A 1 55  ? 2.176   -7.490  16.852  1.00 0.00 ? 55  LYS A CE   5  
ATOM 7703  N NZ   . LYS A 1 55  ? 2.602   -8.295  18.018  1.00 0.00 ? 55  LYS A NZ   5  
ATOM 7704  H H    . LYS A 1 55  ? 3.807   -6.317  12.162  1.00 0.00 ? 55  LYS A H    5  
ATOM 7705  H HA   . LYS A 1 55  ? 3.549   -8.966  12.554  1.00 0.00 ? 55  LYS A HA   5  
ATOM 7706  H HB2  . LYS A 1 55  ? 2.369   -6.631  13.543  1.00 0.00 ? 55  LYS A HB2  5  
ATOM 7707  H HB3  . LYS A 1 55  ? 1.012   -7.609  13.022  1.00 0.00 ? 55  LYS A HB3  5  
ATOM 7708  H HG2  . LYS A 1 55  ? 1.235   -8.784  14.951  1.00 0.00 ? 55  LYS A HG2  5  
ATOM 7709  H HG3  . LYS A 1 55  ? 2.704   -9.467  14.283  1.00 0.00 ? 55  LYS A HG3  5  
ATOM 7710  H HD2  . LYS A 1 55  ? 3.877   -8.447  15.932  1.00 0.00 ? 55  LYS A HD2  5  
ATOM 7711  H HD3  . LYS A 1 55  ? 3.461   -6.899  15.223  1.00 0.00 ? 55  LYS A HD3  5  
ATOM 7712  H HE2  . LYS A 1 55  ? 2.256   -6.428  17.086  1.00 0.00 ? 55  LYS A HE2  5  
ATOM 7713  H HE3  . LYS A 1 55  ? 1.129   -7.689  16.627  1.00 0.00 ? 55  LYS A HE3  5  
ATOM 7714  H HZ1  . LYS A 1 55  ? 2.932   -7.687  18.740  1.00 0.00 ? 55  LYS A HZ1  5  
ATOM 7715  H HZ2  . LYS A 1 55  ? 1.825   -8.825  18.358  1.00 0.00 ? 55  LYS A HZ2  5  
ATOM 7716  H HZ3  . LYS A 1 55  ? 3.336   -8.917  17.744  1.00 0.00 ? 55  LYS A HZ3  5  
ATOM 7717  N N    . GLU A 1 56  ? 1.203   -7.968  10.450  1.00 0.00 ? 56  GLU A N    5  
ATOM 7718  C CA   . GLU A 1 56  ? 0.344   -8.409  9.365   1.00 0.00 ? 56  GLU A CA   5  
ATOM 7719  C C    . GLU A 1 56  ? 1.128   -9.293  8.393   1.00 0.00 ? 56  GLU A C    5  
ATOM 7720  O O    . GLU A 1 56  ? 0.879   -10.495 8.302   1.00 0.00 ? 56  GLU A O    5  
ATOM 7721  C CB   . GLU A 1 56  ? -0.279  -7.215  8.639   1.00 0.00 ? 56  GLU A CB   5  
ATOM 7722  C CG   . GLU A 1 56  ? -1.792  -7.166  8.863   1.00 0.00 ? 56  GLU A CG   5  
ATOM 7723  C CD   . GLU A 1 56  ? -2.439  -8.514  8.535   1.00 0.00 ? 56  GLU A CD   5  
ATOM 7724  O OE1  . GLU A 1 56  ? -2.711  -8.736  7.336   1.00 0.00 ? 56  GLU A OE1  5  
ATOM 7725  O OE2  . GLU A 1 56  ? -2.645  -9.291  9.492   1.00 0.00 ? 56  GLU A OE2  5  
ATOM 7726  H H    . GLU A 1 56  ? 1.090   -7.011  10.716  1.00 0.00 ? 56  GLU A H    5  
ATOM 7727  H HA   . GLU A 1 56  ? -0.446  -8.991  9.839   1.00 0.00 ? 56  GLU A HA   5  
ATOM 7728  H HB2  . GLU A 1 56  ? 0.175   -6.291  8.996   1.00 0.00 ? 56  GLU A HB2  5  
ATOM 7729  H HB3  . GLU A 1 56  ? -0.068  -7.283  7.572   1.00 0.00 ? 56  GLU A HB3  5  
ATOM 7730  H HG2  . GLU A 1 56  ? -2.002  -6.900  9.899   1.00 0.00 ? 56  GLU A HG2  5  
ATOM 7731  H HG3  . GLU A 1 56  ? -2.231  -6.388  8.239   1.00 0.00 ? 56  GLU A HG3  5  
ATOM 7732  N N    . VAL A 1 57  ? 2.059   -8.665  7.691   1.00 0.00 ? 57  VAL A N    5  
ATOM 7733  C CA   . VAL A 1 57  ? 2.881   -9.379  6.729   1.00 0.00 ? 57  VAL A CA   5  
ATOM 7734  C C    . VAL A 1 57  ? 3.395   -10.672 7.365   1.00 0.00 ? 57  VAL A C    5  
ATOM 7735  O O    . VAL A 1 57  ? 3.567   -11.680 6.680   1.00 0.00 ? 57  VAL A O    5  
ATOM 7736  C CB   . VAL A 1 57  ? 4.005   -8.473  6.225   1.00 0.00 ? 57  VAL A CB   5  
ATOM 7737  C CG1  . VAL A 1 57  ? 4.944   -9.233  5.286   1.00 0.00 ? 57  VAL A CG1  5  
ATOM 7738  C CG2  . VAL A 1 57  ? 3.440   -7.225  5.544   1.00 0.00 ? 57  VAL A CG2  5  
ATOM 7739  H H    . VAL A 1 57  ? 2.255   -7.687  7.770   1.00 0.00 ? 57  VAL A H    5  
ATOM 7740  H HA   . VAL A 1 57  ? 2.247   -9.634  5.880   1.00 0.00 ? 57  VAL A HA   5  
ATOM 7741  H HB   . VAL A 1 57  ? 4.586   -8.148  7.089   1.00 0.00 ? 57  VAL A HB   5  
ATOM 7742  H HG11 . VAL A 1 57  ? 5.227   -10.181 5.744   1.00 0.00 ? 57  VAL A HG11 5  
ATOM 7743  H HG12 . VAL A 1 57  ? 4.436   -9.424  4.341   1.00 0.00 ? 57  VAL A HG12 5  
ATOM 7744  H HG13 . VAL A 1 57  ? 5.838   -8.636  5.104   1.00 0.00 ? 57  VAL A HG13 5  
ATOM 7745  H HG21 . VAL A 1 57  ? 4.125   -6.389  5.690   1.00 0.00 ? 57  VAL A HG21 5  
ATOM 7746  H HG22 . VAL A 1 57  ? 3.322   -7.416  4.477   1.00 0.00 ? 57  VAL A HG22 5  
ATOM 7747  H HG23 . VAL A 1 57  ? 2.471   -6.981  5.979   1.00 0.00 ? 57  VAL A HG23 5  
ATOM 7748  N N    . GLU A 1 58  ? 3.625   -10.602 8.668   1.00 0.00 ? 58  GLU A N    5  
ATOM 7749  C CA   . GLU A 1 58  ? 4.116   -11.755 9.404   1.00 0.00 ? 58  GLU A CA   5  
ATOM 7750  C C    . GLU A 1 58  ? 3.012   -12.804 9.545   1.00 0.00 ? 58  GLU A C    5  
ATOM 7751  O O    . GLU A 1 58  ? 3.277   -14.003 9.473   1.00 0.00 ? 58  GLU A O    5  
ATOM 7752  C CB   . GLU A 1 58  ? 4.657   -11.340 10.774  1.00 0.00 ? 58  GLU A CB   5  
ATOM 7753  C CG   . GLU A 1 58  ? 6.185   -11.425 10.809  1.00 0.00 ? 58  GLU A CG   5  
ATOM 7754  C CD   . GLU A 1 58  ? 6.703   -11.394 12.248  1.00 0.00 ? 58  GLU A CD   5  
ATOM 7755  O OE1  . GLU A 1 58  ? 6.781   -10.275 12.799  1.00 0.00 ? 58  GLU A OE1  5  
ATOM 7756  O OE2  . GLU A 1 58  ? 7.010   -12.490 12.764  1.00 0.00 ? 58  GLU A OE2  5  
ATOM 7757  H H    . GLU A 1 58  ? 3.482   -9.779  9.217   1.00 0.00 ? 58  GLU A H    5  
ATOM 7758  H HA   . GLU A 1 58  ? 4.933   -12.156 8.804   1.00 0.00 ? 58  GLU A HA   5  
ATOM 7759  H HB2  . GLU A 1 58  ? 4.341   -10.323 11.001  1.00 0.00 ? 58  GLU A HB2  5  
ATOM 7760  H HB3  . GLU A 1 58  ? 4.236   -11.985 11.545  1.00 0.00 ? 58  GLU A HB3  5  
ATOM 7761  H HG2  . GLU A 1 58  ? 6.513   -12.342 10.320  1.00 0.00 ? 58  GLU A HG2  5  
ATOM 7762  H HG3  . GLU A 1 58  ? 6.611   -10.594 10.247  1.00 0.00 ? 58  GLU A HG3  5  
ATOM 7763  N N    . LYS A 1 59  ? 1.797   -12.315 9.744   1.00 0.00 ? 59  LYS A N    5  
ATOM 7764  C CA   . LYS A 1 59  ? 0.651   -13.196 9.896   1.00 0.00 ? 59  LYS A CA   5  
ATOM 7765  C C    . LYS A 1 59  ? 0.501   -14.052 8.637   1.00 0.00 ? 59  LYS A C    5  
ATOM 7766  O O    . LYS A 1 59  ? 0.346   -15.269 8.725   1.00 0.00 ? 59  LYS A O    5  
ATOM 7767  C CB   . LYS A 1 59  ? -0.602  -12.390 10.244  1.00 0.00 ? 59  LYS A CB   5  
ATOM 7768  C CG   . LYS A 1 59  ? -0.830  -12.357 11.757  1.00 0.00 ? 59  LYS A CG   5  
ATOM 7769  C CD   . LYS A 1 59  ? -0.492  -10.980 12.332  1.00 0.00 ? 59  LYS A CD   5  
ATOM 7770  C CE   . LYS A 1 59  ? -1.721  -10.341 12.982  1.00 0.00 ? 59  LYS A CE   5  
ATOM 7771  N NZ   . LYS A 1 59  ? -1.804  -8.905  12.633  1.00 0.00 ? 59  LYS A NZ   5  
ATOM 7772  H H    . LYS A 1 59  ? 1.589   -11.339 9.801   1.00 0.00 ? 59  LYS A H    5  
ATOM 7773  H HA   . LYS A 1 59  ? 0.855   -13.855 10.740  1.00 0.00 ? 59  LYS A HA   5  
ATOM 7774  H HB2  . LYS A 1 59  ? -0.502  -11.373 9.866   1.00 0.00 ? 59  LYS A HB2  5  
ATOM 7775  H HB3  . LYS A 1 59  ? -1.469  -12.829 9.751   1.00 0.00 ? 59  LYS A HB3  5  
ATOM 7776  H HG2  . LYS A 1 59  ? -1.869  -12.603 11.977  1.00 0.00 ? 59  LYS A HG2  5  
ATOM 7777  H HG3  . LYS A 1 59  ? -0.214  -13.117 12.237  1.00 0.00 ? 59  LYS A HG3  5  
ATOM 7778  H HD2  . LYS A 1 59  ? 0.305   -11.076 13.070  1.00 0.00 ? 59  LYS A HD2  5  
ATOM 7779  H HD3  . LYS A 1 59  ? -0.117  -10.333 11.540  1.00 0.00 ? 59  LYS A HD3  5  
ATOM 7780  H HE2  . LYS A 1 59  ? -2.624  -10.854 12.649  1.00 0.00 ? 59  LYS A HE2  5  
ATOM 7781  H HE3  . LYS A 1 59  ? -1.669  -10.456 14.064  1.00 0.00 ? 59  LYS A HE3  5  
ATOM 7782  H HZ1  . LYS A 1 59  ? -2.219  -8.402  13.391  1.00 0.00 ? 59  LYS A HZ1  5  
ATOM 7783  H HZ2  . LYS A 1 59  ? -0.884  -8.550  12.462  1.00 0.00 ? 59  LYS A HZ2  5  
ATOM 7784  H HZ3  . LYS A 1 59  ? -2.362  -8.793  11.812  1.00 0.00 ? 59  LYS A HZ3  5  
ATOM 7785  N N    . MET A 1 60  ? 0.553   -13.383 7.495   1.00 0.00 ? 60  MET A N    5  
ATOM 7786  C CA   . MET A 1 60  ? 0.425   -14.067 6.219   1.00 0.00 ? 60  MET A CA   5  
ATOM 7787  C C    . MET A 1 60  ? -0.950  -14.724 6.085   1.00 0.00 ? 60  MET A C    5  
ATOM 7788  O O    . MET A 1 60  ? -1.068  -15.822 5.543   1.00 0.00 ? 60  MET A O    5  
ATOM 7789  C CB   . MET A 1 60  ? 1.514   -15.136 6.102   1.00 0.00 ? 60  MET A CB   5  
ATOM 7790  C CG   . MET A 1 60  ? 2.782   -14.559 5.468   1.00 0.00 ? 60  MET A CG   5  
ATOM 7791  S SD   . MET A 1 60  ? 2.726   -14.764 3.696   1.00 0.00 ? 60  MET A SD   5  
ATOM 7792  C CE   . MET A 1 60  ? 2.309   -13.099 3.204   1.00 0.00 ? 60  MET A CE   5  
ATOM 7793  H H    . MET A 1 60  ? 0.680   -12.393 7.432   1.00 0.00 ? 60  MET A H    5  
ATOM 7794  H HA   . MET A 1 60  ? 0.543   -13.295 5.460   1.00 0.00 ? 60  MET A HA   5  
ATOM 7795  H HB2  . MET A 1 60  ? 1.746   -15.534 7.089   1.00 0.00 ? 60  MET A HB2  5  
ATOM 7796  H HB3  . MET A 1 60  ? 1.149   -15.968 5.500   1.00 0.00 ? 60  MET A HB3  5  
ATOM 7797  H HG2  . MET A 1 60  ? 2.874   -13.502 5.718   1.00 0.00 ? 60  MET A HG2  5  
ATOM 7798  H HG3  . MET A 1 60  ? 3.661   -15.060 5.873   1.00 0.00 ? 60  MET A HG3  5  
ATOM 7799  H HE1  . MET A 1 60  ? 1.321   -13.094 2.743   1.00 0.00 ? 60  MET A HE1  5  
ATOM 7800  H HE2  . MET A 1 60  ? 2.304   -12.452 4.081   1.00 0.00 ? 60  MET A HE2  5  
ATOM 7801  H HE3  . MET A 1 60  ? 3.046   -12.736 2.488   1.00 0.00 ? 60  MET A HE3  5  
ATOM 7802  N N    . ASN A 1 61  ? -1.956  -14.023 6.588   1.00 0.00 ? 61  ASN A N    5  
ATOM 7803  C CA   . ASN A 1 61  ? -3.319  -14.524 6.531   1.00 0.00 ? 61  ASN A CA   5  
ATOM 7804  C C    . ASN A 1 61  ? -3.811  -14.489 5.082   1.00 0.00 ? 61  ASN A C    5  
ATOM 7805  O O    . ASN A 1 61  ? -3.026  -14.261 4.163   1.00 0.00 ? 61  ASN A O    5  
ATOM 7806  C CB   . ASN A 1 61  ? -4.260  -13.657 7.370   1.00 0.00 ? 61  ASN A CB   5  
ATOM 7807  C CG   . ASN A 1 61  ? -4.568  -12.337 6.661   1.00 0.00 ? 61  ASN A CG   5  
ATOM 7808  O OD1  . ASN A 1 61  ? -5.573  -12.183 5.988   1.00 0.00 ? 61  ASN A OD1  5  
ATOM 7809  N ND2  . ASN A 1 61  ? -3.647  -11.395 6.849   1.00 0.00 ? 61  ASN A ND2  5  
ATOM 7810  H H    . ASN A 1 61  ? -1.852  -13.131 7.027   1.00 0.00 ? 61  ASN A H    5  
ATOM 7811  H HA   . ASN A 1 61  ? -3.269  -15.537 6.930   1.00 0.00 ? 61  ASN A HA   5  
ATOM 7812  H HB2  . ASN A 1 61  ? -5.188  -14.198 7.558   1.00 0.00 ? 61  ASN A HB2  5  
ATOM 7813  H HB3  . ASN A 1 61  ? -3.806  -13.456 8.341   1.00 0.00 ? 61  ASN A HB3  5  
ATOM 7814  H HD21 . ASN A 1 61  ? -2.844  -11.586 7.414   1.00 0.00 ? 61  ASN A HD21 5  
ATOM 7815  H HD22 . ASN A 1 61  ? -3.759  -10.495 6.426   1.00 0.00 ? 61  ASN A HD22 5  
ATOM 7816  N N    . LYS A 1 62  ? -5.106  -14.719 4.925   1.00 0.00 ? 62  LYS A N    5  
ATOM 7817  C CA   . LYS A 1 62  ? -5.711  -14.716 3.604   1.00 0.00 ? 62  LYS A CA   5  
ATOM 7818  C C    . LYS A 1 62  ? -5.449  -13.368 2.930   1.00 0.00 ? 62  LYS A C    5  
ATOM 7819  O O    . LYS A 1 62  ? -4.806  -13.307 1.883   1.00 0.00 ? 62  LYS A O    5  
ATOM 7820  C CB   . LYS A 1 62  ? -7.194  -15.082 3.693   1.00 0.00 ? 62  LYS A CB   5  
ATOM 7821  C CG   . LYS A 1 62  ? -7.472  -16.419 3.005   1.00 0.00 ? 62  LYS A CG   5  
ATOM 7822  C CD   . LYS A 1 62  ? -7.363  -17.580 3.997   1.00 0.00 ? 62  LYS A CD   5  
ATOM 7823  C CE   . LYS A 1 62  ? -6.852  -18.845 3.306   1.00 0.00 ? 62  LYS A CE   5  
ATOM 7824  N NZ   . LYS A 1 62  ? -7.133  -20.038 4.135   1.00 0.00 ? 62  LYS A NZ   5  
ATOM 7825  H H    . LYS A 1 62  ? -5.737  -14.903 5.678   1.00 0.00 ? 62  LYS A H    5  
ATOM 7826  H HA   . LYS A 1 62  ? -5.222  -15.495 3.019   1.00 0.00 ? 62  LYS A HA   5  
ATOM 7827  H HB2  . LYS A 1 62  ? -7.497  -15.137 4.739   1.00 0.00 ? 62  LYS A HB2  5  
ATOM 7828  H HB3  . LYS A 1 62  ? -7.794  -14.298 3.230   1.00 0.00 ? 62  LYS A HB3  5  
ATOM 7829  H HG2  . LYS A 1 62  ? -8.469  -16.406 2.564   1.00 0.00 ? 62  LYS A HG2  5  
ATOM 7830  H HG3  . LYS A 1 62  ? -6.765  -16.566 2.189   1.00 0.00 ? 62  LYS A HG3  5  
ATOM 7831  H HD2  . LYS A 1 62  ? -6.688  -17.306 4.808   1.00 0.00 ? 62  LYS A HD2  5  
ATOM 7832  H HD3  . LYS A 1 62  ? -8.337  -17.773 4.444   1.00 0.00 ? 62  LYS A HD3  5  
ATOM 7833  H HE2  . LYS A 1 62  ? -7.328  -18.952 2.331   1.00 0.00 ? 62  LYS A HE2  5  
ATOM 7834  H HE3  . LYS A 1 62  ? -5.780  -18.763 3.129   1.00 0.00 ? 62  LYS A HE3  5  
ATOM 7835  H HZ1  . LYS A 1 62  ? -7.671  -20.694 3.605   1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 7836  H HZ2  . LYS A 1 62  ? -6.271  -20.462 4.413   1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 7837  H HZ3  . LYS A 1 62  ? -7.647  -19.765 4.948   1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 7838  N N    . LYS A 1 63  ? -5.962  -12.319 3.558   1.00 0.00 ? 63  LYS A N    5  
ATOM 7839  C CA   . LYS A 1 63  ? -5.791  -10.976 3.032   1.00 0.00 ? 63  LYS A CA   5  
ATOM 7840  C C    . LYS A 1 63  ? -4.340  -10.787 2.588   1.00 0.00 ? 63  LYS A C    5  
ATOM 7841  O O    . LYS A 1 63  ? -4.080  -10.411 1.445   1.00 0.00 ? 63  LYS A O    5  
ATOM 7842  C CB   . LYS A 1 63  ? -6.263  -9.937  4.052   1.00 0.00 ? 63  LYS A CB   5  
ATOM 7843  C CG   . LYS A 1 63  ? -7.787  -9.809  4.039   1.00 0.00 ? 63  LYS A CG   5  
ATOM 7844  C CD   . LYS A 1 63  ? -8.214  -8.384  3.683   1.00 0.00 ? 63  LYS A CD   5  
ATOM 7845  C CE   . LYS A 1 63  ? -9.279  -8.389  2.584   1.00 0.00 ? 63  LYS A CE   5  
ATOM 7846  N NZ   . LYS A 1 63  ? -8.686  -7.995  1.287   1.00 0.00 ? 63  LYS A NZ   5  
ATOM 7847  H H    . LYS A 1 63  ? -6.484  -12.377 4.408   1.00 0.00 ? 63  LYS A H    5  
ATOM 7848  H HA   . LYS A 1 63  ? -6.435  -10.883 2.157   1.00 0.00 ? 63  LYS A HA   5  
ATOM 7849  H HB2  . LYS A 1 63  ? -5.926  -10.222 5.049   1.00 0.00 ? 63  LYS A HB2  5  
ATOM 7850  H HB3  . LYS A 1 63  ? -5.811  -8.971  3.828   1.00 0.00 ? 63  LYS A HB3  5  
ATOM 7851  H HG2  . LYS A 1 63  ? -8.209  -10.510 3.319   1.00 0.00 ? 63  LYS A HG2  5  
ATOM 7852  H HG3  . LYS A 1 63  ? -8.186  -10.079 5.017   1.00 0.00 ? 63  LYS A HG3  5  
ATOM 7853  H HD2  . LYS A 1 63  ? -8.605  -7.885  4.570   1.00 0.00 ? 63  LYS A HD2  5  
ATOM 7854  H HD3  . LYS A 1 63  ? -7.347  -7.812  3.352   1.00 0.00 ? 63  LYS A HD3  5  
ATOM 7855  H HE2  . LYS A 1 63  ? -9.721  -9.382  2.503   1.00 0.00 ? 63  LYS A HE2  5  
ATOM 7856  H HE3  . LYS A 1 63  ? -10.084 -7.702  2.846   1.00 0.00 ? 63  LYS A HE3  5  
ATOM 7857  H HZ1  . LYS A 1 63  ? -8.344  -7.057  1.347   1.00 0.00 ? 63  LYS A HZ1  5  
ATOM 7858  H HZ2  . LYS A 1 63  ? -7.930  -8.612  1.065   1.00 0.00 ? 63  LYS A HZ2  5  
ATOM 7859  H HZ3  . LYS A 1 63  ? -9.383  -8.051  0.571   1.00 0.00 ? 63  LYS A HZ3  5  
ATOM 7860  N N    . MET A 1 64  ? -3.431  -11.055 3.514   1.00 0.00 ? 64  MET A N    5  
ATOM 7861  C CA   . MET A 1 64  ? -2.012  -10.920 3.232   1.00 0.00 ? 64  MET A CA   5  
ATOM 7862  C C    . MET A 1 64  ? -1.578  -11.884 2.126   1.00 0.00 ? 64  MET A C    5  
ATOM 7863  O O    . MET A 1 64  ? -0.750  -11.537 1.285   1.00 0.00 ? 64  MET A O    5  
ATOM 7864  C CB   . MET A 1 64  ? -1.210  -11.205 4.503   1.00 0.00 ? 64  MET A CB   5  
ATOM 7865  C CG   . MET A 1 64  ? 0.251   -10.779 4.337   1.00 0.00 ? 64  MET A CG   5  
ATOM 7866  S SD   . MET A 1 64  ? 0.339   -9.038  3.955   1.00 0.00 ? 64  MET A SD   5  
ATOM 7867  C CE   . MET A 1 64  ? -0.352  -8.357  5.453   1.00 0.00 ? 64  MET A CE   5  
ATOM 7868  H H    . MET A 1 64  ? -3.651  -11.360 4.441   1.00 0.00 ? 64  MET A H    5  
ATOM 7869  H HA   . MET A 1 64  ? -1.877  -9.890  2.900   1.00 0.00 ? 64  MET A HA   5  
ATOM 7870  H HB2  . MET A 1 64  ? -1.653  -10.674 5.345   1.00 0.00 ? 64  MET A HB2  5  
ATOM 7871  H HB3  . MET A 1 64  ? -1.258  -12.269 4.736   1.00 0.00 ? 64  MET A HB3  5  
ATOM 7872  H HG2  . MET A 1 64  ? 0.805   -10.988 5.251   1.00 0.00 ? 64  MET A HG2  5  
ATOM 7873  H HG3  . MET A 1 64  ? 0.719   -11.359 3.541   1.00 0.00 ? 64  MET A HG3  5  
ATOM 7874  H HE1  . MET A 1 64  ? -1.440  -8.406  5.407   1.00 0.00 ? 64  MET A HE1  5  
ATOM 7875  H HE2  . MET A 1 64  ? 0.001   -8.931  6.310   1.00 0.00 ? 64  MET A HE2  5  
ATOM 7876  H HE3  . MET A 1 64  ? -0.039  -7.318  5.558   1.00 0.00 ? 64  MET A HE3  5  
ATOM 7877  N N    . GLU A 1 65  ? -2.156  -13.075 2.164   1.00 0.00 ? 65  GLU A N    5  
ATOM 7878  C CA   . GLU A 1 65  ? -1.839  -14.092 1.175   1.00 0.00 ? 65  GLU A CA   5  
ATOM 7879  C C    . GLU A 1 65  ? -2.055  -13.545 -0.237  1.00 0.00 ? 65  GLU A C    5  
ATOM 7880  O O    . GLU A 1 65  ? -1.197  -13.702 -1.105  1.00 0.00 ? 65  GLU A O    5  
ATOM 7881  C CB   . GLU A 1 65  ? -2.668  -15.358 1.405   1.00 0.00 ? 65  GLU A CB   5  
ATOM 7882  C CG   . GLU A 1 65  ? -1.865  -16.406 2.178   1.00 0.00 ? 65  GLU A CG   5  
ATOM 7883  C CD   . GLU A 1 65  ? -1.320  -17.482 1.237   1.00 0.00 ? 65  GLU A CD   5  
ATOM 7884  O OE1  . GLU A 1 65  ? -0.257  -17.222 0.633   1.00 0.00 ? 65  GLU A OE1  5  
ATOM 7885  O OE2  . GLU A 1 65  ? -1.977  -18.541 1.144   1.00 0.00 ? 65  GLU A OE2  5  
ATOM 7886  H H    . GLU A 1 65  ? -2.828  -13.350 2.852   1.00 0.00 ? 65  GLU A H    5  
ATOM 7887  H HA   . GLU A 1 65  ? -0.785  -14.324 1.326   1.00 0.00 ? 65  GLU A HA   5  
ATOM 7888  H HB2  . GLU A 1 65  ? -3.574  -15.108 1.958   1.00 0.00 ? 65  GLU A HB2  5  
ATOM 7889  H HB3  . GLU A 1 65  ? -2.983  -15.770 0.446   1.00 0.00 ? 65  GLU A HB3  5  
ATOM 7890  H HG2  . GLU A 1 65  ? -1.040  -15.923 2.702   1.00 0.00 ? 65  GLU A HG2  5  
ATOM 7891  H HG3  . GLU A 1 65  ? -2.498  -16.867 2.936   1.00 0.00 ? 65  GLU A HG3  5  
ATOM 7892  N N    . GLU A 1 66  ? -3.204  -12.913 -0.424  1.00 0.00 ? 66  GLU A N    5  
ATOM 7893  C CA   . GLU A 1 66  ? -3.543  -12.342 -1.716  1.00 0.00 ? 66  GLU A CA   5  
ATOM 7894  C C    . GLU A 1 66  ? -2.402  -11.456 -2.220  1.00 0.00 ? 66  GLU A C    5  
ATOM 7895  O O    . GLU A 1 66  ? -2.096  -11.449 -3.411  1.00 0.00 ? 66  GLU A O    5  
ATOM 7896  C CB   . GLU A 1 66  ? -4.855  -11.558 -1.642  1.00 0.00 ? 66  GLU A CB   5  
ATOM 7897  C CG   . GLU A 1 66  ? -5.986  -12.432 -1.098  1.00 0.00 ? 66  GLU A CG   5  
ATOM 7898  C CD   . GLU A 1 66  ? -6.873  -12.950 -2.232  1.00 0.00 ? 66  GLU A CD   5  
ATOM 7899  O OE1  . GLU A 1 66  ? -7.600  -12.113 -2.811  1.00 0.00 ? 66  GLU A OE1  5  
ATOM 7900  O OE2  . GLU A 1 66  ? -6.805  -14.170 -2.494  1.00 0.00 ? 66  GLU A OE2  5  
ATOM 7901  H H    . GLU A 1 66  ? -3.896  -12.790 0.288   1.00 0.00 ? 66  GLU A H    5  
ATOM 7902  H HA   . GLU A 1 66  ? -3.673  -13.193 -2.384  1.00 0.00 ? 66  GLU A HA   5  
ATOM 7903  H HB2  . GLU A 1 66  ? -4.725  -10.685 -1.002  1.00 0.00 ? 66  GLU A HB2  5  
ATOM 7904  H HB3  . GLU A 1 66  ? -5.119  -11.190 -2.633  1.00 0.00 ? 66  GLU A HB3  5  
ATOM 7905  H HG2  . GLU A 1 66  ? -5.567  -13.274 -0.546  1.00 0.00 ? 66  GLU A HG2  5  
ATOM 7906  H HG3  . GLU A 1 66  ? -6.588  -11.858 -0.393  1.00 0.00 ? 66  GLU A HG3  5  
ATOM 7907  N N    . VAL A 1 67  ? -1.804  -10.728 -1.287  1.00 0.00 ? 67  VAL A N    5  
ATOM 7908  C CA   . VAL A 1 67  ? -0.704  -9.840  -1.622  1.00 0.00 ? 67  VAL A CA   5  
ATOM 7909  C C    . VAL A 1 67  ? 0.511   -10.674 -2.035  1.00 0.00 ? 67  VAL A C    5  
ATOM 7910  O O    . VAL A 1 67  ? 1.228   -10.314 -2.967  1.00 0.00 ? 67  VAL A O    5  
ATOM 7911  C CB   . VAL A 1 67  ? -0.414  -8.901  -0.450  1.00 0.00 ? 67  VAL A CB   5  
ATOM 7912  C CG1  . VAL A 1 67  ? 0.636   -7.856  -0.831  1.00 0.00 ? 67  VAL A CG1  5  
ATOM 7913  C CG2  . VAL A 1 67  ? -1.698  -8.233  0.047   1.00 0.00 ? 67  VAL A CG2  5  
ATOM 7914  H H    . VAL A 1 67  ? -2.059  -10.739 -0.321  1.00 0.00 ? 67  VAL A H    5  
ATOM 7915  H HA   . VAL A 1 67  ? -1.018  -9.234  -2.471  1.00 0.00 ? 67  VAL A HA   5  
ATOM 7916  H HB   . VAL A 1 67  ? -0.011  -9.499  0.367   1.00 0.00 ? 67  VAL A HB   5  
ATOM 7917  H HG11 . VAL A 1 67  ? 1.298   -8.268  -1.593  1.00 0.00 ? 67  VAL A HG11 5  
ATOM 7918  H HG12 . VAL A 1 67  ? 0.140   -6.968  -1.222  1.00 0.00 ? 67  VAL A HG12 5  
ATOM 7919  H HG13 . VAL A 1 67  ? 1.219   -7.588  0.050   1.00 0.00 ? 67  VAL A HG13 5  
ATOM 7920  H HG21 . VAL A 1 67  ? -1.800  -7.251  -0.417  1.00 0.00 ? 67  VAL A HG21 5  
ATOM 7921  H HG22 . VAL A 1 67  ? -2.556  -8.851  -0.218  1.00 0.00 ? 67  VAL A HG22 5  
ATOM 7922  H HG23 . VAL A 1 67  ? -1.653  -8.119  1.130   1.00 0.00 ? 67  VAL A HG23 5  
ATOM 7923  N N    . LYS A 1 68  ? 0.705   -11.772 -1.320  1.00 0.00 ? 68  LYS A N    5  
ATOM 7924  C CA   . LYS A 1 68  ? 1.821   -12.660 -1.600  1.00 0.00 ? 68  LYS A CA   5  
ATOM 7925  C C    . LYS A 1 68  ? 1.631   -13.291 -2.980  1.00 0.00 ? 68  LYS A C    5  
ATOM 7926  O O    . LYS A 1 68  ? 2.585   -13.418 -3.746  1.00 0.00 ? 68  LYS A O    5  
ATOM 7927  C CB   . LYS A 1 68  ? 1.989   -13.682 -0.474  1.00 0.00 ? 68  LYS A CB   5  
ATOM 7928  C CG   . LYS A 1 68  ? 3.199   -14.584 -0.727  1.00 0.00 ? 68  LYS A CG   5  
ATOM 7929  C CD   . LYS A 1 68  ? 3.879   -14.971 0.588   1.00 0.00 ? 68  LYS A CD   5  
ATOM 7930  C CE   . LYS A 1 68  ? 5.293   -15.498 0.339   1.00 0.00 ? 68  LYS A CE   5  
ATOM 7931  N NZ   . LYS A 1 68  ? 5.257   -16.678 -0.553  1.00 0.00 ? 68  LYS A NZ   5  
ATOM 7932  H H    . LYS A 1 68  ? 0.118   -12.058 -0.563  1.00 0.00 ? 68  LYS A H    5  
ATOM 7933  H HA   . LYS A 1 68  ? 2.725   -12.051 -1.620  1.00 0.00 ? 68  LYS A HA   5  
ATOM 7934  H HB2  . LYS A 1 68  ? 2.109   -13.164 0.478   1.00 0.00 ? 68  LYS A HB2  5  
ATOM 7935  H HB3  . LYS A 1 68  ? 1.088   -14.290 -0.393  1.00 0.00 ? 68  LYS A HB3  5  
ATOM 7936  H HG2  . LYS A 1 68  ? 2.882   -15.483 -1.256  1.00 0.00 ? 68  LYS A HG2  5  
ATOM 7937  H HG3  . LYS A 1 68  ? 3.911   -14.069 -1.372  1.00 0.00 ? 68  LYS A HG3  5  
ATOM 7938  H HD2  . LYS A 1 68  ? 3.920   -14.105 1.248   1.00 0.00 ? 68  LYS A HD2  5  
ATOM 7939  H HD3  . LYS A 1 68  ? 3.287   -15.732 1.097   1.00 0.00 ? 68  LYS A HD3  5  
ATOM 7940  H HE2  . LYS A 1 68  ? 5.906   -14.715 -0.109  1.00 0.00 ? 68  LYS A HE2  5  
ATOM 7941  H HE3  . LYS A 1 68  ? 5.760   -15.765 1.287   1.00 0.00 ? 68  LYS A HE3  5  
ATOM 7942  H HZ1  . LYS A 1 68  ? 4.374   -16.716 -1.021  1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 7943  H HZ2  . LYS A 1 68  ? 5.990   -16.608 -1.230  1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 7944  H HZ3  . LYS A 1 68  ? 5.383   -17.509 -0.011  1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 7945  N N    . GLU A 1 69  ? 0.392   -13.670 -3.257  1.00 0.00 ? 69  GLU A N    5  
ATOM 7946  C CA   . GLU A 1 69  ? 0.064   -14.286 -4.532  1.00 0.00 ? 69  GLU A CA   5  
ATOM 7947  C C    . GLU A 1 69  ? 0.298   -13.295 -5.674  1.00 0.00 ? 69  GLU A C    5  
ATOM 7948  O O    . GLU A 1 69  ? 0.811   -13.668 -6.728  1.00 0.00 ? 69  GLU A O    5  
ATOM 7949  C CB   . GLU A 1 69  ? -1.377  -14.800 -4.538  1.00 0.00 ? 69  GLU A CB   5  
ATOM 7950  C CG   . GLU A 1 69  ? -1.669  -15.629 -3.285  1.00 0.00 ? 69  GLU A CG   5  
ATOM 7951  C CD   . GLU A 1 69  ? -2.487  -16.875 -3.630  1.00 0.00 ? 69  GLU A CD   5  
ATOM 7952  O OE1  . GLU A 1 69  ? -2.149  -17.510 -4.652  1.00 0.00 ? 69  GLU A OE1  5  
ATOM 7953  O OE2  . GLU A 1 69  ? -3.432  -17.163 -2.864  1.00 0.00 ? 69  GLU A OE2  5  
ATOM 7954  H H    . GLU A 1 69  ? -0.379  -13.563 -2.629  1.00 0.00 ? 69  GLU A H    5  
ATOM 7955  H HA   . GLU A 1 69  ? 0.745   -15.131 -4.629  1.00 0.00 ? 69  GLU A HA   5  
ATOM 7956  H HB2  . GLU A 1 69  ? -2.067  -13.958 -4.591  1.00 0.00 ? 69  GLU A HB2  5  
ATOM 7957  H HB3  . GLU A 1 69  ? -1.546  -15.407 -5.427  1.00 0.00 ? 69  GLU A HB3  5  
ATOM 7958  H HG2  . GLU A 1 69  ? -0.731  -15.924 -2.813  1.00 0.00 ? 69  GLU A HG2  5  
ATOM 7959  H HG3  . GLU A 1 69  ? -2.212  -15.021 -2.562  1.00 0.00 ? 69  GLU A HG3  5  
ATOM 7960  N N    . ALA A 1 70  ? -0.091  -12.053 -5.427  1.00 0.00 ? 70  ALA A N    5  
ATOM 7961  C CA   . ALA A 1 70  ? 0.069   -11.007 -6.423  1.00 0.00 ? 70  ALA A CA   5  
ATOM 7962  C C    . ALA A 1 70  ? 1.449   -10.365 -6.263  1.00 0.00 ? 70  ALA A C    5  
ATOM 7963  O O    . ALA A 1 70  ? 1.740   -9.346  -6.888  1.00 0.00 ? 70  ALA A O    5  
ATOM 7964  C CB   . ALA A 1 70  ? -1.066  -9.991  -6.283  1.00 0.00 ? 70  ALA A CB   5  
ATOM 7965  H H    . ALA A 1 70  ? -0.508  -11.758 -4.568  1.00 0.00 ? 70  ALA A H    5  
ATOM 7966  H HA   . ALA A 1 70  ? 0.006   -11.472 -7.406  1.00 0.00 ? 70  ALA A HA   5  
ATOM 7967  H HB1  . ALA A 1 70  ? -2.023  -10.496 -6.411  1.00 0.00 ? 70  ALA A HB1  5  
ATOM 7968  H HB2  . ALA A 1 70  ? -1.025  -9.534  -5.294  1.00 0.00 ? 70  ALA A HB2  5  
ATOM 7969  H HB3  . ALA A 1 70  ? -0.958  -9.219  -7.045  1.00 0.00 ? 70  ALA A HB3  5  
ATOM 7970  N N    . ASN A 1 71  ? 2.263   -10.987 -5.423  1.00 0.00 ? 71  ASN A N    5  
ATOM 7971  C CA   . ASN A 1 71  ? 3.605   -10.489 -5.173  1.00 0.00 ? 71  ASN A CA   5  
ATOM 7972  C C    . ASN A 1 71  ? 3.570   -8.962  -5.092  1.00 0.00 ? 71  ASN A C    5  
ATOM 7973  O O    . ASN A 1 71  ? 4.300   -8.282  -5.812  1.00 0.00 ? 71  ASN A O    5  
ATOM 7974  C CB   . ASN A 1 71  ? 4.557   -10.881 -6.305  1.00 0.00 ? 71  ASN A CB   5  
ATOM 7975  C CG   . ASN A 1 71  ? 5.972   -11.117 -5.774  1.00 0.00 ? 71  ASN A CG   5  
ATOM 7976  O OD1  . ASN A 1 71  ? 6.188   -11.809 -4.793  1.00 0.00 ? 71  ASN A OD1  5  
ATOM 7977  N ND2  . ASN A 1 71  ? 6.922   -10.503 -6.475  1.00 0.00 ? 71  ASN A ND2  5  
ATOM 7978  H H    . ASN A 1 71  ? 2.018   -11.815 -4.918  1.00 0.00 ? 71  ASN A H    5  
ATOM 7979  H HA   . ASN A 1 71  ? 3.911   -10.950 -4.234  1.00 0.00 ? 71  ASN A HA   5  
ATOM 7980  H HB2  . ASN A 1 71  ? 4.193   -11.785 -6.795  1.00 0.00 ? 71  ASN A HB2  5  
ATOM 7981  H HB3  . ASN A 1 71  ? 4.574   -10.095 -7.060  1.00 0.00 ? 71  ASN A HB3  5  
ATOM 7982  H HD21 . ASN A 1 71  ? 6.677   -9.949  -7.271  1.00 0.00 ? 71  ASN A HD21 5  
ATOM 7983  H HD22 . ASN A 1 71  ? 7.880   -10.597 -6.206  1.00 0.00 ? 71  ASN A HD22 5  
ATOM 7984  N N    . ILE A 1 72  ? 2.715   -8.467  -4.209  1.00 0.00 ? 72  ILE A N    5  
ATOM 7985  C CA   . ILE A 1 72  ? 2.577   -7.033  -4.024  1.00 0.00 ? 72  ILE A CA   5  
ATOM 7986  C C    . ILE A 1 72  ? 3.390   -6.599  -2.803  1.00 0.00 ? 72  ILE A C    5  
ATOM 7987  O O    . ILE A 1 72  ? 3.137   -7.057  -1.690  1.00 0.00 ? 72  ILE A O    5  
ATOM 7988  C CB   . ILE A 1 72  ? 1.099   -6.643  -3.949  1.00 0.00 ? 72  ILE A CB   5  
ATOM 7989  C CG1  . ILE A 1 72  ? 0.368   -7.014  -5.241  1.00 0.00 ? 72  ILE A CG1  5  
ATOM 7990  C CG2  . ILE A 1 72  ? 0.940   -5.160  -3.606  1.00 0.00 ? 72  ILE A CG2  5  
ATOM 7991  C CD1  . ILE A 1 72  ? -1.127  -6.704  -5.133  1.00 0.00 ? 72  ILE A CD1  5  
ATOM 7992  H H    . ILE A 1 72  ? 2.126   -9.027  -3.627  1.00 0.00 ? 72  ILE A H    5  
ATOM 7993  H HA   . ILE A 1 72  ? 2.993   -6.548  -4.907  1.00 0.00 ? 72  ILE A HA   5  
ATOM 7994  H HB   . ILE A 1 72  ? 0.636   -7.211  -3.142  1.00 0.00 ? 72  ILE A HB   5  
ATOM 7995  H HG12 . ILE A 1 72  ? 0.798   -6.463  -6.077  1.00 0.00 ? 72  ILE A HG12 5  
ATOM 7996  H HG13 . ILE A 1 72  ? 0.509   -8.074  -5.451  1.00 0.00 ? 72  ILE A HG13 5  
ATOM 7997  H HG21 . ILE A 1 72  ? 0.902   -5.040  -2.523  1.00 0.00 ? 72  ILE A HG21 5  
ATOM 7998  H HG22 . ILE A 1 72  ? 1.788   -4.602  -4.003  1.00 0.00 ? 72  ILE A HG22 5  
ATOM 7999  H HG23 . ILE A 1 72  ? 0.017   -4.782  -4.046  1.00 0.00 ? 72  ILE A HG23 5  
ATOM 8000  H HD11 . ILE A 1 72  ? -1.404  -5.982  -5.901  1.00 0.00 ? 72  ILE A HD11 5  
ATOM 8001  H HD12 . ILE A 1 72  ? -1.699  -7.621  -5.273  1.00 0.00 ? 72  ILE A HD12 5  
ATOM 8002  H HD13 . ILE A 1 72  ? -1.342  -6.288  -4.148  1.00 0.00 ? 72  ILE A HD13 5  
ATOM 8003  N N    . ARG A 1 73  ? 4.350   -5.721  -3.052  1.00 0.00 ? 73  ARG A N    5  
ATOM 8004  C CA   . ARG A 1 73  ? 5.202   -5.220  -1.987  1.00 0.00 ? 73  ARG A CA   5  
ATOM 8005  C C    . ARG A 1 73  ? 4.351   -4.636  -0.857  1.00 0.00 ? 73  ARG A C    5  
ATOM 8006  O O    . ARG A 1 73  ? 3.397   -3.902  -1.109  1.00 0.00 ? 73  ARG A O    5  
ATOM 8007  C CB   . ARG A 1 73  ? 6.157   -4.143  -2.506  1.00 0.00 ? 73  ARG A CB   5  
ATOM 8008  C CG   . ARG A 1 73  ? 5.410   -2.839  -2.791  1.00 0.00 ? 73  ARG A CG   5  
ATOM 8009  C CD   . ARG A 1 73  ? 6.106   -2.038  -3.893  1.00 0.00 ? 73  ARG A CD   5  
ATOM 8010  N NE   . ARG A 1 73  ? 5.158   -1.764  -4.996  1.00 0.00 ? 73  ARG A NE   5  
ATOM 8011  C CZ   . ARG A 1 73  ? 5.525   -1.365  -6.221  1.00 0.00 ? 73  ARG A CZ   5  
ATOM 8012  N NH1  . ARG A 1 73  ? 6.823   -1.191  -6.508  1.00 0.00 ? 73  ARG A NH1  5  
ATOM 8013  N NH2  . ARG A 1 73  ? 4.596   -1.140  -7.159  1.00 0.00 ? 73  ARG A NH2  5  
ATOM 8014  H H    . ARG A 1 73  ? 4.549   -5.353  -3.961  1.00 0.00 ? 73  ARG A H    5  
ATOM 8015  H HA   . ARG A 1 73  ? 5.763   -6.090  -1.647  1.00 0.00 ? 73  ARG A HA   5  
ATOM 8016  H HB2  . ARG A 1 73  ? 6.942   -3.964  -1.771  1.00 0.00 ? 73  ARG A HB2  5  
ATOM 8017  H HB3  . ARG A 1 73  ? 6.646   -4.493  -3.415  1.00 0.00 ? 73  ARG A HB3  5  
ATOM 8018  H HG2  . ARG A 1 73  ? 4.385   -3.060  -3.090  1.00 0.00 ? 73  ARG A HG2  5  
ATOM 8019  H HG3  . ARG A 1 73  ? 5.354   -2.241  -1.881  1.00 0.00 ? 73  ARG A HG3  5  
ATOM 8020  H HD2  . ARG A 1 73  ? 6.486   -1.100  -3.488  1.00 0.00 ? 73  ARG A HD2  5  
ATOM 8021  H HD3  . ARG A 1 73  ? 6.965   -2.593  -4.270  1.00 0.00 ? 73  ARG A HD3  5  
ATOM 8022  H HE   . ARG A 1 73  ? 4.181   -1.883  -4.815  1.00 0.00 ? 73  ARG A HE   5  
ATOM 8023  H HH11 . ARG A 1 73  ? 7.516   -1.360  -5.808  1.00 0.00 ? 73  ARG A HH11 5  
ATOM 8024  H HH12 . ARG A 1 73  ? 7.097   -0.894  -7.423  1.00 0.00 ? 73  ARG A HH12 5  
ATOM 8025  H HH21 . ARG A 1 73  ? 3.627   -1.269  -6.945  1.00 0.00 ? 73  ARG A HH21 5  
ATOM 8026  H HH22 . ARG A 1 73  ? 4.870   -0.842  -8.074  1.00 0.00 ? 73  ARG A HH22 5  
ATOM 8027  N N    . VAL A 1 74  ? 4.727   -4.985  0.364   1.00 0.00 ? 74  VAL A N    5  
ATOM 8028  C CA   . VAL A 1 74  ? 4.011   -4.505  1.534   1.00 0.00 ? 74  VAL A CA   5  
ATOM 8029  C C    . VAL A 1 74  ? 4.885   -3.499  2.285   1.00 0.00 ? 74  VAL A C    5  
ATOM 8030  O O    . VAL A 1 74  ? 5.939   -3.857  2.809   1.00 0.00 ? 74  VAL A O    5  
ATOM 8031  C CB   . VAL A 1 74  ? 3.577   -5.687  2.403   1.00 0.00 ? 74  VAL A CB   5  
ATOM 8032  C CG1  . VAL A 1 74  ? 2.507   -5.262  3.411   1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8033  C CG2  . VAL A 1 74  ? 3.087   -6.852  1.541   1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8034  H H    . VAL A 1 74  ? 5.504   -5.583  0.561   1.00 0.00 ? 74  VAL A H    5  
ATOM 8035  H HA   . VAL A 1 74  ? 3.113   -3.996  1.183   1.00 0.00 ? 74  VAL A HA   5  
ATOM 8036  H HB   . VAL A 1 74  ? 4.448   -6.028  2.963   1.00 0.00 ? 74  VAL A HB   5  
ATOM 8037  H HG11 . VAL A 1 74  ? 1.922   -6.133  3.709   1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8038  H HG12 . VAL A 1 74  ? 2.986   -4.829  4.289   1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8039  H HG13 . VAL A 1 74  ? 1.850   -4.523  2.953   1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8040  H HG21 . VAL A 1 74  ? 3.867   -7.611  1.479   1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8041  H HG22 . VAL A 1 74  ? 2.193   -7.285  1.989   1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8042  H HG23 . VAL A 1 74  ? 2.852   -6.489  0.540   1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8043  N N    . VAL A 1 75  ? 4.416   -2.261  2.313   1.00 0.00 ? 75  VAL A N    5  
ATOM 8044  C CA   . VAL A 1 75  ? 5.142   -1.200  2.991   1.00 0.00 ? 75  VAL A CA   5  
ATOM 8045  C C    . VAL A 1 75  ? 4.351   -0.752  4.221   1.00 0.00 ? 75  VAL A C    5  
ATOM 8046  O O    . VAL A 1 75  ? 3.191   -1.127  4.388   1.00 0.00 ? 75  VAL A O    5  
ATOM 8047  C CB   . VAL A 1 75  ? 5.431   -0.057  2.016   1.00 0.00 ? 75  VAL A CB   5  
ATOM 8048  C CG1  . VAL A 1 75  ? 6.335   -0.525  0.874   1.00 0.00 ? 75  VAL A CG1  5  
ATOM 8049  C CG2  . VAL A 1 75  ? 4.131   0.544   1.476   1.00 0.00 ? 75  VAL A CG2  5  
ATOM 8050  H H    . VAL A 1 75  ? 3.558   -1.978  1.884   1.00 0.00 ? 75  VAL A H    5  
ATOM 8051  H HA   . VAL A 1 75  ? 6.096   -1.613  3.319   1.00 0.00 ? 75  VAL A HA   5  
ATOM 8052  H HB   . VAL A 1 75  ? 5.959   0.724   2.563   1.00 0.00 ? 75  VAL A HB   5  
ATOM 8053  H HG11 . VAL A 1 75  ? 7.358   -0.198  1.063   1.00 0.00 ? 75  VAL A HG11 5  
ATOM 8054  H HG12 . VAL A 1 75  ? 6.307   -1.613  0.811   1.00 0.00 ? 75  VAL A HG12 5  
ATOM 8055  H HG13 . VAL A 1 75  ? 5.985   -0.098  -0.065  1.00 0.00 ? 75  VAL A HG13 5  
ATOM 8056  H HG21 . VAL A 1 75  ? 4.366   1.317   0.745   1.00 0.00 ? 75  VAL A HG21 5  
ATOM 8057  H HG22 . VAL A 1 75  ? 3.540   -0.239  1.000   1.00 0.00 ? 75  VAL A HG22 5  
ATOM 8058  H HG23 . VAL A 1 75  ? 3.564   0.980   2.298   1.00 0.00 ? 75  VAL A HG23 5  
ATOM 8059  N N    . SER A 1 76  ? 5.009   0.045   5.051   1.00 0.00 ? 76  SER A N    5  
ATOM 8060  C CA   . SER A 1 76  ? 4.381   0.548   6.260   1.00 0.00 ? 76  SER A CA   5  
ATOM 8061  C C    . SER A 1 76  ? 3.693   1.885   5.976   1.00 0.00 ? 76  SER A C    5  
ATOM 8062  O O    . SER A 1 76  ? 3.865   2.459   4.901   1.00 0.00 ? 76  SER A O    5  
ATOM 8063  C CB   . SER A 1 76  ? 5.404   0.707   7.387   1.00 0.00 ? 76  SER A CB   5  
ATOM 8064  O OG   . SER A 1 76  ? 4.865   0.336   8.653   1.00 0.00 ? 76  SER A OG   5  
ATOM 8065  H H    . SER A 1 76  ? 5.951   0.345   4.907   1.00 0.00 ? 76  SER A H    5  
ATOM 8066  H HA   . SER A 1 76  ? 3.647   -0.207  6.541   1.00 0.00 ? 76  SER A HA   5  
ATOM 8067  H HB2  . SER A 1 76  ? 6.279   0.094   7.171   1.00 0.00 ? 76  SER A HB2  5  
ATOM 8068  H HB3  . SER A 1 76  ? 5.742   1.742   7.426   1.00 0.00 ? 76  SER A HB3  5  
ATOM 8069  H HG   . SER A 1 76  ? 3.872   0.450   8.649   1.00 0.00 ? 76  SER A HG   5  
ATOM 8070  N N    . GLU A 1 77  ? 2.929   2.342   6.957   1.00 0.00 ? 77  GLU A N    5  
ATOM 8071  C CA   . GLU A 1 77  ? 2.215   3.601   6.825   1.00 0.00 ? 77  GLU A CA   5  
ATOM 8072  C C    . GLU A 1 77  ? 3.203   4.768   6.769   1.00 0.00 ? 77  GLU A C    5  
ATOM 8073  O O    . GLU A 1 77  ? 2.847   5.867   6.346   1.00 0.00 ? 77  GLU A O    5  
ATOM 8074  C CB   . GLU A 1 77  ? 1.213   3.785   7.966   1.00 0.00 ? 77  GLU A CB   5  
ATOM 8075  C CG   . GLU A 1 77  ? -0.093  4.398   7.456   1.00 0.00 ? 77  GLU A CG   5  
ATOM 8076  C CD   . GLU A 1 77  ? -0.156  5.894   7.771   1.00 0.00 ? 77  GLU A CD   5  
ATOM 8077  O OE1  . GLU A 1 77  ? 0.057   6.235   8.954   1.00 0.00 ? 77  GLU A OE1  5  
ATOM 8078  O OE2  . GLU A 1 77  ? -0.415  6.663   6.820   1.00 0.00 ? 77  GLU A OE2  5  
ATOM 8079  H H    . GLU A 1 77  ? 2.795   1.869   7.828   1.00 0.00 ? 77  GLU A H    5  
ATOM 8080  H HA   . GLU A 1 77  ? 1.673   3.529   5.882   1.00 0.00 ? 77  GLU A HA   5  
ATOM 8081  H HB2  . GLU A 1 77  ? 1.008   2.822   8.434   1.00 0.00 ? 77  GLU A HB2  5  
ATOM 8082  H HB3  . GLU A 1 77  ? 1.645   4.427   8.734   1.00 0.00 ? 77  GLU A HB3  5  
ATOM 8083  H HG2  . GLU A 1 77  ? -0.175  4.245   6.380   1.00 0.00 ? 77  GLU A HG2  5  
ATOM 8084  H HG3  . GLU A 1 77  ? -0.941  3.890   7.916   1.00 0.00 ? 77  GLU A HG3  5  
ATOM 8085  N N    . ASP A 1 78  ? 4.424   4.490   7.202   1.00 0.00 ? 78  ASP A N    5  
ATOM 8086  C CA   . ASP A 1 78  ? 5.465   5.503   7.206   1.00 0.00 ? 78  ASP A CA   5  
ATOM 8087  C C    . ASP A 1 78  ? 5.722   5.970   5.772   1.00 0.00 ? 78  ASP A C    5  
ATOM 8088  O O    . ASP A 1 78  ? 6.130   7.109   5.550   1.00 0.00 ? 78  ASP A O    5  
ATOM 8089  C CB   . ASP A 1 78  ? 6.775   4.943   7.763   1.00 0.00 ? 78  ASP A CB   5  
ATOM 8090  C CG   . ASP A 1 78  ? 6.626   4.063   9.005   1.00 0.00 ? 78  ASP A CG   5  
ATOM 8091  O OD1  . ASP A 1 78  ? 5.632   4.272   9.733   1.00 0.00 ? 78  ASP A OD1  5  
ATOM 8092  O OD2  . ASP A 1 78  ? 7.511   3.201   9.199   1.00 0.00 ? 78  ASP A OD2  5  
ATOM 8093  H H    . ASP A 1 78  ? 4.705   3.593   7.544   1.00 0.00 ? 78  ASP A H    5  
ATOM 8094  H HA   . ASP A 1 78  ? 5.085   6.302   7.843   1.00 0.00 ? 78  ASP A HA   5  
ATOM 8095  H HB2  . ASP A 1 78  ? 7.267   4.363   6.982   1.00 0.00 ? 78  ASP A HB2  5  
ATOM 8096  H HB3  . ASP A 1 78  ? 7.436   5.777   8.004   1.00 0.00 ? 78  ASP A HB3  5  
ATOM 8097  N N    . PHE A 1 79  ? 5.473   5.067   4.836   1.00 0.00 ? 79  PHE A N    5  
ATOM 8098  C CA   . PHE A 1 79  ? 5.672   5.372   3.429   1.00 0.00 ? 79  PHE A CA   5  
ATOM 8099  C C    . PHE A 1 79  ? 4.802   6.553   2.996   1.00 0.00 ? 79  PHE A C    5  
ATOM 8100  O O    . PHE A 1 79  ? 5.279   7.468   2.326   1.00 0.00 ? 79  PHE A O    5  
ATOM 8101  C CB   . PHE A 1 79  ? 5.256   4.130   2.638   1.00 0.00 ? 79  PHE A CB   5  
ATOM 8102  C CG   . PHE A 1 79  ? 4.858   4.419   1.190   1.00 0.00 ? 79  PHE A CG   5  
ATOM 8103  C CD1  . PHE A 1 79  ? 5.793   4.850   0.301   1.00 0.00 ? 79  PHE A CD1  5  
ATOM 8104  C CD2  . PHE A 1 79  ? 3.570   4.245   0.790   1.00 0.00 ? 79  PHE A CD2  5  
ATOM 8105  C CE1  . PHE A 1 79  ? 5.424   5.119   -1.044  1.00 0.00 ? 79  PHE A CE1  5  
ATOM 8106  C CE2  . PHE A 1 79  ? 3.201   4.513   -0.554  1.00 0.00 ? 79  PHE A CE2  5  
ATOM 8107  C CZ   . PHE A 1 79  ? 4.136   4.944   -1.443  1.00 0.00 ? 79  PHE A CZ   5  
ATOM 8108  H H    . PHE A 1 79  ? 5.141   4.142   5.024   1.00 0.00 ? 79  PHE A H    5  
ATOM 8109  H HA   . PHE A 1 79  ? 6.723   5.631   3.300   1.00 0.00 ? 79  PHE A HA   5  
ATOM 8110  H HB2  . PHE A 1 79  ? 6.080   3.416   2.643   1.00 0.00 ? 79  PHE A HB2  5  
ATOM 8111  H HB3  . PHE A 1 79  ? 4.418   3.652   3.146   1.00 0.00 ? 79  PHE A HB3  5  
ATOM 8112  H HD1  . PHE A 1 79  ? 6.826   4.990   0.621   1.00 0.00 ? 79  PHE A HD1  5  
ATOM 8113  H HD2  . PHE A 1 79  ? 2.821   3.899   1.503   1.00 0.00 ? 79  PHE A HD2  5  
ATOM 8114  H HE1  . PHE A 1 79  ? 6.173   5.464   -1.756  1.00 0.00 ? 79  PHE A HE1  5  
ATOM 8115  H HE2  . PHE A 1 79  ? 2.168   4.373   -0.874  1.00 0.00 ? 79  PHE A HE2  5  
ATOM 8116  H HZ   . PHE A 1 79  ? 3.852   5.150   -2.475  1.00 0.00 ? 79  PHE A HZ   5  
ATOM 8117  N N    . LEU A 1 80  ? 3.540   6.495   3.395   1.00 0.00 ? 80  LEU A N    5  
ATOM 8118  C CA   . LEU A 1 80  ? 2.598   7.548   3.057   1.00 0.00 ? 80  LEU A CA   5  
ATOM 8119  C C    . LEU A 1 80  ? 3.156   8.895   3.523   1.00 0.00 ? 80  LEU A C    5  
ATOM 8120  O O    . LEU A 1 80  ? 3.203   9.852   2.752   1.00 0.00 ? 80  LEU A O    5  
ATOM 8121  C CB   . LEU A 1 80  ? 1.212   7.229   3.619   1.00 0.00 ? 80  LEU A CB   5  
ATOM 8122  C CG   . LEU A 1 80  ? 0.397   6.189   2.847   1.00 0.00 ? 80  LEU A CG   5  
ATOM 8123  C CD1  . LEU A 1 80  ? -0.774  5.677   3.686   1.00 0.00 ? 80  LEU A CD1  5  
ATOM 8124  C CD2  . LEU A 1 80  ? -0.064  6.746   1.498   1.00 0.00 ? 80  LEU A CD2  5  
ATOM 8125  H H    . LEU A 1 80  ? 3.159   5.747   3.940   1.00 0.00 ? 80  LEU A H    5  
ATOM 8126  H HA   . LEU A 1 80  ? 2.508   7.569   1.971   1.00 0.00 ? 80  LEU A HA   5  
ATOM 8127  H HB2  . LEU A 1 80  ? 1.329   6.880   4.645   1.00 0.00 ? 80  LEU A HB2  5  
ATOM 8128  H HB3  . LEU A 1 80  ? 0.636   8.154   3.661   1.00 0.00 ? 80  LEU A HB3  5  
ATOM 8129  H HG   . LEU A 1 80  ? 1.042   5.336   2.639   1.00 0.00 ? 80  LEU A HG   5  
ATOM 8130  H HD11 . LEU A 1 80  ? -0.828  6.240   4.618   1.00 0.00 ? 80  LEU A HD11 5  
ATOM 8131  H HD12 . LEU A 1 80  ? -1.703  5.805   3.130   1.00 0.00 ? 80  LEU A HD12 5  
ATOM 8132  H HD13 . LEU A 1 80  ? -0.627  4.620   3.908   1.00 0.00 ? 80  LEU A HD13 5  
ATOM 8133  H HD21 . LEU A 1 80  ? 0.807   7.001   0.893   1.00 0.00 ? 80  LEU A HD21 5  
ATOM 8134  H HD22 . LEU A 1 80  ? -0.659  5.995   0.979   1.00 0.00 ? 80  LEU A HD22 5  
ATOM 8135  H HD23 . LEU A 1 80  ? -0.667  7.639   1.661   1.00 0.00 ? 80  LEU A HD23 5  
ATOM 8136  N N    . GLN A 1 81  ? 3.565   8.925   4.783   1.00 0.00 ? 81  GLN A N    5  
ATOM 8137  C CA   . GLN A 1 81  ? 4.118   10.138  5.362   1.00 0.00 ? 81  GLN A CA   5  
ATOM 8138  C C    . GLN A 1 81  ? 5.338   10.598  4.562   1.00 0.00 ? 81  GLN A C    5  
ATOM 8139  O O    . GLN A 1 81  ? 5.651   11.788  4.530   1.00 0.00 ? 81  GLN A O    5  
ATOM 8140  C CB   . GLN A 1 81  ? 4.474   9.930   6.835   1.00 0.00 ? 81  GLN A CB   5  
ATOM 8141  C CG   . GLN A 1 81  ? 5.589   10.883  7.269   1.00 0.00 ? 81  GLN A CG   5  
ATOM 8142  C CD   . GLN A 1 81  ? 5.151   12.341  7.125   1.00 0.00 ? 81  GLN A CD   5  
ATOM 8143  O OE1  . GLN A 1 81  ? 3.975   12.666  7.120   1.00 0.00 ? 81  GLN A OE1  5  
ATOM 8144  N NE2  . GLN A 1 81  ? 6.160   13.200  7.007   1.00 0.00 ? 81  GLN A NE2  5  
ATOM 8145  H H    . GLN A 1 81  ? 3.523   8.142   5.404   1.00 0.00 ? 81  GLN A H    5  
ATOM 8146  H HA   . GLN A 1 81  ? 3.325   10.882  5.287   1.00 0.00 ? 81  GLN A HA   5  
ATOM 8147  H HB2  . GLN A 1 81  ? 3.590   10.092  7.453   1.00 0.00 ? 81  GLN A HB2  5  
ATOM 8148  H HB3  . GLN A 1 81  ? 4.788   8.899   6.995   1.00 0.00 ? 81  GLN A HB3  5  
ATOM 8149  H HG2  . GLN A 1 81  ? 5.861   10.682  8.306   1.00 0.00 ? 81  GLN A HG2  5  
ATOM 8150  H HG3  . GLN A 1 81  ? 6.479   10.705  6.666   1.00 0.00 ? 81  GLN A HG3  5  
ATOM 8151  H HE21 . GLN A 1 81  ? 7.103   12.868  7.019   1.00 0.00 ? 81  GLN A HE21 5  
ATOM 8152  H HE22 . GLN A 1 81  ? 5.976   14.178  6.908   1.00 0.00 ? 81  GLN A HE22 5  
ATOM 8153  N N    . ASP A 1 82  ? 5.996   9.632   3.938   1.00 0.00 ? 82  ASP A N    5  
ATOM 8154  C CA   . ASP A 1 82  ? 7.175   9.924   3.141   1.00 0.00 ? 82  ASP A CA   5  
ATOM 8155  C C    . ASP A 1 82  ? 6.744   10.360  1.739   1.00 0.00 ? 82  ASP A C    5  
ATOM 8156  O O    . ASP A 1 82  ? 7.096   11.449  1.288   1.00 0.00 ? 82  ASP A O    5  
ATOM 8157  C CB   . ASP A 1 82  ? 8.063   8.686   2.998   1.00 0.00 ? 82  ASP A CB   5  
ATOM 8158  C CG   . ASP A 1 82  ? 8.205   8.153   1.571   1.00 0.00 ? 82  ASP A CG   5  
ATOM 8159  O OD1  . ASP A 1 82  ? 8.604   8.958   0.702   1.00 0.00 ? 82  ASP A OD1  5  
ATOM 8160  O OD2  . ASP A 1 82  ? 7.912   6.953   1.382   1.00 0.00 ? 82  ASP A OD2  5  
ATOM 8161  H H    . ASP A 1 82  ? 5.735   8.667   3.969   1.00 0.00 ? 82  ASP A H    5  
ATOM 8162  H HA   . ASP A 1 82  ? 7.698   10.713  3.681   1.00 0.00 ? 82  ASP A HA   5  
ATOM 8163  H HB2  . ASP A 1 82  ? 9.056   8.923   3.382   1.00 0.00 ? 82  ASP A HB2  5  
ATOM 8164  H HB3  . ASP A 1 82  ? 7.660   7.893   3.628   1.00 0.00 ? 82  ASP A HB3  5  
ATOM 8165  N N    . VAL A 1 83  ? 5.987   9.488   1.089   1.00 0.00 ? 83  VAL A N    5  
ATOM 8166  C CA   . VAL A 1 83  ? 5.504   9.770   -0.251  1.00 0.00 ? 83  VAL A CA   5  
ATOM 8167  C C    . VAL A 1 83  ? 4.898   11.174  -0.286  1.00 0.00 ? 83  VAL A C    5  
ATOM 8168  O O    . VAL A 1 83  ? 4.911   11.834  -1.324  1.00 0.00 ? 83  VAL A O    5  
ATOM 8169  C CB   . VAL A 1 83  ? 4.521   8.683   -0.692  1.00 0.00 ? 83  VAL A CB   5  
ATOM 8170  C CG1  . VAL A 1 83  ? 3.076   9.109   -0.423  1.00 0.00 ? 83  VAL A CG1  5  
ATOM 8171  C CG2  . VAL A 1 83  ? 4.722   8.328   -2.167  1.00 0.00 ? 83  VAL A CG2  5  
ATOM 8172  H H    . VAL A 1 83  ? 5.705   8.605   1.464   1.00 0.00 ? 83  VAL A H    5  
ATOM 8173  H HA   . VAL A 1 83  ? 6.362   9.741   -0.923  1.00 0.00 ? 83  VAL A HA   5  
ATOM 8174  H HB   . VAL A 1 83  ? 4.722   7.789   -0.102  1.00 0.00 ? 83  VAL A HB   5  
ATOM 8175  H HG11 . VAL A 1 83  ? 2.413   8.256   -0.569  1.00 0.00 ? 83  VAL A HG11 5  
ATOM 8176  H HG12 . VAL A 1 83  ? 2.988   9.466   0.603   1.00 0.00 ? 83  VAL A HG12 5  
ATOM 8177  H HG13 . VAL A 1 83  ? 2.798   9.907   -1.111  1.00 0.00 ? 83  VAL A HG13 5  
ATOM 8178  H HG21 . VAL A 1 83  ? 5.362   7.449   -2.245  1.00 0.00 ? 83  VAL A HG21 5  
ATOM 8179  H HG22 . VAL A 1 83  ? 3.755   8.115   -2.624  1.00 0.00 ? 83  VAL A HG22 5  
ATOM 8180  H HG23 . VAL A 1 83  ? 5.190   9.166   -2.682  1.00 0.00 ? 83  VAL A HG23 5  
ATOM 8181  N N    . SER A 1 84  ? 4.381   11.589  0.861   1.00 0.00 ? 84  SER A N    5  
ATOM 8182  C CA   . SER A 1 84  ? 3.771   12.903  0.975   1.00 0.00 ? 84  SER A CA   5  
ATOM 8183  C C    . SER A 1 84  ? 4.838   13.948  1.306   1.00 0.00 ? 84  SER A C    5  
ATOM 8184  O O    . SER A 1 84  ? 4.712   15.111  0.924   1.00 0.00 ? 84  SER A O    5  
ATOM 8185  C CB   . SER A 1 84  ? 2.673   12.910  2.041   1.00 0.00 ? 84  SER A CB   5  
ATOM 8186  O OG   . SER A 1 84  ? 1.795   14.023  1.896   1.00 0.00 ? 84  SER A OG   5  
ATOM 8187  H H    . SER A 1 84  ? 4.374   11.046  1.701   1.00 0.00 ? 84  SER A H    5  
ATOM 8188  H HA   . SER A 1 84  ? 3.329   13.102  -0.001  1.00 0.00 ? 84  SER A HA   5  
ATOM 8189  H HB2  . SER A 1 84  ? 2.099   11.985  1.977   1.00 0.00 ? 84  SER A HB2  5  
ATOM 8190  H HB3  . SER A 1 84  ? 3.129   12.934  3.031   1.00 0.00 ? 84  SER A HB3  5  
ATOM 8191  H HG   . SER A 1 84  ? 1.546   14.382  2.796   1.00 0.00 ? 84  SER A HG   5  
ATOM 8192  N N    . ALA A 1 85  ? 5.864   13.497  2.012   1.00 0.00 ? 85  ALA A N    5  
ATOM 8193  C CA   . ALA A 1 85  ? 6.953   14.379  2.398   1.00 0.00 ? 85  ALA A CA   5  
ATOM 8194  C C    . ALA A 1 85  ? 8.285   13.741  2.001   1.00 0.00 ? 85  ALA A C    5  
ATOM 8195  O O    . ALA A 1 85  ? 9.119   13.452  2.858   1.00 0.00 ? 85  ALA A O    5  
ATOM 8196  C CB   . ALA A 1 85  ? 6.868   14.668  3.898   1.00 0.00 ? 85  ALA A CB   5  
ATOM 8197  H H    . ALA A 1 85  ? 5.959   12.550  2.318   1.00 0.00 ? 85  ALA A H    5  
ATOM 8198  H HA   . ALA A 1 85  ? 6.830   15.315  1.853   1.00 0.00 ? 85  ALA A HA   5  
ATOM 8199  H HB1  . ALA A 1 85  ? 6.950   15.741  4.066   1.00 0.00 ? 85  ALA A HB1  5  
ATOM 8200  H HB2  . ALA A 1 85  ? 5.913   14.311  4.283   1.00 0.00 ? 85  ALA A HB2  5  
ATOM 8201  H HB3  . ALA A 1 85  ? 7.682   14.156  4.412   1.00 0.00 ? 85  ALA A HB3  5  
ATOM 8202  N N    . SER A 1 86  ? 8.445   13.541  0.701   1.00 0.00 ? 86  SER A N    5  
ATOM 8203  C CA   . SER A 1 86  ? 9.662   12.943  0.179   1.00 0.00 ? 86  SER A CA   5  
ATOM 8204  C C    . SER A 1 86  ? 9.750   13.167  -1.331  1.00 0.00 ? 86  SER A C    5  
ATOM 8205  O O    . SER A 1 86  ? 8.728   13.278  -2.007  1.00 0.00 ? 86  SER A O    5  
ATOM 8206  C CB   . SER A 1 86  ? 9.722   11.448  0.499   1.00 0.00 ? 86  SER A CB   5  
ATOM 8207  O OG   . SER A 1 86  ? 11.051  10.939  0.425   1.00 0.00 ? 86  SER A OG   5  
ATOM 8208  H H    . SER A 1 86  ? 7.762   13.780  0.010   1.00 0.00 ? 86  SER A H    5  
ATOM 8209  H HA   . SER A 1 86  ? 10.477  13.456  0.690   1.00 0.00 ? 86  SER A HA   5  
ATOM 8210  H HB2  . SER A 1 86  ? 9.322   11.274  1.498   1.00 0.00 ? 86  SER A HB2  5  
ATOM 8211  H HB3  . SER A 1 86  ? 9.085   10.903  -0.198  1.00 0.00 ? 86  SER A HB3  5  
ATOM 8212  H HG   . SER A 1 86  ? 11.515  11.310  -0.379  1.00 0.00 ? 86  SER A HG   5  
ATOM 8213  N N    . THR A 1 87  ? 10.981  13.227  -1.818  1.00 0.00 ? 87  THR A N    5  
ATOM 8214  C CA   . THR A 1 87  ? 11.216  13.435  -3.237  1.00 0.00 ? 87  THR A CA   5  
ATOM 8215  C C    . THR A 1 87  ? 12.069  12.301  -3.809  1.00 0.00 ? 87  THR A C    5  
ATOM 8216  O O    . THR A 1 87  ? 12.861  12.517  -4.724  1.00 0.00 ? 87  THR A O    5  
ATOM 8217  C CB   . THR A 1 87  ? 11.846  14.818  -3.413  1.00 0.00 ? 87  THR A CB   5  
ATOM 8218  O OG1  . THR A 1 87  ? 13.006  14.780  -2.586  1.00 0.00 ? 87  THR A OG1  5  
ATOM 8219  C CG2  . THR A 1 87  ? 10.992  15.933  -2.806  1.00 0.00 ? 87  THR A CG2  5  
ATOM 8220  H H    . THR A 1 87  ? 11.807  13.135  -1.262  1.00 0.00 ? 87  THR A H    5  
ATOM 8221  H HA   . THR A 1 87  ? 10.256  13.404  -3.752  1.00 0.00 ? 87  THR A HA   5  
ATOM 8222  H HB   . THR A 1 87  ? 12.058  15.018  -4.464  1.00 0.00 ? 87  THR A HB   5  
ATOM 8223  H HG1  . THR A 1 87  ? 13.817  14.603  -3.142  1.00 0.00 ? 87  THR A HG1  5  
ATOM 8224  H HG21 . THR A 1 87  ? 10.755  15.686  -1.771  1.00 0.00 ? 87  THR A HG21 5  
ATOM 8225  H HG22 . THR A 1 87  ? 11.544  16.872  -2.839  1.00 0.00 ? 87  THR A HG22 5  
ATOM 8226  H HG23 . THR A 1 87  ? 10.068  16.034  -3.376  1.00 0.00 ? 87  THR A HG23 5  
ATOM 8227  N N    . LYS A 1 88  ? 11.877  11.118  -3.245  1.00 0.00 ? 88  LYS A N    5  
ATOM 8228  C CA   . LYS A 1 88  ? 12.619  9.949   -3.687  1.00 0.00 ? 88  LYS A CA   5  
ATOM 8229  C C    . LYS A 1 88  ? 11.747  9.126   -4.637  1.00 0.00 ? 88  LYS A C    5  
ATOM 8230  O O    . LYS A 1 88  ? 10.573  9.436   -4.833  1.00 0.00 ? 88  LYS A O    5  
ATOM 8231  C CB   . LYS A 1 88  ? 13.137  9.156   -2.486  1.00 0.00 ? 88  LYS A CB   5  
ATOM 8232  C CG   . LYS A 1 88  ? 14.073  10.010  -1.627  1.00 0.00 ? 88  LYS A CG   5  
ATOM 8233  C CD   . LYS A 1 88  ? 15.387  9.276   -1.352  1.00 0.00 ? 88  LYS A CD   5  
ATOM 8234  C CE   . LYS A 1 88  ? 15.437  8.764   0.089   1.00 0.00 ? 88  LYS A CE   5  
ATOM 8235  N NZ   . LYS A 1 88  ? 16.822  8.813   0.609   1.00 0.00 ? 88  LYS A NZ   5  
ATOM 8236  H H    . LYS A 1 88  ? 11.231  10.951  -2.501  1.00 0.00 ? 88  LYS A H    5  
ATOM 8237  H HA   . LYS A 1 88  ? 13.490  10.305  -4.238  1.00 0.00 ? 88  LYS A HA   5  
ATOM 8238  H HB2  . LYS A 1 88  ? 12.297  8.813   -1.882  1.00 0.00 ? 88  LYS A HB2  5  
ATOM 8239  H HB3  . LYS A 1 88  ? 13.665  8.268   -2.832  1.00 0.00 ? 88  LYS A HB3  5  
ATOM 8240  H HG2  . LYS A 1 88  ? 14.278  10.953  -2.135  1.00 0.00 ? 88  LYS A HG2  5  
ATOM 8241  H HG3  . LYS A 1 88  ? 13.584  10.256  -0.684  1.00 0.00 ? 88  LYS A HG3  5  
ATOM 8242  H HD2  . LYS A 1 88  ? 15.492  8.440   -2.043  1.00 0.00 ? 88  LYS A HD2  5  
ATOM 8243  H HD3  . LYS A 1 88  ? 16.227  9.946   -1.533  1.00 0.00 ? 88  LYS A HD3  5  
ATOM 8244  H HE2  . LYS A 1 88  ? 14.784  9.368   0.719   1.00 0.00 ? 88  LYS A HE2  5  
ATOM 8245  H HE3  . LYS A 1 88  ? 15.063  7.741   0.131   1.00 0.00 ? 88  LYS A HE3  5  
ATOM 8246  H HZ1  . LYS A 1 88  ? 17.466  8.766   -0.155  1.00 0.00 ? 88  LYS A HZ1  5  
ATOM 8247  H HZ2  . LYS A 1 88  ? 16.960  9.668   1.109   1.00 0.00 ? 88  LYS A HZ2  5  
ATOM 8248  H HZ3  . LYS A 1 88  ? 16.975  8.039   1.223   1.00 0.00 ? 88  LYS A HZ3  5  
ATOM 8249  N N    . SER A 1 89  ? 12.355  8.093   -5.203  1.00 0.00 ? 89  SER A N    5  
ATOM 8250  C CA   . SER A 1 89  ? 11.648  7.224   -6.127  1.00 0.00 ? 89  SER A CA   5  
ATOM 8251  C C    . SER A 1 89  ? 10.769  6.240   -5.353  1.00 0.00 ? 89  SER A C    5  
ATOM 8252  O O    . SER A 1 89  ? 11.139  5.792   -4.268  1.00 0.00 ? 89  SER A O    5  
ATOM 8253  C CB   . SER A 1 89  ? 12.627  6.465   -7.027  1.00 0.00 ? 89  SER A CB   5  
ATOM 8254  O OG   . SER A 1 89  ? 13.579  7.335   -7.632  1.00 0.00 ? 89  SER A OG   5  
ATOM 8255  H H    . SER A 1 89  ? 13.310  7.848   -5.038  1.00 0.00 ? 89  SER A H    5  
ATOM 8256  H HA   . SER A 1 89  ? 11.035  7.887   -6.737  1.00 0.00 ? 89  SER A HA   5  
ATOM 8257  H HB2  . SER A 1 89  ? 13.148  5.709   -6.440  1.00 0.00 ? 89  SER A HB2  5  
ATOM 8258  H HB3  . SER A 1 89  ? 12.072  5.939   -7.804  1.00 0.00 ? 89  SER A HB3  5  
ATOM 8259  H HG   . SER A 1 89  ? 14.352  7.480   -7.013  1.00 0.00 ? 89  SER A HG   5  
ATOM 8260  N N    . LEU A 1 90  ? 9.621   5.933   -5.939  1.00 0.00 ? 90  LEU A N    5  
ATOM 8261  C CA   . LEU A 1 90  ? 8.686   5.011   -5.317  1.00 0.00 ? 90  LEU A CA   5  
ATOM 8262  C C    . LEU A 1 90  ? 9.422   3.726   -4.934  1.00 0.00 ? 90  LEU A C    5  
ATOM 8263  O O    . LEU A 1 90  ? 9.452   3.349   -3.763  1.00 0.00 ? 90  LEU A O    5  
ATOM 8264  C CB   . LEU A 1 90  ? 7.478   4.779   -6.227  1.00 0.00 ? 90  LEU A CB   5  
ATOM 8265  C CG   . LEU A 1 90  ? 6.299   5.736   -6.033  1.00 0.00 ? 90  LEU A CG   5  
ATOM 8266  C CD1  . LEU A 1 90  ? 5.798   5.703   -4.588  1.00 0.00 ? 90  LEU A CD1  5  
ATOM 8267  C CD2  . LEU A 1 90  ? 6.663   7.152   -6.482  1.00 0.00 ? 90  LEU A CD2  5  
ATOM 8268  H H    . LEU A 1 90  ? 9.328   6.302   -6.821  1.00 0.00 ? 90  LEU A H    5  
ATOM 8269  H HA   . LEU A 1 90  ? 8.318   5.484   -4.407  1.00 0.00 ? 90  LEU A HA   5  
ATOM 8270  H HB2  . LEU A 1 90  ? 7.809   4.848   -7.263  1.00 0.00 ? 90  LEU A HB2  5  
ATOM 8271  H HB3  . LEU A 1 90  ? 7.122   3.761   -6.073  1.00 0.00 ? 90  LEU A HB3  5  
ATOM 8272  H HG   . LEU A 1 90  ? 5.478   5.399   -6.666  1.00 0.00 ? 90  LEU A HG   5  
ATOM 8273  H HD11 . LEU A 1 90  ? 6.275   6.503   -4.020  1.00 0.00 ? 90  LEU A HD11 5  
ATOM 8274  H HD12 . LEU A 1 90  ? 4.717   5.842   -4.574  1.00 0.00 ? 90  LEU A HD12 5  
ATOM 8275  H HD13 . LEU A 1 90  ? 6.047   4.742   -4.139  1.00 0.00 ? 90  LEU A HD13 5  
ATOM 8276  H HD21 . LEU A 1 90  ? 7.731   7.315   -6.341  1.00 0.00 ? 90  LEU A HD21 5  
ATOM 8277  H HD22 . LEU A 1 90  ? 6.412   7.275   -7.536  1.00 0.00 ? 90  LEU A HD22 5  
ATOM 8278  H HD23 . LEU A 1 90  ? 6.104   7.876   -5.889  1.00 0.00 ? 90  LEU A HD23 5  
ATOM 8279  N N    . GLN A 1 91  ? 9.999   3.089   -5.942  1.00 0.00 ? 91  GLN A N    5  
ATOM 8280  C CA   . GLN A 1 91  ? 10.733  1.854   -5.725  1.00 0.00 ? 91  GLN A CA   5  
ATOM 8281  C C    . GLN A 1 91  ? 11.558  1.946   -4.439  1.00 0.00 ? 91  GLN A C    5  
ATOM 8282  O O    . GLN A 1 91  ? 11.415  1.113   -3.545  1.00 0.00 ? 91  GLN A O    5  
ATOM 8283  C CB   . GLN A 1 91  ? 11.624  1.528   -6.925  1.00 0.00 ? 91  GLN A CB   5  
ATOM 8284  C CG   . GLN A 1 91  ? 11.701  0.017   -7.156  1.00 0.00 ? 91  GLN A CG   5  
ATOM 8285  C CD   . GLN A 1 91  ? 13.134  -0.491  -6.988  1.00 0.00 ? 91  GLN A CD   5  
ATOM 8286  O OE1  . GLN A 1 91  ? 14.078  0.269   -6.851  1.00 0.00 ? 91  GLN A OE1  5  
ATOM 8287  N NE2  . GLN A 1 91  ? 13.243  -1.817  -7.007  1.00 0.00 ? 91  GLN A NE2  5  
ATOM 8288  H H    . GLN A 1 91  ? 9.971   3.402   -6.891  1.00 0.00 ? 91  GLN A H    5  
ATOM 8289  H HA   . GLN A 1 91  ? 9.974   1.080   -5.622  1.00 0.00 ? 91  GLN A HA   5  
ATOM 8290  H HB2  . GLN A 1 91  ? 11.233  2.017   -7.817  1.00 0.00 ? 91  GLN A HB2  5  
ATOM 8291  H HB3  . GLN A 1 91  ? 12.626  1.925   -6.758  1.00 0.00 ? 91  GLN A HB3  5  
ATOM 8292  H HG2  . GLN A 1 91  ? 11.044  -0.495  -6.453  1.00 0.00 ? 91  GLN A HG2  5  
ATOM 8293  H HG3  . GLN A 1 91  ? 11.342  -0.219  -8.158  1.00 0.00 ? 91  GLN A HG3  5  
ATOM 8294  H HE21 . GLN A 1 91  ? 12.428  -2.384  -7.124  1.00 0.00 ? 91  GLN A HE21 5  
ATOM 8295  H HE22 . GLN A 1 91  ? 14.141  -2.246  -6.905  1.00 0.00 ? 91  GLN A HE22 5  
ATOM 8296  N N    . GLU A 1 92  ? 12.402  2.966   -4.386  1.00 0.00 ? 92  GLU A N    5  
ATOM 8297  C CA   . GLU A 1 92  ? 13.249  3.178   -3.225  1.00 0.00 ? 92  GLU A CA   5  
ATOM 8298  C C    . GLU A 1 92  ? 12.397  3.280   -1.958  1.00 0.00 ? 92  GLU A C    5  
ATOM 8299  O O    . GLU A 1 92  ? 12.629  2.558   -0.990  1.00 0.00 ? 92  GLU A O    5  
ATOM 8300  C CB   . GLU A 1 92  ? 14.121  4.422   -3.401  1.00 0.00 ? 92  GLU A CB   5  
ATOM 8301  C CG   . GLU A 1 92  ? 15.097  4.248   -4.567  1.00 0.00 ? 92  GLU A CG   5  
ATOM 8302  C CD   . GLU A 1 92  ? 16.451  3.733   -4.075  1.00 0.00 ? 92  GLU A CD   5  
ATOM 8303  O OE1  . GLU A 1 92  ? 17.261  4.584   -3.650  1.00 0.00 ? 92  GLU A OE1  5  
ATOM 8304  O OE2  . GLU A 1 92  ? 16.645  2.499   -4.136  1.00 0.00 ? 92  GLU A OE2  5  
ATOM 8305  H H    . GLU A 1 92  ? 12.512  3.639   -5.118  1.00 0.00 ? 92  GLU A H    5  
ATOM 8306  H HA   . GLU A 1 92  ? 13.890  2.298   -3.170  1.00 0.00 ? 92  GLU A HA   5  
ATOM 8307  H HB2  . GLU A 1 92  ? 13.488  5.292   -3.580  1.00 0.00 ? 92  GLU A HB2  5  
ATOM 8308  H HB3  . GLU A 1 92  ? 14.676  4.615   -2.484  1.00 0.00 ? 92  GLU A HB3  5  
ATOM 8309  H HG2  . GLU A 1 92  ? 14.680  3.550   -5.293  1.00 0.00 ? 92  GLU A HG2  5  
ATOM 8310  H HG3  . GLU A 1 92  ? 15.230  5.200   -5.080  1.00 0.00 ? 92  GLU A HG3  5  
ATOM 8311  N N    . LEU A 1 93  ? 11.429  4.183   -2.006  1.00 0.00 ? 93  LEU A N    5  
ATOM 8312  C CA   . LEU A 1 93  ? 10.541  4.390   -0.874  1.00 0.00 ? 93  LEU A CA   5  
ATOM 8313  C C    . LEU A 1 93  ? 10.042  3.034   -0.370  1.00 0.00 ? 93  LEU A C    5  
ATOM 8314  O O    . LEU A 1 93  ? 10.252  2.684   0.790   1.00 0.00 ? 93  LEU A O    5  
ATOM 8315  C CB   . LEU A 1 93  ? 9.418   5.360   -1.244  1.00 0.00 ? 93  LEU A CB   5  
ATOM 8316  C CG   . LEU A 1 93  ? 9.799   6.841   -1.288  1.00 0.00 ? 93  LEU A CG   5  
ATOM 8317  C CD1  . LEU A 1 93  ? 8.571   7.716   -1.552  1.00 0.00 ? 93  LEU A CD1  5  
ATOM 8318  C CD2  . LEU A 1 93  ? 10.534  7.256   -0.012  1.00 0.00 ? 93  LEU A CD2  5  
ATOM 8319  H H    . LEU A 1 93  ? 11.247  4.767   -2.797  1.00 0.00 ? 93  LEU A H    5  
ATOM 8320  H HA   . LEU A 1 93  ? 11.125  4.859   -0.083  1.00 0.00 ? 93  LEU A HA   5  
ATOM 8321  H HB2  . LEU A 1 93  ? 9.027   5.077   -2.222  1.00 0.00 ? 93  LEU A HB2  5  
ATOM 8322  H HB3  . LEU A 1 93  ? 8.606   5.235   -0.528  1.00 0.00 ? 93  LEU A HB3  5  
ATOM 8323  H HG   . LEU A 1 93  ? 10.487  6.993   -2.119  1.00 0.00 ? 93  LEU A HG   5  
ATOM 8324  H HD11 . LEU A 1 93  ? 7.819   7.528   -0.785  1.00 0.00 ? 93  LEU A HD11 5  
ATOM 8325  H HD12 . LEU A 1 93  ? 8.861   8.766   -1.527  1.00 0.00 ? 93  LEU A HD12 5  
ATOM 8326  H HD13 . LEU A 1 93  ? 8.159   7.476   -2.532  1.00 0.00 ? 93  LEU A HD13 5  
ATOM 8327  H HD21 . LEU A 1 93  ? 10.549  8.344   0.062   1.00 0.00 ? 93  LEU A HD21 5  
ATOM 8328  H HD22 . LEU A 1 93  ? 10.020  6.841   0.855   1.00 0.00 ? 93  LEU A HD22 5  
ATOM 8329  H HD23 . LEU A 1 93  ? 11.556  6.880   -0.043  1.00 0.00 ? 93  LEU A HD23 5  
ATOM 8330  N N    . PHE A 1 94  ? 9.389   2.309   -1.267  1.00 0.00 ? 94  PHE A N    5  
ATOM 8331  C CA   . PHE A 1 94  ? 8.858   1.000   -0.927  1.00 0.00 ? 94  PHE A CA   5  
ATOM 8332  C C    . PHE A 1 94  ? 9.910   0.149   -0.213  1.00 0.00 ? 94  PHE A C    5  
ATOM 8333  O O    . PHE A 1 94  ? 9.627   -0.459  0.817   1.00 0.00 ? 94  PHE A O    5  
ATOM 8334  C CB   . PHE A 1 94  ? 8.474   0.318   -2.242  1.00 0.00 ? 94  PHE A CB   5  
ATOM 8335  C CG   . PHE A 1 94  ? 7.401   1.062   -3.039  1.00 0.00 ? 94  PHE A CG   5  
ATOM 8336  C CD1  . PHE A 1 94  ? 6.426   1.752   -2.388  1.00 0.00 ? 94  PHE A CD1  5  
ATOM 8337  C CD2  . PHE A 1 94  ? 7.422   1.034   -4.398  1.00 0.00 ? 94  PHE A CD2  5  
ATOM 8338  C CE1  . PHE A 1 94  ? 5.430   2.443   -3.128  1.00 0.00 ? 94  PHE A CE1  5  
ATOM 8339  C CE2  . PHE A 1 94  ? 6.426   1.724   -5.138  1.00 0.00 ? 94  PHE A CE2  5  
ATOM 8340  C CZ   . PHE A 1 94  ? 5.451   2.414   -4.487  1.00 0.00 ? 94  PHE A CZ   5  
ATOM 8341  H H    . PHE A 1 94  ? 9.222   2.602   -2.208  1.00 0.00 ? 94  PHE A H    5  
ATOM 8342  H HA   . PHE A 1 94  ? 8.009   1.158   -0.262  1.00 0.00 ? 94  PHE A HA   5  
ATOM 8343  H HB2  . PHE A 1 94  ? 9.366   0.216   -2.860  1.00 0.00 ? 94  PHE A HB2  5  
ATOM 8344  H HB3  . PHE A 1 94  ? 8.119   -0.690  -2.027  1.00 0.00 ? 94  PHE A HB3  5  
ATOM 8345  H HD1  . PHE A 1 94  ? 6.410   1.775   -1.298  1.00 0.00 ? 94  PHE A HD1  5  
ATOM 8346  H HD2  . PHE A 1 94  ? 8.203   0.481   -4.920  1.00 0.00 ? 94  PHE A HD2  5  
ATOM 8347  H HE1  . PHE A 1 94  ? 4.649   2.996   -2.606  1.00 0.00 ? 94  PHE A HE1  5  
ATOM 8348  H HE2  . PHE A 1 94  ? 6.442   1.702   -6.228  1.00 0.00 ? 94  PHE A HE2  5  
ATOM 8349  H HZ   . PHE A 1 94  ? 4.686   2.945   -5.055  1.00 0.00 ? 94  PHE A HZ   5  
ATOM 8350  N N    . LEU A 1 95  ? 11.103  0.134   -0.790  1.00 0.00 ? 95  LEU A N    5  
ATOM 8351  C CA   . LEU A 1 95  ? 12.199  -0.631  -0.221  1.00 0.00 ? 95  LEU A CA   5  
ATOM 8352  C C    . LEU A 1 95  ? 12.519  -0.096  1.176   1.00 0.00 ? 95  LEU A C    5  
ATOM 8353  O O    . LEU A 1 95  ? 12.447  -0.833  2.158   1.00 0.00 ? 95  LEU A O    5  
ATOM 8354  C CB   . LEU A 1 95  ? 13.400  -0.632  -1.169  1.00 0.00 ? 95  LEU A CB   5  
ATOM 8355  C CG   . LEU A 1 95  ? 14.745  -0.246  -0.549  1.00 0.00 ? 95  LEU A CG   5  
ATOM 8356  C CD1  . LEU A 1 95  ? 15.037  -1.088  0.695   1.00 0.00 ? 95  LEU A CD1  5  
ATOM 8357  C CD2  . LEU A 1 95  ? 15.871  -0.338  -1.580  1.00 0.00 ? 95  LEU A CD2  5  
ATOM 8358  H H    . LEU A 1 95  ? 11.325  0.632   -1.628  1.00 0.00 ? 95  LEU A H    5  
ATOM 8359  H HA   . LEU A 1 95  ? 11.862  -1.664  -0.127  1.00 0.00 ? 95  LEU A HA   5  
ATOM 8360  H HB2  . LEU A 1 95  ? 13.495  -1.628  -1.603  1.00 0.00 ? 95  LEU A HB2  5  
ATOM 8361  H HB3  . LEU A 1 95  ? 13.191  0.054   -1.990  1.00 0.00 ? 95  LEU A HB3  5  
ATOM 8362  H HG   . LEU A 1 95  ? 14.686  0.794   -0.227  1.00 0.00 ? 95  LEU A HG   5  
ATOM 8363  H HD11 . LEU A 1 95  ? 14.981  -0.457  1.582   1.00 0.00 ? 95  LEU A HD11 5  
ATOM 8364  H HD12 . LEU A 1 95  ? 14.301  -1.889  0.772   1.00 0.00 ? 95  LEU A HD12 5  
ATOM 8365  H HD13 . LEU A 1 95  ? 16.035  -1.518  0.616   1.00 0.00 ? 95  LEU A HD13 5  
ATOM 8366  H HD21 . LEU A 1 95  ? 15.556  -0.976  -2.406  1.00 0.00 ? 95  LEU A HD21 5  
ATOM 8367  H HD22 . LEU A 1 95  ? 16.099  0.659   -1.958  1.00 0.00 ? 95  LEU A HD22 5  
ATOM 8368  H HD23 . LEU A 1 95  ? 16.759  -0.761  -1.112  1.00 0.00 ? 95  LEU A HD23 5  
ATOM 8369  N N    . ALA A 1 96  ? 12.866  1.182   1.220   1.00 0.00 ? 96  ALA A N    5  
ATOM 8370  C CA   . ALA A 1 96  ? 13.197  1.824   2.481   1.00 0.00 ? 96  ALA A CA   5  
ATOM 8371  C C    . ALA A 1 96  ? 12.029  1.659   3.455   1.00 0.00 ? 96  ALA A C    5  
ATOM 8372  O O    . ALA A 1 96  ? 12.196  1.815   4.663   1.00 0.00 ? 96  ALA A O    5  
ATOM 8373  C CB   . ALA A 1 96  ? 13.545  3.292   2.230   1.00 0.00 ? 96  ALA A CB   5  
ATOM 8374  H H    . ALA A 1 96  ? 12.923  1.774   0.417   1.00 0.00 ? 96  ALA A H    5  
ATOM 8375  H HA   . ALA A 1 96  ? 14.073  1.320   2.890   1.00 0.00 ? 96  ALA A HA   5  
ATOM 8376  H HB1  . ALA A 1 96  ? 14.334  3.601   2.915   1.00 0.00 ? 96  ALA A HB1  5  
ATOM 8377  H HB2  . ALA A 1 96  ? 13.887  3.414   1.202   1.00 0.00 ? 96  ALA A HB2  5  
ATOM 8378  H HB3  . ALA A 1 96  ? 12.661  3.908   2.394   1.00 0.00 ? 96  ALA A HB3  5  
ATOM 8379  N N    . HIS A 1 97  ? 10.871  1.346   2.892   1.00 0.00 ? 97  HIS A N    5  
ATOM 8380  C CA   . HIS A 1 97  ? 9.674   1.159   3.695   1.00 0.00 ? 97  HIS A CA   5  
ATOM 8381  C C    . HIS A 1 97  ? 9.012   -0.170  3.327   1.00 0.00 ? 97  HIS A C    5  
ATOM 8382  O O    . HIS A 1 97  ? 7.790   -0.248  3.213   1.00 0.00 ? 97  HIS A O    5  
ATOM 8383  C CB   . HIS A 1 97  ? 8.729   2.353   3.549   1.00 0.00 ? 97  HIS A CB   5  
ATOM 8384  C CG   . HIS A 1 97  ? 9.391   3.692   3.773   1.00 0.00 ? 97  HIS A CG   5  
ATOM 8385  N ND1  . HIS A 1 97  ? 9.696   4.175   5.033   1.00 0.00 ? 97  HIS A ND1  5  
ATOM 8386  C CD2  . HIS A 1 97  ? 9.804   4.642   2.885   1.00 0.00 ? 97  HIS A CD2  5  
ATOM 8387  C CE1  . HIS A 1 97  ? 10.266  5.364   4.898   1.00 0.00 ? 97  HIS A CE1  5  
ATOM 8388  N NE2  . HIS A 1 97  ? 10.331  5.652   3.567   1.00 0.00 ? 97  HIS A NE2  5  
ATOM 8389  H H    . HIS A 1 97  ? 10.743  1.221   1.908   1.00 0.00 ? 97  HIS A H    5  
ATOM 8390  H HA   . HIS A 1 97  ? 9.999   1.118   4.735   1.00 0.00 ? 97  HIS A HA   5  
ATOM 8391  H HB2  . HIS A 1 97  ? 8.293   2.338   2.550   1.00 0.00 ? 97  HIS A HB2  5  
ATOM 8392  H HB3  . HIS A 1 97  ? 7.908   2.243   4.257   1.00 0.00 ? 97  HIS A HB3  5  
ATOM 8393  H HD1  . HIS A 1 97  ? 9.517   3.707   5.899   1.00 0.00 ? 97  HIS A HD1  5  
ATOM 8394  H HD2  . HIS A 1 97  ? 9.716   4.582   1.801   1.00 0.00 ? 97  HIS A HD2  5  
ATOM 8395  H HE1  . HIS A 1 97  ? 10.620  6.001   5.709   1.00 0.00 ? 97  HIS A HE1  5  
ATOM 8396  N N    . ILE A 1 98  ? 9.848   -1.182  3.151   1.00 0.00 ? 98  ILE A N    5  
ATOM 8397  C CA   . ILE A 1 98  ? 9.359   -2.504  2.798   1.00 0.00 ? 98  ILE A CA   5  
ATOM 8398  C C    . ILE A 1 98  ? 9.191   -3.337  4.070   1.00 0.00 ? 98  ILE A C    5  
ATOM 8399  O O    . ILE A 1 98  ? 10.142  -3.518  4.829   1.00 0.00 ? 98  ILE A O    5  
ATOM 8400  C CB   . ILE A 1 98  ? 10.271  -3.152  1.754   1.00 0.00 ? 98  ILE A CB   5  
ATOM 8401  C CG1  . ILE A 1 98  ? 9.618   -4.399  1.154   1.00 0.00 ? 98  ILE A CG1  5  
ATOM 8402  C CG2  . ILE A 1 98  ? 11.650  -3.455  2.344   1.00 0.00 ? 98  ILE A CG2  5  
ATOM 8403  C CD1  . ILE A 1 98  ? 9.180   -4.147  -0.290  1.00 0.00 ? 98  ILE A CD1  5  
ATOM 8404  H H    . ILE A 1 98  ? 10.841  -1.110  3.245   1.00 0.00 ? 98  ILE A H    5  
ATOM 8405  H HA   . ILE A 1 98  ? 8.380   -2.378  2.336   1.00 0.00 ? 98  ILE A HA   5  
ATOM 8406  H HB   . ILE A 1 98  ? 10.418  -2.442  0.941   1.00 0.00 ? 98  ILE A HB   5  
ATOM 8407  H HG12 . ILE A 1 98  ? 10.321  -5.232  1.184   1.00 0.00 ? 98  ILE A HG12 5  
ATOM 8408  H HG13 . ILE A 1 98  ? 8.756   -4.687  1.755   1.00 0.00 ? 98  ILE A HG13 5  
ATOM 8409  H HG21 . ILE A 1 98  ? 11.862  -2.753  3.150   1.00 0.00 ? 98  ILE A HG21 5  
ATOM 8410  H HG22 . ILE A 1 98  ? 11.663  -4.472  2.735   1.00 0.00 ? 98  ILE A HG22 5  
ATOM 8411  H HG23 . ILE A 1 98  ? 12.408  -3.355  1.567   1.00 0.00 ? 98  ILE A HG23 5  
ATOM 8412  H HD11 . ILE A 1 98  ? 9.973   -3.624  -0.824  1.00 0.00 ? 98  ILE A HD11 5  
ATOM 8413  H HD12 . ILE A 1 98  ? 8.979   -5.100  -0.780  1.00 0.00 ? 98  ILE A HD12 5  
ATOM 8414  H HD13 . ILE A 1 98  ? 8.276   -3.538  -0.294  1.00 0.00 ? 98  ILE A HD13 5  
ATOM 8415  N N    . LEU A 1 99  ? 7.973   -3.824  4.264   1.00 0.00 ? 99  LEU A N    5  
ATOM 8416  C CA   . LEU A 1 99  ? 7.668   -4.633  5.431   1.00 0.00 ? 99  LEU A CA   5  
ATOM 8417  C C    . LEU A 1 99  ? 7.758   -6.114  5.057   1.00 0.00 ? 99  LEU A C    5  
ATOM 8418  O O    . LEU A 1 99  ? 7.853   -6.974  5.931   1.00 0.00 ? 99  LEU A O    5  
ATOM 8419  C CB   . LEU A 1 99  ? 6.317   -4.230  6.025   1.00 0.00 ? 99  LEU A CB   5  
ATOM 8420  C CG   . LEU A 1 99  ? 6.267   -2.861  6.707   1.00 0.00 ? 99  LEU A CG   5  
ATOM 8421  C CD1  . LEU A 1 99  ? 4.991   -2.709  7.538   1.00 0.00 ? 99  LEU A CD1  5  
ATOM 8422  C CD2  . LEU A 1 99  ? 7.526   -2.617  7.541   1.00 0.00 ? 99  LEU A CD2  5  
ATOM 8423  H H    . LEU A 1 99  ? 7.205   -3.672  3.642   1.00 0.00 ? 99  LEU A H    5  
ATOM 8424  H HA   . LEU A 1 99  ? 8.428   -4.421  6.184   1.00 0.00 ? 99  LEU A HA   5  
ATOM 8425  H HB2  . LEU A 1 99  ? 5.574   -4.244  5.229   1.00 0.00 ? 99  LEU A HB2  5  
ATOM 8426  H HB3  . LEU A 1 99  ? 6.022   -4.987  6.752   1.00 0.00 ? 99  LEU A HB3  5  
ATOM 8427  H HG   . LEU A 1 99  ? 6.240   -2.094  5.933   1.00 0.00 ? 99  LEU A HG   5  
ATOM 8428  H HD11 . LEU A 1 99  ? 4.256   -3.445  7.212   1.00 0.00 ? 99  LEU A HD11 5  
ATOM 8429  H HD12 . LEU A 1 99  ? 5.222   -2.869  8.591   1.00 0.00 ? 99  LEU A HD12 5  
ATOM 8430  H HD13 . LEU A 1 99  ? 4.587   -1.706  7.403   1.00 0.00 ? 99  LEU A HD13 5  
ATOM 8431  H HD21 . LEU A 1 99  ? 8.392   -2.552  6.882   1.00 0.00 ? 99  LEU A HD21 5  
ATOM 8432  H HD22 . LEU A 1 99  ? 7.420   -1.684  8.094   1.00 0.00 ? 99  LEU A HD22 5  
ATOM 8433  H HD23 . LEU A 1 99  ? 7.664   -3.441  8.241   1.00 0.00 ? 99  LEU A HD23 5  
ATOM 8434  N N    . SER A 1 100 ? 7.723   -6.366  3.756   1.00 0.00 ? 100 SER A N    5  
ATOM 8435  C CA   . SER A 1 100 ? 7.799   -7.728  3.255   1.00 0.00 ? 100 SER A CA   5  
ATOM 8436  C C    . SER A 1 100 ? 9.144   -7.956  2.562   1.00 0.00 ? 100 SER A C    5  
ATOM 8437  O O    . SER A 1 100 ? 9.994   -7.067  2.539   1.00 0.00 ? 100 SER A O    5  
ATOM 8438  C CB   . SER A 1 100 ? 6.648   -8.025  2.292   1.00 0.00 ? 100 SER A CB   5  
ATOM 8439  O OG   . SER A 1 100 ? 6.962   -7.649  0.954   1.00 0.00 ? 100 SER A OG   5  
ATOM 8440  H H    . SER A 1 100 ? 7.646   -5.660  3.052   1.00 0.00 ? 100 SER A H    5  
ATOM 8441  H HA   . SER A 1 100 ? 7.709   -8.364  4.136   1.00 0.00 ? 100 SER A HA   5  
ATOM 8442  H HB2  . SER A 1 100 ? 6.415   -9.089  2.325   1.00 0.00 ? 100 SER A HB2  5  
ATOM 8443  H HB3  . SER A 1 100 ? 5.755   -7.493  2.619   1.00 0.00 ? 100 SER A HB3  5  
ATOM 8444  H HG   . SER A 1 100 ? 6.121   -7.465  0.445   1.00 0.00 ? 100 SER A HG   5  
ATOM 8445  N N    . SER A 1 101 ? 9.295   -9.153  2.014   1.00 0.00 ? 101 SER A N    5  
ATOM 8446  C CA   . SER A 1 101 ? 10.522  -9.509  1.322   1.00 0.00 ? 101 SER A CA   5  
ATOM 8447  C C    . SER A 1 101 ? 10.246  -9.695  -0.171  1.00 0.00 ? 101 SER A C    5  
ATOM 8448  O O    . SER A 1 101 ? 11.170  -9.900  -0.956  1.00 0.00 ? 101 SER A O    5  
ATOM 8449  C CB   . SER A 1 101 ? 11.137  -10.781 1.911   1.00 0.00 ? 101 SER A CB   5  
ATOM 8450  O OG   . SER A 1 101 ? 12.490  -10.585 2.311   1.00 0.00 ? 101 SER A OG   5  
ATOM 8451  H H    . SER A 1 101 ? 8.599   -9.871  2.038   1.00 0.00 ? 101 SER A H    5  
ATOM 8452  H HA   . SER A 1 101 ? 11.199  -8.671  1.485   1.00 0.00 ? 101 SER A HA   5  
ATOM 8453  H HB2  . SER A 1 101 ? 10.548  -11.105 2.769   1.00 0.00 ? 101 SER A HB2  5  
ATOM 8454  H HB3  . SER A 1 101 ? 11.089  -11.582 1.173   1.00 0.00 ? 101 SER A HB3  5  
ATOM 8455  H HG   . SER A 1 101 ? 12.529  -10.345 3.281   1.00 0.00 ? 101 SER A HG   5  
ATOM 8456  N N    . TRP A 1 102 ? 8.970   -9.617  -0.518  1.00 0.00 ? 102 TRP A N    5  
ATOM 8457  C CA   . TRP A 1 102 ? 8.560   -9.774  -1.903  1.00 0.00 ? 102 TRP A CA   5  
ATOM 8458  C C    . TRP A 1 102 ? 8.106   -8.407  -2.420  1.00 0.00 ? 102 TRP A C    5  
ATOM 8459  O O    . TRP A 1 102 ? 8.393   -7.381  -1.805  1.00 0.00 ? 102 TRP A O    5  
ATOM 8460  C CB   . TRP A 1 102 ? 7.483   -10.852 -2.038  1.00 0.00 ? 102 TRP A CB   5  
ATOM 8461  C CG   . TRP A 1 102 ? 6.104   -10.420 -1.534  1.00 0.00 ? 102 TRP A CG   5  
ATOM 8462  C CD1  . TRP A 1 102 ? 5.131   -9.804  -2.220  1.00 0.00 ? 102 TRP A CD1  5  
ATOM 8463  C CD2  . TRP A 1 102 ? 5.581   -10.597 -0.201  1.00 0.00 ? 102 TRP A CD2  5  
ATOM 8464  N NE1  . TRP A 1 102 ? 4.024   -9.572  -1.429  1.00 0.00 ? 102 TRP A NE1  5  
ATOM 8465  C CE2  . TRP A 1 102 ? 4.306   -10.070 -0.163  1.00 0.00 ? 102 TRP A CE2  5  
ATOM 8466  C CE3  . TRP A 1 102 ? 6.166   -11.183 0.935   1.00 0.00 ? 102 TRP A CE3  5  
ATOM 8467  C CZ2  . TRP A 1 102 ? 3.508   -10.076 0.988   1.00 0.00 ? 102 TRP A CZ2  5  
ATOM 8468  C CZ3  . TRP A 1 102 ? 5.356   -11.182 2.077   1.00 0.00 ? 102 TRP A CZ3  5  
ATOM 8469  C CH2  . TRP A 1 102 ? 4.071   -10.655 2.132   1.00 0.00 ? 102 TRP A CH2  5  
ATOM 8470  H H    . TRP A 1 102 ? 8.224   -9.450  0.127   1.00 0.00 ? 102 TRP A H    5  
ATOM 8471  H HA   . TRP A 1 102 ? 9.426   -10.118 -2.470  1.00 0.00 ? 102 TRP A HA   5  
ATOM 8472  H HB2  . TRP A 1 102 ? 7.401   -11.141 -3.086  1.00 0.00 ? 102 TRP A HB2  5  
ATOM 8473  H HB3  . TRP A 1 102 ? 7.798   -11.737 -1.486  1.00 0.00 ? 102 TRP A HB3  5  
ATOM 8474  H HD1  . TRP A 1 102 ? 5.205   -9.522  -3.270  1.00 0.00 ? 102 TRP A HD1  5  
ATOM 8475  H HE1  . TRP A 1 102 ? 3.098   -9.089  -1.741  1.00 0.00 ? 102 TRP A HE1  5  
ATOM 8476  H HE3  . TRP A 1 102 ? 7.171   -11.606 0.930   1.00 0.00 ? 102 TRP A HE3  5  
ATOM 8477  H HZ2  . TRP A 1 102 ? 2.504   -9.654  0.992   1.00 0.00 ? 102 TRP A HZ2  5  
ATOM 8478  H HZ3  . TRP A 1 102 ? 5.761   -11.625 2.987   1.00 0.00 ? 102 TRP A HZ3  5  
ATOM 8479  H HH2  . TRP A 1 102 ? 3.503   -10.693 3.062   1.00 0.00 ? 102 TRP A HH2  5  
ATOM 8480  N N    . GLY A 1 103 ? 7.406   -8.438  -3.544  1.00 0.00 ? 103 GLY A N    5  
ATOM 8481  C CA   . GLY A 1 103 ? 6.910   -7.214  -4.150  1.00 0.00 ? 103 GLY A CA   5  
ATOM 8482  C C    . GLY A 1 103 ? 7.925   -6.643  -5.142  1.00 0.00 ? 103 GLY A C    5  
ATOM 8483  O O    . GLY A 1 103 ? 8.361   -5.501  -5.002  1.00 0.00 ? 103 GLY A O    5  
ATOM 8484  H H    . GLY A 1 103 ? 7.178   -9.277  -4.038  1.00 0.00 ? 103 GLY A H    5  
ATOM 8485  H HA2  . GLY A 1 103 ? 5.969   -7.413  -4.662  1.00 0.00 ? 103 GLY A HA2  5  
ATOM 8486  H HA3  . GLY A 1 103 ? 6.701   -6.478  -3.374  1.00 0.00 ? 103 GLY A HA3  5  
ATOM 8487  N N    . ALA A 1 104 ? 8.273   -7.463  -6.123  1.00 0.00 ? 104 ALA A N    5  
ATOM 8488  C CA   . ALA A 1 104 ? 9.229   -7.054  -7.138  1.00 0.00 ? 104 ALA A CA   5  
ATOM 8489  C C    . ALA A 1 104 ? 8.499   -6.848  -8.466  1.00 0.00 ? 104 ALA A C    5  
ATOM 8490  O O    . ALA A 1 104 ? 7.941   -7.792  -9.025  1.00 0.00 ? 104 ALA A O    5  
ATOM 8491  C CB   . ALA A 1 104 ? 10.343  -8.097  -7.240  1.00 0.00 ? 104 ALA A CB   5  
ATOM 8492  H H    . ALA A 1 104 ? 7.914   -8.390  -6.230  1.00 0.00 ? 104 ALA A H    5  
ATOM 8493  H HA   . ALA A 1 104 ? 9.663   -6.105  -6.821  1.00 0.00 ? 104 ALA A HA   5  
ATOM 8494  H HB1  . ALA A 1 104 ? 11.077  -7.923  -6.453  1.00 0.00 ? 104 ALA A HB1  5  
ATOM 8495  H HB2  . ALA A 1 104 ? 9.918   -9.094  -7.127  1.00 0.00 ? 104 ALA A HB2  5  
ATOM 8496  H HB3  . ALA A 1 104 ? 10.828  -8.016  -8.213  1.00 0.00 ? 104 ALA A HB3  5  
ATOM 8497  N N    . GLU A 1 105 ? 8.526   -5.609  -8.935  1.00 0.00 ? 105 GLU A N    5  
ATOM 8498  C CA   . GLU A 1 105 ? 7.873   -5.268  -10.187 1.00 0.00 ? 105 GLU A CA   5  
ATOM 8499  C C    . GLU A 1 105 ? 8.202   -3.826  -10.582 1.00 0.00 ? 105 GLU A C    5  
ATOM 8500  O O    . GLU A 1 105 ? 8.609   -3.026  -9.740  1.00 0.00 ? 105 GLU A O    5  
ATOM 8501  C CB   . GLU A 1 105 ? 6.361   -5.479  -10.093 1.00 0.00 ? 105 GLU A CB   5  
ATOM 8502  C CG   . GLU A 1 105 ? 5.959   -6.832  -10.683 1.00 0.00 ? 105 GLU A CG   5  
ATOM 8503  C CD   . GLU A 1 105 ? 4.930   -6.658  -11.802 1.00 0.00 ? 105 GLU A CD   5  
ATOM 8504  O OE1  . GLU A 1 105 ? 3.829   -6.155  -11.488 1.00 0.00 ? 105 GLU A OE1  5  
ATOM 8505  O OE2  . GLU A 1 105 ? 5.266   -7.033  -12.946 1.00 0.00 ? 105 GLU A OE2  5  
ATOM 8506  H H    . GLU A 1 105 ? 8.982   -4.847  -8.474  1.00 0.00 ? 105 GLU A H    5  
ATOM 8507  H HA   . GLU A 1 105 ? 8.285   -5.956  -10.925 1.00 0.00 ? 105 GLU A HA   5  
ATOM 8508  H HB2  . GLU A 1 105 ? 6.047   -5.424  -9.051  1.00 0.00 ? 105 GLU A HB2  5  
ATOM 8509  H HB3  . GLU A 1 105 ? 5.845   -4.679  -10.624 1.00 0.00 ? 105 GLU A HB3  5  
ATOM 8510  H HG2  . GLU A 1 105 ? 6.841   -7.340  -11.071 1.00 0.00 ? 105 GLU A HG2  5  
ATOM 8511  H HG3  . GLU A 1 105 ? 5.545   -7.466  -9.899  1.00 0.00 ? 105 GLU A HG3  5  
ATOM 8512  N N    . VAL A 1 106 ? 8.015   -3.539  -11.861 1.00 0.00 ? 106 VAL A N    5  
ATOM 8513  C CA   . VAL A 1 106 ? 8.286   -2.208  -12.377 1.00 0.00 ? 106 VAL A CA   5  
ATOM 8514  C C    . VAL A 1 106 ? 7.029   -1.664  -13.059 1.00 0.00 ? 106 VAL A C    5  
ATOM 8515  O O    . VAL A 1 106 ? 6.850   -1.831  -14.264 1.00 0.00 ? 106 VAL A O    5  
ATOM 8516  C CB   . VAL A 1 106 ? 9.502   -2.245  -13.306 1.00 0.00 ? 106 VAL A CB   5  
ATOM 8517  C CG1  . VAL A 1 106 ? 9.661   -0.919  -14.053 1.00 0.00 ? 106 VAL A CG1  5  
ATOM 8518  C CG2  . VAL A 1 106 ? 10.773  -2.595  -12.531 1.00 0.00 ? 106 VAL A CG2  5  
ATOM 8519  H H    . VAL A 1 106 ? 7.684   -4.196  -12.539 1.00 0.00 ? 106 VAL A H    5  
ATOM 8520  H HA   . VAL A 1 106 ? 8.530   -1.570  -11.528 1.00 0.00 ? 106 VAL A HA   5  
ATOM 8521  H HB   . VAL A 1 106 ? 9.334   -3.028  -14.046 1.00 0.00 ? 106 VAL A HB   5  
ATOM 8522  H HG11 . VAL A 1 106 ? 8.980   -0.897  -14.903 1.00 0.00 ? 106 VAL A HG11 5  
ATOM 8523  H HG12 . VAL A 1 106 ? 9.430   -0.093  -13.380 1.00 0.00 ? 106 VAL A HG12 5  
ATOM 8524  H HG13 . VAL A 1 106 ? 10.688  -0.823  -14.407 1.00 0.00 ? 106 VAL A HG13 5  
ATOM 8525  H HG21 . VAL A 1 106 ? 11.590  -1.956  -12.867 1.00 0.00 ? 106 VAL A HG21 5  
ATOM 8526  H HG22 . VAL A 1 106 ? 10.604  -2.439  -11.466 1.00 0.00 ? 106 VAL A HG22 5  
ATOM 8527  H HG23 . VAL A 1 106 ? 11.032  -3.639  -12.709 1.00 0.00 ? 106 VAL A HG23 5  
ATOM 8528  N N    . LYS A 1 107 ? 6.191   -1.023  -12.257 1.00 0.00 ? 107 LYS A N    5  
ATOM 8529  C CA   . LYS A 1 107 ? 4.956   -0.453  -12.768 1.00 0.00 ? 107 LYS A CA   5  
ATOM 8530  C C    . LYS A 1 107 ? 5.255   0.347   -14.038 1.00 0.00 ? 107 LYS A C    5  
ATOM 8531  O O    . LYS A 1 107 ? 6.416   0.566   -14.378 1.00 0.00 ? 107 LYS A O    5  
ATOM 8532  C CB   . LYS A 1 107 ? 4.251   0.360   -11.681 1.00 0.00 ? 107 LYS A CB   5  
ATOM 8533  C CG   . LYS A 1 107 ? 5.012   1.654   -11.383 1.00 0.00 ? 107 LYS A CG   5  
ATOM 8534  C CD   . LYS A 1 107 ? 5.487   1.689   -9.930  1.00 0.00 ? 107 LYS A CD   5  
ATOM 8535  C CE   . LYS A 1 107 ? 6.977   2.026   -9.848  1.00 0.00 ? 107 LYS A CE   5  
ATOM 8536  N NZ   . LYS A 1 107 ? 7.218   3.067   -8.824  1.00 0.00 ? 107 LYS A NZ   5  
ATOM 8537  H H    . LYS A 1 107 ? 6.343   -0.892  -11.278 1.00 0.00 ? 107 LYS A H    5  
ATOM 8538  H HA   . LYS A 1 107 ? 4.297   -1.282  -13.029 1.00 0.00 ? 107 LYS A HA   5  
ATOM 8539  H HB2  . LYS A 1 107 ? 3.235   0.596   -11.998 1.00 0.00 ? 107 LYS A HB2  5  
ATOM 8540  H HB3  . LYS A 1 107 ? 4.170   -0.235  -10.771 1.00 0.00 ? 107 LYS A HB3  5  
ATOM 8541  H HG2  . LYS A 1 107 ? 5.869   1.737   -12.052 1.00 0.00 ? 107 LYS A HG2  5  
ATOM 8542  H HG3  . LYS A 1 107 ? 4.369   2.511   -11.581 1.00 0.00 ? 107 LYS A HG3  5  
ATOM 8543  H HD2  . LYS A 1 107 ? 4.912   2.429   -9.373  1.00 0.00 ? 107 LYS A HD2  5  
ATOM 8544  H HD3  . LYS A 1 107 ? 5.302   0.723   -9.459  1.00 0.00 ? 107 LYS A HD3  5  
ATOM 8545  H HE2  . LYS A 1 107 ? 7.546   1.128   -9.603  1.00 0.00 ? 107 LYS A HE2  5  
ATOM 8546  H HE3  . LYS A 1 107 ? 7.331   2.373   -10.818 1.00 0.00 ? 107 LYS A HE3  5  
ATOM 8547  H HZ1  . LYS A 1 107 ? 6.837   2.769   -7.949  1.00 0.00 ? 107 LYS A HZ1  5  
ATOM 8548  H HZ2  . LYS A 1 107 ? 8.202   3.217   -8.725  1.00 0.00 ? 107 LYS A HZ2  5  
ATOM 8549  H HZ3  . LYS A 1 107 ? 6.777   3.920   -9.106  1.00 0.00 ? 107 LYS A HZ3  5  
ATOM 8550  N N    . SER A 1 108 ? 4.187   0.761   -14.703 1.00 0.00 ? 108 SER A N    5  
ATOM 8551  C CA   . SER A 1 108 ? 4.320   1.532   -15.927 1.00 0.00 ? 108 SER A CA   5  
ATOM 8552  C C    . SER A 1 108 ? 2.999   2.230   -16.253 1.00 0.00 ? 108 SER A C    5  
ATOM 8553  O O    . SER A 1 108 ? 2.194   1.714   -17.027 1.00 0.00 ? 108 SER A O    5  
ATOM 8554  C CB   . SER A 1 108 ? 4.752   0.641   -17.095 1.00 0.00 ? 108 SER A CB   5  
ATOM 8555  O OG   . SER A 1 108 ? 3.735   -0.288  -17.461 1.00 0.00 ? 108 SER A OG   5  
ATOM 8556  H H    . SER A 1 108 ? 3.245   0.578   -14.419 1.00 0.00 ? 108 SER A H    5  
ATOM 8557  H HA   . SER A 1 108 ? 5.100   2.265   -15.723 1.00 0.00 ? 108 SER A HA   5  
ATOM 8558  H HB2  . SER A 1 108 ? 5.000   1.265   -17.954 1.00 0.00 ? 108 SER A HB2  5  
ATOM 8559  H HB3  . SER A 1 108 ? 5.657   0.099   -16.822 1.00 0.00 ? 108 SER A HB3  5  
ATOM 8560  H HG   . SER A 1 108 ? 4.021   -1.217  -17.228 1.00 0.00 ? 108 SER A HG   5  
ATOM 8561  N N    . GLY A 1 109 ? 2.815   3.393   -15.645 1.00 0.00 ? 109 GLY A N    5  
ATOM 8562  C CA   . GLY A 1 109 ? 1.605   4.168   -15.861 1.00 0.00 ? 109 GLY A CA   5  
ATOM 8563  C C    . GLY A 1 109 ? 1.884   5.388   -16.740 1.00 0.00 ? 109 GLY A C    5  
ATOM 8564  O O    . GLY A 1 109 ? 3.022   5.848   -16.828 1.00 0.00 ? 109 GLY A O    5  
ATOM 8565  H H    . GLY A 1 109 ? 3.475   3.806   -15.017 1.00 0.00 ? 109 GLY A H    5  
ATOM 8566  H HA2  . GLY A 1 109 ? 0.847   3.542   -16.332 1.00 0.00 ? 109 GLY A HA2  5  
ATOM 8567  H HA3  . GLY A 1 109 ? 1.200   4.491   -14.902 1.00 0.00 ? 109 GLY A HA3  5  
ATOM 8568  N N    . PRO A 1 110 ? 0.799   5.892   -17.386 1.00 0.00 ? 110 PRO A N    5  
ATOM 8569  C CA   . PRO A 1 110 ? 0.916   7.050   -18.255 1.00 0.00 ? 110 PRO A CA   5  
ATOM 8570  C C    . PRO A 1 110 ? 1.069   8.335   -17.439 1.00 0.00 ? 110 PRO A C    5  
ATOM 8571  O O    . PRO A 1 110 ? 0.306   8.577   -16.506 1.00 0.00 ? 110 PRO A O    5  
ATOM 8572  C CB   . PRO A 1 110 ? -0.344  7.034   -19.105 1.00 0.00 ? 110 PRO A CB   5  
ATOM 8573  C CG   . PRO A 1 110 ? -1.332  6.144   -18.368 1.00 0.00 ? 110 PRO A CG   5  
ATOM 8574  C CD   . PRO A 1 110 ? -0.564  5.374   -17.307 1.00 0.00 ? 110 PRO A CD   5  
ATOM 8575  H HA   . PRO A 1 110 ? 1.742   6.982   -18.815 1.00 0.00 ? 110 PRO A HA   5  
ATOM 8576  H HB2  . PRO A 1 110 ? -0.744  8.040   -19.232 1.00 0.00 ? 110 PRO A HB2  5  
ATOM 8577  H HB3  . PRO A 1 110 ? -0.138  6.645   -20.103 1.00 0.00 ? 110 PRO A HB3  5  
ATOM 8578  H HG2  . PRO A 1 110 ? -2.119  6.744   -17.911 1.00 0.00 ? 110 PRO A HG2  5  
ATOM 8579  H HG3  . PRO A 1 110 ? -1.818  5.457   -19.062 1.00 0.00 ? 110 PRO A HG3  5  
ATOM 8580  H HD2  . PRO A 1 110 ? -0.990  5.532   -16.316 1.00 0.00 ? 110 PRO A HD2  5  
ATOM 8581  H HD3  . PRO A 1 110 ? -0.591  4.301   -17.498 1.00 0.00 ? 110 PRO A HD3  5  
ATOM 8582  N N    . SER A 1 111 ? 2.061   9.126   -17.821 1.00 0.00 ? 111 SER A N    5  
ATOM 8583  C CA   . SER A 1 111 ? 2.325   10.380  -17.136 1.00 0.00 ? 111 SER A CA   5  
ATOM 8584  C C    . SER A 1 111 ? 2.414   11.522  -18.150 1.00 0.00 ? 111 SER A C    5  
ATOM 8585  O O    . SER A 1 111 ? 3.418   11.660  -18.847 1.00 0.00 ? 111 SER A O    5  
ATOM 8586  C CB   . SER A 1 111 ? 3.612   10.299  -16.313 1.00 0.00 ? 111 SER A CB   5  
ATOM 8587  O OG   . SER A 1 111 ? 4.775   10.357  -17.135 1.00 0.00 ? 111 SER A OG   5  
ATOM 8588  H H    . SER A 1 111 ? 2.678   8.922   -18.581 1.00 0.00 ? 111 SER A H    5  
ATOM 8589  H HA   . SER A 1 111 ? 1.476   10.528  -16.468 1.00 0.00 ? 111 SER A HA   5  
ATOM 8590  H HB2  . SER A 1 111 ? 3.635   11.118  -15.594 1.00 0.00 ? 111 SER A HB2  5  
ATOM 8591  H HB3  . SER A 1 111 ? 3.619   9.371   -15.740 1.00 0.00 ? 111 SER A HB3  5  
ATOM 8592  H HG   . SER A 1 111 ? 4.828   9.541   -17.710 1.00 0.00 ? 111 SER A HG   5  
ATOM 8593  N N    . SER A 1 112 ? 1.351   12.311  -18.201 1.00 0.00 ? 112 SER A N    5  
ATOM 8594  C CA   . SER A 1 112 ? 1.297   13.436  -19.118 1.00 0.00 ? 112 SER A CA   5  
ATOM 8595  C C    . SER A 1 112 ? 2.659   14.132  -19.173 1.00 0.00 ? 112 SER A C    5  
ATOM 8596  O O    . SER A 1 112 ? 3.354   14.224  -18.163 1.00 0.00 ? 112 SER A O    5  
ATOM 8597  C CB   . SER A 1 112 ? 0.209   14.430  -18.708 1.00 0.00 ? 112 SER A CB   5  
ATOM 8598  O OG   . SER A 1 112 ? -0.233  15.222  -19.806 1.00 0.00 ? 112 SER A OG   5  
ATOM 8599  H H    . SER A 1 112 ? 0.539   12.191  -17.630 1.00 0.00 ? 112 SER A H    5  
ATOM 8600  H HA   . SER A 1 112 ? 1.048   13.006  -20.088 1.00 0.00 ? 112 SER A HA   5  
ATOM 8601  H HB2  . SER A 1 112 ? -0.638  13.887  -18.288 1.00 0.00 ? 112 SER A HB2  5  
ATOM 8602  H HB3  . SER A 1 112 ? 0.591   15.081  -17.921 1.00 0.00 ? 112 SER A HB3  5  
ATOM 8603  H HG   . SER A 1 112 ? 0.514   15.802  -20.133 1.00 0.00 ? 112 SER A HG   5  
ATOM 8604  N N    . GLY A 1 113 ? 2.998   14.605  -20.364 1.00 0.00 ? 113 GLY A N    5  
ATOM 8605  C CA   . GLY A 1 113 ? 4.264   15.290  -20.563 1.00 0.00 ? 113 GLY A CA   5  
ATOM 8606  C C    . GLY A 1 113 ? 4.312   16.596  -19.768 1.00 0.00 ? 113 GLY A C    5  
ATOM 8607  O O    . GLY A 1 113 ? 3.398   16.894  -19.000 1.00 0.00 ? 113 GLY A O    5  
ATOM 8608  H H    . GLY A 1 113 ? 2.426   14.526  -21.180 1.00 0.00 ? 113 GLY A H    5  
ATOM 8609  H HA2  . GLY A 1 113 ? 5.084   14.642  -20.256 1.00 0.00 ? 113 GLY A HA2  5  
ATOM 8610  H HA3  . GLY A 1 113 ? 4.404   15.500  -21.624 1.00 0.00 ? 113 GLY A HA3  5  
ATOM 8611  N N    . GLY A 1 1   ? -4.665  14.101  -26.065 1.00 0.00 ? 1   GLY A N    6  
ATOM 8612  C CA   . GLY A 1 1   ? -4.683  14.754  -27.363 1.00 0.00 ? 1   GLY A CA   6  
ATOM 8613  C C    . GLY A 1 1   ? -4.034  16.138  -27.289 1.00 0.00 ? 1   GLY A C    6  
ATOM 8614  O O    . GLY A 1 1   ? -2.925  16.335  -27.783 1.00 0.00 ? 1   GLY A O    6  
ATOM 8615  H H1   . GLY A 1 1   ? -5.548  14.070  -25.596 1.00 0.00 ? 1   GLY A H1   6  
ATOM 8616  H HA2  . GLY A 1 1   ? -4.153  14.139  -28.091 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8617  H HA3  . GLY A 1 1   ? -5.711  14.848  -27.713 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8618  N N    . SER A 1 2   ? -4.754  17.061  -26.668 1.00 0.00 ? 2   SER A N    6  
ATOM 8619  C CA   . SER A 1 2   ? -4.262  18.421  -26.523 1.00 0.00 ? 2   SER A CA   6  
ATOM 8620  C C    . SER A 1 2   ? -4.035  18.740  -25.045 1.00 0.00 ? 2   SER A C    6  
ATOM 8621  O O    . SER A 1 2   ? -4.874  18.425  -24.202 1.00 0.00 ? 2   SER A O    6  
ATOM 8622  C CB   . SER A 1 2   ? -5.236  19.427  -27.140 1.00 0.00 ? 2   SER A CB   6  
ATOM 8623  O OG   . SER A 1 2   ? -5.221  19.381  -28.564 1.00 0.00 ? 2   SER A OG   6  
ATOM 8624  H H    . SER A 1 2   ? -5.655  16.893  -26.269 1.00 0.00 ? 2   SER A H    6  
ATOM 8625  H HA   . SER A 1 2   ? -3.320  18.447  -27.070 1.00 0.00 ? 2   SER A HA   6  
ATOM 8626  H HB2  . SER A 1 2   ? -6.245  19.222  -26.782 1.00 0.00 ? 2   SER A HB2  6  
ATOM 8627  H HB3  . SER A 1 2   ? -4.978  20.432  -26.807 1.00 0.00 ? 2   SER A HB3  6  
ATOM 8628  H HG   . SER A 1 2   ? -5.754  18.599  -28.887 1.00 0.00 ? 2   SER A HG   6  
ATOM 8629  N N    . SER A 1 3   ? -2.897  19.362  -24.775 1.00 0.00 ? 3   SER A N    6  
ATOM 8630  C CA   . SER A 1 3   ? -2.549  19.727  -23.412 1.00 0.00 ? 3   SER A CA   6  
ATOM 8631  C C    . SER A 1 3   ? -2.385  18.469  -22.558 1.00 0.00 ? 3   SER A C    6  
ATOM 8632  O O    . SER A 1 3   ? -2.937  17.418  -22.882 1.00 0.00 ? 3   SER A O    6  
ATOM 8633  C CB   . SER A 1 3   ? -3.606  20.649  -22.802 1.00 0.00 ? 3   SER A CB   6  
ATOM 8634  O OG   . SER A 1 3   ? -3.285  22.025  -22.985 1.00 0.00 ? 3   SER A OG   6  
ATOM 8635  H H    . SER A 1 3   ? -2.220  19.614  -25.466 1.00 0.00 ? 3   SER A H    6  
ATOM 8636  H HA   . SER A 1 3   ? -1.602  20.262  -23.490 1.00 0.00 ? 3   SER A HA   6  
ATOM 8637  H HB2  . SER A 1 3   ? -4.575  20.440  -23.256 1.00 0.00 ? 3   SER A HB2  6  
ATOM 8638  H HB3  . SER A 1 3   ? -3.701  20.438  -21.737 1.00 0.00 ? 3   SER A HB3  6  
ATOM 8639  H HG   . SER A 1 3   ? -3.905  22.436  -23.654 1.00 0.00 ? 3   SER A HG   6  
ATOM 8640  N N    . GLY A 1 4   ? -1.625  18.616  -21.483 1.00 0.00 ? 4   GLY A N    6  
ATOM 8641  C CA   . GLY A 1 4   ? -1.382  17.504  -20.580 1.00 0.00 ? 4   GLY A CA   6  
ATOM 8642  C C    . GLY A 1 4   ? 0.077   17.478  -20.121 1.00 0.00 ? 4   GLY A C    6  
ATOM 8643  O O    . GLY A 1 4   ? 0.964   17.095  -20.883 1.00 0.00 ? 4   GLY A O    6  
ATOM 8644  H H    . GLY A 1 4   ? -1.180  19.474  -21.226 1.00 0.00 ? 4   GLY A H    6  
ATOM 8645  H HA2  . GLY A 1 4   ? -2.038  17.585  -19.713 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8646  H HA3  . GLY A 1 4   ? -1.627  16.566  -21.078 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8647  N N    . SER A 1 5   ? 0.281   17.891  -18.879 1.00 0.00 ? 5   SER A N    6  
ATOM 8648  C CA   . SER A 1 5   ? 1.618   17.920  -18.310 1.00 0.00 ? 5   SER A CA   6  
ATOM 8649  C C    . SER A 1 5   ? 1.576   18.528  -16.907 1.00 0.00 ? 5   SER A C    6  
ATOM 8650  O O    . SER A 1 5   ? 1.326   19.722  -16.750 1.00 0.00 ? 5   SER A O    6  
ATOM 8651  C CB   . SER A 1 5   ? 2.579   18.709  -19.202 1.00 0.00 ? 5   SER A CB   6  
ATOM 8652  O OG   . SER A 1 5   ? 3.796   18.005  -19.429 1.00 0.00 ? 5   SER A OG   6  
ATOM 8653  H H    . SER A 1 5   ? -0.446  18.201  -18.266 1.00 0.00 ? 5   SER A H    6  
ATOM 8654  H HA   . SER A 1 5   ? 1.936   16.879  -18.267 1.00 0.00 ? 5   SER A HA   6  
ATOM 8655  H HB2  . SER A 1 5   ? 2.098   18.919  -20.157 1.00 0.00 ? 5   SER A HB2  6  
ATOM 8656  H HB3  . SER A 1 5   ? 2.797   19.671  -18.737 1.00 0.00 ? 5   SER A HB3  6  
ATOM 8657  H HG   . SER A 1 5   ? 4.464   18.238  -18.721 1.00 0.00 ? 5   SER A HG   6  
ATOM 8658  N N    . SER A 1 6   ? 1.825   17.678  -15.921 1.00 0.00 ? 6   SER A N    6  
ATOM 8659  C CA   . SER A 1 6   ? 1.819   18.117  -14.536 1.00 0.00 ? 6   SER A CA   6  
ATOM 8660  C C    . SER A 1 6   ? 2.540   17.091  -13.659 1.00 0.00 ? 6   SER A C    6  
ATOM 8661  O O    . SER A 1 6   ? 2.745   15.951  -14.072 1.00 0.00 ? 6   SER A O    6  
ATOM 8662  C CB   . SER A 1 6   ? 0.390   18.333  -14.033 1.00 0.00 ? 6   SER A CB   6  
ATOM 8663  O OG   . SER A 1 6   ? -0.303  19.313  -14.800 1.00 0.00 ? 6   SER A OG   6  
ATOM 8664  H H    . SER A 1 6   ? 2.028   16.708  -16.056 1.00 0.00 ? 6   SER A H    6  
ATOM 8665  H HA   . SER A 1 6   ? 2.353   19.067  -14.531 1.00 0.00 ? 6   SER A HA   6  
ATOM 8666  H HB2  . SER A 1 6   ? -0.155  17.390  -14.072 1.00 0.00 ? 6   SER A HB2  6  
ATOM 8667  H HB3  . SER A 1 6   ? 0.417   18.643  -12.988 1.00 0.00 ? 6   SER A HB3  6  
ATOM 8668  H HG   . SER A 1 6   ? -0.903  18.867  -15.464 1.00 0.00 ? 6   SER A HG   6  
ATOM 8669  N N    . GLY A 1 7   ? 2.906   17.534  -12.465 1.00 0.00 ? 7   GLY A N    6  
ATOM 8670  C CA   . GLY A 1 7   ? 3.600   16.668  -11.526 1.00 0.00 ? 7   GLY A CA   6  
ATOM 8671  C C    . GLY A 1 7   ? 2.694   16.294  -10.352 1.00 0.00 ? 7   GLY A C    6  
ATOM 8672  O O    . GLY A 1 7   ? 1.472   16.271  -10.489 1.00 0.00 ? 7   GLY A O    6  
ATOM 8673  H H    . GLY A 1 7   ? 2.735   18.463  -12.136 1.00 0.00 ? 7   GLY A H    6  
ATOM 8674  H HA2  . GLY A 1 7   ? 3.932   15.764  -12.037 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8675  H HA3  . GLY A 1 7   ? 4.493   17.171  -11.155 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8676  N N    . ASP A 1 8   ? 3.328   16.010  -9.224  1.00 0.00 ? 8   ASP A N    6  
ATOM 8677  C CA   . ASP A 1 8   ? 2.594   15.637  -8.026  1.00 0.00 ? 8   ASP A CA   6  
ATOM 8678  C C    . ASP A 1 8   ? 1.858   14.319  -8.274  1.00 0.00 ? 8   ASP A C    6  
ATOM 8679  O O    . ASP A 1 8   ? 1.859   13.803  -9.390  1.00 0.00 ? 8   ASP A O    6  
ATOM 8680  C CB   . ASP A 1 8   ? 1.553   16.699  -7.666  1.00 0.00 ? 8   ASP A CB   6  
ATOM 8681  C CG   . ASP A 1 8   ? 2.047   18.145  -7.754  1.00 0.00 ? 8   ASP A CG   6  
ATOM 8682  O OD1  . ASP A 1 8   ? 2.075   18.667  -8.889  1.00 0.00 ? 8   ASP A OD1  6  
ATOM 8683  O OD2  . ASP A 1 8   ? 2.385   18.695  -6.684  1.00 0.00 ? 8   ASP A OD2  6  
ATOM 8684  H H    . ASP A 1 8   ? 4.322   16.031  -9.120  1.00 0.00 ? 8   ASP A H    6  
ATOM 8685  H HA   . ASP A 1 8   ? 3.347   15.554  -7.243  1.00 0.00 ? 8   ASP A HA   6  
ATOM 8686  H HB2  . ASP A 1 8   ? 0.694   16.584  -8.326  1.00 0.00 ? 8   ASP A HB2  6  
ATOM 8687  H HB3  . ASP A 1 8   ? 1.202   16.512  -6.651  1.00 0.00 ? 8   ASP A HB3  6  
ATOM 8688  N N    . LYS A 1 9   ? 1.247   13.812  -7.213  1.00 0.00 ? 9   LYS A N    6  
ATOM 8689  C CA   . LYS A 1 9   ? 0.508   12.563  -7.301  1.00 0.00 ? 9   LYS A CA   6  
ATOM 8690  C C    . LYS A 1 9   ? 1.490   11.409  -7.514  1.00 0.00 ? 9   LYS A C    6  
ATOM 8691  O O    . LYS A 1 9   ? 1.667   10.939  -8.636  1.00 0.00 ? 9   LYS A O    6  
ATOM 8692  C CB   . LYS A 1 9   ? -0.574  12.656  -8.379  1.00 0.00 ? 9   LYS A CB   6  
ATOM 8693  C CG   . LYS A 1 9   ? -1.349  13.970  -8.266  1.00 0.00 ? 9   LYS A CG   6  
ATOM 8694  C CD   . LYS A 1 9   ? -2.854  13.734  -8.415  1.00 0.00 ? 9   LYS A CD   6  
ATOM 8695  C CE   . LYS A 1 9   ? -3.419  14.529  -9.594  1.00 0.00 ? 9   LYS A CE   6  
ATOM 8696  N NZ   . LYS A 1 9   ? -4.897  14.566  -9.532  1.00 0.00 ? 9   LYS A NZ   6  
ATOM 8697  H H    . LYS A 1 9   ? 1.250   14.237  -6.309  1.00 0.00 ? 9   LYS A H    6  
ATOM 8698  H HA   . LYS A 1 9   ? 0.002   12.415  -6.348  1.00 0.00 ? 9   LYS A HA   6  
ATOM 8699  H HB2  . LYS A 1 9   ? -0.118  12.582  -9.366  1.00 0.00 ? 9   LYS A HB2  6  
ATOM 8700  H HB3  . LYS A 1 9   ? -1.261  11.815  -8.282  1.00 0.00 ? 9   LYS A HB3  6  
ATOM 8701  H HG2  . LYS A 1 9   ? -1.144  14.435  -7.302  1.00 0.00 ? 9   LYS A HG2  6  
ATOM 8702  H HG3  . LYS A 1 9   ? -1.008  14.664  -9.034  1.00 0.00 ? 9   LYS A HG3  6  
ATOM 8703  H HD2  . LYS A 1 9   ? -3.046  12.671  -8.562  1.00 0.00 ? 9   LYS A HD2  6  
ATOM 8704  H HD3  . LYS A 1 9   ? -3.364  14.026  -7.497  1.00 0.00 ? 9   LYS A HD3  6  
ATOM 8705  H HE2  . LYS A 1 9   ? -3.023  15.544  -9.579  1.00 0.00 ? 9   LYS A HE2  6  
ATOM 8706  H HE3  . LYS A 1 9   ? -3.099  14.076  -10.532 1.00 0.00 ? 9   LYS A HE3  6  
ATOM 8707  H HZ1  . LYS A 1 9   ? -5.265  14.734  -10.447 1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 8708  H HZ2  . LYS A 1 9   ? -5.239  13.690  -9.192  1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 8709  H HZ3  . LYS A 1 9   ? -5.187  15.299  -8.917  1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 8710  N N    . PRO A 1 10  ? 2.118   10.975  -6.389  1.00 0.00 ? 10  PRO A N    6  
ATOM 8711  C CA   . PRO A 1 10  ? 3.078   9.884   -6.441  1.00 0.00 ? 10  PRO A CA   6  
ATOM 8712  C C    . PRO A 1 10  ? 2.369   8.538   -6.606  1.00 0.00 ? 10  PRO A C    6  
ATOM 8713  O O    . PRO A 1 10  ? 3.000   7.539   -6.947  1.00 0.00 ? 10  PRO A O    6  
ATOM 8714  C CB   . PRO A 1 10  ? 3.861   9.988   -5.142  1.00 0.00 ? 10  PRO A CB   6  
ATOM 8715  C CG   . PRO A 1 10  ? 3.011   10.835  -4.209  1.00 0.00 ? 10  PRO A CG   6  
ATOM 8716  C CD   . PRO A 1 10  ? 1.933   11.508  -5.042  1.00 0.00 ? 10  PRO A CD   6  
ATOM 8717  H HA   . PRO A 1 10  ? 3.670   9.981   -7.240  1.00 0.00 ? 10  PRO A HA   6  
ATOM 8718  H HB2  . PRO A 1 10  ? 4.043   9.001   -4.717  1.00 0.00 ? 10  PRO A HB2  6  
ATOM 8719  H HB3  . PRO A 1 10  ? 4.835   10.447  -5.309  1.00 0.00 ? 10  PRO A HB3  6  
ATOM 8720  H HG2  . PRO A 1 10  ? 2.563   10.214  -3.433  1.00 0.00 ? 10  PRO A HG2  6  
ATOM 8721  H HG3  . PRO A 1 10  ? 3.626   11.581  -3.705  1.00 0.00 ? 10  PRO A HG3  6  
ATOM 8722  H HD2  . PRO A 1 10  ? 0.938   11.281  -4.660  1.00 0.00 ? 10  PRO A HD2  6  
ATOM 8723  H HD3  . PRO A 1 10  ? 2.041   12.592  -5.028  1.00 0.00 ? 10  PRO A HD3  6  
ATOM 8724  N N    . LEU A 1 11  ? 1.068   8.556   -6.357  1.00 0.00 ? 11  LEU A N    6  
ATOM 8725  C CA   . LEU A 1 11  ? 0.267   7.349   -6.474  1.00 0.00 ? 11  LEU A CA   6  
ATOM 8726  C C    . LEU A 1 11  ? -0.652  7.469   -7.692  1.00 0.00 ? 11  LEU A C    6  
ATOM 8727  O O    . LEU A 1 11  ? -1.200  6.472   -8.161  1.00 0.00 ? 11  LEU A O    6  
ATOM 8728  C CB   . LEU A 1 11  ? -0.477  7.071   -5.167  1.00 0.00 ? 11  LEU A CB   6  
ATOM 8729  C CG   . LEU A 1 11  ? 0.368   7.115   -3.892  1.00 0.00 ? 11  LEU A CG   6  
ATOM 8730  C CD1  . LEU A 1 11  ? -0.493  6.853   -2.655  1.00 0.00 ? 11  LEU A CD1  6  
ATOM 8731  C CD2  . LEU A 1 11  ? 1.549   6.147   -3.984  1.00 0.00 ? 11  LEU A CD2  6  
ATOM 8732  H H    . LEU A 1 11  ? 0.563   9.373   -6.081  1.00 0.00 ? 11  LEU A H    6  
ATOM 8733  H HA   . LEU A 1 11  ? 0.952   6.517   -6.639  1.00 0.00 ? 11  LEU A HA   6  
ATOM 8734  H HB2  . LEU A 1 11  ? -1.284  7.797   -5.070  1.00 0.00 ? 11  LEU A HB2  6  
ATOM 8735  H HB3  . LEU A 1 11  ? -0.941  6.087   -5.238  1.00 0.00 ? 11  LEU A HB3  6  
ATOM 8736  H HG   . LEU A 1 11  ? 0.781   8.118   -3.790  1.00 0.00 ? 11  LEU A HG   6  
ATOM 8737  H HD11 . LEU A 1 11  ? 0.119   6.954   -1.758  1.00 0.00 ? 11  LEU A HD11 6  
ATOM 8738  H HD12 . LEU A 1 11  ? -1.309  7.574   -2.621  1.00 0.00 ? 11  LEU A HD12 6  
ATOM 8739  H HD13 . LEU A 1 11  ? -0.902  5.843   -2.704  1.00 0.00 ? 11  LEU A HD13 6  
ATOM 8740  H HD21 . LEU A 1 11  ? 1.435   5.517   -4.866  1.00 0.00 ? 11  LEU A HD21 6  
ATOM 8741  H HD22 . LEU A 1 11  ? 2.478   6.713   -4.059  1.00 0.00 ? 11  LEU A HD22 6  
ATOM 8742  H HD23 . LEU A 1 11  ? 1.576   5.521   -3.092  1.00 0.00 ? 11  LEU A HD23 6  
ATOM 8743  N N    . SER A 1 12  ? -0.793  8.697   -8.169  1.00 0.00 ? 12  SER A N    6  
ATOM 8744  C CA   . SER A 1 12  ? -1.636  8.959   -9.323  1.00 0.00 ? 12  SER A CA   6  
ATOM 8745  C C    . SER A 1 12  ? -1.619  7.756   -10.268 1.00 0.00 ? 12  SER A C    6  
ATOM 8746  O O    . SER A 1 12  ? -0.650  7.550   -10.998 1.00 0.00 ? 12  SER A O    6  
ATOM 8747  C CB   . SER A 1 12  ? -1.183  10.221  -10.060 1.00 0.00 ? 12  SER A CB   6  
ATOM 8748  O OG   . SER A 1 12  ? -0.933  9.971   -11.441 1.00 0.00 ? 12  SER A OG   6  
ATOM 8749  H H    . SER A 1 12  ? -0.344  9.502   -7.782  1.00 0.00 ? 12  SER A H    6  
ATOM 8750  H HA   . SER A 1 12  ? -2.637  9.114   -8.919  1.00 0.00 ? 12  SER A HA   6  
ATOM 8751  H HB2  . SER A 1 12  ? -1.948  10.991  -9.964  1.00 0.00 ? 12  SER A HB2  6  
ATOM 8752  H HB3  . SER A 1 12  ? -0.279  10.609  -9.593  1.00 0.00 ? 12  SER A HB3  6  
ATOM 8753  H HG   . SER A 1 12  ? -1.797  9.932   -11.943 1.00 0.00 ? 12  SER A HG   6  
ATOM 8754  N N    . ASN A 1 13  ? -2.701  6.994   -10.225 1.00 0.00 ? 13  ASN A N    6  
ATOM 8755  C CA   . ASN A 1 13  ? -2.823  5.817   -11.068 1.00 0.00 ? 13  ASN A CA   6  
ATOM 8756  C C    . ASN A 1 13  ? -2.197  4.617   -10.355 1.00 0.00 ? 13  ASN A C    6  
ATOM 8757  O O    . ASN A 1 13  ? -1.324  3.949   -10.907 1.00 0.00 ? 13  ASN A O    6  
ATOM 8758  C CB   . ASN A 1 13  ? -2.089  6.014   -12.396 1.00 0.00 ? 13  ASN A CB   6  
ATOM 8759  C CG   . ASN A 1 13  ? -2.742  5.194   -13.510 1.00 0.00 ? 13  ASN A CG   6  
ATOM 8760  O OD1  . ASN A 1 13  ? -3.604  5.661   -14.237 1.00 0.00 ? 13  ASN A OD1  6  
ATOM 8761  N ND2  . ASN A 1 13  ? -2.286  3.948   -13.604 1.00 0.00 ? 13  ASN A ND2  6  
ATOM 8762  H H    . ASN A 1 13  ? -3.485  7.169   -9.628  1.00 0.00 ? 13  ASN A H    6  
ATOM 8763  H HA   . ASN A 1 13  ? -3.893  5.693   -11.234 1.00 0.00 ? 13  ASN A HA   6  
ATOM 8764  H HB2  . ASN A 1 13  ? -2.094  7.070   -12.666 1.00 0.00 ? 13  ASN A HB2  6  
ATOM 8765  H HB3  . ASN A 1 13  ? -1.045  5.718   -12.286 1.00 0.00 ? 13  ASN A HB3  6  
ATOM 8766  H HD21 . ASN A 1 13  ? -1.577  3.627   -12.976 1.00 0.00 ? 13  ASN A HD21 6  
ATOM 8767  H HD22 . ASN A 1 13  ? -2.652  3.333   -14.303 1.00 0.00 ? 13  ASN A HD22 6  
ATOM 8768  N N    . MET A 1 14  ? -2.668  4.380   -9.140  1.00 0.00 ? 14  MET A N    6  
ATOM 8769  C CA   . MET A 1 14  ? -2.165  3.272   -8.345  1.00 0.00 ? 14  MET A CA   6  
ATOM 8770  C C    . MET A 1 14  ? -3.163  2.884   -7.252  1.00 0.00 ? 14  MET A C    6  
ATOM 8771  O O    . MET A 1 14  ? -3.597  3.732   -6.474  1.00 0.00 ? 14  MET A O    6  
ATOM 8772  C CB   . MET A 1 14  ? -0.833  3.666   -7.705  1.00 0.00 ? 14  MET A CB   6  
ATOM 8773  C CG   . MET A 1 14  ? 0.259   3.826   -8.765  1.00 0.00 ? 14  MET A CG   6  
ATOM 8774  S SD   . MET A 1 14  ? 1.851   4.006   -7.979  1.00 0.00 ? 14  MET A SD   6  
ATOM 8775  C CE   . MET A 1 14  ? 1.806   2.612   -6.864  1.00 0.00 ? 14  MET A CE   6  
ATOM 8776  H H    . MET A 1 14  ? -3.378  4.928   -8.698  1.00 0.00 ? 14  MET A H    6  
ATOM 8777  H HA   . MET A 1 14  ? -2.041  2.444   -9.043  1.00 0.00 ? 14  MET A HA   6  
ATOM 8778  H HB2  . MET A 1 14  ? -0.951  4.600   -7.155  1.00 0.00 ? 14  MET A HB2  6  
ATOM 8779  H HB3  . MET A 1 14  ? -0.534  2.907   -6.982  1.00 0.00 ? 14  MET A HB3  6  
ATOM 8780  H HG2  . MET A 1 14  ? 0.266   2.960   -9.426  1.00 0.00 ? 14  MET A HG2  6  
ATOM 8781  H HG3  . MET A 1 14  ? 0.050   4.698   -9.385  1.00 0.00 ? 14  MET A HG3  6  
ATOM 8782  H HE1  . MET A 1 14  ? 2.810   2.205   -6.751  1.00 0.00 ? 14  MET A HE1  6  
ATOM 8783  H HE2  . MET A 1 14  ? 1.433   2.937   -5.892  1.00 0.00 ? 14  MET A HE2  6  
ATOM 8784  H HE3  . MET A 1 14  ? 1.146   1.845   -7.269  1.00 0.00 ? 14  MET A HE3  6  
ATOM 8785  N N    . LYS A 1 15  ? -3.496  1.602   -7.227  1.00 0.00 ? 15  LYS A N    6  
ATOM 8786  C CA   . LYS A 1 15  ? -4.434  1.092   -6.242  1.00 0.00 ? 15  LYS A CA   6  
ATOM 8787  C C    . LYS A 1 15  ? -3.662  0.600   -5.016  1.00 0.00 ? 15  LYS A C    6  
ATOM 8788  O O    . LYS A 1 15  ? -2.957  -0.406  -5.085  1.00 0.00 ? 15  LYS A O    6  
ATOM 8789  C CB   . LYS A 1 15  ? -5.341  0.029   -6.866  1.00 0.00 ? 15  LYS A CB   6  
ATOM 8790  C CG   . LYS A 1 15  ? -6.722  0.605   -7.186  1.00 0.00 ? 15  LYS A CG   6  
ATOM 8791  C CD   . LYS A 1 15  ? -7.468  -0.283  -8.183  1.00 0.00 ? 15  LYS A CD   6  
ATOM 8792  C CE   . LYS A 1 15  ? -6.639  -0.500  -9.451  1.00 0.00 ? 15  LYS A CE   6  
ATOM 8793  N NZ   . LYS A 1 15  ? -7.517  -0.838  -10.593 1.00 0.00 ? 15  LYS A NZ   6  
ATOM 8794  H H    . LYS A 1 15  ? -3.138  0.919   -7.863  1.00 0.00 ? 15  LYS A H    6  
ATOM 8795  H HA   . LYS A 1 15  ? -5.073  1.922   -5.938  1.00 0.00 ? 15  LYS A HA   6  
ATOM 8796  H HB2  . LYS A 1 15  ? -4.883  -0.356  -7.777  1.00 0.00 ? 15  LYS A HB2  6  
ATOM 8797  H HB3  . LYS A 1 15  ? -5.444  -0.813  -6.181  1.00 0.00 ? 15  LYS A HB3  6  
ATOM 8798  H HG2  . LYS A 1 15  ? -7.303  0.695   -6.268  1.00 0.00 ? 15  LYS A HG2  6  
ATOM 8799  H HG3  . LYS A 1 15  ? -6.615  1.609   -7.595  1.00 0.00 ? 15  LYS A HG3  6  
ATOM 8800  H HD2  . LYS A 1 15  ? -7.694  -1.244  -7.722  1.00 0.00 ? 15  LYS A HD2  6  
ATOM 8801  H HD3  . LYS A 1 15  ? -8.421  0.178   -8.443  1.00 0.00 ? 15  LYS A HD3  6  
ATOM 8802  H HE2  . LYS A 1 15  ? -6.067  0.399   -9.677  1.00 0.00 ? 15  LYS A HE2  6  
ATOM 8803  H HE3  . LYS A 1 15  ? -5.920  -1.303  -9.288  1.00 0.00 ? 15  LYS A HE3  6  
ATOM 8804  H HZ1  . LYS A 1 15  ? -7.538  -0.071  -11.235 1.00 0.00 ? 15  LYS A HZ1  6  
ATOM 8805  H HZ2  . LYS A 1 15  ? -7.164  -1.651  -11.056 1.00 0.00 ? 15  LYS A HZ2  6  
ATOM 8806  H HZ3  . LYS A 1 15  ? -8.443  -1.019  -10.260 1.00 0.00 ? 15  LYS A HZ3  6  
ATOM 8807  N N    . ILE A 1 16  ? -3.822  1.331   -3.923  1.00 0.00 ? 16  ILE A N    6  
ATOM 8808  C CA   . ILE A 1 16  ? -3.149  0.982   -2.684  1.00 0.00 ? 16  ILE A CA   6  
ATOM 8809  C C    . ILE A 1 16  ? -4.092  0.149   -1.814  1.00 0.00 ? 16  ILE A C    6  
ATOM 8810  O O    . ILE A 1 16  ? -5.274  0.465   -1.694  1.00 0.00 ? 16  ILE A O    6  
ATOM 8811  C CB   . ILE A 1 16  ? -2.619  2.238   -1.989  1.00 0.00 ? 16  ILE A CB   6  
ATOM 8812  C CG1  . ILE A 1 16  ? -1.585  2.952   -2.861  1.00 0.00 ? 16  ILE A CG1  6  
ATOM 8813  C CG2  . ILE A 1 16  ? -2.068  1.905   -0.601  1.00 0.00 ? 16  ILE A CG2  6  
ATOM 8814  C CD1  . ILE A 1 16  ? -2.242  3.569   -4.097  1.00 0.00 ? 16  ILE A CD1  6  
ATOM 8815  H H    . ILE A 1 16  ? -4.397  2.148   -3.876  1.00 0.00 ? 16  ILE A H    6  
ATOM 8816  H HA   . ILE A 1 16  ? -2.285  0.369   -2.943  1.00 0.00 ? 16  ILE A HA   6  
ATOM 8817  H HB   . ILE A 1 16  ? -3.452  2.926   -1.848  1.00 0.00 ? 16  ILE A HB   6  
ATOM 8818  H HG12 . ILE A 1 16  ? -1.090  3.731   -2.280  1.00 0.00 ? 16  ILE A HG12 6  
ATOM 8819  H HG13 . ILE A 1 16  ? -0.814  2.246   -3.169  1.00 0.00 ? 16  ILE A HG13 6  
ATOM 8820  H HG21 . ILE A 1 16  ? -1.177  1.285   -0.703  1.00 0.00 ? 16  ILE A HG21 6  
ATOM 8821  H HG22 . ILE A 1 16  ? -1.811  2.828   -0.081  1.00 0.00 ? 16  ILE A HG22 6  
ATOM 8822  H HG23 . ILE A 1 16  ? -2.823  1.365   -0.030  1.00 0.00 ? 16  ILE A HG23 6  
ATOM 8823  H HD11 . ILE A 1 16  ? -1.750  4.512   -4.337  1.00 0.00 ? 16  ILE A HD11 6  
ATOM 8824  H HD12 . ILE A 1 16  ? -2.147  2.884   -4.939  1.00 0.00 ? 16  ILE A HD12 6  
ATOM 8825  H HD13 . ILE A 1 16  ? -3.297  3.752   -3.894  1.00 0.00 ? 16  ILE A HD13 6  
ATOM 8826  N N    . LEU A 1 17  ? -3.533  -0.900  -1.228  1.00 0.00 ? 17  LEU A N    6  
ATOM 8827  C CA   . LEU A 1 17  ? -4.310  -1.781  -0.372  1.00 0.00 ? 17  LEU A CA   6  
ATOM 8828  C C    . LEU A 1 17  ? -3.792  -1.677  1.064   1.00 0.00 ? 17  LEU A C    6  
ATOM 8829  O O    . LEU A 1 17  ? -2.678  -1.209  1.294   1.00 0.00 ? 17  LEU A O    6  
ATOM 8830  C CB   . LEU A 1 17  ? -4.304  -3.208  -0.925  1.00 0.00 ? 17  LEU A CB   6  
ATOM 8831  C CG   . LEU A 1 17  ? -5.443  -4.114  -0.456  1.00 0.00 ? 17  LEU A CG   6  
ATOM 8832  C CD1  . LEU A 1 17  ? -5.144  -4.700  0.926   1.00 0.00 ? 17  LEU A CD1  6  
ATOM 8833  C CD2  . LEU A 1 17  ? -6.782  -3.373  -0.487  1.00 0.00 ? 17  LEU A CD2  6  
ATOM 8834  H H    . LEU A 1 17  ? -2.571  -1.151  -1.330  1.00 0.00 ? 17  LEU A H    6  
ATOM 8835  H HA   . LEU A 1 17  ? -5.342  -1.432  -0.394  1.00 0.00 ? 17  LEU A HA   6  
ATOM 8836  H HB2  . LEU A 1 17  ? -4.333  -3.154  -2.014  1.00 0.00 ? 17  LEU A HB2  6  
ATOM 8837  H HB3  . LEU A 1 17  ? -3.358  -3.677  -0.655  1.00 0.00 ? 17  LEU A HB3  6  
ATOM 8838  H HG   . LEU A 1 17  ? -5.523  -4.951  -1.150  1.00 0.00 ? 17  LEU A HG   6  
ATOM 8839  H HD11 . LEU A 1 17  ? -5.066  -5.785  0.851   1.00 0.00 ? 17  LEU A HD11 6  
ATOM 8840  H HD12 . LEU A 1 17  ? -4.204  -4.292  1.298   1.00 0.00 ? 17  LEU A HD12 6  
ATOM 8841  H HD13 . LEU A 1 17  ? -5.950  -4.440  1.613   1.00 0.00 ? 17  LEU A HD13 6  
ATOM 8842  H HD21 . LEU A 1 17  ? -7.597  -4.096  -0.498  1.00 0.00 ? 17  LEU A HD21 6  
ATOM 8843  H HD22 . LEU A 1 17  ? -6.868  -2.742  0.398   1.00 0.00 ? 17  LEU A HD22 6  
ATOM 8844  H HD23 . LEU A 1 17  ? -6.833  -2.753  -1.382  1.00 0.00 ? 17  LEU A HD23 6  
ATOM 8845  N N    . THR A 1 18  ? -4.626  -2.120  1.993   1.00 0.00 ? 18  THR A N    6  
ATOM 8846  C CA   . THR A 1 18  ? -4.267  -2.081  3.401   1.00 0.00 ? 18  THR A CA   6  
ATOM 8847  C C    . THR A 1 18  ? -4.647  -3.396  4.084   1.00 0.00 ? 18  THR A C    6  
ATOM 8848  O O    . THR A 1 18  ? -5.665  -4.002  3.750   1.00 0.00 ? 18  THR A O    6  
ATOM 8849  C CB   . THR A 1 18  ? -4.936  -0.856  4.026   1.00 0.00 ? 18  THR A CB   6  
ATOM 8850  O OG1  . THR A 1 18  ? -6.325  -1.050  3.770   1.00 0.00 ? 18  THR A OG1  6  
ATOM 8851  C CG2  . THR A 1 18  ? -4.597  0.439   3.285   1.00 0.00 ? 18  THR A CG2  6  
ATOM 8852  H H    . THR A 1 18  ? -5.531  -2.498  1.798   1.00 0.00 ? 18  THR A H    6  
ATOM 8853  H HA   . THR A 1 18  ? -3.184  -1.983  3.476   1.00 0.00 ? 18  THR A HA   6  
ATOM 8854  H HB   . THR A 1 18  ? -4.688  -0.775  5.085   1.00 0.00 ? 18  THR A HB   6  
ATOM 8855  H HG1  . THR A 1 18  ? -6.613  -1.946  4.107   1.00 0.00 ? 18  THR A HG1  6  
ATOM 8856  H HG21 . THR A 1 18  ? -5.144  0.472   2.343   1.00 0.00 ? 18  THR A HG21 6  
ATOM 8857  H HG22 . THR A 1 18  ? -4.880  1.294   3.899   1.00 0.00 ? 18  THR A HG22 6  
ATOM 8858  H HG23 . THR A 1 18  ? -3.527  0.473   3.085   1.00 0.00 ? 18  THR A HG23 6  
ATOM 8859  N N    . LEU A 1 19  ? -3.810  -3.800  5.028   1.00 0.00 ? 19  LEU A N    6  
ATOM 8860  C CA   . LEU A 1 19  ? -4.045  -5.032  5.761   1.00 0.00 ? 19  LEU A CA   6  
ATOM 8861  C C    . LEU A 1 19  ? -3.773  -4.796  7.248   1.00 0.00 ? 19  LEU A C    6  
ATOM 8862  O O    . LEU A 1 19  ? -2.686  -4.355  7.621   1.00 0.00 ? 19  LEU A O    6  
ATOM 8863  C CB   . LEU A 1 19  ? -3.228  -6.177  5.160   1.00 0.00 ? 19  LEU A CB   6  
ATOM 8864  C CG   . LEU A 1 19  ? -4.006  -7.450  4.821   1.00 0.00 ? 19  LEU A CG   6  
ATOM 8865  C CD1  . LEU A 1 19  ? -3.339  -8.211  3.673   1.00 0.00 ? 19  LEU A CD1  6  
ATOM 8866  C CD2  . LEU A 1 19  ? -4.190  -8.328  6.060   1.00 0.00 ? 19  LEU A CD2  6  
ATOM 8867  H H    . LEU A 1 19  ? -2.984  -3.301  5.293   1.00 0.00 ? 19  LEU A H    6  
ATOM 8868  H HA   . LEU A 1 19  ? -5.098  -5.288  5.639   1.00 0.00 ? 19  LEU A HA   6  
ATOM 8869  H HB2  . LEU A 1 19  ? -2.747  -5.816  4.252   1.00 0.00 ? 19  LEU A HB2  6  
ATOM 8870  H HB3  . LEU A 1 19  ? -2.434  -6.437  5.860   1.00 0.00 ? 19  LEU A HB3  6  
ATOM 8871  H HG   . LEU A 1 19  ? -5.001  -7.162  4.480   1.00 0.00 ? 19  LEU A HG   6  
ATOM 8872  H HD11 . LEU A 1 19  ? -2.852  -7.503  3.002   1.00 0.00 ? 19  LEU A HD11 6  
ATOM 8873  H HD12 . LEU A 1 19  ? -2.596  -8.899  4.077   1.00 0.00 ? 19  LEU A HD12 6  
ATOM 8874  H HD13 . LEU A 1 19  ? -4.093  -8.773  3.123   1.00 0.00 ? 19  LEU A HD13 6  
ATOM 8875  H HD21 . LEU A 1 19  ? -5.248  -8.553  6.193   1.00 0.00 ? 19  LEU A HD21 6  
ATOM 8876  H HD22 . LEU A 1 19  ? -3.634  -9.257  5.933   1.00 0.00 ? 19  LEU A HD22 6  
ATOM 8877  H HD23 . LEU A 1 19  ? -3.817  -7.800  6.938   1.00 0.00 ? 19  LEU A HD23 6  
ATOM 8878  N N    . GLY A 1 20  ? -4.777  -5.098  8.057   1.00 0.00 ? 20  GLY A N    6  
ATOM 8879  C CA   . GLY A 1 20  ? -4.660  -4.925  9.494   1.00 0.00 ? 20  GLY A CA   6  
ATOM 8880  C C    . GLY A 1 20  ? -5.009  -3.493  9.904   1.00 0.00 ? 20  GLY A C    6  
ATOM 8881  O O    . GLY A 1 20  ? -5.600  -2.747  9.124   1.00 0.00 ? 20  GLY A O    6  
ATOM 8882  H H    . GLY A 1 20  ? -5.658  -5.456  7.745   1.00 0.00 ? 20  GLY A H    6  
ATOM 8883  H HA2  . GLY A 1 20  ? -5.321  -5.625  10.004  1.00 0.00 ? 20  GLY A HA2  6  
ATOM 8884  H HA3  . GLY A 1 20  ? -3.643  -5.159  9.810   1.00 0.00 ? 20  GLY A HA3  6  
ATOM 8885  N N    . LYS A 1 21  ? -4.630  -3.151  11.127  1.00 0.00 ? 21  LYS A N    6  
ATOM 8886  C CA   . LYS A 1 21  ? -4.896  -1.822  11.649  1.00 0.00 ? 21  LYS A CA   6  
ATOM 8887  C C    . LYS A 1 21  ? -3.621  -0.980  11.564  1.00 0.00 ? 21  LYS A C    6  
ATOM 8888  O O    . LYS A 1 21  ? -2.542  -1.443  11.932  1.00 0.00 ? 21  LYS A O    6  
ATOM 8889  C CB   . LYS A 1 21  ? -5.483  -1.908  13.060  1.00 0.00 ? 21  LYS A CB   6  
ATOM 8890  C CG   . LYS A 1 21  ? -5.702  -0.513  13.649  1.00 0.00 ? 21  LYS A CG   6  
ATOM 8891  C CD   . LYS A 1 21  ? -4.536  -0.111  14.555  1.00 0.00 ? 21  LYS A CD   6  
ATOM 8892  C CE   . LYS A 1 21  ? -5.044  0.506   15.859  1.00 0.00 ? 21  LYS A CE   6  
ATOM 8893  N NZ   . LYS A 1 21  ? -4.911  -0.457  16.975  1.00 0.00 ? 21  LYS A NZ   6  
ATOM 8894  H H    . LYS A 1 21  ? -4.150  -3.764  11.755  1.00 0.00 ? 21  LYS A H    6  
ATOM 8895  H HA   . LYS A 1 21  ? -5.654  -1.366  11.012  1.00 0.00 ? 21  LYS A HA   6  
ATOM 8896  H HB2  . LYS A 1 21  ? -6.429  -2.448  13.032  1.00 0.00 ? 21  LYS A HB2  6  
ATOM 8897  H HB3  . LYS A 1 21  ? -4.811  -2.477  13.703  1.00 0.00 ? 21  LYS A HB3  6  
ATOM 8898  H HG2  . LYS A 1 21  ? -5.808  0.213   12.843  1.00 0.00 ? 21  LYS A HG2  6  
ATOM 8899  H HG3  . LYS A 1 21  ? -6.632  -0.497  14.217  1.00 0.00 ? 21  LYS A HG3  6  
ATOM 8900  H HD2  . LYS A 1 21  ? -3.925  -0.986  14.776  1.00 0.00 ? 21  LYS A HD2  6  
ATOM 8901  H HD3  . LYS A 1 21  ? -3.896  0.602   14.035  1.00 0.00 ? 21  LYS A HD3  6  
ATOM 8902  H HE2  . LYS A 1 21  ? -4.480  1.412   16.083  1.00 0.00 ? 21  LYS A HE2  6  
ATOM 8903  H HE3  . LYS A 1 21  ? -6.087  0.801   15.748  1.00 0.00 ? 21  LYS A HE3  6  
ATOM 8904  H HZ1  . LYS A 1 21  ? -4.903  0.038   17.844  1.00 0.00 ? 21  LYS A HZ1  6  
ATOM 8905  H HZ2  . LYS A 1 21  ? -5.683  -1.092  16.961  1.00 0.00 ? 21  LYS A HZ2  6  
ATOM 8906  H HZ3  . LYS A 1 21  ? -4.057  -0.968  16.875  1.00 0.00 ? 21  LYS A HZ3  6  
ATOM 8907  N N    . LEU A 1 22  ? -3.787  0.240   11.076  1.00 0.00 ? 22  LEU A N    6  
ATOM 8908  C CA   . LEU A 1 22  ? -2.663  1.150   10.938  1.00 0.00 ? 22  LEU A CA   6  
ATOM 8909  C C    . LEU A 1 22  ? -2.801  2.283   11.958  1.00 0.00 ? 22  LEU A C    6  
ATOM 8910  O O    . LEU A 1 22  ? -3.865  2.467   12.546  1.00 0.00 ? 22  LEU A O    6  
ATOM 8911  C CB   . LEU A 1 22  ? -2.542  1.636   9.492   1.00 0.00 ? 22  LEU A CB   6  
ATOM 8912  C CG   . LEU A 1 22  ? -2.312  0.552   8.437   1.00 0.00 ? 22  LEU A CG   6  
ATOM 8913  C CD1  . LEU A 1 22  ? -2.847  0.992   7.073   1.00 0.00 ? 22  LEU A CD1  6  
ATOM 8914  C CD2  . LEU A 1 22  ? -0.836  0.154   8.373   1.00 0.00 ? 22  LEU A CD2  6  
ATOM 8915  H H    . LEU A 1 22  ? -4.668  0.608   10.779  1.00 0.00 ? 22  LEU A H    6  
ATOM 8916  H HA   . LEU A 1 22  ? -1.758  0.588   11.166  1.00 0.00 ? 22  LEU A HA   6  
ATOM 8917  H HB2  . LEU A 1 22  ? -3.452  2.179   9.235   1.00 0.00 ? 22  LEU A HB2  6  
ATOM 8918  H HB3  . LEU A 1 22  ? -1.719  2.349   9.437   1.00 0.00 ? 22  LEU A HB3  6  
ATOM 8919  H HG   . LEU A 1 22  ? -2.872  -0.336  8.732   1.00 0.00 ? 22  LEU A HG   6  
ATOM 8920  H HD11 . LEU A 1 22  ? -2.424  0.356   6.295   1.00 0.00 ? 22  LEU A HD11 6  
ATOM 8921  H HD12 . LEU A 1 22  ? -3.933  0.904   7.064   1.00 0.00 ? 22  LEU A HD12 6  
ATOM 8922  H HD13 . LEU A 1 22  ? -2.564  2.029   6.889   1.00 0.00 ? 22  LEU A HD13 6  
ATOM 8923  H HD21 . LEU A 1 22  ? -0.637  -0.353  7.429   1.00 0.00 ? 22  LEU A HD21 6  
ATOM 8924  H HD22 . LEU A 1 22  ? -0.215  1.048   8.443   1.00 0.00 ? 22  LEU A HD22 6  
ATOM 8925  H HD23 . LEU A 1 22  ? -0.603  -0.515  9.202   1.00 0.00 ? 22  LEU A HD23 6  
ATOM 8926  N N    . SER A 1 23  ? -1.709  3.012   12.136  1.00 0.00 ? 23  SER A N    6  
ATOM 8927  C CA   . SER A 1 23  ? -1.695  4.121   13.074  1.00 0.00 ? 23  SER A CA   6  
ATOM 8928  C C    . SER A 1 23  ? -2.904  5.027   12.833  1.00 0.00 ? 23  SER A C    6  
ATOM 8929  O O    . SER A 1 23  ? -3.588  5.420   13.776  1.00 0.00 ? 23  SER A O    6  
ATOM 8930  C CB   . SER A 1 23  ? -0.398  4.924   12.958  1.00 0.00 ? 23  SER A CB   6  
ATOM 8931  O OG   . SER A 1 23  ? -0.307  5.939   13.954  1.00 0.00 ? 23  SER A OG   6  
ATOM 8932  H H    . SER A 1 23  ? -0.847  2.855   11.654  1.00 0.00 ? 23  SER A H    6  
ATOM 8933  H HA   . SER A 1 23  ? -1.751  3.664   14.062  1.00 0.00 ? 23  SER A HA   6  
ATOM 8934  H HB2  . SER A 1 23  ? 0.455   4.251   13.047  1.00 0.00 ? 23  SER A HB2  6  
ATOM 8935  H HB3  . SER A 1 23  ? -0.342  5.380   11.969  1.00 0.00 ? 23  SER A HB3  6  
ATOM 8936  H HG   . SER A 1 23  ? 0.193   5.596   14.748  1.00 0.00 ? 23  SER A HG   6  
ATOM 8937  N N    . ARG A 1 24  ? -3.130  5.331   11.563  1.00 0.00 ? 24  ARG A N    6  
ATOM 8938  C CA   . ARG A 1 24  ? -4.245  6.184   11.185  1.00 0.00 ? 24  ARG A CA   6  
ATOM 8939  C C    . ARG A 1 24  ? -5.493  5.339   10.922  1.00 0.00 ? 24  ARG A C    6  
ATOM 8940  O O    . ARG A 1 24  ? -5.451  4.114   11.024  1.00 0.00 ? 24  ARG A O    6  
ATOM 8941  C CB   . ARG A 1 24  ? -3.915  6.999   9.933   1.00 0.00 ? 24  ARG A CB   6  
ATOM 8942  C CG   . ARG A 1 24  ? -2.940  8.132   10.258  1.00 0.00 ? 24  ARG A CG   6  
ATOM 8943  C CD   . ARG A 1 24  ? -3.373  9.437   9.587   1.00 0.00 ? 24  ARG A CD   6  
ATOM 8944  N NE   . ARG A 1 24  ? -2.357  10.488  9.822   1.00 0.00 ? 24  ARG A NE   6  
ATOM 8945  C CZ   . ARG A 1 24  ? -2.191  11.124  10.989  1.00 0.00 ? 24  ARG A CZ   6  
ATOM 8946  N NH1  . ARG A 1 24  ? -2.971  10.821  12.035  1.00 0.00 ? 24  ARG A NH1  6  
ATOM 8947  N NH2  . ARG A 1 24  ? -1.243  12.064  11.110  1.00 0.00 ? 24  ARG A NH2  6  
ATOM 8948  H H    . ARG A 1 24  ? -2.569  5.007   10.802  1.00 0.00 ? 24  ARG A H    6  
ATOM 8949  H HA   . ARG A 1 24  ? -4.392  6.845   12.039  1.00 0.00 ? 24  ARG A HA   6  
ATOM 8950  H HB2  . ARG A 1 24  ? -3.482  6.347   9.174   1.00 0.00 ? 24  ARG A HB2  6  
ATOM 8951  H HB3  . ARG A 1 24  ? -4.832  7.412   9.513   1.00 0.00 ? 24  ARG A HB3  6  
ATOM 8952  H HG2  . ARG A 1 24  ? -2.887  8.273   11.337  1.00 0.00 ? 24  ARG A HG2  6  
ATOM 8953  H HG3  . ARG A 1 24  ? -1.938  7.861   9.923   1.00 0.00 ? 24  ARG A HG3  6  
ATOM 8954  H HD2  . ARG A 1 24  ? -3.505  9.279   8.517   1.00 0.00 ? 24  ARG A HD2  6  
ATOM 8955  H HD3  . ARG A 1 24  ? -4.337  9.757   9.983   1.00 0.00 ? 24  ARG A HD3  6  
ATOM 8956  H HE   . ARG A 1 24  ? -1.758  10.738  9.061   1.00 0.00 ? 24  ARG A HE   6  
ATOM 8957  H HH11 . ARG A 1 24  ? -3.678  10.120  11.944  1.00 0.00 ? 24  ARG A HH11 6  
ATOM 8958  H HH12 . ARG A 1 24  ? -2.847  11.297  12.906  1.00 0.00 ? 24  ARG A HH12 6  
ATOM 8959  H HH21 . ARG A 1 24  ? -0.661  12.291  10.329  1.00 0.00 ? 24  ARG A HH21 6  
ATOM 8960  H HH22 . ARG A 1 24  ? -1.119  12.540  11.981  1.00 0.00 ? 24  ARG A HH22 6  
ATOM 8961  N N    . ASN A 1 25  ? -6.575  6.027   10.588  1.00 0.00 ? 25  ASN A N    6  
ATOM 8962  C CA   . ASN A 1 25  ? -7.833  5.356   10.309  1.00 0.00 ? 25  ASN A CA   6  
ATOM 8963  C C    . ASN A 1 25  ? -7.936  5.079   8.808   1.00 0.00 ? 25  ASN A C    6  
ATOM 8964  O O    . ASN A 1 25  ? -7.355  5.800   7.999   1.00 0.00 ? 25  ASN A O    6  
ATOM 8965  C CB   . ASN A 1 25  ? -9.024  6.228   10.712  1.00 0.00 ? 25  ASN A CB   6  
ATOM 8966  C CG   . ASN A 1 25  ? -9.206  6.239   12.231  1.00 0.00 ? 25  ASN A CG   6  
ATOM 8967  O OD1  . ASN A 1 25  ? -9.231  5.210   12.887  1.00 0.00 ? 25  ASN A OD1  6  
ATOM 8968  N ND2  . ASN A 1 25  ? -9.332  7.456   12.752  1.00 0.00 ? 25  ASN A ND2  6  
ATOM 8969  H H    . ASN A 1 25  ? -6.601  7.024   10.507  1.00 0.00 ? 25  ASN A H    6  
ATOM 8970  H HA   . ASN A 1 25  ? -7.807  4.441   10.901  1.00 0.00 ? 25  ASN A HA   6  
ATOM 8971  H HB2  . ASN A 1 25  ? -8.872  7.246   10.353  1.00 0.00 ? 25  ASN A HB2  6  
ATOM 8972  H HB3  . ASN A 1 25  ? -9.930  5.854   10.236  1.00 0.00 ? 25  ASN A HB3  6  
ATOM 8973  H HD21 . ASN A 1 25  ? -9.303  8.259   12.157  1.00 0.00 ? 25  ASN A HD21 6  
ATOM 8974  H HD22 . ASN A 1 25  ? -9.456  7.567   13.738  1.00 0.00 ? 25  ASN A HD22 6  
ATOM 8975  N N    . LYS A 1 26  ? -8.680  4.032   8.482   1.00 0.00 ? 26  LYS A N    6  
ATOM 8976  C CA   . LYS A 1 26  ? -8.867  3.651   7.092   1.00 0.00 ? 26  LYS A CA   6  
ATOM 8977  C C    . LYS A 1 26  ? -9.178  4.898   6.263   1.00 0.00 ? 26  LYS A C    6  
ATOM 8978  O O    . LYS A 1 26  ? -8.643  5.069   5.168   1.00 0.00 ? 26  LYS A O    6  
ATOM 8979  C CB   . LYS A 1 26  ? -9.928  2.555   6.975   1.00 0.00 ? 26  LYS A CB   6  
ATOM 8980  C CG   . LYS A 1 26  ? -9.789  1.795   5.654   1.00 0.00 ? 26  LYS A CG   6  
ATOM 8981  C CD   . LYS A 1 26  ? -10.918 2.162   4.689   1.00 0.00 ? 26  LYS A CD   6  
ATOM 8982  C CE   . LYS A 1 26  ? -11.454 0.919   3.975   1.00 0.00 ? 26  LYS A CE   6  
ATOM 8983  N NZ   . LYS A 1 26  ? -12.385 0.177   4.855   1.00 0.00 ? 26  LYS A NZ   6  
ATOM 8984  H H    . LYS A 1 26  ? -9.149  3.450   9.146   1.00 0.00 ? 26  LYS A H    6  
ATOM 8985  H HA   . LYS A 1 26  ? -7.926  3.227   6.740   1.00 0.00 ? 26  LYS A HA   6  
ATOM 8986  H HB2  . LYS A 1 26  ? -9.833  1.860   7.810   1.00 0.00 ? 26  LYS A HB2  6  
ATOM 8987  H HB3  . LYS A 1 26  ? -10.922 2.997   7.042   1.00 0.00 ? 26  LYS A HB3  6  
ATOM 8988  H HG2  . LYS A 1 26  ? -8.826  2.026   5.198   1.00 0.00 ? 26  LYS A HG2  6  
ATOM 8989  H HG3  . LYS A 1 26  ? -9.802  0.722   5.845   1.00 0.00 ? 26  LYS A HG3  6  
ATOM 8990  H HD2  . LYS A 1 26  ? -11.726 2.648   5.237   1.00 0.00 ? 26  LYS A HD2  6  
ATOM 8991  H HD3  . LYS A 1 26  ? -10.555 2.880   3.954   1.00 0.00 ? 26  LYS A HD3  6  
ATOM 8992  H HE2  . LYS A 1 26  ? -11.966 1.212   3.059   1.00 0.00 ? 26  LYS A HE2  6  
ATOM 8993  H HE3  . LYS A 1 26  ? -10.625 0.273   3.685   1.00 0.00 ? 26  LYS A HE3  6  
ATOM 8994  H HZ1  . LYS A 1 26  ? -12.287 0.503   5.795   1.00 0.00 ? 26  LYS A HZ1  6  
ATOM 8995  H HZ2  . LYS A 1 26  ? -13.324 0.326   4.547   1.00 0.00 ? 26  LYS A HZ2  6  
ATOM 8996  H HZ3  . LYS A 1 26  ? -12.172 -0.799  4.817   1.00 0.00 ? 26  LYS A HZ3  6  
ATOM 8997  N N    . ASP A 1 27  ? -10.041 5.738   6.816   1.00 0.00 ? 27  ASP A N    6  
ATOM 8998  C CA   . ASP A 1 27  ? -10.429 6.965   6.141   1.00 0.00 ? 27  ASP A CA   6  
ATOM 8999  C C    . ASP A 1 27  ? -9.192  7.841   5.935   1.00 0.00 ? 27  ASP A C    6  
ATOM 9000  O O    . ASP A 1 27  ? -8.803  8.115   4.800   1.00 0.00 ? 27  ASP A O    6  
ATOM 9001  C CB   . ASP A 1 27  ? -11.436 7.757   6.976   1.00 0.00 ? 27  ASP A CB   6  
ATOM 9002  C CG   . ASP A 1 27  ? -12.875 7.722   6.458   1.00 0.00 ? 27  ASP A CG   6  
ATOM 9003  O OD1  . ASP A 1 27  ? -13.117 6.949   5.505   1.00 0.00 ? 27  ASP A OD1  6  
ATOM 9004  O OD2  . ASP A 1 27  ? -13.702 8.467   7.026   1.00 0.00 ? 27  ASP A OD2  6  
ATOM 9005  H H    . ASP A 1 27  ? -10.471 5.591   7.707   1.00 0.00 ? 27  ASP A H    6  
ATOM 9006  H HA   . ASP A 1 27  ? -10.875 6.645   5.200   1.00 0.00 ? 27  ASP A HA   6  
ATOM 9007  H HB2  . ASP A 1 27  ? -11.423 7.372   7.996   1.00 0.00 ? 27  ASP A HB2  6  
ATOM 9008  H HB3  . ASP A 1 27  ? -11.109 8.796   7.023   1.00 0.00 ? 27  ASP A HB3  6  
ATOM 9009  N N    . GLU A 1 28  ? -8.609  8.258   7.049   1.00 0.00 ? 28  GLU A N    6  
ATOM 9010  C CA   . GLU A 1 28  ? -7.424  9.098   7.005   1.00 0.00 ? 28  GLU A CA   6  
ATOM 9011  C C    . GLU A 1 28  ? -6.460  8.600   5.926   1.00 0.00 ? 28  GLU A C    6  
ATOM 9012  O O    . GLU A 1 28  ? -5.795  9.397   5.267   1.00 0.00 ? 28  GLU A O    6  
ATOM 9013  C CB   . GLU A 1 28  ? -6.738  9.152   8.371   1.00 0.00 ? 28  GLU A CB   6  
ATOM 9014  C CG   . GLU A 1 28  ? -7.627  9.849   9.404   1.00 0.00 ? 28  GLU A CG   6  
ATOM 9015  C CD   . GLU A 1 28  ? -6.805  10.788  10.290  1.00 0.00 ? 28  GLU A CD   6  
ATOM 9016  O OE1  . GLU A 1 28  ? -6.269  11.770  9.732   1.00 0.00 ? 28  GLU A OE1  6  
ATOM 9017  O OE2  . GLU A 1 28  ? -6.731  10.501  11.504  1.00 0.00 ? 28  GLU A OE2  6  
ATOM 9018  H H    . GLU A 1 28  ? -8.932  8.031   7.968   1.00 0.00 ? 28  GLU A H    6  
ATOM 9019  H HA   . GLU A 1 28  ? -7.785  10.094  6.747   1.00 0.00 ? 28  GLU A HA   6  
ATOM 9020  H HB2  . GLU A 1 28  ? -6.509  8.141   8.707   1.00 0.00 ? 28  GLU A HB2  6  
ATOM 9021  H HB3  . GLU A 1 28  ? -5.790  9.682   8.286   1.00 0.00 ? 28  GLU A HB3  6  
ATOM 9022  H HG2  . GLU A 1 28  ? -8.407  10.415  8.894   1.00 0.00 ? 28  GLU A HG2  6  
ATOM 9023  H HG3  . GLU A 1 28  ? -8.126  9.103   10.022  1.00 0.00 ? 28  GLU A HG3  6  
ATOM 9024  N N    . VAL A 1 29  ? -6.415  7.284   5.781   1.00 0.00 ? 29  VAL A N    6  
ATOM 9025  C CA   . VAL A 1 29  ? -5.543  6.670   4.794   1.00 0.00 ? 29  VAL A CA   6  
ATOM 9026  C C    . VAL A 1 29  ? -6.202  6.751   3.416   1.00 0.00 ? 29  VAL A C    6  
ATOM 9027  O O    . VAL A 1 29  ? -5.588  7.213   2.456   1.00 0.00 ? 29  VAL A O    6  
ATOM 9028  C CB   . VAL A 1 29  ? -5.207  5.237   5.212   1.00 0.00 ? 29  VAL A CB   6  
ATOM 9029  C CG1  . VAL A 1 29  ? -4.377  4.532   4.137   1.00 0.00 ? 29  VAL A CG1  6  
ATOM 9030  C CG2  . VAL A 1 29  ? -4.488  5.213   6.562   1.00 0.00 ? 29  VAL A CG2  6  
ATOM 9031  H H    . VAL A 1 29  ? -6.959  6.642   6.321   1.00 0.00 ? 29  VAL A H    6  
ATOM 9032  H HA   . VAL A 1 29  ? -4.615  7.241   4.773   1.00 0.00 ? 29  VAL A HA   6  
ATOM 9033  H HB   . VAL A 1 29  ? -6.144  4.691   5.322   1.00 0.00 ? 29  VAL A HB   6  
ATOM 9034  H HG11 . VAL A 1 29  ? -4.973  3.744   3.676   1.00 0.00 ? 29  VAL A HG11 6  
ATOM 9035  H HG12 . VAL A 1 29  ? -4.080  5.254   3.376   1.00 0.00 ? 29  VAL A HG12 6  
ATOM 9036  H HG13 . VAL A 1 29  ? -3.488  4.096   4.592   1.00 0.00 ? 29  VAL A HG13 6  
ATOM 9037  H HG21 . VAL A 1 29  ? -5.214  5.358   7.363   1.00 0.00 ? 29  VAL A HG21 6  
ATOM 9038  H HG22 . VAL A 1 29  ? -3.990  4.253   6.692   1.00 0.00 ? 29  VAL A HG22 6  
ATOM 9039  H HG23 . VAL A 1 29  ? -3.749  6.014   6.594   1.00 0.00 ? 29  VAL A HG23 6  
ATOM 9040  N N    . LYS A 1 30  ? -7.445  6.296   3.362   1.00 0.00 ? 30  LYS A N    6  
ATOM 9041  C CA   . LYS A 1 30  ? -8.195  6.312   2.117   1.00 0.00 ? 30  LYS A CA   6  
ATOM 9042  C C    . LYS A 1 30  ? -8.137  7.715   1.510   1.00 0.00 ? 30  LYS A C    6  
ATOM 9043  O O    . LYS A 1 30  ? -8.232  7.873   0.294   1.00 0.00 ? 30  LYS A O    6  
ATOM 9044  C CB   . LYS A 1 30  ? -9.618  5.798   2.343   1.00 0.00 ? 30  LYS A CB   6  
ATOM 9045  C CG   . LYS A 1 30  ? -10.489 6.034   1.107   1.00 0.00 ? 30  LYS A CG   6  
ATOM 9046  C CD   . LYS A 1 30  ? -11.975 5.989   1.466   1.00 0.00 ? 30  LYS A CD   6  
ATOM 9047  C CE   . LYS A 1 30  ? -12.731 5.020   0.554   1.00 0.00 ? 30  LYS A CE   6  
ATOM 9048  N NZ   . LYS A 1 30  ? -14.190 5.138   0.768   1.00 0.00 ? 30  LYS A NZ   6  
ATOM 9049  H H    . LYS A 1 30  ? -7.938  5.922   4.148   1.00 0.00 ? 30  LYS A H    6  
ATOM 9050  H HA   . LYS A 1 30  ? -7.707  5.618   1.433   1.00 0.00 ? 30  LYS A HA   6  
ATOM 9051  H HB2  . LYS A 1 30  ? -9.593  4.733   2.575   1.00 0.00 ? 30  LYS A HB2  6  
ATOM 9052  H HB3  . LYS A 1 30  ? -10.059 6.301   3.204   1.00 0.00 ? 30  LYS A HB3  6  
ATOM 9053  H HG2  . LYS A 1 30  ? -10.247 7.002   0.667   1.00 0.00 ? 30  LYS A HG2  6  
ATOM 9054  H HG3  . LYS A 1 30  ? -10.270 5.278   0.353   1.00 0.00 ? 30  LYS A HG3  6  
ATOM 9055  H HD2  . LYS A 1 30  ? -12.093 5.682   2.505   1.00 0.00 ? 30  LYS A HD2  6  
ATOM 9056  H HD3  . LYS A 1 30  ? -12.405 6.987   1.378   1.00 0.00 ? 30  LYS A HD3  6  
ATOM 9057  H HE2  . LYS A 1 30  ? -12.492 5.231   -0.488  1.00 0.00 ? 30  LYS A HE2  6  
ATOM 9058  H HE3  . LYS A 1 30  ? -12.409 3.998   0.754   1.00 0.00 ? 30  LYS A HE3  6  
ATOM 9059  H HZ1  . LYS A 1 30  ? -14.387 5.109   1.748   1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 9060  H HZ2  . LYS A 1 30  ? -14.514 6.004   0.388   1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 9061  H HZ3  . LYS A 1 30  ? -14.656 4.379   0.313   1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 9062  N N    . ALA A 1 31  ? -7.981  8.698   2.384   1.00 0.00 ? 31  ALA A N    6  
ATOM 9063  C CA   . ALA A 1 31  ? -7.909  10.082  1.949   1.00 0.00 ? 31  ALA A CA   6  
ATOM 9064  C C    . ALA A 1 31  ? -6.518  10.359  1.374   1.00 0.00 ? 31  ALA A C    6  
ATOM 9065  O O    . ALA A 1 31  ? -6.393  10.879  0.266   1.00 0.00 ? 31  ALA A O    6  
ATOM 9066  C CB   . ALA A 1 31  ? -8.249  11.004  3.121   1.00 0.00 ? 31  ALA A CB   6  
ATOM 9067  H H    . ALA A 1 31  ? -7.904  8.560   3.372   1.00 0.00 ? 31  ALA A H    6  
ATOM 9068  H HA   . ALA A 1 31  ? -8.652  10.222  1.164   1.00 0.00 ? 31  ALA A HA   6  
ATOM 9069  H HB1  . ALA A 1 31  ? -8.934  11.783  2.784   1.00 0.00 ? 31  ALA A HB1  6  
ATOM 9070  H HB2  . ALA A 1 31  ? -8.721  10.424  3.915   1.00 0.00 ? 31  ALA A HB2  6  
ATOM 9071  H HB3  . ALA A 1 31  ? -7.336  11.463  3.500   1.00 0.00 ? 31  ALA A HB3  6  
ATOM 9072  N N    . MET A 1 32  ? -5.508  10.000  2.153   1.00 0.00 ? 32  MET A N    6  
ATOM 9073  C CA   . MET A 1 32  ? -4.132  10.204  1.735   1.00 0.00 ? 32  MET A CA   6  
ATOM 9074  C C    . MET A 1 32  ? -3.878  9.580   0.361   1.00 0.00 ? 32  MET A C    6  
ATOM 9075  O O    . MET A 1 32  ? -3.449  10.266  -0.566  1.00 0.00 ? 32  MET A O    6  
ATOM 9076  C CB   . MET A 1 32  ? -3.188  9.577   2.763   1.00 0.00 ? 32  MET A CB   6  
ATOM 9077  C CG   . MET A 1 32  ? -2.343  10.648  3.456   1.00 0.00 ? 32  MET A CG   6  
ATOM 9078  S SD   . MET A 1 32  ? -1.284  11.455  2.267   1.00 0.00 ? 32  MET A SD   6  
ATOM 9079  C CE   . MET A 1 32  ? 0.314   11.065  2.958   1.00 0.00 ? 32  MET A CE   6  
ATOM 9080  H H    . MET A 1 32  ? -5.618  9.578   3.052   1.00 0.00 ? 32  MET A H    6  
ATOM 9081  H HA   . MET A 1 32  ? -3.999  11.285  1.681   1.00 0.00 ? 32  MET A HA   6  
ATOM 9082  H HB2  . MET A 1 32  ? -3.766  9.028   3.505   1.00 0.00 ? 32  MET A HB2  6  
ATOM 9083  H HB3  . MET A 1 32  ? -2.535  8.856   2.270   1.00 0.00 ? 32  MET A HB3  6  
ATOM 9084  H HG2  . MET A 1 32  ? -2.991  11.381  3.935   1.00 0.00 ? 32  MET A HG2  6  
ATOM 9085  H HG3  . MET A 1 32  ? -1.740  10.194  4.243   1.00 0.00 ? 32  MET A HG3  6  
ATOM 9086  H HE1  . MET A 1 32  ? 0.191   10.715  3.983   1.00 0.00 ? 32  MET A HE1  6  
ATOM 9087  H HE2  . MET A 1 32  ? 0.787   10.284  2.363   1.00 0.00 ? 32  MET A HE2  6  
ATOM 9088  H HE3  . MET A 1 32  ? 0.940   11.957  2.952   1.00 0.00 ? 32  MET A HE3  6  
ATOM 9089  N N    . ILE A 1 33  ? -4.154  8.288   0.273   1.00 0.00 ? 33  ILE A N    6  
ATOM 9090  C CA   . ILE A 1 33  ? -3.961  7.564   -0.972  1.00 0.00 ? 33  ILE A CA   6  
ATOM 9091  C C    . ILE A 1 33  ? -4.628  8.334   -2.113  1.00 0.00 ? 33  ILE A C    6  
ATOM 9092  O O    . ILE A 1 33  ? -4.131  8.338   -3.238  1.00 0.00 ? 33  ILE A O    6  
ATOM 9093  C CB   . ILE A 1 33  ? -4.450  6.121   -0.835  1.00 0.00 ? 33  ILE A CB   6  
ATOM 9094  C CG1  . ILE A 1 33  ? -3.681  5.383   0.263   1.00 0.00 ? 33  ILE A CG1  6  
ATOM 9095  C CG2  . ILE A 1 33  ? -4.381  5.388   -2.176  1.00 0.00 ? 33  ILE A CG2  6  
ATOM 9096  C CD1  . ILE A 1 33  ? -4.379  4.074   0.637   1.00 0.00 ? 33  ILE A CD1  6  
ATOM 9097  H H    . ILE A 1 33  ? -4.503  7.738   1.032   1.00 0.00 ? 33  ILE A H    6  
ATOM 9098  H HA   . ILE A 1 33  ? -2.888  7.523   -1.163  1.00 0.00 ? 33  ILE A HA   6  
ATOM 9099  H HB   . ILE A 1 33  ? -5.498  6.143   -0.534  1.00 0.00 ? 33  ILE A HB   6  
ATOM 9100  H HG12 . ILE A 1 33  ? -2.666  5.174   -0.077  1.00 0.00 ? 33  ILE A HG12 6  
ATOM 9101  H HG13 . ILE A 1 33  ? -3.597  6.019   1.144   1.00 0.00 ? 33  ILE A HG13 6  
ATOM 9102  H HG21 . ILE A 1 33  ? -5.154  4.621   -2.211  1.00 0.00 ? 33  ILE A HG21 6  
ATOM 9103  H HG22 . ILE A 1 33  ? -4.537  6.099   -2.987  1.00 0.00 ? 33  ILE A HG22 6  
ATOM 9104  H HG23 . ILE A 1 33  ? -3.401  4.922   -2.285  1.00 0.00 ? 33  ILE A HG23 6  
ATOM 9105  H HD11 . ILE A 1 33  ? -5.202  3.891   -0.054  1.00 0.00 ? 33  ILE A HD11 6  
ATOM 9106  H HD12 . ILE A 1 33  ? -3.666  3.252   0.578   1.00 0.00 ? 33  ILE A HD12 6  
ATOM 9107  H HD13 . ILE A 1 33  ? -4.767  4.147   1.653   1.00 0.00 ? 33  ILE A HD13 6  
ATOM 9108  N N    . GLU A 1 34  ? -5.745  8.967   -1.784  1.00 0.00 ? 34  GLU A N    6  
ATOM 9109  C CA   . GLU A 1 34  ? -6.485  9.739   -2.767  1.00 0.00 ? 34  GLU A CA   6  
ATOM 9110  C C    . GLU A 1 34  ? -5.820  11.099  -2.985  1.00 0.00 ? 34  GLU A C    6  
ATOM 9111  O O    . GLU A 1 34  ? -5.666  11.543  -4.122  1.00 0.00 ? 34  GLU A O    6  
ATOM 9112  C CB   . GLU A 1 34  ? -7.947  9.905   -2.346  1.00 0.00 ? 34  GLU A CB   6  
ATOM 9113  C CG   . GLU A 1 34  ? -8.770  8.671   -2.724  1.00 0.00 ? 34  GLU A CG   6  
ATOM 9114  C CD   . GLU A 1 34  ? -10.185 9.067   -3.152  1.00 0.00 ? 34  GLU A CD   6  
ATOM 9115  O OE1  . GLU A 1 34  ? -10.338 9.429   -4.338  1.00 0.00 ? 34  GLU A OE1  6  
ATOM 9116  O OE2  . GLU A 1 34  ? -11.081 8.997   -2.283  1.00 0.00 ? 34  GLU A OE2  6  
ATOM 9117  H H    . GLU A 1 34  ? -6.142  8.959   -0.866  1.00 0.00 ? 34  GLU A H    6  
ATOM 9118  H HA   . GLU A 1 34  ? -6.443  9.154   -3.686  1.00 0.00 ? 34  GLU A HA   6  
ATOM 9119  H HB2  . GLU A 1 34  ? -8.003  10.068  -1.269  1.00 0.00 ? 34  GLU A HB2  6  
ATOM 9120  H HB3  . GLU A 1 34  ? -8.369  10.788  -2.824  1.00 0.00 ? 34  GLU A HB3  6  
ATOM 9121  H HG2  . GLU A 1 34  ? -8.277  8.135   -3.535  1.00 0.00 ? 34  GLU A HG2  6  
ATOM 9122  H HG3  . GLU A 1 34  ? -8.820  7.989   -1.875  1.00 0.00 ? 34  GLU A HG3  6  
ATOM 9123  N N    . LYS A 1 35  ? -5.443  11.722  -1.879  1.00 0.00 ? 35  LYS A N    6  
ATOM 9124  C CA   . LYS A 1 35  ? -4.798  13.023  -1.935  1.00 0.00 ? 35  LYS A CA   6  
ATOM 9125  C C    . LYS A 1 35  ? -3.480  12.901  -2.703  1.00 0.00 ? 35  LYS A C    6  
ATOM 9126  O O    . LYS A 1 35  ? -3.039  13.855  -3.341  1.00 0.00 ? 35  LYS A O    6  
ATOM 9127  C CB   . LYS A 1 35  ? -4.637  13.602  -0.528  1.00 0.00 ? 35  LYS A CB   6  
ATOM 9128  C CG   . LYS A 1 35  ? -3.250  13.292  0.038   1.00 0.00 ? 35  LYS A CG   6  
ATOM 9129  C CD   . LYS A 1 35  ? -2.285  14.453  -0.208  1.00 0.00 ? 35  LYS A CD   6  
ATOM 9130  C CE   . LYS A 1 35  ? -2.496  15.569  0.818   1.00 0.00 ? 35  LYS A CE   6  
ATOM 9131  N NZ   . LYS A 1 35  ? -2.018  16.863  0.282   1.00 0.00 ? 35  LYS A NZ   6  
ATOM 9132  H H    . LYS A 1 35  ? -5.572  11.354  -0.958  1.00 0.00 ? 35  LYS A H    6  
ATOM 9133  H HA   . LYS A 1 35  ? -5.458  13.692  -2.486  1.00 0.00 ? 35  LYS A HA   6  
ATOM 9134  H HB2  . LYS A 1 35  ? -4.790  14.681  -0.555  1.00 0.00 ? 35  LYS A HB2  6  
ATOM 9135  H HB3  . LYS A 1 35  ? -5.403  13.190  0.129   1.00 0.00 ? 35  LYS A HB3  6  
ATOM 9136  H HG2  . LYS A 1 35  ? -3.325  13.098  1.108   1.00 0.00 ? 35  LYS A HG2  6  
ATOM 9137  H HG3  . LYS A 1 35  ? -2.860  12.385  -0.424  1.00 0.00 ? 35  LYS A HG3  6  
ATOM 9138  H HD2  . LYS A 1 35  ? -1.257  14.094  -0.154  1.00 0.00 ? 35  LYS A HD2  6  
ATOM 9139  H HD3  . LYS A 1 35  ? -2.432  14.846  -1.214  1.00 0.00 ? 35  LYS A HD3  6  
ATOM 9140  H HE2  . LYS A 1 35  ? -3.554  15.642  1.071   1.00 0.00 ? 35  LYS A HE2  6  
ATOM 9141  H HE3  . LYS A 1 35  ? -1.963  15.330  1.738   1.00 0.00 ? 35  LYS A HE3  6  
ATOM 9142  H HZ1  . LYS A 1 35  ? -1.488  16.703  -0.552  1.00 0.00 ? 35  LYS A HZ1  6  
ATOM 9143  H HZ2  . LYS A 1 35  ? -2.802  17.447  0.072   1.00 0.00 ? 35  LYS A HZ2  6  
ATOM 9144  H HZ3  . LYS A 1 35  ? -1.440  17.312  0.963   1.00 0.00 ? 35  LYS A HZ3  6  
ATOM 9145  N N    . LEU A 1 36  ? -2.889  11.718  -2.617  1.00 0.00 ? 36  LEU A N    6  
ATOM 9146  C CA   . LEU A 1 36  ? -1.631  11.459  -3.297  1.00 0.00 ? 36  LEU A CA   6  
ATOM 9147  C C    . LEU A 1 36  ? -1.911  11.083  -4.753  1.00 0.00 ? 36  LEU A C    6  
ATOM 9148  O O    . LEU A 1 36  ? -1.004  10.680  -5.480  1.00 0.00 ? 36  LEU A O    6  
ATOM 9149  C CB   . LEU A 1 36  ? -0.818  10.409  -2.537  1.00 0.00 ? 36  LEU A CB   6  
ATOM 9150  C CG   . LEU A 1 36  ? -0.233  10.856  -1.195  1.00 0.00 ? 36  LEU A CG   6  
ATOM 9151  C CD1  . LEU A 1 36  ? 0.121   9.650   -0.323  1.00 0.00 ? 36  LEU A CD1  6  
ATOM 9152  C CD2  . LEU A 1 36  ? 0.963   11.787  -1.402  1.00 0.00 ? 36  LEU A CD2  6  
ATOM 9153  H H    . LEU A 1 36  ? -3.255  10.946  -2.097  1.00 0.00 ? 36  LEU A H    6  
ATOM 9154  H HA   . LEU A 1 36  ? -1.056  12.384  -3.283  1.00 0.00 ? 36  LEU A HA   6  
ATOM 9155  H HB2  . LEU A 1 36  ? -1.454  9.541   -2.362  1.00 0.00 ? 36  LEU A HB2  6  
ATOM 9156  H HB3  . LEU A 1 36  ? 0.001   10.080  -3.176  1.00 0.00 ? 36  LEU A HB3  6  
ATOM 9157  H HG   . LEU A 1 36  ? -0.996  11.425  -0.663  1.00 0.00 ? 36  LEU A HG   6  
ATOM 9158  H HD11 . LEU A 1 36  ? -0.074  8.732   -0.876  1.00 0.00 ? 36  LEU A HD11 6  
ATOM 9159  H HD12 . LEU A 1 36  ? 1.177   9.695   -0.054  1.00 0.00 ? 36  LEU A HD12 6  
ATOM 9160  H HD13 . LEU A 1 36  ? -0.485  9.666   0.583   1.00 0.00 ? 36  LEU A HD13 6  
ATOM 9161  H HD21 . LEU A 1 36  ? 1.026   12.488  -0.570  1.00 0.00 ? 36  LEU A HD21 6  
ATOM 9162  H HD22 . LEU A 1 36  ? 1.879   11.196  -1.448  1.00 0.00 ? 36  LEU A HD22 6  
ATOM 9163  H HD23 . LEU A 1 36  ? 0.839   12.338  -2.334  1.00 0.00 ? 36  LEU A HD23 6  
ATOM 9164  N N    . GLY A 1 37  ? -3.171  11.228  -5.137  1.00 0.00 ? 37  GLY A N    6  
ATOM 9165  C CA   . GLY A 1 37  ? -3.582  10.909  -6.493  1.00 0.00 ? 37  GLY A CA   6  
ATOM 9166  C C    . GLY A 1 37  ? -3.871  9.413   -6.642  1.00 0.00 ? 37  GLY A C    6  
ATOM 9167  O O    . GLY A 1 37  ? -4.421  8.981   -7.654  1.00 0.00 ? 37  GLY A O    6  
ATOM 9168  H H    . GLY A 1 37  ? -3.903  11.556  -4.540  1.00 0.00 ? 37  GLY A H    6  
ATOM 9169  H HA2  . GLY A 1 37  ? -4.472  11.482  -6.752  1.00 0.00 ? 37  GLY A HA2  6  
ATOM 9170  H HA3  . GLY A 1 37  ? -2.800  11.202  -7.193  1.00 0.00 ? 37  GLY A HA3  6  
ATOM 9171  N N    . GLY A 1 38  ? -3.488  8.665   -5.618  1.00 0.00 ? 38  GLY A N    6  
ATOM 9172  C CA   . GLY A 1 38  ? -3.699  7.228   -5.621  1.00 0.00 ? 38  GLY A CA   6  
ATOM 9173  C C    . GLY A 1 38  ? -5.171  6.889   -5.377  1.00 0.00 ? 38  GLY A C    6  
ATOM 9174  O O    . GLY A 1 38  ? -6.026  7.773   -5.396  1.00 0.00 ? 38  GLY A O    6  
ATOM 9175  H H    . GLY A 1 38  ? -3.042  9.025   -4.798  1.00 0.00 ? 38  GLY A H    6  
ATOM 9176  H HA2  . GLY A 1 38  ? -3.380  6.812   -6.577  1.00 0.00 ? 38  GLY A HA2  6  
ATOM 9177  H HA3  . GLY A 1 38  ? -3.083  6.764   -4.850  1.00 0.00 ? 38  GLY A HA3  6  
ATOM 9178  N N    . LYS A 1 39  ? -5.421  5.607   -5.154  1.00 0.00 ? 39  LYS A N    6  
ATOM 9179  C CA   . LYS A 1 39  ? -6.775  5.141   -4.907  1.00 0.00 ? 39  LYS A CA   6  
ATOM 9180  C C    . LYS A 1 39  ? -6.727  3.903   -4.008  1.00 0.00 ? 39  LYS A C    6  
ATOM 9181  O O    . LYS A 1 39  ? -5.921  3.001   -4.230  1.00 0.00 ? 39  LYS A O    6  
ATOM 9182  C CB   . LYS A 1 39  ? -7.513  4.913   -6.228  1.00 0.00 ? 39  LYS A CB   6  
ATOM 9183  C CG   . LYS A 1 39  ? -8.297  6.161   -6.640  1.00 0.00 ? 39  LYS A CG   6  
ATOM 9184  C CD   . LYS A 1 39  ? -9.663  5.784   -7.217  1.00 0.00 ? 39  LYS A CD   6  
ATOM 9185  C CE   . LYS A 1 39  ? -9.726  6.084   -8.716  1.00 0.00 ? 39  LYS A CE   6  
ATOM 9186  N NZ   . LYS A 1 39  ? -11.017 6.719   -9.063  1.00 0.00 ? 39  LYS A NZ   6  
ATOM 9187  H H    . LYS A 1 39  ? -4.720  4.894   -5.140  1.00 0.00 ? 39  LYS A H    6  
ATOM 9188  H HA   . LYS A 1 39  ? -7.302  5.933   -4.376  1.00 0.00 ? 39  LYS A HA   6  
ATOM 9189  H HB2  . LYS A 1 39  ? -6.798  4.654   -7.009  1.00 0.00 ? 39  LYS A HB2  6  
ATOM 9190  H HB3  . LYS A 1 39  ? -8.194  4.068   -6.127  1.00 0.00 ? 39  LYS A HB3  6  
ATOM 9191  H HG2  . LYS A 1 39  ? -8.430  6.812   -5.776  1.00 0.00 ? 39  LYS A HG2  6  
ATOM 9192  H HG3  . LYS A 1 39  ? -7.728  6.724   -7.379  1.00 0.00 ? 39  LYS A HG3  6  
ATOM 9193  H HD2  . LYS A 1 39  ? -9.854  4.725   -7.047  1.00 0.00 ? 39  LYS A HD2  6  
ATOM 9194  H HD3  . LYS A 1 39  ? -10.446 6.337   -6.698  1.00 0.00 ? 39  LYS A HD3  6  
ATOM 9195  H HE2  . LYS A 1 39  ? -8.904  6.743   -8.996  1.00 0.00 ? 39  LYS A HE2  6  
ATOM 9196  H HE3  . LYS A 1 39  ? -9.603  5.162   -9.283  1.00 0.00 ? 39  LYS A HE3  6  
ATOM 9197  H HZ1  . LYS A 1 39  ? -10.986 7.042   -10.009 1.00 0.00 ? 39  LYS A HZ1  6  
ATOM 9198  H HZ2  . LYS A 1 39  ? -11.755 6.050   -8.964  1.00 0.00 ? 39  LYS A HZ2  6  
ATOM 9199  H HZ3  . LYS A 1 39  ? -11.184 7.492   -8.452  1.00 0.00 ? 39  LYS A HZ3  6  
ATOM 9200  N N    . LEU A 1 40  ? -7.601  3.901   -3.012  1.00 0.00 ? 40  LEU A N    6  
ATOM 9201  C CA   . LEU A 1 40  ? -7.669  2.789   -2.079  1.00 0.00 ? 40  LEU A CA   6  
ATOM 9202  C C    . LEU A 1 40  ? -8.585  1.704   -2.650  1.00 0.00 ? 40  LEU A C    6  
ATOM 9203  O O    . LEU A 1 40  ? -9.628  2.008   -3.227  1.00 0.00 ? 40  LEU A O    6  
ATOM 9204  C CB   . LEU A 1 40  ? -8.088  3.279   -0.692  1.00 0.00 ? 40  LEU A CB   6  
ATOM 9205  C CG   . LEU A 1 40  ? -7.903  2.284   0.456   1.00 0.00 ? 40  LEU A CG   6  
ATOM 9206  C CD1  . LEU A 1 40  ? -7.039  2.884   1.567   1.00 0.00 ? 40  LEU A CD1  6  
ATOM 9207  C CD2  . LEU A 1 40  ? -9.254  1.795   0.981   1.00 0.00 ? 40  LEU A CD2  6  
ATOM 9208  H H    . LEU A 1 40  ? -8.254  4.639   -2.839  1.00 0.00 ? 40  LEU A H    6  
ATOM 9209  H HA   . LEU A 1 40  ? -6.664  2.379   -1.986  1.00 0.00 ? 40  LEU A HA   6  
ATOM 9210  H HB2  . LEU A 1 40  ? -7.521  4.181   -0.460  1.00 0.00 ? 40  LEU A HB2  6  
ATOM 9211  H HB3  . LEU A 1 40  ? -9.139  3.566   -0.731  1.00 0.00 ? 40  LEU A HB3  6  
ATOM 9212  H HG   . LEU A 1 40  ? -7.372  1.413   0.070   1.00 0.00 ? 40  LEU A HG   6  
ATOM 9213  H HD11 . LEU A 1 40  ? -6.166  2.251   1.730   1.00 0.00 ? 40  LEU A HD11 6  
ATOM 9214  H HD12 . LEU A 1 40  ? -6.714  3.883   1.276   1.00 0.00 ? 40  LEU A HD12 6  
ATOM 9215  H HD13 . LEU A 1 40  ? -7.620  2.944   2.487   1.00 0.00 ? 40  LEU A HD13 6  
ATOM 9216  H HD21 . LEU A 1 40  ? -9.932  1.633   0.143   1.00 0.00 ? 40  LEU A HD21 6  
ATOM 9217  H HD22 . LEU A 1 40  ? -9.116  0.858   1.522   1.00 0.00 ? 40  LEU A HD22 6  
ATOM 9218  H HD23 . LEU A 1 40  ? -9.676  2.543   1.652   1.00 0.00 ? 40  LEU A HD23 6  
ATOM 9219  N N    . THR A 1 41  ? -8.161  0.462   -2.470  1.00 0.00 ? 41  THR A N    6  
ATOM 9220  C CA   . THR A 1 41  ? -8.930  -0.669  -2.960  1.00 0.00 ? 41  THR A CA   6  
ATOM 9221  C C    . THR A 1 41  ? -9.225  -1.647  -1.821  1.00 0.00 ? 41  THR A C    6  
ATOM 9222  O O    . THR A 1 41  ? -8.635  -1.550  -0.746  1.00 0.00 ? 41  THR A O    6  
ATOM 9223  C CB   . THR A 1 41  ? -8.155  -1.301  -4.118  1.00 0.00 ? 41  THR A CB   6  
ATOM 9224  O OG1  . THR A 1 41  ? -8.902  -2.472  -4.437  1.00 0.00 ? 41  THR A OG1  6  
ATOM 9225  C CG2  . THR A 1 41  ? -6.789  -1.837  -3.685  1.00 0.00 ? 41  THR A CG2  6  
ATOM 9226  H H    . THR A 1 41  ? -7.312  0.224   -1.999  1.00 0.00 ? 41  THR A H    6  
ATOM 9227  H HA   . THR A 1 41  ? -9.890  -0.302  -3.322  1.00 0.00 ? 41  THR A HA   6  
ATOM 9228  H HB   . THR A 1 41  ? -8.054  -0.600  -4.947  1.00 0.00 ? 41  THR A HB   6  
ATOM 9229  H HG1  . THR A 1 41  ? -8.847  -3.128  -3.685  1.00 0.00 ? 41  THR A HG1  6  
ATOM 9230  H HG21 . THR A 1 41  ? -6.482  -1.346  -2.762  1.00 0.00 ? 41  THR A HG21 6  
ATOM 9231  H HG22 . THR A 1 41  ? -6.856  -2.912  -3.520  1.00 0.00 ? 41  THR A HG22 6  
ATOM 9232  H HG23 . THR A 1 41  ? -6.055  -1.634  -4.465  1.00 0.00 ? 41  THR A HG23 6  
ATOM 9233  N N    . GLY A 1 42  ? -10.137 -2.568  -2.096  1.00 0.00 ? 42  GLY A N    6  
ATOM 9234  C CA   . GLY A 1 42  ? -10.517 -3.563  -1.107  1.00 0.00 ? 42  GLY A CA   6  
ATOM 9235  C C    . GLY A 1 42  ? -9.769  -4.877  -1.336  1.00 0.00 ? 42  GLY A C    6  
ATOM 9236  O O    . GLY A 1 42  ? -9.290  -5.497  -0.388  1.00 0.00 ? 42  GLY A O    6  
ATOM 9237  H H    . GLY A 1 42  ? -10.612 -2.640  -2.972  1.00 0.00 ? 42  GLY A H    6  
ATOM 9238  H HA2  . GLY A 1 42  ? -10.303 -3.188  -0.107  1.00 0.00 ? 42  GLY A HA2  6  
ATOM 9239  H HA3  . GLY A 1 42  ? -11.592 -3.739  -1.158  1.00 0.00 ? 42  GLY A HA3  6  
ATOM 9240  N N    . THR A 1 43  ? -9.691  -5.265  -2.601  1.00 0.00 ? 43  THR A N    6  
ATOM 9241  C CA   . THR A 1 43  ? -9.009  -6.494  -2.967  1.00 0.00 ? 43  THR A CA   6  
ATOM 9242  C C    . THR A 1 43  ? -7.497  -6.270  -3.017  1.00 0.00 ? 43  THR A C    6  
ATOM 9243  O O    . THR A 1 43  ? -7.037  -5.137  -3.154  1.00 0.00 ? 43  THR A O    6  
ATOM 9244  C CB   . THR A 1 43  ? -9.595  -6.983  -4.293  1.00 0.00 ? 43  THR A CB   6  
ATOM 9245  O OG1  . THR A 1 43  ? -10.985 -6.685  -4.190  1.00 0.00 ? 43  THR A OG1  6  
ATOM 9246  C CG2  . THR A 1 43  ? -9.550  -8.507  -4.426  1.00 0.00 ? 43  THR A CG2  6  
ATOM 9247  H H    . THR A 1 43  ? -10.084 -4.755  -3.367  1.00 0.00 ? 43  THR A H    6  
ATOM 9248  H HA   . THR A 1 43  ? -9.197  -7.236  -2.190  1.00 0.00 ? 43  THR A HA   6  
ATOM 9249  H HB   . THR A 1 43  ? -9.101  -6.504  -5.138  1.00 0.00 ? 43  THR A HB   6  
ATOM 9250  H HG1  . THR A 1 43  ? -11.340 -6.399  -5.079  1.00 0.00 ? 43  THR A HG1  6  
ATOM 9251  H HG21 . THR A 1 43  ? -10.438 -8.852  -4.957  1.00 0.00 ? 43  THR A HG21 6  
ATOM 9252  H HG22 . THR A 1 43  ? -8.659  -8.797  -4.983  1.00 0.00 ? 43  THR A HG22 6  
ATOM 9253  H HG23 . THR A 1 43  ? -9.522  -8.958  -3.434  1.00 0.00 ? 43  THR A HG23 6  
ATOM 9254  N N    . ALA A 1 44  ? -6.764  -7.368  -2.904  1.00 0.00 ? 44  ALA A N    6  
ATOM 9255  C CA   . ALA A 1 44  ? -5.313  -7.306  -2.935  1.00 0.00 ? 44  ALA A CA   6  
ATOM 9256  C C    . ALA A 1 44  ? -4.824  -7.590  -4.357  1.00 0.00 ? 44  ALA A C    6  
ATOM 9257  O O    . ALA A 1 44  ? -3.942  -6.899  -4.863  1.00 0.00 ? 44  ALA A O    6  
ATOM 9258  C CB   . ALA A 1 44  ? -4.738  -8.290  -1.914  1.00 0.00 ? 44  ALA A CB   6  
ATOM 9259  H H    . ALA A 1 44  ? -7.145  -8.286  -2.794  1.00 0.00 ? 44  ALA A H    6  
ATOM 9260  H HA   . ALA A 1 44  ? -5.018  -6.295  -2.653  1.00 0.00 ? 44  ALA A HA   6  
ATOM 9261  H HB1  . ALA A 1 44  ? -5.262  -9.243  -1.992  1.00 0.00 ? 44  ALA A HB1  6  
ATOM 9262  H HB2  . ALA A 1 44  ? -3.677  -8.441  -2.113  1.00 0.00 ? 44  ALA A HB2  6  
ATOM 9263  H HB3  . ALA A 1 44  ? -4.865  -7.887  -0.909  1.00 0.00 ? 44  ALA A HB3  6  
ATOM 9264  N N    . ASN A 1 45  ? -5.420  -8.608  -4.961  1.00 0.00 ? 45  ASN A N    6  
ATOM 9265  C CA   . ASN A 1 45  ? -5.056  -8.991  -6.314  1.00 0.00 ? 45  ASN A CA   6  
ATOM 9266  C C    . ASN A 1 45  ? -5.332  -7.823  -7.262  1.00 0.00 ? 45  ASN A C    6  
ATOM 9267  O O    . ASN A 1 45  ? -4.609  -7.626  -8.238  1.00 0.00 ? 45  ASN A O    6  
ATOM 9268  C CB   . ASN A 1 45  ? -5.882  -10.189 -6.788  1.00 0.00 ? 45  ASN A CB   6  
ATOM 9269  C CG   . ASN A 1 45  ? -5.694  -10.426 -8.288  1.00 0.00 ? 45  ASN A CG   6  
ATOM 9270  O OD1  . ASN A 1 45  ? -4.603  -10.684 -8.770  1.00 0.00 ? 45  ASN A OD1  6  
ATOM 9271  N ND2  . ASN A 1 45  ? -6.815  -10.325 -8.996  1.00 0.00 ? 45  ASN A ND2  6  
ATOM 9272  H H    . ASN A 1 45  ? -6.137  -9.165  -4.542  1.00 0.00 ? 45  ASN A H    6  
ATOM 9273  H HA   . ASN A 1 45  ? -3.998  -9.247  -6.265  1.00 0.00 ? 45  ASN A HA   6  
ATOM 9274  H HB2  . ASN A 1 45  ? -5.586  -11.081 -6.235  1.00 0.00 ? 45  ASN A HB2  6  
ATOM 9275  H HB3  . ASN A 1 45  ? -6.937  -10.017 -6.573  1.00 0.00 ? 45  ASN A HB3  6  
ATOM 9276  H HD21 . ASN A 1 45  ? -7.678  -10.111 -8.538  1.00 0.00 ? 45  ASN A HD21 6  
ATOM 9277  H HD22 . ASN A 1 45  ? -6.795  -10.463 -9.986  1.00 0.00 ? 45  ASN A HD22 6  
ATOM 9278  N N    . LYS A 1 46  ? -6.380  -7.077  -6.943  1.00 0.00 ? 46  LYS A N    6  
ATOM 9279  C CA   . LYS A 1 46  ? -6.761  -5.934  -7.754  1.00 0.00 ? 46  LYS A CA   6  
ATOM 9280  C C    . LYS A 1 46  ? -6.166  -4.662  -7.145  1.00 0.00 ? 46  LYS A C    6  
ATOM 9281  O O    . LYS A 1 46  ? -6.810  -3.614  -7.136  1.00 0.00 ? 46  LYS A O    6  
ATOM 9282  C CB   . LYS A 1 46  ? -8.280  -5.881  -7.926  1.00 0.00 ? 46  LYS A CB   6  
ATOM 9283  C CG   . LYS A 1 46  ? -8.801  -7.157  -8.590  1.00 0.00 ? 46  LYS A CG   6  
ATOM 9284  C CD   . LYS A 1 46  ? -9.233  -8.184  -7.542  1.00 0.00 ? 46  LYS A CD   6  
ATOM 9285  C CE   . LYS A 1 46  ? -10.268 -9.153  -8.117  1.00 0.00 ? 46  LYS A CE   6  
ATOM 9286  N NZ   . LYS A 1 46  ? -11.585 -8.945  -7.476  1.00 0.00 ? 46  LYS A NZ   6  
ATOM 9287  H H    . LYS A 1 46  ? -6.963  -7.244  -6.147  1.00 0.00 ? 46  LYS A H    6  
ATOM 9288  H HA   . LYS A 1 46  ? -6.329  -6.077  -8.744  1.00 0.00 ? 46  LYS A HA   6  
ATOM 9289  H HB2  . LYS A 1 46  ? -8.756  -5.752  -6.954  1.00 0.00 ? 46  LYS A HB2  6  
ATOM 9290  H HB3  . LYS A 1 46  ? -8.551  -5.015  -8.531  1.00 0.00 ? 46  LYS A HB3  6  
ATOM 9291  H HG2  . LYS A 1 46  ? -9.645  -6.916  -9.237  1.00 0.00 ? 46  LYS A HG2  6  
ATOM 9292  H HG3  . LYS A 1 46  ? -8.025  -7.584  -9.225  1.00 0.00 ? 46  LYS A HG3  6  
ATOM 9293  H HD2  . LYS A 1 46  ? -8.363  -8.740  -7.193  1.00 0.00 ? 46  LYS A HD2  6  
ATOM 9294  H HD3  . LYS A 1 46  ? -9.651  -7.671  -6.676  1.00 0.00 ? 46  LYS A HD3  6  
ATOM 9295  H HE2  . LYS A 1 46  ? -10.353 -9.006  -9.193  1.00 0.00 ? 46  LYS A HE2  6  
ATOM 9296  H HE3  . LYS A 1 46  ? -9.939  -10.180 -7.961  1.00 0.00 ? 46  LYS A HE3  6  
ATOM 9297  H HZ1  . LYS A 1 46  ? -11.597 -9.398  -6.584  1.00 0.00 ? 46  LYS A HZ1  6  
ATOM 9298  H HZ2  . LYS A 1 46  ? -11.746 -7.965  -7.354  1.00 0.00 ? 46  LYS A HZ2  6  
ATOM 9299  H HZ3  . LYS A 1 46  ? -12.303 -9.331  -8.055  1.00 0.00 ? 46  LYS A HZ3  6  
ATOM 9300  N N    . ALA A 1 47  ? -4.945  -4.796  -6.650  1.00 0.00 ? 47  ALA A N    6  
ATOM 9301  C CA   . ALA A 1 47  ? -4.256  -3.671  -6.041  1.00 0.00 ? 47  ALA A CA   6  
ATOM 9302  C C    . ALA A 1 47  ? -2.871  -3.523  -6.673  1.00 0.00 ? 47  ALA A C    6  
ATOM 9303  O O    . ALA A 1 47  ? -2.341  -4.474  -7.246  1.00 0.00 ? 47  ALA A O    6  
ATOM 9304  C CB   . ALA A 1 47  ? -4.187  -3.874  -4.526  1.00 0.00 ? 47  ALA A CB   6  
ATOM 9305  H H    . ALA A 1 47  ? -4.428  -5.652  -6.661  1.00 0.00 ? 47  ALA A H    6  
ATOM 9306  H HA   . ALA A 1 47  ? -4.839  -2.773  -6.249  1.00 0.00 ? 47  ALA A HA   6  
ATOM 9307  H HB1  . ALA A 1 47  ? -3.153  -3.783  -4.194  1.00 0.00 ? 47  ALA A HB1  6  
ATOM 9308  H HB2  . ALA A 1 47  ? -4.796  -3.118  -4.030  1.00 0.00 ? 47  ALA A HB2  6  
ATOM 9309  H HB3  . ALA A 1 47  ? -4.564  -4.866  -4.275  1.00 0.00 ? 47  ALA A HB3  6  
ATOM 9310  N N    . SER A 1 48  ? -2.323  -2.324  -6.547  1.00 0.00 ? 48  SER A N    6  
ATOM 9311  C CA   . SER A 1 48  ? -1.009  -2.039  -7.099  1.00 0.00 ? 48  SER A CA   6  
ATOM 9312  C C    . SER A 1 48  ? 0.044   -2.075  -5.989  1.00 0.00 ? 48  SER A C    6  
ATOM 9313  O O    . SER A 1 48  ? 1.209   -2.377  -6.243  1.00 0.00 ? 48  SER A O    6  
ATOM 9314  C CB   . SER A 1 48  ? -0.990  -0.682  -7.804  1.00 0.00 ? 48  SER A CB   6  
ATOM 9315  O OG   . SER A 1 48  ? -2.044  -0.559  -8.755  1.00 0.00 ? 48  SER A OG   6  
ATOM 9316  H H    . SER A 1 48  ? -2.760  -1.555  -6.079  1.00 0.00 ? 48  SER A H    6  
ATOM 9317  H HA   . SER A 1 48  ? -0.824  -2.829  -7.827  1.00 0.00 ? 48  SER A HA   6  
ATOM 9318  H HB2  . SER A 1 48  ? -1.076  0.113   -7.063  1.00 0.00 ? 48  SER A HB2  6  
ATOM 9319  H HB3  . SER A 1 48  ? -0.032  -0.547  -8.306  1.00 0.00 ? 48  SER A HB3  6  
ATOM 9320  H HG   . SER A 1 48  ? -1.666  -0.439  -9.672  1.00 0.00 ? 48  SER A HG   6  
ATOM 9321  N N    . LEU A 1 49  ? -0.404  -1.763  -4.782  1.00 0.00 ? 49  LEU A N    6  
ATOM 9322  C CA   . LEU A 1 49  ? 0.484   -1.756  -3.632  1.00 0.00 ? 49  LEU A CA   6  
ATOM 9323  C C    . LEU A 1 49  ? -0.308  -2.129  -2.378  1.00 0.00 ? 49  LEU A C    6  
ATOM 9324  O O    . LEU A 1 49  ? -1.527  -1.965  -2.338  1.00 0.00 ? 49  LEU A O    6  
ATOM 9325  C CB   . LEU A 1 49  ? 1.211   -0.414  -3.525  1.00 0.00 ? 49  LEU A CB   6  
ATOM 9326  C CG   . LEU A 1 49  ? 1.819   -0.088  -2.159  1.00 0.00 ? 49  LEU A CG   6  
ATOM 9327  C CD1  . LEU A 1 49  ? 3.146   -0.823  -1.961  1.00 0.00 ? 49  LEU A CD1  6  
ATOM 9328  C CD2  . LEU A 1 49  ? 1.968   1.423   -1.972  1.00 0.00 ? 49  LEU A CD2  6  
ATOM 9329  H H    . LEU A 1 49  ? -1.354  -1.519  -4.583  1.00 0.00 ? 49  LEU A H    6  
ATOM 9330  H HA   . LEU A 1 49  ? 1.243   -2.520  -3.801  1.00 0.00 ? 49  LEU A HA   6  
ATOM 9331  H HB2  . LEU A 1 49  ? 2.007   -0.393  -4.269  1.00 0.00 ? 49  LEU A HB2  6  
ATOM 9332  H HB3  . LEU A 1 49  ? 0.509   0.378   -3.786  1.00 0.00 ? 49  LEU A HB3  6  
ATOM 9333  H HG   . LEU A 1 49  ? 1.136   -0.442  -1.387  1.00 0.00 ? 49  LEU A HG   6  
ATOM 9334  H HD11 . LEU A 1 49  ? 3.246   -1.602  -2.717  1.00 0.00 ? 49  LEU A HD11 6  
ATOM 9335  H HD12 . LEU A 1 49  ? 3.971   -0.117  -2.055  1.00 0.00 ? 49  LEU A HD12 6  
ATOM 9336  H HD13 . LEU A 1 49  ? 3.166   -1.275  -0.969  1.00 0.00 ? 49  LEU A HD13 6  
ATOM 9337  H HD21 . LEU A 1 49  ? 1.928   1.915   -2.944  1.00 0.00 ? 49  LEU A HD21 6  
ATOM 9338  H HD22 . LEU A 1 49  ? 1.157   1.793   -1.344  1.00 0.00 ? 49  LEU A HD22 6  
ATOM 9339  H HD23 . LEU A 1 49  ? 2.924   1.638   -1.495  1.00 0.00 ? 49  LEU A HD23 6  
ATOM 9340  N N    . CYS A 1 50  ? 0.416   -2.622  -1.384  1.00 0.00 ? 50  CYS A N    6  
ATOM 9341  C CA   . CYS A 1 50  ? -0.205  -3.019  -0.131  1.00 0.00 ? 50  CYS A CA   6  
ATOM 9342  C C    . CYS A 1 50  ? 0.441   -2.217  1.000   1.00 0.00 ? 50  CYS A C    6  
ATOM 9343  O O    . CYS A 1 50  ? 1.641   -1.948  0.969   1.00 0.00 ? 50  CYS A O    6  
ATOM 9344  C CB   . CYS A 1 50  ? -0.093  -4.527  0.102   1.00 0.00 ? 50  CYS A CB   6  
ATOM 9345  S SG   . CYS A 1 50  ? -1.104  -5.013  1.548   1.00 0.00 ? 50  CYS A SG   6  
ATOM 9346  H H    . CYS A 1 50  ? 1.406   -2.752  -1.424  1.00 0.00 ? 50  CYS A H    6  
ATOM 9347  H HA   . CYS A 1 50  ? -1.265  -2.782  -0.218  1.00 0.00 ? 50  CYS A HA   6  
ATOM 9348  H HB2  . CYS A 1 50  ? -0.427  -5.066  -0.784  1.00 0.00 ? 50  CYS A HB2  6  
ATOM 9349  H HB3  . CYS A 1 50  ? 0.949   -4.801  0.268   1.00 0.00 ? 50  CYS A HB3  6  
ATOM 9350  H HG   . CYS A 1 50  ? -2.163  -4.273  1.232   1.00 0.00 ? 50  CYS A HG   6  
ATOM 9351  N N    . ILE A 1 51  ? -0.384  -1.856  1.972   1.00 0.00 ? 51  ILE A N    6  
ATOM 9352  C CA   . ILE A 1 51  ? 0.092   -1.090  3.112   1.00 0.00 ? 51  ILE A CA   6  
ATOM 9353  C C    . ILE A 1 51  ? -0.334  -1.789  4.404   1.00 0.00 ? 51  ILE A C    6  
ATOM 9354  O O    . ILE A 1 51  ? -1.447  -1.585  4.887   1.00 0.00 ? 51  ILE A O    6  
ATOM 9355  C CB   . ILE A 1 51  ? -0.378  0.363   3.014   1.00 0.00 ? 51  ILE A CB   6  
ATOM 9356  C CG1  . ILE A 1 51  ? 0.288   1.077   1.836   1.00 0.00 ? 51  ILE A CG1  6  
ATOM 9357  C CG2  . ILE A 1 51  ? -0.153  1.102   4.335   1.00 0.00 ? 51  ILE A CG2  6  
ATOM 9358  C CD1  . ILE A 1 51  ? -0.132  2.547   1.778   1.00 0.00 ? 51  ILE A CD1  6  
ATOM 9359  H H    . ILE A 1 51  ? -1.358  -2.079  1.990   1.00 0.00 ? 51  ILE A H    6  
ATOM 9360  H HA   . ILE A 1 51  ? 1.181   -1.080  3.067   1.00 0.00 ? 51  ILE A HA   6  
ATOM 9361  H HB   . ILE A 1 51  ? -1.452  0.362   2.825   1.00 0.00 ? 51  ILE A HB   6  
ATOM 9362  H HG12 . ILE A 1 51  ? 1.372   1.008   1.931   1.00 0.00 ? 51  ILE A HG12 6  
ATOM 9363  H HG13 . ILE A 1 51  ? 0.018   0.580   0.905   1.00 0.00 ? 51  ILE A HG13 6  
ATOM 9364  H HG21 . ILE A 1 51  ? -1.116  1.362   4.775   1.00 0.00 ? 51  ILE A HG21 6  
ATOM 9365  H HG22 . ILE A 1 51  ? 0.399   0.459   5.021   1.00 0.00 ? 51  ILE A HG22 6  
ATOM 9366  H HG23 . ILE A 1 51  ? 0.419   2.011   4.149   1.00 0.00 ? 51  ILE A HG23 6  
ATOM 9367  H HD11 . ILE A 1 51  ? 0.039   2.934   0.773   1.00 0.00 ? 51  ILE A HD11 6  
ATOM 9368  H HD12 . ILE A 1 51  ? -1.190  2.632   2.024   1.00 0.00 ? 51  ILE A HD12 6  
ATOM 9369  H HD13 . ILE A 1 51  ? 0.456   3.121   2.494   1.00 0.00 ? 51  ILE A HD13 6  
ATOM 9370  N N    . SER A 1 52  ? 0.574   -2.598  4.929   1.00 0.00 ? 52  SER A N    6  
ATOM 9371  C CA   . SER A 1 52  ? 0.307   -3.328  6.156   1.00 0.00 ? 52  SER A CA   6  
ATOM 9372  C C    . SER A 1 52  ? 1.457   -3.129  7.145   1.00 0.00 ? 52  SER A C    6  
ATOM 9373  O O    . SER A 1 52  ? 2.352   -2.319  6.907   1.00 0.00 ? 52  SER A O    6  
ATOM 9374  C CB   . SER A 1 52  ? 0.099   -4.818  5.877   1.00 0.00 ? 52  SER A CB   6  
ATOM 9375  O OG   . SER A 1 52  ? -0.693  -5.444  6.883   1.00 0.00 ? 52  SER A OG   6  
ATOM 9376  H H    . SER A 1 52  ? 1.477   -2.758  4.530   1.00 0.00 ? 52  SER A H    6  
ATOM 9377  H HA   . SER A 1 52  ? -0.615  -2.901  6.551   1.00 0.00 ? 52  SER A HA   6  
ATOM 9378  H HB2  . SER A 1 52  ? -0.383  -4.941  4.907   1.00 0.00 ? 52  SER A HB2  6  
ATOM 9379  H HB3  . SER A 1 52  ? 1.068   -5.314  5.817   1.00 0.00 ? 52  SER A HB3  6  
ATOM 9380  H HG   . SER A 1 52  ? -1.338  -4.785  7.270   1.00 0.00 ? 52  SER A HG   6  
ATOM 9381  N N    . THR A 1 53  ? 1.396   -3.881  8.234   1.00 0.00 ? 53  THR A N    6  
ATOM 9382  C CA   . THR A 1 53  ? 2.422   -3.798  9.260   1.00 0.00 ? 53  THR A CA   6  
ATOM 9383  C C    . THR A 1 53  ? 3.284   -5.062  9.257   1.00 0.00 ? 53  THR A C    6  
ATOM 9384  O O    . THR A 1 53  ? 2.884   -6.089  8.712   1.00 0.00 ? 53  THR A O    6  
ATOM 9385  C CB   . THR A 1 53  ? 1.731   -3.537  10.599  1.00 0.00 ? 53  THR A CB   6  
ATOM 9386  O OG1  . THR A 1 53  ? 0.740   -4.558  10.683  1.00 0.00 ? 53  THR A OG1  6  
ATOM 9387  C CG2  . THR A 1 53  ? 0.926   -2.236  10.600  1.00 0.00 ? 53  THR A CG2  6  
ATOM 9388  H H    . THR A 1 53  ? 0.665   -4.538  8.420   1.00 0.00 ? 53  THR A H    6  
ATOM 9389  H HA   . THR A 1 53  ? 3.079   -2.962  9.021   1.00 0.00 ? 53  THR A HA   6  
ATOM 9390  H HB   . THR A 1 53  ? 2.450   -3.550  11.418  1.00 0.00 ? 53  THR A HB   6  
ATOM 9391  H HG1  . THR A 1 53  ? 0.708   -4.928  11.612  1.00 0.00 ? 53  THR A HG1  6  
ATOM 9392  H HG21 . THR A 1 53  ? 1.360   -1.540  9.882   1.00 0.00 ? 53  THR A HG21 6  
ATOM 9393  H HG22 . THR A 1 53  ? -0.107  -2.447  10.322  1.00 0.00 ? 53  THR A HG22 6  
ATOM 9394  H HG23 . THR A 1 53  ? 0.951   -1.793  11.596  1.00 0.00 ? 53  THR A HG23 6  
ATOM 9395  N N    . LYS A 1 54  ? 4.452   -4.944  9.871   1.00 0.00 ? 54  LYS A N    6  
ATOM 9396  C CA   . LYS A 1 54  ? 5.374   -6.065  9.946   1.00 0.00 ? 54  LYS A CA   6  
ATOM 9397  C C    . LYS A 1 54  ? 4.640   -7.288  10.500  1.00 0.00 ? 54  LYS A C    6  
ATOM 9398  O O    . LYS A 1 54  ? 4.641   -8.350  9.880   1.00 0.00 ? 54  LYS A O    6  
ATOM 9399  C CB   . LYS A 1 54  ? 6.620   -5.681  10.747  1.00 0.00 ? 54  LYS A CB   6  
ATOM 9400  C CG   . LYS A 1 54  ? 7.561   -6.877  10.905  1.00 0.00 ? 54  LYS A CG   6  
ATOM 9401  C CD   . LYS A 1 54  ? 9.023   -6.426  10.925  1.00 0.00 ? 54  LYS A CD   6  
ATOM 9402  C CE   . LYS A 1 54  ? 9.749   -6.864  9.652   1.00 0.00 ? 54  LYS A CE   6  
ATOM 9403  N NZ   . LYS A 1 54  ? 10.788  -7.869  9.968   1.00 0.00 ? 54  LYS A NZ   6  
ATOM 9404  H H    . LYS A 1 54  ? 4.770   -4.105  10.312  1.00 0.00 ? 54  LYS A H    6  
ATOM 9405  H HA   . LYS A 1 54  ? 5.700   -6.288  8.930   1.00 0.00 ? 54  LYS A HA   6  
ATOM 9406  H HB2  . LYS A 1 54  ? 7.143   -4.866  10.245  1.00 0.00 ? 54  LYS A HB2  6  
ATOM 9407  H HB3  . LYS A 1 54  ? 6.326   -5.312  11.729  1.00 0.00 ? 54  LYS A HB3  6  
ATOM 9408  H HG2  . LYS A 1 54  ? 7.327   -7.408  11.828  1.00 0.00 ? 54  LYS A HG2  6  
ATOM 9409  H HG3  . LYS A 1 54  ? 7.404   -7.578  10.085  1.00 0.00 ? 54  LYS A HG3  6  
ATOM 9410  H HD2  . LYS A 1 54  ? 9.071   -5.342  11.021  1.00 0.00 ? 54  LYS A HD2  6  
ATOM 9411  H HD3  . LYS A 1 54  ? 9.524   -6.846  11.797  1.00 0.00 ? 54  LYS A HD3  6  
ATOM 9412  H HE2  . LYS A 1 54  ? 9.034   -7.282  8.944   1.00 0.00 ? 54  LYS A HE2  6  
ATOM 9413  H HE3  . LYS A 1 54  ? 10.206  -5.999  9.171   1.00 0.00 ? 54  LYS A HE3  6  
ATOM 9414  H HZ1  . LYS A 1 54  ? 11.654  -7.597  9.548   1.00 0.00 ? 54  LYS A HZ1  6  
ATOM 9415  H HZ2  . LYS A 1 54  ? 10.903  -7.930  10.959  1.00 0.00 ? 54  LYS A HZ2  6  
ATOM 9416  H HZ3  . LYS A 1 54  ? 10.510  -8.761  9.610   1.00 0.00 ? 54  LYS A HZ3  6  
ATOM 9417  N N    . LYS A 1 55  ? 4.031   -7.097  11.661  1.00 0.00 ? 55  LYS A N    6  
ATOM 9418  C CA   . LYS A 1 55  ? 3.295   -8.171  12.305  1.00 0.00 ? 55  LYS A CA   6  
ATOM 9419  C C    . LYS A 1 55  ? 2.366   -8.831  11.284  1.00 0.00 ? 55  LYS A C    6  
ATOM 9420  O O    . LYS A 1 55  ? 2.347   -10.054 11.156  1.00 0.00 ? 55  LYS A O    6  
ATOM 9421  C CB   . LYS A 1 55  ? 2.572   -7.653  13.551  1.00 0.00 ? 55  LYS A CB   6  
ATOM 9422  C CG   . LYS A 1 55  ? 3.473   -7.740  14.784  1.00 0.00 ? 55  LYS A CG   6  
ATOM 9423  C CD   . LYS A 1 55  ? 3.846   -6.345  15.290  1.00 0.00 ? 55  LYS A CD   6  
ATOM 9424  C CE   . LYS A 1 55  ? 2.825   -5.842  16.312  1.00 0.00 ? 55  LYS A CE   6  
ATOM 9425  N NZ   . LYS A 1 55  ? 3.428   -5.785  17.662  1.00 0.00 ? 55  LYS A NZ   6  
ATOM 9426  H H    . LYS A 1 55  ? 4.036   -6.229  12.159  1.00 0.00 ? 55  LYS A H    6  
ATOM 9427  H HA   . LYS A 1 55  ? 4.022   -8.911  12.640  1.00 0.00 ? 55  LYS A HA   6  
ATOM 9428  H HB2  . LYS A 1 55  ? 2.263   -6.620  13.393  1.00 0.00 ? 55  LYS A HB2  6  
ATOM 9429  H HB3  . LYS A 1 55  ? 1.665   -8.235  13.717  1.00 0.00 ? 55  LYS A HB3  6  
ATOM 9430  H HG2  . LYS A 1 55  ? 2.963   -8.293  15.573  1.00 0.00 ? 55  LYS A HG2  6  
ATOM 9431  H HG3  . LYS A 1 55  ? 4.378   -8.296  14.539  1.00 0.00 ? 55  LYS A HG3  6  
ATOM 9432  H HD2  . LYS A 1 55  ? 4.837   -6.372  15.744  1.00 0.00 ? 55  LYS A HD2  6  
ATOM 9433  H HD3  . LYS A 1 55  ? 3.898   -5.652  14.451  1.00 0.00 ? 55  LYS A HD3  6  
ATOM 9434  H HE2  . LYS A 1 55  ? 2.470   -4.852  16.023  1.00 0.00 ? 55  LYS A HE2  6  
ATOM 9435  H HE3  . LYS A 1 55  ? 1.956   -6.501  16.322  1.00 0.00 ? 55  LYS A HE3  6  
ATOM 9436  H HZ1  . LYS A 1 55  ? 3.825   -4.880  17.812  1.00 0.00 ? 55  LYS A HZ1  6  
ATOM 9437  H HZ2  . LYS A 1 55  ? 2.722   -5.957  18.350  1.00 0.00 ? 55  LYS A HZ2  6  
ATOM 9438  H HZ3  . LYS A 1 55  ? 4.143   -6.480  17.738  1.00 0.00 ? 55  LYS A HZ3  6  
ATOM 9439  N N    . GLU A 1 56  ? 1.618   -7.991  10.584  1.00 0.00 ? 56  GLU A N    6  
ATOM 9440  C CA   . GLU A 1 56  ? 0.689   -8.478  9.578   1.00 0.00 ? 56  GLU A CA   6  
ATOM 9441  C C    . GLU A 1 56  ? 1.410   -9.395  8.588   1.00 0.00 ? 56  GLU A C    6  
ATOM 9442  O O    . GLU A 1 56  ? 1.162   -10.599 8.559   1.00 0.00 ? 56  GLU A O    6  
ATOM 9443  C CB   . GLU A 1 56  ? 0.008   -7.315  8.853   1.00 0.00 ? 56  GLU A CB   6  
ATOM 9444  C CG   . GLU A 1 56  ? -1.511  -7.377  9.023   1.00 0.00 ? 56  GLU A CG   6  
ATOM 9445  C CD   . GLU A 1 56  ? -1.903  -7.260  10.497  1.00 0.00 ? 56  GLU A CD   6  
ATOM 9446  O OE1  . GLU A 1 56  ? -1.999  -6.107  10.969  1.00 0.00 ? 56  GLU A OE1  6  
ATOM 9447  O OE2  . GLU A 1 56  ? -2.098  -8.327  11.119  1.00 0.00 ? 56  GLU A OE2  6  
ATOM 9448  H H    . GLU A 1 56  ? 1.639   -6.998  10.694  1.00 0.00 ? 56  GLU A H    6  
ATOM 9449  H HA   . GLU A 1 56  ? -0.063  -9.044  10.128  1.00 0.00 ? 56  GLU A HA   6  
ATOM 9450  H HB2  . GLU A 1 56  ? 0.383   -6.369  9.242   1.00 0.00 ? 56  GLU A HB2  6  
ATOM 9451  H HB3  . GLU A 1 56  ? 0.261   -7.345  7.793   1.00 0.00 ? 56  GLU A HB3  6  
ATOM 9452  H HG2  . GLU A 1 56  ? -1.977  -6.572  8.454   1.00 0.00 ? 56  GLU A HG2  6  
ATOM 9453  H HG3  . GLU A 1 56  ? -1.888  -8.315  8.615   1.00 0.00 ? 56  GLU A HG3  6  
ATOM 9454  N N    . VAL A 1 57  ? 2.288   -8.790  7.802   1.00 0.00 ? 57  VAL A N    6  
ATOM 9455  C CA   . VAL A 1 57  ? 3.047   -9.537  6.814   1.00 0.00 ? 57  VAL A CA   6  
ATOM 9456  C C    . VAL A 1 57  ? 3.607   -10.806 7.460   1.00 0.00 ? 57  VAL A C    6  
ATOM 9457  O O    . VAL A 1 57  ? 3.863   -11.795 6.774   1.00 0.00 ? 57  VAL A O    6  
ATOM 9458  C CB   . VAL A 1 57  ? 4.133   -8.647  6.206   1.00 0.00 ? 57  VAL A CB   6  
ATOM 9459  C CG1  . VAL A 1 57  ? 5.115   -9.473  5.372   1.00 0.00 ? 57  VAL A CG1  6  
ATOM 9460  C CG2  . VAL A 1 57  ? 3.517   -7.522  5.372   1.00 0.00 ? 57  VAL A CG2  6  
ATOM 9461  H H    . VAL A 1 57  ? 2.484   -7.810  7.833   1.00 0.00 ? 57  VAL A H    6  
ATOM 9462  H HA   . VAL A 1 57  ? 2.359   -9.822  6.018   1.00 0.00 ? 57  VAL A HA   6  
ATOM 9463  H HB   . VAL A 1 57  ? 4.690   -8.191  7.024   1.00 0.00 ? 57  VAL A HB   6  
ATOM 9464  H HG11 . VAL A 1 57  ? 5.923   -8.831  5.021   1.00 0.00 ? 57  VAL A HG11 6  
ATOM 9465  H HG12 . VAL A 1 57  ? 5.527   -10.275 5.984   1.00 0.00 ? 57  VAL A HG12 6  
ATOM 9466  H HG13 . VAL A 1 57  ? 4.594   -9.901  4.515   1.00 0.00 ? 57  VAL A HG13 6  
ATOM 9467  H HG21 . VAL A 1 57  ? 3.504   -7.813  4.322   1.00 0.00 ? 57  VAL A HG21 6  
ATOM 9468  H HG22 . VAL A 1 57  ? 2.497   -7.336  5.710   1.00 0.00 ? 57  VAL A HG22 6  
ATOM 9469  H HG23 . VAL A 1 57  ? 4.109   -6.615  5.491   1.00 0.00 ? 57  VAL A HG23 6  
ATOM 9470  N N    . GLU A 1 58  ? 3.780   -10.738 8.772   1.00 0.00 ? 58  GLU A N    6  
ATOM 9471  C CA   . GLU A 1 58  ? 4.304   -11.869 9.517   1.00 0.00 ? 58  GLU A CA   6  
ATOM 9472  C C    . GLU A 1 58  ? 3.210   -12.918 9.729   1.00 0.00 ? 58  GLU A C    6  
ATOM 9473  O O    . GLU A 1 58  ? 3.464   -14.116 9.616   1.00 0.00 ? 58  GLU A O    6  
ATOM 9474  C CB   . GLU A 1 58  ? 4.897   -11.417 10.854  1.00 0.00 ? 58  GLU A CB   6  
ATOM 9475  C CG   . GLU A 1 58  ? 6.426   -11.430 10.807  1.00 0.00 ? 58  GLU A CG   6  
ATOM 9476  C CD   . GLU A 1 58  ? 7.018   -11.413 12.218  1.00 0.00 ? 58  GLU A CD   6  
ATOM 9477  O OE1  . GLU A 1 58  ? 6.380   -10.787 13.093  1.00 0.00 ? 58  GLU A OE1  6  
ATOM 9478  O OE2  . GLU A 1 58  ? 8.094   -12.025 12.390  1.00 0.00 ? 58  GLU A OE2  6  
ATOM 9479  H H    . GLU A 1 58  ? 3.568   -9.930  9.322   1.00 0.00 ? 58  GLU A H    6  
ATOM 9480  H HA   . GLU A 1 58  ? 5.098   -12.283 8.896   1.00 0.00 ? 58  GLU A HA   6  
ATOM 9481  H HB2  . GLU A 1 58  ? 4.545   -10.414 11.091  1.00 0.00 ? 58  GLU A HB2  6  
ATOM 9482  H HB3  . GLU A 1 58  ? 4.548   -12.074 11.651  1.00 0.00 ? 58  GLU A HB3  6  
ATOM 9483  H HG2  . GLU A 1 58  ? 6.770   -12.317 10.276  1.00 0.00 ? 58  GLU A HG2  6  
ATOM 9484  H HG3  . GLU A 1 58  ? 6.783   -10.565 10.248  1.00 0.00 ? 58  GLU A HG3  6  
ATOM 9485  N N    . LYS A 1 59  ? 2.017   -12.429 10.033  1.00 0.00 ? 59  LYS A N    6  
ATOM 9486  C CA   . LYS A 1 59  ? 0.884   -13.309 10.262  1.00 0.00 ? 59  LYS A CA   6  
ATOM 9487  C C    . LYS A 1 59  ? 0.661   -14.179 9.023   1.00 0.00 ? 59  LYS A C    6  
ATOM 9488  O O    . LYS A 1 59  ? 0.319   -15.355 9.139   1.00 0.00 ? 59  LYS A O    6  
ATOM 9489  C CB   . LYS A 1 59  ? -0.348  -12.501 10.675  1.00 0.00 ? 59  LYS A CB   6  
ATOM 9490  C CG   . LYS A 1 59  ? -1.245  -12.213 9.469   1.00 0.00 ? 59  LYS A CG   6  
ATOM 9491  C CD   . LYS A 1 59  ? -2.123  -10.986 9.720   1.00 0.00 ? 59  LYS A CD   6  
ATOM 9492  C CE   . LYS A 1 59  ? -3.590  -11.387 9.891   1.00 0.00 ? 59  LYS A CE   6  
ATOM 9493  N NZ   . LYS A 1 59  ? -4.422  -10.770 8.834   1.00 0.00 ? 59  LYS A NZ   6  
ATOM 9494  H H    . LYS A 1 59  ? 1.819   -11.453 10.123  1.00 0.00 ? 59  LYS A H    6  
ATOM 9495  H HA   . LYS A 1 59  ? 1.138   -13.959 11.099  1.00 0.00 ? 59  LYS A HA   6  
ATOM 9496  H HB2  . LYS A 1 59  ? -0.912  -13.050 11.429  1.00 0.00 ? 59  LYS A HB2  6  
ATOM 9497  H HB3  . LYS A 1 59  ? -0.035  -11.562 11.132  1.00 0.00 ? 59  LYS A HB3  6  
ATOM 9498  H HG2  . LYS A 1 59  ? -0.629  -12.049 8.585   1.00 0.00 ? 59  LYS A HG2  6  
ATOM 9499  H HG3  . LYS A 1 59  ? -1.873  -13.079 9.264   1.00 0.00 ? 59  LYS A HG3  6  
ATOM 9500  H HD2  . LYS A 1 59  ? -1.779  -10.464 10.613  1.00 0.00 ? 59  LYS A HD2  6  
ATOM 9501  H HD3  . LYS A 1 59  ? -2.028  -10.289 8.887   1.00 0.00 ? 59  LYS A HD3  6  
ATOM 9502  H HE2  . LYS A 1 59  ? -3.683  -12.472 9.849   1.00 0.00 ? 59  LYS A HE2  6  
ATOM 9503  H HE3  . LYS A 1 59  ? -3.946  -11.074 10.872  1.00 0.00 ? 59  LYS A HE3  6  
ATOM 9504  H HZ1  . LYS A 1 59  ? -3.864  -10.140 8.295   1.00 0.00 ? 59  LYS A HZ1  6  
ATOM 9505  H HZ2  . LYS A 1 59  ? -4.788  -11.485 8.238   1.00 0.00 ? 59  LYS A HZ2  6  
ATOM 9506  H HZ3  . LYS A 1 59  ? -5.178  -10.269 9.256   1.00 0.00 ? 59  LYS A HZ3  6  
ATOM 9507  N N    . MET A 1 60  ? 0.864   -13.568 7.865   1.00 0.00 ? 60  MET A N    6  
ATOM 9508  C CA   . MET A 1 60  ? 0.690   -14.272 6.606   1.00 0.00 ? 60  MET A CA   6  
ATOM 9509  C C    . MET A 1 60  ? -0.681  -14.948 6.542   1.00 0.00 ? 60  MET A C    6  
ATOM 9510  O O    . MET A 1 60  ? -0.774  -16.149 6.289   1.00 0.00 ? 60  MET A O    6  
ATOM 9511  C CB   . MET A 1 60  ? 1.788   -15.327 6.455   1.00 0.00 ? 60  MET A CB   6  
ATOM 9512  C CG   . MET A 1 60  ? 3.000   -14.755 5.717   1.00 0.00 ? 60  MET A CG   6  
ATOM 9513  S SD   . MET A 1 60  ? 2.863   -15.088 3.969   1.00 0.00 ? 60  MET A SD   6  
ATOM 9514  C CE   . MET A 1 60  ? 2.329   -13.486 3.389   1.00 0.00 ? 60  MET A CE   6  
ATOM 9515  H H    . MET A 1 60  ? 1.142   -12.611 7.780   1.00 0.00 ? 60  MET A H    6  
ATOM 9516  H HA   . MET A 1 60  ? 0.763   -13.509 5.832   1.00 0.00 ? 60  MET A HA   6  
ATOM 9517  H HB2  . MET A 1 60  ? 2.092   -15.684 7.439   1.00 0.00 ? 60  MET A HB2  6  
ATOM 9518  H HB3  . MET A 1 60  ? 1.398   -16.187 5.910   1.00 0.00 ? 60  MET A HB3  6  
ATOM 9519  H HG2  . MET A 1 60  ? 3.066   -13.680 5.887   1.00 0.00 ? 60  MET A HG2  6  
ATOM 9520  H HG3  . MET A 1 60  ? 3.916   -15.196 6.109   1.00 0.00 ? 60  MET A HG3  6  
ATOM 9521  H HE1  . MET A 1 60  ? 2.239   -12.805 4.235   1.00 0.00 ? 60  MET A HE1  6  
ATOM 9522  H HE2  . MET A 1 60  ? 3.060   -13.093 2.683   1.00 0.00 ? 60  MET A HE2  6  
ATOM 9523  H HE3  . MET A 1 60  ? 1.362   -13.582 2.895   1.00 0.00 ? 60  MET A HE3  6  
ATOM 9524  N N    . ASN A 1 61  ? -1.711  -14.149 6.774   1.00 0.00 ? 61  ASN A N    6  
ATOM 9525  C CA   . ASN A 1 61  ? -3.073  -14.655 6.746   1.00 0.00 ? 61  ASN A CA   6  
ATOM 9526  C C    . ASN A 1 61  ? -3.596  -14.618 5.308   1.00 0.00 ? 61  ASN A C    6  
ATOM 9527  O O    . ASN A 1 61  ? -2.917  -14.125 4.409   1.00 0.00 ? 61  ASN A O    6  
ATOM 9528  C CB   . ASN A 1 61  ? -3.999  -13.795 7.608   1.00 0.00 ? 61  ASN A CB   6  
ATOM 9529  C CG   . ASN A 1 61  ? -4.463  -14.562 8.848   1.00 0.00 ? 61  ASN A CG   6  
ATOM 9530  O OD1  . ASN A 1 61  ? -3.723  -15.320 9.454   1.00 0.00 ? 61  ASN A OD1  6  
ATOM 9531  N ND2  . ASN A 1 61  ? -5.726  -14.325 9.189   1.00 0.00 ? 61  ASN A ND2  6  
ATOM 9532  H H    . ASN A 1 61  ? -1.627  -13.173 6.979   1.00 0.00 ? 61  ASN A H    6  
ATOM 9533  H HA   . ASN A 1 61  ? -3.010  -15.669 7.140   1.00 0.00 ? 61  ASN A HA   6  
ATOM 9534  H HB2  . ASN A 1 61  ? -3.479  -12.886 7.912   1.00 0.00 ? 61  ASN A HB2  6  
ATOM 9535  H HB3  . ASN A 1 61  ? -4.864  -13.486 7.022   1.00 0.00 ? 61  ASN A HB3  6  
ATOM 9536  H HD21 . ASN A 1 61  ? -6.280  -13.691 8.649   1.00 0.00 ? 61  ASN A HD21 6  
ATOM 9537  H HD22 . ASN A 1 61  ? -6.123  -14.780 9.987   1.00 0.00 ? 61  ASN A HD22 6  
ATOM 9538  N N    . LYS A 1 62  ? -4.799  -15.145 5.137   1.00 0.00 ? 62  LYS A N    6  
ATOM 9539  C CA   . LYS A 1 62  ? -5.421  -15.178 3.824   1.00 0.00 ? 62  LYS A CA   6  
ATOM 9540  C C    . LYS A 1 62  ? -5.302  -13.799 3.172   1.00 0.00 ? 62  LYS A C    6  
ATOM 9541  O O    . LYS A 1 62  ? -5.024  -13.695 1.979   1.00 0.00 ? 62  LYS A O    6  
ATOM 9542  C CB   . LYS A 1 62  ? -6.861  -15.688 3.926   1.00 0.00 ? 62  LYS A CB   6  
ATOM 9543  C CG   . LYS A 1 62  ? -6.909  -17.215 3.844   1.00 0.00 ? 62  LYS A CG   6  
ATOM 9544  C CD   . LYS A 1 62  ? -7.311  -17.824 5.188   1.00 0.00 ? 62  LYS A CD   6  
ATOM 9545  C CE   . LYS A 1 62  ? -7.730  -19.286 5.025   1.00 0.00 ? 62  LYS A CE   6  
ATOM 9546  N NZ   . LYS A 1 62  ? -7.592  -20.011 6.307   1.00 0.00 ? 62  LYS A NZ   6  
ATOM 9547  H H    . LYS A 1 62  ? -5.345  -15.544 5.873   1.00 0.00 ? 62  LYS A H    6  
ATOM 9548  H HA   . LYS A 1 62  ? -4.868  -15.896 3.218   1.00 0.00 ? 62  LYS A HA   6  
ATOM 9549  H HB2  . LYS A 1 62  ? -7.302  -15.356 4.866   1.00 0.00 ? 62  LYS A HB2  6  
ATOM 9550  H HB3  . LYS A 1 62  ? -7.460  -15.257 3.123   1.00 0.00 ? 62  LYS A HB3  6  
ATOM 9551  H HG2  . LYS A 1 62  ? -7.620  -17.519 3.076   1.00 0.00 ? 62  LYS A HG2  6  
ATOM 9552  H HG3  . LYS A 1 62  ? -5.933  -17.597 3.544   1.00 0.00 ? 62  LYS A HG3  6  
ATOM 9553  H HD2  . LYS A 1 62  ? -6.476  -17.757 5.886   1.00 0.00 ? 62  LYS A HD2  6  
ATOM 9554  H HD3  . LYS A 1 62  ? -8.133  -17.252 5.619   1.00 0.00 ? 62  LYS A HD3  6  
ATOM 9555  H HE2  . LYS A 1 62  ? -8.762  -19.338 4.680   1.00 0.00 ? 62  LYS A HE2  6  
ATOM 9556  H HE3  . LYS A 1 62  ? -7.115  -19.764 4.262   1.00 0.00 ? 62  LYS A HE3  6  
ATOM 9557  H HZ1  . LYS A 1 62  ? -8.199  -19.602 6.989   1.00 0.00 ? 62  LYS A HZ1  6  
ATOM 9558  H HZ2  . LYS A 1 62  ? -7.838  -20.972 6.175   1.00 0.00 ? 62  LYS A HZ2  6  
ATOM 9559  H HZ3  . LYS A 1 62  ? -6.645  -19.950 6.625   1.00 0.00 ? 62  LYS A HZ3  6  
ATOM 9560  N N    . LYS A 1 63  ? -5.518  -12.775 3.985   1.00 0.00 ? 63  LYS A N    6  
ATOM 9561  C CA   . LYS A 1 63  ? -5.438  -11.407 3.503   1.00 0.00 ? 63  LYS A CA   6  
ATOM 9562  C C    . LYS A 1 63  ? -4.045  -11.157 2.919   1.00 0.00 ? 63  LYS A C    6  
ATOM 9563  O O    . LYS A 1 63  ? -3.917  -10.706 1.783   1.00 0.00 ? 63  LYS A O    6  
ATOM 9564  C CB   . LYS A 1 63  ? -5.825  -10.425 4.610   1.00 0.00 ? 63  LYS A CB   6  
ATOM 9565  C CG   . LYS A 1 63  ? -7.326  -10.492 4.902   1.00 0.00 ? 63  LYS A CG   6  
ATOM 9566  C CD   . LYS A 1 63  ? -8.072  -9.354  4.202   1.00 0.00 ? 63  LYS A CD   6  
ATOM 9567  C CE   . LYS A 1 63  ? -9.316  -8.946  4.992   1.00 0.00 ? 63  LYS A CE   6  
ATOM 9568  N NZ   . LYS A 1 63  ? -9.606  -7.508  4.796   1.00 0.00 ? 63  LYS A NZ   6  
ATOM 9569  H H    . LYS A 1 63  ? -5.743  -12.869 4.955   1.00 0.00 ? 63  LYS A H    6  
ATOM 9570  H HA   . LYS A 1 63  ? -6.172  -11.299 2.705   1.00 0.00 ? 63  LYS A HA   6  
ATOM 9571  H HB2  . LYS A 1 63  ? -5.265  -10.653 5.517   1.00 0.00 ? 63  LYS A HB2  6  
ATOM 9572  H HB3  . LYS A 1 63  ? -5.553  -9.412  4.315   1.00 0.00 ? 63  LYS A HB3  6  
ATOM 9573  H HG2  . LYS A 1 63  ? -7.722  -11.451 4.568   1.00 0.00 ? 63  LYS A HG2  6  
ATOM 9574  H HG3  . LYS A 1 63  ? -7.494  -10.434 5.977   1.00 0.00 ? 63  LYS A HG3  6  
ATOM 9575  H HD2  . LYS A 1 63  ? -7.409  -8.495  4.090   1.00 0.00 ? 63  LYS A HD2  6  
ATOM 9576  H HD3  . LYS A 1 63  ? -8.360  -9.667  3.198   1.00 0.00 ? 63  LYS A HD3  6  
ATOM 9577  H HE2  . LYS A 1 63  ? -10.170 -9.543  4.672   1.00 0.00 ? 63  LYS A HE2  6  
ATOM 9578  H HE3  . LYS A 1 63  ? -9.164  -9.150  6.052   1.00 0.00 ? 63  LYS A HE3  6  
ATOM 9579  H HZ1  . LYS A 1 63  ? -9.173  -7.193  3.952   1.00 0.00 ? 63  LYS A HZ1  6  
ATOM 9580  H HZ2  . LYS A 1 63  ? -10.595 -7.373  4.733   1.00 0.00 ? 63  LYS A HZ2  6  
ATOM 9581  H HZ3  . LYS A 1 63  ? -9.248  -6.986  5.570   1.00 0.00 ? 63  LYS A HZ3  6  
ATOM 9582  N N    . MET A 1 64  ? -3.038  -11.462 3.724   1.00 0.00 ? 64  MET A N    6  
ATOM 9583  C CA   . MET A 1 64  ? -1.660  -11.276 3.302   1.00 0.00 ? 64  MET A CA   6  
ATOM 9584  C C    . MET A 1 64  ? -1.315  -12.202 2.133   1.00 0.00 ? 64  MET A C    6  
ATOM 9585  O O    . MET A 1 64  ? -0.408  -11.914 1.355   1.00 0.00 ? 64  MET A O    6  
ATOM 9586  C CB   . MET A 1 64  ? -0.723  -11.565 4.476   1.00 0.00 ? 64  MET A CB   6  
ATOM 9587  C CG   . MET A 1 64  ? 0.669   -10.983 4.222   1.00 0.00 ? 64  MET A CG   6  
ATOM 9588  S SD   . MET A 1 64  ? 0.564   -9.212  4.026   1.00 0.00 ? 64  MET A SD   6  
ATOM 9589  C CE   . MET A 1 64  ? -0.065  -8.759  5.634   1.00 0.00 ? 64  MET A CE   6  
ATOM 9590  H H    . MET A 1 64  ? -3.151  -11.829 4.648   1.00 0.00 ? 64  MET A H    6  
ATOM 9591  H HA   . MET A 1 64  ? -1.589  -10.236 2.984   1.00 0.00 ? 64  MET A HA   6  
ATOM 9592  H HB2  . MET A 1 64  ? -1.137  -11.140 5.390   1.00 0.00 ? 64  MET A HB2  6  
ATOM 9593  H HB3  . MET A 1 64  ? -0.648  -12.641 4.630   1.00 0.00 ? 64  MET A HB3  6  
ATOM 9594  H HG2  . MET A 1 64  ? 1.331   -11.226 5.053   1.00 0.00 ? 64  MET A HG2  6  
ATOM 9595  H HG3  . MET A 1 64  ? 1.102   -11.431 3.328   1.00 0.00 ? 64  MET A HG3  6  
ATOM 9596  H HE1  . MET A 1 64  ? 0.424   -9.362  6.399   1.00 0.00 ? 64  MET A HE1  6  
ATOM 9597  H HE2  . MET A 1 64  ? 0.137   -7.704  5.819   1.00 0.00 ? 64  MET A HE2  6  
ATOM 9598  H HE3  . MET A 1 64  ? -1.141  -8.933  5.666   1.00 0.00 ? 64  MET A HE3  6  
ATOM 9599  N N    . GLU A 1 65  ? -2.058  -13.296 2.048   1.00 0.00 ? 65  GLU A N    6  
ATOM 9600  C CA   . GLU A 1 65  ? -1.842  -14.266 0.987   1.00 0.00 ? 65  GLU A CA   6  
ATOM 9601  C C    . GLU A 1 65  ? -2.148  -13.640 -0.375  1.00 0.00 ? 65  GLU A C    6  
ATOM 9602  O O    . GLU A 1 65  ? -1.343  -13.733 -1.300  1.00 0.00 ? 65  GLU A O    6  
ATOM 9603  C CB   . GLU A 1 65  ? -2.684  -15.523 1.215   1.00 0.00 ? 65  GLU A CB   6  
ATOM 9604  C CG   . GLU A 1 65  ? -1.844  -16.641 1.836   1.00 0.00 ? 65  GLU A CG   6  
ATOM 9605  C CD   . GLU A 1 65  ? -1.565  -17.747 0.817   1.00 0.00 ? 65  GLU A CD   6  
ATOM 9606  O OE1  . GLU A 1 65  ? -2.556  -18.319 0.314   1.00 0.00 ? 65  GLU A OE1  6  
ATOM 9607  O OE2  . GLU A 1 65  ? -0.366  -17.996 0.564   1.00 0.00 ? 65  GLU A OE2  6  
ATOM 9608  H H    . GLU A 1 65  ? -2.795  -13.523 2.685   1.00 0.00 ? 65  GLU A H    6  
ATOM 9609  H HA   . GLU A 1 65  ? -0.786  -14.528 1.045   1.00 0.00 ? 65  GLU A HA   6  
ATOM 9610  H HB2  . GLU A 1 65  ? -3.525  -15.289 1.868   1.00 0.00 ? 65  GLU A HB2  6  
ATOM 9611  H HB3  . GLU A 1 65  ? -3.102  -15.861 0.267   1.00 0.00 ? 65  GLU A HB3  6  
ATOM 9612  H HG2  . GLU A 1 65  ? -0.902  -16.232 2.201   1.00 0.00 ? 65  GLU A HG2  6  
ATOM 9613  H HG3  . GLU A 1 65  ? -2.366  -17.057 2.697   1.00 0.00 ? 65  GLU A HG3  6  
ATOM 9614  N N    . GLU A 1 66  ? -3.314  -13.016 -0.455  1.00 0.00 ? 66  GLU A N    6  
ATOM 9615  C CA   . GLU A 1 66  ? -3.737  -12.375 -1.689  1.00 0.00 ? 66  GLU A CA   6  
ATOM 9616  C C    . GLU A 1 66  ? -2.645  -11.430 -2.197  1.00 0.00 ? 66  GLU A C    6  
ATOM 9617  O O    . GLU A 1 66  ? -2.459  -11.284 -3.404  1.00 0.00 ? 66  GLU A O    6  
ATOM 9618  C CB   . GLU A 1 66  ? -5.059  -11.630 -1.495  1.00 0.00 ? 66  GLU A CB   6  
ATOM 9619  C CG   . GLU A 1 66  ? -6.149  -12.573 -0.982  1.00 0.00 ? 66  GLU A CG   6  
ATOM 9620  C CD   . GLU A 1 66  ? -7.003  -13.104 -2.135  1.00 0.00 ? 66  GLU A CD   6  
ATOM 9621  O OE1  . GLU A 1 66  ? -6.398  -13.499 -3.155  1.00 0.00 ? 66  GLU A OE1  6  
ATOM 9622  O OE2  . GLU A 1 66  ? -8.242  -13.103 -1.971  1.00 0.00 ? 66  GLU A OE2  6  
ATOM 9623  H H    . GLU A 1 66  ? -3.964  -12.944 0.302   1.00 0.00 ? 66  GLU A H    6  
ATOM 9624  H HA   . GLU A 1 66  ? -3.885  -13.186 -2.401  1.00 0.00 ? 66  GLU A HA   6  
ATOM 9625  H HB2  . GLU A 1 66  ? -4.920  -10.811 -0.789  1.00 0.00 ? 66  GLU A HB2  6  
ATOM 9626  H HB3  . GLU A 1 66  ? -5.373  -11.187 -2.440  1.00 0.00 ? 66  GLU A HB3  6  
ATOM 9627  H HG2  . GLU A 1 66  ? -5.692  -13.407 -0.449  1.00 0.00 ? 66  GLU A HG2  6  
ATOM 9628  H HG3  . GLU A 1 66  ? -6.783  -12.048 -0.267  1.00 0.00 ? 66  GLU A HG3  6  
ATOM 9629  N N    . VAL A 1 67  ? -1.953  -10.814 -1.250  1.00 0.00 ? 67  VAL A N    6  
ATOM 9630  C CA   . VAL A 1 67  ? -0.885  -9.888  -1.587  1.00 0.00 ? 67  VAL A CA   6  
ATOM 9631  C C    . VAL A 1 67  ? 0.346   -10.677 -2.035  1.00 0.00 ? 67  VAL A C    6  
ATOM 9632  O O    . VAL A 1 67  ? 1.028   -10.286 -2.982  1.00 0.00 ? 67  VAL A O    6  
ATOM 9633  C CB   . VAL A 1 67  ? -0.602  -8.962  -0.402  1.00 0.00 ? 67  VAL A CB   6  
ATOM 9634  C CG1  . VAL A 1 67  ? 0.420   -7.887  -0.777  1.00 0.00 ? 67  VAL A CG1  6  
ATOM 9635  C CG2  . VAL A 1 67  ? -1.894  -8.331  0.121   1.00 0.00 ? 67  VAL A CG2  6  
ATOM 9636  H H    . VAL A 1 67  ? -2.111  -10.939 -0.271  1.00 0.00 ? 67  VAL A H    6  
ATOM 9637  H HA   . VAL A 1 67  ? -1.231  -9.275  -2.419  1.00 0.00 ? 67  VAL A HA   6  
ATOM 9638  H HB   . VAL A 1 67  ? -0.176  -9.565  0.400   1.00 0.00 ? 67  VAL A HB   6  
ATOM 9639  H HG11 . VAL A 1 67  ? 0.953   -7.565  0.117   1.00 0.00 ? 67  VAL A HG11 6  
ATOM 9640  H HG12 . VAL A 1 67  ? 1.129   -8.296  -1.496  1.00 0.00 ? 67  VAL A HG12 6  
ATOM 9641  H HG13 . VAL A 1 67  ? -0.096  -7.035  -1.220  1.00 0.00 ? 67  VAL A HG13 6  
ATOM 9642  H HG21 . VAL A 1 67  ? -2.710  -9.050  0.036   1.00 0.00 ? 67  VAL A HG21 6  
ATOM 9643  H HG22 . VAL A 1 67  ? -1.765  -8.051  1.167   1.00 0.00 ? 67  VAL A HG22 6  
ATOM 9644  H HG23 . VAL A 1 67  ? -2.130  -7.444  -0.466  1.00 0.00 ? 67  VAL A HG23 6  
ATOM 9645  N N    . LYS A 1 68  ? 0.594   -11.774 -1.335  1.00 0.00 ? 68  LYS A N    6  
ATOM 9646  C CA   . LYS A 1 68  ? 1.731   -12.622 -1.649  1.00 0.00 ? 68  LYS A CA   6  
ATOM 9647  C C    . LYS A 1 68  ? 1.529   -13.248 -3.031  1.00 0.00 ? 68  LYS A C    6  
ATOM 9648  O O    . LYS A 1 68  ? 2.464   -13.315 -3.828  1.00 0.00 ? 68  LYS A O    6  
ATOM 9649  C CB   . LYS A 1 68  ? 1.958   -13.648 -0.537  1.00 0.00 ? 68  LYS A CB   6  
ATOM 9650  C CG   . LYS A 1 68  ? 3.176   -14.524 -0.840  1.00 0.00 ? 68  LYS A CG   6  
ATOM 9651  C CD   . LYS A 1 68  ? 3.799   -15.061 0.451   1.00 0.00 ? 68  LYS A CD   6  
ATOM 9652  C CE   . LYS A 1 68  ? 5.327   -14.998 0.389   1.00 0.00 ? 68  LYS A CE   6  
ATOM 9653  N NZ   . LYS A 1 68  ? 5.922   -16.150 1.102   1.00 0.00 ? 68  LYS A NZ   6  
ATOM 9654  H H    . LYS A 1 68  ? 0.035   -12.086 -0.567  1.00 0.00 ? 68  LYS A H    6  
ATOM 9655  H HA   . LYS A 1 68  ? 2.615   -11.984 -1.684  1.00 0.00 ? 68  LYS A HA   6  
ATOM 9656  H HB2  . LYS A 1 68  ? 2.103   -13.135 0.413   1.00 0.00 ? 68  LYS A HB2  6  
ATOM 9657  H HB3  . LYS A 1 68  ? 1.073   -14.275 -0.429  1.00 0.00 ? 68  LYS A HB3  6  
ATOM 9658  H HG2  . LYS A 1 68  ? 2.880   -15.356 -1.478  1.00 0.00 ? 68  LYS A HG2  6  
ATOM 9659  H HG3  . LYS A 1 68  ? 3.916   -13.946 -1.392  1.00 0.00 ? 68  LYS A HG3  6  
ATOM 9660  H HD2  . LYS A 1 68  ? 3.441   -14.480 1.301   1.00 0.00 ? 68  LYS A HD2  6  
ATOM 9661  H HD3  . LYS A 1 68  ? 3.481   -16.091 0.611   1.00 0.00 ? 68  LYS A HD3  6  
ATOM 9662  H HE2  . LYS A 1 68  ? 5.655   -14.996 -0.650  1.00 0.00 ? 68  LYS A HE2  6  
ATOM 9663  H HE3  . LYS A 1 68  ? 5.676   -14.067 0.836   1.00 0.00 ? 68  LYS A HE3  6  
ATOM 9664  H HZ1  . LYS A 1 68  ? 6.041   -16.911 0.464   1.00 0.00 ? 68  LYS A HZ1  6  
ATOM 9665  H HZ2  . LYS A 1 68  ? 6.811   -15.887 1.477   1.00 0.00 ? 68  LYS A HZ2  6  
ATOM 9666  H HZ3  . LYS A 1 68  ? 5.316   -16.431 1.846   1.00 0.00 ? 68  LYS A HZ3  6  
ATOM 9667  N N    . GLU A 1 69  ? 0.304   -13.689 -3.272  1.00 0.00 ? 69  GLU A N    6  
ATOM 9668  C CA   . GLU A 1 69  ? -0.033  -14.306 -4.544  1.00 0.00 ? 69  GLU A CA   6  
ATOM 9669  C C    . GLU A 1 69  ? 0.160   -13.307 -5.686  1.00 0.00 ? 69  GLU A C    6  
ATOM 9670  O O    . GLU A 1 69  ? 0.692   -13.657 -6.739  1.00 0.00 ? 69  GLU A O    6  
ATOM 9671  C CB   . GLU A 1 69  ? -1.462  -14.851 -4.527  1.00 0.00 ? 69  GLU A CB   6  
ATOM 9672  C CG   . GLU A 1 69  ? -1.711  -15.700 -3.279  1.00 0.00 ? 69  GLU A CG   6  
ATOM 9673  C CD   . GLU A 1 69  ? -2.323  -17.052 -3.648  1.00 0.00 ? 69  GLU A CD   6  
ATOM 9674  O OE1  . GLU A 1 69  ? -1.620  -17.825 -4.334  1.00 0.00 ? 69  GLU A OE1  6  
ATOM 9675  O OE2  . GLU A 1 69  ? -3.481  -17.283 -3.236  1.00 0.00 ? 69  GLU A OE2  6  
ATOM 9676  H H    . GLU A 1 69  ? -0.451  -13.630 -2.618  1.00 0.00 ? 69  GLU A H    6  
ATOM 9677  H HA   . GLU A 1 69  ? 0.665   -15.136 -4.656  1.00 0.00 ? 69  GLU A HA   6  
ATOM 9678  H HB2  . GLU A 1 69  ? -2.171  -14.024 -4.556  1.00 0.00 ? 69  GLU A HB2  6  
ATOM 9679  H HB3  . GLU A 1 69  ? -1.637  -15.452 -5.420  1.00 0.00 ? 69  GLU A HB3  6  
ATOM 9680  H HG2  . GLU A 1 69  ? -0.773  -15.854 -2.746  1.00 0.00 ? 69  GLU A HG2  6  
ATOM 9681  H HG3  . GLU A 1 69  ? -2.378  -15.168 -2.600  1.00 0.00 ? 69  GLU A HG3  6  
ATOM 9682  N N    . ALA A 1 70  ? -0.283  -12.083 -5.440  1.00 0.00 ? 70  ALA A N    6  
ATOM 9683  C CA   . ALA A 1 70  ? -0.166  -11.031 -6.436  1.00 0.00 ? 70  ALA A CA   6  
ATOM 9684  C C    . ALA A 1 70  ? 1.216   -10.383 -6.327  1.00 0.00 ? 70  ALA A C    6  
ATOM 9685  O O    . ALA A 1 70  ? 1.482   -9.368  -6.969  1.00 0.00 ? 70  ALA A O    6  
ATOM 9686  C CB   . ALA A 1 70  ? -1.300  -10.021 -6.247  1.00 0.00 ? 70  ALA A CB   6  
ATOM 9687  H H    . ALA A 1 70  ? -0.715  -11.806 -4.582  1.00 0.00 ? 70  ALA A H    6  
ATOM 9688  H HA   . ALA A 1 70  ? -0.266  -11.491 -7.419  1.00 0.00 ? 70  ALA A HA   6  
ATOM 9689  H HB1  . ALA A 1 70  ? -1.120  -9.438  -5.343  1.00 0.00 ? 70  ALA A HB1  6  
ATOM 9690  H HB2  . ALA A 1 70  ? -1.339  -9.353  -7.108  1.00 0.00 ? 70  ALA A HB2  6  
ATOM 9691  H HB3  . ALA A 1 70  ? -2.248  -10.551 -6.155  1.00 0.00 ? 70  ALA A HB3  6  
ATOM 9692  N N    . ASN A 1 71  ? 2.059   -10.997 -5.510  1.00 0.00 ? 71  ASN A N    6  
ATOM 9693  C CA   . ASN A 1 71  ? 3.407   -10.493 -5.309  1.00 0.00 ? 71  ASN A CA   6  
ATOM 9694  C C    . ASN A 1 71  ? 3.364   -8.969  -5.186  1.00 0.00 ? 71  ASN A C    6  
ATOM 9695  O O    . ASN A 1 71  ? 4.052   -8.263  -5.922  1.00 0.00 ? 71  ASN A O    6  
ATOM 9696  C CB   . ASN A 1 71  ? 4.309   -10.846 -6.493  1.00 0.00 ? 71  ASN A CB   6  
ATOM 9697  C CG   . ASN A 1 71  ? 5.751   -11.075 -6.034  1.00 0.00 ? 71  ASN A CG   6  
ATOM 9698  O OD1  . ASN A 1 71  ? 6.020   -11.772 -5.070  1.00 0.00 ? 71  ASN A OD1  6  
ATOM 9699  N ND2  . ASN A 1 71  ? 6.660   -10.451 -6.777  1.00 0.00 ? 71  ASN A ND2  6  
ATOM 9700  H H    . ASN A 1 71  ? 1.835   -11.822 -4.991  1.00 0.00 ? 71  ASN A H    6  
ATOM 9701  H HA   . ASN A 1 71  ? 3.760   -10.975 -4.397  1.00 0.00 ? 71  ASN A HA   6  
ATOM 9702  H HB2  . ASN A 1 71  ? 3.934   -11.743 -6.985  1.00 0.00 ? 71  ASN A HB2  6  
ATOM 9703  H HB3  . ASN A 1 71  ? 4.281   -10.043 -7.229  1.00 0.00 ? 71  ASN A HB3  6  
ATOM 9704  H HD21 . ASN A 1 71  ? 6.372   -9.893  -7.556  1.00 0.00 ? 71  ASN A HD21 6  
ATOM 9705  H HD22 . ASN A 1 71  ? 7.632   -10.538 -6.557  1.00 0.00 ? 71  ASN A HD22 6  
ATOM 9706  N N    . ILE A 1 72  ? 2.548   -8.505  -4.250  1.00 0.00 ? 72  ILE A N    6  
ATOM 9707  C CA   . ILE A 1 72  ? 2.406   -7.077  -4.021  1.00 0.00 ? 72  ILE A CA   6  
ATOM 9708  C C    . ILE A 1 72  ? 3.255   -6.672  -2.814  1.00 0.00 ? 72  ILE A C    6  
ATOM 9709  O O    . ILE A 1 72  ? 2.994   -7.105  -1.693  1.00 0.00 ? 72  ILE A O    6  
ATOM 9710  C CB   . ILE A 1 72  ? 0.929   -6.700  -3.889  1.00 0.00 ? 72  ILE A CB   6  
ATOM 9711  C CG1  . ILE A 1 72  ? 0.168   -7.004  -5.181  1.00 0.00 ? 72  ILE A CG1  6  
ATOM 9712  C CG2  . ILE A 1 72  ? 0.773   -5.239  -3.462  1.00 0.00 ? 72  ILE A CG2  6  
ATOM 9713  C CD1  . ILE A 1 72  ? -1.327  -6.723  -5.015  1.00 0.00 ? 72  ILE A CD1  6  
ATOM 9714  H H    . ILE A 1 72  ? 1.992   -9.086  -3.656  1.00 0.00 ? 72  ILE A H    6  
ATOM 9715  H HA   . ILE A 1 72  ? 2.792   -6.565  -4.903  1.00 0.00 ? 72  ILE A HA   6  
ATOM 9716  H HB   . ILE A 1 72  ? 0.489   -7.314  -3.103  1.00 0.00 ? 72  ILE A HB   6  
ATOM 9717  H HG12 . ILE A 1 72  ? 0.568   -6.398  -5.994  1.00 0.00 ? 72  ILE A HG12 6  
ATOM 9718  H HG13 . ILE A 1 72  ? 0.317   -8.048  -5.458  1.00 0.00 ? 72  ILE A HG13 6  
ATOM 9719  H HG21 . ILE A 1 72  ? -0.165  -4.845  -3.853  1.00 0.00 ? 72  ILE A HG21 6  
ATOM 9720  H HG22 . ILE A 1 72  ? 0.767   -5.178  -2.373  1.00 0.00 ? 72  ILE A HG22 6  
ATOM 9721  H HG23 . ILE A 1 72  ? 1.605   -4.655  -3.854  1.00 0.00 ? 72  ILE A HG23 6  
ATOM 9722  H HD11 . ILE A 1 72  ? -1.897  -7.601  -5.318  1.00 0.00 ? 72  ILE A HD11 6  
ATOM 9723  H HD12 . ILE A 1 72  ? -1.540  -6.494  -3.971  1.00 0.00 ? 72  ILE A HD12 6  
ATOM 9724  H HD13 . ILE A 1 72  ? -1.608  -5.874  -5.639  1.00 0.00 ? 72  ILE A HD13 6  
ATOM 9725  N N    . ARG A 1 73  ? 4.254   -5.845  -3.085  1.00 0.00 ? 73  ARG A N    6  
ATOM 9726  C CA   . ARG A 1 73  ? 5.143   -5.376  -2.036  1.00 0.00 ? 73  ARG A CA   6  
ATOM 9727  C C    . ARG A 1 73  ? 4.336   -4.740  -0.902  1.00 0.00 ? 73  ARG A C    6  
ATOM 9728  O O    . ARG A 1 73  ? 3.597   -3.782  -1.123  1.00 0.00 ? 73  ARG A O    6  
ATOM 9729  C CB   . ARG A 1 73  ? 6.143   -4.353  -2.577  1.00 0.00 ? 73  ARG A CB   6  
ATOM 9730  C CG   . ARG A 1 73  ? 5.498   -2.972  -2.709  1.00 0.00 ? 73  ARG A CG   6  
ATOM 9731  C CD   . ARG A 1 73  ? 6.376   -2.033  -3.538  1.00 0.00 ? 73  ARG A CD   6  
ATOM 9732  N NE   . ARG A 1 73  ? 5.575   -1.408  -4.614  1.00 0.00 ? 73  ARG A NE   6  
ATOM 9733  C CZ   . ARG A 1 73  ? 5.185   -2.044  -5.727  1.00 0.00 ? 73  ARG A CZ   6  
ATOM 9734  N NH1  . ARG A 1 73  ? 5.522   -3.327  -5.918  1.00 0.00 ? 73  ARG A NH1  6  
ATOM 9735  N NH2  . ARG A 1 73  ? 4.460   -1.397  -6.649  1.00 0.00 ? 73  ARG A NH2  6  
ATOM 9736  H H    . ARG A 1 73  ? 4.460   -5.497  -4.000  1.00 0.00 ? 73  ARG A H    6  
ATOM 9737  H HA   . ARG A 1 73  ? 5.664   -6.270  -1.692  1.00 0.00 ? 73  ARG A HA   6  
ATOM 9738  H HB2  . ARG A 1 73  ? 7.005   -4.294  -1.912  1.00 0.00 ? 73  ARG A HB2  6  
ATOM 9739  H HB3  . ARG A 1 73  ? 6.513   -4.680  -3.549  1.00 0.00 ? 73  ARG A HB3  6  
ATOM 9740  H HG2  . ARG A 1 73  ? 4.518   -3.067  -3.177  1.00 0.00 ? 73  ARG A HG2  6  
ATOM 9741  H HG3  . ARG A 1 73  ? 5.337   -2.546  -1.719  1.00 0.00 ? 73  ARG A HG3  6  
ATOM 9742  H HD2  . ARG A 1 73  ? 6.805   -1.262  -2.898  1.00 0.00 ? 73  ARG A HD2  6  
ATOM 9743  H HD3  . ARG A 1 73  ? 7.210   -2.588  -3.970  1.00 0.00 ? 73  ARG A HD3  6  
ATOM 9744  H HE   . ARG A 1 73  ? 5.307   -0.451  -4.503  1.00 0.00 ? 73  ARG A HE   6  
ATOM 9745  H HH11 . ARG A 1 73  ? 6.063   -3.810  -5.229  1.00 0.00 ? 73  ARG A HH11 6  
ATOM 9746  H HH12 . ARG A 1 73  ? 5.231   -3.802  -6.749  1.00 0.00 ? 73  ARG A HH12 6  
ATOM 9747  H HH21 . ARG A 1 73  ? 4.209   -0.440  -6.507  1.00 0.00 ? 73  ARG A HH21 6  
ATOM 9748  H HH22 . ARG A 1 73  ? 4.169   -1.872  -7.480  1.00 0.00 ? 73  ARG A HH22 6  
ATOM 9749  N N    . VAL A 1 74  ? 4.506   -5.298  0.288   1.00 0.00 ? 74  VAL A N    6  
ATOM 9750  C CA   . VAL A 1 74  ? 3.802   -4.797  1.456   1.00 0.00 ? 74  VAL A CA   6  
ATOM 9751  C C    . VAL A 1 74  ? 4.688   -3.784  2.184   1.00 0.00 ? 74  VAL A C    6  
ATOM 9752  O O    . VAL A 1 74  ? 5.740   -4.141  2.713   1.00 0.00 ? 74  VAL A O    6  
ATOM 9753  C CB   . VAL A 1 74  ? 3.372   -5.964  2.348   1.00 0.00 ? 74  VAL A CB   6  
ATOM 9754  C CG1  . VAL A 1 74  ? 2.312   -5.520  3.358   1.00 0.00 ? 74  VAL A CG1  6  
ATOM 9755  C CG2  . VAL A 1 74  ? 2.871   -7.140  1.508   1.00 0.00 ? 74  VAL A CG2  6  
ATOM 9756  H H    . VAL A 1 74  ? 5.109   -6.077  0.459   1.00 0.00 ? 74  VAL A H    6  
ATOM 9757  H HA   . VAL A 1 74  ? 2.903   -4.290  1.107   1.00 0.00 ? 74  VAL A HA   6  
ATOM 9758  H HB   . VAL A 1 74  ? 4.246   -6.299  2.906   1.00 0.00 ? 74  VAL A HB   6  
ATOM 9759  H HG11 . VAL A 1 74  ? 2.799   -5.054  4.215   1.00 0.00 ? 74  VAL A HG11 6  
ATOM 9760  H HG12 . VAL A 1 74  ? 1.640   -4.801  2.887   1.00 0.00 ? 74  VAL A HG12 6  
ATOM 9761  H HG13 . VAL A 1 74  ? 1.741   -6.387  3.691   1.00 0.00 ? 74  VAL A HG13 6  
ATOM 9762  H HG21 . VAL A 1 74  ? 2.774   -6.828  0.468   1.00 0.00 ? 74  VAL A HG21 6  
ATOM 9763  H HG22 . VAL A 1 74  ? 3.581   -7.964  1.575   1.00 0.00 ? 74  VAL A HG22 6  
ATOM 9764  H HG23 . VAL A 1 74  ? 1.900   -7.466  1.881   1.00 0.00 ? 74  VAL A HG23 6  
ATOM 9765  N N    . VAL A 1 75  ? 4.231   -2.540  2.187   1.00 0.00 ? 75  VAL A N    6  
ATOM 9766  C CA   . VAL A 1 75  ? 4.969   -1.473  2.841   1.00 0.00 ? 75  VAL A CA   6  
ATOM 9767  C C    . VAL A 1 75  ? 4.165   -0.963  4.040   1.00 0.00 ? 75  VAL A C    6  
ATOM 9768  O O    . VAL A 1 75  ? 3.013   -1.351  4.229   1.00 0.00 ? 75  VAL A O    6  
ATOM 9769  C CB   . VAL A 1 75  ? 5.301   -0.372  1.832   1.00 0.00 ? 75  VAL A CB   6  
ATOM 9770  C CG1  . VAL A 1 75  ? 6.058   -0.940  0.630   1.00 0.00 ? 75  VAL A CG1  6  
ATOM 9771  C CG2  . VAL A 1 75  ? 4.035   0.362   1.386   1.00 0.00 ? 75  VAL A CG2  6  
ATOM 9772  H H    . VAL A 1 75  ? 3.374   -2.259  1.755   1.00 0.00 ? 75  VAL A H    6  
ATOM 9773  H HA   . VAL A 1 75  ? 5.907   -1.895  3.202   1.00 0.00 ? 75  VAL A HA   6  
ATOM 9774  H HB   . VAL A 1 75  ? 5.950   0.350   2.326   1.00 0.00 ? 75  VAL A HB   6  
ATOM 9775  H HG11 . VAL A 1 75  ? 5.476   -0.777  -0.277  1.00 0.00 ? 75  VAL A HG11 6  
ATOM 9776  H HG12 . VAL A 1 75  ? 7.022   -0.440  0.538   1.00 0.00 ? 75  VAL A HG12 6  
ATOM 9777  H HG13 . VAL A 1 75  ? 6.216   -2.009  0.773   1.00 0.00 ? 75  VAL A HG13 6  
ATOM 9778  H HG21 . VAL A 1 75  ? 4.284   1.065   0.591   1.00 0.00 ? 75  VAL A HG21 6  
ATOM 9779  H HG22 . VAL A 1 75  ? 3.307   -0.360  1.016   1.00 0.00 ? 75  VAL A HG22 6  
ATOM 9780  H HG23 . VAL A 1 75  ? 3.612   0.904   2.231   1.00 0.00 ? 75  VAL A HG23 6  
ATOM 9781  N N    . SER A 1 76  ? 4.805   -0.102  4.817   1.00 0.00 ? 76  SER A N    6  
ATOM 9782  C CA   . SER A 1 76  ? 4.164   0.465   5.992   1.00 0.00 ? 76  SER A CA   6  
ATOM 9783  C C    . SER A 1 76  ? 3.411   1.741   5.612   1.00 0.00 ? 76  SER A C    6  
ATOM 9784  O O    . SER A 1 76  ? 3.306   2.077   4.433   1.00 0.00 ? 76  SER A O    6  
ATOM 9785  C CB   . SER A 1 76  ? 5.189   0.760   7.089   1.00 0.00 ? 76  SER A CB   6  
ATOM 9786  O OG   . SER A 1 76  ? 5.475   2.152   7.192   1.00 0.00 ? 76  SER A OG   6  
ATOM 9787  H H    . SER A 1 76  ? 5.742   0.208   4.656   1.00 0.00 ? 76  SER A H    6  
ATOM 9788  H HA   . SER A 1 76  ? 3.470   -0.301  6.339   1.00 0.00 ? 76  SER A HA   6  
ATOM 9789  H HB2  . SER A 1 76  ? 4.811   0.396   8.045   1.00 0.00 ? 76  SER A HB2  6  
ATOM 9790  H HB3  . SER A 1 76  ? 6.109   0.215   6.882   1.00 0.00 ? 76  SER A HB3  6  
ATOM 9791  H HG   . SER A 1 76  ? 5.757   2.510   6.302   1.00 0.00 ? 76  SER A HG   6  
ATOM 9792  N N    . GLU A 1 77  ? 2.904   2.417   6.633   1.00 0.00 ? 77  GLU A N    6  
ATOM 9793  C CA   . GLU A 1 77  ? 2.163   3.648   6.421   1.00 0.00 ? 77  GLU A CA   6  
ATOM 9794  C C    . GLU A 1 77  ? 3.127   4.821   6.230   1.00 0.00 ? 77  GLU A C    6  
ATOM 9795  O O    . GLU A 1 77  ? 2.766   5.835   5.633   1.00 0.00 ? 77  GLU A O    6  
ATOM 9796  C CB   . GLU A 1 77  ? 1.198   3.914   7.578   1.00 0.00 ? 77  GLU A CB   6  
ATOM 9797  C CG   . GLU A 1 77  ? -0.248  3.973   7.084   1.00 0.00 ? 77  GLU A CG   6  
ATOM 9798  C CD   . GLU A 1 77  ? -1.016  5.106   7.768   1.00 0.00 ? 77  GLU A CD   6  
ATOM 9799  O OE1  . GLU A 1 77  ? -0.436  6.210   7.859   1.00 0.00 ? 77  GLU A OE1  6  
ATOM 9800  O OE2  . GLU A 1 77  ? -2.165  4.843   8.184   1.00 0.00 ? 77  GLU A OE2  6  
ATOM 9801  H H    . GLU A 1 77  ? 2.993   2.136   7.589   1.00 0.00 ? 77  GLU A H    6  
ATOM 9802  H HA   . GLU A 1 77  ? 1.590   3.488   5.508   1.00 0.00 ? 77  GLU A HA   6  
ATOM 9803  H HB2  . GLU A 1 77  ? 1.299   3.128   8.328   1.00 0.00 ? 77  GLU A HB2  6  
ATOM 9804  H HB3  . GLU A 1 77  ? 1.459   4.854   8.065   1.00 0.00 ? 77  GLU A HB3  6  
ATOM 9805  H HG2  . GLU A 1 77  ? -0.262  4.120   6.004   1.00 0.00 ? 77  GLU A HG2  6  
ATOM 9806  H HG3  . GLU A 1 77  ? -0.743  3.022   7.282   1.00 0.00 ? 77  GLU A HG3  6  
ATOM 9807  N N    . ASP A 1 78  ? 4.333   4.645   6.749   1.00 0.00 ? 78  ASP A N    6  
ATOM 9808  C CA   . ASP A 1 78  ? 5.351   5.677   6.643   1.00 0.00 ? 78  ASP A CA   6  
ATOM 9809  C C    . ASP A 1 78  ? 5.502   6.090   5.178   1.00 0.00 ? 78  ASP A C    6  
ATOM 9810  O O    . ASP A 1 78  ? 5.646   7.273   4.874   1.00 0.00 ? 78  ASP A O    6  
ATOM 9811  C CB   . ASP A 1 78  ? 6.707   5.164   7.132   1.00 0.00 ? 78  ASP A CB   6  
ATOM 9812  C CG   . ASP A 1 78  ? 6.817   4.969   8.646   1.00 0.00 ? 78  ASP A CG   6  
ATOM 9813  O OD1  . ASP A 1 78  ? 5.797   5.215   9.325   1.00 0.00 ? 78  ASP A OD1  6  
ATOM 9814  O OD2  . ASP A 1 78  ? 7.918   4.578   9.089   1.00 0.00 ? 78  ASP A OD2  6  
ATOM 9815  H H    . ASP A 1 78  ? 4.618   3.818   7.233   1.00 0.00 ? 78  ASP A H    6  
ATOM 9816  H HA   . ASP A 1 78  ? 4.997   6.493   7.272   1.00 0.00 ? 78  ASP A HA   6  
ATOM 9817  H HB2  . ASP A 1 78  ? 6.918   4.214   6.642   1.00 0.00 ? 78  ASP A HB2  6  
ATOM 9818  H HB3  . ASP A 1 78  ? 7.479   5.865   6.814   1.00 0.00 ? 78  ASP A HB3  6  
ATOM 9819  N N    . PHE A 1 79  ? 5.465   5.091   4.308   1.00 0.00 ? 79  PHE A N    6  
ATOM 9820  C CA   . PHE A 1 79  ? 5.596   5.335   2.882   1.00 0.00 ? 79  PHE A CA   6  
ATOM 9821  C C    . PHE A 1 79  ? 4.764   6.547   2.454   1.00 0.00 ? 79  PHE A C    6  
ATOM 9822  O O    . PHE A 1 79  ? 5.222   7.370   1.664   1.00 0.00 ? 79  PHE A O    6  
ATOM 9823  C CB   . PHE A 1 79  ? 5.069   4.091   2.164   1.00 0.00 ? 79  PHE A CB   6  
ATOM 9824  C CG   . PHE A 1 79  ? 4.630   4.344   0.721   1.00 0.00 ? 79  PHE A CG   6  
ATOM 9825  C CD1  . PHE A 1 79  ? 5.529   4.234   -0.294  1.00 0.00 ? 79  PHE A CD1  6  
ATOM 9826  C CD2  . PHE A 1 79  ? 3.339   4.680   0.452   1.00 0.00 ? 79  PHE A CD2  6  
ATOM 9827  C CE1  . PHE A 1 79  ? 5.121   4.469   -1.633  1.00 0.00 ? 79  PHE A CE1  6  
ATOM 9828  C CE2  . PHE A 1 79  ? 2.931   4.915   -0.888  1.00 0.00 ? 79  PHE A CE2  6  
ATOM 9829  C CZ   . PHE A 1 79  ? 3.831   4.805   -1.902  1.00 0.00 ? 79  PHE A CZ   6  
ATOM 9830  H H    . PHE A 1 79  ? 5.348   4.131   4.563   1.00 0.00 ? 79  PHE A H    6  
ATOM 9831  H HA   . PHE A 1 79  ? 6.649   5.532   2.683   1.00 0.00 ? 79  PHE A HA   6  
ATOM 9832  H HB2  . PHE A 1 79  ? 5.845   3.326   2.168   1.00 0.00 ? 79  PHE A HB2  6  
ATOM 9833  H HB3  . PHE A 1 79  ? 4.225   3.691   2.725   1.00 0.00 ? 79  PHE A HB3  6  
ATOM 9834  H HD1  . PHE A 1 79  ? 6.563   3.965   -0.078  1.00 0.00 ? 79  PHE A HD1  6  
ATOM 9835  H HD2  . PHE A 1 79  ? 2.618   4.768   1.264   1.00 0.00 ? 79  PHE A HD2  6  
ATOM 9836  H HE1  . PHE A 1 79  ? 5.842   4.381   -2.446  1.00 0.00 ? 79  PHE A HE1  6  
ATOM 9837  H HE2  . PHE A 1 79  ? 1.897   5.184   -1.104  1.00 0.00 ? 79  PHE A HE2  6  
ATOM 9838  H HZ   . PHE A 1 79  ? 3.518   4.985   -2.930  1.00 0.00 ? 79  PHE A HZ   6  
ATOM 9839  N N    . LEU A 1 80  ? 3.557   6.616   2.996   1.00 0.00 ? 80  LEU A N    6  
ATOM 9840  C CA   . LEU A 1 80  ? 2.657   7.713   2.681   1.00 0.00 ? 80  LEU A CA   6  
ATOM 9841  C C    . LEU A 1 80  ? 3.263   9.024   3.185   1.00 0.00 ? 80  LEU A C    6  
ATOM 9842  O O    . LEU A 1 80  ? 3.179   10.050  2.511   1.00 0.00 ? 80  LEU A O    6  
ATOM 9843  C CB   . LEU A 1 80  ? 1.257   7.431   3.229   1.00 0.00 ? 80  LEU A CB   6  
ATOM 9844  C CG   . LEU A 1 80  ? 0.464   6.336   2.512   1.00 0.00 ? 80  LEU A CG   6  
ATOM 9845  C CD1  . LEU A 1 80  ? -0.738  5.893   3.349   1.00 0.00 ? 80  LEU A CD1  6  
ATOM 9846  C CD2  . LEU A 1 80  ? 0.051   6.786   1.110   1.00 0.00 ? 80  LEU A CD2  6  
ATOM 9847  H H    . LEU A 1 80  ? 3.193   5.942   3.638   1.00 0.00 ? 80  LEU A H    6  
ATOM 9848  H HA   . LEU A 1 80  ? 2.574   7.765   1.595   1.00 0.00 ? 80  LEU A HA   6  
ATOM 9849  H HB2  . LEU A 1 80  ? 1.348   7.158   4.280   1.00 0.00 ? 80  LEU A HB2  6  
ATOM 9850  H HB3  . LEU A 1 80  ? 0.680   8.355   3.188   1.00 0.00 ? 80  LEU A HB3  6  
ATOM 9851  H HG   . LEU A 1 80  ? 1.112   5.467   2.394   1.00 0.00 ? 80  LEU A HG   6  
ATOM 9852  H HD11 . LEU A 1 80  ? -1.659  6.133   2.817   1.00 0.00 ? 80  LEU A HD11 6  
ATOM 9853  H HD12 . LEU A 1 80  ? -0.686  4.818   3.519   1.00 0.00 ? 80  LEU A HD12 6  
ATOM 9854  H HD13 . LEU A 1 80  ? -0.726  6.413   4.307   1.00 0.00 ? 80  LEU A HD13 6  
ATOM 9855  H HD21 . LEU A 1 80  ? -0.802  7.460   1.181   1.00 0.00 ? 80  LEU A HD21 6  
ATOM 9856  H HD22 . LEU A 1 80  ? 0.885   7.304   0.634   1.00 0.00 ? 80  LEU A HD22 6  
ATOM 9857  H HD23 . LEU A 1 80  ? -0.222  5.915   0.514   1.00 0.00 ? 80  LEU A HD23 6  
ATOM 9858  N N    . GLN A 1 81  ? 3.859   8.949   4.366   1.00 0.00 ? 81  GLN A N    6  
ATOM 9859  C CA   . GLN A 1 81  ? 4.478   10.117  4.968   1.00 0.00 ? 81  GLN A CA   6  
ATOM 9860  C C    . GLN A 1 81  ? 5.711   10.538  4.165   1.00 0.00 ? 81  GLN A C    6  
ATOM 9861  O O    . GLN A 1 81  ? 6.004   11.726  4.049   1.00 0.00 ? 81  GLN A O    6  
ATOM 9862  C CB   . GLN A 1 81  ? 4.840   9.854   6.431   1.00 0.00 ? 81  GLN A CB   6  
ATOM 9863  C CG   . GLN A 1 81  ? 5.893   10.848  6.923   1.00 0.00 ? 81  GLN A CG   6  
ATOM 9864  C CD   . GLN A 1 81  ? 5.331   12.271  6.954   1.00 0.00 ? 81  GLN A CD   6  
ATOM 9865  O OE1  . GLN A 1 81  ? 5.334   12.989  5.968   1.00 0.00 ? 81  GLN A OE1  6  
ATOM 9866  N NE2  . GLN A 1 81  ? 4.851   12.637  8.139   1.00 0.00 ? 81  GLN A NE2  6  
ATOM 9867  H H    . GLN A 1 81  ? 3.922   8.110   4.907   1.00 0.00 ? 81  GLN A H    6  
ATOM 9868  H HA   . GLN A 1 81  ? 3.722   10.901  4.922   1.00 0.00 ? 81  GLN A HA   6  
ATOM 9869  H HB2  . GLN A 1 81  ? 3.946   9.930   7.050   1.00 0.00 ? 81  GLN A HB2  6  
ATOM 9870  H HB3  . GLN A 1 81  ? 5.216   8.836   6.538   1.00 0.00 ? 81  GLN A HB3  6  
ATOM 9871  H HG2  . GLN A 1 81  ? 6.229   10.564  7.920   1.00 0.00 ? 81  GLN A HG2  6  
ATOM 9872  H HG3  . GLN A 1 81  ? 6.765   10.812  6.270   1.00 0.00 ? 81  GLN A HG3  6  
ATOM 9873  H HE21 . GLN A 1 81  ? 4.879   11.999  8.908   1.00 0.00 ? 81  GLN A HE21 6  
ATOM 9874  H HE22 . GLN A 1 81  ? 4.461   13.550  8.260   1.00 0.00 ? 81  GLN A HE22 6  
ATOM 9875  N N    . ASP A 1 82  ? 6.399   9.539   3.632   1.00 0.00 ? 82  ASP A N    6  
ATOM 9876  C CA   . ASP A 1 82  ? 7.593   9.790   2.844   1.00 0.00 ? 82  ASP A CA   6  
ATOM 9877  C C    . ASP A 1 82  ? 7.187   10.218  1.432   1.00 0.00 ? 82  ASP A C    6  
ATOM 9878  O O    . ASP A 1 82  ? 7.521   11.317  0.993   1.00 0.00 ? 82  ASP A O    6  
ATOM 9879  C CB   . ASP A 1 82  ? 8.452   8.529   2.727   1.00 0.00 ? 82  ASP A CB   6  
ATOM 9880  C CG   . ASP A 1 82  ? 9.543   8.388   3.790   1.00 0.00 ? 82  ASP A CG   6  
ATOM 9881  O OD1  . ASP A 1 82  ? 9.175   8.388   4.984   1.00 0.00 ? 82  ASP A OD1  6  
ATOM 9882  O OD2  . ASP A 1 82  ? 10.720  8.285   3.384   1.00 0.00 ? 82  ASP A OD2  6  
ATOM 9883  H H    . ASP A 1 82  ? 6.153   8.575   3.731   1.00 0.00 ? 82  ASP A H    6  
ATOM 9884  H HA   . ASP A 1 82  ? 8.130   10.574  3.379   1.00 0.00 ? 82  ASP A HA   6  
ATOM 9885  H HB2  . ASP A 1 82  ? 7.799   7.657   2.780   1.00 0.00 ? 82  ASP A HB2  6  
ATOM 9886  H HB3  . ASP A 1 82  ? 8.920   8.516   1.743   1.00 0.00 ? 82  ASP A HB3  6  
ATOM 9887  N N    . VAL A 1 83  ? 6.472   9.327   0.761   1.00 0.00 ? 83  VAL A N    6  
ATOM 9888  C CA   . VAL A 1 83  ? 6.016   9.599   -0.592  1.00 0.00 ? 83  VAL A CA   6  
ATOM 9889  C C    . VAL A 1 83  ? 5.427   11.010  -0.653  1.00 0.00 ? 83  VAL A C    6  
ATOM 9890  O O    . VAL A 1 83  ? 5.547   11.692  -1.669  1.00 0.00 ? 83  VAL A O    6  
ATOM 9891  C CB   . VAL A 1 83  ? 5.029   8.519   -1.038  1.00 0.00 ? 83  VAL A CB   6  
ATOM 9892  C CG1  . VAL A 1 83  ? 3.651   8.744   -0.413  1.00 0.00 ? 83  VAL A CG1  6  
ATOM 9893  C CG2  . VAL A 1 83  ? 4.936   8.458   -2.564  1.00 0.00 ? 83  VAL A CG2  6  
ATOM 9894  H H    . VAL A 1 83  ? 6.205   8.435   1.126   1.00 0.00 ? 83  VAL A H    6  
ATOM 9895  H HA   . VAL A 1 83  ? 6.886   9.553   -1.247  1.00 0.00 ? 83  VAL A HA   6  
ATOM 9896  H HB   . VAL A 1 83  ? 5.403   7.557   -0.687  1.00 0.00 ? 83  VAL A HB   6  
ATOM 9897  H HG11 . VAL A 1 83  ? 3.066   9.406   -1.052  1.00 0.00 ? 83  VAL A HG11 6  
ATOM 9898  H HG12 . VAL A 1 83  ? 3.136   7.788   -0.313  1.00 0.00 ? 83  VAL A HG12 6  
ATOM 9899  H HG13 . VAL A 1 83  ? 3.768   9.199   0.571   1.00 0.00 ? 83  VAL A HG13 6  
ATOM 9900  H HG21 . VAL A 1 83  ? 5.752   7.850   -2.954  1.00 0.00 ? 83  VAL A HG21 6  
ATOM 9901  H HG22 . VAL A 1 83  ? 3.983   8.014   -2.853  1.00 0.00 ? 83  VAL A HG22 6  
ATOM 9902  H HG23 . VAL A 1 83  ? 5.006   9.466   -2.973  1.00 0.00 ? 83  VAL A HG23 6  
ATOM 9903  N N    . SER A 1 84  ? 4.804   11.405  0.447   1.00 0.00 ? 84  SER A N    6  
ATOM 9904  C CA   . SER A 1 84  ? 4.196   12.722  0.531   1.00 0.00 ? 84  SER A CA   6  
ATOM 9905  C C    . SER A 1 84  ? 5.263   13.771  0.853   1.00 0.00 ? 84  SER A C    6  
ATOM 9906  O O    . SER A 1 84  ? 5.219   14.885  0.334   1.00 0.00 ? 84  SER A O    6  
ATOM 9907  C CB   . SER A 1 84  ? 3.088   12.751  1.585   1.00 0.00 ? 84  SER A CB   6  
ATOM 9908  O OG   . SER A 1 84  ? 2.368   13.980  1.569   1.00 0.00 ? 84  SER A OG   6  
ATOM 9909  H H    . SER A 1 84  ? 4.711   10.843  1.269   1.00 0.00 ? 84  SER A H    6  
ATOM 9910  H HA   . SER A 1 84  ? 3.765   12.904  -0.453  1.00 0.00 ? 84  SER A HA   6  
ATOM 9911  H HB2  . SER A 1 84  ? 2.399   11.925  1.410   1.00 0.00 ? 84  SER A HB2  6  
ATOM 9912  H HB3  . SER A 1 84  ? 3.523   12.598  2.573   1.00 0.00 ? 84  SER A HB3  6  
ATOM 9913  H HG   . SER A 1 84  ? 1.399   13.807  1.392   1.00 0.00 ? 84  SER A HG   6  
ATOM 9914  N N    . ALA A 1 85  ? 6.195   13.377  1.707   1.00 0.00 ? 85  ALA A N    6  
ATOM 9915  C CA   . ALA A 1 85  ? 7.271   14.269  2.104   1.00 0.00 ? 85  ALA A CA   6  
ATOM 9916  C C    . ALA A 1 85  ? 8.598   13.508  2.069   1.00 0.00 ? 85  ALA A C    6  
ATOM 9917  O O    . ALA A 1 85  ? 9.161   13.186  3.114   1.00 0.00 ? 85  ALA A O    6  
ATOM 9918  C CB   . ALA A 1 85  ? 6.969   14.850  3.487   1.00 0.00 ? 85  ALA A CB   6  
ATOM 9919  H H    . ALA A 1 85  ? 6.224   12.469  2.125   1.00 0.00 ? 85  ALA A H    6  
ATOM 9920  H HA   . ALA A 1 85  ? 7.310   15.084  1.382   1.00 0.00 ? 85  ALA A HA   6  
ATOM 9921  H HB1  . ALA A 1 85  ? 7.320   15.881  3.533   1.00 0.00 ? 85  ALA A HB1  6  
ATOM 9922  H HB2  . ALA A 1 85  ? 5.893   14.824  3.665   1.00 0.00 ? 85  ALA A HB2  6  
ATOM 9923  H HB3  . ALA A 1 85  ? 7.477   14.259  4.249   1.00 0.00 ? 85  ALA A HB3  6  
ATOM 9924  N N    . SER A 1 86  ? 9.059   13.243  0.856   1.00 0.00 ? 86  SER A N    6  
ATOM 9925  C CA   . SER A 1 86  ? 10.310  12.526  0.671   1.00 0.00 ? 86  SER A CA   6  
ATOM 9926  C C    . SER A 1 86  ? 11.036  13.053  -0.568  1.00 0.00 ? 86  SER A C    6  
ATOM 9927  O O    . SER A 1 86  ? 10.426  13.230  -1.622  1.00 0.00 ? 86  SER A O    6  
ATOM 9928  C CB   . SER A 1 86  ? 10.068  11.021  0.544   1.00 0.00 ? 86  SER A CB   6  
ATOM 9929  O OG   . SER A 1 86  ? 11.273  10.306  0.286   1.00 0.00 ? 86  SER A OG   6  
ATOM 9930  H H    . SER A 1 86  ? 8.595   13.508  0.011   1.00 0.00 ? 86  SER A H    6  
ATOM 9931  H HA   . SER A 1 86  ? 10.892  12.725  1.570   1.00 0.00 ? 86  SER A HA   6  
ATOM 9932  H HB2  . SER A 1 86  ? 9.615   10.648  1.463   1.00 0.00 ? 86  SER A HB2  6  
ATOM 9933  H HB3  . SER A 1 86  ? 9.356   10.834  -0.260  1.00 0.00 ? 86  SER A HB3  6  
ATOM 9934  H HG   . SER A 1 86  ? 11.996  10.620  0.902   1.00 0.00 ? 86  SER A HG   6  
ATOM 9935  N N    . THR A 1 87  ? 12.329  13.288  -0.401  1.00 0.00 ? 87  THR A N    6  
ATOM 9936  C CA   . THR A 1 87  ? 13.146  13.791  -1.493  1.00 0.00 ? 87  THR A CA   6  
ATOM 9937  C C    . THR A 1 87  ? 13.667  12.633  -2.347  1.00 0.00 ? 87  THR A C    6  
ATOM 9938  O O    . THR A 1 87  ? 14.569  12.815  -3.162  1.00 0.00 ? 87  THR A O    6  
ATOM 9939  C CB   . THR A 1 87  ? 14.259  14.652  -0.893  1.00 0.00 ? 87  THR A CB   6  
ATOM 9940  O OG1  . THR A 1 87  ? 15.202  13.706  -0.399  1.00 0.00 ? 87  THR A OG1  6  
ATOM 9941  C CG2  . THR A 1 87  ? 13.804  15.411  0.355   1.00 0.00 ? 87  THR A CG2  6  
ATOM 9942  H H    . THR A 1 87  ? 12.818  13.141  0.459   1.00 0.00 ? 87  THR A H    6  
ATOM 9943  H HA   . THR A 1 87  ? 12.517  14.406  -2.137  1.00 0.00 ? 87  THR A HA   6  
ATOM 9944  H HB   . THR A 1 87  ? 14.666  15.336  -1.638  1.00 0.00 ? 87  THR A HB   6  
ATOM 9945  H HG1  . THR A 1 87  ? 14.759  13.089  0.251   1.00 0.00 ? 87  THR A HG1  6  
ATOM 9946  H HG21 . THR A 1 87  ? 12.744  15.650  0.269   1.00 0.00 ? 87  THR A HG21 6  
ATOM 9947  H HG22 . THR A 1 87  ? 13.966  14.791  1.237   1.00 0.00 ? 87  THR A HG22 6  
ATOM 9948  H HG23 . THR A 1 87  ? 14.377  16.334  0.448   1.00 0.00 ? 87  THR A HG23 6  
ATOM 9949  N N    . LYS A 1 88  ? 13.075  11.467  -2.130  1.00 0.00 ? 88  LYS A N    6  
ATOM 9950  C CA   . LYS A 1 88  ? 13.468  10.280  -2.869  1.00 0.00 ? 88  LYS A CA   6  
ATOM 9951  C C    . LYS A 1 88  ? 12.388  9.944   -3.899  1.00 0.00 ? 88  LYS A C    6  
ATOM 9952  O O    . LYS A 1 88  ? 11.519  10.768  -4.183  1.00 0.00 ? 88  LYS A O    6  
ATOM 9953  C CB   . LYS A 1 88  ? 13.781  9.130   -1.909  1.00 0.00 ? 88  LYS A CB   6  
ATOM 9954  C CG   . LYS A 1 88  ? 14.896  9.517   -0.935  1.00 0.00 ? 88  LYS A CG   6  
ATOM 9955  C CD   . LYS A 1 88  ? 15.935  8.400   -0.819  1.00 0.00 ? 88  LYS A CD   6  
ATOM 9956  C CE   . LYS A 1 88  ? 16.038  7.894   0.621   1.00 0.00 ? 88  LYS A CE   6  
ATOM 9957  N NZ   . LYS A 1 88  ? 17.268  8.407   1.265   1.00 0.00 ? 88  LYS A NZ   6  
ATOM 9958  H H    . LYS A 1 88  ? 12.342  11.328  -1.465  1.00 0.00 ? 88  LYS A H    6  
ATOM 9959  H HA   . LYS A 1 88  ? 14.390  10.516  -3.400  1.00 0.00 ? 88  LYS A HA   6  
ATOM 9960  H HB2  . LYS A 1 88  ? 12.884  8.861   -1.352  1.00 0.00 ? 88  LYS A HB2  6  
ATOM 9961  H HB3  . LYS A 1 88  ? 14.079  8.249   -2.477  1.00 0.00 ? 88  LYS A HB3  6  
ATOM 9962  H HG2  . LYS A 1 88  ? 15.378  10.434  -1.274  1.00 0.00 ? 88  LYS A HG2  6  
ATOM 9963  H HG3  . LYS A 1 88  ? 14.469  9.725   0.046   1.00 0.00 ? 88  LYS A HG3  6  
ATOM 9964  H HD2  . LYS A 1 88  ? 15.664  7.577   -1.480  1.00 0.00 ? 88  LYS A HD2  6  
ATOM 9965  H HD3  . LYS A 1 88  ? 16.907  8.767   -1.149  1.00 0.00 ? 88  LYS A HD3  6  
ATOM 9966  H HE2  . LYS A 1 88  ? 15.163  8.213   1.188   1.00 0.00 ? 88  LYS A HE2  6  
ATOM 9967  H HE3  . LYS A 1 88  ? 16.043  6.804   0.630   1.00 0.00 ? 88  LYS A HE3  6  
ATOM 9968  H HZ1  . LYS A 1 88  ? 17.947  8.621   0.563   1.00 0.00 ? 88  LYS A HZ1  6  
ATOM 9969  H HZ2  . LYS A 1 88  ? 17.052  9.235   1.783   1.00 0.00 ? 88  LYS A HZ2  6  
ATOM 9970  H HZ3  . LYS A 1 88  ? 17.635  7.713   1.883   1.00 0.00 ? 88  LYS A HZ3  6  
ATOM 9971  N N    . SER A 1 89  ? 12.477  8.734   -4.430  1.00 0.00 ? 89  SER A N    6  
ATOM 9972  C CA   . SER A 1 89  ? 11.517  8.279   -5.422  1.00 0.00 ? 89  SER A CA   6  
ATOM 9973  C C    . SER A 1 89  ? 10.722  7.092   -4.875  1.00 0.00 ? 89  SER A C    6  
ATOM 9974  O O    . SER A 1 89  ? 11.213  6.350   -4.026  1.00 0.00 ? 89  SER A O    6  
ATOM 9975  C CB   . SER A 1 89  ? 12.215  7.895   -6.728  1.00 0.00 ? 89  SER A CB   6  
ATOM 9976  O OG   . SER A 1 89  ? 13.059  8.938   -7.209  1.00 0.00 ? 89  SER A OG   6  
ATOM 9977  H H    . SER A 1 89  ? 13.186  8.070   -4.193  1.00 0.00 ? 89  SER A H    6  
ATOM 9978  H HA   . SER A 1 89  ? 10.860  9.131   -5.599  1.00 0.00 ? 89  SER A HA   6  
ATOM 9979  H HB2  . SER A 1 89  ? 12.807  6.993   -6.570  1.00 0.00 ? 89  SER A HB2  6  
ATOM 9980  H HB3  . SER A 1 89  ? 11.466  7.657   -7.483  1.00 0.00 ? 89  SER A HB3  6  
ATOM 9981  H HG   . SER A 1 89  ? 12.504  9.699   -7.545  1.00 0.00 ? 89  SER A HG   6  
ATOM 9982  N N    . LEU A 1 90  ? 9.508   6.949   -5.385  1.00 0.00 ? 90  LEU A N    6  
ATOM 9983  C CA   . LEU A 1 90  ? 8.640   5.864   -4.959  1.00 0.00 ? 90  LEU A CA   6  
ATOM 9984  C C    . LEU A 1 90  ? 9.477   4.601   -4.744  1.00 0.00 ? 90  LEU A C    6  
ATOM 9985  O O    . LEU A 1 90  ? 9.468   4.024   -3.658  1.00 0.00 ? 90  LEU A O    6  
ATOM 9986  C CB   . LEU A 1 90  ? 7.489   5.678   -5.949  1.00 0.00 ? 90  LEU A CB   6  
ATOM 9987  C CG   . LEU A 1 90  ? 6.217   6.476   -5.657  1.00 0.00 ? 90  LEU A CG   6  
ATOM 9988  C CD1  . LEU A 1 90  ? 5.533   5.973   -4.385  1.00 0.00 ? 90  LEU A CD1  6  
ATOM 9989  C CD2  . LEU A 1 90  ? 6.513   7.976   -5.594  1.00 0.00 ? 90  LEU A CD2  6  
ATOM 9990  H H    . LEU A 1 90  ? 9.116   7.557   -6.075  1.00 0.00 ? 90  LEU A H    6  
ATOM 9991  H HA   . LEU A 1 90  ? 8.200   6.153   -4.004  1.00 0.00 ? 90  LEU A HA   6  
ATOM 9992  H HB2  . LEU A 1 90  ? 7.844   5.948   -6.944  1.00 0.00 ? 90  LEU A HB2  6  
ATOM 9993  H HB3  . LEU A 1 90  ? 7.231   4.619   -5.981  1.00 0.00 ? 90  LEU A HB3  6  
ATOM 9994  H HG   . LEU A 1 90  ? 5.519   6.320   -6.480  1.00 0.00 ? 90  LEU A HG   6  
ATOM 9995  H HD11 . LEU A 1 90  ? 6.247   5.982   -3.561  1.00 0.00 ? 90  LEU A HD11 6  
ATOM 9996  H HD12 . LEU A 1 90  ? 4.692   6.622   -4.143  1.00 0.00 ? 90  LEU A HD12 6  
ATOM 9997  H HD13 . LEU A 1 90  ? 5.174   4.956   -4.543  1.00 0.00 ? 90  LEU A HD13 6  
ATOM 9998  H HD21 . LEU A 1 90  ? 5.614   8.535   -5.851  1.00 0.00 ? 90  LEU A HD21 6  
ATOM 9999  H HD22 . LEU A 1 90  ? 6.831   8.241   -4.586  1.00 0.00 ? 90  LEU A HD22 6  
ATOM 10000 H HD23 . LEU A 1 90  ? 7.307   8.219   -6.301  1.00 0.00 ? 90  LEU A HD23 6  
ATOM 10001 N N    . GLN A 1 91  ? 10.181  4.210   -5.797  1.00 0.00 ? 91  GLN A N    6  
ATOM 10002 C CA   . GLN A 1 91  ? 11.021  3.027   -5.737  1.00 0.00 ? 91  GLN A CA   6  
ATOM 10003 C C    . GLN A 1 91  ? 11.720  2.940   -4.379  1.00 0.00 ? 91  GLN A C    6  
ATOM 10004 O O    . GLN A 1 91  ? 11.725  1.886   -3.746  1.00 0.00 ? 91  GLN A O    6  
ATOM 10005 C CB   . GLN A 1 91  ? 12.039  3.019   -6.879  1.00 0.00 ? 91  GLN A CB   6  
ATOM 10006 C CG   . GLN A 1 91  ? 12.372  1.589   -7.308  1.00 0.00 ? 91  GLN A CG   6  
ATOM 10007 C CD   . GLN A 1 91  ? 13.882  1.399   -7.462  1.00 0.00 ? 91  GLN A CD   6  
ATOM 10008 O OE1  . GLN A 1 91  ? 14.592  2.252   -7.969  1.00 0.00 ? 91  GLN A OE1  6  
ATOM 10009 N NE2  . GLN A 1 91  ? 14.331  0.237   -6.997  1.00 0.00 ? 91  GLN A NE2  6  
ATOM 10010 H H    . GLN A 1 91  ? 10.182  4.686   -6.676  1.00 0.00 ? 91  GLN A H    6  
ATOM 10011 H HA   . GLN A 1 91  ? 10.342  2.183   -5.859  1.00 0.00 ? 91  GLN A HA   6  
ATOM 10012 H HB2  . GLN A 1 91  ? 11.642  3.575   -7.729  1.00 0.00 ? 91  GLN A HB2  6  
ATOM 10013 H HB3  . GLN A 1 91  ? 12.950  3.529   -6.563  1.00 0.00 ? 91  GLN A HB3  6  
ATOM 10014 H HG2  . GLN A 1 91  ? 11.986  0.885   -6.571  1.00 0.00 ? 91  GLN A HG2  6  
ATOM 10015 H HG3  . GLN A 1 91  ? 11.876  1.364   -8.253  1.00 0.00 ? 91  GLN A HG3  6  
ATOM 10016 H HE21 . GLN A 1 91  ? 13.695  -0.419  -6.592  1.00 0.00 ? 91  GLN A HE21 6  
ATOM 10017 H HE22 . GLN A 1 91  ? 15.306  0.020   -7.052  1.00 0.00 ? 91  GLN A HE22 6  
ATOM 10018 N N    . GLU A 1 92  ? 12.294  4.063   -3.972  1.00 0.00 ? 92  GLU A N    6  
ATOM 10019 C CA   . GLU A 1 92  ? 12.994  4.127   -2.700  1.00 0.00 ? 92  GLU A CA   6  
ATOM 10020 C C    . GLU A 1 92  ? 12.045  3.777   -1.553  1.00 0.00 ? 92  GLU A C    6  
ATOM 10021 O O    . GLU A 1 92  ? 12.217  2.755   -0.890  1.00 0.00 ? 92  GLU A O    6  
ATOM 10022 C CB   . GLU A 1 92  ? 13.623  5.506   -2.490  1.00 0.00 ? 92  GLU A CB   6  
ATOM 10023 C CG   . GLU A 1 92  ? 14.748  5.755   -3.496  1.00 0.00 ? 92  GLU A CG   6  
ATOM 10024 C CD   . GLU A 1 92  ? 15.978  4.907   -3.164  1.00 0.00 ? 92  GLU A CD   6  
ATOM 10025 O OE1  . GLU A 1 92  ? 16.693  5.293   -2.214  1.00 0.00 ? 92  GLU A OE1  6  
ATOM 10026 O OE2  . GLU A 1 92  ? 16.175  3.894   -3.868  1.00 0.00 ? 92  GLU A OE2  6  
ATOM 10027 H H    . GLU A 1 92  ? 12.285  4.916   -4.493  1.00 0.00 ? 92  GLU A H    6  
ATOM 10028 H HA   . GLU A 1 92  ? 13.785  3.380   -2.767  1.00 0.00 ? 92  GLU A HA   6  
ATOM 10029 H HB2  . GLU A 1 92  ? 12.860  6.277   -2.593  1.00 0.00 ? 92  GLU A HB2  6  
ATOM 10030 H HB3  . GLU A 1 92  ? 14.015  5.580   -1.475  1.00 0.00 ? 92  GLU A HB3  6  
ATOM 10031 H HG2  . GLU A 1 92  ? 14.400  5.519   -4.502  1.00 0.00 ? 92  GLU A HG2  6  
ATOM 10032 H HG3  . GLU A 1 92  ? 15.018  6.811   -3.491  1.00 0.00 ? 92  GLU A HG3  6  
ATOM 10033 N N    . LEU A 1 93  ? 11.063  4.644   -1.354  1.00 0.00 ? 93  LEU A N    6  
ATOM 10034 C CA   . LEU A 1 93  ? 10.086  4.439   -0.298  1.00 0.00 ? 93  LEU A CA   6  
ATOM 10035 C C    . LEU A 1 93  ? 9.695   2.960   -0.251  1.00 0.00 ? 93  LEU A C    6  
ATOM 10036 O O    . LEU A 1 93  ? 9.885   2.296   0.767   1.00 0.00 ? 93  LEU A O    6  
ATOM 10037 C CB   . LEU A 1 93  ? 8.896   5.384   -0.478  1.00 0.00 ? 93  LEU A CB   6  
ATOM 10038 C CG   . LEU A 1 93  ? 9.197   6.876   -0.332  1.00 0.00 ? 93  LEU A CG   6  
ATOM 10039 C CD1  . LEU A 1 93  ? 10.432  7.104   0.542   1.00 0.00 ? 93  LEU A CD1  6  
ATOM 10040 C CD2  . LEU A 1 93  ? 9.333   7.545   -1.701  1.00 0.00 ? 93  LEU A CD2  6  
ATOM 10041 H H    . LEU A 1 93  ? 10.930  5.472   -1.897  1.00 0.00 ? 93  LEU A H    6  
ATOM 10042 H HA   . LEU A 1 93  ? 10.565  4.700   0.646   1.00 0.00 ? 93  LEU A HA   6  
ATOM 10043 H HB2  . LEU A 1 93  ? 8.469   5.214   -1.467  1.00 0.00 ? 93  LEU A HB2  6  
ATOM 10044 H HB3  . LEU A 1 93  ? 8.130   5.114   0.250   1.00 0.00 ? 93  LEU A HB3  6  
ATOM 10045 H HG   . LEU A 1 93  ? 8.354   7.347   0.174   1.00 0.00 ? 93  LEU A HG   6  
ATOM 10046 H HD11 . LEU A 1 93  ? 10.575  8.173   0.698   1.00 0.00 ? 93  LEU A HD11 6  
ATOM 10047 H HD12 . LEU A 1 93  ? 10.291  6.612   1.505   1.00 0.00 ? 93  LEU A HD12 6  
ATOM 10048 H HD13 . LEU A 1 93  ? 11.309  6.688   0.047   1.00 0.00 ? 93  LEU A HD13 6  
ATOM 10049 H HD21 . LEU A 1 93  ? 8.528   7.205   -2.353  1.00 0.00 ? 93  LEU A HD21 6  
ATOM 10050 H HD22 . LEU A 1 93  ? 9.274   8.627   -1.584  1.00 0.00 ? 93  LEU A HD22 6  
ATOM 10051 H HD23 . LEU A 1 93  ? 10.294  7.279   -2.141  1.00 0.00 ? 93  LEU A HD23 6  
ATOM 10052 N N    . PHE A 1 94  ? 9.157   2.487   -1.365  1.00 0.00 ? 94  PHE A N    6  
ATOM 10053 C CA   . PHE A 1 94  ? 8.738   1.099   -1.464  1.00 0.00 ? 94  PHE A CA   6  
ATOM 10054 C C    . PHE A 1 94  ? 9.760   0.170   -0.806  1.00 0.00 ? 94  PHE A C    6  
ATOM 10055 O O    . PHE A 1 94  ? 9.401   -0.888  -0.291  1.00 0.00 ? 94  PHE A O    6  
ATOM 10056 C CB   . PHE A 1 94  ? 8.647   0.764   -2.954  1.00 0.00 ? 94  PHE A CB   6  
ATOM 10057 C CG   . PHE A 1 94  ? 7.381   1.290   -3.634  1.00 0.00 ? 94  PHE A CG   6  
ATOM 10058 C CD1  . PHE A 1 94  ? 6.176   1.166   -3.016  1.00 0.00 ? 94  PHE A CD1  6  
ATOM 10059 C CD2  . PHE A 1 94  ? 7.461   1.881   -4.856  1.00 0.00 ? 94  PHE A CD2  6  
ATOM 10060 C CE1  . PHE A 1 94  ? 5.001   1.654   -3.647  1.00 0.00 ? 94  PHE A CE1  6  
ATOM 10061 C CE2  . PHE A 1 94  ? 6.286   2.368   -5.487  1.00 0.00 ? 94  PHE A CE2  6  
ATOM 10062 C CZ   . PHE A 1 94  ? 5.081   2.245   -4.869  1.00 0.00 ? 94  PHE A CZ   6  
ATOM 10063 H H    . PHE A 1 94  ? 9.006   3.034   -2.189  1.00 0.00 ? 94  PHE A H    6  
ATOM 10064 H HA   . PHE A 1 94  ? 7.783   1.012   -0.945  1.00 0.00 ? 94  PHE A HA   6  
ATOM 10065 H HB2  . PHE A 1 94  ? 9.518   1.177   -3.463  1.00 0.00 ? 94  PHE A HB2  6  
ATOM 10066 H HB3  . PHE A 1 94  ? 8.690   -0.318  -3.076  1.00 0.00 ? 94  PHE A HB3  6  
ATOM 10067 H HD1  . PHE A 1 94  ? 6.112   0.693   -2.036  1.00 0.00 ? 94  PHE A HD1  6  
ATOM 10068 H HD2  . PHE A 1 94  ? 8.427   1.980   -5.352  1.00 0.00 ? 94  PHE A HD2  6  
ATOM 10069 H HE1  . PHE A 1 94  ? 4.035   1.555   -3.151  1.00 0.00 ? 94  PHE A HE1  6  
ATOM 10070 H HE2  . PHE A 1 94  ? 6.350   2.842   -6.467  1.00 0.00 ? 94  PHE A HE2  6  
ATOM 10071 H HZ   . PHE A 1 94  ? 4.179   2.619   -5.353  1.00 0.00 ? 94  PHE A HZ   6  
ATOM 10072 N N    . LEU A 1 95  ? 11.013  0.599   -0.844  1.00 0.00 ? 95  LEU A N    6  
ATOM 10073 C CA   . LEU A 1 95  ? 12.089  -0.181  -0.258  1.00 0.00 ? 95  LEU A CA   6  
ATOM 10074 C C    . LEU A 1 95  ? 12.407  0.362   1.136   1.00 0.00 ? 95  LEU A C    6  
ATOM 10075 O O    . LEU A 1 95  ? 12.733  -0.400  2.044   1.00 0.00 ? 95  LEU A O    6  
ATOM 10076 C CB   . LEU A 1 95  ? 13.298  -0.215  -1.195  1.00 0.00 ? 95  LEU A CB   6  
ATOM 10077 C CG   . LEU A 1 95  ? 13.363  -1.397  -2.165  1.00 0.00 ? 95  LEU A CG   6  
ATOM 10078 C CD1  . LEU A 1 95  ? 14.401  -1.151  -3.261  1.00 0.00 ? 95  LEU A CD1  6  
ATOM 10079 C CD2  . LEU A 1 95  ? 13.619  -2.707  -1.417  1.00 0.00 ? 95  LEU A CD2  6  
ATOM 10080 H H    . LEU A 1 95  ? 11.296  1.461   -1.265  1.00 0.00 ? 95  LEU A H    6  
ATOM 10081 H HA   . LEU A 1 95  ? 11.732  -1.206  -0.156  1.00 0.00 ? 95  LEU A HA   6  
ATOM 10082 H HB2  . LEU A 1 95  ? 13.309  0.707   -1.776  1.00 0.00 ? 95  LEU A HB2  6  
ATOM 10083 H HB3  . LEU A 1 95  ? 14.204  -0.219  -0.588  1.00 0.00 ? 95  LEU A HB3  6  
ATOM 10084 H HG   . LEU A 1 95  ? 12.394  -1.490  -2.655  1.00 0.00 ? 95  LEU A HG   6  
ATOM 10085 H HD11 . LEU A 1 95  ? 15.338  -1.636  -2.989  1.00 0.00 ? 95  LEU A HD11 6  
ATOM 10086 H HD12 . LEU A 1 95  ? 14.039  -1.561  -4.204  1.00 0.00 ? 95  LEU A HD12 6  
ATOM 10087 H HD13 . LEU A 1 95  ? 14.566  -0.079  -3.371  1.00 0.00 ? 95  LEU A HD13 6  
ATOM 10088 H HD21 . LEU A 1 95  ? 13.539  -3.543  -2.111  1.00 0.00 ? 95  LEU A HD21 6  
ATOM 10089 H HD22 . LEU A 1 95  ? 14.619  -2.688  -0.983  1.00 0.00 ? 95  LEU A HD22 6  
ATOM 10090 H HD23 . LEU A 1 95  ? 12.881  -2.822  -0.622  1.00 0.00 ? 95  LEU A HD23 6  
ATOM 10091 N N    . ALA A 1 96  ? 12.301  1.677   1.262   1.00 0.00 ? 96  ALA A N    6  
ATOM 10092 C CA   . ALA A 1 96  ? 12.573  2.332   2.530   1.00 0.00 ? 96  ALA A CA   6  
ATOM 10093 C C    . ALA A 1 96  ? 11.373  2.148   3.462   1.00 0.00 ? 96  ALA A C    6  
ATOM 10094 O O    . ALA A 1 96  ? 11.368  2.656   4.582   1.00 0.00 ? 96  ALA A O    6  
ATOM 10095 C CB   . ALA A 1 96  ? 12.899  3.806   2.284   1.00 0.00 ? 96  ALA A CB   6  
ATOM 10096 H H    . ALA A 1 96  ? 12.035  2.290   0.518   1.00 0.00 ? 96  ALA A H    6  
ATOM 10097 H HA   . ALA A 1 96  ? 13.443  1.848   2.974   1.00 0.00 ? 96  ALA A HA   6  
ATOM 10098 H HB1  . ALA A 1 96  ? 13.474  3.902   1.363   1.00 0.00 ? 96  ALA A HB1  6  
ATOM 10099 H HB2  . ALA A 1 96  ? 11.973  4.374   2.196   1.00 0.00 ? 96  ALA A HB2  6  
ATOM 10100 H HB3  . ALA A 1 96  ? 13.484  4.193   3.119   1.00 0.00 ? 96  ALA A HB3  6  
ATOM 10101 N N    . HIS A 1 97  ? 10.383  1.421   2.964   1.00 0.00 ? 97  HIS A N    6  
ATOM 10102 C CA   . HIS A 1 97  ? 9.181   1.164   3.737   1.00 0.00 ? 97  HIS A CA   6  
ATOM 10103 C C    . HIS A 1 97  ? 8.658   -0.239  3.423   1.00 0.00 ? 97  HIS A C    6  
ATOM 10104 O O    . HIS A 1 97  ? 7.478   -0.524  3.617   1.00 0.00 ? 97  HIS A O    6  
ATOM 10105 C CB   . HIS A 1 97  ? 8.135   2.254   3.494   1.00 0.00 ? 97  HIS A CB   6  
ATOM 10106 C CG   . HIS A 1 97  ? 8.576   3.634   3.920   1.00 0.00 ? 97  HIS A CG   6  
ATOM 10107 N ND1  . HIS A 1 97  ? 8.770   3.982   5.246   1.00 0.00 ? 97  HIS A ND1  6  
ATOM 10108 C CD2  . HIS A 1 97  ? 8.857   4.747   3.184   1.00 0.00 ? 97  HIS A CD2  6  
ATOM 10109 C CE1  . HIS A 1 97  ? 9.151   5.250   5.293   1.00 0.00 ? 97  HIS A CE1  6  
ATOM 10110 N NE2  . HIS A 1 97  ? 9.204   5.722   4.015   1.00 0.00 ? 97  HIS A NE2  6  
ATOM 10111 H H    . HIS A 1 97  ? 10.395  1.011   2.051   1.00 0.00 ? 97  HIS A H    6  
ATOM 10112 H HA   . HIS A 1 97  ? 9.469   1.208   4.787   1.00 0.00 ? 97  HIS A HA   6  
ATOM 10113 H HB2  . HIS A 1 97  ? 7.887   2.275   2.432   1.00 0.00 ? 97  HIS A HB2  6  
ATOM 10114 H HB3  . HIS A 1 97  ? 7.222   1.993   4.029   1.00 0.00 ? 97  HIS A HB3  6  
ATOM 10115 H HD1  . HIS A 1 97  ? 8.645   3.379   6.033   1.00 0.00 ? 97  HIS A HD1  6  
ATOM 10116 H HD2  . HIS A 1 97  ? 8.806   4.822   2.098   1.00 0.00 ? 97  HIS A HD2  6  
ATOM 10117 H HE1  . HIS A 1 97  ? 9.382   5.817   6.195   1.00 0.00 ? 97  HIS A HE1  6  
ATOM 10118 N N    . ILE A 1 98  ? 9.564   -1.079  2.942   1.00 0.00 ? 98  ILE A N    6  
ATOM 10119 C CA   . ILE A 1 98  ? 9.209   -2.446  2.599   1.00 0.00 ? 98  ILE A CA   6  
ATOM 10120 C C    . ILE A 1 98  ? 9.042   -3.262  3.882   1.00 0.00 ? 98  ILE A C    6  
ATOM 10121 O O    . ILE A 1 98  ? 9.961   -3.342  4.696   1.00 0.00 ? 98  ILE A O    6  
ATOM 10122 C CB   . ILE A 1 98  ? 10.230  -3.035  1.624   1.00 0.00 ? 98  ILE A CB   6  
ATOM 10123 C CG1  . ILE A 1 98  ? 9.636   -4.220  0.859   1.00 0.00 ? 98  ILE A CG1  6  
ATOM 10124 C CG2  . ILE A 1 98  ? 11.525  -3.411  2.346   1.00 0.00 ? 98  ILE A CG2  6  
ATOM 10125 C CD1  . ILE A 1 98  ? 9.224   -3.808  -0.556  1.00 0.00 ? 98  ILE A CD1  6  
ATOM 10126 H H    . ILE A 1 98  ? 10.522  -0.839  2.787   1.00 0.00 ? 98  ILE A H    6  
ATOM 10127 H HA   . ILE A 1 98  ? 8.250   -2.415  2.082   1.00 0.00 ? 98  ILE A HA   6  
ATOM 10128 H HB   . ILE A 1 98  ? 10.481  -2.271  0.889   1.00 0.00 ? 98  ILE A HB   6  
ATOM 10129 H HG12 . ILE A 1 98  ? 10.367  -5.027  0.808   1.00 0.00 ? 98  ILE A HG12 6  
ATOM 10130 H HG13 . ILE A 1 98  ? 8.770   -4.607  1.395   1.00 0.00 ? 98  ILE A HG13 6  
ATOM 10131 H HG21 . ILE A 1 98  ? 11.708  -2.703  3.155   1.00 0.00 ? 98  ILE A HG21 6  
ATOM 10132 H HG22 . ILE A 1 98  ? 11.434  -4.416  2.757   1.00 0.00 ? 98  ILE A HG22 6  
ATOM 10133 H HG23 . ILE A 1 98  ? 12.356  -3.380  1.642   1.00 0.00 ? 98  ILE A HG23 6  
ATOM 10134 H HD11 . ILE A 1 98  ? 9.175   -4.691  -1.192  1.00 0.00 ? 98  ILE A HD11 6  
ATOM 10135 H HD12 . ILE A 1 98  ? 8.246   -3.328  -0.524  1.00 0.00 ? 98  ILE A HD12 6  
ATOM 10136 H HD13 . ILE A 1 98  ? 9.958   -3.110  -0.959  1.00 0.00 ? 98  ILE A HD13 6  
ATOM 10137 N N    . LEU A 1 99  ? 7.862   -3.848  4.024   1.00 0.00 ? 99  LEU A N    6  
ATOM 10138 C CA   . LEU A 1 99  ? 7.563   -4.655  5.194   1.00 0.00 ? 99  LEU A CA   6  
ATOM 10139 C C    . LEU A 1 99  ? 7.673   -6.137  4.828   1.00 0.00 ? 99  LEU A C    6  
ATOM 10140 O O    . LEU A 1 99  ? 7.817   -6.987  5.705   1.00 0.00 ? 99  LEU A O    6  
ATOM 10141 C CB   . LEU A 1 99  ? 6.204   -4.266  5.780   1.00 0.00 ? 99  LEU A CB   6  
ATOM 10142 C CG   . LEU A 1 99  ? 6.142   -2.910  6.486   1.00 0.00 ? 99  LEU A CG   6  
ATOM 10143 C CD1  . LEU A 1 99  ? 4.879   -2.795  7.342   1.00 0.00 ? 99  LEU A CD1  6  
ATOM 10144 C CD2  . LEU A 1 99  ? 7.412   -2.658  7.301   1.00 0.00 ? 99  LEU A CD2  6  
ATOM 10145 H H    . LEU A 1 99  ? 7.120   -3.778  3.357   1.00 0.00 ? 99  LEU A H    6  
ATOM 10146 H HA   . LEU A 1 99  ? 8.316   -4.429  5.948   1.00 0.00 ? 99  LEU A HA   6  
ATOM 10147 H HB2  . LEU A 1 99  ? 5.469   -4.268  4.975   1.00 0.00 ? 99  LEU A HB2  6  
ATOM 10148 H HB3  . LEU A 1 99  ? 5.902   -5.037  6.489   1.00 0.00 ? 99  LEU A HB3  6  
ATOM 10149 H HG   . LEU A 1 99  ? 6.087   -2.131  5.726   1.00 0.00 ? 99  LEU A HG   6  
ATOM 10150 H HD11 . LEU A 1 99  ? 4.152   -3.540  7.019   1.00 0.00 ? 99  LEU A HD11 6  
ATOM 10151 H HD12 . LEU A 1 99  ? 5.133   -2.965  8.389   1.00 0.00 ? 99  LEU A HD12 6  
ATOM 10152 H HD13 . LEU A 1 99  ? 4.453   -1.798  7.229   1.00 0.00 ? 99  LEU A HD13 6  
ATOM 10153 H HD21 . LEU A 1 99  ? 7.589   -3.501  7.969   1.00 0.00 ? 99  LEU A HD21 6  
ATOM 10154 H HD22 . LEU A 1 99  ? 8.260   -2.545  6.626   1.00 0.00 ? 99  LEU A HD22 6  
ATOM 10155 H HD23 . LEU A 1 99  ? 7.292   -1.747  7.889   1.00 0.00 ? 99  LEU A HD23 6  
ATOM 10156 N N    . SER A 1 100 ? 7.600   -6.400  3.531   1.00 0.00 ? 100 SER A N    6  
ATOM 10157 C CA   . SER A 1 100 ? 7.689   -7.764  3.039   1.00 0.00 ? 100 SER A CA   6  
ATOM 10158 C C    . SER A 1 100 ? 9.005   -7.962  2.283   1.00 0.00 ? 100 SER A C    6  
ATOM 10159 O O    . SER A 1 100 ? 9.779   -7.021  2.121   1.00 0.00 ? 100 SER A O    6  
ATOM 10160 C CB   . SER A 1 100 ? 6.502   -8.102  2.135   1.00 0.00 ? 100 SER A CB   6  
ATOM 10161 O OG   . SER A 1 100 ? 6.482   -7.300  0.957   1.00 0.00 ? 100 SER A OG   6  
ATOM 10162 H H    . SER A 1 100 ? 7.482   -5.703  2.825   1.00 0.00 ? 100 SER A H    6  
ATOM 10163 H HA   . SER A 1 100 ? 7.660   -8.395  3.927   1.00 0.00 ? 100 SER A HA   6  
ATOM 10164 H HB2  . SER A 1 100 ? 6.548   -9.155  1.855   1.00 0.00 ? 100 SER A HB2  6  
ATOM 10165 H HB3  . SER A 1 100 ? 5.574   -7.960  2.687   1.00 0.00 ? 100 SER A HB3  6  
ATOM 10166 H HG   . SER A 1 100 ? 7.312   -6.744  0.908   1.00 0.00 ? 100 SER A HG   6  
ATOM 10167 N N    . SER A 1 101 ? 9.218   -9.193  1.842   1.00 0.00 ? 101 SER A N    6  
ATOM 10168 C CA   . SER A 1 101 ? 10.426  -9.527  1.108   1.00 0.00 ? 101 SER A CA   6  
ATOM 10169 C C    . SER A 1 101 ? 10.109  -9.681  -0.381  1.00 0.00 ? 101 SER A C    6  
ATOM 10170 O O    . SER A 1 101 ? 11.010  -9.660  -1.217  1.00 0.00 ? 101 SER A O    6  
ATOM 10171 C CB   . SER A 1 101 ? 11.064  -10.808 1.650   1.00 0.00 ? 101 SER A CB   6  
ATOM 10172 O OG   . SER A 1 101 ? 12.452  -10.638 1.925   1.00 0.00 ? 101 SER A OG   6  
ATOM 10173 H H    . SER A 1 101 ? 8.583   -9.954  1.979   1.00 0.00 ? 101 SER A H    6  
ATOM 10174 H HA   . SER A 1 101 ? 11.103  -8.688  1.270   1.00 0.00 ? 101 SER A HA   6  
ATOM 10175 H HB2  . SER A 1 101 ? 10.548  -11.113 2.560   1.00 0.00 ? 101 SER A HB2  6  
ATOM 10176 H HB3  . SER A 1 101 ? 10.934  -11.612 0.926   1.00 0.00 ? 101 SER A HB3  6  
ATOM 10177 H HG   . SER A 1 101 ? 12.643  -9.681  2.140   1.00 0.00 ? 101 SER A HG   6  
ATOM 10178 N N    . TRP A 1 102 ? 8.824   -9.832  -0.666  1.00 0.00 ? 102 TRP A N    6  
ATOM 10179 C CA   . TRP A 1 102 ? 8.376   -9.989  -2.040  1.00 0.00 ? 102 TRP A CA   6  
ATOM 10180 C C    . TRP A 1 102 ? 7.942   -8.616  -2.556  1.00 0.00 ? 102 TRP A C    6  
ATOM 10181 O O    . TRP A 1 102 ? 8.240   -7.595  -1.939  1.00 0.00 ? 102 TRP A O    6  
ATOM 10182 C CB   . TRP A 1 102 ? 7.269   -11.041 -2.138  1.00 0.00 ? 102 TRP A CB   6  
ATOM 10183 C CG   . TRP A 1 102 ? 5.905   -10.558 -1.643  1.00 0.00 ? 102 TRP A CG   6  
ATOM 10184 C CD1  . TRP A 1 102 ? 5.000   -9.822  -2.303  1.00 0.00 ? 102 TRP A CD1  6  
ATOM 10185 C CD2  . TRP A 1 102 ? 5.323   -10.808 -0.346  1.00 0.00 ? 102 TRP A CD2  6  
ATOM 10186 N NE1  . TRP A 1 102 ? 3.883   -9.581  -1.530  1.00 0.00 ? 102 TRP A NE1  6  
ATOM 10187 C CE2  . TRP A 1 102 ? 4.086   -10.200 -0.302  1.00 0.00 ? 102 TRP A CE2  6  
ATOM 10188 C CE3  . TRP A 1 102 ? 5.826   -11.526 0.754   1.00 0.00 ? 102 TRP A CE3  6  
ATOM 10189 C CZ2  . TRP A 1 102 ? 3.248   -10.246 0.819   1.00 0.00 ? 102 TRP A CZ2  6  
ATOM 10190 C CZ3  . TRP A 1 102 ? 4.977   -11.563 1.866   1.00 0.00 ? 102 TRP A CZ3  6  
ATOM 10191 C CH2  . TRP A 1 102 ? 3.728   -10.955 1.926   1.00 0.00 ? 102 TRP A CH2  6  
ATOM 10192 H H    . TRP A 1 102 ? 8.096   -9.848  0.020   1.00 0.00 ? 102 TRP A H    6  
ATOM 10193 H HA   . TRP A 1 102 ? 9.218   -10.359 -2.625  1.00 0.00 ? 102 TRP A HA   6  
ATOM 10194 H HB2  . TRP A 1 102 ? 7.175   -11.359 -3.177  1.00 0.00 ? 102 TRP A HB2  6  
ATOM 10195 H HB3  . TRP A 1 102 ? 7.564   -11.919 -1.563  1.00 0.00 ? 102 TRP A HB3  6  
ATOM 10196 H HD1  . TRP A 1 102 ? 5.131   -9.460  -3.323  1.00 0.00 ? 102 TRP A HD1  6  
ATOM 10197 H HE1  . TRP A 1 102 ? 3.004   -9.010  -1.828  1.00 0.00 ? 102 TRP A HE1  6  
ATOM 10198 H HE3  . TRP A 1 102 ? 6.800   -12.015 0.744   1.00 0.00 ? 102 TRP A HE3  6  
ATOM 10199 H HZ2  . TRP A 1 102 ? 2.274   -9.756  0.828   1.00 0.00 ? 102 TRP A HZ2  6  
ATOM 10200 H HZ3  . TRP A 1 102 ? 5.319   -12.106 2.747   1.00 0.00 ? 102 TRP A HZ3  6  
ATOM 10201 H HH2  . TRP A 1 102 ? 3.126   -11.030 2.831   1.00 0.00 ? 102 TRP A HH2  6  
ATOM 10202 N N    . GLY A 1 103 ? 7.246   -8.635  -3.683  1.00 0.00 ? 103 GLY A N    6  
ATOM 10203 C CA   . GLY A 1 103 ? 6.769   -7.404  -4.289  1.00 0.00 ? 103 GLY A CA   6  
ATOM 10204 C C    . GLY A 1 103 ? 7.813   -6.823  -5.245  1.00 0.00 ? 103 GLY A C    6  
ATOM 10205 O O    . GLY A 1 103 ? 8.335   -5.735  -5.012  1.00 0.00 ? 103 GLY A O    6  
ATOM 10206 H H    . GLY A 1 103 ? 7.008   -9.471  -4.179  1.00 0.00 ? 103 GLY A H    6  
ATOM 10207 H HA2  . GLY A 1 103 ? 5.842   -7.596  -4.830  1.00 0.00 ? 103 GLY A HA2  6  
ATOM 10208 H HA3  . GLY A 1 103 ? 6.539   -6.677  -3.511  1.00 0.00 ? 103 GLY A HA3  6  
ATOM 10209 N N    . ALA A 1 104 ? 8.085   -7.576  -6.301  1.00 0.00 ? 104 ALA A N    6  
ATOM 10210 C CA   . ALA A 1 104 ? 9.057   -7.150  -7.294  1.00 0.00 ? 104 ALA A CA   6  
ATOM 10211 C C    . ALA A 1 104 ? 8.327   -6.753  -8.578  1.00 0.00 ? 104 ALA A C    6  
ATOM 10212 O O    . ALA A 1 104 ? 7.666   -7.581  -9.202  1.00 0.00 ? 104 ALA A O    6  
ATOM 10213 C CB   . ALA A 1 104 ? 10.076  -8.267  -7.524  1.00 0.00 ? 104 ALA A CB   6  
ATOM 10214 H H    . ALA A 1 104 ? 7.655   -8.460  -6.484  1.00 0.00 ? 104 ALA A H    6  
ATOM 10215 H HA   . ALA A 1 104 ? 9.576   -6.277  -6.896  1.00 0.00 ? 104 ALA A HA   6  
ATOM 10216 H HB1  . ALA A 1 104 ? 9.576   -9.234  -7.461  1.00 0.00 ? 104 ALA A HB1  6  
ATOM 10217 H HB2  . ALA A 1 104 ? 10.524  -8.153  -8.511  1.00 0.00 ? 104 ALA A HB2  6  
ATOM 10218 H HB3  . ALA A 1 104 ? 10.854  -8.211  -6.763  1.00 0.00 ? 104 ALA A HB3  6  
ATOM 10219 N N    . GLU A 1 105 ? 8.471   -5.485  -8.936  1.00 0.00 ? 105 GLU A N    6  
ATOM 10220 C CA   . GLU A 1 105 ? 7.834   -4.968  -10.135 1.00 0.00 ? 105 GLU A CA   6  
ATOM 10221 C C    . GLU A 1 105 ? 8.468   -3.636  -10.541 1.00 0.00 ? 105 GLU A C    6  
ATOM 10222 O O    . GLU A 1 105 ? 9.143   -2.996  -9.737  1.00 0.00 ? 105 GLU A O    6  
ATOM 10223 C CB   . GLU A 1 105 ? 6.325   -4.819  -9.933  1.00 0.00 ? 105 GLU A CB   6  
ATOM 10224 C CG   . GLU A 1 105 ? 5.557   -5.868  -10.739 1.00 0.00 ? 105 GLU A CG   6  
ATOM 10225 C CD   . GLU A 1 105 ? 4.863   -5.233  -11.946 1.00 0.00 ? 105 GLU A CD   6  
ATOM 10226 O OE1  . GLU A 1 105 ? 3.875   -4.504  -11.713 1.00 0.00 ? 105 GLU A OE1  6  
ATOM 10227 O OE2  . GLU A 1 105 ? 5.336   -5.492  -13.073 1.00 0.00 ? 105 GLU A OE2  6  
ATOM 10228 H H    . GLU A 1 105 ? 9.011   -4.818  -8.423  1.00 0.00 ? 105 GLU A H    6  
ATOM 10229 H HA   . GLU A 1 105 ? 8.019   -5.716  -10.906 1.00 0.00 ? 105 GLU A HA   6  
ATOM 10230 H HB2  . GLU A 1 105 ? 6.084   -4.920  -8.875  1.00 0.00 ? 105 GLU A HB2  6  
ATOM 10231 H HB3  . GLU A 1 105 ? 6.011   -3.820  -10.237 1.00 0.00 ? 105 GLU A HB3  6  
ATOM 10232 H HG2  . GLU A 1 105 ? 6.242   -6.646  -11.077 1.00 0.00 ? 105 GLU A HG2  6  
ATOM 10233 H HG3  . GLU A 1 105 ? 4.816   -6.351  -10.102 1.00 0.00 ? 105 GLU A HG3  6  
ATOM 10234 N N    . VAL A 1 106 ? 8.227   -3.258  -11.788 1.00 0.00 ? 106 VAL A N    6  
ATOM 10235 C CA   . VAL A 1 106 ? 8.765   -2.014  -12.310 1.00 0.00 ? 106 VAL A CA   6  
ATOM 10236 C C    . VAL A 1 106 ? 8.466   -0.881  -11.326 1.00 0.00 ? 106 VAL A C    6  
ATOM 10237 O O    . VAL A 1 106 ? 7.777   -1.087  -10.329 1.00 0.00 ? 106 VAL A O    6  
ATOM 10238 C CB   . VAL A 1 106 ? 8.211   -1.751  -13.712 1.00 0.00 ? 106 VAL A CB   6  
ATOM 10239 C CG1  . VAL A 1 106 ? 8.768   -2.759  -14.719 1.00 0.00 ? 106 VAL A CG1  6  
ATOM 10240 C CG2  . VAL A 1 106 ? 6.681   -1.768  -13.708 1.00 0.00 ? 106 VAL A CG2  6  
ATOM 10241 H H    . VAL A 1 106 ? 7.676   -3.785  -12.435 1.00 0.00 ? 106 VAL A H    6  
ATOM 10242 H HA   . VAL A 1 106 ? 9.846   -2.132  -12.391 1.00 0.00 ? 106 VAL A HA   6  
ATOM 10243 H HB   . VAL A 1 106 ? 8.534   -0.757  -14.019 1.00 0.00 ? 106 VAL A HB   6  
ATOM 10244 H HG11 . VAL A 1 106 ? 8.733   -3.760  -14.290 1.00 0.00 ? 106 VAL A HG11 6  
ATOM 10245 H HG12 . VAL A 1 106 ? 8.169   -2.732  -15.629 1.00 0.00 ? 106 VAL A HG12 6  
ATOM 10246 H HG13 . VAL A 1 106 ? 9.801   -2.502  -14.957 1.00 0.00 ? 106 VAL A HG13 6  
ATOM 10247 H HG21 . VAL A 1 106 ? 6.325   -2.540  -14.390 1.00 0.00 ? 106 VAL A HG21 6  
ATOM 10248 H HG22 . VAL A 1 106 ? 6.322   -1.979  -12.701 1.00 0.00 ? 106 VAL A HG22 6  
ATOM 10249 H HG23 . VAL A 1 106 ? 6.306   -0.797  -14.031 1.00 0.00 ? 106 VAL A HG23 6  
ATOM 10250 N N    . LYS A 1 107 ? 8.998   0.290   -11.642 1.00 0.00 ? 107 LYS A N    6  
ATOM 10251 C CA   . LYS A 1 107 ? 8.796   1.456   -10.799 1.00 0.00 ? 107 LYS A CA   6  
ATOM 10252 C C    . LYS A 1 107 ? 8.337   2.632   -11.663 1.00 0.00 ? 107 LYS A C    6  
ATOM 10253 O O    . LYS A 1 107 ? 8.492   2.608   -12.883 1.00 0.00 ? 107 LYS A O    6  
ATOM 10254 C CB   . LYS A 1 107 ? 10.055  1.749   -9.980  1.00 0.00 ? 107 LYS A CB   6  
ATOM 10255 C CG   . LYS A 1 107 ? 11.168  2.311   -10.868 1.00 0.00 ? 107 LYS A CG   6  
ATOM 10256 C CD   . LYS A 1 107 ? 12.106  1.199   -11.341 1.00 0.00 ? 107 LYS A CD   6  
ATOM 10257 C CE   . LYS A 1 107 ? 12.493  1.395   -12.808 1.00 0.00 ? 107 LYS A CE   6  
ATOM 10258 N NZ   . LYS A 1 107 ? 13.952  1.224   -12.987 1.00 0.00 ? 107 LYS A NZ   6  
ATOM 10259 H H    . LYS A 1 107 ? 9.557   0.449   -12.456 1.00 0.00 ? 107 LYS A H    6  
ATOM 10260 H HA   . LYS A 1 107 ? 8.001   1.215   -10.093 1.00 0.00 ? 107 LYS A HA   6  
ATOM 10261 H HB2  . LYS A 1 107 ? 9.821   2.462   -9.189  1.00 0.00 ? 107 LYS A HB2  6  
ATOM 10262 H HB3  . LYS A 1 107 ? 10.398  0.836   -9.495  1.00 0.00 ? 107 LYS A HB3  6  
ATOM 10263 H HG2  . LYS A 1 107 ? 10.731  2.815   -11.730 1.00 0.00 ? 107 LYS A HG2  6  
ATOM 10264 H HG3  . LYS A 1 107 ? 11.735  3.060   -10.315 1.00 0.00 ? 107 LYS A HG3  6  
ATOM 10265 H HD2  . LYS A 1 107 ? 13.004  1.188   -10.722 1.00 0.00 ? 107 LYS A HD2  6  
ATOM 10266 H HD3  . LYS A 1 107 ? 11.621  0.231   -11.215 1.00 0.00 ? 107 LYS A HD3  6  
ATOM 10267 H HE2  . LYS A 1 107 ? 11.957  0.678   -13.430 1.00 0.00 ? 107 LYS A HE2  6  
ATOM 10268 H HE3  . LYS A 1 107 ? 12.194  2.390   -13.139 1.00 0.00 ? 107 LYS A HE3  6  
ATOM 10269 H HZ1  . LYS A 1 107 ? 14.351  2.082   -13.310 1.00 0.00 ? 107 LYS A HZ1  6  
ATOM 10270 H HZ2  . LYS A 1 107 ? 14.367  0.972   -12.113 1.00 0.00 ? 107 LYS A HZ2  6  
ATOM 10271 H HZ3  . LYS A 1 107 ? 14.123  0.502   -13.657 1.00 0.00 ? 107 LYS A HZ3  6  
ATOM 10272 N N    . SER A 1 108 ? 7.781   3.633   -10.997 1.00 0.00 ? 108 SER A N    6  
ATOM 10273 C CA   . SER A 1 108 ? 7.298   4.816   -11.689 1.00 0.00 ? 108 SER A CA   6  
ATOM 10274 C C    . SER A 1 108 ? 7.008   5.930   -10.681 1.00 0.00 ? 108 SER A C    6  
ATOM 10275 O O    . SER A 1 108 ? 6.072   5.828   -9.889  1.00 0.00 ? 108 SER A O    6  
ATOM 10276 C CB   . SER A 1 108 ? 6.044   4.502   -12.508 1.00 0.00 ? 108 SER A CB   6  
ATOM 10277 O OG   . SER A 1 108 ? 5.982   5.271   -13.705 1.00 0.00 ? 108 SER A OG   6  
ATOM 10278 H H    . SER A 1 108 ? 7.658   3.645   -10.004 1.00 0.00 ? 108 SER A H    6  
ATOM 10279 H HA   . SER A 1 108 ? 8.106   5.108   -12.360 1.00 0.00 ? 108 SER A HA   6  
ATOM 10280 H HB2  . SER A 1 108 ? 6.031   3.441   -12.757 1.00 0.00 ? 108 SER A HB2  6  
ATOM 10281 H HB3  . SER A 1 108 ? 5.158   4.698   -11.904 1.00 0.00 ? 108 SER A HB3  6  
ATOM 10282 H HG   . SER A 1 108 ? 5.429   6.091   -13.557 1.00 0.00 ? 108 SER A HG   6  
ATOM 10283 N N    . GLY A 1 109 ? 7.828   6.969   -10.743 1.00 0.00 ? 109 GLY A N    6  
ATOM 10284 C CA   . GLY A 1 109 ? 7.671   8.101   -9.846  1.00 0.00 ? 109 GLY A CA   6  
ATOM 10285 C C    . GLY A 1 109 ? 8.192   9.387   -10.490 1.00 0.00 ? 109 GLY A C    6  
ATOM 10286 O O    . GLY A 1 109 ? 8.771   9.352   -11.574 1.00 0.00 ? 109 GLY A O    6  
ATOM 10287 H H    . GLY A 1 109 ? 8.587   7.044   -11.390 1.00 0.00 ? 109 GLY A H    6  
ATOM 10288 H HA2  . GLY A 1 109 ? 6.620   8.220   -9.586  1.00 0.00 ? 109 GLY A HA2  6  
ATOM 10289 H HA3  . GLY A 1 109 ? 8.210   7.911   -8.917  1.00 0.00 ? 109 GLY A HA3  6  
ATOM 10290 N N    . PRO A 1 110 ? 7.962   10.522  -9.776  1.00 0.00 ? 110 PRO A N    6  
ATOM 10291 C CA   . PRO A 1 110 ? 8.401   11.817  -10.266 1.00 0.00 ? 110 PRO A CA   6  
ATOM 10292 C C    . PRO A 1 110 ? 9.914   11.980  -10.103 1.00 0.00 ? 110 PRO A C    6  
ATOM 10293 O O    . PRO A 1 110 ? 10.573  11.130  -9.508  1.00 0.00 ? 110 PRO A O    6  
ATOM 10294 C CB   . PRO A 1 110 ? 7.604   12.832  -9.464  1.00 0.00 ? 110 PRO A CB   6  
ATOM 10295 C CG   . PRO A 1 110 ? 7.094   12.089  -8.240  1.00 0.00 ? 110 PRO A CG   6  
ATOM 10296 C CD   . PRO A 1 110 ? 7.279   10.601  -8.488  1.00 0.00 ? 110 PRO A CD   6  
ATOM 10297 H HA   . PRO A 1 110 ? 8.222   11.896  -11.247 1.00 0.00 ? 110 PRO A HA   6  
ATOM 10298 H HB2  . PRO A 1 110 ? 8.228   13.679  -9.176  1.00 0.00 ? 110 PRO A HB2  6  
ATOM 10299 H HB3  . PRO A 1 110 ? 6.777   13.232  -10.051 1.00 0.00 ? 110 PRO A HB3  6  
ATOM 10300 H HG2  . PRO A 1 110 ? 7.642   12.399  -7.350  1.00 0.00 ? 110 PRO A HG2  6  
ATOM 10301 H HG3  . PRO A 1 110 ? 6.043   12.319  -8.064  1.00 0.00 ? 110 PRO A HG3  6  
ATOM 10302 H HD2  . PRO A 1 110 ? 7.870   10.138  -7.697  1.00 0.00 ? 110 PRO A HD2  6  
ATOM 10303 H HD3  . PRO A 1 110 ? 6.321   10.082  -8.515  1.00 0.00 ? 110 PRO A HD3  6  
ATOM 10304 N N    . SER A 1 111 ? 10.419  13.080  -10.643 1.00 0.00 ? 111 SER A N    6  
ATOM 10305 C CA   . SER A 1 111 ? 11.842  13.366  -10.565 1.00 0.00 ? 111 SER A CA   6  
ATOM 10306 C C    . SER A 1 111 ? 12.308  13.309  -9.109  1.00 0.00 ? 111 SER A C    6  
ATOM 10307 O O    . SER A 1 111 ? 11.491  13.200  -8.196  1.00 0.00 ? 111 SER A O    6  
ATOM 10308 C CB   . SER A 1 111 ? 12.163  14.733  -11.172 1.00 0.00 ? 111 SER A CB   6  
ATOM 10309 O OG   . SER A 1 111 ? 11.382  15.773  -10.590 1.00 0.00 ? 111 SER A OG   6  
ATOM 10310 H H    . SER A 1 111 ? 9.876   13.767  -11.126 1.00 0.00 ? 111 SER A H    6  
ATOM 10311 H HA   . SER A 1 111 ? 12.326  12.585  -11.152 1.00 0.00 ? 111 SER A HA   6  
ATOM 10312 H HB2  . SER A 1 111 ? 13.221  14.953  -11.031 1.00 0.00 ? 111 SER A HB2  6  
ATOM 10313 H HB3  . SER A 1 111 ? 11.984  14.703  -12.247 1.00 0.00 ? 111 SER A HB3  6  
ATOM 10314 H HG   . SER A 1 111 ? 10.583  15.961  -11.161 1.00 0.00 ? 111 SER A HG   6  
ATOM 10315 N N    . SER A 1 112 ? 13.619  13.387  -8.937  1.00 0.00 ? 112 SER A N    6  
ATOM 10316 C CA   . SER A 1 112 ? 14.203  13.346  -7.607  1.00 0.00 ? 112 SER A CA   6  
ATOM 10317 C C    . SER A 1 112 ? 14.526  14.764  -7.133  1.00 0.00 ? 112 SER A C    6  
ATOM 10318 O O    . SER A 1 112 ? 14.016  15.210  -6.107  1.00 0.00 ? 112 SER A O    6  
ATOM 10319 C CB   . SER A 1 112 ? 15.465  12.480  -7.586  1.00 0.00 ? 112 SER A CB   6  
ATOM 10320 O OG   . SER A 1 112 ? 15.442  11.529  -6.525  1.00 0.00 ? 112 SER A OG   6  
ATOM 10321 H H    . SER A 1 112 ? 14.277  13.476  -9.685  1.00 0.00 ? 112 SER A H    6  
ATOM 10322 H HA   . SER A 1 112 ? 13.442  12.893  -6.971  1.00 0.00 ? 112 SER A HA   6  
ATOM 10323 H HB2  . SER A 1 112 ? 15.562  11.958  -8.538  1.00 0.00 ? 112 SER A HB2  6  
ATOM 10324 H HB3  . SER A 1 112 ? 16.341  13.119  -7.482  1.00 0.00 ? 112 SER A HB3  6  
ATOM 10325 H HG   . SER A 1 112 ? 14.517  11.167  -6.410  1.00 0.00 ? 112 SER A HG   6  
ATOM 10326 N N    . GLY A 1 113 ? 15.370  15.434  -7.904  1.00 0.00 ? 113 GLY A N    6  
ATOM 10327 C CA   . GLY A 1 113 ? 15.767  16.793  -7.575  1.00 0.00 ? 113 GLY A CA   6  
ATOM 10328 C C    . GLY A 1 113 ? 16.600  17.408  -8.701  1.00 0.00 ? 113 GLY A C    6  
ATOM 10329 O O    . GLY A 1 113 ? 17.381  16.714  -9.351  1.00 0.00 ? 113 GLY A O    6  
ATOM 10330 H H    . GLY A 1 113 ? 15.781  15.064  -8.737  1.00 0.00 ? 113 GLY A H    6  
ATOM 10331 H HA2  . GLY A 1 113 ? 14.880  17.401  -7.400  1.00 0.00 ? 113 GLY A HA2  6  
ATOM 10332 H HA3  . GLY A 1 113 ? 16.342  16.794  -6.650  1.00 0.00 ? 113 GLY A HA3  6  
ATOM 10333 N N    . GLY A 1 1   ? -9.629  14.603  -19.783 1.00 0.00 ? 1   GLY A N    7  
ATOM 10334 C CA   . GLY A 1 1   ? -8.358  14.117  -20.293 1.00 0.00 ? 1   GLY A CA   7  
ATOM 10335 C C    . GLY A 1 1   ? -7.814  15.044  -21.382 1.00 0.00 ? 1   GLY A C    7  
ATOM 10336 O O    . GLY A 1 1   ? -8.416  15.178  -22.446 1.00 0.00 ? 1   GLY A O    7  
ATOM 10337 H H1   . GLY A 1 1   ? -9.619  15.547  -19.453 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10338 H HA2  . GLY A 1 1   ? -7.639  14.046  -19.478 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10339 H HA3  . GLY A 1 1   ? -8.484  13.112  -20.695 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10340 N N    . SER A 1 2   ? -6.681  15.659  -21.078 1.00 0.00 ? 2   SER A N    7  
ATOM 10341 C CA   . SER A 1 2   ? -6.049  16.570  -22.018 1.00 0.00 ? 2   SER A CA   7  
ATOM 10342 C C    . SER A 1 2   ? -4.615  16.868  -21.574 1.00 0.00 ? 2   SER A C    7  
ATOM 10343 O O    . SER A 1 2   ? -3.666  16.606  -22.311 1.00 0.00 ? 2   SER A O    7  
ATOM 10344 C CB   . SER A 1 2   ? -6.846  17.869  -22.147 1.00 0.00 ? 2   SER A CB   7  
ATOM 10345 O OG   . SER A 1 2   ? -6.934  18.309  -23.500 1.00 0.00 ? 2   SER A OG   7  
ATOM 10346 H H    . SER A 1 2   ? -6.197  15.545  -20.211 1.00 0.00 ? 2   SER A H    7  
ATOM 10347 H HA   . SER A 1 2   ? -6.052  16.046  -22.974 1.00 0.00 ? 2   SER A HA   7  
ATOM 10348 H HB2  . SER A 1 2   ? -7.849  17.720  -21.748 1.00 0.00 ? 2   SER A HB2  7  
ATOM 10349 H HB3  . SER A 1 2   ? -6.375  18.645  -21.543 1.00 0.00 ? 2   SER A HB3  7  
ATOM 10350 H HG   . SER A 1 2   ? -7.575  17.732  -24.006 1.00 0.00 ? 2   SER A HG   7  
ATOM 10351 N N    . SER A 1 3   ? -4.504  17.412  -20.371 1.00 0.00 ? 3   SER A N    7  
ATOM 10352 C CA   . SER A 1 3   ? -3.202  17.749  -19.820 1.00 0.00 ? 3   SER A CA   7  
ATOM 10353 C C    . SER A 1 3   ? -3.225  17.603  -18.297 1.00 0.00 ? 3   SER A C    7  
ATOM 10354 O O    . SER A 1 3   ? -4.293  17.501  -17.696 1.00 0.00 ? 3   SER A O    7  
ATOM 10355 C CB   . SER A 1 3   ? -2.790  19.170  -20.210 1.00 0.00 ? 3   SER A CB   7  
ATOM 10356 O OG   . SER A 1 3   ? -3.814  20.120  -19.929 1.00 0.00 ? 3   SER A OG   7  
ATOM 10357 H H    . SER A 1 3   ? -5.281  17.623  -19.778 1.00 0.00 ? 3   SER A H    7  
ATOM 10358 H HA   . SER A 1 3   ? -2.508  17.035  -20.263 1.00 0.00 ? 3   SER A HA   7  
ATOM 10359 H HB2  . SER A 1 3   ? -1.883  19.445  -19.672 1.00 0.00 ? 3   SER A HB2  7  
ATOM 10360 H HB3  . SER A 1 3   ? -2.550  19.199  -21.273 1.00 0.00 ? 3   SER A HB3  7  
ATOM 10361 H HG   . SER A 1 3   ? -3.408  20.981  -19.626 1.00 0.00 ? 3   SER A HG   7  
ATOM 10362 N N    . GLY A 1 4   ? -2.033  17.597  -17.717 1.00 0.00 ? 4   GLY A N    7  
ATOM 10363 C CA   . GLY A 1 4   ? -1.903  17.465  -16.276 1.00 0.00 ? 4   GLY A CA   7  
ATOM 10364 C C    . GLY A 1 4   ? -1.271  16.122  -15.904 1.00 0.00 ? 4   GLY A C    7  
ATOM 10365 O O    . GLY A 1 4   ? -0.352  15.656  -16.577 1.00 0.00 ? 4   GLY A O    7  
ATOM 10366 H H    . GLY A 1 4   ? -1.169  17.681  -18.214 1.00 0.00 ? 4   GLY A H    7  
ATOM 10367 H HA2  . GLY A 1 4   ? -1.292  18.279  -15.887 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10368 H HA3  . GLY A 1 4   ? -2.884  17.550  -15.810 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10369 N N    . SER A 1 5   ? -1.787  15.538  -14.833 1.00 0.00 ? 5   SER A N    7  
ATOM 10370 C CA   . SER A 1 5   ? -1.284  14.258  -14.363 1.00 0.00 ? 5   SER A CA   7  
ATOM 10371 C C    . SER A 1 5   ? 0.153   14.412  -13.861 1.00 0.00 ? 5   SER A C    7  
ATOM 10372 O O    . SER A 1 5   ? 0.399   14.395  -12.656 1.00 0.00 ? 5   SER A O    7  
ATOM 10373 C CB   . SER A 1 5   ? -1.350  13.201  -15.468 1.00 0.00 ? 5   SER A CB   7  
ATOM 10374 O OG   . SER A 1 5   ? -0.956  11.914  -14.999 1.00 0.00 ? 5   SER A OG   7  
ATOM 10375 H H    . SER A 1 5   ? -2.534  15.923  -14.291 1.00 0.00 ? 5   SER A H    7  
ATOM 10376 H HA   . SER A 1 5   ? -1.946  13.970  -13.546 1.00 0.00 ? 5   SER A HA   7  
ATOM 10377 H HB2  . SER A 1 5   ? -2.366  13.149  -15.860 1.00 0.00 ? 5   SER A HB2  7  
ATOM 10378 H HB3  . SER A 1 5   ? -0.705  13.500  -16.294 1.00 0.00 ? 5   SER A HB3  7  
ATOM 10379 H HG   . SER A 1 5   ? -0.728  11.324  -15.773 1.00 0.00 ? 5   SER A HG   7  
ATOM 10380 N N    . SER A 1 6   ? 1.065   14.561  -14.811 1.00 0.00 ? 6   SER A N    7  
ATOM 10381 C CA   . SER A 1 6   ? 2.471   14.719  -14.480 1.00 0.00 ? 6   SER A CA   7  
ATOM 10382 C C    . SER A 1 6   ? 2.625   15.668  -13.290 1.00 0.00 ? 6   SER A C    7  
ATOM 10383 O O    . SER A 1 6   ? 1.798   16.555  -13.088 1.00 0.00 ? 6   SER A O    7  
ATOM 10384 C CB   . SER A 1 6   ? 3.264   15.239  -15.681 1.00 0.00 ? 6   SER A CB   7  
ATOM 10385 O OG   . SER A 1 6   ? 4.663   15.286  -15.417 1.00 0.00 ? 6   SER A OG   7  
ATOM 10386 H H    . SER A 1 6   ? 0.856   14.575  -15.789 1.00 0.00 ? 6   SER A H    7  
ATOM 10387 H HA   . SER A 1 6   ? 2.820   13.719  -14.221 1.00 0.00 ? 6   SER A HA   7  
ATOM 10388 H HB2  . SER A 1 6   ? 3.079   14.598  -16.543 1.00 0.00 ? 6   SER A HB2  7  
ATOM 10389 H HB3  . SER A 1 6   ? 2.911   16.236  -15.944 1.00 0.00 ? 6   SER A HB3  7  
ATOM 10390 H HG   . SER A 1 6   ? 5.034   16.172  -15.693 1.00 0.00 ? 6   SER A HG   7  
ATOM 10391 N N    . GLY A 1 7   ? 3.691   15.448  -12.534 1.00 0.00 ? 7   GLY A N    7  
ATOM 10392 C CA   . GLY A 1 7   ? 3.964   16.273  -11.369 1.00 0.00 ? 7   GLY A CA   7  
ATOM 10393 C C    . GLY A 1 7   ? 3.055   15.888  -10.199 1.00 0.00 ? 7   GLY A C    7  
ATOM 10394 O O    . GLY A 1 7   ? 1.842   15.770  -10.364 1.00 0.00 ? 7   GLY A O    7  
ATOM 10395 H H    . GLY A 1 7   ? 4.359   14.724  -12.705 1.00 0.00 ? 7   GLY A H    7  
ATOM 10396 H HA2  . GLY A 1 7   ? 5.008   16.160  -11.076 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10397 H HA3  . GLY A 1 7   ? 3.815   17.323  -11.620 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10398 N N    . ASP A 1 8   ? 3.678   15.704  -9.044  1.00 0.00 ? 8   ASP A N    7  
ATOM 10399 C CA   . ASP A 1 8   ? 2.940   15.336  -7.848  1.00 0.00 ? 8   ASP A CA   7  
ATOM 10400 C C    . ASP A 1 8   ? 2.124   14.072  -8.126  1.00 0.00 ? 8   ASP A C    7  
ATOM 10401 O O    . ASP A 1 8   ? 2.037   13.624  -9.268  1.00 0.00 ? 8   ASP A O    7  
ATOM 10402 C CB   . ASP A 1 8   ? 1.970   16.444  -7.435  1.00 0.00 ? 8   ASP A CB   7  
ATOM 10403 C CG   . ASP A 1 8   ? 2.576   17.849  -7.386  1.00 0.00 ? 8   ASP A CG   7  
ATOM 10404 O OD1  . ASP A 1 8   ? 3.106   18.275  -8.435  1.00 0.00 ? 8   ASP A OD1  7  
ATOM 10405 O OD2  . ASP A 1 8   ? 2.495   18.464  -6.301  1.00 0.00 ? 8   ASP A OD2  7  
ATOM 10406 H H    . ASP A 1 8   ? 4.665   15.803  -8.919  1.00 0.00 ? 8   ASP A H    7  
ATOM 10407 H HA   . ASP A 1 8   ? 3.699   15.181  -7.080  1.00 0.00 ? 8   ASP A HA   7  
ATOM 10408 H HB2  . ASP A 1 8   ? 1.132   16.451  -8.132  1.00 0.00 ? 8   ASP A HB2  7  
ATOM 10409 H HB3  . ASP A 1 8   ? 1.566   16.205  -6.452  1.00 0.00 ? 8   ASP A HB3  7  
ATOM 10410 N N    . LYS A 1 9   ? 1.545   13.534  -7.062  1.00 0.00 ? 9   LYS A N    7  
ATOM 10411 C CA   . LYS A 1 9   ? 0.739   12.331  -7.178  1.00 0.00 ? 9   LYS A CA   7  
ATOM 10412 C C    . LYS A 1 9   ? 1.648   11.139  -7.485  1.00 0.00 ? 9   LYS A C    7  
ATOM 10413 O O    . LYS A 1 9   ? 1.783   10.738  -8.640  1.00 0.00 ? 9   LYS A O    7  
ATOM 10414 C CB   . LYS A 1 9   ? -0.379  12.531  -8.203  1.00 0.00 ? 9   LYS A CB   7  
ATOM 10415 C CG   . LYS A 1 9   ? -1.142  13.830  -7.935  1.00 0.00 ? 9   LYS A CG   7  
ATOM 10416 C CD   . LYS A 1 9   ? -2.630  13.667  -8.253  1.00 0.00 ? 9   LYS A CD   7  
ATOM 10417 C CE   . LYS A 1 9   ? -3.024  14.498  -9.475  1.00 0.00 ? 9   LYS A CE   7  
ATOM 10418 N NZ   . LYS A 1 9   ? -4.111  13.831  -10.227 1.00 0.00 ? 9   LYS A NZ   7  
ATOM 10419 H H    . LYS A 1 9   ? 1.621   13.905  -6.137  1.00 0.00 ? 9   LYS A H    7  
ATOM 10420 H HA   . LYS A 1 9   ? 0.263   12.162  -6.212  1.00 0.00 ? 9   LYS A HA   7  
ATOM 10421 H HB2  . LYS A 1 9   ? 0.044   12.555  -9.208  1.00 0.00 ? 9   LYS A HB2  7  
ATOM 10422 H HB3  . LYS A 1 9   ? -1.067  11.687  -8.167  1.00 0.00 ? 9   LYS A HB3  7  
ATOM 10423 H HG2  . LYS A 1 9   ? -1.019  14.119  -6.892  1.00 0.00 ? 9   LYS A HG2  7  
ATOM 10424 H HG3  . LYS A 1 9   ? -0.724  14.634  -8.540  1.00 0.00 ? 9   LYS A HG3  7  
ATOM 10425 H HD2  . LYS A 1 9   ? -2.853  12.615  -8.436  1.00 0.00 ? 9   LYS A HD2  7  
ATOM 10426 H HD3  . LYS A 1 9   ? -3.225  13.974  -7.393  1.00 0.00 ? 9   LYS A HD3  7  
ATOM 10427 H HE2  . LYS A 1 9   ? -3.348  15.489  -9.159  1.00 0.00 ? 9   LYS A HE2  7  
ATOM 10428 H HE3  . LYS A 1 9   ? -2.158  14.636  -10.123 1.00 0.00 ? 9   LYS A HE3  7  
ATOM 10429 H HZ1  . LYS A 1 9   ? -4.375  12.989  -9.755  1.00 0.00 ? 9   LYS A HZ1  7  
ATOM 10430 H HZ2  . LYS A 1 9   ? -4.900  14.442  -10.284 1.00 0.00 ? 9   LYS A HZ2  7  
ATOM 10431 H HZ3  . LYS A 1 9   ? -3.792  13.610  -11.149 1.00 0.00 ? 9   LYS A HZ3  7  
ATOM 10432 N N    . PRO A 1 10  ? 2.264   10.593  -6.402  1.00 0.00 ? 10  PRO A N    7  
ATOM 10433 C CA   . PRO A 1 10  ? 3.157   9.455   -6.545  1.00 0.00 ? 10  PRO A CA   7  
ATOM 10434 C C    . PRO A 1 10  ? 2.369   8.167   -6.790  1.00 0.00 ? 10  PRO A C    7  
ATOM 10435 O O    . PRO A 1 10  ? 2.913   7.191   -7.305  1.00 0.00 ? 10  PRO A O    7  
ATOM 10436 C CB   . PRO A 1 10  ? 3.962   9.423   -5.255  1.00 0.00 ? 10  PRO A CB   7  
ATOM 10437 C CG   . PRO A 1 10  ? 3.175   10.251  -4.252  1.00 0.00 ? 10  PRO A CG   7  
ATOM 10438 C CD   . PRO A 1 10  ? 2.128   11.042  -5.020  1.00 0.00 ? 10  PRO A CD   7  
ATOM 10439 H HA   . PRO A 1 10  ? 3.745   9.573   -7.345  1.00 0.00 ? 10  PRO A HA   7  
ATOM 10440 H HB2  . PRO A 1 10  ? 4.091   8.401   -4.901  1.00 0.00 ? 10  PRO A HB2  7  
ATOM 10441 H HB3  . PRO A 1 10  ? 4.959   9.837   -5.407  1.00 0.00 ? 10  PRO A HB3  7  
ATOM 10442 H HG2  . PRO A 1 10  ? 2.701   9.606   -3.513  1.00 0.00 ? 10  PRO A HG2  7  
ATOM 10443 H HG3  . PRO A 1 10  ? 3.839   10.924  -3.709  1.00 0.00 ? 10  PRO A HG3  7  
ATOM 10444 H HD2  . PRO A 1 10  ? 1.126   10.847  -4.637  1.00 0.00 ? 10  PRO A HD2  7  
ATOM 10445 H HD3  . PRO A 1 10  ? 2.299   12.115  -4.933  1.00 0.00 ? 10  PRO A HD3  7  
ATOM 10446 N N    . LEU A 1 11  ? 1.101   8.206   -6.409  1.00 0.00 ? 11  LEU A N    7  
ATOM 10447 C CA   . LEU A 1 11  ? 0.233   7.053   -6.581  1.00 0.00 ? 11  LEU A CA   7  
ATOM 10448 C C    . LEU A 1 11  ? -0.822  7.369   -7.644  1.00 0.00 ? 11  LEU A C    7  
ATOM 10449 O O    . LEU A 1 11  ? -1.695  6.548   -7.920  1.00 0.00 ? 11  LEU A O    7  
ATOM 10450 C CB   . LEU A 1 11  ? -0.358  6.622   -5.238  1.00 0.00 ? 11  LEU A CB   7  
ATOM 10451 C CG   . LEU A 1 11  ? 0.646   6.388   -4.107  1.00 0.00 ? 11  LEU A CG   7  
ATOM 10452 C CD1  . LEU A 1 11  ? 1.915   5.714   -4.632  1.00 0.00 ? 11  LEU A CD1  7  
ATOM 10453 C CD2  . LEU A 1 11  ? 0.953   7.692   -3.368  1.00 0.00 ? 11  LEU A CD2  7  
ATOM 10454 H H    . LEU A 1 11  ? 0.666   9.003   -5.991  1.00 0.00 ? 11  LEU A H    7  
ATOM 10455 H HA   . LEU A 1 11  ? 0.850   6.230   -6.941  1.00 0.00 ? 11  LEU A HA   7  
ATOM 10456 H HB2  . LEU A 1 11  ? -1.068  7.384   -4.914  1.00 0.00 ? 11  LEU A HB2  7  
ATOM 10457 H HB3  . LEU A 1 11  ? -0.924  5.703   -5.390  1.00 0.00 ? 11  LEU A HB3  7  
ATOM 10458 H HG   . LEU A 1 11  ? 0.195   5.708   -3.385  1.00 0.00 ? 11  LEU A HG   7  
ATOM 10459 H HD11 . LEU A 1 11  ? 1.650   4.993   -5.405  1.00 0.00 ? 11  LEU A HD11 7  
ATOM 10460 H HD12 . LEU A 1 11  ? 2.580   6.469   -5.052  1.00 0.00 ? 11  LEU A HD12 7  
ATOM 10461 H HD13 . LEU A 1 11  ? 2.419   5.201   -3.813  1.00 0.00 ? 11  LEU A HD13 7  
ATOM 10462 H HD21 . LEU A 1 11  ? 1.094   8.495   -4.091  1.00 0.00 ? 11  LEU A HD21 7  
ATOM 10463 H HD22 . LEU A 1 11  ? 0.122   7.940   -2.708  1.00 0.00 ? 11  LEU A HD22 7  
ATOM 10464 H HD23 . LEU A 1 11  ? 1.862   7.570   -2.779  1.00 0.00 ? 11  LEU A HD23 7  
ATOM 10465 N N    . SER A 1 12  ? -0.706  8.560   -8.212  1.00 0.00 ? 12  SER A N    7  
ATOM 10466 C CA   . SER A 1 12  ? -1.638  8.995   -9.238  1.00 0.00 ? 12  SER A CA   7  
ATOM 10467 C C    . SER A 1 12  ? -1.962  7.831   -10.177 1.00 0.00 ? 12  SER A C    7  
ATOM 10468 O O    . SER A 1 12  ? -1.218  7.564   -11.120 1.00 0.00 ? 12  SER A O    7  
ATOM 10469 C CB   . SER A 1 12  ? -1.074  10.175  -10.031 1.00 0.00 ? 12  SER A CB   7  
ATOM 10470 O OG   . SER A 1 12  ? -2.019  11.235  -10.155 1.00 0.00 ? 12  SER A OG   7  
ATOM 10471 H H    . SER A 1 12  ? 0.008   9.222   -7.981  1.00 0.00 ? 12  SER A H    7  
ATOM 10472 H HA   . SER A 1 12  ? -2.532  9.312   -8.700  1.00 0.00 ? 12  SER A HA   7  
ATOM 10473 H HB2  . SER A 1 12  ? -0.176  10.547  -9.537  1.00 0.00 ? 12  SER A HB2  7  
ATOM 10474 H HB3  . SER A 1 12  ? -0.776  9.837   -11.023 1.00 0.00 ? 12  SER A HB3  7  
ATOM 10475 H HG   . SER A 1 12  ? -2.219  11.403  -11.121 1.00 0.00 ? 12  SER A HG   7  
ATOM 10476 N N    . ASN A 1 13  ? -3.073  7.170   -9.887  1.00 0.00 ? 13  ASN A N    7  
ATOM 10477 C CA   . ASN A 1 13  ? -3.504  6.041   -10.694 1.00 0.00 ? 13  ASN A CA   7  
ATOM 10478 C C    . ASN A 1 13  ? -2.870  4.759   -10.150 1.00 0.00 ? 13  ASN A C    7  
ATOM 10479 O O    . ASN A 1 13  ? -2.270  3.991   -10.901 1.00 0.00 ? 13  ASN A O    7  
ATOM 10480 C CB   . ASN A 1 13  ? -3.063  6.204   -12.150 1.00 0.00 ? 13  ASN A CB   7  
ATOM 10481 C CG   . ASN A 1 13  ? -4.053  5.529   -13.101 1.00 0.00 ? 13  ASN A CG   7  
ATOM 10482 O OD1  . ASN A 1 13  ? -5.258  5.696   -13.006 1.00 0.00 ? 13  ASN A OD1  7  
ATOM 10483 N ND2  . ASN A 1 13  ? -3.479  4.760   -14.022 1.00 0.00 ? 13  ASN A ND2  7  
ATOM 10484 H H    . ASN A 1 13  ? -3.672  7.393   -9.119  1.00 0.00 ? 13  ASN A H    7  
ATOM 10485 H HA   . ASN A 1 13  ? -4.591  6.033   -10.618 1.00 0.00 ? 13  ASN A HA   7  
ATOM 10486 H HB2  . ASN A 1 13  ? -2.984  7.264   -12.393 1.00 0.00 ? 13  ASN A HB2  7  
ATOM 10487 H HB3  . ASN A 1 13  ? -2.071  5.772   -12.284 1.00 0.00 ? 13  ASN A HB3  7  
ATOM 10488 H HD21 . ASN A 1 13  ? -2.484  4.667   -14.046 1.00 0.00 ? 13  ASN A HD21 7  
ATOM 10489 H HD22 . ASN A 1 13  ? -4.043  4.276   -14.691 1.00 0.00 ? 13  ASN A HD22 7  
ATOM 10490 N N    . MET A 1 14  ? -3.025  4.567   -8.848  1.00 0.00 ? 14  MET A N    7  
ATOM 10491 C CA   . MET A 1 14  ? -2.476  3.391   -8.194  1.00 0.00 ? 14  MET A CA   7  
ATOM 10492 C C    . MET A 1 14  ? -3.405  2.897   -7.083  1.00 0.00 ? 14  MET A C    7  
ATOM 10493 O O    . MET A 1 14  ? -3.736  3.648   -6.167  1.00 0.00 ? 14  MET A O    7  
ATOM 10494 C CB   . MET A 1 14  ? -1.106  3.729   -7.602  1.00 0.00 ? 14  MET A CB   7  
ATOM 10495 C CG   . MET A 1 14  ? -0.031  3.760   -8.691  1.00 0.00 ? 14  MET A CG   7  
ATOM 10496 S SD   . MET A 1 14  ? 1.015   2.321   -8.556  1.00 0.00 ? 14  MET A SD   7  
ATOM 10497 C CE   . MET A 1 14  ? 1.473   2.429   -6.834  1.00 0.00 ? 14  MET A CE   7  
ATOM 10498 H H    . MET A 1 14  ? -3.515  5.196   -8.244  1.00 0.00 ? 14  MET A H    7  
ATOM 10499 H HA   . MET A 1 14  ? -2.396  2.633   -8.974  1.00 0.00 ? 14  MET A HA   7  
ATOM 10500 H HB2  . MET A 1 14  ? -1.151  4.696   -7.102  1.00 0.00 ? 14  MET A HB2  7  
ATOM 10501 H HB3  . MET A 1 14  ? -0.841  2.991   -6.845  1.00 0.00 ? 14  MET A HB3  7  
ATOM 10502 H HG2  . MET A 1 14  ? -0.499  3.789   -9.675  1.00 0.00 ? 14  MET A HG2  7  
ATOM 10503 H HG3  . MET A 1 14  ? 0.568   4.666   -8.596  1.00 0.00 ? 14  MET A HG3  7  
ATOM 10504 H HE1  . MET A 1 14  ? 2.559   2.431   -6.746  1.00 0.00 ? 14  MET A HE1  7  
ATOM 10505 H HE2  . MET A 1 14  ? 1.073   3.350   -6.410  1.00 0.00 ? 14  MET A HE2  7  
ATOM 10506 H HE3  . MET A 1 14  ? 1.065   1.574   -6.295  1.00 0.00 ? 14  MET A HE3  7  
ATOM 10507 N N    . LYS A 1 15  ? -3.799  1.638   -7.201  1.00 0.00 ? 15  LYS A N    7  
ATOM 10508 C CA   . LYS A 1 15  ? -4.683  1.035   -6.218  1.00 0.00 ? 15  LYS A CA   7  
ATOM 10509 C C    . LYS A 1 15  ? -3.857  0.550   -5.025  1.00 0.00 ? 15  LYS A C    7  
ATOM 10510 O O    . LYS A 1 15  ? -3.142  -0.446  -5.123  1.00 0.00 ? 15  LYS A O    7  
ATOM 10511 C CB   . LYS A 1 15  ? -5.533  -0.062  -6.863  1.00 0.00 ? 15  LYS A CB   7  
ATOM 10512 C CG   . LYS A 1 15  ? -6.905  0.477   -7.272  1.00 0.00 ? 15  LYS A CG   7  
ATOM 10513 C CD   . LYS A 1 15  ? -7.439  -0.259  -8.502  1.00 0.00 ? 15  LYS A CD   7  
ATOM 10514 C CE   . LYS A 1 15  ? -8.952  -0.464  -8.405  1.00 0.00 ? 15  LYS A CE   7  
ATOM 10515 N NZ   . LYS A 1 15  ? -9.268  -1.888  -8.158  1.00 0.00 ? 15  LYS A NZ   7  
ATOM 10516 H H    . LYS A 1 15  ? -3.524  1.034   -7.950  1.00 0.00 ? 15  LYS A H    7  
ATOM 10517 H HA   . LYS A 1 15  ? -5.366  1.811   -5.873  1.00 0.00 ? 15  LYS A HA   7  
ATOM 10518 H HB2  . LYS A 1 15  ? -5.018  -0.459  -7.738  1.00 0.00 ? 15  LYS A HB2  7  
ATOM 10519 H HB3  . LYS A 1 15  ? -5.656  -0.889  -6.164  1.00 0.00 ? 15  LYS A HB3  7  
ATOM 10520 H HG2  . LYS A 1 15  ? -7.605  0.365   -6.444  1.00 0.00 ? 15  LYS A HG2  7  
ATOM 10521 H HG3  . LYS A 1 15  ? -6.832  1.544   -7.486  1.00 0.00 ? 15  LYS A HG3  7  
ATOM 10522 H HD2  . LYS A 1 15  ? -7.202  0.309   -9.402  1.00 0.00 ? 15  LYS A HD2  7  
ATOM 10523 H HD3  . LYS A 1 15  ? -6.943  -1.225  -8.596  1.00 0.00 ? 15  LYS A HD3  7  
ATOM 10524 H HE2  . LYS A 1 15  ? -9.357  0.149   -7.600  1.00 0.00 ? 15  LYS A HE2  7  
ATOM 10525 H HE3  . LYS A 1 15  ? -9.430  -0.134  -9.327  1.00 0.00 ? 15  LYS A HE3  7  
ATOM 10526 H HZ1  . LYS A 1 15  ? -10.169 -1.961  -7.732  1.00 0.00 ? 15  LYS A HZ1  7  
ATOM 10527 H HZ2  . LYS A 1 15  ? -9.269  -2.385  -9.027  1.00 0.00 ? 15  LYS A HZ2  7  
ATOM 10528 H HZ3  . LYS A 1 15  ? -8.578  -2.282  -7.550  1.00 0.00 ? 15  LYS A HZ3  7  
ATOM 10529 N N    . ILE A 1 16  ? -3.982  1.278   -3.925  1.00 0.00 ? 16  ILE A N    7  
ATOM 10530 C CA   . ILE A 1 16  ? -3.256  0.935   -2.714  1.00 0.00 ? 16  ILE A CA   7  
ATOM 10531 C C    . ILE A 1 16  ? -4.155  0.092   -1.807  1.00 0.00 ? 16  ILE A C    7  
ATOM 10532 O O    . ILE A 1 16  ? -5.311  0.441   -1.575  1.00 0.00 ? 16  ILE A O    7  
ATOM 10533 C CB   . ILE A 1 16  ? -2.713  2.197   -2.039  1.00 0.00 ? 16  ILE A CB   7  
ATOM 10534 C CG1  . ILE A 1 16  ? -1.637  2.860   -2.902  1.00 0.00 ? 16  ILE A CG1  7  
ATOM 10535 C CG2  . ILE A 1 16  ? -2.208  1.890   -0.628  1.00 0.00 ? 16  ILE A CG2  7  
ATOM 10536 C CD1  . ILE A 1 16  ? -2.267  3.698   -4.016  1.00 0.00 ? 16  ILE A CD1  7  
ATOM 10537 H H    . ILE A 1 16  ? -4.566  2.087   -3.853  1.00 0.00 ? 16  ILE A H    7  
ATOM 10538 H HA   . ILE A 1 16  ? -2.397  0.332   -3.007  1.00 0.00 ? 16  ILE A HA   7  
ATOM 10539 H HB   . ILE A 1 16  ? -3.531  2.910   -1.940  1.00 0.00 ? 16  ILE A HB   7  
ATOM 10540 H HG12 . ILE A 1 16  ? -1.005  3.492   -2.279  1.00 0.00 ? 16  ILE A HG12 7  
ATOM 10541 H HG13 . ILE A 1 16  ? -0.993  2.096   -3.337  1.00 0.00 ? 16  ILE A HG13 7  
ATOM 10542 H HG21 . ILE A 1 16  ? -1.316  1.266   -0.689  1.00 0.00 ? 16  ILE A HG21 7  
ATOM 10543 H HG22 . ILE A 1 16  ? -1.965  2.822   -0.118  1.00 0.00 ? 16  ILE A HG22 7  
ATOM 10544 H HG23 . ILE A 1 16  ? -2.982  1.362   -0.072  1.00 0.00 ? 16  ILE A HG23 7  
ATOM 10545 H HD11 . ILE A 1 16  ? -3.352  3.605   -3.972  1.00 0.00 ? 16  ILE A HD11 7  
ATOM 10546 H HD12 . ILE A 1 16  ? -1.987  4.743   -3.887  1.00 0.00 ? 16  ILE A HD12 7  
ATOM 10547 H HD13 . ILE A 1 16  ? -1.911  3.343   -4.983  1.00 0.00 ? 16  ILE A HD13 7  
ATOM 10548 N N    . LEU A 1 17  ? -3.589  -1.003  -1.320  1.00 0.00 ? 17  LEU A N    7  
ATOM 10549 C CA   . LEU A 1 17  ? -4.324  -1.899  -0.444  1.00 0.00 ? 17  LEU A CA   7  
ATOM 10550 C C    . LEU A 1 17  ? -3.842  -1.707  0.996   1.00 0.00 ? 17  LEU A C    7  
ATOM 10551 O O    . LEU A 1 17  ? -2.746  -1.199  1.225   1.00 0.00 ? 17  LEU A O    7  
ATOM 10552 C CB   . LEU A 1 17  ? -4.217  -3.342  -0.941  1.00 0.00 ? 17  LEU A CB   7  
ATOM 10553 C CG   . LEU A 1 17  ? -5.346  -4.283  -0.518  1.00 0.00 ? 17  LEU A CG   7  
ATOM 10554 C CD1  . LEU A 1 17  ? -5.071  -4.885  0.861   1.00 0.00 ? 17  LEU A CD1  7  
ATOM 10555 C CD2  . LEU A 1 17  ? -6.701  -3.573  -0.573  1.00 0.00 ? 17  LEU A CD2  7  
ATOM 10556 H H    . LEU A 1 17  ? -2.648  -1.279  -1.514  1.00 0.00 ? 17  LEU A H    7  
ATOM 10557 H HA   . LEU A 1 17  ? -5.376  -1.617  -0.497  1.00 0.00 ? 17  LEU A HA   7  
ATOM 10558 H HB2  . LEU A 1 17  ? -4.171  -3.327  -2.030  1.00 0.00 ? 17  LEU A HB2  7  
ATOM 10559 H HB3  . LEU A 1 17  ? -3.273  -3.757  -0.588  1.00 0.00 ? 17  LEU A HB3  7  
ATOM 10560 H HG   . LEU A 1 17  ? -5.387  -5.109  -1.228  1.00 0.00 ? 17  LEU A HG   7  
ATOM 10561 H HD11 . LEU A 1 17  ? -5.874  -4.611  1.545   1.00 0.00 ? 17  LEU A HD11 7  
ATOM 10562 H HD12 . LEU A 1 17  ? -5.018  -5.971  0.779   1.00 0.00 ? 17  LEU A HD12 7  
ATOM 10563 H HD13 . LEU A 1 17  ? -4.123  -4.504  1.242   1.00 0.00 ? 17  LEU A HD13 7  
ATOM 10564 H HD21 . LEU A 1 17  ? -6.724  -2.900  -1.430  1.00 0.00 ? 17  LEU A HD21 7  
ATOM 10565 H HD22 . LEU A 1 17  ? -7.495  -4.313  -0.671  1.00 0.00 ? 17  LEU A HD22 7  
ATOM 10566 H HD23 . LEU A 1 17  ? -6.848  -3.001  0.343   1.00 0.00 ? 17  LEU A HD23 7  
ATOM 10567 N N    . THR A 1 18  ? -4.686  -2.123  1.929   1.00 0.00 ? 18  THR A N    7  
ATOM 10568 C CA   . THR A 1 18  ? -4.360  -2.004  3.340   1.00 0.00 ? 18  THR A CA   7  
ATOM 10569 C C    . THR A 1 18  ? -4.802  -3.257  4.097   1.00 0.00 ? 18  THR A C    7  
ATOM 10570 O O    . THR A 1 18  ? -5.728  -3.948  3.675   1.00 0.00 ? 18  THR A O    7  
ATOM 10571 C CB   . THR A 1 18  ? -5.002  -0.718  3.866   1.00 0.00 ? 18  THR A CB   7  
ATOM 10572 O OG1  . THR A 1 18  ? -6.398  -0.919  3.665   1.00 0.00 ? 18  THR A OG1  7  
ATOM 10573 C CG2  . THR A 1 18  ? -4.672  0.498   2.998   1.00 0.00 ? 18  THR A CG2  7  
ATOM 10574 H H    . THR A 1 18  ? -5.576  -2.535  1.734   1.00 0.00 ? 18  THR A H    7  
ATOM 10575 H HA   . THR A 1 18  ? -3.277  -1.936  3.438   1.00 0.00 ? 18  THR A HA   7  
ATOM 10576 H HB   . THR A 1 18  ? -4.725  -0.542  4.905   1.00 0.00 ? 18  THR A HB   7  
ATOM 10577 H HG1  . THR A 1 18  ? -6.612  -0.881  2.689   1.00 0.00 ? 18  THR A HG1  7  
ATOM 10578 H HG21 . THR A 1 18  ? -5.194  1.373   3.386   1.00 0.00 ? 18  THR A HG21 7  
ATOM 10579 H HG22 . THR A 1 18  ? -3.597  0.678   3.018   1.00 0.00 ? 18  THR A HG22 7  
ATOM 10580 H HG23 . THR A 1 18  ? -4.990  0.310   1.973   1.00 0.00 ? 18  THR A HG23 7  
ATOM 10581 N N    . LEU A 1 19  ? -4.119  -3.513  5.203   1.00 0.00 ? 19  LEU A N    7  
ATOM 10582 C CA   . LEU A 1 19  ? -4.429  -4.671  6.024   1.00 0.00 ? 19  LEU A CA   7  
ATOM 10583 C C    . LEU A 1 19  ? -4.212  -4.321  7.497   1.00 0.00 ? 19  LEU A C    7  
ATOM 10584 O O    . LEU A 1 19  ? -3.712  -3.243  7.815   1.00 0.00 ? 19  LEU A O    7  
ATOM 10585 C CB   . LEU A 1 19  ? -3.628  -5.889  5.557   1.00 0.00 ? 19  LEU A CB   7  
ATOM 10586 C CG   . LEU A 1 19  ? -4.420  -6.967  4.814   1.00 0.00 ? 19  LEU A CG   7  
ATOM 10587 C CD1  . LEU A 1 19  ? -3.481  -7.985  4.163   1.00 0.00 ? 19  LEU A CD1  7  
ATOM 10588 C CD2  . LEU A 1 19  ? -5.437  -7.637  5.741   1.00 0.00 ? 19  LEU A CD2  7  
ATOM 10589 H H    . LEU A 1 19  ? -3.367  -2.946  5.540   1.00 0.00 ? 19  LEU A H    7  
ATOM 10590 H HA   . LEU A 1 19  ? -5.484  -4.903  5.876   1.00 0.00 ? 19  LEU A HA   7  
ATOM 10591 H HB2  . LEU A 1 19  ? -2.825  -5.543  4.906   1.00 0.00 ? 19  LEU A HB2  7  
ATOM 10592 H HB3  . LEU A 1 19  ? -3.159  -6.345  6.428   1.00 0.00 ? 19  LEU A HB3  7  
ATOM 10593 H HG   . LEU A 1 19  ? -4.981  -6.488  4.012   1.00 0.00 ? 19  LEU A HG   7  
ATOM 10594 H HD11 . LEU A 1 19  ? -2.540  -7.499  3.905   1.00 0.00 ? 19  LEU A HD11 7  
ATOM 10595 H HD12 . LEU A 1 19  ? -3.289  -8.801  4.861   1.00 0.00 ? 19  LEU A HD12 7  
ATOM 10596 H HD13 . LEU A 1 19  ? -3.945  -8.381  3.260   1.00 0.00 ? 19  LEU A HD13 7  
ATOM 10597 H HD21 . LEU A 1 19  ? -4.970  -8.486  6.239   1.00 0.00 ? 19  LEU A HD21 7  
ATOM 10598 H HD22 . LEU A 1 19  ? -5.776  -6.918  6.488   1.00 0.00 ? 19  LEU A HD22 7  
ATOM 10599 H HD23 . LEU A 1 19  ? -6.289  -7.982  5.156   1.00 0.00 ? 19  LEU A HD23 7  
ATOM 10600 N N    . GLY A 1 20  ? -4.598  -5.251  8.357   1.00 0.00 ? 20  GLY A N    7  
ATOM 10601 C CA   . GLY A 1 20  ? -4.452  -5.054  9.789   1.00 0.00 ? 20  GLY A CA   7  
ATOM 10602 C C    . GLY A 1 20  ? -4.823  -3.623  10.186  1.00 0.00 ? 20  GLY A C    7  
ATOM 10603 O O    . GLY A 1 20  ? -5.693  -3.010  9.570   1.00 0.00 ? 20  GLY A O    7  
ATOM 10604 H H    . GLY A 1 20  ? -5.004  -6.125  8.090   1.00 0.00 ? 20  GLY A H    7  
ATOM 10605 H HA2  . GLY A 1 20  ? -5.087  -5.760  10.324  1.00 0.00 ? 20  GLY A HA2  7  
ATOM 10606 H HA3  . GLY A 1 20  ? -3.424  -5.262  10.085  1.00 0.00 ? 20  GLY A HA3  7  
ATOM 10607 N N    . LYS A 1 21  ? -4.143  -3.133  11.213  1.00 0.00 ? 21  LYS A N    7  
ATOM 10608 C CA   . LYS A 1 21  ? -4.391  -1.787  11.699  1.00 0.00 ? 21  LYS A CA   7  
ATOM 10609 C C    . LYS A 1 21  ? -3.126  -0.944  11.519  1.00 0.00 ? 21  LYS A C    7  
ATOM 10610 O O    . LYS A 1 21  ? -2.020  -1.414  11.782  1.00 0.00 ? 21  LYS A O    7  
ATOM 10611 C CB   . LYS A 1 21  ? -4.905  -1.823  13.140  1.00 0.00 ? 21  LYS A CB   7  
ATOM 10612 C CG   . LYS A 1 21  ? -5.174  -0.411  13.662  1.00 0.00 ? 21  LYS A CG   7  
ATOM 10613 C CD   . LYS A 1 21  ? -6.487  0.140   13.103  1.00 0.00 ? 21  LYS A CD   7  
ATOM 10614 C CE   . LYS A 1 21  ? -6.735  1.569   13.592  1.00 0.00 ? 21  LYS A CE   7  
ATOM 10615 N NZ   . LYS A 1 21  ? -7.020  1.577   15.045  1.00 0.00 ? 21  LYS A NZ   7  
ATOM 10616 H H    . LYS A 1 21  ? -3.437  -3.639  11.708  1.00 0.00 ? 21  LYS A H    7  
ATOM 10617 H HA   . LYS A 1 21  ? -5.182  -1.358  11.085  1.00 0.00 ? 21  LYS A HA   7  
ATOM 10618 H HB2  . LYS A 1 21  ? -5.821  -2.413  13.188  1.00 0.00 ? 21  LYS A HB2  7  
ATOM 10619 H HB3  . LYS A 1 21  ? -4.174  -2.318  13.778  1.00 0.00 ? 21  LYS A HB3  7  
ATOM 10620 H HG2  . LYS A 1 21  ? -5.215  -0.424  14.751  1.00 0.00 ? 21  LYS A HG2  7  
ATOM 10621 H HG3  . LYS A 1 21  ? -4.351  0.247   13.382  1.00 0.00 ? 21  LYS A HG3  7  
ATOM 10622 H HD2  . LYS A 1 21  ? -6.458  0.125   12.014  1.00 0.00 ? 21  LYS A HD2  7  
ATOM 10623 H HD3  . LYS A 1 21  ? -7.314  -0.501  13.409  1.00 0.00 ? 21  LYS A HD3  7  
ATOM 10624 H HE2  . LYS A 1 21  ? -5.862  2.187   13.383  1.00 0.00 ? 21  LYS A HE2  7  
ATOM 10625 H HE3  . LYS A 1 21  ? -7.573  2.005   13.049  1.00 0.00 ? 21  LYS A HE3  7  
ATOM 10626 H HZ1  . LYS A 1 21  ? -7.692  2.289   15.249  1.00 0.00 ? 21  LYS A HZ1  7  
ATOM 10627 H HZ2  . LYS A 1 21  ? -7.384  0.687   15.318  1.00 0.00 ? 21  LYS A HZ2  7  
ATOM 10628 H HZ3  . LYS A 1 21  ? -6.176  1.761   15.549  1.00 0.00 ? 21  LYS A HZ3  7  
ATOM 10629 N N    . LEU A 1 22  ? -3.332  0.286   11.072  1.00 0.00 ? 22  LEU A N    7  
ATOM 10630 C CA   . LEU A 1 22  ? -2.223  1.198   10.854  1.00 0.00 ? 22  LEU A CA   7  
ATOM 10631 C C    . LEU A 1 22  ? -2.278  2.320   11.894  1.00 0.00 ? 22  LEU A C    7  
ATOM 10632 O O    . LEU A 1 22  ? -3.286  2.487   12.578  1.00 0.00 ? 22  LEU A O    7  
ATOM 10633 C CB   . LEU A 1 22  ? -2.218  1.700   9.409   1.00 0.00 ? 22  LEU A CB   7  
ATOM 10634 C CG   . LEU A 1 22  ? -2.161  0.621   8.325   1.00 0.00 ? 22  LEU A CG   7  
ATOM 10635 C CD1  . LEU A 1 22  ? -2.833  1.102   7.037   1.00 0.00 ? 22  LEU A CD1  7  
ATOM 10636 C CD2  . LEU A 1 22  ? -0.722  0.162   8.083   1.00 0.00 ? 22  LEU A CD2  7  
ATOM 10637 H H    . LEU A 1 22  ? -4.235  0.660   10.861  1.00 0.00 ? 22  LEU A H    7  
ATOM 10638 H HA   . LEU A 1 22  ? -1.302  0.635   11.003  1.00 0.00 ? 22  LEU A HA   7  
ATOM 10639 H HB2  . LEU A 1 22  ? -3.114  2.300   9.250   1.00 0.00 ? 22  LEU A HB2  7  
ATOM 10640 H HB3  . LEU A 1 22  ? -1.363  2.363   9.278   1.00 0.00 ? 22  LEU A HB3  7  
ATOM 10641 H HG   . LEU A 1 22  ? -2.721  -0.245  8.675   1.00 0.00 ? 22  LEU A HG   7  
ATOM 10642 H HD11 . LEU A 1 22  ? -2.576  0.428   6.220   1.00 0.00 ? 22  LEU A HD11 7  
ATOM 10643 H HD12 . LEU A 1 22  ? -3.914  1.114   7.174   1.00 0.00 ? 22  LEU A HD12 7  
ATOM 10644 H HD13 . LEU A 1 22  ? -2.486  2.108   6.800   1.00 0.00 ? 22  LEU A HD13 7  
ATOM 10645 H HD21 . LEU A 1 22  ? -0.058  1.027   8.088   1.00 0.00 ? 22  LEU A HD21 7  
ATOM 10646 H HD22 . LEU A 1 22  ? -0.424  -0.529  8.872   1.00 0.00 ? 22  LEU A HD22 7  
ATOM 10647 H HD23 . LEU A 1 22  ? -0.658  -0.340  7.118   1.00 0.00 ? 22  LEU A HD23 7  
ATOM 10648 N N    . SER A 1 23  ? -1.181  3.058   11.979  1.00 0.00 ? 23  SER A N    7  
ATOM 10649 C CA   . SER A 1 23  ? -1.092  4.159   12.924  1.00 0.00 ? 23  SER A CA   7  
ATOM 10650 C C    . SER A 1 23  ? -2.264  5.121   12.719  1.00 0.00 ? 23  SER A C    7  
ATOM 10651 O O    . SER A 1 23  ? -2.932  5.505   13.678  1.00 0.00 ? 23  SER A O    7  
ATOM 10652 C CB   . SER A 1 23  ? 0.237   4.903   12.779  1.00 0.00 ? 23  SER A CB   7  
ATOM 10653 O OG   . SER A 1 23  ? 0.985   4.901   13.992  1.00 0.00 ? 23  SER A OG   7  
ATOM 10654 H H    . SER A 1 23  ? -0.365  2.915   11.419  1.00 0.00 ? 23  SER A H    7  
ATOM 10655 H HA   . SER A 1 23  ? -1.144  3.697   13.910  1.00 0.00 ? 23  SER A HA   7  
ATOM 10656 H HB2  . SER A 1 23  ? 0.827   4.440   11.989  1.00 0.00 ? 23  SER A HB2  7  
ATOM 10657 H HB3  . SER A 1 23  ? 0.045   5.931   12.473  1.00 0.00 ? 23  SER A HB3  7  
ATOM 10658 H HG   . SER A 1 23  ? 0.374   4.752   14.770  1.00 0.00 ? 23  SER A HG   7  
ATOM 10659 N N    . ARG A 1 24  ? -2.478  5.483   11.462  1.00 0.00 ? 24  ARG A N    7  
ATOM 10660 C CA   . ARG A 1 24  ? -3.558  6.392   11.119  1.00 0.00 ? 24  ARG A CA   7  
ATOM 10661 C C    . ARG A 1 24  ? -4.859  5.616   10.905  1.00 0.00 ? 24  ARG A C    7  
ATOM 10662 O O    . ARG A 1 24  ? -4.863  4.386   10.929  1.00 0.00 ? 24  ARG A O    7  
ATOM 10663 C CB   . ARG A 1 24  ? -3.230  7.183   9.851   1.00 0.00 ? 24  ARG A CB   7  
ATOM 10664 C CG   . ARG A 1 24  ? -2.182  8.262   10.133  1.00 0.00 ? 24  ARG A CG   7  
ATOM 10665 C CD   . ARG A 1 24  ? -2.503  9.550   9.374   1.00 0.00 ? 24  ARG A CD   7  
ATOM 10666 N NE   . ARG A 1 24  ? -1.415  10.535  9.565   1.00 0.00 ? 24  ARG A NE   7  
ATOM 10667 C CZ   . ARG A 1 24  ? -1.194  11.198  10.708  1.00 0.00 ? 24  ARG A CZ   7  
ATOM 10668 N NH1  . ARG A 1 24  ? -1.983  10.985  11.770  1.00 0.00 ? 24  ARG A NH1  7  
ATOM 10669 N NH2  . ARG A 1 24  ? -0.183  12.073  10.790  1.00 0.00 ? 24  ARG A NH2  7  
ATOM 10670 H H    . ARG A 1 24  ? -1.930  5.166   10.688  1.00 0.00 ? 24  ARG A H    7  
ATOM 10671 H HA   . ARG A 1 24  ? -3.638  7.064   11.973  1.00 0.00 ? 24  ARG A HA   7  
ATOM 10672 H HB2  . ARG A 1 24  ? -2.861  6.505   9.081   1.00 0.00 ? 24  ARG A HB2  7  
ATOM 10673 H HB3  . ARG A 1 24  ? -4.137  7.645   9.461   1.00 0.00 ? 24  ARG A HB3  7  
ATOM 10674 H HG2  . ARG A 1 24  ? -2.144  8.466   11.203  1.00 0.00 ? 24  ARG A HG2  7  
ATOM 10675 H HG3  . ARG A 1 24  ? -1.195  7.901   9.842   1.00 0.00 ? 24  ARG A HG3  7  
ATOM 10676 H HD2  . ARG A 1 24  ? -2.628  9.335   8.313   1.00 0.00 ? 24  ARG A HD2  7  
ATOM 10677 H HD3  . ARG A 1 24  ? -3.447  9.965   9.728   1.00 0.00 ? 24  ARG A HD3  7  
ATOM 10678 H HE   . ARG A 1 24  ? -0.807  10.718  8.792   1.00 0.00 ? 24  ARG A HE   7  
ATOM 10679 H HH11 . ARG A 1 24  ? -2.738  10.332  11.708  1.00 0.00 ? 24  ARG A HH11 7  
ATOM 10680 H HH12 . ARG A 1 24  ? -1.818  11.479  12.623  1.00 0.00 ? 24  ARG A HH12 7  
ATOM 10681 H HH21 . ARG A 1 24  ? 0.407   12.232  9.998   1.00 0.00 ? 24  ARG A HH21 7  
ATOM 10682 H HH22 . ARG A 1 24  ? -0.017  12.568  11.644  1.00 0.00 ? 24  ARG A HH22 7  
ATOM 10683 N N    . ASN A 1 25  ? -5.931  6.366   10.701  1.00 0.00 ? 25  ASN A N    7  
ATOM 10684 C CA   . ASN A 1 25  ? -7.236  5.763   10.483  1.00 0.00 ? 25  ASN A CA   7  
ATOM 10685 C C    . ASN A 1 25  ? -7.413  5.466   8.993   1.00 0.00 ? 25  ASN A C    7  
ATOM 10686 O O    . ASN A 1 25  ? -6.956  6.232   8.145   1.00 0.00 ? 25  ASN A O    7  
ATOM 10687 C CB   . ASN A 1 25  ? -8.358  6.709   10.913  1.00 0.00 ? 25  ASN A CB   7  
ATOM 10688 C CG   . ASN A 1 25  ? -8.502  6.733   12.436  1.00 0.00 ? 25  ASN A CG   7  
ATOM 10689 O OD1  . ASN A 1 25  ? -8.100  5.819   13.138  1.00 0.00 ? 25  ASN A OD1  7  
ATOM 10690 N ND2  . ASN A 1 25  ? -9.097  7.825   12.907  1.00 0.00 ? 25  ASN A ND2  7  
ATOM 10691 H H    . ASN A 1 25  ? -5.920  7.366   10.683  1.00 0.00 ? 25  ASN A H    7  
ATOM 10692 H HA   . ASN A 1 25  ? -7.238  4.859   11.092  1.00 0.00 ? 25  ASN A HA   7  
ATOM 10693 H HB2  . ASN A 1 25  ? -8.151  7.715   10.549  1.00 0.00 ? 25  ASN A HB2  7  
ATOM 10694 H HB3  . ASN A 1 25  ? -9.298  6.394   10.460  1.00 0.00 ? 25  ASN A HB3  7  
ATOM 10695 H HD21 . ASN A 1 25  ? -9.403  8.539   12.276  1.00 0.00 ? 25  ASN A HD21 7  
ATOM 10696 H HD22 . ASN A 1 25  ? -9.237  7.934   13.891  1.00 0.00 ? 25  ASN A HD22 7  
ATOM 10697 N N    . LYS A 1 26  ? -8.077  4.353   8.719   1.00 0.00 ? 26  LYS A N    7  
ATOM 10698 C CA   . LYS A 1 26  ? -8.320  3.945   7.346   1.00 0.00 ? 26  LYS A CA   7  
ATOM 10699 C C    . LYS A 1 26  ? -8.667  5.176   6.507   1.00 0.00 ? 26  LYS A C    7  
ATOM 10700 O O    . LYS A 1 26  ? -8.068  5.405   5.457   1.00 0.00 ? 26  LYS A O    7  
ATOM 10701 C CB   . LYS A 1 26  ? -9.382  2.845   7.293   1.00 0.00 ? 26  LYS A CB   7  
ATOM 10702 C CG   . LYS A 1 26  ? -9.499  2.262   5.884   1.00 0.00 ? 26  LYS A CG   7  
ATOM 10703 C CD   . LYS A 1 26  ? -10.965 2.086   5.483   1.00 0.00 ? 26  LYS A CD   7  
ATOM 10704 C CE   . LYS A 1 26  ? -11.084 1.305   4.172   1.00 0.00 ? 26  LYS A CE   7  
ATOM 10705 N NZ   . LYS A 1 26  ? -12.297 0.456   4.184   1.00 0.00 ? 26  LYS A NZ   7  
ATOM 10706 H H    . LYS A 1 26  ? -8.445  3.736   9.414   1.00 0.00 ? 26  LYS A H    7  
ATOM 10707 H HA   . LYS A 1 26  ? -7.393  3.516   6.963   1.00 0.00 ? 26  LYS A HA   7  
ATOM 10708 H HB2  . LYS A 1 26  ? -9.128  2.054   7.998   1.00 0.00 ? 26  LYS A HB2  7  
ATOM 10709 H HB3  . LYS A 1 26  ? -10.345 3.250   7.604   1.00 0.00 ? 26  LYS A HB3  7  
ATOM 10710 H HG2  . LYS A 1 26  ? -9.000  2.920   5.172   1.00 0.00 ? 26  LYS A HG2  7  
ATOM 10711 H HG3  . LYS A 1 26  ? -8.988  1.300   5.841   1.00 0.00 ? 26  LYS A HG3  7  
ATOM 10712 H HD2  . LYS A 1 26  ? -11.501 1.561   6.273   1.00 0.00 ? 26  LYS A HD2  7  
ATOM 10713 H HD3  . LYS A 1 26  ? -11.435 3.063   5.372   1.00 0.00 ? 26  LYS A HD3  7  
ATOM 10714 H HE2  . LYS A 1 26  ? -11.127 1.998   3.332   1.00 0.00 ? 26  LYS A HE2  7  
ATOM 10715 H HE3  . LYS A 1 26  ? -10.200 0.685   4.029   1.00 0.00 ? 26  LYS A HE3  7  
ATOM 10716 H HZ1  . LYS A 1 26  ? -12.040 -0.489  4.386   1.00 0.00 ? 26  LYS A HZ1  7  
ATOM 10717 H HZ2  . LYS A 1 26  ? -12.929 0.787   4.884   1.00 0.00 ? 26  LYS A HZ2  7  
ATOM 10718 H HZ3  . LYS A 1 26  ? -12.740 0.497   3.288   1.00 0.00 ? 26  LYS A HZ3  7  
ATOM 10719 N N    . ASP A 1 27  ? -9.633  5.937   7.001   1.00 0.00 ? 27  ASP A N    7  
ATOM 10720 C CA   . ASP A 1 27  ? -10.067 7.139   6.310   1.00 0.00 ? 27  ASP A CA   7  
ATOM 10721 C C    . ASP A 1 27  ? -8.850  8.016   6.008   1.00 0.00 ? 27  ASP A C    7  
ATOM 10722 O O    . ASP A 1 27  ? -8.519  8.245   4.846   1.00 0.00 ? 27  ASP A O    7  
ATOM 10723 C CB   . ASP A 1 27  ? -11.034 7.952   7.173   1.00 0.00 ? 27  ASP A CB   7  
ATOM 10724 C CG   . ASP A 1 27  ? -12.175 8.624   6.408   1.00 0.00 ? 27  ASP A CG   7  
ATOM 10725 O OD1  . ASP A 1 27  ? -11.879 9.206   5.342   1.00 0.00 ? 27  ASP A OD1  7  
ATOM 10726 O OD2  . ASP A 1 27  ? -13.319 8.541   6.906   1.00 0.00 ? 27  ASP A OD2  7  
ATOM 10727 H H    . ASP A 1 27  ? -10.115 5.743   7.856   1.00 0.00 ? 27  ASP A H    7  
ATOM 10728 H HA   . ASP A 1 27  ? -10.562 6.786   5.405   1.00 0.00 ? 27  ASP A HA   7  
ATOM 10729 H HB2  . ASP A 1 27  ? -11.461 7.295   7.931   1.00 0.00 ? 27  ASP A HB2  7  
ATOM 10730 H HB3  . ASP A 1 27  ? -10.468 8.720   7.700   1.00 0.00 ? 27  ASP A HB3  7  
ATOM 10731 N N    . GLU A 1 28  ? -8.218  8.483   7.075   1.00 0.00 ? 28  GLU A N    7  
ATOM 10732 C CA   . GLU A 1 28  ? -7.045  9.330   6.939   1.00 0.00 ? 28  GLU A CA   7  
ATOM 10733 C C    . GLU A 1 28  ? -6.159  8.830   5.796   1.00 0.00 ? 28  GLU A C    7  
ATOM 10734 O O    . GLU A 1 28  ? -5.669  9.623   4.993   1.00 0.00 ? 28  GLU A O    7  
ATOM 10735 C CB   . GLU A 1 28  ? -6.262  9.396   8.251   1.00 0.00 ? 28  GLU A CB   7  
ATOM 10736 C CG   . GLU A 1 28  ? -7.027  10.197  9.307   1.00 0.00 ? 28  GLU A CG   7  
ATOM 10737 C CD   . GLU A 1 28  ? -6.100  11.172  10.034  1.00 0.00 ? 28  GLU A CD   7  
ATOM 10738 O OE1  . GLU A 1 28  ? -5.383  11.910  9.324   1.00 0.00 ? 28  GLU A OE1  7  
ATOM 10739 O OE2  . GLU A 1 28  ? -6.129  11.159  11.284  1.00 0.00 ? 28  GLU A OE2  7  
ATOM 10740 H H    . GLU A 1 28  ? -8.494  8.292   8.017   1.00 0.00 ? 28  GLU A H    7  
ATOM 10741 H HA   . GLU A 1 28  ? -7.430  10.322  6.702   1.00 0.00 ? 28  GLU A HA   7  
ATOM 10742 H HB2  . GLU A 1 28  ? -6.076  8.387   8.619   1.00 0.00 ? 28  GLU A HB2  7  
ATOM 10743 H HB3  . GLU A 1 28  ? -5.289  9.856   8.075   1.00 0.00 ? 28  GLU A HB3  7  
ATOM 10744 H HG2  . GLU A 1 28  ? -7.840  10.747  8.832   1.00 0.00 ? 28  GLU A HG2  7  
ATOM 10745 H HG3  . GLU A 1 28  ? -7.481  9.516   10.026  1.00 0.00 ? 28  GLU A HG3  7  
ATOM 10746 N N    . VAL A 1 29  ? -5.982  7.517   5.758   1.00 0.00 ? 29  VAL A N    7  
ATOM 10747 C CA   . VAL A 1 29  ? -5.163  6.902   4.727   1.00 0.00 ? 29  VAL A CA   7  
ATOM 10748 C C    . VAL A 1 29  ? -5.910  6.952   3.393   1.00 0.00 ? 29  VAL A C    7  
ATOM 10749 O O    . VAL A 1 29  ? -5.385  7.458   2.402   1.00 0.00 ? 29  VAL A O    7  
ATOM 10750 C CB   . VAL A 1 29  ? -4.777  5.482   5.144   1.00 0.00 ? 29  VAL A CB   7  
ATOM 10751 C CG1  . VAL A 1 29  ? -4.056  4.754   4.007   1.00 0.00 ? 29  VAL A CG1  7  
ATOM 10752 C CG2  . VAL A 1 29  ? -3.923  5.496   6.413   1.00 0.00 ? 29  VAL A CG2  7  
ATOM 10753 H H    . VAL A 1 29  ? -6.384  6.879   6.415   1.00 0.00 ? 29  VAL A H    7  
ATOM 10754 H HA   . VAL A 1 29  ? -4.249  7.489   4.639   1.00 0.00 ? 29  VAL A HA   7  
ATOM 10755 H HB   . VAL A 1 29  ? -5.694  4.936   5.363   1.00 0.00 ? 29  VAL A HB   7  
ATOM 10756 H HG11 . VAL A 1 29  ? -4.598  3.841   3.759   1.00 0.00 ? 29  VAL A HG11 7  
ATOM 10757 H HG12 . VAL A 1 29  ? -4.015  5.400   3.130   1.00 0.00 ? 29  VAL A HG12 7  
ATOM 10758 H HG13 . VAL A 1 29  ? -3.044  4.502   4.321   1.00 0.00 ? 29  VAL A HG13 7  
ATOM 10759 H HG21 . VAL A 1 29  ? -3.616  4.479   6.656   1.00 0.00 ? 29  VAL A HG21 7  
ATOM 10760 H HG22 . VAL A 1 29  ? -3.040  6.113   6.251   1.00 0.00 ? 29  VAL A HG22 7  
ATOM 10761 H HG23 . VAL A 1 29  ? -4.506  5.906   7.238   1.00 0.00 ? 29  VAL A HG23 7  
ATOM 10762 N N    . LYS A 1 30  ? -7.123  6.419   3.410   1.00 0.00 ? 30  LYS A N    7  
ATOM 10763 C CA   . LYS A 1 30  ? -7.947  6.396   2.213   1.00 0.00 ? 30  LYS A CA   7  
ATOM 10764 C C    . LYS A 1 30  ? -7.861  7.754   1.514   1.00 0.00 ? 30  LYS A C    7  
ATOM 10765 O O    . LYS A 1 30  ? -7.739  7.820   0.291   1.00 0.00 ? 30  LYS A O    7  
ATOM 10766 C CB   . LYS A 1 30  ? -9.376  5.970   2.555   1.00 0.00 ? 30  LYS A CB   7  
ATOM 10767 C CG   . LYS A 1 30  ? -10.217 5.804   1.288   1.00 0.00 ? 30  LYS A CG   7  
ATOM 10768 C CD   . LYS A 1 30  ? -11.710 5.771   1.621   1.00 0.00 ? 30  LYS A CD   7  
ATOM 10769 C CE   . LYS A 1 30  ? -12.377 4.529   1.025   1.00 0.00 ? 30  LYS A CE   7  
ATOM 10770 N NZ   . LYS A 1 30  ? -13.850 4.669   1.051   1.00 0.00 ? 30  LYS A NZ   7  
ATOM 10771 H H    . LYS A 1 30  ? -7.543  6.009   4.220   1.00 0.00 ? 30  LYS A H    7  
ATOM 10772 H HA   . LYS A 1 30  ? -7.535  5.638   1.547   1.00 0.00 ? 30  LYS A HA   7  
ATOM 10773 H HB2  . LYS A 1 30  ? -9.358  5.031   3.109   1.00 0.00 ? 30  LYS A HB2  7  
ATOM 10774 H HB3  . LYS A 1 30  ? -9.835  6.714   3.206   1.00 0.00 ? 30  LYS A HB3  7  
ATOM 10775 H HG2  . LYS A 1 30  ? -10.012 6.626   0.601   1.00 0.00 ? 30  LYS A HG2  7  
ATOM 10776 H HG3  . LYS A 1 30  ? -9.934  4.884   0.777   1.00 0.00 ? 30  LYS A HG3  7  
ATOM 10777 H HD2  . LYS A 1 30  ? -11.845 5.777   2.702   1.00 0.00 ? 30  LYS A HD2  7  
ATOM 10778 H HD3  . LYS A 1 30  ? -12.193 6.668   1.234   1.00 0.00 ? 30  LYS A HD3  7  
ATOM 10779 H HE2  . LYS A 1 30  ? -12.037 4.383   0.000   1.00 0.00 ? 30  LYS A HE2  7  
ATOM 10780 H HE3  . LYS A 1 30  ? -12.080 3.644   1.588   1.00 0.00 ? 30  LYS A HE3  7  
ATOM 10781 H HZ1  . LYS A 1 30  ? -14.101 5.597   0.778   1.00 0.00 ? 30  LYS A HZ1  7  
ATOM 10782 H HZ2  . LYS A 1 30  ? -14.258 4.013   0.416   1.00 0.00 ? 30  LYS A HZ2  7  
ATOM 10783 H HZ3  . LYS A 1 30  ? -14.186 4.490   1.976   1.00 0.00 ? 30  LYS A HZ3  7  
ATOM 10784 N N    . ALA A 1 31  ? -7.929  8.804   2.319   1.00 0.00 ? 31  ALA A N    7  
ATOM 10785 C CA   . ALA A 1 31  ? -7.860  10.156  1.792   1.00 0.00 ? 31  ALA A CA   7  
ATOM 10786 C C    . ALA A 1 31  ? -6.440  10.433  1.293   1.00 0.00 ? 31  ALA A C    7  
ATOM 10787 O O    . ALA A 1 31  ? -6.257  11.048  0.243   1.00 0.00 ? 31  ALA A O    7  
ATOM 10788 C CB   . ALA A 1 31  ? -8.302  11.147  2.871   1.00 0.00 ? 31  ALA A CB   7  
ATOM 10789 H H    . ALA A 1 31  ? -8.028  8.742   3.312   1.00 0.00 ? 31  ALA A H    7  
ATOM 10790 H HA   . ALA A 1 31  ? -8.551  10.221  0.952   1.00 0.00 ? 31  ALA A HA   7  
ATOM 10791 H HB1  . ALA A 1 31  ? -7.434  11.695  3.239   1.00 0.00 ? 31  ALA A HB1  7  
ATOM 10792 H HB2  . ALA A 1 31  ? -9.021  11.849  2.448   1.00 0.00 ? 31  ALA A HB2  7  
ATOM 10793 H HB3  . ALA A 1 31  ? -8.766  10.605  3.695   1.00 0.00 ? 31  ALA A HB3  7  
ATOM 10794 N N    . MET A 1 32  ? -5.473  9.966   2.068   1.00 0.00 ? 32  MET A N    7  
ATOM 10795 C CA   . MET A 1 32  ? -4.076  10.155  1.718   1.00 0.00 ? 32  MET A CA   7  
ATOM 10796 C C    . MET A 1 32  ? -3.745  9.468   0.391   1.00 0.00 ? 32  MET A C    7  
ATOM 10797 O O    . MET A 1 32  ? -3.115  10.063  -0.481  1.00 0.00 ? 32  MET A O    7  
ATOM 10798 C CB   . MET A 1 32  ? -3.189  9.583   2.825   1.00 0.00 ? 32  MET A CB   7  
ATOM 10799 C CG   . MET A 1 32  ? -2.355  10.683  3.484   1.00 0.00 ? 32  MET A CG   7  
ATOM 10800 S SD   . MET A 1 32  ? -1.466  10.021  4.883   1.00 0.00 ? 32  MET A SD   7  
ATOM 10801 C CE   . MET A 1 32  ? 0.207   10.418  4.404   1.00 0.00 ? 32  MET A CE   7  
ATOM 10802 H H    . MET A 1 32  ? -5.631  9.467   2.920   1.00 0.00 ? 32  MET A H    7  
ATOM 10803 H HA   . MET A 1 32  ? -3.942  11.233  1.619   1.00 0.00 ? 32  MET A HA   7  
ATOM 10804 H HB2  . MET A 1 32  ? -3.809  9.093   3.575   1.00 0.00 ? 32  MET A HB2  7  
ATOM 10805 H HB3  . MET A 1 32  ? -2.529  8.821   2.410   1.00 0.00 ? 32  MET A HB3  7  
ATOM 10806 H HG2  . MET A 1 32  ? -1.654  11.101  2.762   1.00 0.00 ? 32  MET A HG2  7  
ATOM 10807 H HG3  . MET A 1 32  ? -3.003  11.498  3.807   1.00 0.00 ? 32  MET A HG3  7  
ATOM 10808 H HE1  . MET A 1 32  ? 0.258   10.528  3.321   1.00 0.00 ? 32  MET A HE1  7  
ATOM 10809 H HE2  . MET A 1 32  ? 0.508   11.352  4.878   1.00 0.00 ? 32  MET A HE2  7  
ATOM 10810 H HE3  . MET A 1 32  ? 0.875   9.618   4.720   1.00 0.00 ? 32  MET A HE3  7  
ATOM 10811 N N    . ILE A 1 33  ? -4.185  8.223   0.281   1.00 0.00 ? 33  ILE A N    7  
ATOM 10812 C CA   . ILE A 1 33  ? -3.944  7.447   -0.924  1.00 0.00 ? 33  ILE A CA   7  
ATOM 10813 C C    . ILE A 1 33  ? -4.587  8.155   -2.118  1.00 0.00 ? 33  ILE A C    7  
ATOM 10814 O O    . ILE A 1 33  ? -4.056  8.117   -3.226  1.00 0.00 ? 33  ILE A O    7  
ATOM 10815 C CB   . ILE A 1 33  ? -4.417  6.004   -0.736  1.00 0.00 ? 33  ILE A CB   7  
ATOM 10816 C CG1  . ILE A 1 33  ? -3.674  5.330   0.419   1.00 0.00 ? 33  ILE A CG1  7  
ATOM 10817 C CG2  . ILE A 1 33  ? -4.291  5.212   -2.039  1.00 0.00 ? 33  ILE A CG2  7  
ATOM 10818 C CD1  . ILE A 1 33  ? -4.368  4.030   0.833   1.00 0.00 ? 33  ILE A CD1  7  
ATOM 10819 H H    . ILE A 1 33  ? -4.697  7.745   0.996   1.00 0.00 ? 33  ILE A H    7  
ATOM 10820 H HA   . ILE A 1 33  ? -2.866  7.415   -1.081  1.00 0.00 ? 33  ILE A HA   7  
ATOM 10821 H HB   . ILE A 1 33  ? -5.474  6.023   -0.472  1.00 0.00 ? 33  ILE A HB   7  
ATOM 10822 H HG12 . ILE A 1 33  ? -2.647  5.119   0.122   1.00 0.00 ? 33  ILE A HG12 7  
ATOM 10823 H HG13 . ILE A 1 33  ? -3.626  6.008   1.271   1.00 0.00 ? 33  ILE A HG13 7  
ATOM 10824 H HG21 . ILE A 1 33  ? -4.934  4.334   -1.993  1.00 0.00 ? 33  ILE A HG21 7  
ATOM 10825 H HG22 . ILE A 1 33  ? -4.593  5.841   -2.877  1.00 0.00 ? 33  ILE A HG22 7  
ATOM 10826 H HG23 . ILE A 1 33  ? -3.256  4.899   -2.175  1.00 0.00 ? 33  ILE A HG23 7  
ATOM 10827 H HD11 . ILE A 1 33  ? -4.847  4.167   1.802   1.00 0.00 ? 33  ILE A HD11 7  
ATOM 10828 H HD12 . ILE A 1 33  ? -5.121  3.768   0.090   1.00 0.00 ? 33  ILE A HD12 7  
ATOM 10829 H HD13 . ILE A 1 33  ? -3.631  3.230   0.901   1.00 0.00 ? 33  ILE A HD13 7  
ATOM 10830 N N    . GLU A 1 34  ? -5.722  8.784   -1.850  1.00 0.00 ? 34  GLU A N    7  
ATOM 10831 C CA   . GLU A 1 34  ? -6.444  9.500   -2.889  1.00 0.00 ? 34  GLU A CA   7  
ATOM 10832 C C    . GLU A 1 34  ? -5.786  10.856  -3.155  1.00 0.00 ? 34  GLU A C    7  
ATOM 10833 O O    . GLU A 1 34  ? -5.623  11.256  -4.307  1.00 0.00 ? 34  GLU A O    7  
ATOM 10834 C CB   . GLU A 1 34  ? -7.917  9.669   -2.516  1.00 0.00 ? 34  GLU A CB   7  
ATOM 10835 C CG   . GLU A 1 34  ? -8.677  8.350   -2.669  1.00 0.00 ? 34  GLU A CG   7  
ATOM 10836 C CD   . GLU A 1 34  ? -10.122 8.598   -3.108  1.00 0.00 ? 34  GLU A CD   7  
ATOM 10837 O OE1  . GLU A 1 34  ? -10.328 9.576   -3.857  1.00 0.00 ? 34  GLU A OE1  7  
ATOM 10838 O OE2  . GLU A 1 34  ? -10.988 7.802   -2.683  1.00 0.00 ? 34  GLU A OE2  7  
ATOM 10839 H H    . GLU A 1 34  ? -6.147  8.811   -0.946  1.00 0.00 ? 34  GLU A H    7  
ATOM 10840 H HA   . GLU A 1 34  ? -6.370  8.872   -3.777  1.00 0.00 ? 34  GLU A HA   7  
ATOM 10841 H HB2  . GLU A 1 34  ? -7.998  10.022  -1.487  1.00 0.00 ? 34  GLU A HB2  7  
ATOM 10842 H HB3  . GLU A 1 34  ? -8.372  10.431  -3.150  1.00 0.00 ? 34  GLU A HB3  7  
ATOM 10843 H HG2  . GLU A 1 34  ? -8.174  7.720   -3.402  1.00 0.00 ? 34  GLU A HG2  7  
ATOM 10844 H HG3  . GLU A 1 34  ? -8.668  7.809   -1.723  1.00 0.00 ? 34  GLU A HG3  7  
ATOM 10845 N N    . LYS A 1 35  ? -5.425  11.525  -2.070  1.00 0.00 ? 35  LYS A N    7  
ATOM 10846 C CA   . LYS A 1 35  ? -4.789  12.828  -2.171  1.00 0.00 ? 35  LYS A CA   7  
ATOM 10847 C C    . LYS A 1 35  ? -3.442  12.678  -2.881  1.00 0.00 ? 35  LYS A C    7  
ATOM 10848 O O    . LYS A 1 35  ? -2.978  13.607  -3.542  1.00 0.00 ? 35  LYS A O    7  
ATOM 10849 C CB   . LYS A 1 35  ? -4.688  13.484  -0.793  1.00 0.00 ? 35  LYS A CB   7  
ATOM 10850 C CG   . LYS A 1 35  ? -3.323  13.215  -0.156  1.00 0.00 ? 35  LYS A CG   7  
ATOM 10851 C CD   . LYS A 1 35  ? -2.331  14.329  -0.496  1.00 0.00 ? 35  LYS A CD   7  
ATOM 10852 C CE   . LYS A 1 35  ? -2.352  15.426  0.570   1.00 0.00 ? 35  LYS A CE   7  
ATOM 10853 N NZ   . LYS A 1 35  ? -1.616  16.621  0.099   1.00 0.00 ? 35  LYS A NZ   7  
ATOM 10854 H H    . LYS A 1 35  ? -5.561  11.193  -1.137  1.00 0.00 ? 35  LYS A H    7  
ATOM 10855 H HA   . LYS A 1 35  ? -5.434  13.459  -2.782  1.00 0.00 ? 35  LYS A HA   7  
ATOM 10856 H HB2  . LYS A 1 35  ? -4.846  14.558  -0.884  1.00 0.00 ? 35  LYS A HB2  7  
ATOM 10857 H HB3  . LYS A 1 35  ? -5.477  13.100  -0.145  1.00 0.00 ? 35  LYS A HB3  7  
ATOM 10858 H HG2  . LYS A 1 35  ? -3.431  13.137  0.925   1.00 0.00 ? 35  LYS A HG2  7  
ATOM 10859 H HG3  . LYS A 1 35  ? -2.936  12.259  -0.508  1.00 0.00 ? 35  LYS A HG3  7  
ATOM 10860 H HD2  . LYS A 1 35  ? -1.326  13.915  -0.577  1.00 0.00 ? 35  LYS A HD2  7  
ATOM 10861 H HD3  . LYS A 1 35  ? -2.578  14.757  -1.468  1.00 0.00 ? 35  LYS A HD3  7  
ATOM 10862 H HE2  . LYS A 1 35  ? -3.382  15.695  0.804   1.00 0.00 ? 35  LYS A HE2  7  
ATOM 10863 H HE3  . LYS A 1 35  ? -1.902  15.055  1.491   1.00 0.00 ? 35  LYS A HE3  7  
ATOM 10864 H HZ1  . LYS A 1 35  ? -0.777  16.727  0.632   1.00 0.00 ? 35  LYS A HZ1  7  
ATOM 10865 H HZ2  . LYS A 1 35  ? -1.386  16.511  -0.868  1.00 0.00 ? 35  LYS A HZ2  7  
ATOM 10866 H HZ3  . LYS A 1 35  ? -2.190  17.432  0.215   1.00 0.00 ? 35  LYS A HZ3  7  
ATOM 10867 N N    . LEU A 1 36  ? -2.852  11.503  -2.721  1.00 0.00 ? 36  LEU A N    7  
ATOM 10868 C CA   . LEU A 1 36  ? -1.567  11.220  -3.338  1.00 0.00 ? 36  LEU A CA   7  
ATOM 10869 C C    . LEU A 1 36  ? -1.787  10.796  -4.792  1.00 0.00 ? 36  LEU A C    7  
ATOM 10870 O O    . LEU A 1 36  ? -0.843  10.410  -5.479  1.00 0.00 ? 36  LEU A O    7  
ATOM 10871 C CB   . LEU A 1 36  ? -0.788  10.196  -2.510  1.00 0.00 ? 36  LEU A CB   7  
ATOM 10872 C CG   . LEU A 1 36  ? -0.357  10.651  -1.114  1.00 0.00 ? 36  LEU A CG   7  
ATOM 10873 C CD1  . LEU A 1 36  ? 0.031   9.454   -0.243  1.00 0.00 ? 36  LEU A CD1  7  
ATOM 10874 C CD2  . LEU A 1 36  ? 0.765   11.687  -1.197  1.00 0.00 ? 36  LEU A CD2  7  
ATOM 10875 H H    . LEU A 1 36  ? -3.236  10.753  -2.182  1.00 0.00 ? 36  LEU A H    7  
ATOM 10876 H HA   . LEU A 1 36  ? -0.991  12.145  -3.332  1.00 0.00 ? 36  LEU A HA   7  
ATOM 10877 H HB2  . LEU A 1 36  ? -1.401  9.301   -2.406  1.00 0.00 ? 36  LEU A HB2  7  
ATOM 10878 H HB3  . LEU A 1 36  ? 0.103   9.909   -3.068  1.00 0.00 ? 36  LEU A HB3  7  
ATOM 10879 H HG   . LEU A 1 36  ? -1.208  11.135  -0.635  1.00 0.00 ? 36  LEU A HG   7  
ATOM 10880 H HD11 . LEU A 1 36  ? 1.105   9.471   -0.060  1.00 0.00 ? 36  LEU A HD11 7  
ATOM 10881 H HD12 . LEU A 1 36  ? -0.501  9.509   0.707   1.00 0.00 ? 36  LEU A HD12 7  
ATOM 10882 H HD13 . LEU A 1 36  ? -0.236  8.530   -0.756  1.00 0.00 ? 36  LEU A HD13 7  
ATOM 10883 H HD21 . LEU A 1 36  ? 0.760   12.301  -0.297  1.00 0.00 ? 36  LEU A HD21 7  
ATOM 10884 H HD22 . LEU A 1 36  ? 1.725   11.177  -1.284  1.00 0.00 ? 36  LEU A HD22 7  
ATOM 10885 H HD23 . LEU A 1 36  ? 0.610   12.322  -2.070  1.00 0.00 ? 36  LEU A HD23 7  
ATOM 10886 N N    . GLY A 1 37  ? -3.039  10.883  -5.217  1.00 0.00 ? 37  GLY A N    7  
ATOM 10887 C CA   . GLY A 1 37  ? -3.395  10.513  -6.577  1.00 0.00 ? 37  GLY A CA   7  
ATOM 10888 C C    . GLY A 1 37  ? -3.745  9.027   -6.667  1.00 0.00 ? 37  GLY A C    7  
ATOM 10889 O O    . GLY A 1 37  ? -4.319  8.579   -7.658  1.00 0.00 ? 37  GLY A O    7  
ATOM 10890 H H    . GLY A 1 37  ? -3.801  11.199  -4.652  1.00 0.00 ? 37  GLY A H    7  
ATOM 10891 H HA2  . GLY A 1 37  ? -4.243  11.111  -6.910  1.00 0.00 ? 37  GLY A HA2  7  
ATOM 10892 H HA3  . GLY A 1 37  ? -2.565  10.736  -7.247  1.00 0.00 ? 37  GLY A HA3  7  
ATOM 10893 N N    . GLY A 1 38  ? -3.385  8.302   -5.617  1.00 0.00 ? 38  GLY A N    7  
ATOM 10894 C CA   . GLY A 1 38  ? -3.654  6.875   -5.565  1.00 0.00 ? 38  GLY A CA   7  
ATOM 10895 C C    . GLY A 1 38  ? -5.138  6.606   -5.307  1.00 0.00 ? 38  GLY A C    7  
ATOM 10896 O O    . GLY A 1 38  ? -5.967  7.507   -5.430  1.00 0.00 ? 38  GLY A O    7  
ATOM 10897 H H    . GLY A 1 38  ? -2.919  8.674   -4.814  1.00 0.00 ? 38  GLY A H    7  
ATOM 10898 H HA2  . GLY A 1 38  ? -3.355  6.411   -6.505  1.00 0.00 ? 38  GLY A HA2  7  
ATOM 10899 H HA3  . GLY A 1 38  ? -3.056  6.417   -4.778  1.00 0.00 ? 38  GLY A HA3  7  
ATOM 10900 N N    . LYS A 1 39  ? -5.429  5.363   -4.954  1.00 0.00 ? 39  LYS A N    7  
ATOM 10901 C CA   . LYS A 1 39  ? -6.798  4.964   -4.677  1.00 0.00 ? 39  LYS A CA   7  
ATOM 10902 C C    . LYS A 1 39  ? -6.793  3.722   -3.784  1.00 0.00 ? 39  LYS A C    7  
ATOM 10903 O O    . LYS A 1 39  ? -6.051  2.774   -4.038  1.00 0.00 ? 39  LYS A O    7  
ATOM 10904 C CB   . LYS A 1 39  ? -7.577  4.780   -5.982  1.00 0.00 ? 39  LYS A CB   7  
ATOM 10905 C CG   . LYS A 1 39  ? -8.092  6.122   -6.507  1.00 0.00 ? 39  LYS A CG   7  
ATOM 10906 C CD   . LYS A 1 39  ? -7.272  6.591   -7.710  1.00 0.00 ? 39  LYS A CD   7  
ATOM 10907 C CE   . LYS A 1 39  ? -8.161  6.777   -8.941  1.00 0.00 ? 39  LYS A CE   7  
ATOM 10908 N NZ   . LYS A 1 39  ? -7.645  7.871   -9.793  1.00 0.00 ? 39  LYS A NZ   7  
ATOM 10909 H H    . LYS A 1 39  ? -4.749  4.636   -4.856  1.00 0.00 ? 39  LYS A H    7  
ATOM 10910 H HA   . LYS A 1 39  ? -7.272  5.780   -4.131  1.00 0.00 ? 39  LYS A HA   7  
ATOM 10911 H HB2  . LYS A 1 39  ? -6.935  4.315   -6.730  1.00 0.00 ? 39  LYS A HB2  7  
ATOM 10912 H HB3  . LYS A 1 39  ? -8.415  4.104   -5.817  1.00 0.00 ? 39  LYS A HB3  7  
ATOM 10913 H HG2  . LYS A 1 39  ? -9.140  6.027   -6.791  1.00 0.00 ? 39  LYS A HG2  7  
ATOM 10914 H HG3  . LYS A 1 39  ? -8.043  6.869   -5.715  1.00 0.00 ? 39  LYS A HG3  7  
ATOM 10915 H HD2  . LYS A 1 39  ? -6.774  7.531   -7.471  1.00 0.00 ? 39  LYS A HD2  7  
ATOM 10916 H HD3  . LYS A 1 39  ? -6.490  5.863   -7.928  1.00 0.00 ? 39  LYS A HD3  7  
ATOM 10917 H HE2  . LYS A 1 39  ? -8.200  5.850   -9.512  1.00 0.00 ? 39  LYS A HE2  7  
ATOM 10918 H HE3  . LYS A 1 39  ? -9.181  7.001   -8.629  1.00 0.00 ? 39  LYS A HE3  7  
ATOM 10919 H HZ1  . LYS A 1 39  ? -8.019  7.780   -10.716 1.00 0.00 ? 39  LYS A HZ1  7  
ATOM 10920 H HZ2  . LYS A 1 39  ? -7.920  8.752   -9.408  1.00 0.00 ? 39  LYS A HZ2  7  
ATOM 10921 H HZ3  . LYS A 1 39  ? -6.647  7.821   -9.831  1.00 0.00 ? 39  LYS A HZ3  7  
ATOM 10922 N N    . LEU A 1 40  ? -7.628  3.767   -2.757  1.00 0.00 ? 40  LEU A N    7  
ATOM 10923 C CA   . LEU A 1 40  ? -7.729  2.657   -1.824  1.00 0.00 ? 40  LEU A CA   7  
ATOM 10924 C C    . LEU A 1 40  ? -8.696  1.613   -2.384  1.00 0.00 ? 40  LEU A C    7  
ATOM 10925 O O    . LEU A 1 40  ? -9.769  1.957   -2.879  1.00 0.00 ? 40  LEU A O    7  
ATOM 10926 C CB   . LEU A 1 40  ? -8.107  3.161   -0.430  1.00 0.00 ? 40  LEU A CB   7  
ATOM 10927 C CG   . LEU A 1 40  ? -7.903  2.171   0.719   1.00 0.00 ? 40  LEU A CG   7  
ATOM 10928 C CD1  . LEU A 1 40  ? -6.897  2.712   1.737   1.00 0.00 ? 40  LEU A CD1  7  
ATOM 10929 C CD2  . LEU A 1 40  ? -9.238  1.805   1.370   1.00 0.00 ? 40  LEU A CD2  7  
ATOM 10930 H H    . LEU A 1 40  ? -8.228  4.542   -2.557  1.00 0.00 ? 40  LEU A H    7  
ATOM 10931 H HA   . LEU A 1 40  ? -6.740  2.205   -1.747  1.00 0.00 ? 40  LEU A HA   7  
ATOM 10932 H HB2  . LEU A 1 40  ? -7.523  4.057   -0.219  1.00 0.00 ? 40  LEU A HB2  7  
ATOM 10933 H HB3  . LEU A 1 40  ? -9.155  3.459   -0.445  1.00 0.00 ? 40  LEU A HB3  7  
ATOM 10934 H HG   . LEU A 1 40  ? -7.483  1.253   0.308   1.00 0.00 ? 40  LEU A HG   7  
ATOM 10935 H HD11 . LEU A 1 40  ? -5.924  2.251   1.567   1.00 0.00 ? 40  LEU A HD11 7  
ATOM 10936 H HD12 . LEU A 1 40  ? -6.812  3.793   1.624   1.00 0.00 ? 40  LEU A HD12 7  
ATOM 10937 H HD13 . LEU A 1 40  ? -7.239  2.478   2.745   1.00 0.00 ? 40  LEU A HD13 7  
ATOM 10938 H HD21 . LEU A 1 40  ? -9.103  0.932   2.009   1.00 0.00 ? 40  LEU A HD21 7  
ATOM 10939 H HD22 . LEU A 1 40  ? -9.591  2.643   1.971   1.00 0.00 ? 40  LEU A HD22 7  
ATOM 10940 H HD23 . LEU A 1 40  ? -9.970  1.579   0.595   1.00 0.00 ? 40  LEU A HD23 7  
ATOM 10941 N N    . THR A 1 41  ? -8.283  0.358   -2.287  1.00 0.00 ? 41  THR A N    7  
ATOM 10942 C CA   . THR A 1 41  ? -9.101  -0.739  -2.778  1.00 0.00 ? 41  THR A CA   7  
ATOM 10943 C C    . THR A 1 41  ? -9.286  -1.796  -1.687  1.00 0.00 ? 41  THR A C    7  
ATOM 10944 O O    . THR A 1 41  ? -8.627  -1.744  -0.649  1.00 0.00 ? 41  THR A O    7  
ATOM 10945 C CB   . THR A 1 41  ? -8.445  -1.286  -4.047  1.00 0.00 ? 41  THR A CB   7  
ATOM 10946 O OG1  . THR A 1 41  ? -9.303  -2.351  -4.450  1.00 0.00 ? 41  THR A OG1  7  
ATOM 10947 C CG2  . THR A 1 41  ? -7.106  -1.971  -3.767  1.00 0.00 ? 41  THR A CG2  7  
ATOM 10948 H H    . THR A 1 41  ? -7.410  0.086   -1.883  1.00 0.00 ? 41  THR A H    7  
ATOM 10949 H HA   . THR A 1 41  ? -10.090 -0.350  -3.017  1.00 0.00 ? 41  THR A HA   7  
ATOM 10950 H HB   . THR A 1 41  ? -8.332  -0.501  -4.796  1.00 0.00 ? 41  THR A HB   7  
ATOM 10951 H HG1  . THR A 1 41  ? -8.973  -2.750  -5.305  1.00 0.00 ? 41  THR A HG1  7  
ATOM 10952 H HG21 . THR A 1 41  ? -7.286  -2.974  -3.378  1.00 0.00 ? 41  THR A HG21 7  
ATOM 10953 H HG22 . THR A 1 41  ? -6.532  -2.037  -4.691  1.00 0.00 ? 41  THR A HG22 7  
ATOM 10954 H HG23 . THR A 1 41  ? -6.548  -1.391  -3.032  1.00 0.00 ? 41  THR A HG23 7  
ATOM 10955 N N    . GLY A 1 42  ? -10.186 -2.729  -1.958  1.00 0.00 ? 42  GLY A N    7  
ATOM 10956 C CA   . GLY A 1 42  ? -10.467 -3.796  -1.013  1.00 0.00 ? 42  GLY A CA   7  
ATOM 10957 C C    . GLY A 1 42  ? -9.666  -5.055  -1.353  1.00 0.00 ? 42  GLY A C    7  
ATOM 10958 O O    . GLY A 1 42  ? -9.196  -5.757  -0.459  1.00 0.00 ? 42  GLY A O    7  
ATOM 10959 H H    . GLY A 1 42  ? -10.718 -2.764  -2.805  1.00 0.00 ? 42  GLY A H    7  
ATOM 10960 H HA2  . GLY A 1 42  ? -10.221 -3.466  -0.003  1.00 0.00 ? 42  GLY A HA2  7  
ATOM 10961 H HA3  . GLY A 1 42  ? -11.532 -4.025  -1.022  1.00 0.00 ? 42  GLY A HA3  7  
ATOM 10962 N N    . THR A 1 43  ? -9.536  -5.303  -2.648  1.00 0.00 ? 43  THR A N    7  
ATOM 10963 C CA   . THR A 1 43  ? -8.801  -6.465  -3.118  1.00 0.00 ? 43  THR A CA   7  
ATOM 10964 C C    . THR A 1 43  ? -7.295  -6.203  -3.056  1.00 0.00 ? 43  THR A C    7  
ATOM 10965 O O    . THR A 1 43  ? -6.866  -5.065  -2.872  1.00 0.00 ? 43  THR A O    7  
ATOM 10966 C CB   . THR A 1 43  ? -9.302  -6.805  -4.523  1.00 0.00 ? 43  THR A CB   7  
ATOM 10967 O OG1  . THR A 1 43  ? -10.680 -7.115  -4.335  1.00 0.00 ? 43  THR A OG1  7  
ATOM 10968 C CG2  . THR A 1 43  ? -8.698  -8.103  -5.061  1.00 0.00 ? 43  THR A CG2  7  
ATOM 10969 H H    . THR A 1 43  ? -9.922  -4.727  -3.369  1.00 0.00 ? 43  THR A H    7  
ATOM 10970 H HA   . THR A 1 43  ? -9.009  -7.297  -2.446  1.00 0.00 ? 43  THR A HA   7  
ATOM 10971 H HB   . THR A 1 43  ? -9.124  -5.978  -5.210  1.00 0.00 ? 43  THR A HB   7  
ATOM 10972 H HG1  . THR A 1 43  ? -10.773 -8.014  -3.906  1.00 0.00 ? 43  THR A HG1  7  
ATOM 10973 H HG21 . THR A 1 43  ? -9.250  -8.422  -5.945  1.00 0.00 ? 43  THR A HG21 7  
ATOM 10974 H HG22 . THR A 1 43  ? -7.654  -7.936  -5.326  1.00 0.00 ? 43  THR A HG22 7  
ATOM 10975 H HG23 . THR A 1 43  ? -8.759  -8.877  -4.296  1.00 0.00 ? 43  THR A HG23 7  
ATOM 10976 N N    . ALA A 1 44  ? -6.534  -7.276  -3.214  1.00 0.00 ? 44  ALA A N    7  
ATOM 10977 C CA   . ALA A 1 44  ? -5.085  -7.177  -3.179  1.00 0.00 ? 44  ALA A CA   7  
ATOM 10978 C C    . ALA A 1 44  ? -4.532  -7.339  -4.597  1.00 0.00 ? 44  ALA A C    7  
ATOM 10979 O O    . ALA A 1 44  ? -3.726  -6.527  -5.049  1.00 0.00 ? 44  ALA A O    7  
ATOM 10980 C CB   . ALA A 1 44  ? -4.525  -8.223  -2.212  1.00 0.00 ? 44  ALA A CB   7  
ATOM 10981 H H    . ALA A 1 44  ? -6.891  -8.198  -3.364  1.00 0.00 ? 44  ALA A H    7  
ATOM 10982 H HA   . ALA A 1 44  ? -4.829  -6.184  -2.809  1.00 0.00 ? 44  ALA A HA   7  
ATOM 10983 H HB1  . ALA A 1 44  ? -4.593  -7.847  -1.191  1.00 0.00 ? 44  ALA A HB1  7  
ATOM 10984 H HB2  . ALA A 1 44  ? -5.101  -9.144  -2.300  1.00 0.00 ? 44  ALA A HB2  7  
ATOM 10985 H HB3  . ALA A 1 44  ? -3.481  -8.422  -2.457  1.00 0.00 ? 44  ALA A HB3  7  
ATOM 10986 N N    . ASN A 1 45  ? -4.988  -8.392  -5.259  1.00 0.00 ? 45  ASN A N    7  
ATOM 10987 C CA   . ASN A 1 45  ? -4.549  -8.670  -6.616  1.00 0.00 ? 45  ASN A CA   7  
ATOM 10988 C C    . ASN A 1 45  ? -4.899  -7.482  -7.514  1.00 0.00 ? 45  ASN A C    7  
ATOM 10989 O O    . ASN A 1 45  ? -4.359  -7.348  -8.611  1.00 0.00 ? 45  ASN A O    7  
ATOM 10990 C CB   . ASN A 1 45  ? -5.248  -9.909  -7.177  1.00 0.00 ? 45  ASN A CB   7  
ATOM 10991 C CG   . ASN A 1 45  ? -5.198  -11.067 -6.178  1.00 0.00 ? 45  ASN A CG   7  
ATOM 10992 O OD1  . ASN A 1 45  ? -5.581  -10.944 -5.027  1.00 0.00 ? 45  ASN A OD1  7  
ATOM 10993 N ND2  . ASN A 1 45  ? -4.706  -12.195 -6.682  1.00 0.00 ? 45  ASN A ND2  7  
ATOM 10994 H H    . ASN A 1 45  ? -5.643  -9.047  -4.884  1.00 0.00 ? 45  ASN A H    7  
ATOM 10995 H HA   . ASN A 1 45  ? -3.474  -8.834  -6.541  1.00 0.00 ? 45  ASN A HA   7  
ATOM 10996 H HB2  . ASN A 1 45  ? -6.286  -9.671  -7.412  1.00 0.00 ? 45  ASN A HB2  7  
ATOM 10997 H HB3  . ASN A 1 45  ? -4.771  -10.209 -8.111  1.00 0.00 ? 45  ASN A HB3  7  
ATOM 10998 H HD21 . ASN A 1 45  ? -4.409  -12.229 -7.636  1.00 0.00 ? 45  ASN A HD21 7  
ATOM 10999 H HD22 . ASN A 1 45  ? -4.633  -13.010 -6.107  1.00 0.00 ? 45  ASN A HD22 7  
ATOM 11000 N N    . LYS A 1 46  ? -5.801  -6.649  -7.015  1.00 0.00 ? 46  LYS A N    7  
ATOM 11001 C CA   . LYS A 1 46  ? -6.229  -5.477  -7.758  1.00 0.00 ? 46  LYS A CA   7  
ATOM 11002 C C    . LYS A 1 46  ? -5.655  -4.221  -7.098  1.00 0.00 ? 46  LYS A C    7  
ATOM 11003 O O    . LYS A 1 46  ? -6.327  -3.194  -7.021  1.00 0.00 ? 46  LYS A O    7  
ATOM 11004 C CB   . LYS A 1 46  ? -7.753  -5.457  -7.896  1.00 0.00 ? 46  LYS A CB   7  
ATOM 11005 C CG   . LYS A 1 46  ? -8.246  -6.663  -8.698  1.00 0.00 ? 46  LYS A CG   7  
ATOM 11006 C CD   . LYS A 1 46  ? -9.002  -6.216  -9.951  1.00 0.00 ? 46  LYS A CD   7  
ATOM 11007 C CE   . LYS A 1 46  ? -9.425  -7.420  -10.795 1.00 0.00 ? 46  LYS A CE   7  
ATOM 11008 N NZ   . LYS A 1 46  ? -10.894 -7.437  -10.975 1.00 0.00 ? 46  LYS A NZ   7  
ATOM 11009 H H    . LYS A 1 46  ? -6.235  -6.765  -6.121  1.00 0.00 ? 46  LYS A H    7  
ATOM 11010 H HA   . LYS A 1 46  ? -5.815  -5.558  -8.763  1.00 0.00 ? 46  LYS A HA   7  
ATOM 11011 H HB2  . LYS A 1 46  ? -8.212  -5.461  -6.908  1.00 0.00 ? 46  LYS A HB2  7  
ATOM 11012 H HB3  . LYS A 1 46  ? -8.065  -4.536  -8.388  1.00 0.00 ? 46  LYS A HB3  7  
ATOM 11013 H HG2  . LYS A 1 46  ? -7.398  -7.286  -8.984  1.00 0.00 ? 46  LYS A HG2  7  
ATOM 11014 H HG3  . LYS A 1 46  ? -8.897  -7.276  -8.076  1.00 0.00 ? 46  LYS A HG3  7  
ATOM 11015 H HD2  . LYS A 1 46  ? -9.883  -5.642  -9.663  1.00 0.00 ? 46  LYS A HD2  7  
ATOM 11016 H HD3  . LYS A 1 46  ? -8.371  -5.555  -10.545 1.00 0.00 ? 46  LYS A HD3  7  
ATOM 11017 H HE2  . LYS A 1 46  ? -8.934  -7.381  -11.767 1.00 0.00 ? 46  LYS A HE2  7  
ATOM 11018 H HE3  . LYS A 1 46  ? -9.102  -8.342  -10.312 1.00 0.00 ? 46  LYS A HE3  7  
ATOM 11019 H HZ1  . LYS A 1 46  ? -11.152 -6.770  -11.675 1.00 0.00 ? 46  LYS A HZ1  7  
ATOM 11020 H HZ2  . LYS A 1 46  ? -11.185 -8.350  -11.261 1.00 0.00 ? 46  LYS A HZ2  7  
ATOM 11021 H HZ3  . LYS A 1 46  ? -11.339 -7.201  -10.111 1.00 0.00 ? 46  LYS A HZ3  7  
ATOM 11022 N N    . ALA A 1 47  ? -4.419  -4.346  -6.638  1.00 0.00 ? 47  ALA A N    7  
ATOM 11023 C CA   . ALA A 1 47  ? -3.747  -3.235  -5.986  1.00 0.00 ? 47  ALA A CA   7  
ATOM 11024 C C    . ALA A 1 47  ? -2.278  -3.212  -6.412  1.00 0.00 ? 47  ALA A C    7  
ATOM 11025 O O    . ALA A 1 47  ? -1.704  -4.252  -6.731  1.00 0.00 ? 47  ALA A O    7  
ATOM 11026 C CB   . ALA A 1 47  ? -3.913  -3.355  -4.470  1.00 0.00 ? 47  ALA A CB   7  
ATOM 11027 H H    . ALA A 1 47  ? -3.880  -5.185  -6.704  1.00 0.00 ? 47  ALA A H    7  
ATOM 11028 H HA   . ALA A 1 47  ? -4.228  -2.315  -6.320  1.00 0.00 ? 47  ALA A HA   7  
ATOM 11029 H HB1  . ALA A 1 47  ? -3.468  -2.486  -3.986  1.00 0.00 ? 47  ALA A HB1  7  
ATOM 11030 H HB2  . ALA A 1 47  ? -4.974  -3.404  -4.224  1.00 0.00 ? 47  ALA A HB2  7  
ATOM 11031 H HB3  . ALA A 1 47  ? -3.417  -4.260  -4.121  1.00 0.00 ? 47  ALA A HB3  7  
ATOM 11032 N N    . SER A 1 48  ? -1.710  -2.015  -6.402  1.00 0.00 ? 48  SER A N    7  
ATOM 11033 C CA   . SER A 1 48  ? -0.319  -1.843  -6.783  1.00 0.00 ? 48  SER A CA   7  
ATOM 11034 C C    . SER A 1 48  ? 0.571   -1.859  -5.538  1.00 0.00 ? 48  SER A C    7  
ATOM 11035 O O    . SER A 1 48  ? 1.716   -2.305  -5.594  1.00 0.00 ? 48  SER A O    7  
ATOM 11036 C CB   . SER A 1 48  ? -0.117  -0.543  -7.563  1.00 0.00 ? 48  SER A CB   7  
ATOM 11037 O OG   . SER A 1 48  ? 1.205   -0.430  -8.082  1.00 0.00 ? 48  SER A OG   7  
ATOM 11038 H H    . SER A 1 48  ? -2.184  -1.174  -6.141  1.00 0.00 ? 48  SER A H    7  
ATOM 11039 H HA   . SER A 1 48  ? -0.089  -2.692  -7.428  1.00 0.00 ? 48  SER A HA   7  
ATOM 11040 H HB2  . SER A 1 48  ? -0.834  -0.497  -8.383  1.00 0.00 ? 48  SER A HB2  7  
ATOM 11041 H HB3  . SER A 1 48  ? -0.324  0.306   -6.911  1.00 0.00 ? 48  SER A HB3  7  
ATOM 11042 H HG   . SER A 1 48  ? 1.832   -0.135  -7.361  1.00 0.00 ? 48  SER A HG   7  
ATOM 11043 N N    . LEU A 1 49  ? 0.010   -1.367  -4.443  1.00 0.00 ? 49  LEU A N    7  
ATOM 11044 C CA   . LEU A 1 49  ? 0.737   -1.319  -3.187  1.00 0.00 ? 49  LEU A CA   7  
ATOM 11045 C C    . LEU A 1 49  ? -0.103  -1.977  -2.090  1.00 0.00 ? 49  LEU A C    7  
ATOM 11046 O O    . LEU A 1 49  ? -1.307  -2.166  -2.255  1.00 0.00 ? 49  LEU A O    7  
ATOM 11047 C CB   . LEU A 1 49  ? 1.154   0.118   -2.863  1.00 0.00 ? 49  LEU A CB   7  
ATOM 11048 C CG   . LEU A 1 49  ? 2.531   0.288   -2.219  1.00 0.00 ? 49  LEU A CG   7  
ATOM 11049 C CD1  . LEU A 1 49  ? 3.581   -0.564  -2.935  1.00 0.00 ? 49  LEU A CD1  7  
ATOM 11050 C CD2  . LEU A 1 49  ? 2.931   1.763   -2.162  1.00 0.00 ? 49  LEU A CD2  7  
ATOM 11051 H H    . LEU A 1 49  ? -0.922  -1.006  -4.406  1.00 0.00 ? 49  LEU A H    7  
ATOM 11052 H HA   . LEU A 1 49  ? 1.652   -1.898  -3.316  1.00 0.00 ? 49  LEU A HA   7  
ATOM 11053 H HB2  . LEU A 1 49  ? 1.132   0.698   -3.786  1.00 0.00 ? 49  LEU A HB2  7  
ATOM 11054 H HB3  . LEU A 1 49  ? 0.407   0.550   -2.197  1.00 0.00 ? 49  LEU A HB3  7  
ATOM 11055 H HG   . LEU A 1 49  ? 2.473   -0.070  -1.190  1.00 0.00 ? 49  LEU A HG   7  
ATOM 11056 H HD11 . LEU A 1 49  ? 3.236   -0.794  -3.943  1.00 0.00 ? 49  LEU A HD11 7  
ATOM 11057 H HD12 . LEU A 1 49  ? 4.520   -0.013  -2.990  1.00 0.00 ? 49  LEU A HD12 7  
ATOM 11058 H HD13 . LEU A 1 49  ? 3.735   -1.491  -2.383  1.00 0.00 ? 49  LEU A HD13 7  
ATOM 11059 H HD21 . LEU A 1 49  ? 2.943   2.176   -3.171  1.00 0.00 ? 49  LEU A HD21 7  
ATOM 11060 H HD22 . LEU A 1 49  ? 2.212   2.312   -1.554  1.00 0.00 ? 49  LEU A HD22 7  
ATOM 11061 H HD23 . LEU A 1 49  ? 3.924   1.854   -1.720  1.00 0.00 ? 49  LEU A HD23 7  
ATOM 11062 N N    . CYS A 1 50  ? 0.566   -2.308  -0.995  1.00 0.00 ? 50  CYS A N    7  
ATOM 11063 C CA   . CYS A 1 50  ? -0.104  -2.942  0.128   1.00 0.00 ? 50  CYS A CA   7  
ATOM 11064 C C    . CYS A 1 50  ? 0.437   -2.325  1.419   1.00 0.00 ? 50  CYS A C    7  
ATOM 11065 O O    . CYS A 1 50  ? 1.592   -2.544  1.780   1.00 0.00 ? 50  CYS A O    7  
ATOM 11066 C CB   . CYS A 1 50  ? 0.069   -4.462  0.106   1.00 0.00 ? 50  CYS A CB   7  
ATOM 11067 S SG   . CYS A 1 50  ? -0.888  -5.220  1.468   1.00 0.00 ? 50  CYS A SG   7  
ATOM 11068 H H    . CYS A 1 50  ? 1.546   -2.151  -0.869  1.00 0.00 ? 50  CYS A H    7  
ATOM 11069 H HA   . CYS A 1 50  ? -1.168  -2.734  0.015   1.00 0.00 ? 50  CYS A HA   7  
ATOM 11070 H HB2  . CYS A 1 50  ? -0.267  -4.860  -0.852  1.00 0.00 ? 50  CYS A HB2  7  
ATOM 11071 H HB3  . CYS A 1 50  ? 1.124   -4.718  0.204   1.00 0.00 ? 50  CYS A HB3  7  
ATOM 11072 H HG   . CYS A 1 50  ? -1.532  -4.111  1.820   1.00 0.00 ? 50  CYS A HG   7  
ATOM 11073 N N    . ILE A 1 51  ? -0.425  -1.565  2.080   1.00 0.00 ? 51  ILE A N    7  
ATOM 11074 C CA   . ILE A 1 51  ? -0.048  -0.915  3.324   1.00 0.00 ? 51  ILE A CA   7  
ATOM 11075 C C    . ILE A 1 51  ? -0.564  -1.742  4.503   1.00 0.00 ? 51  ILE A C    7  
ATOM 11076 O O    . ILE A 1 51  ? -1.712  -1.591  4.917   1.00 0.00 ? 51  ILE A O    7  
ATOM 11077 C CB   . ILE A 1 51  ? -0.527  0.538   3.336   1.00 0.00 ? 51  ILE A CB   7  
ATOM 11078 C CG1  . ILE A 1 51  ? 0.059   1.318   2.157   1.00 0.00 ? 51  ILE A CG1  7  
ATOM 11079 C CG2  . ILE A 1 51  ? -0.218  1.207   4.677   1.00 0.00 ? 51  ILE A CG2  7  
ATOM 11080 C CD1  . ILE A 1 51  ? -0.230  2.814   2.292   1.00 0.00 ? 51  ILE A CD1  7  
ATOM 11081 H H    . ILE A 1 51  ? -1.363  -1.392  1.780   1.00 0.00 ? 51  ILE A H    7  
ATOM 11082 H HA   . ILE A 1 51  ? 1.041   -0.895  3.366   1.00 0.00 ? 51  ILE A HA   7  
ATOM 11083 H HB   . ILE A 1 51  ? -1.611  0.541   3.217   1.00 0.00 ? 51  ILE A HB   7  
ATOM 11084 H HG12 . ILE A 1 51  ? 1.136   1.155   2.109   1.00 0.00 ? 51  ILE A HG12 7  
ATOM 11085 H HG13 . ILE A 1 51  ? -0.362  0.945   1.224   1.00 0.00 ? 51  ILE A HG13 7  
ATOM 11086 H HG21 . ILE A 1 51  ? 0.308   0.502   5.321   1.00 0.00 ? 51  ILE A HG21 7  
ATOM 11087 H HG22 . ILE A 1 51  ? 0.407   2.084   4.510   1.00 0.00 ? 51  ILE A HG22 7  
ATOM 11088 H HG23 . ILE A 1 51  ? -1.150  1.510   5.155   1.00 0.00 ? 51  ILE A HG23 7  
ATOM 11089 H HD11 . ILE A 1 51  ? -0.227  3.276   1.305   1.00 0.00 ? 51  ILE A HD11 7  
ATOM 11090 H HD12 . ILE A 1 51  ? -1.207  2.955   2.755   1.00 0.00 ? 51  ILE A HD12 7  
ATOM 11091 H HD13 . ILE A 1 51  ? 0.536   3.278   2.913   1.00 0.00 ? 51  ILE A HD13 7  
ATOM 11092 N N    . SER A 1 52  ? 0.310   -2.599  5.011   1.00 0.00 ? 52  SER A N    7  
ATOM 11093 C CA   . SER A 1 52  ? -0.043  -3.451  6.134   1.00 0.00 ? 52  SER A CA   7  
ATOM 11094 C C    . SER A 1 52  ? 1.010   -3.325  7.237   1.00 0.00 ? 52  SER A C    7  
ATOM 11095 O O    . SER A 1 52  ? 1.898   -2.477  7.159   1.00 0.00 ? 52  SER A O    7  
ATOM 11096 C CB   . SER A 1 52  ? -0.182  -4.910  5.697   1.00 0.00 ? 52  SER A CB   7  
ATOM 11097 O OG   . SER A 1 52  ? -1.081  -5.634  6.532   1.00 0.00 ? 52  SER A OG   7  
ATOM 11098 H H    . SER A 1 52  ? 1.242   -2.716  4.668   1.00 0.00 ? 52  SER A H    7  
ATOM 11099 H HA   . SER A 1 52  ? -1.008  -3.083  6.483   1.00 0.00 ? 52  SER A HA   7  
ATOM 11100 H HB2  . SER A 1 52  ? -0.534  -4.948  4.666   1.00 0.00 ? 52  SER A HB2  7  
ATOM 11101 H HB3  . SER A 1 52  ? 0.797   -5.389  5.717   1.00 0.00 ? 52  SER A HB3  7  
ATOM 11102 H HG   . SER A 1 52  ? -1.701  -5.002  6.996   1.00 0.00 ? 52  SER A HG   7  
ATOM 11103 N N    . THR A 1 53  ? 0.877   -4.181  8.239   1.00 0.00 ? 53  THR A N    7  
ATOM 11104 C CA   . THR A 1 53  ? 1.805   -4.176  9.357   1.00 0.00 ? 53  THR A CA   7  
ATOM 11105 C C    . THR A 1 53  ? 2.683   -5.429  9.326   1.00 0.00 ? 53  THR A C    7  
ATOM 11106 O O    . THR A 1 53  ? 2.290   -6.453  8.770   1.00 0.00 ? 53  THR A O    7  
ATOM 11107 C CB   . THR A 1 53  ? 0.994   -4.034  10.646  1.00 0.00 ? 53  THR A CB   7  
ATOM 11108 O OG1  . THR A 1 53  ? 0.077   -5.124  10.600  1.00 0.00 ? 53  THR A OG1  7  
ATOM 11109 C CG2  . THR A 1 53  ? 0.098   -2.794  10.640  1.00 0.00 ? 53  THR A CG2  7  
ATOM 11110 H H    . THR A 1 53  ? 0.152   -4.868  8.295   1.00 0.00 ? 53  THR A H    7  
ATOM 11111 H HA   . THR A 1 53  ? 2.469   -3.318  9.248   1.00 0.00 ? 53  THR A HA   7  
ATOM 11112 H HB   . THR A 1 53  ? 1.646   -4.040  11.519  1.00 0.00 ? 53  THR A HB   7  
ATOM 11113 H HG1  . THR A 1 53  ? 0.542   -5.950  10.281  1.00 0.00 ? 53  THR A HG1  7  
ATOM 11114 H HG21 . THR A 1 53  ? -0.058  -2.454  11.664  1.00 0.00 ? 53  THR A HG21 7  
ATOM 11115 H HG22 . THR A 1 53  ? 0.578   -2.002  10.065  1.00 0.00 ? 53  THR A HG22 7  
ATOM 11116 H HG23 . THR A 1 53  ? -0.862  -3.041  10.189  1.00 0.00 ? 53  THR A HG23 7  
ATOM 11117 N N    . LYS A 1 54  ? 3.856   -5.306  9.930   1.00 0.00 ? 54  LYS A N    7  
ATOM 11118 C CA   . LYS A 1 54  ? 4.792   -6.416  9.979   1.00 0.00 ? 54  LYS A CA   7  
ATOM 11119 C C    . LYS A 1 54  ? 4.057   -7.679  10.431  1.00 0.00 ? 54  LYS A C    7  
ATOM 11120 O O    . LYS A 1 54  ? 4.085   -8.698  9.743   1.00 0.00 ? 54  LYS A O    7  
ATOM 11121 C CB   . LYS A 1 54  ? 5.998   -6.061  10.852  1.00 0.00 ? 54  LYS A CB   7  
ATOM 11122 C CG   . LYS A 1 54  ? 6.901   -7.279  11.061  1.00 0.00 ? 54  LYS A CG   7  
ATOM 11123 C CD   . LYS A 1 54  ? 7.906   -7.419  9.917   1.00 0.00 ? 54  LYS A CD   7  
ATOM 11124 C CE   . LYS A 1 54  ? 9.299   -6.959  10.351  1.00 0.00 ? 54  LYS A CE   7  
ATOM 11125 N NZ   . LYS A 1 54  ? 10.328  -7.471  9.419   1.00 0.00 ? 54  LYS A NZ   7  
ATOM 11126 H H    . LYS A 1 54  ? 4.168   -4.469  10.380  1.00 0.00 ? 54  LYS A H    7  
ATOM 11127 H HA   . LYS A 1 54  ? 5.163   -6.575  8.967   1.00 0.00 ? 54  LYS A HA   7  
ATOM 11128 H HB2  . LYS A 1 54  ? 6.567   -5.258  10.384  1.00 0.00 ? 54  LYS A HB2  7  
ATOM 11129 H HB3  . LYS A 1 54  ? 5.656   -5.688  11.817  1.00 0.00 ? 54  LYS A HB3  7  
ATOM 11130 H HG2  . LYS A 1 54  ? 7.432   -7.183  12.008  1.00 0.00 ? 54  LYS A HG2  7  
ATOM 11131 H HG3  . LYS A 1 54  ? 6.292   -8.180  11.127  1.00 0.00 ? 54  LYS A HG3  7  
ATOM 11132 H HD2  . LYS A 1 54  ? 7.948   -8.458  9.589   1.00 0.00 ? 54  LYS A HD2  7  
ATOM 11133 H HD3  . LYS A 1 54  ? 7.575   -6.829  9.062   1.00 0.00 ? 54  LYS A HD3  7  
ATOM 11134 H HE2  . LYS A 1 54  ? 9.336   -5.870  10.381  1.00 0.00 ? 54  LYS A HE2  7  
ATOM 11135 H HE3  . LYS A 1 54  ? 9.507   -7.313  11.361  1.00 0.00 ? 54  LYS A HE3  7  
ATOM 11136 H HZ1  . LYS A 1 54  ? 11.237  -7.244  9.769   1.00 0.00 ? 54  LYS A HZ1  7  
ATOM 11137 H HZ2  . LYS A 1 54  ? 10.240  -8.464  9.338   1.00 0.00 ? 54  LYS A HZ2  7  
ATOM 11138 H HZ3  . LYS A 1 54  ? 10.203  -7.051  8.520   1.00 0.00 ? 54  LYS A HZ3  7  
ATOM 11139 N N    . LYS A 1 55  ? 3.415   -7.571  11.585  1.00 0.00 ? 55  LYS A N    7  
ATOM 11140 C CA   . LYS A 1 55  ? 2.673   -8.692  12.136  1.00 0.00 ? 55  LYS A CA   7  
ATOM 11141 C C    . LYS A 1 55  ? 1.956   -9.430  11.004  1.00 0.00 ? 55  LYS A C    7  
ATOM 11142 O O    . LYS A 1 55  ? 2.279   -10.579 10.705  1.00 0.00 ? 55  LYS A O    7  
ATOM 11143 C CB   . LYS A 1 55  ? 1.737   -8.219  13.251  1.00 0.00 ? 55  LYS A CB   7  
ATOM 11144 C CG   . LYS A 1 55  ? 2.174   -8.776  14.607  1.00 0.00 ? 55  LYS A CG   7  
ATOM 11145 C CD   . LYS A 1 55  ? 1.537   -10.142 14.870  1.00 0.00 ? 55  LYS A CD   7  
ATOM 11146 C CE   . LYS A 1 55  ? 2.466   -11.031 15.699  1.00 0.00 ? 55  LYS A CE   7  
ATOM 11147 N NZ   . LYS A 1 55  ? 3.442   -11.719 14.824  1.00 0.00 ? 55  LYS A NZ   7  
ATOM 11148 H H    . LYS A 1 55  ? 3.396   -6.738  12.139  1.00 0.00 ? 55  LYS A H    7  
ATOM 11149 H HA   . LYS A 1 55  ? 3.395   -9.371  12.589  1.00 0.00 ? 55  LYS A HA   7  
ATOM 11150 H HB2  . LYS A 1 55  ? 1.730   -7.129  13.287  1.00 0.00 ? 55  LYS A HB2  7  
ATOM 11151 H HB3  . LYS A 1 55  ? 0.718   -8.537  13.034  1.00 0.00 ? 55  LYS A HB3  7  
ATOM 11152 H HG2  . LYS A 1 55  ? 3.260   -8.867  14.634  1.00 0.00 ? 55  LYS A HG2  7  
ATOM 11153 H HG3  . LYS A 1 55  ? 1.893   -8.081  15.398  1.00 0.00 ? 55  LYS A HG3  7  
ATOM 11154 H HD2  . LYS A 1 55  ? 0.590   -10.011 15.394  1.00 0.00 ? 55  LYS A HD2  7  
ATOM 11155 H HD3  . LYS A 1 55  ? 1.311   -10.630 13.922  1.00 0.00 ? 55  LYS A HD3  7  
ATOM 11156 H HE2  . LYS A 1 55  ? 2.994   -10.427 16.437  1.00 0.00 ? 55  LYS A HE2  7  
ATOM 11157 H HE3  . LYS A 1 55  ? 1.880   -11.767 16.249  1.00 0.00 ? 55  LYS A HE3  7  
ATOM 11158 H HZ1  . LYS A 1 55  ? 3.480   -12.688 15.066  1.00 0.00 ? 55  LYS A HZ1  7  
ATOM 11159 H HZ2  . LYS A 1 55  ? 3.159   -11.624 13.870  1.00 0.00 ? 55  LYS A HZ2  7  
ATOM 11160 H HZ3  . LYS A 1 55  ? 4.346   -11.309 14.946  1.00 0.00 ? 55  LYS A HZ3  7  
ATOM 11161 N N    . GLU A 1 56  ? 0.996   -8.740  10.405  1.00 0.00 ? 56  GLU A N    7  
ATOM 11162 C CA   . GLU A 1 56  ? 0.231   -9.316  9.312   1.00 0.00 ? 56  GLU A CA   7  
ATOM 11163 C C    . GLU A 1 56  ? 1.144   -10.138 8.401   1.00 0.00 ? 56  GLU A C    7  
ATOM 11164 O O    . GLU A 1 56  ? 0.947   -11.342 8.241   1.00 0.00 ? 56  GLU A O    7  
ATOM 11165 C CB   . GLU A 1 56  ? -0.499  -8.228  8.521   1.00 0.00 ? 56  GLU A CB   7  
ATOM 11166 C CG   . GLU A 1 56  ? -2.013  -8.447  8.557   1.00 0.00 ? 56  GLU A CG   7  
ATOM 11167 C CD   . GLU A 1 56  ? -2.408  -9.681  7.744   1.00 0.00 ? 56  GLU A CD   7  
ATOM 11168 O OE1  . GLU A 1 56  ? -1.482  -10.426 7.357   1.00 0.00 ? 56  GLU A OE1  7  
ATOM 11169 O OE2  . GLU A 1 56  ? -3.627  -9.850  7.527   1.00 0.00 ? 56  GLU A OE2  7  
ATOM 11170 H H    . GLU A 1 56  ? 0.740   -7.806  10.655  1.00 0.00 ? 56  GLU A H    7  
ATOM 11171 H HA   . GLU A 1 56  ? -0.504  -9.968  9.785   1.00 0.00 ? 56  GLU A HA   7  
ATOM 11172 H HB2  . GLU A 1 56  ? -0.259  -7.249  8.936   1.00 0.00 ? 56  GLU A HB2  7  
ATOM 11173 H HB3  . GLU A 1 56  ? -0.152  -8.231  7.488   1.00 0.00 ? 56  GLU A HB3  7  
ATOM 11174 H HG2  . GLU A 1 56  ? -2.342  -8.567  9.589   1.00 0.00 ? 56  GLU A HG2  7  
ATOM 11175 H HG3  . GLU A 1 56  ? -2.520  -7.567  8.161   1.00 0.00 ? 56  GLU A HG3  7  
ATOM 11176 N N    . VAL A 1 57  ? 2.124   -9.455  7.826   1.00 0.00 ? 57  VAL A N    7  
ATOM 11177 C CA   . VAL A 1 57  ? 3.068   -10.107 6.935   1.00 0.00 ? 57  VAL A CA   7  
ATOM 11178 C C    . VAL A 1 57  ? 3.617   -11.364 7.612   1.00 0.00 ? 57  VAL A C    7  
ATOM 11179 O O    . VAL A 1 57  ? 3.802   -12.393 6.963   1.00 0.00 ? 57  VAL A O    7  
ATOM 11180 C CB   . VAL A 1 57  ? 4.164   -9.123  6.522   1.00 0.00 ? 57  VAL A CB   7  
ATOM 11181 C CG1  . VAL A 1 57  ? 5.002   -9.685  5.372   1.00 0.00 ? 57  VAL A CG1  7  
ATOM 11182 C CG2  . VAL A 1 57  ? 3.568   -7.763  6.152   1.00 0.00 ? 57  VAL A CG2  7  
ATOM 11183 H H    . VAL A 1 57  ? 2.277   -8.477  7.962   1.00 0.00 ? 57  VAL A H    7  
ATOM 11184 H HA   . VAL A 1 57  ? 2.523   -10.402 6.038   1.00 0.00 ? 57  VAL A HA   7  
ATOM 11185 H HB   . VAL A 1 57  ? 4.823   -8.978  7.378   1.00 0.00 ? 57  VAL A HB   7  
ATOM 11186 H HG11 . VAL A 1 57  ? 5.540   -8.873  4.884   1.00 0.00 ? 57  VAL A HG11 7  
ATOM 11187 H HG12 . VAL A 1 57  ? 5.715   -10.411 5.764   1.00 0.00 ? 57  VAL A HG12 7  
ATOM 11188 H HG13 . VAL A 1 57  ? 4.347   -10.173 4.650   1.00 0.00 ? 57  VAL A HG13 7  
ATOM 11189 H HG21 . VAL A 1 57  ? 3.438   -7.166  7.055   1.00 0.00 ? 57  VAL A HG21 7  
ATOM 11190 H HG22 . VAL A 1 57  ? 4.241   -7.245  5.469   1.00 0.00 ? 57  VAL A HG22 7  
ATOM 11191 H HG23 . VAL A 1 57  ? 2.602   -7.908  5.670   1.00 0.00 ? 57  VAL A HG23 7  
ATOM 11192 N N    . GLU A 1 58  ? 3.863   -11.240 8.908   1.00 0.00 ? 58  GLU A N    7  
ATOM 11193 C CA   . GLU A 1 58  ? 4.388   -12.354 9.680   1.00 0.00 ? 58  GLU A CA   7  
ATOM 11194 C C    . GLU A 1 58  ? 3.293   -13.393 9.926   1.00 0.00 ? 58  GLU A C    7  
ATOM 11195 O O    . GLU A 1 58  ? 3.584   -14.564 10.164  1.00 0.00 ? 58  GLU A O    7  
ATOM 11196 C CB   . GLU A 1 58  ? 4.991   -11.869 11.000  1.00 0.00 ? 58  GLU A CB   7  
ATOM 11197 C CG   . GLU A 1 58  ? 6.451   -11.452 10.816  1.00 0.00 ? 58  GLU A CG   7  
ATOM 11198 C CD   . GLU A 1 58  ? 7.267   -11.740 12.078  1.00 0.00 ? 58  GLU A CD   7  
ATOM 11199 O OE1  . GLU A 1 58  ? 6.929   -11.141 13.122  1.00 0.00 ? 58  GLU A OE1  7  
ATOM 11200 O OE2  . GLU A 1 58  ? 8.210   -12.553 11.971  1.00 0.00 ? 58  GLU A OE2  7  
ATOM 11201 H H    . GLU A 1 58  ? 3.710   -10.400 9.428   1.00 0.00 ? 58  GLU A H    7  
ATOM 11202 H HA   . GLU A 1 58  ? 5.177   -12.786 9.065   1.00 0.00 ? 58  GLU A HA   7  
ATOM 11203 H HB2  . GLU A 1 58  ? 4.413   -11.027 11.381  1.00 0.00 ? 58  GLU A HB2  7  
ATOM 11204 H HB3  . GLU A 1 58  ? 4.927   -12.662 11.746  1.00 0.00 ? 58  GLU A HB3  7  
ATOM 11205 H HG2  . GLU A 1 58  ? 6.882   -11.987 9.970   1.00 0.00 ? 58  GLU A HG2  7  
ATOM 11206 H HG3  . GLU A 1 58  ? 6.502   -10.389 10.581  1.00 0.00 ? 58  GLU A HG3  7  
ATOM 11207 N N    . LYS A 1 59  ? 2.054   -12.927 9.859   1.00 0.00 ? 59  LYS A N    7  
ATOM 11208 C CA   . LYS A 1 59  ? 0.913   -13.801 10.072  1.00 0.00 ? 59  LYS A CA   7  
ATOM 11209 C C    . LYS A 1 59  ? 0.595   -14.542 8.772   1.00 0.00 ? 59  LYS A C    7  
ATOM 11210 O O    . LYS A 1 59  ? 0.265   -15.727 8.793   1.00 0.00 ? 59  LYS A O    7  
ATOM 11211 C CB   . LYS A 1 59  ? -0.270  -13.011 10.634  1.00 0.00 ? 59  LYS A CB   7  
ATOM 11212 C CG   . LYS A 1 59  ? -1.562  -13.355 9.890   1.00 0.00 ? 59  LYS A CG   7  
ATOM 11213 C CD   . LYS A 1 59  ? -2.790  -12.928 10.697  1.00 0.00 ? 59  LYS A CD   7  
ATOM 11214 C CE   . LYS A 1 59  ? -3.275  -11.542 10.266  1.00 0.00 ? 59  LYS A CE   7  
ATOM 11215 N NZ   . LYS A 1 59  ? -4.451  -11.133 11.065  1.00 0.00 ? 59  LYS A NZ   7  
ATOM 11216 H H    . LYS A 1 59  ? 1.825   -11.973 9.665   1.00 0.00 ? 59  LYS A H    7  
ATOM 11217 H HA   . LYS A 1 59  ? 1.199   -14.534 10.826  1.00 0.00 ? 59  LYS A HA   7  
ATOM 11218 H HB2  . LYS A 1 59  ? -0.388  -13.229 11.695  1.00 0.00 ? 59  LYS A HB2  7  
ATOM 11219 H HB3  . LYS A 1 59  ? -0.072  -11.942 10.549  1.00 0.00 ? 59  LYS A HB3  7  
ATOM 11220 H HG2  . LYS A 1 59  ? -1.571  -12.860 8.919   1.00 0.00 ? 59  LYS A HG2  7  
ATOM 11221 H HG3  . LYS A 1 59  ? -1.602  -14.428 9.701   1.00 0.00 ? 59  LYS A HG3  7  
ATOM 11222 H HD2  . LYS A 1 59  ? -3.590  -13.656 10.562  1.00 0.00 ? 59  LYS A HD2  7  
ATOM 11223 H HD3  . LYS A 1 59  ? -2.546  -12.917 11.759  1.00 0.00 ? 59  LYS A HD3  7  
ATOM 11224 H HE2  . LYS A 1 59  ? -2.473  -10.815 10.390  1.00 0.00 ? 59  LYS A HE2  7  
ATOM 11225 H HE3  . LYS A 1 59  ? -3.534  -11.554 9.207   1.00 0.00 ? 59  LYS A HE3  7  
ATOM 11226 H HZ1  . LYS A 1 59  ? -5.108  -11.887 11.103  1.00 0.00 ? 59  LYS A HZ1  7  
ATOM 11227 H HZ2  . LYS A 1 59  ? -4.159  -10.899 11.992  1.00 0.00 ? 59  LYS A HZ2  7  
ATOM 11228 H HZ3  . LYS A 1 59  ? -4.882  -10.337 10.640  1.00 0.00 ? 59  LYS A HZ3  7  
ATOM 11229 N N    . MET A 1 60  ? 0.707   -13.815 7.670   1.00 0.00 ? 60  MET A N    7  
ATOM 11230 C CA   . MET A 1 60  ? 0.436   -14.388 6.363   1.00 0.00 ? 60  MET A CA   7  
ATOM 11231 C C    . MET A 1 60  ? -0.993  -14.930 6.288   1.00 0.00 ? 60  MET A C    7  
ATOM 11232 O O    . MET A 1 60  ? -1.199  -16.115 6.031   1.00 0.00 ? 60  MET A O    7  
ATOM 11233 C CB   . MET A 1 60  ? 1.427   -15.521 6.087   1.00 0.00 ? 60  MET A CB   7  
ATOM 11234 C CG   . MET A 1 60  ? 2.707   -14.986 5.443   1.00 0.00 ? 60  MET A CG   7  
ATOM 11235 S SD   . MET A 1 60  ? 2.575   -15.066 3.665   1.00 0.00 ? 60  MET A SD   7  
ATOM 11236 C CE   . MET A 1 60  ? 2.339   -13.337 3.293   1.00 0.00 ? 60  MET A CE   7  
ATOM 11237 H H    . MET A 1 60  ? 0.977   -12.852 7.661   1.00 0.00 ? 60  MET A H    7  
ATOM 11238 H HA   . MET A 1 60  ? 0.560   -13.571 5.653   1.00 0.00 ? 60  MET A HA   7  
ATOM 11239 H HB2  . MET A 1 60  ? 1.670   -16.031 7.020   1.00 0.00 ? 60  MET A HB2  7  
ATOM 11240 H HB3  . MET A 1 60  ? 0.967   -16.260 5.431   1.00 0.00 ? 60  MET A HB3  7  
ATOM 11241 H HG2  . MET A 1 60  ? 2.878   -13.956 5.757   1.00 0.00 ? 60  MET A HG2  7  
ATOM 11242 H HG3  . MET A 1 60  ? 3.564   -15.568 5.780   1.00 0.00 ? 60  MET A HG3  7  
ATOM 11243 H HE1  . MET A 1 60  ? 3.268   -12.918 2.905   1.00 0.00 ? 60  MET A HE1  7  
ATOM 11244 H HE2  . MET A 1 60  ? 1.553   -13.230 2.546   1.00 0.00 ? 60  MET A HE2  7  
ATOM 11245 H HE3  . MET A 1 60  ? 2.052   -12.806 4.201   1.00 0.00 ? 60  MET A HE3  7  
ATOM 11246 N N    . ASN A 1 61  ? -1.943  -14.036 6.516   1.00 0.00 ? 61  ASN A N    7  
ATOM 11247 C CA   . ASN A 1 61  ? -3.347  -14.409 6.477   1.00 0.00 ? 61  ASN A CA   7  
ATOM 11248 C C    . ASN A 1 61  ? -3.842  -14.365 5.030   1.00 0.00 ? 61  ASN A C    7  
ATOM 11249 O O    . ASN A 1 61  ? -3.191  -13.783 4.164   1.00 0.00 ? 61  ASN A O    7  
ATOM 11250 C CB   . ASN A 1 61  ? -4.198  -13.437 7.297   1.00 0.00 ? 61  ASN A CB   7  
ATOM 11251 C CG   . ASN A 1 61  ? -5.676  -13.830 7.252   1.00 0.00 ? 61  ASN A CG   7  
ATOM 11252 O OD1  . ASN A 1 61  ? -6.041  -14.987 7.380   1.00 0.00 ? 61  ASN A OD1  7  
ATOM 11253 N ND2  . ASN A 1 61  ? -6.503  -12.806 7.065   1.00 0.00 ? 61  ASN A ND2  7  
ATOM 11254 H H    . ASN A 1 61  ? -1.767  -13.073 6.724   1.00 0.00 ? 61  ASN A H    7  
ATOM 11255 H HA   . ASN A 1 61  ? -3.389  -15.411 6.902   1.00 0.00 ? 61  ASN A HA   7  
ATOM 11256 H HB2  . ASN A 1 61  ? -3.852  -13.428 8.331   1.00 0.00 ? 61  ASN A HB2  7  
ATOM 11257 H HB3  . ASN A 1 61  ? -4.076  -12.425 6.911   1.00 0.00 ? 61  ASN A HB3  7  
ATOM 11258 H HD21 . ASN A 1 61  ? -6.138  -11.880 6.967   1.00 0.00 ? 61  ASN A HD21 7  
ATOM 11259 H HD22 . ASN A 1 61  ? -7.490  -12.961 7.021   1.00 0.00 ? 61  ASN A HD22 7  
ATOM 11260 N N    . LYS A 1 62  ? -4.990  -14.989 4.812   1.00 0.00 ? 62  LYS A N    7  
ATOM 11261 C CA   . LYS A 1 62  ? -5.580  -15.029 3.485   1.00 0.00 ? 62  LYS A CA   7  
ATOM 11262 C C    . LYS A 1 62  ? -5.419  -13.661 2.818   1.00 0.00 ? 62  LYS A C    7  
ATOM 11263 O O    . LYS A 1 62  ? -4.983  -13.573 1.672   1.00 0.00 ? 62  LYS A O    7  
ATOM 11264 C CB   . LYS A 1 62  ? -7.031  -15.511 3.557   1.00 0.00 ? 62  LYS A CB   7  
ATOM 11265 C CG   . LYS A 1 62  ? -7.267  -16.684 2.603   1.00 0.00 ? 62  LYS A CG   7  
ATOM 11266 C CD   . LYS A 1 62  ? -7.339  -18.007 3.368   1.00 0.00 ? 62  LYS A CD   7  
ATOM 11267 C CE   . LYS A 1 62  ? -7.986  -19.099 2.514   1.00 0.00 ? 62  LYS A CE   7  
ATOM 11268 N NZ   . LYS A 1 62  ? -9.458  -19.075 2.671   1.00 0.00 ? 62  LYS A NZ   7  
ATOM 11269 H H    . LYS A 1 62  ? -5.514  -15.461 5.522   1.00 0.00 ? 62  LYS A H    7  
ATOM 11270 H HA   . LYS A 1 62  ? -5.025  -15.765 2.903   1.00 0.00 ? 62  LYS A HA   7  
ATOM 11271 H HB2  . LYS A 1 62  ? -7.267  -15.814 4.577   1.00 0.00 ? 62  LYS A HB2  7  
ATOM 11272 H HB3  . LYS A 1 62  ? -7.703  -14.691 3.305   1.00 0.00 ? 62  LYS A HB3  7  
ATOM 11273 H HG2  . LYS A 1 62  ? -8.195  -16.527 2.052   1.00 0.00 ? 62  LYS A HG2  7  
ATOM 11274 H HG3  . LYS A 1 62  ? -6.463  -16.727 1.868   1.00 0.00 ? 62  LYS A HG3  7  
ATOM 11275 H HD2  . LYS A 1 62  ? -6.335  -18.316 3.661   1.00 0.00 ? 62  LYS A HD2  7  
ATOM 11276 H HD3  . LYS A 1 62  ? -7.911  -17.870 4.285   1.00 0.00 ? 62  LYS A HD3  7  
ATOM 11277 H HE2  . LYS A 1 62  ? -7.724  -18.953 1.466   1.00 0.00 ? 62  LYS A HE2  7  
ATOM 11278 H HE3  . LYS A 1 62  ? -7.599  -20.075 2.806   1.00 0.00 ? 62  LYS A HE3  7  
ATOM 11279 H HZ1  . LYS A 1 62  ? -9.889  -19.355 1.813   1.00 0.00 ? 62  LYS A HZ1  7  
ATOM 11280 H HZ2  . LYS A 1 62  ? -9.725  -19.706 3.400   1.00 0.00 ? 62  LYS A HZ2  7  
ATOM 11281 H HZ3  . LYS A 1 62  ? -9.753  -18.149 2.906   1.00 0.00 ? 62  LYS A HZ3  7  
ATOM 11282 N N    . LYS A 1 63  ? -5.780  -12.628 3.566   1.00 0.00 ? 63  LYS A N    7  
ATOM 11283 C CA   . LYS A 1 63  ? -5.681  -11.269 3.062   1.00 0.00 ? 63  LYS A CA   7  
ATOM 11284 C C    . LYS A 1 63  ? -4.271  -11.033 2.519   1.00 0.00 ? 63  LYS A C    7  
ATOM 11285 O O    . LYS A 1 63  ? -4.100  -10.714 1.343   1.00 0.00 ? 63  LYS A O    7  
ATOM 11286 C CB   . LYS A 1 63  ? -6.102  -10.267 4.138   1.00 0.00 ? 63  LYS A CB   7  
ATOM 11287 C CG   . LYS A 1 63  ? -7.465  -9.652  3.813   1.00 0.00 ? 63  LYS A CG   7  
ATOM 11288 C CD   . LYS A 1 63  ? -7.343  -8.606  2.703   1.00 0.00 ? 63  LYS A CD   7  
ATOM 11289 C CE   . LYS A 1 63  ? -8.585  -8.608  1.809   1.00 0.00 ? 63  LYS A CE   7  
ATOM 11290 N NZ   . LYS A 1 63  ? -8.258  -9.143  0.469   1.00 0.00 ? 63  LYS A NZ   7  
ATOM 11291 H H    . LYS A 1 63  ? -6.134  -12.709 4.498   1.00 0.00 ? 63  LYS A H    7  
ATOM 11292 H HA   . LYS A 1 63  ? -6.389  -11.174 2.239   1.00 0.00 ? 63  LYS A HA   7  
ATOM 11293 H HB2  . LYS A 1 63  ? -6.145  -10.764 5.107   1.00 0.00 ? 63  LYS A HB2  7  
ATOM 11294 H HB3  . LYS A 1 63  ? -5.353  -9.479  4.219   1.00 0.00 ? 63  LYS A HB3  7  
ATOM 11295 H HG2  . LYS A 1 63  ? -8.157  -10.436 3.505   1.00 0.00 ? 63  LYS A HG2  7  
ATOM 11296 H HG3  . LYS A 1 63  ? -7.883  -9.191  4.708   1.00 0.00 ? 63  LYS A HG3  7  
ATOM 11297 H HD2  . LYS A 1 63  ? -7.209  -7.618  3.143   1.00 0.00 ? 63  LYS A HD2  7  
ATOM 11298 H HD3  . LYS A 1 63  ? -6.458  -8.810  2.101   1.00 0.00 ? 63  LYS A HD3  7  
ATOM 11299 H HE2  . LYS A 1 63  ? -9.369  -9.212  2.267   1.00 0.00 ? 63  LYS A HE2  7  
ATOM 11300 H HE3  . LYS A 1 63  ? -8.977  -7.595  1.718   1.00 0.00 ? 63  LYS A HE3  7  
ATOM 11301 H HZ1  . LYS A 1 63  ? -7.992  -10.104 0.549   1.00 0.00 ? 63  LYS A HZ1  7  
ATOM 11302 H HZ2  . LYS A 1 63  ? -9.059  -9.067  -0.125  1.00 0.00 ? 63  LYS A HZ2  7  
ATOM 11303 H HZ3  . LYS A 1 63  ? -7.502  -8.619  0.076   1.00 0.00 ? 63  LYS A HZ3  7  
ATOM 11304 N N    . MET A 1 64  ? -3.296  -11.198 3.401   1.00 0.00 ? 64  MET A N    7  
ATOM 11305 C CA   . MET A 1 64  ? -1.906  -11.006 3.025   1.00 0.00 ? 64  MET A CA   7  
ATOM 11306 C C    . MET A 1 64  ? -1.514  -11.941 1.878   1.00 0.00 ? 64  MET A C    7  
ATOM 11307 O O    . MET A 1 64  ? -0.747  -11.559 0.996   1.00 0.00 ? 64  MET A O    7  
ATOM 11308 C CB   . MET A 1 64  ? -1.007  -11.277 4.233   1.00 0.00 ? 64  MET A CB   7  
ATOM 11309 C CG   . MET A 1 64  ? 0.436   -10.857 3.948   1.00 0.00 ? 64  MET A CG   7  
ATOM 11310 S SD   . MET A 1 64  ? 0.493   -9.131  3.498   1.00 0.00 ? 64  MET A SD   7  
ATOM 11311 C CE   . MET A 1 64  ? 0.109   -8.387  5.075   1.00 0.00 ? 64  MET A CE   7  
ATOM 11312 H H    . MET A 1 64  ? -3.444  -11.457 4.355   1.00 0.00 ? 64  MET A H    7  
ATOM 11313 H HA   . MET A 1 64  ? -1.831  -9.969  2.699   1.00 0.00 ? 64  MET A HA   7  
ATOM 11314 H HB2  . MET A 1 64  ? -1.384  -10.733 5.100   1.00 0.00 ? 64  MET A HB2  7  
ATOM 11315 H HB3  . MET A 1 64  ? -1.039  -12.337 4.484   1.00 0.00 ? 64  MET A HB3  7  
ATOM 11316 H HG2  . MET A 1 64  ? 1.055   -11.032 4.828   1.00 0.00 ? 64  MET A HG2  7  
ATOM 11317 H HG3  . MET A 1 64  ? 0.848   -11.466 3.143   1.00 0.00 ? 64  MET A HG3  7  
ATOM 11318 H HE1  . MET A 1 64  ? 0.807   -8.753  5.828   1.00 0.00 ? 64  MET A HE1  7  
ATOM 11319 H HE2  . MET A 1 64  ? 0.195   -7.303  4.995   1.00 0.00 ? 64  MET A HE2  7  
ATOM 11320 H HE3  . MET A 1 64  ? -0.908  -8.650  5.363   1.00 0.00 ? 64  MET A HE3  7  
ATOM 11321 N N    . GLU A 1 65  ? -2.060  -13.147 1.928   1.00 0.00 ? 65  GLU A N    7  
ATOM 11322 C CA   . GLU A 1 65  ? -1.777  -14.139 0.904   1.00 0.00 ? 65  GLU A CA   7  
ATOM 11323 C C    . GLU A 1 65  ? -2.041  -13.557 -0.486  1.00 0.00 ? 65  GLU A C    7  
ATOM 11324 O O    . GLU A 1 65  ? -1.224  -13.710 -1.393  1.00 0.00 ? 65  GLU A O    7  
ATOM 11325 C CB   . GLU A 1 65  ? -2.597  -15.410 1.131   1.00 0.00 ? 65  GLU A CB   7  
ATOM 11326 C CG   . GLU A 1 65  ? -1.769  -16.475 1.855   1.00 0.00 ? 65  GLU A CG   7  
ATOM 11327 C CD   . GLU A 1 65  ? -1.301  -17.559 0.882   1.00 0.00 ? 65  GLU A CD   7  
ATOM 11328 O OE1  . GLU A 1 65  ? -0.252  -17.333 0.241   1.00 0.00 ? 65  GLU A OE1  7  
ATOM 11329 O OE2  . GLU A 1 65  ? -2.003  -18.591 0.802   1.00 0.00 ? 65  GLU A OE2  7  
ATOM 11330 H H    . GLU A 1 65  ? -2.683  -13.450 2.649   1.00 0.00 ? 65  GLU A H    7  
ATOM 11331 H HA   . GLU A 1 65  ? -0.718  -14.373 1.012   1.00 0.00 ? 65  GLU A HA   7  
ATOM 11332 H HB2  . GLU A 1 65  ? -3.485  -15.175 1.718   1.00 0.00 ? 65  GLU A HB2  7  
ATOM 11333 H HB3  . GLU A 1 65  ? -2.942  -15.801 0.174   1.00 0.00 ? 65  GLU A HB3  7  
ATOM 11334 H HG2  . GLU A 1 65  ? -0.906  -16.009 2.329   1.00 0.00 ? 65  GLU A HG2  7  
ATOM 11335 H HG3  . GLU A 1 65  ? -2.364  -16.925 2.649   1.00 0.00 ? 65  GLU A HG3  7  
ATOM 11336 N N    . GLU A 1 66  ? -3.186  -12.902 -0.610  1.00 0.00 ? 66  GLU A N    7  
ATOM 11337 C CA   . GLU A 1 66  ? -3.569  -12.296 -1.875  1.00 0.00 ? 66  GLU A CA   7  
ATOM 11338 C C    . GLU A 1 66  ? -2.468  -11.354 -2.366  1.00 0.00 ? 66  GLU A C    7  
ATOM 11339 O O    . GLU A 1 66  ? -2.149  -11.332 -3.554  1.00 0.00 ? 66  GLU A O    7  
ATOM 11340 C CB   . GLU A 1 66  ? -4.904  -11.561 -1.749  1.00 0.00 ? 66  GLU A CB   7  
ATOM 11341 C CG   . GLU A 1 66  ? -5.988  -12.484 -1.187  1.00 0.00 ? 66  GLU A CG   7  
ATOM 11342 C CD   . GLU A 1 66  ? -6.906  -12.993 -2.300  1.00 0.00 ? 66  GLU A CD   7  
ATOM 11343 O OE1  . GLU A 1 66  ? -6.357  -13.381 -3.355  1.00 0.00 ? 66  GLU A OE1  7  
ATOM 11344 O OE2  . GLU A 1 66  ? -8.134  -12.982 -2.072  1.00 0.00 ? 66  GLU A OE2  7  
ATOM 11345 H H    . GLU A 1 66  ? -3.845  -12.782 0.132   1.00 0.00 ? 66  GLU A H    7  
ATOM 11346 H HA   . GLU A 1 66  ? -3.683  -13.127 -2.571  1.00 0.00 ? 66  GLU A HA   7  
ATOM 11347 H HB2  . GLU A 1 66  ? -4.786  -10.694 -1.098  1.00 0.00 ? 66  GLU A HB2  7  
ATOM 11348 H HB3  . GLU A 1 66  ? -5.211  -11.186 -2.726  1.00 0.00 ? 66  GLU A HB3  7  
ATOM 11349 H HG2  . GLU A 1 66  ? -5.523  -13.329 -0.679  1.00 0.00 ? 66  GLU A HG2  7  
ATOM 11350 H HG3  . GLU A 1 66  ? -6.576  -11.948 -0.442  1.00 0.00 ? 66  GLU A HG3  7  
ATOM 11351 N N    . VAL A 1 67  ? -1.917  -10.598 -1.428  1.00 0.00 ? 67  VAL A N    7  
ATOM 11352 C CA   . VAL A 1 67  ? -0.859  -9.656  -1.751  1.00 0.00 ? 67  VAL A CA   7  
ATOM 11353 C C    . VAL A 1 67  ? 0.391   -10.427 -2.179  1.00 0.00 ? 67  VAL A C    7  
ATOM 11354 O O    . VAL A 1 67  ? 1.111   -9.999  -3.079  1.00 0.00 ? 67  VAL A O    7  
ATOM 11355 C CB   . VAL A 1 67  ? -0.609  -8.723  -0.564  1.00 0.00 ? 67  VAL A CB   7  
ATOM 11356 C CG1  . VAL A 1 67  ? 0.412   -7.642  -0.923  1.00 0.00 ? 67  VAL A CG1  7  
ATOM 11357 C CG2  . VAL A 1 67  ? -1.917  -8.101  -0.071  1.00 0.00 ? 67  VAL A CG2  7  
ATOM 11358 H H    . VAL A 1 67  ? -2.182  -10.622 -0.464  1.00 0.00 ? 67  VAL A H    7  
ATOM 11359 H HA   . VAL A 1 67  ? -1.202  -9.051  -2.589  1.00 0.00 ? 67  VAL A HA   7  
ATOM 11360 H HB   . VAL A 1 67  ? -0.194  -9.319  0.249   1.00 0.00 ? 67  VAL A HB   7  
ATOM 11361 H HG11 . VAL A 1 67  ? 0.928   -7.316  -0.019  1.00 0.00 ? 67  VAL A HG11 7  
ATOM 11362 H HG12 . VAL A 1 67  ? 1.137   -8.046  -1.629  1.00 0.00 ? 67  VAL A HG12 7  
ATOM 11363 H HG13 . VAL A 1 67  ? -0.101  -6.793  -1.374  1.00 0.00 ? 67  VAL A HG13 7  
ATOM 11364 H HG21 . VAL A 1 67  ? -1.868  -7.960  1.009   1.00 0.00 ? 67  VAL A HG21 7  
ATOM 11365 H HG22 . VAL A 1 67  ? -2.066  -7.136  -0.556  1.00 0.00 ? 67  VAL A HG22 7  
ATOM 11366 H HG23 . VAL A 1 67  ? -2.748  -8.762  -0.313  1.00 0.00 ? 67  VAL A HG23 7  
ATOM 11367 N N    . LYS A 1 68  ? 0.611   -11.552 -1.513  1.00 0.00 ? 68  LYS A N    7  
ATOM 11368 C CA   . LYS A 1 68  ? 1.761   -12.387 -1.813  1.00 0.00 ? 68  LYS A CA   7  
ATOM 11369 C C    . LYS A 1 68  ? 1.577   -13.025 -3.191  1.00 0.00 ? 68  LYS A C    7  
ATOM 11370 O O    . LYS A 1 68  ? 2.545   -13.219 -3.924  1.00 0.00 ? 68  LYS A O    7  
ATOM 11371 C CB   . LYS A 1 68  ? 1.995   -13.401 -0.692  1.00 0.00 ? 68  LYS A CB   7  
ATOM 11372 C CG   . LYS A 1 68  ? 3.297   -14.172 -0.913  1.00 0.00 ? 68  LYS A CG   7  
ATOM 11373 C CD   . LYS A 1 68  ? 3.896   -14.630 0.419   1.00 0.00 ? 68  LYS A CD   7  
ATOM 11374 C CE   . LYS A 1 68  ? 5.319   -15.160 0.227   1.00 0.00 ? 68  LYS A CE   7  
ATOM 11375 N NZ   . LYS A 1 68  ? 5.309   -16.380 -0.610  1.00 0.00 ? 68  LYS A NZ   7  
ATOM 11376 H H    . LYS A 1 68  ? 0.020   -11.893 -0.782  1.00 0.00 ? 68  LYS A H    7  
ATOM 11377 H HA   . LYS A 1 68  ? 2.636   -11.737 -1.848  1.00 0.00 ? 68  LYS A HA   7  
ATOM 11378 H HB2  . LYS A 1 68  ? 2.032   -12.885 0.268   1.00 0.00 ? 68  LYS A HB2  7  
ATOM 11379 H HB3  . LYS A 1 68  ? 1.158   -14.098 -0.647  1.00 0.00 ? 68  LYS A HB3  7  
ATOM 11380 H HG2  . LYS A 1 68  ? 3.108   -15.038 -1.547  1.00 0.00 ? 68  LYS A HG2  7  
ATOM 11381 H HG3  . LYS A 1 68  ? 4.013   -13.541 -1.440  1.00 0.00 ? 68  LYS A HG3  7  
ATOM 11382 H HD2  . LYS A 1 68  ? 3.906   -13.798 1.123   1.00 0.00 ? 68  LYS A HD2  7  
ATOM 11383 H HD3  . LYS A 1 68  ? 3.270   -15.409 0.854   1.00 0.00 ? 68  LYS A HD3  7  
ATOM 11384 H HE2  . LYS A 1 68  ? 5.938   -14.395 -0.242  1.00 0.00 ? 68  LYS A HE2  7  
ATOM 11385 H HE3  . LYS A 1 68  ? 5.765   -15.380 1.197   1.00 0.00 ? 68  LYS A HE3  7  
ATOM 11386 H HZ1  . LYS A 1 68  ? 5.868   -17.087 -0.176  1.00 0.00 ? 68  LYS A HZ1  7  
ATOM 11387 H HZ2  . LYS A 1 68  ? 4.370   -16.711 -0.707  1.00 0.00 ? 68  LYS A HZ2  7  
ATOM 11388 H HZ3  . LYS A 1 68  ? 5.683   -16.168 -1.513  1.00 0.00 ? 68  LYS A HZ3  7  
ATOM 11389 N N    . GLU A 1 69  ? 0.327   -13.335 -3.502  1.00 0.00 ? 69  GLU A N    7  
ATOM 11390 C CA   . GLU A 1 69  ? 0.003   -13.948 -4.779  1.00 0.00 ? 69  GLU A CA   7  
ATOM 11391 C C    . GLU A 1 69  ? 0.298   -12.976 -5.924  1.00 0.00 ? 69  GLU A C    7  
ATOM 11392 O O    . GLU A 1 69  ? 0.896   -13.358 -6.929  1.00 0.00 ? 69  GLU A O    7  
ATOM 11393 C CB   . GLU A 1 69  ? -1.456  -14.408 -4.812  1.00 0.00 ? 69  GLU A CB   7  
ATOM 11394 C CG   . GLU A 1 69  ? -1.775  -15.307 -3.616  1.00 0.00 ? 69  GLU A CG   7  
ATOM 11395 C CD   . GLU A 1 69  ? -2.483  -16.586 -4.066  1.00 0.00 ? 69  GLU A CD   7  
ATOM 11396 O OE1  . GLU A 1 69  ? -1.829  -17.376 -4.781  1.00 0.00 ? 69  GLU A OE1  7  
ATOM 11397 O OE2  . GLU A 1 69  ? -3.663  -16.746 -3.684  1.00 0.00 ? 69  GLU A OE2  7  
ATOM 11398 H H    . GLU A 1 69  ? -0.456  -13.174 -2.900  1.00 0.00 ? 69  GLU A H    7  
ATOM 11399 H HA   . GLU A 1 69  ? 0.654   -14.818 -4.856  1.00 0.00 ? 69  GLU A HA   7  
ATOM 11400 H HB2  . GLU A 1 69  ? -2.115  -13.539 -4.805  1.00 0.00 ? 69  GLU A HB2  7  
ATOM 11401 H HB3  . GLU A 1 69  ? -1.650  -14.947 -5.739  1.00 0.00 ? 69  GLU A HB3  7  
ATOM 11402 H HG2  . GLU A 1 69  ? -0.853  -15.562 -3.093  1.00 0.00 ? 69  GLU A HG2  7  
ATOM 11403 H HG3  . GLU A 1 69  ? -2.404  -14.767 -2.909  1.00 0.00 ? 69  GLU A HG3  7  
ATOM 11404 N N    . ALA A 1 70  ? -0.136  -11.739 -5.734  1.00 0.00 ? 70  ALA A N    7  
ATOM 11405 C CA   . ALA A 1 70  ? 0.074   -10.710 -6.738  1.00 0.00 ? 70  ALA A CA   7  
ATOM 11406 C C    . ALA A 1 70  ? 1.457   -10.086 -6.542  1.00 0.00 ? 70  ALA A C    7  
ATOM 11407 O O    . ALA A 1 70  ? 1.788   -9.088  -7.180  1.00 0.00 ? 70  ALA A O    7  
ATOM 11408 C CB   . ALA A 1 70  ? -1.050  -9.675  -6.652  1.00 0.00 ? 70  ALA A CB   7  
ATOM 11409 H H    . ALA A 1 70  ? -0.622  -11.436 -4.914  1.00 0.00 ? 70  ALA A H    7  
ATOM 11410 H HA   . ALA A 1 70  ? 0.036   -11.188 -7.717  1.00 0.00 ? 70  ALA A HA   7  
ATOM 11411 H HB1  . ALA A 1 70  ? -1.044  -9.057  -7.550  1.00 0.00 ? 70  ALA A HB1  7  
ATOM 11412 H HB2  . ALA A 1 70  ? -2.009  -10.186 -6.569  1.00 0.00 ? 70  ALA A HB2  7  
ATOM 11413 H HB3  . ALA A 1 70  ? -0.897  -9.045  -5.776  1.00 0.00 ? 70  ALA A HB3  7  
ATOM 11414 N N    . ASN A 1 71  ? 2.228   -10.700 -5.656  1.00 0.00 ? 71  ASN A N    7  
ATOM 11415 C CA   . ASN A 1 71  ? 3.567   -10.217 -5.367  1.00 0.00 ? 71  ASN A CA   7  
ATOM 11416 C C    . ASN A 1 71  ? 3.541   -8.692  -5.251  1.00 0.00 ? 71  ASN A C    7  
ATOM 11417 O O    . ASN A 1 71  ? 4.237   -7.998  -5.991  1.00 0.00 ? 71  ASN A O    7  
ATOM 11418 C CB   . ASN A 1 71  ? 4.540   -10.590 -6.488  1.00 0.00 ? 71  ASN A CB   7  
ATOM 11419 C CG   . ASN A 1 71  ? 5.939   -10.861 -5.932  1.00 0.00 ? 71  ASN A CG   7  
ATOM 11420 O OD1  . ASN A 1 71  ? 6.136   -11.055 -4.744  1.00 0.00 ? 71  ASN A OD1  7  
ATOM 11421 N ND2  . ASN A 1 71  ? 6.897   -10.862 -6.854  1.00 0.00 ? 71  ASN A ND2  7  
ATOM 11422 H H    . ASN A 1 71  ? 1.951   -11.511 -5.141  1.00 0.00 ? 71  ASN A H    7  
ATOM 11423 H HA   . ASN A 1 71  ? 3.851   -10.702 -4.433  1.00 0.00 ? 71  ASN A HA   7  
ATOM 11424 H HB2  . ASN A 1 71  ? 4.176   -11.473 -7.012  1.00 0.00 ? 71  ASN A HB2  7  
ATOM 11425 H HB3  . ASN A 1 71  ? 4.585   -9.782  -7.218  1.00 0.00 ? 71  ASN A HB3  7  
ATOM 11426 H HD21 . ASN A 1 71  ? 6.668   -10.696 -7.813  1.00 0.00 ? 71  ASN A HD21 7  
ATOM 11427 H HD22 . ASN A 1 71  ? 7.847   -11.031 -6.589  1.00 0.00 ? 71  ASN A HD22 7  
ATOM 11428 N N    . ILE A 1 72  ? 2.731   -8.215  -4.317  1.00 0.00 ? 72  ILE A N    7  
ATOM 11429 C CA   . ILE A 1 72  ? 2.606   -6.785  -4.094  1.00 0.00 ? 72  ILE A CA   7  
ATOM 11430 C C    . ILE A 1 72  ? 3.402   -6.395  -2.847  1.00 0.00 ? 72  ILE A C    7  
ATOM 11431 O O    . ILE A 1 72  ? 3.037   -6.766  -1.733  1.00 0.00 ? 72  ILE A O    7  
ATOM 11432 C CB   . ILE A 1 72  ? 1.131   -6.380  -4.034  1.00 0.00 ? 72  ILE A CB   7  
ATOM 11433 C CG1  . ILE A 1 72  ? 0.390   -6.819  -5.298  1.00 0.00 ? 72  ILE A CG1  7  
ATOM 11434 C CG2  . ILE A 1 72  ? 0.986   -4.879  -3.777  1.00 0.00 ? 72  ILE A CG2  7  
ATOM 11435 C CD1  . ILE A 1 72  ? -1.125  -6.743  -5.100  1.00 0.00 ? 72  ILE A CD1  7  
ATOM 11436 H H    . ILE A 1 72  ? 2.169   -8.787  -3.719  1.00 0.00 ? 72  ILE A H    7  
ATOM 11437 H HA   . ILE A 1 72  ? 3.044   -6.281  -4.955  1.00 0.00 ? 72  ILE A HA   7  
ATOM 11438 H HB   . ILE A 1 72  ? 0.669   -6.897  -3.193  1.00 0.00 ? 72  ILE A HB   7  
ATOM 11439 H HG12 . ILE A 1 72  ? 0.683   -6.185  -6.135  1.00 0.00 ? 72  ILE A HG12 7  
ATOM 11440 H HG13 . ILE A 1 72  ? 0.676   -7.839  -5.556  1.00 0.00 ? 72  ILE A HG13 7  
ATOM 11441 H HG21 . ILE A 1 72  ? 0.112   -4.502  -4.309  1.00 0.00 ? 72  ILE A HG21 7  
ATOM 11442 H HG22 . ILE A 1 72  ? 0.863   -4.704  -2.708  1.00 0.00 ? 72  ILE A HG22 7  
ATOM 11443 H HG23 . ILE A 1 72  ? 1.878   -4.361  -4.129  1.00 0.00 ? 72  ILE A HG23 7  
ATOM 11444 H HD11 . ILE A 1 72  ? -1.436  -7.502  -4.382  1.00 0.00 ? 72  ILE A HD11 7  
ATOM 11445 H HD12 . ILE A 1 72  ? -1.393  -5.755  -4.724  1.00 0.00 ? 72  ILE A HD12 7  
ATOM 11446 H HD13 . ILE A 1 72  ? -1.626  -6.917  -6.052  1.00 0.00 ? 72  ILE A HD13 7  
ATOM 11447 N N    . ARG A 1 73  ? 4.474   -5.652  -3.077  1.00 0.00 ? 73  ARG A N    7  
ATOM 11448 C CA   . ARG A 1 73  ? 5.325   -5.208  -1.987  1.00 0.00 ? 73  ARG A CA   7  
ATOM 11449 C C    . ARG A 1 73  ? 4.483   -4.557  -0.888  1.00 0.00 ? 73  ARG A C    7  
ATOM 11450 O O    . ARG A 1 73  ? 3.714   -3.634  -1.155  1.00 0.00 ? 73  ARG A O    7  
ATOM 11451 C CB   . ARG A 1 73  ? 6.373   -4.207  -2.478  1.00 0.00 ? 73  ARG A CB   7  
ATOM 11452 C CG   . ARG A 1 73  ? 5.747   -2.832  -2.719  1.00 0.00 ? 73  ARG A CG   7  
ATOM 11453 C CD   . ARG A 1 73  ? 6.681   -1.941  -3.540  1.00 0.00 ? 73  ARG A CD   7  
ATOM 11454 N NE   . ARG A 1 73  ? 6.943   -2.560  -4.858  1.00 0.00 ? 73  ARG A NE   7  
ATOM 11455 C CZ   . ARG A 1 73  ? 6.161   -2.395  -5.934  1.00 0.00 ? 73  ARG A CZ   7  
ATOM 11456 N NH1  . ARG A 1 73  ? 5.065   -1.629  -5.855  1.00 0.00 ? 73  ARG A NH1  7  
ATOM 11457 N NH2  . ARG A 1 73  ? 6.477   -2.995  -7.090  1.00 0.00 ? 73  ARG A NH2  7  
ATOM 11458 H H    . ARG A 1 73  ? 4.764   -5.355  -3.987  1.00 0.00 ? 73  ARG A H    7  
ATOM 11459 H HA   . ARG A 1 73  ? 5.810   -6.115  -1.624  1.00 0.00 ? 73  ARG A HA   7  
ATOM 11460 H HB2  . ARG A 1 73  ? 7.173   -4.122  -1.742  1.00 0.00 ? 73  ARG A HB2  7  
ATOM 11461 H HB3  . ARG A 1 73  ? 6.825   -4.572  -3.400  1.00 0.00 ? 73  ARG A HB3  7  
ATOM 11462 H HG2  . ARG A 1 73  ? 4.797   -2.948  -3.241  1.00 0.00 ? 73  ARG A HG2  7  
ATOM 11463 H HG3  . ARG A 1 73  ? 5.529   -2.355  -1.763  1.00 0.00 ? 73  ARG A HG3  7  
ATOM 11464 H HD2  . ARG A 1 73  ? 6.233   -0.956  -3.674  1.00 0.00 ? 73  ARG A HD2  7  
ATOM 11465 H HD3  . ARG A 1 73  ? 7.619   -1.794  -3.005  1.00 0.00 ? 73  ARG A HD3  7  
ATOM 11466 H HE   . ARG A 1 73  ? 7.753   -3.138  -4.952  1.00 0.00 ? 73  ARG A HE   7  
ATOM 11467 H HH11 . ARG A 1 73  ? 4.830   -1.180  -4.992  1.00 0.00 ? 73  ARG A HH11 7  
ATOM 11468 H HH12 . ARG A 1 73  ? 4.482   -1.505  -6.658  1.00 0.00 ? 73  ARG A HH12 7  
ATOM 11469 H HH21 . ARG A 1 73  ? 7.295   -3.567  -7.149  1.00 0.00 ? 73  ARG A HH21 7  
ATOM 11470 H HH22 . ARG A 1 73  ? 5.894   -2.872  -7.893  1.00 0.00 ? 73  ARG A HH22 7  
ATOM 11471 N N    . VAL A 1 74  ? 4.656   -5.062  0.325   1.00 0.00 ? 74  VAL A N    7  
ATOM 11472 C CA   . VAL A 1 74  ? 3.922   -4.541  1.465   1.00 0.00 ? 74  VAL A CA   7  
ATOM 11473 C C    . VAL A 1 74  ? 4.789   -3.516  2.199   1.00 0.00 ? 74  VAL A C    7  
ATOM 11474 O O    . VAL A 1 74  ? 5.930   -3.805  2.556   1.00 0.00 ? 74  VAL A O    7  
ATOM 11475 C CB   . VAL A 1 74  ? 3.466   -5.692  2.364   1.00 0.00 ? 74  VAL A CB   7  
ATOM 11476 C CG1  . VAL A 1 74  ? 2.477   -5.201  3.423   1.00 0.00 ? 74  VAL A CG1  7  
ATOM 11477 C CG2  . VAL A 1 74  ? 2.864   -6.829  1.536   1.00 0.00 ? 74  VAL A CG2  7  
ATOM 11478 H H    . VAL A 1 74  ? 5.284   -5.812  0.533   1.00 0.00 ? 74  VAL A H    7  
ATOM 11479 H HA   . VAL A 1 74  ? 3.033   -4.039  1.082   1.00 0.00 ? 74  VAL A HA   7  
ATOM 11480 H HB   . VAL A 1 74  ? 4.343   -6.082  2.880   1.00 0.00 ? 74  VAL A HB   7  
ATOM 11481 H HG11 . VAL A 1 74  ? 1.898   -4.370  3.022   1.00 0.00 ? 74  VAL A HG11 7  
ATOM 11482 H HG12 . VAL A 1 74  ? 1.804   -6.014  3.696   1.00 0.00 ? 74  VAL A HG12 7  
ATOM 11483 H HG13 . VAL A 1 74  ? 3.024   -4.871  4.306   1.00 0.00 ? 74  VAL A HG13 7  
ATOM 11484 H HG21 . VAL A 1 74  ? 2.659   -6.474  0.526   1.00 0.00 ? 74  VAL A HG21 7  
ATOM 11485 H HG22 . VAL A 1 74  ? 3.568   -7.660  1.493   1.00 0.00 ? 74  VAL A HG22 7  
ATOM 11486 H HG23 . VAL A 1 74  ? 1.935   -7.163  1.999   1.00 0.00 ? 74  VAL A HG23 7  
ATOM 11487 N N    . VAL A 1 75  ? 4.214   -2.340  2.403   1.00 0.00 ? 75  VAL A N    7  
ATOM 11488 C CA   . VAL A 1 75  ? 4.920   -1.271  3.088   1.00 0.00 ? 75  VAL A CA   7  
ATOM 11489 C C    . VAL A 1 75  ? 4.088   -0.800  4.283   1.00 0.00 ? 75  VAL A C    7  
ATOM 11490 O O    . VAL A 1 75  ? 2.935   -1.201  4.438   1.00 0.00 ? 75  VAL A O    7  
ATOM 11491 C CB   . VAL A 1 75  ? 5.245   -0.144  2.105   1.00 0.00 ? 75  VAL A CB   7  
ATOM 11492 C CG1  . VAL A 1 75  ? 6.117   -0.654  0.956   1.00 0.00 ? 75  VAL A CG1  7  
ATOM 11493 C CG2  . VAL A 1 75  ? 3.966   0.507   1.575   1.00 0.00 ? 75  VAL A CG2  7  
ATOM 11494 H H    . VAL A 1 75  ? 3.285   -2.113  2.109   1.00 0.00 ? 75  VAL A H    7  
ATOM 11495 H HA   . VAL A 1 75  ? 5.860   -1.680  3.455   1.00 0.00 ? 75  VAL A HA   7  
ATOM 11496 H HB   . VAL A 1 75  ? 5.810   0.617   2.643   1.00 0.00 ? 75  VAL A HB   7  
ATOM 11497 H HG11 . VAL A 1 75  ? 5.878   -1.698  0.754   1.00 0.00 ? 75  VAL A HG11 7  
ATOM 11498 H HG12 . VAL A 1 75  ? 5.928   -0.058  0.064   1.00 0.00 ? 75  VAL A HG12 7  
ATOM 11499 H HG13 . VAL A 1 75  ? 7.168   -0.569  1.233   1.00 0.00 ? 75  VAL A HG13 7  
ATOM 11500 H HG21 . VAL A 1 75  ? 4.200   1.492   1.170   1.00 0.00 ? 75  VAL A HG21 7  
ATOM 11501 H HG22 . VAL A 1 75  ? 3.539   -0.117  0.789   1.00 0.00 ? 75  VAL A HG22 7  
ATOM 11502 H HG23 . VAL A 1 75  ? 3.247   0.610   2.387   1.00 0.00 ? 75  VAL A HG23 7  
ATOM 11503 N N    . SER A 1 76  ? 4.704   0.045   5.096   1.00 0.00 ? 76  SER A N    7  
ATOM 11504 C CA   . SER A 1 76  ? 4.035   0.574   6.272   1.00 0.00 ? 76  SER A CA   7  
ATOM 11505 C C    . SER A 1 76  ? 3.310   1.875   5.921   1.00 0.00 ? 76  SER A C    7  
ATOM 11506 O O    . SER A 1 76  ? 3.317   2.301   4.767   1.00 0.00 ? 76  SER A O    7  
ATOM 11507 C CB   . SER A 1 76  ? 5.028   0.811   7.412   1.00 0.00 ? 76  SER A CB   7  
ATOM 11508 O OG   . SER A 1 76  ? 5.432   2.175   7.493   1.00 0.00 ? 76  SER A OG   7  
ATOM 11509 H H    . SER A 1 76  ? 5.642   0.366   4.963   1.00 0.00 ? 76  SER A H    7  
ATOM 11510 H HA   . SER A 1 76  ? 3.320   -0.194  6.568   1.00 0.00 ? 76  SER A HA   7  
ATOM 11511 H HB2  . SER A 1 76  ? 4.575   0.510   8.356   1.00 0.00 ? 76  SER A HB2  7  
ATOM 11512 H HB3  . SER A 1 76  ? 5.905   0.181   7.264   1.00 0.00 ? 76  SER A HB3  7  
ATOM 11513 H HG   . SER A 1 76  ? 5.423   2.478   8.446   1.00 0.00 ? 76  SER A HG   7  
ATOM 11514 N N    . GLU A 1 77  ? 2.703   2.470   6.937   1.00 0.00 ? 77  GLU A N    7  
ATOM 11515 C CA   . GLU A 1 77  ? 1.976   3.714   6.750   1.00 0.00 ? 77  GLU A CA   7  
ATOM 11516 C C    . GLU A 1 77  ? 2.952   4.877   6.565   1.00 0.00 ? 77  GLU A C    7  
ATOM 11517 O O    . GLU A 1 77  ? 2.668   5.820   5.828   1.00 0.00 ? 77  GLU A O    7  
ATOM 11518 C CB   . GLU A 1 77  ? 1.026   3.975   7.920   1.00 0.00 ? 77  GLU A CB   7  
ATOM 11519 C CG   . GLU A 1 77  ? -0.319  4.511   7.426   1.00 0.00 ? 77  GLU A CG   7  
ATOM 11520 C CD   . GLU A 1 77  ? -0.425  6.020   7.651   1.00 0.00 ? 77  GLU A CD   7  
ATOM 11521 O OE1  . GLU A 1 77  ? 0.054   6.471   8.714   1.00 0.00 ? 77  GLU A OE1  7  
ATOM 11522 O OE2  . GLU A 1 77  ? -0.981  6.690   6.754   1.00 0.00 ? 77  GLU A OE2  7  
ATOM 11523 H H    . GLU A 1 77  ? 2.702   2.117   7.872   1.00 0.00 ? 77  GLU A H    7  
ATOM 11524 H HA   . GLU A 1 77  ? 1.391   3.573   5.840   1.00 0.00 ? 77  GLU A HA   7  
ATOM 11525 H HB2  . GLU A 1 77  ? 0.871   3.053   8.481   1.00 0.00 ? 77  GLU A HB2  7  
ATOM 11526 H HB3  . GLU A 1 77  ? 1.477   4.693   8.606   1.00 0.00 ? 77  GLU A HB3  7  
ATOM 11527 H HG2  . GLU A 1 77  ? -0.436  4.288   6.366   1.00 0.00 ? 77  GLU A HG2  7  
ATOM 11528 H HG3  . GLU A 1 77  ? -1.131  4.004   7.949   1.00 0.00 ? 77  GLU A HG3  7  
ATOM 11529 N N    . ASP A 1 78  ? 4.083   4.772   7.247   1.00 0.00 ? 78  ASP A N    7  
ATOM 11530 C CA   . ASP A 1 78  ? 5.103   5.804   7.168   1.00 0.00 ? 78  ASP A CA   7  
ATOM 11531 C C    . ASP A 1 78  ? 5.372   6.137   5.699   1.00 0.00 ? 78  ASP A C    7  
ATOM 11532 O O    . ASP A 1 78  ? 5.629   7.291   5.357   1.00 0.00 ? 78  ASP A O    7  
ATOM 11533 C CB   . ASP A 1 78  ? 6.416   5.330   7.794   1.00 0.00 ? 78  ASP A CB   7  
ATOM 11534 C CG   . ASP A 1 78  ? 6.363   5.090   9.304   1.00 0.00 ? 78  ASP A CG   7  
ATOM 11535 O OD1  . ASP A 1 78  ? 5.424   4.387   9.735   1.00 0.00 ? 78  ASP A OD1  7  
ATOM 11536 O OD2  . ASP A 1 78  ? 7.264   5.616   9.994   1.00 0.00 ? 78  ASP A OD2  7  
ATOM 11537 H H    . ASP A 1 78  ? 4.306   4.002   7.845   1.00 0.00 ? 78  ASP A H    7  
ATOM 11538 H HA   . ASP A 1 78  ? 4.697   6.652   7.720   1.00 0.00 ? 78  ASP A HA   7  
ATOM 11539 H HB2  . ASP A 1 78  ? 6.721   4.404   7.305   1.00 0.00 ? 78  ASP A HB2  7  
ATOM 11540 H HB3  . ASP A 1 78  ? 7.189   6.070   7.585   1.00 0.00 ? 78  ASP A HB3  7  
ATOM 11541 N N    . PHE A 1 79  ? 5.305   5.106   4.870   1.00 0.00 ? 79  PHE A N    7  
ATOM 11542 C CA   . PHE A 1 79  ? 5.539   5.275   3.446   1.00 0.00 ? 79  PHE A CA   7  
ATOM 11543 C C    . PHE A 1 79  ? 4.798   6.501   2.910   1.00 0.00 ? 79  PHE A C    7  
ATOM 11544 O O    . PHE A 1 79  ? 5.391   7.347   2.243   1.00 0.00 ? 79  PHE A O    7  
ATOM 11545 C CB   . PHE A 1 79  ? 4.996   4.023   2.752   1.00 0.00 ? 79  PHE A CB   7  
ATOM