data_2COR
# 
_entry.id   2COR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2COR         
RCSB  RCSB024459   
WWPDB D_1000024459 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001001107.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2COR 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-18 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, X.R.'                                              1 
'Nagashima, T.'                                          2 
'Hayashi, F.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the third LIM domain of particularly interesting new Cys-His protein' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Qin, X.R.'     1 
primary 'Nagashima, T.' 2 
primary 'Hayashi, F.'   3 
primary 'Yokoyama, S.'  4 
# 
_cell.entry_id           2COR 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2COR 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PINCH protein' 8495.583 1 ? ? 'LIM domain' ? 
2 non-polymer syn 'ZINC ION'      65.409   2 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Particularly interesting new Cys-His protein, LIM and senescent cell antigen-like domains 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGEKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGEKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001001107.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  GLU n 
1 9  LYS n 
1 10 ALA n 
1 11 ARG n 
1 12 GLY n 
1 13 LEU n 
1 14 GLY n 
1 15 LYS n 
1 16 TYR n 
1 17 ILE n 
1 18 CYS n 
1 19 GLN n 
1 20 LYS n 
1 21 CYS n 
1 22 HIS n 
1 23 ALA n 
1 24 ILE n 
1 25 ILE n 
1 26 ASP n 
1 27 GLU n 
1 28 GLN n 
1 29 PRO n 
1 30 LEU n 
1 31 ILE n 
1 32 PHE n 
1 33 LYS n 
1 34 ASN n 
1 35 ASP n 
1 36 PRO n 
1 37 TYR n 
1 38 HIS n 
1 39 PRO n 
1 40 ASP n 
1 41 HIS n 
1 42 PHE n 
1 43 ASN n 
1 44 CYS n 
1 45 ALA n 
1 46 ASN n 
1 47 CYS n 
1 48 GLY n 
1 49 LYS n 
1 50 GLU n 
1 51 LEU n 
1 52 THR n 
1 53 ALA n 
1 54 ASP n 
1 55 ALA n 
1 56 ARG n 
1 57 GLU n 
1 58 LEU n 
1 59 LYS n 
1 60 GLY n 
1 61 GLU n 
1 62 LEU n 
1 63 TYR n 
1 64 CYS n 
1 65 LEU n 
1 66 PRO n 
1 67 CYS n 
1 68 HIS n 
1 69 ASP n 
1 70 LYS n 
1 71 MET n 
1 72 GLY n 
1 73 VAL n 
1 74 SER n 
1 75 GLY n 
1 76 PRO n 
1 77 SER n 
1 78 SER n 
1 79 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 LIMS1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040727-07 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PINC_HUMAN 
_struct_ref.pdbx_db_accession          P48059 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   EKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGV 
_struct_ref.pdbx_align_begin           125 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2COR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P48059 
_struct_ref_seq.db_align_beg                  125 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  190 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2COR GLY A 1  ? UNP P48059 ? ? 'CLONING ARTIFACT' 1  1  
1 2COR SER A 2  ? UNP P48059 ? ? 'CLONING ARTIFACT' 2  2  
1 2COR SER A 3  ? UNP P48059 ? ? 'CLONING ARTIFACT' 3  3  
1 2COR GLY A 4  ? UNP P48059 ? ? 'CLONING ARTIFACT' 4  4  
1 2COR SER A 5  ? UNP P48059 ? ? 'CLONING ARTIFACT' 5  5  
1 2COR SER A 6  ? UNP P48059 ? ? 'CLONING ARTIFACT' 6  6  
1 2COR GLY A 7  ? UNP P48059 ? ? 'CLONING ARTIFACT' 7  7  
1 2COR SER A 74 ? UNP P48059 ? ? 'CLONING ARTIFACT' 74 8  
1 2COR GLY A 75 ? UNP P48059 ? ? 'CLONING ARTIFACT' 75 9  
1 2COR PRO A 76 ? UNP P48059 ? ? 'CLONING ARTIFACT' 76 10 
1 2COR SER A 77 ? UNP P48059 ? ? 'CLONING ARTIFACT' 77 11 
1 2COR SER A 78 ? UNP P48059 ? ? 'CLONING ARTIFACT' 78 12 
1 2COR GLY A 79 ? UNP P48059 ? ? 'CLONING ARTIFACT' 79 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.39mM 13C, 15N-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 800 ? 
2 INOVA Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           2COR 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2COR 
_pdbx_nmr_details.text       'spectrometer_id 1 for 3D_15N_separated_NOESY, spectrometer_id 2 for 3D_13C_separated_NOESY' 
# 
_pdbx_nmr_ensemble.entry_id                                      2COR 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2COR 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian       1 
processing           NMRPipe 20031121 Delaglio,F.  2 
'data analysis'      NMRView 5.0.4    Johnson,B.A. 3 
'data analysis'      Kujira  0.9296   Kobayashi,N. 4 
'structure solution' CYANA   2.0.17   Guntert,P.   5 
refinement           CYANA   2.0.17   Guntert,P.   6 
# 
_exptl.entry_id          2COR 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2COR 
_struct.title                     'Solution structure of the third LIM domain of particularly interesting new Cys-His protein' 
_struct.pdbx_descriptor           'PINCH protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2COR 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;LIM domain, PINCH protein, Particularly interesting new Cys-His protein, LIM and senescent cell antigen-like domains 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       CYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        64 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        70 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        CYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         64 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         70 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18 SG  ? ? A ZN 201 A CYS 18 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 21 SG  ? ? A ZN 201 A CYS 21 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 38 ND1 ? ? A ZN 201 A HIS 38 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 41 NE2 ? ? A ZN 201 A HIS 41 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 44 SG  ? ? A ZN 401 A CYS 44 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 47 SG  ? ? A ZN 401 A CYS 47 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 64 SG  ? ? A ZN 401 A CYS 64 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 67 SG  ? ? A ZN 401 A CYS 67 1_555 ? ? ? ? ? ? ? 2.369 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 24 ? ILE A 25 ? ILE A 24 ILE A 25 
A 2 TYR A 16 ? ILE A 17 ? TYR A 16 ILE A 17 
A 3 PRO A 36 ? TYR A 37 ? PRO A 36 TYR A 37 
A 4 LEU A 30 ? ILE A 31 ? LEU A 30 ILE A 31 
A 5 ARG A 56 ? LEU A 58 ? ARG A 56 LEU A 58 
A 6 GLU A 61 ? TYR A 63 ? GLU A 61 TYR A 63 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              5 
_pdbx_struct_sheet_hbond.range_id_2              6 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    56 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     56 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    63 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     63 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 
2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 
3 AC1 4 HIS A 38 ? HIS A 38 . ? 1_555 ? 
4 AC1 4 HIS A 41 ? HIS A 41 . ? 1_555 ? 
5 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
6 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
7 AC2 4 CYS A 64 ? CYS A 64 . ? 1_555 ? 
8 AC2 4 CYS A 67 ? CYS A 67 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2COR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2COR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -38.064 25.959  -27.880 1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -37.001 25.834  -26.900 1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -35.943 24.831  -27.316 1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -35.845 24.473  -28.490 1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -37.877 25.792  -28.827 1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -36.534 26.799  -26.766 1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -37.429 25.519  -25.960 1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -35.149 24.377  -26.352 1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -34.090 23.412  -26.626 1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -34.647 21.993  -26.680 1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -35.160 21.478  -25.687 1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -32.999 23.504  -25.556 1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -31.747 23.081  -26.068 1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -35.277 24.700  -25.436 1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -33.661 23.655  -27.587 1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -32.912 24.526  -25.222 1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -33.265 22.872  -24.721 1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -31.236 23.848  -26.337 1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -34.543 21.368  -27.848 1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -35.040 20.010  -28.035 1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -34.509 19.082  -26.946 1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -33.321 18.766  -26.909 1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -34.635 19.481  -29.413 1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -35.382 20.110  -30.440 1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -34.124 21.832  -28.603 1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -36.117 20.039  -27.973 1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -33.586 19.675  -29.576 1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -34.815 18.416  -29.453 1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -34.782 20.505  -31.076 1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -35.400 18.650  -26.059 1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -35.004 17.764  -24.980 1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -35.312 18.340  -23.613 1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -36.468 18.620  -23.296 1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -36.335 18.935  -26.138 1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -35.526 16.825  -25.090 1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -33.941 17.583  -25.051 1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -34.276 18.518  -22.800 1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -34.442 19.060  -21.457 1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -33.195 19.822  -21.020 1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -32.082 19.510  -21.444 1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -34.740 17.935  -20.463 1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -35.134 18.457  -19.206 1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -33.378 18.276  -23.111 1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -35.279 19.743  -21.476 1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -35.537 17.319  -20.850 1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -33.853 17.334  -20.328 1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -34.518 19.141  -18.935 1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -33.389 20.825  -20.169 1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -32.281 21.635  -19.677 1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -32.621 22.256  -18.325 1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -33.673 22.872  -18.159 1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -31.939 22.735  -20.685 1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -30.872 23.541  -20.217 1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -34.300 21.025  -19.867 1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -31.425 20.989  -19.558 1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -31.650 22.284  -21.621 1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -32.807 23.360  -20.839 1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -30.214 23.635  -20.909 1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -31.721 22.088  -17.361 1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -31.942 22.637  -16.036 1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -31.643 21.637  -14.937 1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -32.558 21.089  -14.323 1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -30.900 21.588  -17.551 1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -31.308 23.501  -15.905 1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -32.974 22.946  -15.955 1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . GLU A 1 8  ? -30.359 21.398  -14.690 1.00 0.00 ? 8   GLU A N    1  
ATOM   67    C  CA   . GLU A 1 8  ? -29.943 20.454  -13.659 1.00 0.00 ? 8   GLU A CA   1  
ATOM   68    C  C    . GLU A 1 8  ? -28.580 20.838  -13.088 1.00 0.00 ? 8   GLU A C    1  
ATOM   69    O  O    . GLU A 1 8  ? -27.675 21.234  -13.823 1.00 0.00 ? 8   GLU A O    1  
ATOM   70    C  CB   . GLU A 1 8  ? -29.888 19.035  -14.227 1.00 0.00 ? 8   GLU A CB   1  
ATOM   71    C  CG   . GLU A 1 8  ? -28.914 18.879  -15.383 1.00 0.00 ? 8   GLU A CG   1  
ATOM   72    C  CD   . GLU A 1 8  ? -28.478 17.441  -15.588 1.00 0.00 ? 8   GLU A CD   1  
ATOM   73    O  OE1  . GLU A 1 8  ? -29.313 16.624  -16.028 1.00 0.00 ? 8   GLU A OE1  1  
ATOM   74    O  OE2  . GLU A 1 8  ? -27.300 17.133  -15.308 1.00 0.00 ? 8   GLU A OE2  1  
ATOM   75    H  H    . GLU A 1 8  ? -29.676 21.866  -15.214 1.00 0.00 ? 8   GLU A H    1  
ATOM   76    H  HA   . GLU A 1 8  ? -30.674 20.487  -12.866 1.00 0.00 ? 8   GLU A HA   1  
ATOM   77    H  HB2  . GLU A 1 8  ? -29.594 18.356  -13.441 1.00 0.00 ? 8   GLU A HB2  1  
ATOM   78    H  HB3  . GLU A 1 8  ? -30.874 18.762  -14.576 1.00 0.00 ? 8   GLU A HB3  1  
ATOM   79    H  HG2  . GLU A 1 8  ? -29.390 19.227  -16.287 1.00 0.00 ? 8   GLU A HG2  1  
ATOM   80    H  HG3  . GLU A 1 8  ? -28.039 19.480  -15.183 1.00 0.00 ? 8   GLU A HG3  1  
ATOM   81    N  N    . LYS A 1 9  ? -28.442 20.719  -11.772 1.00 0.00 ? 9   LYS A N    1  
ATOM   82    C  CA   . LYS A 1 9  ? -27.191 21.052  -11.101 1.00 0.00 ? 9   LYS A CA   1  
ATOM   83    C  C    . LYS A 1 9  ? -26.898 20.064  -9.976  1.00 0.00 ? 9   LYS A C    1  
ATOM   84    O  O    . LYS A 1 9  ? -27.813 19.472  -9.403  1.00 0.00 ? 9   LYS A O    1  
ATOM   85    C  CB   . LYS A 1 9  ? -27.252 22.475  -10.541 1.00 0.00 ? 9   LYS A CB   1  
ATOM   86    C  CG   . LYS A 1 9  ? -27.538 23.531  -11.595 1.00 0.00 ? 9   LYS A CG   1  
ATOM   87    C  CD   . LYS A 1 9  ? -27.574 24.925  -10.992 1.00 0.00 ? 9   LYS A CD   1  
ATOM   88    C  CE   . LYS A 1 9  ? -26.172 25.467  -10.757 1.00 0.00 ? 9   LYS A CE   1  
ATOM   89    N  NZ   . LYS A 1 9  ? -25.529 25.909  -12.025 1.00 0.00 ? 9   LYS A NZ   1  
ATOM   90    H  H    . LYS A 1 9  ? -29.200 20.398  -11.239 1.00 0.00 ? 9   LYS A H    1  
ATOM   91    H  HA   . LYS A 1 9  ? -26.398 20.994  -11.830 1.00 0.00 ? 9   LYS A HA   1  
ATOM   92    H  HB2  . LYS A 1 9  ? -28.030 22.522  -9.794  1.00 0.00 ? 9   LYS A HB2  1  
ATOM   93    H  HB3  . LYS A 1 9  ? -26.304 22.707  -10.077 1.00 0.00 ? 9   LYS A HB3  1  
ATOM   94    H  HG2  . LYS A 1 9  ? -26.763 23.495  -12.347 1.00 0.00 ? 9   LYS A HG2  1  
ATOM   95    H  HG3  . LYS A 1 9  ? -28.495 23.321  -12.052 1.00 0.00 ? 9   LYS A HG3  1  
ATOM   96    H  HD2  . LYS A 1 9  ? -28.095 25.587  -11.668 1.00 0.00 ? 9   LYS A HD2  1  
ATOM   97    H  HD3  . LYS A 1 9  ? -28.099 24.886  -10.048 1.00 0.00 ? 9   LYS A HD3  1  
ATOM   98    H  HE2  . LYS A 1 9  ? -26.234 26.307  -10.082 1.00 0.00 ? 9   LYS A HE2  1  
ATOM   99    H  HE3  . LYS A 1 9  ? -25.571 24.690  -10.310 1.00 0.00 ? 9   LYS A HE3  1  
ATOM   100   H  HZ1  . LYS A 1 9  ? -24.536 25.600  -12.048 1.00 0.00 ? 9   LYS A HZ1  1  
ATOM   101   H  HZ2  . LYS A 1 9  ? -25.558 26.946  -12.098 1.00 0.00 ? 9   LYS A HZ2  1  
ATOM   102   H  HZ3  . LYS A 1 9  ? -26.027 25.500  -12.841 1.00 0.00 ? 9   LYS A HZ3  1  
ATOM   103   N  N    . ALA A 1 10 ? -25.618 19.893  -9.663  1.00 0.00 ? 10  ALA A N    1  
ATOM   104   C  CA   . ALA A 1 10 ? -25.206 18.981  -8.604  1.00 0.00 ? 10  ALA A CA   1  
ATOM   105   C  C    . ALA A 1 10 ? -23.784 19.282  -8.143  1.00 0.00 ? 10  ALA A C    1  
ATOM   106   O  O    . ALA A 1 10 ? -22.901 19.554  -8.957  1.00 0.00 ? 10  ALA A O    1  
ATOM   107   C  CB   . ALA A 1 10 ? -25.315 17.539  -9.078  1.00 0.00 ? 10  ALA A CB   1  
ATOM   108   H  H    . ALA A 1 10 ? -24.935 20.394  -10.155 1.00 0.00 ? 10  ALA A H    1  
ATOM   109   H  HA   . ALA A 1 10 ? -25.880 19.111  -7.769  1.00 0.00 ? 10  ALA A HA   1  
ATOM   110   H  HB1  . ALA A 1 10 ? -24.373 17.230  -9.507  1.00 0.00 ? 10  ALA A HB1  1  
ATOM   111   H  HB2  . ALA A 1 10 ? -25.555 16.902  -8.240  1.00 0.00 ? 10  ALA A HB2  1  
ATOM   112   H  HB3  . ALA A 1 10 ? -26.093 17.463  -9.822  1.00 0.00 ? 10  ALA A HB3  1  
ATOM   113   N  N    . ARG A 1 11 ? -23.569 19.232  -6.832  1.00 0.00 ? 11  ARG A N    1  
ATOM   114   C  CA   . ARG A 1 11 ? -22.254 19.501  -6.263  1.00 0.00 ? 11  ARG A CA   1  
ATOM   115   C  C    . ARG A 1 11 ? -21.859 18.414  -5.268  1.00 0.00 ? 11  ARG A C    1  
ATOM   116   O  O    . ARG A 1 11 ? -21.303 18.699  -4.209  1.00 0.00 ? 11  ARG A O    1  
ATOM   117   C  CB   . ARG A 1 11 ? -22.244 20.867  -5.572  1.00 0.00 ? 11  ARG A CB   1  
ATOM   118   C  CG   . ARG A 1 11 ? -22.264 22.039  -6.540  1.00 0.00 ? 11  ARG A CG   1  
ATOM   119   C  CD   . ARG A 1 11 ? -20.857 22.458  -6.936  1.00 0.00 ? 11  ARG A CD   1  
ATOM   120   N  NE   . ARG A 1 11 ? -20.821 23.066  -8.264  1.00 0.00 ? 11  ARG A NE   1  
ATOM   121   C  CZ   . ARG A 1 11 ? -19.840 23.858  -8.683  1.00 0.00 ? 11  ARG A CZ   1  
ATOM   122   N  NH1  . ARG A 1 11 ? -18.820 24.135  -7.883  1.00 0.00 ? 11  ARG A NH1  1  
ATOM   123   N  NH2  . ARG A 1 11 ? -19.878 24.373  -9.905  1.00 0.00 ? 11  ARG A NH2  1  
ATOM   124   H  H    . ARG A 1 11 ? -24.312 19.009  -6.233  1.00 0.00 ? 11  ARG A H    1  
ATOM   125   H  HA   . ARG A 1 11 ? -21.538 19.511  -7.071  1.00 0.00 ? 11  ARG A HA   1  
ATOM   126   H  HB2  . ARG A 1 11 ? -23.112 20.941  -4.934  1.00 0.00 ? 11  ARG A HB2  1  
ATOM   127   H  HB3  . ARG A 1 11 ? -21.353 20.943  -4.967  1.00 0.00 ? 11  ARG A HB3  1  
ATOM   128   H  HG2  . ARG A 1 11 ? -22.806 21.750  -7.429  1.00 0.00 ? 11  ARG A HG2  1  
ATOM   129   H  HG3  . ARG A 1 11 ? -22.760 22.874  -6.069  1.00 0.00 ? 11  ARG A HG3  1  
ATOM   130   H  HD2  . ARG A 1 11 ? -20.492 23.173  -6.214  1.00 0.00 ? 11  ARG A HD2  1  
ATOM   131   H  HD3  . ARG A 1 11 ? -20.221 21.586  -6.932  1.00 0.00 ? 11  ARG A HD3  1  
ATOM   132   H  HE   . ARG A 1 11 ? -21.565 22.874  -8.871  1.00 0.00 ? 11  ARG A HE   1  
ATOM   133   H  HH11 . ARG A 1 11 ? -18.788 23.747  -6.962  1.00 0.00 ? 11  ARG A HH11 1  
ATOM   134   H  HH12 . ARG A 1 11 ? -18.082 24.730  -8.202  1.00 0.00 ? 11  ARG A HH12 1  
ATOM   135   H  HH21 . ARG A 1 11 ? -20.646 24.166  -10.511 1.00 0.00 ? 11  ARG A HH21 1  
ATOM   136   H  HH22 . ARG A 1 11 ? -19.140 24.968  -10.220 1.00 0.00 ? 11  ARG A HH22 1  
ATOM   137   N  N    . GLY A 1 12 ? -22.150 17.164  -5.618  1.00 0.00 ? 12  GLY A N    1  
ATOM   138   C  CA   . GLY A 1 12 ? -21.819 16.053  -4.746  1.00 0.00 ? 12  GLY A CA   1  
ATOM   139   C  C    . GLY A 1 12 ? -20.330 15.772  -4.705  1.00 0.00 ? 12  GLY A C    1  
ATOM   140   O  O    . GLY A 1 12 ? -19.867 14.761  -5.234  1.00 0.00 ? 12  GLY A O    1  
ATOM   141   H  H    . GLY A 1 12 ? -22.594 16.996  -6.476  1.00 0.00 ? 12  GLY A H    1  
ATOM   142   H  HA2  . GLY A 1 12 ? -22.160 16.280  -3.747  1.00 0.00 ? 12  GLY A HA2  1  
ATOM   143   H  HA3  . GLY A 1 12 ? -22.331 15.169  -5.098  1.00 0.00 ? 12  GLY A HA3  1  
ATOM   144   N  N    . LEU A 1 13 ? -19.578 16.668  -4.076  1.00 0.00 ? 13  LEU A N    1  
ATOM   145   C  CA   . LEU A 1 13 ? -18.131 16.513  -3.969  1.00 0.00 ? 13  LEU A CA   1  
ATOM   146   C  C    . LEU A 1 13 ? -17.770 15.515  -2.874  1.00 0.00 ? 13  LEU A C    1  
ATOM   147   O  O    . LEU A 1 13 ? -17.687 15.871  -1.699  1.00 0.00 ? 13  LEU A O    1  
ATOM   148   C  CB   . LEU A 1 13 ? -17.474 17.864  -3.681  1.00 0.00 ? 13  LEU A CB   1  
ATOM   149   C  CG   . LEU A 1 13 ? -17.892 19.021  -4.589  1.00 0.00 ? 13  LEU A CG   1  
ATOM   150   C  CD1  . LEU A 1 13 ? -17.726 20.351  -3.870  1.00 0.00 ? 13  LEU A CD1  1  
ATOM   151   C  CD2  . LEU A 1 13 ? -17.084 19.006  -5.879  1.00 0.00 ? 13  LEU A CD2  1  
ATOM   152   H  H    . LEU A 1 13 ? -20.004 17.454  -3.674  1.00 0.00 ? 13  LEU A H    1  
ATOM   153   H  HA   . LEU A 1 13 ? -17.768 16.139  -4.914  1.00 0.00 ? 13  LEU A HA   1  
ATOM   154   H  HB2  . LEU A 1 13 ? -17.712 18.138  -2.665  1.00 0.00 ? 13  LEU A HB2  1  
ATOM   155   H  HB3  . LEU A 1 13 ? -16.404 17.737  -3.776  1.00 0.00 ? 13  LEU A HB3  1  
ATOM   156   H  HG   . LEU A 1 13 ? -18.936 18.909  -4.846  1.00 0.00 ? 13  LEU A HG   1  
ATOM   157   H  HD11 . LEU A 1 13 ? -17.357 21.091  -4.563  1.00 0.00 ? 13  LEU A HD11 1  
ATOM   158   H  HD12 . LEU A 1 13 ? -17.024 20.235  -3.058  1.00 0.00 ? 13  LEU A HD12 1  
ATOM   159   H  HD13 . LEU A 1 13 ? -18.681 20.668  -3.477  1.00 0.00 ? 13  LEU A HD13 1  
ATOM   160   H  HD21 . LEU A 1 13 ? -17.526 18.306  -6.572  1.00 0.00 ? 13  LEU A HD21 1  
ATOM   161   H  HD22 . LEU A 1 13 ? -16.068 18.707  -5.663  1.00 0.00 ? 13  LEU A HD22 1  
ATOM   162   H  HD23 . LEU A 1 13 ? -17.084 19.994  -6.315  1.00 0.00 ? 13  LEU A HD23 1  
ATOM   163   N  N    . GLY A 1 14 ? -17.555 14.264  -3.268  1.00 0.00 ? 14  GLY A N    1  
ATOM   164   C  CA   . GLY A 1 14 ? -17.203 13.234  -2.307  1.00 0.00 ? 14  GLY A CA   1  
ATOM   165   C  C    . GLY A 1 14 ? -15.710 12.978  -2.253  1.00 0.00 ? 14  GLY A C    1  
ATOM   166   O  O    . GLY A 1 14 ? -14.948 13.802  -1.748  1.00 0.00 ? 14  GLY A O    1  
ATOM   167   H  H    . GLY A 1 14 ? -17.635 14.038  -4.218  1.00 0.00 ? 14  GLY A H    1  
ATOM   168   H  HA2  . GLY A 1 14 ? -17.541 13.539  -1.328  1.00 0.00 ? 14  GLY A HA2  1  
ATOM   169   H  HA3  . GLY A 1 14 ? -17.704 12.317  -2.581  1.00 0.00 ? 14  GLY A HA3  1  
ATOM   170   N  N    . LYS A 1 15 ? -15.289 11.830  -2.774  1.00 0.00 ? 15  LYS A N    1  
ATOM   171   C  CA   . LYS A 1 15 ? -13.877 11.465  -2.783  1.00 0.00 ? 15  LYS A CA   1  
ATOM   172   C  C    . LYS A 1 15 ? -13.578 10.475  -3.904  1.00 0.00 ? 15  LYS A C    1  
ATOM   173   O  O    . LYS A 1 15 ? -14.478 10.062  -4.637  1.00 0.00 ? 15  LYS A O    1  
ATOM   174   C  CB   . LYS A 1 15 ? -13.476 10.862  -1.435  1.00 0.00 ? 15  LYS A CB   1  
ATOM   175   C  CG   . LYS A 1 15 ? -13.780 11.764  -0.251  1.00 0.00 ? 15  LYS A CG   1  
ATOM   176   C  CD   . LYS A 1 15 ? -12.916 13.014  -0.266  1.00 0.00 ? 15  LYS A CD   1  
ATOM   177   C  CE   . LYS A 1 15 ? -11.562 12.763  0.381   1.00 0.00 ? 15  LYS A CE   1  
ATOM   178   N  NZ   . LYS A 1 15 ? -10.642 13.921  0.208   1.00 0.00 ? 15  LYS A NZ   1  
ATOM   179   H  H    . LYS A 1 15 ? -15.945 11.213  -3.163  1.00 0.00 ? 15  LYS A H    1  
ATOM   180   H  HA   . LYS A 1 15 ? -13.304 12.364  -2.951  1.00 0.00 ? 15  LYS A HA   1  
ATOM   181   H  HB2  . LYS A 1 15 ? -14.007 9.932   -1.298  1.00 0.00 ? 15  LYS A HB2  1  
ATOM   182   H  HB3  . LYS A 1 15 ? -12.415 10.663  -1.445  1.00 0.00 ? 15  LYS A HB3  1  
ATOM   183   H  HG2  . LYS A 1 15 ? -14.819 12.057  -0.290  1.00 0.00 ? 15  LYS A HG2  1  
ATOM   184   H  HG3  . LYS A 1 15 ? -13.593 11.218  0.663   1.00 0.00 ? 15  LYS A HG3  1  
ATOM   185   H  HD2  . LYS A 1 15 ? -12.762 13.323  -1.289  1.00 0.00 ? 15  LYS A HD2  1  
ATOM   186   H  HD3  . LYS A 1 15 ? -13.425 13.798  0.277   1.00 0.00 ? 15  LYS A HD3  1  
ATOM   187   H  HE2  . LYS A 1 15 ? -11.709 12.585  1.435   1.00 0.00 ? 15  LYS A HE2  1  
ATOM   188   H  HE3  . LYS A 1 15 ? -11.118 11.890  -0.073  1.00 0.00 ? 15  LYS A HE3  1  
ATOM   189   H  HZ1  . LYS A 1 15 ? -10.385 14.026  -0.794  1.00 0.00 ? 15  LYS A HZ1  1  
ATOM   190   H  HZ2  . LYS A 1 15 ? -9.775  13.774  0.763   1.00 0.00 ? 15  LYS A HZ2  1  
ATOM   191   H  HZ3  . LYS A 1 15 ? -11.104 14.795  0.530   1.00 0.00 ? 15  LYS A HZ3  1  
ATOM   192   N  N    . TYR A 1 16 ? -12.312 10.096  -4.031  1.00 0.00 ? 16  TYR A N    1  
ATOM   193   C  CA   . TYR A 1 16 ? -11.894 9.155   -5.063  1.00 0.00 ? 16  TYR A CA   1  
ATOM   194   C  C    . TYR A 1 16 ? -12.364 7.741   -4.733  1.00 0.00 ? 16  TYR A C    1  
ATOM   195   O  O    . TYR A 1 16 ? -12.038 7.198   -3.677  1.00 0.00 ? 16  TYR A O    1  
ATOM   196   C  CB   . TYR A 1 16 ? -10.373 9.176   -5.217  1.00 0.00 ? 16  TYR A CB   1  
ATOM   197   C  CG   . TYR A 1 16 ? -9.852  10.408  -5.921  1.00 0.00 ? 16  TYR A CG   1  
ATOM   198   C  CD1  . TYR A 1 16 ? -10.020 11.672  -5.367  1.00 0.00 ? 16  TYR A CD1  1  
ATOM   199   C  CD2  . TYR A 1 16 ? -9.194  10.310  -7.141  1.00 0.00 ? 16  TYR A CD2  1  
ATOM   200   C  CE1  . TYR A 1 16 ? -9.547  12.801  -6.007  1.00 0.00 ? 16  TYR A CE1  1  
ATOM   201   C  CE2  . TYR A 1 16 ? -8.717  11.434  -7.787  1.00 0.00 ? 16  TYR A CE2  1  
ATOM   202   C  CZ   . TYR A 1 16 ? -8.895  12.677  -7.216  1.00 0.00 ? 16  TYR A CZ   1  
ATOM   203   O  OH   . TYR A 1 16 ? -8.422  13.799  -7.858  1.00 0.00 ? 16  TYR A OH   1  
ATOM   204   H  H    . TYR A 1 16 ? -11.640 10.460  -3.416  1.00 0.00 ? 16  TYR A H    1  
ATOM   205   H  HA   . TYR A 1 16 ? -12.345 9.463   -5.995  1.00 0.00 ? 16  TYR A HA   1  
ATOM   206   H  HB2  . TYR A 1 16 ? -9.918  9.136   -4.239  1.00 0.00 ? 16  TYR A HB2  1  
ATOM   207   H  HB3  . TYR A 1 16 ? -10.064 8.312   -5.788  1.00 0.00 ? 16  TYR A HB3  1  
ATOM   208   H  HD1  . TYR A 1 16 ? -10.531 11.766  -4.419  1.00 0.00 ? 16  TYR A HD1  1  
ATOM   209   H  HD2  . TYR A 1 16 ? -9.056  9.335   -7.585  1.00 0.00 ? 16  TYR A HD2  1  
ATOM   210   H  HE1  . TYR A 1 16 ? -9.686  13.774  -5.560  1.00 0.00 ? 16  TYR A HE1  1  
ATOM   211   H  HE2  . TYR A 1 16 ? -8.207  11.337  -8.734  1.00 0.00 ? 16  TYR A HE2  1  
ATOM   212   H  HH   . TYR A 1 16 ? -8.024  14.391  -7.215  1.00 0.00 ? 16  TYR A HH   1  
ATOM   213   N  N    . ILE A 1 17 ? -13.131 7.152   -5.644  1.00 0.00 ? 17  ILE A N    1  
ATOM   214   C  CA   . ILE A 1 17 ? -13.644 5.801   -5.452  1.00 0.00 ? 17  ILE A CA   1  
ATOM   215   C  C    . ILE A 1 17 ? -12.654 4.759   -5.960  1.00 0.00 ? 17  ILE A C    1  
ATOM   216   O  O    . ILE A 1 17 ? -12.279 4.763   -7.133  1.00 0.00 ? 17  ILE A O    1  
ATOM   217   C  CB   . ILE A 1 17 ? -14.993 5.604   -6.168  1.00 0.00 ? 17  ILE A CB   1  
ATOM   218   C  CG1  . ILE A 1 17 ? -16.028 6.596   -5.635  1.00 0.00 ? 17  ILE A CG1  1  
ATOM   219   C  CG2  . ILE A 1 17 ? -15.482 4.174   -5.993  1.00 0.00 ? 17  ILE A CG2  1  
ATOM   220   C  CD1  . ILE A 1 17 ? -16.435 6.333   -4.202  1.00 0.00 ? 17  ILE A CD1  1  
ATOM   221   H  H    . ILE A 1 17 ? -13.356 7.636   -6.465  1.00 0.00 ? 17  ILE A H    1  
ATOM   222   H  HA   . ILE A 1 17 ? -13.796 5.651   -4.393  1.00 0.00 ? 17  ILE A HA   1  
ATOM   223   H  HB   . ILE A 1 17 ? -14.844 5.782   -7.222  1.00 0.00 ? 17  ILE A HB   1  
ATOM   224   H  HG12 . ILE A 1 17 ? -15.622 7.594   -5.685  1.00 0.00 ? 17  ILE A HG12 1  
ATOM   225   H  HG13 . ILE A 1 17 ? -16.917 6.542   -6.248  1.00 0.00 ? 17  ILE A HG13 1  
ATOM   226   H  HG21 . ILE A 1 17 ? -16.501 4.097   -6.342  1.00 0.00 ? 17  ILE A HG21 1  
ATOM   227   H  HG22 . ILE A 1 17 ? -14.855 3.507   -6.566  1.00 0.00 ? 17  ILE A HG22 1  
ATOM   228   H  HG23 . ILE A 1 17 ? -15.437 3.903   -4.949  1.00 0.00 ? 17  ILE A HG23 1  
ATOM   229   H  HD11 . ILE A 1 17 ? -17.055 7.143   -3.848  1.00 0.00 ? 17  ILE A HD11 1  
ATOM   230   H  HD12 . ILE A 1 17 ? -16.986 5.406   -4.148  1.00 0.00 ? 17  ILE A HD12 1  
ATOM   231   H  HD13 . ILE A 1 17 ? -15.551 6.262   -3.584  1.00 0.00 ? 17  ILE A HD13 1  
ATOM   232   N  N    . CYS A 1 18 ? -12.234 3.866   -5.071  1.00 0.00 ? 18  CYS A N    1  
ATOM   233   C  CA   . CYS A 1 18 ? -11.288 2.816   -5.428  1.00 0.00 ? 18  CYS A CA   1  
ATOM   234   C  C    . CYS A 1 18 ? -11.845 1.941   -6.548  1.00 0.00 ? 18  CYS A C    1  
ATOM   235   O  O    . CYS A 1 18 ? -12.933 1.380   -6.427  1.00 0.00 ? 18  CYS A O    1  
ATOM   236   C  CB   . CYS A 1 18 ? -10.964 1.954   -4.206  1.00 0.00 ? 18  CYS A CB   1  
ATOM   237   S  SG   . CYS A 1 18 ? -9.540  0.842   -4.437  1.00 0.00 ? 18  CYS A SG   1  
ATOM   238   H  H    . CYS A 1 18 ? -12.568 3.914   -4.150  1.00 0.00 ? 18  CYS A H    1  
ATOM   239   H  HA   . CYS A 1 18 ? -10.382 3.289   -5.775  1.00 0.00 ? 18  CYS A HA   1  
ATOM   240   H  HB2  . CYS A 1 18 ? -10.743 2.600   -3.369  1.00 0.00 ? 18  CYS A HB2  1  
ATOM   241   H  HB3  . CYS A 1 18 ? -11.823 1.345   -3.967  1.00 0.00 ? 18  CYS A HB3  1  
ATOM   242   N  N    . GLN A 1 19 ? -11.089 1.830   -7.636  1.00 0.00 ? 19  GLN A N    1  
ATOM   243   C  CA   . GLN A 1 19 ? -11.508 1.024   -8.776  1.00 0.00 ? 19  GLN A CA   1  
ATOM   244   C  C    . GLN A 1 19 ? -11.194 -0.451  -8.545  1.00 0.00 ? 19  GLN A C    1  
ATOM   245   O  O    . GLN A 1 19 ? -11.160 -1.244  -9.486  1.00 0.00 ? 19  GLN A O    1  
ATOM   246   C  CB   . GLN A 1 19 ? -10.817 1.510   -10.052 1.00 0.00 ? 19  GLN A CB   1  
ATOM   247   C  CG   . GLN A 1 19 ? -11.597 2.583   -10.795 1.00 0.00 ? 19  GLN A CG   1  
ATOM   248   C  CD   . GLN A 1 19 ? -12.981 2.120   -11.205 1.00 0.00 ? 19  GLN A CD   1  
ATOM   249   O  OE1  . GLN A 1 19 ? -13.150 1.474   -12.240 1.00 0.00 ? 19  GLN A OE1  1  
ATOM   250   N  NE2  . GLN A 1 19 ? -13.980 2.447   -10.395 1.00 0.00 ? 19  GLN A NE2  1  
ATOM   251   H  H    . GLN A 1 19 ? -10.232 2.301   -7.672  1.00 0.00 ? 19  GLN A H    1  
ATOM   252   H  HA   . GLN A 1 19 ? -12.575 1.138   -8.890  1.00 0.00 ? 19  GLN A HA   1  
ATOM   253   H  HB2  . GLN A 1 19 ? -9.850  1.913   -9.792  1.00 0.00 ? 19  GLN A HB2  1  
ATOM   254   H  HB3  . GLN A 1 19 ? -10.682 0.670   -10.717 1.00 0.00 ? 19  GLN A HB3  1  
ATOM   255   H  HG2  . GLN A 1 19 ? -11.700 3.445   -10.152 1.00 0.00 ? 19  GLN A HG2  1  
ATOM   256   H  HG3  . GLN A 1 19 ? -11.048 2.860   -11.682 1.00 0.00 ? 19  GLN A HG3  1  
ATOM   257   H  HE21 . GLN A 1 19 ? -13.771 2.965   -9.588  1.00 0.00 ? 19  GLN A HE21 1  
ATOM   258   H  HE22 . GLN A 1 19 ? -14.885 2.162   -10.636 1.00 0.00 ? 19  GLN A HE22 1  
ATOM   259   N  N    . LYS A 1 20 ? -10.965 -0.812  -7.287  1.00 0.00 ? 20  LYS A N    1  
ATOM   260   C  CA   . LYS A 1 20 ? -10.655 -2.191  -6.930  1.00 0.00 ? 20  LYS A CA   1  
ATOM   261   C  C    . LYS A 1 20 ? -11.713 -2.761  -5.992  1.00 0.00 ? 20  LYS A C    1  
ATOM   262   O  O    . LYS A 1 20 ? -12.278 -3.825  -6.249  1.00 0.00 ? 20  LYS A O    1  
ATOM   263   C  CB   . LYS A 1 20 ? -9.276  -2.271  -6.271  1.00 0.00 ? 20  LYS A CB   1  
ATOM   264   C  CG   . LYS A 1 20 ? -8.900  -3.671  -5.818  1.00 0.00 ? 20  LYS A CG   1  
ATOM   265   C  CD   . LYS A 1 20 ? -8.164  -4.431  -6.909  1.00 0.00 ? 20  LYS A CD   1  
ATOM   266   C  CE   . LYS A 1 20 ? -9.128  -5.206  -7.795  1.00 0.00 ? 20  LYS A CE   1  
ATOM   267   N  NZ   . LYS A 1 20 ? -8.411  -6.041  -8.798  1.00 0.00 ? 20  LYS A NZ   1  
ATOM   268   H  H    . LYS A 1 20 ? -11.007 -0.133  -6.580  1.00 0.00 ? 20  LYS A H    1  
ATOM   269   H  HA   . LYS A 1 20 ? -10.645 -2.774  -7.839  1.00 0.00 ? 20  LYS A HA   1  
ATOM   270   H  HB2  . LYS A 1 20 ? -8.533  -1.931  -6.977  1.00 0.00 ? 20  LYS A HB2  1  
ATOM   271   H  HB3  . LYS A 1 20 ? -9.265  -1.621  -5.408  1.00 0.00 ? 20  LYS A HB3  1  
ATOM   272   H  HG2  . LYS A 1 20 ? -8.260  -3.599  -4.951  1.00 0.00 ? 20  LYS A HG2  1  
ATOM   273   H  HG3  . LYS A 1 20 ? -9.800  -4.211  -5.560  1.00 0.00 ? 20  LYS A HG3  1  
ATOM   274   H  HD2  . LYS A 1 20 ? -7.618  -3.729  -7.520  1.00 0.00 ? 20  LYS A HD2  1  
ATOM   275   H  HD3  . LYS A 1 20 ? -7.474  -5.125  -6.450  1.00 0.00 ? 20  LYS A HD3  1  
ATOM   276   H  HE2  . LYS A 1 20 ? -9.733  -5.847  -7.172  1.00 0.00 ? 20  LYS A HE2  1  
ATOM   277   H  HE3  . LYS A 1 20 ? -9.764  -4.504  -8.312  1.00 0.00 ? 20  LYS A HE3  1  
ATOM   278   H  HZ1  . LYS A 1 20 ? -8.115  -6.940  -8.367  1.00 0.00 ? 20  LYS A HZ1  1  
ATOM   279   H  HZ2  . LYS A 1 20 ? -7.567  -5.540  -9.141  1.00 0.00 ? 20  LYS A HZ2  1  
ATOM   280   H  HZ3  . LYS A 1 20 ? -9.033  -6.244  -9.605  1.00 0.00 ? 20  LYS A HZ3  1  
ATOM   281   N  N    . CYS A 1 21 ? -11.979 -2.047  -4.903  1.00 0.00 ? 21  CYS A N    1  
ATOM   282   C  CA   . CYS A 1 21 ? -12.970 -2.481  -3.926  1.00 0.00 ? 21  CYS A CA   1  
ATOM   283   C  C    . CYS A 1 21 ? -14.200 -1.579  -3.962  1.00 0.00 ? 21  CYS A C    1  
ATOM   284   O  O    . CYS A 1 21 ? -15.164 -1.795  -3.226  1.00 0.00 ? 21  CYS A O    1  
ATOM   285   C  CB   . CYS A 1 21 ? -12.365 -2.481  -2.521  1.00 0.00 ? 21  CYS A CB   1  
ATOM   286   S  SG   . CYS A 1 21 ? -11.955 -0.823  -1.887  1.00 0.00 ? 21  CYS A SG   1  
ATOM   287   H  H    . CYS A 1 21 ? -11.495 -1.207  -4.752  1.00 0.00 ? 21  CYS A H    1  
ATOM   288   H  HA   . CYS A 1 21 ? -13.268 -3.487  -4.180  1.00 0.00 ? 21  CYS A HA   1  
ATOM   289   H  HB2  . CYS A 1 21 ? -13.069 -2.929  -1.834  1.00 0.00 ? 21  CYS A HB2  1  
ATOM   290   H  HB3  . CYS A 1 21 ? -11.457 -3.065  -2.528  1.00 0.00 ? 21  CYS A HB3  1  
ATOM   291   N  N    . HIS A 1 22 ? -14.161 -0.569  -4.825  1.00 0.00 ? 22  HIS A N    1  
ATOM   292   C  CA   . HIS A 1 22 ? -15.273 0.366   -4.958  1.00 0.00 ? 22  HIS A CA   1  
ATOM   293   C  C    . HIS A 1 22 ? -15.648 0.962   -3.604  1.00 0.00 ? 22  HIS A C    1  
ATOM   294   O  O    . HIS A 1 22 ? -16.802 0.892   -3.183  1.00 0.00 ? 22  HIS A O    1  
ATOM   295   C  CB   . HIS A 1 22 ? -16.485 -0.335  -5.573  1.00 0.00 ? 22  HIS A CB   1  
ATOM   296   C  CG   . HIS A 1 22 ? -16.375 -0.533  -7.053  1.00 0.00 ? 22  HIS A CG   1  
ATOM   297   N  ND1  . HIS A 1 22 ? -16.061 -1.746  -7.629  1.00 0.00 ? 22  HIS A ND1  1  
ATOM   298   C  CD2  . HIS A 1 22 ? -16.541 0.336   -8.078  1.00 0.00 ? 22  HIS A CD2  1  
ATOM   299   C  CE1  . HIS A 1 22 ? -16.036 -1.615  -8.943  1.00 0.00 ? 22  HIS A CE1  1  
ATOM   300   N  NE2  . HIS A 1 22 ? -16.325 -0.361  -9.241  1.00 0.00 ? 22  HIS A NE2  1  
ATOM   301   H  H    . HIS A 1 22 ? -13.366 -0.449  -5.384  1.00 0.00 ? 22  HIS A H    1  
ATOM   302   H  HA   . HIS A 1 22 ? -14.959 1.164   -5.614  1.00 0.00 ? 22  HIS A HA   1  
ATOM   303   H  HB2  . HIS A 1 22 ? -16.601 -1.307  -5.116  1.00 0.00 ? 22  HIS A HB2  1  
ATOM   304   H  HB3  . HIS A 1 22 ? -17.370 0.255   -5.381  1.00 0.00 ? 22  HIS A HB3  1  
ATOM   305   H  HD1  . HIS A 1 22 ? -15.880 -2.579  -7.146  1.00 0.00 ? 22  HIS A HD1  1  
ATOM   306   H  HD2  . HIS A 1 22 ? -16.796 1.383   -7.996  1.00 0.00 ? 22  HIS A HD2  1  
ATOM   307   H  HE1  . HIS A 1 22 ? -15.818 -2.398  -9.653  1.00 0.00 ? 22  HIS A HE1  1  
ATOM   308   N  N    . ALA A 1 23 ? -14.664 1.546   -2.928  1.00 0.00 ? 23  ALA A N    1  
ATOM   309   C  CA   . ALA A 1 23 ? -14.891 2.154   -1.623  1.00 0.00 ? 23  ALA A CA   1  
ATOM   310   C  C    . ALA A 1 23 ? -14.167 3.491   -1.507  1.00 0.00 ? 23  ALA A C    1  
ATOM   311   O  O    . ALA A 1 23 ? -13.000 3.610   -1.882  1.00 0.00 ? 23  ALA A O    1  
ATOM   312   C  CB   . ALA A 1 23 ? -14.443 1.211   -0.516  1.00 0.00 ? 23  ALA A CB   1  
ATOM   313   H  H    . ALA A 1 23 ? -13.765 1.569   -3.316  1.00 0.00 ? 23  ALA A H    1  
ATOM   314   H  HA   . ALA A 1 23 ? -15.953 2.320   -1.512  1.00 0.00 ? 23  ALA A HA   1  
ATOM   315   H  HB1  . ALA A 1 23 ? -13.393 0.989   -0.637  1.00 0.00 ? 23  ALA A HB1  1  
ATOM   316   H  HB2  . ALA A 1 23 ? -14.604 1.680   0.444   1.00 0.00 ? 23  ALA A HB2  1  
ATOM   317   H  HB3  . ALA A 1 23 ? -15.013 0.296   -0.570  1.00 0.00 ? 23  ALA A HB3  1  
ATOM   318   N  N    . ILE A 1 24 ? -14.866 4.494   -0.987  1.00 0.00 ? 24  ILE A N    1  
ATOM   319   C  CA   . ILE A 1 24 ? -14.289 5.822   -0.822  1.00 0.00 ? 24  ILE A CA   1  
ATOM   320   C  C    . ILE A 1 24 ? -12.816 5.737   -0.437  1.00 0.00 ? 24  ILE A C    1  
ATOM   321   O  O    . ILE A 1 24 ? -12.403 4.828   0.283   1.00 0.00 ? 24  ILE A O    1  
ATOM   322   C  CB   . ILE A 1 24 ? -15.042 6.634   0.249   1.00 0.00 ? 24  ILE A CB   1  
ATOM   323   C  CG1  . ILE A 1 24 ? -16.493 6.862   -0.179  1.00 0.00 ? 24  ILE A CG1  1  
ATOM   324   C  CG2  . ILE A 1 24 ? -14.341 7.962   0.496   1.00 0.00 ? 24  ILE A CG2  1  
ATOM   325   C  CD1  . ILE A 1 24 ? -16.642 7.874   -1.294  1.00 0.00 ? 24  ILE A CD1  1  
ATOM   326   H  H    . ILE A 1 24 ? -15.792 4.337   -0.706  1.00 0.00 ? 24  ILE A H    1  
ATOM   327   H  HA   . ILE A 1 24 ? -14.374 6.342   -1.765  1.00 0.00 ? 24  ILE A HA   1  
ATOM   328   H  HB   . ILE A 1 24 ? -15.030 6.072   1.170   1.00 0.00 ? 24  ILE A HB   1  
ATOM   329   H  HG12 . ILE A 1 24 ? -16.912 5.929   -0.521  1.00 0.00 ? 24  ILE A HG12 1  
ATOM   330   H  HG13 . ILE A 1 24 ? -17.059 7.217   0.670   1.00 0.00 ? 24  ILE A HG13 1  
ATOM   331   H  HG21 . ILE A 1 24 ? -13.732 7.888   1.384   1.00 0.00 ? 24  ILE A HG21 1  
ATOM   332   H  HG22 . ILE A 1 24 ? -13.715 8.201   -0.350  1.00 0.00 ? 24  ILE A HG22 1  
ATOM   333   H  HG23 . ILE A 1 24 ? -15.079 8.739   0.629   1.00 0.00 ? 24  ILE A HG23 1  
ATOM   334   H  HD11 . ILE A 1 24 ? -17.683 7.956   -1.570  1.00 0.00 ? 24  ILE A HD11 1  
ATOM   335   H  HD12 . ILE A 1 24 ? -16.280 8.835   -0.960  1.00 0.00 ? 24  ILE A HD12 1  
ATOM   336   H  HD13 . ILE A 1 24 ? -16.068 7.552   -2.151  1.00 0.00 ? 24  ILE A HD13 1  
ATOM   337   N  N    . ILE A 1 25 ? -12.028 6.692   -0.920  1.00 0.00 ? 25  ILE A N    1  
ATOM   338   C  CA   . ILE A 1 25 ? -10.601 6.726   -0.624  1.00 0.00 ? 25  ILE A CA   1  
ATOM   339   C  C    . ILE A 1 25 ? -10.240 7.959   0.198   1.00 0.00 ? 25  ILE A C    1  
ATOM   340   O  O    . ILE A 1 25 ? -9.600  8.885   -0.301  1.00 0.00 ? 25  ILE A O    1  
ATOM   341   C  CB   . ILE A 1 25 ? -9.758  6.718   -1.914  1.00 0.00 ? 25  ILE A CB   1  
ATOM   342   C  CG1  . ILE A 1 25 ? -9.962  5.406   -2.674  1.00 0.00 ? 25  ILE A CG1  1  
ATOM   343   C  CG2  . ILE A 1 25 ? -8.287  6.924   -1.586  1.00 0.00 ? 25  ILE A CG2  1  
ATOM   344   C  CD1  . ILE A 1 25 ? -9.707  5.523   -4.160  1.00 0.00 ? 25  ILE A CD1  1  
ATOM   345   H  H    . ILE A 1 25 ? -12.415 7.389   -1.489  1.00 0.00 ? 25  ILE A H    1  
ATOM   346   H  HA   . ILE A 1 25 ? -10.358 5.842   -0.054  1.00 0.00 ? 25  ILE A HA   1  
ATOM   347   H  HB   . ILE A 1 25 ? -10.083 7.540   -2.534  1.00 0.00 ? 25  ILE A HB   1  
ATOM   348   H  HG12 . ILE A 1 25 ? -9.289  4.661   -2.280  1.00 0.00 ? 25  ILE A HG12 1  
ATOM   349   H  HG13 . ILE A 1 25 ? -10.981 5.074   -2.536  1.00 0.00 ? 25  ILE A HG13 1  
ATOM   350   H  HG21 . ILE A 1 25 ? -7.730  6.040   -1.859  1.00 0.00 ? 25  ILE A HG21 1  
ATOM   351   H  HG22 . ILE A 1 25 ? -7.911  7.771   -2.140  1.00 0.00 ? 25  ILE A HG22 1  
ATOM   352   H  HG23 . ILE A 1 25 ? -8.176  7.107   -0.528  1.00 0.00 ? 25  ILE A HG23 1  
ATOM   353   H  HD11 . ILE A 1 25 ? -9.114  4.684   -4.491  1.00 0.00 ? 25  ILE A HD11 1  
ATOM   354   H  HD12 . ILE A 1 25 ? -10.649 5.531   -4.688  1.00 0.00 ? 25  ILE A HD12 1  
ATOM   355   H  HD13 . ILE A 1 25 ? -9.174  6.441   -4.363  1.00 0.00 ? 25  ILE A HD13 1  
ATOM   356   N  N    . ASP A 1 26 ? -10.652 7.962   1.461   1.00 0.00 ? 26  ASP A N    1  
ATOM   357   C  CA   . ASP A 1 26 ? -10.370 9.079   2.354   1.00 0.00 ? 26  ASP A CA   1  
ATOM   358   C  C    . ASP A 1 26 ? -8.957  9.609   2.132   1.00 0.00 ? 26  ASP A C    1  
ATOM   359   O  O    . ASP A 1 26 ? -8.769  10.773  1.781   1.00 0.00 ? 26  ASP A O    1  
ATOM   360   C  CB   . ASP A 1 26 ? -10.545 8.651   3.812   1.00 0.00 ? 26  ASP A CB   1  
ATOM   361   C  CG   . ASP A 1 26 ? -11.671 7.652   3.991   1.00 0.00 ? 26  ASP A CG   1  
ATOM   362   O  OD1  . ASP A 1 26 ? -12.731 7.834   3.356   1.00 0.00 ? 26  ASP A OD1  1  
ATOM   363   O  OD2  . ASP A 1 26 ? -11.494 6.690   4.767   1.00 0.00 ? 26  ASP A OD2  1  
ATOM   364   H  H    . ASP A 1 26 ? -11.159 7.194   1.800   1.00 0.00 ? 26  ASP A H    1  
ATOM   365   H  HA   . ASP A 1 26 ? -11.075 9.867   2.133   1.00 0.00 ? 26  ASP A HA   1  
ATOM   366   H  HB2  . ASP A 1 26 ? -9.628  8.197   4.159   1.00 0.00 ? 26  ASP A HB2  1  
ATOM   367   H  HB3  . ASP A 1 26 ? -10.760 9.522   4.413   1.00 0.00 ? 26  ASP A HB3  1  
ATOM   368   N  N    . GLU A 1 27 ? -7.967  8.746   2.341   1.00 0.00 ? 27  GLU A N    1  
ATOM   369   C  CA   . GLU A 1 27 ? -6.571  9.128   2.166   1.00 0.00 ? 27  GLU A CA   1  
ATOM   370   C  C    . GLU A 1 27 ? -6.240  9.314   0.688   1.00 0.00 ? 27  GLU A C    1  
ATOM   371   O  O    . GLU A 1 27 ? -7.076  9.070   -0.181  1.00 0.00 ? 27  GLU A O    1  
ATOM   372   C  CB   . GLU A 1 27 ? -5.649  8.072   2.778   1.00 0.00 ? 27  GLU A CB   1  
ATOM   373   C  CG   . GLU A 1 27 ? -5.819  6.690   2.170   1.00 0.00 ? 27  GLU A CG   1  
ATOM   374   C  CD   . GLU A 1 27 ? -4.635  5.783   2.445   1.00 0.00 ? 27  GLU A CD   1  
ATOM   375   O  OE1  . GLU A 1 27 ? -3.526  6.093   1.963   1.00 0.00 ? 27  GLU A OE1  1  
ATOM   376   O  OE2  . GLU A 1 27 ? -4.818  4.762   3.141   1.00 0.00 ? 27  GLU A OE2  1  
ATOM   377   H  H    . GLU A 1 27 ? -8.181  7.831   2.620   1.00 0.00 ? 27  GLU A H    1  
ATOM   378   H  HA   . GLU A 1 27 ? -6.418  10.067  2.677   1.00 0.00 ? 27  GLU A HA   1  
ATOM   379   H  HB2  . GLU A 1 27 ? -4.624  8.382   2.638   1.00 0.00 ? 27  GLU A HB2  1  
ATOM   380   H  HB3  . GLU A 1 27 ? -5.853  8.004   3.836   1.00 0.00 ? 27  GLU A HB3  1  
ATOM   381   H  HG2  . GLU A 1 27 ? -6.705  6.235   2.584   1.00 0.00 ? 27  GLU A HG2  1  
ATOM   382   H  HG3  . GLU A 1 27 ? -5.934  6.793   1.101   1.00 0.00 ? 27  GLU A HG3  1  
ATOM   383   N  N    . GLN A 1 28 ? -5.014  9.747   0.412   1.00 0.00 ? 28  GLN A N    1  
ATOM   384   C  CA   . GLN A 1 28 ? -4.572  9.967   -0.960  1.00 0.00 ? 28  GLN A CA   1  
ATOM   385   C  C    . GLN A 1 28 ? -4.801  8.722   -1.811  1.00 0.00 ? 28  GLN A C    1  
ATOM   386   O  O    . GLN A 1 28 ? -4.274  7.645   -1.533  1.00 0.00 ? 28  GLN A O    1  
ATOM   387   C  CB   . GLN A 1 28 ? -3.092  10.352  -0.986  1.00 0.00 ? 28  GLN A CB   1  
ATOM   388   C  CG   . GLN A 1 28 ? -2.615  10.843  -2.343  1.00 0.00 ? 28  GLN A CG   1  
ATOM   389   C  CD   . GLN A 1 28 ? -3.469  11.970  -2.890  1.00 0.00 ? 28  GLN A CD   1  
ATOM   390   O  OE1  . GLN A 1 28 ? -4.022  12.768  -2.132  1.00 0.00 ? 28  GLN A OE1  1  
ATOM   391   N  NE2  . GLN A 1 28 ? -3.582  12.042  -4.211  1.00 0.00 ? 28  GLN A NE2  1  
ATOM   392   H  H    . GLN A 1 28 ? -4.393  9.924   1.148   1.00 0.00 ? 28  GLN A H    1  
ATOM   393   H  HA   . GLN A 1 28 ? -5.153  10.779  -1.369  1.00 0.00 ? 28  GLN A HA   1  
ATOM   394   H  HB2  . GLN A 1 28 ? -2.924  11.137  -0.264  1.00 0.00 ? 28  GLN A HB2  1  
ATOM   395   H  HB3  . GLN A 1 28 ? -2.503  9.489   -0.713  1.00 0.00 ? 28  GLN A HB3  1  
ATOM   396   H  HG2  . GLN A 1 28 ? -1.599  11.197  -2.248  1.00 0.00 ? 28  GLN A HG2  1  
ATOM   397   H  HG3  . GLN A 1 28 ? -2.644  10.019  -3.040  1.00 0.00 ? 28  GLN A HG3  1  
ATOM   398   H  HE21 . GLN A 1 28 ? -3.114  11.371  -4.752  1.00 0.00 ? 28  GLN A HE21 1  
ATOM   399   H  HE22 . GLN A 1 28 ? -4.128  12.759  -4.591  1.00 0.00 ? 28  GLN A HE22 1  
ATOM   400   N  N    . PRO A 1 29 ? -5.605  8.871   -2.874  1.00 0.00 ? 29  PRO A N    1  
ATOM   401   C  CA   . PRO A 1 29 ? -5.922  7.769   -3.787  1.00 0.00 ? 29  PRO A CA   1  
ATOM   402   C  C    . PRO A 1 29 ? -4.722  7.352   -4.631  1.00 0.00 ? 29  PRO A C    1  
ATOM   403   O  O    . PRO A 1 29 ? -4.090  8.185   -5.283  1.00 0.00 ? 29  PRO A O    1  
ATOM   404   C  CB   . PRO A 1 29 ? -7.024  8.350   -4.676  1.00 0.00 ? 29  PRO A CB   1  
ATOM   405   C  CG   . PRO A 1 29 ? -6.805  9.823   -4.637  1.00 0.00 ? 29  PRO A CG   1  
ATOM   406   C  CD   . PRO A 1 29 ? -6.268  10.126  -3.266  1.00 0.00 ? 29  PRO A CD   1  
ATOM   407   H  HA   . PRO A 1 29 ? -6.302  6.909   -3.255  1.00 0.00 ? 29  PRO A HA   1  
ATOM   408   H  HB2  . PRO A 1 29 ? -6.924  7.961   -5.679  1.00 0.00 ? 29  PRO A HB2  1  
ATOM   409   H  HB3  . PRO A 1 29 ? -7.992  8.085   -4.276  1.00 0.00 ? 29  PRO A HB3  1  
ATOM   410   H  HG2  . PRO A 1 29 ? -6.087  10.107  -5.392  1.00 0.00 ? 29  PRO A HG2  1  
ATOM   411   H  HG3  . PRO A 1 29 ? -7.741  10.338  -4.795  1.00 0.00 ? 29  PRO A HG3  1  
ATOM   412   H  HD2  . PRO A 1 29 ? -5.558  10.939  -3.309  1.00 0.00 ? 29  PRO A HD2  1  
ATOM   413   H  HD3  . PRO A 1 29 ? -7.075  10.363  -2.588  1.00 0.00 ? 29  PRO A HD3  1  
ATOM   414   N  N    . LEU A 1 30 ? -4.413  6.060   -4.615  1.00 0.00 ? 30  LEU A N    1  
ATOM   415   C  CA   . LEU A 1 30 ? -3.289  5.533   -5.380  1.00 0.00 ? 30  LEU A CA   1  
ATOM   416   C  C    . LEU A 1 30 ? -3.657  5.376   -6.852  1.00 0.00 ? 30  LEU A C    1  
ATOM   417   O  O    . LEU A 1 30 ? -4.417  4.479   -7.219  1.00 0.00 ? 30  LEU A O    1  
ATOM   418   C  CB   . LEU A 1 30 ? -2.844  4.186   -4.807  1.00 0.00 ? 30  LEU A CB   1  
ATOM   419   C  CG   . LEU A 1 30 ? -2.132  3.245   -5.780  1.00 0.00 ? 30  LEU A CG   1  
ATOM   420   C  CD1  . LEU A 1 30 ? -0.699  3.700   -6.010  1.00 0.00 ? 30  LEU A CD1  1  
ATOM   421   C  CD2  . LEU A 1 30 ? -2.163  1.816   -5.258  1.00 0.00 ? 30  LEU A CD2  1  
ATOM   422   H  H    . LEU A 1 30 ? -4.954  5.446   -4.077  1.00 0.00 ? 30  LEU A H    1  
ATOM   423   H  HA   . LEU A 1 30 ? -2.474  6.237   -5.299  1.00 0.00 ? 30  LEU A HA   1  
ATOM   424   H  HB2  . LEU A 1 30 ? -2.172  4.382   -3.986  1.00 0.00 ? 30  LEU A HB2  1  
ATOM   425   H  HB3  . LEU A 1 30 ? -3.723  3.678   -4.438  1.00 0.00 ? 30  LEU A HB3  1  
ATOM   426   H  HG   . LEU A 1 30 ? -2.645  3.266   -6.732  1.00 0.00 ? 30  LEU A HG   1  
ATOM   427   H  HD11 . LEU A 1 30 ? -0.129  2.890   -6.440  1.00 0.00 ? 30  LEU A HD11 1  
ATOM   428   H  HD12 . LEU A 1 30 ? -0.258  3.991   -5.068  1.00 0.00 ? 30  LEU A HD12 1  
ATOM   429   H  HD13 . LEU A 1 30 ? -0.693  4.543   -6.686  1.00 0.00 ? 30  LEU A HD13 1  
ATOM   430   H  HD21 . LEU A 1 30 ? -1.152  1.459   -5.130  1.00 0.00 ? 30  LEU A HD21 1  
ATOM   431   H  HD22 . LEU A 1 30 ? -2.680  1.186   -5.967  1.00 0.00 ? 30  LEU A HD22 1  
ATOM   432   H  HD23 . LEU A 1 30 ? -2.677  1.790   -4.309  1.00 0.00 ? 30  LEU A HD23 1  
ATOM   433   N  N    . ILE A 1 31 ? -3.112  6.251   -7.690  1.00 0.00 ? 31  ILE A N    1  
ATOM   434   C  CA   . ILE A 1 31 ? -3.381  6.207   -9.122  1.00 0.00 ? 31  ILE A CA   1  
ATOM   435   C  C    . ILE A 1 31 ? -2.536  5.138   -9.807  1.00 0.00 ? 31  ILE A C    1  
ATOM   436   O  O    . ILE A 1 31 ? -1.311  5.128   -9.686  1.00 0.00 ? 31  ILE A O    1  
ATOM   437   C  CB   . ILE A 1 31 ? -3.106  7.568   -9.788  1.00 0.00 ? 31  ILE A CB   1  
ATOM   438   C  CG1  . ILE A 1 31 ? -3.889  8.675   -9.080  1.00 0.00 ? 31  ILE A CG1  1  
ATOM   439   C  CG2  . ILE A 1 31 ? -3.468  7.517   -11.265 1.00 0.00 ? 31  ILE A CG2  1  
ATOM   440   C  CD1  . ILE A 1 31 ? -5.390  8.521   -9.193  1.00 0.00 ? 31  ILE A CD1  1  
ATOM   441   H  H    . ILE A 1 31 ? -2.514  6.942   -7.337  1.00 0.00 ? 31  ILE A H    1  
ATOM   442   H  HA   . ILE A 1 31 ? -4.425  5.967   -9.257  1.00 0.00 ? 31  ILE A HA   1  
ATOM   443   H  HB   . ILE A 1 31 ? -2.050  7.776   -9.708  1.00 0.00 ? 31  ILE A HB   1  
ATOM   444   H  HG12 . ILE A 1 31 ? -3.634  8.674   -8.032  1.00 0.00 ? 31  ILE A HG12 1  
ATOM   445   H  HG13 . ILE A 1 31 ? -3.619  9.628   -9.511  1.00 0.00 ? 31  ILE A HG13 1  
ATOM   446   H  HG21 . ILE A 1 31 ? -4.324  8.149   -11.447 1.00 0.00 ? 31  ILE A HG21 1  
ATOM   447   H  HG22 . ILE A 1 31 ? -2.632  7.867   -11.852 1.00 0.00 ? 31  ILE A HG22 1  
ATOM   448   H  HG23 . ILE A 1 31 ? -3.704  6.501   -11.543 1.00 0.00 ? 31  ILE A HG23 1  
ATOM   449   H  HD11 . ILE A 1 31 ? -5.873  9.158   -8.468  1.00 0.00 ? 31  ILE A HD11 1  
ATOM   450   H  HD12 . ILE A 1 31 ? -5.707  8.799   -10.187 1.00 0.00 ? 31  ILE A HD12 1  
ATOM   451   H  HD13 . ILE A 1 31 ? -5.661  7.492   -9.004  1.00 0.00 ? 31  ILE A HD13 1  
ATOM   452   N  N    . PHE A 1 32 ? -3.199  4.240   -10.528 1.00 0.00 ? 32  PHE A N    1  
ATOM   453   C  CA   . PHE A 1 32 ? -2.509  3.167   -11.235 1.00 0.00 ? 32  PHE A CA   1  
ATOM   454   C  C    . PHE A 1 32 ? -3.201  2.855   -12.559 1.00 0.00 ? 32  PHE A C    1  
ATOM   455   O  O    . PHE A 1 32 ? -4.385  2.520   -12.590 1.00 0.00 ? 32  PHE A O    1  
ATOM   456   C  CB   . PHE A 1 32 ? -2.455  1.909   -10.366 1.00 0.00 ? 32  PHE A CB   1  
ATOM   457   C  CG   . PHE A 1 32 ? -1.557  0.838   -10.916 1.00 0.00 ? 32  PHE A CG   1  
ATOM   458   C  CD1  . PHE A 1 32 ? -0.183  1.015   -10.945 1.00 0.00 ? 32  PHE A CD1  1  
ATOM   459   C  CD2  . PHE A 1 32 ? -2.087  -0.346  -11.404 1.00 0.00 ? 32  PHE A CD2  1  
ATOM   460   C  CE1  . PHE A 1 32 ? 0.645   0.032   -11.452 1.00 0.00 ? 32  PHE A CE1  1  
ATOM   461   C  CE2  . PHE A 1 32 ? -1.263  -1.333  -11.912 1.00 0.00 ? 32  PHE A CE2  1  
ATOM   462   C  CZ   . PHE A 1 32 ? 0.105   -1.144  -11.935 1.00 0.00 ? 32  PHE A CZ   1  
ATOM   463   H  H    . PHE A 1 32 ? -4.176  4.301   -10.587 1.00 0.00 ? 32  PHE A H    1  
ATOM   464   H  HA   . PHE A 1 32 ? -1.503  3.498   -11.437 1.00 0.00 ? 32  PHE A HA   1  
ATOM   465   H  HB2  . PHE A 1 32 ? -2.092  2.173   -9.384  1.00 0.00 ? 32  PHE A HB2  1  
ATOM   466   H  HB3  . PHE A 1 32 ? -3.450  1.497   -10.279 1.00 0.00 ? 32  PHE A HB3  1  
ATOM   467   H  HD1  . PHE A 1 32 ? 0.241   1.934   -10.567 1.00 0.00 ? 32  PHE A HD1  1  
ATOM   468   H  HD2  . PHE A 1 32 ? -3.157  -0.494  -11.386 1.00 0.00 ? 32  PHE A HD2  1  
ATOM   469   H  HE1  . PHE A 1 32 ? 1.714   0.182   -11.469 1.00 0.00 ? 32  PHE A HE1  1  
ATOM   470   H  HE2  . PHE A 1 32 ? -1.689  -2.251  -12.289 1.00 0.00 ? 32  PHE A HE2  1  
ATOM   471   H  HZ   . PHE A 1 32 ? 0.750   -1.913  -12.332 1.00 0.00 ? 32  PHE A HZ   1  
ATOM   472   N  N    . LYS A 1 33 ? -2.453  2.969   -13.651 1.00 0.00 ? 33  LYS A N    1  
ATOM   473   C  CA   . LYS A 1 33 ? -2.991  2.699   -14.979 1.00 0.00 ? 33  LYS A CA   1  
ATOM   474   C  C    . LYS A 1 33 ? -4.157  3.631   -15.293 1.00 0.00 ? 33  LYS A C    1  
ATOM   475   O  O    . LYS A 1 33 ? -5.124  3.233   -15.941 1.00 0.00 ? 33  LYS A O    1  
ATOM   476   C  CB   . LYS A 1 33 ? -3.446  1.242   -15.081 1.00 0.00 ? 33  LYS A CB   1  
ATOM   477   C  CG   . LYS A 1 33 ? -2.321  0.238   -14.897 1.00 0.00 ? 33  LYS A CG   1  
ATOM   478   C  CD   . LYS A 1 33 ? -2.789  -1.181  -15.172 1.00 0.00 ? 33  LYS A CD   1  
ATOM   479   C  CE   . LYS A 1 33 ? -1.615  -2.135  -15.326 1.00 0.00 ? 33  LYS A CE   1  
ATOM   480   N  NZ   . LYS A 1 33 ? -1.971  -3.324  -16.149 1.00 0.00 ? 33  LYS A NZ   1  
ATOM   481   H  H    . LYS A 1 33 ? -1.514  3.240   -13.561 1.00 0.00 ? 33  LYS A H    1  
ATOM   482   H  HA   . LYS A 1 33 ? -2.204  2.872   -15.697 1.00 0.00 ? 33  LYS A HA   1  
ATOM   483   H  HB2  . LYS A 1 33 ? -4.193  1.057   -14.322 1.00 0.00 ? 33  LYS A HB2  1  
ATOM   484   H  HB3  . LYS A 1 33 ? -3.887  1.082   -16.054 1.00 0.00 ? 33  LYS A HB3  1  
ATOM   485   H  HG2  . LYS A 1 33 ? -1.520  0.480   -15.580 1.00 0.00 ? 33  LYS A HG2  1  
ATOM   486   H  HG3  . LYS A 1 33 ? -1.960  0.298   -13.880 1.00 0.00 ? 33  LYS A HG3  1  
ATOM   487   H  HD2  . LYS A 1 33 ? -3.403  -1.514  -14.348 1.00 0.00 ? 33  LYS A HD2  1  
ATOM   488   H  HD3  . LYS A 1 33 ? -3.371  -1.189  -16.083 1.00 0.00 ? 33  LYS A HD3  1  
ATOM   489   H  HE2  . LYS A 1 33 ? -0.801  -1.610  -15.802 1.00 0.00 ? 33  LYS A HE2  1  
ATOM   490   H  HE3  . LYS A 1 33 ? -1.305  -2.466  -14.346 1.00 0.00 ? 33  LYS A HE3  1  
ATOM   491   H  HZ1  . LYS A 1 33 ? -1.752  -4.197  -15.628 1.00 0.00 ? 33  LYS A HZ1  1  
ATOM   492   H  HZ2  . LYS A 1 33 ? -1.429  -3.319  -17.037 1.00 0.00 ? 33  LYS A HZ2  1  
ATOM   493   H  HZ3  . LYS A 1 33 ? -2.986  -3.312  -16.375 1.00 0.00 ? 33  LYS A HZ3  1  
ATOM   494   N  N    . ASN A 1 34 ? -4.058  4.873   -14.830 1.00 0.00 ? 34  ASN A N    1  
ATOM   495   C  CA   . ASN A 1 34 ? -5.105  5.861   -15.063 1.00 0.00 ? 34  ASN A CA   1  
ATOM   496   C  C    . ASN A 1 34 ? -6.393  5.468   -14.346 1.00 0.00 ? 34  ASN A C    1  
ATOM   497   O  O    . ASN A 1 34 ? -7.475  5.495   -14.933 1.00 0.00 ? 34  ASN A O    1  
ATOM   498   C  CB   . ASN A 1 34 ? -5.367  6.012   -16.562 1.00 0.00 ? 34  ASN A CB   1  
ATOM   499   C  CG   . ASN A 1 34 ? -6.130  7.282   -16.891 1.00 0.00 ? 34  ASN A CG   1  
ATOM   500   O  OD1  . ASN A 1 34 ? -6.310  8.149   -16.036 1.00 0.00 ? 34  ASN A OD1  1  
ATOM   501   N  ND2  . ASN A 1 34 ? -6.581  7.396   -18.134 1.00 0.00 ? 34  ASN A ND2  1  
ATOM   502   H  H    . ASN A 1 34 ? -3.262  5.131   -14.319 1.00 0.00 ? 34  ASN A H    1  
ATOM   503   H  HA   . ASN A 1 34 ? -4.761  6.806   -14.669 1.00 0.00 ? 34  ASN A HA   1  
ATOM   504   H  HB2  . ASN A 1 34 ? -4.423  6.037   -17.087 1.00 0.00 ? 34  ASN A HB2  1  
ATOM   505   H  HB3  . ASN A 1 34 ? -5.944  5.168   -16.908 1.00 0.00 ? 34  ASN A HB3  1  
ATOM   506   H  HD21 . ASN A 1 34 ? -6.399  6.665   -18.762 1.00 0.00 ? 34  ASN A HD21 1  
ATOM   507   H  HD22 . ASN A 1 34 ? -7.076  8.207   -18.374 1.00 0.00 ? 34  ASN A HD22 1  
ATOM   508   N  N    . ASP A 1 35 ? -6.269  5.103   -13.075 1.00 0.00 ? 35  ASP A N    1  
ATOM   509   C  CA   . ASP A 1 35 ? -7.423  4.706   -12.277 1.00 0.00 ? 35  ASP A CA   1  
ATOM   510   C  C    . ASP A 1 35 ? -7.096  4.752   -10.788 1.00 0.00 ? 35  ASP A C    1  
ATOM   511   O  O    . ASP A 1 35 ? -6.006  4.377   -10.355 1.00 0.00 ? 35  ASP A O    1  
ATOM   512   C  CB   . ASP A 1 35 ? -7.881  3.300   -12.668 1.00 0.00 ? 35  ASP A CB   1  
ATOM   513   C  CG   . ASP A 1 35 ? -8.594  3.274   -14.006 1.00 0.00 ? 35  ASP A CG   1  
ATOM   514   O  OD1  . ASP A 1 35 ? -9.614  3.980   -14.147 1.00 0.00 ? 35  ASP A OD1  1  
ATOM   515   O  OD2  . ASP A 1 35 ? -8.133  2.548   -14.911 1.00 0.00 ? 35  ASP A OD2  1  
ATOM   516   H  H    . ASP A 1 35 ? -5.379  5.102   -12.663 1.00 0.00 ? 35  ASP A H    1  
ATOM   517   H  HA   . ASP A 1 35 ? -8.222  5.404   -12.479 1.00 0.00 ? 35  ASP A HA   1  
ATOM   518   H  HB2  . ASP A 1 35 ? -7.018  2.652   -12.729 1.00 0.00 ? 35  ASP A HB2  1  
ATOM   519   H  HB3  . ASP A 1 35 ? -8.555  2.925   -11.913 1.00 0.00 ? 35  ASP A HB3  1  
ATOM   520   N  N    . PRO A 1 36 ? -8.061  5.225   -9.984  1.00 0.00 ? 36  PRO A N    1  
ATOM   521   C  CA   . PRO A 1 36 ? -7.898  5.332   -8.531  1.00 0.00 ? 36  PRO A CA   1  
ATOM   522   C  C    . PRO A 1 36 ? -7.863  3.968   -7.850  1.00 0.00 ? 36  PRO A C    1  
ATOM   523   O  O    . PRO A 1 36 ? -8.548  3.035   -8.270  1.00 0.00 ? 36  PRO A O    1  
ATOM   524   C  CB   . PRO A 1 36 ? -9.138  6.117   -8.093  1.00 0.00 ? 36  PRO A CB   1  
ATOM   525   C  CG   . PRO A 1 36 ? -10.152 5.842   -9.149  1.00 0.00 ? 36  PRO A CG   1  
ATOM   526   C  CD   . PRO A 1 36 ? -9.384  5.690   -10.432 1.00 0.00 ? 36  PRO A CD   1  
ATOM   527   H  HA   . PRO A 1 36 ? -7.009  5.887   -8.271  1.00 0.00 ? 36  PRO A HA   1  
ATOM   528   H  HB2  . PRO A 1 36 ? -9.467  5.763   -7.126  1.00 0.00 ? 36  PRO A HB2  1  
ATOM   529   H  HB3  . PRO A 1 36 ? -8.901  7.168   -8.037  1.00 0.00 ? 36  PRO A HB3  1  
ATOM   530   H  HG2  . PRO A 1 36 ? -10.684 4.931   -8.920  1.00 0.00 ? 36  PRO A HG2  1  
ATOM   531   H  HG3  . PRO A 1 36 ? -10.840 6.672   -9.221  1.00 0.00 ? 36  PRO A HG3  1  
ATOM   532   H  HD2  . PRO A 1 36 ? -9.855  4.956   -11.069 1.00 0.00 ? 36  PRO A HD2  1  
ATOM   533   H  HD3  . PRO A 1 36 ? -9.306  6.640   -10.941 1.00 0.00 ? 36  PRO A HD3  1  
ATOM   534   N  N    . TYR A 1 37 ? -7.061  3.860   -6.796  1.00 0.00 ? 37  TYR A N    1  
ATOM   535   C  CA   . TYR A 1 37 ? -6.935  2.609   -6.058  1.00 0.00 ? 37  TYR A CA   1  
ATOM   536   C  C    . TYR A 1 37 ? -6.402  2.859   -4.650  1.00 0.00 ? 37  TYR A C    1  
ATOM   537   O  O    . TYR A 1 37 ? -5.903  3.943   -4.346  1.00 0.00 ? 37  TYR A O    1  
ATOM   538   C  CB   . TYR A 1 37 ? -6.010  1.644   -6.801  1.00 0.00 ? 37  TYR A CB   1  
ATOM   539   C  CG   . TYR A 1 37 ? -6.555  1.191   -8.137  1.00 0.00 ? 37  TYR A CG   1  
ATOM   540   C  CD1  . TYR A 1 37 ? -7.665  0.358   -8.210  1.00 0.00 ? 37  TYR A CD1  1  
ATOM   541   C  CD2  . TYR A 1 37 ? -5.961  1.596   -9.326  1.00 0.00 ? 37  TYR A CD2  1  
ATOM   542   C  CE1  . TYR A 1 37 ? -8.166  -0.059  -9.428  1.00 0.00 ? 37  TYR A CE1  1  
ATOM   543   C  CE2  . TYR A 1 37 ? -6.456  1.186   -10.548 1.00 0.00 ? 37  TYR A CE2  1  
ATOM   544   C  CZ   . TYR A 1 37 ? -7.558  0.357   -10.594 1.00 0.00 ? 37  TYR A CZ   1  
ATOM   545   O  OH   . TYR A 1 37 ? -8.055  -0.055  -11.809 1.00 0.00 ? 37  TYR A OH   1  
ATOM   546   H  H    . TYR A 1 37 ? -6.540  4.638   -6.509  1.00 0.00 ? 37  TYR A H    1  
ATOM   547   H  HA   . TYR A 1 37 ? -7.918  2.166   -5.985  1.00 0.00 ? 37  TYR A HA   1  
ATOM   548   H  HB2  . TYR A 1 37 ? -5.062  2.129   -6.978  1.00 0.00 ? 37  TYR A HB2  1  
ATOM   549   H  HB3  . TYR A 1 37 ? -5.852  0.766   -6.192  1.00 0.00 ? 37  TYR A HB3  1  
ATOM   550   H  HD1  . TYR A 1 37 ? -8.138  0.034   -7.295  1.00 0.00 ? 37  TYR A HD1  1  
ATOM   551   H  HD2  . TYR A 1 37 ? -5.098  2.245   -9.287  1.00 0.00 ? 37  TYR A HD2  1  
ATOM   552   H  HE1  . TYR A 1 37 ? -9.029  -0.708  -9.464  1.00 0.00 ? 37  TYR A HE1  1  
ATOM   553   H  HE2  . TYR A 1 37 ? -5.981  1.511   -11.462 1.00 0.00 ? 37  TYR A HE2  1  
ATOM   554   H  HH   . TYR A 1 37 ? -8.298  0.713   -12.333 1.00 0.00 ? 37  TYR A HH   1  
ATOM   555   N  N    . HIS A 1 38 ? -6.511  1.847   -3.795  1.00 0.00 ? 38  HIS A N    1  
ATOM   556   C  CA   . HIS A 1 38 ? -6.039  1.955   -2.419  1.00 0.00 ? 38  HIS A CA   1  
ATOM   557   C  C    . HIS A 1 38 ? -4.573  1.546   -2.314  1.00 0.00 ? 38  HIS A C    1  
ATOM   558   O  O    . HIS A 1 38 ? -4.170  0.471   -2.759  1.00 0.00 ? 38  HIS A O    1  
ATOM   559   C  CB   . HIS A 1 38 ? -6.892  1.084   -1.496  1.00 0.00 ? 38  HIS A CB   1  
ATOM   560   C  CG   . HIS A 1 38 ? -8.187  1.721   -1.098  1.00 0.00 ? 38  HIS A CG   1  
ATOM   561   N  ND1  . HIS A 1 38 ? -9.399  1.067   -1.162  1.00 0.00 ? 38  HIS A ND1  1  
ATOM   562   C  CD2  . HIS A 1 38 ? -8.455  2.962   -0.626  1.00 0.00 ? 38  HIS A CD2  1  
ATOM   563   C  CE1  . HIS A 1 38 ? -10.357 1.878   -0.749  1.00 0.00 ? 38  HIS A CE1  1  
ATOM   564   N  NE2  . HIS A 1 38 ? -9.810  3.034   -0.418  1.00 0.00 ? 38  HIS A NE2  1  
ATOM   565   H  H    . HIS A 1 38 ? -6.918  1.008   -4.097  1.00 0.00 ? 38  HIS A H    1  
ATOM   566   H  HA   . HIS A 1 38 ? -6.135  2.986   -2.115  1.00 0.00 ? 38  HIS A HA   1  
ATOM   567   H  HB2  . HIS A 1 38 ? -7.120  0.155   -1.998  1.00 0.00 ? 38  HIS A HB2  1  
ATOM   568   H  HB3  . HIS A 1 38 ? -6.334  0.872   -0.594  1.00 0.00 ? 38  HIS A HB3  1  
ATOM   569   H  HD2  . HIS A 1 38 ? -7.737  3.749   -0.447  1.00 0.00 ? 38  HIS A HD2  1  
ATOM   570   H  HE1  . HIS A 1 38 ? -11.408 1.637   -0.692  1.00 0.00 ? 38  HIS A HE1  1  
ATOM   571   H  HE2  . HIS A 1 38 ? -10.306 3.839   -0.161  1.00 0.00 ? 38  HIS A HE2  1  
ATOM   572   N  N    . PRO A 1 39 ? -3.756  2.422   -1.711  1.00 0.00 ? 39  PRO A N    1  
ATOM   573   C  CA   . PRO A 1 39 ? -2.322  2.174   -1.534  1.00 0.00 ? 39  PRO A CA   1  
ATOM   574   C  C    . PRO A 1 39 ? -2.046  1.070   -0.519  1.00 0.00 ? 39  PRO A C    1  
ATOM   575   O  O    . PRO A 1 39 ? -0.892  0.730   -0.256  1.00 0.00 ? 39  PRO A O    1  
ATOM   576   C  CB   . PRO A 1 39 ? -1.790  3.516   -1.023  1.00 0.00 ? 39  PRO A CB   1  
ATOM   577   C  CG   . PRO A 1 39 ? -2.963  4.165   -0.373  1.00 0.00 ? 39  PRO A CG   1  
ATOM   578   C  CD   . PRO A 1 39 ? -4.168  3.723   -1.157  1.00 0.00 ? 39  PRO A CD   1  
ATOM   579   H  HA   . PRO A 1 39 ? -1.843  1.929   -2.471  1.00 0.00 ? 39  PRO A HA   1  
ATOM   580   H  HB2  . PRO A 1 39 ? -0.992  3.343   -0.315  1.00 0.00 ? 39  PRO A HB2  1  
ATOM   581   H  HB3  . PRO A 1 39 ? -1.424  4.101   -1.852  1.00 0.00 ? 39  PRO A HB3  1  
ATOM   582   H  HG2  . PRO A 1 39 ? -3.043  3.839   0.652   1.00 0.00 ? 39  PRO A HG2  1  
ATOM   583   H  HG3  . PRO A 1 39 ? -2.860  5.239   -0.420  1.00 0.00 ? 39  PRO A HG3  1  
ATOM   584   H  HD2  . PRO A 1 39 ? -5.022  3.611   -0.505  1.00 0.00 ? 39  PRO A HD2  1  
ATOM   585   H  HD3  . PRO A 1 39 ? -4.384  4.427   -1.947  1.00 0.00 ? 39  PRO A HD3  1  
ATOM   586   N  N    . ASP A 1 40 ? -3.111  0.514   0.047   1.00 0.00 ? 40  ASP A N    1  
ATOM   587   C  CA   . ASP A 1 40 ? -2.983  -0.554  1.032   1.00 0.00 ? 40  ASP A CA   1  
ATOM   588   C  C    . ASP A 1 40 ? -3.252  -1.915  0.397   1.00 0.00 ? 40  ASP A C    1  
ATOM   589   O  O    . ASP A 1 40 ? -2.875  -2.952  0.944   1.00 0.00 ? 40  ASP A O    1  
ATOM   590   C  CB   . ASP A 1 40 ? -3.948  -0.321  2.196   1.00 0.00 ? 40  ASP A CB   1  
ATOM   591   C  CG   . ASP A 1 40 ? -5.400  -0.410  1.770   1.00 0.00 ? 40  ASP A CG   1  
ATOM   592   O  OD1  . ASP A 1 40 ? -5.798  -1.466  1.236   1.00 0.00 ? 40  ASP A OD1  1  
ATOM   593   O  OD2  . ASP A 1 40 ? -6.139  0.578   1.971   1.00 0.00 ? 40  ASP A OD2  1  
ATOM   594   H  H    . ASP A 1 40 ? -4.005  0.828   -0.205  1.00 0.00 ? 40  ASP A H    1  
ATOM   595   H  HA   . ASP A 1 40 ? -1.971  -0.540  1.407   1.00 0.00 ? 40  ASP A HA   1  
ATOM   596   H  HB2  . ASP A 1 40 ? -3.770  -1.066  2.958   1.00 0.00 ? 40  ASP A HB2  1  
ATOM   597   H  HB3  . ASP A 1 40 ? -3.772  0.661   2.610   1.00 0.00 ? 40  ASP A HB3  1  
ATOM   598   N  N    . HIS A 1 41 ? -3.906  -1.903  -0.760  1.00 0.00 ? 41  HIS A N    1  
ATOM   599   C  CA   . HIS A 1 41 ? -4.226  -3.137  -1.470  1.00 0.00 ? 41  HIS A CA   1  
ATOM   600   C  C    . HIS A 1 41 ? -2.958  -3.810  -1.987  1.00 0.00 ? 41  HIS A C    1  
ATOM   601   O  O    . HIS A 1 41 ? -2.775  -5.017  -1.827  1.00 0.00 ? 41  HIS A O    1  
ATOM   602   C  CB   . HIS A 1 41 ? -5.176  -2.850  -2.633  1.00 0.00 ? 41  HIS A CB   1  
ATOM   603   C  CG   . HIS A 1 41 ? -6.605  -2.695  -2.215  1.00 0.00 ? 41  HIS A CG   1  
ATOM   604   N  ND1  . HIS A 1 41 ? -7.116  -3.248  -1.059  1.00 0.00 ? 41  HIS A ND1  1  
ATOM   605   C  CD2  . HIS A 1 41 ? -7.635  -2.043  -2.804  1.00 0.00 ? 41  HIS A CD2  1  
ATOM   606   C  CE1  . HIS A 1 41 ? -8.397  -2.944  -0.957  1.00 0.00 ? 41  HIS A CE1  1  
ATOM   607   N  NE2  . HIS A 1 41 ? -8.737  -2.213  -2.003  1.00 0.00 ? 41  HIS A NE2  1  
ATOM   608   H  H    . HIS A 1 41 ? -4.180  -1.045  -1.145  1.00 0.00 ? 41  HIS A H    1  
ATOM   609   H  HA   . HIS A 1 41 ? -4.714  -3.803  -0.774  1.00 0.00 ? 41  HIS A HA   1  
ATOM   610   H  HB2  . HIS A 1 41 ? -4.872  -1.934  -3.119  1.00 0.00 ? 41  HIS A HB2  1  
ATOM   611   H  HB3  . HIS A 1 41 ? -5.123  -3.663  -3.342  1.00 0.00 ? 41  HIS A HB3  1  
ATOM   612   H  HD1  . HIS A 1 41 ? -6.614  -3.784  -0.412  1.00 0.00 ? 41  HIS A HD1  1  
ATOM   613   H  HD2  . HIS A 1 41 ? -7.597  -1.491  -3.733  1.00 0.00 ? 41  HIS A HD2  1  
ATOM   614   H  HE1  . HIS A 1 41 ? -9.056  -3.242  -0.155  1.00 0.00 ? 41  HIS A HE1  1  
ATOM   615   N  N    . PHE A 1 42 ? -2.086  -3.022  -2.607  1.00 0.00 ? 42  PHE A N    1  
ATOM   616   C  CA   . PHE A 1 42 ? -0.837  -3.543  -3.149  1.00 0.00 ? 42  PHE A CA   1  
ATOM   617   C  C    . PHE A 1 42 ? 0.316   -3.310  -2.178  1.00 0.00 ? 42  PHE A C    1  
ATOM   618   O  O    . PHE A 1 42 ? 0.269   -2.403  -1.348  1.00 0.00 ? 42  PHE A O    1  
ATOM   619   C  CB   . PHE A 1 42 ? -0.526  -2.883  -4.495  1.00 0.00 ? 42  PHE A CB   1  
ATOM   620   C  CG   . PHE A 1 42 ? -1.743  -2.656  -5.346  1.00 0.00 ? 42  PHE A CG   1  
ATOM   621   C  CD1  . PHE A 1 42 ? -2.202  -3.645  -6.201  1.00 0.00 ? 42  PHE A CD1  1  
ATOM   622   C  CD2  . PHE A 1 42 ? -2.427  -1.452  -5.291  1.00 0.00 ? 42  PHE A CD2  1  
ATOM   623   C  CE1  . PHE A 1 42 ? -3.321  -3.439  -6.985  1.00 0.00 ? 42  PHE A CE1  1  
ATOM   624   C  CE2  . PHE A 1 42 ? -3.547  -1.241  -6.073  1.00 0.00 ? 42  PHE A CE2  1  
ATOM   625   C  CZ   . PHE A 1 42 ? -3.994  -2.234  -6.921  1.00 0.00 ? 42  PHE A CZ   1  
ATOM   626   H  H    . PHE A 1 42 ? -2.289  -2.068  -2.703  1.00 0.00 ? 42  PHE A H    1  
ATOM   627   H  HA   . PHE A 1 42 ? -0.958  -4.605  -3.298  1.00 0.00 ? 42  PHE A HA   1  
ATOM   628   H  HB2  . PHE A 1 42 ? -0.061  -1.925  -4.319  1.00 0.00 ? 42  PHE A HB2  1  
ATOM   629   H  HB3  . PHE A 1 42 ? 0.154   -3.514  -5.048  1.00 0.00 ? 42  PHE A HB3  1  
ATOM   630   H  HD1  . PHE A 1 42 ? -1.675  -4.588  -6.251  1.00 0.00 ? 42  PHE A HD1  1  
ATOM   631   H  HD2  . PHE A 1 42 ? -2.079  -0.673  -4.629  1.00 0.00 ? 42  PHE A HD2  1  
ATOM   632   H  HE1  . PHE A 1 42 ? -3.667  -4.218  -7.647  1.00 0.00 ? 42  PHE A HE1  1  
ATOM   633   H  HE2  . PHE A 1 42 ? -4.072  -0.298  -6.021  1.00 0.00 ? 42  PHE A HE2  1  
ATOM   634   H  HZ   . PHE A 1 42 ? -4.869  -2.072  -7.533  1.00 0.00 ? 42  PHE A HZ   1  
ATOM   635   N  N    . ASN A 1 43 ? 1.352   -4.136  -2.289  1.00 0.00 ? 43  ASN A N    1  
ATOM   636   C  CA   . ASN A 1 43 ? 2.517   -4.021  -1.420  1.00 0.00 ? 43  ASN A CA   1  
ATOM   637   C  C    . ASN A 1 43 ? 3.805   -3.994  -2.237  1.00 0.00 ? 43  ASN A C    1  
ATOM   638   O  O    . ASN A 1 43 ? 3.864   -4.537  -3.342  1.00 0.00 ? 43  ASN A O    1  
ATOM   639   C  CB   . ASN A 1 43 ? 2.555   -5.184  -0.426  1.00 0.00 ? 43  ASN A CB   1  
ATOM   640   C  CG   . ASN A 1 43 ? 1.526   -5.035  0.678   1.00 0.00 ? 43  ASN A CG   1  
ATOM   641   O  OD1  . ASN A 1 43 ? 0.330   -4.912  0.413   1.00 0.00 ? 43  ASN A OD1  1  
ATOM   642   N  ND2  . ASN A 1 43 ? 1.988   -5.046  1.922   1.00 0.00 ? 43  ASN A ND2  1  
ATOM   643   H  H    . ASN A 1 43 ? 1.332   -4.839  -2.970  1.00 0.00 ? 43  ASN A H    1  
ATOM   644   H  HA   . ASN A 1 43 ? 2.433   -3.094  -0.872  1.00 0.00 ? 43  ASN A HA   1  
ATOM   645   H  HB2  . ASN A 1 43 ? 2.358   -6.106  -0.953  1.00 0.00 ? 43  ASN A HB2  1  
ATOM   646   H  HB3  . ASN A 1 43 ? 3.535   -5.234  0.024   1.00 0.00 ? 43  ASN A HB3  1  
ATOM   647   H  HD21 . ASN A 1 43 ? 2.953   -5.147  2.058   1.00 0.00 ? 43  ASN A HD21 1  
ATOM   648   H  HD22 . ASN A 1 43 ? 1.344   -4.952  2.655   1.00 0.00 ? 43  ASN A HD22 1  
ATOM   649   N  N    . CYS A 1 44 ? 4.835   -3.360  -1.688  1.00 0.00 ? 44  CYS A N    1  
ATOM   650   C  CA   . CYS A 1 44 ? 6.123   -3.262  -2.365  1.00 0.00 ? 44  CYS A CA   1  
ATOM   651   C  C    . CYS A 1 44 ? 6.567   -4.625  -2.889  1.00 0.00 ? 44  CYS A C    1  
ATOM   652   O  O    . CYS A 1 44 ? 6.046   -5.660  -2.475  1.00 0.00 ? 44  CYS A O    1  
ATOM   653   C  CB   . CYS A 1 44 ? 7.181   -2.699  -1.414  1.00 0.00 ? 44  CYS A CB   1  
ATOM   654   S  SG   . CYS A 1 44 ? 8.734   -2.214  -2.233  1.00 0.00 ? 44  CYS A SG   1  
ATOM   655   H  H    . CYS A 1 44 ? 4.727   -2.947  -0.805  1.00 0.00 ? 44  CYS A H    1  
ATOM   656   H  HA   . CYS A 1 44 ? 6.008   -2.589  -3.201  1.00 0.00 ? 44  CYS A HA   1  
ATOM   657   H  HB2  . CYS A 1 44 ? 6.783   -1.824  -0.922  1.00 0.00 ? 44  CYS A HB2  1  
ATOM   658   H  HB3  . CYS A 1 44 ? 7.420   -3.446  -0.671  1.00 0.00 ? 44  CYS A HB3  1  
ATOM   659   N  N    . ALA A 1 45 ? 7.533   -4.615  -3.802  1.00 0.00 ? 45  ALA A N    1  
ATOM   660   C  CA   . ALA A 1 45 ? 8.049   -5.849  -4.381  1.00 0.00 ? 45  ALA A CA   1  
ATOM   661   C  C    . ALA A 1 45 ? 9.439   -6.170  -3.840  1.00 0.00 ? 45  ALA A C    1  
ATOM   662   O  O    . ALA A 1 45 ? 9.854   -7.328  -3.819  1.00 0.00 ? 45  ALA A O    1  
ATOM   663   C  CB   . ALA A 1 45 ? 8.082   -5.747  -5.898  1.00 0.00 ? 45  ALA A CB   1  
ATOM   664   H  H    . ALA A 1 45 ? 7.908   -3.757  -4.091  1.00 0.00 ? 45  ALA A H    1  
ATOM   665   H  HA   . ALA A 1 45 ? 7.376   -6.651  -4.113  1.00 0.00 ? 45  ALA A HA   1  
ATOM   666   H  HB1  . ALA A 1 45 ? 9.072   -5.993  -6.254  1.00 0.00 ? 45  ALA A HB1  1  
ATOM   667   H  HB2  . ALA A 1 45 ? 7.365   -6.435  -6.321  1.00 0.00 ? 45  ALA A HB2  1  
ATOM   668   H  HB3  . ALA A 1 45 ? 7.833   -4.739  -6.196  1.00 0.00 ? 45  ALA A HB3  1  
ATOM   669   N  N    . ASN A 1 46 ? 10.152  -5.137  -3.405  1.00 0.00 ? 46  ASN A N    1  
ATOM   670   C  CA   . ASN A 1 46 ? 11.496  -5.309  -2.865  1.00 0.00 ? 46  ASN A CA   1  
ATOM   671   C  C    . ASN A 1 46 ? 11.444  -5.787  -1.417  1.00 0.00 ? 46  ASN A C    1  
ATOM   672   O  O    . ASN A 1 46 ? 11.865  -6.901  -1.104  1.00 0.00 ? 46  ASN A O    1  
ATOM   673   C  CB   . ASN A 1 46 ? 12.276  -3.996  -2.953  1.00 0.00 ? 46  ASN A CB   1  
ATOM   674   C  CG   . ASN A 1 46 ? 13.686  -4.123  -2.410  1.00 0.00 ? 46  ASN A CG   1  
ATOM   675   O  OD1  . ASN A 1 46 ? 14.601  -4.541  -3.119  1.00 0.00 ? 46  ASN A OD1  1  
ATOM   676   N  ND2  . ASN A 1 46 ? 13.867  -3.762  -1.145  1.00 0.00 ? 46  ASN A ND2  1  
ATOM   677   H  H    . ASN A 1 46 ? 9.766   -4.237  -3.448  1.00 0.00 ? 46  ASN A H    1  
ATOM   678   H  HA   . ASN A 1 46 ? 11.999  -6.056  -3.461  1.00 0.00 ? 46  ASN A HA   1  
ATOM   679   H  HB2  . ASN A 1 46 ? 12.336  -3.688  -3.987  1.00 0.00 ? 46  ASN A HB2  1  
ATOM   680   H  HB3  . ASN A 1 46 ? 11.758  -3.237  -2.385  1.00 0.00 ? 46  ASN A HB3  1  
ATOM   681   H  HD21 . ASN A 1 46 ? 13.092  -3.439  -0.639  1.00 0.00 ? 46  ASN A HD21 1  
ATOM   682   H  HD22 . ASN A 1 46 ? 14.769  -3.834  -0.768  1.00 0.00 ? 46  ASN A HD22 1  
ATOM   683   N  N    . CYS A 1 47 ? 10.924  -4.937  -0.538  1.00 0.00 ? 47  CYS A N    1  
ATOM   684   C  CA   . CYS A 1 47 ? 10.815  -5.271  0.877   1.00 0.00 ? 47  CYS A CA   1  
ATOM   685   C  C    . CYS A 1 47 ? 9.551   -6.080  1.149   1.00 0.00 ? 47  CYS A C    1  
ATOM   686   O  O    . CYS A 1 47 ? 9.576   -7.058  1.895   1.00 0.00 ? 47  CYS A O    1  
ATOM   687   C  CB   . CYS A 1 47 ? 10.811  -3.997  1.724   1.00 0.00 ? 47  CYS A CB   1  
ATOM   688   S  SG   . CYS A 1 47 ? 9.512   -2.804  1.267   1.00 0.00 ? 47  CYS A SG   1  
ATOM   689   H  H    . CYS A 1 47 ? 10.604  -4.063  -0.849  1.00 0.00 ? 47  CYS A H    1  
ATOM   690   H  HA   . CYS A 1 47 ? 11.674  -5.867  1.144   1.00 0.00 ? 47  CYS A HA   1  
ATOM   691   H  HB2  . CYS A 1 47 ? 10.662  -4.263  2.760   1.00 0.00 ? 47  CYS A HB2  1  
ATOM   692   H  HB3  . CYS A 1 47 ? 11.765  -3.501  1.619   1.00 0.00 ? 47  CYS A HB3  1  
ATOM   693   N  N    . GLY A 1 48 ? 8.445   -5.664  0.539   1.00 0.00 ? 48  GLY A N    1  
ATOM   694   C  CA   . GLY A 1 48 ? 7.186   -6.361  0.728   1.00 0.00 ? 48  GLY A CA   1  
ATOM   695   C  C    . GLY A 1 48 ? 6.341   -5.744  1.825   1.00 0.00 ? 48  GLY A C    1  
ATOM   696   O  O    . GLY A 1 48 ? 5.759   -6.454  2.645   1.00 0.00 ? 48  GLY A O    1  
ATOM   697   H  H    . GLY A 1 48 ? 8.485   -4.877  -0.044  1.00 0.00 ? 48  GLY A H    1  
ATOM   698   H  HA2  . GLY A 1 48 ? 6.631   -6.336  -0.197  1.00 0.00 ? 48  GLY A HA2  1  
ATOM   699   H  HA3  . GLY A 1 48 ? 7.393   -7.390  0.985   1.00 0.00 ? 48  GLY A HA3  1  
ATOM   700   N  N    . LYS A 1 49 ? 6.273   -4.417  1.842   1.00 0.00 ? 49  LYS A N    1  
ATOM   701   C  CA   . LYS A 1 49 ? 5.494   -3.703  2.846   1.00 0.00 ? 49  LYS A CA   1  
ATOM   702   C  C    . LYS A 1 49 ? 4.278   -3.031  2.214   1.00 0.00 ? 49  LYS A C    1  
ATOM   703   O  O    . LYS A 1 49 ? 4.137   -3.007  0.992   1.00 0.00 ? 49  LYS A O    1  
ATOM   704   C  CB   . LYS A 1 49 ? 6.362   -2.656  3.546   1.00 0.00 ? 49  LYS A CB   1  
ATOM   705   C  CG   . LYS A 1 49 ? 6.569   -1.392  2.728   1.00 0.00 ? 49  LYS A CG   1  
ATOM   706   C  CD   . LYS A 1 49 ? 7.400   -0.369  3.484   1.00 0.00 ? 49  LYS A CD   1  
ATOM   707   C  CE   . LYS A 1 49 ? 6.557   0.402   4.488   1.00 0.00 ? 49  LYS A CE   1  
ATOM   708   N  NZ   . LYS A 1 49 ? 6.395   -0.346  5.766   1.00 0.00 ? 49  LYS A NZ   1  
ATOM   709   H  H    . LYS A 1 49 ? 6.759   -3.905  1.161   1.00 0.00 ? 49  LYS A H    1  
ATOM   710   H  HA   . LYS A 1 49 ? 5.154   -4.422  3.575   1.00 0.00 ? 49  LYS A HA   1  
ATOM   711   H  HB2  . LYS A 1 49 ? 5.894   -2.382  4.480   1.00 0.00 ? 49  LYS A HB2  1  
ATOM   712   H  HB3  . LYS A 1 49 ? 7.331   -3.088  3.752   1.00 0.00 ? 49  LYS A HB3  1  
ATOM   713   H  HG2  . LYS A 1 49 ? 7.079   -1.647  1.811   1.00 0.00 ? 49  LYS A HG2  1  
ATOM   714   H  HG3  . LYS A 1 49 ? 5.605   -0.961  2.499   1.00 0.00 ? 49  LYS A HG3  1  
ATOM   715   H  HD2  . LYS A 1 49 ? 8.192   -0.879  4.012   1.00 0.00 ? 49  LYS A HD2  1  
ATOM   716   H  HD3  . LYS A 1 49 ? 7.828   0.327   2.776   1.00 0.00 ? 49  LYS A HD3  1  
ATOM   717   H  HE2  . LYS A 1 49 ? 7.038   1.346   4.692   1.00 0.00 ? 49  LYS A HE2  1  
ATOM   718   H  HE3  . LYS A 1 49 ? 5.582   0.579   4.059   1.00 0.00 ? 49  LYS A HE3  1  
ATOM   719   H  HZ1  . LYS A 1 49 ? 6.691   0.249   6.567   1.00 0.00 ? 49  LYS A HZ1  1  
ATOM   720   H  HZ2  . LYS A 1 49 ? 6.980   -1.205  5.753   1.00 0.00 ? 49  LYS A HZ2  1  
ATOM   721   H  HZ3  . LYS A 1 49 ? 5.400   -0.617  5.898   1.00 0.00 ? 49  LYS A HZ3  1  
ATOM   722   N  N    . GLU A 1 50 ? 3.405   -2.486  3.056   1.00 0.00 ? 50  GLU A N    1  
ATOM   723   C  CA   . GLU A 1 50 ? 2.203   -1.813  2.578   1.00 0.00 ? 50  GLU A CA   1  
ATOM   724   C  C    . GLU A 1 50 ? 2.559   -0.547  1.805   1.00 0.00 ? 50  GLU A C    1  
ATOM   725   O  O    . GLU A 1 50 ? 2.963   0.459   2.391   1.00 0.00 ? 50  GLU A O    1  
ATOM   726   C  CB   . GLU A 1 50 ? 1.285   -1.467  3.753   1.00 0.00 ? 50  GLU A CB   1  
ATOM   727   C  CG   . GLU A 1 50 ? 0.087   -0.620  3.359   1.00 0.00 ? 50  GLU A CG   1  
ATOM   728   C  CD   . GLU A 1 50 ? -0.880  -0.408  4.508   1.00 0.00 ? 50  GLU A CD   1  
ATOM   729   O  OE1  . GLU A 1 50 ? -0.436  0.047   5.582   1.00 0.00 ? 50  GLU A OE1  1  
ATOM   730   O  OE2  . GLU A 1 50 ? -2.083  -0.697  4.331   1.00 0.00 ? 50  GLU A OE2  1  
ATOM   731   H  H    . GLU A 1 50 ? 3.574   -2.538  4.020   1.00 0.00 ? 50  GLU A H    1  
ATOM   732   H  HA   . GLU A 1 50 ? 1.685   -2.491  1.917   1.00 0.00 ? 50  GLU A HA   1  
ATOM   733   H  HB2  . GLU A 1 50 ? 0.923   -2.383  4.194   1.00 0.00 ? 50  GLU A HB2  1  
ATOM   734   H  HB3  . GLU A 1 50 ? 1.856   -0.923  4.491   1.00 0.00 ? 50  GLU A HB3  1  
ATOM   735   H  HG2  . GLU A 1 50 ? 0.438   0.344   3.022   1.00 0.00 ? 50  GLU A HG2  1  
ATOM   736   H  HG3  . GLU A 1 50 ? -0.437  -1.112  2.553   1.00 0.00 ? 50  GLU A HG3  1  
ATOM   737   N  N    . LEU A 1 51 ? 2.406   -0.603  0.487   1.00 0.00 ? 51  LEU A N    1  
ATOM   738   C  CA   . LEU A 1 51 ? 2.712   0.539   -0.368  1.00 0.00 ? 51  LEU A CA   1  
ATOM   739   C  C    . LEU A 1 51 ? 1.953   1.780   0.090   1.00 0.00 ? 51  LEU A C    1  
ATOM   740   O  O    . LEU A 1 51 ? 1.178   1.731   1.046   1.00 0.00 ? 51  LEU A O    1  
ATOM   741   C  CB   . LEU A 1 51 ? 2.361   0.220   -1.822  1.00 0.00 ? 51  LEU A CB   1  
ATOM   742   C  CG   . LEU A 1 51 ? 3.306   -0.740  -2.546  1.00 0.00 ? 51  LEU A CG   1  
ATOM   743   C  CD1  . LEU A 1 51 ? 2.723   -1.151  -3.889  1.00 0.00 ? 51  LEU A CD1  1  
ATOM   744   C  CD2  . LEU A 1 51 ? 4.676   -0.104  -2.729  1.00 0.00 ? 51  LEU A CD2  1  
ATOM   745   H  H    . LEU A 1 51 ? 2.081   -1.431  0.078   1.00 0.00 ? 51  LEU A H    1  
ATOM   746   H  HA   . LEU A 1 51 ? 3.771   0.733   -0.296  1.00 0.00 ? 51  LEU A HA   1  
ATOM   747   H  HB2  . LEU A 1 51 ? 1.373   -0.214  -1.837  1.00 0.00 ? 51  LEU A HB2  1  
ATOM   748   H  HB3  . LEU A 1 51 ? 2.351   1.151   -2.371  1.00 0.00 ? 51  LEU A HB3  1  
ATOM   749   H  HG   . LEU A 1 51 ? 3.428   -1.633  -1.948  1.00 0.00 ? 51  LEU A HG   1  
ATOM   750   H  HD11 . LEU A 1 51 ? 3.456   -1.721  -4.440  1.00 0.00 ? 51  LEU A HD11 1  
ATOM   751   H  HD12 . LEU A 1 51 ? 2.457   -0.268  -4.451  1.00 0.00 ? 51  LEU A HD12 1  
ATOM   752   H  HD13 . LEU A 1 51 ? 1.842   -1.756  -3.729  1.00 0.00 ? 51  LEU A HD13 1  
ATOM   753   H  HD21 . LEU A 1 51 ? 4.666   0.895   -2.319  1.00 0.00 ? 51  LEU A HD21 1  
ATOM   754   H  HD22 . LEU A 1 51 ? 4.914   -0.058  -3.781  1.00 0.00 ? 51  LEU A HD22 1  
ATOM   755   H  HD23 . LEU A 1 51 ? 5.419   -0.696  -2.216  1.00 0.00 ? 51  LEU A HD23 1  
ATOM   756   N  N    . THR A 1 52 ? 2.178   2.894   -0.601  1.00 0.00 ? 52  THR A N    1  
ATOM   757   C  CA   . THR A 1 52 ? 1.515   4.148   -0.266  1.00 0.00 ? 52  THR A CA   1  
ATOM   758   C  C    . THR A 1 52 ? 0.845   4.759   -1.491  1.00 0.00 ? 52  THR A C    1  
ATOM   759   O  O    . THR A 1 52 ? 0.987   4.255   -2.605  1.00 0.00 ? 52  THR A O    1  
ATOM   760   C  CB   . THR A 1 52 ? 2.508   5.168   0.324   1.00 0.00 ? 52  THR A CB   1  
ATOM   761   O  OG1  . THR A 1 52 ? 3.588   5.385   -0.589  1.00 0.00 ? 52  THR A OG1  1  
ATOM   762   C  CG2  . THR A 1 52 ? 3.055   4.681   1.658   1.00 0.00 ? 52  THR A CG2  1  
ATOM   763   H  H    . THR A 1 52 ? 2.807   2.870   -1.352  1.00 0.00 ? 52  THR A H    1  
ATOM   764   H  HA   . THR A 1 52 ? 0.761   3.938   0.479   1.00 0.00 ? 52  THR A HA   1  
ATOM   765   H  HB   . THR A 1 52 ? 1.988   6.101   0.485   1.00 0.00 ? 52  THR A HB   1  
ATOM   766   H  HG1  . THR A 1 52 ? 3.944   6.268   -0.460  1.00 0.00 ? 52  THR A HG1  1  
ATOM   767   H  HG21 . THR A 1 52 ? 2.632   3.714   1.889   1.00 0.00 ? 52  THR A HG21 1  
ATOM   768   H  HG22 . THR A 1 52 ? 2.791   5.384   2.433   1.00 0.00 ? 52  THR A HG22 1  
ATOM   769   H  HG23 . THR A 1 52 ? 4.129   4.598   1.597   1.00 0.00 ? 52  THR A HG23 1  
ATOM   770   N  N    . ALA A 1 53 ? 0.114   5.848   -1.278  1.00 0.00 ? 53  ALA A N    1  
ATOM   771   C  CA   . ALA A 1 53 ? -0.577  6.530   -2.366  1.00 0.00 ? 53  ALA A CA   1  
ATOM   772   C  C    . ALA A 1 53 ? 0.416   7.110   -3.368  1.00 0.00 ? 53  ALA A C    1  
ATOM   773   O  O    . ALA A 1 53 ? 0.110   7.242   -4.553  1.00 0.00 ? 53  ALA A O    1  
ATOM   774   C  CB   . ALA A 1 53 ? -1.476  7.626   -1.815  1.00 0.00 ? 53  ALA A CB   1  
ATOM   775   H  H    . ALA A 1 53 ? 0.038   6.203   -0.368  1.00 0.00 ? 53  ALA A H    1  
ATOM   776   H  HA   . ALA A 1 53 ? -1.201  5.806   -2.870  1.00 0.00 ? 53  ALA A HA   1  
ATOM   777   H  HB1  . ALA A 1 53 ? -2.148  7.964   -2.591  1.00 0.00 ? 53  ALA A HB1  1  
ATOM   778   H  HB2  . ALA A 1 53 ? -2.049  7.239   -0.986  1.00 0.00 ? 53  ALA A HB2  1  
ATOM   779   H  HB3  . ALA A 1 53 ? -0.870  8.454   -1.479  1.00 0.00 ? 53  ALA A HB3  1  
ATOM   780   N  N    . ASP A 1 54 ? 1.604   7.456   -2.884  1.00 0.00 ? 54  ASP A N    1  
ATOM   781   C  CA   . ASP A 1 54 ? 2.642   8.022   -3.737  1.00 0.00 ? 54  ASP A CA   1  
ATOM   782   C  C    . ASP A 1 54 ? 3.624   6.945   -4.186  1.00 0.00 ? 54  ASP A C    1  
ATOM   783   O  O    . ASP A 1 54 ? 4.765   7.240   -4.539  1.00 0.00 ? 54  ASP A O    1  
ATOM   784   C  CB   . ASP A 1 54 ? 3.388   9.135   -3.000  1.00 0.00 ? 54  ASP A CB   1  
ATOM   785   C  CG   . ASP A 1 54 ? 2.705   10.481  -3.140  1.00 0.00 ? 54  ASP A CG   1  
ATOM   786   O  OD1  . ASP A 1 54 ? 2.720   11.040  -4.256  1.00 0.00 ? 54  ASP A OD1  1  
ATOM   787   O  OD2  . ASP A 1 54 ? 2.155   10.976  -2.133  1.00 0.00 ? 54  ASP A OD2  1  
ATOM   788   H  H    . ASP A 1 54 ? 1.787   7.326   -1.930  1.00 0.00 ? 54  ASP A H    1  
ATOM   789   H  HA   . ASP A 1 54 ? 2.162   8.440   -4.610  1.00 0.00 ? 54  ASP A HA   1  
ATOM   790   H  HB2  . ASP A 1 54 ? 3.442   8.888   -1.949  1.00 0.00 ? 54  ASP A HB2  1  
ATOM   791   H  HB3  . ASP A 1 54 ? 4.388   9.215   -3.399  1.00 0.00 ? 54  ASP A HB3  1  
ATOM   792   N  N    . ALA A 1 55 ? 3.173   5.695   -4.168  1.00 0.00 ? 55  ALA A N    1  
ATOM   793   C  CA   . ALA A 1 55 ? 4.012   4.574   -4.573  1.00 0.00 ? 55  ALA A CA   1  
ATOM   794   C  C    . ALA A 1 55 ? 4.338   4.642   -6.061  1.00 0.00 ? 55  ALA A C    1  
ATOM   795   O  O    . ALA A 1 55 ? 3.439   4.672   -6.902  1.00 0.00 ? 55  ALA A O    1  
ATOM   796   C  CB   . ALA A 1 55 ? 3.328   3.256   -4.241  1.00 0.00 ? 55  ALA A CB   1  
ATOM   797   H  H    . ALA A 1 55 ? 2.253   5.523   -3.876  1.00 0.00 ? 55  ALA A H    1  
ATOM   798   H  HA   . ALA A 1 55 ? 4.933   4.625   -4.010  1.00 0.00 ? 55  ALA A HA   1  
ATOM   799   H  HB1  . ALA A 1 55 ? 3.548   2.532   -5.013  1.00 0.00 ? 55  ALA A HB1  1  
ATOM   800   H  HB2  . ALA A 1 55 ? 3.691   2.892   -3.291  1.00 0.00 ? 55  ALA A HB2  1  
ATOM   801   H  HB3  . ALA A 1 55 ? 2.261   3.409   -4.184  1.00 0.00 ? 55  ALA A HB3  1  
ATOM   802   N  N    . ARG A 1 56 ? 5.628   4.668   -6.379  1.00 0.00 ? 56  ARG A N    1  
ATOM   803   C  CA   . ARG A 1 56 ? 6.072   4.735   -7.766  1.00 0.00 ? 56  ARG A CA   1  
ATOM   804   C  C    . ARG A 1 56 ? 5.957   3.371   -8.440  1.00 0.00 ? 56  ARG A C    1  
ATOM   805   O  O    . ARG A 1 56 ? 6.252   2.342   -7.833  1.00 0.00 ? 56  ARG A O    1  
ATOM   806   C  CB   . ARG A 1 56 ? 7.518   5.231   -7.837  1.00 0.00 ? 56  ARG A CB   1  
ATOM   807   C  CG   . ARG A 1 56 ? 7.741   6.560   -7.135  1.00 0.00 ? 56  ARG A CG   1  
ATOM   808   C  CD   . ARG A 1 56 ? 7.145   7.715   -7.926  1.00 0.00 ? 56  ARG A CD   1  
ATOM   809   N  NE   . ARG A 1 56 ? 7.747   7.840   -9.250  1.00 0.00 ? 56  ARG A NE   1  
ATOM   810   C  CZ   . ARG A 1 56 ? 7.733   8.962   -9.961  1.00 0.00 ? 56  ARG A CZ   1  
ATOM   811   N  NH1  . ARG A 1 56 ? 7.150   10.050  -9.476  1.00 0.00 ? 56  ARG A NH1  1  
ATOM   812   N  NH2  . ARG A 1 56 ? 8.303   8.998   -11.158 1.00 0.00 ? 56  ARG A NH2  1  
ATOM   813   H  H    . ARG A 1 56 ? 6.297   4.642   -5.663  1.00 0.00 ? 56  ARG A H    1  
ATOM   814   H  HA   . ARG A 1 56 ? 5.435   5.435   -8.285  1.00 0.00 ? 56  ARG A HA   1  
ATOM   815   H  HB2  . ARG A 1 56 ? 8.162   4.494   -7.380  1.00 0.00 ? 56  ARG A HB2  1  
ATOM   816   H  HB3  . ARG A 1 56 ? 7.795   5.345   -8.874  1.00 0.00 ? 56  ARG A HB3  1  
ATOM   817   H  HG2  . ARG A 1 56 ? 7.274   6.526   -6.162  1.00 0.00 ? 56  ARG A HG2  1  
ATOM   818   H  HG3  . ARG A 1 56 ? 8.802   6.723   -7.022  1.00 0.00 ? 56  ARG A HG3  1  
ATOM   819   H  HD2  . ARG A 1 56 ? 6.084   7.547   -8.038  1.00 0.00 ? 56  ARG A HD2  1  
ATOM   820   H  HD3  . ARG A 1 56 ? 7.309   8.630   -7.377  1.00 0.00 ? 56  ARG A HD3  1  
ATOM   821   H  HE   . ARG A 1 56 ? 8.184   7.048   -9.627  1.00 0.00 ? 56  ARG A HE   1  
ATOM   822   H  HH11 . ARG A 1 56 ? 6.721   10.027  -8.574  1.00 0.00 ? 56  ARG A HH11 1  
ATOM   823   H  HH12 . ARG A 1 56 ? 7.142   10.894  -10.013 1.00 0.00 ? 56  ARG A HH12 1  
ATOM   824   H  HH21 . ARG A 1 56 ? 8.743   8.180   -11.527 1.00 0.00 ? 56  ARG A HH21 1  
ATOM   825   H  HH22 . ARG A 1 56 ? 8.291   9.842   -11.693 1.00 0.00 ? 56  ARG A HH22 1  
ATOM   826   N  N    . GLU A 1 57 ? 5.526   3.373   -9.698  1.00 0.00 ? 57  GLU A N    1  
ATOM   827   C  CA   . GLU A 1 57 ? 5.371   2.135   -10.453 1.00 0.00 ? 57  GLU A CA   1  
ATOM   828   C  C    . GLU A 1 57 ? 6.656   1.788   -11.199 1.00 0.00 ? 57  GLU A C    1  
ATOM   829   O  O    . GLU A 1 57 ? 7.346   2.669   -11.714 1.00 0.00 ? 57  GLU A O    1  
ATOM   830   C  CB   . GLU A 1 57 ? 4.211   2.258   -11.443 1.00 0.00 ? 57  GLU A CB   1  
ATOM   831   C  CG   . GLU A 1 57 ? 4.223   1.195   -12.529 1.00 0.00 ? 57  GLU A CG   1  
ATOM   832   C  CD   . GLU A 1 57 ? 4.994   1.629   -13.761 1.00 0.00 ? 57  GLU A CD   1  
ATOM   833   O  OE1  . GLU A 1 57 ? 6.241   1.641   -13.706 1.00 0.00 ? 57  GLU A OE1  1  
ATOM   834   O  OE2  . GLU A 1 57 ? 4.350   1.956   -14.780 1.00 0.00 ? 57  GLU A OE2  1  
ATOM   835   H  H    . GLU A 1 57 ? 5.307   4.226   -10.127 1.00 0.00 ? 57  GLU A H    1  
ATOM   836   H  HA   . GLU A 1 57 ? 5.151   1.344   -9.752  1.00 0.00 ? 57  GLU A HA   1  
ATOM   837   H  HB2  . GLU A 1 57 ? 3.280   2.179   -10.901 1.00 0.00 ? 57  GLU A HB2  1  
ATOM   838   H  HB3  . GLU A 1 57 ? 4.260   3.227   -11.917 1.00 0.00 ? 57  GLU A HB3  1  
ATOM   839   H  HG2  . GLU A 1 57 ? 4.680   0.300   -12.135 1.00 0.00 ? 57  GLU A HG2  1  
ATOM   840   H  HG3  . GLU A 1 57 ? 3.204   0.981   -12.817 1.00 0.00 ? 57  GLU A HG3  1  
ATOM   841   N  N    . LEU A 1 58 ? 6.973   0.499   -11.252 1.00 0.00 ? 58  LEU A N    1  
ATOM   842   C  CA   . LEU A 1 58 ? 8.176   0.033   -11.933 1.00 0.00 ? 58  LEU A CA   1  
ATOM   843   C  C    . LEU A 1 58 ? 7.862   -1.147  -12.847 1.00 0.00 ? 58  LEU A C    1  
ATOM   844   O  O    . LEU A 1 58 ? 7.737   -2.284  -12.389 1.00 0.00 ? 58  LEU A O    1  
ATOM   845   C  CB   . LEU A 1 58 ? 9.242   -0.366  -10.912 1.00 0.00 ? 58  LEU A CB   1  
ATOM   846   C  CG   . LEU A 1 58 ? 10.214  0.736   -10.490 1.00 0.00 ? 58  LEU A CG   1  
ATOM   847   C  CD1  . LEU A 1 58 ? 10.964  0.333   -9.230  1.00 0.00 ? 58  LEU A CD1  1  
ATOM   848   C  CD2  . LEU A 1 58 ? 11.189  1.048   -11.617 1.00 0.00 ? 58  LEU A CD2  1  
ATOM   849   H  H    . LEU A 1 58 ? 6.384   -0.156  -10.822 1.00 0.00 ? 58  LEU A H    1  
ATOM   850   H  HA   . LEU A 1 58 ? 8.552   0.848   -12.535 1.00 0.00 ? 58  LEU A HA   1  
ATOM   851   H  HB2  . LEU A 1 58 ? 8.736   -0.718  -10.026 1.00 0.00 ? 58  LEU A HB2  1  
ATOM   852   H  HB3  . LEU A 1 58 ? 9.821   -1.173  -11.339 1.00 0.00 ? 58  LEU A HB3  1  
ATOM   853   H  HG   . LEU A 1 58 ? 9.655   1.636   -10.272 1.00 0.00 ? 58  LEU A HG   1  
ATOM   854   H  HD11 . LEU A 1 58 ? 10.816  1.084   -8.468  1.00 0.00 ? 58  LEU A HD11 1  
ATOM   855   H  HD12 . LEU A 1 58 ? 12.017  0.246   -9.451  1.00 0.00 ? 58  LEU A HD12 1  
ATOM   856   H  HD13 . LEU A 1 58 ? 10.590  -0.617  -8.878  1.00 0.00 ? 58  LEU A HD13 1  
ATOM   857   H  HD21 . LEU A 1 58 ? 12.134  1.359   -11.198 1.00 0.00 ? 58  LEU A HD21 1  
ATOM   858   H  HD22 . LEU A 1 58 ? 10.788  1.842   -12.230 1.00 0.00 ? 58  LEU A HD22 1  
ATOM   859   H  HD23 . LEU A 1 58 ? 11.335  0.165   -12.220 1.00 0.00 ? 58  LEU A HD23 1  
ATOM   860   N  N    . LYS A 1 59 ? 7.737   -0.871  -14.140 1.00 0.00 ? 59  LYS A N    1  
ATOM   861   C  CA   . LYS A 1 59 ? 7.441   -1.910  -15.120 1.00 0.00 ? 59  LYS A CA   1  
ATOM   862   C  C    . LYS A 1 59 ? 6.191   -2.690  -14.725 1.00 0.00 ? 59  LYS A C    1  
ATOM   863   O  O    . LYS A 1 59 ? 6.187   -3.920  -14.732 1.00 0.00 ? 59  LYS A O    1  
ATOM   864   C  CB   . LYS A 1 59 ? 8.630   -2.865  -15.255 1.00 0.00 ? 59  LYS A CB   1  
ATOM   865   C  CG   . LYS A 1 59 ? 9.626   -2.448  -16.323 1.00 0.00 ? 59  LYS A CG   1  
ATOM   866   C  CD   . LYS A 1 59 ? 11.031  -2.923  -15.990 1.00 0.00 ? 59  LYS A CD   1  
ATOM   867   C  CE   . LYS A 1 59 ? 11.747  -1.946  -15.070 1.00 0.00 ? 59  LYS A CE   1  
ATOM   868   N  NZ   . LYS A 1 59 ? 12.998  -2.527  -14.510 1.00 0.00 ? 59  LYS A NZ   1  
ATOM   869   H  H    . LYS A 1 59 ? 7.848   0.054   -14.444 1.00 0.00 ? 59  LYS A H    1  
ATOM   870   H  HA   . LYS A 1 59 ? 7.266   -1.430  -16.070 1.00 0.00 ? 59  LYS A HA   1  
ATOM   871   H  HB2  . LYS A 1 59 ? 9.147   -2.914  -14.308 1.00 0.00 ? 59  LYS A HB2  1  
ATOM   872   H  HB3  . LYS A 1 59 ? 8.259   -3.849  -15.504 1.00 0.00 ? 59  LYS A HB3  1  
ATOM   873   H  HG2  . LYS A 1 59 ? 9.328   -2.876  -17.268 1.00 0.00 ? 59  LYS A HG2  1  
ATOM   874   H  HG3  . LYS A 1 59 ? 9.629   -1.370  -16.398 1.00 0.00 ? 59  LYS A HG3  1  
ATOM   875   H  HD2  . LYS A 1 59 ? 10.970  -3.883  -15.499 1.00 0.00 ? 59  LYS A HD2  1  
ATOM   876   H  HD3  . LYS A 1 59 ? 11.595  -3.020  -16.907 1.00 0.00 ? 59  LYS A HD3  1  
ATOM   877   H  HE2  . LYS A 1 59 ? 11.992  -1.057  -15.632 1.00 0.00 ? 59  LYS A HE2  1  
ATOM   878   H  HE3  . LYS A 1 59 ? 11.085  -1.686  -14.257 1.00 0.00 ? 59  LYS A HE3  1  
ATOM   879   H  HZ1  . LYS A 1 59 ? 12.998  -2.441  -13.473 1.00 0.00 ? 59  LYS A HZ1  1  
ATOM   880   H  HZ2  . LYS A 1 59 ? 13.826  -2.023  -14.887 1.00 0.00 ? 59  LYS A HZ2  1  
ATOM   881   H  HZ3  . LYS A 1 59 ? 13.071  -3.532  -14.764 1.00 0.00 ? 59  LYS A HZ3  1  
ATOM   882   N  N    . GLY A 1 60 ? 5.130   -1.965  -14.383 1.00 0.00 ? 60  GLY A N    1  
ATOM   883   C  CA   . GLY A 1 60 ? 3.889   -2.607  -13.991 1.00 0.00 ? 60  GLY A CA   1  
ATOM   884   C  C    . GLY A 1 60 ? 3.798   -2.830  -12.495 1.00 0.00 ? 60  GLY A C    1  
ATOM   885   O  O    . GLY A 1 60 ? 2.707   -2.826  -11.926 1.00 0.00 ? 60  GLY A O    1  
ATOM   886   H  H    . GLY A 1 60 ? 5.191   -0.987  -14.396 1.00 0.00 ? 60  GLY A H    1  
ATOM   887   H  HA2  . GLY A 1 60 ? 3.062   -1.986  -14.303 1.00 0.00 ? 60  GLY A HA2  1  
ATOM   888   H  HA3  . GLY A 1 60 ? 3.817   -3.562  -14.491 1.00 0.00 ? 60  GLY A HA3  1  
ATOM   889   N  N    . GLU A 1 61 ? 4.947   -3.027  -11.857 1.00 0.00 ? 61  GLU A N    1  
ATOM   890   C  CA   . GLU A 1 61 ? 4.992   -3.255  -10.417 1.00 0.00 ? 61  GLU A CA   1  
ATOM   891   C  C    . GLU A 1 61 ? 4.801   -1.949  -9.652  1.00 0.00 ? 61  GLU A C    1  
ATOM   892   O  O    . GLU A 1 61 ? 4.616   -0.888  -10.250 1.00 0.00 ? 61  GLU A O    1  
ATOM   893   C  CB   . GLU A 1 61 ? 6.321   -3.901  -10.022 1.00 0.00 ? 61  GLU A CB   1  
ATOM   894   C  CG   . GLU A 1 61 ? 6.463   -5.340  -10.490 1.00 0.00 ? 61  GLU A CG   1  
ATOM   895   C  CD   . GLU A 1 61 ? 7.842   -5.908  -10.220 1.00 0.00 ? 61  GLU A CD   1  
ATOM   896   O  OE1  . GLU A 1 61 ? 8.158   -6.167  -9.040  1.00 0.00 ? 61  GLU A OE1  1  
ATOM   897   O  OE2  . GLU A 1 61 ? 8.607   -6.094  -11.191 1.00 0.00 ? 61  GLU A OE2  1  
ATOM   898   H  H    . GLU A 1 61 ? 5.785   -3.018  -12.366 1.00 0.00 ? 61  GLU A H    1  
ATOM   899   H  HA   . GLU A 1 61 ? 4.186   -3.928  -10.163 1.00 0.00 ? 61  GLU A HA   1  
ATOM   900   H  HB2  . GLU A 1 61 ? 7.129   -3.324  -10.448 1.00 0.00 ? 61  GLU A HB2  1  
ATOM   901   H  HB3  . GLU A 1 61 ? 6.409   -3.885  -8.945  1.00 0.00 ? 61  GLU A HB3  1  
ATOM   902   H  HG2  . GLU A 1 61 ? 5.733   -5.946  -9.974  1.00 0.00 ? 61  GLU A HG2  1  
ATOM   903   H  HG3  . GLU A 1 61 ? 6.275   -5.379  -11.553 1.00 0.00 ? 61  GLU A HG3  1  
ATOM   904   N  N    . LEU A 1 62 ? 4.846   -2.034  -8.328  1.00 0.00 ? 62  LEU A N    1  
ATOM   905   C  CA   . LEU A 1 62 ? 4.678   -0.859  -7.479  1.00 0.00 ? 62  LEU A CA   1  
ATOM   906   C  C    . LEU A 1 62 ? 5.570   -0.946  -6.245  1.00 0.00 ? 62  LEU A C    1  
ATOM   907   O  O    . LEU A 1 62 ? 5.419   -1.846  -5.419  1.00 0.00 ? 62  LEU A O    1  
ATOM   908   C  CB   . LEU A 1 62 ? 3.215   -0.716  -7.056  1.00 0.00 ? 62  LEU A CB   1  
ATOM   909   C  CG   . LEU A 1 62 ? 2.230   -0.338  -8.162  1.00 0.00 ? 62  LEU A CG   1  
ATOM   910   C  CD1  . LEU A 1 62 ? 0.827   -0.808  -7.811  1.00 0.00 ? 62  LEU A CD1  1  
ATOM   911   C  CD2  . LEU A 1 62 ? 2.247   1.164   -8.401  1.00 0.00 ? 62  LEU A CD2  1  
ATOM   912   H  H    . LEU A 1 62 ? 4.997   -2.906  -7.909  1.00 0.00 ? 62  LEU A H    1  
ATOM   913   H  HA   . LEU A 1 62 ? 4.964   0.009   -8.055  1.00 0.00 ? 62  LEU A HA   1  
ATOM   914   H  HB2  . LEU A 1 62 ? 2.898   -1.660  -6.640  1.00 0.00 ? 62  LEU A HB2  1  
ATOM   915   H  HB3  . LEU A 1 62 ? 3.166   0.047   -6.292  1.00 0.00 ? 62  LEU A HB3  1  
ATOM   916   H  HG   . LEU A 1 62 ? 2.525   -0.827  -9.081  1.00 0.00 ? 62  LEU A HG   1  
ATOM   917   H  HD11 . LEU A 1 62 ? 0.102   -0.163  -8.285  1.00 0.00 ? 62  LEU A HD11 1  
ATOM   918   H  HD12 . LEU A 1 62 ? 0.693   -0.773  -6.740  1.00 0.00 ? 62  LEU A HD12 1  
ATOM   919   H  HD13 . LEU A 1 62 ? 0.689   -1.822  -8.157  1.00 0.00 ? 62  LEU A HD13 1  
ATOM   920   H  HD21 . LEU A 1 62 ? 3.163   1.438   -8.905  1.00 0.00 ? 62  LEU A HD21 1  
ATOM   921   H  HD22 . LEU A 1 62 ? 2.190   1.680   -7.454  1.00 0.00 ? 62  LEU A HD22 1  
ATOM   922   H  HD23 . LEU A 1 62 ? 1.402   1.441   -9.014  1.00 0.00 ? 62  LEU A HD23 1  
ATOM   923   N  N    . TYR A 1 63 ? 6.499   -0.003  -6.126  1.00 0.00 ? 63  TYR A N    1  
ATOM   924   C  CA   . TYR A 1 63 ? 7.416   0.027   -4.992  1.00 0.00 ? 63  TYR A CA   1  
ATOM   925   C  C    . TYR A 1 63 ? 7.126   1.221   -4.089  1.00 0.00 ? 63  TYR A C    1  
ATOM   926   O  O    . TYR A 1 63 ? 6.559   2.223   -4.526  1.00 0.00 ? 63  TYR A O    1  
ATOM   927   C  CB   . TYR A 1 63 ? 8.864   0.083   -5.482  1.00 0.00 ? 63  TYR A CB   1  
ATOM   928   C  CG   . TYR A 1 63 ? 9.265   -1.107  -6.325  1.00 0.00 ? 63  TYR A CG   1  
ATOM   929   C  CD1  . TYR A 1 63 ? 8.681   -1.332  -7.566  1.00 0.00 ? 63  TYR A CD1  1  
ATOM   930   C  CD2  . TYR A 1 63 ? 10.225  -2.006  -5.880  1.00 0.00 ? 63  TYR A CD2  1  
ATOM   931   C  CE1  . TYR A 1 63 ? 9.044   -2.418  -8.339  1.00 0.00 ? 63  TYR A CE1  1  
ATOM   932   C  CE2  . TYR A 1 63 ? 10.595  -3.094  -6.647  1.00 0.00 ? 63  TYR A CE2  1  
ATOM   933   C  CZ   . TYR A 1 63 ? 10.001  -3.296  -7.875  1.00 0.00 ? 63  TYR A CZ   1  
ATOM   934   O  OH   . TYR A 1 63 ? 10.366  -4.379  -8.641  1.00 0.00 ? 63  TYR A OH   1  
ATOM   935   H  H    . TYR A 1 63 ? 6.571   0.688   -6.816  1.00 0.00 ? 63  TYR A H    1  
ATOM   936   H  HA   . TYR A 1 63 ? 7.273   -0.882  -4.426  1.00 0.00 ? 63  TYR A HA   1  
ATOM   937   H  HB2  . TYR A 1 63 ? 9.001   0.972   -6.079  1.00 0.00 ? 63  TYR A HB2  1  
ATOM   938   H  HB3  . TYR A 1 63 ? 9.524   0.123   -4.628  1.00 0.00 ? 63  TYR A HB3  1  
ATOM   939   H  HD1  . TYR A 1 63 ? 7.932   -0.643  -7.926  1.00 0.00 ? 63  TYR A HD1  1  
ATOM   940   H  HD2  . TYR A 1 63 ? 10.688  -1.845  -4.917  1.00 0.00 ? 63  TYR A HD2  1  
ATOM   941   H  HE1  . TYR A 1 63 ? 8.580   -2.576  -9.301  1.00 0.00 ? 63  TYR A HE1  1  
ATOM   942   H  HE2  . TYR A 1 63 ? 11.345  -3.782  -6.284  1.00 0.00 ? 63  TYR A HE2  1  
ATOM   943   H  HH   . TYR A 1 63 ? 9.581   -4.868  -8.898  1.00 0.00 ? 63  TYR A HH   1  
ATOM   944   N  N    . CYS A 1 64 ? 7.520   1.108   -2.825  1.00 0.00 ? 64  CYS A N    1  
ATOM   945   C  CA   . CYS A 1 64 ? 7.304   2.176   -1.857  1.00 0.00 ? 64  CYS A CA   1  
ATOM   946   C  C    . CYS A 1 64 ? 8.404   3.230   -1.956  1.00 0.00 ? 64  CYS A C    1  
ATOM   947   O  O    . CYS A 1 64 ? 9.551   2.918   -2.277  1.00 0.00 ? 64  CYS A O    1  
ATOM   948   C  CB   . CYS A 1 64 ? 7.256   1.606   -0.438  1.00 0.00 ? 64  CYS A CB   1  
ATOM   949   S  SG   . CYS A 1 64 ? 8.858   0.987   0.169   1.00 0.00 ? 64  CYS A SG   1  
ATOM   950   H  H    . CYS A 1 64 ? 7.967   0.284   -2.535  1.00 0.00 ? 64  CYS A H    1  
ATOM   951   H  HA   . CYS A 1 64 ? 6.356   2.641   -2.081  1.00 0.00 ? 64  CYS A HA   1  
ATOM   952   H  HB2  . CYS A 1 64 ? 6.924   2.378   0.241   1.00 0.00 ? 64  CYS A HB2  1  
ATOM   953   H  HB3  . CYS A 1 64 ? 6.554   0.785   -0.412  1.00 0.00 ? 64  CYS A HB3  1  
ATOM   954   N  N    . LEU A 1 65 ? 8.045   4.479   -1.678  1.00 0.00 ? 65  LEU A N    1  
ATOM   955   C  CA   . LEU A 1 65 ? 9.000   5.580   -1.736  1.00 0.00 ? 65  LEU A CA   1  
ATOM   956   C  C    . LEU A 1 65 ? 10.347  5.163   -1.153  1.00 0.00 ? 65  LEU A C    1  
ATOM   957   O  O    . LEU A 1 65 ? 11.401  5.366   -1.756  1.00 0.00 ? 65  LEU A O    1  
ATOM   958   C  CB   . LEU A 1 65 ? 8.457   6.792   -0.978  1.00 0.00 ? 65  LEU A CB   1  
ATOM   959   C  CG   . LEU A 1 65 ? 7.666   7.804   -1.808  1.00 0.00 ? 65  LEU A CG   1  
ATOM   960   C  CD1  . LEU A 1 65 ? 8.577   8.503   -2.806  1.00 0.00 ? 65  LEU A CD1  1  
ATOM   961   C  CD2  . LEU A 1 65 ? 6.512   7.120   -2.525  1.00 0.00 ? 65  LEU A CD2  1  
ATOM   962   H  H    . LEU A 1 65 ? 7.116   4.666   -1.429  1.00 0.00 ? 65  LEU A H    1  
ATOM   963   H  HA   . LEU A 1 65 ? 9.137   5.846   -2.773  1.00 0.00 ? 65  LEU A HA   1  
ATOM   964   H  HB2  . LEU A 1 65 ? 7.809   6.429   -0.195  1.00 0.00 ? 65  LEU A HB2  1  
ATOM   965   H  HB3  . LEU A 1 65 ? 9.298   7.309   -0.537  1.00 0.00 ? 65  LEU A HB3  1  
ATOM   966   H  HG   . LEU A 1 65 ? 7.254   8.556   -1.150  1.00 0.00 ? 65  LEU A HG   1  
ATOM   967   H  HD11 . LEU A 1 65 ? 9.416   7.865   -3.036  1.00 0.00 ? 65  LEU A HD11 1  
ATOM   968   H  HD12 . LEU A 1 65 ? 8.934   9.429   -2.380  1.00 0.00 ? 65  LEU A HD12 1  
ATOM   969   H  HD13 . LEU A 1 65 ? 8.025   8.713   -3.710  1.00 0.00 ? 65  LEU A HD13 1  
ATOM   970   H  HD21 . LEU A 1 65 ? 6.200   6.254   -1.959  1.00 0.00 ? 65  LEU A HD21 1  
ATOM   971   H  HD22 . LEU A 1 65 ? 6.833   6.809   -3.509  1.00 0.00 ? 65  LEU A HD22 1  
ATOM   972   H  HD23 . LEU A 1 65 ? 5.685   7.808   -2.615  1.00 0.00 ? 65  LEU A HD23 1  
ATOM   973   N  N    . PRO A 1 66 ? 10.313  4.564   0.046   1.00 0.00 ? 66  PRO A N    1  
ATOM   974   C  CA   . PRO A 1 66 ? 11.522  4.103   0.735   1.00 0.00 ? 66  PRO A CA   1  
ATOM   975   C  C    . PRO A 1 66 ? 12.440  3.299   -0.179  1.00 0.00 ? 66  PRO A C    1  
ATOM   976   O  O    . PRO A 1 66 ? 13.622  3.614   -0.323  1.00 0.00 ? 66  PRO A O    1  
ATOM   977   C  CB   . PRO A 1 66 ? 10.976  3.217   1.857   1.00 0.00 ? 66  PRO A CB   1  
ATOM   978   C  CG   . PRO A 1 66 ? 9.604   3.738   2.117   1.00 0.00 ? 66  PRO A CG   1  
ATOM   979   C  CD   . PRO A 1 66 ? 9.092   4.289   0.822   1.00 0.00 ? 66  PRO A CD   1  
ATOM   980   H  HA   . PRO A 1 66 ? 12.074  4.928   1.162   1.00 0.00 ? 66  PRO A HA   1  
ATOM   981   H  HB2  . PRO A 1 66 ? 10.952  2.188   1.528   1.00 0.00 ? 66  PRO A HB2  1  
ATOM   982   H  HB3  . PRO A 1 66 ? 11.604  3.307   2.731   1.00 0.00 ? 66  PRO A HB3  1  
ATOM   983   H  HG2  . PRO A 1 66 ? 8.964   2.937   2.453   1.00 0.00 ? 66  PRO A HG2  1  
ATOM   984   H  HG3  . PRO A 1 66 ? 9.645   4.524   2.858   1.00 0.00 ? 66  PRO A HG3  1  
ATOM   985   H  HD2  . PRO A 1 66 ? 8.475   3.557   0.323   1.00 0.00 ? 66  PRO A HD2  1  
ATOM   986   H  HD3  . PRO A 1 66 ? 8.535   5.198   0.998   1.00 0.00 ? 66  PRO A HD3  1  
ATOM   987   N  N    . CYS A 1 67 ? 11.889  2.259   -0.797  1.00 0.00 ? 67  CYS A N    1  
ATOM   988   C  CA   . CYS A 1 67 ? 12.657  1.409   -1.698  1.00 0.00 ? 67  CYS A CA   1  
ATOM   989   C  C    . CYS A 1 67 ? 13.020  2.159   -2.976  1.00 0.00 ? 67  CYS A C    1  
ATOM   990   O  O    . CYS A 1 67 ? 14.189  2.229   -3.358  1.00 0.00 ? 67  CYS A O    1  
ATOM   991   C  CB   . CYS A 1 67 ? 11.864  0.147   -2.042  1.00 0.00 ? 67  CYS A CB   1  
ATOM   992   S  SG   . CYS A 1 67 ? 12.019  -1.187  -0.812  1.00 0.00 ? 67  CYS A SG   1  
ATOM   993   H  H    . CYS A 1 67 ? 10.941  2.058   -0.642  1.00 0.00 ? 67  CYS A H    1  
ATOM   994   H  HA   . CYS A 1 67 ? 13.567  1.125   -1.191  1.00 0.00 ? 67  CYS A HA   1  
ATOM   995   H  HB2  . CYS A 1 67 ? 10.817  0.400   -2.121  1.00 0.00 ? 67  CYS A HB2  1  
ATOM   996   H  HB3  . CYS A 1 67 ? 12.208  -0.238  -2.990  1.00 0.00 ? 67  CYS A HB3  1  
ATOM   997   N  N    . HIS A 1 68 ? 12.010  2.720   -3.634  1.00 0.00 ? 68  HIS A N    1  
ATOM   998   C  CA   . HIS A 1 68 ? 12.222  3.466   -4.869  1.00 0.00 ? 68  HIS A CA   1  
ATOM   999   C  C    . HIS A 1 68 ? 13.449  4.366   -4.756  1.00 0.00 ? 68  HIS A C    1  
ATOM   1000  O  O    . HIS A 1 68 ? 14.273  4.426   -5.669  1.00 0.00 ? 68  HIS A O    1  
ATOM   1001  C  CB   . HIS A 1 68 ? 10.989  4.306   -5.201  1.00 0.00 ? 68  HIS A CB   1  
ATOM   1002  C  CG   . HIS A 1 68 ? 10.778  4.507   -6.670  1.00 0.00 ? 68  HIS A CG   1  
ATOM   1003  N  ND1  . HIS A 1 68 ? 11.035  5.700   -7.311  1.00 0.00 ? 68  HIS A ND1  1  
ATOM   1004  C  CD2  . HIS A 1 68 ? 10.334  3.656   -7.625  1.00 0.00 ? 68  HIS A CD2  1  
ATOM   1005  C  CE1  . HIS A 1 68 ? 10.756  5.576   -8.596  1.00 0.00 ? 68  HIS A CE1  1  
ATOM   1006  N  NE2  . HIS A 1 68 ? 10.329  4.345   -8.813  1.00 0.00 ? 68  HIS A NE2  1  
ATOM   1007  H  H    . HIS A 1 68 ? 11.101  2.630   -3.280  1.00 0.00 ? 68  HIS A H    1  
ATOM   1008  H  HA   . HIS A 1 68 ? 12.386  2.754   -5.663  1.00 0.00 ? 68  HIS A HA   1  
ATOM   1009  H  HB2  . HIS A 1 68 ? 10.111  3.817   -4.804  1.00 0.00 ? 68  HIS A HB2  1  
ATOM   1010  H  HB3  . HIS A 1 68 ? 11.090  5.279   -4.743  1.00 0.00 ? 68  HIS A HB3  1  
ATOM   1011  H  HD1  . HIS A 1 68 ? 11.369  6.517   -6.886  1.00 0.00 ? 68  HIS A HD1  1  
ATOM   1012  H  HD2  . HIS A 1 68 ? 10.038  2.627   -7.480  1.00 0.00 ? 68  HIS A HD2  1  
ATOM   1013  H  HE1  . HIS A 1 68 ? 10.860  6.349   -9.343  1.00 0.00 ? 68  HIS A HE1  1  
ATOM   1014  N  N    . ASP A 1 69 ? 13.563  5.064   -3.632  1.00 0.00 ? 69  ASP A N    1  
ATOM   1015  C  CA   . ASP A 1 69 ? 14.690  5.961   -3.399  1.00 0.00 ? 69  ASP A CA   1  
ATOM   1016  C  C    . ASP A 1 69 ? 16.008  5.193   -3.417  1.00 0.00 ? 69  ASP A C    1  
ATOM   1017  O  O    . ASP A 1 69 ? 17.037  5.715   -3.846  1.00 0.00 ? 69  ASP A O    1  
ATOM   1018  C  CB   . ASP A 1 69 ? 14.525  6.686   -2.063  1.00 0.00 ? 69  ASP A CB   1  
ATOM   1019  C  CG   . ASP A 1 69 ? 15.301  7.987   -2.010  1.00 0.00 ? 69  ASP A CG   1  
ATOM   1020  O  OD1  . ASP A 1 69 ? 16.400  8.047   -2.600  1.00 0.00 ? 69  ASP A OD1  1  
ATOM   1021  O  OD2  . ASP A 1 69 ? 14.808  8.946   -1.380  1.00 0.00 ? 69  ASP A OD2  1  
ATOM   1022  H  H    . ASP A 1 69 ? 12.874  4.974   -2.941  1.00 0.00 ? 69  ASP A H    1  
ATOM   1023  H  HA   . ASP A 1 69 ? 14.702  6.691   -4.195  1.00 0.00 ? 69  ASP A HA   1  
ATOM   1024  H  HB2  . ASP A 1 69 ? 13.479  6.906   -1.906  1.00 0.00 ? 69  ASP A HB2  1  
ATOM   1025  H  HB3  . ASP A 1 69 ? 14.876  6.045   -1.267  1.00 0.00 ? 69  ASP A HB3  1  
ATOM   1026  N  N    . LYS A 1 70 ? 15.970  3.951   -2.946  1.00 0.00 ? 70  LYS A N    1  
ATOM   1027  C  CA   . LYS A 1 70 ? 17.160  3.110   -2.906  1.00 0.00 ? 70  LYS A CA   1  
ATOM   1028  C  C    . LYS A 1 70 ? 17.386  2.424   -4.250  1.00 0.00 ? 70  LYS A C    1  
ATOM   1029  O  O    . LYS A 1 70 ? 18.000  1.359   -4.317  1.00 0.00 ? 70  LYS A O    1  
ATOM   1030  C  CB   . LYS A 1 70 ? 17.032  2.061   -1.800  1.00 0.00 ? 70  LYS A CB   1  
ATOM   1031  C  CG   . LYS A 1 70 ? 16.714  2.650   -0.437  1.00 0.00 ? 70  LYS A CG   1  
ATOM   1032  C  CD   . LYS A 1 70 ? 16.581  1.568   0.621   1.00 0.00 ? 70  LYS A CD   1  
ATOM   1033  C  CE   . LYS A 1 70 ? 16.083  2.136   1.941   1.00 0.00 ? 70  LYS A CE   1  
ATOM   1034  N  NZ   . LYS A 1 70 ? 16.208  1.152   3.052   1.00 0.00 ? 70  LYS A NZ   1  
ATOM   1035  H  H    . LYS A 1 70 ? 15.119  3.591   -2.617  1.00 0.00 ? 70  LYS A H    1  
ATOM   1036  H  HA   . LYS A 1 70 ? 18.007  3.744   -2.693  1.00 0.00 ? 70  LYS A HA   1  
ATOM   1037  H  HB2  . LYS A 1 70 ? 16.244  1.371   -2.064  1.00 0.00 ? 70  LYS A HB2  1  
ATOM   1038  H  HB3  . LYS A 1 70 ? 17.964  1.518   -1.726  1.00 0.00 ? 70  LYS A HB3  1  
ATOM   1039  H  HG2  . LYS A 1 70 ? 17.510  3.322   -0.150  1.00 0.00 ? 70  LYS A HG2  1  
ATOM   1040  H  HG3  . LYS A 1 70 ? 15.784  3.196   -0.499  1.00 0.00 ? 70  LYS A HG3  1  
ATOM   1041  H  HD2  . LYS A 1 70 ? 15.879  0.823   0.276   1.00 0.00 ? 70  LYS A HD2  1  
ATOM   1042  H  HD3  . LYS A 1 70 ? 17.547  1.109   0.778   1.00 0.00 ? 70  LYS A HD3  1  
ATOM   1043  H  HE2  . LYS A 1 70 ? 16.665  3.013   2.182   1.00 0.00 ? 70  LYS A HE2  1  
ATOM   1044  H  HE3  . LYS A 1 70 ? 15.045  2.412   1.831   1.00 0.00 ? 70  LYS A HE3  1  
ATOM   1045  H  HZ1  . LYS A 1 70 ? 17.163  1.194   3.461   1.00 0.00 ? 70  LYS A HZ1  1  
ATOM   1046  H  HZ2  . LYS A 1 70 ? 16.038  0.190   2.697   1.00 0.00 ? 70  LYS A HZ2  1  
ATOM   1047  H  HZ3  . LYS A 1 70 ? 15.513  1.363   3.796   1.00 0.00 ? 70  LYS A HZ3  1  
ATOM   1048  N  N    . MET A 1 71 ? 16.886  3.040   -5.316  1.00 0.00 ? 71  MET A N    1  
ATOM   1049  C  CA   . MET A 1 71 ? 17.036  2.488   -6.657  1.00 0.00 ? 71  MET A CA   1  
ATOM   1050  C  C    . MET A 1 71 ? 17.800  3.452   -7.559  1.00 0.00 ? 71  MET A C    1  
ATOM   1051  O  O    . MET A 1 71 ? 18.669  3.042   -8.328  1.00 0.00 ? 71  MET A O    1  
ATOM   1052  C  CB   . MET A 1 71 ? 15.664  2.184   -7.263  1.00 0.00 ? 71  MET A CB   1  
ATOM   1053  C  CG   . MET A 1 71 ? 14.787  1.317   -6.374  1.00 0.00 ? 71  MET A CG   1  
ATOM   1054  S  SD   . MET A 1 71 ? 13.628  0.307   -7.316  1.00 0.00 ? 71  MET A SD   1  
ATOM   1055  C  CE   . MET A 1 71 ? 13.644  -1.207  -6.360  1.00 0.00 ? 71  MET A CE   1  
ATOM   1056  H  H    . MET A 1 71 ? 16.406  3.887   -5.198  1.00 0.00 ? 71  MET A H    1  
ATOM   1057  H  HA   . MET A 1 71 ? 17.596  1.569   -6.576  1.00 0.00 ? 71  MET A HA   1  
ATOM   1058  H  HB2  . MET A 1 71 ? 15.149  3.115   -7.443  1.00 0.00 ? 71  MET A HB2  1  
ATOM   1059  H  HB3  . MET A 1 71 ? 15.804  1.671   -8.203  1.00 0.00 ? 71  MET A HB3  1  
ATOM   1060  H  HG2  . MET A 1 71 ? 15.420  0.664   -5.792  1.00 0.00 ? 71  MET A HG2  1  
ATOM   1061  H  HG3  . MET A 1 71 ? 14.227  1.959   -5.710  1.00 0.00 ? 71  MET A HG3  1  
ATOM   1062  H  HE1  . MET A 1 71 ? 12.843  -1.185  -5.636  1.00 0.00 ? 71  MET A HE1  1  
ATOM   1063  H  HE2  . MET A 1 71 ? 13.508  -2.051  -7.020  1.00 0.00 ? 71  MET A HE2  1  
ATOM   1064  H  HE3  . MET A 1 71 ? 14.590  -1.299  -5.847  1.00 0.00 ? 71  MET A HE3  1  
ATOM   1065  N  N    . GLY A 1 72 ? 17.470  4.737   -7.460  1.00 0.00 ? 72  GLY A N    1  
ATOM   1066  C  CA   . GLY A 1 72 ? 18.135  5.738   -8.273  1.00 0.00 ? 72  GLY A CA   1  
ATOM   1067  C  C    . GLY A 1 72 ? 19.444  6.202   -7.666  1.00 0.00 ? 72  GLY A C    1  
ATOM   1068  O  O    . GLY A 1 72 ? 19.693  7.403   -7.551  1.00 0.00 ? 72  GLY A O    1  
ATOM   1069  H  H    . GLY A 1 72 ? 16.770  5.006   -6.829  1.00 0.00 ? 72  GLY A H    1  
ATOM   1070  H  HA2  . GLY A 1 72 ? 18.331  5.322   -9.250  1.00 0.00 ? 72  GLY A HA2  1  
ATOM   1071  H  HA3  . GLY A 1 72 ? 17.480  6.590   -8.381  1.00 0.00 ? 72  GLY A HA3  1  
ATOM   1072  N  N    . VAL A 1 73 ? 20.283  5.249   -7.274  1.00 0.00 ? 73  VAL A N    1  
ATOM   1073  C  CA   . VAL A 1 73 ? 21.574  5.567   -6.674  1.00 0.00 ? 73  VAL A CA   1  
ATOM   1074  C  C    . VAL A 1 73 ? 22.721  5.020   -7.517  1.00 0.00 ? 73  VAL A C    1  
ATOM   1075  O  O    . VAL A 1 73 ? 22.652  3.901   -8.026  1.00 0.00 ? 73  VAL A O    1  
ATOM   1076  C  CB   . VAL A 1 73 ? 21.684  4.999   -5.247  1.00 0.00 ? 73  VAL A CB   1  
ATOM   1077  C  CG1  . VAL A 1 73 ? 20.699  5.693   -4.318  1.00 0.00 ? 73  VAL A CG1  1  
ATOM   1078  C  CG2  . VAL A 1 73 ? 21.456  3.495   -5.252  1.00 0.00 ? 73  VAL A CG2  1  
ATOM   1079  H  H    . VAL A 1 73 ? 20.029  4.310   -7.391  1.00 0.00 ? 73  VAL A H    1  
ATOM   1080  H  HA   . VAL A 1 73 ? 21.661  6.642   -6.619  1.00 0.00 ? 73  VAL A HA   1  
ATOM   1081  H  HB   . VAL A 1 73 ? 22.683  5.189   -4.882  1.00 0.00 ? 73  VAL A HB   1  
ATOM   1082  H  HG11 . VAL A 1 73 ? 21.183  5.910   -3.377  1.00 0.00 ? 73  VAL A HG11 1  
ATOM   1083  H  HG12 . VAL A 1 73 ? 20.363  6.613   -4.772  1.00 0.00 ? 73  VAL A HG12 1  
ATOM   1084  H  HG13 . VAL A 1 73 ? 19.851  5.046   -4.145  1.00 0.00 ? 73  VAL A HG13 1  
ATOM   1085  H  HG21 . VAL A 1 73 ? 20.445  3.284   -4.936  1.00 0.00 ? 73  VAL A HG21 1  
ATOM   1086  H  HG22 . VAL A 1 73 ? 21.608  3.111   -6.251  1.00 0.00 ? 73  VAL A HG22 1  
ATOM   1087  H  HG23 . VAL A 1 73 ? 22.152  3.022   -4.576  1.00 0.00 ? 73  VAL A HG23 1  
ATOM   1088  N  N    . SER A 1 74 ? 23.775  5.816   -7.659  1.00 0.00 ? 74  SER A N    1  
ATOM   1089  C  CA   . SER A 1 74 ? 24.937  5.413   -8.443  1.00 0.00 ? 74  SER A CA   1  
ATOM   1090  C  C    . SER A 1 74 ? 26.057  6.442   -8.323  1.00 0.00 ? 74  SER A C    1  
ATOM   1091  O  O    . SER A 1 74 ? 25.828  7.581   -7.917  1.00 0.00 ? 74  SER A O    1  
ATOM   1092  C  CB   . SER A 1 74 ? 24.550  5.232   -9.912  1.00 0.00 ? 74  SER A CB   1  
ATOM   1093  O  OG   . SER A 1 74 ? 24.122  3.906   -10.167 1.00 0.00 ? 74  SER A OG   1  
ATOM   1094  H  H    . SER A 1 74 ? 23.771  6.696   -7.228  1.00 0.00 ? 74  SER A H    1  
ATOM   1095  H  HA   . SER A 1 74 ? 25.289  4.469   -8.054  1.00 0.00 ? 74  SER A HA   1  
ATOM   1096  H  HB2  . SER A 1 74 ? 23.746  5.910   -10.155 1.00 0.00 ? 74  SER A HB2  1  
ATOM   1097  H  HB3  . SER A 1 74 ? 25.405  5.449   -10.536 1.00 0.00 ? 74  SER A HB3  1  
ATOM   1098  H  HG   . SER A 1 74 ? 23.255  3.768   -9.779  1.00 0.00 ? 74  SER A HG   1  
ATOM   1099  N  N    . GLY A 1 75 ? 27.270  6.032   -8.680  1.00 0.00 ? 75  GLY A N    1  
ATOM   1100  C  CA   . GLY A 1 75 ? 28.408  6.929   -8.606  1.00 0.00 ? 75  GLY A CA   1  
ATOM   1101  C  C    . GLY A 1 75 ? 28.506  7.843   -9.811  1.00 0.00 ? 75  GLY A C    1  
ATOM   1102  O  O    . GLY A 1 75 ? 27.779  8.830   -9.929  1.00 0.00 ? 75  GLY A O    1  
ATOM   1103  H  H    . GLY A 1 75 ? 27.394  5.112   -8.996  1.00 0.00 ? 75  GLY A H    1  
ATOM   1104  H  HA2  . GLY A 1 75 ? 28.319  7.533   -7.715  1.00 0.00 ? 75  GLY A HA2  1  
ATOM   1105  H  HA3  . GLY A 1 75 ? 29.312  6.341   -8.541  1.00 0.00 ? 75  GLY A HA3  1  
ATOM   1106  N  N    . PRO A 1 76 ? 29.424  7.517   -10.733 1.00 0.00 ? 76  PRO A N    1  
ATOM   1107  C  CA   . PRO A 1 76 ? 29.636  8.305   -11.951 1.00 0.00 ? 76  PRO A CA   1  
ATOM   1108  C  C    . PRO A 1 76 ? 28.471  8.187   -12.928 1.00 0.00 ? 76  PRO A C    1  
ATOM   1109  O  O    . PRO A 1 76 ? 28.362  7.207   -13.664 1.00 0.00 ? 76  PRO A O    1  
ATOM   1110  C  CB   . PRO A 1 76 ? 30.903  7.691   -12.554 1.00 0.00 ? 76  PRO A CB   1  
ATOM   1111  C  CG   . PRO A 1 76 ? 30.933  6.296   -12.031 1.00 0.00 ? 76  PRO A CG   1  
ATOM   1112  C  CD   . PRO A 1 76 ? 30.325  6.355   -10.658 1.00 0.00 ? 76  PRO A CD   1  
ATOM   1113  H  HA   . PRO A 1 76 ? 29.812  9.346   -11.725 1.00 0.00 ? 76  PRO A HA   1  
ATOM   1114  H  HB2  . PRO A 1 76 ? 30.836  7.709   -13.632 1.00 0.00 ? 76  PRO A HB2  1  
ATOM   1115  H  HB3  . PRO A 1 76 ? 31.767  8.252   -12.231 1.00 0.00 ? 76  PRO A HB3  1  
ATOM   1116  H  HG2  . PRO A 1 76 ? 30.352  5.652   -12.672 1.00 0.00 ? 76  PRO A HG2  1  
ATOM   1117  H  HG3  . PRO A 1 76 ? 31.954  5.949   -11.974 1.00 0.00 ? 76  PRO A HG3  1  
ATOM   1118  H  HD2  . PRO A 1 76 ? 29.771  5.451   -10.451 1.00 0.00 ? 76  PRO A HD2  1  
ATOM   1119  H  HD3  . PRO A 1 76 ? 31.091  6.509   -9.912  1.00 0.00 ? 76  PRO A HD3  1  
ATOM   1120  N  N    . SER A 1 77 ? 27.603  9.194   -12.929 1.00 0.00 ? 77  SER A N    1  
ATOM   1121  C  CA   . SER A 1 77 ? 26.444  9.202   -13.814 1.00 0.00 ? 77  SER A CA   1  
ATOM   1122  C  C    . SER A 1 77 ? 26.683  10.111  -15.015 1.00 0.00 ? 77  SER A C    1  
ATOM   1123  O  O    . SER A 1 77 ? 26.924  11.309  -14.862 1.00 0.00 ? 77  SER A O    1  
ATOM   1124  C  CB   . SER A 1 77 ? 25.198  9.660   -13.053 1.00 0.00 ? 77  SER A CB   1  
ATOM   1125  O  OG   . SER A 1 77 ? 24.038  9.546   -13.858 1.00 0.00 ? 77  SER A OG   1  
ATOM   1126  H  H    . SER A 1 77 ? 27.744  9.948   -12.319 1.00 0.00 ? 77  SER A H    1  
ATOM   1127  H  HA   . SER A 1 77 ? 26.289  8.193   -14.166 1.00 0.00 ? 77  SER A HA   1  
ATOM   1128  H  HB2  . SER A 1 77 ? 25.072  9.048   -12.172 1.00 0.00 ? 77  SER A HB2  1  
ATOM   1129  H  HB3  . SER A 1 77 ? 25.318  10.693  -12.759 1.00 0.00 ? 77  SER A HB3  1  
ATOM   1130  H  HG   . SER A 1 77 ? 23.830  10.400  -14.243 1.00 0.00 ? 77  SER A HG   1  
ATOM   1131  N  N    . SER A 1 78 ? 26.614  9.534   -16.210 1.00 0.00 ? 78  SER A N    1  
ATOM   1132  C  CA   . SER A 1 78 ? 26.827  10.290  -17.438 1.00 0.00 ? 78  SER A CA   1  
ATOM   1133  C  C    . SER A 1 78 ? 25.571  10.283  -18.305 1.00 0.00 ? 78  SER A C    1  
ATOM   1134  O  O    . SER A 1 78 ? 25.204  9.257   -18.877 1.00 0.00 ? 78  SER A O    1  
ATOM   1135  C  CB   . SER A 1 78 ? 28.005  9.709   -18.223 1.00 0.00 ? 78  SER A CB   1  
ATOM   1136  O  OG   . SER A 1 78 ? 27.776  8.352   -18.557 1.00 0.00 ? 78  SER A OG   1  
ATOM   1137  H  H    . SER A 1 78 ? 26.418  8.575   -16.266 1.00 0.00 ? 78  SER A H    1  
ATOM   1138  H  HA   . SER A 1 78 ? 27.055  11.309  -17.164 1.00 0.00 ? 78  SER A HA   1  
ATOM   1139  H  HB2  . SER A 1 78 ? 28.141  10.273  -19.133 1.00 0.00 ? 78  SER A HB2  1  
ATOM   1140  H  HB3  . SER A 1 78 ? 28.900  9.774   -17.621 1.00 0.00 ? 78  SER A HB3  1  
ATOM   1141  H  HG   . SER A 1 78 ? 28.449  7.803   -18.148 1.00 0.00 ? 78  SER A HG   1  
ATOM   1142  N  N    . GLY A 1 79 ? 24.916  11.436  -18.397 1.00 0.00 ? 79  GLY A N    1  
ATOM   1143  C  CA   . GLY A 1 79 ? 23.709  11.542  -19.196 1.00 0.00 ? 79  GLY A CA   1  
ATOM   1144  C  C    . GLY A 1 79 ? 23.961  11.277  -20.666 1.00 0.00 ? 79  GLY A C    1  
ATOM   1145  O  O    . GLY A 1 79 ? 24.610  10.285  -20.993 1.00 0.00 ? 79  GLY A O    1  
ATOM   1146  H  H    . GLY A 1 79 ? 25.256  12.222  -17.919 1.00 0.00 ? 79  GLY A H    1  
ATOM   1147  H  HA2  . GLY A 1 79 ? 22.985  10.829  -18.830 1.00 0.00 ? 79  GLY A HA2  1  
ATOM   1148  H  HA3  . GLY A 1 79 ? 23.305  12.538  -19.086 1.00 0.00 ? 79  GLY A HA3  1  
HETATM 1149  ZN ZN   . ZN  B 2 .  ? -9.707  -0.467  -2.516  1.00 0.00 ? 201 ZN  A ZN   1  
HETATM 1150  ZN ZN   . ZN  C 2 .  ? 9.696   -1.138  -0.349  1.00 0.00 ? 401 ZN  A ZN   1  
ATOM   1151  N  N    . GLY A 1 1  ? -18.802 -13.360 -35.217 1.00 0.00 ? 1   GLY A N    2  
ATOM   1152  C  CA   . GLY A 1 1  ? -18.781 -11.949 -34.875 1.00 0.00 ? 1   GLY A CA   2  
ATOM   1153  C  C    . GLY A 1 1  ? -18.406 -11.710 -33.426 1.00 0.00 ? 1   GLY A C    2  
ATOM   1154  O  O    . GLY A 1 1  ? -18.984 -12.313 -32.521 1.00 0.00 ? 1   GLY A O    2  
ATOM   1155  H  H1   . GLY A 1 1  ? -18.771 -13.634 -36.158 1.00 0.00 ? 1   GLY A H1   2  
ATOM   1156  H  HA2  . GLY A 1 1  ? -18.066 -11.447 -35.509 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   1157  H  HA3  . GLY A 1 1  ? -19.761 -11.532 -35.055 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   1158  N  N    . SER A 1 2  ? -17.435 -10.830 -33.205 1.00 0.00 ? 2   SER A N    2  
ATOM   1159  C  CA   . SER A 1 2  ? -16.980 -10.516 -31.856 1.00 0.00 ? 2   SER A CA   2  
ATOM   1160  C  C    . SER A 1 2  ? -16.657 -9.031  -31.722 1.00 0.00 ? 2   SER A C    2  
ATOM   1161  O  O    . SER A 1 2  ? -15.866 -8.486  -32.492 1.00 0.00 ? 2   SER A O    2  
ATOM   1162  C  CB   . SER A 1 2  ? -15.748 -11.352 -31.503 1.00 0.00 ? 2   SER A CB   2  
ATOM   1163  O  OG   . SER A 1 2  ? -15.526 -11.369 -30.104 1.00 0.00 ? 2   SER A OG   2  
ATOM   1164  H  H    . SER A 1 2  ? -17.014 -10.382 -33.968 1.00 0.00 ? 2   SER A H    2  
ATOM   1165  H  HA   . SER A 1 2  ? -17.778 -10.762 -31.171 1.00 0.00 ? 2   SER A HA   2  
ATOM   1166  H  HB2  . SER A 1 2  ? -15.894 -12.365 -31.845 1.00 0.00 ? 2   SER A HB2  2  
ATOM   1167  H  HB3  . SER A 1 2  ? -14.880 -10.930 -31.988 1.00 0.00 ? 2   SER A HB3  2  
ATOM   1168  H  HG   . SER A 1 2  ? -14.585 -11.435 -29.929 1.00 0.00 ? 2   SER A HG   2  
ATOM   1169  N  N    . SER A 1 3  ? -17.275 -8.383  -30.740 1.00 0.00 ? 3   SER A N    2  
ATOM   1170  C  CA   . SER A 1 3  ? -17.056 -6.960  -30.507 1.00 0.00 ? 3   SER A CA   2  
ATOM   1171  C  C    . SER A 1 3  ? -17.658 -6.530  -29.173 1.00 0.00 ? 3   SER A C    2  
ATOM   1172  O  O    . SER A 1 3  ? -18.726 -6.998  -28.781 1.00 0.00 ? 3   SER A O    2  
ATOM   1173  C  CB   . SER A 1 3  ? -17.665 -6.137  -31.644 1.00 0.00 ? 3   SER A CB   2  
ATOM   1174  O  OG   . SER A 1 3  ? -19.077 -6.259  -31.663 1.00 0.00 ? 3   SER A OG   2  
ATOM   1175  H  H    . SER A 1 3  ? -17.894 -8.874  -30.160 1.00 0.00 ? 3   SER A H    2  
ATOM   1176  H  HA   . SER A 1 3  ? -15.991 -6.789  -30.480 1.00 0.00 ? 3   SER A HA   2  
ATOM   1177  H  HB2  . SER A 1 3  ? -17.408 -5.097  -31.509 1.00 0.00 ? 3   SER A HB2  2  
ATOM   1178  H  HB3  . SER A 1 3  ? -17.272 -6.486  -32.588 1.00 0.00 ? 3   SER A HB3  2  
ATOM   1179  H  HG   . SER A 1 3  ? -19.320 -7.183  -31.572 1.00 0.00 ? 3   SER A HG   2  
ATOM   1180  N  N    . GLY A 1 4  ? -16.963 -5.633  -28.479 1.00 0.00 ? 4   GLY A N    2  
ATOM   1181  C  CA   . GLY A 1 4  ? -17.443 -5.154  -27.196 1.00 0.00 ? 4   GLY A CA   2  
ATOM   1182  C  C    . GLY A 1 4  ? -16.636 -3.981  -26.677 1.00 0.00 ? 4   GLY A C    2  
ATOM   1183  O  O    . GLY A 1 4  ? -15.521 -4.155  -26.185 1.00 0.00 ? 4   GLY A O    2  
ATOM   1184  H  H    . GLY A 1 4  ? -16.118 -5.295  -28.841 1.00 0.00 ? 4   GLY A H    2  
ATOM   1185  H  HA2  . GLY A 1 4  ? -18.474 -4.850  -27.301 1.00 0.00 ? 4   GLY A HA2  2  
ATOM   1186  H  HA3  . GLY A 1 4  ? -17.387 -5.960  -26.480 1.00 0.00 ? 4   GLY A HA3  2  
ATOM   1187  N  N    . SER A 1 5  ? -17.199 -2.782  -26.787 1.00 0.00 ? 5   SER A N    2  
ATOM   1188  C  CA   . SER A 1 5  ? -16.522 -1.574  -26.329 1.00 0.00 ? 5   SER A CA   2  
ATOM   1189  C  C    . SER A 1 5  ? -17.316 -0.894  -25.218 1.00 0.00 ? 5   SER A C    2  
ATOM   1190  O  O    . SER A 1 5  ? -18.537 -1.030  -25.140 1.00 0.00 ? 5   SER A O    2  
ATOM   1191  C  CB   . SER A 1 5  ? -16.320 -0.604  -27.495 1.00 0.00 ? 5   SER A CB   2  
ATOM   1192  O  OG   . SER A 1 5  ? -15.940 0.679   -27.030 1.00 0.00 ? 5   SER A OG   2  
ATOM   1193  H  H    . SER A 1 5  ? -18.091 -2.708  -27.188 1.00 0.00 ? 5   SER A H    2  
ATOM   1194  H  HA   . SER A 1 5  ? -15.556 -1.863  -25.941 1.00 0.00 ? 5   SER A HA   2  
ATOM   1195  H  HB2  . SER A 1 5  ? -15.546 -0.983  -28.145 1.00 0.00 ? 5   SER A HB2  2  
ATOM   1196  H  HB3  . SER A 1 5  ? -17.244 -0.515  -28.048 1.00 0.00 ? 5   SER A HB3  2  
ATOM   1197  H  HG   . SER A 1 5  ? -15.318 0.586   -26.305 1.00 0.00 ? 5   SER A HG   2  
ATOM   1198  N  N    . SER A 1 6  ? -16.613 -0.162  -24.360 1.00 0.00 ? 6   SER A N    2  
ATOM   1199  C  CA   . SER A 1 6  ? -17.250 0.538   -23.250 1.00 0.00 ? 6   SER A CA   2  
ATOM   1200  C  C    . SER A 1 6  ? -16.440 1.766   -22.846 1.00 0.00 ? 6   SER A C    2  
ATOM   1201  O  O    . SER A 1 6  ? -15.256 1.666   -22.531 1.00 0.00 ? 6   SER A O    2  
ATOM   1202  C  CB   . SER A 1 6  ? -17.408 -0.401  -22.052 1.00 0.00 ? 6   SER A CB   2  
ATOM   1203  O  OG   . SER A 1 6  ? -17.726 0.323   -20.876 1.00 0.00 ? 6   SER A OG   2  
ATOM   1204  H  H    . SER A 1 6  ? -15.642 -0.092  -24.475 1.00 0.00 ? 6   SER A H    2  
ATOM   1205  H  HA   . SER A 1 6  ? -18.228 0.857   -23.578 1.00 0.00 ? 6   SER A HA   2  
ATOM   1206  H  HB2  . SER A 1 6  ? -18.201 -1.105  -22.252 1.00 0.00 ? 6   SER A HB2  2  
ATOM   1207  H  HB3  . SER A 1 6  ? -16.482 -0.935  -21.893 1.00 0.00 ? 6   SER A HB3  2  
ATOM   1208  H  HG   . SER A 1 6  ? -17.728 -0.273  -20.124 1.00 0.00 ? 6   SER A HG   2  
ATOM   1209  N  N    . GLY A 1 7  ? -17.091 2.926   -22.857 1.00 0.00 ? 7   GLY A N    2  
ATOM   1210  C  CA   . GLY A 1 7  ? -16.417 4.158   -22.490 1.00 0.00 ? 7   GLY A CA   2  
ATOM   1211  C  C    . GLY A 1 7  ? -17.297 5.076   -21.665 1.00 0.00 ? 7   GLY A C    2  
ATOM   1212  O  O    . GLY A 1 7  ? -17.821 6.066   -22.175 1.00 0.00 ? 7   GLY A O    2  
ATOM   1213  H  H    . GLY A 1 7  ? -18.036 2.945   -23.117 1.00 0.00 ? 7   GLY A H    2  
ATOM   1214  H  HA2  . GLY A 1 7  ? -15.533 3.915   -21.919 1.00 0.00 ? 7   GLY A HA2  2  
ATOM   1215  H  HA3  . GLY A 1 7  ? -16.122 4.675   -23.391 1.00 0.00 ? 7   GLY A HA3  2  
ATOM   1216  N  N    . GLU A 1 8  ? -17.462 4.746   -20.388 1.00 0.00 ? 8   GLU A N    2  
ATOM   1217  C  CA   . GLU A 1 8  ? -18.287 5.548   -19.493 1.00 0.00 ? 8   GLU A CA   2  
ATOM   1218  C  C    . GLU A 1 8  ? -17.523 5.904   -18.221 1.00 0.00 ? 8   GLU A C    2  
ATOM   1219  O  O    . GLU A 1 8  ? -17.182 5.031   -17.423 1.00 0.00 ? 8   GLU A O    2  
ATOM   1220  C  CB   . GLU A 1 8  ? -19.571 4.796   -19.136 1.00 0.00 ? 8   GLU A CB   2  
ATOM   1221  C  CG   . GLU A 1 8  ? -20.486 5.565   -18.197 1.00 0.00 ? 8   GLU A CG   2  
ATOM   1222  C  CD   . GLU A 1 8  ? -21.941 5.167   -18.345 1.00 0.00 ? 8   GLU A CD   2  
ATOM   1223  O  OE1  . GLU A 1 8  ? -22.529 5.456   -19.409 1.00 0.00 ? 8   GLU A OE1  2  
ATOM   1224  O  OE2  . GLU A 1 8  ? -22.493 4.568   -17.399 1.00 0.00 ? 8   GLU A OE2  2  
ATOM   1225  H  H    . GLU A 1 8  ? -17.018 3.945   -20.040 1.00 0.00 ? 8   GLU A H    2  
ATOM   1226  H  HA   . GLU A 1 8  ? -18.547 6.460   -20.009 1.00 0.00 ? 8   GLU A HA   2  
ATOM   1227  H  HB2  . GLU A 1 8  ? -20.116 4.586   -20.045 1.00 0.00 ? 8   GLU A HB2  2  
ATOM   1228  H  HB3  . GLU A 1 8  ? -19.306 3.862   -18.662 1.00 0.00 ? 8   GLU A HB3  2  
ATOM   1229  H  HG2  . GLU A 1 8  ? -20.179 5.374   -17.179 1.00 0.00 ? 8   GLU A HG2  2  
ATOM   1230  H  HG3  . GLU A 1 8  ? -20.392 6.620   -18.408 1.00 0.00 ? 8   GLU A HG3  2  
ATOM   1231  N  N    . LYS A 1 9  ? -17.257 7.193   -18.039 1.00 0.00 ? 9   LYS A N    2  
ATOM   1232  C  CA   . LYS A 1 9  ? -16.533 7.668   -16.865 1.00 0.00 ? 9   LYS A CA   2  
ATOM   1233  C  C    . LYS A 1 9  ? -17.500 8.074   -15.758 1.00 0.00 ? 9   LYS A C    2  
ATOM   1234  O  O    . LYS A 1 9  ? -18.658 8.398   -16.020 1.00 0.00 ? 9   LYS A O    2  
ATOM   1235  C  CB   . LYS A 1 9  ? -15.639 8.853   -17.236 1.00 0.00 ? 9   LYS A CB   2  
ATOM   1236  C  CG   . LYS A 1 9  ? -16.411 10.077  -17.697 1.00 0.00 ? 9   LYS A CG   2  
ATOM   1237  C  CD   . LYS A 1 9  ? -15.583 11.343  -17.559 1.00 0.00 ? 9   LYS A CD   2  
ATOM   1238  C  CE   . LYS A 1 9  ? -16.344 12.563  -18.054 1.00 0.00 ? 9   LYS A CE   2  
ATOM   1239  N  NZ   . LYS A 1 9  ? -16.170 12.769  -19.518 1.00 0.00 ? 9   LYS A NZ   2  
ATOM   1240  H  H    . LYS A 1 9  ? -17.555 7.842   -18.712 1.00 0.00 ? 9   LYS A H    2  
ATOM   1241  H  HA   . LYS A 1 9  ? -15.915 6.859   -16.508 1.00 0.00 ? 9   LYS A HA   2  
ATOM   1242  H  HB2  . LYS A 1 9  ? -15.050 9.128   -16.374 1.00 0.00 ? 9   LYS A HB2  2  
ATOM   1243  H  HB3  . LYS A 1 9  ? -14.974 8.551   -18.033 1.00 0.00 ? 9   LYS A HB3  2  
ATOM   1244  H  HG2  . LYS A 1 9  ? -16.684 9.950   -18.735 1.00 0.00 ? 9   LYS A HG2  2  
ATOM   1245  H  HG3  . LYS A 1 9  ? -17.305 10.174  -17.098 1.00 0.00 ? 9   LYS A HG3  2  
ATOM   1246  H  HD2  . LYS A 1 9  ? -15.333 11.487  -16.518 1.00 0.00 ? 9   LYS A HD2  2  
ATOM   1247  H  HD3  . LYS A 1 9  ? -14.677 11.235  -18.138 1.00 0.00 ? 9   LYS A HD3  2  
ATOM   1248  H  HE2  . LYS A 1 9  ? -17.393 12.428  -17.840 1.00 0.00 ? 9   LYS A HE2  2  
ATOM   1249  H  HE3  . LYS A 1 9  ? -15.980 13.435  -17.531 1.00 0.00 ? 9   LYS A HE3  2  
ATOM   1250  H  HZ1  . LYS A 1 9  ? -16.277 13.777  -19.753 1.00 0.00 ? 9   LYS A HZ1  2  
ATOM   1251  H  HZ2  . LYS A 1 9  ? -16.885 12.226  -20.043 1.00 0.00 ? 9   LYS A HZ2  2  
ATOM   1252  H  HZ3  . LYS A 1 9  ? -15.224 12.454  -19.814 1.00 0.00 ? 9   LYS A HZ3  2  
ATOM   1253  N  N    . ALA A 1 10 ? -17.017 8.056   -14.520 1.00 0.00 ? 10  ALA A N    2  
ATOM   1254  C  CA   . ALA A 1 10 ? -17.838 8.426   -13.374 1.00 0.00 ? 10  ALA A CA   2  
ATOM   1255  C  C    . ALA A 1 10 ? -17.110 9.421   -12.476 1.00 0.00 ? 10  ALA A C    2  
ATOM   1256  O  O    . ALA A 1 10 ? -16.065 9.108   -11.906 1.00 0.00 ? 10  ALA A O    2  
ATOM   1257  C  CB   . ALA A 1 10 ? -18.229 7.187   -12.583 1.00 0.00 ? 10  ALA A CB   2  
ATOM   1258  H  H    . ALA A 1 10 ? -16.086 7.788   -14.375 1.00 0.00 ? 10  ALA A H    2  
ATOM   1259  H  HA   . ALA A 1 10 ? -18.742 8.886   -13.746 1.00 0.00 ? 10  ALA A HA   2  
ATOM   1260  H  HB1  . ALA A 1 10 ? -17.583 6.366   -12.859 1.00 0.00 ? 10  ALA A HB1  2  
ATOM   1261  H  HB2  . ALA A 1 10 ? -18.126 7.387   -11.527 1.00 0.00 ? 10  ALA A HB2  2  
ATOM   1262  H  HB3  . ALA A 1 10 ? -19.254 6.928   -12.803 1.00 0.00 ? 10  ALA A HB3  2  
ATOM   1263  N  N    . ARG A 1 11 ? -17.669 10.621  -12.356 1.00 0.00 ? 11  ARG A N    2  
ATOM   1264  C  CA   . ARG A 1 11 ? -17.072 11.663  -11.529 1.00 0.00 ? 11  ARG A CA   2  
ATOM   1265  C  C    . ARG A 1 11 ? -18.150 12.519  -10.872 1.00 0.00 ? 11  ARG A C    2  
ATOM   1266  O  O    . ARG A 1 11 ? -19.075 12.988  -11.534 1.00 0.00 ? 11  ARG A O    2  
ATOM   1267  C  CB   . ARG A 1 11 ? -16.148 12.545  -12.371 1.00 0.00 ? 11  ARG A CB   2  
ATOM   1268  C  CG   . ARG A 1 11 ? -14.733 12.003  -12.492 1.00 0.00 ? 11  ARG A CG   2  
ATOM   1269  C  CD   . ARG A 1 11 ? -13.856 12.473  -11.343 1.00 0.00 ? 11  ARG A CD   2  
ATOM   1270  N  NE   . ARG A 1 11 ? -13.414 13.854  -11.521 1.00 0.00 ? 11  ARG A NE   2  
ATOM   1271  C  CZ   . ARG A 1 11 ? -12.363 14.375  -10.898 1.00 0.00 ? 11  ARG A CZ   2  
ATOM   1272  N  NH1  . ARG A 1 11 ? -11.649 13.634  -10.062 1.00 0.00 ? 11  ARG A NH1  2  
ATOM   1273  N  NH2  . ARG A 1 11 ? -12.023 15.640  -11.113 1.00 0.00 ? 11  ARG A NH2  2  
ATOM   1274  H  H    . ARG A 1 11 ? -18.502 10.811  -12.836 1.00 0.00 ? 11  ARG A H    2  
ATOM   1275  H  HA   . ARG A 1 11 ? -16.491 11.181  -10.758 1.00 0.00 ? 11  ARG A HA   2  
ATOM   1276  H  HB2  . ARG A 1 11 ? -16.562 12.634  -13.365 1.00 0.00 ? 11  ARG A HB2  2  
ATOM   1277  H  HB3  . ARG A 1 11 ? -16.098 13.525  -11.921 1.00 0.00 ? 11  ARG A HB3  2  
ATOM   1278  H  HG2  . ARG A 1 11 ? -14.769 10.923  -12.485 1.00 0.00 ? 11  ARG A HG2  2  
ATOM   1279  H  HG3  . ARG A 1 11 ? -14.306 12.344  -13.423 1.00 0.00 ? 11  ARG A HG3  2  
ATOM   1280  H  HD2  . ARG A 1 11 ? -14.420 12.402  -10.425 1.00 0.00 ? 11  ARG A HD2  2  
ATOM   1281  H  HD3  . ARG A 1 11 ? -12.989 11.832  -11.283 1.00 0.00 ? 11  ARG A HD3  2  
ATOM   1282  H  HE   . ARG A 1 11 ? -13.927 14.419  -12.135 1.00 0.00 ? 11  ARG A HE   2  
ATOM   1283  H  HH11 . ARG A 1 11 ? -11.902 12.681  -9.899  1.00 0.00 ? 11  ARG A HH11 2  
ATOM   1284  H  HH12 . ARG A 1 11 ? -10.857 14.029  -9.595  1.00 0.00 ? 11  ARG A HH12 2  
ATOM   1285  H  HH21 . ARG A 1 11 ? -12.558 16.201  -11.743 1.00 0.00 ? 11  ARG A HH21 2  
ATOM   1286  H  HH22 . ARG A 1 11 ? -11.232 16.031  -10.644 1.00 0.00 ? 11  ARG A HH22 2  
ATOM   1287  N  N    . GLY A 1 12 ? -18.024 12.718  -9.563  1.00 0.00 ? 12  GLY A N    2  
ATOM   1288  C  CA   . GLY A 1 12 ? -18.994 13.517  -8.837  1.00 0.00 ? 12  GLY A CA   2  
ATOM   1289  C  C    . GLY A 1 12 ? -18.376 14.260  -7.669  1.00 0.00 ? 12  GLY A C    2  
ATOM   1290  O  O    . GLY A 1 12 ? -17.157 14.250  -7.492  1.00 0.00 ? 12  GLY A O    2  
ATOM   1291  H  H    . GLY A 1 12 ? -17.265 12.320  -9.087  1.00 0.00 ? 12  GLY A H    2  
ATOM   1292  H  HA2  . GLY A 1 12 ? -19.432 14.234  -9.515  1.00 0.00 ? 12  GLY A HA2  2  
ATOM   1293  H  HA3  . GLY A 1 12 ? -19.771 12.867  -8.464  1.00 0.00 ? 12  GLY A HA3  2  
ATOM   1294  N  N    . LEU A 1 13 ? -19.217 14.907  -6.870  1.00 0.00 ? 13  LEU A N    2  
ATOM   1295  C  CA   . LEU A 1 13 ? -18.746 15.660  -5.713  1.00 0.00 ? 13  LEU A CA   2  
ATOM   1296  C  C    . LEU A 1 13 ? -18.524 14.739  -4.517  1.00 0.00 ? 13  LEU A C    2  
ATOM   1297  O  O    . LEU A 1 13 ? -19.460 14.419  -3.785  1.00 0.00 ? 13  LEU A O    2  
ATOM   1298  C  CB   . LEU A 1 13 ? -19.751 16.754  -5.349  1.00 0.00 ? 13  LEU A CB   2  
ATOM   1299  C  CG   . LEU A 1 13 ? -19.645 18.055  -6.145  1.00 0.00 ? 13  LEU A CG   2  
ATOM   1300  C  CD1  . LEU A 1 13 ? -18.295 18.715  -5.912  1.00 0.00 ? 13  LEU A CD1  2  
ATOM   1301  C  CD2  . LEU A 1 13 ? -19.862 17.792  -7.628  1.00 0.00 ? 13  LEU A CD2  2  
ATOM   1302  H  H    . LEU A 1 13 ? -20.177 14.878  -7.062  1.00 0.00 ? 13  LEU A H    2  
ATOM   1303  H  HA   . LEU A 1 13 ? -17.805 16.120  -5.977  1.00 0.00 ? 13  LEU A HA   2  
ATOM   1304  H  HB2  . LEU A 1 13 ? -20.743 16.356  -5.498  1.00 0.00 ? 13  LEU A HB2  2  
ATOM   1305  H  HB3  . LEU A 1 13 ? -19.614 16.993  -4.303  1.00 0.00 ? 13  LEU A HB3  2  
ATOM   1306  H  HG   . LEU A 1 13 ? -20.412 18.739  -5.810  1.00 0.00 ? 13  LEU A HG   2  
ATOM   1307  H  HD11 . LEU A 1 13 ? -17.721 18.124  -5.214  1.00 0.00 ? 13  LEU A HD11 2  
ATOM   1308  H  HD12 . LEU A 1 13 ? -18.443 19.706  -5.508  1.00 0.00 ? 13  LEU A HD12 2  
ATOM   1309  H  HD13 . LEU A 1 13 ? -17.762 18.786  -6.849  1.00 0.00 ? 13  LEU A HD13 2  
ATOM   1310  H  HD21 . LEU A 1 13 ? -19.333 16.895  -7.915  1.00 0.00 ? 13  LEU A HD21 2  
ATOM   1311  H  HD22 . LEU A 1 13 ? -19.490 18.629  -8.201  1.00 0.00 ? 13  LEU A HD22 2  
ATOM   1312  H  HD23 . LEU A 1 13 ? -20.917 17.664  -7.820  1.00 0.00 ? 13  LEU A HD23 2  
ATOM   1313  N  N    . GLY A 1 14 ? -17.278 14.318  -4.324  1.00 0.00 ? 14  GLY A N    2  
ATOM   1314  C  CA   . GLY A 1 14 ? -16.956 13.439  -3.215  1.00 0.00 ? 14  GLY A CA   2  
ATOM   1315  C  C    . GLY A 1 14 ? -15.478 13.105  -3.150  1.00 0.00 ? 14  GLY A C    2  
ATOM   1316  O  O    . GLY A 1 14 ? -14.633 13.999  -3.104  1.00 0.00 ? 14  GLY A O    2  
ATOM   1317  H  H    . GLY A 1 14 ? -16.572 14.605  -4.940  1.00 0.00 ? 14  GLY A H    2  
ATOM   1318  H  HA2  . GLY A 1 14 ? -17.246 13.921  -2.293  1.00 0.00 ? 14  GLY A HA2  2  
ATOM   1319  H  HA3  . GLY A 1 14 ? -17.516 12.522  -3.322  1.00 0.00 ? 14  GLY A HA3  2  
ATOM   1320  N  N    . LYS A 1 15 ? -15.165 11.814  -3.146  1.00 0.00 ? 15  LYS A N    2  
ATOM   1321  C  CA   . LYS A 1 15 ? -13.780 11.362  -3.086  1.00 0.00 ? 15  LYS A CA   2  
ATOM   1322  C  C    . LYS A 1 15 ? -13.481 10.375  -4.210  1.00 0.00 ? 15  LYS A C    2  
ATOM   1323  O  O    . LYS A 1 15 ? -14.321 10.133  -5.077  1.00 0.00 ? 15  LYS A O    2  
ATOM   1324  C  CB   . LYS A 1 15 ? -13.493 10.711  -1.731  1.00 0.00 ? 15  LYS A CB   2  
ATOM   1325  C  CG   . LYS A 1 15 ? -13.414 11.704  -0.584  1.00 0.00 ? 15  LYS A CG   2  
ATOM   1326  C  CD   . LYS A 1 15 ? -11.986 12.159  -0.337  1.00 0.00 ? 15  LYS A CD   2  
ATOM   1327  C  CE   . LYS A 1 15 ? -11.574 13.253  -1.310  1.00 0.00 ? 15  LYS A CE   2  
ATOM   1328  N  NZ   . LYS A 1 15 ? -10.923 12.696  -2.528  1.00 0.00 ? 15  LYS A NZ   2  
ATOM   1329  H  H    . LYS A 1 15 ? -15.884 11.148  -3.185  1.00 0.00 ? 15  LYS A H    2  
ATOM   1330  H  HA   . LYS A 1 15 ? -13.144 12.226  -3.203  1.00 0.00 ? 15  LYS A HA   2  
ATOM   1331  H  HB2  . LYS A 1 15 ? -14.276 10.001  -1.513  1.00 0.00 ? 15  LYS A HB2  2  
ATOM   1332  H  HB3  . LYS A 1 15 ? -12.550 10.187  -1.791  1.00 0.00 ? 15  LYS A HB3  2  
ATOM   1333  H  HG2  . LYS A 1 15 ? -14.019 12.566  -0.824  1.00 0.00 ? 15  LYS A HG2  2  
ATOM   1334  H  HG3  . LYS A 1 15 ? -13.793 11.234  0.312   1.00 0.00 ? 15  LYS A HG3  2  
ATOM   1335  H  HD2  . LYS A 1 15 ? -11.908 12.540  0.670   1.00 0.00 ? 15  LYS A HD2  2  
ATOM   1336  H  HD3  . LYS A 1 15 ? -11.322 11.314  -0.457  1.00 0.00 ? 15  LYS A HD3  2  
ATOM   1337  H  HE2  . LYS A 1 15 ? -12.453 13.806  -1.603  1.00 0.00 ? 15  LYS A HE2  2  
ATOM   1338  H  HE3  . LYS A 1 15 ? -10.881 13.916  -0.813  1.00 0.00 ? 15  LYS A HE3  2  
ATOM   1339  H  HZ1  . LYS A 1 15 ? -9.907  12.554  -2.356  1.00 0.00 ? 15  LYS A HZ1  2  
ATOM   1340  H  HZ2  . LYS A 1 15 ? -11.039 13.352  -3.326  1.00 0.00 ? 15  LYS A HZ2  2  
ATOM   1341  H  HZ3  . LYS A 1 15 ? -11.353 11.783  -2.778  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM   1342  N  N    . TYR A 1 16 ? -12.280 9.808   -4.189  1.00 0.00 ? 16  TYR A N    2  
ATOM   1343  C  CA   . TYR A 1 16 ? -11.870 8.848   -5.207  1.00 0.00 ? 16  TYR A CA   2  
ATOM   1344  C  C    . TYR A 1 16 ? -12.346 7.443   -4.854  1.00 0.00 ? 16  TYR A C    2  
ATOM   1345  O  O    . TYR A 1 16 ? -11.999 6.903   -3.803  1.00 0.00 ? 16  TYR A O    2  
ATOM   1346  C  CB   . TYR A 1 16 ? -10.348 8.858   -5.364  1.00 0.00 ? 16  TYR A CB   2  
ATOM   1347  C  CG   . TYR A 1 16 ? -9.822  10.083  -6.078  1.00 0.00 ? 16  TYR A CG   2  
ATOM   1348  C  CD1  . TYR A 1 16 ? -9.981  11.351  -5.534  1.00 0.00 ? 16  TYR A CD1  2  
ATOM   1349  C  CD2  . TYR A 1 16 ? -9.166  9.971   -7.298  1.00 0.00 ? 16  TYR A CD2  2  
ATOM   1350  C  CE1  . TYR A 1 16 ? -9.502  12.472  -6.183  1.00 0.00 ? 16  TYR A CE1  2  
ATOM   1351  C  CE2  . TYR A 1 16 ? -8.682  11.087  -7.953  1.00 0.00 ? 16  TYR A CE2  2  
ATOM   1352  C  CZ   . TYR A 1 16 ? -8.853  12.335  -7.392  1.00 0.00 ? 16  TYR A CZ   2  
ATOM   1353  O  OH   . TYR A 1 16 ? -8.374  13.449  -8.043  1.00 0.00 ? 16  TYR A OH   2  
ATOM   1354  H  H    . TYR A 1 16 ? -11.653 10.042  -3.473  1.00 0.00 ? 16  TYR A H    2  
ATOM   1355  H  HA   . TYR A 1 16 ? -12.321 9.144   -6.143  1.00 0.00 ? 16  TYR A HA   2  
ATOM   1356  H  HB2  . TYR A 1 16 ? -9.892  8.824   -4.387  1.00 0.00 ? 16  TYR A HB2  2  
ATOM   1357  H  HB3  . TYR A 1 16 ? -10.046 7.989   -5.928  1.00 0.00 ? 16  TYR A HB3  2  
ATOM   1358  H  HD1  . TYR A 1 16 ? -10.490 11.455  -4.586  1.00 0.00 ? 16  TYR A HD1  2  
ATOM   1359  H  HD2  . TYR A 1 16 ? -9.034  8.992   -7.735  1.00 0.00 ? 16  TYR A HD2  2  
ATOM   1360  H  HE1  . TYR A 1 16 ? -9.635  13.450  -5.744  1.00 0.00 ? 16  TYR A HE1  2  
ATOM   1361  H  HE2  . TYR A 1 16 ? -8.174  10.980  -8.901  1.00 0.00 ? 16  TYR A HE2  2  
ATOM   1362  H  HH   . TYR A 1 16 ? -9.099  13.899  -8.482  1.00 0.00 ? 16  TYR A HH   2  
ATOM   1363  N  N    . ILE A 1 17 ? -13.144 6.855   -5.740  1.00 0.00 ? 17  ILE A N    2  
ATOM   1364  C  CA   . ILE A 1 17 ? -13.667 5.512   -5.523  1.00 0.00 ? 17  ILE A CA   2  
ATOM   1365  C  C    . ILE A 1 17 ? -12.699 4.455   -6.043  1.00 0.00 ? 17  ILE A C    2  
ATOM   1366  O  O    . ILE A 1 17 ? -12.447 4.365   -7.245  1.00 0.00 ? 17  ILE A O    2  
ATOM   1367  C  CB   . ILE A 1 17 ? -15.033 5.323   -6.209  1.00 0.00 ? 17  ILE A CB   2  
ATOM   1368  C  CG1  . ILE A 1 17 ? -15.987 6.453   -5.815  1.00 0.00 ? 17  ILE A CG1  2  
ATOM   1369  C  CG2  . ILE A 1 17 ? -15.626 3.971   -5.844  1.00 0.00 ? 17  ILE A CG2  2  
ATOM   1370  C  CD1  . ILE A 1 17 ? -16.572 6.294   -4.429  1.00 0.00 ? 17  ILE A CD1  2  
ATOM   1371  H  H    . ILE A 1 17 ? -13.385 7.336   -6.558  1.00 0.00 ? 17  ILE A H    2  
ATOM   1372  H  HA   . ILE A 1 17 ? -13.798 5.373   -4.460  1.00 0.00 ? 17  ILE A HA   2  
ATOM   1373  H  HB   . ILE A 1 17 ? -14.881 5.346   -7.277  1.00 0.00 ? 17  ILE A HB   2  
ATOM   1374  H  HG12 . ILE A 1 17 ? -15.455 7.391   -5.844  1.00 0.00 ? 17  ILE A HG12 2  
ATOM   1375  H  HG13 . ILE A 1 17 ? -16.805 6.485   -6.520  1.00 0.00 ? 17  ILE A HG13 2  
ATOM   1376  H  HG21 . ILE A 1 17 ? -16.701 4.055   -5.778  1.00 0.00 ? 17  ILE A HG21 2  
ATOM   1377  H  HG22 . ILE A 1 17 ? -15.368 3.248   -6.603  1.00 0.00 ? 17  ILE A HG22 2  
ATOM   1378  H  HG23 . ILE A 1 17 ? -15.232 3.649   -4.892  1.00 0.00 ? 17  ILE A HG23 2  
ATOM   1379  H  HD11 . ILE A 1 17 ? -17.256 5.459   -4.420  1.00 0.00 ? 17  ILE A HD11 2  
ATOM   1380  H  HD12 . ILE A 1 17 ? -15.777 6.118   -3.720  1.00 0.00 ? 17  ILE A HD12 2  
ATOM   1381  H  HD13 . ILE A 1 17 ? -17.102 7.196   -4.157  1.00 0.00 ? 17  ILE A HD13 2  
ATOM   1382  N  N    . CYS A 1 18 ? -12.160 3.654   -5.130  1.00 0.00 ? 18  CYS A N    2  
ATOM   1383  C  CA   . CYS A 1 18 ? -11.221 2.600   -5.495  1.00 0.00 ? 18  CYS A CA   2  
ATOM   1384  C  C    . CYS A 1 18 ? -11.808 1.699   -6.577  1.00 0.00 ? 18  CYS A C    2  
ATOM   1385  O  O    . CYS A 1 18 ? -12.919 1.187   -6.436  1.00 0.00 ? 18  CYS A O    2  
ATOM   1386  C  CB   . CYS A 1 18 ? -10.853 1.768   -4.266  1.00 0.00 ? 18  CYS A CB   2  
ATOM   1387  S  SG   . CYS A 1 18 ? -9.559  0.523   -4.571  1.00 0.00 ? 18  CYS A SG   2  
ATOM   1388  H  H    . CYS A 1 18 ? -12.400 3.774   -4.187  1.00 0.00 ? 18  CYS A H    2  
ATOM   1389  H  HA   . CYS A 1 18 ? -10.329 3.070   -5.881  1.00 0.00 ? 18  CYS A HA   2  
ATOM   1390  H  HB2  . CYS A 1 18 ? -10.497 2.427   -3.487  1.00 0.00 ? 18  CYS A HB2  2  
ATOM   1391  H  HB3  . CYS A 1 18 ? -11.733 1.248   -3.916  1.00 0.00 ? 18  CYS A HB3  2  
ATOM   1392  N  N    . GLN A 1 19 ? -11.054 1.509   -7.655  1.00 0.00 ? 19  GLN A N    2  
ATOM   1393  C  CA   . GLN A 1 19 ? -11.500 0.669   -8.761  1.00 0.00 ? 19  GLN A CA   2  
ATOM   1394  C  C    . GLN A 1 19 ? -11.303 -0.808  -8.436  1.00 0.00 ? 19  GLN A C    2  
ATOM   1395  O  O    . GLN A 1 19 ? -11.418 -1.667  -9.311  1.00 0.00 ? 19  GLN A O    2  
ATOM   1396  C  CB   . GLN A 1 19 ? -10.742 1.028   -10.040 1.00 0.00 ? 19  GLN A CB   2  
ATOM   1397  C  CG   . GLN A 1 19 ? -11.427 2.100   -10.872 1.00 0.00 ? 19  GLN A CG   2  
ATOM   1398  C  CD   . GLN A 1 19 ? -12.841 1.719   -11.265 1.00 0.00 ? 19  GLN A CD   2  
ATOM   1399  O  OE1  . GLN A 1 19 ? -13.056 1.034   -12.265 1.00 0.00 ? 19  GLN A OE1  2  
ATOM   1400  N  NE2  . GLN A 1 19 ? -13.814 2.163   -10.478 1.00 0.00 ? 19  GLN A NE2  2  
ATOM   1401  H  H    . GLN A 1 19 ? -10.178 1.944   -7.708  1.00 0.00 ? 19  GLN A H    2  
ATOM   1402  H  HA   . GLN A 1 19 ? -12.553 0.854   -8.913  1.00 0.00 ? 19  GLN A HA   2  
ATOM   1403  H  HB2  . GLN A 1 19 ? -9.758  1.384   -9.773  1.00 0.00 ? 19  GLN A HB2  2  
ATOM   1404  H  HB3  . GLN A 1 19 ? -10.643 0.141   -10.646 1.00 0.00 ? 19  GLN A HB3  2  
ATOM   1405  H  HG2  . GLN A 1 19 ? -11.463 3.015   -10.299 1.00 0.00 ? 19  GLN A HG2  2  
ATOM   1406  H  HG3  . GLN A 1 19 ? -10.850 2.262   -11.771 1.00 0.00 ? 19  GLN A HG3  2  
ATOM   1407  H  HE21 . GLN A 1 19 ? -13.567 2.705   -9.699  1.00 0.00 ? 19  GLN A HE21 2  
ATOM   1408  H  HE22 . GLN A 1 19 ? -14.737 1.932   -10.709 1.00 0.00 ? 19  GLN A HE22 2  
ATOM   1409  N  N    . LYS A 1 20 ? -11.006 -1.097  -7.174  1.00 0.00 ? 20  LYS A N    2  
ATOM   1410  C  CA   . LYS A 1 20 ? -10.794 -2.470  -6.733  1.00 0.00 ? 20  LYS A CA   2  
ATOM   1411  C  C    . LYS A 1 20 ? -11.876 -2.898  -5.746  1.00 0.00 ? 20  LYS A C    2  
ATOM   1412  O  O    . LYS A 1 20 ? -12.653 -3.813  -6.020  1.00 0.00 ? 20  LYS A O    2  
ATOM   1413  C  CB   . LYS A 1 20 ? -9.414  -2.612  -6.086  1.00 0.00 ? 20  LYS A CB   2  
ATOM   1414  C  CG   . LYS A 1 20 ? -8.997  -4.054  -5.853  1.00 0.00 ? 20  LYS A CG   2  
ATOM   1415  C  CD   . LYS A 1 20 ? -7.485  -4.208  -5.879  1.00 0.00 ? 20  LYS A CD   2  
ATOM   1416  C  CE   . LYS A 1 20 ? -7.045  -5.497  -5.203  1.00 0.00 ? 20  LYS A CE   2  
ATOM   1417  N  NZ   . LYS A 1 20 ? -5.567  -5.555  -5.029  1.00 0.00 ? 20  LYS A NZ   2  
ATOM   1418  H  H    . LYS A 1 20 ? -10.929 -0.368  -6.522  1.00 0.00 ? 20  LYS A H    2  
ATOM   1419  H  HA   . LYS A 1 20 ? -10.842 -3.109  -7.601  1.00 0.00 ? 20  LYS A HA   2  
ATOM   1420  H  HB2  . LYS A 1 20 ? -8.680  -2.145  -6.726  1.00 0.00 ? 20  LYS A HB2  2  
ATOM   1421  H  HB3  . LYS A 1 20 ? -9.423  -2.104  -5.132  1.00 0.00 ? 20  LYS A HB3  2  
ATOM   1422  H  HG2  . LYS A 1 20 ? -9.364  -4.375  -4.890  1.00 0.00 ? 20  LYS A HG2  2  
ATOM   1423  H  HG3  . LYS A 1 20 ? -9.426  -4.673  -6.628  1.00 0.00 ? 20  LYS A HG3  2  
ATOM   1424  H  HD2  . LYS A 1 20 ? -7.151  -4.222  -6.906  1.00 0.00 ? 20  LYS A HD2  2  
ATOM   1425  H  HD3  . LYS A 1 20 ? -7.038  -3.370  -5.364  1.00 0.00 ? 20  LYS A HD3  2  
ATOM   1426  H  HE2  . LYS A 1 20 ? -7.516  -5.559  -4.234  1.00 0.00 ? 20  LYS A HE2  2  
ATOM   1427  H  HE3  . LYS A 1 20 ? -7.361  -6.333  -5.810  1.00 0.00 ? 20  LYS A HE3  2  
ATOM   1428  H  HZ1  . LYS A 1 20 ? -5.197  -6.448  -5.414  1.00 0.00 ? 20  LYS A HZ1  2  
ATOM   1429  H  HZ2  . LYS A 1 20 ? -5.324  -5.500  -4.019  1.00 0.00 ? 20  LYS A HZ2  2  
ATOM   1430  H  HZ3  . LYS A 1 20 ? -5.117  -4.761  -5.527  1.00 0.00 ? 20  LYS A HZ3  2  
ATOM   1431  N  N    . CYS A 1 21 ? -11.922 -2.229  -4.599  1.00 0.00 ? 21  CYS A N    2  
ATOM   1432  C  CA   . CYS A 1 21 ? -12.909 -2.539  -3.572  1.00 0.00 ? 21  CYS A CA   2  
ATOM   1433  C  C    . CYS A 1 21 ? -14.186 -1.731  -3.783  1.00 0.00 ? 21  CYS A C    2  
ATOM   1434  O  O    . CYS A 1 21 ? -15.221 -2.015  -3.180  1.00 0.00 ? 21  CYS A O    2  
ATOM   1435  C  CB   . CYS A 1 21 ? -12.337 -2.254  -2.182  1.00 0.00 ? 21  CYS A CB   2  
ATOM   1436  S  SG   . CYS A 1 21 ? -12.045 -0.488  -1.846  1.00 0.00 ? 21  CYS A SG   2  
ATOM   1437  H  H    . CYS A 1 21 ? -11.275 -1.509  -4.438  1.00 0.00 ? 21  CYS A H    2  
ATOM   1438  H  HA   . CYS A 1 21 ? -13.146 -3.590  -3.645  1.00 0.00 ? 21  CYS A HA   2  
ATOM   1439  H  HB2  . CYS A 1 21 ? -13.026 -2.621  -1.435  1.00 0.00 ? 21  CYS A HB2  2  
ATOM   1440  H  HB3  . CYS A 1 21 ? -11.393 -2.770  -2.077  1.00 0.00 ? 21  CYS A HB3  2  
ATOM   1441  N  N    . HIS A 1 22 ? -14.105 -0.722  -4.645  1.00 0.00 ? 22  HIS A N    2  
ATOM   1442  C  CA   . HIS A 1 22 ? -15.255 0.127   -4.937  1.00 0.00 ? 22  HIS A CA   2  
ATOM   1443  C  C    . HIS A 1 22 ? -15.704 0.882   -3.690  1.00 0.00 ? 22  HIS A C    2  
ATOM   1444  O  O    . HIS A 1 22 ? -16.889 0.899   -3.357  1.00 0.00 ? 22  HIS A O    2  
ATOM   1445  C  CB   . HIS A 1 22 ? -16.410 -0.712  -5.484  1.00 0.00 ? 22  HIS A CB   2  
ATOM   1446  C  CG   . HIS A 1 22 ? -16.342 -0.932  -6.964  1.00 0.00 ? 22  HIS A CG   2  
ATOM   1447  N  ND1  . HIS A 1 22 ? -16.124 -2.169  -7.532  1.00 0.00 ? 22  HIS A ND1  2  
ATOM   1448  C  CD2  . HIS A 1 22 ? -16.467 -0.064  -7.995  1.00 0.00 ? 22  HIS A CD2  2  
ATOM   1449  C  CE1  . HIS A 1 22 ? -16.115 -2.053  -8.848  1.00 0.00 ? 22  HIS A CE1  2  
ATOM   1450  N  NE2  . HIS A 1 22 ? -16.322 -0.785  -9.155  1.00 0.00 ? 22  HIS A NE2  2  
ATOM   1451  H  H    . HIS A 1 22 ? -13.253 -0.545  -5.095  1.00 0.00 ? 22  HIS A H    2  
ATOM   1452  H  HA   . HIS A 1 22 ? -14.955 0.844   -5.687  1.00 0.00 ? 22  HIS A HA   2  
ATOM   1453  H  HB2  . HIS A 1 22 ? -16.401 -1.680  -5.005  1.00 0.00 ? 22  HIS A HB2  2  
ATOM   1454  H  HB3  . HIS A 1 22 ? -17.343 -0.214  -5.264  1.00 0.00 ? 22  HIS A HB3  2  
ATOM   1455  H  HD1  . HIS A 1 22 ? -15.992 -3.008  -7.043  1.00 0.00 ? 22  HIS A HD1  2  
ATOM   1456  H  HD2  . HIS A 1 22 ? -16.647 1.000   -7.920  1.00 0.00 ? 22  HIS A HD2  2  
ATOM   1457  H  HE1  . HIS A 1 22 ? -15.966 -2.856  -9.553  1.00 0.00 ? 22  HIS A HE1  2  
ATOM   1458  N  N    . ALA A 1 23 ? -14.750 1.502   -3.003  1.00 0.00 ? 23  ALA A N    2  
ATOM   1459  C  CA   . ALA A 1 23 ? -15.049 2.259   -1.794  1.00 0.00 ? 23  ALA A CA   2  
ATOM   1460  C  C    . ALA A 1 23 ? -14.296 3.585   -1.775  1.00 0.00 ? 23  ALA A C    2  
ATOM   1461  O  O    . ALA A 1 23 ? -13.125 3.649   -2.151  1.00 0.00 ? 23  ALA A O    2  
ATOM   1462  C  CB   . ALA A 1 23 ? -14.705 1.438   -0.560  1.00 0.00 ? 23  ALA A CB   2  
ATOM   1463  H  H    . ALA A 1 23 ? -13.824 1.452   -3.319  1.00 0.00 ? 23  ALA A H    2  
ATOM   1464  H  HA   . ALA A 1 23 ? -16.111 2.459   -1.778  1.00 0.00 ? 23  ALA A HA   2  
ATOM   1465  H  HB1  . ALA A 1 23 ? -15.040 1.961   0.324   1.00 0.00 ? 23  ALA A HB1  2  
ATOM   1466  H  HB2  . ALA A 1 23 ? -15.196 0.478   -0.618  1.00 0.00 ? 23  ALA A HB2  2  
ATOM   1467  H  HB3  . ALA A 1 23 ? -13.636 1.293   -0.510  1.00 0.00 ? 23  ALA A HB3  2  
ATOM   1468  N  N    . ILE A 1 24 ? -14.975 4.639   -1.337  1.00 0.00 ? 24  ILE A N    2  
ATOM   1469  C  CA   . ILE A 1 24 ? -14.369 5.963   -1.270  1.00 0.00 ? 24  ILE A CA   2  
ATOM   1470  C  C    . ILE A 1 24 ? -13.035 5.921   -0.532  1.00 0.00 ? 24  ILE A C    2  
ATOM   1471  O  O    . ILE A 1 24 ? -12.927 5.329   0.542   1.00 0.00 ? 24  ILE A O    2  
ATOM   1472  C  CB   . ILE A 1 24 ? -15.298 6.973   -0.570  1.00 0.00 ? 24  ILE A CB   2  
ATOM   1473  C  CG1  . ILE A 1 24 ? -16.371 7.470   -1.541  1.00 0.00 ? 24  ILE A CG1  2  
ATOM   1474  C  CG2  . ILE A 1 24 ? -14.492 8.140   -0.019  1.00 0.00 ? 24  ILE A CG2  2  
ATOM   1475  C  CD1  . ILE A 1 24 ? -17.210 8.600   -0.987  1.00 0.00 ? 24  ILE A CD1  2  
ATOM   1476  H  H    . ILE A 1 24 ? -15.905 4.524   -1.051  1.00 0.00 ? 24  ILE A H    2  
ATOM   1477  H  HA   . ILE A 1 24 ? -14.198 6.303   -2.281  1.00 0.00 ? 24  ILE A HA   2  
ATOM   1478  H  HB   . ILE A 1 24 ? -15.776 6.473   0.259   1.00 0.00 ? 24  ILE A HB   2  
ATOM   1479  H  HG12 . ILE A 1 24 ? -15.896 7.822   -2.443  1.00 0.00 ? 24  ILE A HG12 2  
ATOM   1480  H  HG13 . ILE A 1 24 ? -17.033 6.652   -1.783  1.00 0.00 ? 24  ILE A HG13 2  
ATOM   1481  H  HG21 . ILE A 1 24 ? -14.153 7.904   0.979   1.00 0.00 ? 24  ILE A HG21 2  
ATOM   1482  H  HG22 . ILE A 1 24 ? -13.639 8.320   -0.655  1.00 0.00 ? 24  ILE A HG22 2  
ATOM   1483  H  HG23 . ILE A 1 24 ? -15.112 9.023   0.011   1.00 0.00 ? 24  ILE A HG23 2  
ATOM   1484  H  HD11 . ILE A 1 24 ? -17.161 8.590   0.092   1.00 0.00 ? 24  ILE A HD11 2  
ATOM   1485  H  HD12 . ILE A 1 24 ? -16.835 9.542   -1.356  1.00 0.00 ? 24  ILE A HD12 2  
ATOM   1486  H  HD13 . ILE A 1 24 ? -18.236 8.474   -1.301  1.00 0.00 ? 24  ILE A HD13 2  
ATOM   1487  N  N    . ILE A 1 25 ? -12.022 6.553   -1.116  1.00 0.00 ? 25  ILE A N    2  
ATOM   1488  C  CA   . ILE A 1 25 ? -10.696 6.590   -0.512  1.00 0.00 ? 25  ILE A CA   2  
ATOM   1489  C  C    . ILE A 1 25 ? -10.492 7.870   0.290   1.00 0.00 ? 25  ILE A C    2  
ATOM   1490  O  O    . ILE A 1 25 ? -10.106 8.903   -0.257  1.00 0.00 ? 25  ILE A O    2  
ATOM   1491  C  CB   . ILE A 1 25 ? -9.589  6.484   -1.578  1.00 0.00 ? 25  ILE A CB   2  
ATOM   1492  C  CG1  . ILE A 1 25 ? -9.795  5.233   -2.435  1.00 0.00 ? 25  ILE A CG1  2  
ATOM   1493  C  CG2  . ILE A 1 25 ? -8.219  6.461   -0.918  1.00 0.00 ? 25  ILE A CG2  2  
ATOM   1494  C  CD1  . ILE A 1 25 ? -9.227  5.358   -3.832  1.00 0.00 ? 25  ILE A CD1  2  
ATOM   1495  H  H    . ILE A 1 25 ? -12.171 7.006   -1.972  1.00 0.00 ? 25  ILE A H    2  
ATOM   1496  H  HA   . ILE A 1 25 ? -10.609 5.743   0.153   1.00 0.00 ? 25  ILE A HA   2  
ATOM   1497  H  HB   . ILE A 1 25 ? -9.644  7.357   -2.210  1.00 0.00 ? 25  ILE A HB   2  
ATOM   1498  H  HG12 . ILE A 1 25 ? -9.316  4.394   -1.957  1.00 0.00 ? 25  ILE A HG12 2  
ATOM   1499  H  HG13 . ILE A 1 25 ? -10.854 5.036   -2.524  1.00 0.00 ? 25  ILE A HG13 2  
ATOM   1500  H  HG21 . ILE A 1 25 ? -8.334  6.536   0.153   1.00 0.00 ? 25  ILE A HG21 2  
ATOM   1501  H  HG22 . ILE A 1 25 ? -7.718  5.536   -1.161  1.00 0.00 ? 25  ILE A HG22 2  
ATOM   1502  H  HG23 . ILE A 1 25 ? -7.632  7.293   -1.277  1.00 0.00 ? 25  ILE A HG23 2  
ATOM   1503  H  HD11 . ILE A 1 25 ? -8.150  5.425   -3.778  1.00 0.00 ? 25  ILE A HD11 2  
ATOM   1504  H  HD12 . ILE A 1 25 ? -9.505  4.492   -4.413  1.00 0.00 ? 25  ILE A HD12 2  
ATOM   1505  H  HD13 . ILE A 1 25 ? -9.619  6.248   -4.302  1.00 0.00 ? 25  ILE A HD13 2  
ATOM   1506  N  N    . ASP A 1 26 ? -10.753 7.795   1.590   1.00 0.00 ? 26  ASP A N    2  
ATOM   1507  C  CA   . ASP A 1 26 ? -10.596 8.947   2.470   1.00 0.00 ? 26  ASP A CA   2  
ATOM   1508  C  C    . ASP A 1 26 ? -9.213  9.571   2.307   1.00 0.00 ? 26  ASP A C    2  
ATOM   1509  O  O    . ASP A 1 26 ? -9.088  10.770  2.063   1.00 0.00 ? 26  ASP A O    2  
ATOM   1510  C  CB   . ASP A 1 26 ? -10.815 8.537   3.927   1.00 0.00 ? 26  ASP A CB   2  
ATOM   1511  C  CG   . ASP A 1 26 ? -9.794  7.522   4.403   1.00 0.00 ? 26  ASP A CG   2  
ATOM   1512  O  OD1  . ASP A 1 26 ? -9.574  6.523   3.688   1.00 0.00 ? 26  ASP A OD1  2  
ATOM   1513  O  OD2  . ASP A 1 26 ? -9.216  7.727   5.491   1.00 0.00 ? 26  ASP A OD2  2  
ATOM   1514  H  H    . ASP A 1 26 ? -11.058 6.943   1.968   1.00 0.00 ? 26  ASP A H    2  
ATOM   1515  H  HA   . ASP A 1 26 ? -11.341 9.678   2.196   1.00 0.00 ? 26  ASP A HA   2  
ATOM   1516  H  HB2  . ASP A 1 26 ? -10.744 9.413   4.556   1.00 0.00 ? 26  ASP A HB2  2  
ATOM   1517  H  HB3  . ASP A 1 26 ? -11.800 8.105   4.029   1.00 0.00 ? 26  ASP A HB3  2  
ATOM   1518  N  N    . GLU A 1 27 ? -8.178  8.748   2.444   1.00 0.00 ? 27  GLU A N    2  
ATOM   1519  C  CA   . GLU A 1 27 ? -6.805  9.220   2.314   1.00 0.00 ? 27  GLU A CA   2  
ATOM   1520  C  C    . GLU A 1 27 ? -6.431  9.408   0.846   1.00 0.00 ? 27  GLU A C    2  
ATOM   1521  O  O    . GLU A 1 27 ? -7.270  9.258   -0.042  1.00 0.00 ? 27  GLU A O    2  
ATOM   1522  C  CB   . GLU A 1 27 ? -5.838  8.235   2.975   1.00 0.00 ? 27  GLU A CB   2  
ATOM   1523  C  CG   . GLU A 1 27 ? -5.881  6.842   2.371   1.00 0.00 ? 27  GLU A CG   2  
ATOM   1524  C  CD   . GLU A 1 27 ? -4.585  6.080   2.570   1.00 0.00 ? 27  GLU A CD   2  
ATOM   1525  O  OE1  . GLU A 1 27 ? -3.513  6.645   2.269   1.00 0.00 ? 27  GLU A OE1  2  
ATOM   1526  O  OE2  . GLU A 1 27 ? -4.644  4.919   3.027   1.00 0.00 ? 27  GLU A OE2  2  
ATOM   1527  H  H    . GLU A 1 27 ? -8.342  7.801   2.639   1.00 0.00 ? 27  GLU A H    2  
ATOM   1528  H  HA   . GLU A 1 27 ? -6.733  10.173  2.816   1.00 0.00 ? 27  GLU A HA   2  
ATOM   1529  H  HB2  . GLU A 1 27 ? -4.833  8.617   2.879   1.00 0.00 ? 27  GLU A HB2  2  
ATOM   1530  H  HB3  . GLU A 1 27 ? -6.085  8.158   4.024   1.00 0.00 ? 27  GLU A HB3  2  
ATOM   1531  H  HG2  . GLU A 1 27 ? -6.682  6.287   2.835   1.00 0.00 ? 27  GLU A HG2  2  
ATOM   1532  H  HG3  . GLU A 1 27 ? -6.071  6.929   1.311   1.00 0.00 ? 27  GLU A HG3  2  
ATOM   1533  N  N    . GLN A 1 28 ? -5.168  9.739   0.601   1.00 0.00 ? 28  GLN A N    2  
ATOM   1534  C  CA   . GLN A 1 28 ? -4.683  9.949   -0.758  1.00 0.00 ? 28  GLN A CA   2  
ATOM   1535  C  C    . GLN A 1 28 ? -4.873  8.694   -1.604  1.00 0.00 ? 28  GLN A C    2  
ATOM   1536  O  O    . GLN A 1 28 ? -4.311  7.635   -1.321  1.00 0.00 ? 28  GLN A O    2  
ATOM   1537  C  CB   . GLN A 1 28 ? -3.207  10.348  -0.740  1.00 0.00 ? 28  GLN A CB   2  
ATOM   1538  C  CG   . GLN A 1 28 ? -2.649  10.678  -2.115  1.00 0.00 ? 28  GLN A CG   2  
ATOM   1539  C  CD   . GLN A 1 28 ? -2.861  12.130  -2.498  1.00 0.00 ? 28  GLN A CD   2  
ATOM   1540  O  OE1  . GLN A 1 28 ? -2.574  13.038  -1.717  1.00 0.00 ? 28  GLN A OE1  2  
ATOM   1541  N  NE2  . GLN A 1 28 ? -3.366  12.356  -3.705  1.00 0.00 ? 28  GLN A NE2  2  
ATOM   1542  H  H    . GLN A 1 28 ? -4.547  9.844   1.351   1.00 0.00 ? 28  GLN A H    2  
ATOM   1543  H  HA   . GLN A 1 28 ? -5.259  10.751  -1.194  1.00 0.00 ? 28  GLN A HA   2  
ATOM   1544  H  HB2  . GLN A 1 28 ? -3.089  11.216  -0.109  1.00 0.00 ? 28  GLN A HB2  2  
ATOM   1545  H  HB3  . GLN A 1 28 ? -2.631  9.533   -0.328  1.00 0.00 ? 28  GLN A HB3  2  
ATOM   1546  H  HG2  . GLN A 1 28 ? -1.589  10.472  -2.119  1.00 0.00 ? 28  GLN A HG2  2  
ATOM   1547  H  HG3  . GLN A 1 28 ? -3.138  10.053  -2.847  1.00 0.00 ? 28  GLN A HG3  2  
ATOM   1548  H  HE21 . GLN A 1 28 ? -3.572  11.584  -4.273  1.00 0.00 ? 28  GLN A HE21 2  
ATOM   1549  H  HE22 . GLN A 1 28 ? -3.513  13.285  -3.978  1.00 0.00 ? 28  GLN A HE22 2  
ATOM   1550  N  N    . PRO A 1 29 ? -5.683  8.812   -2.666  1.00 0.00 ? 29  PRO A N    2  
ATOM   1551  C  CA   . PRO A 1 29 ? -5.965  7.696   -3.574  1.00 0.00 ? 29  PRO A CA   2  
ATOM   1552  C  C    . PRO A 1 29 ? -4.754  7.315   -4.418  1.00 0.00 ? 29  PRO A C    2  
ATOM   1553  O  O    . PRO A 1 29 ? -4.131  8.169   -5.051  1.00 0.00 ? 29  PRO A O    2  
ATOM   1554  C  CB   . PRO A 1 29 ? -7.087  8.238   -4.464  1.00 0.00 ? 29  PRO A CB   2  
ATOM   1555  C  CG   . PRO A 1 29 ? -6.915  9.717   -4.432  1.00 0.00 ? 29  PRO A CG   2  
ATOM   1556  C  CD   . PRO A 1 29 ? -6.386  10.043  -3.062  1.00 0.00 ? 29  PRO A CD   2  
ATOM   1557  H  HA   . PRO A 1 29 ? -6.317  6.827   -3.038  1.00 0.00 ? 29  PRO A HA   2  
ATOM   1558  H  HB2  . PRO A 1 29 ? -6.976  7.848   -5.466  1.00 0.00 ? 29  PRO A HB2  2  
ATOM   1559  H  HB3  . PRO A 1 29 ? -8.045  7.943   -4.061  1.00 0.00 ? 29  PRO A HB3  2  
ATOM   1560  H  HG2  . PRO A 1 29 ? -6.208  10.021  -5.189  1.00 0.00 ? 29  PRO A HG2  2  
ATOM   1561  H  HG3  . PRO A 1 29 ? -7.867  10.201  -4.590  1.00 0.00 ? 29  PRO A HG3  2  
ATOM   1562  H  HD2  . PRO A 1 29 ? -5.704  10.879  -3.110  1.00 0.00 ? 29  PRO A HD2  2  
ATOM   1563  H  HD3  . PRO A 1 29 ? -7.200  10.257  -2.385  1.00 0.00 ? 29  PRO A HD3  2  
ATOM   1564  N  N    . LEU A 1 30 ? -4.424  6.028   -4.424  1.00 0.00 ? 30  LEU A N    2  
ATOM   1565  C  CA   . LEU A 1 30 ? -3.286  5.534   -5.191  1.00 0.00 ? 30  LEU A CA   2  
ATOM   1566  C  C    . LEU A 1 30 ? -3.653  5.364   -6.661  1.00 0.00 ? 30  LEU A C    2  
ATOM   1567  O  O    . LEU A 1 30 ? -4.424  4.474   -7.020  1.00 0.00 ? 30  LEU A O    2  
ATOM   1568  C  CB   . LEU A 1 30 ? -2.800  4.201   -4.618  1.00 0.00 ? 30  LEU A CB   2  
ATOM   1569  C  CG   . LEU A 1 30 ? -2.063  3.281   -5.591  1.00 0.00 ? 30  LEU A CG   2  
ATOM   1570  C  CD1  . LEU A 1 30 ? -0.658  3.799   -5.856  1.00 0.00 ? 30  LEU A CD1  2  
ATOM   1571  C  CD2  . LEU A 1 30 ? -2.016  1.859   -5.050  1.00 0.00 ? 30  LEU A CD2  2  
ATOM   1572  H  H    . LEU A 1 30 ? -4.957  5.395   -3.900  1.00 0.00 ? 30  LEU A H    2  
ATOM   1573  H  HA   . LEU A 1 30 ? -2.492  6.261   -5.112  1.00 0.00 ? 30  LEU A HA   2  
ATOM   1574  H  HB2  . LEU A 1 30 ? -2.132  4.418   -3.798  1.00 0.00 ? 30  LEU A HB2  2  
ATOM   1575  H  HB3  . LEU A 1 30 ? -3.663  3.668   -4.245  1.00 0.00 ? 30  LEU A HB3  2  
ATOM   1576  H  HG   . LEU A 1 30 ? -2.595  3.263   -6.533  1.00 0.00 ? 30  LEU A HG   2  
ATOM   1577  H  HD11 . LEU A 1 30 ? -0.221  4.143   -4.931  1.00 0.00 ? 30  LEU A HD11 2  
ATOM   1578  H  HD12 . LEU A 1 30 ? -0.702  4.617   -6.560  1.00 0.00 ? 30  LEU A HD12 2  
ATOM   1579  H  HD13 . LEU A 1 30 ? -0.053  3.004   -6.267  1.00 0.00 ? 30  LEU A HD13 2  
ATOM   1580  H  HD21 . LEU A 1 30 ? -0.987  1.558   -4.919  1.00 0.00 ? 30  LEU A HD21 2  
ATOM   1581  H  HD22 . LEU A 1 30 ? -2.501  1.192   -5.748  1.00 0.00 ? 30  LEU A HD22 2  
ATOM   1582  H  HD23 . LEU A 1 30 ? -2.527  1.819   -4.099  1.00 0.00 ? 30  LEU A HD23 2  
ATOM   1583  N  N    . ILE A 1 31 ? -3.094  6.222   -7.508  1.00 0.00 ? 31  ILE A N    2  
ATOM   1584  C  CA   . ILE A 1 31 ? -3.360  6.165   -8.940  1.00 0.00 ? 31  ILE A CA   2  
ATOM   1585  C  C    . ILE A 1 31 ? -2.470  5.133   -9.624  1.00 0.00 ? 31  ILE A C    2  
ATOM   1586  O  O    . ILE A 1 31 ? -1.265  5.075   -9.377  1.00 0.00 ? 31  ILE A O    2  
ATOM   1587  C  CB   . ILE A 1 31 ? -3.145  7.536   -9.608  1.00 0.00 ? 31  ILE A CB   2  
ATOM   1588  C  CG1  . ILE A 1 31 ? -4.007  8.601   -8.927  1.00 0.00 ? 31  ILE A CG1  2  
ATOM   1589  C  CG2  . ILE A 1 31 ? -3.465  7.458   -11.093 1.00 0.00 ? 31  ILE A CG2  2  
ATOM   1590  C  CD1  . ILE A 1 31 ? -5.491  8.407   -9.145  1.00 0.00 ? 31  ILE A CD1  2  
ATOM   1591  H  H    . ILE A 1 31 ? -2.488  6.910   -7.162  1.00 0.00 ? 31  ILE A H    2  
ATOM   1592  H  HA   . ILE A 1 31 ? -4.394  5.880   -9.075  1.00 0.00 ? 31  ILE A HA   2  
ATOM   1593  H  HB   . ILE A 1 31 ? -2.104  7.803   -9.502  1.00 0.00 ? 31  ILE A HB   2  
ATOM   1594  H  HG12 . ILE A 1 31 ? -3.822  8.579   -7.865  1.00 0.00 ? 31  ILE A HG12 2  
ATOM   1595  H  HG13 . ILE A 1 31 ? -3.738  9.573   -9.315  1.00 0.00 ? 31  ILE A HG13 2  
ATOM   1596  H  HG21 . ILE A 1 31 ? -2.609  7.070   -11.626 1.00 0.00 ? 31  ILE A HG21 2  
ATOM   1597  H  HG22 . ILE A 1 31 ? -4.309  6.803   -11.245 1.00 0.00 ? 31  ILE A HG22 2  
ATOM   1598  H  HG23 . ILE A 1 31 ? -3.702  8.444   -11.463 1.00 0.00 ? 31  ILE A HG23 2  
ATOM   1599  H  HD11 . ILE A 1 31 ? -5.662  7.462   -9.638  1.00 0.00 ? 31  ILE A HD11 2  
ATOM   1600  H  HD12 . ILE A 1 31 ? -5.999  8.415   -8.193  1.00 0.00 ? 31  ILE A HD12 2  
ATOM   1601  H  HD13 . ILE A 1 31 ? -5.872  9.208   -9.762  1.00 0.00 ? 31  ILE A HD13 2  
ATOM   1602  N  N    . PHE A 1 32 ? -3.071  4.320   -10.486 1.00 0.00 ? 32  PHE A N    2  
ATOM   1603  C  CA   . PHE A 1 32 ? -2.333  3.290   -11.208 1.00 0.00 ? 32  PHE A CA   2  
ATOM   1604  C  C    . PHE A 1 32 ? -3.025  2.946   -12.523 1.00 0.00 ? 32  PHE A C    2  
ATOM   1605  O  O    . PHE A 1 32 ? -4.177  2.513   -12.538 1.00 0.00 ? 32  PHE A O    2  
ATOM   1606  C  CB   . PHE A 1 32 ? -2.196  2.033   -10.346 1.00 0.00 ? 32  PHE A CB   2  
ATOM   1607  C  CG   . PHE A 1 32 ? -1.392  0.945   -10.997 1.00 0.00 ? 32  PHE A CG   2  
ATOM   1608  C  CD1  . PHE A 1 32 ? -0.084  1.174   -11.393 1.00 0.00 ? 32  PHE A CD1  2  
ATOM   1609  C  CD2  . PHE A 1 32 ? -1.943  -0.308  -11.213 1.00 0.00 ? 32  PHE A CD2  2  
ATOM   1610  C  CE1  . PHE A 1 32 ? 0.658   0.174   -11.994 1.00 0.00 ? 32  PHE A CE1  2  
ATOM   1611  C  CE2  . PHE A 1 32 ? -1.206  -1.312  -11.812 1.00 0.00 ? 32  PHE A CE2  2  
ATOM   1612  C  CZ   . PHE A 1 32 ? 0.097   -1.071  -12.202 1.00 0.00 ? 32  PHE A CZ   2  
ATOM   1613  H  H    . PHE A 1 32 ? -4.035  4.415   -10.641 1.00 0.00 ? 32  PHE A H    2  
ATOM   1614  H  HA   . PHE A 1 32 ? -1.349  3.678   -11.423 1.00 0.00 ? 32  PHE A HA   2  
ATOM   1615  H  HB2  . PHE A 1 32 ? -1.711  2.293   -9.417  1.00 0.00 ? 32  PHE A HB2  2  
ATOM   1616  H  HB3  . PHE A 1 32 ? -3.179  1.641   -10.136 1.00 0.00 ? 32  PHE A HB3  2  
ATOM   1617  H  HD1  . PHE A 1 32 ? 0.357   2.146   -11.230 1.00 0.00 ? 32  PHE A HD1  2  
ATOM   1618  H  HD2  . PHE A 1 32 ? -2.963  -0.498  -10.908 1.00 0.00 ? 32  PHE A HD2  2  
ATOM   1619  H  HE1  . PHE A 1 32 ? 1.677   0.365   -12.297 1.00 0.00 ? 32  PHE A HE1  2  
ATOM   1620  H  HE2  . PHE A 1 32 ? -1.648  -2.284  -11.974 1.00 0.00 ? 32  PHE A HE2  2  
ATOM   1621  H  HZ   . PHE A 1 32 ? 0.674   -1.853  -12.671 1.00 0.00 ? 32  PHE A HZ   2  
ATOM   1622  N  N    . LYS A 1 33 ? -2.313  3.141   -13.628 1.00 0.00 ? 33  LYS A N    2  
ATOM   1623  C  CA   . LYS A 1 33 ? -2.855  2.851   -14.950 1.00 0.00 ? 33  LYS A CA   2  
ATOM   1624  C  C    . LYS A 1 33 ? -4.107  3.681   -15.218 1.00 0.00 ? 33  LYS A C    2  
ATOM   1625  O  O    . LYS A 1 33 ? -5.069  3.196   -15.812 1.00 0.00 ? 33  LYS A O    2  
ATOM   1626  C  CB   . LYS A 1 33 ? -3.182  1.361   -15.075 1.00 0.00 ? 33  LYS A CB   2  
ATOM   1627  C  CG   . LYS A 1 33 ? -1.954  0.480   -15.223 1.00 0.00 ? 33  LYS A CG   2  
ATOM   1628  C  CD   . LYS A 1 33 ? -2.330  -0.989  -15.320 1.00 0.00 ? 33  LYS A CD   2  
ATOM   1629  C  CE   . LYS A 1 33 ? -1.097  -1.874  -15.419 1.00 0.00 ? 33  LYS A CE   2  
ATOM   1630  N  NZ   . LYS A 1 33 ? -0.446  -1.772  -16.755 1.00 0.00 ? 33  LYS A NZ   2  
ATOM   1631  H  H    . LYS A 1 33 ? -1.399  3.488   -13.552 1.00 0.00 ? 33  LYS A H    2  
ATOM   1632  H  HA   . LYS A 1 33 ? -2.104  3.109   -15.681 1.00 0.00 ? 33  LYS A HA   2  
ATOM   1633  H  HB2  . LYS A 1 33 ? -3.719  1.048   -14.192 1.00 0.00 ? 33  LYS A HB2  2  
ATOM   1634  H  HB3  . LYS A 1 33 ? -3.811  1.214   -15.941 1.00 0.00 ? 33  LYS A HB3  2  
ATOM   1635  H  HG2  . LYS A 1 33 ? -1.424  0.765   -16.120 1.00 0.00 ? 33  LYS A HG2  2  
ATOM   1636  H  HG3  . LYS A 1 33 ? -1.313  0.623   -14.364 1.00 0.00 ? 33  LYS A HG3  2  
ATOM   1637  H  HD2  . LYS A 1 33 ? -2.889  -1.267  -14.440 1.00 0.00 ? 33  LYS A HD2  2  
ATOM   1638  H  HD3  . LYS A 1 33 ? -2.941  -1.138  -16.199 1.00 0.00 ? 33  LYS A HD3  2  
ATOM   1639  H  HE2  . LYS A 1 33 ? -0.391  -1.573  -14.660 1.00 0.00 ? 33  LYS A HE2  2  
ATOM   1640  H  HE3  . LYS A 1 33 ? -1.392  -2.899  -15.249 1.00 0.00 ? 33  LYS A HE3  2  
ATOM   1641  H  HZ1  . LYS A 1 33 ? -1.153  -1.899  -17.507 1.00 0.00 ? 33  LYS A HZ1  2  
ATOM   1642  H  HZ2  . LYS A 1 33 ? 0.284   -2.506  -16.853 1.00 0.00 ? 33  LYS A HZ2  2  
ATOM   1643  H  HZ3  . LYS A 1 33 ? -0.002  -0.839  -16.865 1.00 0.00 ? 33  LYS A HZ3  2  
ATOM   1644  N  N    . ASN A 1 34 ? -4.087  4.934   -14.777 1.00 0.00 ? 34  ASN A N    2  
ATOM   1645  C  CA   . ASN A 1 34 ? -5.220  5.831   -14.970 1.00 0.00 ? 34  ASN A CA   2  
ATOM   1646  C  C    . ASN A 1 34 ? -6.462  5.300   -14.261 1.00 0.00 ? 34  ASN A C    2  
ATOM   1647  O  O    . ASN A 1 34 ? -7.535  5.201   -14.856 1.00 0.00 ? 34  ASN A O    2  
ATOM   1648  C  CB   . ASN A 1 34 ? -5.508  6.009   -16.462 1.00 0.00 ? 34  ASN A CB   2  
ATOM   1649  C  CG   . ASN A 1 34 ? -4.560  6.991   -17.122 1.00 0.00 ? 34  ASN A CG   2  
ATOM   1650  O  OD1  . ASN A 1 34 ? -4.447  8.142   -16.698 1.00 0.00 ? 34  ASN A OD1  2  
ATOM   1651  N  ND2  . ASN A 1 34 ? -3.872  6.541   -18.165 1.00 0.00 ? 34  ASN A ND2  2  
ATOM   1652  H  H    . ASN A 1 34 ? -3.291  5.264   -14.310 1.00 0.00 ? 34  ASN A H    2  
ATOM   1653  H  HA   . ASN A 1 34 ? -4.960  6.790   -14.547 1.00 0.00 ? 34  ASN A HA   2  
ATOM   1654  H  HB2  . ASN A 1 34 ? -5.408  5.054   -16.958 1.00 0.00 ? 34  ASN A HB2  2  
ATOM   1655  H  HB3  . ASN A 1 34 ? -6.517  6.370   -16.588 1.00 0.00 ? 34  ASN A HB3  2  
ATOM   1656  H  HD21 . ASN A 1 34 ? -4.013  5.613   -18.447 1.00 0.00 ? 34  ASN A HD21 2  
ATOM   1657  H  HD22 . ASN A 1 34 ? -3.251  7.155   -18.610 1.00 0.00 ? 34  ASN A HD22 2  
ATOM   1658  N  N    . ASP A 1 35 ? -6.308  4.959   -12.986 1.00 0.00 ? 35  ASP A N    2  
ATOM   1659  C  CA   . ASP A 1 35 ? -7.416  4.439   -12.194 1.00 0.00 ? 35  ASP A CA   2  
ATOM   1660  C  C    . ASP A 1 35 ? -7.113  4.541   -10.703 1.00 0.00 ? 35  ASP A C    2  
ATOM   1661  O  O    . ASP A 1 35 ? -6.015  4.225   -10.244 1.00 0.00 ? 35  ASP A O    2  
ATOM   1662  C  CB   . ASP A 1 35 ? -7.702  2.985   -12.571 1.00 0.00 ? 35  ASP A CB   2  
ATOM   1663  C  CG   . ASP A 1 35 ? -8.095  2.831   -14.027 1.00 0.00 ? 35  ASP A CG   2  
ATOM   1664  O  OD1  . ASP A 1 35 ? -9.162  3.353   -14.412 1.00 0.00 ? 35  ASP A OD1  2  
ATOM   1665  O  OD2  . ASP A 1 35 ? -7.336  2.187   -14.782 1.00 0.00 ? 35  ASP A OD2  2  
ATOM   1666  H  H    . ASP A 1 35 ? -5.427  5.061   -12.567 1.00 0.00 ? 35  ASP A H    2  
ATOM   1667  H  HA   . ASP A 1 35 ? -8.289  5.036   -12.413 1.00 0.00 ? 35  ASP A HA   2  
ATOM   1668  H  HB2  . ASP A 1 35 ? -6.817  2.392   -12.392 1.00 0.00 ? 35  ASP A HB2  2  
ATOM   1669  H  HB3  . ASP A 1 35 ? -8.510  2.613   -11.958 1.00 0.00 ? 35  ASP A HB3  2  
ATOM   1670  N  N    . PRO A 1 36 ? -8.109  4.994   -9.926  1.00 0.00 ? 36  PRO A N    2  
ATOM   1671  C  CA   . PRO A 1 36 ? -7.972  5.148   -8.474  1.00 0.00 ? 36  PRO A CA   2  
ATOM   1672  C  C    . PRO A 1 36 ? -7.889  3.807   -7.754  1.00 0.00 ? 36  PRO A C    2  
ATOM   1673  O  O    . PRO A 1 36 ? -8.532  2.836   -8.153  1.00 0.00 ? 36  PRO A O    2  
ATOM   1674  C  CB   . PRO A 1 36 ? -9.250  5.891   -8.075  1.00 0.00 ? 36  PRO A CB   2  
ATOM   1675  C  CG   . PRO A 1 36 ? -10.237 5.544   -9.136  1.00 0.00 ? 36  PRO A CG   2  
ATOM   1676  C  CD   . PRO A 1 36 ? -9.444  5.389   -10.404 1.00 0.00 ? 36  PRO A CD   2  
ATOM   1677  H  HA   . PRO A 1 36 ? -7.111  5.747   -8.218  1.00 0.00 ? 36  PRO A HA   2  
ATOM   1678  H  HB2  . PRO A 1 36 ? -9.578  5.551   -7.103  1.00 0.00 ? 36  PRO A HB2  2  
ATOM   1679  H  HB3  . PRO A 1 36 ? -9.059  6.953   -8.046  1.00 0.00 ? 36  PRO A HB3  2  
ATOM   1680  H  HG2  . PRO A 1 36 ? -10.733 4.618   -8.888  1.00 0.00 ? 36  PRO A HG2  2  
ATOM   1681  H  HG3  . PRO A 1 36 ? -10.958 6.341   -9.241  1.00 0.00 ? 36  PRO A HG3  2  
ATOM   1682  H  HD2  . PRO A 1 36 ? -9.874  4.619   -11.027 1.00 0.00 ? 36  PRO A HD2  2  
ATOM   1683  H  HD3  . PRO A 1 36 ? -9.399  6.327   -10.938 1.00 0.00 ? 36  PRO A HD3  2  
ATOM   1684  N  N    . TYR A 1 37 ? -7.093  3.760   -6.691  1.00 0.00 ? 37  TYR A N    2  
ATOM   1685  C  CA   . TYR A 1 37 ? -6.925  2.536   -5.916  1.00 0.00 ? 37  TYR A CA   2  
ATOM   1686  C  C    . TYR A 1 37 ? -6.440  2.849   -4.504  1.00 0.00 ? 37  TYR A C    2  
ATOM   1687  O  O    . TYR A 1 37 ? -6.067  3.982   -4.199  1.00 0.00 ? 37  TYR A O    2  
ATOM   1688  C  CB   . TYR A 1 37 ? -5.935  1.600   -6.611  1.00 0.00 ? 37  TYR A CB   2  
ATOM   1689  C  CG   . TYR A 1 37 ? -6.392  1.143   -7.979  1.00 0.00 ? 37  TYR A CG   2  
ATOM   1690  C  CD1  . TYR A 1 37 ? -7.530  0.360   -8.127  1.00 0.00 ? 37  TYR A CD1  2  
ATOM   1691  C  CD2  . TYR A 1 37 ? -5.686  1.496   -9.122  1.00 0.00 ? 37  TYR A CD2  2  
ATOM   1692  C  CE1  . TYR A 1 37 ? -7.950  -0.060  -9.374  1.00 0.00 ? 37  TYR A CE1  2  
ATOM   1693  C  CE2  . TYR A 1 37 ? -6.100  1.082   -10.373 1.00 0.00 ? 37  TYR A CE2  2  
ATOM   1694  C  CZ   . TYR A 1 37 ? -7.232  0.304   -10.494 1.00 0.00 ? 37  TYR A CZ   2  
ATOM   1695  O  OH   . TYR A 1 37 ? -7.649  -0.111  -11.738 1.00 0.00 ? 37  TYR A OH   2  
ATOM   1696  H  H    . TYR A 1 37 ? -6.607  4.567   -6.422  1.00 0.00 ? 37  TYR A H    2  
ATOM   1697  H  HA   . TYR A 1 37 ? -7.886  2.048   -5.855  1.00 0.00 ? 37  TYR A HA   2  
ATOM   1698  H  HB2  . TYR A 1 37 ? -4.991  2.109   -6.731  1.00 0.00 ? 37  TYR A HB2  2  
ATOM   1699  H  HB3  . TYR A 1 37 ? -5.790  0.722   -5.999  1.00 0.00 ? 37  TYR A HB3  2  
ATOM   1700  H  HD1  . TYR A 1 37 ? -8.090  0.077   -7.247  1.00 0.00 ? 37  TYR A HD1  2  
ATOM   1701  H  HD2  . TYR A 1 37 ? -4.800  2.106   -9.024  1.00 0.00 ? 37  TYR A HD2  2  
ATOM   1702  H  HE1  . TYR A 1 37 ? -8.837  -0.669  -9.469  1.00 0.00 ? 37  TYR A HE1  2  
ATOM   1703  H  HE2  . TYR A 1 37 ? -5.538  1.367   -11.251 1.00 0.00 ? 37  TYR A HE2  2  
ATOM   1704  H  HH   . TYR A 1 37 ? -6.933  -0.577  -12.176 1.00 0.00 ? 37  TYR A HH   2  
ATOM   1705  N  N    . HIS A 1 38 ? -6.446  1.834   -3.645  1.00 0.00 ? 38  HIS A N    2  
ATOM   1706  C  CA   . HIS A 1 38 ? -6.006  1.999   -2.264  1.00 0.00 ? 38  HIS A CA   2  
ATOM   1707  C  C    . HIS A 1 38 ? -4.539  1.608   -2.111  1.00 0.00 ? 38  HIS A C    2  
ATOM   1708  O  O    . HIS A 1 38 ? -4.114  0.528   -2.522  1.00 0.00 ? 38  HIS A O    2  
ATOM   1709  C  CB   . HIS A 1 38 ? -6.871  1.155   -1.327  1.00 0.00 ? 38  HIS A CB   2  
ATOM   1710  C  CG   . HIS A 1 38 ? -8.173  1.803   -0.967  1.00 0.00 ? 38  HIS A CG   2  
ATOM   1711  N  ND1  . HIS A 1 38 ? -9.382  1.411   -1.502  1.00 0.00 ? 38  HIS A ND1  2  
ATOM   1712  C  CD2  . HIS A 1 38 ? -8.450  2.821   -0.120  1.00 0.00 ? 38  HIS A CD2  2  
ATOM   1713  C  CE1  . HIS A 1 38 ? -10.347 2.161   -1.000  1.00 0.00 ? 38  HIS A CE1  2  
ATOM   1714  N  NE2  . HIS A 1 38 ? -9.808  3.024   -0.158  1.00 0.00 ? 38  HIS A NE2  2  
ATOM   1715  H  H    . HIS A 1 38 ? -6.754  0.955   -3.947  1.00 0.00 ? 38  HIS A H    2  
ATOM   1716  H  HA   . HIS A 1 38 ? -6.117  3.040   -2.002  1.00 0.00 ? 38  HIS A HA   2  
ATOM   1717  H  HB2  . HIS A 1 38 ? -7.092  0.211   -1.804  1.00 0.00 ? 38  HIS A HB2  2  
ATOM   1718  H  HB3  . HIS A 1 38 ? -6.327  0.972   -0.412  1.00 0.00 ? 38  HIS A HB3  2  
ATOM   1719  H  HD2  . HIS A 1 38 ? -7.737  3.373   0.477   1.00 0.00 ? 38  HIS A HD2  2  
ATOM   1720  H  HE1  . HIS A 1 38 ? -11.397 2.082   -1.237  1.00 0.00 ? 38  HIS A HE1  2  
ATOM   1721  H  HE2  . HIS A 1 38 ? -10.288 3.753   0.287   1.00 0.00 ? 38  HIS A HE2  2  
ATOM   1722  N  N    . PRO A 1 39 ? -3.747  2.506   -1.508  1.00 0.00 ? 39  PRO A N    2  
ATOM   1723  C  CA   . PRO A 1 39 ? -2.316  2.277   -1.287  1.00 0.00 ? 39  PRO A CA   2  
ATOM   1724  C  C    . PRO A 1 39 ? -2.055  1.199   -0.241  1.00 0.00 ? 39  PRO A C    2  
ATOM   1725  O  O    . PRO A 1 39 ? -0.907  0.918   0.103   1.00 0.00 ? 39  PRO A O    2  
ATOM   1726  C  CB   . PRO A 1 39 ? -1.812  3.635   -0.792  1.00 0.00 ? 39  PRO A CB   2  
ATOM   1727  C  CG   . PRO A 1 39 ? -3.008  4.286   -0.188  1.00 0.00 ? 39  PRO A CG   2  
ATOM   1728  C  CD   . PRO A 1 39 ? -4.187  3.814   -0.993  1.00 0.00 ? 39  PRO A CD   2  
ATOM   1729  H  HA   . PRO A 1 39 ? -1.810  2.016   -2.205  1.00 0.00 ? 39  PRO A HA   2  
ATOM   1730  H  HB2  . PRO A 1 39 ? -1.030  3.487   -0.060  1.00 0.00 ? 39  PRO A HB2  2  
ATOM   1731  H  HB3  . PRO A 1 39 ? -1.429  4.207   -1.624  1.00 0.00 ? 39  PRO A HB3  2  
ATOM   1732  H  HG2  . PRO A 1 39 ? -3.111  3.982   0.842   1.00 0.00 ? 39  PRO A HG2  2  
ATOM   1733  H  HG3  . PRO A 1 39 ? -2.915  5.360   -0.256  1.00 0.00 ? 39  PRO A HG3  2  
ATOM   1734  H  HD2  . PRO A 1 39 ? -5.057  3.707   -0.362  1.00 0.00 ? 39  PRO A HD2  2  
ATOM   1735  H  HD3  . PRO A 1 39 ? -4.389  4.498   -1.804  1.00 0.00 ? 39  PRO A HD3  2  
ATOM   1736  N  N    . ASP A 1 40 ? -3.128  0.597   0.261   1.00 0.00 ? 40  ASP A N    2  
ATOM   1737  C  CA   . ASP A 1 40 ? -3.015  -0.452  1.267   1.00 0.00 ? 40  ASP A CA   2  
ATOM   1738  C  C    . ASP A 1 40 ? -3.336  -1.818  0.667   1.00 0.00 ? 40  ASP A C    2  
ATOM   1739  O  O    . ASP A 1 40 ? -3.059  -2.854  1.271   1.00 0.00 ? 40  ASP A O    2  
ATOM   1740  C  CB   . ASP A 1 40 ? -3.952  -0.165  2.442   1.00 0.00 ? 40  ASP A CB   2  
ATOM   1741  C  CG   . ASP A 1 40 ? -5.413  -0.196  2.038   1.00 0.00 ? 40  ASP A CG   2  
ATOM   1742  O  OD1  . ASP A 1 40 ? -5.951  -1.306  1.843   1.00 0.00 ? 40  ASP A OD1  2  
ATOM   1743  O  OD2  . ASP A 1 40 ? -6.018  0.890   1.916   1.00 0.00 ? 40  ASP A OD2  2  
ATOM   1744  H  H    . ASP A 1 40 ? -4.017  0.865   -0.053  1.00 0.00 ? 40  ASP A H    2  
ATOM   1745  H  HA   . ASP A 1 40 ? -1.997  -0.461  1.625   1.00 0.00 ? 40  ASP A HA   2  
ATOM   1746  H  HB2  . ASP A 1 40 ? -3.794  -0.908  3.210   1.00 0.00 ? 40  ASP A HB2  2  
ATOM   1747  H  HB3  . ASP A 1 40 ? -3.728  0.813   2.842   1.00 0.00 ? 40  ASP A HB3  2  
ATOM   1748  N  N    . HIS A 1 41 ? -3.923  -1.811  -0.526  1.00 0.00 ? 41  HIS A N    2  
ATOM   1749  C  CA   . HIS A 1 41 ? -4.282  -3.049  -1.208  1.00 0.00 ? 41  HIS A CA   2  
ATOM   1750  C  C    . HIS A 1 41 ? -3.039  -3.759  -1.736  1.00 0.00 ? 41  HIS A C    2  
ATOM   1751  O  O    . HIS A 1 41 ? -2.881  -4.967  -1.561  1.00 0.00 ? 41  HIS A O    2  
ATOM   1752  C  CB   . HIS A 1 41 ? -5.246  -2.760  -2.359  1.00 0.00 ? 41  HIS A CB   2  
ATOM   1753  C  CG   . HIS A 1 41 ? -6.656  -2.519  -1.914  1.00 0.00 ? 41  HIS A CG   2  
ATOM   1754  N  ND1  . HIS A 1 41 ? -7.127  -2.890  -0.672  1.00 0.00 ? 41  HIS A ND1  2  
ATOM   1755  C  CD2  . HIS A 1 41 ? -7.698  -1.937  -2.551  1.00 0.00 ? 41  HIS A CD2  2  
ATOM   1756  C  CE1  . HIS A 1 41 ? -8.399  -2.549  -0.566  1.00 0.00 ? 41  HIS A CE1  2  
ATOM   1757  N  NE2  . HIS A 1 41 ? -8.770  -1.968  -1.693  1.00 0.00 ? 41  HIS A NE2  2  
ATOM   1758  H  H    . HIS A 1 41 ? -4.118  -0.953  -0.957  1.00 0.00 ? 41  HIS A H    2  
ATOM   1759  H  HA   . HIS A 1 41 ? -4.772  -3.692  -0.493  1.00 0.00 ? 41  HIS A HA   2  
ATOM   1760  H  HB2  . HIS A 1 41 ? -4.911  -1.881  -2.889  1.00 0.00 ? 41  HIS A HB2  2  
ATOM   1761  H  HB3  . HIS A 1 41 ? -5.251  -3.603  -3.036  1.00 0.00 ? 41  HIS A HB3  2  
ATOM   1762  H  HD1  . HIS A 1 41 ? -6.607  -3.339  0.026   1.00 0.00 ? 41  HIS A HD1  2  
ATOM   1763  H  HD2  . HIS A 1 41 ? -7.690  -1.524  -3.551  1.00 0.00 ? 41  HIS A HD2  2  
ATOM   1764  H  HE1  . HIS A 1 41 ? -9.029  -2.716  0.295   1.00 0.00 ? 41  HIS A HE1  2  
ATOM   1765  N  N    . PHE A 1 42 ? -2.160  -3.000  -2.383  1.00 0.00 ? 42  PHE A N    2  
ATOM   1766  C  CA   . PHE A 1 42 ? -0.932  -3.557  -2.938  1.00 0.00 ? 42  PHE A CA   2  
ATOM   1767  C  C    . PHE A 1 42 ? 0.231   -3.387  -1.964  1.00 0.00 ? 42  PHE A C    2  
ATOM   1768  O  O    . PHE A 1 42 ? 0.121   -2.672  -0.969  1.00 0.00 ? 42  PHE A O    2  
ATOM   1769  C  CB   . PHE A 1 42 ? -0.599  -2.884  -4.271  1.00 0.00 ? 42  PHE A CB   2  
ATOM   1770  C  CG   . PHE A 1 42 ? -1.796  -2.675  -5.153  1.00 0.00 ? 42  PHE A CG   2  
ATOM   1771  C  CD1  . PHE A 1 42 ? -2.254  -3.691  -5.976  1.00 0.00 ? 42  PHE A CD1  2  
ATOM   1772  C  CD2  . PHE A 1 42 ? -2.464  -1.461  -5.159  1.00 0.00 ? 42  PHE A CD2  2  
ATOM   1773  C  CE1  . PHE A 1 42 ? -3.356  -3.501  -6.788  1.00 0.00 ? 42  PHE A CE1  2  
ATOM   1774  C  CE2  . PHE A 1 42 ? -3.567  -1.265  -5.969  1.00 0.00 ? 42  PHE A CE2  2  
ATOM   1775  C  CZ   . PHE A 1 42 ? -4.013  -2.287  -6.785  1.00 0.00 ? 42  PHE A CZ   2  
ATOM   1776  H  H    . PHE A 1 42 ? -2.343  -2.043  -2.490  1.00 0.00 ? 42  PHE A H    2  
ATOM   1777  H  HA   . PHE A 1 42 ? -1.094  -4.611  -3.106  1.00 0.00 ? 42  PHE A HA   2  
ATOM   1778  H  HB2  . PHE A 1 42 ? -0.156  -1.919  -4.078  1.00 0.00 ? 42  PHE A HB2  2  
ATOM   1779  H  HB3  . PHE A 1 42 ? 0.108   -3.498  -4.809  1.00 0.00 ? 42  PHE A HB3  2  
ATOM   1780  H  HD1  . PHE A 1 42 ? -1.740  -4.642  -5.979  1.00 0.00 ? 42  PHE A HD1  2  
ATOM   1781  H  HD2  . PHE A 1 42 ? -2.117  -0.661  -4.522  1.00 0.00 ? 42  PHE A HD2  2  
ATOM   1782  H  HE1  . PHE A 1 42 ? -3.701  -4.302  -7.425  1.00 0.00 ? 42  PHE A HE1  2  
ATOM   1783  H  HE2  . PHE A 1 42 ? -4.079  -0.315  -5.965  1.00 0.00 ? 42  PHE A HE2  2  
ATOM   1784  H  HZ   . PHE A 1 42 ? -4.874  -2.136  -7.419  1.00 0.00 ? 42  PHE A HZ   2  
ATOM   1785  N  N    . ASN A 1 43 ? 1.344   -4.051  -2.260  1.00 0.00 ? 43  ASN A N    2  
ATOM   1786  C  CA   . ASN A 1 43 ? 2.527   -3.975  -1.411  1.00 0.00 ? 43  ASN A CA   2  
ATOM   1787  C  C    . ASN A 1 43 ? 3.798   -3.920  -2.253  1.00 0.00 ? 43  ASN A C    2  
ATOM   1788  O  O    . ASN A 1 43 ? 3.844   -4.452  -3.362  1.00 0.00 ? 43  ASN A O    2  
ATOM   1789  C  CB   . ASN A 1 43 ? 2.580   -5.176  -0.465  1.00 0.00 ? 43  ASN A CB   2  
ATOM   1790  C  CG   . ASN A 1 43 ? 1.593   -5.054  0.681   1.00 0.00 ? 43  ASN A CG   2  
ATOM   1791  O  OD1  . ASN A 1 43 ? 0.400   -4.840  0.467   1.00 0.00 ? 43  ASN A OD1  2  
ATOM   1792  N  ND2  . ASN A 1 43 ? 2.089   -5.189  1.905   1.00 0.00 ? 43  ASN A ND2  2  
ATOM   1793  H  H    . ASN A 1 43 ? 1.370   -4.605  -3.067  1.00 0.00 ? 43  ASN A H    2  
ATOM   1794  H  HA   . ASN A 1 43 ? 2.457   -3.070  -0.826  1.00 0.00 ? 43  ASN A HA   2  
ATOM   1795  H  HB2  . ASN A 1 43 ? 2.348   -6.074  -1.019  1.00 0.00 ? 43  ASN A HB2  2  
ATOM   1796  H  HB3  . ASN A 1 43 ? 3.574   -5.259  -0.052  1.00 0.00 ? 43  ASN A HB3  2  
ATOM   1797  H  HD21 . ASN A 1 43 ? 3.050   -5.358  2.000   1.00 0.00 ? 43  ASN A HD21 2  
ATOM   1798  H  HD22 . ASN A 1 43 ? 1.473   -5.115  2.664   1.00 0.00 ? 43  ASN A HD22 2  
ATOM   1799  N  N    . CYS A 1 44 ? 4.828   -3.274  -1.718  1.00 0.00 ? 44  CYS A N    2  
ATOM   1800  C  CA   . CYS A 1 44 ? 6.101   -3.149  -2.418  1.00 0.00 ? 44  CYS A CA   2  
ATOM   1801  C  C    . CYS A 1 44 ? 6.549   -4.497  -2.975  1.00 0.00 ? 44  CYS A C    2  
ATOM   1802  O  O    . CYS A 1 44 ? 6.110   -5.549  -2.512  1.00 0.00 ? 44  CYS A O    2  
ATOM   1803  C  CB   . CYS A 1 44 ? 7.172   -2.591  -1.479  1.00 0.00 ? 44  CYS A CB   2  
ATOM   1804  S  SG   . CYS A 1 44 ? 8.704   -2.079  -2.319  1.00 0.00 ? 44  CYS A SG   2  
ATOM   1805  H  H    . CYS A 1 44 ? 4.731   -2.870  -0.829  1.00 0.00 ? 44  CYS A H    2  
ATOM   1806  H  HA   . CYS A 1 44 ? 5.962   -2.462  -3.239  1.00 0.00 ? 44  CYS A HA   2  
ATOM   1807  H  HB2  . CYS A 1 44 ? 6.775   -1.727  -0.966  1.00 0.00 ? 44  CYS A HB2  2  
ATOM   1808  H  HB3  . CYS A 1 44 ? 7.431   -3.346  -0.752  1.00 0.00 ? 44  CYS A HB3  2  
ATOM   1809  N  N    . ALA A 1 45 ? 7.427   -4.456  -3.972  1.00 0.00 ? 45  ALA A N    2  
ATOM   1810  C  CA   . ALA A 1 45 ? 7.937   -5.673  -4.591  1.00 0.00 ? 45  ALA A CA   2  
ATOM   1811  C  C    . ALA A 1 45 ? 9.341   -5.997  -4.091  1.00 0.00 ? 45  ALA A C    2  
ATOM   1812  O  O    . ALA A 1 45 ? 9.805   -7.130  -4.204  1.00 0.00 ? 45  ALA A O    2  
ATOM   1813  C  CB   . ALA A 1 45 ? 7.934   -5.537  -6.106  1.00 0.00 ? 45  ALA A CB   2  
ATOM   1814  H  H    . ALA A 1 45 ? 7.740   -3.587  -4.298  1.00 0.00 ? 45  ALA A H    2  
ATOM   1815  H  HA   . ALA A 1 45 ? 7.276   -6.485  -4.326  1.00 0.00 ? 45  ALA A HA   2  
ATOM   1816  H  HB1  . ALA A 1 45 ? 7.131   -4.878  -6.405  1.00 0.00 ? 45  ALA A HB1  2  
ATOM   1817  H  HB2  . ALA A 1 45 ? 8.877   -5.126  -6.433  1.00 0.00 ? 45  ALA A HB2  2  
ATOM   1818  H  HB3  . ALA A 1 45 ? 7.788   -6.508  -6.555  1.00 0.00 ? 45  ALA A HB3  2  
ATOM   1819  N  N    . ASN A 1 46 ? 10.013  -4.992  -3.537  1.00 0.00 ? 46  ASN A N    2  
ATOM   1820  C  CA   . ASN A 1 46 ? 11.365  -5.170  -3.021  1.00 0.00 ? 46  ASN A CA   2  
ATOM   1821  C  C    . ASN A 1 46 ? 11.336  -5.655  -1.574  1.00 0.00 ? 46  ASN A C    2  
ATOM   1822  O  O    . ASN A 1 46 ? 11.755  -6.773  -1.274  1.00 0.00 ? 46  ASN A O    2  
ATOM   1823  C  CB   . ASN A 1 46 ? 12.146  -3.858  -3.115  1.00 0.00 ? 46  ASN A CB   2  
ATOM   1824  C  CG   . ASN A 1 46 ? 13.595  -4.016  -2.695  1.00 0.00 ? 46  ASN A CG   2  
ATOM   1825  O  OD1  . ASN A 1 46 ? 14.440  -4.435  -3.486  1.00 0.00 ? 46  ASN A OD1  2  
ATOM   1826  N  ND2  . ASN A 1 46 ? 13.888  -3.679  -1.444  1.00 0.00 ? 46  ASN A ND2  2  
ATOM   1827  H  H    . ASN A 1 46 ? 9.590   -4.110  -3.475  1.00 0.00 ? 46  ASN A H    2  
ATOM   1828  H  HA   . ASN A 1 46 ? 11.857  -5.915  -3.628  1.00 0.00 ? 46  ASN A HA   2  
ATOM   1829  H  HB2  . ASN A 1 46 ? 12.124  -3.505  -4.136  1.00 0.00 ? 46  ASN A HB2  2  
ATOM   1830  H  HB3  . ASN A 1 46 ? 11.683  -3.123  -2.474  1.00 0.00 ? 46  ASN A HB3  2  
ATOM   1831  H  HD21 . ASN A 1 46 ? 13.164  -3.353  -0.870  1.00 0.00 ? 46  ASN A HD21 2  
ATOM   1832  H  HD22 . ASN A 1 46 ? 14.817  -3.771  -1.146  1.00 0.00 ? 46  ASN A HD22 2  
ATOM   1833  N  N    . CYS A 1 47 ? 10.837  -4.806  -0.682  1.00 0.00 ? 47  CYS A N    2  
ATOM   1834  C  CA   . CYS A 1 47 ? 10.752  -5.146  0.733   1.00 0.00 ? 47  CYS A CA   2  
ATOM   1835  C  C    . CYS A 1 47 ? 9.491   -5.956  1.023   1.00 0.00 ? 47  CYS A C    2  
ATOM   1836  O  O    . CYS A 1 47 ? 9.494   -6.845  1.874   1.00 0.00 ? 47  CYS A O    2  
ATOM   1837  C  CB   . CYS A 1 47 ? 10.762  -3.876  1.586   1.00 0.00 ? 47  CYS A CB   2  
ATOM   1838  S  SG   . CYS A 1 47 ? 9.415   -2.712  1.202   1.00 0.00 ? 47  CYS A SG   2  
ATOM   1839  H  H    . CYS A 1 47 ? 10.518  -3.928  -0.982  1.00 0.00 ? 47  CYS A H    2  
ATOM   1840  H  HA   . CYS A 1 47 ? 11.615  -5.744  0.983   1.00 0.00 ? 47  CYS A HA   2  
ATOM   1841  H  HB2  . CYS A 1 47 ? 10.672  -4.150  2.627   1.00 0.00 ? 47  CYS A HB2  2  
ATOM   1842  H  HB3  . CYS A 1 47 ? 11.698  -3.358  1.435   1.00 0.00 ? 47  CYS A HB3  2  
ATOM   1843  N  N    . GLY A 1 48 ? 8.415   -5.642  0.308   1.00 0.00 ? 48  GLY A N    2  
ATOM   1844  C  CA   . GLY A 1 48 ? 7.163   -6.350  0.502   1.00 0.00 ? 48  GLY A CA   2  
ATOM   1845  C  C    . GLY A 1 48 ? 6.349   -5.783  1.648   1.00 0.00 ? 48  GLY A C    2  
ATOM   1846  O  O    . GLY A 1 48 ? 5.832   -6.528  2.481   1.00 0.00 ? 48  GLY A O    2  
ATOM   1847  H  H    . GLY A 1 48 ? 8.472   -4.924  -0.357  1.00 0.00 ? 48  GLY A H    2  
ATOM   1848  H  HA2  . GLY A 1 48 ? 6.582   -6.286  -0.405  1.00 0.00 ? 48  GLY A HA2  2  
ATOM   1849  H  HA3  . GLY A 1 48 ? 7.378   -7.388  0.708   1.00 0.00 ? 48  GLY A HA3  2  
ATOM   1850  N  N    . LYS A 1 49 ? 6.235   -4.460  1.693   1.00 0.00 ? 49  LYS A N    2  
ATOM   1851  C  CA   . LYS A 1 49 ? 5.478   -3.792  2.745   1.00 0.00 ? 49  LYS A CA   2  
ATOM   1852  C  C    . LYS A 1 49 ? 4.278   -3.051  2.165   1.00 0.00 ? 49  LYS A C    2  
ATOM   1853  O  O    . LYS A 1 49 ? 4.149   -2.916  0.949   1.00 0.00 ? 49  LYS A O    2  
ATOM   1854  C  CB   . LYS A 1 49 ? 6.377   -2.813  3.505   1.00 0.00 ? 49  LYS A CB   2  
ATOM   1855  C  CG   . LYS A 1 49 ? 6.847   -1.640  2.663   1.00 0.00 ? 49  LYS A CG   2  
ATOM   1856  C  CD   . LYS A 1 49 ? 5.878   -0.472  2.743   1.00 0.00 ? 49  LYS A CD   2  
ATOM   1857  C  CE   . LYS A 1 49 ? 6.216   0.454   3.902   1.00 0.00 ? 49  LYS A CE   2  
ATOM   1858  N  NZ   . LYS A 1 49 ? 5.300   1.627   3.960   1.00 0.00 ? 49  LYS A NZ   2  
ATOM   1859  H  H    . LYS A 1 49 ? 6.670   -3.919  1.000   1.00 0.00 ? 49  LYS A H    2  
ATOM   1860  H  HA   . LYS A 1 49 ? 5.124   -4.547  3.430   1.00 0.00 ? 49  LYS A HA   2  
ATOM   1861  H  HB2  . LYS A 1 49 ? 5.830   -2.425  4.352   1.00 0.00 ? 49  LYS A HB2  2  
ATOM   1862  H  HB3  . LYS A 1 49 ? 7.247   -3.345  3.862   1.00 0.00 ? 49  LYS A HB3  2  
ATOM   1863  H  HG2  . LYS A 1 49 ? 7.814   -1.317  3.020   1.00 0.00 ? 49  LYS A HG2  2  
ATOM   1864  H  HG3  . LYS A 1 49 ? 6.929   -1.958  1.633   1.00 0.00 ? 49  LYS A HG3  2  
ATOM   1865  H  HD2  . LYS A 1 49 ? 5.928   0.090   1.822   1.00 0.00 ? 49  LYS A HD2  2  
ATOM   1866  H  HD3  . LYS A 1 49 ? 4.877   -0.855  2.880   1.00 0.00 ? 49  LYS A HD3  2  
ATOM   1867  H  HE2  . LYS A 1 49 ? 6.136   -0.101  4.824   1.00 0.00 ? 49  LYS A HE2  2  
ATOM   1868  H  HE3  . LYS A 1 49 ? 7.230   0.805   3.781   1.00 0.00 ? 49  LYS A HE3  2  
ATOM   1869  H  HZ1  . LYS A 1 49 ? 4.367   1.334   4.314   1.00 0.00 ? 49  LYS A HZ1  2  
ATOM   1870  H  HZ2  . LYS A 1 49 ? 5.186   2.037   3.011   1.00 0.00 ? 49  LYS A HZ2  2  
ATOM   1871  H  HZ3  . LYS A 1 49 ? 5.689   2.352   4.596   1.00 0.00 ? 49  LYS A HZ3  2  
ATOM   1872  N  N    . GLU A 1 50 ? 3.403   -2.571  3.044   1.00 0.00 ? 50  GLU A N    2  
ATOM   1873  C  CA   . GLU A 1 50 ? 2.213   -1.844  2.618   1.00 0.00 ? 50  GLU A CA   2  
ATOM   1874  C  C    . GLU A 1 50 ? 2.594   -0.554  1.896   1.00 0.00 ? 50  GLU A C    2  
ATOM   1875  O  O    . GLU A 1 50 ? 3.082   0.395   2.511   1.00 0.00 ? 50  GLU A O    2  
ATOM   1876  C  CB   . GLU A 1 50 ? 1.325   -1.523  3.822   1.00 0.00 ? 50  GLU A CB   2  
ATOM   1877  C  CG   . GLU A 1 50 ? -0.153  -1.437  3.482   1.00 0.00 ? 50  GLU A CG   2  
ATOM   1878  C  CD   . GLU A 1 50 ? -1.044  -1.763  4.665   1.00 0.00 ? 50  GLU A CD   2  
ATOM   1879  O  OE1  . GLU A 1 50 ? -0.844  -1.164  5.742   1.00 0.00 ? 50  GLU A OE1  2  
ATOM   1880  O  OE2  . GLU A 1 50 ? -1.942  -2.618  4.512   1.00 0.00 ? 50  GLU A OE2  2  
ATOM   1881  H  H    . GLU A 1 50 ? 3.561   -2.711  4.001   1.00 0.00 ? 50  GLU A H    2  
ATOM   1882  H  HA   . GLU A 1 50 ? 1.665   -2.475  1.936   1.00 0.00 ? 50  GLU A HA   2  
ATOM   1883  H  HB2  . GLU A 1 50 ? 1.458   -2.294  4.567   1.00 0.00 ? 50  GLU A HB2  2  
ATOM   1884  H  HB3  . GLU A 1 50 ? 1.633   -0.576  4.239   1.00 0.00 ? 50  GLU A HB3  2  
ATOM   1885  H  HG2  . GLU A 1 50 ? -0.375  -0.433  3.150   1.00 0.00 ? 50  GLU A HG2  2  
ATOM   1886  H  HG3  . GLU A 1 50 ? -0.368  -2.134  2.685   1.00 0.00 ? 50  GLU A HG3  2  
ATOM   1887  N  N    . LEU A 1 51 ? 2.370   -0.528  0.587   1.00 0.00 ? 51  LEU A N    2  
ATOM   1888  C  CA   . LEU A 1 51 ? 2.689   0.644   -0.221  1.00 0.00 ? 51  LEU A CA   2  
ATOM   1889  C  C    . LEU A 1 51 ? 1.912   1.865   0.260   1.00 0.00 ? 51  LEU A C    2  
ATOM   1890  O  O    . LEU A 1 51 ? 1.093   1.773   1.175   1.00 0.00 ? 51  LEU A O    2  
ATOM   1891  C  CB   . LEU A 1 51 ? 2.376   0.374   -1.694  1.00 0.00 ? 51  LEU A CB   2  
ATOM   1892  C  CG   . LEU A 1 51 ? 3.331   -0.574  -2.420  1.00 0.00 ? 51  LEU A CG   2  
ATOM   1893  C  CD1  . LEU A 1 51 ? 2.795   -0.917  -3.801  1.00 0.00 ? 51  LEU A CD1  2  
ATOM   1894  C  CD2  . LEU A 1 51 ? 4.719   0.042   -2.522  1.00 0.00 ? 51  LEU A CD2  2  
ATOM   1895  H  H    . LEU A 1 51 ? 1.980   -1.314  0.152   1.00 0.00 ? 51  LEU A H    2  
ATOM   1896  H  HA   . LEU A 1 51 ? 3.746   0.840   -0.116  1.00 0.00 ? 51  LEU A HA   2  
ATOM   1897  H  HB2  . LEU A 1 51 ? 1.385   -0.050  -1.749  1.00 0.00 ? 51  LEU A HB2  2  
ATOM   1898  H  HB3  . LEU A 1 51 ? 2.391   1.321   -2.213  1.00 0.00 ? 51  LEU A HB3  2  
ATOM   1899  H  HG   . LEU A 1 51 ? 3.413   -1.494  -1.856  1.00 0.00 ? 51  LEU A HG   2  
ATOM   1900  H  HD11 . LEU A 1 51 ? 3.262   -1.825  -4.153  1.00 0.00 ? 51  LEU A HD11 2  
ATOM   1901  H  HD12 . LEU A 1 51 ? 3.016   -0.110  -4.483  1.00 0.00 ? 51  LEU A HD12 2  
ATOM   1902  H  HD13 . LEU A 1 51 ? 1.726   -1.060  -3.747  1.00 0.00 ? 51  LEU A HD13 2  
ATOM   1903  H  HD21 . LEU A 1 51 ? 4.803   0.857   -1.819  1.00 0.00 ? 51  LEU A HD21 2  
ATOM   1904  H  HD22 . LEU A 1 51 ? 4.874   0.414   -3.525  1.00 0.00 ? 51  LEU A HD22 2  
ATOM   1905  H  HD23 . LEU A 1 51 ? 5.463   -0.707  -2.296  1.00 0.00 ? 51  LEU A HD23 2  
ATOM   1906  N  N    . THR A 1 52 ? 2.173   3.010   -0.364  1.00 0.00 ? 52  THR A N    2  
ATOM   1907  C  CA   . THR A 1 52 ? 1.497   4.249   -0.001  1.00 0.00 ? 52  THR A CA   2  
ATOM   1908  C  C    . THR A 1 52 ? 0.821   4.882   -1.212  1.00 0.00 ? 52  THR A C    2  
ATOM   1909  O  O    . THR A 1 52 ? 0.950   4.392   -2.334  1.00 0.00 ? 52  THR A O    2  
ATOM   1910  C  CB   . THR A 1 52 ? 2.479   5.265   0.613   1.00 0.00 ? 52  THR A CB   2  
ATOM   1911  O  OG1  . THR A 1 52 ? 3.553   5.522   -0.299  1.00 0.00 ? 52  THR A OG1  2  
ATOM   1912  C  CG2  . THR A 1 52 ? 3.039   4.748   1.930   1.00 0.00 ? 52  THR A CG2  2  
ATOM   1913  H  H    . THR A 1 52 ? 2.836   3.019   -1.086  1.00 0.00 ? 52  THR A H    2  
ATOM   1914  H  HA   . THR A 1 52 ? 0.745   4.015   0.738   1.00 0.00 ? 52  THR A HA   2  
ATOM   1915  H  HB   . THR A 1 52 ? 1.948   6.187   0.802   1.00 0.00 ? 52  THR A HB   2  
ATOM   1916  H  HG1  . THR A 1 52 ? 3.993   4.697   -0.516  1.00 0.00 ? 52  THR A HG1  2  
ATOM   1917  H  HG21 . THR A 1 52 ? 3.553   5.548   2.441   1.00 0.00 ? 52  THR A HG21 2  
ATOM   1918  H  HG22 . THR A 1 52 ? 3.730   3.941   1.735   1.00 0.00 ? 52  THR A HG22 2  
ATOM   1919  H  HG23 . THR A 1 52 ? 2.230   4.387   2.547   1.00 0.00 ? 52  THR A HG23 2  
ATOM   1920  N  N    . ALA A 1 53 ? 0.101   5.974   -0.978  1.00 0.00 ? 53  ALA A N    2  
ATOM   1921  C  CA   . ALA A 1 53 ? -0.593  6.676   -2.051  1.00 0.00 ? 53  ALA A CA   2  
ATOM   1922  C  C    . ALA A 1 53 ? 0.395   7.254   -3.058  1.00 0.00 ? 53  ALA A C    2  
ATOM   1923  O  O    . ALA A 1 53 ? 0.072   7.418   -4.235  1.00 0.00 ? 53  ALA A O    2  
ATOM   1924  C  CB   . ALA A 1 53 ? -1.472  7.778   -1.479  1.00 0.00 ? 53  ALA A CB   2  
ATOM   1925  H  H    . ALA A 1 53 ? 0.036   6.317   -0.063  1.00 0.00 ? 53  ALA A H    2  
ATOM   1926  H  HA   . ALA A 1 53 ? -1.232  5.965   -2.556  1.00 0.00 ? 53  ALA A HA   2  
ATOM   1927  H  HB1  . ALA A 1 53 ? -2.194  7.345   -0.801  1.00 0.00 ? 53  ALA A HB1  2  
ATOM   1928  H  HB2  . ALA A 1 53 ? -0.858  8.488   -0.946  1.00 0.00 ? 53  ALA A HB2  2  
ATOM   1929  H  HB3  . ALA A 1 53 ? -1.989  8.280   -2.283  1.00 0.00 ? 53  ALA A HB3  2  
ATOM   1930  N  N    . ASP A 1 54 ? 1.599   7.563   -2.588  1.00 0.00 ? 54  ASP A N    2  
ATOM   1931  C  CA   . ASP A 1 54 ? 2.634   8.123   -3.449  1.00 0.00 ? 54  ASP A CA   2  
ATOM   1932  C  C    . ASP A 1 54 ? 3.542   7.024   -3.992  1.00 0.00 ? 54  ASP A C    2  
ATOM   1933  O  O    . ASP A 1 54 ? 4.639   7.296   -4.480  1.00 0.00 ? 54  ASP A O    2  
ATOM   1934  C  CB   . ASP A 1 54 ? 3.464   9.153   -2.680  1.00 0.00 ? 54  ASP A CB   2  
ATOM   1935  C  CG   . ASP A 1 54 ? 2.665   10.393  -2.328  1.00 0.00 ? 54  ASP A CG   2  
ATOM   1936  O  OD1  . ASP A 1 54 ? 2.275   11.130  -3.257  1.00 0.00 ? 54  ASP A OD1  2  
ATOM   1937  O  OD2  . ASP A 1 54 ? 2.432   10.626  -1.123  1.00 0.00 ? 54  ASP A OD2  2  
ATOM   1938  H  H    . ASP A 1 54 ? 1.796   7.409   -1.640  1.00 0.00 ? 54  ASP A H    2  
ATOM   1939  H  HA   . ASP A 1 54 ? 2.147   8.613   -4.278  1.00 0.00 ? 54  ASP A HA   2  
ATOM   1940  H  HB2  . ASP A 1 54 ? 3.822   8.706   -1.763  1.00 0.00 ? 54  ASP A HB2  2  
ATOM   1941  H  HB3  . ASP A 1 54 ? 4.308   9.449   -3.284  1.00 0.00 ? 54  ASP A HB3  2  
ATOM   1942  N  N    . ALA A 1 55 ? 3.078   5.782   -3.903  1.00 0.00 ? 55  ALA A N    2  
ATOM   1943  C  CA   . ALA A 1 55 ? 3.847   4.643   -4.387  1.00 0.00 ? 55  ALA A CA   2  
ATOM   1944  C  C    . ALA A 1 55 ? 4.260   4.837   -5.842  1.00 0.00 ? 55  ALA A C    2  
ATOM   1945  O  O    . ALA A 1 55 ? 3.420   5.074   -6.710  1.00 0.00 ? 55  ALA A O    2  
ATOM   1946  C  CB   . ALA A 1 55 ? 3.045   3.359   -4.231  1.00 0.00 ? 55  ALA A CB   2  
ATOM   1947  H  H    . ALA A 1 55 ? 2.197   5.629   -3.504  1.00 0.00 ? 55  ALA A H    2  
ATOM   1948  H  HA   . ALA A 1 55 ? 4.737   4.558   -3.779  1.00 0.00 ? 55  ALA A HA   2  
ATOM   1949  H  HB1  . ALA A 1 55 ? 3.196   2.734   -5.099  1.00 0.00 ? 55  ALA A HB1  2  
ATOM   1950  H  HB2  . ALA A 1 55 ? 3.374   2.834   -3.347  1.00 0.00 ? 55  ALA A HB2  2  
ATOM   1951  H  HB3  . ALA A 1 55 ? 1.997   3.600   -4.138  1.00 0.00 ? 55  ALA A HB3  2  
ATOM   1952  N  N    . ARG A 1 56 ? 5.560   4.735   -6.103  1.00 0.00 ? 56  ARG A N    2  
ATOM   1953  C  CA   . ARG A 1 56 ? 6.084   4.902   -7.453  1.00 0.00 ? 56  ARG A CA   2  
ATOM   1954  C  C    . ARG A 1 56 ? 5.989   3.596   -8.237  1.00 0.00 ? 56  ARG A C    2  
ATOM   1955  O  O    . ARG A 1 56 ? 6.267   2.521   -7.707  1.00 0.00 ? 56  ARG A O    2  
ATOM   1956  C  CB   . ARG A 1 56 ? 7.537   5.376   -7.404  1.00 0.00 ? 56  ARG A CB   2  
ATOM   1957  C  CG   . ARG A 1 56 ? 7.742   6.627   -6.565  1.00 0.00 ? 56  ARG A CG   2  
ATOM   1958  C  CD   . ARG A 1 56 ? 7.147   7.853   -7.240  1.00 0.00 ? 56  ARG A CD   2  
ATOM   1959  N  NE   . ARG A 1 56 ? 6.697   8.847   -6.270  1.00 0.00 ? 56  ARG A NE   2  
ATOM   1960  C  CZ   . ARG A 1 56 ? 5.788   9.778   -6.539  1.00 0.00 ? 56  ARG A CZ   2  
ATOM   1961  N  NH1  . ARG A 1 56 ? 5.236   9.841   -7.743  1.00 0.00 ? 56  ARG A NH1  2  
ATOM   1962  N  NH2  . ARG A 1 56 ? 5.430   10.648  -5.604  1.00 0.00 ? 56  ARG A NH2  2  
ATOM   1963  H  H    . ARG A 1 56 ? 6.181   4.544   -5.369  1.00 0.00 ? 56  ARG A H    2  
ATOM   1964  H  HA   . ARG A 1 56 ? 5.487   5.651   -7.950  1.00 0.00 ? 56  ARG A HA   2  
ATOM   1965  H  HB2  . ARG A 1 56 ? 8.147   4.587   -6.988  1.00 0.00 ? 56  ARG A HB2  2  
ATOM   1966  H  HB3  . ARG A 1 56 ? 7.869   5.584   -8.409  1.00 0.00 ? 56  ARG A HB3  2  
ATOM   1967  H  HG2  . ARG A 1 56 ? 7.263   6.489   -5.607  1.00 0.00 ? 56  ARG A HG2  2  
ATOM   1968  H  HG3  . ARG A 1 56 ? 8.801   6.783   -6.421  1.00 0.00 ? 56  ARG A HG3  2  
ATOM   1969  H  HD2  . ARG A 1 56 ? 7.899   8.298   -7.875  1.00 0.00 ? 56  ARG A HD2  2  
ATOM   1970  H  HD3  . ARG A 1 56 ? 6.306   7.544   -7.842  1.00 0.00 ? 56  ARG A HD3  2  
ATOM   1971  H  HE   . ARG A 1 56 ? 7.092   8.819   -5.374  1.00 0.00 ? 56  ARG A HE   2  
ATOM   1972  H  HH11 . ARG A 1 56 ? 5.503   9.186   -8.450  1.00 0.00 ? 56  ARG A HH11 2  
ATOM   1973  H  HH12 . ARG A 1 56 ? 4.551   10.542  -7.943  1.00 0.00 ? 56  ARG A HH12 2  
ATOM   1974  H  HH21 . ARG A 1 56 ? 5.844   10.604  -4.695  1.00 0.00 ? 56  ARG A HH21 2  
ATOM   1975  H  HH22 . ARG A 1 56 ? 4.746   11.348  -5.807  1.00 0.00 ? 56  ARG A HH22 2  
ATOM   1976  N  N    . GLU A 1 57 ? 5.596   3.700   -9.503  1.00 0.00 ? 57  GLU A N    2  
ATOM   1977  C  CA   . GLU A 1 57 ? 5.464   2.527   -10.360 1.00 0.00 ? 57  GLU A CA   2  
ATOM   1978  C  C    . GLU A 1 57 ? 6.786   2.207   -11.051 1.00 0.00 ? 57  GLU A C    2  
ATOM   1979  O  O    . GLU A 1 57 ? 7.576   3.103   -11.352 1.00 0.00 ? 57  GLU A O    2  
ATOM   1980  C  CB   . GLU A 1 57 ? 4.370   2.752   -11.405 1.00 0.00 ? 57  GLU A CB   2  
ATOM   1981  C  CG   . GLU A 1 57 ? 4.451   1.799   -12.586 1.00 0.00 ? 57  GLU A CG   2  
ATOM   1982  C  CD   . GLU A 1 57 ? 5.308   2.340   -13.714 1.00 0.00 ? 57  GLU A CD   2  
ATOM   1983  O  OE1  . GLU A 1 57 ? 6.189   3.181   -13.439 1.00 0.00 ? 57  GLU A OE1  2  
ATOM   1984  O  OE2  . GLU A 1 57 ? 5.097   1.922   -14.872 1.00 0.00 ? 57  GLU A OE2  2  
ATOM   1985  H  H    . GLU A 1 57 ? 5.389   4.585   -9.869  1.00 0.00 ? 57  GLU A H    2  
ATOM   1986  H  HA   . GLU A 1 57 ? 5.186   1.691   -9.736  1.00 0.00 ? 57  GLU A HA   2  
ATOM   1987  H  HB2  . GLU A 1 57 ? 3.406   2.628   -10.933 1.00 0.00 ? 57  GLU A HB2  2  
ATOM   1988  H  HB3  . GLU A 1 57 ? 4.449   3.762   -11.779 1.00 0.00 ? 57  GLU A HB3  2  
ATOM   1989  H  HG2  . GLU A 1 57 ? 4.874   0.865   -12.249 1.00 0.00 ? 57  GLU A HG2  2  
ATOM   1990  H  HG3  . GLU A 1 57 ? 3.453   1.626   -12.962 1.00 0.00 ? 57  GLU A HG3  2  
ATOM   1991  N  N    . LEU A 1 58 ? 7.021   0.924   -11.301 1.00 0.00 ? 58  LEU A N    2  
ATOM   1992  C  CA   . LEU A 1 58 ? 8.247   0.484   -11.957 1.00 0.00 ? 58  LEU A CA   2  
ATOM   1993  C  C    . LEU A 1 58 ? 7.981   -0.715  -12.862 1.00 0.00 ? 58  LEU A C    2  
ATOM   1994  O  O    . LEU A 1 58 ? 7.757   -1.828  -12.386 1.00 0.00 ? 58  LEU A O    2  
ATOM   1995  C  CB   . LEU A 1 58 ? 9.306   0.124   -10.914 1.00 0.00 ? 58  LEU A CB   2  
ATOM   1996  C  CG   . LEU A 1 58 ? 10.762  0.275   -11.355 1.00 0.00 ? 58  LEU A CG   2  
ATOM   1997  C  CD1  . LEU A 1 58 ? 11.045  1.708   -11.780 1.00 0.00 ? 58  LEU A CD1  2  
ATOM   1998  C  CD2  . LEU A 1 58 ? 11.705  -0.147  -10.238 1.00 0.00 ? 58  LEU A CD2  2  
ATOM   1999  H  H    . LEU A 1 58 ? 6.354   0.255   -11.039 1.00 0.00 ? 58  LEU A H    2  
ATOM   2000  H  HA   . LEU A 1 58 ? 8.612   1.301   -12.561 1.00 0.00 ? 58  LEU A HA   2  
ATOM   2001  H  HB2  . LEU A 1 58 ? 9.153   0.759   -10.055 1.00 0.00 ? 58  LEU A HB2  2  
ATOM   2002  H  HB3  . LEU A 1 58 ? 9.151   -0.907  -10.628 1.00 0.00 ? 58  LEU A HB3  2  
ATOM   2003  H  HG   . LEU A 1 58 ? 10.942  -0.366  -12.207 1.00 0.00 ? 58  LEU A HG   2  
ATOM   2004  H  HD11 . LEU A 1 58 ? 10.520  1.921   -12.699 1.00 0.00 ? 58  LEU A HD11 2  
ATOM   2005  H  HD12 . LEU A 1 58 ? 12.106  1.835   -11.934 1.00 0.00 ? 58  LEU A HD12 2  
ATOM   2006  H  HD13 . LEU A 1 58 ? 10.709  2.385   -11.008 1.00 0.00 ? 58  LEU A HD13 2  
ATOM   2007  H  HD21 . LEU A 1 58 ? 11.771  0.643   -9.505  1.00 0.00 ? 58  LEU A HD21 2  
ATOM   2008  H  HD22 . LEU A 1 58 ? 12.686  -0.340  -10.648 1.00 0.00 ? 58  LEU A HD22 2  
ATOM   2009  H  HD23 . LEU A 1 58 ? 11.328  -1.043  -9.768  1.00 0.00 ? 58  LEU A HD23 2  
ATOM   2010  N  N    . LYS A 1 59 ? 8.008   -0.480  -14.170 1.00 0.00 ? 59  LYS A N    2  
ATOM   2011  C  CA   . LYS A 1 59 ? 7.773   -1.540  -15.143 1.00 0.00 ? 59  LYS A CA   2  
ATOM   2012  C  C    . LYS A 1 59 ? 6.440   -2.234  -14.880 1.00 0.00 ? 59  LYS A C    2  
ATOM   2013  O  O    . LYS A 1 59 ? 6.316   -3.446  -15.053 1.00 0.00 ? 59  LYS A O    2  
ATOM   2014  C  CB   . LYS A 1 59 ? 8.911   -2.563  -15.098 1.00 0.00 ? 59  LYS A CB   2  
ATOM   2015  C  CG   . LYS A 1 59 ? 10.176  -2.096  -15.796 1.00 0.00 ? 59  LYS A CG   2  
ATOM   2016  C  CD   . LYS A 1 59 ? 10.919  -1.061  -14.969 1.00 0.00 ? 59  LYS A CD   2  
ATOM   2017  C  CE   . LYS A 1 59 ? 12.066  -0.440  -15.752 1.00 0.00 ? 59  LYS A CE   2  
ATOM   2018  N  NZ   . LYS A 1 59 ? 13.312  -1.248  -15.647 1.00 0.00 ? 59  LYS A NZ   2  
ATOM   2019  H  H    . LYS A 1 59 ? 8.192   0.429   -14.488 1.00 0.00 ? 59  LYS A H    2  
ATOM   2020  H  HA   . LYS A 1 59 ? 7.744   -1.090  -16.123 1.00 0.00 ? 59  LYS A HA   2  
ATOM   2021  H  HB2  . LYS A 1 59 ? 9.150   -2.773  -14.066 1.00 0.00 ? 59  LYS A HB2  2  
ATOM   2022  H  HB3  . LYS A 1 59 ? 8.578   -3.475  -15.574 1.00 0.00 ? 59  LYS A HB3  2  
ATOM   2023  H  HG2  . LYS A 1 59 ? 10.824  -2.946  -15.955 1.00 0.00 ? 59  LYS A HG2  2  
ATOM   2024  H  HG3  . LYS A 1 59 ? 9.911   -1.660  -16.748 1.00 0.00 ? 59  LYS A HG3  2  
ATOM   2025  H  HD2  . LYS A 1 59 ? 10.231  -0.280  -14.681 1.00 0.00 ? 59  LYS A HD2  2  
ATOM   2026  H  HD3  . LYS A 1 59 ? 11.316  -1.537  -14.083 1.00 0.00 ? 59  LYS A HD3  2  
ATOM   2027  H  HE2  . LYS A 1 59 ? 11.779  -0.369  -16.790 1.00 0.00 ? 59  LYS A HE2  2  
ATOM   2028  H  HE3  . LYS A 1 59 ? 12.255  0.550   -15.363 1.00 0.00 ? 59  LYS A HE3  2  
ATOM   2029  H  HZ1  . LYS A 1 59 ? 13.921  -0.869  -14.894 1.00 0.00 ? 59  LYS A HZ1  2  
ATOM   2030  H  HZ2  . LYS A 1 59 ? 13.833  -1.220  -16.546 1.00 0.00 ? 59  LYS A HZ2  2  
ATOM   2031  H  HZ3  . LYS A 1 59 ? 13.079  -2.237  -15.424 1.00 0.00 ? 59  LYS A HZ3  2  
ATOM   2032  N  N    . GLY A 1 60 ? 5.445   -1.457  -14.463 1.00 0.00 ? 60  GLY A N    2  
ATOM   2033  C  CA   . GLY A 1 60 ? 4.135   -2.015  -14.185 1.00 0.00 ? 60  GLY A CA   2  
ATOM   2034  C  C    . GLY A 1 60 ? 3.934   -2.319  -12.713 1.00 0.00 ? 60  GLY A C    2  
ATOM   2035  O  O    . GLY A 1 60 ? 2.803   -2.374  -12.234 1.00 0.00 ? 60  GLY A O    2  
ATOM   2036  H  H    . GLY A 1 60 ? 5.603   -0.497  -14.343 1.00 0.00 ? 60  GLY A H    2  
ATOM   2037  H  HA2  . GLY A 1 60 ? 3.381   -1.311  -14.503 1.00 0.00 ? 60  GLY A HA2  2  
ATOM   2038  H  HA3  . GLY A 1 60 ? 4.019   -2.930  -14.748 1.00 0.00 ? 60  GLY A HA3  2  
ATOM   2039  N  N    . GLU A 1 61 ? 5.036   -2.518  -11.996 1.00 0.00 ? 61  GLU A N    2  
ATOM   2040  C  CA   . GLU A 1 61 ? 4.974   -2.821  -10.571 1.00 0.00 ? 61  GLU A CA   2  
ATOM   2041  C  C    . GLU A 1 61 ? 4.793   -1.546  -9.752  1.00 0.00 ? 61  GLU A C    2  
ATOM   2042  O  O    . GLU A 1 61 ? 4.754   -0.443  -10.299 1.00 0.00 ? 61  GLU A O    2  
ATOM   2043  C  CB   . GLU A 1 61 ? 6.244   -3.550  -10.127 1.00 0.00 ? 61  GLU A CB   2  
ATOM   2044  C  CG   . GLU A 1 61 ? 6.215   -5.044  -10.399 1.00 0.00 ? 61  GLU A CG   2  
ATOM   2045  C  CD   . GLU A 1 61 ? 5.160   -5.766  -9.583  1.00 0.00 ? 61  GLU A CD   2  
ATOM   2046  O  OE1  . GLU A 1 61 ? 5.440   -6.095  -8.411  1.00 0.00 ? 61  GLU A OE1  2  
ATOM   2047  O  OE2  . GLU A 1 61 ? 4.056   -6.002  -10.116 1.00 0.00 ? 61  GLU A OE2  2  
ATOM   2048  H  H    . GLU A 1 61 ? 5.910   -2.461  -12.436 1.00 0.00 ? 61  GLU A H    2  
ATOM   2049  H  HA   . GLU A 1 61 ? 4.124   -3.465  -10.405 1.00 0.00 ? 61  GLU A HA   2  
ATOM   2050  H  HB2  . GLU A 1 61 ? 7.089   -3.126  -10.648 1.00 0.00 ? 61  GLU A HB2  2  
ATOM   2051  H  HB3  . GLU A 1 61 ? 6.376   -3.402  -9.065  1.00 0.00 ? 61  GLU A HB3  2  
ATOM   2052  H  HG2  . GLU A 1 61 ? 6.008   -5.202  -11.447 1.00 0.00 ? 61  GLU A HG2  2  
ATOM   2053  H  HG3  . GLU A 1 61 ? 7.182   -5.460  -10.158 1.00 0.00 ? 61  GLU A HG3  2  
ATOM   2054  N  N    . LEU A 1 62 ? 4.682   -1.706  -8.438  1.00 0.00 ? 62  LEU A N    2  
ATOM   2055  C  CA   . LEU A 1 62 ? 4.504   -0.569  -7.541  1.00 0.00 ? 62  LEU A CA   2  
ATOM   2056  C  C    . LEU A 1 62 ? 5.395   -0.702  -6.310  1.00 0.00 ? 62  LEU A C    2  
ATOM   2057  O  O    . LEU A 1 62 ? 5.172   -1.565  -5.460  1.00 0.00 ? 62  LEU A O    2  
ATOM   2058  C  CB   . LEU A 1 62 ? 3.040   -0.454  -7.116  1.00 0.00 ? 62  LEU A CB   2  
ATOM   2059  C  CG   . LEU A 1 62 ? 2.030   -0.224  -8.241  1.00 0.00 ? 62  LEU A CG   2  
ATOM   2060  C  CD1  . LEU A 1 62 ? 0.619   -0.533  -7.763  1.00 0.00 ? 62  LEU A CD1  2  
ATOM   2061  C  CD2  . LEU A 1 62 ? 2.120   1.205   -8.755  1.00 0.00 ? 62  LEU A CD2  2  
ATOM   2062  H  H    . LEU A 1 62 ? 4.721   -2.609  -8.060  1.00 0.00 ? 62  LEU A H    2  
ATOM   2063  H  HA   . LEU A 1 62 ? 4.786   0.324   -8.079  1.00 0.00 ? 62  LEU A HA   2  
ATOM   2064  H  HB2  . LEU A 1 62 ? 2.769   -1.368  -6.611  1.00 0.00 ? 62  LEU A HB2  2  
ATOM   2065  H  HB3  . LEU A 1 62 ? 2.961   0.374   -6.425  1.00 0.00 ? 62  LEU A HB3  2  
ATOM   2066  H  HG   . LEU A 1 62 ? 2.257   -0.891  -9.061  1.00 0.00 ? 62  LEU A HG   2  
ATOM   2067  H  HD11 . LEU A 1 62 ? 0.574   -0.438  -6.689  1.00 0.00 ? 62  LEU A HD11 2  
ATOM   2068  H  HD12 . LEU A 1 62 ? 0.356   -1.541  -8.047  1.00 0.00 ? 62  LEU A HD12 2  
ATOM   2069  H  HD13 . LEU A 1 62 ? -0.074  0.161   -8.216  1.00 0.00 ? 62  LEU A HD13 2  
ATOM   2070  H  HD21 . LEU A 1 62 ? 1.126   1.579   -8.953  1.00 0.00 ? 62  LEU A HD21 2  
ATOM   2071  H  HD22 . LEU A 1 62 ? 2.700   1.224   -9.666  1.00 0.00 ? 62  LEU A HD22 2  
ATOM   2072  H  HD23 . LEU A 1 62 ? 2.596   1.826   -8.011  1.00 0.00 ? 62  LEU A HD23 2  
ATOM   2073  N  N    . TYR A 1 63 ? 6.402   0.159   -6.219  1.00 0.00 ? 63  TYR A N    2  
ATOM   2074  C  CA   . TYR A 1 63 ? 7.326   0.138   -5.091  1.00 0.00 ? 63  TYR A CA   2  
ATOM   2075  C  C    . TYR A 1 63 ? 7.092   1.333   -4.172  1.00 0.00 ? 63  TYR A C    2  
ATOM   2076  O  O    . TYR A 1 63 ? 6.502   2.336   -4.576  1.00 0.00 ? 63  TYR A O    2  
ATOM   2077  C  CB   . TYR A 1 63 ? 8.772   0.139   -5.590  1.00 0.00 ? 63  TYR A CB   2  
ATOM   2078  C  CG   . TYR A 1 63 ? 9.132   -1.081  -6.406  1.00 0.00 ? 63  TYR A CG   2  
ATOM   2079  C  CD1  . TYR A 1 63 ? 8.657   -1.239  -7.703  1.00 0.00 ? 63  TYR A CD1  2  
ATOM   2080  C  CD2  . TYR A 1 63 ? 9.947   -2.077  -5.881  1.00 0.00 ? 63  TYR A CD2  2  
ATOM   2081  C  CE1  . TYR A 1 63 ? 8.983   -2.353  -8.452  1.00 0.00 ? 63  TYR A CE1  2  
ATOM   2082  C  CE2  . TYR A 1 63 ? 10.279  -3.193  -6.624  1.00 0.00 ? 63  TYR A CE2  2  
ATOM   2083  C  CZ   . TYR A 1 63 ? 9.794   -3.327  -7.909  1.00 0.00 ? 63  TYR A CZ   2  
ATOM   2084  O  OH   . TYR A 1 63 ? 10.122  -4.438  -8.651  1.00 0.00 ? 63  TYR A OH   2  
ATOM   2085  H  H    . TYR A 1 63 ? 6.529   0.824   -6.927  1.00 0.00 ? 63  TYR A H    2  
ATOM   2086  H  HA   . TYR A 1 63 ? 7.149   -0.770  -4.534  1.00 0.00 ? 63  TYR A HA   2  
ATOM   2087  H  HB2  . TYR A 1 63 ? 8.932   1.010   -6.208  1.00 0.00 ? 63  TYR A HB2  2  
ATOM   2088  H  HB3  . TYR A 1 63 ? 9.439   0.179   -4.741  1.00 0.00 ? 63  TYR A HB3  2  
ATOM   2089  H  HD1  . TYR A 1 63 ? 8.022   -0.474  -8.125  1.00 0.00 ? 63  TYR A HD1  2  
ATOM   2090  H  HD2  . TYR A 1 63 ? 10.324  -1.969  -4.875  1.00 0.00 ? 63  TYR A HD2  2  
ATOM   2091  H  HE1  . TYR A 1 63 ? 8.604   -2.458  -9.458  1.00 0.00 ? 63  TYR A HE1  2  
ATOM   2092  H  HE2  . TYR A 1 63 ? 10.914  -3.957  -6.199  1.00 0.00 ? 63  TYR A HE2  2  
ATOM   2093  H  HH   . TYR A 1 63 ? 9.436   -5.103  -8.552  1.00 0.00 ? 63  TYR A HH   2  
ATOM   2094  N  N    . CYS A 1 64 ? 7.560   1.220   -2.934  1.00 0.00 ? 64  CYS A N    2  
ATOM   2095  C  CA   . CYS A 1 64 ? 7.404   2.289   -1.956  1.00 0.00 ? 64  CYS A CA   2  
ATOM   2096  C  C    . CYS A 1 64 ? 8.517   3.323   -2.097  1.00 0.00 ? 64  CYS A C    2  
ATOM   2097  O  O    . CYS A 1 64 ? 9.632   2.999   -2.509  1.00 0.00 ? 64  CYS A O    2  
ATOM   2098  C  CB   . CYS A 1 64 ? 7.403   1.715   -0.537  1.00 0.00 ? 64  CYS A CB   2  
ATOM   2099  S  SG   . CYS A 1 64 ? 9.021   1.081   0.008   1.00 0.00 ? 64  CYS A SG   2  
ATOM   2100  H  H    . CYS A 1 64 ? 8.022   0.395   -2.671  1.00 0.00 ? 64  CYS A H    2  
ATOM   2101  H  HA   . CYS A 1 64 ? 6.456   2.771   -2.140  1.00 0.00 ? 64  CYS A HA   2  
ATOM   2102  H  HB2  . CYS A 1 64 ? 7.104   2.488   0.155   1.00 0.00 ? 64  CYS A HB2  2  
ATOM   2103  H  HB3  . CYS A 1 64 ? 6.696   0.900   -0.487  1.00 0.00 ? 64  CYS A HB3  2  
ATOM   2104  N  N    . LEU A 1 65 ? 8.206   4.568   -1.754  1.00 0.00 ? 65  LEU A N    2  
ATOM   2105  C  CA   . LEU A 1 65 ? 9.180   5.652   -1.843  1.00 0.00 ? 65  LEU A CA   2  
ATOM   2106  C  C    . LEU A 1 65 ? 10.533  5.214   -1.292  1.00 0.00 ? 65  LEU A C    2  
ATOM   2107  O  O    . LEU A 1 65 ? 11.577  5.406   -1.916  1.00 0.00 ? 65  LEU A O    2  
ATOM   2108  C  CB   . LEU A 1 65 ? 8.678   6.878   -1.079  1.00 0.00 ? 65  LEU A CB   2  
ATOM   2109  C  CG   . LEU A 1 65 ? 7.879   7.896   -1.893  1.00 0.00 ? 65  LEU A CG   2  
ATOM   2110  C  CD1  . LEU A 1 65 ? 8.695   8.391   -3.077  1.00 0.00 ? 65  LEU A CD1  2  
ATOM   2111  C  CD2  . LEU A 1 65 ? 6.566   7.288   -2.365  1.00 0.00 ? 65  LEU A CD2  2  
ATOM   2112  H  H    . LEU A 1 65 ? 7.302   4.766   -1.434  1.00 0.00 ? 65  LEU A H    2  
ATOM   2113  H  HA   . LEU A 1 65 ? 9.295   5.909   -2.885  1.00 0.00 ? 65  LEU A HA   2  
ATOM   2114  H  HB2  . LEU A 1 65 ? 8.049   6.531   -0.274  1.00 0.00 ? 65  LEU A HB2  2  
ATOM   2115  H  HB3  . LEU A 1 65 ? 9.539   7.385   -0.667  1.00 0.00 ? 65  LEU A HB3  2  
ATOM   2116  H  HG   . LEU A 1 65 ? 7.648   8.747   -1.268  1.00 0.00 ? 65  LEU A HG   2  
ATOM   2117  H  HD11 . LEU A 1 65 ? 8.457   9.426   -3.270  1.00 0.00 ? 65  LEU A HD11 2  
ATOM   2118  H  HD12 . LEU A 1 65 ? 8.459   7.799   -3.949  1.00 0.00 ? 65  LEU A HD12 2  
ATOM   2119  H  HD13 . LEU A 1 65 ? 9.747   8.298   -2.853  1.00 0.00 ? 65  LEU A HD13 2  
ATOM   2120  H  HD21 . LEU A 1 65 ? 5.786   8.033   -2.315  1.00 0.00 ? 65  LEU A HD21 2  
ATOM   2121  H  HD22 . LEU A 1 65 ? 6.307   6.453   -1.729  1.00 0.00 ? 65  LEU A HD22 2  
ATOM   2122  H  HD23 . LEU A 1 65 ? 6.673   6.946   -3.384  1.00 0.00 ? 65  LEU A HD23 2  
ATOM   2123  N  N    . PRO A 1 66 ? 10.517  4.608   -0.095  1.00 0.00 ? 66  PRO A N    2  
ATOM   2124  C  CA   . PRO A 1 66 ? 11.735  4.127   0.565   1.00 0.00 ? 66  PRO A CA   2  
ATOM   2125  C  C    . PRO A 1 66 ? 12.621  3.316   -0.374  1.00 0.00 ? 66  PRO A C    2  
ATOM   2126  O  O    . PRO A 1 66 ? 13.815  3.589   -0.508  1.00 0.00 ? 66  PRO A O    2  
ATOM   2127  C  CB   . PRO A 1 66 ? 11.200  3.242   1.694   1.00 0.00 ? 66  PRO A CB   2  
ATOM   2128  C  CG   . PRO A 1 66 ? 9.842   3.779   1.986   1.00 0.00 ? 66  PRO A CG   2  
ATOM   2129  C  CD   . PRO A 1 66 ? 9.309   4.345   0.705   1.00 0.00 ? 66  PRO A CD   2  
ATOM   2130  H  HA   . PRO A 1 66 ? 12.307  4.942   0.985   1.00 0.00 ? 66  PRO A HA   2  
ATOM   2131  H  HB2  . PRO A 1 66 ? 11.156  2.215   1.359   1.00 0.00 ? 66  PRO A HB2  2  
ATOM   2132  H  HB3  . PRO A 1 66 ? 11.848  3.318   2.554   1.00 0.00 ? 66  PRO A HB3  2  
ATOM   2133  H  HG2  . PRO A 1 66 ? 9.199   2.984   2.331   1.00 0.00 ? 66  PRO A HG2  2  
ATOM   2134  H  HG3  . PRO A 1 66 ? 9.909   4.559   2.730   1.00 0.00 ? 66  PRO A HG3  2  
ATOM   2135  H  HD2  . PRO A 1 66 ? 8.672   3.623   0.216   1.00 0.00 ? 66  PRO A HD2  2  
ATOM   2136  H  HD3  . PRO A 1 66 ? 8.769   5.260   0.898   1.00 0.00 ? 66  PRO A HD3  2  
ATOM   2137  N  N    . CYS A 1 67 ? 12.031  2.317   -1.022  1.00 0.00 ? 67  CYS A N    2  
ATOM   2138  C  CA   . CYS A 1 67 ? 12.767  1.466   -1.949  1.00 0.00 ? 67  CYS A CA   2  
ATOM   2139  C  C    . CYS A 1 67 ? 13.049  2.201   -3.256  1.00 0.00 ? 67  CYS A C    2  
ATOM   2140  O  O    . CYS A 1 67 ? 14.198  2.307   -3.686  1.00 0.00 ? 67  CYS A O    2  
ATOM   2141  C  CB   . CYS A 1 67 ? 11.981  0.184   -2.231  1.00 0.00 ? 67  CYS A CB   2  
ATOM   2142  S  SG   . CYS A 1 67 ? 12.043  -1.038  -0.881  1.00 0.00 ? 67  CYS A SG   2  
ATOM   2143  H  H    . CYS A 1 67 ? 11.077  2.148   -0.873  1.00 0.00 ? 67  CYS A H    2  
ATOM   2144  H  HA   . CYS A 1 67 ? 13.708  1.207   -1.486  1.00 0.00 ? 67  CYS A HA   2  
ATOM   2145  H  HB2  . CYS A 1 67 ? 10.944  0.436   -2.397  1.00 0.00 ? 67  CYS A HB2  2  
ATOM   2146  H  HB3  . CYS A 1 67 ? 12.379  -0.285  -3.118  1.00 0.00 ? 67  CYS A HB3  2  
ATOM   2147  N  N    . HIS A 1 68 ? 11.992  2.707   -3.883  1.00 0.00 ? 68  HIS A N    2  
ATOM   2148  C  CA   . HIS A 1 68 ? 12.125  3.433   -5.141  1.00 0.00 ? 68  HIS A CA   2  
ATOM   2149  C  C    . HIS A 1 68 ? 13.243  4.468   -5.056  1.00 0.00 ? 68  HIS A C    2  
ATOM   2150  O  O    . HIS A 1 68 ? 13.772  4.910   -6.076  1.00 0.00 ? 68  HIS A O    2  
ATOM   2151  C  CB   . HIS A 1 68 ? 10.806  4.118   -5.501  1.00 0.00 ? 68  HIS A CB   2  
ATOM   2152  C  CG   . HIS A 1 68 ? 10.664  4.414   -6.963  1.00 0.00 ? 68  HIS A CG   2  
ATOM   2153  N  ND1  . HIS A 1 68 ? 10.922  5.654   -7.508  1.00 0.00 ? 68  HIS A ND1  2  
ATOM   2154  C  CD2  . HIS A 1 68 ? 10.290  3.622   -7.994  1.00 0.00 ? 68  HIS A CD2  2  
ATOM   2155  C  CE1  . HIS A 1 68 ? 10.711  5.612   -8.811  1.00 0.00 ? 68  HIS A CE1  2  
ATOM   2156  N  NE2  . HIS A 1 68 ? 10.328  4.390   -9.132  1.00 0.00 ? 68  HIS A NE2  2  
ATOM   2157  H  H    . HIS A 1 68 ? 11.102  2.590   -3.491  1.00 0.00 ? 68  HIS A H    2  
ATOM   2158  H  HA   . HIS A 1 68 ? 12.371  2.719   -5.912  1.00 0.00 ? 68  HIS A HA   2  
ATOM   2159  H  HB2  . HIS A 1 68 ? 9.985   3.479   -5.212  1.00 0.00 ? 68  HIS A HB2  2  
ATOM   2160  H  HB3  . HIS A 1 68 ? 10.735  5.053   -4.964  1.00 0.00 ? 68  HIS A HB3  2  
ATOM   2161  H  HD1  . HIS A 1 68 ? 11.214  6.447   -7.012  1.00 0.00 ? 68  HIS A HD1  2  
ATOM   2162  H  HD2  . HIS A 1 68 ? 10.013  2.579   -7.935  1.00 0.00 ? 68  HIS A HD2  2  
ATOM   2163  H  HE1  . HIS A 1 68 ? 10.832  6.437   -9.498  1.00 0.00 ? 68  HIS A HE1  2  
ATOM   2164  N  N    . ASP A 1 69 ? 13.595  4.851   -3.834  1.00 0.00 ? 69  ASP A N    2  
ATOM   2165  C  CA   . ASP A 1 69 ? 14.650  5.834   -3.615  1.00 0.00 ? 69  ASP A CA   2  
ATOM   2166  C  C    . ASP A 1 69 ? 16.027  5.187   -3.727  1.00 0.00 ? 69  ASP A C    2  
ATOM   2167  O  O    . ASP A 1 69 ? 16.932  5.733   -4.359  1.00 0.00 ? 69  ASP A O    2  
ATOM   2168  C  CB   . ASP A 1 69 ? 14.490  6.488   -2.242  1.00 0.00 ? 69  ASP A CB   2  
ATOM   2169  C  CG   . ASP A 1 69 ? 13.566  7.690   -2.277  1.00 0.00 ? 69  ASP A CG   2  
ATOM   2170  O  OD1  . ASP A 1 69 ? 12.489  7.591   -2.902  1.00 0.00 ? 69  ASP A OD1  2  
ATOM   2171  O  OD2  . ASP A 1 69 ? 13.920  8.729   -1.680  1.00 0.00 ? 69  ASP A OD2  2  
ATOM   2172  H  H    . ASP A 1 69 ? 13.136  4.463   -3.060  1.00 0.00 ? 69  ASP A H    2  
ATOM   2173  H  HA   . ASP A 1 69 ? 14.560  6.593   -4.377  1.00 0.00 ? 69  ASP A HA   2  
ATOM   2174  H  HB2  . ASP A 1 69 ? 14.083  5.765   -1.551  1.00 0.00 ? 69  ASP A HB2  2  
ATOM   2175  H  HB3  . ASP A 1 69 ? 15.458  6.811   -1.889  1.00 0.00 ? 69  ASP A HB3  2  
ATOM   2176  N  N    . LYS A 1 70 ? 16.180  4.022   -3.107  1.00 0.00 ? 70  LYS A N    2  
ATOM   2177  C  CA   . LYS A 1 70 ? 17.446  3.299   -3.136  1.00 0.00 ? 70  LYS A CA   2  
ATOM   2178  C  C    . LYS A 1 70 ? 17.589  2.505   -4.430  1.00 0.00 ? 70  LYS A C    2  
ATOM   2179  O  O    . LYS A 1 70 ? 18.655  1.964   -4.722  1.00 0.00 ? 70  LYS A O    2  
ATOM   2180  C  CB   . LYS A 1 70 ? 17.548  2.359   -1.933  1.00 0.00 ? 70  LYS A CB   2  
ATOM   2181  C  CG   . LYS A 1 70 ? 16.738  1.083   -2.089  1.00 0.00 ? 70  LYS A CG   2  
ATOM   2182  C  CD   . LYS A 1 70 ? 16.701  0.285   -0.796  1.00 0.00 ? 70  LYS A CD   2  
ATOM   2183  C  CE   . LYS A 1 70 ? 16.150  -1.115  -1.021  1.00 0.00 ? 70  LYS A CE   2  
ATOM   2184  N  NZ   . LYS A 1 70 ? 16.286  -1.965  0.194   1.00 0.00 ? 70  LYS A NZ   2  
ATOM   2185  H  H    . LYS A 1 70 ? 15.421  3.637   -2.619  1.00 0.00 ? 70  LYS A H    2  
ATOM   2186  H  HA   . LYS A 1 70 ? 18.243  4.025   -3.083  1.00 0.00 ? 70  LYS A HA   2  
ATOM   2187  H  HB2  . LYS A 1 70 ? 18.583  2.088   -1.790  1.00 0.00 ? 70  LYS A HB2  2  
ATOM   2188  H  HB3  . LYS A 1 70 ? 17.196  2.879   -1.054  1.00 0.00 ? 70  LYS A HB3  2  
ATOM   2189  H  HG2  . LYS A 1 70 ? 15.727  1.341   -2.369  1.00 0.00 ? 70  LYS A HG2  2  
ATOM   2190  H  HG3  . LYS A 1 70 ? 17.184  0.476   -2.863  1.00 0.00 ? 70  LYS A HG3  2  
ATOM   2191  H  HD2  . LYS A 1 70 ? 17.704  0.207   -0.403  1.00 0.00 ? 70  LYS A HD2  2  
ATOM   2192  H  HD3  . LYS A 1 70 ? 16.072  0.800   -0.083  1.00 0.00 ? 70  LYS A HD3  2  
ATOM   2193  H  HE2  . LYS A 1 70 ? 15.106  -1.039  -1.282  1.00 0.00 ? 70  LYS A HE2  2  
ATOM   2194  H  HE3  . LYS A 1 70 ? 16.693  -1.574  -1.834  1.00 0.00 ? 70  LYS A HE3  2  
ATOM   2195  H  HZ1  . LYS A 1 70 ? 17.101  -2.603  0.094   1.00 0.00 ? 70  LYS A HZ1  2  
ATOM   2196  H  HZ2  . LYS A 1 70 ? 15.427  -2.537  0.327   1.00 0.00 ? 70  LYS A HZ2  2  
ATOM   2197  H  HZ3  . LYS A 1 70 ? 16.426  -1.369  1.034   1.00 0.00 ? 70  LYS A HZ3  2  
ATOM   2198  N  N    . MET A 1 71 ? 16.509  2.440   -5.202  1.00 0.00 ? 71  MET A N    2  
ATOM   2199  C  CA   . MET A 1 71 ? 16.517  1.713   -6.467  1.00 0.00 ? 71  MET A CA   2  
ATOM   2200  C  C    . MET A 1 71 ? 17.596  2.255   -7.399  1.00 0.00 ? 71  MET A C    2  
ATOM   2201  O  O    . MET A 1 71 ? 18.401  1.497   -7.938  1.00 0.00 ? 71  MET A O    2  
ATOM   2202  C  CB   . MET A 1 71 ? 15.148  1.809   -7.143  1.00 0.00 ? 71  MET A CB   2  
ATOM   2203  C  CG   . MET A 1 71 ? 14.167  0.743   -6.683  1.00 0.00 ? 71  MET A CG   2  
ATOM   2204  S  SD   . MET A 1 71 ? 14.335  -0.799  -7.603  1.00 0.00 ? 71  MET A SD   2  
ATOM   2205  C  CE   . MET A 1 71 ? 13.075  -1.801  -6.817  1.00 0.00 ? 71  MET A CE   2  
ATOM   2206  H  H    . MET A 1 71 ? 15.688  2.892   -4.916  1.00 0.00 ? 71  MET A H    2  
ATOM   2207  H  HA   . MET A 1 71 ? 16.730  0.677   -6.252  1.00 0.00 ? 71  MET A HA   2  
ATOM   2208  H  HB2  . MET A 1 71 ? 14.721  2.777   -6.928  1.00 0.00 ? 71  MET A HB2  2  
ATOM   2209  H  HB3  . MET A 1 71 ? 15.278  1.710   -8.210  1.00 0.00 ? 71  MET A HB3  2  
ATOM   2210  H  HG2  . MET A 1 71 ? 14.340  0.540   -5.636  1.00 0.00 ? 71  MET A HG2  2  
ATOM   2211  H  HG3  . MET A 1 71 ? 13.163  1.117   -6.813  1.00 0.00 ? 71  MET A HG3  2  
ATOM   2212  H  HE1  . MET A 1 71 ? 12.651  -2.480  -7.542  1.00 0.00 ? 71  MET A HE1  2  
ATOM   2213  H  HE2  . MET A 1 71 ? 13.517  -2.365  -6.010  1.00 0.00 ? 71  MET A HE2  2  
ATOM   2214  H  HE3  . MET A 1 71 ? 12.297  -1.160  -6.427  1.00 0.00 ? 71  MET A HE3  2  
ATOM   2215  N  N    . GLY A 1 72 ? 17.606  3.572   -7.584  1.00 0.00 ? 72  GLY A N    2  
ATOM   2216  C  CA   . GLY A 1 72 ? 18.590  4.191   -8.451  1.00 0.00 ? 72  GLY A CA   2  
ATOM   2217  C  C    . GLY A 1 72 ? 19.970  4.235   -7.825  1.00 0.00 ? 72  GLY A C    2  
ATOM   2218  O  O    . GLY A 1 72 ? 20.442  5.296   -7.418  1.00 0.00 ? 72  GLY A O    2  
ATOM   2219  H  H    . GLY A 1 72 ? 16.939  4.126   -7.127  1.00 0.00 ? 72  GLY A H    2  
ATOM   2220  H  HA2  . GLY A 1 72 ? 18.643  3.633   -9.374  1.00 0.00 ? 72  GLY A HA2  2  
ATOM   2221  H  HA3  . GLY A 1 72 ? 18.275  5.201   -8.670  1.00 0.00 ? 72  GLY A HA3  2  
ATOM   2222  N  N    . VAL A 1 73 ? 20.619  3.077   -7.745  1.00 0.00 ? 73  VAL A N    2  
ATOM   2223  C  CA   . VAL A 1 73 ? 21.953  2.987   -7.163  1.00 0.00 ? 73  VAL A CA   2  
ATOM   2224  C  C    . VAL A 1 73 ? 23.022  3.376   -8.177  1.00 0.00 ? 73  VAL A C    2  
ATOM   2225  O  O    . VAL A 1 73 ? 24.090  2.767   -8.233  1.00 0.00 ? 73  VAL A O    2  
ATOM   2226  C  CB   . VAL A 1 73 ? 22.244  1.566   -6.646  1.00 0.00 ? 73  VAL A CB   2  
ATOM   2227  C  CG1  . VAL A 1 73 ? 21.279  1.195   -5.531  1.00 0.00 ? 73  VAL A CG1  2  
ATOM   2228  C  CG2  . VAL A 1 73 ? 22.169  0.559   -7.784  1.00 0.00 ? 73  VAL A CG2  2  
ATOM   2229  H  H    . VAL A 1 73 ? 20.191  2.265   -8.087  1.00 0.00 ? 73  VAL A H    2  
ATOM   2230  H  HA   . VAL A 1 73 ? 21.999  3.669   -6.326  1.00 0.00 ? 73  VAL A HA   2  
ATOM   2231  H  HB   . VAL A 1 73 ? 23.247  1.549   -6.244  1.00 0.00 ? 73  VAL A HB   2  
ATOM   2232  H  HG11 . VAL A 1 73 ? 21.784  0.567   -4.812  1.00 0.00 ? 73  VAL A HG11 2  
ATOM   2233  H  HG12 . VAL A 1 73 ? 20.929  2.093   -5.044  1.00 0.00 ? 73  VAL A HG12 2  
ATOM   2234  H  HG13 . VAL A 1 73 ? 20.438  0.659   -5.946  1.00 0.00 ? 73  VAL A HG13 2  
ATOM   2235  H  HG21 . VAL A 1 73 ? 21.254  0.709   -8.337  1.00 0.00 ? 73  VAL A HG21 2  
ATOM   2236  H  HG22 . VAL A 1 73 ? 23.014  0.697   -8.444  1.00 0.00 ? 73  VAL A HG22 2  
ATOM   2237  H  HG23 . VAL A 1 73 ? 22.187  -0.442  -7.381  1.00 0.00 ? 73  VAL A HG23 2  
ATOM   2238  N  N    . SER A 1 74 ? 22.728  4.396   -8.977  1.00 0.00 ? 74  SER A N    2  
ATOM   2239  C  CA   . SER A 1 74 ? 23.664  4.866   -9.993  1.00 0.00 ? 74  SER A CA   2  
ATOM   2240  C  C    . SER A 1 74 ? 24.084  3.724   -10.914 1.00 0.00 ? 74  SER A C    2  
ATOM   2241  O  O    . SER A 1 74 ? 25.246  3.621   -11.303 1.00 0.00 ? 74  SER A O    2  
ATOM   2242  C  CB   . SER A 1 74 ? 24.898  5.484   -9.333  1.00 0.00 ? 74  SER A CB   2  
ATOM   2243  O  OG   . SER A 1 74 ? 24.568  6.687   -8.661  1.00 0.00 ? 74  SER A OG   2  
ATOM   2244  H  H    . SER A 1 74 ? 21.860  4.842   -8.884  1.00 0.00 ? 74  SER A H    2  
ATOM   2245  H  HA   . SER A 1 74 ? 23.164  5.621   -10.580 1.00 0.00 ? 74  SER A HA   2  
ATOM   2246  H  HB2  . SER A 1 74 ? 25.307  4.787   -8.617  1.00 0.00 ? 74  SER A HB2  2  
ATOM   2247  H  HB3  . SER A 1 74 ? 25.638  5.699   -10.090 1.00 0.00 ? 74  SER A HB3  2  
ATOM   2248  H  HG   . SER A 1 74 ? 23.772  7.061   -9.046  1.00 0.00 ? 74  SER A HG   2  
ATOM   2249  N  N    . GLY A 1 75 ? 23.127  2.867   -11.258 1.00 0.00 ? 75  GLY A N    2  
ATOM   2250  C  CA   . GLY A 1 75 ? 23.417  1.744   -12.130 1.00 0.00 ? 75  GLY A CA   2  
ATOM   2251  C  C    . GLY A 1 75 ? 22.921  1.966   -13.545 1.00 0.00 ? 75  GLY A C    2  
ATOM   2252  O  O    . GLY A 1 75 ? 22.335  3.000   -13.866 1.00 0.00 ? 75  GLY A O    2  
ATOM   2253  H  H    . GLY A 1 75 ? 22.218  2.999   -10.917 1.00 0.00 ? 75  GLY A H    2  
ATOM   2254  H  HA2  . GLY A 1 75 ? 24.484  1.586   -12.154 1.00 0.00 ? 75  GLY A HA2  2  
ATOM   2255  H  HA3  . GLY A 1 75 ? 22.941  0.860   -11.730 1.00 0.00 ? 75  GLY A HA3  2  
ATOM   2256  N  N    . PRO A 1 76 ? 23.158  0.978   -14.422 1.00 0.00 ? 76  PRO A N    2  
ATOM   2257  C  CA   . PRO A 1 76 ? 22.741  1.048   -15.825 1.00 0.00 ? 76  PRO A CA   2  
ATOM   2258  C  C    . PRO A 1 76 ? 21.228  0.959   -15.985 1.00 0.00 ? 76  PRO A C    2  
ATOM   2259  O  O    . PRO A 1 76 ? 20.670  1.424   -16.979 1.00 0.00 ? 76  PRO A O    2  
ATOM   2260  C  CB   . PRO A 1 76 ? 23.419  -0.170  -16.457 1.00 0.00 ? 76  PRO A CB   2  
ATOM   2261  C  CG   . PRO A 1 76 ? 23.608  -1.126  -15.330 1.00 0.00 ? 76  PRO A CG   2  
ATOM   2262  C  CD   . PRO A 1 76 ? 23.852  -0.283  -14.109 1.00 0.00 ? 76  PRO A CD   2  
ATOM   2263  H  HA   . PRO A 1 76 ? 23.100  1.949   -16.301 1.00 0.00 ? 76  PRO A HA   2  
ATOM   2264  H  HB2  . PRO A 1 76 ? 22.778  -0.584  -17.224 1.00 0.00 ? 76  PRO A HB2  2  
ATOM   2265  H  HB3  . PRO A 1 76 ? 24.364  0.123   -16.890 1.00 0.00 ? 76  PRO A HB3  2  
ATOM   2266  H  HG2  . PRO A 1 76 ? 22.719  -1.723  -15.202 1.00 0.00 ? 76  PRO A HG2  2  
ATOM   2267  H  HG3  . PRO A 1 76 ? 24.462  -1.758  -15.525 1.00 0.00 ? 76  PRO A HG3  2  
ATOM   2268  H  HD2  . PRO A 1 76 ? 23.424  -0.752  -13.235 1.00 0.00 ? 76  PRO A HD2  2  
ATOM   2269  H  HD3  . PRO A 1 76 ? 24.910  -0.116  -13.971 1.00 0.00 ? 76  PRO A HD3  2  
ATOM   2270  N  N    . SER A 1 77 ? 20.567  0.359   -15.000 1.00 0.00 ? 77  SER A N    2  
ATOM   2271  C  CA   . SER A 1 77 ? 19.117  0.206   -15.033 1.00 0.00 ? 77  SER A CA   2  
ATOM   2272  C  C    . SER A 1 77 ? 18.426  1.565   -14.986 1.00 0.00 ? 77  SER A C    2  
ATOM   2273  O  O    . SER A 1 77 ? 17.612  1.891   -15.849 1.00 0.00 ? 77  SER A O    2  
ATOM   2274  C  CB   . SER A 1 77 ? 18.648  -0.659  -13.862 1.00 0.00 ? 77  SER A CB   2  
ATOM   2275  O  OG   . SER A 1 77 ? 17.275  -0.989  -13.990 1.00 0.00 ? 77  SER A OG   2  
ATOM   2276  H  H    . SER A 1 77 ? 21.068  0.009   -14.233 1.00 0.00 ? 77  SER A H    2  
ATOM   2277  H  HA   . SER A 1 77 ? 18.857  -0.285  -15.959 1.00 0.00 ? 77  SER A HA   2  
ATOM   2278  H  HB2  . SER A 1 77 ? 19.224  -1.571  -13.837 1.00 0.00 ? 77  SER A HB2  2  
ATOM   2279  H  HB3  . SER A 1 77 ? 18.791  -0.117  -12.938 1.00 0.00 ? 77  SER A HB3  2  
ATOM   2280  H  HG   . SER A 1 77 ? 16.904  -0.527  -14.745 1.00 0.00 ? 77  SER A HG   2  
ATOM   2281  N  N    . SER A 1 78 ? 18.758  2.355   -13.969 1.00 0.00 ? 78  SER A N    2  
ATOM   2282  C  CA   . SER A 1 78 ? 18.167  3.678   -13.805 1.00 0.00 ? 78  SER A CA   2  
ATOM   2283  C  C    . SER A 1 78 ? 18.973  4.731   -14.561 1.00 0.00 ? 78  SER A C    2  
ATOM   2284  O  O    . SER A 1 78 ? 19.971  5.245   -14.056 1.00 0.00 ? 78  SER A O    2  
ATOM   2285  C  CB   . SER A 1 78 ? 18.091  4.046   -12.322 1.00 0.00 ? 78  SER A CB   2  
ATOM   2286  O  OG   . SER A 1 78 ? 17.118  3.263   -11.652 1.00 0.00 ? 78  SER A OG   2  
ATOM   2287  H  H    . SER A 1 78 ? 19.413  2.039   -13.313 1.00 0.00 ? 78  SER A H    2  
ATOM   2288  H  HA   . SER A 1 78 ? 17.167  3.648   -14.212 1.00 0.00 ? 78  SER A HA   2  
ATOM   2289  H  HB2  . SER A 1 78 ? 19.052  3.875   -11.862 1.00 0.00 ? 78  SER A HB2  2  
ATOM   2290  H  HB3  . SER A 1 78 ? 17.825  5.089   -12.226 1.00 0.00 ? 78  SER A HB3  2  
ATOM   2291  H  HG   . SER A 1 78 ? 16.355  3.143   -12.223 1.00 0.00 ? 78  SER A HG   2  
ATOM   2292  N  N    . GLY A 1 79 ? 18.533  5.046   -15.775 1.00 0.00 ? 79  GLY A N    2  
ATOM   2293  C  CA   . GLY A 1 79 ? 19.224  6.035   -16.581 1.00 0.00 ? 79  GLY A CA   2  
ATOM   2294  C  C    . GLY A 1 79 ? 19.503  7.314   -15.817 1.00 0.00 ? 79  GLY A C    2  
ATOM   2295  O  O    . GLY A 1 79 ? 19.960  8.284   -16.420 1.00 0.00 ? 79  GLY A O    2  
ATOM   2296  H  H    . GLY A 1 79 ? 17.732  4.603   -16.126 1.00 0.00 ? 79  GLY A H    2  
ATOM   2297  H  HA2  . GLY A 1 79 ? 20.161  5.617   -16.918 1.00 0.00 ? 79  GLY A HA2  2  
ATOM   2298  H  HA3  . GLY A 1 79 ? 18.616  6.269   -17.443 1.00 0.00 ? 79  GLY A HA3  2  
HETATM 2299  ZN ZN   . ZN  B 2 .  ? -9.777  -0.366  -2.429  1.00 0.00 ? 201 ZN  A ZN   2  
HETATM 2300  ZN ZN   . ZN  C 2 .  ? 9.749   -1.091  -0.470  1.00 0.00 ? 401 ZN  A ZN   2  
ATOM   2301  N  N    . GLY A 1 1  ? -15.733 -24.373 6.706   1.00 0.00 ? 1   GLY A N    3  
ATOM   2302  C  CA   . GLY A 1 1  ? -16.293 -23.109 7.150   1.00 0.00 ? 1   GLY A CA   3  
ATOM   2303  C  C    . GLY A 1 1  ? -16.917 -22.322 6.015   1.00 0.00 ? 1   GLY A C    3  
ATOM   2304  O  O    . GLY A 1 1  ? -17.098 -22.843 4.914   1.00 0.00 ? 1   GLY A O    3  
ATOM   2305  H  H1   . GLY A 1 1  ? -16.132 -24.842 5.944   1.00 0.00 ? 1   GLY A H1   3  
ATOM   2306  H  HA2  . GLY A 1 1  ? -17.047 -23.304 7.897   1.00 0.00 ? 1   GLY A HA2  3  
ATOM   2307  H  HA3  . GLY A 1 1  ? -15.506 -22.517 7.593   1.00 0.00 ? 1   GLY A HA3  3  
ATOM   2308  N  N    . SER A 1 2  ? -17.249 -21.063 6.283   1.00 0.00 ? 2   SER A N    3  
ATOM   2309  C  CA   . SER A 1 2  ? -17.862 -20.203 5.277   1.00 0.00 ? 2   SER A CA   3  
ATOM   2310  C  C    . SER A 1 2  ? -17.921 -18.758 5.761   1.00 0.00 ? 2   SER A C    3  
ATOM   2311  O  O    . SER A 1 2  ? -18.203 -18.494 6.930   1.00 0.00 ? 2   SER A O    3  
ATOM   2312  C  CB   . SER A 1 2  ? -19.270 -20.699 4.942   1.00 0.00 ? 2   SER A CB   3  
ATOM   2313  O  OG   . SER A 1 2  ? -19.241 -21.636 3.879   1.00 0.00 ? 2   SER A OG   3  
ATOM   2314  H  H    . SER A 1 2  ? -17.079 -20.704 7.180   1.00 0.00 ? 2   SER A H    3  
ATOM   2315  H  HA   . SER A 1 2  ? -17.252 -20.248 4.387   1.00 0.00 ? 2   SER A HA   3  
ATOM   2316  H  HB2  . SER A 1 2  ? -19.698 -21.173 5.811   1.00 0.00 ? 2   SER A HB2  3  
ATOM   2317  H  HB3  . SER A 1 2  ? -19.884 -19.859 4.650   1.00 0.00 ? 2   SER A HB3  3  
ATOM   2318  H  HG   . SER A 1 2  ? -18.519 -21.422 3.283   1.00 0.00 ? 2   SER A HG   3  
ATOM   2319  N  N    . SER A 1 3  ? -17.654 -17.825 4.853   1.00 0.00 ? 3   SER A N    3  
ATOM   2320  C  CA   . SER A 1 3  ? -17.673 -16.405 5.187   1.00 0.00 ? 3   SER A CA   3  
ATOM   2321  C  C    . SER A 1 3  ? -17.810 -15.553 3.929   1.00 0.00 ? 3   SER A C    3  
ATOM   2322  O  O    . SER A 1 3  ? -17.822 -16.071 2.813   1.00 0.00 ? 3   SER A O    3  
ATOM   2323  C  CB   . SER A 1 3  ? -16.398 -16.020 5.940   1.00 0.00 ? 3   SER A CB   3  
ATOM   2324  O  OG   . SER A 1 3  ? -16.600 -14.854 6.721   1.00 0.00 ? 3   SER A OG   3  
ATOM   2325  H  H    . SER A 1 3  ? -17.436 -18.098 3.937   1.00 0.00 ? 3   SER A H    3  
ATOM   2326  H  HA   . SER A 1 3  ? -18.526 -16.226 5.824   1.00 0.00 ? 3   SER A HA   3  
ATOM   2327  H  HB2  . SER A 1 3  ? -16.110 -16.830 6.593   1.00 0.00 ? 3   SER A HB2  3  
ATOM   2328  H  HB3  . SER A 1 3  ? -15.606 -15.831 5.230   1.00 0.00 ? 3   SER A HB3  3  
ATOM   2329  H  HG   . SER A 1 3  ? -16.496 -15.070 7.651   1.00 0.00 ? 3   SER A HG   3  
ATOM   2330  N  N    . GLY A 1 4  ? -17.915 -14.241 4.118   1.00 0.00 ? 4   GLY A N    3  
ATOM   2331  C  CA   . GLY A 1 4  ? -18.051 -13.337 2.991   1.00 0.00 ? 4   GLY A CA   3  
ATOM   2332  C  C    . GLY A 1 4  ? -19.379 -12.607 2.991   1.00 0.00 ? 4   GLY A C    3  
ATOM   2333  O  O    . GLY A 1 4  ? -19.553 -11.619 3.704   1.00 0.00 ? 4   GLY A O    3  
ATOM   2334  H  H    . GLY A 1 4  ? -17.899 -13.884 5.031   1.00 0.00 ? 4   GLY A H    3  
ATOM   2335  H  HA2  . GLY A 1 4  ? -17.252 -12.611 3.028   1.00 0.00 ? 4   GLY A HA2  3  
ATOM   2336  H  HA3  . GLY A 1 4  ? -17.965 -13.905 2.077   1.00 0.00 ? 4   GLY A HA3  3  
ATOM   2337  N  N    . SER A 1 5  ? -20.319 -13.093 2.186   1.00 0.00 ? 5   SER A N    3  
ATOM   2338  C  CA   . SER A 1 5  ? -21.637 -12.477 2.091   1.00 0.00 ? 5   SER A CA   3  
ATOM   2339  C  C    . SER A 1 5  ? -21.538 -10.959 2.217   1.00 0.00 ? 5   SER A C    3  
ATOM   2340  O  O    . SER A 1 5  ? -22.355 -10.326 2.886   1.00 0.00 ? 5   SER A O    3  
ATOM   2341  C  CB   . SER A 1 5  ? -22.562 -13.030 3.177   1.00 0.00 ? 5   SER A CB   3  
ATOM   2342  O  OG   . SER A 1 5  ? -23.873 -12.509 3.045   1.00 0.00 ? 5   SER A OG   3  
ATOM   2343  H  H    . SER A 1 5  ? -20.120 -13.883 1.642   1.00 0.00 ? 5   SER A H    3  
ATOM   2344  H  HA   . SER A 1 5  ? -22.048 -12.720 1.123   1.00 0.00 ? 5   SER A HA   3  
ATOM   2345  H  HB2  . SER A 1 5  ? -22.605 -14.106 3.096   1.00 0.00 ? 5   SER A HB2  3  
ATOM   2346  H  HB3  . SER A 1 5  ? -22.175 -12.758 4.149   1.00 0.00 ? 5   SER A HB3  3  
ATOM   2347  H  HG   . SER A 1 5  ? -23.840 -11.674 2.572   1.00 0.00 ? 5   SER A HG   3  
ATOM   2348  N  N    . SER A 1 6  ? -20.531 -10.383 1.569   1.00 0.00 ? 6   SER A N    3  
ATOM   2349  C  CA   . SER A 1 6  ? -20.321 -8.940  1.611   1.00 0.00 ? 6   SER A CA   3  
ATOM   2350  C  C    . SER A 1 6  ? -20.848 -8.278  0.342   1.00 0.00 ? 6   SER A C    3  
ATOM   2351  O  O    . SER A 1 6  ? -20.891 -8.894  -0.722  1.00 0.00 ? 6   SER A O    3  
ATOM   2352  C  CB   . SER A 1 6  ? -18.834 -8.625  1.784   1.00 0.00 ? 6   SER A CB   3  
ATOM   2353  O  OG   . SER A 1 6  ? -18.629 -7.241  2.009   1.00 0.00 ? 6   SER A OG   3  
ATOM   2354  H  H    . SER A 1 6  ? -19.913 -10.942 1.053   1.00 0.00 ? 6   SER A H    3  
ATOM   2355  H  HA   . SER A 1 6  ? -20.864 -8.551  2.459   1.00 0.00 ? 6   SER A HA   3  
ATOM   2356  H  HB2  . SER A 1 6  ? -18.448 -9.175  2.628   1.00 0.00 ? 6   SER A HB2  3  
ATOM   2357  H  HB3  . SER A 1 6  ? -18.301 -8.915  0.890   1.00 0.00 ? 6   SER A HB3  3  
ATOM   2358  H  HG   . SER A 1 6  ? -19.183 -6.949  2.737   1.00 0.00 ? 6   SER A HG   3  
ATOM   2359  N  N    . GLY A 1 7  ? -21.249 -7.016  0.463   1.00 0.00 ? 7   GLY A N    3  
ATOM   2360  C  CA   . GLY A 1 7  ? -21.769 -6.289  -0.681  1.00 0.00 ? 7   GLY A CA   3  
ATOM   2361  C  C    . GLY A 1 7  ? -21.914 -4.805  -0.408  1.00 0.00 ? 7   GLY A C    3  
ATOM   2362  O  O    . GLY A 1 7  ? -22.476 -4.408  0.612   1.00 0.00 ? 7   GLY A O    3  
ATOM   2363  H  H    . GLY A 1 7  ? -21.192 -6.575  1.336   1.00 0.00 ? 7   GLY A H    3  
ATOM   2364  H  HA2  . GLY A 1 7  ? -21.099 -6.428  -1.516  1.00 0.00 ? 7   GLY A HA2  3  
ATOM   2365  H  HA3  . GLY A 1 7  ? -22.737 -6.692  -0.939  1.00 0.00 ? 7   GLY A HA3  3  
ATOM   2366  N  N    . GLU A 1 8  ? -21.404 -3.985  -1.321  1.00 0.00 ? 8   GLU A N    3  
ATOM   2367  C  CA   . GLU A 1 8  ? -21.478 -2.536  -1.171  1.00 0.00 ? 8   GLU A CA   3  
ATOM   2368  C  C    . GLU A 1 8  ? -21.548 -1.851  -2.533  1.00 0.00 ? 8   GLU A C    3  
ATOM   2369  O  O    . GLU A 1 8  ? -20.754 -2.141  -3.428  1.00 0.00 ? 8   GLU A O    3  
ATOM   2370  C  CB   . GLU A 1 8  ? -20.269 -2.019  -0.390  1.00 0.00 ? 8   GLU A CB   3  
ATOM   2371  C  CG   . GLU A 1 8  ? -20.524 -0.705  0.329   1.00 0.00 ? 8   GLU A CG   3  
ATOM   2372  C  CD   . GLU A 1 8  ? -19.659 -0.537  1.563   1.00 0.00 ? 8   GLU A CD   3  
ATOM   2373  O  OE1  . GLU A 1 8  ? -19.516 -1.516  2.324   1.00 0.00 ? 8   GLU A OE1  3  
ATOM   2374  O  OE2  . GLU A 1 8  ? -19.126 0.573   1.767   1.00 0.00 ? 8   GLU A OE2  3  
ATOM   2375  H  H    . GLU A 1 8  ? -20.968 -4.362  -2.113  1.00 0.00 ? 8   GLU A H    3  
ATOM   2376  H  HA   . GLU A 1 8  ? -22.377 -2.305  -0.620  1.00 0.00 ? 8   GLU A HA   3  
ATOM   2377  H  HB2  . GLU A 1 8  ? -19.987 -2.759  0.345   1.00 0.00 ? 8   GLU A HB2  3  
ATOM   2378  H  HB3  . GLU A 1 8  ? -19.447 -1.876  -1.076  1.00 0.00 ? 8   GLU A HB3  3  
ATOM   2379  H  HG2  . GLU A 1 8  ? -20.317 0.108   -0.351  1.00 0.00 ? 8   GLU A HG2  3  
ATOM   2380  H  HG3  . GLU A 1 8  ? -21.562 -0.668  0.626   1.00 0.00 ? 8   GLU A HG3  3  
ATOM   2381  N  N    . LYS A 1 9  ? -22.504 -0.941  -2.683  1.00 0.00 ? 9   LYS A N    3  
ATOM   2382  C  CA   . LYS A 1 9  ? -22.679 -0.213  -3.934  1.00 0.00 ? 9   LYS A CA   3  
ATOM   2383  C  C    . LYS A 1 9  ? -22.944 1.266   -3.671  1.00 0.00 ? 9   LYS A C    3  
ATOM   2384  O  O    . LYS A 1 9  ? -23.741 1.618   -2.801  1.00 0.00 ? 9   LYS A O    3  
ATOM   2385  C  CB   . LYS A 1 9  ? -23.833 -0.813  -4.740  1.00 0.00 ? 9   LYS A CB   3  
ATOM   2386  C  CG   . LYS A 1 9  ? -23.422 -1.991  -5.606  1.00 0.00 ? 9   LYS A CG   3  
ATOM   2387  C  CD   . LYS A 1 9  ? -22.753 -1.532  -6.891  1.00 0.00 ? 9   LYS A CD   3  
ATOM   2388  C  CE   . LYS A 1 9  ? -22.488 -2.700  -7.829  1.00 0.00 ? 9   LYS A CE   3  
ATOM   2389  N  NZ   . LYS A 1 9  ? -22.066 -2.240  -9.181  1.00 0.00 ? 9   LYS A NZ   3  
ATOM   2390  H  H    . LYS A 1 9  ? -23.107 -0.753  -1.932  1.00 0.00 ? 9   LYS A H    3  
ATOM   2391  H  HA   . LYS A 1 9  ? -21.766 -0.307  -4.503  1.00 0.00 ? 9   LYS A HA   3  
ATOM   2392  H  HB2  . LYS A 1 9  ? -24.599 -1.146  -4.056  1.00 0.00 ? 9   LYS A HB2  3  
ATOM   2393  H  HB3  . LYS A 1 9  ? -24.244 -0.048  -5.383  1.00 0.00 ? 9   LYS A HB3  3  
ATOM   2394  H  HG2  . LYS A 1 9  ? -22.729 -2.609  -5.053  1.00 0.00 ? 9   LYS A HG2  3  
ATOM   2395  H  HG3  . LYS A 1 9  ? -24.301 -2.568  -5.855  1.00 0.00 ? 9   LYS A HG3  3  
ATOM   2396  H  HD2  . LYS A 1 9  ? -23.397 -0.824  -7.389  1.00 0.00 ? 9   LYS A HD2  3  
ATOM   2397  H  HD3  . LYS A 1 9  ? -21.813 -1.057  -6.647  1.00 0.00 ? 9   LYS A HD3  3  
ATOM   2398  H  HE2  . LYS A 1 9  ? -21.707 -3.314  -7.408  1.00 0.00 ? 9   LYS A HE2  3  
ATOM   2399  H  HE3  . LYS A 1 9  ? -23.393 -3.282  -7.922  1.00 0.00 ? 9   LYS A HE3  3  
ATOM   2400  H  HZ1  . LYS A 1 9  ? -21.105 -1.844  -9.140  1.00 0.00 ? 9   LYS A HZ1  3  
ATOM   2401  H  HZ2  . LYS A 1 9  ? -22.716 -1.506  -9.528  1.00 0.00 ? 9   LYS A HZ2  3  
ATOM   2402  H  HZ3  . LYS A 1 9  ? -22.073 -3.037  -9.849  1.00 0.00 ? 9   LYS A HZ3  3  
ATOM   2403  N  N    . ALA A 1 10 ? -22.273 2.127   -4.428  1.00 0.00 ? 10  ALA A N    3  
ATOM   2404  C  CA   . ALA A 1 10 ? -22.440 3.567   -4.279  1.00 0.00 ? 10  ALA A CA   3  
ATOM   2405  C  C    . ALA A 1 10 ? -21.697 4.323   -5.375  1.00 0.00 ? 10  ALA A C    3  
ATOM   2406  O  O    . ALA A 1 10 ? -20.537 4.031   -5.667  1.00 0.00 ? 10  ALA A O    3  
ATOM   2407  C  CB   . ALA A 1 10 ? -21.957 4.015   -2.907  1.00 0.00 ? 10  ALA A CB   3  
ATOM   2408  H  H    . ALA A 1 10 ? -21.652 1.785   -5.105  1.00 0.00 ? 10  ALA A H    3  
ATOM   2409  H  HA   . ALA A 1 10 ? -23.494 3.791   -4.353  1.00 0.00 ? 10  ALA A HA   3  
ATOM   2410  H  HB1  . ALA A 1 10 ? -21.295 3.266   -2.497  1.00 0.00 ? 10  ALA A HB1  3  
ATOM   2411  H  HB2  . ALA A 1 10 ? -21.428 4.951   -3.000  1.00 0.00 ? 10  ALA A HB2  3  
ATOM   2412  H  HB3  . ALA A 1 10 ? -22.805 4.143   -2.252  1.00 0.00 ? 10  ALA A HB3  3  
ATOM   2413  N  N    . ARG A 1 11 ? -22.372 5.294   -5.981  1.00 0.00 ? 11  ARG A N    3  
ATOM   2414  C  CA   . ARG A 1 11 ? -21.776 6.090   -7.047  1.00 0.00 ? 11  ARG A CA   3  
ATOM   2415  C  C    . ARG A 1 11 ? -22.249 7.539   -6.973  1.00 0.00 ? 11  ARG A C    3  
ATOM   2416  O  O    . ARG A 1 11 ? -23.430 7.807   -6.758  1.00 0.00 ? 11  ARG A O    3  
ATOM   2417  C  CB   . ARG A 1 11 ? -22.127 5.497   -8.412  1.00 0.00 ? 11  ARG A CB   3  
ATOM   2418  C  CG   . ARG A 1 11 ? -21.322 4.256   -8.763  1.00 0.00 ? 11  ARG A CG   3  
ATOM   2419  C  CD   . ARG A 1 11 ? -21.410 3.935   -10.246 1.00 0.00 ? 11  ARG A CD   3  
ATOM   2420  N  NE   . ARG A 1 11 ? -20.302 3.094   -10.691 1.00 0.00 ? 11  ARG A NE   3  
ATOM   2421  C  CZ   . ARG A 1 11 ? -19.930 2.981   -11.961 1.00 0.00 ? 11  ARG A CZ   3  
ATOM   2422  N  NH1  . ARG A 1 11 ? -20.574 3.651   -12.907 1.00 0.00 ? 11  ARG A NH1  3  
ATOM   2423  N  NH2  . ARG A 1 11 ? -18.911 2.195   -12.288 1.00 0.00 ? 11  ARG A NH2  3  
ATOM   2424  H  H    . ARG A 1 11 ? -23.294 5.480   -5.704  1.00 0.00 ? 11  ARG A H    3  
ATOM   2425  H  HA   . ARG A 1 11 ? -20.704 6.066   -6.919  1.00 0.00 ? 11  ARG A HA   3  
ATOM   2426  H  HB2  . ARG A 1 11 ? -23.174 5.233   -8.419  1.00 0.00 ? 11  ARG A HB2  3  
ATOM   2427  H  HB3  . ARG A 1 11 ? -21.947 6.242   -9.172  1.00 0.00 ? 11  ARG A HB3  3  
ATOM   2428  H  HG2  . ARG A 1 11 ? -20.287 4.424   -8.503  1.00 0.00 ? 11  ARG A HG2  3  
ATOM   2429  H  HG3  . ARG A 1 11 ? -21.705 3.419   -8.198  1.00 0.00 ? 11  ARG A HG3  3  
ATOM   2430  H  HD2  . ARG A 1 11 ? -22.339 3.418   -10.435 1.00 0.00 ? 11  ARG A HD2  3  
ATOM   2431  H  HD3  . ARG A 1 11 ? -21.394 4.860   -10.802 1.00 0.00 ? 11  ARG A HD3  3  
ATOM   2432  H  HE   . ARG A 1 11 ? -19.812 2.590   -10.009 1.00 0.00 ? 11  ARG A HE   3  
ATOM   2433  H  HH11 . ARG A 1 11 ? -21.341 4.244   -12.664 1.00 0.00 ? 11  ARG A HH11 3  
ATOM   2434  H  HH12 . ARG A 1 11 ? -20.290 3.564   -13.862 1.00 0.00 ? 11  ARG A HH12 3  
ATOM   2435  H  HH21 . ARG A 1 11 ? -18.423 1.689   -11.577 1.00 0.00 ? 11  ARG A HH21 3  
ATOM   2436  H  HH22 . ARG A 1 11 ? -18.632 2.110   -13.244 1.00 0.00 ? 11  ARG A HH22 3  
ATOM   2437  N  N    . GLY A 1 12 ? -21.317 8.470   -7.152  1.00 0.00 ? 12  GLY A N    3  
ATOM   2438  C  CA   . GLY A 1 12 ? -21.657 9.880   -7.102  1.00 0.00 ? 12  GLY A CA   3  
ATOM   2439  C  C    . GLY A 1 12 ? -20.447 10.760  -6.858  1.00 0.00 ? 12  GLY A C    3  
ATOM   2440  O  O    . GLY A 1 12 ? -19.328 10.265  -6.717  1.00 0.00 ? 12  GLY A O    3  
ATOM   2441  H  H    . GLY A 1 12 ? -20.390 8.198   -7.320  1.00 0.00 ? 12  GLY A H    3  
ATOM   2442  H  HA2  . GLY A 1 12 ? -22.112 10.163  -8.039  1.00 0.00 ? 12  GLY A HA2  3  
ATOM   2443  H  HA3  . GLY A 1 12 ? -22.369 10.038  -6.305  1.00 0.00 ? 12  GLY A HA3  3  
ATOM   2444  N  N    . LEU A 1 13 ? -20.670 12.069  -6.809  1.00 0.00 ? 13  LEU A N    3  
ATOM   2445  C  CA   . LEU A 1 13 ? -19.589 13.021  -6.582  1.00 0.00 ? 13  LEU A CA   3  
ATOM   2446  C  C    . LEU A 1 13 ? -19.282 13.152  -5.093  1.00 0.00 ? 13  LEU A C    3  
ATOM   2447  O  O    . LEU A 1 13 ? -20.187 13.299  -4.273  1.00 0.00 ? 13  LEU A O    3  
ATOM   2448  C  CB   . LEU A 1 13 ? -19.957 14.389  -7.160  1.00 0.00 ? 13  LEU A CB   3  
ATOM   2449  C  CG   . LEU A 1 13 ? -19.671 14.587  -8.649  1.00 0.00 ? 13  LEU A CG   3  
ATOM   2450  C  CD1  . LEU A 1 13 ? -18.182 14.452  -8.929  1.00 0.00 ? 13  LEU A CD1  3  
ATOM   2451  C  CD2  . LEU A 1 13 ? -20.465 13.591  -9.482  1.00 0.00 ? 13  LEU A CD2  3  
ATOM   2452  H  H    . LEU A 1 13 ? -21.583 12.404  -6.928  1.00 0.00 ? 13  LEU A H    3  
ATOM   2453  H  HA   . LEU A 1 13 ? -18.710 12.651  -7.087  1.00 0.00 ? 13  LEU A HA   3  
ATOM   2454  H  HB2  . LEU A 1 13 ? -21.014 14.540  -7.004  1.00 0.00 ? 13  LEU A HB2  3  
ATOM   2455  H  HB3  . LEU A 1 13 ? -19.404 15.138  -6.613  1.00 0.00 ? 13  LEU A HB3  3  
ATOM   2456  H  HG   . LEU A 1 13 ? -19.975 15.584  -8.938  1.00 0.00 ? 13  LEU A HG   3  
ATOM   2457  H  HD11 . LEU A 1 13 ? -17.672 14.155  -8.025  1.00 0.00 ? 13  LEU A HD11 3  
ATOM   2458  H  HD12 . LEU A 1 13 ? -17.792 15.400  -9.268  1.00 0.00 ? 13  LEU A HD12 3  
ATOM   2459  H  HD13 . LEU A 1 13 ? -18.026 13.705  -9.693  1.00 0.00 ? 13  LEU A HD13 3  
ATOM   2460  H  HD21 . LEU A 1 13 ? -21.518 13.815  -9.402  1.00 0.00 ? 13  LEU A HD21 3  
ATOM   2461  H  HD22 . LEU A 1 13 ? -20.281 12.590  -9.118  1.00 0.00 ? 13  LEU A HD22 3  
ATOM   2462  H  HD23 . LEU A 1 13 ? -20.158 13.661  -10.515 1.00 0.00 ? 13  LEU A HD23 3  
ATOM   2463  N  N    . GLY A 1 14 ? -17.998 13.100  -4.752  1.00 0.00 ? 14  GLY A N    3  
ATOM   2464  C  CA   . GLY A 1 14 ? -17.594 13.216  -3.363  1.00 0.00 ? 14  GLY A CA   3  
ATOM   2465  C  C    . GLY A 1 14 ? -16.108 12.986  -3.170  1.00 0.00 ? 14  GLY A C    3  
ATOM   2466  O  O    . GLY A 1 14 ? -15.400 13.850  -2.653  1.00 0.00 ? 14  GLY A O    3  
ATOM   2467  H  H    . GLY A 1 14 ? -17.319 12.981  -5.449  1.00 0.00 ? 14  GLY A H    3  
ATOM   2468  H  HA2  . GLY A 1 14 ? -17.844 14.205  -3.008  1.00 0.00 ? 14  GLY A HA2  3  
ATOM   2469  H  HA3  . GLY A 1 14 ? -18.138 12.487  -2.780  1.00 0.00 ? 14  GLY A HA3  3  
ATOM   2470  N  N    . LYS A 1 15 ? -15.634 11.816  -3.585  1.00 0.00 ? 15  LYS A N    3  
ATOM   2471  C  CA   . LYS A 1 15 ? -14.223 11.473  -3.455  1.00 0.00 ? 15  LYS A CA   3  
ATOM   2472  C  C    . LYS A 1 15 ? -13.822 10.420  -4.483  1.00 0.00 ? 15  LYS A C    3  
ATOM   2473  O  O    . LYS A 1 15 ? -14.635 10.002  -5.308  1.00 0.00 ? 15  LYS A O    3  
ATOM   2474  C  CB   . LYS A 1 15 ? -13.929 10.960  -2.043  1.00 0.00 ? 15  LYS A CB   3  
ATOM   2475  C  CG   . LYS A 1 15 ? -14.288 11.951  -0.949  1.00 0.00 ? 15  LYS A CG   3  
ATOM   2476  C  CD   . LYS A 1 15 ? -13.386 13.172  -0.985  1.00 0.00 ? 15  LYS A CD   3  
ATOM   2477  C  CE   . LYS A 1 15 ? -13.997 14.339  -0.224  1.00 0.00 ? 15  LYS A CE   3  
ATOM   2478  N  NZ   . LYS A 1 15 ? -13.964 14.119  1.248   1.00 0.00 ? 15  LYS A NZ   3  
ATOM   2479  H  H    . LYS A 1 15 ? -16.248 11.167  -3.989  1.00 0.00 ? 15  LYS A H    3  
ATOM   2480  H  HA   . LYS A 1 15 ? -13.646 12.368  -3.631  1.00 0.00 ? 15  LYS A HA   3  
ATOM   2481  H  HB2  . LYS A 1 15 ? -14.492 10.053  -1.878  1.00 0.00 ? 15  LYS A HB2  3  
ATOM   2482  H  HB3  . LYS A 1 15 ? -12.874 10.738  -1.966  1.00 0.00 ? 15  LYS A HB3  3  
ATOM   2483  H  HG2  . LYS A 1 15 ? -15.312 12.268  -1.086  1.00 0.00 ? 15  LYS A HG2  3  
ATOM   2484  H  HG3  . LYS A 1 15 ? -14.185 11.465  0.011   1.00 0.00 ? 15  LYS A HG3  3  
ATOM   2485  H  HD2  . LYS A 1 15 ? -12.437 12.922  -0.535  1.00 0.00 ? 15  LYS A HD2  3  
ATOM   2486  H  HD3  . LYS A 1 15 ? -13.233 13.466  -2.014  1.00 0.00 ? 15  LYS A HD3  3  
ATOM   2487  H  HE2  . LYS A 1 15 ? -13.442 15.235  -0.458  1.00 0.00 ? 15  LYS A HE2  3  
ATOM   2488  H  HE3  . LYS A 1 15 ? -15.023 14.459  -0.539  1.00 0.00 ? 15  LYS A HE3  3  
ATOM   2489  H  HZ1  . LYS A 1 15 ? -13.155 14.621  1.666   1.00 0.00 ? 15  LYS A HZ1  3  
ATOM   2490  H  HZ2  . LYS A 1 15 ? -13.873 13.104  1.456   1.00 0.00 ? 15  LYS A HZ2  3  
ATOM   2491  H  HZ3  . LYS A 1 15 ? -14.840 14.473  1.683   1.00 0.00 ? 15  LYS A HZ3  3  
ATOM   2492  N  N    . TYR A 1 16 ? -12.565 9.994   -4.428  1.00 0.00 ? 16  TYR A N    3  
ATOM   2493  C  CA   . TYR A 1 16 ? -12.057 8.990   -5.355  1.00 0.00 ? 16  TYR A CA   3  
ATOM   2494  C  C    . TYR A 1 16 ? -12.528 7.594   -4.959  1.00 0.00 ? 16  TYR A C    3  
ATOM   2495  O  O    . TYR A 1 16 ? -12.231 7.114   -3.864  1.00 0.00 ? 16  TYR A O    3  
ATOM   2496  C  CB   . TYR A 1 16 ? -10.528 9.032   -5.398  1.00 0.00 ? 16  TYR A CB   3  
ATOM   2497  C  CG   . TYR A 1 16 ? -9.975  10.252  -6.099  1.00 0.00 ? 16  TYR A CG   3  
ATOM   2498  C  CD1  . TYR A 1 16 ? -10.156 11.524  -5.569  1.00 0.00 ? 16  TYR A CD1  3  
ATOM   2499  C  CD2  . TYR A 1 16 ? -9.273  10.133  -7.292  1.00 0.00 ? 16  TYR A CD2  3  
ATOM   2500  C  CE1  . TYR A 1 16 ? -9.654  12.641  -6.207  1.00 0.00 ? 16  TYR A CE1  3  
ATOM   2501  C  CE2  . TYR A 1 16 ? -8.765  11.245  -7.935  1.00 0.00 ? 16  TYR A CE2  3  
ATOM   2502  C  CZ   . TYR A 1 16 ? -8.958  12.497  -7.389  1.00 0.00 ? 16  TYR A CZ   3  
ATOM   2503  O  OH   . TYR A 1 16 ? -8.455  13.607  -8.028  1.00 0.00 ? 16  TYR A OH   3  
ATOM   2504  H  H    . TYR A 1 16 ? -11.964 10.364  -3.748  1.00 0.00 ? 16  TYR A H    3  
ATOM   2505  H  HA   . TYR A 1 16 ? -12.441 9.221   -6.338  1.00 0.00 ? 16  TYR A HA   3  
ATOM   2506  H  HB2  . TYR A 1 16 ? -10.147 9.029   -4.388  1.00 0.00 ? 16  TYR A HB2  3  
ATOM   2507  H  HB3  . TYR A 1 16 ? -10.165 8.157   -5.917  1.00 0.00 ? 16  TYR A HB3  3  
ATOM   2508  H  HD1  . TYR A 1 16 ? -10.701 11.634  -4.643  1.00 0.00 ? 16  TYR A HD1  3  
ATOM   2509  H  HD2  . TYR A 1 16 ? -9.124  9.151   -7.717  1.00 0.00 ? 16  TYR A HD2  3  
ATOM   2510  H  HE1  . TYR A 1 16 ? -9.804  13.622  -5.779  1.00 0.00 ? 16  TYR A HE1  3  
ATOM   2511  H  HE2  . TYR A 1 16 ? -8.221  11.132  -8.862  1.00 0.00 ? 16  TYR A HE2  3  
ATOM   2512  H  HH   . TYR A 1 16 ? -9.119  13.960  -8.625  1.00 0.00 ? 16  TYR A HH   3  
ATOM   2513  N  N    . ILE A 1 17 ? -13.262 6.947   -5.857  1.00 0.00 ? 17  ILE A N    3  
ATOM   2514  C  CA   . ILE A 1 17 ? -13.773 5.606   -5.603  1.00 0.00 ? 17  ILE A CA   3  
ATOM   2515  C  C    . ILE A 1 17 ? -12.771 4.544   -6.042  1.00 0.00 ? 17  ILE A C    3  
ATOM   2516  O  O    . ILE A 1 17 ? -12.440 4.437   -7.223  1.00 0.00 ? 17  ILE A O    3  
ATOM   2517  C  CB   . ILE A 1 17 ? -15.110 5.365   -6.330  1.00 0.00 ? 17  ILE A CB   3  
ATOM   2518  C  CG1  . ILE A 1 17 ? -16.109 6.471   -5.984  1.00 0.00 ? 17  ILE A CG1  3  
ATOM   2519  C  CG2  . ILE A 1 17 ? -15.674 4.001   -5.963  1.00 0.00 ? 17  ILE A CG2  3  
ATOM   2520  C  CD1  . ILE A 1 17 ? -16.741 6.310   -4.619  1.00 0.00 ? 17  ILE A CD1  3  
ATOM   2521  H  H    . ILE A 1 17 ? -13.465 7.382   -6.712  1.00 0.00 ? 17  ILE A H    3  
ATOM   2522  H  HA   . ILE A 1 17 ? -13.941 5.510   -4.540  1.00 0.00 ? 17  ILE A HA   3  
ATOM   2523  H  HB   . ILE A 1 17 ? -14.924 5.378   -7.392  1.00 0.00 ? 17  ILE A HB   3  
ATOM   2524  H  HG12 . ILE A 1 17 ? -15.604 7.424   -6.004  1.00 0.00 ? 17  ILE A HG12 3  
ATOM   2525  H  HG13 . ILE A 1 17 ? -16.901 6.473   -6.719  1.00 0.00 ? 17  ILE A HG13 3  
ATOM   2526  H  HG21 . ILE A 1 17 ? -16.728 3.973   -6.195  1.00 0.00 ? 17  ILE A HG21 3  
ATOM   2527  H  HG22 . ILE A 1 17 ? -15.162 3.237   -6.528  1.00 0.00 ? 17  ILE A HG22 3  
ATOM   2528  H  HG23 . ILE A 1 17 ? -15.532 3.824   -4.907  1.00 0.00 ? 17  ILE A HG23 3  
ATOM   2529  H  HD11 . ILE A 1 17 ? -17.653 5.739   -4.709  1.00 0.00 ? 17  ILE A HD11 3  
ATOM   2530  H  HD12 . ILE A 1 17 ? -16.055 5.795   -3.963  1.00 0.00 ? 17  ILE A HD12 3  
ATOM   2531  H  HD13 . ILE A 1 17 ? -16.967 7.284   -4.210  1.00 0.00 ? 17  ILE A HD13 3  
ATOM   2532  N  N    . CYS A 1 18 ? -12.292 3.758   -5.083  1.00 0.00 ? 18  CYS A N    3  
ATOM   2533  C  CA   . CYS A 1 18 ? -11.328 2.702   -5.370  1.00 0.00 ? 18  CYS A CA   3  
ATOM   2534  C  C    . CYS A 1 18 ? -11.868 1.745   -6.428  1.00 0.00 ? 18  CYS A C    3  
ATOM   2535  O  O    . CYS A 1 18 ? -12.961 1.197   -6.282  1.00 0.00 ? 18  CYS A O    3  
ATOM   2536  C  CB   . CYS A 1 18 ? -10.991 1.931   -4.092  1.00 0.00 ? 18  CYS A CB   3  
ATOM   2537  S  SG   . CYS A 1 18 ? -9.666  0.697   -4.296  1.00 0.00 ? 18  CYS A SG   3  
ATOM   2538  H  H    . CYS A 1 18 ? -12.593 3.892   -4.160  1.00 0.00 ? 18  CYS A H    3  
ATOM   2539  H  HA   . CYS A 1 18 ? -10.430 3.167   -5.747  1.00 0.00 ? 18  CYS A HA   3  
ATOM   2540  H  HB2  . CYS A 1 18 ? -10.673 2.630   -3.332  1.00 0.00 ? 18  CYS A HB2  3  
ATOM   2541  H  HB3  . CYS A 1 18 ? -11.874 1.412   -3.750  1.00 0.00 ? 18  CYS A HB3  3  
ATOM   2542  N  N    . GLN A 1 19 ? -11.095 1.548   -7.490  1.00 0.00 ? 19  GLN A N    3  
ATOM   2543  C  CA   . GLN A 1 19 ? -11.496 0.658   -8.573  1.00 0.00 ? 19  GLN A CA   3  
ATOM   2544  C  C    . GLN A 1 19 ? -11.147 -0.790  -8.244  1.00 0.00 ? 19  GLN A C    3  
ATOM   2545  O  O    . GLN A 1 19 ? -10.937 -1.608  -9.139  1.00 0.00 ? 19  GLN A O    3  
ATOM   2546  C  CB   . GLN A 1 19 ? -10.821 1.073   -9.881  1.00 0.00 ? 19  GLN A CB   3  
ATOM   2547  C  CG   . GLN A 1 19 ? -11.634 2.065   -10.697 1.00 0.00 ? 19  GLN A CG   3  
ATOM   2548  C  CD   . GLN A 1 19 ? -12.978 1.508   -11.122 1.00 0.00 ? 19  GLN A CD   3  
ATOM   2549  O  OE1  . GLN A 1 19 ? -13.054 0.613   -11.964 1.00 0.00 ? 19  GLN A OE1  3  
ATOM   2550  N  NE2  . GLN A 1 19 ? -14.049 2.036   -10.539 1.00 0.00 ? 19  GLN A NE2  3  
ATOM   2551  H  H    . GLN A 1 19 ? -10.235 2.014   -7.548  1.00 0.00 ? 19  GLN A H    3  
ATOM   2552  H  HA   . GLN A 1 19 ? -12.566 0.739   -8.689  1.00 0.00 ? 19  GLN A HA   3  
ATOM   2553  H  HB2  . GLN A 1 19 ? -9.867  1.524   -9.652  1.00 0.00 ? 19  GLN A HB2  3  
ATOM   2554  H  HB3  . GLN A 1 19 ? -10.659 0.192   -10.484 1.00 0.00 ? 19  GLN A HB3  3  
ATOM   2555  H  HG2  . GLN A 1 19 ? -11.801 2.950   -10.101 1.00 0.00 ? 19  GLN A HG2  3  
ATOM   2556  H  HG3  . GLN A 1 19 ? -11.073 2.328   -11.582 1.00 0.00 ? 19  GLN A HG3  3  
ATOM   2557  H  HE21 . GLN A 1 19 ? -13.912 2.746   -9.878  1.00 0.00 ? 19  GLN A HE21 3  
ATOM   2558  H  HE22 . GLN A 1 19 ? -14.930 1.695   -10.795 1.00 0.00 ? 19  GLN A HE22 3  
ATOM   2559  N  N    . LYS A 1 20 ? -11.086 -1.100  -6.953  1.00 0.00 ? 20  LYS A N    3  
ATOM   2560  C  CA   . LYS A 1 20 ? -10.763 -2.449  -6.504  1.00 0.00 ? 20  LYS A CA   3  
ATOM   2561  C  C    . LYS A 1 20 ? -11.772 -2.934  -5.468  1.00 0.00 ? 20  LYS A C    3  
ATOM   2562  O  O    . LYS A 1 20 ? -12.344 -4.017  -5.602  1.00 0.00 ? 20  LYS A O    3  
ATOM   2563  C  CB   . LYS A 1 20 ? -9.351  -2.489  -5.915  1.00 0.00 ? 20  LYS A CB   3  
ATOM   2564  C  CG   . LYS A 1 20 ? -8.952  -3.855  -5.384  1.00 0.00 ? 20  LYS A CG   3  
ATOM   2565  C  CD   . LYS A 1 20 ? -8.286  -4.698  -6.459  1.00 0.00 ? 20  LYS A CD   3  
ATOM   2566  C  CE   . LYS A 1 20 ? -8.002  -6.108  -5.964  1.00 0.00 ? 20  LYS A CE   3  
ATOM   2567  N  NZ   . LYS A 1 20 ? -7.667  -7.031  -7.083  1.00 0.00 ? 20  LYS A NZ   3  
ATOM   2568  H  H    . LYS A 1 20 ? -11.264 -0.404  -6.286  1.00 0.00 ? 20  LYS A H    3  
ATOM   2569  H  HA   . LYS A 1 20 ? -10.804 -3.103  -7.362  1.00 0.00 ? 20  LYS A HA   3  
ATOM   2570  H  HB2  . LYS A 1 20 ? -8.646  -2.203  -6.681  1.00 0.00 ? 20  LYS A HB2  3  
ATOM   2571  H  HB3  . LYS A 1 20 ? -9.294  -1.779  -5.102  1.00 0.00 ? 20  LYS A HB3  3  
ATOM   2572  H  HG2  . LYS A 1 20 ? -8.261  -3.724  -4.564  1.00 0.00 ? 20  LYS A HG2  3  
ATOM   2573  H  HG3  . LYS A 1 20 ? -9.836  -4.367  -5.033  1.00 0.00 ? 20  LYS A HG3  3  
ATOM   2574  H  HD2  . LYS A 1 20 ? -8.940  -4.754  -7.316  1.00 0.00 ? 20  LYS A HD2  3  
ATOM   2575  H  HD3  . LYS A 1 20 ? -7.354  -4.231  -6.744  1.00 0.00 ? 20  LYS A HD3  3  
ATOM   2576  H  HE2  . LYS A 1 20 ? -7.171  -6.074  -5.276  1.00 0.00 ? 20  LYS A HE2  3  
ATOM   2577  H  HE3  . LYS A 1 20 ? -8.878  -6.479  -5.452  1.00 0.00 ? 20  LYS A HE3  3  
ATOM   2578  H  HZ1  . LYS A 1 20 ? -7.467  -6.487  -7.947  1.00 0.00 ? 20  LYS A HZ1  3  
ATOM   2579  H  HZ2  . LYS A 1 20 ? -8.464  -7.672  -7.269  1.00 0.00 ? 20  LYS A HZ2  3  
ATOM   2580  H  HZ3  . LYS A 1 20 ? -6.829  -7.598  -6.841  1.00 0.00 ? 20  LYS A HZ3  3  
ATOM   2581  N  N    . CYS A 1 21 ? -11.987 -2.126  -4.435  1.00 0.00 ? 21  CYS A N    3  
ATOM   2582  C  CA   . CYS A 1 21 ? -12.927 -2.472  -3.376  1.00 0.00 ? 21  CYS A CA   3  
ATOM   2583  C  C    . CYS A 1 21 ? -14.203 -1.641  -3.489  1.00 0.00 ? 21  CYS A C    3  
ATOM   2584  O  O    . CYS A 1 21 ? -15.154 -1.838  -2.732  1.00 0.00 ? 21  CYS A O    3  
ATOM   2585  C  CB   . CYS A 1 21 ? -12.285 -2.256  -2.005  1.00 0.00 ? 21  CYS A CB   3  
ATOM   2586  S  SG   . CYS A 1 21 ? -12.110 -0.505  -1.533  1.00 0.00 ? 21  CYS A SG   3  
ATOM   2587  H  H    . CYS A 1 21 ? -11.501 -1.276  -4.384  1.00 0.00 ? 21  CYS A H    3  
ATOM   2588  H  HA   . CYS A 1 21 ? -13.181 -3.515  -3.485  1.00 0.00 ? 21  CYS A HA   3  
ATOM   2589  H  HB2  . CYS A 1 21 ? -12.891 -2.739  -1.252  1.00 0.00 ? 21  CYS A HB2  3  
ATOM   2590  H  HB3  . CYS A 1 21 ? -11.300 -2.697  -2.004  1.00 0.00 ? 21  CYS A HB3  3  
ATOM   2591  N  N    . HIS A 1 22 ? -14.216 -0.713  -4.441  1.00 0.00 ? 22  HIS A N    3  
ATOM   2592  C  CA   . HIS A 1 22 ? -15.374 0.147   -4.654  1.00 0.00 ? 22  HIS A CA   3  
ATOM   2593  C  C    . HIS A 1 22 ? -15.728 0.908   -3.380  1.00 0.00 ? 22  HIS A C    3  
ATOM   2594  O  O    . HIS A 1 22 ? -16.877 0.899   -2.939  1.00 0.00 ? 22  HIS A O    3  
ATOM   2595  C  CB   . HIS A 1 22 ? -16.573 -0.682  -5.116  1.00 0.00 ? 22  HIS A CB   3  
ATOM   2596  C  CG   . HIS A 1 22 ? -16.487 -1.113  -6.549  1.00 0.00 ? 22  HIS A CG   3  
ATOM   2597  N  ND1  . HIS A 1 22 ? -16.178 -2.401  -6.930  1.00 0.00 ? 22  HIS A ND1  3  
ATOM   2598  C  CD2  . HIS A 1 22 ? -16.674 -0.417  -7.695  1.00 0.00 ? 22  HIS A CD2  3  
ATOM   2599  C  CE1  . HIS A 1 22 ? -16.176 -2.479  -8.249  1.00 0.00 ? 22  HIS A CE1  3  
ATOM   2600  N  NE2  . HIS A 1 22 ? -16.475 -1.289  -8.737  1.00 0.00 ? 22  HIS A NE2  3  
ATOM   2601  H  H    . HIS A 1 22 ? -13.428 -0.605  -5.013  1.00 0.00 ? 22  HIS A H    3  
ATOM   2602  H  HA   . HIS A 1 22 ? -15.121 0.859   -5.425  1.00 0.00 ? 22  HIS A HA   3  
ATOM   2603  H  HB2  . HIS A 1 22 ? -16.644 -1.571  -4.507  1.00 0.00 ? 22  HIS A HB2  3  
ATOM   2604  H  HB3  . HIS A 1 22 ? -17.474 -0.098  -4.998  1.00 0.00 ? 22  HIS A HB3  3  
ATOM   2605  H  HD1  . HIS A 1 22 ? -15.986 -3.147  -6.324  1.00 0.00 ? 22  HIS A HD1  3  
ATOM   2606  H  HD2  . HIS A 1 22 ? -16.932 0.630   -7.776  1.00 0.00 ? 22  HIS A HD2  3  
ATOM   2607  H  HE1  . HIS A 1 22 ? -15.967 -3.365  -8.829  1.00 0.00 ? 22  HIS A HE1  3  
ATOM   2608  N  N    . ALA A 1 23 ? -14.733 1.565   -2.793  1.00 0.00 ? 23  ALA A N    3  
ATOM   2609  C  CA   . ALA A 1 23 ? -14.939 2.331   -1.571  1.00 0.00 ? 23  ALA A CA   3  
ATOM   2610  C  C    . ALA A 1 23 ? -14.239 3.684   -1.646  1.00 0.00 ? 23  ALA A C    3  
ATOM   2611  O  O    . ALA A 1 23 ? -13.092 3.776   -2.085  1.00 0.00 ? 23  ALA A O    3  
ATOM   2612  C  CB   . ALA A 1 23 ? -14.446 1.546   -0.365  1.00 0.00 ? 23  ALA A CB   3  
ATOM   2613  H  H    . ALA A 1 23 ? -13.839 1.534   -3.193  1.00 0.00 ? 23  ALA A H    3  
ATOM   2614  H  HA   . ALA A 1 23 ? -16.001 2.493   -1.454  1.00 0.00 ? 23  ALA A HA   3  
ATOM   2615  H  HB1  . ALA A 1 23 ? -14.814 0.531   -0.422  1.00 0.00 ? 23  ALA A HB1  3  
ATOM   2616  H  HB2  . ALA A 1 23 ? -13.366 1.537   -0.359  1.00 0.00 ? 23  ALA A HB2  3  
ATOM   2617  H  HB3  . ALA A 1 23 ? -14.808 2.010   0.540   1.00 0.00 ? 23  ALA A HB3  3  
ATOM   2618  N  N    . ILE A 1 24 ? -14.936 4.730   -1.217  1.00 0.00 ? 24  ILE A N    3  
ATOM   2619  C  CA   . ILE A 1 24 ? -14.380 6.078   -1.236  1.00 0.00 ? 24  ILE A CA   3  
ATOM   2620  C  C    . ILE A 1 24 ? -13.014 6.118   -0.557  1.00 0.00 ? 24  ILE A C    3  
ATOM   2621  O  O    . ILE A 1 24 ? -12.834 5.572   0.531   1.00 0.00 ? 24  ILE A O    3  
ATOM   2622  C  CB   . ILE A 1 24 ? -15.316 7.083   -0.540  1.00 0.00 ? 24  ILE A CB   3  
ATOM   2623  C  CG1  . ILE A 1 24 ? -16.503 7.419   -1.445  1.00 0.00 ? 24  ILE A CG1  3  
ATOM   2624  C  CG2  . ILE A 1 24 ? -14.554 8.346   -0.166  1.00 0.00 ? 24  ILE A CG2  3  
ATOM   2625  C  CD1  . ILE A 1 24 ? -17.393 8.510   -0.894  1.00 0.00 ? 24  ILE A CD1  3  
ATOM   2626  H  H    . ILE A 1 24 ? -15.845 4.593   -0.878  1.00 0.00 ? 24  ILE A H    3  
ATOM   2627  H  HA   . ILE A 1 24 ? -14.266 6.377   -2.268  1.00 0.00 ? 24  ILE A HA   3  
ATOM   2628  H  HB   . ILE A 1 24 ? -15.682 6.630   0.369   1.00 0.00 ? 24  ILE A HB   3  
ATOM   2629  H  HG12 . ILE A 1 24 ? -16.135 7.745   -2.405  1.00 0.00 ? 24  ILE A HG12 3  
ATOM   2630  H  HG13 . ILE A 1 24 ? -17.107 6.532   -1.578  1.00 0.00 ? 24  ILE A HG13 3  
ATOM   2631  H  HG21 . ILE A 1 24 ? -13.744 8.497   -0.865  1.00 0.00 ? 24  ILE A HG21 3  
ATOM   2632  H  HG22 . ILE A 1 24 ? -15.222 9.193   -0.203  1.00 0.00 ? 24  ILE A HG22 3  
ATOM   2633  H  HG23 . ILE A 1 24 ? -14.155 8.244   0.832   1.00 0.00 ? 24  ILE A HG23 3  
ATOM   2634  H  HD11 . ILE A 1 24 ? -17.234 8.603   0.170   1.00 0.00 ? 24  ILE A HD11 3  
ATOM   2635  H  HD12 . ILE A 1 24 ? -17.157 9.446   -1.377  1.00 0.00 ? 24  ILE A HD12 3  
ATOM   2636  H  HD13 . ILE A 1 24 ? -18.428 8.260   -1.082  1.00 0.00 ? 24  ILE A HD13 3  
ATOM   2637  N  N    . ILE A 1 25 ? -12.056 6.770   -1.207  1.00 0.00 ? 25  ILE A N    3  
ATOM   2638  C  CA   . ILE A 1 25 ? -10.708 6.885   -0.666  1.00 0.00 ? 25  ILE A CA   3  
ATOM   2639  C  C    . ILE A 1 25 ? -10.514 8.219   0.047   1.00 0.00 ? 25  ILE A C    3  
ATOM   2640  O  O    . ILE A 1 25 ? -9.983  9.170   -0.528  1.00 0.00 ? 25  ILE A O    3  
ATOM   2641  C  CB   . ILE A 1 25 ? -9.644  6.746   -1.770  1.00 0.00 ? 25  ILE A CB   3  
ATOM   2642  C  CG1  . ILE A 1 25 ? -9.830  5.428   -2.525  1.00 0.00 ? 25  ILE A CG1  3  
ATOM   2643  C  CG2  . ILE A 1 25 ? -8.247  6.827   -1.173  1.00 0.00 ? 25  ILE A CG2  3  
ATOM   2644  C  CD1  . ILE A 1 25 ? -9.354  5.481   -3.960  1.00 0.00 ? 25  ILE A CD1  3  
ATOM   2645  H  H    . ILE A 1 25 ? -12.261 7.185   -2.071  1.00 0.00 ? 25  ILE A H    3  
ATOM   2646  H  HA   . ILE A 1 25 ? -10.566 6.085   0.047   1.00 0.00 ? 25  ILE A HA   3  
ATOM   2647  H  HB   . ILE A 1 25 ? -9.763  7.567   -2.459  1.00 0.00 ? 25  ILE A HB   3  
ATOM   2648  H  HG12 . ILE A 1 25 ? -9.278  4.650   -2.021  1.00 0.00 ? 25  ILE A HG12 3  
ATOM   2649  H  HG13 . ILE A 1 25 ? -10.880 5.171   -2.532  1.00 0.00 ? 25  ILE A HG13 3  
ATOM   2650  H  HG21 . ILE A 1 25 ? -7.711  7.649   -1.622  1.00 0.00 ? 25  ILE A HG21 3  
ATOM   2651  H  HG22 . ILE A 1 25 ? -8.320  6.986   -0.107  1.00 0.00 ? 25  ILE A HG22 3  
ATOM   2652  H  HG23 . ILE A 1 25 ? -7.719  5.905   -1.364  1.00 0.00 ? 25  ILE A HG23 3  
ATOM   2653  H  HD11 . ILE A 1 25 ? -9.764  4.644   -4.506  1.00 0.00 ? 25  ILE A HD11 3  
ATOM   2654  H  HD12 . ILE A 1 25 ? -9.680  6.404   -4.414  1.00 0.00 ? 25  ILE A HD12 3  
ATOM   2655  H  HD13 . ILE A 1 25 ? -8.275  5.430   -3.982  1.00 0.00 ? 25  ILE A HD13 3  
ATOM   2656  N  N    . ASP A 1 26 ? -10.945 8.282   1.302   1.00 0.00 ? 26  ASP A N    3  
ATOM   2657  C  CA   . ASP A 1 26 ? -10.816 9.499   2.095   1.00 0.00 ? 26  ASP A CA   3  
ATOM   2658  C  C    . ASP A 1 26 ? -9.415  10.089  1.961   1.00 0.00 ? 26  ASP A C    3  
ATOM   2659  O  O    . ASP A 1 26 ? -9.256  11.274  1.668   1.00 0.00 ? 26  ASP A O    3  
ATOM   2660  C  CB   . ASP A 1 26 ? -11.122 9.210   3.565   1.00 0.00 ? 26  ASP A CB   3  
ATOM   2661  C  CG   . ASP A 1 26 ? -12.186 8.143   3.736   1.00 0.00 ? 26  ASP A CG   3  
ATOM   2662  O  OD1  . ASP A 1 26 ? -11.870 6.952   3.534   1.00 0.00 ? 26  ASP A OD1  3  
ATOM   2663  O  OD2  . ASP A 1 26 ? -13.334 8.500   4.073   1.00 0.00 ? 26  ASP A OD2  3  
ATOM   2664  H  H    . ASP A 1 26 ? -11.360 7.490   1.705   1.00 0.00 ? 26  ASP A H    3  
ATOM   2665  H  HA   . ASP A 1 26 ? -11.532 10.216  1.722   1.00 0.00 ? 26  ASP A HA   3  
ATOM   2666  H  HB2  . ASP A 1 26 ? -10.220 8.874   4.055   1.00 0.00 ? 26  ASP A HB2  3  
ATOM   2667  H  HB3  . ASP A 1 26 ? -11.467 10.117  4.039   1.00 0.00 ? 26  ASP A HB3  3  
ATOM   2668  N  N    . GLU A 1 27 ? -8.404  9.254   2.177   1.00 0.00 ? 27  GLU A N    3  
ATOM   2669  C  CA   . GLU A 1 27 ? -7.017  9.695   2.082   1.00 0.00 ? 27  GLU A CA   3  
ATOM   2670  C  C    . GLU A 1 27 ? -6.552  9.719   0.629   1.00 0.00 ? 27  GLU A C    3  
ATOM   2671  O  O    . GLU A 1 27 ? -7.303  9.363   -0.279  1.00 0.00 ? 27  GLU A O    3  
ATOM   2672  C  CB   . GLU A 1 27 ? -6.109  8.777   2.904   1.00 0.00 ? 27  GLU A CB   3  
ATOM   2673  C  CG   . GLU A 1 27 ? -6.133  7.328   2.445   1.00 0.00 ? 27  GLU A CG   3  
ATOM   2674  C  CD   . GLU A 1 27 ? -4.928  6.544   2.927   1.00 0.00 ? 27  GLU A CD   3  
ATOM   2675  O  OE1  . GLU A 1 27 ? -3.796  7.053   2.789   1.00 0.00 ? 27  GLU A OE1  3  
ATOM   2676  O  OE2  . GLU A 1 27 ? -5.116  5.422   3.442   1.00 0.00 ? 27  GLU A OE2  3  
ATOM   2677  H  H    . GLU A 1 27 ? -8.594  8.321   2.407   1.00 0.00 ? 27  GLU A H    3  
ATOM   2678  H  HA   . GLU A 1 27 ? -6.958  10.695  2.482   1.00 0.00 ? 27  GLU A HA   3  
ATOM   2679  H  HB2  . GLU A 1 27 ? -5.094  9.139   2.835   1.00 0.00 ? 27  GLU A HB2  3  
ATOM   2680  H  HB3  . GLU A 1 27 ? -6.424  8.810   3.936   1.00 0.00 ? 27  GLU A HB3  3  
ATOM   2681  H  HG2  . GLU A 1 27 ? -7.026  6.857   2.828   1.00 0.00 ? 27  GLU A HG2  3  
ATOM   2682  H  HG3  . GLU A 1 27 ? -6.150  7.306   1.365   1.00 0.00 ? 27  GLU A HG3  3  
ATOM   2683  N  N    . GLN A 1 28 ? -5.310  10.142  0.418   1.00 0.00 ? 28  GLN A N    3  
ATOM   2684  C  CA   . GLN A 1 28 ? -4.746  10.214  -0.925  1.00 0.00 ? 28  GLN A CA   3  
ATOM   2685  C  C    . GLN A 1 28 ? -4.909  8.886   -1.656  1.00 0.00 ? 28  GLN A C    3  
ATOM   2686  O  O    . GLN A 1 28 ? -4.271  7.885   -1.327  1.00 0.00 ? 28  GLN A O    3  
ATOM   2687  C  CB   . GLN A 1 28 ? -3.266  10.595  -0.859  1.00 0.00 ? 28  GLN A CB   3  
ATOM   2688  C  CG   . GLN A 1 28 ? -2.771  11.331  -2.094  1.00 0.00 ? 28  GLN A CG   3  
ATOM   2689  C  CD   . GLN A 1 28 ? -2.807  10.468  -3.340  1.00 0.00 ? 28  GLN A CD   3  
ATOM   2690  O  OE1  . GLN A 1 28 ? -3.824  10.395  -4.030  1.00 0.00 ? 28  GLN A OE1  3  
ATOM   2691  N  NE2  . GLN A 1 28 ? -1.693  9.808   -3.636  1.00 0.00 ? 28  GLN A NE2  3  
ATOM   2692  H  H    . GLN A 1 28 ? -4.761  10.412  1.182   1.00 0.00 ? 28  GLN A H    3  
ATOM   2693  H  HA   . GLN A 1 28 ? -5.281  10.978  -1.469  1.00 0.00 ? 28  GLN A HA   3  
ATOM   2694  H  HB2  . GLN A 1 28 ? -3.108  11.231  -0.001  1.00 0.00 ? 28  GLN A HB2  3  
ATOM   2695  H  HB3  . GLN A 1 28 ? -2.679  9.696   -0.744  1.00 0.00 ? 28  GLN A HB3  3  
ATOM   2696  H  HG2  . GLN A 1 28 ? -3.397  12.196  -2.257  1.00 0.00 ? 28  GLN A HG2  3  
ATOM   2697  H  HG3  . GLN A 1 28 ? -1.754  11.650  -1.924  1.00 0.00 ? 28  GLN A HG3  3  
ATOM   2698  H  HE21 . GLN A 1 28 ? -0.921  9.914   -3.040  1.00 0.00 ? 28  GLN A HE21 3  
ATOM   2699  H  HE22 . GLN A 1 28 ? -1.688  9.243   -4.435  1.00 0.00 ? 28  GLN A HE22 3  
ATOM   2700  N  N    . PRO A 1 29 ? -5.784  8.873   -2.673  1.00 0.00 ? 29  PRO A N    3  
ATOM   2701  C  CA   . PRO A 1 29 ? -6.051  7.673   -3.472  1.00 0.00 ? 29  PRO A CA   3  
ATOM   2702  C  C    . PRO A 1 29 ? -4.869  7.290   -4.355  1.00 0.00 ? 29  PRO A C    3  
ATOM   2703  O  O    . PRO A 1 29 ? -4.328  8.124   -5.083  1.00 0.00 ? 29  PRO A O    3  
ATOM   2704  C  CB   . PRO A 1 29 ? -7.251  8.079   -4.331  1.00 0.00 ? 29  PRO A CB   3  
ATOM   2705  C  CG   . PRO A 1 29 ? -7.164  9.563   -4.426  1.00 0.00 ? 29  PRO A CG   3  
ATOM   2706  C  CD   . PRO A 1 29 ? -6.579  10.028  -3.121  1.00 0.00 ? 29  PRO A CD   3  
ATOM   2707  H  HA   . PRO A 1 29 ? -6.320  6.833   -2.848  1.00 0.00 ? 29  PRO A HA   3  
ATOM   2708  H  HB2  . PRO A 1 29 ? -7.174  7.615   -5.304  1.00 0.00 ? 29  PRO A HB2  3  
ATOM   2709  H  HB3  . PRO A 1 29 ? -8.165  7.768   -3.849  1.00 0.00 ? 29  PRO A HB3  3  
ATOM   2710  H  HG2  . PRO A 1 29 ? -6.520  9.842   -5.246  1.00 0.00 ? 29  PRO A HG2  3  
ATOM   2711  H  HG3  . PRO A 1 29 ? -8.151  9.981   -4.563  1.00 0.00 ? 29  PRO A HG3  3  
ATOM   2712  H  HD2  . PRO A 1 29 ? -5.950  10.892  -3.276  1.00 0.00 ? 29  PRO A HD2  3  
ATOM   2713  H  HD3  . PRO A 1 29 ? -7.364  10.252  -2.414  1.00 0.00 ? 29  PRO A HD3  3  
ATOM   2714  N  N    . LEU A 1 30 ? -4.472  6.024   -4.288  1.00 0.00 ? 30  LEU A N    3  
ATOM   2715  C  CA   . LEU A 1 30 ? -3.353  5.530   -5.083  1.00 0.00 ? 30  LEU A CA   3  
ATOM   2716  C  C    . LEU A 1 30 ? -3.739  5.414   -6.554  1.00 0.00 ? 30  LEU A C    3  
ATOM   2717  O  O    . LEU A 1 30 ? -4.666  4.684   -6.907  1.00 0.00 ? 30  LEU A O    3  
ATOM   2718  C  CB   . LEU A 1 30 ? -2.889  4.171   -4.557  1.00 0.00 ? 30  LEU A CB   3  
ATOM   2719  C  CG   . LEU A 1 30 ? -2.177  3.268   -5.565  1.00 0.00 ? 30  LEU A CG   3  
ATOM   2720  C  CD1  . LEU A 1 30 ? -0.747  3.736   -5.784  1.00 0.00 ? 30  LEU A CD1  3  
ATOM   2721  C  CD2  . LEU A 1 30 ? -2.200  1.821   -5.095  1.00 0.00 ? 30  LEU A CD2  3  
ATOM   2722  H  H    . LEU A 1 30 ? -4.941  5.406   -3.690  1.00 0.00 ? 30  LEU A H    3  
ATOM   2723  H  HA   . LEU A 1 30 ? -2.543  6.238   -4.991  1.00 0.00 ? 30  LEU A HA   3  
ATOM   2724  H  HB2  . LEU A 1 30 ? -2.211  4.347   -3.736  1.00 0.00 ? 30  LEU A HB2  3  
ATOM   2725  H  HB3  . LEU A 1 30 ? -3.760  3.642   -4.196  1.00 0.00 ? 30  LEU A HB3  3  
ATOM   2726  H  HG   . LEU A 1 30 ? -2.694  3.321   -6.514  1.00 0.00 ? 30  LEU A HG   3  
ATOM   2727  H  HD11 . LEU A 1 30 ? -0.264  3.878   -4.829  1.00 0.00 ? 30  LEU A HD11 3  
ATOM   2728  H  HD12 . LEU A 1 30 ? -0.753  4.670   -6.326  1.00 0.00 ? 30  LEU A HD12 3  
ATOM   2729  H  HD13 . LEU A 1 30 ? -0.208  2.993   -6.354  1.00 0.00 ? 30  LEU A HD13 3  
ATOM   2730  H  HD21 . LEU A 1 30 ? -1.790  1.760   -4.098  1.00 0.00 ? 30  LEU A HD21 3  
ATOM   2731  H  HD22 . LEU A 1 30 ? -1.608  1.215   -5.766  1.00 0.00 ? 30  LEU A HD22 3  
ATOM   2732  H  HD23 . LEU A 1 30 ? -3.218  1.461   -5.089  1.00 0.00 ? 30  LEU A HD23 3  
ATOM   2733  N  N    . ILE A 1 31 ? -3.022  6.137   -7.407  1.00 0.00 ? 31  ILE A N    3  
ATOM   2734  C  CA   . ILE A 1 31 ? -3.288  6.112   -8.840  1.00 0.00 ? 31  ILE A CA   3  
ATOM   2735  C  C    . ILE A 1 31 ? -2.437  5.058   -9.539  1.00 0.00 ? 31  ILE A C    3  
ATOM   2736  O  O    . ILE A 1 31 ? -1.225  4.985   -9.332  1.00 0.00 ? 31  ILE A O    3  
ATOM   2737  C  CB   . ILE A 1 31 ? -3.019  7.484   -9.487  1.00 0.00 ? 31  ILE A CB   3  
ATOM   2738  C  CG1  . ILE A 1 31 ? -3.932  8.549   -8.875  1.00 0.00 ? 31  ILE A CG1  3  
ATOM   2739  C  CG2  . ILE A 1 31 ? -3.220  7.409   -10.993 1.00 0.00 ? 31  ILE A CG2  3  
ATOM   2740  C  CD1  . ILE A 1 31 ? -5.403  8.299   -9.124  1.00 0.00 ? 31  ILE A CD1  3  
ATOM   2741  H  H    . ILE A 1 31 ? -2.297  6.700   -7.066  1.00 0.00 ? 31  ILE A H    3  
ATOM   2742  H  HA   . ILE A 1 31 ? -4.331  5.869   -8.981  1.00 0.00 ? 31  ILE A HA   3  
ATOM   2743  H  HB   . ILE A 1 31 ? -1.991  7.751   -9.298  1.00 0.00 ? 31  ILE A HB   3  
ATOM   2744  H  HG12 . ILE A 1 31 ? -3.778  8.576   -7.808  1.00 0.00 ? 31  ILE A HG12 3  
ATOM   2745  H  HG13 . ILE A 1 31 ? -3.682  9.512   -9.296  1.00 0.00 ? 31  ILE A HG13 3  
ATOM   2746  H  HG21 . ILE A 1 31 ? -4.193  6.991   -11.206 1.00 0.00 ? 31  ILE A HG21 3  
ATOM   2747  H  HG22 . ILE A 1 31 ? -3.156  8.401   -11.414 1.00 0.00 ? 31  ILE A HG22 3  
ATOM   2748  H  HG23 . ILE A 1 31 ? -2.456  6.782   -11.427 1.00 0.00 ? 31  ILE A HG23 3  
ATOM   2749  H  HD11 . ILE A 1 31 ? -5.912  8.170   -8.180  1.00 0.00 ? 31  ILE A HD11 3  
ATOM   2750  H  HD12 . ILE A 1 31 ? -5.828  9.140   -9.651  1.00 0.00 ? 31  ILE A HD12 3  
ATOM   2751  H  HD13 . ILE A 1 31 ? -5.520  7.405   -9.720  1.00 0.00 ? 31  ILE A HD13 3  
ATOM   2752  N  N    . PHE A 1 32 ? -3.078  4.243   -10.370 1.00 0.00 ? 32  PHE A N    3  
ATOM   2753  C  CA   . PHE A 1 32 ? -2.380  3.192   -11.102 1.00 0.00 ? 32  PHE A CA   3  
ATOM   2754  C  C    . PHE A 1 32 ? -3.116  2.847   -12.393 1.00 0.00 ? 32  PHE A C    3  
ATOM   2755  O  O    . PHE A 1 32 ? -4.313  2.557   -12.381 1.00 0.00 ? 32  PHE A O    3  
ATOM   2756  C  CB   . PHE A 1 32 ? -2.241  1.942   -10.231 1.00 0.00 ? 32  PHE A CB   3  
ATOM   2757  C  CG   . PHE A 1 32 ? -1.514  0.816   -10.910 1.00 0.00 ? 32  PHE A CG   3  
ATOM   2758  C  CD1  . PHE A 1 32 ? -0.214  0.984   -11.359 1.00 0.00 ? 32  PHE A CD1  3  
ATOM   2759  C  CD2  . PHE A 1 32 ? -2.131  -0.410  -11.099 1.00 0.00 ? 32  PHE A CD2  3  
ATOM   2760  C  CE1  . PHE A 1 32 ? 0.456   -0.050  -11.986 1.00 0.00 ? 32  PHE A CE1  3  
ATOM   2761  C  CE2  . PHE A 1 32 ? -1.466  -1.448  -11.725 1.00 0.00 ? 32  PHE A CE2  3  
ATOM   2762  C  CZ   . PHE A 1 32 ? -0.170  -1.267  -12.167 1.00 0.00 ? 32  PHE A CZ   3  
ATOM   2763  H  H    . PHE A 1 32 ? -4.045  4.351   -10.494 1.00 0.00 ? 32  PHE A H    3  
ATOM   2764  H  HA   . PHE A 1 32 ? -1.396  3.560   -11.349 1.00 0.00 ? 32  PHE A HA   3  
ATOM   2765  H  HB2  . PHE A 1 32 ? -1.695  2.195   -9.335  1.00 0.00 ? 32  PHE A HB2  3  
ATOM   2766  H  HB3  . PHE A 1 32 ? -3.224  1.589   -9.961  1.00 0.00 ? 32  PHE A HB3  3  
ATOM   2767  H  HD1  . PHE A 1 32 ? 0.277   1.935   -11.217 1.00 0.00 ? 32  PHE A HD1  3  
ATOM   2768  H  HD2  . PHE A 1 32 ? -3.146  -0.552  -10.753 1.00 0.00 ? 32  PHE A HD2  3  
ATOM   2769  H  HE1  . PHE A 1 32 ? 1.469   0.094   -12.330 1.00 0.00 ? 32  PHE A HE1  3  
ATOM   2770  H  HE2  . PHE A 1 32 ? -1.959  -2.398  -11.865 1.00 0.00 ? 32  PHE A HE2  3  
ATOM   2771  H  HZ   . PHE A 1 32 ? 0.351   -2.076  -12.657 1.00 0.00 ? 32  PHE A HZ   3  
ATOM   2772  N  N    . LYS A 1 33 ? -2.392  2.881   -13.507 1.00 0.00 ? 33  LYS A N    3  
ATOM   2773  C  CA   . LYS A 1 33 ? -2.974  2.572   -14.807 1.00 0.00 ? 33  LYS A CA   3  
ATOM   2774  C  C    . LYS A 1 33 ? -4.178  3.465   -15.092 1.00 0.00 ? 33  LYS A C    3  
ATOM   2775  O  O    . LYS A 1 33 ? -5.158  3.028   -15.691 1.00 0.00 ? 33  LYS A O    3  
ATOM   2776  C  CB   . LYS A 1 33 ? -3.392  1.101   -14.866 1.00 0.00 ? 33  LYS A CB   3  
ATOM   2777  C  CG   . LYS A 1 33 ? -2.227  0.133   -14.754 1.00 0.00 ? 33  LYS A CG   3  
ATOM   2778  C  CD   . LYS A 1 33 ? -2.605  -1.254  -15.244 1.00 0.00 ? 33  LYS A CD   3  
ATOM   2779  C  CE   . LYS A 1 33 ? -1.376  -2.123  -15.462 1.00 0.00 ? 33  LYS A CE   3  
ATOM   2780  N  NZ   . LYS A 1 33 ? -1.723  -3.428  -16.090 1.00 0.00 ? 33  LYS A NZ   3  
ATOM   2781  H  H    . LYS A 1 33 ? -1.443  3.120   -13.452 1.00 0.00 ? 33  LYS A H    3  
ATOM   2782  H  HA   . LYS A 1 33 ? -2.221  2.754   -15.559 1.00 0.00 ? 33  LYS A HA   3  
ATOM   2783  H  HB2  . LYS A 1 33 ? -4.077  0.902   -14.055 1.00 0.00 ? 33  LYS A HB2  3  
ATOM   2784  H  HB3  . LYS A 1 33 ? -3.895  0.919   -15.804 1.00 0.00 ? 33  LYS A HB3  3  
ATOM   2785  H  HG2  . LYS A 1 33 ? -1.405  0.502   -15.349 1.00 0.00 ? 33  LYS A HG2  3  
ATOM   2786  H  HG3  . LYS A 1 33 ? -1.922  0.068   -13.719 1.00 0.00 ? 33  LYS A HG3  3  
ATOM   2787  H  HD2  . LYS A 1 33 ? -3.240  -1.726  -14.509 1.00 0.00 ? 33  LYS A HD2  3  
ATOM   2788  H  HD3  . LYS A 1 33 ? -3.140  -1.162  -16.179 1.00 0.00 ? 33  LYS A HD3  3  
ATOM   2789  H  HE2  . LYS A 1 33 ? -0.688  -1.596  -16.105 1.00 0.00 ? 33  LYS A HE2  3  
ATOM   2790  H  HE3  . LYS A 1 33 ? -0.907  -2.306  -14.506 1.00 0.00 ? 33  LYS A HE3  3  
ATOM   2791  H  HZ1  . LYS A 1 33 ? -2.362  -3.277  -16.896 1.00 0.00 ? 33  LYS A HZ1  3  
ATOM   2792  H  HZ2  . LYS A 1 33 ? -2.197  -4.043  -15.397 1.00 0.00 ? 33  LYS A HZ2  3  
ATOM   2793  H  HZ3  . LYS A 1 33 ? -0.862  -3.903  -16.427 1.00 0.00 ? 33  LYS A HZ3  3  
ATOM   2794  N  N    . ASN A 1 34 ? -4.094  4.718   -14.658 1.00 0.00 ? 34  ASN A N    3  
ATOM   2795  C  CA   . ASN A 1 34 ? -5.177  5.673   -14.866 1.00 0.00 ? 34  ASN A CA   3  
ATOM   2796  C  C    . ASN A 1 34 ? -6.446  5.222   -14.150 1.00 0.00 ? 34  ASN A C    3  
ATOM   2797  O  O    . ASN A 1 34 ? -7.522  5.167   -14.746 1.00 0.00 ? 34  ASN A O    3  
ATOM   2798  C  CB   . ASN A 1 34 ? -5.455  5.841   -16.362 1.00 0.00 ? 34  ASN A CB   3  
ATOM   2799  C  CG   . ASN A 1 34 ? -4.404  6.688   -17.053 1.00 0.00 ? 34  ASN A CG   3  
ATOM   2800  O  OD1  . ASN A 1 34 ? -3.759  7.530   -16.428 1.00 0.00 ? 34  ASN A OD1  3  
ATOM   2801  N  ND2  . ASN A 1 34 ? -4.227  6.467   -18.351 1.00 0.00 ? 34  ASN A ND2  3  
ATOM   2802  H  H    . ASN A 1 34 ? -3.286  5.009   -14.185 1.00 0.00 ? 34  ASN A H    3  
ATOM   2803  H  HA   . ASN A 1 34 ? -4.865  6.622   -14.458 1.00 0.00 ? 34  ASN A HA   3  
ATOM   2804  H  HB2  . ASN A 1 34 ? -5.471  4.868   -16.830 1.00 0.00 ? 34  ASN A HB2  3  
ATOM   2805  H  HB3  . ASN A 1 34 ? -6.416  6.315   -16.492 1.00 0.00 ? 34  ASN A HB3  3  
ATOM   2806  H  HD21 . ASN A 1 34 ? -4.776  5.780   -18.783 1.00 0.00 ? 34  ASN A HD21 3  
ATOM   2807  H  HD22 . ASN A 1 34 ? -3.553  7.000   -18.823 1.00 0.00 ? 34  ASN A HD22 3  
ATOM   2808  N  N    . ASP A 1 35 ? -6.312  4.901   -12.868 1.00 0.00 ? 35  ASP A N    3  
ATOM   2809  C  CA   . ASP A 1 35 ? -7.448  4.456   -12.068 1.00 0.00 ? 35  ASP A CA   3  
ATOM   2810  C  C    . ASP A 1 35 ? -7.138  4.562   -10.578 1.00 0.00 ? 35  ASP A C    3  
ATOM   2811  O  O    . ASP A 1 35 ? -6.041  4.237   -10.123 1.00 0.00 ? 35  ASP A O    3  
ATOM   2812  C  CB   . ASP A 1 35 ? -7.816  3.015   -12.424 1.00 0.00 ? 35  ASP A CB   3  
ATOM   2813  C  CG   . ASP A 1 35 ? -8.213  2.862   -13.879 1.00 0.00 ? 35  ASP A CG   3  
ATOM   2814  O  OD1  . ASP A 1 35 ? -9.346  3.253   -14.229 1.00 0.00 ? 35  ASP A OD1  3  
ATOM   2815  O  OD2  . ASP A 1 35 ? -7.391  2.350   -14.668 1.00 0.00 ? 35  ASP A OD2  3  
ATOM   2816  H  H    . ASP A 1 35 ? -5.428  4.966   -12.448 1.00 0.00 ? 35  ASP A H    3  
ATOM   2817  H  HA   . ASP A 1 35 ? -8.285  5.099   -12.295 1.00 0.00 ? 35  ASP A HA   3  
ATOM   2818  H  HB2  . ASP A 1 35 ? -6.967  2.375   -12.233 1.00 0.00 ? 35  ASP A HB2  3  
ATOM   2819  H  HB3  . ASP A 1 35 ? -8.645  2.700   -11.808 1.00 0.00 ? 35  ASP A HB3  3  
ATOM   2820  N  N    . PRO A 1 36 ? -8.126  5.027   -9.799  1.00 0.00 ? 36  PRO A N    3  
ATOM   2821  C  CA   . PRO A 1 36 ? -7.982  5.187   -8.349  1.00 0.00 ? 36  PRO A CA   3  
ATOM   2822  C  C    . PRO A 1 36 ? -7.908  3.848   -7.623  1.00 0.00 ? 36  PRO A C    3  
ATOM   2823  O  O    . PRO A 1 36 ? -8.563  2.882   -8.015  1.00 0.00 ? 36  PRO A O    3  
ATOM   2824  C  CB   . PRO A 1 36 ? -9.251  5.944   -7.949  1.00 0.00 ? 36  PRO A CB   3  
ATOM   2825  C  CG   . PRO A 1 36 ? -10.245 5.602   -9.004  1.00 0.00 ? 36  PRO A CG   3  
ATOM   2826  C  CD   . PRO A 1 36 ? -9.459  5.433   -10.275 1.00 0.00 ? 36  PRO A CD   3  
ATOM   2827  H  HA   . PRO A 1 36 ? -7.114  5.779   -8.099  1.00 0.00 ? 36  PRO A HA   3  
ATOM   2828  H  HB2  . PRO A 1 36 ? -9.579  5.611   -6.973  1.00 0.00 ? 36  PRO A HB2  3  
ATOM   2829  H  HB3  . PRO A 1 36 ? -9.050  7.004   -7.925  1.00 0.00 ? 36  PRO A HB3  3  
ATOM   2830  H  HG2  . PRO A 1 36 ? -10.749 4.681   -8.750  1.00 0.00 ? 36  PRO A HG2  3  
ATOM   2831  H  HG3  . PRO A 1 36 ? -10.959 6.405   -9.109  1.00 0.00 ? 36  PRO A HG3  3  
ATOM   2832  H  HD2  . PRO A 1 36 ? -9.899  4.664   -10.892 1.00 0.00 ? 36  PRO A HD2  3  
ATOM   2833  H  HD3  . PRO A 1 36 ? -9.408  6.368   -10.813 1.00 0.00 ? 36  PRO A HD3  3  
ATOM   2834  N  N    . TYR A 1 37 ? -7.109  3.799   -6.564  1.00 0.00 ? 37  TYR A N    3  
ATOM   2835  C  CA   . TYR A 1 37 ? -6.948  2.577   -5.784  1.00 0.00 ? 37  TYR A CA   3  
ATOM   2836  C  C    . TYR A 1 37 ? -6.425  2.889   -4.385  1.00 0.00 ? 37  TYR A C    3  
ATOM   2837  O  O    . TYR A 1 37 ? -5.956  3.996   -4.117  1.00 0.00 ? 37  TYR A O    3  
ATOM   2838  C  CB   . TYR A 1 37 ? -5.995  1.615   -6.494  1.00 0.00 ? 37  TYR A CB   3  
ATOM   2839  C  CG   . TYR A 1 37 ? -6.485  1.173   -7.855  1.00 0.00 ? 37  TYR A CG   3  
ATOM   2840  C  CD1  . TYR A 1 37 ? -7.656  0.437   -7.989  1.00 0.00 ? 37  TYR A CD1  3  
ATOM   2841  C  CD2  . TYR A 1 37 ? -5.777  1.492   -9.007  1.00 0.00 ? 37  TYR A CD2  3  
ATOM   2842  C  CE1  . TYR A 1 37 ? -8.106  0.030   -9.230  1.00 0.00 ? 37  TYR A CE1  3  
ATOM   2843  C  CE2  . TYR A 1 37 ? -6.221  1.091   -10.252 1.00 0.00 ? 37  TYR A CE2  3  
ATOM   2844  C  CZ   . TYR A 1 37 ? -7.385  0.359   -10.358 1.00 0.00 ? 37  TYR A CZ   3  
ATOM   2845  O  OH   . TYR A 1 37 ? -7.831  -0.043  -11.597 1.00 0.00 ? 37  TYR A OH   3  
ATOM   2846  H  H    . TYR A 1 37 ? -6.613  4.602   -6.300  1.00 0.00 ? 37  TYR A H    3  
ATOM   2847  H  HA   . TYR A 1 37 ? -7.918  2.109   -5.697  1.00 0.00 ? 37  TYR A HA   3  
ATOM   2848  H  HB2  . TYR A 1 37 ? -5.040  2.098   -6.628  1.00 0.00 ? 37  TYR A HB2  3  
ATOM   2849  H  HB3  . TYR A 1 37 ? -5.866  0.732   -5.885  1.00 0.00 ? 37  TYR A HB3  3  
ATOM   2850  H  HD1  . TYR A 1 37 ? -8.218  0.180   -7.102  1.00 0.00 ? 37  TYR A HD1  3  
ATOM   2851  H  HD2  . TYR A 1 37 ? -4.865  2.065   -8.921  1.00 0.00 ? 37  TYR A HD2  3  
ATOM   2852  H  HE1  . TYR A 1 37 ? -9.018  -0.542  -9.313  1.00 0.00 ? 37  TYR A HE1  3  
ATOM   2853  H  HE2  . TYR A 1 37 ? -5.657  1.348   -11.137 1.00 0.00 ? 37  TYR A HE2  3  
ATOM   2854  H  HH   . TYR A 1 37 ? -7.618  -0.970  -11.728 1.00 0.00 ? 37  TYR A HH   3  
ATOM   2855  N  N    . HIS A 1 38 ? -6.507  1.904   -3.496  1.00 0.00 ? 38  HIS A N    3  
ATOM   2856  C  CA   . HIS A 1 38 ? -6.041  2.071   -2.124  1.00 0.00 ? 38  HIS A CA   3  
ATOM   2857  C  C    . HIS A 1 38 ? -4.584  1.640   -1.990  1.00 0.00 ? 38  HIS A C    3  
ATOM   2858  O  O    . HIS A 1 38 ? -4.193  0.549   -2.405  1.00 0.00 ? 38  HIS A O    3  
ATOM   2859  C  CB   . HIS A 1 38 ? -6.915  1.262   -1.164  1.00 0.00 ? 38  HIS A CB   3  
ATOM   2860  C  CG   . HIS A 1 38 ? -8.230  1.911   -0.862  1.00 0.00 ? 38  HIS A CG   3  
ATOM   2861  N  ND1  . HIS A 1 38 ? -9.443  1.325   -1.158  1.00 0.00 ? 38  HIS A ND1  3  
ATOM   2862  C  CD2  . HIS A 1 38 ? -8.519  3.100   -0.285  1.00 0.00 ? 38  HIS A CD2  3  
ATOM   2863  C  CE1  . HIS A 1 38 ? -10.422 2.128   -0.778  1.00 0.00 ? 38  HIS A CE1  3  
ATOM   2864  N  NE2  . HIS A 1 38 ? -9.888  3.211   -0.244  1.00 0.00 ? 38  HIS A NE2  3  
ATOM   2865  H  H    . HIS A 1 38 ? -6.891  1.044   -3.770  1.00 0.00 ? 38  HIS A H    3  
ATOM   2866  H  HA   . HIS A 1 38 ? -6.119  3.117   -1.873  1.00 0.00 ? 38  HIS A HA   3  
ATOM   2867  H  HB2  . HIS A 1 38 ? -7.115  0.294   -1.599  1.00 0.00 ? 38  HIS A HB2  3  
ATOM   2868  H  HB3  . HIS A 1 38 ? -6.386  1.131   -0.231  1.00 0.00 ? 38  HIS A HB3  3  
ATOM   2869  H  HD2  . HIS A 1 38 ? -7.807  3.828   0.077   1.00 0.00 ? 38  HIS A HD2  3  
ATOM   2870  H  HE1  . HIS A 1 38 ? -11.478 1.931   -0.884  1.00 0.00 ? 38  HIS A HE1  3  
ATOM   2871  H  HE2  . HIS A 1 38 ? -10.387 4.004   0.041   1.00 0.00 ? 38  HIS A HE2  3  
ATOM   2872  N  N    . PRO A 1 39 ? -3.759  2.516   -1.397  1.00 0.00 ? 39  PRO A N    3  
ATOM   2873  C  CA   . PRO A 1 39 ? -2.332  2.248   -1.194  1.00 0.00 ? 39  PRO A CA   3  
ATOM   2874  C  C    . PRO A 1 39 ? -2.089  1.163   -0.151  1.00 0.00 ? 39  PRO A C    3  
ATOM   2875  O  O    . PRO A 1 39 ? -0.944  0.854   0.181   1.00 0.00 ? 39  PRO A O    3  
ATOM   2876  C  CB   . PRO A 1 39 ? -1.785  3.592   -0.706  1.00 0.00 ? 39  PRO A CB   3  
ATOM   2877  C  CG   . PRO A 1 39 ? -2.956  4.276   -0.088  1.00 0.00 ? 39  PRO A CG   3  
ATOM   2878  C  CD   . PRO A 1 39 ? -4.157  3.835   -0.877  1.00 0.00 ? 39  PRO A CD   3  
ATOM   2879  H  HA   . PRO A 1 39 ? -1.845  1.974   -2.118  1.00 0.00 ? 39  PRO A HA   3  
ATOM   2880  H  HB2  . PRO A 1 39 ? -0.999  3.422   0.016   1.00 0.00 ? 39  PRO A HB2  3  
ATOM   2881  H  HB3  . PRO A 1 39 ? -1.398  4.153   -1.543  1.00 0.00 ? 39  PRO A HB3  3  
ATOM   2882  H  HG2  . PRO A 1 39 ? -3.054  3.974   0.944   1.00 0.00 ? 39  PRO A HG2  3  
ATOM   2883  H  HG3  . PRO A 1 39 ? -2.834  5.346   -0.157  1.00 0.00 ? 39  PRO A HG3  3  
ATOM   2884  H  HD2  . PRO A 1 39 ? -5.021  3.753   -0.235  1.00 0.00 ? 39  PRO A HD2  3  
ATOM   2885  H  HD3  . PRO A 1 39 ? -4.350  4.525   -1.686  1.00 0.00 ? 39  PRO A HD3  3  
ATOM   2886  N  N    . ASP A 1 40 ? -3.171  0.589   0.363   1.00 0.00 ? 40  ASP A N    3  
ATOM   2887  C  CA   . ASP A 1 40 ? -3.074  -0.463  1.368   1.00 0.00 ? 40  ASP A CA   3  
ATOM   2888  C  C    . ASP A 1 40 ? -3.475  -1.813  0.781   1.00 0.00 ? 40  ASP A C    3  
ATOM   2889  O  O    . ASP A 1 40 ? -3.429  -2.837  1.464   1.00 0.00 ? 40  ASP A O    3  
ATOM   2890  C  CB   . ASP A 1 40 ? -3.959  -0.132  2.570   1.00 0.00 ? 40  ASP A CB   3  
ATOM   2891  C  CG   . ASP A 1 40 ? -5.395  0.146   2.173   1.00 0.00 ? 40  ASP A CG   3  
ATOM   2892  O  OD1  . ASP A 1 40 ? -6.024  -0.742  1.560   1.00 0.00 ? 40  ASP A OD1  3  
ATOM   2893  O  OD2  . ASP A 1 40 ? -5.891  1.253   2.474   1.00 0.00 ? 40  ASP A OD2  3  
ATOM   2894  H  H    . ASP A 1 40 ? -4.056  0.879   0.058   1.00 0.00 ? 40  ASP A H    3  
ATOM   2895  H  HA   . ASP A 1 40 ? -2.046  -0.518  1.693   1.00 0.00 ? 40  ASP A HA   3  
ATOM   2896  H  HB2  . ASP A 1 40 ? -3.951  -0.967  3.256   1.00 0.00 ? 40  ASP A HB2  3  
ATOM   2897  H  HB3  . ASP A 1 40 ? -3.566  0.742   3.068   1.00 0.00 ? 40  ASP A HB3  3  
ATOM   2898  N  N    . HIS A 1 41 ? -3.870  -1.808  -0.488  1.00 0.00 ? 41  HIS A N    3  
ATOM   2899  C  CA   . HIS A 1 41 ? -4.280  -3.032  -1.167  1.00 0.00 ? 41  HIS A CA   3  
ATOM   2900  C  C    . HIS A 1 41 ? -3.069  -3.785  -1.708  1.00 0.00 ? 41  HIS A C    3  
ATOM   2901  O  O    . HIS A 1 41 ? -2.955  -5.000  -1.542  1.00 0.00 ? 41  HIS A O    3  
ATOM   2902  C  CB   . HIS A 1 41 ? -5.246  -2.709  -2.307  1.00 0.00 ? 41  HIS A CB   3  
ATOM   2903  C  CG   . HIS A 1 41 ? -6.660  -2.512  -1.856  1.00 0.00 ? 41  HIS A CG   3  
ATOM   2904  N  ND1  . HIS A 1 41 ? -7.159  -3.045  -0.686  1.00 0.00 ? 41  HIS A ND1  3  
ATOM   2905  C  CD2  . HIS A 1 41 ? -7.685  -1.834  -2.425  1.00 0.00 ? 41  HIS A CD2  3  
ATOM   2906  C  CE1  . HIS A 1 41 ? -8.428  -2.705  -0.556  1.00 0.00 ? 41  HIS A CE1  3  
ATOM   2907  N  NE2  . HIS A 1 41 ? -8.772  -1.969  -1.598  1.00 0.00 ? 41  HIS A NE2  3  
ATOM   2908  H  H    . HIS A 1 41 ? -3.885  -0.960  -0.980  1.00 0.00 ? 41  HIS A H    3  
ATOM   2909  H  HA   . HIS A 1 41 ? -4.784  -3.658  -0.446  1.00 0.00 ? 41  HIS A HA   3  
ATOM   2910  H  HB2  . HIS A 1 41 ? -4.924  -1.801  -2.796  1.00 0.00 ? 41  HIS A HB2  3  
ATOM   2911  H  HB3  . HIS A 1 41 ? -5.234  -3.520  -3.021  1.00 0.00 ? 41  HIS A HB3  3  
ATOM   2912  H  HD1  . HIS A 1 41 ? -6.657  -3.592  -0.048  1.00 0.00 ? 41  HIS A HD1  3  
ATOM   2913  H  HD2  . HIS A 1 41 ? -7.653  -1.288  -3.358  1.00 0.00 ? 41  HIS A HD2  3  
ATOM   2914  H  HE1  . HIS A 1 41 ? -9.076  -2.980  0.263   1.00 0.00 ? 41  HIS A HE1  3  
ATOM   2915  N  N    . PHE A 1 42 ? -2.166  -3.056  -2.356  1.00 0.00 ? 42  PHE A N    3  
ATOM   2916  C  CA   . PHE A 1 42 ? -0.964  -3.656  -2.924  1.00 0.00 ? 42  PHE A CA   3  
ATOM   2917  C  C    . PHE A 1 42 ? 0.213   -3.529  -1.961  1.00 0.00 ? 42  PHE A C    3  
ATOM   2918  O  O    . PHE A 1 42 ? 0.095   -2.928  -0.894  1.00 0.00 ? 42  PHE A O    3  
ATOM   2919  C  CB   . PHE A 1 42 ? -0.619  -2.993  -4.259  1.00 0.00 ? 42  PHE A CB   3  
ATOM   2920  C  CG   . PHE A 1 42 ? -1.820  -2.714  -5.117  1.00 0.00 ? 42  PHE A CG   3  
ATOM   2921  C  CD1  . PHE A 1 42 ? -2.509  -1.518  -5.000  1.00 0.00 ? 42  PHE A CD1  3  
ATOM   2922  C  CD2  . PHE A 1 42 ? -2.258  -3.648  -6.042  1.00 0.00 ? 42  PHE A CD2  3  
ATOM   2923  C  CE1  . PHE A 1 42 ? -3.614  -1.259  -5.789  1.00 0.00 ? 42  PHE A CE1  3  
ATOM   2924  C  CE2  . PHE A 1 42 ? -3.363  -3.395  -6.833  1.00 0.00 ? 42  PHE A CE2  3  
ATOM   2925  C  CZ   . PHE A 1 42 ? -4.041  -2.199  -6.707  1.00 0.00 ? 42  PHE A CZ   3  
ATOM   2926  H  H    . PHE A 1 42 ? -2.312  -2.092  -2.456  1.00 0.00 ? 42  PHE A H    3  
ATOM   2927  H  HA   . PHE A 1 42 ? -1.164  -4.702  -3.092  1.00 0.00 ? 42  PHE A HA   3  
ATOM   2928  H  HB2  . PHE A 1 42 ? -0.123  -2.053  -4.068  1.00 0.00 ? 42  PHE A HB2  3  
ATOM   2929  H  HB3  . PHE A 1 42 ? 0.044   -3.640  -4.813  1.00 0.00 ? 42  PHE A HB3  3  
ATOM   2930  H  HD1  . PHE A 1 42 ? -2.176  -0.782  -4.283  1.00 0.00 ? 42  PHE A HD1  3  
ATOM   2931  H  HD2  . PHE A 1 42 ? -1.728  -4.585  -6.141  1.00 0.00 ? 42  PHE A HD2  3  
ATOM   2932  H  HE1  . PHE A 1 42 ? -4.142  -0.323  -5.688  1.00 0.00 ? 42  PHE A HE1  3  
ATOM   2933  H  HE2  . PHE A 1 42 ? -3.694  -4.132  -7.550  1.00 0.00 ? 42  PHE A HE2  3  
ATOM   2934  H  HZ   . PHE A 1 42 ? -4.905  -1.999  -7.324  1.00 0.00 ? 42  PHE A HZ   3  
ATOM   2935  N  N    . ASN A 1 43 ? 1.349   -4.101  -2.347  1.00 0.00 ? 43  ASN A N    3  
ATOM   2936  C  CA   . ASN A 1 43 ? 2.549   -4.054  -1.518  1.00 0.00 ? 43  ASN A CA   3  
ATOM   2937  C  C    . ASN A 1 43 ? 3.804   -3.985  -2.382  1.00 0.00 ? 43  ASN A C    3  
ATOM   2938  O  O    . ASN A 1 43 ? 3.817   -4.461  -3.517  1.00 0.00 ? 43  ASN A O    3  
ATOM   2939  C  CB   . ASN A 1 43 ? 2.611   -5.280  -0.604  1.00 0.00 ? 43  ASN A CB   3  
ATOM   2940  C  CG   . ASN A 1 43 ? 1.597   -5.214  0.522   1.00 0.00 ? 43  ASN A CG   3  
ATOM   2941  O  OD1  . ASN A 1 43 ? 0.398   -5.067  0.285   1.00 0.00 ? 43  ASN A OD1  3  
ATOM   2942  N  ND2  . ASN A 1 43 ? 2.076   -5.322  1.756   1.00 0.00 ? 43  ASN A ND2  3  
ATOM   2943  H  H    . ASN A 1 43 ? 1.382   -4.567  -3.208  1.00 0.00 ? 43  ASN A H    3  
ATOM   2944  H  HA   . ASN A 1 43 ? 2.495   -3.164  -0.909  1.00 0.00 ? 43  ASN A HA   3  
ATOM   2945  H  HB2  . ASN A 1 43 ? 2.414   -6.167  -1.188  1.00 0.00 ? 43  ASN A HB2  3  
ATOM   2946  H  HB3  . ASN A 1 43 ? 3.598   -5.350  -0.172  1.00 0.00 ? 43  ASN A HB3  3  
ATOM   2947  H  HD21 . ASN A 1 43 ? 3.043   -5.437  1.869   1.00 0.00 ? 43  ASN A HD21 3  
ATOM   2948  H  HD22 . ASN A 1 43 ? 1.443   -5.283  2.502   1.00 0.00 ? 43  ASN A HD22 3  
ATOM   2949  N  N    . CYS A 1 44 ? 4.860   -3.390  -1.836  1.00 0.00 ? 44  CYS A N    3  
ATOM   2950  C  CA   . CYS A 1 44 ? 6.121   -3.259  -2.554  1.00 0.00 ? 44  CYS A CA   3  
ATOM   2951  C  C    . CYS A 1 44 ? 6.575   -4.606  -3.107  1.00 0.00 ? 44  CYS A C    3  
ATOM   2952  O  O    . CYS A 1 44 ? 6.139   -5.659  -2.642  1.00 0.00 ? 44  CYS A O    3  
ATOM   2953  C  CB   . CYS A 1 44 ? 7.199   -2.683  -1.634  1.00 0.00 ? 44  CYS A CB   3  
ATOM   2954  S  SG   . CYS A 1 44 ? 8.719   -2.172  -2.498  1.00 0.00 ? 44  CYS A SG   3  
ATOM   2955  H  H    . CYS A 1 44 ? 4.788   -3.030  -0.926  1.00 0.00 ? 44  CYS A H    3  
ATOM   2956  H  HA   . CYS A 1 44 ? 5.964   -2.580  -3.379  1.00 0.00 ? 44  CYS A HA   3  
ATOM   2957  H  HB2  . CYS A 1 44 ? 6.803   -1.816  -1.127  1.00 0.00 ? 44  CYS A HB2  3  
ATOM   2958  H  HB3  . CYS A 1 44 ? 7.472   -3.429  -0.902  1.00 0.00 ? 44  CYS A HB3  3  
ATOM   2959  N  N    . ALA A 1 45 ? 7.454   -4.565  -4.103  1.00 0.00 ? 45  ALA A N    3  
ATOM   2960  C  CA   . ALA A 1 45 ? 7.969   -5.782  -4.718  1.00 0.00 ? 45  ALA A CA   3  
ATOM   2961  C  C    . ALA A 1 45 ? 9.365   -6.111  -4.199  1.00 0.00 ? 45  ALA A C    3  
ATOM   2962  O  O    . ALA A 1 45 ? 9.770   -7.273  -4.175  1.00 0.00 ? 45  ALA A O    3  
ATOM   2963  C  CB   . ALA A 1 45 ? 7.988   -5.641  -6.233  1.00 0.00 ? 45  ALA A CB   3  
ATOM   2964  H  H    . ALA A 1 45 ? 7.765   -3.696  -4.431  1.00 0.00 ? 45  ALA A H    3  
ATOM   2965  H  HA   . ALA A 1 45 ? 7.301   -6.593  -4.465  1.00 0.00 ? 45  ALA A HA   3  
ATOM   2966  H  HB1  . ALA A 1 45 ? 7.975   -6.622  -6.685  1.00 0.00 ? 45  ALA A HB1  3  
ATOM   2967  H  HB2  . ALA A 1 45 ? 7.119   -5.085  -6.553  1.00 0.00 ? 45  ALA A HB2  3  
ATOM   2968  H  HB3  . ALA A 1 45 ? 8.882   -5.117  -6.535  1.00 0.00 ? 45  ALA A HB3  3  
ATOM   2969  N  N    . ASN A 1 46 ? 10.095  -5.081  -3.785  1.00 0.00 ? 46  ASN A N    3  
ATOM   2970  C  CA   . ASN A 1 46 ? 11.447  -5.261  -3.267  1.00 0.00 ? 46  ASN A CA   3  
ATOM   2971  C  C    . ASN A 1 46 ? 11.415  -5.759  -1.825  1.00 0.00 ? 46  ASN A C    3  
ATOM   2972  O  O    . ASN A 1 46 ? 11.820  -6.885  -1.536  1.00 0.00 ? 46  ASN A O    3  
ATOM   2973  C  CB   . ASN A 1 46 ? 12.226  -3.947  -3.349  1.00 0.00 ? 46  ASN A CB   3  
ATOM   2974  C  CG   . ASN A 1 46 ? 13.693  -4.122  -3.004  1.00 0.00 ? 46  ASN A CG   3  
ATOM   2975  O  OD1  . ASN A 1 46 ? 14.455  -4.715  -3.768  1.00 0.00 ? 46  ASN A OD1  3  
ATOM   2976  N  ND2  . ASN A 1 46 ? 14.094  -3.606  -1.848  1.00 0.00 ? 46  ASN A ND2  3  
ATOM   2977  H  H    . ASN A 1 46 ? 9.717   -4.178  -3.829  1.00 0.00 ? 46  ASN A H    3  
ATOM   2978  H  HA   . ASN A 1 46 ? 11.940  -6.001  -3.880  1.00 0.00 ? 46  ASN A HA   3  
ATOM   2979  H  HB2  . ASN A 1 46 ? 12.157  -3.556  -4.353  1.00 0.00 ? 46  ASN A HB2  3  
ATOM   2980  H  HB3  . ASN A 1 46 ? 11.795  -3.237  -2.660  1.00 0.00 ? 46  ASN A HB3  3  
ATOM   2981  H  HD21 . ASN A 1 46 ? 13.432  -3.148  -1.290  1.00 0.00 ? 46  ASN A HD21 3  
ATOM   2982  H  HD22 . ASN A 1 46 ? 15.037  -3.705  -1.601  1.00 0.00 ? 46  ASN A HD22 3  
ATOM   2983  N  N    . CYS A 1 47 ? 10.930  -4.911  -0.924  1.00 0.00 ? 47  CYS A N    3  
ATOM   2984  C  CA   . CYS A 1 47 ? 10.845  -5.263  0.488   1.00 0.00 ? 47  CYS A CA   3  
ATOM   2985  C  C    . CYS A 1 47 ? 9.593   -6.090  0.768   1.00 0.00 ? 47  CYS A C    3  
ATOM   2986  O  O    . CYS A 1 47 ? 9.617   -7.018  1.575   1.00 0.00 ? 47  CYS A O    3  
ATOM   2987  C  CB   . CYS A 1 47 ? 10.837  -3.999  1.351   1.00 0.00 ? 47  CYS A CB   3  
ATOM   2988  S  SG   . CYS A 1 47 ? 9.380   -2.935  1.098   1.00 0.00 ? 47  CYS A SG   3  
ATOM   2989  H  H    . CYS A 1 47 ? 10.623  -4.027  -1.215  1.00 0.00 ? 47  CYS A H    3  
ATOM   2990  H  HA   . CYS A 1 47 ? 11.714  -5.852  0.737   1.00 0.00 ? 47  CYS A HA   3  
ATOM   2991  H  HB2  . CYS A 1 47 ? 10.858  -4.283  2.393   1.00 0.00 ? 47  CYS A HB2  3  
ATOM   2992  H  HB3  . CYS A 1 47 ? 11.716  -3.413  1.125   1.00 0.00 ? 47  CYS A HB3  3  
ATOM   2993  N  N    . GLY A 1 48 ? 8.500   -5.745  0.094   1.00 0.00 ? 48  GLY A N    3  
ATOM   2994  C  CA   . GLY A 1 48 ? 7.254   -6.465  0.284   1.00 0.00 ? 48  GLY A CA   3  
ATOM   2995  C  C    . GLY A 1 48 ? 6.430   -5.907  1.427   1.00 0.00 ? 48  GLY A C    3  
ATOM   2996  O  O    . GLY A 1 48 ? 5.907   -6.659  2.250   1.00 0.00 ? 48  GLY A O    3  
ATOM   2997  H  H    . GLY A 1 48 ? 8.539   -4.996  -0.536  1.00 0.00 ? 48  GLY A H    3  
ATOM   2998  H  HA2  . GLY A 1 48 ? 6.675   -6.407  -0.626  1.00 0.00 ? 48  GLY A HA2  3  
ATOM   2999  H  HA3  . GLY A 1 48 ? 7.478   -7.502  0.490   1.00 0.00 ? 48  GLY A HA3  3  
ATOM   3000  N  N    . LYS A 1 49 ? 6.314   -4.585  1.480   1.00 0.00 ? 49  LYS A N    3  
ATOM   3001  C  CA   . LYS A 1 49 ? 5.548   -3.925  2.531   1.00 0.00 ? 49  LYS A CA   3  
ATOM   3002  C  C    . LYS A 1 49 ? 4.315   -3.237  1.955   1.00 0.00 ? 49  LYS A C    3  
ATOM   3003  O  O    . LYS A 1 49 ? 4.114   -3.218  0.741   1.00 0.00 ? 49  LYS A O    3  
ATOM   3004  C  CB   . LYS A 1 49 ? 6.421   -2.903  3.262   1.00 0.00 ? 49  LYS A CB   3  
ATOM   3005  C  CG   . LYS A 1 49 ? 6.580   -1.591  2.511   1.00 0.00 ? 49  LYS A CG   3  
ATOM   3006  C  CD   . LYS A 1 49 ? 7.586   -0.678  3.191   1.00 0.00 ? 49  LYS A CD   3  
ATOM   3007  C  CE   . LYS A 1 49 ? 6.939   0.135   4.302   1.00 0.00 ? 49  LYS A CE   3  
ATOM   3008  N  NZ   . LYS A 1 49 ? 7.053   -0.543  5.623   1.00 0.00 ? 49  LYS A NZ   3  
ATOM   3009  H  H    . LYS A 1 49 ? 6.754   -4.039  0.795   1.00 0.00 ? 49  LYS A H    3  
ATOM   3010  H  HA   . LYS A 1 49 ? 5.229   -4.680  3.233   1.00 0.00 ? 49  LYS A HA   3  
ATOM   3011  H  HB2  . LYS A 1 49 ? 5.979   -2.692  4.224   1.00 0.00 ? 49  LYS A HB2  3  
ATOM   3012  H  HB3  . LYS A 1 49 ? 7.403   -3.328  3.412   1.00 0.00 ? 49  LYS A HB3  3  
ATOM   3013  H  HG2  . LYS A 1 49 ? 6.920   -1.800  1.508   1.00 0.00 ? 49  LYS A HG2  3  
ATOM   3014  H  HG3  . LYS A 1 49 ? 5.622   -1.092  2.473   1.00 0.00 ? 49  LYS A HG3  3  
ATOM   3015  H  HD2  . LYS A 1 49 ? 8.377   -1.279  3.614   1.00 0.00 ? 49  LYS A HD2  3  
ATOM   3016  H  HD3  . LYS A 1 49 ? 7.999   -0.002  2.456   1.00 0.00 ? 49  LYS A HD3  3  
ATOM   3017  H  HE2  . LYS A 1 49 ? 7.426   1.096   4.358   1.00 0.00 ? 49  LYS A HE2  3  
ATOM   3018  H  HE3  . LYS A 1 49 ? 5.894   0.274   4.067   1.00 0.00 ? 49  LYS A HE3  3  
ATOM   3019  H  HZ1  . LYS A 1 49 ? 6.723   -1.527  5.549   1.00 0.00 ? 49  LYS A HZ1  3  
ATOM   3020  H  HZ2  . LYS A 1 49 ? 6.474   -0.048  6.330   1.00 0.00 ? 49  LYS A HZ2  3  
ATOM   3021  H  HZ3  . LYS A 1 49 ? 8.043   -0.544  5.941   1.00 0.00 ? 49  LYS A HZ3  3  
ATOM   3022  N  N    . GLU A 1 50 ? 3.493   -2.672  2.834   1.00 0.00 ? 50  GLU A N    3  
ATOM   3023  C  CA   . GLU A 1 50 ? 2.280   -1.982  2.411   1.00 0.00 ? 50  GLU A CA   3  
ATOM   3024  C  C    . GLU A 1 50 ? 2.617   -0.667  1.713   1.00 0.00 ? 50  GLU A C    3  
ATOM   3025  O  O    . GLU A 1 50 ? 3.023   0.303   2.355   1.00 0.00 ? 50  GLU A O    3  
ATOM   3026  C  CB   . GLU A 1 50 ? 1.372   -1.716  3.614   1.00 0.00 ? 50  GLU A CB   3  
ATOM   3027  C  CG   . GLU A 1 50 ? -0.035  -1.288  3.231   1.00 0.00 ? 50  GLU A CG   3  
ATOM   3028  C  CD   . GLU A 1 50 ? -0.964  -1.205  4.426   1.00 0.00 ? 50  GLU A CD   3  
ATOM   3029  O  OE1  . GLU A 1 50 ? -1.185  -2.247  5.078   1.00 0.00 ? 50  GLU A OE1  3  
ATOM   3030  O  OE2  . GLU A 1 50 ? -1.471  -0.100  4.709   1.00 0.00 ? 50  GLU A OE2  3  
ATOM   3031  H  H    . GLU A 1 50 ? 3.707   -2.720  3.789   1.00 0.00 ? 50  GLU A H    3  
ATOM   3032  H  HA   . GLU A 1 50 ? 1.760   -2.622  1.714   1.00 0.00 ? 50  GLU A HA   3  
ATOM   3033  H  HB2  . GLU A 1 50 ? 1.305   -2.617  4.205   1.00 0.00 ? 50  GLU A HB2  3  
ATOM   3034  H  HB3  . GLU A 1 50 ? 1.812   -0.934  4.215   1.00 0.00 ? 50  GLU A HB3  3  
ATOM   3035  H  HG2  . GLU A 1 50 ? 0.013   -0.316  2.764   1.00 0.00 ? 50  GLU A HG2  3  
ATOM   3036  H  HG3  . GLU A 1 50 ? -0.437  -2.004  2.530   1.00 0.00 ? 50  GLU A HG3  3  
ATOM   3037  N  N    . LEU A 1 51 ? 2.447   -0.643  0.396   1.00 0.00 ? 51  LEU A N    3  
ATOM   3038  C  CA   . LEU A 1 51 ? 2.733   0.552   -0.390  1.00 0.00 ? 51  LEU A CA   3  
ATOM   3039  C  C    . LEU A 1 51 ? 1.968   1.756   0.150   1.00 0.00 ? 51  LEU A C    3  
ATOM   3040  O  O    . LEU A 1 51 ? 1.151   1.628   1.063   1.00 0.00 ? 51  LEU A O    3  
ATOM   3041  C  CB   . LEU A 1 51 ? 2.370   0.320   -1.858  1.00 0.00 ? 51  LEU A CB   3  
ATOM   3042  C  CG   . LEU A 1 51 ? 3.307   -0.598  -2.644  1.00 0.00 ? 51  LEU A CG   3  
ATOM   3043  C  CD1  . LEU A 1 51 ? 2.696   -0.959  -3.989  1.00 0.00 ? 51  LEU A CD1  3  
ATOM   3044  C  CD2  . LEU A 1 51 ? 4.665   0.062   -2.833  1.00 0.00 ? 51  LEU A CD2  3  
ATOM   3045  H  H    . LEU A 1 51 ? 2.121   -1.446  -0.059  1.00 0.00 ? 51  LEU A H    3  
ATOM   3046  H  HA   . LEU A 1 51 ? 3.792   0.751   -0.317  1.00 0.00 ? 51  LEU A HA   3  
ATOM   3047  H  HB2  . LEU A 1 51 ? 1.381   -0.112  -1.890  1.00 0.00 ? 51  LEU A HB2  3  
ATOM   3048  H  HB3  . LEU A 1 51 ? 2.357   1.282   -2.351  1.00 0.00 ? 51  LEU A HB3  3  
ATOM   3049  H  HG   . LEU A 1 51 ? 3.453   -1.514  -2.088  1.00 0.00 ? 51  LEU A HG   3  
ATOM   3050  H  HD11 . LEU A 1 51 ? 1.922   -1.698  -3.846  1.00 0.00 ? 51  LEU A HD11 3  
ATOM   3051  H  HD12 . LEU A 1 51 ? 3.462   -1.360  -4.636  1.00 0.00 ? 51  LEU A HD12 3  
ATOM   3052  H  HD13 . LEU A 1 51 ? 2.271   -0.074  -4.440  1.00 0.00 ? 51  LEU A HD13 3  
ATOM   3053  H  HD21 . LEU A 1 51 ? 4.674   0.605   -3.766  1.00 0.00 ? 51  LEU A HD21 3  
ATOM   3054  H  HD22 . LEU A 1 51 ? 5.434   -0.697  -2.851  1.00 0.00 ? 51  LEU A HD22 3  
ATOM   3055  H  HD23 . LEU A 1 51 ? 4.850   0.744   -2.017  1.00 0.00 ? 51  LEU A HD23 3  
ATOM   3056  N  N    . THR A 1 52 ? 2.236   2.926   -0.421  1.00 0.00 ? 52  THR A N    3  
ATOM   3057  C  CA   . THR A 1 52 ? 1.572   4.153   0.002   1.00 0.00 ? 52  THR A CA   3  
ATOM   3058  C  C    . THR A 1 52 ? 0.884   4.839   -1.172  1.00 0.00 ? 52  THR A C    3  
ATOM   3059  O  O    . THR A 1 52 ? 1.001   4.399   -2.316  1.00 0.00 ? 52  THR A O    3  
ATOM   3060  C  CB   . THR A 1 52 ? 2.568   5.137   0.645   1.00 0.00 ? 52  THR A CB   3  
ATOM   3061  O  OG1  . THR A 1 52 ? 3.574   5.506   -0.304  1.00 0.00 ? 52  THR A OG1  3  
ATOM   3062  C  CG2  . THR A 1 52 ? 3.223   4.520   1.872   1.00 0.00 ? 52  THR A CG2  3  
ATOM   3063  H  H    . THR A 1 52 ? 2.896   2.964   -1.144  1.00 0.00 ? 52  THR A H    3  
ATOM   3064  H  HA   . THR A 1 52 ? 0.828   3.892   0.741   1.00 0.00 ? 52  THR A HA   3  
ATOM   3065  H  HB   . THR A 1 52 ? 2.029   6.023   0.950   1.00 0.00 ? 52  THR A HB   3  
ATOM   3066  H  HG1  . THR A 1 52 ? 4.375   5.760   0.161   1.00 0.00 ? 52  THR A HG1  3  
ATOM   3067  H  HG21 . THR A 1 52 ? 3.631   3.554   1.614   1.00 0.00 ? 52  THR A HG21 3  
ATOM   3068  H  HG22 . THR A 1 52 ? 2.486   4.403   2.653   1.00 0.00 ? 52  THR A HG22 3  
ATOM   3069  H  HG23 . THR A 1 52 ? 4.016   5.165   2.218   1.00 0.00 ? 52  THR A HG23 3  
ATOM   3070  N  N    . ALA A 1 53 ? 0.166   5.919   -0.882  1.00 0.00 ? 53  ALA A N    3  
ATOM   3071  C  CA   . ALA A 1 53 ? -0.539  6.668   -1.916  1.00 0.00 ? 53  ALA A CA   3  
ATOM   3072  C  C    . ALA A 1 53 ? 0.441   7.345   -2.868  1.00 0.00 ? 53  ALA A C    3  
ATOM   3073  O  O    . ALA A 1 53 ? 0.150   7.520   -4.051  1.00 0.00 ? 53  ALA A O    3  
ATOM   3074  C  CB   . ALA A 1 53 ? -1.462  7.699   -1.283  1.00 0.00 ? 53  ALA A CB   3  
ATOM   3075  H  H    . ALA A 1 53 ? 0.111   6.221   0.048   1.00 0.00 ? 53  ALA A H    3  
ATOM   3076  H  HA   . ALA A 1 53 ? -1.147  5.972   -2.476  1.00 0.00 ? 53  ALA A HA   3  
ATOM   3077  H  HB1  . ALA A 1 53 ? -0.869  8.462   -0.799  1.00 0.00 ? 53  ALA A HB1  3  
ATOM   3078  H  HB2  . ALA A 1 53 ? -2.075  8.151   -2.049  1.00 0.00 ? 53  ALA A HB2  3  
ATOM   3079  H  HB3  . ALA A 1 53 ? -2.094  7.216   -0.553  1.00 0.00 ? 53  ALA A HB3  3  
ATOM   3080  N  N    . ASP A 1 54 ? 1.601   7.725   -2.344  1.00 0.00 ? 54  ASP A N    3  
ATOM   3081  C  CA   . ASP A 1 54 ? 2.624   8.383   -3.148  1.00 0.00 ? 54  ASP A CA   3  
ATOM   3082  C  C    . ASP A 1 54 ? 3.584   7.361   -3.748  1.00 0.00 ? 54  ASP A C    3  
ATOM   3083  O  O    . ASP A 1 54 ? 4.648   7.717   -4.255  1.00 0.00 ? 54  ASP A O    3  
ATOM   3084  C  CB   . ASP A 1 54 ? 3.399   9.393   -2.299  1.00 0.00 ? 54  ASP A CB   3  
ATOM   3085  C  CG   . ASP A 1 54 ? 2.517   10.513  -1.783  1.00 0.00 ? 54  ASP A CG   3  
ATOM   3086  O  OD1  . ASP A 1 54 ? 1.940   11.244  -2.614  1.00 0.00 ? 54  ASP A OD1  3  
ATOM   3087  O  OD2  . ASP A 1 54 ? 2.405   10.658  -0.547  1.00 0.00 ? 54  ASP A OD2  3  
ATOM   3088  H  H    . ASP A 1 54 ? 1.774   7.558   -1.394  1.00 0.00 ? 54  ASP A H    3  
ATOM   3089  H  HA   . ASP A 1 54 ? 2.128   8.908   -3.951  1.00 0.00 ? 54  ASP A HA   3  
ATOM   3090  H  HB2  . ASP A 1 54 ? 3.834   8.882   -1.452  1.00 0.00 ? 54  ASP A HB2  3  
ATOM   3091  H  HB3  . ASP A 1 54 ? 4.188   9.826   -2.897  1.00 0.00 ? 54  ASP A HB3  3  
ATOM   3092  N  N    . ALA A 1 55 ? 3.202   6.090   -3.686  1.00 0.00 ? 55  ALA A N    3  
ATOM   3093  C  CA   . ALA A 1 55 ? 4.029   5.017   -4.224  1.00 0.00 ? 55  ALA A CA   3  
ATOM   3094  C  C    . ALA A 1 55 ? 4.519   5.353   -5.629  1.00 0.00 ? 55  ALA A C    3  
ATOM   3095  O  O    . ALA A 1 55 ? 4.154   6.384   -6.194  1.00 0.00 ? 55  ALA A O    3  
ATOM   3096  C  CB   . ALA A 1 55 ? 3.254   3.707   -4.233  1.00 0.00 ? 55  ALA A CB   3  
ATOM   3097  H  H    . ALA A 1 55 ? 2.343   5.869   -3.270  1.00 0.00 ? 55  ALA A H    3  
ATOM   3098  H  HA   . ALA A 1 55 ? 4.884   4.896   -3.575  1.00 0.00 ? 55  ALA A HA   3  
ATOM   3099  H  HB1  . ALA A 1 55 ? 3.413   3.202   -5.174  1.00 0.00 ? 55  ALA A HB1  3  
ATOM   3100  H  HB2  . ALA A 1 55 ? 3.598   3.080   -3.424  1.00 0.00 ? 55  ALA A HB2  3  
ATOM   3101  H  HB3  . ALA A 1 55 ? 2.201   3.912   -4.107  1.00 0.00 ? 55  ALA A HB3  3  
ATOM   3102  N  N    . ARG A 1 56 ? 5.347   4.476   -6.187  1.00 0.00 ? 56  ARG A N    3  
ATOM   3103  C  CA   . ARG A 1 56 ? 5.889   4.681   -7.525  1.00 0.00 ? 56  ARG A CA   3  
ATOM   3104  C  C    . ARG A 1 56 ? 5.746   3.418   -8.369  1.00 0.00 ? 56  ARG A C    3  
ATOM   3105  O  O    . ARG A 1 56 ? 5.877   2.304   -7.862  1.00 0.00 ? 56  ARG A O    3  
ATOM   3106  C  CB   . ARG A 1 56 ? 7.360   5.091   -7.445  1.00 0.00 ? 56  ARG A CB   3  
ATOM   3107  C  CG   . ARG A 1 56 ? 7.605   6.322   -6.588  1.00 0.00 ? 56  ARG A CG   3  
ATOM   3108  C  CD   . ARG A 1 56 ? 7.061   7.578   -7.250  1.00 0.00 ? 56  ARG A CD   3  
ATOM   3109  N  NE   . ARG A 1 56 ? 6.830   8.650   -6.285  1.00 0.00 ? 56  ARG A NE   3  
ATOM   3110  C  CZ   . ARG A 1 56 ? 6.010   9.672   -6.503  1.00 0.00 ? 56  ARG A CZ   3  
ATOM   3111  N  NH1  . ARG A 1 56 ? 5.347   9.761   -7.648  1.00 0.00 ? 56  ARG A NH1  3  
ATOM   3112  N  NH2  . ARG A 1 56 ? 5.853   10.608  -5.576  1.00 0.00 ? 56  ARG A NH2  3  
ATOM   3113  H  H    . ARG A 1 56 ? 5.602   3.673   -5.687  1.00 0.00 ? 56  ARG A H    3  
ATOM   3114  H  HA   . ARG A 1 56 ? 5.328   5.477   -7.991  1.00 0.00 ? 56  ARG A HA   3  
ATOM   3115  H  HB2  . ARG A 1 56 ? 7.928   4.271   -7.029  1.00 0.00 ? 56  ARG A HB2  3  
ATOM   3116  H  HB3  . ARG A 1 56 ? 7.718   5.297   -8.443  1.00 0.00 ? 56  ARG A HB3  3  
ATOM   3117  H  HG2  . ARG A 1 56 ? 7.114   6.189   -5.636  1.00 0.00 ? 56  ARG A HG2  3  
ATOM   3118  H  HG3  . ARG A 1 56 ? 8.667   6.437   -6.435  1.00 0.00 ? 56  ARG A HG3  3  
ATOM   3119  H  HD2  . ARG A 1 56 ? 7.774   7.919   -7.987  1.00 0.00 ? 56  ARG A HD2  3  
ATOM   3120  H  HD3  . ARG A 1 56 ? 6.128   7.337   -7.737  1.00 0.00 ? 56  ARG A HD3  3  
ATOM   3121  H  HE   . ARG A 1 56 ? 7.310   8.603   -5.432  1.00 0.00 ? 56  ARG A HE   3  
ATOM   3122  H  HH11 . ARG A 1 56 ? 5.463   9.057   -8.348  1.00 0.00 ? 56  ARG A HH11 3  
ATOM   3123  H  HH12 . ARG A 1 56 ? 4.730   10.531  -7.809  1.00 0.00 ? 56  ARG A HH12 3  
ATOM   3124  H  HH21 . ARG A 1 56 ? 6.351   10.543  -4.711  1.00 0.00 ? 56  ARG A HH21 3  
ATOM   3125  H  HH22 . ARG A 1 56 ? 5.236   11.376  -5.741  1.00 0.00 ? 56  ARG A HH22 3  
ATOM   3126  N  N    . GLU A 1 57 ? 5.476   3.601   -9.658  1.00 0.00 ? 57  GLU A N    3  
ATOM   3127  C  CA   . GLU A 1 57 ? 5.314   2.475   -10.571 1.00 0.00 ? 57  GLU A CA   3  
ATOM   3128  C  C    . GLU A 1 57 ? 6.575   2.266   -11.405 1.00 0.00 ? 57  GLU A C    3  
ATOM   3129  O  O    . GLU A 1 57 ? 7.090   3.202   -12.018 1.00 0.00 ? 57  GLU A O    3  
ATOM   3130  C  CB   . GLU A 1 57 ? 4.113   2.705   -11.490 1.00 0.00 ? 57  GLU A CB   3  
ATOM   3131  C  CG   . GLU A 1 57 ? 3.887   1.581   -12.488 1.00 0.00 ? 57  GLU A CG   3  
ATOM   3132  C  CD   . GLU A 1 57 ? 3.146   2.043   -13.728 1.00 0.00 ? 57  GLU A CD   3  
ATOM   3133  O  OE1  . GLU A 1 57 ? 3.793   2.629   -14.621 1.00 0.00 ? 57  GLU A OE1  3  
ATOM   3134  O  OE2  . GLU A 1 57 ? 1.921   1.817   -13.806 1.00 0.00 ? 57  GLU A OE2  3  
ATOM   3135  H  H    . GLU A 1 57 ? 5.384   4.513   -10.002 1.00 0.00 ? 57  GLU A H    3  
ATOM   3136  H  HA   . GLU A 1 57 ? 5.139   1.590   -9.978  1.00 0.00 ? 57  GLU A HA   3  
ATOM   3137  H  HB2  . GLU A 1 57 ? 3.225   2.804   -10.884 1.00 0.00 ? 57  GLU A HB2  3  
ATOM   3138  H  HB3  . GLU A 1 57 ? 4.267   3.621   -12.041 1.00 0.00 ? 57  GLU A HB3  3  
ATOM   3139  H  HG2  . GLU A 1 57 ? 4.846   1.185   -12.787 1.00 0.00 ? 57  GLU A HG2  3  
ATOM   3140  H  HG3  . GLU A 1 57 ? 3.311   0.803   -12.011 1.00 0.00 ? 57  GLU A HG3  3  
ATOM   3141  N  N    . LEU A 1 58 ? 7.067   1.032   -11.423 1.00 0.00 ? 58  LEU A N    3  
ATOM   3142  C  CA   . LEU A 1 58 ? 8.268   0.699   -12.181 1.00 0.00 ? 58  LEU A CA   3  
ATOM   3143  C  C    . LEU A 1 58 ? 8.011   -0.478  -13.117 1.00 0.00 ? 58  LEU A C    3  
ATOM   3144  O  O    . LEU A 1 58 ? 7.937   -1.627  -12.682 1.00 0.00 ? 58  LEU A O    3  
ATOM   3145  C  CB   . LEU A 1 58 ? 9.419   0.367   -11.230 1.00 0.00 ? 58  LEU A CB   3  
ATOM   3146  C  CG   . LEU A 1 58 ? 10.242  1.555   -10.731 1.00 0.00 ? 58  LEU A CG   3  
ATOM   3147  C  CD1  . LEU A 1 58 ? 11.120  1.143   -9.560  1.00 0.00 ? 58  LEU A CD1  3  
ATOM   3148  C  CD2  . LEU A 1 58 ? 11.088  2.129   -11.859 1.00 0.00 ? 58  LEU A CD2  3  
ATOM   3149  H  H    . LEU A 1 58 ? 6.613   0.329   -10.914 1.00 0.00 ? 58  LEU A H    3  
ATOM   3150  H  HA   . LEU A 1 58 ? 8.537   1.561   -12.772 1.00 0.00 ? 58  LEU A HA   3  
ATOM   3151  H  HB2  . LEU A 1 58 ? 9.003   -0.132  -10.368 1.00 0.00 ? 58  LEU A HB2  3  
ATOM   3152  H  HB3  . LEU A 1 58 ? 10.089  -0.307  -11.746 1.00 0.00 ? 58  LEU A HB3  3  
ATOM   3153  H  HG   . LEU A 1 58 ? 9.571   2.330   -10.388 1.00 0.00 ? 58  LEU A HG   3  
ATOM   3154  H  HD11 . LEU A 1 58 ? 12.019  0.675   -9.932  1.00 0.00 ? 58  LEU A HD11 3  
ATOM   3155  H  HD12 . LEU A 1 58 ? 10.583  0.444   -8.936  1.00 0.00 ? 58  LEU A HD12 3  
ATOM   3156  H  HD13 . LEU A 1 58 ? 11.381  2.016   -8.981  1.00 0.00 ? 58  LEU A HD13 3  
ATOM   3157  H  HD21 . LEU A 1 58 ? 12.132  2.076   -11.587 1.00 0.00 ? 58  LEU A HD21 3  
ATOM   3158  H  HD22 . LEU A 1 58 ? 10.811  3.160   -12.027 1.00 0.00 ? 58  LEU A HD22 3  
ATOM   3159  H  HD23 . LEU A 1 58 ? 10.920  1.559   -12.760 1.00 0.00 ? 58  LEU A HD23 3  
ATOM   3160  N  N    . LYS A 1 59 ? 7.878   -0.183  -14.406 1.00 0.00 ? 59  LYS A N    3  
ATOM   3161  C  CA   . LYS A 1 59 ? 7.634   -1.216  -15.406 1.00 0.00 ? 59  LYS A CA   3  
ATOM   3162  C  C    . LYS A 1 59 ? 6.421   -2.062  -15.029 1.00 0.00 ? 59  LYS A C    3  
ATOM   3163  O  O    . LYS A 1 59 ? 6.413   -3.275  -15.230 1.00 0.00 ? 59  LYS A O    3  
ATOM   3164  C  CB   . LYS A 1 59 ? 8.866   -2.111  -15.557 1.00 0.00 ? 59  LYS A CB   3  
ATOM   3165  C  CG   . LYS A 1 59 ? 10.081  -1.384  -16.106 1.00 0.00 ? 59  LYS A CG   3  
ATOM   3166  C  CD   . LYS A 1 59 ? 11.366  -2.135  -15.798 1.00 0.00 ? 59  LYS A CD   3  
ATOM   3167  C  CE   . LYS A 1 59 ? 12.568  -1.202  -15.787 1.00 0.00 ? 59  LYS A CE   3  
ATOM   3168  N  NZ   . LYS A 1 59 ? 12.901  -0.710  -17.152 1.00 0.00 ? 59  LYS A NZ   3  
ATOM   3169  H  H    . LYS A 1 59 ? 7.948   0.752   -14.692 1.00 0.00 ? 59  LYS A H    3  
ATOM   3170  H  HA   . LYS A 1 59 ? 7.437   -0.726  -16.347 1.00 0.00 ? 59  LYS A HA   3  
ATOM   3171  H  HB2  . LYS A 1 59 ? 9.122   -2.517  -14.590 1.00 0.00 ? 59  LYS A HB2  3  
ATOM   3172  H  HB3  . LYS A 1 59 ? 8.626   -2.924  -16.227 1.00 0.00 ? 59  LYS A HB3  3  
ATOM   3173  H  HG2  . LYS A 1 59 ? 9.980   -1.290  -17.177 1.00 0.00 ? 59  LYS A HG2  3  
ATOM   3174  H  HG3  . LYS A 1 59 ? 10.134  -0.401  -15.660 1.00 0.00 ? 59  LYS A HG3  3  
ATOM   3175  H  HD2  . LYS A 1 59 ? 11.277  -2.600  -14.828 1.00 0.00 ? 59  LYS A HD2  3  
ATOM   3176  H  HD3  . LYS A 1 59 ? 11.518  -2.894  -16.552 1.00 0.00 ? 59  LYS A HD3  3  
ATOM   3177  H  HE2  . LYS A 1 59 ? 12.345  -0.357  -15.153 1.00 0.00 ? 59  LYS A HE2  3  
ATOM   3178  H  HE3  . LYS A 1 59 ? 13.418  -1.736  -15.388 1.00 0.00 ? 59  LYS A HE3  3  
ATOM   3179  H  HZ1  . LYS A 1 59 ? 12.133  -0.106  -17.511 1.00 0.00 ? 59  LYS A HZ1  3  
ATOM   3180  H  HZ2  . LYS A 1 59 ? 13.027  -1.513  -17.800 1.00 0.00 ? 59  LYS A HZ2  3  
ATOM   3181  H  HZ3  . LYS A 1 59 ? 13.780  -0.156  -17.128 1.00 0.00 ? 59  LYS A HZ3  3  
ATOM   3182  N  N    . GLY A 1 60 ? 5.398   -1.412  -14.483 1.00 0.00 ? 60  GLY A N    3  
ATOM   3183  C  CA   . GLY A 1 60 ? 4.195   -2.120  -14.088 1.00 0.00 ? 60  GLY A CA   3  
ATOM   3184  C  C    . GLY A 1 60 ? 4.133   -2.371  -12.594 1.00 0.00 ? 60  GLY A C    3  
ATOM   3185  O  O    . GLY A 1 60 ? 3.078   -2.226  -11.978 1.00 0.00 ? 60  GLY A O    3  
ATOM   3186  H  H    . GLY A 1 60 ? 5.461   -0.443  -14.346 1.00 0.00 ? 60  GLY A H    3  
ATOM   3187  H  HA2  . GLY A 1 60 ? 3.335   -1.537  -14.381 1.00 0.00 ? 60  GLY A HA2  3  
ATOM   3188  H  HA3  . GLY A 1 60 ? 4.165   -3.070  -14.602 1.00 0.00 ? 60  GLY A HA3  3  
ATOM   3189  N  N    . GLU A 1 61 ? 5.266   -2.750  -12.012 1.00 0.00 ? 61  GLU A N    3  
ATOM   3190  C  CA   . GLU A 1 61 ? 5.335   -3.024  -10.582 1.00 0.00 ? 61  GLU A CA   3  
ATOM   3191  C  C    . GLU A 1 61 ? 5.120   -1.749  -9.772  1.00 0.00 ? 61  GLU A C    3  
ATOM   3192  O  O    . GLU A 1 61 ? 5.037   -0.653  -10.329 1.00 0.00 ? 61  GLU A O    3  
ATOM   3193  C  CB   . GLU A 1 61 ? 6.686   -3.647  -10.223 1.00 0.00 ? 61  GLU A CB   3  
ATOM   3194  C  CG   . GLU A 1 61 ? 6.857   -5.066  -10.739 1.00 0.00 ? 61  GLU A CG   3  
ATOM   3195  C  CD   . GLU A 1 61 ? 6.244   -6.101  -9.815  1.00 0.00 ? 61  GLU A CD   3  
ATOM   3196  O  OE1  . GLU A 1 61 ? 5.028   -6.011  -9.547  1.00 0.00 ? 61  GLU A OE1  3  
ATOM   3197  O  OE2  . GLU A 1 61 ? 6.981   -7.001  -9.360  1.00 0.00 ? 61  GLU A OE2  3  
ATOM   3198  H  H    . GLU A 1 61 ? 6.075   -2.849  -12.557 1.00 0.00 ? 61  GLU A H    3  
ATOM   3199  H  HA   . GLU A 1 61 ? 4.550   -3.725  -10.340 1.00 0.00 ? 61  GLU A HA   3  
ATOM   3200  H  HB2  . GLU A 1 61 ? 7.472   -3.037  -10.641 1.00 0.00 ? 61  GLU A HB2  3  
ATOM   3201  H  HB3  . GLU A 1 61 ? 6.787   -3.663  -9.148  1.00 0.00 ? 61  GLU A HB3  3  
ATOM   3202  H  HG2  . GLU A 1 61 ? 6.383   -5.144  -11.706 1.00 0.00 ? 61  GLU A HG2  3  
ATOM   3203  H  HG3  . GLU A 1 61 ? 7.912   -5.275  -10.838 1.00 0.00 ? 61  GLU A HG3  3  
ATOM   3204  N  N    . LEU A 1 62 ? 5.030   -1.898  -8.456  1.00 0.00 ? 62  LEU A N    3  
ATOM   3205  C  CA   . LEU A 1 62 ? 4.824   -0.759  -7.568  1.00 0.00 ? 62  LEU A CA   3  
ATOM   3206  C  C    . LEU A 1 62 ? 5.731   -0.851  -6.345  1.00 0.00 ? 62  LEU A C    3  
ATOM   3207  O  O    . LEU A 1 62 ? 5.555   -1.724  -5.494  1.00 0.00 ? 62  LEU A O    3  
ATOM   3208  C  CB   . LEU A 1 62 ? 3.361   -0.688  -7.128  1.00 0.00 ? 62  LEU A CB   3  
ATOM   3209  C  CG   . LEU A 1 62 ? 2.363   -0.226  -8.191  1.00 0.00 ? 62  LEU A CG   3  
ATOM   3210  C  CD1  . LEU A 1 62 ? 0.969   -0.748  -7.877  1.00 0.00 ? 62  LEU A CD1  3  
ATOM   3211  C  CD2  . LEU A 1 62 ? 2.356   1.292   -8.292  1.00 0.00 ? 62  LEU A CD2  3  
ATOM   3212  H  H    . LEU A 1 62 ? 5.104   -2.796  -8.070  1.00 0.00 ? 62  LEU A H    3  
ATOM   3213  H  HA   . LEU A 1 62 ? 5.071   0.137   -8.117  1.00 0.00 ? 62  LEU A HA   3  
ATOM   3214  H  HB2  . LEU A 1 62 ? 3.065   -1.673  -6.803  1.00 0.00 ? 62  LEU A HB2  3  
ATOM   3215  H  HB3  . LEU A 1 62 ? 3.300   -0.002  -6.295  1.00 0.00 ? 62  LEU A HB3  3  
ATOM   3216  H  HG   . LEU A 1 62 ? 2.659   -0.625  -9.151  1.00 0.00 ? 62  LEU A HG   3  
ATOM   3217  H  HD11 . LEU A 1 62 ? 0.261   -0.324  -8.572  1.00 0.00 ? 62  LEU A HD11 3  
ATOM   3218  H  HD12 . LEU A 1 62 ? 0.698   -0.466  -6.870  1.00 0.00 ? 62  LEU A HD12 3  
ATOM   3219  H  HD13 . LEU A 1 62 ? 0.960   -1.824  -7.964  1.00 0.00 ? 62  LEU A HD13 3  
ATOM   3220  H  HD21 . LEU A 1 62 ? 2.232   1.583   -9.325  1.00 0.00 ? 62  LEU A HD21 3  
ATOM   3221  H  HD22 . LEU A 1 62 ? 3.291   1.682   -7.918  1.00 0.00 ? 62  LEU A HD22 3  
ATOM   3222  H  HD23 . LEU A 1 62 ? 1.540   1.688   -7.706  1.00 0.00 ? 62  LEU A HD23 3  
ATOM   3223  N  N    . TYR A 1 63 ? 6.698   0.055   -6.262  1.00 0.00 ? 63  TYR A N    3  
ATOM   3224  C  CA   . TYR A 1 63 ? 7.632   0.076   -5.143  1.00 0.00 ? 63  TYR A CA   3  
ATOM   3225  C  C    . TYR A 1 63 ? 7.365   1.271   -4.233  1.00 0.00 ? 63  TYR A C    3  
ATOM   3226  O  O    . TYR A 1 63 ? 6.986   2.348   -4.696  1.00 0.00 ? 63  TYR A O    3  
ATOM   3227  C  CB   . TYR A 1 63 ? 9.073   0.123   -5.654  1.00 0.00 ? 63  TYR A CB   3  
ATOM   3228  C  CG   . TYR A 1 63 ? 9.433   -1.037  -6.555  1.00 0.00 ? 63  TYR A CG   3  
ATOM   3229  C  CD1  . TYR A 1 63 ? 9.064   -1.043  -7.894  1.00 0.00 ? 63  TYR A CD1  3  
ATOM   3230  C  CD2  . TYR A 1 63 ? 10.142  -2.128  -6.066  1.00 0.00 ? 63  TYR A CD2  3  
ATOM   3231  C  CE1  . TYR A 1 63 ? 9.391   -2.100  -8.721  1.00 0.00 ? 63  TYR A CE1  3  
ATOM   3232  C  CE2  . TYR A 1 63 ? 10.474  -3.189  -6.885  1.00 0.00 ? 63  TYR A CE2  3  
ATOM   3233  C  CZ   . TYR A 1 63 ? 10.096  -3.171  -8.212  1.00 0.00 ? 63  TYR A CZ   3  
ATOM   3234  O  OH   . TYR A 1 63 ? 10.424  -4.227  -9.031  1.00 0.00 ? 63  TYR A OH   3  
ATOM   3235  H  H    . TYR A 1 63 ? 6.787   0.726   -6.971  1.00 0.00 ? 63  TYR A H    3  
ATOM   3236  H  HA   . TYR A 1 63 ? 7.491   -0.832  -4.576  1.00 0.00 ? 63  TYR A HA   3  
ATOM   3237  H  HB2  . TYR A 1 63 ? 9.220   1.034   -6.214  1.00 0.00 ? 63  TYR A HB2  3  
ATOM   3238  H  HB3  . TYR A 1 63 ? 9.748   0.111   -4.811  1.00 0.00 ? 63  TYR A HB3  3  
ATOM   3239  H  HD1  . TYR A 1 63 ? 8.512   -0.203  -8.290  1.00 0.00 ? 63  TYR A HD1  3  
ATOM   3240  H  HD2  . TYR A 1 63 ? 10.436  -2.139  -5.026  1.00 0.00 ? 63  TYR A HD2  3  
ATOM   3241  H  HE1  . TYR A 1 63 ? 9.095   -2.087  -9.760  1.00 0.00 ? 63  TYR A HE1  3  
ATOM   3242  H  HE2  . TYR A 1 63 ? 11.026  -4.028  -6.487  1.00 0.00 ? 63  TYR A HE2  3  
ATOM   3243  H  HH   . TYR A 1 63 ? 10.114  -5.046  -8.636  1.00 0.00 ? 63  TYR A HH   3  
ATOM   3244  N  N    . CYS A 1 64 ? 7.566   1.074   -2.934  1.00 0.00 ? 64  CYS A N    3  
ATOM   3245  C  CA   . CYS A 1 64 ? 7.348   2.133   -1.956  1.00 0.00 ? 64  CYS A CA   3  
ATOM   3246  C  C    . CYS A 1 64 ? 8.447   3.189   -2.044  1.00 0.00 ? 64  CYS A C    3  
ATOM   3247  O  O    . CYS A 1 64 ? 9.578   2.893   -2.430  1.00 0.00 ? 64  CYS A O    3  
ATOM   3248  C  CB   . CYS A 1 64 ? 7.298   1.550   -0.543  1.00 0.00 ? 64  CYS A CB   3  
ATOM   3249  S  SG   . CYS A 1 64 ? 8.891   0.891   0.046   1.00 0.00 ? 64  CYS A SG   3  
ATOM   3250  H  H    . CYS A 1 64 ? 7.868   0.194   -2.625  1.00 0.00 ? 64  CYS A H    3  
ATOM   3251  H  HA   . CYS A 1 64 ? 6.400   2.599   -2.178  1.00 0.00 ? 64  CYS A HA   3  
ATOM   3252  H  HB2  . CYS A 1 64 ? 6.988   2.321   0.146   1.00 0.00 ? 64  CYS A HB2  3  
ATOM   3253  H  HB3  . CYS A 1 64 ? 6.580   0.744   -0.520  1.00 0.00 ? 64  CYS A HB3  3  
ATOM   3254  N  N    . LEU A 1 65 ? 8.105   4.421   -1.683  1.00 0.00 ? 65  LEU A N    3  
ATOM   3255  C  CA   . LEU A 1 65 ? 9.062   5.522   -1.720  1.00 0.00 ? 65  LEU A CA   3  
ATOM   3256  C  C    . LEU A 1 65 ? 10.418  5.083   -1.177  1.00 0.00 ? 65  LEU A C    3  
ATOM   3257  O  O    . LEU A 1 65 ? 11.462  5.305   -1.792  1.00 0.00 ? 65  LEU A O    3  
ATOM   3258  C  CB   . LEU A 1 65 ? 8.536   6.708   -0.911  1.00 0.00 ? 65  LEU A CB   3  
ATOM   3259  C  CG   . LEU A 1 65 ? 7.730   7.748   -1.691  1.00 0.00 ? 65  LEU A CG   3  
ATOM   3260  C  CD1  . LEU A 1 65 ? 8.602   8.421   -2.740  1.00 0.00 ? 65  LEU A CD1  3  
ATOM   3261  C  CD2  . LEU A 1 65 ? 6.513   7.105   -2.338  1.00 0.00 ? 65  LEU A CD2  3  
ATOM   3262  H  H    . LEU A 1 65 ? 7.189   4.596   -1.384  1.00 0.00 ? 65  LEU A H    3  
ATOM   3263  H  HA   . LEU A 1 65 ? 9.180   5.823   -2.750  1.00 0.00 ? 65  LEU A HA   3  
ATOM   3264  H  HB2  . LEU A 1 65 ? 7.903   6.320   -0.128  1.00 0.00 ? 65  LEU A HB2  3  
ATOM   3265  H  HB3  . LEU A 1 65 ? 9.385   7.209   -0.469  1.00 0.00 ? 65  LEU A HB3  3  
ATOM   3266  H  HG   . LEU A 1 65 ? 7.383   8.511   -1.008  1.00 0.00 ? 65  LEU A HG   3  
ATOM   3267  H  HD11 . LEU A 1 65 ? 9.478   7.817   -2.921  1.00 0.00 ? 65  LEU A HD11 3  
ATOM   3268  H  HD12 . LEU A 1 65 ? 8.904   9.396   -2.386  1.00 0.00 ? 65  LEU A HD12 3  
ATOM   3269  H  HD13 . LEU A 1 65 ? 8.042   8.529   -3.657  1.00 0.00 ? 65  LEU A HD13 3  
ATOM   3270  H  HD21 . LEU A 1 65 ? 6.746   6.845   -3.361  1.00 0.00 ? 65  LEU A HD21 3  
ATOM   3271  H  HD22 . LEU A 1 65 ? 5.687   7.800   -2.323  1.00 0.00 ? 65  LEU A HD22 3  
ATOM   3272  H  HD23 . LEU A 1 65 ? 6.244   6.213   -1.792  1.00 0.00 ? 65  LEU A HD23 3  
ATOM   3273  N  N    . PRO A 1 66 ? 10.405  4.443   0.002   1.00 0.00 ? 66  PRO A N    3  
ATOM   3274  C  CA   . PRO A 1 66 ? 11.626  3.957   0.652   1.00 0.00 ? 66  PRO A CA   3  
ATOM   3275  C  C    . PRO A 1 66 ? 12.524  3.183   -0.306  1.00 0.00 ? 66  PRO A C    3  
ATOM   3276  O  O    . PRO A 1 66 ? 13.708  3.490   -0.449  1.00 0.00 ? 66  PRO A O    3  
ATOM   3277  C  CB   . PRO A 1 66 ? 11.098  3.035   1.753   1.00 0.00 ? 66  PRO A CB   3  
ATOM   3278  C  CG   . PRO A 1 66 ? 9.733   3.549   2.056   1.00 0.00 ? 66  PRO A CG   3  
ATOM   3279  C  CD   . PRO A 1 66 ? 9.198   4.145   0.790   1.00 0.00 ? 66  PRO A CD   3  
ATOM   3280  H  HA   . PRO A 1 66 ? 12.188  4.766   1.096   1.00 0.00 ? 66  PRO A HA   3  
ATOM   3281  H  HB2  . PRO A 1 66 ? 11.065  2.017   1.389   1.00 0.00 ? 66  PRO A HB2  3  
ATOM   3282  H  HB3  . PRO A 1 66 ? 11.742  3.093   2.617   1.00 0.00 ? 66  PRO A HB3  3  
ATOM   3283  H  HG2  . PRO A 1 66 ? 9.097   2.738   2.376   1.00 0.00 ? 66  PRO A HG2  3  
ATOM   3284  H  HG3  . PRO A 1 66 ? 9.789   4.308   2.822   1.00 0.00 ? 66  PRO A HG3  3  
ATOM   3285  H  HD2  . PRO A 1 66 ? 8.570   3.431   0.278   1.00 0.00 ? 66  PRO A HD2  3  
ATOM   3286  H  HD3  . PRO A 1 66 ? 8.647   5.048   1.007   1.00 0.00 ? 66  PRO A HD3  3  
ATOM   3287  N  N    . CYS A 1 67 ? 11.954  2.178   -0.963  1.00 0.00 ? 67  CYS A N    3  
ATOM   3288  C  CA   . CYS A 1 67 ? 12.703  1.359   -1.908  1.00 0.00 ? 67  CYS A CA   3  
ATOM   3289  C  C    . CYS A 1 67 ? 13.035  2.150   -3.170  1.00 0.00 ? 67  CYS A C    3  
ATOM   3290  O  O    . CYS A 1 67 ? 14.195  2.237   -3.574  1.00 0.00 ? 67  CYS A O    3  
ATOM   3291  C  CB   . CYS A 1 67 ? 11.905  0.106   -2.274  1.00 0.00 ? 67  CYS A CB   3  
ATOM   3292  S  SG   . CYS A 1 67 ? 11.843  -1.148  -0.955  1.00 0.00 ? 67  CYS A SG   3  
ATOM   3293  H  H    . CYS A 1 67 ? 11.006  1.981   -0.807  1.00 0.00 ? 67  CYS A H    3  
ATOM   3294  H  HA   . CYS A 1 67 ? 13.625  1.061   -1.432  1.00 0.00 ? 67  CYS A HA   3  
ATOM   3295  H  HB2  . CYS A 1 67 ? 10.888  0.391   -2.503  1.00 0.00 ? 67  CYS A HB2  3  
ATOM   3296  H  HB3  . CYS A 1 67 ? 12.349  -0.353  -3.145  1.00 0.00 ? 67  CYS A HB3  3  
ATOM   3297  N  N    . HIS A 1 68 ? 12.009  2.726   -3.787  1.00 0.00 ? 68  HIS A N    3  
ATOM   3298  C  CA   . HIS A 1 68 ? 12.191  3.512   -5.003  1.00 0.00 ? 68  HIS A CA   3  
ATOM   3299  C  C    . HIS A 1 68 ? 13.453  4.366   -4.914  1.00 0.00 ? 68  HIS A C    3  
ATOM   3300  O  O    . HIS A 1 68 ? 14.149  4.567   -5.908  1.00 0.00 ? 68  HIS A O    3  
ATOM   3301  C  CB   . HIS A 1 68 ? 10.974  4.404   -5.246  1.00 0.00 ? 68  HIS A CB   3  
ATOM   3302  C  CG   . HIS A 1 68 ? 10.841  4.863   -6.666  1.00 0.00 ? 68  HIS A CG   3  
ATOM   3303  N  ND1  . HIS A 1 68 ? 11.226  6.117   -7.091  1.00 0.00 ? 68  HIS A ND1  3  
ATOM   3304  C  CD2  . HIS A 1 68 ? 10.364  4.226   -7.760  1.00 0.00 ? 68  HIS A CD2  3  
ATOM   3305  C  CE1  . HIS A 1 68 ? 10.990  6.232   -8.385  1.00 0.00 ? 68  HIS A CE1  3  
ATOM   3306  N  NE2  . HIS A 1 68 ? 10.467  5.098   -8.816  1.00 0.00 ? 68  HIS A NE2  3  
ATOM   3307  H  H    . HIS A 1 68 ? 11.108  2.621   -3.417  1.00 0.00 ? 68  HIS A H    3  
ATOM   3308  H  HA   . HIS A 1 68 ? 12.294  2.825   -5.829  1.00 0.00 ? 68  HIS A HA   3  
ATOM   3309  H  HB2  . HIS A 1 68 ? 10.078  3.858   -4.989  1.00 0.00 ? 68  HIS A HB2  3  
ATOM   3310  H  HB3  . HIS A 1 68 ? 11.047  5.281   -4.619  1.00 0.00 ? 68  HIS A HB3  3  
ATOM   3311  H  HD1  . HIS A 1 68 ? 11.614  6.818   -6.527  1.00 0.00 ? 68  HIS A HD1  3  
ATOM   3312  H  HD2  . HIS A 1 68 ? 9.973   3.219   -7.798  1.00 0.00 ? 68  HIS A HD2  3  
ATOM   3313  H  HE1  . HIS A 1 68 ? 11.191  7.104   -8.990  1.00 0.00 ? 68  HIS A HE1  3  
ATOM   3314  N  N    . ASP A 1 69 ? 13.739  4.866   -3.717  1.00 0.00 ? 69  ASP A N    3  
ATOM   3315  C  CA   . ASP A 1 69 ? 14.917  5.698   -3.498  1.00 0.00 ? 69  ASP A CA   3  
ATOM   3316  C  C    . ASP A 1 69 ? 16.195  4.875   -3.625  1.00 0.00 ? 69  ASP A C    3  
ATOM   3317  O  O    . ASP A 1 69 ? 17.179  5.323   -4.213  1.00 0.00 ? 69  ASP A O    3  
ATOM   3318  C  CB   . ASP A 1 69 ? 14.854  6.355   -2.118  1.00 0.00 ? 69  ASP A CB   3  
ATOM   3319  C  CG   . ASP A 1 69 ? 13.848  7.488   -2.062  1.00 0.00 ? 69  ASP A CG   3  
ATOM   3320  O  OD1  . ASP A 1 69 ? 13.959  8.422   -2.884  1.00 0.00 ? 69  ASP A OD1  3  
ATOM   3321  O  OD2  . ASP A 1 69 ? 12.949  7.440   -1.196  1.00 0.00 ? 69  ASP A OD2  3  
ATOM   3322  H  H    . ASP A 1 69 ? 13.145  4.670   -2.962  1.00 0.00 ? 69  ASP A H    3  
ATOM   3323  H  HA   . ASP A 1 69 ? 14.923  6.469   -4.253  1.00 0.00 ? 69  ASP A HA   3  
ATOM   3324  H  HB2  . ASP A 1 69 ? 14.573  5.612   -1.385  1.00 0.00 ? 69  ASP A HB2  3  
ATOM   3325  H  HB3  . ASP A 1 69 ? 15.828  6.750   -1.870  1.00 0.00 ? 69  ASP A HB3  3  
ATOM   3326  N  N    . LYS A 1 70 ? 16.173  3.668   -3.069  1.00 0.00 ? 70  LYS A N    3  
ATOM   3327  C  CA   . LYS A 1 70 ? 17.330  2.781   -3.119  1.00 0.00 ? 70  LYS A CA   3  
ATOM   3328  C  C    . LYS A 1 70 ? 17.716  2.472   -4.562  1.00 0.00 ? 70  LYS A C    3  
ATOM   3329  O  O    . LYS A 1 70 ? 18.897  2.430   -4.903  1.00 0.00 ? 70  LYS A O    3  
ATOM   3330  C  CB   . LYS A 1 70 ? 17.033  1.480   -2.370  1.00 0.00 ? 70  LYS A CB   3  
ATOM   3331  C  CG   . LYS A 1 70 ? 16.700  1.686   -0.902  1.00 0.00 ? 70  LYS A CG   3  
ATOM   3332  C  CD   . LYS A 1 70 ? 16.919  0.416   -0.097  1.00 0.00 ? 70  LYS A CD   3  
ATOM   3333  C  CE   . LYS A 1 70 ? 15.667  -0.448  -0.068  1.00 0.00 ? 70  LYS A CE   3  
ATOM   3334  N  NZ   . LYS A 1 70 ? 14.591  0.161   0.761   1.00 0.00 ? 70  LYS A NZ   3  
ATOM   3335  H  H    . LYS A 1 70 ? 15.359  3.366   -2.613  1.00 0.00 ? 70  LYS A H    3  
ATOM   3336  H  HA   . LYS A 1 70 ? 18.155  3.284   -2.638  1.00 0.00 ? 70  LYS A HA   3  
ATOM   3337  H  HB2  . LYS A 1 70 ? 16.195  0.989   -2.842  1.00 0.00 ? 70  LYS A HB2  3  
ATOM   3338  H  HB3  . LYS A 1 70 ? 17.899  0.837   -2.433  1.00 0.00 ? 70  LYS A HB3  3  
ATOM   3339  H  HG2  . LYS A 1 70 ? 17.332  2.465   -0.504  1.00 0.00 ? 70  LYS A HG2  3  
ATOM   3340  H  HG3  . LYS A 1 70 ? 15.664  1.982   -0.816  1.00 0.00 ? 70  LYS A HG3  3  
ATOM   3341  H  HD2  . LYS A 1 70 ? 17.723  -0.149  -0.544  1.00 0.00 ? 70  LYS A HD2  3  
ATOM   3342  H  HD3  . LYS A 1 70 ? 17.184  0.684   0.916   1.00 0.00 ? 70  LYS A HD3  3  
ATOM   3343  H  HE2  . LYS A 1 70 ? 15.307  -0.570  -1.078  1.00 0.00 ? 70  LYS A HE2  3  
ATOM   3344  H  HE3  . LYS A 1 70 ? 15.923  -1.414  0.342   1.00 0.00 ? 70  LYS A HE3  3  
ATOM   3345  H  HZ1  . LYS A 1 70 ? 14.806  1.162   0.945   1.00 0.00 ? 70  LYS A HZ1  3  
ATOM   3346  H  HZ2  . LYS A 1 70 ? 14.514  -0.337  1.670   1.00 0.00 ? 70  LYS A HZ2  3  
ATOM   3347  H  HZ3  . LYS A 1 70 ? 13.679  0.099   0.265   1.00 0.00 ? 70  LYS A HZ3  3  
ATOM   3348  N  N    . MET A 1 71 ? 16.711  2.258   -5.406  1.00 0.00 ? 71  MET A N    3  
ATOM   3349  C  CA   . MET A 1 71 ? 16.947  1.956   -6.813  1.00 0.00 ? 71  MET A CA   3  
ATOM   3350  C  C    . MET A 1 71 ? 18.172  2.703   -7.332  1.00 0.00 ? 71  MET A C    3  
ATOM   3351  O  O    . MET A 1 71 ? 19.107  2.095   -7.851  1.00 0.00 ? 71  MET A O    3  
ATOM   3352  C  CB   . MET A 1 71 ? 15.719  2.325   -7.648  1.00 0.00 ? 71  MET A CB   3  
ATOM   3353  C  CG   . MET A 1 71 ? 14.464  1.564   -7.252  1.00 0.00 ? 71  MET A CG   3  
ATOM   3354  S  SD   . MET A 1 71 ? 14.559  -0.191  -7.655  1.00 0.00 ? 71  MET A SD   3  
ATOM   3355  C  CE   . MET A 1 71 ? 13.173  -0.829  -6.716  1.00 0.00 ? 71  MET A CE   3  
ATOM   3356  H  H    . MET A 1 71 ? 15.790  2.306   -5.075  1.00 0.00 ? 71  MET A H    3  
ATOM   3357  H  HA   . MET A 1 71 ? 17.124  0.895   -6.898  1.00 0.00 ? 71  MET A HA   3  
ATOM   3358  H  HB2  . MET A 1 71 ? 15.525  3.381   -7.535  1.00 0.00 ? 71  MET A HB2  3  
ATOM   3359  H  HB3  . MET A 1 71 ? 15.928  2.114   -8.687  1.00 0.00 ? 71  MET A HB3  3  
ATOM   3360  H  HG2  . MET A 1 71 ? 14.318  1.667   -6.187  1.00 0.00 ? 71  MET A HG2  3  
ATOM   3361  H  HG3  . MET A 1 71 ? 13.621  1.994   -7.772  1.00 0.00 ? 71  MET A HG3  3  
ATOM   3362  H  HE1  . MET A 1 71 ? 13.241  -1.905  -6.661  1.00 0.00 ? 71  MET A HE1  3  
ATOM   3363  H  HE2  . MET A 1 71 ? 13.193  -0.415  -5.719  1.00 0.00 ? 71  MET A HE2  3  
ATOM   3364  H  HE3  . MET A 1 71 ? 12.250  -0.551  -7.204  1.00 0.00 ? 71  MET A HE3  3  
ATOM   3365  N  N    . GLY A 1 72 ? 18.159  4.024   -7.187  1.00 0.00 ? 72  GLY A N    3  
ATOM   3366  C  CA   . GLY A 1 72 ? 19.275  4.832   -7.647  1.00 0.00 ? 72  GLY A CA   3  
ATOM   3367  C  C    . GLY A 1 72 ? 20.611  4.152   -7.427  1.00 0.00 ? 72  GLY A C    3  
ATOM   3368  O  O    . GLY A 1 72 ? 21.426  4.057   -8.345  1.00 0.00 ? 72  GLY A O    3  
ATOM   3369  H  H    . GLY A 1 72 ? 17.386  4.455   -6.766  1.00 0.00 ? 72  GLY A H    3  
ATOM   3370  H  HA2  . GLY A 1 72 ? 19.152  5.029   -8.701  1.00 0.00 ? 72  GLY A HA2  3  
ATOM   3371  H  HA3  . GLY A 1 72 ? 19.269  5.770   -7.112  1.00 0.00 ? 72  GLY A HA3  3  
ATOM   3372  N  N    . VAL A 1 73 ? 20.839  3.678   -6.206  1.00 0.00 ? 73  VAL A N    3  
ATOM   3373  C  CA   . VAL A 1 73 ? 22.087  3.004   -5.868  1.00 0.00 ? 73  VAL A CA   3  
ATOM   3374  C  C    . VAL A 1 73 ? 21.980  1.501   -6.101  1.00 0.00 ? 73  VAL A C    3  
ATOM   3375  O  O    . VAL A 1 73 ? 20.912  0.911   -5.938  1.00 0.00 ? 73  VAL A O    3  
ATOM   3376  C  CB   . VAL A 1 73 ? 22.483  3.258   -4.402  1.00 0.00 ? 73  VAL A CB   3  
ATOM   3377  C  CG1  . VAL A 1 73 ? 22.661  4.747   -4.147  1.00 0.00 ? 73  VAL A CG1  3  
ATOM   3378  C  CG2  . VAL A 1 73 ? 21.444  2.669   -3.460  1.00 0.00 ? 73  VAL A CG2  3  
ATOM   3379  H  H    . VAL A 1 73 ? 20.151  3.783   -5.517  1.00 0.00 ? 73  VAL A H    3  
ATOM   3380  H  HA   . VAL A 1 73 ? 22.864  3.402   -6.504  1.00 0.00 ? 73  VAL A HA   3  
ATOM   3381  H  HB   . VAL A 1 73 ? 23.427  2.768   -4.215  1.00 0.00 ? 73  VAL A HB   3  
ATOM   3382  H  HG11 . VAL A 1 73 ? 21.694  5.204   -3.995  1.00 0.00 ? 73  VAL A HG11 3  
ATOM   3383  H  HG12 . VAL A 1 73 ? 23.272  4.892   -3.269  1.00 0.00 ? 73  VAL A HG12 3  
ATOM   3384  H  HG13 . VAL A 1 73 ? 23.143  5.203   -5.000  1.00 0.00 ? 73  VAL A HG13 3  
ATOM   3385  H  HG21 . VAL A 1 73 ? 20.519  3.215   -3.558  1.00 0.00 ? 73  VAL A HG21 3  
ATOM   3386  H  HG22 . VAL A 1 73 ? 21.278  1.631   -3.710  1.00 0.00 ? 73  VAL A HG22 3  
ATOM   3387  H  HG23 . VAL A 1 73 ? 21.799  2.740   -2.442  1.00 0.00 ? 73  VAL A HG23 3  
ATOM   3388  N  N    . SER A 1 74 ? 23.095  0.886   -6.482  1.00 0.00 ? 74  SER A N    3  
ATOM   3389  C  CA   . SER A 1 74 ? 23.126  -0.549  -6.740  1.00 0.00 ? 74  SER A CA   3  
ATOM   3390  C  C    . SER A 1 74 ? 22.332  -1.309  -5.682  1.00 0.00 ? 74  SER A C    3  
ATOM   3391  O  O    . SER A 1 74 ? 22.496  -1.082  -4.484  1.00 0.00 ? 74  SER A O    3  
ATOM   3392  C  CB   . SER A 1 74 ? 24.571  -1.052  -6.768  1.00 0.00 ? 74  SER A CB   3  
ATOM   3393  O  OG   . SER A 1 74 ? 24.619  -2.468  -6.728  1.00 0.00 ? 74  SER A OG   3  
ATOM   3394  H  H    . SER A 1 74 ? 23.915  1.410   -6.594  1.00 0.00 ? 74  SER A H    3  
ATOM   3395  H  HA   . SER A 1 74 ? 22.675  -0.722  -7.706  1.00 0.00 ? 74  SER A HA   3  
ATOM   3396  H  HB2  . SER A 1 74 ? 25.050  -0.714  -7.675  1.00 0.00 ? 74  SER A HB2  3  
ATOM   3397  H  HB3  . SER A 1 74 ? 25.102  -0.661  -5.913  1.00 0.00 ? 74  SER A HB3  3  
ATOM   3398  H  HG   . SER A 1 74 ? 23.754  -2.824  -6.943  1.00 0.00 ? 74  SER A HG   3  
ATOM   3399  N  N    . GLY A 1 75 ? 21.470  -2.214  -6.135  1.00 0.00 ? 75  GLY A N    3  
ATOM   3400  C  CA   . GLY A 1 75 ? 20.662  -2.995  -5.216  1.00 0.00 ? 75  GLY A CA   3  
ATOM   3401  C  C    . GLY A 1 75 ? 20.644  -4.469  -5.568  1.00 0.00 ? 75  GLY A C    3  
ATOM   3402  O  O    . GLY A 1 75 ? 21.473  -4.956  -6.337  1.00 0.00 ? 75  GLY A O    3  
ATOM   3403  H  H    . GLY A 1 75 ? 21.381  -2.353  -7.101  1.00 0.00 ? 75  GLY A H    3  
ATOM   3404  H  HA2  . GLY A 1 75 ? 21.058  -2.878  -4.218  1.00 0.00 ? 75  GLY A HA2  3  
ATOM   3405  H  HA3  . GLY A 1 75 ? 19.649  -2.619  -5.237  1.00 0.00 ? 75  GLY A HA3  3  
ATOM   3406  N  N    . PRO A 1 76 ? 19.682  -5.207  -4.995  1.00 0.00 ? 76  PRO A N    3  
ATOM   3407  C  CA   . PRO A 1 76 ? 19.537  -6.645  -5.236  1.00 0.00 ? 76  PRO A CA   3  
ATOM   3408  C  C    . PRO A 1 76 ? 19.064  -6.950  -6.653  1.00 0.00 ? 76  PRO A C    3  
ATOM   3409  O  O    . PRO A 1 76 ? 18.916  -8.112  -7.032  1.00 0.00 ? 76  PRO A O    3  
ATOM   3410  C  CB   . PRO A 1 76 ? 18.479  -7.072  -4.215  1.00 0.00 ? 76  PRO A CB   3  
ATOM   3411  C  CG   . PRO A 1 76 ? 17.691  -5.836  -3.948  1.00 0.00 ? 76  PRO A CG   3  
ATOM   3412  C  CD   . PRO A 1 76 ? 18.660  -4.693  -4.067  1.00 0.00 ? 76  PRO A CD   3  
ATOM   3413  H  HA   . PRO A 1 76 ? 20.459  -7.174  -5.044  1.00 0.00 ? 76  PRO A HA   3  
ATOM   3414  H  HB2  . PRO A 1 76 ? 17.862  -7.852  -4.638  1.00 0.00 ? 76  PRO A HB2  3  
ATOM   3415  H  HB3  . PRO A 1 76 ? 18.963  -7.433  -3.320  1.00 0.00 ? 76  PRO A HB3  3  
ATOM   3416  H  HG2  . PRO A 1 76 ? 16.903  -5.738  -4.680  1.00 0.00 ? 76  PRO A HG2  3  
ATOM   3417  H  HG3  . PRO A 1 76 ? 17.277  -5.874  -2.951  1.00 0.00 ? 76  PRO A HG3  3  
ATOM   3418  H  HD2  . PRO A 1 76 ? 18.169  -3.823  -4.478  1.00 0.00 ? 76  PRO A HD2  3  
ATOM   3419  H  HD3  . PRO A 1 76 ? 19.094  -4.464  -3.105  1.00 0.00 ? 76  PRO A HD3  3  
ATOM   3420  N  N    . SER A 1 77 ? 18.827  -5.900  -7.432  1.00 0.00 ? 77  SER A N    3  
ATOM   3421  C  CA   . SER A 1 77 ? 18.367  -6.056  -8.807  1.00 0.00 ? 77  SER A CA   3  
ATOM   3422  C  C    . SER A 1 77 ? 19.431  -5.584  -9.793  1.00 0.00 ? 77  SER A C    3  
ATOM   3423  O  O    . SER A 1 77 ? 19.468  -4.413  -10.170 1.00 0.00 ? 77  SER A O    3  
ATOM   3424  C  CB   . SER A 1 77 ? 17.071  -5.273  -9.025  1.00 0.00 ? 77  SER A CB   3  
ATOM   3425  O  OG   . SER A 1 77 ? 16.096  -5.620  -8.056  1.00 0.00 ? 77  SER A OG   3  
ATOM   3426  H  H    . SER A 1 77 ? 18.964  -4.998  -7.073  1.00 0.00 ? 77  SER A H    3  
ATOM   3427  H  HA   . SER A 1 77 ? 18.177  -7.105  -8.976  1.00 0.00 ? 77  SER A HA   3  
ATOM   3428  H  HB2  . SER A 1 77 ? 17.275  -4.216  -8.951  1.00 0.00 ? 77  SER A HB2  3  
ATOM   3429  H  HB3  . SER A 1 77 ? 16.680  -5.496  -10.008 1.00 0.00 ? 77  SER A HB3  3  
ATOM   3430  H  HG   . SER A 1 77 ? 15.369  -4.995  -8.096  1.00 0.00 ? 77  SER A HG   3  
ATOM   3431  N  N    . SER A 1 78 ? 20.296  -6.505  -10.207 1.00 0.00 ? 78  SER A N    3  
ATOM   3432  C  CA   . SER A 1 78 ? 21.364  -6.184  -11.146 1.00 0.00 ? 78  SER A CA   3  
ATOM   3433  C  C    . SER A 1 78 ? 21.346  -7.138  -12.336 1.00 0.00 ? 78  SER A C    3  
ATOM   3434  O  O    . SER A 1 78 ? 21.827  -8.267  -12.249 1.00 0.00 ? 78  SER A O    3  
ATOM   3435  C  CB   . SER A 1 78 ? 22.723  -6.248  -10.447 1.00 0.00 ? 78  SER A CB   3  
ATOM   3436  O  OG   . SER A 1 78 ? 23.773  -5.921  -11.341 1.00 0.00 ? 78  SER A OG   3  
ATOM   3437  H  H    . SER A 1 78 ? 20.214  -7.422  -9.870  1.00 0.00 ? 78  SER A H    3  
ATOM   3438  H  HA   . SER A 1 78 ? 21.200  -5.178  -11.503 1.00 0.00 ? 78  SER A HA   3  
ATOM   3439  H  HB2  . SER A 1 78 ? 22.736  -5.549  -9.625  1.00 0.00 ? 78  SER A HB2  3  
ATOM   3440  H  HB3  . SER A 1 78 ? 22.885  -7.249  -10.072 1.00 0.00 ? 78  SER A HB3  3  
ATOM   3441  H  HG   . SER A 1 78 ? 23.420  -5.415  -12.077 1.00 0.00 ? 78  SER A HG   3  
ATOM   3442  N  N    . GLY A 1 79 ? 20.786  -6.675  -13.450 1.00 0.00 ? 79  GLY A N    3  
ATOM   3443  C  CA   . GLY A 1 79 ? 20.714  -7.499  -14.642 1.00 0.00 ? 79  GLY A CA   3  
ATOM   3444  C  C    . GLY A 1 79 ? 19.291  -7.877  -15.001 1.00 0.00 ? 79  GLY A C    3  
ATOM   3445  O  O    . GLY A 1 79 ? 18.759  -7.351  -15.977 1.00 0.00 ? 79  GLY A O    3  
ATOM   3446  H  H    . GLY A 1 79 ? 20.418  -5.767  -13.461 1.00 0.00 ? 79  GLY A H    3  
ATOM   3447  H  HA2  . GLY A 1 79 ? 21.150  -6.957  -15.468 1.00 0.00 ? 79  GLY A HA2  3  
ATOM   3448  H  HA3  . GLY A 1 79 ? 21.283  -8.402  -14.477 1.00 0.00 ? 79  GLY A HA3  3  
HETATM 3449  ZN ZN   . ZN  B 2 .  ? -9.872  -0.366  -2.233  1.00 0.00 ? 201 ZN  A ZN   3  
HETATM 3450  ZN ZN   . ZN  C 2 .  ? 9.558   -1.268  -0.520  1.00 0.00 ? 401 ZN  A ZN   3  
ATOM   3451  N  N    . GLY A 1 1  ? -27.301 6.587   -42.756 1.00 0.00 ? 1   GLY A N    4  
ATOM   3452  C  CA   . GLY A 1 1  ? -28.509 7.228   -42.270 1.00 0.00 ? 1   GLY A CA   4  
ATOM   3453  C  C    . GLY A 1 1  ? -28.218 8.334   -41.275 1.00 0.00 ? 1   GLY A C    4  
ATOM   3454  O  O    . GLY A 1 1  ? -27.096 8.457   -40.785 1.00 0.00 ? 1   GLY A O    4  
ATOM   3455  H  H1   . GLY A 1 1  ? -27.352 5.946   -43.497 1.00 0.00 ? 1   GLY A H1   4  
ATOM   3456  H  HA2  . GLY A 1 1  ? -29.045 7.645   -43.109 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   3457  H  HA3  . GLY A 1 1  ? -29.130 6.484   -41.792 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   3458  N  N    . SER A 1 2  ? -29.231 9.142   -40.977 1.00 0.00 ? 2   SER A N    4  
ATOM   3459  C  CA   . SER A 1 2  ? -29.076 10.247  -40.039 1.00 0.00 ? 2   SER A CA   4  
ATOM   3460  C  C    . SER A 1 2  ? -29.303 9.777   -38.605 1.00 0.00 ? 2   SER A C    4  
ATOM   3461  O  O    . SER A 1 2  ? -30.008 8.797   -38.365 1.00 0.00 ? 2   SER A O    4  
ATOM   3462  C  CB   . SER A 1 2  ? -30.055 11.373  -40.379 1.00 0.00 ? 2   SER A CB   4  
ATOM   3463  O  OG   . SER A 1 2  ? -29.783 12.533  -39.612 1.00 0.00 ? 2   SER A OG   4  
ATOM   3464  H  H    . SER A 1 2  ? -30.101 8.992   -41.402 1.00 0.00 ? 2   SER A H    4  
ATOM   3465  H  HA   . SER A 1 2  ? -28.067 10.619  -40.128 1.00 0.00 ? 2   SER A HA   4  
ATOM   3466  H  HB2  . SER A 1 2  ? -29.966 11.619  -41.426 1.00 0.00 ? 2   SER A HB2  4  
ATOM   3467  H  HB3  . SER A 1 2  ? -31.063 11.045  -40.170 1.00 0.00 ? 2   SER A HB3  4  
ATOM   3468  H  HG   . SER A 1 2  ? -28.943 12.909  -39.887 1.00 0.00 ? 2   SER A HG   4  
ATOM   3469  N  N    . SER A 1 3  ? -28.698 10.484  -37.655 1.00 0.00 ? 3   SER A N    4  
ATOM   3470  C  CA   . SER A 1 3  ? -28.830 10.138  -36.245 1.00 0.00 ? 3   SER A CA   4  
ATOM   3471  C  C    . SER A 1 3  ? -28.209 11.216  -35.361 1.00 0.00 ? 3   SER A C    4  
ATOM   3472  O  O    . SER A 1 3  ? -27.136 11.738  -35.661 1.00 0.00 ? 3   SER A O    4  
ATOM   3473  C  CB   . SER A 1 3  ? -28.166 8.788   -35.964 1.00 0.00 ? 3   SER A CB   4  
ATOM   3474  O  OG   . SER A 1 3  ? -28.566 8.275   -34.706 1.00 0.00 ? 3   SER A OG   4  
ATOM   3475  H  H    . SER A 1 3  ? -28.149 11.255  -37.910 1.00 0.00 ? 3   SER A H    4  
ATOM   3476  H  HA   . SER A 1 3  ? -29.883 10.066  -36.018 1.00 0.00 ? 3   SER A HA   4  
ATOM   3477  H  HB2  . SER A 1 3  ? -28.449 8.085   -36.733 1.00 0.00 ? 3   SER A HB2  4  
ATOM   3478  H  HB3  . SER A 1 3  ? -27.093 8.911   -35.965 1.00 0.00 ? 3   SER A HB3  4  
ATOM   3479  H  HG   . SER A 1 3  ? -28.023 8.661   -34.015 1.00 0.00 ? 3   SER A HG   4  
ATOM   3480  N  N    . GLY A 1 4  ? -28.893 11.544  -34.269 1.00 0.00 ? 4   GLY A N    4  
ATOM   3481  C  CA   . GLY A 1 4  ? -28.394 12.557  -33.358 1.00 0.00 ? 4   GLY A CA   4  
ATOM   3482  C  C    . GLY A 1 4  ? -29.316 12.778  -32.175 1.00 0.00 ? 4   GLY A C    4  
ATOM   3483  O  O    . GLY A 1 4  ? -29.973 13.815  -32.077 1.00 0.00 ? 4   GLY A O    4  
ATOM   3484  H  H    . GLY A 1 4  ? -29.743 11.094  -34.080 1.00 0.00 ? 4   GLY A H    4  
ATOM   3485  H  HA2  . GLY A 1 4  ? -27.425 12.253  -32.993 1.00 0.00 ? 4   GLY A HA2  4  
ATOM   3486  H  HA3  . GLY A 1 4  ? -28.288 13.488  -33.896 1.00 0.00 ? 4   GLY A HA3  4  
ATOM   3487  N  N    . SER A 1 5  ? -29.367 11.801  -31.276 1.00 0.00 ? 5   SER A N    4  
ATOM   3488  C  CA   . SER A 1 5  ? -30.220 11.891  -30.097 1.00 0.00 ? 5   SER A CA   4  
ATOM   3489  C  C    . SER A 1 5  ? -29.473 11.430  -28.849 1.00 0.00 ? 5   SER A C    4  
ATOM   3490  O  O    . SER A 1 5  ? -29.024 10.287  -28.768 1.00 0.00 ? 5   SER A O    4  
ATOM   3491  C  CB   . SER A 1 5  ? -31.483 11.050  -30.289 1.00 0.00 ? 5   SER A CB   4  
ATOM   3492  O  OG   . SER A 1 5  ? -32.298 11.582  -31.319 1.00 0.00 ? 5   SER A OG   4  
ATOM   3493  H  H    . SER A 1 5  ? -28.819 11.000  -31.410 1.00 0.00 ? 5   SER A H    4  
ATOM   3494  H  HA   . SER A 1 5  ? -30.503 12.926  -29.970 1.00 0.00 ? 5   SER A HA   4  
ATOM   3495  H  HB2  . SER A 1 5  ? -31.204 10.041  -30.553 1.00 0.00 ? 5   SER A HB2  4  
ATOM   3496  H  HB3  . SER A 1 5  ? -32.049 11.038  -29.369 1.00 0.00 ? 5   SER A HB3  4  
ATOM   3497  H  HG   . SER A 1 5  ? -32.300 12.540  -31.263 1.00 0.00 ? 5   SER A HG   4  
ATOM   3498  N  N    . SER A 1 6  ? -29.344 12.328  -27.878 1.00 0.00 ? 6   SER A N    4  
ATOM   3499  C  CA   . SER A 1 6  ? -28.649 12.016  -26.635 1.00 0.00 ? 6   SER A CA   4  
ATOM   3500  C  C    . SER A 1 6  ? -29.029 13.004  -25.536 1.00 0.00 ? 6   SER A C    4  
ATOM   3501  O  O    . SER A 1 6  ? -29.590 14.065  -25.807 1.00 0.00 ? 6   SER A O    4  
ATOM   3502  C  CB   . SER A 1 6  ? -27.135 12.038  -26.854 1.00 0.00 ? 6   SER A CB   4  
ATOM   3503  O  OG   . SER A 1 6  ? -26.695 13.326  -27.248 1.00 0.00 ? 6   SER A OG   4  
ATOM   3504  H  H    . SER A 1 6  ? -29.724 13.223  -28.002 1.00 0.00 ? 6   SER A H    4  
ATOM   3505  H  HA   . SER A 1 6  ? -28.945 11.024  -26.329 1.00 0.00 ? 6   SER A HA   4  
ATOM   3506  H  HB2  . SER A 1 6  ? -26.637 11.766  -25.936 1.00 0.00 ? 6   SER A HB2  4  
ATOM   3507  H  HB3  . SER A 1 6  ? -26.875 11.329  -27.627 1.00 0.00 ? 6   SER A HB3  4  
ATOM   3508  H  HG   . SER A 1 6  ? -26.281 13.766  -26.501 1.00 0.00 ? 6   SER A HG   4  
ATOM   3509  N  N    . GLY A 1 7  ? -28.720 12.645  -24.294 1.00 0.00 ? 7   GLY A N    4  
ATOM   3510  C  CA   . GLY A 1 7  ? -29.037 13.510  -23.172 1.00 0.00 ? 7   GLY A CA   4  
ATOM   3511  C  C    . GLY A 1 7  ? -28.983 12.780  -21.844 1.00 0.00 ? 7   GLY A C    4  
ATOM   3512  O  O    . GLY A 1 7  ? -29.720 11.819  -21.628 1.00 0.00 ? 7   GLY A O    4  
ATOM   3513  H  H    . GLY A 1 7  ? -28.273 11.787  -24.138 1.00 0.00 ? 7   GLY A H    4  
ATOM   3514  H  HA2  . GLY A 1 7  ? -28.331 14.327  -23.150 1.00 0.00 ? 7   GLY A HA2  4  
ATOM   3515  H  HA3  . GLY A 1 7  ? -30.030 13.910  -23.310 1.00 0.00 ? 7   GLY A HA3  4  
ATOM   3516  N  N    . GLU A 1 8  ? -28.107 13.237  -20.954 1.00 0.00 ? 8   GLU A N    4  
ATOM   3517  C  CA   . GLU A 1 8  ? -27.960 12.618  -19.642 1.00 0.00 ? 8   GLU A CA   4  
ATOM   3518  C  C    . GLU A 1 8  ? -27.223 13.548  -18.682 1.00 0.00 ? 8   GLU A C    4  
ATOM   3519  O  O    . GLU A 1 8  ? -26.349 14.313  -19.089 1.00 0.00 ? 8   GLU A O    4  
ATOM   3520  C  CB   . GLU A 1 8  ? -27.208 11.290  -19.762 1.00 0.00 ? 8   GLU A CB   4  
ATOM   3521  C  CG   . GLU A 1 8  ? -25.818 11.430  -20.360 1.00 0.00 ? 8   GLU A CG   4  
ATOM   3522  C  CD   . GLU A 1 8  ? -24.915 10.261  -20.017 1.00 0.00 ? 8   GLU A CD   4  
ATOM   3523  O  OE1  . GLU A 1 8  ? -24.942 9.253   -20.754 1.00 0.00 ? 8   GLU A OE1  4  
ATOM   3524  O  OE2  . GLU A 1 8  ? -24.181 10.354  -19.011 1.00 0.00 ? 8   GLU A OE2  4  
ATOM   3525  H  H    . GLU A 1 8  ? -27.547 14.007  -21.186 1.00 0.00 ? 8   GLU A H    4  
ATOM   3526  H  HA   . GLU A 1 8  ? -28.948 12.427  -19.252 1.00 0.00 ? 8   GLU A HA   4  
ATOM   3527  H  HB2  . GLU A 1 8  ? -27.112 10.855  -18.778 1.00 0.00 ? 8   GLU A HB2  4  
ATOM   3528  H  HB3  . GLU A 1 8  ? -27.780 10.622  -20.387 1.00 0.00 ? 8   GLU A HB3  4  
ATOM   3529  H  HG2  . GLU A 1 8  ? -25.907 11.492  -21.434 1.00 0.00 ? 8   GLU A HG2  4  
ATOM   3530  H  HG3  . GLU A 1 8  ? -25.367 12.336  -19.984 1.00 0.00 ? 8   GLU A HG3  4  
ATOM   3531  N  N    . LYS A 1 9  ? -27.584 13.476  -17.405 1.00 0.00 ? 9   LYS A N    4  
ATOM   3532  C  CA   . LYS A 1 9  ? -26.958 14.309  -16.385 1.00 0.00 ? 9   LYS A CA   4  
ATOM   3533  C  C    . LYS A 1 9  ? -26.134 13.462  -15.421 1.00 0.00 ? 9   LYS A C    4  
ATOM   3534  O  O    . LYS A 1 9  ? -26.291 12.243  -15.361 1.00 0.00 ? 9   LYS A O    4  
ATOM   3535  C  CB   . LYS A 1 9  ? -28.023 15.091  -15.613 1.00 0.00 ? 9   LYS A CB   4  
ATOM   3536  C  CG   . LYS A 1 9  ? -28.718 14.273  -14.538 1.00 0.00 ? 9   LYS A CG   4  
ATOM   3537  C  CD   . LYS A 1 9  ? -29.966 13.592  -15.074 1.00 0.00 ? 9   LYS A CD   4  
ATOM   3538  C  CE   . LYS A 1 9  ? -31.160 14.534  -15.070 1.00 0.00 ? 9   LYS A CE   4  
ATOM   3539  N  NZ   . LYS A 1 9  ? -31.556 14.923  -13.688 1.00 0.00 ? 9   LYS A NZ   4  
ATOM   3540  H  H    . LYS A 1 9  ? -28.287 12.846  -17.142 1.00 0.00 ? 9   LYS A H    4  
ATOM   3541  H  HA   . LYS A 1 9  ? -26.302 15.007  -16.883 1.00 0.00 ? 9   LYS A HA   4  
ATOM   3542  H  HB2  . LYS A 1 9  ? -27.556 15.943  -15.142 1.00 0.00 ? 9   LYS A HB2  4  
ATOM   3543  H  HB3  . LYS A 1 9  ? -28.772 15.440  -16.309 1.00 0.00 ? 9   LYS A HB3  4  
ATOM   3544  H  HG2  . LYS A 1 9  ? -28.036 13.517  -14.176 1.00 0.00 ? 9   LYS A HG2  4  
ATOM   3545  H  HG3  . LYS A 1 9  ? -28.997 14.927  -13.724 1.00 0.00 ? 9   LYS A HG3  4  
ATOM   3546  H  HD2  . LYS A 1 9  ? -29.781 13.267  -16.087 1.00 0.00 ? 9   LYS A HD2  4  
ATOM   3547  H  HD3  . LYS A 1 9  ? -30.192 12.736  -14.455 1.00 0.00 ? 9   LYS A HD3  4  
ATOM   3548  H  HE2  . LYS A 1 9  ? -30.902 15.424  -15.625 1.00 0.00 ? 9   LYS A HE2  4  
ATOM   3549  H  HE3  . LYS A 1 9  ? -31.992 14.041  -15.549 1.00 0.00 ? 9   LYS A HE3  4  
ATOM   3550  H  HZ1  . LYS A 1 9  ? -31.225 15.887  -13.480 1.00 0.00 ? 9   LYS A HZ1  4  
ATOM   3551  H  HZ2  . LYS A 1 9  ? -31.136 14.267  -12.999 1.00 0.00 ? 9   LYS A HZ2  4  
ATOM   3552  H  HZ3  . LYS A 1 9  ? -32.591 14.895  -13.592 1.00 0.00 ? 9   LYS A HZ3  4  
ATOM   3553  N  N    . ALA A 1 10 ? -25.257 14.117  -14.666 1.00 0.00 ? 10  ALA A N    4  
ATOM   3554  C  CA   . ALA A 1 10 ? -24.412 13.424  -13.702 1.00 0.00 ? 10  ALA A CA   4  
ATOM   3555  C  C    . ALA A 1 10 ? -23.800 14.403  -12.706 1.00 0.00 ? 10  ALA A C    4  
ATOM   3556  O  O    . ALA A 1 10 ? -23.381 15.499  -13.076 1.00 0.00 ? 10  ALA A O    4  
ATOM   3557  C  CB   . ALA A 1 10 ? -23.319 12.647  -14.421 1.00 0.00 ? 10  ALA A CB   4  
ATOM   3558  H  H    . ALA A 1 10 ? -25.179 15.089  -14.760 1.00 0.00 ? 10  ALA A H    4  
ATOM   3559  H  HA   . ALA A 1 10 ? -25.028 12.717  -13.165 1.00 0.00 ? 10  ALA A HA   4  
ATOM   3560  H  HB1  . ALA A 1 10 ? -22.450 12.576  -13.783 1.00 0.00 ? 10  ALA A HB1  4  
ATOM   3561  H  HB2  . ALA A 1 10 ? -23.676 11.655  -14.654 1.00 0.00 ? 10  ALA A HB2  4  
ATOM   3562  H  HB3  . ALA A 1 10 ? -23.055 13.159  -15.334 1.00 0.00 ? 10  ALA A HB3  4  
ATOM   3563  N  N    . ARG A 1 11 ? -23.753 14.000  -11.440 1.00 0.00 ? 11  ARG A N    4  
ATOM   3564  C  CA   . ARG A 1 11 ? -23.194 14.842  -10.390 1.00 0.00 ? 11  ARG A CA   4  
ATOM   3565  C  C    . ARG A 1 11 ? -22.078 14.115  -9.646  1.00 0.00 ? 11  ARG A C    4  
ATOM   3566  O  O    . ARG A 1 11 ? -22.336 13.251  -8.809  1.00 0.00 ? 11  ARG A O    4  
ATOM   3567  C  CB   . ARG A 1 11 ? -24.288 15.262  -9.407  1.00 0.00 ? 11  ARG A CB   4  
ATOM   3568  C  CG   . ARG A 1 11 ? -25.353 16.153  -10.024 1.00 0.00 ? 11  ARG A CG   4  
ATOM   3569  C  CD   . ARG A 1 11 ? -26.562 16.290  -9.112  1.00 0.00 ? 11  ARG A CD   4  
ATOM   3570  N  NE   . ARG A 1 11 ? -27.256 17.560  -9.311  1.00 0.00 ? 11  ARG A NE   4  
ATOM   3571  C  CZ   . ARG A 1 11 ? -26.877 18.701  -8.748  1.00 0.00 ? 11  ARG A CZ   4  
ATOM   3572  N  NH1  . ARG A 1 11 ? -25.814 18.732  -7.955  1.00 0.00 ? 11  ARG A NH1  4  
ATOM   3573  N  NH2  . ARG A 1 11 ? -27.560 19.815  -8.977  1.00 0.00 ? 11  ARG A NH2  4  
ATOM   3574  H  H    . ARG A 1 11 ? -24.103 13.115  -11.207 1.00 0.00 ? 11  ARG A H    4  
ATOM   3575  H  HA   . ARG A 1 11 ? -22.784 15.726  -10.857 1.00 0.00 ? 11  ARG A HA   4  
ATOM   3576  H  HB2  . ARG A 1 11 ? -24.771 14.375  -9.023  1.00 0.00 ? 11  ARG A HB2  4  
ATOM   3577  H  HB3  . ARG A 1 11 ? -23.832 15.797  -8.587  1.00 0.00 ? 11  ARG A HB3  4  
ATOM   3578  H  HG2  . ARG A 1 11 ? -24.933 17.133  -10.197 1.00 0.00 ? 11  ARG A HG2  4  
ATOM   3579  H  HG3  . ARG A 1 11 ? -25.668 15.724  -10.963 1.00 0.00 ? 11  ARG A HG3  4  
ATOM   3580  H  HD2  . ARG A 1 11 ? -27.246 15.481  -9.319  1.00 0.00 ? 11  ARG A HD2  4  
ATOM   3581  H  HD3  . ARG A 1 11 ? -26.231 16.228  -8.086  1.00 0.00 ? 11  ARG A HD3  4  
ATOM   3582  H  HE   . ARG A 1 11 ? -28.044 17.560  -9.893  1.00 0.00 ? 11  ARG A HE   4  
ATOM   3583  H  HH11 . ARG A 1 11 ? -25.296 17.894  -7.782  1.00 0.00 ? 11  ARG A HH11 4  
ATOM   3584  H  HH12 . ARG A 1 11 ? -25.529 19.593  -7.533  1.00 0.00 ? 11  ARG A HH12 4  
ATOM   3585  H  HH21 . ARG A 1 11 ? -28.361 19.796  -9.574  1.00 0.00 ? 11  ARG A HH21 4  
ATOM   3586  H  HH22 . ARG A 1 11 ? -27.274 20.674  -8.553  1.00 0.00 ? 11  ARG A HH22 4  
ATOM   3587  N  N    . GLY A 1 12 ? -20.835 14.472  -9.958  1.00 0.00 ? 12  GLY A N    4  
ATOM   3588  C  CA   . GLY A 1 12 ? -19.698 13.844  -9.311  1.00 0.00 ? 12  GLY A CA   4  
ATOM   3589  C  C    . GLY A 1 12 ? -19.051 14.742  -8.275  1.00 0.00 ? 12  GLY A C    4  
ATOM   3590  O  O    . GLY A 1 12 ? -18.318 15.671  -8.619  1.00 0.00 ? 12  GLY A O    4  
ATOM   3591  H  H    . GLY A 1 12 ? -20.689 15.167  -10.633 1.00 0.00 ? 12  GLY A H    4  
ATOM   3592  H  HA2  . GLY A 1 12 ? -20.029 12.936  -8.829  1.00 0.00 ? 12  GLY A HA2  4  
ATOM   3593  H  HA3  . GLY A 1 12 ? -18.964 13.593  -10.062 1.00 0.00 ? 12  GLY A HA3  4  
ATOM   3594  N  N    . LEU A 1 13 ? -19.322 14.467  -7.004  1.00 0.00 ? 13  LEU A N    4  
ATOM   3595  C  CA   . LEU A 1 13 ? -18.762 15.259  -5.914  1.00 0.00 ? 13  LEU A CA   4  
ATOM   3596  C  C    . LEU A 1 13 ? -18.633 14.424  -4.645  1.00 0.00 ? 13  LEU A C    4  
ATOM   3597  O  O    . LEU A 1 13 ? -19.632 13.994  -4.068  1.00 0.00 ? 13  LEU A O    4  
ATOM   3598  C  CB   . LEU A 1 13 ? -19.637 16.484  -5.646  1.00 0.00 ? 13  LEU A CB   4  
ATOM   3599  C  CG   . LEU A 1 13 ? -19.425 17.678  -6.578  1.00 0.00 ? 13  LEU A CG   4  
ATOM   3600  C  CD1  . LEU A 1 13 ? -20.439 18.772  -6.283  1.00 0.00 ? 13  LEU A CD1  4  
ATOM   3601  C  CD2  . LEU A 1 13 ? -18.007 18.213  -6.446  1.00 0.00 ? 13  LEU A CD2  4  
ATOM   3602  H  H    . LEU A 1 13 ? -19.912 13.715  -6.792  1.00 0.00 ? 13  LEU A H    4  
ATOM   3603  H  HA   . LEU A 1 13 ? -17.779 15.588  -6.216  1.00 0.00 ? 13  LEU A HA   4  
ATOM   3604  H  HB2  . LEU A 1 13 ? -20.669 16.179  -5.730  1.00 0.00 ? 13  LEU A HB2  4  
ATOM   3605  H  HB3  . LEU A 1 13 ? -19.442 16.814  -4.635  1.00 0.00 ? 13  LEU A HB3  4  
ATOM   3606  H  HG   . LEU A 1 13 ? -19.569 17.358  -7.601  1.00 0.00 ? 13  LEU A HG   4  
ATOM   3607  H  HD11 . LEU A 1 13 ? -21.362 18.558  -6.800  1.00 0.00 ? 13  LEU A HD11 4  
ATOM   3608  H  HD12 . LEU A 1 13 ? -20.051 19.723  -6.618  1.00 0.00 ? 13  LEU A HD12 4  
ATOM   3609  H  HD13 . LEU A 1 13 ? -20.623 18.815  -5.219  1.00 0.00 ? 13  LEU A HD13 4  
ATOM   3610  H  HD21 . LEU A 1 13 ? -17.899 19.100  -7.052  1.00 0.00 ? 13  LEU A HD21 4  
ATOM   3611  H  HD22 . LEU A 1 13 ? -17.306 17.461  -6.781  1.00 0.00 ? 13  LEU A HD22 4  
ATOM   3612  H  HD23 . LEU A 1 13 ? -17.808 18.455  -5.413  1.00 0.00 ? 13  LEU A HD23 4  
ATOM   3613  N  N    . GLY A 1 14 ? -17.396 14.199  -4.213  1.00 0.00 ? 14  GLY A N    4  
ATOM   3614  C  CA   . GLY A 1 14 ? -17.160 13.417  -3.013  1.00 0.00 ? 14  GLY A CA   4  
ATOM   3615  C  C    . GLY A 1 14 ? -15.695 13.076  -2.823  1.00 0.00 ? 14  GLY A C    4  
ATOM   3616  O  O    . GLY A 1 14 ? -14.950 13.832  -2.198  1.00 0.00 ? 14  GLY A O    4  
ATOM   3617  H  H    . GLY A 1 14 ? -16.638 14.566  -4.714  1.00 0.00 ? 14  GLY A H    4  
ATOM   3618  H  HA2  . GLY A 1 14 ? -17.502 13.980  -2.157  1.00 0.00 ? 14  GLY A HA2  4  
ATOM   3619  H  HA3  . GLY A 1 14 ? -17.725 12.499  -3.078  1.00 0.00 ? 14  GLY A HA3  4  
ATOM   3620  N  N    . LYS A 1 15 ? -15.280 11.934  -3.360  1.00 0.00 ? 15  LYS A N    4  
ATOM   3621  C  CA   . LYS A 1 15 ? -13.895 11.493  -3.247  1.00 0.00 ? 15  LYS A CA   4  
ATOM   3622  C  C    . LYS A 1 15 ? -13.554 10.483  -4.338  1.00 0.00 ? 15  LYS A C    4  
ATOM   3623  O  O    . LYS A 1 15 ? -14.405 10.125  -5.153  1.00 0.00 ? 15  LYS A O    4  
ATOM   3624  C  CB   . LYS A 1 15 ? -13.647 10.874  -1.869  1.00 0.00 ? 15  LYS A CB   4  
ATOM   3625  C  CG   . LYS A 1 15 ? -13.242 11.887  -0.812  1.00 0.00 ? 15  LYS A CG   4  
ATOM   3626  C  CD   . LYS A 1 15 ? -12.362 11.258  0.255   1.00 0.00 ? 15  LYS A CD   4  
ATOM   3627  C  CE   . LYS A 1 15 ? -12.500 11.978  1.588   1.00 0.00 ? 15  LYS A CE   4  
ATOM   3628  N  NZ   . LYS A 1 15 ? -13.633 11.442  2.393   1.00 0.00 ? 15  LYS A NZ   4  
ATOM   3629  H  H    . LYS A 1 15 ? -15.922 11.374  -3.847  1.00 0.00 ? 15  LYS A H    4  
ATOM   3630  H  HA   . LYS A 1 15 ? -13.261 12.359  -3.363  1.00 0.00 ? 15  LYS A HA   4  
ATOM   3631  H  HB2  . LYS A 1 15 ? -14.550 10.383  -1.540  1.00 0.00 ? 15  LYS A HB2  4  
ATOM   3632  H  HB3  . LYS A 1 15 ? -12.858 10.140  -1.954  1.00 0.00 ? 15  LYS A HB3  4  
ATOM   3633  H  HG2  . LYS A 1 15 ? -12.697 12.690  -1.285  1.00 0.00 ? 15  LYS A HG2  4  
ATOM   3634  H  HG3  . LYS A 1 15 ? -14.133 12.281  -0.344  1.00 0.00 ? 15  LYS A HG3  4  
ATOM   3635  H  HD2  . LYS A 1 15 ? -12.651 10.225  0.385   1.00 0.00 ? 15  LYS A HD2  4  
ATOM   3636  H  HD3  . LYS A 1 15 ? -11.331 11.307  -0.066  1.00 0.00 ? 15  LYS A HD3  4  
ATOM   3637  H  HE2  . LYS A 1 15 ? -11.584 11.855  2.145   1.00 0.00 ? 15  LYS A HE2  4  
ATOM   3638  H  HE3  . LYS A 1 15 ? -12.668 13.028  1.399   1.00 0.00 ? 15  LYS A HE3  4  
ATOM   3639  H  HZ1  . LYS A 1 15 ? -13.333 10.590  2.908   1.00 0.00 ? 15  LYS A HZ1  4  
ATOM   3640  H  HZ2  . LYS A 1 15 ? -14.428 11.195  1.770   1.00 0.00 ? 15  LYS A HZ2  4  
ATOM   3641  H  HZ3  . LYS A 1 15 ? -13.952 12.155  3.079   1.00 0.00 ? 15  LYS A HZ3  4  
ATOM   3642  N  N    . TYR A 1 16 ? -12.307 10.027  -4.347  1.00 0.00 ? 16  TYR A N    4  
ATOM   3643  C  CA   . TYR A 1 16 ? -11.854 9.059   -5.339  1.00 0.00 ? 16  TYR A CA   4  
ATOM   3644  C  C    . TYR A 1 16 ? -12.350 7.658   -4.998  1.00 0.00 ? 16  TYR A C    4  
ATOM   3645  O  O    . TYR A 1 16 ? -12.103 7.148   -3.905  1.00 0.00 ? 16  TYR A O    4  
ATOM   3646  C  CB   . TYR A 1 16 ? -10.327 9.064   -5.427  1.00 0.00 ? 16  TYR A CB   4  
ATOM   3647  C  CG   . TYR A 1 16 ? -9.764  10.285  -6.119  1.00 0.00 ? 16  TYR A CG   4  
ATOM   3648  C  CD1  . TYR A 1 16 ? -9.886  11.548  -5.551  1.00 0.00 ? 16  TYR A CD1  4  
ATOM   3649  C  CD2  . TYR A 1 16 ? -9.112  10.177  -7.341  1.00 0.00 ? 16  TYR A CD2  4  
ATOM   3650  C  CE1  . TYR A 1 16 ? -9.374  12.666  -6.180  1.00 0.00 ? 16  TYR A CE1  4  
ATOM   3651  C  CE2  . TYR A 1 16 ? -8.596  11.290  -7.976  1.00 0.00 ? 16  TYR A CE2  4  
ATOM   3652  C  CZ   . TYR A 1 16 ? -8.729  12.532  -7.392  1.00 0.00 ? 16  TYR A CZ   4  
ATOM   3653  O  OH   . TYR A 1 16 ? -8.218  13.643  -8.022  1.00 0.00 ? 16  TYR A OH   4  
ATOM   3654  H  H    . TYR A 1 16 ? -11.675 10.350  -3.671  1.00 0.00 ? 16  TYR A H    4  
ATOM   3655  H  HA   . TYR A 1 16 ? -12.261 9.350   -6.296  1.00 0.00 ? 16  TYR A HA   4  
ATOM   3656  H  HB2  . TYR A 1 16 ? -9.916  9.030   -4.430  1.00 0.00 ? 16  TYR A HB2  4  
ATOM   3657  H  HB3  . TYR A 1 16 ? -10.002 8.192   -5.975  1.00 0.00 ? 16  TYR A HB3  4  
ATOM   3658  H  HD1  . TYR A 1 16 ? -10.391 11.650  -4.602  1.00 0.00 ? 16  TYR A HD1  4  
ATOM   3659  H  HD2  . TYR A 1 16 ? -9.009  9.202   -7.796  1.00 0.00 ? 16  TYR A HD2  4  
ATOM   3660  H  HE1  . TYR A 1 16 ? -9.478  13.639  -5.723  1.00 0.00 ? 16  TYR A HE1  4  
ATOM   3661  H  HE2  . TYR A 1 16 ? -8.091  11.185  -8.925  1.00 0.00 ? 16  TYR A HE2  4  
ATOM   3662  H  HH   . TYR A 1 16 ? -7.646  14.120  -7.416  1.00 0.00 ? 16  TYR A HH   4  
ATOM   3663  N  N    . ILE A 1 17 ? -13.051 7.040   -5.943  1.00 0.00 ? 17  ILE A N    4  
ATOM   3664  C  CA   . ILE A 1 17 ? -13.581 5.696   -5.745  1.00 0.00 ? 17  ILE A CA   4  
ATOM   3665  C  C    . ILE A 1 17 ? -12.572 4.638   -6.178  1.00 0.00 ? 17  ILE A C    4  
ATOM   3666  O  O    . ILE A 1 17 ? -12.152 4.601   -7.334  1.00 0.00 ? 17  ILE A O    4  
ATOM   3667  C  CB   . ILE A 1 17 ? -14.893 5.488   -6.524  1.00 0.00 ? 17  ILE A CB   4  
ATOM   3668  C  CG1  . ILE A 1 17 ? -15.896 6.591   -6.181  1.00 0.00 ? 17  ILE A CG1  4  
ATOM   3669  C  CG2  . ILE A 1 17 ? -15.479 4.118   -6.219  1.00 0.00 ? 17  ILE A CG2  4  
ATOM   3670  C  CD1  . ILE A 1 17 ? -16.155 6.733   -4.698  1.00 0.00 ? 17  ILE A CD1  4  
ATOM   3671  H  H    . ILE A 1 17 ? -13.215 7.498   -6.793  1.00 0.00 ? 17  ILE A H    4  
ATOM   3672  H  HA   . ILE A 1 17 ? -13.788 5.572   -4.692  1.00 0.00 ? 17  ILE A HA   4  
ATOM   3673  H  HB   . ILE A 1 17 ? -14.669 5.530   -7.579  1.00 0.00 ? 17  ILE A HB   4  
ATOM   3674  H  HG12 . ILE A 1 17 ? -15.522 7.535   -6.544  1.00 0.00 ? 17  ILE A HG12 4  
ATOM   3675  H  HG13 . ILE A 1 17 ? -16.838 6.373   -6.664  1.00 0.00 ? 17  ILE A HG13 4  
ATOM   3676  H  HG21 . ILE A 1 17 ? -15.370 3.906   -5.165  1.00 0.00 ? 17  ILE A HG21 4  
ATOM   3677  H  HG22 . ILE A 1 17 ? -16.526 4.108   -6.480  1.00 0.00 ? 17  ILE A HG22 4  
ATOM   3678  H  HG23 . ILE A 1 17 ? -14.957 3.367   -6.792  1.00 0.00 ? 17  ILE A HG23 4  
ATOM   3679  H  HD11 . ILE A 1 17 ? -15.285 7.158   -4.219  1.00 0.00 ? 17  ILE A HD11 4  
ATOM   3680  H  HD12 . ILE A 1 17 ? -17.005 7.378   -4.540  1.00 0.00 ? 17  ILE A HD12 4  
ATOM   3681  H  HD13 . ILE A 1 17 ? -16.358 5.760   -4.273  1.00 0.00 ? 17  ILE A HD13 4  
ATOM   3682  N  N    . CYS A 1 18 ? -12.189 3.776   -5.241  1.00 0.00 ? 18  CYS A N    4  
ATOM   3683  C  CA   . CYS A 1 18 ? -11.230 2.715   -5.525  1.00 0.00 ? 18  CYS A CA   4  
ATOM   3684  C  C    . CYS A 1 18 ? -11.756 1.784   -6.613  1.00 0.00 ? 18  CYS A C    4  
ATOM   3685  O  O    . CYS A 1 18 ? -12.854 1.240   -6.500  1.00 0.00 ? 18  CYS A O    4  
ATOM   3686  C  CB   . CYS A 1 18 ? -10.932 1.916   -4.254  1.00 0.00 ? 18  CYS A CB   4  
ATOM   3687  S  SG   . CYS A 1 18 ? -9.549  0.743   -4.422  1.00 0.00 ? 18  CYS A SG   4  
ATOM   3688  H  H    . CYS A 1 18 ? -12.559 3.856   -4.337  1.00 0.00 ? 18  CYS A H    4  
ATOM   3689  H  HA   . CYS A 1 18 ? -10.318 3.176   -5.872  1.00 0.00 ? 18  CYS A HA   4  
ATOM   3690  H  HB2  . CYS A 1 18 ? -10.685 2.602   -3.457  1.00 0.00 ? 18  CYS A HB2  4  
ATOM   3691  H  HB3  . CYS A 1 18 ? -11.810 1.353   -3.978  1.00 0.00 ? 18  CYS A HB3  4  
ATOM   3692  N  N    . GLN A 1 19 ? -10.963 1.605   -7.665  1.00 0.00 ? 19  GLN A N    4  
ATOM   3693  C  CA   . GLN A 1 19 ? -11.349 0.739   -8.773  1.00 0.00 ? 19  GLN A CA   4  
ATOM   3694  C  C    . GLN A 1 19 ? -11.027 -0.719  -8.463  1.00 0.00 ? 19  GLN A C    4  
ATOM   3695  O  O    . GLN A 1 19 ? -10.810 -1.524  -9.368  1.00 0.00 ? 19  GLN A O    4  
ATOM   3696  C  CB   . GLN A 1 19 ? -10.636 1.169   -10.056 1.00 0.00 ? 19  GLN A CB   4  
ATOM   3697  C  CG   . GLN A 1 19 ? -11.411 2.193   -10.869 1.00 0.00 ? 19  GLN A CG   4  
ATOM   3698  C  CD   . GLN A 1 19 ? -12.771 1.685   -11.304 1.00 0.00 ? 19  GLN A CD   4  
ATOM   3699  O  OE1  . GLN A 1 19 ? -12.875 0.842   -12.196 1.00 0.00 ? 19  GLN A OE1  4  
ATOM   3700  N  NE2  . GLN A 1 19 ? -13.823 2.194   -10.674 1.00 0.00 ? 19  GLN A NE2  4  
ATOM   3701  H  H    . GLN A 1 19 ? -10.099 2.065   -7.696  1.00 0.00 ? 19  GLN A H    4  
ATOM   3702  H  HA   . GLN A 1 19 ? -12.415 0.837   -8.914  1.00 0.00 ? 19  GLN A HA   4  
ATOM   3703  H  HB2  . GLN A 1 19 ? -9.679  1.597   -9.796  1.00 0.00 ? 19  GLN A HB2  4  
ATOM   3704  H  HB3  . GLN A 1 19 ? -10.475 0.298   -10.674 1.00 0.00 ? 19  GLN A HB3  4  
ATOM   3705  H  HG2  . GLN A 1 19 ? -11.551 3.080   -10.268 1.00 0.00 ? 19  GLN A HG2  4  
ATOM   3706  H  HG3  . GLN A 1 19 ? -10.838 2.444   -11.749 1.00 0.00 ? 19  GLN A HG3  4  
ATOM   3707  H  HE21 . GLN A 1 19 ? -13.664 2.862   -9.975  1.00 0.00 ? 19  GLN A HE21 4  
ATOM   3708  H  HE22 . GLN A 1 19 ? -14.714 1.884   -10.936 1.00 0.00 ? 19  GLN A HE22 4  
ATOM   3709  N  N    . LYS A 1 20 ? -10.997 -1.052  -7.177  1.00 0.00 ? 20  LYS A N    4  
ATOM   3710  C  CA   . LYS A 1 20 ? -10.703 -2.414  -6.745  1.00 0.00 ? 20  LYS A CA   4  
ATOM   3711  C  C    . LYS A 1 20 ? -11.759 -2.914  -5.765  1.00 0.00 ? 20  LYS A C    4  
ATOM   3712  O  O    . LYS A 1 20 ? -12.331 -3.989  -5.949  1.00 0.00 ? 20  LYS A O    4  
ATOM   3713  C  CB   . LYS A 1 20 ? -9.318  -2.477  -6.096  1.00 0.00 ? 20  LYS A CB   4  
ATOM   3714  C  CG   . LYS A 1 20 ? -8.946  -3.860  -5.590  1.00 0.00 ? 20  LYS A CG   4  
ATOM   3715  C  CD   . LYS A 1 20 ? -8.290  -4.693  -6.678  1.00 0.00 ? 20  LYS A CD   4  
ATOM   3716  C  CE   . LYS A 1 20 ? -8.320  -6.176  -6.339  1.00 0.00 ? 20  LYS A CE   4  
ATOM   3717  N  NZ   . LYS A 1 20 ? -7.337  -6.521  -5.275  1.00 0.00 ? 20  LYS A NZ   4  
ATOM   3718  H  H    . LYS A 1 20 ? -11.179 -0.366  -6.501  1.00 0.00 ? 20  LYS A H    4  
ATOM   3719  H  HA   . LYS A 1 20 ? -10.710 -3.048  -7.619  1.00 0.00 ? 20  LYS A HA   4  
ATOM   3720  H  HB2  . LYS A 1 20 ? -8.579  -2.170  -6.822  1.00 0.00 ? 20  LYS A HB2  4  
ATOM   3721  H  HB3  . LYS A 1 20 ? -9.295  -1.792  -5.260  1.00 0.00 ? 20  LYS A HB3  4  
ATOM   3722  H  HG2  . LYS A 1 20 ? -8.257  -3.758  -4.765  1.00 0.00 ? 20  LYS A HG2  4  
ATOM   3723  H  HG3  . LYS A 1 20 ? -9.842  -4.363  -5.254  1.00 0.00 ? 20  LYS A HG3  4  
ATOM   3724  H  HD2  . LYS A 1 20 ? -8.818  -4.538  -7.607  1.00 0.00 ? 20  LYS A HD2  4  
ATOM   3725  H  HD3  . LYS A 1 20 ? -7.262  -4.379  -6.789  1.00 0.00 ? 20  LYS A HD3  4  
ATOM   3726  H  HE2  . LYS A 1 20 ? -9.311  -6.434  -5.998  1.00 0.00 ? 20  LYS A HE2  4  
ATOM   3727  H  HE3  . LYS A 1 20 ? -8.087  -6.740  -7.229  1.00 0.00 ? 20  LYS A HE3  4  
ATOM   3728  H  HZ1  . LYS A 1 20 ? -6.732  -5.701  -5.067  1.00 0.00 ? 20  LYS A HZ1  4  
ATOM   3729  H  HZ2  . LYS A 1 20 ? -6.736  -7.310  -5.586  1.00 0.00 ? 20  LYS A HZ2  4  
ATOM   3730  H  HZ3  . LYS A 1 20 ? -7.834  -6.800  -4.405  1.00 0.00 ? 20  LYS A HZ3  4  
ATOM   3731  N  N    . CYS A 1 21 ? -12.014 -2.128  -4.725  1.00 0.00 ? 21  CYS A N    4  
ATOM   3732  C  CA   . CYS A 1 21 ? -13.002 -2.491  -3.716  1.00 0.00 ? 21  CYS A CA   4  
ATOM   3733  C  C    . CYS A 1 21 ? -14.258 -1.634  -3.852  1.00 0.00 ? 21  CYS A C    4  
ATOM   3734  O  O    . CYS A 1 21 ? -15.233 -1.822  -3.124  1.00 0.00 ? 21  CYS A O    4  
ATOM   3735  C  CB   . CYS A 1 21 ? -12.412 -2.332  -2.314  1.00 0.00 ? 21  CYS A CB   4  
ATOM   3736  S  SG   . CYS A 1 21 ? -11.939 -0.623  -1.895  1.00 0.00 ? 21  CYS A SG   4  
ATOM   3737  H  H    . CYS A 1 21 ? -11.525 -1.283  -4.633  1.00 0.00 ? 21  CYS A H    4  
ATOM   3738  H  HA   . CYS A 1 21 ? -13.269 -3.525  -3.870  1.00 0.00 ? 21  CYS A HA   4  
ATOM   3739  H  HB2  . CYS A 1 21 ? -13.141 -2.658  -1.586  1.00 0.00 ? 21  CYS A HB2  4  
ATOM   3740  H  HB3  . CYS A 1 21 ? -11.529 -2.947  -2.231  1.00 0.00 ? 21  CYS A HB3  4  
ATOM   3741  N  N    . HIS A 1 22 ? -14.226 -0.692  -4.789  1.00 0.00 ? 22  HIS A N    4  
ATOM   3742  C  CA   . HIS A 1 22 ? -15.361 0.194   -5.022  1.00 0.00 ? 22  HIS A CA   4  
ATOM   3743  C  C    . HIS A 1 22 ? -15.758 0.917   -3.738  1.00 0.00 ? 22  HIS A C    4  
ATOM   3744  O  O    . HIS A 1 22 ? -16.927 0.923   -3.354  1.00 0.00 ? 22  HIS A O    4  
ATOM   3745  C  CB   . HIS A 1 22 ? -16.551 -0.599  -5.563  1.00 0.00 ? 22  HIS A CB   4  
ATOM   3746  C  CG   . HIS A 1 22 ? -16.446 -0.916  -7.023  1.00 0.00 ? 22  HIS A CG   4  
ATOM   3747  N  ND1  . HIS A 1 22 ? -16.124 -2.170  -7.499  1.00 0.00 ? 22  HIS A ND1  4  
ATOM   3748  C  CD2  . HIS A 1 22 ? -16.623 -0.135  -8.114  1.00 0.00 ? 22  HIS A CD2  4  
ATOM   3749  C  CE1  . HIS A 1 22 ? -16.106 -2.145  -8.820  1.00 0.00 ? 22  HIS A CE1  4  
ATOM   3750  N  NE2  . HIS A 1 22 ? -16.406 -0.922  -9.218  1.00 0.00 ? 22  HIS A NE2  4  
ATOM   3751  H  H    . HIS A 1 22 ? -13.420 -0.591  -5.338  1.00 0.00 ? 22  HIS A H    4  
ATOM   3752  H  HA   . HIS A 1 22 ? -15.065 0.927   -5.756  1.00 0.00 ? 22  HIS A HA   4  
ATOM   3753  H  HB2  . HIS A 1 22 ? -16.628 -1.533  -5.026  1.00 0.00 ? 22  HIS A HB2  4  
ATOM   3754  H  HB3  . HIS A 1 22 ? -17.456 -0.027  -5.411  1.00 0.00 ? 22  HIS A HB3  4  
ATOM   3755  H  HD1  . HIS A 1 22 ? -15.935 -2.959  -6.951  1.00 0.00 ? 22  HIS A HD1  4  
ATOM   3756  H  HD2  . HIS A 1 22 ? -16.885 0.914   -8.116  1.00 0.00 ? 22  HIS A HD2  4  
ATOM   3757  H  HE1  . HIS A 1 22 ? -15.885 -2.982  -9.465  1.00 0.00 ? 22  HIS A HE1  4  
ATOM   3758  N  N    . ALA A 1 23 ? -14.776 1.524   -3.079  1.00 0.00 ? 23  ALA A N    4  
ATOM   3759  C  CA   . ALA A 1 23 ? -15.023 2.250   -1.840  1.00 0.00 ? 23  ALA A CA   4  
ATOM   3760  C  C    . ALA A 1 23 ? -14.234 3.555   -1.801  1.00 0.00 ? 23  ALA A C    4  
ATOM   3761  O  O    . ALA A 1 23 ? -13.049 3.583   -2.133  1.00 0.00 ? 23  ALA A O    4  
ATOM   3762  C  CB   . ALA A 1 23 ? -14.672 1.383   -0.640  1.00 0.00 ? 23  ALA A CB   4  
ATOM   3763  H  H    . ALA A 1 23 ? -13.865 1.483   -3.436  1.00 0.00 ? 23  ALA A H    4  
ATOM   3764  H  HA   . ALA A 1 23 ? -16.079 2.478   -1.791  1.00 0.00 ? 23  ALA A HA   4  
ATOM   3765  H  HB1  . ALA A 1 23 ? -14.882 1.926   0.270   1.00 0.00 ? 23  ALA A HB1  4  
ATOM   3766  H  HB2  . ALA A 1 23 ? -15.262 0.479   -0.665  1.00 0.00 ? 23  ALA A HB2  4  
ATOM   3767  H  HB3  . ALA A 1 23 ? -13.623 1.130   -0.675  1.00 0.00 ? 23  ALA A HB3  4  
ATOM   3768  N  N    . ILE A 1 24 ? -14.899 4.631   -1.396  1.00 0.00 ? 24  ILE A N    4  
ATOM   3769  C  CA   . ILE A 1 24 ? -14.258 5.938   -1.314  1.00 0.00 ? 24  ILE A CA   4  
ATOM   3770  C  C    . ILE A 1 24 ? -12.914 5.848   -0.599  1.00 0.00 ? 24  ILE A C    4  
ATOM   3771  O  O    . ILE A 1 24 ? -12.779 5.147   0.404   1.00 0.00 ? 24  ILE A O    4  
ATOM   3772  C  CB   . ILE A 1 24 ? -15.150 6.957   -0.580  1.00 0.00 ? 24  ILE A CB   4  
ATOM   3773  C  CG1  . ILE A 1 24 ? -16.353 7.332   -1.447  1.00 0.00 ? 24  ILE A CG1  4  
ATOM   3774  C  CG2  . ILE A 1 24 ? -14.347 8.196   -0.214  1.00 0.00 ? 24  ILE A CG2  4  
ATOM   3775  C  CD1  . ILE A 1 24 ? -17.178 8.465   -0.878  1.00 0.00 ? 24  ILE A CD1  4  
ATOM   3776  H  H    . ILE A 1 24 ? -15.842 4.544   -1.144  1.00 0.00 ? 24  ILE A H    4  
ATOM   3777  H  HA   . ILE A 1 24 ? -14.095 6.292   -2.321  1.00 0.00 ? 24  ILE A HA   4  
ATOM   3778  H  HB   . ILE A 1 24 ? -15.500 6.502   0.334   1.00 0.00 ? 24  ILE A HB   4  
ATOM   3779  H  HG12 . ILE A 1 24 ? -16.007 7.632   -2.423  1.00 0.00 ? 24  ILE A HG12 4  
ATOM   3780  H  HG13 . ILE A 1 24 ? -16.997 6.470   -1.547  1.00 0.00 ? 24  ILE A HG13 4  
ATOM   3781  H  HG21 . ILE A 1 24 ? -13.648 8.419   -1.007  1.00 0.00 ? 24  ILE A HG21 4  
ATOM   3782  H  HG22 . ILE A 1 24 ? -15.017 9.032   -0.081  1.00 0.00 ? 24  ILE A HG22 4  
ATOM   3783  H  HG23 . ILE A 1 24 ? -13.806 8.018   0.703   1.00 0.00 ? 24  ILE A HG23 4  
ATOM   3784  H  HD11 . ILE A 1 24 ? -18.215 8.325   -1.143  1.00 0.00 ? 24  ILE A HD11 4  
ATOM   3785  H  HD12 . ILE A 1 24 ? -17.078 8.480   0.197   1.00 0.00 ? 24  ILE A HD12 4  
ATOM   3786  H  HD13 . ILE A 1 24 ? -16.828 9.404   -1.284  1.00 0.00 ? 24  ILE A HD13 4  
ATOM   3787  N  N    . ILE A 1 25 ? -11.923 6.562   -1.122  1.00 0.00 ? 25  ILE A N    4  
ATOM   3788  C  CA   . ILE A 1 25 ? -10.590 6.564   -0.532  1.00 0.00 ? 25  ILE A CA   4  
ATOM   3789  C  C    . ILE A 1 25 ? -10.341 7.845   0.257   1.00 0.00 ? 25  ILE A C    4  
ATOM   3790  O  O    . ILE A 1 25 ? -10.002 8.882   -0.314  1.00 0.00 ? 25  ILE A O    4  
ATOM   3791  C  CB   . ILE A 1 25 ? -9.498  6.417   -1.608  1.00 0.00 ? 25  ILE A CB   4  
ATOM   3792  C  CG1  . ILE A 1 25 ? -9.738  5.155   -2.440  1.00 0.00 ? 25  ILE A CG1  4  
ATOM   3793  C  CG2  . ILE A 1 25 ? -8.121  6.379   -0.963  1.00 0.00 ? 25  ILE A CG2  4  
ATOM   3794  C  CD1  . ILE A 1 25 ? -9.242  5.267   -3.864  1.00 0.00 ? 25  ILE A CD1  4  
ATOM   3795  H  H    . ILE A 1 25 ? -12.093 7.100   -1.923  1.00 0.00 ? 25  ILE A H    4  
ATOM   3796  H  HA   . ILE A 1 25 ? -10.522 5.721   0.140   1.00 0.00 ? 25  ILE A HA   4  
ATOM   3797  H  HB   . ILE A 1 25 ? -9.543  7.280   -2.255  1.00 0.00 ? 25  ILE A HB   4  
ATOM   3798  H  HG12 . ILE A 1 25 ? -9.230  4.324   -1.977  1.00 0.00 ? 25  ILE A HG12 4  
ATOM   3799  H  HG13 . ILE A 1 25 ? -10.798 4.951   -2.472  1.00 0.00 ? 25  ILE A HG13 4  
ATOM   3800  H  HG21 . ILE A 1 25 ? -8.225  6.422   0.111   1.00 0.00 ? 25  ILE A HG21 4  
ATOM   3801  H  HG22 . ILE A 1 25 ? -7.620  5.463   -1.239  1.00 0.00 ? 25  ILE A HG22 4  
ATOM   3802  H  HG23 . ILE A 1 25 ? -7.541  7.224   -1.303  1.00 0.00 ? 25  ILE A HG23 4  
ATOM   3803  H  HD11 . ILE A 1 25 ? -9.144  6.309   -4.132  1.00 0.00 ? 25  ILE A HD11 4  
ATOM   3804  H  HD12 . ILE A 1 25 ? -8.282  4.781   -3.951  1.00 0.00 ? 25  ILE A HD12 4  
ATOM   3805  H  HD13 . ILE A 1 25 ? -9.947  4.791   -4.530  1.00 0.00 ? 25  ILE A HD13 4  
ATOM   3806  N  N    . ASP A 1 26 ? -10.509 7.765   1.572   1.00 0.00 ? 26  ASP A N    4  
ATOM   3807  C  CA   . ASP A 1 26 ? -10.299 8.917   2.441   1.00 0.00 ? 26  ASP A CA   4  
ATOM   3808  C  C    . ASP A 1 26 ? -8.953  9.575   2.156   1.00 0.00 ? 26  ASP A C    4  
ATOM   3809  O  O    . ASP A 1 26 ? -8.893  10.678  1.614   1.00 0.00 ? 26  ASP A O    4  
ATOM   3810  C  CB   . ASP A 1 26 ? -10.374 8.495   3.910   1.00 0.00 ? 26  ASP A CB   4  
ATOM   3811  C  CG   . ASP A 1 26 ? -9.541  9.385   4.811   1.00 0.00 ? 26  ASP A CG   4  
ATOM   3812  O  OD1  . ASP A 1 26 ? -8.345  9.081   5.002   1.00 0.00 ? 26  ASP A OD1  4  
ATOM   3813  O  OD2  . ASP A 1 26 ? -10.084 10.385  5.325   1.00 0.00 ? 26  ASP A OD2  4  
ATOM   3814  H  H    . ASP A 1 26 ? -10.780 6.910   1.968   1.00 0.00 ? 26  ASP A H    4  
ATOM   3815  H  HA   . ASP A 1 26 ? -11.084 9.631   2.241   1.00 0.00 ? 26  ASP A HA   4  
ATOM   3816  H  HB2  . ASP A 1 26 ? -11.402 8.543   4.239   1.00 0.00 ? 26  ASP A HB2  4  
ATOM   3817  H  HB3  . ASP A 1 26 ? -10.017 7.481   4.005   1.00 0.00 ? 26  ASP A HB3  4  
ATOM   3818  N  N    . GLU A 1 27 ? -7.875  8.890   2.526   1.00 0.00 ? 27  GLU A N    4  
ATOM   3819  C  CA   . GLU A 1 27 ? -6.530  9.410   2.312   1.00 0.00 ? 27  GLU A CA   4  
ATOM   3820  C  C    . GLU A 1 27 ? -6.221  9.522   0.822   1.00 0.00 ? 27  GLU A C    4  
ATOM   3821  O  O    . GLU A 1 27 ? -7.047  9.172   -0.021  1.00 0.00 ? 27  GLU A O    4  
ATOM   3822  C  CB   . GLU A 1 27 ? -5.496  8.509   2.992   1.00 0.00 ? 27  GLU A CB   4  
ATOM   3823  C  CG   . GLU A 1 27 ? -5.477  7.090   2.451   1.00 0.00 ? 27  GLU A CG   4  
ATOM   3824  C  CD   . GLU A 1 27 ? -4.127  6.420   2.619   1.00 0.00 ? 27  GLU A CD   4  
ATOM   3825  O  OE1  . GLU A 1 27 ? -3.120  6.986   2.144   1.00 0.00 ? 27  GLU A OE1  4  
ATOM   3826  O  OE2  . GLU A 1 27 ? -4.077  5.330   3.226   1.00 0.00 ? 27  GLU A OE2  4  
ATOM   3827  H  H    . GLU A 1 27 ? -7.987  8.016   2.954   1.00 0.00 ? 27  GLU A H    4  
ATOM   3828  H  HA   . GLU A 1 27 ? -6.480  10.394  2.752   1.00 0.00 ? 27  GLU A HA   4  
ATOM   3829  H  HB2  . GLU A 1 27 ? -4.515  8.939   2.854   1.00 0.00 ? 27  GLU A HB2  4  
ATOM   3830  H  HB3  . GLU A 1 27 ? -5.715  8.466   4.049   1.00 0.00 ? 27  GLU A HB3  4  
ATOM   3831  H  HG2  . GLU A 1 27 ? -6.218  6.507   2.976   1.00 0.00 ? 27  GLU A HG2  4  
ATOM   3832  H  HG3  . GLU A 1 27 ? -5.720  7.116   1.398   1.00 0.00 ? 27  GLU A HG3  4  
ATOM   3833  N  N    . GLN A 1 28 ? -5.027  10.013  0.506   1.00 0.00 ? 28  GLN A N    4  
ATOM   3834  C  CA   . GLN A 1 28 ? -4.609  10.172  -0.882  1.00 0.00 ? 28  GLN A CA   4  
ATOM   3835  C  C    . GLN A 1 28 ? -4.775  8.867   -1.654  1.00 0.00 ? 28  GLN A C    4  
ATOM   3836  O  O    . GLN A 1 28 ? -4.187  7.839   -1.317  1.00 0.00 ? 28  GLN A O    4  
ATOM   3837  C  CB   . GLN A 1 28 ? -3.154  10.636  -0.949  1.00 0.00 ? 28  GLN A CB   4  
ATOM   3838  C  CG   . GLN A 1 28 ? -2.702  11.024  -2.348  1.00 0.00 ? 28  GLN A CG   4  
ATOM   3839  C  CD   . GLN A 1 28 ? -3.215  12.386  -2.770  1.00 0.00 ? 28  GLN A CD   4  
ATOM   3840  O  OE1  . GLN A 1 28 ? -4.212  12.878  -2.241  1.00 0.00 ? 28  GLN A OE1  4  
ATOM   3841  N  NE2  . GLN A 1 28 ? -2.536  13.004  -3.729  1.00 0.00 ? 28  GLN A NE2  4  
ATOM   3842  H  H    . GLN A 1 28 ? -4.413  10.274  1.223   1.00 0.00 ? 28  GLN A H    4  
ATOM   3843  H  HA   . GLN A 1 28 ? -5.239  10.924  -1.333  1.00 0.00 ? 28  GLN A HA   4  
ATOM   3844  H  HB2  . GLN A 1 28 ? -3.032  11.494  -0.304  1.00 0.00 ? 28  GLN A HB2  4  
ATOM   3845  H  HB3  . GLN A 1 28 ? -2.517  9.838   -0.597  1.00 0.00 ? 28  GLN A HB3  4  
ATOM   3846  H  HG2  . GLN A 1 28 ? -1.623  11.040  -2.372  1.00 0.00 ? 28  GLN A HG2  4  
ATOM   3847  H  HG3  . GLN A 1 28 ? -3.066  10.285  -3.047  1.00 0.00 ? 28  GLN A HG3  4  
ATOM   3848  H  HE21 . GLN A 1 28 ? -1.752  12.551  -4.106  1.00 0.00 ? 28  GLN A HE21 4  
ATOM   3849  H  HE22 . GLN A 1 28 ? -2.846  13.885  -4.022  1.00 0.00 ? 28  GLN A HE22 4  
ATOM   3850  N  N    . PRO A 1 29 ? -5.596  8.906   -2.714  1.00 0.00 ? 29  PRO A N    4  
ATOM   3851  C  CA   . PRO A 1 29 ? -5.858  7.735   -3.555  1.00 0.00 ? 29  PRO A CA   4  
ATOM   3852  C  C    . PRO A 1 29 ? -4.644  7.334   -4.386  1.00 0.00 ? 29  PRO A C    4  
ATOM   3853  O  O    . PRO A 1 29 ? -3.995  8.180   -5.004  1.00 0.00 ? 29  PRO A O    4  
ATOM   3854  C  CB   . PRO A 1 29 ? -6.999  8.199   -4.465  1.00 0.00 ? 29  PRO A CB   4  
ATOM   3855  C  CG   . PRO A 1 29 ? -6.861  9.682   -4.518  1.00 0.00 ? 29  PRO A CG   4  
ATOM   3856  C  CD   . PRO A 1 29 ? -6.330  10.097  -3.173  1.00 0.00 ? 29  PRO A CD   4  
ATOM   3857  H  HA   . PRO A 1 29 ? -6.185  6.889   -2.968  1.00 0.00 ? 29  PRO A HA   4  
ATOM   3858  H  HB2  . PRO A 1 29 ? -6.885  7.756   -5.444  1.00 0.00 ? 29  PRO A HB2  4  
ATOM   3859  H  HB3  . PRO A 1 29 ? -7.946  7.906   -4.038  1.00 0.00 ? 29  PRO A HB3  4  
ATOM   3860  H  HG2  . PRO A 1 29 ? -6.166  9.958   -5.296  1.00 0.00 ? 29  PRO A HG2  4  
ATOM   3861  H  HG3  . PRO A 1 29 ? -7.826  10.134  -4.695  1.00 0.00 ? 29  PRO A HG3  4  
ATOM   3862  H  HD2  . PRO A 1 29 ? -5.668  10.944  -3.274  1.00 0.00 ? 29  PRO A HD2  4  
ATOM   3863  H  HD3  . PRO A 1 29 ? -7.144  10.330  -2.502  1.00 0.00 ? 29  PRO A HD3  4  
ATOM   3864  N  N    . LEU A 1 30 ? -4.342  6.041   -4.398  1.00 0.00 ? 30  LEU A N    4  
ATOM   3865  C  CA   . LEU A 1 30 ? -3.205  5.528   -5.155  1.00 0.00 ? 30  LEU A CA   4  
ATOM   3866  C  C    . LEU A 1 30 ? -3.558  5.371   -6.630  1.00 0.00 ? 30  LEU A C    4  
ATOM   3867  O  O    . LEU A 1 30 ? -4.360  4.513   -6.999  1.00 0.00 ? 30  LEU A O    4  
ATOM   3868  C  CB   . LEU A 1 30 ? -2.750  4.184   -4.582  1.00 0.00 ? 30  LEU A CB   4  
ATOM   3869  C  CG   . LEU A 1 30 ? -2.017  3.255   -5.550  1.00 0.00 ? 30  LEU A CG   4  
ATOM   3870  C  CD1  . LEU A 1 30 ? -0.582  3.718   -5.749  1.00 0.00 ? 30  LEU A CD1  4  
ATOM   3871  C  CD2  . LEU A 1 30 ? -2.052  1.821   -5.043  1.00 0.00 ? 30  LEU A CD2  4  
ATOM   3872  H  H    . LEU A 1 30 ? -4.895  5.415   -3.887  1.00 0.00 ? 30  LEU A H    4  
ATOM   3873  H  HA   . LEU A 1 30 ? -2.398  6.240   -5.064  1.00 0.00 ? 30  LEU A HA   4  
ATOM   3874  H  HB2  . LEU A 1 30 ? -2.090  4.385   -3.752  1.00 0.00 ? 30  LEU A HB2  4  
ATOM   3875  H  HB3  . LEU A 1 30 ? -3.628  3.664   -4.224  1.00 0.00 ? 30  LEU A HB3  4  
ATOM   3876  H  HG   . LEU A 1 30 ? -2.512  3.283   -6.511  1.00 0.00 ? 30  LEU A HG   4  
ATOM   3877  H  HD11 . LEU A 1 30 ? -0.041  2.977   -6.319  1.00 0.00 ? 30  LEU A HD11 4  
ATOM   3878  H  HD12 . LEU A 1 30 ? -0.109  3.848   -4.787  1.00 0.00 ? 30  LEU A HD12 4  
ATOM   3879  H  HD13 . LEU A 1 30 ? -0.577  4.657   -6.283  1.00 0.00 ? 30  LEU A HD13 4  
ATOM   3880  H  HD21 . LEU A 1 30 ? -1.042  1.455   -4.931  1.00 0.00 ? 30  LEU A HD21 4  
ATOM   3881  H  HD22 . LEU A 1 30 ? -2.582  1.201   -5.752  1.00 0.00 ? 30  LEU A HD22 4  
ATOM   3882  H  HD23 . LEU A 1 30 ? -2.555  1.789   -4.088  1.00 0.00 ? 30  LEU A HD23 4  
ATOM   3883  N  N    . ILE A 1 31 ? -2.953  6.205   -7.470  1.00 0.00 ? 31  ILE A N    4  
ATOM   3884  C  CA   . ILE A 1 31 ? -3.202  6.156   -8.905  1.00 0.00 ? 31  ILE A CA   4  
ATOM   3885  C  C    . ILE A 1 31 ? -2.347  5.085   -9.575  1.00 0.00 ? 31  ILE A C    4  
ATOM   3886  O  O    . ILE A 1 31 ? -1.169  4.926   -9.256  1.00 0.00 ? 31  ILE A O    4  
ATOM   3887  C  CB   . ILE A 1 31 ? -2.917  7.515   -9.572  1.00 0.00 ? 31  ILE A CB   4  
ATOM   3888  C  CG1  . ILE A 1 31 ? -3.806  8.602   -8.964  1.00 0.00 ? 31  ILE A CG1  4  
ATOM   3889  C  CG2  . ILE A 1 31 ? -3.137  7.424   -11.075 1.00 0.00 ? 31  ILE A CG2  4  
ATOM   3890  C  CD1  . ILE A 1 31 ? -5.283  8.373   -9.192  1.00 0.00 ? 31  ILE A CD1  4  
ATOM   3891  H  H    . ILE A 1 31 ? -2.324  6.867   -7.116  1.00 0.00 ? 31  ILE A H    4  
ATOM   3892  H  HA   . ILE A 1 31 ? -4.244  5.916   -9.055  1.00 0.00 ? 31  ILE A HA   4  
ATOM   3893  H  HB   . ILE A 1 31 ? -1.882  7.767   -9.398  1.00 0.00 ? 31  ILE A HB   4  
ATOM   3894  H  HG12 . ILE A 1 31 ? -3.638  8.642   -7.899  1.00 0.00 ? 31  ILE A HG12 4  
ATOM   3895  H  HG13 . ILE A 1 31 ? -3.546  9.555   -9.401  1.00 0.00 ? 31  ILE A HG13 4  
ATOM   3896  H  HG21 . ILE A 1 31 ? -3.216  8.419   -11.488 1.00 0.00 ? 31  ILE A HG21 4  
ATOM   3897  H  HG22 . ILE A 1 31 ? -2.302  6.912   -11.529 1.00 0.00 ? 31  ILE A HG22 4  
ATOM   3898  H  HG23 . ILE A 1 31 ? -4.046  6.878   -11.274 1.00 0.00 ? 31  ILE A HG23 4  
ATOM   3899  H  HD11 . ILE A 1 31 ? -5.495  8.416   -10.250 1.00 0.00 ? 31  ILE A HD11 4  
ATOM   3900  H  HD12 . ILE A 1 31 ? -5.562  7.403   -8.808  1.00 0.00 ? 31  ILE A HD12 4  
ATOM   3901  H  HD13 . ILE A 1 31 ? -5.850  9.139   -8.682  1.00 0.00 ? 31  ILE A HD13 4  
ATOM   3902  N  N    . PHE A 1 32 ? -2.949  4.354   -10.508 1.00 0.00 ? 32  PHE A N    4  
ATOM   3903  C  CA   . PHE A 1 32 ? -2.243  3.299   -11.225 1.00 0.00 ? 32  PHE A CA   4  
ATOM   3904  C  C    . PHE A 1 32 ? -2.949  2.966   -12.536 1.00 0.00 ? 32  PHE A C    4  
ATOM   3905  O  O    . PHE A 1 32 ? -4.119  2.582   -12.546 1.00 0.00 ? 32  PHE A O    4  
ATOM   3906  C  CB   . PHE A 1 32 ? -2.140  2.044   -10.356 1.00 0.00 ? 32  PHE A CB   4  
ATOM   3907  C  CG   . PHE A 1 32 ? -1.477  0.888   -11.048 1.00 0.00 ? 32  PHE A CG   4  
ATOM   3908  C  CD1  . PHE A 1 32 ? -0.137  0.948   -11.395 1.00 0.00 ? 32  PHE A CD1  4  
ATOM   3909  C  CD2  . PHE A 1 32 ? -2.192  -0.260  -11.350 1.00 0.00 ? 32  PHE A CD2  4  
ATOM   3910  C  CE1  . PHE A 1 32 ? 0.476   -0.114  -12.033 1.00 0.00 ? 32  PHE A CE1  4  
ATOM   3911  C  CE2  . PHE A 1 32 ? -1.584  -1.325  -11.987 1.00 0.00 ? 32  PHE A CE2  4  
ATOM   3912  C  CZ   . PHE A 1 32 ? -0.248  -1.252  -12.328 1.00 0.00 ? 32  PHE A CZ   4  
ATOM   3913  H  H    . PHE A 1 32 ? -3.890  4.529   -10.719 1.00 0.00 ? 32  PHE A H    4  
ATOM   3914  H  HA   . PHE A 1 32 ? -1.249  3.656   -11.445 1.00 0.00 ? 32  PHE A HA   4  
ATOM   3915  H  HB2  . PHE A 1 32 ? -1.567  2.273   -9.471  1.00 0.00 ? 32  PHE A HB2  4  
ATOM   3916  H  HB3  . PHE A 1 32 ? -3.133  1.733   -10.066 1.00 0.00 ? 32  PHE A HB3  4  
ATOM   3917  H  HD1  . PHE A 1 32 ? 0.432   1.837   -11.164 1.00 0.00 ? 32  PHE A HD1  4  
ATOM   3918  H  HD2  . PHE A 1 32 ? -3.238  -0.318  -11.084 1.00 0.00 ? 32  PHE A HD2  4  
ATOM   3919  H  HE1  . PHE A 1 32 ? 1.522   -0.054  -12.298 1.00 0.00 ? 32  PHE A HE1  4  
ATOM   3920  H  HE2  . PHE A 1 32 ? -2.154  -2.213  -12.217 1.00 0.00 ? 32  PHE A HE2  4  
ATOM   3921  H  HZ   . PHE A 1 32 ? 0.229   -2.083  -12.827 1.00 0.00 ? 32  PHE A HZ   4  
ATOM   3922  N  N    . LYS A 1 33 ? -2.229  3.117   -13.643 1.00 0.00 ? 33  LYS A N    4  
ATOM   3923  C  CA   . LYS A 1 33 ? -2.784  2.833   -14.961 1.00 0.00 ? 33  LYS A CA   4  
ATOM   3924  C  C    . LYS A 1 33 ? -3.967  3.747   -15.263 1.00 0.00 ? 33  LYS A C    4  
ATOM   3925  O  O    . LYS A 1 33 ? -4.897  3.361   -15.970 1.00 0.00 ? 33  LYS A O    4  
ATOM   3926  C  CB   . LYS A 1 33 ? -3.222  1.369   -15.048 1.00 0.00 ? 33  LYS A CB   4  
ATOM   3927  C  CG   . LYS A 1 33 ? -2.076  0.405   -15.304 1.00 0.00 ? 33  LYS A CG   4  
ATOM   3928  C  CD   . LYS A 1 33 ? -2.580  -1.005  -15.562 1.00 0.00 ? 33  LYS A CD   4  
ATOM   3929  C  CE   . LYS A 1 33 ? -1.430  -1.980  -15.760 1.00 0.00 ? 33  LYS A CE   4  
ATOM   3930  N  NZ   . LYS A 1 33 ? -1.861  -3.207  -16.485 1.00 0.00 ? 33  LYS A NZ   4  
ATOM   3931  H  H    . LYS A 1 33 ? -1.302  3.426   -13.571 1.00 0.00 ? 33  LYS A H    4  
ATOM   3932  H  HA   . LYS A 1 33 ? -2.010  3.012   -15.692 1.00 0.00 ? 33  LYS A HA   4  
ATOM   3933  H  HB2  . LYS A 1 33 ? -3.697  1.092   -14.119 1.00 0.00 ? 33  LYS A HB2  4  
ATOM   3934  H  HB3  . LYS A 1 33 ? -3.937  1.267   -15.852 1.00 0.00 ? 33  LYS A HB3  4  
ATOM   3935  H  HG2  . LYS A 1 33 ? -1.521  0.741   -16.168 1.00 0.00 ? 33  LYS A HG2  4  
ATOM   3936  H  HG3  . LYS A 1 33 ? -1.427  0.394   -14.440 1.00 0.00 ? 33  LYS A HG3  4  
ATOM   3937  H  HD2  . LYS A 1 33 ? -3.169  -1.327  -14.717 1.00 0.00 ? 33  LYS A HD2  4  
ATOM   3938  H  HD3  . LYS A 1 33 ? -3.194  -1.001  -16.452 1.00 0.00 ? 33  LYS A HD3  4  
ATOM   3939  H  HE2  . LYS A 1 33 ? -0.654  -1.491  -16.328 1.00 0.00 ? 33  LYS A HE2  4  
ATOM   3940  H  HE3  . LYS A 1 33 ? -1.044  -2.262  -14.791 1.00 0.00 ? 33  LYS A HE3  4  
ATOM   3941  H  HZ1  . LYS A 1 33 ? -2.732  -3.586  -16.060 1.00 0.00 ? 33  LYS A HZ1  4  
ATOM   3942  H  HZ2  . LYS A 1 33 ? -1.119  -3.934  -16.432 1.00 0.00 ? 33  LYS A HZ2  4  
ATOM   3943  H  HZ3  . LYS A 1 33 ? -2.044  -2.986  -17.485 1.00 0.00 ? 33  LYS A HZ3  4  
ATOM   3944  N  N    . ASN A 1 34 ? -3.924  4.960   -14.722 1.00 0.00 ? 34  ASN A N    4  
ATOM   3945  C  CA   . ASN A 1 34 ? -4.993  5.930   -14.934 1.00 0.00 ? 34  ASN A CA   4  
ATOM   3946  C  C    . ASN A 1 34 ? -6.273  5.491   -14.230 1.00 0.00 ? 34  ASN A C    4  
ATOM   3947  O  O    . ASN A 1 34 ? -7.361  5.550   -14.803 1.00 0.00 ? 34  ASN A O    4  
ATOM   3948  C  CB   . ASN A 1 34 ? -5.257  6.110   -16.430 1.00 0.00 ? 34  ASN A CB   4  
ATOM   3949  C  CG   . ASN A 1 34 ? -3.986  6.379   -17.213 1.00 0.00 ? 34  ASN A CG   4  
ATOM   3950  O  OD1  . ASN A 1 34 ? -2.905  6.508   -16.638 1.00 0.00 ? 34  ASN A OD1  4  
ATOM   3951  N  ND2  . ASN A 1 34 ? -4.111  6.466   -18.532 1.00 0.00 ? 34  ASN A ND2  4  
ATOM   3952  H  H    . ASN A 1 34 ? -3.156  5.210   -14.167 1.00 0.00 ? 34  ASN A H    4  
ATOM   3953  H  HA   . ASN A 1 34 ? -4.672  6.873   -14.518 1.00 0.00 ? 34  ASN A HA   4  
ATOM   3954  H  HB2  . ASN A 1 34 ? -5.712  5.211   -16.820 1.00 0.00 ? 34  ASN A HB2  4  
ATOM   3955  H  HB3  . ASN A 1 34 ? -5.930  6.942   -16.574 1.00 0.00 ? 34  ASN A HB3  4  
ATOM   3956  H  HD21 . ASN A 1 34 ? -5.004  6.353   -18.922 1.00 0.00 ? 34  ASN A HD21 4  
ATOM   3957  H  HD22 . ASN A 1 34 ? -3.306  6.639   -19.063 1.00 0.00 ? 34  ASN A HD22 4  
ATOM   3958  N  N    . ASP A 1 35 ? -6.135  5.052   -12.984 1.00 0.00 ? 35  ASP A N    4  
ATOM   3959  C  CA   . ASP A 1 35 ? -7.281  4.605   -12.199 1.00 0.00 ? 35  ASP A CA   4  
ATOM   3960  C  C    . ASP A 1 35 ? -6.974  4.666   -10.706 1.00 0.00 ? 35  ASP A C    4  
ATOM   3961  O  O    . ASP A 1 35 ? -5.878  4.331   -10.258 1.00 0.00 ? 35  ASP A O    4  
ATOM   3962  C  CB   . ASP A 1 35 ? -7.671  3.180   -12.594 1.00 0.00 ? 35  ASP A CB   4  
ATOM   3963  C  CG   . ASP A 1 35 ? -8.122  3.082   -14.038 1.00 0.00 ? 35  ASP A CG   4  
ATOM   3964  O  OD1  . ASP A 1 35 ? -9.277  3.460   -14.326 1.00 0.00 ? 35  ASP A OD1  4  
ATOM   3965  O  OD2  . ASP A 1 35 ? -7.320  2.628   -14.881 1.00 0.00 ? 35  ASP A OD2  4  
ATOM   3966  H  H    . ASP A 1 35 ? -5.242  5.029   -12.581 1.00 0.00 ? 35  ASP A H    4  
ATOM   3967  H  HA   . ASP A 1 35 ? -8.107  5.267   -12.412 1.00 0.00 ? 35  ASP A HA   4  
ATOM   3968  H  HB2  . ASP A 1 35 ? -6.819  2.529   -12.458 1.00 0.00 ? 35  ASP A HB2  4  
ATOM   3969  H  HB3  . ASP A 1 35 ? -8.479  2.846   -11.960 1.00 0.00 ? 35  ASP A HB3  4  
ATOM   3970  N  N    . PRO A 1 36 ? -7.965  5.107   -9.916  1.00 0.00 ? 36  PRO A N    4  
ATOM   3971  C  CA   . PRO A 1 36 ? -7.825  5.223   -8.462  1.00 0.00 ? 36  PRO A CA   4  
ATOM   3972  C  C    . PRO A 1 36 ? -7.750  3.863   -7.776  1.00 0.00 ? 36  PRO A C    4  
ATOM   3973  O  O    . PRO A 1 36 ? -8.335  2.887   -8.245  1.00 0.00 ? 36  PRO A O    4  
ATOM   3974  C  CB   . PRO A 1 36 ? -9.096  5.965   -8.041  1.00 0.00 ? 36  PRO A CB   4  
ATOM   3975  C  CG   . PRO A 1 36 ? -10.087 5.652   -9.109  1.00 0.00 ? 36  PRO A CG   4  
ATOM   3976  C  CD   . PRO A 1 36 ? -9.298  5.524   -10.382 1.00 0.00 ? 36  PRO A CD   4  
ATOM   3977  H  HA   . PRO A 1 36 ? -6.958  5.809   -8.192  1.00 0.00 ? 36  PRO A HA   4  
ATOM   3978  H  HB2  . PRO A 1 36 ? -9.425  5.602   -7.077  1.00 0.00 ? 36  PRO A HB2  4  
ATOM   3979  H  HB3  . PRO A 1 36 ? -8.897  7.024   -7.985  1.00 0.00 ? 36  PRO A HB3  4  
ATOM   3980  H  HG2  . PRO A 1 36 ? -10.590 4.724   -8.883  1.00 0.00 ? 36  PRO A HG2  4  
ATOM   3981  H  HG3  . PRO A 1 36 ? -10.803 6.457   -9.191  1.00 0.00 ? 36  PRO A HG3  4  
ATOM   3982  H  HD2  . PRO A 1 36 ? -9.735  4.773   -11.023 1.00 0.00 ? 36  PRO A HD2  4  
ATOM   3983  H  HD3  . PRO A 1 36 ? -9.247  6.475   -10.892 1.00 0.00 ? 36  PRO A HD3  4  
ATOM   3984  N  N    . TYR A 1 37 ? -7.026  3.806   -6.663  1.00 0.00 ? 37  TYR A N    4  
ATOM   3985  C  CA   . TYR A 1 37 ? -6.873  2.565   -5.914  1.00 0.00 ? 37  TYR A CA   4  
ATOM   3986  C  C    . TYR A 1 37 ? -6.376  2.841   -4.498  1.00 0.00 ? 37  TYR A C    4  
ATOM   3987  O  O    . TYR A 1 37 ? -5.945  3.951   -4.184  1.00 0.00 ? 37  TYR A O    4  
ATOM   3988  C  CB   . TYR A 1 37 ? -5.903  1.626   -6.633  1.00 0.00 ? 37  TYR A CB   4  
ATOM   3989  C  CG   . TYR A 1 37 ? -6.375  1.205   -8.006  1.00 0.00 ? 37  TYR A CG   4  
ATOM   3990  C  CD1  . TYR A 1 37 ? -7.514  0.424   -8.162  1.00 0.00 ? 37  TYR A CD1  4  
ATOM   3991  C  CD2  . TYR A 1 37 ? -5.682  1.588   -9.148  1.00 0.00 ? 37  TYR A CD2  4  
ATOM   3992  C  CE1  . TYR A 1 37 ? -7.948  0.036   -9.415  1.00 0.00 ? 37  TYR A CE1  4  
ATOM   3993  C  CE2  . TYR A 1 37 ? -6.110  1.206   -10.405 1.00 0.00 ? 37  TYR A CE2  4  
ATOM   3994  C  CZ   . TYR A 1 37 ? -7.243  0.430   -10.533 1.00 0.00 ? 37  TYR A CZ   4  
ATOM   3995  O  OH   . TYR A 1 37 ? -7.672  0.046   -11.783 1.00 0.00 ? 37  TYR A OH   4  
ATOM   3996  H  H    . TYR A 1 37 ? -6.583  4.618   -6.339  1.00 0.00 ? 37  TYR A H    4  
ATOM   3997  H  HA   . TYR A 1 37 ? -7.842  2.091   -5.856  1.00 0.00 ? 37  TYR A HA   4  
ATOM   3998  H  HB2  . TYR A 1 37 ? -4.952  2.122   -6.748  1.00 0.00 ? 37  TYR A HB2  4  
ATOM   3999  H  HB3  . TYR A 1 37 ? -5.770  0.734   -6.039  1.00 0.00 ? 37  TYR A HB3  4  
ATOM   4000  H  HD1  . TYR A 1 37 ? -8.064  0.118   -7.284  1.00 0.00 ? 37  TYR A HD1  4  
ATOM   4001  H  HD2  . TYR A 1 37 ? -4.795  2.197   -9.045  1.00 0.00 ? 37  TYR A HD2  4  
ATOM   4002  H  HE1  . TYR A 1 37 ? -8.835  -0.572  -9.516  1.00 0.00 ? 37  TYR A HE1  4  
ATOM   4003  H  HE2  . TYR A 1 37 ? -5.558  1.514   -11.281 1.00 0.00 ? 37  TYR A HE2  4  
ATOM   4004  H  HH   . TYR A 1 37 ? -8.563  -0.308  -11.720 1.00 0.00 ? 37  TYR A HH   4  
ATOM   4005  N  N    . HIS A 1 38 ? -6.439  1.822   -3.647  1.00 0.00 ? 38  HIS A N    4  
ATOM   4006  C  CA   . HIS A 1 38 ? -5.994  1.953   -2.264  1.00 0.00 ? 38  HIS A CA   4  
ATOM   4007  C  C    . HIS A 1 38 ? -4.532  1.538   -2.122  1.00 0.00 ? 38  HIS A C    4  
ATOM   4008  O  O    . HIS A 1 38 ? -4.122  0.463   -2.558  1.00 0.00 ? 38  HIS A O    4  
ATOM   4009  C  CB   . HIS A 1 38 ? -6.869  1.104   -1.341  1.00 0.00 ? 38  HIS A CB   4  
ATOM   4010  C  CG   . HIS A 1 38 ? -8.116  1.801   -0.891  1.00 0.00 ? 38  HIS A CG   4  
ATOM   4011  N  ND1  . HIS A 1 38 ? -9.380  1.397   -1.264  1.00 0.00 ? 38  HIS A ND1  4  
ATOM   4012  C  CD2  . HIS A 1 38 ? -8.288  2.879   -0.091  1.00 0.00 ? 38  HIS A CD2  4  
ATOM   4013  C  CE1  . HIS A 1 38 ? -10.276 2.198   -0.715  1.00 0.00 ? 38  HIS A CE1  4  
ATOM   4014  N  NE2  . HIS A 1 38 ? -9.639  3.106   0.002   1.00 0.00 ? 38  HIS A NE2  4  
ATOM   4015  H  H    . HIS A 1 38 ? -6.792  0.962   -3.956  1.00 0.00 ? 38  HIS A H    4  
ATOM   4016  H  HA   . HIS A 1 38 ? -6.089  2.991   -1.981  1.00 0.00 ? 38  HIS A HA   4  
ATOM   4017  H  HB2  . HIS A 1 38 ? -7.162  0.204   -1.862  1.00 0.00 ? 38  HIS A HB2  4  
ATOM   4018  H  HB3  . HIS A 1 38 ? -6.301  0.837   -0.462  1.00 0.00 ? 38  HIS A HB3  4  
ATOM   4019  H  HD2  . HIS A 1 38 ? -7.507  3.456   0.386   1.00 0.00 ? 38  HIS A HD2  4  
ATOM   4020  H  HE1  . HIS A 1 38 ? -11.347 2.123   -0.832  1.00 0.00 ? 38  HIS A HE1  4  
ATOM   4021  H  HE2  . HIS A 1 38 ? -10.059 3.872   0.445   1.00 0.00 ? 38  HIS A HE2  4  
ATOM   4022  N  N    . PRO A 1 39 ? -3.727  2.411   -1.497  1.00 0.00 ? 39  PRO A N    4  
ATOM   4023  C  CA   . PRO A 1 39 ? -2.299  2.157   -1.284  1.00 0.00 ? 39  PRO A CA   4  
ATOM   4024  C  C    . PRO A 1 39 ? -2.053  1.050   -0.264  1.00 0.00 ? 39  PRO A C    4  
ATOM   4025  O  O    . PRO A 1 39 ? -0.908  0.726   0.051   1.00 0.00 ? 39  PRO A O    4  
ATOM   4026  C  CB   . PRO A 1 39 ? -1.775  3.495   -0.757  1.00 0.00 ? 39  PRO A CB   4  
ATOM   4027  C  CG   . PRO A 1 39 ? -2.962  4.148   -0.137  1.00 0.00 ? 39  PRO A CG   4  
ATOM   4028  C  CD   . PRO A 1 39 ? -4.148  3.712   -0.952  1.00 0.00 ? 39  PRO A CD   4  
ATOM   4029  H  HA   . PRO A 1 39 ? -1.797  1.911   -2.208  1.00 0.00 ? 39  PRO A HA   4  
ATOM   4030  H  HB2  . PRO A 1 39 ? -0.996  3.318   -0.030  1.00 0.00 ? 39  PRO A HB2  4  
ATOM   4031  H  HB3  . PRO A 1 39 ? -1.386  4.081   -1.576  1.00 0.00 ? 39  PRO A HB3  4  
ATOM   4032  H  HG2  . PRO A 1 39 ? -3.069  3.821   0.886   1.00 0.00 ? 39  PRO A HG2  4  
ATOM   4033  H  HG3  . PRO A 1 39 ? -2.854  5.222   -0.179  1.00 0.00 ? 39  PRO A HG3  4  
ATOM   4034  H  HD2  . PRO A 1 39 ? -5.019  3.602   -0.322  1.00 0.00 ? 39  PRO A HD2  4  
ATOM   4035  H  HD3  . PRO A 1 39 ? -4.341  4.418   -1.746  1.00 0.00 ? 39  PRO A HD3  4  
ATOM   4036  N  N    . ASP A 1 40 ? -3.135  0.473   0.248   1.00 0.00 ? 40  ASP A N    4  
ATOM   4037  C  CA   . ASP A 1 40 ? -3.036  -0.599  1.232   1.00 0.00 ? 40  ASP A CA   4  
ATOM   4038  C  C    . ASP A 1 40 ? -3.317  -1.954  0.589   1.00 0.00 ? 40  ASP A C    4  
ATOM   4039  O  O    . ASP A 1 40 ? -2.996  -2.999  1.154   1.00 0.00 ? 40  ASP A O    4  
ATOM   4040  C  CB   . ASP A 1 40 ? -4.012  -0.355  2.383   1.00 0.00 ? 40  ASP A CB   4  
ATOM   4041  C  CG   . ASP A 1 40 ? -5.452  -0.270  1.914   1.00 0.00 ? 40  ASP A CG   4  
ATOM   4042  O  OD1  . ASP A 1 40 ? -5.949  -1.263  1.344   1.00 0.00 ? 40  ASP A OD1  4  
ATOM   4043  O  OD2  . ASP A 1 40 ? -6.080  0.790   2.117   1.00 0.00 ? 40  ASP A OD2  4  
ATOM   4044  H  H    . ASP A 1 40 ? -4.021  0.775   -0.043  1.00 0.00 ? 40  ASP A H    4  
ATOM   4045  H  HA   . ASP A 1 40 ? -2.029  -0.601  1.620   1.00 0.00 ? 40  ASP A HA   4  
ATOM   4046  H  HB2  . ASP A 1 40 ? -3.932  -1.166  3.093   1.00 0.00 ? 40  ASP A HB2  4  
ATOM   4047  H  HB3  . ASP A 1 40 ? -3.756  0.573   2.873   1.00 0.00 ? 40  ASP A HB3  4  
ATOM   4048  N  N    . HIS A 1 41 ? -3.919  -1.927  -0.596  1.00 0.00 ? 41  HIS A N    4  
ATOM   4049  C  CA   . HIS A 1 41 ? -4.244  -3.153  -1.316  1.00 0.00 ? 41  HIS A CA   4  
ATOM   4050  C  C    . HIS A 1 41 ? -2.980  -3.824  -1.845  1.00 0.00 ? 41  HIS A C    4  
ATOM   4051  O  O    . HIS A 1 41 ? -2.802  -5.034  -1.704  1.00 0.00 ? 41  HIS A O    4  
ATOM   4052  C  CB   . HIS A 1 41 ? -5.198  -2.853  -2.473  1.00 0.00 ? 41  HIS A CB   4  
ATOM   4053  C  CG   . HIS A 1 41 ? -6.613  -2.627  -2.038  1.00 0.00 ? 41  HIS A CG   4  
ATOM   4054  N  ND1  . HIS A 1 41 ? -7.109  -3.068  -0.830  1.00 0.00 ? 41  HIS A ND1  4  
ATOM   4055  C  CD2  . HIS A 1 41 ? -7.641  -2.001  -2.659  1.00 0.00 ? 41  HIS A CD2  4  
ATOM   4056  C  CE1  . HIS A 1 41 ? -8.381  -2.724  -0.726  1.00 0.00 ? 41  HIS A CE1  4  
ATOM   4057  N  NE2  . HIS A 1 41 ? -8.727  -2.075  -1.823  1.00 0.00 ? 41  HIS A NE2  4  
ATOM   4058  H  H    . HIS A 1 41 ? -4.150  -1.063  -0.995  1.00 0.00 ? 41  HIS A H    4  
ATOM   4059  H  HA   . HIS A 1 41 ? -4.731  -3.825  -0.625  1.00 0.00 ? 41  HIS A HA   4  
ATOM   4060  H  HB2  . HIS A 1 41 ? -4.863  -1.964  -2.985  1.00 0.00 ? 41  HIS A HB2  4  
ATOM   4061  H  HB3  . HIS A 1 41 ? -5.190  -3.685  -3.162  1.00 0.00 ? 41  HIS A HB3  4  
ATOM   4062  H  HD1  . HIS A 1 41 ? -6.605  -3.561  -0.150  1.00 0.00 ? 41  HIS A HD1  4  
ATOM   4063  H  HD2  . HIS A 1 41 ? -7.612  -1.531  -3.632  1.00 0.00 ? 41  HIS A HD2  4  
ATOM   4064  H  HE1  . HIS A 1 41 ? -9.027  -2.936  0.112   1.00 0.00 ? 41  HIS A HE1  4  
ATOM   4065  N  N    . PHE A 1 42 ? -2.105  -3.031  -2.454  1.00 0.00 ? 42  PHE A N    4  
ATOM   4066  C  CA   . PHE A 1 42 ? -0.858  -3.548  -3.005  1.00 0.00 ? 42  PHE A CA   4  
ATOM   4067  C  C    . PHE A 1 42 ? 0.298   -3.329  -2.034  1.00 0.00 ? 42  PHE A C    4  
ATOM   4068  O  O    . PHE A 1 42 ? 0.224   -2.482  -1.144  1.00 0.00 ? 42  PHE A O    4  
ATOM   4069  C  CB   . PHE A 1 42 ? -0.549  -2.874  -4.344  1.00 0.00 ? 42  PHE A CB   4  
ATOM   4070  C  CG   . PHE A 1 42 ? -1.763  -2.664  -5.203  1.00 0.00 ? 42  PHE A CG   4  
ATOM   4071  C  CD1  . PHE A 1 42 ? -2.265  -3.695  -5.981  1.00 0.00 ? 42  PHE A CD1  4  
ATOM   4072  C  CD2  . PHE A 1 42 ? -2.402  -1.435  -5.233  1.00 0.00 ? 42  PHE A CD2  4  
ATOM   4073  C  CE1  . PHE A 1 42 ? -3.382  -3.505  -6.772  1.00 0.00 ? 42  PHE A CE1  4  
ATOM   4074  C  CE2  . PHE A 1 42 ? -3.519  -1.239  -6.023  1.00 0.00 ? 42  PHE A CE2  4  
ATOM   4075  C  CZ   . PHE A 1 42 ? -4.009  -2.274  -6.794  1.00 0.00 ? 42  PHE A CZ   4  
ATOM   4076  H  H    . PHE A 1 42 ? -2.304  -2.074  -2.535  1.00 0.00 ? 42  PHE A H    4  
ATOM   4077  H  HA   . PHE A 1 42 ? -0.982  -4.608  -3.165  1.00 0.00 ? 42  PHE A HA   4  
ATOM   4078  H  HB2  . PHE A 1 42 ? -0.104  -1.909  -4.158  1.00 0.00 ? 42  PHE A HB2  4  
ATOM   4079  H  HB3  . PHE A 1 42 ? 0.147   -3.488  -4.895  1.00 0.00 ? 42  PHE A HB3  4  
ATOM   4080  H  HD1  . PHE A 1 42 ? -1.775  -4.658  -5.964  1.00 0.00 ? 42  PHE A HD1  4  
ATOM   4081  H  HD2  . PHE A 1 42 ? -2.019  -0.623  -4.632  1.00 0.00 ? 42  PHE A HD2  4  
ATOM   4082  H  HE1  . PHE A 1 42 ? -3.762  -4.317  -7.374  1.00 0.00 ? 42  PHE A HE1  4  
ATOM   4083  H  HE2  . PHE A 1 42 ? -4.008  -0.276  -6.038  1.00 0.00 ? 42  PHE A HE2  4  
ATOM   4084  H  HZ   . PHE A 1 42 ? -4.882  -2.124  -7.411  1.00 0.00 ? 42  PHE A HZ   4  
ATOM   4085  N  N    . ASN A 1 43 ? 1.366   -4.100  -2.211  1.00 0.00 ? 43  ASN A N    4  
ATOM   4086  C  CA   . ASN A 1 43 ? 2.538   -3.992  -1.351  1.00 0.00 ? 43  ASN A CA   4  
ATOM   4087  C  C    . ASN A 1 43 ? 3.821   -3.983  -2.177  1.00 0.00 ? 43  ASN A C    4  
ATOM   4088  O  O    . ASN A 1 43 ? 3.872   -4.547  -3.270  1.00 0.00 ? 43  ASN A O    4  
ATOM   4089  C  CB   . ASN A 1 43 ? 2.571   -5.149  -0.350  1.00 0.00 ? 43  ASN A CB   4  
ATOM   4090  C  CG   . ASN A 1 43 ? 1.442   -5.072  0.659   1.00 0.00 ? 43  ASN A CG   4  
ATOM   4091  O  OD1  . ASN A 1 43 ? 0.359   -4.569  0.359   1.00 0.00 ? 43  ASN A OD1  4  
ATOM   4092  N  ND2  . ASN A 1 43 ? 1.690   -5.572  1.864   1.00 0.00 ? 43  ASN A ND2  4  
ATOM   4093  H  H    . ASN A 1 43 ? 1.366   -4.757  -2.938  1.00 0.00 ? 43  ASN A H    4  
ATOM   4094  H  HA   . ASN A 1 43 ? 2.467   -3.061  -0.809  1.00 0.00 ? 43  ASN A HA   4  
ATOM   4095  H  HB2  . ASN A 1 43 ? 2.485   -6.083  -0.886  1.00 0.00 ? 43  ASN A HB2  4  
ATOM   4096  H  HB3  . ASN A 1 43 ? 3.509   -5.130  0.184   1.00 0.00 ? 43  ASN A HB3  4  
ATOM   4097  H  HD21 . ASN A 1 43 ? 2.576   -5.957  2.032   1.00 0.00 ? 43  ASN A HD21 4  
ATOM   4098  H  HD22 . ASN A 1 43 ? 0.978   -5.536  2.536   1.00 0.00 ? 43  ASN A HD22 4  
ATOM   4099  N  N    . CYS A 1 44 ? 4.856   -3.341  -1.646  1.00 0.00 ? 44  CYS A N    4  
ATOM   4100  C  CA   . CYS A 1 44 ? 6.139   -3.258  -2.332  1.00 0.00 ? 44  CYS A CA   4  
ATOM   4101  C  C    . CYS A 1 44 ? 6.573   -4.630  -2.841  1.00 0.00 ? 44  CYS A C    4  
ATOM   4102  O  O    . CYS A 1 44 ? 6.152   -5.660  -2.316  1.00 0.00 ? 44  CYS A O    4  
ATOM   4103  C  CB   . CYS A 1 44 ? 7.207   -2.688  -1.396  1.00 0.00 ? 44  CYS A CB   4  
ATOM   4104  S  SG   . CYS A 1 44 ? 8.806   -2.360  -2.203  1.00 0.00 ? 44  CYS A SG   4  
ATOM   4105  H  H    . CYS A 1 44 ? 4.754   -2.911  -0.770  1.00 0.00 ? 44  CYS A H    4  
ATOM   4106  H  HA   . CYS A 1 44 ? 6.022   -2.595  -3.176  1.00 0.00 ? 44  CYS A HA   4  
ATOM   4107  H  HB2  . CYS A 1 44 ? 6.851   -1.755  -0.983  1.00 0.00 ? 44  CYS A HB2  4  
ATOM   4108  H  HB3  . CYS A 1 44 ? 7.380   -3.388  -0.592  1.00 0.00 ? 44  CYS A HB3  4  
ATOM   4109  N  N    . ALA A 1 45 ? 7.419   -4.634  -3.866  1.00 0.00 ? 45  ALA A N    4  
ATOM   4110  C  CA   . ALA A 1 45 ? 7.913   -5.877  -4.445  1.00 0.00 ? 45  ALA A CA   4  
ATOM   4111  C  C    . ALA A 1 45 ? 9.311   -6.205  -3.931  1.00 0.00 ? 45  ALA A C    4  
ATOM   4112  O  O    . ALA A 1 45 ? 9.716   -7.366  -3.905  1.00 0.00 ? 45  ALA A O    4  
ATOM   4113  C  CB   . ALA A 1 45 ? 7.913   -5.789  -5.964  1.00 0.00 ? 45  ALA A CB   4  
ATOM   4114  H  H    . ALA A 1 45 ? 7.719   -3.780  -4.242  1.00 0.00 ? 45  ALA A H    4  
ATOM   4115  H  HA   . ALA A 1 45 ? 7.239   -6.671  -4.155  1.00 0.00 ? 45  ALA A HA   4  
ATOM   4116  H  HB1  . ALA A 1 45 ? 8.047   -4.760  -6.264  1.00 0.00 ? 45  ALA A HB1  4  
ATOM   4117  H  HB2  . ALA A 1 45 ? 8.720   -6.388  -6.358  1.00 0.00 ? 45  ALA A HB2  4  
ATOM   4118  H  HB3  . ALA A 1 45 ? 6.972   -6.156  -6.345  1.00 0.00 ? 45  ALA A HB3  4  
ATOM   4119  N  N    . ASN A 1 46 ? 10.043  -5.173  -3.524  1.00 0.00 ? 46  ASN A N    4  
ATOM   4120  C  CA   . ASN A 1 46 ? 11.397  -5.352  -3.013  1.00 0.00 ? 46  ASN A CA   4  
ATOM   4121  C  C    . ASN A 1 46 ? 11.373  -5.838  -1.567  1.00 0.00 ? 46  ASN A C    4  
ATOM   4122  O  O    . ASN A 1 46 ? 11.807  -6.951  -1.267  1.00 0.00 ? 46  ASN A O    4  
ATOM   4123  C  CB   . ASN A 1 46 ? 12.178  -4.040  -3.109  1.00 0.00 ? 46  ASN A CB   4  
ATOM   4124  C  CG   . ASN A 1 46 ? 13.658  -4.227  -2.836  1.00 0.00 ? 46  ASN A CG   4  
ATOM   4125  O  OD1  . ASN A 1 46 ? 14.376  -4.833  -3.632  1.00 0.00 ? 46  ASN A OD1  4  
ATOM   4126  N  ND2  . ASN A 1 46 ? 14.122  -3.706  -1.706  1.00 0.00 ? 46  ASN A ND2  4  
ATOM   4127  H  H    . ASN A 1 46 ? 9.665   -4.270  -3.570  1.00 0.00 ? 46  ASN A H    4  
ATOM   4128  H  HA   . ASN A 1 46 ? 11.886  -6.097  -3.622  1.00 0.00 ? 46  ASN A HA   4  
ATOM   4129  H  HB2  . ASN A 1 46 ? 12.064  -3.632  -4.102  1.00 0.00 ? 46  ASN A HB2  4  
ATOM   4130  H  HB3  . ASN A 1 46 ? 11.784  -3.339  -2.388  1.00 0.00 ? 46  ASN A HB3  4  
ATOM   4131  H  HD21 . ASN A 1 46 ? 13.492  -3.237  -1.119  1.00 0.00 ? 46  ASN A HD21 4  
ATOM   4132  H  HD22 . ASN A 1 46 ? 15.075  -3.812  -1.505  1.00 0.00 ? 46  ASN A HD22 4  
ATOM   4133  N  N    . CYS A 1 47 ? 10.862  -4.996  -0.674  1.00 0.00 ? 47  CYS A N    4  
ATOM   4134  C  CA   . CYS A 1 47 ? 10.780  -5.339  0.740   1.00 0.00 ? 47  CYS A CA   4  
ATOM   4135  C  C    . CYS A 1 47 ? 9.520   -6.149  1.032   1.00 0.00 ? 47  CYS A C    4  
ATOM   4136  O  O    . CYS A 1 47 ? 9.566   -7.156  1.736   1.00 0.00 ? 47  CYS A O    4  
ATOM   4137  C  CB   . CYS A 1 47 ? 10.792  -4.070  1.595   1.00 0.00 ? 47  CYS A CB   4  
ATOM   4138  S  SG   . CYS A 1 47 ? 9.489   -2.871  1.166   1.00 0.00 ? 47  CYS A SG   4  
ATOM   4139  H  H    . CYS A 1 47 ? 10.532  -4.123  -0.975  1.00 0.00 ? 47  CYS A H    4  
ATOM   4140  H  HA   . CYS A 1 47 ? 11.643  -5.937  0.988   1.00 0.00 ? 47  CYS A HA   4  
ATOM   4141  H  HB2  . CYS A 1 47 ? 10.659  -4.342  2.632   1.00 0.00 ? 47  CYS A HB2  4  
ATOM   4142  H  HB3  . CYS A 1 47 ? 11.745  -3.575  1.478   1.00 0.00 ? 47  CYS A HB3  4  
ATOM   4143  N  N    . GLY A 1 48 ? 8.394   -5.700  0.484   1.00 0.00 ? 48  GLY A N    4  
ATOM   4144  C  CA   . GLY A 1 48 ? 7.138   -6.395  0.696   1.00 0.00 ? 48  GLY A CA   4  
ATOM   4145  C  C    . GLY A 1 48 ? 6.314   -5.776  1.807   1.00 0.00 ? 48  GLY A C    4  
ATOM   4146  O  O    . GLY A 1 48 ? 5.775   -6.483  2.660   1.00 0.00 ? 48  GLY A O    4  
ATOM   4147  H  H    . GLY A 1 48 ? 8.417   -4.891  -0.069  1.00 0.00 ? 48  GLY A H    4  
ATOM   4148  H  HA2  . GLY A 1 48 ? 6.566   -6.369  -0.219  1.00 0.00 ? 48  GLY A HA2  4  
ATOM   4149  H  HA3  . GLY A 1 48 ? 7.347   -7.424  0.950   1.00 0.00 ? 48  GLY A HA3  4  
ATOM   4150  N  N    . LYS A 1 49 ? 6.215   -4.451  1.801   1.00 0.00 ? 49  LYS A N    4  
ATOM   4151  C  CA   . LYS A 1 49 ? 5.451   -3.735  2.816   1.00 0.00 ? 49  LYS A CA   4  
ATOM   4152  C  C    . LYS A 1 49 ? 4.240   -3.043  2.198   1.00 0.00 ? 49  LYS A C    4  
ATOM   4153  O  O    . LYS A 1 49 ? 4.150   -2.902  0.979   1.00 0.00 ? 49  LYS A O    4  
ATOM   4154  C  CB   . LYS A 1 49 ? 6.338   -2.703  3.518   1.00 0.00 ? 49  LYS A CB   4  
ATOM   4155  C  CG   . LYS A 1 49 ? 6.722   -1.529  2.634   1.00 0.00 ? 49  LYS A CG   4  
ATOM   4156  C  CD   . LYS A 1 49 ? 5.718   -0.394  2.747   1.00 0.00 ? 49  LYS A CD   4  
ATOM   4157  C  CE   . LYS A 1 49 ? 6.066   0.546   3.891   1.00 0.00 ? 49  LYS A CE   4  
ATOM   4158  N  NZ   . LYS A 1 49 ? 7.257   1.383   3.577   1.00 0.00 ? 49  LYS A NZ   4  
ATOM   4159  H  H    . LYS A 1 49 ? 6.667   -3.941  1.095   1.00 0.00 ? 49  LYS A H    4  
ATOM   4160  H  HA   . LYS A 1 49 ? 5.108   -4.456  3.542   1.00 0.00 ? 49  LYS A HA   4  
ATOM   4161  H  HB2  . LYS A 1 49 ? 5.811   -2.321  4.380   1.00 0.00 ? 49  LYS A HB2  4  
ATOM   4162  H  HB3  . LYS A 1 49 ? 7.245   -3.191  3.847   1.00 0.00 ? 49  LYS A HB3  4  
ATOM   4163  H  HG2  . LYS A 1 49 ? 7.694   -1.167  2.934   1.00 0.00 ? 49  LYS A HG2  4  
ATOM   4164  H  HG3  . LYS A 1 49 ? 6.761   -1.862  1.606   1.00 0.00 ? 49  LYS A HG3  4  
ATOM   4165  H  HD2  . LYS A 1 49 ? 5.714   0.165   1.824   1.00 0.00 ? 49  LYS A HD2  4  
ATOM   4166  H  HD3  . LYS A 1 49 ? 4.735   -0.811  2.922   1.00 0.00 ? 49  LYS A HD3  4  
ATOM   4167  H  HE2  . LYS A 1 49 ? 5.223   1.192   4.079   1.00 0.00 ? 49  LYS A HE2  4  
ATOM   4168  H  HE3  . LYS A 1 49 ? 6.273   -0.042  4.773   1.00 0.00 ? 49  LYS A HE3  4  
ATOM   4169  H  HZ1  . LYS A 1 49 ? 6.960   2.272   3.125   1.00 0.00 ? 49  LYS A HZ1  4  
ATOM   4170  H  HZ2  . LYS A 1 49 ? 7.892   0.874   2.929   1.00 0.00 ? 49  LYS A HZ2  4  
ATOM   4171  H  HZ3  . LYS A 1 49 ? 7.777   1.607   4.449   1.00 0.00 ? 49  LYS A HZ3  4  
ATOM   4172  N  N    . GLU A 1 50 ? 3.313   -2.614  3.048   1.00 0.00 ? 50  GLU A N    4  
ATOM   4173  C  CA   . GLU A 1 50 ? 2.107   -1.936  2.584   1.00 0.00 ? 50  GLU A CA   4  
ATOM   4174  C  C    . GLU A 1 50 ? 2.455   -0.621  1.892   1.00 0.00 ? 50  GLU A C    4  
ATOM   4175  O  O    . GLU A 1 50 ? 2.794   0.367   2.546   1.00 0.00 ? 50  GLU A O    4  
ATOM   4176  C  CB   . GLU A 1 50 ? 1.160   -1.674  3.756   1.00 0.00 ? 50  GLU A CB   4  
ATOM   4177  C  CG   . GLU A 1 50 ? -0.140  -1.000  3.349   1.00 0.00 ? 50  GLU A CG   4  
ATOM   4178  C  CD   . GLU A 1 50 ? -0.943  -0.513  4.539   1.00 0.00 ? 50  GLU A CD   4  
ATOM   4179  O  OE1  . GLU A 1 50 ? -0.400  0.281   5.336   1.00 0.00 ? 50  GLU A OE1  4  
ATOM   4180  O  OE2  . GLU A 1 50 ? -2.114  -0.925  4.673   1.00 0.00 ? 50  GLU A OE2  4  
ATOM   4181  H  H    . GLU A 1 50 ? 3.441   -2.756  4.009   1.00 0.00 ? 50  GLU A H    4  
ATOM   4182  H  HA   . GLU A 1 50 ? 1.616   -2.584  1.873   1.00 0.00 ? 50  GLU A HA   4  
ATOM   4183  H  HB2  . GLU A 1 50 ? 0.921   -2.616  4.228   1.00 0.00 ? 50  GLU A HB2  4  
ATOM   4184  H  HB3  . GLU A 1 50 ? 1.660   -1.040  4.472   1.00 0.00 ? 50  GLU A HB3  4  
ATOM   4185  H  HG2  . GLU A 1 50 ? 0.090   -0.154  2.719   1.00 0.00 ? 50  GLU A HG2  4  
ATOM   4186  H  HG3  . GLU A 1 50 ? -0.739  -1.707  2.794   1.00 0.00 ? 50  GLU A HG3  4  
ATOM   4187  N  N    . LEU A 1 51 ? 2.369   -0.616  0.567   1.00 0.00 ? 51  LEU A N    4  
ATOM   4188  C  CA   . LEU A 1 51 ? 2.674   0.577   -0.215  1.00 0.00 ? 51  LEU A CA   4  
ATOM   4189  C  C    . LEU A 1 51 ? 1.901   1.784   0.307   1.00 0.00 ? 51  LEU A C    4  
ATOM   4190  O  O    . LEU A 1 51 ? 1.019   1.650   1.156   1.00 0.00 ? 51  LEU A O    4  
ATOM   4191  C  CB   . LEU A 1 51 ? 2.341   0.343   -1.690  1.00 0.00 ? 51  LEU A CB   4  
ATOM   4192  C  CG   . LEU A 1 51 ? 3.292   -0.578  -2.455  1.00 0.00 ? 51  LEU A CG   4  
ATOM   4193  C  CD1  . LEU A 1 51 ? 2.719   -0.920  -3.822  1.00 0.00 ? 51  LEU A CD1  4  
ATOM   4194  C  CD2  . LEU A 1 51 ? 4.663   0.067   -2.595  1.00 0.00 ? 51  LEU A CD2  4  
ATOM   4195  H  H    . LEU A 1 51 ? 2.094   -1.433  0.102   1.00 0.00 ? 51  LEU A H    4  
ATOM   4196  H  HA   . LEU A 1 51 ? 3.732   0.774   -0.120  1.00 0.00 ? 51  LEU A HA   4  
ATOM   4197  H  HB2  . LEU A 1 51 ? 1.352   -0.085  -1.742  1.00 0.00 ? 51  LEU A HB2  4  
ATOM   4198  H  HB3  . LEU A 1 51 ? 2.341   1.305   -2.184  1.00 0.00 ? 51  LEU A HB3  4  
ATOM   4199  H  HG   . LEU A 1 51 ? 3.410   -1.501  -1.903  1.00 0.00 ? 51  LEU A HG   4  
ATOM   4200  H  HD11 . LEU A 1 51 ? 1.921   -1.638  -3.708  1.00 0.00 ? 51  LEU A HD11 4  
ATOM   4201  H  HD12 . LEU A 1 51 ? 3.496   -1.341  -4.442  1.00 0.00 ? 51  LEU A HD12 4  
ATOM   4202  H  HD13 . LEU A 1 51 ? 2.335   -0.024  -4.285  1.00 0.00 ? 51  LEU A HD13 4  
ATOM   4203  H  HD21 . LEU A 1 51 ? 4.749   0.519   -3.572  1.00 0.00 ? 51  LEU A HD21 4  
ATOM   4204  H  HD22 . LEU A 1 51 ? 5.429   -0.686  -2.478  1.00 0.00 ? 51  LEU A HD22 4  
ATOM   4205  H  HD23 . LEU A 1 51 ? 4.783   0.825   -1.836  1.00 0.00 ? 51  LEU A HD23 4  
ATOM   4206  N  N    . THR A 1 52 ? 2.236   2.963   -0.207  1.00 0.00 ? 52  THR A N    4  
ATOM   4207  C  CA   . THR A 1 52 ? 1.573   4.193   0.207   1.00 0.00 ? 52  THR A CA   4  
ATOM   4208  C  C    . THR A 1 52 ? 0.888   4.872   -0.974  1.00 0.00 ? 52  THR A C    4  
ATOM   4209  O  O    . THR A 1 52 ? 1.056   4.461   -2.121  1.00 0.00 ? 52  THR A O    4  
ATOM   4210  C  CB   . THR A 1 52 ? 2.568   5.180   0.846   1.00 0.00 ? 52  THR A CB   4  
ATOM   4211  O  OG1  . THR A 1 52 ? 3.597   5.514   -0.092  1.00 0.00 ? 52  THR A OG1  4  
ATOM   4212  C  CG2  . THR A 1 52 ? 3.191   4.585   2.099   1.00 0.00 ? 52  THR A CG2  4  
ATOM   4213  H  H    . THR A 1 52 ? 2.947   3.005   -0.880  1.00 0.00 ? 52  THR A H    4  
ATOM   4214  H  HA   . THR A 1 52 ? 0.827   3.938   0.946   1.00 0.00 ? 52  THR A HA   4  
ATOM   4215  H  HB   . THR A 1 52 ? 2.035   6.080   1.119   1.00 0.00 ? 52  THR A HB   4  
ATOM   4216  H  HG1  . THR A 1 52 ? 4.314   5.960   0.365   1.00 0.00 ? 52  THR A HG1  4  
ATOM   4217  H  HG21 . THR A 1 52 ? 3.508   5.381   2.757   1.00 0.00 ? 52  THR A HG21 4  
ATOM   4218  H  HG22 . THR A 1 52 ? 4.045   3.982   1.826   1.00 0.00 ? 52  THR A HG22 4  
ATOM   4219  H  HG23 . THR A 1 52 ? 2.463   3.970   2.605   1.00 0.00 ? 52  THR A HG23 4  
ATOM   4220  N  N    . ALA A 1 53 ? 0.117   5.915   -0.684  1.00 0.00 ? 53  ALA A N    4  
ATOM   4221  C  CA   . ALA A 1 53 ? -0.591  6.653   -1.723  1.00 0.00 ? 53  ALA A CA   4  
ATOM   4222  C  C    . ALA A 1 53 ? 0.382   7.240   -2.739  1.00 0.00 ? 53  ALA A C    4  
ATOM   4223  O  O    . ALA A 1 53 ? 0.105   7.259   -3.939  1.00 0.00 ? 53  ALA A O    4  
ATOM   4224  C  CB   . ALA A 1 53 ? -1.439  7.754   -1.103  1.00 0.00 ? 53  ALA A CB   4  
ATOM   4225  H  H    . ALA A 1 53 ? 0.023   6.195   0.250   1.00 0.00 ? 53  ALA A H    4  
ATOM   4226  H  HA   . ALA A 1 53 ? -1.253  5.965   -2.229  1.00 0.00 ? 53  ALA A HA   4  
ATOM   4227  H  HB1  . ALA A 1 53 ? -1.887  8.347   -1.888  1.00 0.00 ? 53  ALA A HB1  4  
ATOM   4228  H  HB2  . ALA A 1 53 ? -2.215  7.313   -0.497  1.00 0.00 ? 53  ALA A HB2  4  
ATOM   4229  H  HB3  . ALA A 1 53 ? -0.815  8.385   -0.487  1.00 0.00 ? 53  ALA A HB3  4  
ATOM   4230  N  N    . ASP A 1 54 ? 1.521   7.719   -2.252  1.00 0.00 ? 54  ASP A N    4  
ATOM   4231  C  CA   . ASP A 1 54 ? 2.536   8.307   -3.119  1.00 0.00 ? 54  ASP A CA   4  
ATOM   4232  C  C    . ASP A 1 54 ? 3.351   7.222   -3.816  1.00 0.00 ? 54  ASP A C    4  
ATOM   4233  O  O    . ASP A 1 54 ? 4.218   7.514   -4.638  1.00 0.00 ? 54  ASP A O    4  
ATOM   4234  C  CB   . ASP A 1 54 ? 3.461   9.218   -2.311  1.00 0.00 ? 54  ASP A CB   4  
ATOM   4235  C  CG   . ASP A 1 54 ? 4.010   10.365  -3.137  1.00 0.00 ? 54  ASP A CG   4  
ATOM   4236  O  OD1  . ASP A 1 54 ? 4.757   10.097  -4.101  1.00 0.00 ? 54  ASP A OD1  4  
ATOM   4237  O  OD2  . ASP A 1 54 ? 3.692   11.530  -2.819  1.00 0.00 ? 54  ASP A OD2  4  
ATOM   4238  H  H    . ASP A 1 54 ? 1.684   7.676   -1.287  1.00 0.00 ? 54  ASP A H    4  
ATOM   4239  H  HA   . ASP A 1 54 ? 2.030   8.897   -3.869  1.00 0.00 ? 54  ASP A HA   4  
ATOM   4240  H  HB2  . ASP A 1 54 ? 2.912   9.630   -1.477  1.00 0.00 ? 54  ASP A HB2  4  
ATOM   4241  H  HB3  . ASP A 1 54 ? 4.292   8.637   -1.939  1.00 0.00 ? 54  ASP A HB3  4  
ATOM   4242  N  N    . ALA A 1 55 ? 3.066   5.968   -3.479  1.00 0.00 ? 55  ALA A N    4  
ATOM   4243  C  CA   . ALA A 1 55 ? 3.772   4.839   -4.073  1.00 0.00 ? 55  ALA A CA   4  
ATOM   4244  C  C    . ALA A 1 55 ? 4.108   5.109   -5.535  1.00 0.00 ? 55  ALA A C    4  
ATOM   4245  O  O    . ALA A 1 55 ? 3.404   5.854   -6.217  1.00 0.00 ? 55  ALA A O    4  
ATOM   4246  C  CB   . ALA A 1 55 ? 2.940   3.571   -3.947  1.00 0.00 ? 55  ALA A CB   4  
ATOM   4247  H  H    . ALA A 1 55 ? 2.364   5.798   -2.818  1.00 0.00 ? 55  ALA A H    4  
ATOM   4248  H  HA   . ALA A 1 55 ? 4.690   4.693   -3.523  1.00 0.00 ? 55  ALA A HA   4  
ATOM   4249  H  HB1  . ALA A 1 55 ? 3.267   2.852   -4.684  1.00 0.00 ? 55  ALA A HB1  4  
ATOM   4250  H  HB2  . ALA A 1 55 ? 3.064   3.156   -2.958  1.00 0.00 ? 55  ALA A HB2  4  
ATOM   4251  H  HB3  . ALA A 1 55 ? 1.899   3.806   -4.111  1.00 0.00 ? 55  ALA A HB3  4  
ATOM   4252  N  N    . ARG A 1 56 ? 5.190   4.501   -6.011  1.00 0.00 ? 56  ARG A N    4  
ATOM   4253  C  CA   . ARG A 1 56 ? 5.621   4.678   -7.392  1.00 0.00 ? 56  ARG A CA   4  
ATOM   4254  C  C    . ARG A 1 56 ? 5.466   3.381   -8.181  1.00 0.00 ? 56  ARG A C    4  
ATOM   4255  O  O    . ARG A 1 56 ? 5.375   2.299   -7.602  1.00 0.00 ? 56  ARG A O    4  
ATOM   4256  C  CB   . ARG A 1 56 ? 7.077   5.145   -7.439  1.00 0.00 ? 56  ARG A CB   4  
ATOM   4257  C  CG   . ARG A 1 56 ? 7.367   6.327   -6.528  1.00 0.00 ? 56  ARG A CG   4  
ATOM   4258  C  CD   . ARG A 1 56 ? 6.652   7.583   -7.000  1.00 0.00 ? 56  ARG A CD   4  
ATOM   4259  N  NE   . ARG A 1 56 ? 6.760   8.671   -6.032  1.00 0.00 ? 56  ARG A NE   4  
ATOM   4260  C  CZ   . ARG A 1 56 ? 6.635   9.954   -6.352  1.00 0.00 ? 56  ARG A CZ   4  
ATOM   4261  N  NH1  . ARG A 1 56 ? 6.399   10.308  -7.608  1.00 0.00 ? 56  ARG A NH1  4  
ATOM   4262  N  NH2  . ARG A 1 56 ? 6.746   10.887  -5.415  1.00 0.00 ? 56  ARG A NH2  4  
ATOM   4263  H  H    . ARG A 1 56 ? 5.711   3.919   -5.419  1.00 0.00 ? 56  ARG A H    4  
ATOM   4264  H  HA   . ARG A 1 56 ? 4.995   5.435   -7.841  1.00 0.00 ? 56  ARG A HA   4  
ATOM   4265  H  HB2  . ARG A 1 56 ? 7.716   4.325   -7.142  1.00 0.00 ? 56  ARG A HB2  4  
ATOM   4266  H  HB3  . ARG A 1 56 ? 7.319   5.431   -8.451  1.00 0.00 ? 56  ARG A HB3  4  
ATOM   4267  H  HG2  . ARG A 1 56 ? 7.033   6.090   -5.529  1.00 0.00 ? 56  ARG A HG2  4  
ATOM   4268  H  HG3  . ARG A 1 56 ? 8.431   6.510   -6.520  1.00 0.00 ? 56  ARG A HG3  4  
ATOM   4269  H  HD2  . ARG A 1 56 ? 7.089   7.901   -7.935  1.00 0.00 ? 56  ARG A HD2  4  
ATOM   4270  H  HD3  . ARG A 1 56 ? 5.608   7.350   -7.152  1.00 0.00 ? 56  ARG A HD3  4  
ATOM   4271  H  HE   . ARG A 1 56 ? 6.934   8.432   -5.098  1.00 0.00 ? 56  ARG A HE   4  
ATOM   4272  H  HH11 . ARG A 1 56 ? 6.314   9.607   -8.316  1.00 0.00 ? 56  ARG A HH11 4  
ATOM   4273  H  HH12 . ARG A 1 56 ? 6.305   11.275  -7.846  1.00 0.00 ? 56  ARG A HH12 4  
ATOM   4274  H  HH21 . ARG A 1 56 ? 6.924   10.624  -4.467  1.00 0.00 ? 56  ARG A HH21 4  
ATOM   4275  H  HH22 . ARG A 1 56 ? 6.652   11.852  -5.656  1.00 0.00 ? 56  ARG A HH22 4  
ATOM   4276  N  N    . GLU A 1 57 ? 5.437   3.499   -9.505  1.00 0.00 ? 57  GLU A N    4  
ATOM   4277  C  CA   . GLU A 1 57 ? 5.292   2.336   -10.372 1.00 0.00 ? 57  GLU A CA   4  
ATOM   4278  C  C    . GLU A 1 57 ? 6.581   2.067   -11.143 1.00 0.00 ? 57  GLU A C    4  
ATOM   4279  O  O    . GLU A 1 57 ? 7.232   2.993   -11.628 1.00 0.00 ? 57  GLU A O    4  
ATOM   4280  C  CB   . GLU A 1 57 ? 4.134   2.543   -11.350 1.00 0.00 ? 57  GLU A CB   4  
ATOM   4281  C  CG   . GLU A 1 57 ? 3.878   1.347   -12.252 1.00 0.00 ? 57  GLU A CG   4  
ATOM   4282  C  CD   . GLU A 1 57 ? 3.091   1.712   -13.496 1.00 0.00 ? 57  GLU A CD   4  
ATOM   4283  O  OE1  . GLU A 1 57 ? 2.212   2.594   -13.405 1.00 0.00 ? 57  GLU A OE1  4  
ATOM   4284  O  OE2  . GLU A 1 57 ? 3.356   1.116   -14.561 1.00 0.00 ? 57  GLU A OE2  4  
ATOM   4285  H  H    . GLU A 1 57 ? 5.515   4.389   -9.908  1.00 0.00 ? 57  GLU A H    4  
ATOM   4286  H  HA   . GLU A 1 57 ? 5.075   1.482   -9.748  1.00 0.00 ? 57  GLU A HA   4  
ATOM   4287  H  HB2  . GLU A 1 57 ? 3.234   2.742   -10.787 1.00 0.00 ? 57  GLU A HB2  4  
ATOM   4288  H  HB3  . GLU A 1 57 ? 4.354   3.397   -11.974 1.00 0.00 ? 57  GLU A HB3  4  
ATOM   4289  H  HG2  . GLU A 1 57 ? 4.827   0.931   -12.555 1.00 0.00 ? 57  GLU A HG2  4  
ATOM   4290  H  HG3  . GLU A 1 57 ? 3.322   0.606   -11.697 1.00 0.00 ? 57  GLU A HG3  4  
ATOM   4291  N  N    . LEU A 1 58 ? 6.944   0.794   -11.250 1.00 0.00 ? 58  LEU A N    4  
ATOM   4292  C  CA   . LEU A 1 58 ? 8.156   0.402   -11.961 1.00 0.00 ? 58  LEU A CA   4  
ATOM   4293  C  C    . LEU A 1 58 ? 7.891   -0.793  -12.872 1.00 0.00 ? 58  LEU A C    4  
ATOM   4294  O  O    . LEU A 1 58 ? 7.677   -1.911  -12.402 1.00 0.00 ? 58  LEU A O    4  
ATOM   4295  C  CB   . LEU A 1 58 ? 9.268   0.062   -10.966 1.00 0.00 ? 58  LEU A CB   4  
ATOM   4296  C  CG   . LEU A 1 58 ? 10.159  1.226   -10.533 1.00 0.00 ? 58  LEU A CG   4  
ATOM   4297  C  CD1  . LEU A 1 58 ? 11.123  0.783   -9.443  1.00 0.00 ? 58  LEU A CD1  4  
ATOM   4298  C  CD2  . LEU A 1 58 ? 10.921  1.787   -11.725 1.00 0.00 ? 58  LEU A CD2  4  
ATOM   4299  H  H    . LEU A 1 58 ? 6.385   0.100   -10.843 1.00 0.00 ? 58  LEU A H    4  
ATOM   4300  H  HA   . LEU A 1 58 ? 8.470   1.238   -12.568 1.00 0.00 ? 58  LEU A HA   4  
ATOM   4301  H  HB2  . LEU A 1 58 ? 8.805   -0.347  -10.082 1.00 0.00 ? 58  LEU A HB2  4  
ATOM   4302  H  HB3  . LEU A 1 58 ? 9.899   -0.688  -11.421 1.00 0.00 ? 58  LEU A HB3  4  
ATOM   4303  H  HG   . LEU A 1 58 ? 9.539   2.015   -10.129 1.00 0.00 ? 58  LEU A HG   4  
ATOM   4304  H  HD11 . LEU A 1 58 ? 10.713  -0.071  -8.926  1.00 0.00 ? 58  LEU A HD11 4  
ATOM   4305  H  HD12 . LEU A 1 58 ? 11.269  1.592   -8.742  1.00 0.00 ? 58  LEU A HD12 4  
ATOM   4306  H  HD13 . LEU A 1 58 ? 12.071  0.516   -9.887  1.00 0.00 ? 58  LEU A HD13 4  
ATOM   4307  H  HD21 . LEU A 1 58 ? 11.939  2.000   -11.433 1.00 0.00 ? 58  LEU A HD21 4  
ATOM   4308  H  HD22 . LEU A 1 58 ? 10.445  2.697   -12.060 1.00 0.00 ? 58  LEU A HD22 4  
ATOM   4309  H  HD23 . LEU A 1 58 ? 10.919  1.063   -12.526 1.00 0.00 ? 58  LEU A HD23 4  
ATOM   4310  N  N    . LYS A 1 59 ? 7.908   -0.550  -14.178 1.00 0.00 ? 59  LYS A N    4  
ATOM   4311  C  CA   . LYS A 1 59 ? 7.673   -1.605  -15.156 1.00 0.00 ? 59  LYS A CA   4  
ATOM   4312  C  C    . LYS A 1 59 ? 6.423   -2.405  -14.804 1.00 0.00 ? 59  LYS A C    4  
ATOM   4313  O  O    . LYS A 1 59 ? 6.407   -3.630  -14.912 1.00 0.00 ? 59  LYS A O    4  
ATOM   4314  C  CB   . LYS A 1 59 ? 8.884   -2.538  -15.232 1.00 0.00 ? 59  LYS A CB   4  
ATOM   4315  C  CG   . LYS A 1 59 ? 10.160  -1.843  -15.673 1.00 0.00 ? 59  LYS A CG   4  
ATOM   4316  C  CD   . LYS A 1 59 ? 10.924  -1.276  -14.488 1.00 0.00 ? 59  LYS A CD   4  
ATOM   4317  C  CE   . LYS A 1 59 ? 12.003  -0.301  -14.934 1.00 0.00 ? 59  LYS A CE   4  
ATOM   4318  N  NZ   . LYS A 1 59 ? 13.082  -0.164  -13.917 1.00 0.00 ? 59  LYS A NZ   4  
ATOM   4319  H  H    . LYS A 1 59 ? 8.084   0.362   -14.492 1.00 0.00 ? 59  LYS A H    4  
ATOM   4320  H  HA   . LYS A 1 59 ? 7.528   -1.139  -16.119 1.00 0.00 ? 59  LYS A HA   4  
ATOM   4321  H  HB2  . LYS A 1 59 ? 9.052   -2.970  -14.256 1.00 0.00 ? 59  LYS A HB2  4  
ATOM   4322  H  HB3  . LYS A 1 59 ? 8.669   -3.330  -15.935 1.00 0.00 ? 59  LYS A HB3  4  
ATOM   4323  H  HG2  . LYS A 1 59 ? 10.789  -2.556  -16.185 1.00 0.00 ? 59  LYS A HG2  4  
ATOM   4324  H  HG3  . LYS A 1 59 ? 9.906   -1.036  -16.345 1.00 0.00 ? 59  LYS A HG3  4  
ATOM   4325  H  HD2  . LYS A 1 59 ? 10.234  -0.759  -13.839 1.00 0.00 ? 59  LYS A HD2  4  
ATOM   4326  H  HD3  . LYS A 1 59 ? 11.388  -2.090  -13.947 1.00 0.00 ? 59  LYS A HD3  4  
ATOM   4327  H  HE2  . LYS A 1 59 ? 12.433  -0.659  -15.857 1.00 0.00 ? 59  LYS A HE2  4  
ATOM   4328  H  HE3  . LYS A 1 59 ? 11.549  0.665   -15.099 1.00 0.00 ? 59  LYS A HE3  4  
ATOM   4329  H  HZ1  . LYS A 1 59 ? 13.979  0.085   -14.381 1.00 0.00 ? 59  LYS A HZ1  4  
ATOM   4330  H  HZ2  . LYS A 1 59 ? 13.206  -1.060  -13.405 1.00 0.00 ? 59  LYS A HZ2  4  
ATOM   4331  H  HZ3  . LYS A 1 59 ? 12.837  0.582   -13.235 1.00 0.00 ? 59  LYS A HZ3  4  
ATOM   4332  N  N    . GLY A 1 60 ? 5.375   -1.703  -14.383 1.00 0.00 ? 60  GLY A N    4  
ATOM   4333  C  CA   . GLY A 1 60 ? 4.135   -2.365  -14.022 1.00 0.00 ? 60  GLY A CA   4  
ATOM   4334  C  C    . GLY A 1 60 ? 4.026   -2.620  -12.532 1.00 0.00 ? 60  GLY A C    4  
ATOM   4335  O  O    . GLY A 1 60 ? 2.951   -2.479  -11.949 1.00 0.00 ? 60  GLY A O    4  
ATOM   4336  H  H    . GLY A 1 60 ? 5.445   -0.727  -14.316 1.00 0.00 ? 60  GLY A H    4  
ATOM   4337  H  HA2  . GLY A 1 60 ? 3.306   -1.746  -14.333 1.00 0.00 ? 60  GLY A HA2  4  
ATOM   4338  H  HA3  . GLY A 1 60 ? 4.080   -3.309  -14.543 1.00 0.00 ? 60  GLY A HA3  4  
ATOM   4339  N  N    . GLU A 1 61 ? 5.141   -2.999  -11.915 1.00 0.00 ? 61  GLU A N    4  
ATOM   4340  C  CA   . GLU A 1 61 ? 5.164   -3.277  -10.484 1.00 0.00 ? 61  GLU A CA   4  
ATOM   4341  C  C    . GLU A 1 61 ? 4.951   -1.999  -9.677  1.00 0.00 ? 61  GLU A C    4  
ATOM   4342  O  O    . GLU A 1 61 ? 4.928   -0.899  -10.231 1.00 0.00 ? 61  GLU A O    4  
ATOM   4343  C  CB   . GLU A 1 61 ? 6.492   -3.926  -10.090 1.00 0.00 ? 61  GLU A CB   4  
ATOM   4344  C  CG   . GLU A 1 61 ? 6.633   -5.362  -10.566 1.00 0.00 ? 61  GLU A CG   4  
ATOM   4345  C  CD   . GLU A 1 61 ? 5.631   -6.295  -9.913  1.00 0.00 ? 61  GLU A CD   4  
ATOM   4346  O  OE1  . GLU A 1 61 ? 5.057   -5.912  -8.872  1.00 0.00 ? 61  GLU A OE1  4  
ATOM   4347  O  OE2  . GLU A 1 61 ? 5.421   -7.406  -10.442 1.00 0.00 ? 61  GLU A OE2  4  
ATOM   4348  H  H    . GLU A 1 61 ? 5.966   -3.093  -12.434 1.00 0.00 ? 61  GLU A H    4  
ATOM   4349  H  HA   . GLU A 1 61 ? 4.360   -3.963  -10.266 1.00 0.00 ? 61  GLU A HA   4  
ATOM   4350  H  HB2  . GLU A 1 61 ? 7.301   -3.348  -10.511 1.00 0.00 ? 61  GLU A HB2  4  
ATOM   4351  H  HB3  . GLU A 1 61 ? 6.578   -3.917  -9.013  1.00 0.00 ? 61  GLU A HB3  4  
ATOM   4352  H  HG2  . GLU A 1 61 ? 6.483   -5.390  -11.635 1.00 0.00 ? 61  GLU A HG2  4  
ATOM   4353  H  HG3  . GLU A 1 61 ? 7.629   -5.709  -10.335 1.00 0.00 ? 61  GLU A HG3  4  
ATOM   4354  N  N    . LEU A 1 62 ? 4.796   -2.153  -8.367  1.00 0.00 ? 62  LEU A N    4  
ATOM   4355  C  CA   . LEU A 1 62 ? 4.584   -1.012  -7.483  1.00 0.00 ? 62  LEU A CA   4  
ATOM   4356  C  C    . LEU A 1 62 ? 5.494   -1.094  -6.261  1.00 0.00 ? 62  LEU A C    4  
ATOM   4357  O  O    . LEU A 1 62 ? 5.375   -2.009  -5.446  1.00 0.00 ? 62  LEU A O    4  
ATOM   4358  C  CB   . LEU A 1 62 ? 3.121   -0.949  -7.041  1.00 0.00 ? 62  LEU A CB   4  
ATOM   4359  C  CG   . LEU A 1 62 ? 2.126   -0.441  -8.084  1.00 0.00 ? 62  LEU A CG   4  
ATOM   4360  C  CD1  . LEU A 1 62 ? 0.702   -0.791  -7.679  1.00 0.00 ? 62  LEU A CD1  4  
ATOM   4361  C  CD2  . LEU A 1 62 ? 2.273   1.062   -8.275  1.00 0.00 ? 62  LEU A CD2  4  
ATOM   4362  H  H    . LEU A 1 62 ? 4.824   -3.054  -7.984  1.00 0.00 ? 62  LEU A H    4  
ATOM   4363  H  HA   . LEU A 1 62 ? 4.824   -0.115  -8.036  1.00 0.00 ? 62  LEU A HA   4  
ATOM   4364  H  HB2  . LEU A 1 62 ? 2.820   -1.944  -6.754  1.00 0.00 ? 62  LEU A HB2  4  
ATOM   4365  H  HB3  . LEU A 1 62 ? 3.064   -0.295  -6.182  1.00 0.00 ? 62  LEU A HB3  4  
ATOM   4366  H  HG   . LEU A 1 62 ? 2.330   -0.921  -9.031  1.00 0.00 ? 62  LEU A HG   4  
ATOM   4367  H  HD11 . LEU A 1 62 ? 0.012   -0.136  -8.188  1.00 0.00 ? 62  LEU A HD11 4  
ATOM   4368  H  HD12 . LEU A 1 62 ? 0.592   -0.672  -6.612  1.00 0.00 ? 62  LEU A HD12 4  
ATOM   4369  H  HD13 . LEU A 1 62 ? 0.493   -1.816  -7.950  1.00 0.00 ? 62  LEU A HD13 4  
ATOM   4370  H  HD21 . LEU A 1 62 ? 1.380   1.455   -8.737  1.00 0.00 ? 62  LEU A HD21 4  
ATOM   4371  H  HD22 . LEU A 1 62 ? 3.124   1.262   -8.910  1.00 0.00 ? 62  LEU A HD22 4  
ATOM   4372  H  HD23 . LEU A 1 62 ? 2.420   1.534   -7.315  1.00 0.00 ? 62  LEU A HD23 4  
ATOM   4373  N  N    . TYR A 1 63 ? 6.400   -0.130  -6.139  1.00 0.00 ? 63  TYR A N    4  
ATOM   4374  C  CA   . TYR A 1 63 ? 7.330   -0.093  -5.017  1.00 0.00 ? 63  TYR A CA   4  
ATOM   4375  C  C    . TYR A 1 63 ? 7.050   1.106   -4.117  1.00 0.00 ? 63  TYR A C    4  
ATOM   4376  O  O    . TYR A 1 63 ? 6.530   2.128   -4.567  1.00 0.00 ? 63  TYR A O    4  
ATOM   4377  C  CB   . TYR A 1 63 ? 8.772   -0.038  -5.524  1.00 0.00 ? 63  TYR A CB   4  
ATOM   4378  C  CG   . TYR A 1 63 ? 9.164   -1.233  -6.364  1.00 0.00 ? 63  TYR A CG   4  
ATOM   4379  C  CD1  . TYR A 1 63 ? 8.815   -1.307  -7.707  1.00 0.00 ? 63  TYR A CD1  4  
ATOM   4380  C  CD2  . TYR A 1 63 ? 9.884   -2.287  -5.815  1.00 0.00 ? 63  TYR A CD2  4  
ATOM   4381  C  CE1  . TYR A 1 63 ? 9.170   -2.397  -8.478  1.00 0.00 ? 63  TYR A CE1  4  
ATOM   4382  C  CE2  . TYR A 1 63 ? 10.245  -3.380  -6.579  1.00 0.00 ? 63  TYR A CE2  4  
ATOM   4383  C  CZ   . TYR A 1 63 ? 9.886   -3.430  -7.910  1.00 0.00 ? 63  TYR A CZ   4  
ATOM   4384  O  OH   . TYR A 1 63 ? 10.243  -4.517  -8.674  1.00 0.00 ? 63  TYR A OH   4  
ATOM   4385  H  H    . TYR A 1 63 ? 6.446   0.572   -6.821  1.00 0.00 ? 63  TYR A H    4  
ATOM   4386  H  HA   . TYR A 1 63 ? 7.194   -0.999  -4.444  1.00 0.00 ? 63  TYR A HA   4  
ATOM   4387  H  HB2  . TYR A 1 63 ? 8.901   0.847   -6.127  1.00 0.00 ? 63  TYR A HB2  4  
ATOM   4388  H  HB3  . TYR A 1 63 ? 9.442   0.007   -4.678  1.00 0.00 ? 63  TYR A HB3  4  
ATOM   4389  H  HD1  . TYR A 1 63 ? 8.254   -0.496  -8.149  1.00 0.00 ? 63  TYR A HD1  4  
ATOM   4390  H  HD2  . TYR A 1 63 ? 10.163  -2.244  -4.772  1.00 0.00 ? 63  TYR A HD2  4  
ATOM   4391  H  HE1  . TYR A 1 63 ? 8.889   -2.437  -9.520  1.00 0.00 ? 63  TYR A HE1  4  
ATOM   4392  H  HE2  . TYR A 1 63 ? 10.805  -4.189  -6.134  1.00 0.00 ? 63  TYR A HE2  4  
ATOM   4393  H  HH   . TYR A 1 63 ? 9.764   -4.495  -9.506  1.00 0.00 ? 63  TYR A HH   4  
ATOM   4394  N  N    . CYS A 1 64 ? 7.398   0.974   -2.841  1.00 0.00 ? 64  CYS A N    4  
ATOM   4395  C  CA   . CYS A 1 64 ? 7.185   2.045   -1.875  1.00 0.00 ? 64  CYS A CA   4  
ATOM   4396  C  C    . CYS A 1 64 ? 8.218   3.153   -2.055  1.00 0.00 ? 64  CYS A C    4  
ATOM   4397  O  O    . CYS A 1 64 ? 9.308   2.921   -2.580  1.00 0.00 ? 64  CYS A O    4  
ATOM   4398  C  CB   . CYS A 1 64 ? 7.254   1.495   -0.449  1.00 0.00 ? 64  CYS A CB   4  
ATOM   4399  S  SG   . CYS A 1 64 ? 8.904   0.897   0.039   1.00 0.00 ? 64  CYS A SG   4  
ATOM   4400  H  H    . CYS A 1 64 ? 7.808   0.135   -2.541  1.00 0.00 ? 64  CYS A H    4  
ATOM   4401  H  HA   . CYS A 1 64 ? 6.201   2.455   -2.046  1.00 0.00 ? 64  CYS A HA   4  
ATOM   4402  H  HB2  . CYS A 1 64 ? 6.970   2.274   0.243   1.00 0.00 ? 64  CYS A HB2  4  
ATOM   4403  H  HB3  . CYS A 1 64 ? 6.564   0.669   -0.356  1.00 0.00 ? 64  CYS A HB3  4  
ATOM   4404  N  N    . LEU A 1 65 ? 7.869   4.357   -1.615  1.00 0.00 ? 65  LEU A N    4  
ATOM   4405  C  CA   . LEU A 1 65 ? 8.766   5.502   -1.727  1.00 0.00 ? 65  LEU A CA   4  
ATOM   4406  C  C    . LEU A 1 65 ? 10.174  5.137   -1.268  1.00 0.00 ? 65  LEU A C    4  
ATOM   4407  O  O    . LEU A 1 65 ? 11.164  5.403   -1.951  1.00 0.00 ? 65  LEU A O    4  
ATOM   4408  C  CB   . LEU A 1 65 ? 8.235   6.673   -0.898  1.00 0.00 ? 65  LEU A CB   4  
ATOM   4409  C  CG   . LEU A 1 65 ? 7.332   7.662   -1.636  1.00 0.00 ? 65  LEU A CG   4  
ATOM   4410  C  CD1  . LEU A 1 65 ? 8.152   8.543   -2.565  1.00 0.00 ? 65  LEU A CD1  4  
ATOM   4411  C  CD2  . LEU A 1 65 ? 6.254   6.922   -2.414  1.00 0.00 ? 65  LEU A CD2  4  
ATOM   4412  H  H    . LEU A 1 65 ? 6.988   4.480   -1.206  1.00 0.00 ? 65  LEU A H    4  
ATOM   4413  H  HA   . LEU A 1 65 ? 8.803   5.794   -2.766  1.00 0.00 ? 65  LEU A HA   4  
ATOM   4414  H  HB2  . LEU A 1 65 ? 7.673   6.266   -0.072  1.00 0.00 ? 65  LEU A HB2  4  
ATOM   4415  H  HB3  . LEU A 1 65 ? 9.086   7.221   -0.518  1.00 0.00 ? 65  LEU A HB3  4  
ATOM   4416  H  HG   . LEU A 1 65 ? 6.844   8.302   -0.914  1.00 0.00 ? 65  LEU A HG   4  
ATOM   4417  H  HD11 . LEU A 1 65 ? 8.931   9.034   -2.001  1.00 0.00 ? 65  LEU A HD11 4  
ATOM   4418  H  HD12 . LEU A 1 65 ? 7.511   9.287   -3.016  1.00 0.00 ? 65  LEU A HD12 4  
ATOM   4419  H  HD13 . LEU A 1 65 ? 8.596   7.935   -3.339  1.00 0.00 ? 65  LEU A HD13 4  
ATOM   4420  H  HD21 . LEU A 1 65 ? 6.091   7.415   -3.361  1.00 0.00 ? 65  LEU A HD21 4  
ATOM   4421  H  HD22 . LEU A 1 65 ? 5.335   6.923   -1.846  1.00 0.00 ? 65  LEU A HD22 4  
ATOM   4422  H  HD23 . LEU A 1 65 ? 6.570   5.904   -2.587  1.00 0.00 ? 65  LEU A HD23 4  
ATOM   4423  N  N    . PRO A 1 66 ? 10.269  4.512   -0.086  1.00 0.00 ? 66  PRO A N    4  
ATOM   4424  C  CA   . PRO A 1 66 ? 11.551  4.094   0.489   1.00 0.00 ? 66  PRO A CA   4  
ATOM   4425  C  C    . PRO A 1 66 ? 12.424  3.354   -0.518  1.00 0.00 ? 66  PRO A C    4  
ATOM   4426  O  O    . PRO A 1 66 ? 13.493  3.832   -0.899  1.00 0.00 ? 66  PRO A O    4  
ATOM   4427  C  CB   . PRO A 1 66 ? 11.141  3.160   1.630   1.00 0.00 ? 66  PRO A CB   4  
ATOM   4428  C  CG   . PRO A 1 66 ? 9.774   3.610   2.016   1.00 0.00 ? 66  PRO A CG   4  
ATOM   4429  C  CD   . PRO A 1 66 ? 9.131   4.163   0.782   1.00 0.00 ? 66  PRO A CD   4  
ATOM   4430  H  HA   . PRO A 1 66 ? 12.099  4.935   0.889   1.00 0.00 ? 66  PRO A HA   4  
ATOM   4431  H  HB2  . PRO A 1 66 ? 11.137  2.138   1.278   1.00 0.00 ? 66  PRO A HB2  4  
ATOM   4432  H  HB3  . PRO A 1 66 ? 11.836  3.261   2.450   1.00 0.00 ? 66  PRO A HB3  4  
ATOM   4433  H  HG2  . PRO A 1 66 ? 9.202   2.772   2.383   1.00 0.00 ? 66  PRO A HG2  4  
ATOM   4434  H  HG3  . PRO A 1 66 ? 9.841   4.380   2.770   1.00 0.00 ? 66  PRO A HG3  4  
ATOM   4435  H  HD2  . PRO A 1 66 ? 8.508   3.413   0.317   1.00 0.00 ? 66  PRO A HD2  4  
ATOM   4436  H  HD3  . PRO A 1 66 ? 8.550   5.041   1.025   1.00 0.00 ? 66  PRO A HD3  4  
ATOM   4437  N  N    . CYS A 1 67 ? 11.963  2.184   -0.947  1.00 0.00 ? 67  CYS A N    4  
ATOM   4438  C  CA   . CYS A 1 67 ? 12.701  1.377   -1.911  1.00 0.00 ? 67  CYS A CA   4  
ATOM   4439  C  C    . CYS A 1 67 ? 12.942  2.155   -3.201  1.00 0.00 ? 67  CYS A C    4  
ATOM   4440  O  O    . CYS A 1 67 ? 14.071  2.245   -3.683  1.00 0.00 ? 67  CYS A O    4  
ATOM   4441  C  CB   . CYS A 1 67 ? 11.939  0.085   -2.215  1.00 0.00 ? 67  CYS A CB   4  
ATOM   4442  S  SG   . CYS A 1 67 ? 12.072  -1.181  -0.913  1.00 0.00 ? 67  CYS A SG   4  
ATOM   4443  H  H    . CYS A 1 67 ? 11.103  1.855   -0.607  1.00 0.00 ? 67  CYS A H    4  
ATOM   4444  H  HA   . CYS A 1 67 ? 13.655  1.127   -1.472  1.00 0.00 ? 67  CYS A HA   4  
ATOM   4445  H  HB2  . CYS A 1 67 ? 10.892  0.316   -2.343  1.00 0.00 ? 67  CYS A HB2  4  
ATOM   4446  H  HB3  . CYS A 1 67 ? 12.322  -0.342  -3.130  1.00 0.00 ? 67  CYS A HB3  4  
ATOM   4447  N  N    . HIS A 1 68 ? 11.872  2.716   -3.756  1.00 0.00 ? 68  HIS A N    4  
ATOM   4448  C  CA   . HIS A 1 68 ? 11.966  3.488   -4.990  1.00 0.00 ? 68  HIS A CA   4  
ATOM   4449  C  C    . HIS A 1 68 ? 13.216  4.362   -4.990  1.00 0.00 ? 68  HIS A C    4  
ATOM   4450  O  O    . HIS A 1 68 ? 13.926  4.447   -5.992  1.00 0.00 ? 68  HIS A O    4  
ATOM   4451  C  CB   . HIS A 1 68 ? 10.721  4.357   -5.170  1.00 0.00 ? 68  HIS A CB   4  
ATOM   4452  C  CG   . HIS A 1 68 ? 10.480  4.772   -6.588  1.00 0.00 ? 68  HIS A CG   4  
ATOM   4453  N  ND1  . HIS A 1 68 ? 10.696  6.055   -7.044  1.00 0.00 ? 68  HIS A ND1  4  
ATOM   4454  C  CD2  . HIS A 1 68 ? 10.040  4.064   -7.655  1.00 0.00 ? 68  HIS A CD2  4  
ATOM   4455  C  CE1  . HIS A 1 68 ? 10.397  6.119   -8.330  1.00 0.00 ? 68  HIS A CE1  4  
ATOM   4456  N  NE2  . HIS A 1 68 ? 9.997   4.924   -8.725  1.00 0.00 ? 68  HIS A NE2  4  
ATOM   4457  H  H    . HIS A 1 68 ? 10.998  2.609   -3.324  1.00 0.00 ? 68  HIS A H    4  
ATOM   4458  H  HA   . HIS A 1 68 ? 12.030  2.791   -5.812  1.00 0.00 ? 68  HIS A HA   4  
ATOM   4459  H  HB2  . HIS A 1 68 ? 9.855   3.807   -4.833  1.00 0.00 ? 68  HIS A HB2  4  
ATOM   4460  H  HB3  . HIS A 1 68 ? 10.826  5.253   -4.574  1.00 0.00 ? 68  HIS A HB3  4  
ATOM   4461  H  HD1  . HIS A 1 68 ? 11.018  6.807   -6.505  1.00 0.00 ? 68  HIS A HD1  4  
ATOM   4462  H  HD2  . HIS A 1 68 ? 9.771   3.017   -7.664  1.00 0.00 ? 68  HIS A HD2  4  
ATOM   4463  H  HE1  . HIS A 1 68 ? 10.469  6.999   -8.952  1.00 0.00 ? 68  HIS A HE1  4  
ATOM   4464  N  N    . ASP A 1 69 ? 13.478  5.011   -3.860  1.00 0.00 ? 69  ASP A N    4  
ATOM   4465  C  CA   . ASP A 1 69 ? 14.642  5.879   -3.730  1.00 0.00 ? 69  ASP A CA   4  
ATOM   4466  C  C    . ASP A 1 69 ? 15.926  5.120   -4.052  1.00 0.00 ? 69  ASP A C    4  
ATOM   4467  O  O    . ASP A 1 69 ? 16.756  5.585   -4.832  1.00 0.00 ? 69  ASP A O    4  
ATOM   4468  C  CB   . ASP A 1 69 ? 14.718  6.457   -2.315  1.00 0.00 ? 69  ASP A CB   4  
ATOM   4469  C  CG   . ASP A 1 69 ? 13.721  7.577   -2.093  1.00 0.00 ? 69  ASP A CG   4  
ATOM   4470  O  OD1  . ASP A 1 69 ? 13.730  8.545   -2.882  1.00 0.00 ? 69  ASP A OD1  4  
ATOM   4471  O  OD2  . ASP A 1 69 ? 12.930  7.484   -1.131  1.00 0.00 ? 69  ASP A OD2  4  
ATOM   4472  H  H    . ASP A 1 69 ? 12.874  4.903   -3.096  1.00 0.00 ? 69  ASP A H    4  
ATOM   4473  H  HA   . ASP A 1 69 ? 14.532  6.690   -4.434  1.00 0.00 ? 69  ASP A HA   4  
ATOM   4474  H  HB2  . ASP A 1 69 ? 14.515  5.672   -1.601  1.00 0.00 ? 69  ASP A HB2  4  
ATOM   4475  H  HB3  . ASP A 1 69 ? 15.712  6.844   -2.145  1.00 0.00 ? 69  ASP A HB3  4  
ATOM   4476  N  N    . LYS A 1 70 ? 16.081  3.948   -3.445  1.00 0.00 ? 70  LYS A N    4  
ATOM   4477  C  CA   . LYS A 1 70 ? 17.263  3.122   -3.666  1.00 0.00 ? 70  LYS A CA   4  
ATOM   4478  C  C    . LYS A 1 70 ? 17.533  2.947   -5.157  1.00 0.00 ? 70  LYS A C    4  
ATOM   4479  O  O    . LYS A 1 70 ? 18.670  3.071   -5.610  1.00 0.00 ? 70  LYS A O    4  
ATOM   4480  C  CB   . LYS A 1 70 ? 17.085  1.754   -3.004  1.00 0.00 ? 70  LYS A CB   4  
ATOM   4481  C  CG   . LYS A 1 70 ? 17.172  1.795   -1.489  1.00 0.00 ? 70  LYS A CG   4  
ATOM   4482  C  CD   . LYS A 1 70 ? 16.597  0.536   -0.862  1.00 0.00 ? 70  LYS A CD   4  
ATOM   4483  C  CE   . LYS A 1 70 ? 16.536  0.645   0.653   1.00 0.00 ? 70  LYS A CE   4  
ATOM   4484  N  NZ   . LYS A 1 70 ? 17.785  0.150   1.295   1.00 0.00 ? 70  LYS A NZ   4  
ATOM   4485  H  H    . LYS A 1 70 ? 15.384  3.630   -2.833  1.00 0.00 ? 70  LYS A H    4  
ATOM   4486  H  HA   . LYS A 1 70 ? 18.107  3.623   -3.216  1.00 0.00 ? 70  LYS A HA   4  
ATOM   4487  H  HB2  . LYS A 1 70 ? 16.118  1.358   -3.278  1.00 0.00 ? 70  LYS A HB2  4  
ATOM   4488  H  HB3  . LYS A 1 70 ? 17.854  1.088   -3.370  1.00 0.00 ? 70  LYS A HB3  4  
ATOM   4489  H  HG2  . LYS A 1 70 ? 18.208  1.887   -1.199  1.00 0.00 ? 70  LYS A HG2  4  
ATOM   4490  H  HG3  . LYS A 1 70 ? 16.619  2.651   -1.129  1.00 0.00 ? 70  LYS A HG3  4  
ATOM   4491  H  HD2  . LYS A 1 70 ? 15.597  0.380   -1.241  1.00 0.00 ? 70  LYS A HD2  4  
ATOM   4492  H  HD3  . LYS A 1 70 ? 17.220  -0.306  -1.130  1.00 0.00 ? 70  LYS A HD3  4  
ATOM   4493  H  HE2  . LYS A 1 70 ? 16.389  1.680   0.921   1.00 0.00 ? 70  LYS A HE2  4  
ATOM   4494  H  HE3  . LYS A 1 70 ? 15.701  0.059   1.010   1.00 0.00 ? 70  LYS A HE3  4  
ATOM   4495  H  HZ1  . LYS A 1 70 ? 17.727  -0.878  1.444   1.00 0.00 ? 70  LYS A HZ1  4  
ATOM   4496  H  HZ2  . LYS A 1 70 ? 17.922  0.614   2.216   1.00 0.00 ? 70  LYS A HZ2  4  
ATOM   4497  H  HZ3  . LYS A 1 70 ? 18.605  0.357   0.690   1.00 0.00 ? 70  LYS A HZ3  4  
ATOM   4498  N  N    . MET A 1 71 ? 16.479  2.659   -5.914  1.00 0.00 ? 71  MET A N    4  
ATOM   4499  C  CA   . MET A 1 71 ? 16.603  2.469   -7.355  1.00 0.00 ? 71  MET A CA   4  
ATOM   4500  C  C    . MET A 1 71 ? 17.671  3.391   -7.935  1.00 0.00 ? 71  MET A C    4  
ATOM   4501  O  O    . MET A 1 71 ? 18.575  2.944   -8.639  1.00 0.00 ? 71  MET A O    4  
ATOM   4502  C  CB   . MET A 1 71 ? 15.261  2.729   -8.042  1.00 0.00 ? 71  MET A CB   4  
ATOM   4503  C  CG   . MET A 1 71 ? 14.148  1.808   -7.570  1.00 0.00 ? 71  MET A CG   4  
ATOM   4504  S  SD   . MET A 1 71 ? 14.426  0.087   -8.032  1.00 0.00 ? 71  MET A SD   4  
ATOM   4505  C  CE   . MET A 1 71 ? 13.304  -0.750  -6.915  1.00 0.00 ? 71  MET A CE   4  
ATOM   4506  H  H    . MET A 1 71 ? 15.597  2.572   -5.495  1.00 0.00 ? 71  MET A H    4  
ATOM   4507  H  HA   . MET A 1 71 ? 16.895  1.445   -7.530  1.00 0.00 ? 71  MET A HA   4  
ATOM   4508  H  HB2  . MET A 1 71 ? 14.962  3.748   -7.849  1.00 0.00 ? 71  MET A HB2  4  
ATOM   4509  H  HB3  . MET A 1 71 ? 15.383  2.593   -9.107  1.00 0.00 ? 71  MET A HB3  4  
ATOM   4510  H  HG2  . MET A 1 71 ? 14.080  1.869   -6.494  1.00 0.00 ? 71  MET A HG2  4  
ATOM   4511  H  HG3  . MET A 1 71 ? 13.217  2.138   -8.006  1.00 0.00 ? 71  MET A HG3  4  
ATOM   4512  H  HE1  . MET A 1 71 ? 12.499  -0.082  -6.646  1.00 0.00 ? 71  MET A HE1  4  
ATOM   4513  H  HE2  . MET A 1 71 ? 12.900  -1.625  -7.400  1.00 0.00 ? 71  MET A HE2  4  
ATOM   4514  H  HE3  . MET A 1 71 ? 13.839  -1.046  -6.024  1.00 0.00 ? 71  MET A HE3  4  
ATOM   4515  N  N    . GLY A 1 72 ? 17.560  4.682   -7.634  1.00 0.00 ? 72  GLY A N    4  
ATOM   4516  C  CA   . GLY A 1 72 ? 18.523  5.645   -8.134  1.00 0.00 ? 72  GLY A CA   4  
ATOM   4517  C  C    . GLY A 1 72 ? 19.939  5.104   -8.134  1.00 0.00 ? 72  GLY A C    4  
ATOM   4518  O  O    . GLY A 1 72 ? 20.643  5.188   -9.140  1.00 0.00 ? 72  GLY A O    4  
ATOM   4519  H  H    . GLY A 1 72 ? 16.818  4.981   -7.068  1.00 0.00 ? 72  GLY A H    4  
ATOM   4520  H  HA2  . GLY A 1 72 ? 18.252  5.918   -9.143  1.00 0.00 ? 72  GLY A HA2  4  
ATOM   4521  H  HA3  . GLY A 1 72 ? 18.487  6.528   -7.512  1.00 0.00 ? 72  GLY A HA3  4  
ATOM   4522  N  N    . VAL A 1 73 ? 20.358  4.548   -7.001  1.00 0.00 ? 73  VAL A N    4  
ATOM   4523  C  CA   . VAL A 1 73 ? 21.700  3.992   -6.874  1.00 0.00 ? 73  VAL A CA   4  
ATOM   4524  C  C    . VAL A 1 73 ? 21.732  2.531   -7.310  1.00 0.00 ? 73  VAL A C    4  
ATOM   4525  O  O    . VAL A 1 73 ? 20.700  1.862   -7.351  1.00 0.00 ? 73  VAL A O    4  
ATOM   4526  C  CB   . VAL A 1 73 ? 22.215  4.096   -5.427  1.00 0.00 ? 73  VAL A CB   4  
ATOM   4527  C  CG1  . VAL A 1 73 ? 22.350  5.553   -5.011  1.00 0.00 ? 73  VAL A CG1  4  
ATOM   4528  C  CG2  . VAL A 1 73 ? 21.294  3.345   -4.478  1.00 0.00 ? 73  VAL A CG2  4  
ATOM   4529  H  H    . VAL A 1 73 ? 19.750  4.511   -6.234  1.00 0.00 ? 73  VAL A H    4  
ATOM   4530  H  HA   . VAL A 1 73 ? 22.360  4.562   -7.511  1.00 0.00 ? 73  VAL A HA   4  
ATOM   4531  H  HB   . VAL A 1 73 ? 23.194  3.640   -5.381  1.00 0.00 ? 73  VAL A HB   4  
ATOM   4532  H  HG11 . VAL A 1 73 ? 22.873  5.611   -4.068  1.00 0.00 ? 73  VAL A HG11 4  
ATOM   4533  H  HG12 . VAL A 1 73 ? 22.903  6.093   -5.765  1.00 0.00 ? 73  VAL A HG12 4  
ATOM   4534  H  HG13 . VAL A 1 73 ? 21.367  5.988   -4.904  1.00 0.00 ? 73  VAL A HG13 4  
ATOM   4535  H  HG21 . VAL A 1 73 ? 21.082  2.366   -4.882  1.00 0.00 ? 73  VAL A HG21 4  
ATOM   4536  H  HG22 . VAL A 1 73 ? 21.774  3.241   -3.515  1.00 0.00 ? 73  VAL A HG22 4  
ATOM   4537  H  HG23 . VAL A 1 73 ? 20.371  3.894   -4.361  1.00 0.00 ? 73  VAL A HG23 4  
ATOM   4538  N  N    . SER A 1 74 ? 22.925  2.043   -7.634  1.00 0.00 ? 74  SER A N    4  
ATOM   4539  C  CA   . SER A 1 74 ? 23.092  0.661   -8.071  1.00 0.00 ? 74  SER A CA   4  
ATOM   4540  C  C    . SER A 1 74 ? 22.865  -0.305  -6.912  1.00 0.00 ? 74  SER A C    4  
ATOM   4541  O  O    . SER A 1 74 ? 22.057  -1.228  -7.008  1.00 0.00 ? 74  SER A O    4  
ATOM   4542  C  CB   . SER A 1 74 ? 24.491  0.455   -8.655  1.00 0.00 ? 74  SER A CB   4  
ATOM   4543  O  OG   . SER A 1 74 ? 25.492  0.716   -7.687  1.00 0.00 ? 74  SER A OG   4  
ATOM   4544  H  H    . SER A 1 74 ? 23.711  2.626   -7.582  1.00 0.00 ? 74  SER A H    4  
ATOM   4545  H  HA   . SER A 1 74 ? 22.358  0.465   -8.837  1.00 0.00 ? 74  SER A HA   4  
ATOM   4546  H  HB2  . SER A 1 74 ? 24.590  -0.566  -8.992  1.00 0.00 ? 74  SER A HB2  4  
ATOM   4547  H  HB3  . SER A 1 74 ? 24.631  1.125   -9.491  1.00 0.00 ? 74  SER A HB3  4  
ATOM   4548  H  HG   . SER A 1 74 ? 25.766  1.634   -7.749  1.00 0.00 ? 74  SER A HG   4  
ATOM   4549  N  N    . GLY A 1 75 ? 23.586  -0.086  -5.816  1.00 0.00 ? 75  GLY A N    4  
ATOM   4550  C  CA   . GLY A 1 75 ? 23.449  -0.945  -4.655  1.00 0.00 ? 75  GLY A CA   4  
ATOM   4551  C  C    . GLY A 1 75 ? 24.368  -2.149  -4.713  1.00 0.00 ? 75  GLY A C    4  
ATOM   4552  O  O    . GLY A 1 75 ? 24.802  -2.574  -5.784  1.00 0.00 ? 75  GLY A O    4  
ATOM   4553  H  H    . GLY A 1 75 ? 24.215  0.665   -5.797  1.00 0.00 ? 75  GLY A H    4  
ATOM   4554  H  HA2  . GLY A 1 75 ? 23.679  -0.373  -3.768  1.00 0.00 ? 75  GLY A HA2  4  
ATOM   4555  H  HA3  . GLY A 1 75 ? 22.427  -1.289  -4.594  1.00 0.00 ? 75  GLY A HA3  4  
ATOM   4556  N  N    . PRO A 1 76 ? 24.679  -2.719  -3.539  1.00 0.00 ? 76  PRO A N    4  
ATOM   4557  C  CA   . PRO A 1 76 ? 25.556  -3.889  -3.435  1.00 0.00 ? 76  PRO A CA   4  
ATOM   4558  C  C    . PRO A 1 76 ? 24.905  -5.152  -3.987  1.00 0.00 ? 76  PRO A C    4  
ATOM   4559  O  O    . PRO A 1 76 ? 25.529  -6.212  -4.037  1.00 0.00 ? 76  PRO A O    4  
ATOM   4560  C  CB   . PRO A 1 76 ? 25.791  -4.023  -1.928  1.00 0.00 ? 76  PRO A CB   4  
ATOM   4561  C  CG   . PRO A 1 76 ? 24.601  -3.382  -1.301  1.00 0.00 ? 76  PRO A CG   4  
ATOM   4562  C  CD   . PRO A 1 76 ? 24.198  -2.265  -2.224  1.00 0.00 ? 76  PRO A CD   4  
ATOM   4563  H  HA   . PRO A 1 76 ? 26.499  -3.723  -3.935  1.00 0.00 ? 76  PRO A HA   4  
ATOM   4564  H  HB2  . PRO A 1 76 ? 25.862  -5.069  -1.664  1.00 0.00 ? 76  PRO A HB2  4  
ATOM   4565  H  HB3  . PRO A 1 76 ? 26.703  -3.514  -1.656  1.00 0.00 ? 76  PRO A HB3  4  
ATOM   4566  H  HG2  . PRO A 1 76 ? 23.801  -4.101  -1.211  1.00 0.00 ? 76  PRO A HG2  4  
ATOM   4567  H  HG3  . PRO A 1 76 ? 24.865  -2.989  -0.331  1.00 0.00 ? 76  PRO A HG3  4  
ATOM   4568  H  HD2  . PRO A 1 76 ? 23.124  -2.146  -2.226  1.00 0.00 ? 76  PRO A HD2  4  
ATOM   4569  H  HD3  . PRO A 1 76 ? 24.681  -1.343  -1.934  1.00 0.00 ? 76  PRO A HD3  4  
ATOM   4570  N  N    . SER A 1 77 ? 23.648  -5.033  -4.401  1.00 0.00 ? 77  SER A N    4  
ATOM   4571  C  CA   . SER A 1 77 ? 22.911  -6.167  -4.947  1.00 0.00 ? 77  SER A CA   4  
ATOM   4572  C  C    . SER A 1 77 ? 23.553  -6.659  -6.241  1.00 0.00 ? 77  SER A C    4  
ATOM   4573  O  O    . SER A 1 77 ? 23.331  -6.092  -7.311  1.00 0.00 ? 77  SER A O    4  
ATOM   4574  C  CB   . SER A 1 77 ? 21.453  -5.780  -5.202  1.00 0.00 ? 77  SER A CB   4  
ATOM   4575  O  OG   . SER A 1 77 ? 20.620  -6.926  -5.234  1.00 0.00 ? 77  SER A OG   4  
ATOM   4576  H  H    . SER A 1 77 ? 23.204  -4.161  -4.336  1.00 0.00 ? 77  SER A H    4  
ATOM   4577  H  HA   . SER A 1 77 ? 22.942  -6.963  -4.219  1.00 0.00 ? 77  SER A HA   4  
ATOM   4578  H  HB2  . SER A 1 77 ? 21.114  -5.125  -4.414  1.00 0.00 ? 77  SER A HB2  4  
ATOM   4579  H  HB3  . SER A 1 77 ? 21.380  -5.269  -6.151  1.00 0.00 ? 77  SER A HB3  4  
ATOM   4580  H  HG   . SER A 1 77 ? 20.586  -7.272  -6.128  1.00 0.00 ? 77  SER A HG   4  
ATOM   4581  N  N    . SER A 1 78 ? 24.349  -7.717  -6.134  1.00 0.00 ? 78  SER A N    4  
ATOM   4582  C  CA   . SER A 1 78 ? 25.026  -8.285  -7.294  1.00 0.00 ? 78  SER A CA   4  
ATOM   4583  C  C    . SER A 1 78 ? 24.025  -8.633  -8.391  1.00 0.00 ? 78  SER A C    4  
ATOM   4584  O  O    . SER A 1 78 ? 22.983  -9.233  -8.129  1.00 0.00 ? 78  SER A O    4  
ATOM   4585  C  CB   . SER A 1 78 ? 25.813  -9.533  -6.892  1.00 0.00 ? 78  SER A CB   4  
ATOM   4586  O  OG   . SER A 1 78 ? 26.829  -9.822  -7.837  1.00 0.00 ? 78  SER A OG   4  
ATOM   4587  H  H    . SER A 1 78 ? 24.486  -8.125  -5.253  1.00 0.00 ? 78  SER A H    4  
ATOM   4588  H  HA   . SER A 1 78 ? 25.713  -7.543  -7.673  1.00 0.00 ? 78  SER A HA   4  
ATOM   4589  H  HB2  . SER A 1 78 ? 26.271  -9.372  -5.928  1.00 0.00 ? 78  SER A HB2  4  
ATOM   4590  H  HB3  . SER A 1 78 ? 25.141  -10.377 -6.834  1.00 0.00 ? 78  SER A HB3  4  
ATOM   4591  H  HG   . SER A 1 78 ? 26.428  -10.088 -8.667  1.00 0.00 ? 78  SER A HG   4  
ATOM   4592  N  N    . GLY A 1 79 ? 24.349  -8.252  -9.623  1.00 0.00 ? 79  GLY A N    4  
ATOM   4593  C  CA   . GLY A 1 79 ? 23.469  -8.532  -10.743 1.00 0.00 ? 79  GLY A CA   4  
ATOM   4594  C  C    . GLY A 1 79 ? 23.651  -9.935  -11.287 1.00 0.00 ? 79  GLY A C    4  
ATOM   4595  O  O    . GLY A 1 79 ? 23.582  -10.119 -12.501 1.00 0.00 ? 79  GLY A O    4  
ATOM   4596  H  H    . GLY A 1 79 ? 25.194  -7.777  -9.773  1.00 0.00 ? 79  GLY A H    4  
ATOM   4597  H  HA2  . GLY A 1 79 ? 22.446  -8.412  -10.420 1.00 0.00 ? 79  GLY A HA2  4  
ATOM   4598  H  HA3  . GLY A 1 79 ? 23.673  -7.823  -11.532 1.00 0.00 ? 79  GLY A HA3  4  
HETATM 4599  ZN ZN   . ZN  B 2 .  ? -9.665  -0.337  -2.359  1.00 0.00 ? 201 ZN  A ZN   4  
HETATM 4600  ZN ZN   . ZN  C 2 .  ? 9.794   -1.205  -0.433  1.00 0.00 ? 401 ZN  A ZN   4  
ATOM   4601  N  N    . GLY A 1 1  ? -19.520 -9.741  -33.527 1.00 0.00 ? 1   GLY A N    5  
ATOM   4602  C  CA   . GLY A 1 1  ? -20.897 -9.513  -33.923 1.00 0.00 ? 1   GLY A CA   5  
ATOM   4603  C  C    . GLY A 1 1  ? -21.320 -8.068  -33.749 1.00 0.00 ? 1   GLY A C    5  
ATOM   4604  O  O    . GLY A 1 1  ? -20.479 -7.169  -33.710 1.00 0.00 ? 1   GLY A O    5  
ATOM   4605  H  H1   . GLY A 1 1  ? -18.875 -9.003  -33.556 1.00 0.00 ? 1   GLY A H1   5  
ATOM   4606  H  HA2  . GLY A 1 1  ? -21.012 -9.788  -34.961 1.00 0.00 ? 1   GLY A HA2  5  
ATOM   4607  H  HA3  . GLY A 1 1  ? -21.541 -10.139 -33.322 1.00 0.00 ? 1   GLY A HA3  5  
ATOM   4608  N  N    . SER A 1 2  ? -22.625 -7.843  -33.644 1.00 0.00 ? 2   SER A N    5  
ATOM   4609  C  CA   . SER A 1 2  ? -23.158 -6.496  -33.479 1.00 0.00 ? 2   SER A CA   5  
ATOM   4610  C  C    . SER A 1 2  ? -23.230 -6.117  -32.003 1.00 0.00 ? 2   SER A C    5  
ATOM   4611  O  O    . SER A 1 2  ? -23.827 -6.830  -31.196 1.00 0.00 ? 2   SER A O    5  
ATOM   4612  C  CB   . SER A 1 2  ? -24.547 -6.392  -34.112 1.00 0.00 ? 2   SER A CB   5  
ATOM   4613  O  OG   . SER A 1 2  ? -24.964 -5.041  -34.210 1.00 0.00 ? 2   SER A OG   5  
ATOM   4614  H  H    . SER A 1 2  ? -23.245 -8.601  -33.682 1.00 0.00 ? 2   SER A H    5  
ATOM   4615  H  HA   . SER A 1 2  ? -22.491 -5.811  -33.982 1.00 0.00 ? 2   SER A HA   5  
ATOM   4616  H  HB2  . SER A 1 2  ? -24.521 -6.821  -35.102 1.00 0.00 ? 2   SER A HB2  5  
ATOM   4617  H  HB3  . SER A 1 2  ? -25.258 -6.933  -33.503 1.00 0.00 ? 2   SER A HB3  5  
ATOM   4618  H  HG   . SER A 1 2  ? -24.455 -4.504  -33.598 1.00 0.00 ? 2   SER A HG   5  
ATOM   4619  N  N    . SER A 1 3  ? -22.617 -4.990  -31.656 1.00 0.00 ? 3   SER A N    5  
ATOM   4620  C  CA   . SER A 1 3  ? -22.607 -4.518  -30.277 1.00 0.00 ? 3   SER A CA   5  
ATOM   4621  C  C    . SER A 1 3  ? -22.862 -3.015  -30.215 1.00 0.00 ? 3   SER A C    5  
ATOM   4622  O  O    . SER A 1 3  ? -22.746 -2.313  -31.219 1.00 0.00 ? 3   SER A O    5  
ATOM   4623  C  CB   . SER A 1 3  ? -21.269 -4.847  -29.612 1.00 0.00 ? 3   SER A CB   5  
ATOM   4624  O  OG   . SER A 1 3  ? -20.197 -4.202  -30.277 1.00 0.00 ? 3   SER A OG   5  
ATOM   4625  H  H    . SER A 1 3  ? -22.157 -4.465  -32.345 1.00 0.00 ? 3   SER A H    5  
ATOM   4626  H  HA   . SER A 1 3  ? -23.397 -5.028  -29.746 1.00 0.00 ? 3   SER A HA   5  
ATOM   4627  H  HB2  . SER A 1 3  ? -21.289 -4.517  -28.585 1.00 0.00 ? 3   SER A HB2  5  
ATOM   4628  H  HB3  . SER A 1 3  ? -21.107 -5.915  -29.645 1.00 0.00 ? 3   SER A HB3  5  
ATOM   4629  H  HG   . SER A 1 3  ? -20.470 -3.322  -30.548 1.00 0.00 ? 3   SER A HG   5  
ATOM   4630  N  N    . GLY A 1 4  ? -23.212 -2.529  -29.028 1.00 0.00 ? 4   GLY A N    5  
ATOM   4631  C  CA   . GLY A 1 4  ? -23.479 -1.112  -28.856 1.00 0.00 ? 4   GLY A CA   5  
ATOM   4632  C  C    . GLY A 1 4  ? -22.747 -0.525  -27.666 1.00 0.00 ? 4   GLY A C    5  
ATOM   4633  O  O    . GLY A 1 4  ? -21.639 -0.949  -27.339 1.00 0.00 ? 4   GLY A O    5  
ATOM   4634  H  H    . GLY A 1 4  ? -23.289 -3.136  -28.263 1.00 0.00 ? 4   GLY A H    5  
ATOM   4635  H  HA2  . GLY A 1 4  ? -23.172 -0.588  -29.749 1.00 0.00 ? 4   GLY A HA2  5  
ATOM   4636  H  HA3  . GLY A 1 4  ? -24.541 -0.972  -28.716 1.00 0.00 ? 4   GLY A HA3  5  
ATOM   4637  N  N    . SER A 1 5  ? -23.366 0.456   -27.018 1.00 0.00 ? 5   SER A N    5  
ATOM   4638  C  CA   . SER A 1 5  ? -22.764 1.107   -25.860 1.00 0.00 ? 5   SER A CA   5  
ATOM   4639  C  C    . SER A 1 5  ? -23.836 1.562   -24.874 1.00 0.00 ? 5   SER A C    5  
ATOM   4640  O  O    . SER A 1 5  ? -25.024 1.574   -25.194 1.00 0.00 ? 5   SER A O    5  
ATOM   4641  C  CB   . SER A 1 5  ? -21.921 2.305   -26.303 1.00 0.00 ? 5   SER A CB   5  
ATOM   4642  O  OG   . SER A 1 5  ? -21.140 2.802   -25.231 1.00 0.00 ? 5   SER A OG   5  
ATOM   4643  H  H    . SER A 1 5  ? -24.249 0.751   -27.327 1.00 0.00 ? 5   SER A H    5  
ATOM   4644  H  HA   . SER A 1 5  ? -22.124 0.388   -25.371 1.00 0.00 ? 5   SER A HA   5  
ATOM   4645  H  HB2  . SER A 1 5  ? -21.263 2.002   -27.103 1.00 0.00 ? 5   SER A HB2  5  
ATOM   4646  H  HB3  . SER A 1 5  ? -22.574 3.091   -26.653 1.00 0.00 ? 5   SER A HB3  5  
ATOM   4647  H  HG   . SER A 1 5  ? -20.673 2.076   -24.810 1.00 0.00 ? 5   SER A HG   5  
ATOM   4648  N  N    . SER A 1 6  ? -23.406 1.936   -23.673 1.00 0.00 ? 6   SER A N    5  
ATOM   4649  C  CA   . SER A 1 6  ? -24.328 2.388   -22.638 1.00 0.00 ? 6   SER A CA   5  
ATOM   4650  C  C    . SER A 1 6  ? -23.955 3.786   -22.152 1.00 0.00 ? 6   SER A C    5  
ATOM   4651  O  O    . SER A 1 6  ? -24.769 4.483   -21.548 1.00 0.00 ? 6   SER A O    5  
ATOM   4652  C  CB   . SER A 1 6  ? -24.327 1.410   -21.462 1.00 0.00 ? 6   SER A CB   5  
ATOM   4653  O  OG   . SER A 1 6  ? -23.040 0.853   -21.262 1.00 0.00 ? 6   SER A OG   5  
ATOM   4654  H  H    . SER A 1 6  ? -22.446 1.904   -23.479 1.00 0.00 ? 6   SER A H    5  
ATOM   4655  H  HA   . SER A 1 6  ? -25.318 2.422   -23.067 1.00 0.00 ? 6   SER A HA   5  
ATOM   4656  H  HB2  . SER A 1 6  ? -24.625 1.930   -20.564 1.00 0.00 ? 6   SER A HB2  5  
ATOM   4657  H  HB3  . SER A 1 6  ? -25.025 0.610   -21.663 1.00 0.00 ? 6   SER A HB3  5  
ATOM   4658  H  HG   . SER A 1 6  ? -22.373 1.461   -21.591 1.00 0.00 ? 6   SER A HG   5  
ATOM   4659  N  N    . GLY A 1 7  ? -22.716 4.188   -22.419 1.00 0.00 ? 7   GLY A N    5  
ATOM   4660  C  CA   . GLY A 1 7  ? -22.255 5.499   -22.002 1.00 0.00 ? 7   GLY A CA   5  
ATOM   4661  C  C    . GLY A 1 7  ? -22.183 5.636   -20.494 1.00 0.00 ? 7   GLY A C    5  
ATOM   4662  O  O    . GLY A 1 7  ? -23.084 5.194   -19.782 1.00 0.00 ? 7   GLY A O    5  
ATOM   4663  H  H    . GLY A 1 7  ? -22.110 3.589   -22.904 1.00 0.00 ? 7   GLY A H    5  
ATOM   4664  H  HA2  . GLY A 1 7  ? -21.273 5.673   -22.417 1.00 0.00 ? 7   GLY A HA2  5  
ATOM   4665  H  HA3  . GLY A 1 7  ? -22.934 6.246   -22.388 1.00 0.00 ? 7   GLY A HA3  5  
ATOM   4666  N  N    . GLU A 1 8  ? -21.108 6.248   -20.008 1.00 0.00 ? 8   GLU A N    5  
ATOM   4667  C  CA   . GLU A 1 8  ? -20.922 6.439   -18.574 1.00 0.00 ? 8   GLU A CA   5  
ATOM   4668  C  C    . GLU A 1 8  ? -21.063 7.911   -18.198 1.00 0.00 ? 8   GLU A C    5  
ATOM   4669  O  O    . GLU A 1 8  ? -20.073 8.638   -18.106 1.00 0.00 ? 8   GLU A O    5  
ATOM   4670  C  CB   . GLU A 1 8  ? -19.549 5.921   -18.143 1.00 0.00 ? 8   GLU A CB   5  
ATOM   4671  C  CG   . GLU A 1 8  ? -19.392 4.416   -18.289 1.00 0.00 ? 8   GLU A CG   5  
ATOM   4672  C  CD   . GLU A 1 8  ? -20.307 3.641   -17.361 1.00 0.00 ? 8   GLU A CD   5  
ATOM   4673  O  OE1  . GLU A 1 8  ? -20.163 3.788   -16.129 1.00 0.00 ? 8   GLU A OE1  5  
ATOM   4674  O  OE2  . GLU A 1 8  ? -21.166 2.888   -17.866 1.00 0.00 ? 8   GLU A OE2  5  
ATOM   4675  H  H    . GLU A 1 8  ? -20.425 6.579   -20.627 1.00 0.00 ? 8   GLU A H    5  
ATOM   4676  H  HA   . GLU A 1 8  ? -21.686 5.875   -18.062 1.00 0.00 ? 8   GLU A HA   5  
ATOM   4677  H  HB2  . GLU A 1 8  ? -18.790 6.401   -18.743 1.00 0.00 ? 8   GLU A HB2  5  
ATOM   4678  H  HB3  . GLU A 1 8  ? -19.390 6.178   -17.106 1.00 0.00 ? 8   GLU A HB3  5  
ATOM   4679  H  HG2  . GLU A 1 8  ? -19.622 4.141   -19.308 1.00 0.00 ? 8   GLU A HG2  5  
ATOM   4680  H  HG3  . GLU A 1 8  ? -18.369 4.150   -18.068 1.00 0.00 ? 8   GLU A HG3  5  
ATOM   4681  N  N    . LYS A 1 9  ? -22.300 8.345   -17.984 1.00 0.00 ? 9   LYS A N    5  
ATOM   4682  C  CA   . LYS A 1 9  ? -22.574 9.730   -17.617 1.00 0.00 ? 9   LYS A CA   5  
ATOM   4683  C  C    . LYS A 1 9  ? -22.415 9.936   -16.114 1.00 0.00 ? 9   LYS A C    5  
ATOM   4684  O  O    . LYS A 1 9  ? -23.239 10.593  -15.479 1.00 0.00 ? 9   LYS A O    5  
ATOM   4685  C  CB   . LYS A 1 9  ? -23.987 10.124  -18.051 1.00 0.00 ? 9   LYS A CB   5  
ATOM   4686  C  CG   . LYS A 1 9  ? -24.056 10.686  -19.460 1.00 0.00 ? 9   LYS A CG   5  
ATOM   4687  C  CD   . LYS A 1 9  ? -25.494 10.883  -19.913 1.00 0.00 ? 9   LYS A CD   5  
ATOM   4688  C  CE   . LYS A 1 9  ? -26.070 9.607   -20.507 1.00 0.00 ? 9   LYS A CE   5  
ATOM   4689  N  NZ   . LYS A 1 9  ? -26.698 8.745   -19.467 1.00 0.00 ? 9   LYS A NZ   5  
ATOM   4690  H  H    . LYS A 1 9  ? -23.049 7.718   -18.073 1.00 0.00 ? 9   LYS A H    5  
ATOM   4691  H  HA   . LYS A 1 9  ? -21.860 10.356  -18.132 1.00 0.00 ? 9   LYS A HA   5  
ATOM   4692  H  HB2  . LYS A 1 9  ? -24.622 9.252   -18.002 1.00 0.00 ? 9   LYS A HB2  5  
ATOM   4693  H  HB3  . LYS A 1 9  ? -24.364 10.872  -17.369 1.00 0.00 ? 9   LYS A HB3  5  
ATOM   4694  H  HG2  . LYS A 1 9  ? -23.550 11.640  -19.483 1.00 0.00 ? 9   LYS A HG2  5  
ATOM   4695  H  HG3  . LYS A 1 9  ? -23.566 10.000  -20.136 1.00 0.00 ? 9   LYS A HG3  5  
ATOM   4696  H  HD2  . LYS A 1 9  ? -26.093 11.173  -19.063 1.00 0.00 ? 9   LYS A HD2  5  
ATOM   4697  H  HD3  . LYS A 1 9  ? -25.523 11.663  -20.660 1.00 0.00 ? 9   LYS A HD3  5  
ATOM   4698  H  HE2  . LYS A 1 9  ? -26.816 9.872   -21.240 1.00 0.00 ? 9   LYS A HE2  5  
ATOM   4699  H  HE3  . LYS A 1 9  ? -25.274 9.057   -20.986 1.00 0.00 ? 9   LYS A HE3  5  
ATOM   4700  H  HZ1  . LYS A 1 9  ? -27.688 8.547   -19.717 1.00 0.00 ? 9   LYS A HZ1  5  
ATOM   4701  H  HZ2  . LYS A 1 9  ? -26.675 9.224   -18.544 1.00 0.00 ? 9   LYS A HZ2  5  
ATOM   4702  H  HZ3  . LYS A 1 9  ? -26.184 7.844   -19.391 1.00 0.00 ? 9   LYS A HZ3  5  
ATOM   4703  N  N    . ALA A 1 10 ? -21.351 9.372   -15.553 1.00 0.00 ? 10  ALA A N    5  
ATOM   4704  C  CA   . ALA A 1 10 ? -21.083 9.498   -14.126 1.00 0.00 ? 10  ALA A CA   5  
ATOM   4705  C  C    . ALA A 1 10 ? -20.236 10.731  -13.832 1.00 0.00 ? 10  ALA A C    5  
ATOM   4706  O  O    . ALA A 1 10 ? -19.032 10.744  -14.092 1.00 0.00 ? 10  ALA A O    5  
ATOM   4707  C  CB   . ALA A 1 10 ? -20.394 8.245   -13.606 1.00 0.00 ? 10  ALA A CB   5  
ATOM   4708  H  H    . ALA A 1 10 ? -20.730 8.861   -16.112 1.00 0.00 ? 10  ALA A H    5  
ATOM   4709  H  HA   . ALA A 1 10 ? -22.031 9.595   -13.616 1.00 0.00 ? 10  ALA A HA   5  
ATOM   4710  H  HB1  . ALA A 1 10 ? -20.194 7.576   -14.431 1.00 0.00 ? 10  ALA A HB1  5  
ATOM   4711  H  HB2  . ALA A 1 10 ? -19.464 8.517   -13.129 1.00 0.00 ? 10  ALA A HB2  5  
ATOM   4712  H  HB3  . ALA A 1 10 ? -21.035 7.752   -12.890 1.00 0.00 ? 10  ALA A HB3  5  
ATOM   4713  N  N    . ARG A 1 11 ? -20.871 11.765  -13.291 1.00 0.00 ? 11  ARG A N    5  
ATOM   4714  C  CA   . ARG A 1 11 ? -20.175 13.004  -12.964 1.00 0.00 ? 11  ARG A CA   5  
ATOM   4715  C  C    . ARG A 1 11 ? -19.116 12.766  -11.891 1.00 0.00 ? 11  ARG A C    5  
ATOM   4716  O  O    . ARG A 1 11 ? -17.982 13.225  -12.012 1.00 0.00 ? 11  ARG A O    5  
ATOM   4717  C  CB   . ARG A 1 11 ? -21.170 14.063  -12.488 1.00 0.00 ? 11  ARG A CB   5  
ATOM   4718  C  CG   . ARG A 1 11 ? -21.933 13.662  -11.236 1.00 0.00 ? 11  ARG A CG   5  
ATOM   4719  C  CD   . ARG A 1 11 ? -23.220 14.459  -11.089 1.00 0.00 ? 11  ARG A CD   5  
ATOM   4720  N  NE   . ARG A 1 11 ? -23.693 14.486  -9.707  1.00 0.00 ? 11  ARG A NE   5  
ATOM   4721  C  CZ   . ARG A 1 11 ? -24.628 15.320  -9.266  1.00 0.00 ? 11  ARG A CZ   5  
ATOM   4722  N  NH1  . ARG A 1 11 ? -25.188 16.190  -10.095 1.00 0.00 ? 11  ARG A NH1  5  
ATOM   4723  N  NH2  . ARG A 1 11 ? -25.005 15.283  -7.995  1.00 0.00 ? 11  ARG A NH2  5  
ATOM   4724  H  H    . ARG A 1 11 ? -21.831 11.694  -13.107 1.00 0.00 ? 11  ARG A H    5  
ATOM   4725  H  HA   . ARG A 1 11 ? -19.688 13.357  -13.861 1.00 0.00 ? 11  ARG A HA   5  
ATOM   4726  H  HB2  . ARG A 1 11 ? -20.634 14.977  -12.279 1.00 0.00 ? 11  ARG A HB2  5  
ATOM   4727  H  HB3  . ARG A 1 11 ? -21.885 14.247  -13.276 1.00 0.00 ? 11  ARG A HB3  5  
ATOM   4728  H  HG2  . ARG A 1 11 ? -22.178 12.612  -11.295 1.00 0.00 ? 11  ARG A HG2  5  
ATOM   4729  H  HG3  . ARG A 1 11 ? -21.309 13.840  -10.373 1.00 0.00 ? 11  ARG A HG3  5  
ATOM   4730  H  HD2  . ARG A 1 11 ? -23.040 15.472  -11.417 1.00 0.00 ? 11  ARG A HD2  5  
ATOM   4731  H  HD3  . ARG A 1 11 ? -23.979 14.009  -11.711 1.00 0.00 ? 11  ARG A HD3  5  
ATOM   4732  H  HE   . ARG A 1 11 ? -23.292 13.851  -9.078  1.00 0.00 ? 11  ARG A HE   5  
ATOM   4733  H  HH11 . ARG A 1 11 ? -24.907 16.219  -11.053 1.00 0.00 ? 11  ARG A HH11 5  
ATOM   4734  H  HH12 . ARG A 1 11 ? -25.893 16.816  -9.760  1.00 0.00 ? 11  ARG A HH12 5  
ATOM   4735  H  HH21 . ARG A 1 11 ? -24.585 14.628  -7.367  1.00 0.00 ? 11  ARG A HH21 5  
ATOM   4736  H  HH22 . ARG A 1 11 ? -25.709 15.911  -7.664  1.00 0.00 ? 11  ARG A HH22 5  
ATOM   4737  N  N    . GLY A 1 12 ? -19.497 12.045  -10.841 1.00 0.00 ? 12  GLY A N    5  
ATOM   4738  C  CA   . GLY A 1 12 ? -18.570 11.759  -9.762  1.00 0.00 ? 12  GLY A CA   5  
ATOM   4739  C  C    . GLY A 1 12 ? -18.383 12.940  -8.830  1.00 0.00 ? 12  GLY A C    5  
ATOM   4740  O  O    . GLY A 1 12 ? -18.303 14.086  -9.276  1.00 0.00 ? 12  GLY A O    5  
ATOM   4741  H  H    . GLY A 1 12 ? -20.415 11.704  -10.799 1.00 0.00 ? 12  GLY A H    5  
ATOM   4742  H  HA2  . GLY A 1 12 ? -18.944 10.921  -9.193  1.00 0.00 ? 12  GLY A HA2  5  
ATOM   4743  H  HA3  . GLY A 1 12 ? -17.613 11.495  -10.186 1.00 0.00 ? 12  GLY A HA3  5  
ATOM   4744  N  N    . LEU A 1 13 ? -18.314 12.664  -7.533  1.00 0.00 ? 13  LEU A N    5  
ATOM   4745  C  CA   . LEU A 1 13 ? -18.137 13.713  -6.535  1.00 0.00 ? 13  LEU A CA   5  
ATOM   4746  C  C    . LEU A 1 13 ? -17.876 13.115  -5.156  1.00 0.00 ? 13  LEU A C    5  
ATOM   4747  O  O    . LEU A 1 13 ? -18.115 11.930  -4.927  1.00 0.00 ? 13  LEU A O    5  
ATOM   4748  C  CB   . LEU A 1 13 ? -19.373 14.613  -6.487  1.00 0.00 ? 13  LEU A CB   5  
ATOM   4749  C  CG   . LEU A 1 13 ? -20.595 14.037  -5.772  1.00 0.00 ? 13  LEU A CG   5  
ATOM   4750  C  CD1  . LEU A 1 13 ? -20.489 14.257  -4.271  1.00 0.00 ? 13  LEU A CD1  5  
ATOM   4751  C  CD2  . LEU A 1 13 ? -21.873 14.659  -6.315  1.00 0.00 ? 13  LEU A CD2  5  
ATOM   4752  H  H    . LEU A 1 13 ? -18.384 11.732  -7.238  1.00 0.00 ? 13  LEU A H    5  
ATOM   4753  H  HA   . LEU A 1 13 ? -17.281 14.305  -6.825  1.00 0.00 ? 13  LEU A HA   5  
ATOM   4754  H  HB2  . LEU A 1 13 ? -19.097 15.527  -5.985  1.00 0.00 ? 13  LEU A HB2  5  
ATOM   4755  H  HB3  . LEU A 1 13 ? -19.658 14.835  -7.506  1.00 0.00 ? 13  LEU A HB3  5  
ATOM   4756  H  HG   . LEU A 1 13 ? -20.640 12.971  -5.950  1.00 0.00 ? 13  LEU A HG   5  
ATOM   4757  H  HD11 . LEU A 1 13 ? -21.449 14.559  -3.883  1.00 0.00 ? 13  LEU A HD11 5  
ATOM   4758  H  HD12 . LEU A 1 13 ? -19.761 15.029  -4.072  1.00 0.00 ? 13  LEU A HD12 5  
ATOM   4759  H  HD13 . LEU A 1 13 ? -20.179 13.339  -3.794  1.00 0.00 ? 13  LEU A HD13 5  
ATOM   4760  H  HD21 . LEU A 1 13 ? -21.708 14.993  -7.329  1.00 0.00 ? 13  LEU A HD21 5  
ATOM   4761  H  HD22 . LEU A 1 13 ? -22.153 15.502  -5.699  1.00 0.00 ? 13  LEU A HD22 5  
ATOM   4762  H  HD23 . LEU A 1 13 ? -22.665 13.925  -6.302  1.00 0.00 ? 13  LEU A HD23 5  
ATOM   4763  N  N    . GLY A 1 14 ? -17.384 13.944  -4.240  1.00 0.00 ? 14  GLY A N    5  
ATOM   4764  C  CA   . GLY A 1 14 ? -17.101 13.480  -2.895  1.00 0.00 ? 14  GLY A CA   5  
ATOM   4765  C  C    . GLY A 1 14 ? -15.648 13.089  -2.711  1.00 0.00 ? 14  GLY A C    5  
ATOM   4766  O  O    . GLY A 1 14 ? -14.833 13.894  -2.258  1.00 0.00 ? 14  GLY A O    5  
ATOM   4767  H  H    . GLY A 1 14 ? -17.213 14.879  -4.480  1.00 0.00 ? 14  GLY A H    5  
ATOM   4768  H  HA2  . GLY A 1 14 ? -17.343 14.266  -2.196  1.00 0.00 ? 14  GLY A HA2  5  
ATOM   4769  H  HA3  . GLY A 1 14 ? -17.722 12.621  -2.685  1.00 0.00 ? 14  GLY A HA3  5  
ATOM   4770  N  N    . LYS A 1 15 ? -15.321 11.850  -3.061  1.00 0.00 ? 15  LYS A N    5  
ATOM   4771  C  CA   . LYS A 1 15 ? -13.956 11.353  -2.931  1.00 0.00 ? 15  LYS A CA   5  
ATOM   4772  C  C    . LYS A 1 15 ? -13.626 10.371  -4.052  1.00 0.00 ? 15  LYS A C    5  
ATOM   4773  O  O    . LYS A 1 15 ? -14.510 9.942   -4.794  1.00 0.00 ? 15  LYS A O    5  
ATOM   4774  C  CB   . LYS A 1 15 ? -13.765 10.675  -1.572  1.00 0.00 ? 15  LYS A CB   5  
ATOM   4775  C  CG   . LYS A 1 15 ? -13.290 11.620  -0.483  1.00 0.00 ? 15  LYS A CG   5  
ATOM   4776  C  CD   . LYS A 1 15 ? -11.774 11.699  -0.435  1.00 0.00 ? 15  LYS A CD   5  
ATOM   4777  C  CE   . LYS A 1 15 ? -11.303 12.909  0.359   1.00 0.00 ? 15  LYS A CE   5  
ATOM   4778  N  NZ   . LYS A 1 15 ? -9.947  13.356  -0.063  1.00 0.00 ? 15  LYS A NZ   5  
ATOM   4779  H  H    . LYS A 1 15 ? -16.015 11.255  -3.416  1.00 0.00 ? 15  LYS A H    5  
ATOM   4780  H  HA   . LYS A 1 15 ? -13.288 12.197  -3.000  1.00 0.00 ? 15  LYS A HA   5  
ATOM   4781  H  HB2  . LYS A 1 15 ? -14.706 10.245  -1.263  1.00 0.00 ? 15  LYS A HB2  5  
ATOM   4782  H  HB3  . LYS A 1 15 ? -13.036 9.885   -1.677  1.00 0.00 ? 15  LYS A HB3  5  
ATOM   4783  H  HG2  . LYS A 1 15 ? -13.686 12.606  -0.677  1.00 0.00 ? 15  LYS A HG2  5  
ATOM   4784  H  HG3  . LYS A 1 15 ? -13.654 11.266  0.472   1.00 0.00 ? 15  LYS A HG3  5  
ATOM   4785  H  HD2  . LYS A 1 15 ? -11.390 10.805  0.032   1.00 0.00 ? 15  LYS A HD2  5  
ATOM   4786  H  HD3  . LYS A 1 15 ? -11.394 11.772  -1.444  1.00 0.00 ? 15  LYS A HD3  5  
ATOM   4787  H  HE2  . LYS A 1 15 ? -12.003 13.716  0.208   1.00 0.00 ? 15  LYS A HE2  5  
ATOM   4788  H  HE3  . LYS A 1 15 ? -11.277 12.647  1.406   1.00 0.00 ? 15  LYS A HE3  5  
ATOM   4789  H  HZ1  . LYS A 1 15 ? -9.561  14.028  0.631   1.00 0.00 ? 15  LYS A HZ1  5  
ATOM   4790  H  HZ2  . LYS A 1 15 ? -9.998  13.824  -0.990  1.00 0.00 ? 15  LYS A HZ2  5  
ATOM   4791  H  HZ3  . LYS A 1 15 ? -9.307  12.540  -0.133  1.00 0.00 ? 15  LYS A HZ3  5  
ATOM   4792  N  N    . TYR A 1 16 ? -12.351 10.019  -4.166  1.00 0.00 ? 16  TYR A N    5  
ATOM   4793  C  CA   . TYR A 1 16 ? -11.905 9.089   -5.197  1.00 0.00 ? 16  TYR A CA   5  
ATOM   4794  C  C    . TYR A 1 16 ? -12.379 7.671   -4.893  1.00 0.00 ? 16  TYR A C    5  
ATOM   4795  O  O    . TYR A 1 16 ? -12.095 7.125   -3.827  1.00 0.00 ? 16  TYR A O    5  
ATOM   4796  C  CB   . TYR A 1 16 ? -10.380 9.115   -5.311  1.00 0.00 ? 16  TYR A CB   5  
ATOM   4797  C  CG   . TYR A 1 16 ? -9.844  10.355  -5.989  1.00 0.00 ? 16  TYR A CG   5  
ATOM   4798  C  CD1  . TYR A 1 16 ? -10.025 11.612  -5.425  1.00 0.00 ? 16  TYR A CD1  5  
ATOM   4799  C  CD2  . TYR A 1 16 ? -9.158  10.271  -7.194  1.00 0.00 ? 16  TYR A CD2  5  
ATOM   4800  C  CE1  . TYR A 1 16 ? -9.539  12.749  -6.041  1.00 0.00 ? 16  TYR A CE1  5  
ATOM   4801  C  CE2  . TYR A 1 16 ? -8.667  11.402  -7.817  1.00 0.00 ? 16  TYR A CE2  5  
ATOM   4802  C  CZ   . TYR A 1 16 ? -8.859  12.639  -7.236  1.00 0.00 ? 16  TYR A CZ   5  
ATOM   4803  O  OH   . TYR A 1 16 ? -8.373  13.768  -7.854  1.00 0.00 ? 16  TYR A OH   5  
ATOM   4804  H  H    . TYR A 1 16 ? -11.693 10.395  -3.545  1.00 0.00 ? 16  TYR A H    5  
ATOM   4805  H  HA   . TYR A 1 16 ? -12.332 9.406   -6.137  1.00 0.00 ? 16  TYR A HA   5  
ATOM   4806  H  HB2  . TYR A 1 16 ? -9.950  9.067   -4.322  1.00 0.00 ? 16  TYR A HB2  5  
ATOM   4807  H  HB3  . TYR A 1 16 ? -10.054 8.257   -5.882  1.00 0.00 ? 16  TYR A HB3  5  
ATOM   4808  H  HD1  . TYR A 1 16 ? -10.558 11.695  -4.488  1.00 0.00 ? 16  TYR A HD1  5  
ATOM   4809  H  HD2  . TYR A 1 16 ? -9.009  9.301   -7.646  1.00 0.00 ? 16  TYR A HD2  5  
ATOM   4810  H  HE1  . TYR A 1 16 ? -9.689  13.717  -5.587  1.00 0.00 ? 16  TYR A HE1  5  
ATOM   4811  H  HE2  . TYR A 1 16 ? -8.135  11.316  -8.753  1.00 0.00 ? 16  TYR A HE2  5  
ATOM   4812  H  HH   . TYR A 1 16 ? -7.643  14.123  -7.342  1.00 0.00 ? 16  TYR A HH   5  
ATOM   4813  N  N    . ILE A 1 17 ? -13.103 7.081   -5.838  1.00 0.00 ? 17  ILE A N    5  
ATOM   4814  C  CA   . ILE A 1 17 ? -13.616 5.727   -5.674  1.00 0.00 ? 17  ILE A CA   5  
ATOM   4815  C  C    . ILE A 1 17 ? -12.577 4.691   -6.092  1.00 0.00 ? 17  ILE A C    5  
ATOM   4816  O  O    . ILE A 1 17 ? -12.119 4.681   -7.235  1.00 0.00 ? 17  ILE A O    5  
ATOM   4817  C  CB   . ILE A 1 17 ? -14.901 5.508   -6.493  1.00 0.00 ? 17  ILE A CB   5  
ATOM   4818  C  CG1  . ILE A 1 17 ? -15.912 6.619   -6.203  1.00 0.00 ? 17  ILE A CG1  5  
ATOM   4819  C  CG2  . ILE A 1 17 ? -15.501 4.144   -6.184  1.00 0.00 ? 17  ILE A CG2  5  
ATOM   4820  C  CD1  . ILE A 1 17 ? -16.616 6.463   -4.873  1.00 0.00 ? 17  ILE A CD1  5  
ATOM   4821  H  H    . ILE A 1 17 ? -13.296 7.568   -6.666  1.00 0.00 ? 17  ILE A H    5  
ATOM   4822  H  HA   . ILE A 1 17 ? -13.850 5.584   -4.629  1.00 0.00 ? 17  ILE A HA   5  
ATOM   4823  H  HB   . ILE A 1 17 ? -14.642 5.531   -7.541  1.00 0.00 ? 17  ILE A HB   5  
ATOM   4824  H  HG12 . ILE A 1 17 ? -15.402 7.569   -6.198  1.00 0.00 ? 17  ILE A HG12 5  
ATOM   4825  H  HG13 . ILE A 1 17 ? -16.664 6.622   -6.979  1.00 0.00 ? 17  ILE A HG13 5  
ATOM   4826  H  HG21 . ILE A 1 17 ? -15.511 3.990   -5.115  1.00 0.00 ? 17  ILE A HG21 5  
ATOM   4827  H  HG22 . ILE A 1 17 ? -16.511 4.102   -6.563  1.00 0.00 ? 17  ILE A HG22 5  
ATOM   4828  H  HG23 . ILE A 1 17 ? -14.907 3.375   -6.653  1.00 0.00 ? 17  ILE A HG23 5  
ATOM   4829  H  HD11 . ILE A 1 17 ? -17.238 7.327   -4.691  1.00 0.00 ? 17  ILE A HD11 5  
ATOM   4830  H  HD12 . ILE A 1 17 ? -17.228 5.575   -4.891  1.00 0.00 ? 17  ILE A HD12 5  
ATOM   4831  H  HD13 . ILE A 1 17 ? -15.881 6.377   -4.085  1.00 0.00 ? 17  ILE A HD13 5  
ATOM   4832  N  N    . CYS A 1 18 ? -12.210 3.819   -5.159  1.00 0.00 ? 18  CYS A N    5  
ATOM   4833  C  CA   . CYS A 1 18 ? -11.227 2.777   -5.430  1.00 0.00 ? 18  CYS A CA   5  
ATOM   4834  C  C    . CYS A 1 18 ? -11.703 1.858   -6.551  1.00 0.00 ? 18  CYS A C    5  
ATOM   4835  O  O    . CYS A 1 18 ? -12.779 1.267   -6.467  1.00 0.00 ? 18  CYS A O    5  
ATOM   4836  C  CB   . CYS A 1 18 ? -10.958 1.960   -4.165  1.00 0.00 ? 18  CYS A CB   5  
ATOM   4837  S  SG   . CYS A 1 18 ? -9.540  0.825   -4.301  1.00 0.00 ? 18  CYS A SG   5  
ATOM   4838  H  H    . CYS A 1 18 ? -12.611 3.877   -4.266  1.00 0.00 ? 18  CYS A H    5  
ATOM   4839  H  HA   . CYS A 1 18 ? -10.311 3.258   -5.739  1.00 0.00 ? 18  CYS A HA   5  
ATOM   4840  H  HB2  . CYS A 1 18 ? -10.760 2.635   -3.345  1.00 0.00 ? 18  CYS A HB2  5  
ATOM   4841  H  HB3  . CYS A 1 18 ? -11.832 1.369   -3.935  1.00 0.00 ? 18  CYS A HB3  5  
ATOM   4842  N  N    . GLN A 1 19 ? -10.893 1.743   -7.598  1.00 0.00 ? 19  GLN A N    5  
ATOM   4843  C  CA   . GLN A 1 19 ? -11.231 0.896   -8.736  1.00 0.00 ? 19  GLN A CA   5  
ATOM   4844  C  C    . GLN A 1 19 ? -10.918 -0.566  -8.438  1.00 0.00 ? 19  GLN A C    5  
ATOM   4845  O  O    . GLN A 1 19 ? -10.858 -1.397  -9.345  1.00 0.00 ? 19  GLN A O    5  
ATOM   4846  C  CB   . GLN A 1 19 ? -10.468 1.350   -9.981  1.00 0.00 ? 19  GLN A CB   5  
ATOM   4847  C  CG   . GLN A 1 19 ? -11.194 2.418   -10.784 1.00 0.00 ? 19  GLN A CG   5  
ATOM   4848  C  CD   . GLN A 1 19 ? -12.512 1.927   -11.350 1.00 0.00 ? 19  GLN A CD   5  
ATOM   4849  O  OE1  . GLN A 1 19 ? -12.542 1.200   -12.344 1.00 0.00 ? 19  GLN A OE1  5  
ATOM   4850  N  NE2  . GLN A 1 19 ? -13.611 2.322   -10.719 1.00 0.00 ? 19  GLN A NE2  5  
ATOM   4851  H  H    . GLN A 1 19 ? -10.048 2.239   -7.606  1.00 0.00 ? 19  GLN A H    5  
ATOM   4852  H  HA   . GLN A 1 19 ? -12.291 0.995   -8.918  1.00 0.00 ? 19  GLN A HA   5  
ATOM   4853  H  HB2  . GLN A 1 19 ? -9.511  1.747   -9.678  1.00 0.00 ? 19  GLN A HB2  5  
ATOM   4854  H  HB3  . GLN A 1 19 ? -10.308 0.496   -10.622 1.00 0.00 ? 19  GLN A HB3  5  
ATOM   4855  H  HG2  . GLN A 1 19 ? -11.389 3.263   -10.142 1.00 0.00 ? 19  GLN A HG2  5  
ATOM   4856  H  HG3  . GLN A 1 19 ? -10.560 2.727   -11.602 1.00 0.00 ? 19  GLN A HG3  5  
ATOM   4857  H  HE21 . GLN A 1 19 ? -13.511 2.902   -9.935  1.00 0.00 ? 19  GLN A HE21 5  
ATOM   4858  H  HE22 . GLN A 1 19 ? -14.477 2.020   -11.064 1.00 0.00 ? 19  GLN A HE22 5  
ATOM   4859  N  N    . LYS A 1 20 ? -10.720 -0.876  -7.161  1.00 0.00 ? 20  LYS A N    5  
ATOM   4860  C  CA   . LYS A 1 20 ? -10.413 -2.238  -6.742  1.00 0.00 ? 20  LYS A CA   5  
ATOM   4861  C  C    . LYS A 1 20 ? -11.523 -2.798  -5.858  1.00 0.00 ? 20  LYS A C    5  
ATOM   4862  O  O    . LYS A 1 20 ? -12.067 -3.869  -6.130  1.00 0.00 ? 20  LYS A O    5  
ATOM   4863  C  CB   . LYS A 1 20 ? -9.081  -2.275  -5.991  1.00 0.00 ? 20  LYS A CB   5  
ATOM   4864  C  CG   . LYS A 1 20 ? -8.719  -3.653  -5.462  1.00 0.00 ? 20  LYS A CG   5  
ATOM   4865  C  CD   . LYS A 1 20 ? -7.953  -4.463  -6.494  1.00 0.00 ? 20  LYS A CD   5  
ATOM   4866  C  CE   . LYS A 1 20 ? -8.890  -5.291  -7.360  1.00 0.00 ? 20  LYS A CE   5  
ATOM   4867  N  NZ   . LYS A 1 20 ? -9.133  -6.641  -6.779  1.00 0.00 ? 20  LYS A NZ   5  
ATOM   4868  H  H    . LYS A 1 20 ? -10.781 -0.170  -6.484  1.00 0.00 ? 20  LYS A H    5  
ATOM   4869  H  HA   . LYS A 1 20 ? -10.334 -2.848  -7.629  1.00 0.00 ? 20  LYS A HA   5  
ATOM   4870  H  HB2  . LYS A 1 20 ? -8.296  -1.951  -6.659  1.00 0.00 ? 20  LYS A HB2  5  
ATOM   4871  H  HB3  . LYS A 1 20 ? -9.134  -1.594  -5.154  1.00 0.00 ? 20  LYS A HB3  5  
ATOM   4872  H  HG2  . LYS A 1 20 ? -8.105  -3.540  -4.581  1.00 0.00 ? 20  LYS A HG2  5  
ATOM   4873  H  HG3  . LYS A 1 20 ? -9.627  -4.179  -5.206  1.00 0.00 ? 20  LYS A HG3  5  
ATOM   4874  H  HD2  . LYS A 1 20 ? -7.397  -3.789  -7.129  1.00 0.00 ? 20  LYS A HD2  5  
ATOM   4875  H  HD3  . LYS A 1 20 ? -7.268  -5.125  -5.983  1.00 0.00 ? 20  LYS A HD3  5  
ATOM   4876  H  HE2  . LYS A 1 20 ? -9.831  -4.772  -7.448  1.00 0.00 ? 20  LYS A HE2  5  
ATOM   4877  H  HE3  . LYS A 1 20 ? -8.448  -5.405  -8.339  1.00 0.00 ? 20  LYS A HE3  5  
ATOM   4878  H  HZ1  . LYS A 1 20 ? -9.372  -7.316  -7.533  1.00 0.00 ? 20  LYS A HZ1  5  
ATOM   4879  H  HZ2  . LYS A 1 20 ? -9.922  -6.602  -6.103  1.00 0.00 ? 20  LYS A HZ2  5  
ATOM   4880  H  HZ3  . LYS A 1 20 ? -8.283  -6.976  -6.284  1.00 0.00 ? 20  LYS A HZ3  5  
ATOM   4881  N  N    . CYS A 1 21 ? -11.856 -2.067  -4.800  1.00 0.00 ? 21  CYS A N    5  
ATOM   4882  C  CA   . CYS A 1 21 ? -12.901 -2.489  -3.876  1.00 0.00 ? 21  CYS A CA   5  
ATOM   4883  C  C    . CYS A 1 21 ? -14.158 -1.641  -4.052  1.00 0.00 ? 21  CYS A C    5  
ATOM   4884  O  O    . CYS A 1 21 ? -15.180 -1.886  -3.411  1.00 0.00 ? 21  CYS A O    5  
ATOM   4885  C  CB   . CYS A 1 21 ? -12.405 -2.392  -2.432  1.00 0.00 ? 21  CYS A CB   5  
ATOM   4886  S  SG   . CYS A 1 21 ? -12.145 -0.686  -1.848  1.00 0.00 ? 21  CYS A SG   5  
ATOM   4887  H  H    . CYS A 1 21 ? -11.386 -1.222  -4.635  1.00 0.00 ? 21  CYS A H    5  
ATOM   4888  H  HA   . CYS A 1 21 ? -13.143 -3.518  -4.096  1.00 0.00 ? 21  CYS A HA   5  
ATOM   4889  H  HB2  . CYS A 1 21 ? -13.130 -2.855  -1.778  1.00 0.00 ? 21  CYS A HB2  5  
ATOM   4890  H  HB3  . CYS A 1 21 ? -11.465 -2.916  -2.347  1.00 0.00 ? 21  CYS A HB3  5  
ATOM   4891  N  N    . HIS A 1 22 ? -14.073 -0.642  -4.925  1.00 0.00 ? 22  HIS A N    5  
ATOM   4892  C  CA   . HIS A 1 22 ? -15.203 0.243   -5.186  1.00 0.00 ? 22  HIS A CA   5  
ATOM   4893  C  C    . HIS A 1 22 ? -15.692 0.895   -3.896  1.00 0.00 ? 22  HIS A C    5  
ATOM   4894  O  O    . HIS A 1 22 ? -16.873 0.819   -3.559  1.00 0.00 ? 22  HIS A O    5  
ATOM   4895  C  CB   . HIS A 1 22 ? -16.345 -0.534  -5.843  1.00 0.00 ? 22  HIS A CB   5  
ATOM   4896  C  CG   . HIS A 1 22 ? -16.108 -0.837  -7.290  1.00 0.00 ? 22  HIS A CG   5  
ATOM   4897  N  ND1  . HIS A 1 22 ? -15.745 -2.085  -7.748  1.00 0.00 ? 22  HIS A ND1  5  
ATOM   4898  C  CD2  . HIS A 1 22 ? -16.187 -0.044  -8.385  1.00 0.00 ? 22  HIS A CD2  5  
ATOM   4899  C  CE1  . HIS A 1 22 ? -15.609 -2.048  -9.062  1.00 0.00 ? 22  HIS A CE1  5  
ATOM   4900  N  NE2  . HIS A 1 22 ? -15.872 -0.820  -9.473  1.00 0.00 ? 22  HIS A NE2  5  
ATOM   4901  H  H    . HIS A 1 22 ? -13.232 -0.497  -5.405  1.00 0.00 ? 22  HIS A H    5  
ATOM   4902  H  HA   . HIS A 1 22 ? -14.870 1.016   -5.862  1.00 0.00 ? 22  HIS A HA   5  
ATOM   4903  H  HB2  . HIS A 1 22 ? -16.477 -1.473  -5.325  1.00 0.00 ? 22  HIS A HB2  5  
ATOM   4904  H  HB3  . HIS A 1 22 ? -17.255 0.044   -5.768  1.00 0.00 ? 22  HIS A HB3  5  
ATOM   4905  H  HD1  . HIS A 1 22 ? -15.606 -2.880  -7.193  1.00 0.00 ? 22  HIS A HD1  5  
ATOM   4906  H  HD2  . HIS A 1 22 ? -16.449 1.005   -8.401  1.00 0.00 ? 22  HIS A HD2  5  
ATOM   4907  H  HE1  . HIS A 1 22 ? -15.330 -2.878  -9.693  1.00 0.00 ? 22  HIS A HE1  5  
ATOM   4908  N  N    . ALA A 1 23 ? -14.775 1.537   -3.179  1.00 0.00 ? 23  ALA A N    5  
ATOM   4909  C  CA   . ALA A 1 23 ? -15.113 2.203   -1.928  1.00 0.00 ? 23  ALA A CA   5  
ATOM   4910  C  C    . ALA A 1 23 ? -14.399 3.546   -1.811  1.00 0.00 ? 23  ALA A C    5  
ATOM   4911  O  O    . ALA A 1 23 ? -13.227 3.669   -2.168  1.00 0.00 ? 23  ALA A O    5  
ATOM   4912  C  CB   . ALA A 1 23 ? -14.763 1.313   -0.744  1.00 0.00 ? 23  ALA A CB   5  
ATOM   4913  H  H    . ALA A 1 23 ? -13.849 1.563   -3.500  1.00 0.00 ? 23  ALA A H    5  
ATOM   4914  H  HA   . ALA A 1 23 ? -16.180 2.372   -1.917  1.00 0.00 ? 23  ALA A HA   5  
ATOM   4915  H  HB1  . ALA A 1 23 ? -13.689 1.235   -0.658  1.00 0.00 ? 23  ALA A HB1  5  
ATOM   4916  H  HB2  . ALA A 1 23 ? -15.167 1.742   0.160   1.00 0.00 ? 23  ALA A HB2  5  
ATOM   4917  H  HB3  . ALA A 1 23 ? -15.184 0.330   -0.897  1.00 0.00 ? 23  ALA A HB3  5  
ATOM   4918  N  N    . ILE A 1 24 ? -15.113 4.548   -1.310  1.00 0.00 ? 24  ILE A N    5  
ATOM   4919  C  CA   . ILE A 1 24 ? -14.547 5.882   -1.147  1.00 0.00 ? 24  ILE A CA   5  
ATOM   4920  C  C    . ILE A 1 24 ? -13.092 5.809   -0.696  1.00 0.00 ? 24  ILE A C    5  
ATOM   4921  O  O    . ILE A 1 24 ? -12.695 4.880   0.007   1.00 0.00 ? 24  ILE A O    5  
ATOM   4922  C  CB   . ILE A 1 24 ? -15.348 6.712   -0.127  1.00 0.00 ? 24  ILE A CB   5  
ATOM   4923  C  CG1  . ILE A 1 24 ? -16.802 6.853   -0.581  1.00 0.00 ? 24  ILE A CG1  5  
ATOM   4924  C  CG2  . ILE A 1 24 ? -14.710 8.081   0.060   1.00 0.00 ? 24  ILE A CG2  5  
ATOM   4925  C  CD1  . ILE A 1 24 ? -16.971 7.726   -1.804  1.00 0.00 ? 24  ILE A CD1  5  
ATOM   4926  H  H    . ILE A 1 24 ? -16.042 4.388   -1.044  1.00 0.00 ? 24  ILE A H    5  
ATOM   4927  H  HA   . ILE A 1 24 ? -14.592 6.382   -2.103  1.00 0.00 ? 24  ILE A HA   5  
ATOM   4928  H  HB   . ILE A 1 24 ? -15.323 6.198   0.822   1.00 0.00 ? 24  ILE A HB   5  
ATOM   4929  H  HG12 . ILE A 1 24 ? -17.197 5.877   -0.814  1.00 0.00 ? 24  ILE A HG12 5  
ATOM   4930  H  HG13 . ILE A 1 24 ? -17.381 7.289   0.221   1.00 0.00 ? 24  ILE A HG13 5  
ATOM   4931  H  HG21 . ILE A 1 24 ? -14.019 8.046   0.889   1.00 0.00 ? 24  ILE A HG21 5  
ATOM   4932  H  HG22 . ILE A 1 24 ? -14.179 8.355   -0.839  1.00 0.00 ? 24  ILE A HG22 5  
ATOM   4933  H  HG23 . ILE A 1 24 ? -15.478 8.812   0.262   1.00 0.00 ? 24  ILE A HG23 5  
ATOM   4934  H  HD11 . ILE A 1 24 ? -16.046 8.245   -2.008  1.00 0.00 ? 24  ILE A HD11 5  
ATOM   4935  H  HD12 . ILE A 1 24 ? -17.235 7.112   -2.652  1.00 0.00 ? 24  ILE A HD12 5  
ATOM   4936  H  HD13 . ILE A 1 24 ? -17.755 8.449   -1.626  1.00 0.00 ? 24  ILE A HD13 5  
ATOM   4937  N  N    . ILE A 1 25 ? -12.302 6.797   -1.104  1.00 0.00 ? 25  ILE A N    5  
ATOM   4938  C  CA   . ILE A 1 25 ? -10.892 6.847   -0.740  1.00 0.00 ? 25  ILE A CA   5  
ATOM   4939  C  C    . ILE A 1 25 ? -10.578 8.100   0.071   1.00 0.00 ? 25  ILE A C    5  
ATOM   4940  O  O    . ILE A 1 25 ? -9.936  9.027   -0.423  1.00 0.00 ? 25  ILE A O    5  
ATOM   4941  C  CB   . ILE A 1 25 ? -9.987  6.816   -1.986  1.00 0.00 ? 25  ILE A CB   5  
ATOM   4942  C  CG1  . ILE A 1 25 ? -10.121 5.473   -2.707  1.00 0.00 ? 25  ILE A CG1  5  
ATOM   4943  C  CG2  . ILE A 1 25 ? -8.539  7.072   -1.596  1.00 0.00 ? 25  ILE A CG2  5  
ATOM   4944  C  CD1  . ILE A 1 25 ? -9.748  5.534   -4.172  1.00 0.00 ? 25  ILE A CD1  5  
ATOM   4945  H  H    . ILE A 1 25 ? -12.677 7.509   -1.663  1.00 0.00 ? 25  ILE A H    5  
ATOM   4946  H  HA   . ILE A 1 25 ? -10.672 5.977   -0.139  1.00 0.00 ? 25  ILE A HA   5  
ATOM   4947  H  HB   . ILE A 1 25 ? -10.301 7.606   -2.651  1.00 0.00 ? 25  ILE A HB   5  
ATOM   4948  H  HG12 . ILE A 1 25 ? -9.477  4.750   -2.231  1.00 0.00 ? 25  ILE A HG12 5  
ATOM   4949  H  HG13 . ILE A 1 25 ? -11.146 5.137   -2.638  1.00 0.00 ? 25  ILE A HG13 5  
ATOM   4950  H  HG21 . ILE A 1 25 ? -8.474  7.214   -0.527  1.00 0.00 ? 25  ILE A HG21 5  
ATOM   4951  H  HG22 . ILE A 1 25 ? -7.935  6.225   -1.883  1.00 0.00 ? 25  ILE A HG22 5  
ATOM   4952  H  HG23 . ILE A 1 25 ? -8.181  7.957   -2.100  1.00 0.00 ? 25  ILE A HG23 5  
ATOM   4953  H  HD11 . ILE A 1 25 ? -9.157  6.418   -4.357  1.00 0.00 ? 25  ILE A HD11 5  
ATOM   4954  H  HD12 . ILE A 1 25 ? -9.178  4.656   -4.435  1.00 0.00 ? 25  ILE A HD12 5  
ATOM   4955  H  HD13 . ILE A 1 25 ? -10.647 5.571   -4.770  1.00 0.00 ? 25  ILE A HD13 5  
ATOM   4956  N  N    . ASP A 1 26 ? -11.032 8.119   1.319   1.00 0.00 ? 26  ASP A N    5  
ATOM   4957  C  CA   . ASP A 1 26 ? -10.797 9.256   2.201   1.00 0.00 ? 26  ASP A CA   5  
ATOM   4958  C  C    . ASP A 1 26 ? -9.363  9.757   2.071   1.00 0.00 ? 26  ASP A C    5  
ATOM   4959  O  O    . ASP A 1 26 ? -9.129  10.920  1.741   1.00 0.00 ? 26  ASP A O    5  
ATOM   4960  C  CB   . ASP A 1 26 ? -11.087 8.871   3.653   1.00 0.00 ? 26  ASP A CB   5  
ATOM   4961  C  CG   . ASP A 1 26 ? -12.569 8.874   3.968   1.00 0.00 ? 26  ASP A CG   5  
ATOM   4962  O  OD1  . ASP A 1 26 ? -13.205 9.939   3.820   1.00 0.00 ? 26  ASP A OD1  5  
ATOM   4963  O  OD2  . ASP A 1 26 ? -13.095 7.813   4.365   1.00 0.00 ? 26  ASP A OD2  5  
ATOM   4964  H  H    . ASP A 1 26 ? -11.538 7.349   1.656   1.00 0.00 ? 26  ASP A H    5  
ATOM   4965  H  HA   . ASP A 1 26 ? -11.470 10.048  1.908   1.00 0.00 ? 26  ASP A HA   5  
ATOM   4966  H  HB2  . ASP A 1 26 ? -10.700 7.879   3.839   1.00 0.00 ? 26  ASP A HB2  5  
ATOM   4967  H  HB3  . ASP A 1 26 ? -10.595 9.574   4.309   1.00 0.00 ? 26  ASP A HB3  5  
ATOM   4968  N  N    . GLU A 1 27 ? -8.406  8.873   2.333   1.00 0.00 ? 27  GLU A N    5  
ATOM   4969  C  CA   . GLU A 1 27 ? -6.994  9.227   2.247   1.00 0.00 ? 27  GLU A CA   5  
ATOM   4970  C  C    . GLU A 1 27 ? -6.560  9.383   0.792   1.00 0.00 ? 27  GLU A C    5  
ATOM   4971  O  O    . GLU A 1 27 ? -7.338  9.134   -0.128  1.00 0.00 ? 27  GLU A O    5  
ATOM   4972  C  CB   . GLU A 1 27 ? -6.135  8.164   2.936   1.00 0.00 ? 27  GLU A CB   5  
ATOM   4973  C  CG   . GLU A 1 27 ? -6.285  6.777   2.334   1.00 0.00 ? 27  GLU A CG   5  
ATOM   4974  C  CD   . GLU A 1 27 ? -5.148  5.849   2.717   1.00 0.00 ? 27  GLU A CD   5  
ATOM   4975  O  OE1  . GLU A 1 27 ? -4.016  6.343   2.900   1.00 0.00 ? 27  GLU A OE1  5  
ATOM   4976  O  OE2  . GLU A 1 27 ? -5.391  4.630   2.834   1.00 0.00 ? 27  GLU A OE2  5  
ATOM   4977  H  H    . GLU A 1 27 ? -8.655  7.961   2.591   1.00 0.00 ? 27  GLU A H    5  
ATOM   4978  H  HA   . GLU A 1 27 ? -6.857  10.170  2.754   1.00 0.00 ? 27  GLU A HA   5  
ATOM   4979  H  HB2  . GLU A 1 27 ? -5.098  8.455   2.865   1.00 0.00 ? 27  GLU A HB2  5  
ATOM   4980  H  HB3  . GLU A 1 27 ? -6.415  8.114   3.978   1.00 0.00 ? 27  GLU A HB3  5  
ATOM   4981  H  HG2  . GLU A 1 27 ? -7.213  6.346   2.681   1.00 0.00 ? 27  GLU A HG2  5  
ATOM   4982  H  HG3  . GLU A 1 27 ? -6.310  6.866   1.258   1.00 0.00 ? 27  GLU A HG3  5  
ATOM   4983  N  N    . GLN A 1 28 ? -5.313  9.797   0.594   1.00 0.00 ? 28  GLN A N    5  
ATOM   4984  C  CA   . GLN A 1 28 ? -4.775  9.987   -0.748  1.00 0.00 ? 28  GLN A CA   5  
ATOM   4985  C  C    . GLN A 1 28 ? -4.990  8.742   -1.602  1.00 0.00 ? 28  GLN A C    5  
ATOM   4986  O  O    . GLN A 1 28 ? -4.475  7.662   -1.309  1.00 0.00 ? 28  GLN A O    5  
ATOM   4987  C  CB   . GLN A 1 28 ? -3.285  10.323  -0.681  1.00 0.00 ? 28  GLN A CB   5  
ATOM   4988  C  CG   . GLN A 1 28 ? -2.692  10.730  -2.020  1.00 0.00 ? 28  GLN A CG   5  
ATOM   4989  C  CD   . GLN A 1 28 ? -1.515  11.675  -1.874  1.00 0.00 ? 28  GLN A CD   5  
ATOM   4990  O  OE1  . GLN A 1 28 ? -1.396  12.388  -0.878  1.00 0.00 ? 28  GLN A OE1  5  
ATOM   4991  N  NE2  . GLN A 1 28 ? -0.637  11.685  -2.871  1.00 0.00 ? 28  GLN A NE2  5  
ATOM   4992  H  H    . GLN A 1 28 ? -4.741  9.979   1.368   1.00 0.00 ? 28  GLN A H    5  
ATOM   4993  H  HA   . GLN A 1 28 ? -5.301  10.814  -1.201  1.00 0.00 ? 28  GLN A HA   5  
ATOM   4994  H  HB2  . GLN A 1 28 ? -3.143  11.138  0.014   1.00 0.00 ? 28  GLN A HB2  5  
ATOM   4995  H  HB3  . GLN A 1 28 ? -2.748  9.457   -0.322  1.00 0.00 ? 28  GLN A HB3  5  
ATOM   4996  H  HG2  . GLN A 1 28 ? -2.359  9.842   -2.536  1.00 0.00 ? 28  GLN A HG2  5  
ATOM   4997  H  HG3  . GLN A 1 28 ? -3.457  11.219  -2.604  1.00 0.00 ? 28  GLN A HG3  5  
ATOM   4998  H  HE21 . GLN A 1 28 ? -0.797  11.090  -3.634  1.00 0.00 ? 28  GLN A HE21 5  
ATOM   4999  H  HE22 . GLN A 1 28 ? 0.133   12.286  -2.803  1.00 0.00 ? 28  GLN A HE22 5  
ATOM   5000  N  N    . PRO A 1 29 ? -5.768  8.892   -2.683  1.00 0.00 ? 29  PRO A N    5  
ATOM   5001  C  CA   . PRO A 1 29 ? -6.068  7.789   -3.602  1.00 0.00 ? 29  PRO A CA   5  
ATOM   5002  C  C    . PRO A 1 29 ? -4.851  7.365   -4.416  1.00 0.00 ? 29  PRO A C    5  
ATOM   5003  O  O    . PRO A 1 29 ? -4.235  8.182   -5.103  1.00 0.00 ? 29  PRO A O    5  
ATOM   5004  C  CB   . PRO A 1 29 ? -7.146  8.374   -4.518  1.00 0.00 ? 29  PRO A CB   5  
ATOM   5005  C  CG   . PRO A 1 29 ? -6.920  9.846   -4.477  1.00 0.00 ? 29  PRO A CG   5  
ATOM   5006  C  CD   . PRO A 1 29 ? -6.415  10.150  -3.094  1.00 0.00 ? 29  PRO A CD   5  
ATOM   5007  H  HA   . PRO A 1 29 ? -6.465  6.933   -3.077  1.00 0.00 ? 29  PRO A HA   5  
ATOM   5008  H  HB2  . PRO A 1 29 ? -7.024  7.983   -5.518  1.00 0.00 ? 29  PRO A HB2  5  
ATOM   5009  H  HB3  . PRO A 1 29 ? -8.124  8.115   -4.140  1.00 0.00 ? 29  PRO A HB3  5  
ATOM   5010  H  HG2  . PRO A 1 29 ? -6.184  10.125  -5.215  1.00 0.00 ? 29  PRO A HG2  5  
ATOM   5011  H  HG3  . PRO A 1 29 ? -7.850  10.365  -4.658  1.00 0.00 ? 29  PRO A HG3  5  
ATOM   5012  H  HD2  . PRO A 1 29 ? -5.701  10.959  -3.122  1.00 0.00 ? 29  PRO A HD2  5  
ATOM   5013  H  HD3  . PRO A 1 29 ? -7.237  10.392  -2.436  1.00 0.00 ? 29  PRO A HD3  5  
ATOM   5014  N  N    . LEU A 1 30 ? -4.508  6.084   -4.335  1.00 0.00 ? 30  LEU A N    5  
ATOM   5015  C  CA   . LEU A 1 30 ? -3.363  5.551   -5.066  1.00 0.00 ? 30  LEU A CA   5  
ATOM   5016  C  C    . LEU A 1 30 ? -3.683  5.408   -6.550  1.00 0.00 ? 30  LEU A C    5  
ATOM   5017  O  O    . LEU A 1 30 ? -4.543  4.615   -6.936  1.00 0.00 ? 30  LEU A O    5  
ATOM   5018  C  CB   . LEU A 1 30 ? -2.951  4.196   -4.488  1.00 0.00 ? 30  LEU A CB   5  
ATOM   5019  C  CG   . LEU A 1 30 ? -2.186  3.269   -5.433  1.00 0.00 ? 30  LEU A CG   5  
ATOM   5020  C  CD1  . LEU A 1 30 ? -0.719  3.664   -5.497  1.00 0.00 ? 30  LEU A CD1  5  
ATOM   5021  C  CD2  . LEU A 1 30 ? -2.331  1.820   -4.991  1.00 0.00 ? 30  LEU A CD2  5  
ATOM   5022  H  H    . LEU A 1 30 ? -5.036  5.482   -3.772  1.00 0.00 ? 30  LEU A H    5  
ATOM   5023  H  HA   . LEU A 1 30 ? -2.545  6.247   -4.952  1.00 0.00 ? 30  LEU A HA   5  
ATOM   5024  H  HB2  . LEU A 1 30 ? -2.325  4.380   -3.628  1.00 0.00 ? 30  LEU A HB2  5  
ATOM   5025  H  HB3  . LEU A 1 30 ? -3.849  3.684   -4.175  1.00 0.00 ? 30  LEU A HB3  5  
ATOM   5026  H  HG   . LEU A 1 30 ? -2.599  3.358   -6.428  1.00 0.00 ? 30  LEU A HG   5  
ATOM   5027  H  HD11 . LEU A 1 30 ? -0.591  4.459   -6.216  1.00 0.00 ? 30  LEU A HD11 5  
ATOM   5028  H  HD12 . LEU A 1 30 ? -0.129  2.810   -5.796  1.00 0.00 ? 30  LEU A HD12 5  
ATOM   5029  H  HD13 . LEU A 1 30 ? -0.394  4.002   -4.524  1.00 0.00 ? 30  LEU A HD13 5  
ATOM   5030  H  HD21 . LEU A 1 30 ? -2.540  1.786   -3.932  1.00 0.00 ? 30  LEU A HD21 5  
ATOM   5031  H  HD22 . LEU A 1 30 ? -1.412  1.288   -5.193  1.00 0.00 ? 30  LEU A HD22 5  
ATOM   5032  H  HD23 . LEU A 1 30 ? -3.142  1.357   -5.533  1.00 0.00 ? 30  LEU A HD23 5  
ATOM   5033  N  N    . ILE A 1 31 ? -2.984  6.178   -7.378  1.00 0.00 ? 31  ILE A N    5  
ATOM   5034  C  CA   . ILE A 1 31 ? -3.192  6.133   -8.820  1.00 0.00 ? 31  ILE A CA   5  
ATOM   5035  C  C    . ILE A 1 31 ? -2.359  5.029   -9.462  1.00 0.00 ? 31  ILE A C    5  
ATOM   5036  O  O    . ILE A 1 31 ? -1.164  4.902   -9.192  1.00 0.00 ? 31  ILE A O    5  
ATOM   5037  C  CB   . ILE A 1 31 ? -2.838  7.478   -9.481  1.00 0.00 ? 31  ILE A CB   5  
ATOM   5038  C  CG1  . ILE A 1 31 ? -3.710  8.598   -8.909  1.00 0.00 ? 31  ILE A CG1  5  
ATOM   5039  C  CG2  . ILE A 1 31 ? -3.006  7.387   -10.991 1.00 0.00 ? 31  ILE A CG2  5  
ATOM   5040  C  CD1  . ILE A 1 31 ? -5.188  8.404   -9.167  1.00 0.00 ? 31  ILE A CD1  5  
ATOM   5041  H  H    . ILE A 1 31 ? -2.313  6.789   -7.010  1.00 0.00 ? 31  ILE A H    5  
ATOM   5042  H  HA   . ILE A 1 31 ? -4.238  5.931   -9.000  1.00 0.00 ? 31  ILE A HA   5  
ATOM   5043  H  HB   . ILE A 1 31 ? -1.802  7.696   -9.271  1.00 0.00 ? 31  ILE A HB   5  
ATOM   5044  H  HG12 . ILE A 1 31 ? -3.564  8.650   -7.842  1.00 0.00 ? 31  ILE A HG12 5  
ATOM   5045  H  HG13 . ILE A 1 31 ? -3.414  9.537   -9.355  1.00 0.00 ? 31  ILE A HG13 5  
ATOM   5046  H  HG21 . ILE A 1 31 ? -2.399  6.579   -11.372 1.00 0.00 ? 31  ILE A HG21 5  
ATOM   5047  H  HG22 . ILE A 1 31 ? -4.042  7.200   -11.226 1.00 0.00 ? 31  ILE A HG22 5  
ATOM   5048  H  HG23 . ILE A 1 31 ? -2.694  8.316   -11.445 1.00 0.00 ? 31  ILE A HG23 5  
ATOM   5049  H  HD11 . ILE A 1 31 ? -5.712  8.336   -8.225  1.00 0.00 ? 31  ILE A HD11 5  
ATOM   5050  H  HD12 . ILE A 1 31 ? -5.568  9.242   -9.732  1.00 0.00 ? 31  ILE A HD12 5  
ATOM   5051  H  HD13 . ILE A 1 31 ? -5.338  7.493   -9.728  1.00 0.00 ? 31  ILE A HD13 5  
ATOM   5052  N  N    . PHE A 1 32 ? -2.997  4.233   -10.314 1.00 0.00 ? 32  PHE A N    5  
ATOM   5053  C  CA   . PHE A 1 32 ? -2.315  3.140   -10.995 1.00 0.00 ? 32  PHE A CA   5  
ATOM   5054  C  C    . PHE A 1 32 ? -2.969  2.846   -12.342 1.00 0.00 ? 32  PHE A C    5  
ATOM   5055  O  O    . PHE A 1 32 ? -4.174  2.608   -12.422 1.00 0.00 ? 32  PHE A O    5  
ATOM   5056  C  CB   . PHE A 1 32 ? -2.327  1.881   -10.125 1.00 0.00 ? 32  PHE A CB   5  
ATOM   5057  C  CG   . PHE A 1 32 ? -1.652  0.702   -10.766 1.00 0.00 ? 32  PHE A CG   5  
ATOM   5058  C  CD1  . PHE A 1 32 ? -0.279  0.690   -10.953 1.00 0.00 ? 32  PHE A CD1  5  
ATOM   5059  C  CD2  . PHE A 1 32 ? -2.391  -0.394  -11.181 1.00 0.00 ? 32  PHE A CD2  5  
ATOM   5060  C  CE1  . PHE A 1 32 ? 0.344   -0.393  -11.543 1.00 0.00 ? 32  PHE A CE1  5  
ATOM   5061  C  CE2  . PHE A 1 32 ? -1.773  -1.480  -11.772 1.00 0.00 ? 32  PHE A CE2  5  
ATOM   5062  C  CZ   . PHE A 1 32 ? -0.404  -1.480  -11.952 1.00 0.00 ? 32  PHE A CZ   5  
ATOM   5063  H  H    . PHE A 1 32 ? -3.950  4.385   -10.487 1.00 0.00 ? 32  PHE A H    5  
ATOM   5064  H  HA   . PHE A 1 32 ? -1.292  3.441   -11.163 1.00 0.00 ? 32  PHE A HA   5  
ATOM   5065  H  HB2  . PHE A 1 32 ? -1.818  2.089   -9.196  1.00 0.00 ? 32  PHE A HB2  5  
ATOM   5066  H  HB3  . PHE A 1 32 ? -3.350  1.607   -9.916  1.00 0.00 ? 32  PHE A HB3  5  
ATOM   5067  H  HD1  . PHE A 1 32 ? 0.307   1.539   -10.633 1.00 0.00 ? 32  PHE A HD1  5  
ATOM   5068  H  HD2  . PHE A 1 32 ? -3.463  -0.395  -11.040 1.00 0.00 ? 32  PHE A HD2  5  
ATOM   5069  H  HE1  . PHE A 1 32 ? 1.415   -0.390  -11.683 1.00 0.00 ? 32  PHE A HE1  5  
ATOM   5070  H  HE2  . PHE A 1 32 ? -2.361  -2.329  -12.090 1.00 0.00 ? 32  PHE A HE2  5  
ATOM   5071  H  HZ   . PHE A 1 32 ? 0.081   -2.327  -12.414 1.00 0.00 ? 32  PHE A HZ   5  
ATOM   5072  N  N    . LYS A 1 33 ? -2.165  2.866   -13.400 1.00 0.00 ? 33  LYS A N    5  
ATOM   5073  C  CA   . LYS A 1 33 ? -2.663  2.602   -14.745 1.00 0.00 ? 33  LYS A CA   5  
ATOM   5074  C  C    . LYS A 1 33 ? -3.841  3.512   -15.078 1.00 0.00 ? 33  LYS A C    5  
ATOM   5075  O  O    . LYS A 1 33 ? -4.811  3.084   -15.701 1.00 0.00 ? 33  LYS A O    5  
ATOM   5076  C  CB   . LYS A 1 33 ? -3.083  1.137   -14.877 1.00 0.00 ? 33  LYS A CB   5  
ATOM   5077  C  CG   . LYS A 1 33 ? -1.927  0.159   -14.758 1.00 0.00 ? 33  LYS A CG   5  
ATOM   5078  C  CD   . LYS A 1 33 ? -2.298  -1.211  -15.299 1.00 0.00 ? 33  LYS A CD   5  
ATOM   5079  C  CE   . LYS A 1 33 ? -1.096  -2.143  -15.328 1.00 0.00 ? 33  LYS A CE   5  
ATOM   5080  N  NZ   . LYS A 1 33 ? -1.505  -3.575  -15.349 1.00 0.00 ? 33  LYS A NZ   5  
ATOM   5081  H  H    . LYS A 1 33 ? -1.213  3.063   -13.273 1.00 0.00 ? 33  LYS A H    5  
ATOM   5082  H  HA   . LYS A 1 33 ? -1.862  2.802   -15.441 1.00 0.00 ? 33  LYS A HA   5  
ATOM   5083  H  HB2  . LYS A 1 33 ? -3.801  0.910   -14.102 1.00 0.00 ? 33  LYS A HB2  5  
ATOM   5084  H  HB3  . LYS A 1 33 ? -3.550  0.994   -15.841 1.00 0.00 ? 33  LYS A HB3  5  
ATOM   5085  H  HG2  . LYS A 1 33 ? -1.086  0.540   -15.318 1.00 0.00 ? 33  LYS A HG2  5  
ATOM   5086  H  HG3  . LYS A 1 33 ? -1.655  0.063   -13.716 1.00 0.00 ? 33  LYS A HG3  5  
ATOM   5087  H  HD2  . LYS A 1 33 ? -3.060  -1.644  -14.668 1.00 0.00 ? 33  LYS A HD2  5  
ATOM   5088  H  HD3  . LYS A 1 33 ? -2.681  -1.100  -16.304 1.00 0.00 ? 33  LYS A HD3  5  
ATOM   5089  H  HE2  . LYS A 1 33 ? -0.514  -1.931  -16.212 1.00 0.00 ? 33  LYS A HE2  5  
ATOM   5090  H  HE3  . LYS A 1 33 ? -0.496  -1.962  -14.449 1.00 0.00 ? 33  LYS A HE3  5  
ATOM   5091  H  HZ1  . LYS A 1 33 ? -2.515  -3.661  -15.117 1.00 0.00 ? 33  LYS A HZ1  5  
ATOM   5092  H  HZ2  . LYS A 1 33 ? -0.954  -4.114  -14.651 1.00 0.00 ? 33  LYS A HZ2  5  
ATOM   5093  H  HZ3  . LYS A 1 33 ? -1.340  -3.980  -16.293 1.00 0.00 ? 33  LYS A HZ3  5  
ATOM   5094  N  N    . ASN A 1 34 ? -3.748  4.770   -14.658 1.00 0.00 ? 34  ASN A N    5  
ATOM   5095  C  CA   . ASN A 1 34 ? -4.806  5.741   -14.913 1.00 0.00 ? 34  ASN A CA   5  
ATOM   5096  C  C    . ASN A 1 34 ? -6.106  5.320   -14.232 1.00 0.00 ? 34  ASN A C    5  
ATOM   5097  O  O    . ASN A 1 34 ? -7.166  5.294   -14.858 1.00 0.00 ? 34  ASN A O    5  
ATOM   5098  C  CB   . ASN A 1 34 ? -5.033  5.896   -16.418 1.00 0.00 ? 34  ASN A CB   5  
ATOM   5099  C  CG   . ASN A 1 34 ? -3.900  6.639   -17.099 1.00 0.00 ? 34  ASN A CG   5  
ATOM   5100  O  OD1  . ASN A 1 34 ? -3.847  7.869   -17.077 1.00 0.00 ? 34  ASN A OD1  5  
ATOM   5101  N  ND2  . ASN A 1 34 ? -2.987  5.893   -17.710 1.00 0.00 ? 34  ASN A ND2  5  
ATOM   5102  H  H    . ASN A 1 34 ? -2.949  5.052   -14.165 1.00 0.00 ? 34  ASN A H    5  
ATOM   5103  H  HA   . ASN A 1 34 ? -4.491  6.689   -14.505 1.00 0.00 ? 34  ASN A HA   5  
ATOM   5104  H  HB2  . ASN A 1 34 ? -5.117  4.917   -16.866 1.00 0.00 ? 34  ASN A HB2  5  
ATOM   5105  H  HB3  . ASN A 1 34 ? -5.949  6.443   -16.583 1.00 0.00 ? 34  ASN A HB3  5  
ATOM   5106  H  HD21 . ASN A 1 34 ? -3.093  4.919   -17.687 1.00 0.00 ? 34  ASN A HD21 5  
ATOM   5107  H  HD22 . ASN A 1 34 ? -2.243  6.347   -18.158 1.00 0.00 ? 34  ASN A HD22 5  
ATOM   5108  N  N    . ASP A 1 35 ? -6.015  4.992   -12.948 1.00 0.00 ? 35  ASP A N    5  
ATOM   5109  C  CA   . ASP A 1 35 ? -7.183  4.574   -12.182 1.00 0.00 ? 35  ASP A CA   5  
ATOM   5110  C  C    . ASP A 1 35 ? -6.908  4.657   -10.683 1.00 0.00 ? 35  ASP A C    5  
ATOM   5111  O  O    . ASP A 1 35 ? -5.832  4.299   -10.204 1.00 0.00 ? 35  ASP A O    5  
ATOM   5112  C  CB   . ASP A 1 35 ? -7.585  3.147   -12.561 1.00 0.00 ? 35  ASP A CB   5  
ATOM   5113  C  CG   . ASP A 1 35 ? -8.418  3.097   -13.826 1.00 0.00 ? 35  ASP A CG   5  
ATOM   5114  O  OD1  . ASP A 1 35 ? -9.292  3.973   -13.995 1.00 0.00 ? 35  ASP A OD1  5  
ATOM   5115  O  OD2  . ASP A 1 35 ? -8.197  2.182   -14.647 1.00 0.00 ? 35  ASP A OD2  5  
ATOM   5116  H  H    . ASP A 1 35 ? -5.142  5.032   -12.505 1.00 0.00 ? 35  ASP A H    5  
ATOM   5117  H  HA   . ASP A 1 35 ? -7.995  5.242   -12.424 1.00 0.00 ? 35  ASP A HA   5  
ATOM   5118  H  HB2  . ASP A 1 35 ? -6.692  2.558   -12.716 1.00 0.00 ? 35  ASP A HB2  5  
ATOM   5119  H  HB3  . ASP A 1 35 ? -8.160  2.716   -11.755 1.00 0.00 ? 35  ASP A HB3  5  
ATOM   5120  N  N    . PRO A 1 36 ? -7.903  5.141   -9.925  1.00 0.00 ? 36  PRO A N    5  
ATOM   5121  C  CA   . PRO A 1 36 ? -7.792  5.283   -8.470  1.00 0.00 ? 36  PRO A CA   5  
ATOM   5122  C  C    . PRO A 1 36 ? -7.771  3.936   -7.756  1.00 0.00 ? 36  PRO A C    5  
ATOM   5123  O  O    . PRO A 1 36 ? -8.388  2.972   -8.210  1.00 0.00 ? 36  PRO A O    5  
ATOM   5124  C  CB   . PRO A 1 36 ? -9.050  6.069   -8.094  1.00 0.00 ? 36  PRO A CB   5  
ATOM   5125  C  CG   . PRO A 1 36 ? -10.026 5.763   -9.177  1.00 0.00 ? 36  PRO A CG   5  
ATOM   5126  C  CD   . PRO A 1 36 ? -9.213  5.586   -10.429 1.00 0.00 ? 36  PRO A CD   5  
ATOM   5127  H  HA   . PRO A 1 36 ? -6.915  5.850   -8.193  1.00 0.00 ? 36  PRO A HA   5  
ATOM   5128  H  HB2  . PRO A 1 36 ? -9.411  5.736   -7.130  1.00 0.00 ? 36  PRO A HB2  5  
ATOM   5129  H  HB3  . PRO A 1 36 ? -8.822  7.124   -8.054  1.00 0.00 ? 36  PRO A HB3  5  
ATOM   5130  H  HG2  . PRO A 1 36 ? -10.560 4.854   -8.945  1.00 0.00 ? 36  PRO A HG2  5  
ATOM   5131  H  HG3  . PRO A 1 36 ? -10.716 6.586   -9.292  1.00 0.00 ? 36  PRO A HG3  5  
ATOM   5132  H  HD2  . PRO A 1 36 ? -9.657  4.835   -11.065 1.00 0.00 ? 36  PRO A HD2  5  
ATOM   5133  H  HD3  . PRO A 1 36 ? -9.123  6.525   -10.957 1.00 0.00 ? 36  PRO A HD3  5  
ATOM   5134  N  N    . TYR A 1 37 ? -7.059  3.876   -6.636  1.00 0.00 ? 37  TYR A N    5  
ATOM   5135  C  CA   . TYR A 1 37 ? -6.957  2.646   -5.860  1.00 0.00 ? 37  TYR A CA   5  
ATOM   5136  C  C    . TYR A 1 37 ? -6.485  2.937   -4.439  1.00 0.00 ? 37  TYR A C    5  
ATOM   5137  O  O    . TYR A 1 37 ? -6.058  4.049   -4.129  1.00 0.00 ? 37  TYR A O    5  
ATOM   5138  C  CB   . TYR A 1 37 ? -5.996  1.669   -6.539  1.00 0.00 ? 37  TYR A CB   5  
ATOM   5139  C  CG   . TYR A 1 37 ? -6.451  1.227   -7.911  1.00 0.00 ? 37  TYR A CG   5  
ATOM   5140  C  CD1  . TYR A 1 37 ? -7.506  0.335   -8.062  1.00 0.00 ? 37  TYR A CD1  5  
ATOM   5141  C  CD2  . TYR A 1 37 ? -5.826  1.702   -9.058  1.00 0.00 ? 37  TYR A CD2  5  
ATOM   5142  C  CE1  . TYR A 1 37 ? -7.924  -0.072  -9.314  1.00 0.00 ? 37  TYR A CE1  5  
ATOM   5143  C  CE2  . TYR A 1 37 ? -6.238  1.301   -10.314 1.00 0.00 ? 37  TYR A CE2  5  
ATOM   5144  C  CZ   . TYR A 1 37 ? -7.287  0.414   -10.437 1.00 0.00 ? 37  TYR A CZ   5  
ATOM   5145  O  OH   . TYR A 1 37 ? -7.702  0.012   -11.686 1.00 0.00 ? 37  TYR A OH   5  
ATOM   5146  H  H    . TYR A 1 37 ? -6.589  4.678   -6.325  1.00 0.00 ? 37  TYR A H    5  
ATOM   5147  H  HA   . TYR A 1 37 ? -7.939  2.199   -5.817  1.00 0.00 ? 37  TYR A HA   5  
ATOM   5148  H  HB2  . TYR A 1 37 ? -5.031  2.139   -6.646  1.00 0.00 ? 37  TYR A HB2  5  
ATOM   5149  H  HB3  . TYR A 1 37 ? -5.895  0.787   -5.923  1.00 0.00 ? 37  TYR A HB3  5  
ATOM   5150  H  HD1  . TYR A 1 37 ? -8.002  -0.043  -7.180  1.00 0.00 ? 37  TYR A HD1  5  
ATOM   5151  H  HD2  . TYR A 1 37 ? -5.004  2.397   -8.959  1.00 0.00 ? 37  TYR A HD2  5  
ATOM   5152  H  HE1  . TYR A 1 37 ? -8.746  -0.766  -9.410  1.00 0.00 ? 37  TYR A HE1  5  
ATOM   5153  H  HE2  . TYR A 1 37 ? -5.740  1.681   -11.194 1.00 0.00 ? 37  TYR A HE2  5  
ATOM   5154  H  HH   . TYR A 1 37 ? -7.292  -0.828  -11.904 1.00 0.00 ? 37  TYR A HH   5  
ATOM   5155  N  N    . HIS A 1 38 ? -6.565  1.927   -3.578  1.00 0.00 ? 38  HIS A N    5  
ATOM   5156  C  CA   . HIS A 1 38 ? -6.145  2.072   -2.189  1.00 0.00 ? 38  HIS A CA   5  
ATOM   5157  C  C    . HIS A 1 38 ? -4.686  1.661   -2.016  1.00 0.00 ? 38  HIS A C    5  
ATOM   5158  O  O    . HIS A 1 38 ? -4.267  0.580   -2.432  1.00 0.00 ? 38  HIS A O    5  
ATOM   5159  C  CB   . HIS A 1 38 ? -7.036  1.230   -1.274  1.00 0.00 ? 38  HIS A CB   5  
ATOM   5160  C  CG   . HIS A 1 38 ? -8.350  1.875   -0.959  1.00 0.00 ? 38  HIS A CG   5  
ATOM   5161  N  ND1  . HIS A 1 38 ? -9.559  1.226   -1.094  1.00 0.00 ? 38  HIS A ND1  5  
ATOM   5162  C  CD2  . HIS A 1 38 ? -8.640  3.119   -0.509  1.00 0.00 ? 38  HIS A CD2  5  
ATOM   5163  C  CE1  . HIS A 1 38 ? -10.537 2.043   -0.744  1.00 0.00 ? 38  HIS A CE1  5  
ATOM   5164  N  NE2  . HIS A 1 38 ? -10.006 3.198   -0.384  1.00 0.00 ? 38  HIS A NE2  5  
ATOM   5165  H  H    . HIS A 1 38 ? -6.914  1.064   -3.885  1.00 0.00 ? 38  HIS A H    5  
ATOM   5166  H  HA   . HIS A 1 38 ? -6.248  3.112   -1.918  1.00 0.00 ? 38  HIS A HA   5  
ATOM   5167  H  HB2  . HIS A 1 38 ? -7.239  0.283   -1.753  1.00 0.00 ? 38  HIS A HB2  5  
ATOM   5168  H  HB3  . HIS A 1 38 ? -6.519  1.054   -0.342  1.00 0.00 ? 38  HIS A HB3  5  
ATOM   5169  H  HD2  . HIS A 1 38 ? -7.930  3.904   -0.290  1.00 0.00 ? 38  HIS A HD2  5  
ATOM   5170  H  HE1  . HIS A 1 38 ? -11.590 1.808   -0.749  1.00 0.00 ? 38  HIS A HE1  5  
ATOM   5171  H  HE2  . HIS A 1 38 ? -10.512 4.007   -0.162  1.00 0.00 ? 38  HIS A HE2  5  
ATOM   5172  N  N    . PRO A 1 39 ? -3.893  2.541   -1.389  1.00 0.00 ? 39  PRO A N    5  
ATOM   5173  C  CA   . PRO A 1 39 ? -2.469  2.292   -1.147  1.00 0.00 ? 39  PRO A CA   5  
ATOM   5174  C  C    . PRO A 1 39 ? -2.239  1.198   -0.110  1.00 0.00 ? 39  PRO A C    5  
ATOM   5175  O  O    . PRO A 1 39 ? -1.100  0.895   0.245   1.00 0.00 ? 39  PRO A O    5  
ATOM   5176  C  CB   . PRO A 1 39 ? -1.956  3.637   -0.627  1.00 0.00 ? 39  PRO A CB   5  
ATOM   5177  C  CG   . PRO A 1 39 ? -3.154  4.296   -0.036  1.00 0.00 ? 39  PRO A CG   5  
ATOM   5178  C  CD   . PRO A 1 39 ? -4.325  3.848   -0.866  1.00 0.00 ? 39  PRO A CD   5  
ATOM   5179  H  HA   . PRO A 1 39 ? -1.951  2.036   -2.060  1.00 0.00 ? 39  PRO A HA   5  
ATOM   5180  H  HB2  . PRO A 1 39 ? -1.189  3.470   0.115   1.00 0.00 ? 39  PRO A HB2  5  
ATOM   5181  H  HB3  . PRO A 1 39 ? -1.553  4.214   -1.446  1.00 0.00 ? 39  PRO A HB3  5  
ATOM   5182  H  HG2  . PRO A 1 39 ? -3.278  3.981   0.989   1.00 0.00 ? 39  PRO A HG2  5  
ATOM   5183  H  HG3  . PRO A 1 39 ? -3.046  5.370   -0.089  1.00 0.00 ? 39  PRO A HG3  5  
ATOM   5184  H  HD2  . PRO A 1 39 ? -5.207  3.745   -0.250  1.00 0.00 ? 39  PRO A HD2  5  
ATOM   5185  H  HD3  . PRO A 1 39 ? -4.505  4.545   -1.672  1.00 0.00 ? 39  PRO A HD3  5  
ATOM   5186  N  N    . ASP A 1 40 ? -3.328  0.609   0.372   1.00 0.00 ? 40  ASP A N    5  
ATOM   5187  C  CA   . ASP A 1 40 ? -3.245  -0.453  1.368   1.00 0.00 ? 40  ASP A CA   5  
ATOM   5188  C  C    . ASP A 1 40 ? -3.607  -1.803  0.755   1.00 0.00 ? 40  ASP A C    5  
ATOM   5189  O  O    . ASP A 1 40 ? -3.521  -2.839  1.414   1.00 0.00 ? 40  ASP A O    5  
ATOM   5190  C  CB   . ASP A 1 40 ? -4.172  -0.150  2.546   1.00 0.00 ? 40  ASP A CB   5  
ATOM   5191  C  CG   . ASP A 1 40 ? -5.605  -0.566  2.279   1.00 0.00 ? 40  ASP A CG   5  
ATOM   5192  O  OD1  . ASP A 1 40 ? -5.978  -0.681  1.092   1.00 0.00 ? 40  ASP A OD1  5  
ATOM   5193  O  OD2  . ASP A 1 40 ? -6.353  -0.777  3.255   1.00 0.00 ? 40  ASP A OD2  5  
ATOM   5194  H  H    . ASP A 1 40 ? -4.209  0.894   0.050   1.00 0.00 ? 40  ASP A H    5  
ATOM   5195  H  HA   . ASP A 1 40 ? -2.227  -0.496  1.724   1.00 0.00 ? 40  ASP A HA   5  
ATOM   5196  H  HB2  . ASP A 1 40 ? -3.820  -0.681  3.419   1.00 0.00 ? 40  ASP A HB2  5  
ATOM   5197  H  HB3  . ASP A 1 40 ? -4.155  0.912   2.745   1.00 0.00 ? 40  ASP A HB3  5  
ATOM   5198  N  N    . HIS A 1 41 ? -4.014  -1.782  -0.511  1.00 0.00 ? 41  HIS A N    5  
ATOM   5199  C  CA   . HIS A 1 41 ? -4.390  -3.004  -1.213  1.00 0.00 ? 41  HIS A CA   5  
ATOM   5200  C  C    . HIS A 1 41 ? -3.155  -3.728  -1.742  1.00 0.00 ? 41  HIS A C    5  
ATOM   5201  O  O    . HIS A 1 41 ? -3.025  -4.943  -1.595  1.00 0.00 ? 41  HIS A O    5  
ATOM   5202  C  CB   . HIS A 1 41 ? -5.340  -2.682  -2.366  1.00 0.00 ? 41  HIS A CB   5  
ATOM   5203  C  CG   . HIS A 1 41 ? -6.767  -2.520  -1.939  1.00 0.00 ? 41  HIS A CG   5  
ATOM   5204  N  ND1  . HIS A 1 41 ? -7.260  -3.026  -0.756  1.00 0.00 ? 41  HIS A ND1  5  
ATOM   5205  C  CD2  . HIS A 1 41 ? -7.807  -1.901  -2.545  1.00 0.00 ? 41  HIS A CD2  5  
ATOM   5206  C  CE1  . HIS A 1 41 ? -8.543  -2.727  -0.653  1.00 0.00 ? 41  HIS A CE1  5  
ATOM   5207  N  NE2  . HIS A 1 41 ? -8.899  -2.044  -1.725  1.00 0.00 ? 41  HIS A NE2  5  
ATOM   5208  H  H    . HIS A 1 41 ? -4.062  -0.925  -0.983  1.00 0.00 ? 41  HIS A H    5  
ATOM   5209  H  HA   . HIS A 1 41 ? -4.896  -3.648  -0.510  1.00 0.00 ? 41  HIS A HA   5  
ATOM   5210  H  HB2  . HIS A 1 41 ? -5.028  -1.761  -2.835  1.00 0.00 ? 41  HIS A HB2  5  
ATOM   5211  H  HB3  . HIS A 1 41 ? -5.299  -3.482  -3.092  1.00 0.00 ? 41  HIS A HB3  5  
ATOM   5212  H  HD1  . HIS A 1 41 ? -6.747  -3.531  -0.091  1.00 0.00 ? 41  HIS A HD1  5  
ATOM   5213  H  HD2  . HIS A 1 41 ? -7.783  -1.389  -3.497  1.00 0.00 ? 41  HIS A HD2  5  
ATOM   5214  H  HE1  . HIS A 1 41 ? -9.191  -2.995  0.169   1.00 0.00 ? 41  HIS A HE1  5  
ATOM   5215  N  N    . PHE A 1 42 ? -2.252  -2.974  -2.359  1.00 0.00 ? 42  PHE A N    5  
ATOM   5216  C  CA   . PHE A 1 42 ? -1.029  -3.544  -2.912  1.00 0.00 ? 42  PHE A CA   5  
ATOM   5217  C  C    . PHE A 1 42 ? 0.118   -3.446  -1.910  1.00 0.00 ? 42  PHE A C    5  
ATOM   5218  O  O    . PHE A 1 42 ? -0.030  -2.864  -0.836  1.00 0.00 ? 42  PHE A O    5  
ATOM   5219  C  CB   . PHE A 1 42 ? -0.649  -2.829  -4.210  1.00 0.00 ? 42  PHE A CB   5  
ATOM   5220  C  CG   . PHE A 1 42 ? -1.816  -2.590  -5.126  1.00 0.00 ? 42  PHE A CG   5  
ATOM   5221  C  CD1  . PHE A 1 42 ? -2.571  -1.434  -5.020  1.00 0.00 ? 42  PHE A CD1  5  
ATOM   5222  C  CD2  . PHE A 1 42 ? -2.156  -3.522  -6.094  1.00 0.00 ? 42  PHE A CD2  5  
ATOM   5223  C  CE1  . PHE A 1 42 ? -3.645  -1.212  -5.861  1.00 0.00 ? 42  PHE A CE1  5  
ATOM   5224  C  CE2  . PHE A 1 42 ? -3.229  -3.306  -6.938  1.00 0.00 ? 42  PHE A CE2  5  
ATOM   5225  C  CZ   . PHE A 1 42 ? -3.974  -2.148  -6.822  1.00 0.00 ? 42  PHE A CZ   5  
ATOM   5226  H  H    . PHE A 1 42 ? -2.412  -2.010  -2.445  1.00 0.00 ? 42  PHE A H    5  
ATOM   5227  H  HA   . PHE A 1 42 ? -1.216  -4.585  -3.126  1.00 0.00 ? 42  PHE A HA   5  
ATOM   5228  H  HB2  . PHE A 1 42 ? -0.214  -1.870  -3.971  1.00 0.00 ? 42  PHE A HB2  5  
ATOM   5229  H  HB3  . PHE A 1 42 ? 0.076   -3.426  -4.743  1.00 0.00 ? 42  PHE A HB3  5  
ATOM   5230  H  HD1  . PHE A 1 42 ? -2.315  -0.700  -4.270  1.00 0.00 ? 42  PHE A HD1  5  
ATOM   5231  H  HD2  . PHE A 1 42 ? -1.573  -4.428  -6.185  1.00 0.00 ? 42  PHE A HD2  5  
ATOM   5232  H  HE1  . PHE A 1 42 ? -4.226  -0.306  -5.769  1.00 0.00 ? 42  PHE A HE1  5  
ATOM   5233  H  HE2  . PHE A 1 42 ? -3.483  -4.040  -7.688  1.00 0.00 ? 42  PHE A HE2  5  
ATOM   5234  H  HZ   . PHE A 1 42 ? -4.813  -1.978  -7.480  1.00 0.00 ? 42  PHE A HZ   5  
ATOM   5235  N  N    . ASN A 1 43 ? 1.261   -4.020  -2.270  1.00 0.00 ? 43  ASN A N    5  
ATOM   5236  C  CA   . ASN A 1 43 ? 2.434   -3.999  -1.403  1.00 0.00 ? 43  ASN A CA   5  
ATOM   5237  C  C    . ASN A 1 43 ? 3.718   -3.991  -2.226  1.00 0.00 ? 43  ASN A C    5  
ATOM   5238  O  O    . ASN A 1 43 ? 3.758   -4.512  -3.341  1.00 0.00 ? 43  ASN A O    5  
ATOM   5239  C  CB   . ASN A 1 43 ? 2.422   -5.208  -0.466  1.00 0.00 ? 43  ASN A CB   5  
ATOM   5240  C  CG   . ASN A 1 43 ? 1.533   -4.994  0.744   1.00 0.00 ? 43  ASN A CG   5  
ATOM   5241  O  OD1  . ASN A 1 43 ? 0.328   -4.783  0.612   1.00 0.00 ? 43  ASN A OD1  5  
ATOM   5242  N  ND2  . ASN A 1 43 ? 2.127   -5.047  1.931   1.00 0.00 ? 43  ASN A ND2  5  
ATOM   5243  H  H    . ASN A 1 43 ? 1.318   -4.469  -3.140  1.00 0.00 ? 43  ASN A H    5  
ATOM   5244  H  HA   . ASN A 1 43 ? 2.393   -3.097  -0.813  1.00 0.00 ? 43  ASN A HA   5  
ATOM   5245  H  HB2  . ASN A 1 43 ? 2.060   -6.071  -1.006  1.00 0.00 ? 43  ASN A HB2  5  
ATOM   5246  H  HB3  . ASN A 1 43 ? 3.428   -5.400  -0.122  1.00 0.00 ? 43  ASN A HB3  5  
ATOM   5247  H  HD21 . ASN A 1 43 ? 3.091   -5.219  1.959   1.00 0.00 ? 43  ASN A HD21 5  
ATOM   5248  H  HD22 . ASN A 1 43 ? 1.575   -4.912  2.730   1.00 0.00 ? 43  ASN A HD22 5  
ATOM   5249  N  N    . CYS A 1 44 ? 4.768   -3.398  -1.668  1.00 0.00 ? 44  CYS A N    5  
ATOM   5250  C  CA   . CYS A 1 44 ? 6.055   -3.322  -2.348  1.00 0.00 ? 44  CYS A CA   5  
ATOM   5251  C  C    . CYS A 1 44 ? 6.481   -4.694  -2.862  1.00 0.00 ? 44  CYS A C    5  
ATOM   5252  O  O    . CYS A 1 44 ? 5.965   -5.721  -2.421  1.00 0.00 ? 44  CYS A O    5  
ATOM   5253  C  CB   . CYS A 1 44 ? 7.123   -2.765  -1.404  1.00 0.00 ? 44  CYS A CB   5  
ATOM   5254  S  SG   . CYS A 1 44 ? 8.678   -2.302  -2.231  1.00 0.00 ? 44  CYS A SG   5  
ATOM   5255  H  H    . CYS A 1 44 ? 4.675   -3.001  -0.776  1.00 0.00 ? 44  CYS A H    5  
ATOM   5256  H  HA   . CYS A 1 44 ? 5.947   -2.654  -3.189  1.00 0.00 ? 44  CYS A HA   5  
ATOM   5257  H  HB2  . CYS A 1 44 ? 6.735   -1.881  -0.917  1.00 0.00 ? 44  CYS A HB2  5  
ATOM   5258  H  HB3  . CYS A 1 44 ? 7.355   -3.509  -0.657  1.00 0.00 ? 44  CYS A HB3  5  
ATOM   5259  N  N    . ALA A 1 45 ? 7.427   -4.703  -3.796  1.00 0.00 ? 45  ALA A N    5  
ATOM   5260  C  CA   . ALA A 1 45 ? 7.924   -5.948  -4.368  1.00 0.00 ? 45  ALA A CA   5  
ATOM   5261  C  C    . ALA A 1 45 ? 9.312   -6.283  -3.832  1.00 0.00 ? 45  ALA A C    5  
ATOM   5262  O  O    . ALA A 1 45 ? 9.665   -7.452  -3.684  1.00 0.00 ? 45  ALA A O    5  
ATOM   5263  C  CB   . ALA A 1 45 ? 7.949   -5.859  -5.886  1.00 0.00 ? 45  ALA A CB   5  
ATOM   5264  H  H    . ALA A 1 45 ? 7.799   -3.852  -4.107  1.00 0.00 ? 45  ALA A H    5  
ATOM   5265  H  HA   . ALA A 1 45 ? 7.242   -6.739  -4.090  1.00 0.00 ? 45  ALA A HA   5  
ATOM   5266  H  HB1  . ALA A 1 45 ? 7.083   -6.363  -6.290  1.00 0.00 ? 45  ALA A HB1  5  
ATOM   5267  H  HB2  . ALA A 1 45 ? 7.935   -4.821  -6.186  1.00 0.00 ? 45  ALA A HB2  5  
ATOM   5268  H  HB3  . ALA A 1 45 ? 8.847   -6.329  -6.259  1.00 0.00 ? 45  ALA A HB3  5  
ATOM   5269  N  N    . ASN A 1 46 ? 10.095  -5.248  -3.545  1.00 0.00 ? 46  ASN A N    5  
ATOM   5270  C  CA   . ASN A 1 46 ? 11.446  -5.433  -3.027  1.00 0.00 ? 46  ASN A CA   5  
ATOM   5271  C  C    . ASN A 1 46 ? 11.414  -5.844  -1.558  1.00 0.00 ? 46  ASN A C    5  
ATOM   5272  O  O    . ASN A 1 46 ? 11.967  -6.877  -1.178  1.00 0.00 ? 46  ASN A O    5  
ATOM   5273  C  CB   . ASN A 1 46 ? 12.257  -4.146  -3.190  1.00 0.00 ? 46  ASN A CB   5  
ATOM   5274  C  CG   . ASN A 1 46 ? 13.724  -4.342  -2.859  1.00 0.00 ? 46  ASN A CG   5  
ATOM   5275  O  OD1  . ASN A 1 46 ? 14.462  -4.981  -3.609  1.00 0.00 ? 46  ASN A OD1  5  
ATOM   5276  N  ND2  . ASN A 1 46 ? 14.155  -3.790  -1.730  1.00 0.00 ? 46  ASN A ND2  5  
ATOM   5277  H  H    . ASN A 1 46 ? 9.757   -4.339  -3.685  1.00 0.00 ? 46  ASN A H    5  
ATOM   5278  H  HA   . ASN A 1 46 ? 11.915  -6.219  -3.598  1.00 0.00 ? 46  ASN A HA   5  
ATOM   5279  H  HB2  . ASN A 1 46 ? 12.182  -3.807  -4.213  1.00 0.00 ? 46  ASN A HB2  5  
ATOM   5280  H  HB3  . ASN A 1 46 ? 11.857  -3.388  -2.534  1.00 0.00 ? 46  ASN A HB3  5  
ATOM   5281  H  HD21 . ASN A 1 46 ? 13.511  -3.295  -1.182  1.00 0.00 ? 46  ASN A HD21 5  
ATOM   5282  H  HD22 . ASN A 1 46 ? 15.099  -3.901  -1.492  1.00 0.00 ? 46  ASN A HD22 5  
ATOM   5283  N  N    . CYS A 1 47 ? 10.762  -5.029  -0.735  1.00 0.00 ? 47  CYS A N    5  
ATOM   5284  C  CA   . CYS A 1 47 ? 10.657  -5.306  0.692   1.00 0.00 ? 47  CYS A CA   5  
ATOM   5285  C  C    . CYS A 1 47 ? 9.406   -6.126  0.996   1.00 0.00 ? 47  CYS A C    5  
ATOM   5286  O  O    . CYS A 1 47 ? 9.427   -7.020  1.841   1.00 0.00 ? 47  CYS A O    5  
ATOM   5287  C  CB   . CYS A 1 47 ? 10.628  -3.998  1.486   1.00 0.00 ? 47  CYS A CB   5  
ATOM   5288  S  SG   . CYS A 1 47 ? 9.330   -2.835  0.956   1.00 0.00 ? 47  CYS A SG   5  
ATOM   5289  H  H    . CYS A 1 47 ? 10.342  -4.220  -1.097  1.00 0.00 ? 47  CYS A H    5  
ATOM   5290  H  HA   . CYS A 1 47 ? 11.525  -5.875  0.985   1.00 0.00 ? 47  CYS A HA   5  
ATOM   5291  H  HB2  . CYS A 1 47 ? 10.460  -4.224  2.529   1.00 0.00 ? 47  CYS A HB2  5  
ATOM   5292  H  HB3  . CYS A 1 47 ? 11.580  -3.500  1.380   1.00 0.00 ? 47  CYS A HB3  5  
ATOM   5293  N  N    . GLY A 1 48 ? 8.317   -5.815  0.300   1.00 0.00 ? 48  GLY A N    5  
ATOM   5294  C  CA   . GLY A 1 48 ? 7.073   -6.531  0.509   1.00 0.00 ? 48  GLY A CA   5  
ATOM   5295  C  C    . GLY A 1 48 ? 6.260   -5.961  1.654   1.00 0.00 ? 48  GLY A C    5  
ATOM   5296  O  O    . GLY A 1 48 ? 5.728   -6.704  2.479   1.00 0.00 ? 48  GLY A O    5  
ATOM   5297  H  H    . GLY A 1 48 ? 8.359   -5.092  -0.361  1.00 0.00 ? 48  GLY A H    5  
ATOM   5298  H  HA2  . GLY A 1 48 ? 6.485   -6.482  -0.396  1.00 0.00 ? 48  GLY A HA2  5  
ATOM   5299  H  HA3  . GLY A 1 48 ? 7.298   -7.566  0.723   1.00 0.00 ? 48  GLY A HA3  5  
ATOM   5300  N  N    . LYS A 1 49 ? 6.165   -4.637  1.708   1.00 0.00 ? 49  LYS A N    5  
ATOM   5301  C  CA   . LYS A 1 49 ? 5.413   -3.966  2.762   1.00 0.00 ? 49  LYS A CA   5  
ATOM   5302  C  C    . LYS A 1 49 ? 4.194   -3.250  2.188   1.00 0.00 ? 49  LYS A C    5  
ATOM   5303  O  O    . LYS A 1 49 ? 4.020   -3.181  0.972   1.00 0.00 ? 49  LYS A O    5  
ATOM   5304  C  CB   . LYS A 1 49 ? 6.307   -2.964  3.496   1.00 0.00 ? 49  LYS A CB   5  
ATOM   5305  C  CG   . LYS A 1 49 ? 6.524   -1.669  2.733   1.00 0.00 ? 49  LYS A CG   5  
ATOM   5306  C  CD   . LYS A 1 49 ? 7.393   -0.699  3.516   1.00 0.00 ? 49  LYS A CD   5  
ATOM   5307  C  CE   . LYS A 1 49 ? 6.571   0.106   4.512   1.00 0.00 ? 49  LYS A CE   5  
ATOM   5308  N  NZ   . LYS A 1 49 ? 6.477   -0.576  5.833   1.00 0.00 ? 49  LYS A NZ   5  
ATOM   5309  H  H    . LYS A 1 49 ? 6.612   -4.097  1.022   1.00 0.00 ? 49  LYS A H    5  
ATOM   5310  H  HA   . LYS A 1 49 ? 5.078   -4.717  3.461   1.00 0.00 ? 49  LYS A HA   5  
ATOM   5311  H  HB2  . LYS A 1 49 ? 5.854   -2.725  4.447   1.00 0.00 ? 49  LYS A HB2  5  
ATOM   5312  H  HB3  . LYS A 1 49 ? 7.271   -3.420  3.671   1.00 0.00 ? 49  LYS A HB3  5  
ATOM   5313  H  HG2  . LYS A 1 49 ? 7.009   -1.892  1.794   1.00 0.00 ? 49  LYS A HG2  5  
ATOM   5314  H  HG3  . LYS A 1 49 ? 5.565   -1.208  2.544   1.00 0.00 ? 49  LYS A HG3  5  
ATOM   5315  H  HD2  . LYS A 1 49 ? 8.145   -1.256  4.055   1.00 0.00 ? 49  LYS A HD2  5  
ATOM   5316  H  HD3  . LYS A 1 49 ? 7.871   -0.019  2.826   1.00 0.00 ? 49  LYS A HD3  5  
ATOM   5317  H  HE2  . LYS A 1 49 ? 7.036   1.070   4.647   1.00 0.00 ? 49  LYS A HE2  5  
ATOM   5318  H  HE3  . LYS A 1 49 ? 5.576   0.238   4.113   1.00 0.00 ? 49  LYS A HE3  5  
ATOM   5319  H  HZ1  . LYS A 1 49 ? 7.041   -0.062  6.540   1.00 0.00 ? 49  LYS A HZ1  5  
ATOM   5320  H  HZ2  . LYS A 1 49 ? 6.838   -1.549  5.759   1.00 0.00 ? 49  LYS A HZ2  5  
ATOM   5321  H  HZ3  . LYS A 1 49 ? 5.487   -0.607  6.150   1.00 0.00 ? 49  LYS A HZ3  5  
ATOM   5322  N  N    . GLU A 1 50 ? 3.355   -2.718  3.072   1.00 0.00 ? 50  GLU A N    5  
ATOM   5323  C  CA   . GLU A 1 50 ? 2.154   -2.007  2.651   1.00 0.00 ? 50  GLU A CA   5  
ATOM   5324  C  C    . GLU A 1 50 ? 2.512   -0.695  1.959   1.00 0.00 ? 50  GLU A C    5  
ATOM   5325  O  O    . GLU A 1 50 ? 2.922   0.269   2.606   1.00 0.00 ? 50  GLU A O    5  
ATOM   5326  C  CB   . GLU A 1 50 ? 1.250   -1.732  3.855   1.00 0.00 ? 50  GLU A CB   5  
ATOM   5327  C  CG   . GLU A 1 50 ? -0.210  -1.526  3.485   1.00 0.00 ? 50  GLU A CG   5  
ATOM   5328  C  CD   . GLU A 1 50 ? -1.156  -1.935  4.598   1.00 0.00 ? 50  GLU A CD   5  
ATOM   5329  O  OE1  . GLU A 1 50 ? -0.989  -1.440  5.731   1.00 0.00 ? 50  GLU A OE1  5  
ATOM   5330  O  OE2  . GLU A 1 50 ? -2.064  -2.751  4.333   1.00 0.00 ? 50  GLU A OE2  5  
ATOM   5331  H  H    . GLU A 1 50 ? 3.549   -2.806  4.028   1.00 0.00 ? 50  GLU A H    5  
ATOM   5332  H  HA   . GLU A 1 50 ? 1.624   -2.636  1.952   1.00 0.00 ? 50  GLU A HA   5  
ATOM   5333  H  HB2  . GLU A 1 50 ? 1.314   -2.567  4.536   1.00 0.00 ? 50  GLU A HB2  5  
ATOM   5334  H  HB3  . GLU A 1 50 ? 1.601   -0.842  4.357   1.00 0.00 ? 50  GLU A HB3  5  
ATOM   5335  H  HG2  . GLU A 1 50 ? -0.368  -0.481  3.265   1.00 0.00 ? 50  GLU A HG2  5  
ATOM   5336  H  HG3  . GLU A 1 50 ? -0.432  -2.116  2.608   1.00 0.00 ? 50  GLU A HG3  5  
ATOM   5337  N  N    . LEU A 1 51 ? 2.354   -0.666  0.641   1.00 0.00 ? 51  LEU A N    5  
ATOM   5338  C  CA   . LEU A 1 51 ? 2.660   0.527   -0.141  1.00 0.00 ? 51  LEU A CA   5  
ATOM   5339  C  C    . LEU A 1 51 ? 1.847   1.722   0.348   1.00 0.00 ? 51  LEU A C    5  
ATOM   5340  O  O    . LEU A 1 51 ? 0.991   1.589   1.223   1.00 0.00 ? 51  LEU A O    5  
ATOM   5341  C  CB   . LEU A 1 51 ? 2.379   0.276   -1.623  1.00 0.00 ? 51  LEU A CB   5  
ATOM   5342  C  CG   . LEU A 1 51 ? 3.354   -0.656  -2.343  1.00 0.00 ? 51  LEU A CG   5  
ATOM   5343  C  CD1  . LEU A 1 51 ? 2.916   -0.879  -3.782  1.00 0.00 ? 51  LEU A CD1  5  
ATOM   5344  C  CD2  . LEU A 1 51 ? 4.766   -0.091  -2.295  1.00 0.00 ? 51  LEU A CD2  5  
ATOM   5345  H  H    . LEU A 1 51 ? 2.023   -1.465  0.181   1.00 0.00 ? 51  LEU A H    5  
ATOM   5346  H  HA   . LEU A 1 51 ? 3.710   0.745   -0.014  1.00 0.00 ? 51  LEU A HA   5  
ATOM   5347  H  HB2  . LEU A 1 51 ? 1.392   -0.152  -1.704  1.00 0.00 ? 51  LEU A HB2  5  
ATOM   5348  H  HB3  . LEU A 1 51 ? 2.398   1.231   -2.129  1.00 0.00 ? 51  LEU A HB3  5  
ATOM   5349  H  HG   . LEU A 1 51 ? 3.360   -1.616  -1.844  1.00 0.00 ? 51  LEU A HG   5  
ATOM   5350  H  HD11 . LEU A 1 51 ? 3.221   -1.863  -4.103  1.00 0.00 ? 51  LEU A HD11 5  
ATOM   5351  H  HD12 . LEU A 1 51 ? 3.374   -0.135  -4.417  1.00 0.00 ? 51  LEU A HD12 5  
ATOM   5352  H  HD13 . LEU A 1 51 ? 1.841   -0.795  -3.848  1.00 0.00 ? 51  LEU A HD13 5  
ATOM   5353  H  HD21 . LEU A 1 51 ? 5.326   -0.448  -3.147  1.00 0.00 ? 51  LEU A HD21 5  
ATOM   5354  H  HD22 . LEU A 1 51 ? 5.252   -0.412  -1.385  1.00 0.00 ? 51  LEU A HD22 5  
ATOM   5355  H  HD23 . LEU A 1 51 ? 4.723   0.988   -2.319  1.00 0.00 ? 51  LEU A HD23 5  
ATOM   5356  N  N    . THR A 1 52 ? 2.119   2.890   -0.226  1.00 0.00 ? 52  THR A N    5  
ATOM   5357  C  CA   . THR A 1 52 ? 1.413   4.108   0.150   1.00 0.00 ? 52  THR A CA   5  
ATOM   5358  C  C    . THR A 1 52 ? 0.784   4.777   -1.067  1.00 0.00 ? 52  THR A C    5  
ATOM   5359  O  O    . THR A 1 52 ? 0.952   4.317   -2.196  1.00 0.00 ? 52  THR A O    5  
ATOM   5360  C  CB   . THR A 1 52 ? 2.353   5.111   0.845   1.00 0.00 ? 52  THR A CB   5  
ATOM   5361  O  OG1  . THR A 1 52 ? 3.527   5.313   0.051   1.00 0.00 ? 52  THR A OG1  5  
ATOM   5362  C  CG2  . THR A 1 52 ? 2.748   4.614   2.227   1.00 0.00 ? 52  THR A CG2  5  
ATOM   5363  H  H    . THR A 1 52 ? 2.812   2.932   -0.917  1.00 0.00 ? 52  THR A H    5  
ATOM   5364  H  HA   . THR A 1 52 ? 0.630   3.839   0.845   1.00 0.00 ? 52  THR A HA   5  
ATOM   5365  H  HB   . THR A 1 52 ? 1.834   6.053   0.952   1.00 0.00 ? 52  THR A HB   5  
ATOM   5366  H  HG1  . THR A 1 52 ? 3.810   6.228   0.124   1.00 0.00 ? 52  THR A HG1  5  
ATOM   5367  H  HG21 . THR A 1 52 ? 2.993   5.457   2.856   1.00 0.00 ? 52  THR A HG21 5  
ATOM   5368  H  HG22 . THR A 1 52 ? 3.607   3.965   2.144   1.00 0.00 ? 52  THR A HG22 5  
ATOM   5369  H  HG23 . THR A 1 52 ? 1.925   4.068   2.662   1.00 0.00 ? 52  THR A HG23 5  
ATOM   5370  N  N    . ALA A 1 53 ? 0.061   5.867   -0.830  1.00 0.00 ? 53  ALA A N    5  
ATOM   5371  C  CA   . ALA A 1 53 ? -0.590  6.601   -1.908  1.00 0.00 ? 53  ALA A CA   5  
ATOM   5372  C  C    . ALA A 1 53 ? 0.437   7.188   -2.871  1.00 0.00 ? 53  ALA A C    5  
ATOM   5373  O  O    . ALA A 1 53 ? 0.213   7.234   -4.080  1.00 0.00 ? 53  ALA A O    5  
ATOM   5374  C  CB   . ALA A 1 53 ? -1.473  7.701   -1.339  1.00 0.00 ? 53  ALA A CB   5  
ATOM   5375  H  H    . ALA A 1 53 ? -0.036  6.185   0.091   1.00 0.00 ? 53  ALA A H    5  
ATOM   5376  H  HA   . ALA A 1 53 ? -1.221  5.910   -2.449  1.00 0.00 ? 53  ALA A HA   5  
ATOM   5377  H  HB1  . ALA A 1 53 ? -2.279  7.908   -2.029  1.00 0.00 ? 53  ALA A HB1  5  
ATOM   5378  H  HB2  . ALA A 1 53 ? -1.883  7.381   -0.393  1.00 0.00 ? 53  ALA A HB2  5  
ATOM   5379  H  HB3  . ALA A 1 53 ? -0.886  8.595   -1.194  1.00 0.00 ? 53  ALA A HB3  5  
ATOM   5380  N  N    . ASP A 1 54 ? 1.562   7.638   -2.325  1.00 0.00 ? 54  ASP A N    5  
ATOM   5381  C  CA   . ASP A 1 54 ? 2.624   8.223   -3.136  1.00 0.00 ? 54  ASP A CA   5  
ATOM   5382  C  C    . ASP A 1 54 ? 3.531   7.138   -3.708  1.00 0.00 ? 54  ASP A C    5  
ATOM   5383  O  O    . ASP A 1 54 ? 4.616   7.425   -4.212  1.00 0.00 ? 54  ASP A O    5  
ATOM   5384  C  CB   . ASP A 1 54 ? 3.447   9.207   -2.303  1.00 0.00 ? 54  ASP A CB   5  
ATOM   5385  C  CG   . ASP A 1 54 ? 2.627   10.391  -1.830  1.00 0.00 ? 54  ASP A CG   5  
ATOM   5386  O  OD1  . ASP A 1 54 ? 2.158   11.168  -2.687  1.00 0.00 ? 54  ASP A OD1  5  
ATOM   5387  O  OD2  . ASP A 1 54 ? 2.456   10.542  -0.602  1.00 0.00 ? 54  ASP A OD2  5  
ATOM   5388  H  H    . ASP A 1 54 ? 1.681   7.574   -1.355  1.00 0.00 ? 54  ASP A H    5  
ATOM   5389  H  HA   . ASP A 1 54 ? 2.162   8.755   -3.953  1.00 0.00 ? 54  ASP A HA   5  
ATOM   5390  H  HB2  . ASP A 1 54 ? 3.839   8.695   -1.436  1.00 0.00 ? 54  ASP A HB2  5  
ATOM   5391  H  HB3  . ASP A 1 54 ? 4.267   9.575   -2.901  1.00 0.00 ? 54  ASP A HB3  5  
ATOM   5392  N  N    . ALA A 1 55 ? 3.079   5.891   -3.624  1.00 0.00 ? 55  ALA A N    5  
ATOM   5393  C  CA   . ALA A 1 55 ? 3.850   4.763   -4.134  1.00 0.00 ? 55  ALA A CA   5  
ATOM   5394  C  C    . ALA A 1 55 ? 4.314   5.017   -5.564  1.00 0.00 ? 55  ALA A C    5  
ATOM   5395  O  O    . ALA A 1 55 ? 3.649   5.718   -6.327  1.00 0.00 ? 55  ALA A O    5  
ATOM   5396  C  CB   . ALA A 1 55 ? 3.026   3.486   -4.063  1.00 0.00 ? 55  ALA A CB   5  
ATOM   5397  H  H    . ALA A 1 55 ? 2.206   5.726   -3.211  1.00 0.00 ? 55  ALA A H    5  
ATOM   5398  H  HA   . ALA A 1 55 ? 4.717   4.639   -3.502  1.00 0.00 ? 55  ALA A HA   5  
ATOM   5399  H  HB1  . ALA A 1 55 ? 1.975   3.737   -4.059  1.00 0.00 ? 55  ALA A HB1  5  
ATOM   5400  H  HB2  . ALA A 1 55 ? 3.246   2.868   -4.921  1.00 0.00 ? 55  ALA A HB2  5  
ATOM   5401  H  HB3  . ALA A 1 55 ? 3.272   2.949   -3.159  1.00 0.00 ? 55  ALA A HB3  5  
ATOM   5402  N  N    . ARG A 1 56 ? 5.458   4.444   -5.921  1.00 0.00 ? 56  ARG A N    5  
ATOM   5403  C  CA   . ARG A 1 56 ? 6.012   4.610   -7.259  1.00 0.00 ? 56  ARG A CA   5  
ATOM   5404  C  C    . ARG A 1 56 ? 5.860   3.329   -8.073  1.00 0.00 ? 56  ARG A C    5  
ATOM   5405  O  O    . ARG A 1 56 ? 6.076   2.230   -7.564  1.00 0.00 ? 56  ARG A O    5  
ATOM   5406  C  CB   . ARG A 1 56 ? 7.488   5.004   -7.178  1.00 0.00 ? 56  ARG A CB   5  
ATOM   5407  C  CG   . ARG A 1 56 ? 7.746   6.226   -6.311  1.00 0.00 ? 56  ARG A CG   5  
ATOM   5408  C  CD   . ARG A 1 56 ? 7.197   7.490   -6.953  1.00 0.00 ? 56  ARG A CD   5  
ATOM   5409  N  NE   . ARG A 1 56 ? 6.887   8.517   -5.961  1.00 0.00 ? 56  ARG A NE   5  
ATOM   5410  C  CZ   . ARG A 1 56 ? 6.052   9.526   -6.184  1.00 0.00 ? 56  ARG A CZ   5  
ATOM   5411  N  NH1  . ARG A 1 56 ? 5.446   9.642   -7.358  1.00 0.00 ? 56  ARG A NH1  5  
ATOM   5412  N  NH2  . ARG A 1 56 ? 5.822   10.421  -5.232  1.00 0.00 ? 56  ARG A NH2  5  
ATOM   5413  H  H    . ARG A 1 56 ? 5.943   3.896   -5.268  1.00 0.00 ? 56  ARG A H    5  
ATOM   5414  H  HA   . ARG A 1 56 ? 5.464   5.401   -7.749  1.00 0.00 ? 56  ARG A HA   5  
ATOM   5415  H  HB2  . ARG A 1 56 ? 8.048   4.176   -6.770  1.00 0.00 ? 56  ARG A HB2  5  
ATOM   5416  H  HB3  . ARG A 1 56 ? 7.847   5.215   -8.174  1.00 0.00 ? 56  ARG A HB3  5  
ATOM   5417  H  HG2  . ARG A 1 56 ? 7.266   6.084   -5.354  1.00 0.00 ? 56  ARG A HG2  5  
ATOM   5418  H  HG3  . ARG A 1 56 ? 8.810   6.337   -6.170  1.00 0.00 ? 56  ARG A HG3  5  
ATOM   5419  H  HD2  . ARG A 1 56 ? 7.933   7.878   -7.640  1.00 0.00 ? 56  ARG A HD2  5  
ATOM   5420  H  HD3  . ARG A 1 56 ? 6.296   7.242   -7.493  1.00 0.00 ? 56  ARG A HD3  5  
ATOM   5421  H  HE   . ARG A 1 56 ? 7.325   8.450   -5.087  1.00 0.00 ? 56  ARG A HE   5  
ATOM   5422  H  HH11 . ARG A 1 56 ? 5.617   8.969   -8.077  1.00 0.00 ? 56  ARG A HH11 5  
ATOM   5423  H  HH12 . ARG A 1 56 ? 4.817   10.402  -7.522  1.00 0.00 ? 56  ARG A HH12 5  
ATOM   5424  H  HH21 . ARG A 1 56 ? 6.277   10.336  -4.346  1.00 0.00 ? 56  ARG A HH21 5  
ATOM   5425  H  HH22 . ARG A 1 56 ? 5.194   11.179  -5.401  1.00 0.00 ? 56  ARG A HH22 5  
ATOM   5426  N  N    . GLU A 1 57 ? 5.488   3.479   -9.340  1.00 0.00 ? 57  GLU A N    5  
ATOM   5427  C  CA   . GLU A 1 57 ? 5.306   2.333   -10.224 1.00 0.00 ? 57  GLU A CA   5  
ATOM   5428  C  C    . GLU A 1 57 ? 6.531   2.130   -11.110 1.00 0.00 ? 57  GLU A C    5  
ATOM   5429  O  O    . GLU A 1 57 ? 6.972   3.050   -11.800 1.00 0.00 ? 57  GLU A O    5  
ATOM   5430  C  CB   . GLU A 1 57 ? 4.060   2.523   -11.092 1.00 0.00 ? 57  GLU A CB   5  
ATOM   5431  C  CG   . GLU A 1 57 ? 3.849   1.410   -12.105 1.00 0.00 ? 57  GLU A CG   5  
ATOM   5432  C  CD   . GLU A 1 57 ? 2.975   1.838   -13.268 1.00 0.00 ? 57  GLU A CD   5  
ATOM   5433  O  OE1  . GLU A 1 57 ? 1.749   1.972   -13.071 1.00 0.00 ? 57  GLU A OE1  5  
ATOM   5434  O  OE2  . GLU A 1 57 ? 3.518   2.039   -14.375 1.00 0.00 ? 57  GLU A OE2  5  
ATOM   5435  H  H    . GLU A 1 57 ? 5.330   4.381   -9.689  1.00 0.00 ? 57  GLU A H    5  
ATOM   5436  H  HA   . GLU A 1 57 ? 5.173   1.457   -9.607  1.00 0.00 ? 57  GLU A HA   5  
ATOM   5437  H  HB2  . GLU A 1 57 ? 3.192   2.568   -10.451 1.00 0.00 ? 57  GLU A HB2  5  
ATOM   5438  H  HB3  . GLU A 1 57 ? 4.149   3.456   -11.628 1.00 0.00 ? 57  GLU A HB3  5  
ATOM   5439  H  HG2  . GLU A 1 57 ? 4.811   1.105   -12.491 1.00 0.00 ? 57  GLU A HG2  5  
ATOM   5440  H  HG3  . GLU A 1 57 ? 3.380   0.573   -11.609 1.00 0.00 ? 57  GLU A HG3  5  
ATOM   5441  N  N    . LEU A 1 58 ? 7.077   0.919   -11.086 1.00 0.00 ? 58  LEU A N    5  
ATOM   5442  C  CA   . LEU A 1 58 ? 8.252   0.594   -11.887 1.00 0.00 ? 58  LEU A CA   5  
ATOM   5443  C  C    . LEU A 1 58 ? 8.034   -0.693  -12.677 1.00 0.00 ? 58  LEU A C    5  
ATOM   5444  O  O    . LEU A 1 58 ? 7.609   -1.708  -12.126 1.00 0.00 ? 58  LEU A O    5  
ATOM   5445  C  CB   . LEU A 1 58 ? 9.482   0.451   -10.988 1.00 0.00 ? 58  LEU A CB   5  
ATOM   5446  C  CG   . LEU A 1 58 ? 10.255  1.739   -10.699 1.00 0.00 ? 58  LEU A CG   5  
ATOM   5447  C  CD1  . LEU A 1 58 ? 11.401  1.469   -9.737  1.00 0.00 ? 58  LEU A CD1  5  
ATOM   5448  C  CD2  . LEU A 1 58 ? 10.774  2.351   -11.992 1.00 0.00 ? 58  LEU A CD2  5  
ATOM   5449  H  H    . LEU A 1 58 ? 6.682   0.227   -10.517 1.00 0.00 ? 58  LEU A H    5  
ATOM   5450  H  HA   . LEU A 1 58 ? 8.415   1.405   -12.581 1.00 0.00 ? 58  LEU A HA   5  
ATOM   5451  H  HB2  . LEU A 1 58 ? 9.157   0.043   -10.045 1.00 0.00 ? 58  LEU A HB2  5  
ATOM   5452  H  HB3  . LEU A 1 58 ? 10.160  -0.243  -11.465 1.00 0.00 ? 58  LEU A HB3  5  
ATOM   5453  H  HG   . LEU A 1 58 ? 9.590   2.453   -10.233 1.00 0.00 ? 58  LEU A HG   5  
ATOM   5454  H  HD11 . LEU A 1 58 ? 12.202  0.971   -10.263 1.00 0.00 ? 58  LEU A HD11 5  
ATOM   5455  H  HD12 . LEU A 1 58 ? 11.054  0.840   -8.931  1.00 0.00 ? 58  LEU A HD12 5  
ATOM   5456  H  HD13 . LEU A 1 58 ? 11.761  2.405   -9.334  1.00 0.00 ? 58  LEU A HD13 5  
ATOM   5457  H  HD21 . LEU A 1 58 ? 10.033  3.027   -12.393 1.00 0.00 ? 58  LEU A HD21 5  
ATOM   5458  H  HD22 . LEU A 1 58 ? 10.971  1.566   -12.709 1.00 0.00 ? 58  LEU A HD22 5  
ATOM   5459  H  HD23 . LEU A 1 58 ? 11.686  2.894   -11.793 1.00 0.00 ? 58  LEU A HD23 5  
ATOM   5460  N  N    . LYS A 1 59 ? 8.330   -0.643  -13.971 1.00 0.00 ? 59  LYS A N    5  
ATOM   5461  C  CA   . LYS A 1 59 ? 8.170   -1.805  -14.838 1.00 0.00 ? 59  LYS A CA   5  
ATOM   5462  C  C    . LYS A 1 59 ? 6.831   -2.491  -14.586 1.00 0.00 ? 59  LYS A C    5  
ATOM   5463  O  O    . LYS A 1 59 ? 6.739   -3.718  -14.598 1.00 0.00 ? 59  LYS A O    5  
ATOM   5464  C  CB   . LYS A 1 59 ? 9.314   -2.796  -14.613 1.00 0.00 ? 59  LYS A CB   5  
ATOM   5465  C  CG   . LYS A 1 59 ? 10.688  -2.150  -14.617 1.00 0.00 ? 59  LYS A CG   5  
ATOM   5466  C  CD   . LYS A 1 59 ? 11.062  -1.643  -16.000 1.00 0.00 ? 59  LYS A CD   5  
ATOM   5467  C  CE   . LYS A 1 59 ? 10.684  -0.181  -16.178 1.00 0.00 ? 59  LYS A CE   5  
ATOM   5468  N  NZ   . LYS A 1 59 ? 11.211  0.376   -17.455 1.00 0.00 ? 59  LYS A NZ   5  
ATOM   5469  H  H    . LYS A 1 59 ? 8.665   0.195   -14.353 1.00 0.00 ? 59  LYS A H    5  
ATOM   5470  H  HA   . LYS A 1 59 ? 8.198   -1.462  -15.861 1.00 0.00 ? 59  LYS A HA   5  
ATOM   5471  H  HB2  . LYS A 1 59 ? 9.170   -3.283  -13.659 1.00 0.00 ? 59  LYS A HB2  5  
ATOM   5472  H  HB3  . LYS A 1 59 ? 9.287   -3.541  -15.395 1.00 0.00 ? 59  LYS A HB3  5  
ATOM   5473  H  HG2  . LYS A 1 59 ? 10.687  -1.318  -13.929 1.00 0.00 ? 59  LYS A HG2  5  
ATOM   5474  H  HG3  . LYS A 1 59 ? 11.420  -2.880  -14.301 1.00 0.00 ? 59  LYS A HG3  5  
ATOM   5475  H  HD2  . LYS A 1 59 ? 12.128  -1.747  -16.136 1.00 0.00 ? 59  LYS A HD2  5  
ATOM   5476  H  HD3  . LYS A 1 59 ? 10.543  -2.233  -16.742 1.00 0.00 ? 59  LYS A HD3  5  
ATOM   5477  H  HE2  . LYS A 1 59 ? 9.608   -0.097  -16.176 1.00 0.00 ? 59  LYS A HE2  5  
ATOM   5478  H  HE3  . LYS A 1 59 ? 11.091  0.385   -15.353 1.00 0.00 ? 59  LYS A HE3  5  
ATOM   5479  H  HZ1  . LYS A 1 59 ? 12.212  0.119   -17.570 1.00 0.00 ? 59  LYS A HZ1  5  
ATOM   5480  H  HZ2  . LYS A 1 59 ? 11.129  1.413   -17.453 1.00 0.00 ? 59  LYS A HZ2  5  
ATOM   5481  H  HZ3  . LYS A 1 59 ? 10.672  -0.002  -18.259 1.00 0.00 ? 59  LYS A HZ3  5  
ATOM   5482  N  N    . GLY A 1 60 ? 5.794   -1.691  -14.359 1.00 0.00 ? 60  GLY A N    5  
ATOM   5483  C  CA   . GLY A 1 60 ? 4.474   -2.240  -14.109 1.00 0.00 ? 60  GLY A CA   5  
ATOM   5484  C  C    . GLY A 1 60 ? 4.223   -2.498  -12.636 1.00 0.00 ? 60  GLY A C    5  
ATOM   5485  O  O    . GLY A 1 60 ? 3.102   -2.340  -12.155 1.00 0.00 ? 60  GLY A O    5  
ATOM   5486  H  H    . GLY A 1 60 ? 5.926   -0.719  -14.361 1.00 0.00 ? 60  GLY A H    5  
ATOM   5487  H  HA2  . GLY A 1 60 ? 3.732   -1.545  -14.473 1.00 0.00 ? 60  GLY A HA2  5  
ATOM   5488  H  HA3  . GLY A 1 60 ? 4.376   -3.171  -14.647 1.00 0.00 ? 60  GLY A HA3  5  
ATOM   5489  N  N    . GLU A 1 61 ? 5.269   -2.898  -11.920 1.00 0.00 ? 61  GLU A N    5  
ATOM   5490  C  CA   . GLU A 1 61 ? 5.155   -3.182  -10.495 1.00 0.00 ? 61  GLU A CA   5  
ATOM   5491  C  C    . GLU A 1 61 ? 4.924   -1.898  -9.702  1.00 0.00 ? 61  GLU A C    5  
ATOM   5492  O  O    . GLU A 1 61 ? 4.913   -0.802  -10.263 1.00 0.00 ? 61  GLU A O    5  
ATOM   5493  C  CB   . GLU A 1 61 ? 6.415   -3.887  -9.990  1.00 0.00 ? 61  GLU A CB   5  
ATOM   5494  C  CG   . GLU A 1 61 ? 6.465   -5.366  -10.334 1.00 0.00 ? 61  GLU A CG   5  
ATOM   5495  C  CD   . GLU A 1 61 ? 5.458   -6.182  -9.547  1.00 0.00 ? 61  GLU A CD   5  
ATOM   5496  O  OE1  . GLU A 1 61 ? 4.265   -6.171  -9.916  1.00 0.00 ? 61  GLU A OE1  5  
ATOM   5497  O  OE2  . GLU A 1 61 ? 5.864   -6.833  -8.561  1.00 0.00 ? 61  GLU A OE2  5  
ATOM   5498  H  H    . GLU A 1 61 ? 6.137   -3.006  -12.361 1.00 0.00 ? 61  GLU A H    5  
ATOM   5499  H  HA   . GLU A 1 61 ? 4.307   -3.835  -10.353 1.00 0.00 ? 61  GLU A HA   5  
ATOM   5500  H  HB2  . GLU A 1 61 ? 7.280   -3.407  -10.424 1.00 0.00 ? 61  GLU A HB2  5  
ATOM   5501  H  HB3  . GLU A 1 61 ? 6.462   -3.788  -8.915  1.00 0.00 ? 61  GLU A HB3  5  
ATOM   5502  H  HG2  . GLU A 1 61 ? 6.257   -5.484  -11.387 1.00 0.00 ? 61  GLU A HG2  5  
ATOM   5503  H  HG3  . GLU A 1 61 ? 7.455   -5.739  -10.120 1.00 0.00 ? 61  GLU A HG3  5  
ATOM   5504  N  N    . LEU A 1 62 ? 4.741   -2.043  -8.394  1.00 0.00 ? 62  LEU A N    5  
ATOM   5505  C  CA   . LEU A 1 62 ? 4.510   -0.896  -7.522  1.00 0.00 ? 62  LEU A CA   5  
ATOM   5506  C  C    . LEU A 1 62 ? 5.379   -0.979  -6.271  1.00 0.00 ? 62  LEU A C    5  
ATOM   5507  O  O    . LEU A 1 62 ? 5.142   -1.809  -5.393  1.00 0.00 ? 62  LEU A O    5  
ATOM   5508  C  CB   . LEU A 1 62 ? 3.034   -0.820  -7.128  1.00 0.00 ? 62  LEU A CB   5  
ATOM   5509  C  CG   . LEU A 1 62 ? 2.053   -0.497  -8.256  1.00 0.00 ? 62  LEU A CG   5  
ATOM   5510  C  CD1  . LEU A 1 62 ? 0.635   -0.870  -7.853  1.00 0.00 ? 62  LEU A CD1  5  
ATOM   5511  C  CD2  . LEU A 1 62 ? 2.134   0.976   -8.628  1.00 0.00 ? 62  LEU A CD2  5  
ATOM   5512  H  H    . LEU A 1 62 ? 4.761   -2.942  -8.004  1.00 0.00 ? 62  LEU A H    5  
ATOM   5513  H  HA   . LEU A 1 62 ? 4.774   -0.005  -8.071  1.00 0.00 ? 62  LEU A HA   5  
ATOM   5514  H  HB2  . LEU A 1 62 ? 2.754   -1.774  -6.709  1.00 0.00 ? 62  LEU A HB2  5  
ATOM   5515  H  HB3  . LEU A 1 62 ? 2.934   -0.054  -6.372  1.00 0.00 ? 62  LEU A HB3  5  
ATOM   5516  H  HG   . LEU A 1 62 ? 2.315   -1.079  -9.129  1.00 0.00 ? 62  LEU A HG   5  
ATOM   5517  H  HD11 . LEU A 1 62 ? 0.059   0.028   -7.691  1.00 0.00 ? 62  LEU A HD11 5  
ATOM   5518  H  HD12 . LEU A 1 62 ? 0.660   -1.451  -6.943  1.00 0.00 ? 62  LEU A HD12 5  
ATOM   5519  H  HD13 . LEU A 1 62 ? 0.180   -1.454  -8.639  1.00 0.00 ? 62  LEU A HD13 5  
ATOM   5520  H  HD21 . LEU A 1 62 ? 1.321   1.510   -8.159  1.00 0.00 ? 62  LEU A HD21 5  
ATOM   5521  H  HD22 . LEU A 1 62 ? 2.063   1.080   -9.701  1.00 0.00 ? 62  LEU A HD22 5  
ATOM   5522  H  HD23 . LEU A 1 62 ? 3.075   1.382   -8.288  1.00 0.00 ? 62  LEU A HD23 5  
ATOM   5523  N  N    . TYR A 1 63 ? 6.383   -0.114  -6.197  1.00 0.00 ? 63  TYR A N    5  
ATOM   5524  C  CA   . TYR A 1 63 ? 7.288   -0.089  -5.054  1.00 0.00 ? 63  TYR A CA   5  
ATOM   5525  C  C    . TYR A 1 63 ? 7.018   1.126   -4.171  1.00 0.00 ? 63  TYR A C    5  
ATOM   5526  O  O    . TYR A 1 63 ? 6.310   2.052   -4.568  1.00 0.00 ? 63  TYR A O    5  
ATOM   5527  C  CB   . TYR A 1 63 ? 8.742   -0.076  -5.527  1.00 0.00 ? 63  TYR A CB   5  
ATOM   5528  C  CG   . TYR A 1 63 ? 9.063   -1.163  -6.528  1.00 0.00 ? 63  TYR A CG   5  
ATOM   5529  C  CD1  . TYR A 1 63 ? 8.634   -1.070  -7.846  1.00 0.00 ? 63  TYR A CD1  5  
ATOM   5530  C  CD2  . TYR A 1 63 ? 9.794   -2.284  -6.154  1.00 0.00 ? 63  TYR A CD2  5  
ATOM   5531  C  CE1  . TYR A 1 63 ? 8.924   -2.062  -8.763  1.00 0.00 ? 63  TYR A CE1  5  
ATOM   5532  C  CE2  . TYR A 1 63 ? 10.090  -3.280  -7.065  1.00 0.00 ? 63  TYR A CE2  5  
ATOM   5533  C  CZ   . TYR A 1 63 ? 9.653   -3.164  -8.368  1.00 0.00 ? 63  TYR A CZ   5  
ATOM   5534  O  OH   . TYR A 1 63 ? 9.944   -4.154  -9.278  1.00 0.00 ? 63  TYR A OH   5  
ATOM   5535  H  H    . TYR A 1 63 ? 6.521   0.523   -6.929  1.00 0.00 ? 63  TYR A H    5  
ATOM   5536  H  HA   . TYR A 1 63 ? 7.116   -0.985  -4.475  1.00 0.00 ? 63  TYR A HA   5  
ATOM   5537  H  HB2  . TYR A 1 63 ? 8.954   0.874   -5.993  1.00 0.00 ? 63  TYR A HB2  5  
ATOM   5538  H  HB3  . TYR A 1 63 ? 9.393   -0.207  -4.675  1.00 0.00 ? 63  TYR A HB3  5  
ATOM   5539  H  HD1  . TYR A 1 63 ? 8.063   -0.205  -8.152  1.00 0.00 ? 63  TYR A HD1  5  
ATOM   5540  H  HD2  . TYR A 1 63 ? 10.135  -2.372  -5.133  1.00 0.00 ? 63  TYR A HD2  5  
ATOM   5541  H  HE1  . TYR A 1 63 ? 8.582   -1.971  -9.784  1.00 0.00 ? 63  TYR A HE1  5  
ATOM   5542  H  HE2  . TYR A 1 63 ? 10.660  -4.143  -6.756  1.00 0.00 ? 63  TYR A HE2  5  
ATOM   5543  H  HH   . TYR A 1 63 ? 9.761   -3.837  -10.166 1.00 0.00 ? 63  TYR A HH   5  
ATOM   5544  N  N    . CYS A 1 64 ? 7.587   1.115   -2.971  1.00 0.00 ? 64  CYS A N    5  
ATOM   5545  C  CA   . CYS A 1 64 ? 7.410   2.215   -2.030  1.00 0.00 ? 64  CYS A CA   5  
ATOM   5546  C  C    . CYS A 1 64 ? 8.490   3.275   -2.223  1.00 0.00 ? 64  CYS A C    5  
ATOM   5547  O  O    . CYS A 1 64 ? 9.500   3.035   -2.885  1.00 0.00 ? 64  CYS A O    5  
ATOM   5548  C  CB   . CYS A 1 64 ? 7.443   1.693   -0.592  1.00 0.00 ? 64  CYS A CB   5  
ATOM   5549  S  SG   . CYS A 1 64 ? 9.047   0.987   -0.094  1.00 0.00 ? 64  CYS A SG   5  
ATOM   5550  H  H    . CYS A 1 64 ? 8.141   0.348   -2.710  1.00 0.00 ? 64  CYS A H    5  
ATOM   5551  H  HA   . CYS A 1 64 ? 6.446   2.661   -2.219  1.00 0.00 ? 64  CYS A HA   5  
ATOM   5552  H  HB2  . CYS A 1 64 ? 7.220   2.507   0.083   1.00 0.00 ? 64  CYS A HB2  5  
ATOM   5553  H  HB3  . CYS A 1 64 ? 6.695   0.923   -0.479  1.00 0.00 ? 64  CYS A HB3  5  
ATOM   5554  N  N    . LEU A 1 65 ? 8.270   4.448   -1.640  1.00 0.00 ? 65  LEU A N    5  
ATOM   5555  C  CA   . LEU A 1 65 ? 9.224   5.547   -1.747  1.00 0.00 ? 65  LEU A CA   5  
ATOM   5556  C  C    . LEU A 1 65 ? 10.609  5.113   -1.280  1.00 0.00 ? 65  LEU A C    5  
ATOM   5557  O  O    . LEU A 1 65 ? 11.613  5.312   -1.964  1.00 0.00 ? 65  LEU A O    5  
ATOM   5558  C  CB   . LEU A 1 65 ? 8.747   6.744   -0.922  1.00 0.00 ? 65  LEU A CB   5  
ATOM   5559  C  CG   . LEU A 1 65 ? 7.904   7.780   -1.668  1.00 0.00 ? 65  LEU A CG   5  
ATOM   5560  C  CD1  . LEU A 1 65 ? 8.770   8.585   -2.624  1.00 0.00 ? 65  LEU A CD1  5  
ATOM   5561  C  CD2  . LEU A 1 65 ? 6.767   7.101   -2.418  1.00 0.00 ? 65  LEU A CD2  5  
ATOM   5562  H  H    . LEU A 1 65 ? 7.447   4.580   -1.125  1.00 0.00 ? 65  LEU A H    5  
ATOM   5563  H  HA   . LEU A 1 65 ? 9.281   5.836   -2.786  1.00 0.00 ? 65  LEU A HA   5  
ATOM   5564  H  HB2  . LEU A 1 65 ? 8.157   6.367   -0.102  1.00 0.00 ? 65  LEU A HB2  5  
ATOM   5565  H  HB3  . LEU A 1 65 ? 9.622   7.246   -0.534  1.00 0.00 ? 65  LEU A HB3  5  
ATOM   5566  H  HG   . LEU A 1 65 ? 7.472   8.465   -0.952  1.00 0.00 ? 65  LEU A HG   5  
ATOM   5567  H  HD11 . LEU A 1 65 ? 9.305   7.913   -3.277  1.00 0.00 ? 65  LEU A HD11 5  
ATOM   5568  H  HD12 . LEU A 1 65 ? 9.476   9.176   -2.059  1.00 0.00 ? 65  LEU A HD12 5  
ATOM   5569  H  HD13 . LEU A 1 65 ? 8.144   9.239   -3.213  1.00 0.00 ? 65  LEU A HD13 5  
ATOM   5570  H  HD21 . LEU A 1 65 ? 6.469   6.209   -1.887  1.00 0.00 ? 65  LEU A HD21 5  
ATOM   5571  H  HD22 . LEU A 1 65 ? 7.099   6.836   -3.411  1.00 0.00 ? 65  LEU A HD22 5  
ATOM   5572  H  HD23 . LEU A 1 65 ? 5.928   7.777   -2.487  1.00 0.00 ? 65  LEU A HD23 5  
ATOM   5573  N  N    . PRO A 1 66 ? 10.667  4.502   -0.087  1.00 0.00 ? 66  PRO A N    5  
ATOM   5574  C  CA   . PRO A 1 66 ? 11.924  4.024   0.497   1.00 0.00 ? 66  PRO A CA   5  
ATOM   5575  C  C    . PRO A 1 66 ? 12.756  3.220   -0.497  1.00 0.00 ? 66  PRO A C    5  
ATOM   5576  O  O    . PRO A 1 66 ? 13.937  3.500   -0.703  1.00 0.00 ? 66  PRO A O    5  
ATOM   5577  C  CB   . PRO A 1 66 ? 11.462  3.132   1.652   1.00 0.00 ? 66  PRO A CB   5  
ATOM   5578  C  CG   . PRO A 1 66 ? 10.121  3.662   2.027   1.00 0.00 ? 66  PRO A CG   5  
ATOM   5579  C  CD   . PRO A 1 66 ? 9.511   4.231   0.783   1.00 0.00 ? 66  PRO A CD   5  
ATOM   5580  H  HA   . PRO A 1 66 ? 12.517  4.839   0.885   1.00 0.00 ? 66  PRO A HA   5  
ATOM   5581  H  HB2  . PRO A 1 66 ? 11.401  2.106   1.316   1.00 0.00 ? 66  PRO A HB2  5  
ATOM   5582  H  HB3  . PRO A 1 66 ? 12.160  3.207   2.472   1.00 0.00 ? 66  PRO A HB3  5  
ATOM   5583  H  HG2  . PRO A 1 66 ? 9.503   2.863   2.407   1.00 0.00 ? 66  PRO A HG2  5  
ATOM   5584  H  HG3  . PRO A 1 66 ? 10.229  4.440   2.769   1.00 0.00 ? 66  PRO A HG3  5  
ATOM   5585  H  HD2  . PRO A 1 66 ? 8.848   3.509   0.330   1.00 0.00 ? 66  PRO A HD2  5  
ATOM   5586  H  HD3  . PRO A 1 66 ? 8.979   5.143   1.012   1.00 0.00 ? 66  PRO A HD3  5  
ATOM   5587  N  N    . CYS A 1 67 ? 12.133  2.220   -1.111  1.00 0.00 ? 67  CYS A N    5  
ATOM   5588  C  CA   . CYS A 1 67 ? 12.816  1.375   -2.083  1.00 0.00 ? 67  CYS A CA   5  
ATOM   5589  C  C    . CYS A 1 67 ? 13.054  2.130   -3.387  1.00 0.00 ? 67  CYS A C    5  
ATOM   5590  O  O    . CYS A 1 67 ? 14.186  2.230   -3.862  1.00 0.00 ? 67  CYS A O    5  
ATOM   5591  C  CB   . CYS A 1 67 ? 11.997  0.111   -2.355  1.00 0.00 ? 67  CYS A CB   5  
ATOM   5592  S  SG   . CYS A 1 67 ? 12.160  -1.170  -1.071  1.00 0.00 ? 67  CYS A SG   5  
ATOM   5593  H  H    . CYS A 1 67 ? 11.190  2.045   -0.905  1.00 0.00 ? 67  CYS A H    5  
ATOM   5594  H  HA   . CYS A 1 67 ? 13.770  1.093   -1.666  1.00 0.00 ? 67  CYS A HA   5  
ATOM   5595  H  HB2  . CYS A 1 67 ? 10.952  0.376   -2.424  1.00 0.00 ? 67  CYS A HB2  5  
ATOM   5596  H  HB3  . CYS A 1 67 ? 12.316  -0.320  -3.293  1.00 0.00 ? 67  CYS A HB3  5  
ATOM   5597  N  N    . HIS A 1 68 ? 11.979  2.661   -3.962  1.00 0.00 ? 68  HIS A N    5  
ATOM   5598  C  CA   . HIS A 1 68 ? 12.071  3.409   -5.211  1.00 0.00 ? 68  HIS A CA   5  
ATOM   5599  C  C    . HIS A 1 68 ? 13.266  4.357   -5.191  1.00 0.00 ? 68  HIS A C    5  
ATOM   5600  O  O    . HIS A 1 68 ? 13.933  4.553   -6.207  1.00 0.00 ? 68  HIS A O    5  
ATOM   5601  C  CB   . HIS A 1 68 ? 10.784  4.197   -5.454  1.00 0.00 ? 68  HIS A CB   5  
ATOM   5602  C  CG   . HIS A 1 68 ? 10.607  4.631   -6.877  1.00 0.00 ? 68  HIS A CG   5  
ATOM   5603  N  ND1  . HIS A 1 68 ? 10.878  5.911   -7.313  1.00 0.00 ? 68  HIS A ND1  5  
ATOM   5604  C  CD2  . HIS A 1 68 ? 10.185  3.946   -7.965  1.00 0.00 ? 68  HIS A CD2  5  
ATOM   5605  C  CE1  . HIS A 1 68 ? 10.628  5.995   -8.607  1.00 0.00 ? 68  HIS A CE1  5  
ATOM   5606  N  NE2  . HIS A 1 68 ? 10.207  4.816   -9.028  1.00 0.00 ? 68  HIS A NE2  5  
ATOM   5607  H  H    . HIS A 1 68 ? 11.105  2.548   -3.536  1.00 0.00 ? 68  HIS A H    5  
ATOM   5608  H  HA   . HIS A 1 68 ? 12.205  2.699   -6.014  1.00 0.00 ? 68  HIS A HA   5  
ATOM   5609  H  HB2  . HIS A 1 68 ? 9.937   3.582   -5.188  1.00 0.00 ? 68  HIS A HB2  5  
ATOM   5610  H  HB3  . HIS A 1 68 ? 10.789  5.083   -4.835  1.00 0.00 ? 68  HIS A HB3  5  
ATOM   5611  H  HD1  . HIS A 1 68 ? 11.203  6.648   -6.756  1.00 0.00 ? 68  HIS A HD1  5  
ATOM   5612  H  HD2  . HIS A 1 68 ? 9.885   2.908   -7.994  1.00 0.00 ? 68  HIS A HD2  5  
ATOM   5613  H  HE1  . HIS A 1 68 ? 10.749  6.877   -9.219  1.00 0.00 ? 68  HIS A HE1  5  
ATOM   5614  N  N    . ASP A 1 69 ? 13.530  4.943   -4.028  1.00 0.00 ? 69  ASP A N    5  
ATOM   5615  C  CA   . ASP A 1 69 ? 14.645  5.871   -3.875  1.00 0.00 ? 69  ASP A CA   5  
ATOM   5616  C  C    . ASP A 1 69 ? 15.973  5.175   -4.154  1.00 0.00 ? 69  ASP A C    5  
ATOM   5617  O  O    . ASP A 1 69 ? 16.866  5.746   -4.780  1.00 0.00 ? 69  ASP A O    5  
ATOM   5618  C  CB   . ASP A 1 69 ? 14.652  6.464   -2.465  1.00 0.00 ? 69  ASP A CB   5  
ATOM   5619  C  CG   . ASP A 1 69 ? 13.837  7.739   -2.369  1.00 0.00 ? 69  ASP A CG   5  
ATOM   5620  O  OD1  . ASP A 1 69 ? 12.652  7.715   -2.761  1.00 0.00 ? 69  ASP A OD1  5  
ATOM   5621  O  OD2  . ASP A 1 69 ? 14.385  8.760   -1.903  1.00 0.00 ? 69  ASP A OD2  5  
ATOM   5622  H  H    . ASP A 1 69 ? 12.962  4.747   -3.254  1.00 0.00 ? 69  ASP A H    5  
ATOM   5623  H  HA   . ASP A 1 69 ? 14.513  6.668   -4.590  1.00 0.00 ? 69  ASP A HA   5  
ATOM   5624  H  HB2  . ASP A 1 69 ? 14.239  5.742   -1.775  1.00 0.00 ? 69  ASP A HB2  5  
ATOM   5625  H  HB3  . ASP A 1 69 ? 15.670  6.687   -2.181  1.00 0.00 ? 69  ASP A HB3  5  
ATOM   5626  N  N    . LYS A 1 70 ? 16.097  3.938   -3.685  1.00 0.00 ? 70  LYS A N    5  
ATOM   5627  C  CA   . LYS A 1 70 ? 17.316  3.163   -3.883  1.00 0.00 ? 70  LYS A CA   5  
ATOM   5628  C  C    . LYS A 1 70 ? 17.599  2.964   -5.369  1.00 0.00 ? 70  LYS A C    5  
ATOM   5629  O  O    . LYS A 1 70 ? 18.731  3.127   -5.822  1.00 0.00 ? 70  LYS A O    5  
ATOM   5630  C  CB   . LYS A 1 70 ? 17.199  1.804   -3.189  1.00 0.00 ? 70  LYS A CB   5  
ATOM   5631  C  CG   . LYS A 1 70 ? 16.969  1.904   -1.691  1.00 0.00 ? 70  LYS A CG   5  
ATOM   5632  C  CD   . LYS A 1 70 ? 16.895  0.530   -1.045  1.00 0.00 ? 70  LYS A CD   5  
ATOM   5633  C  CE   . LYS A 1 70 ? 16.305  0.604   0.355   1.00 0.00 ? 70  LYS A CE   5  
ATOM   5634  N  NZ   . LYS A 1 70 ? 16.726  -0.551  1.195   1.00 0.00 ? 70  LYS A NZ   5  
ATOM   5635  H  H    . LYS A 1 70 ? 15.350  3.536   -3.193  1.00 0.00 ? 70  LYS A H    5  
ATOM   5636  H  HA   . LYS A 1 70 ? 18.135  3.713   -3.444  1.00 0.00 ? 70  LYS A HA   5  
ATOM   5637  H  HB2  . LYS A 1 70 ? 16.373  1.261   -3.624  1.00 0.00 ? 70  LYS A HB2  5  
ATOM   5638  H  HB3  . LYS A 1 70 ? 18.111  1.249   -3.355  1.00 0.00 ? 70  LYS A HB3  5  
ATOM   5639  H  HG2  . LYS A 1 70 ? 17.784  2.455   -1.246  1.00 0.00 ? 70  LYS A HG2  5  
ATOM   5640  H  HG3  . LYS A 1 70 ? 16.039  2.426   -1.513  1.00 0.00 ? 70  LYS A HG3  5  
ATOM   5641  H  HD2  . LYS A 1 70 ? 16.272  -0.110  -1.652  1.00 0.00 ? 70  LYS A HD2  5  
ATOM   5642  H  HD3  . LYS A 1 70 ? 17.891  0.116   -0.986  1.00 0.00 ? 70  LYS A HD3  5  
ATOM   5643  H  HE2  . LYS A 1 70 ? 16.636  1.518   0.823   1.00 0.00 ? 70  LYS A HE2  5  
ATOM   5644  H  HE3  . LYS A 1 70 ? 15.228  0.608   0.278   1.00 0.00 ? 70  LYS A HE3  5  
ATOM   5645  H  HZ1  . LYS A 1 70 ? 16.011  -0.741  1.926   1.00 0.00 ? 70  LYS A HZ1  5  
ATOM   5646  H  HZ2  . LYS A 1 70 ? 17.633  -0.343  1.660   1.00 0.00 ? 70  LYS A HZ2  5  
ATOM   5647  H  HZ3  . LYS A 1 70 ? 16.838  -1.400  0.606   1.00 0.00 ? 70  LYS A HZ3  5  
ATOM   5648  N  N    . MET A 1 71 ? 16.562  2.612   -6.122  1.00 0.00 ? 71  MET A N    5  
ATOM   5649  C  CA   . MET A 1 71 ? 16.699  2.394   -7.557  1.00 0.00 ? 71  MET A CA   5  
ATOM   5650  C  C    . MET A 1 71 ? 17.643  3.420   -8.175  1.00 0.00 ? 71  MET A C    5  
ATOM   5651  O  O    . MET A 1 71 ? 18.456  3.090   -9.037  1.00 0.00 ? 71  MET A O    5  
ATOM   5652  C  CB   . MET A 1 71 ? 15.331  2.466   -8.239  1.00 0.00 ? 71  MET A CB   5  
ATOM   5653  C  CG   . MET A 1 71 ? 14.343  1.430   -7.729  1.00 0.00 ? 71  MET A CG   5  
ATOM   5654  S  SD   . MET A 1 71 ? 14.810  -0.254  -8.175  1.00 0.00 ? 71  MET A SD   5  
ATOM   5655  C  CE   . MET A 1 71 ? 13.837  -1.197  -7.004  1.00 0.00 ? 71  MET A CE   5  
ATOM   5656  H  H    . MET A 1 71 ? 15.683  2.497   -5.703  1.00 0.00 ? 71  MET A H    5  
ATOM   5657  H  HA   . MET A 1 71 ? 17.112  1.407   -7.704  1.00 0.00 ? 71  MET A HA   5  
ATOM   5658  H  HB2  . MET A 1 71 ? 14.910  3.446   -8.072  1.00 0.00 ? 71  MET A HB2  5  
ATOM   5659  H  HB3  . MET A 1 71 ? 15.462  2.315   -9.300  1.00 0.00 ? 71  MET A HB3  5  
ATOM   5660  H  HG2  . MET A 1 71 ? 14.290  1.499   -6.653  1.00 0.00 ? 71  MET A HG2  5  
ATOM   5661  H  HG3  . MET A 1 71 ? 13.371  1.643   -8.149  1.00 0.00 ? 71  MET A HG3  5  
ATOM   5662  H  HE1  . MET A 1 71 ? 13.845  -2.239  -7.285  1.00 0.00 ? 71  MET A HE1  5  
ATOM   5663  H  HE2  . MET A 1 71 ? 14.258  -1.087  -6.016  1.00 0.00 ? 71  MET A HE2  5  
ATOM   5664  H  HE3  . MET A 1 71 ? 12.820  -0.832  -7.005  1.00 0.00 ? 71  MET A HE3  5  
ATOM   5665  N  N    . GLY A 1 72 ? 17.528  4.668   -7.729  1.00 0.00 ? 72  GLY A N    5  
ATOM   5666  C  CA   . GLY A 1 72 ? 18.377  5.723   -8.250  1.00 0.00 ? 72  GLY A CA   5  
ATOM   5667  C  C    . GLY A 1 72 ? 19.783  5.242   -8.548  1.00 0.00 ? 72  GLY A C    5  
ATOM   5668  O  O    . GLY A 1 72 ? 20.370  5.609   -9.566  1.00 0.00 ? 72  GLY A O    5  
ATOM   5669  H  H    . GLY A 1 72 ? 16.861  4.873   -7.041  1.00 0.00 ? 72  GLY A H    5  
ATOM   5670  H  HA2  . GLY A 1 72 ? 17.939  6.107   -9.159  1.00 0.00 ? 72  GLY A HA2  5  
ATOM   5671  H  HA3  . GLY A 1 72 ? 18.428  6.520   -7.523  1.00 0.00 ? 72  GLY A HA3  5  
ATOM   5672  N  N    . VAL A 1 73 ? 20.326  4.419   -7.657  1.00 0.00 ? 73  VAL A N    5  
ATOM   5673  C  CA   . VAL A 1 73 ? 21.673  3.887   -7.829  1.00 0.00 ? 73  VAL A CA   5  
ATOM   5674  C  C    . VAL A 1 73 ? 21.924  3.485   -9.278  1.00 0.00 ? 73  VAL A C    5  
ATOM   5675  O  O    . VAL A 1 73 ? 20.988  3.199   -10.025 1.00 0.00 ? 73  VAL A O    5  
ATOM   5676  C  CB   . VAL A 1 73 ? 21.915  2.667   -6.921  1.00 0.00 ? 73  VAL A CB   5  
ATOM   5677  C  CG1  . VAL A 1 73 ? 21.735  3.046   -5.459  1.00 0.00 ? 73  VAL A CG1  5  
ATOM   5678  C  CG2  . VAL A 1 73 ? 20.985  1.525   -7.303  1.00 0.00 ? 73  VAL A CG2  5  
ATOM   5679  H  H    . VAL A 1 73 ? 19.809  4.162   -6.866  1.00 0.00 ? 73  VAL A H    5  
ATOM   5680  H  HA   . VAL A 1 73 ? 22.375  4.660   -7.553  1.00 0.00 ? 73  VAL A HA   5  
ATOM   5681  H  HB   . VAL A 1 73 ? 22.934  2.335   -7.061  1.00 0.00 ? 73  VAL A HB   5  
ATOM   5682  H  HG11 . VAL A 1 73 ? 22.684  3.362   -5.050  1.00 0.00 ? 73  VAL A HG11 5  
ATOM   5683  H  HG12 . VAL A 1 73 ? 21.021  3.852   -5.381  1.00 0.00 ? 73  VAL A HG12 5  
ATOM   5684  H  HG13 . VAL A 1 73 ? 21.374  2.190   -4.907  1.00 0.00 ? 73  VAL A HG13 5  
ATOM   5685  H  HG21 . VAL A 1 73 ? 19.967  1.884   -7.325  1.00 0.00 ? 73  VAL A HG21 5  
ATOM   5686  H  HG22 . VAL A 1 73 ? 21.256  1.151   -8.279  1.00 0.00 ? 73  VAL A HG22 5  
ATOM   5687  H  HG23 . VAL A 1 73 ? 21.072  0.731   -6.577  1.00 0.00 ? 73  VAL A HG23 5  
ATOM   5688  N  N    . SER A 1 74 ? 23.194  3.466   -9.670  1.00 0.00 ? 74  SER A N    5  
ATOM   5689  C  CA   . SER A 1 74 ? 23.569  3.102   -11.031 1.00 0.00 ? 74  SER A CA   5  
ATOM   5690  C  C    . SER A 1 74 ? 22.800  1.870   -11.496 1.00 0.00 ? 74  SER A C    5  
ATOM   5691  O  O    . SER A 1 74 ? 23.158  0.740   -11.167 1.00 0.00 ? 74  SER A O    5  
ATOM   5692  C  CB   . SER A 1 74 ? 25.074  2.840   -11.116 1.00 0.00 ? 74  SER A CB   5  
ATOM   5693  O  OG   . SER A 1 74 ? 25.798  4.053   -11.231 1.00 0.00 ? 74  SER A OG   5  
ATOM   5694  H  H    . SER A 1 74 ? 23.896  3.704   -9.028  1.00 0.00 ? 74  SER A H    5  
ATOM   5695  H  HA   . SER A 1 74 ? 23.320  3.932   -11.676 1.00 0.00 ? 74  SER A HA   5  
ATOM   5696  H  HB2  . SER A 1 74 ? 25.398  2.325   -10.224 1.00 0.00 ? 74  SER A HB2  5  
ATOM   5697  H  HB3  . SER A 1 74 ? 25.282  2.227   -11.981 1.00 0.00 ? 74  SER A HB3  5  
ATOM   5698  H  HG   . SER A 1 74 ? 25.393  4.604   -11.905 1.00 0.00 ? 74  SER A HG   5  
ATOM   5699  N  N    . GLY A 1 75 ? 21.738  2.097   -12.264 1.00 0.00 ? 75  GLY A N    5  
ATOM   5700  C  CA   . GLY A 1 75 ? 20.934  0.996   -12.762 1.00 0.00 ? 75  GLY A CA   5  
ATOM   5701  C  C    . GLY A 1 75 ? 20.503  1.198   -14.201 1.00 0.00 ? 75  GLY A C    5  
ATOM   5702  O  O    . GLY A 1 75 ? 21.005  2.075   -14.904 1.00 0.00 ? 75  GLY A O    5  
ATOM   5703  H  H    . GLY A 1 75 ? 21.500  3.019   -12.494 1.00 0.00 ? 75  GLY A H    5  
ATOM   5704  H  HA2  . GLY A 1 75 ? 21.508  0.085   -12.692 1.00 0.00 ? 75  GLY A HA2  5  
ATOM   5705  H  HA3  . GLY A 1 75 ? 20.052  0.902   -12.145 1.00 0.00 ? 75  GLY A HA3  5  
ATOM   5706  N  N    . PRO A 1 76 ? 19.553  0.369   -14.660 1.00 0.00 ? 76  PRO A N    5  
ATOM   5707  C  CA   . PRO A 1 76 ? 19.036  0.440   -16.030 1.00 0.00 ? 76  PRO A CA   5  
ATOM   5708  C  C    . PRO A 1 76 ? 18.198  1.691   -16.269 1.00 0.00 ? 76  PRO A C    5  
ATOM   5709  O  O    . PRO A 1 76 ? 18.417  2.422   -17.235 1.00 0.00 ? 76  PRO A O    5  
ATOM   5710  C  CB   . PRO A 1 76 ? 18.168  -0.815  -16.146 1.00 0.00 ? 76  PRO A CB   5  
ATOM   5711  C  CG   . PRO A 1 76 ? 17.761  -1.126  -14.747 1.00 0.00 ? 76  PRO A CG   5  
ATOM   5712  C  CD   . PRO A 1 76 ? 18.911  -0.700  -13.877 1.00 0.00 ? 76  PRO A CD   5  
ATOM   5713  H  HA   . PRO A 1 76 ? 19.833  0.397   -16.758 1.00 0.00 ? 76  PRO A HA   5  
ATOM   5714  H  HB2  . PRO A 1 76 ? 17.310  -0.606  -16.771 1.00 0.00 ? 76  PRO A HB2  5  
ATOM   5715  H  HB3  . PRO A 1 76 ? 18.746  -1.619  -16.577 1.00 0.00 ? 76  PRO A HB3  5  
ATOM   5716  H  HG2  . PRO A 1 76 ? 16.872  -0.570  -14.491 1.00 0.00 ? 76  PRO A HG2  5  
ATOM   5717  H  HG3  . PRO A 1 76 ? 17.585  -2.186  -14.643 1.00 0.00 ? 76  PRO A HG3  5  
ATOM   5718  H  HD2  . PRO A 1 76 ? 18.550  -0.322  -12.932 1.00 0.00 ? 76  PRO A HD2  5  
ATOM   5719  H  HD3  . PRO A 1 76 ? 19.592  -1.524  -13.721 1.00 0.00 ? 76  PRO A HD3  5  
ATOM   5720  N  N    . SER A 1 77 ? 17.237  1.933   -15.382 1.00 0.00 ? 77  SER A N    5  
ATOM   5721  C  CA   . SER A 1 77 ? 16.364  3.095   -15.499 1.00 0.00 ? 77  SER A CA   5  
ATOM   5722  C  C    . SER A 1 77 ? 17.171  4.389   -15.447 1.00 0.00 ? 77  SER A C    5  
ATOM   5723  O  O    . SER A 1 77 ? 18.205  4.462   -14.783 1.00 0.00 ? 77  SER A O    5  
ATOM   5724  C  CB   . SER A 1 77 ? 15.318  3.088   -14.383 1.00 0.00 ? 77  SER A CB   5  
ATOM   5725  O  OG   . SER A 1 77 ? 14.440  1.983   -14.514 1.00 0.00 ? 77  SER A OG   5  
ATOM   5726  H  H    . SER A 1 77 ? 17.112  1.313   -14.633 1.00 0.00 ? 77  SER A H    5  
ATOM   5727  H  HA   . SER A 1 77 ? 15.861  3.037   -16.453 1.00 0.00 ? 77  SER A HA   5  
ATOM   5728  H  HB2  . SER A 1 77 ? 15.816  3.025   -13.427 1.00 0.00 ? 77  SER A HB2  5  
ATOM   5729  H  HB3  . SER A 1 77 ? 14.740  4.000   -14.429 1.00 0.00 ? 77  SER A HB3  5  
ATOM   5730  H  HG   . SER A 1 77 ? 13.547  2.301   -14.670 1.00 0.00 ? 77  SER A HG   5  
ATOM   5731  N  N    . SER A 1 78 ? 16.690  5.408   -16.152 1.00 0.00 ? 78  SER A N    5  
ATOM   5732  C  CA   . SER A 1 78 ? 17.368  6.698   -16.190 1.00 0.00 ? 78  SER A CA   5  
ATOM   5733  C  C    . SER A 1 78 ? 16.520  7.777   -15.523 1.00 0.00 ? 78  SER A C    5  
ATOM   5734  O  O    . SER A 1 78 ? 15.487  8.186   -16.052 1.00 0.00 ? 78  SER A O    5  
ATOM   5735  C  CB   . SER A 1 78 ? 17.674  7.095   -17.636 1.00 0.00 ? 78  SER A CB   5  
ATOM   5736  O  OG   . SER A 1 78 ? 18.758  8.005   -17.696 1.00 0.00 ? 78  SER A OG   5  
ATOM   5737  H  H    . SER A 1 78 ? 15.861  5.287   -16.661 1.00 0.00 ? 78  SER A H    5  
ATOM   5738  H  HA   . SER A 1 78 ? 18.297  6.601   -15.649 1.00 0.00 ? 78  SER A HA   5  
ATOM   5739  H  HB2  . SER A 1 78 ? 17.928  6.213   -18.203 1.00 0.00 ? 78  SER A HB2  5  
ATOM   5740  H  HB3  . SER A 1 78 ? 16.802  7.563   -18.070 1.00 0.00 ? 78  SER A HB3  5  
ATOM   5741  H  HG   . SER A 1 78 ? 19.366  7.734   -18.389 1.00 0.00 ? 78  SER A HG   5  
ATOM   5742  N  N    . GLY A 1 79 ? 16.966  8.234   -14.357 1.00 0.00 ? 79  GLY A N    5  
ATOM   5743  C  CA   . GLY A 1 79 ? 16.237  9.261   -13.635 1.00 0.00 ? 79  GLY A CA   5  
ATOM   5744  C  C    . GLY A 1 79 ? 16.145  10.560  -14.411 1.00 0.00 ? 79  GLY A C    5  
ATOM   5745  O  O    . GLY A 1 79 ? 17.041  11.393  -14.291 1.00 0.00 ? 79  GLY A O    5  
ATOM   5746  H  H    . GLY A 1 79 ? 17.796  7.871   -13.983 1.00 0.00 ? 79  GLY A H    5  
ATOM   5747  H  HA2  . GLY A 1 79 ? 15.238  8.903   -13.432 1.00 0.00 ? 79  GLY A HA2  5  
ATOM   5748  H  HA3  . GLY A 1 79 ? 16.738  9.450   -12.697 1.00 0.00 ? 79  GLY A HA3  5  
HETATM 5749  ZN ZN   . ZN  B 2 .  ? -9.880  -0.364  -2.325  1.00 0.00 ? 201 ZN  A ZN   5  
HETATM 5750  ZN ZN   . ZN  C 2 .  ? 9.879   -1.166  -0.581  1.00 0.00 ? 401 ZN  A ZN   5  
ATOM   5751  N  N    . GLY A 1 1  ? -37.098 10.562  -32.610 1.00 0.00 ? 1   GLY A N    6  
ATOM   5752  C  CA   . GLY A 1 1  ? -37.883 10.268  -31.426 1.00 0.00 ? 1   GLY A CA   6  
ATOM   5753  C  C    . GLY A 1 1  ? -37.953 11.443  -30.470 1.00 0.00 ? 1   GLY A C    6  
ATOM   5754  O  O    . GLY A 1 1  ? -37.942 12.598  -30.895 1.00 0.00 ? 1   GLY A O    6  
ATOM   5755  H  H1   . GLY A 1 1  ? -36.138 10.742  -32.527 1.00 0.00 ? 1   GLY A H1   6  
ATOM   5756  H  HA2  . GLY A 1 1  ? -38.885 10.003  -31.728 1.00 0.00 ? 1   GLY A HA2  6  
ATOM   5757  H  HA3  . GLY A 1 1  ? -37.439 9.428   -30.913 1.00 0.00 ? 1   GLY A HA3  6  
ATOM   5758  N  N    . SER A 1 2  ? -38.028 11.147  -29.177 1.00 0.00 ? 2   SER A N    6  
ATOM   5759  C  CA   . SER A 1 2  ? -38.106 12.188  -28.158 1.00 0.00 ? 2   SER A CA   6  
ATOM   5760  C  C    . SER A 1 2  ? -37.494 11.711  -26.845 1.00 0.00 ? 2   SER A C    6  
ATOM   5761  O  O    . SER A 1 2  ? -37.684 10.564  -26.439 1.00 0.00 ? 2   SER A O    6  
ATOM   5762  C  CB   . SER A 1 2  ? -39.561 12.604  -27.934 1.00 0.00 ? 2   SER A CB   6  
ATOM   5763  O  OG   . SER A 1 2  ? -40.061 13.331  -29.044 1.00 0.00 ? 2   SER A OG   6  
ATOM   5764  H  H    . SER A 1 2  ? -38.033 10.207  -28.901 1.00 0.00 ? 2   SER A H    6  
ATOM   5765  H  HA   . SER A 1 2  ? -37.547 13.042  -28.513 1.00 0.00 ? 2   SER A HA   6  
ATOM   5766  H  HB2  . SER A 1 2  ? -40.167 11.722  -27.795 1.00 0.00 ? 2   SER A HB2  6  
ATOM   5767  H  HB3  . SER A 1 2  ? -39.623 13.226  -27.053 1.00 0.00 ? 2   SER A HB3  6  
ATOM   5768  H  HG   . SER A 1 2  ? -39.948 12.812  -29.843 1.00 0.00 ? 2   SER A HG   6  
ATOM   5769  N  N    . SER A 1 3  ? -36.757 12.599  -26.185 1.00 0.00 ? 3   SER A N    6  
ATOM   5770  C  CA   . SER A 1 3  ? -36.113 12.269  -24.919 1.00 0.00 ? 3   SER A CA   6  
ATOM   5771  C  C    . SER A 1 3  ? -35.788 13.533  -24.129 1.00 0.00 ? 3   SER A C    6  
ATOM   5772  O  O    . SER A 1 3  ? -35.516 14.585  -24.705 1.00 0.00 ? 3   SER A O    6  
ATOM   5773  C  CB   . SER A 1 3  ? -34.835 11.466  -25.168 1.00 0.00 ? 3   SER A CB   6  
ATOM   5774  O  OG   . SER A 1 3  ? -34.570 10.583  -24.092 1.00 0.00 ? 3   SER A OG   6  
ATOM   5775  H  H    . SER A 1 3  ? -36.643 13.498  -26.560 1.00 0.00 ? 3   SER A H    6  
ATOM   5776  H  HA   . SER A 1 3  ? -36.801 11.666  -24.345 1.00 0.00 ? 3   SER A HA   6  
ATOM   5777  H  HB2  . SER A 1 3  ? -34.946 10.888  -26.073 1.00 0.00 ? 3   SER A HB2  6  
ATOM   5778  H  HB3  . SER A 1 3  ? -34.001 12.145  -25.274 1.00 0.00 ? 3   SER A HB3  6  
ATOM   5779  H  HG   . SER A 1 3  ? -34.087 11.049  -23.406 1.00 0.00 ? 3   SER A HG   6  
ATOM   5780  N  N    . GLY A 1 4  ? -35.819 13.419  -22.805 1.00 0.00 ? 4   GLY A N    6  
ATOM   5781  C  CA   . GLY A 1 4  ? -35.526 14.559  -21.955 1.00 0.00 ? 4   GLY A CA   6  
ATOM   5782  C  C    . GLY A 1 4  ? -35.803 14.278  -20.492 1.00 0.00 ? 4   GLY A C    6  
ATOM   5783  O  O    . GLY A 1 4  ? -36.958 14.242  -20.068 1.00 0.00 ? 4   GLY A O    6  
ATOM   5784  H  H    . GLY A 1 4  ? -36.042 12.555  -22.401 1.00 0.00 ? 4   GLY A H    6  
ATOM   5785  H  HA2  . GLY A 1 4  ? -34.485 14.822  -22.070 1.00 0.00 ? 4   GLY A HA2  6  
ATOM   5786  H  HA3  . GLY A 1 4  ? -36.134 15.394  -22.271 1.00 0.00 ? 4   GLY A HA3  6  
ATOM   5787  N  N    . SER A 1 5  ? -34.741 14.078  -19.718 1.00 0.00 ? 5   SER A N    6  
ATOM   5788  C  CA   . SER A 1 5  ? -34.875 13.793  -18.294 1.00 0.00 ? 5   SER A CA   6  
ATOM   5789  C  C    . SER A 1 5  ? -33.544 13.985  -17.574 1.00 0.00 ? 5   SER A C    6  
ATOM   5790  O  O    . SER A 1 5  ? -32.488 13.619  -18.090 1.00 0.00 ? 5   SER A O    6  
ATOM   5791  C  CB   . SER A 1 5  ? -35.381 12.364  -18.084 1.00 0.00 ? 5   SER A CB   6  
ATOM   5792  O  OG   . SER A 1 5  ? -36.796 12.309  -18.149 1.00 0.00 ? 5   SER A OG   6  
ATOM   5793  H  H    . SER A 1 5  ? -33.846 14.120  -20.115 1.00 0.00 ? 5   SER A H    6  
ATOM   5794  H  HA   . SER A 1 5  ? -35.596 14.485  -17.885 1.00 0.00 ? 5   SER A HA   6  
ATOM   5795  H  HB2  . SER A 1 5  ? -34.972 11.724  -18.851 1.00 0.00 ? 5   SER A HB2  6  
ATOM   5796  H  HB3  . SER A 1 5  ? -35.063 12.012  -17.113 1.00 0.00 ? 5   SER A HB3  6  
ATOM   5797  H  HG   . SER A 1 5  ? -37.065 12.035  -19.029 1.00 0.00 ? 5   SER A HG   6  
ATOM   5798  N  N    . SER A 1 6  ? -33.604 14.560  -16.377 1.00 0.00 ? 6   SER A N    6  
ATOM   5799  C  CA   . SER A 1 6  ? -32.404 14.805  -15.586 1.00 0.00 ? 6   SER A CA   6  
ATOM   5800  C  C    . SER A 1 6  ? -32.667 14.547  -14.106 1.00 0.00 ? 6   SER A C    6  
ATOM   5801  O  O    . SER A 1 6  ? -33.815 14.427  -13.679 1.00 0.00 ? 6   SER A O    6  
ATOM   5802  C  CB   . SER A 1 6  ? -31.919 16.242  -15.787 1.00 0.00 ? 6   SER A CB   6  
ATOM   5803  O  OG   . SER A 1 6  ? -31.418 16.433  -17.099 1.00 0.00 ? 6   SER A OG   6  
ATOM   5804  H  H    . SER A 1 6  ? -34.476 14.829  -16.020 1.00 0.00 ? 6   SER A H    6  
ATOM   5805  H  HA   . SER A 1 6  ? -31.637 14.125  -15.927 1.00 0.00 ? 6   SER A HA   6  
ATOM   5806  H  HB2  . SER A 1 6  ? -32.741 16.922  -15.626 1.00 0.00 ? 6   SER A HB2  6  
ATOM   5807  H  HB3  . SER A 1 6  ? -31.131 16.455  -15.079 1.00 0.00 ? 6   SER A HB3  6  
ATOM   5808  H  HG   . SER A 1 6  ? -31.507 15.618  -17.597 1.00 0.00 ? 6   SER A HG   6  
ATOM   5809  N  N    . GLY A 1 7  ? -31.593 14.463  -13.326 1.00 0.00 ? 7   GLY A N    6  
ATOM   5810  C  CA   . GLY A 1 7  ? -31.728 14.219  -11.902 1.00 0.00 ? 7   GLY A CA   6  
ATOM   5811  C  C    . GLY A 1 7  ? -30.390 14.187  -11.190 1.00 0.00 ? 7   GLY A C    6  
ATOM   5812  O  O    . GLY A 1 7  ? -29.638 13.221  -11.312 1.00 0.00 ? 7   GLY A O    6  
ATOM   5813  H  H    . GLY A 1 7  ? -30.702 14.566  -13.721 1.00 0.00 ? 7   GLY A H    6  
ATOM   5814  H  HA2  . GLY A 1 7  ? -32.335 15.001  -11.470 1.00 0.00 ? 7   GLY A HA2  6  
ATOM   5815  H  HA3  . GLY A 1 7  ? -32.223 13.270  -11.756 1.00 0.00 ? 7   GLY A HA3  6  
ATOM   5816  N  N    . GLU A 1 8  ? -30.093 15.247  -10.444 1.00 0.00 ? 8   GLU A N    6  
ATOM   5817  C  CA   . GLU A 1 8  ? -28.835 15.336  -9.712  1.00 0.00 ? 8   GLU A CA   6  
ATOM   5818  C  C    . GLU A 1 8  ? -29.059 15.128  -8.217  1.00 0.00 ? 8   GLU A C    6  
ATOM   5819  O  O    . GLU A 1 8  ? -29.134 16.088  -7.450  1.00 0.00 ? 8   GLU A O    6  
ATOM   5820  C  CB   . GLU A 1 8  ? -28.172 16.694  -9.956  1.00 0.00 ? 8   GLU A CB   6  
ATOM   5821  C  CG   . GLU A 1 8  ? -27.518 16.816  -11.322 1.00 0.00 ? 8   GLU A CG   6  
ATOM   5822  C  CD   . GLU A 1 8  ? -28.514 16.691  -12.459 1.00 0.00 ? 8   GLU A CD   6  
ATOM   5823  O  OE1  . GLU A 1 8  ? -29.479 17.482  -12.492 1.00 0.00 ? 8   GLU A OE1  6  
ATOM   5824  O  OE2  . GLU A 1 8  ? -28.326 15.803  -13.316 1.00 0.00 ? 8   GLU A OE2  6  
ATOM   5825  H  H    . GLU A 1 8  ? -30.733 15.986  -10.386 1.00 0.00 ? 8   GLU A H    6  
ATOM   5826  H  HA   . GLU A 1 8  ? -28.182 14.558  -10.078 1.00 0.00 ? 8   GLU A HA   6  
ATOM   5827  H  HB2  . GLU A 1 8  ? -28.921 17.467  -9.868  1.00 0.00 ? 8   GLU A HB2  6  
ATOM   5828  H  HB3  . GLU A 1 8  ? -27.415 16.851  -9.202  1.00 0.00 ? 8   GLU A HB3  6  
ATOM   5829  H  HG2  . GLU A 1 8  ? -27.035 17.779  -11.391 1.00 0.00 ? 8   GLU A HG2  6  
ATOM   5830  H  HG3  . GLU A 1 8  ? -26.778 16.035  -11.424 1.00 0.00 ? 8   GLU A HG3  6  
ATOM   5831  N  N    . LYS A 1 9  ? -29.166 13.868  -7.811  1.00 0.00 ? 9   LYS A N    6  
ATOM   5832  C  CA   . LYS A 1 9  ? -29.381 13.532  -6.409  1.00 0.00 ? 9   LYS A CA   6  
ATOM   5833  C  C    . LYS A 1 9  ? -28.185 12.775  -5.841  1.00 0.00 ? 9   LYS A C    6  
ATOM   5834  O  O    . LYS A 1 9  ? -27.576 11.954  -6.526  1.00 0.00 ? 9   LYS A O    6  
ATOM   5835  C  CB   . LYS A 1 9  ? -30.650 12.691  -6.254  1.00 0.00 ? 9   LYS A CB   6  
ATOM   5836  C  CG   . LYS A 1 9  ? -30.590 11.359  -6.982  1.00 0.00 ? 9   LYS A CG   6  
ATOM   5837  C  CD   . LYS A 1 9  ? -31.537 10.343  -6.365  1.00 0.00 ? 9   LYS A CD   6  
ATOM   5838  C  CE   . LYS A 1 9  ? -31.439 8.995   -7.062  1.00 0.00 ? 9   LYS A CE   6  
ATOM   5839  N  NZ   . LYS A 1 9  ? -32.298 7.969   -6.409  1.00 0.00 ? 9   LYS A NZ   6  
ATOM   5840  H  H    . LYS A 1 9  ? -29.098 13.146  -8.471  1.00 0.00 ? 9   LYS A H    6  
ATOM   5841  H  HA   . LYS A 1 9  ? -29.502 14.454  -5.861  1.00 0.00 ? 9   LYS A HA   6  
ATOM   5842  H  HB2  . LYS A 1 9  ? -30.813 12.496  -5.204  1.00 0.00 ? 9   LYS A HB2  6  
ATOM   5843  H  HB3  . LYS A 1 9  ? -31.489 13.251  -6.641  1.00 0.00 ? 9   LYS A HB3  6  
ATOM   5844  H  HG2  . LYS A 1 9  ? -30.866 11.511  -8.015  1.00 0.00 ? 9   LYS A HG2  6  
ATOM   5845  H  HG3  . LYS A 1 9  ? -29.581 10.975  -6.929  1.00 0.00 ? 9   LYS A HG3  6  
ATOM   5846  H  HD2  . LYS A 1 9  ? -31.286 10.216  -5.323  1.00 0.00 ? 9   LYS A HD2  6  
ATOM   5847  H  HD3  . LYS A 1 9  ? -32.550 10.710  -6.451  1.00 0.00 ? 9   LYS A HD3  6  
ATOM   5848  H  HE2  . LYS A 1 9  ? -31.750 9.112   -8.089  1.00 0.00 ? 9   LYS A HE2  6  
ATOM   5849  H  HE3  . LYS A 1 9  ? -30.412 8.663   -7.033  1.00 0.00 ? 9   LYS A HE3  6  
ATOM   5850  H  HZ1  . LYS A 1 9  ? -33.148 7.797   -6.983  1.00 0.00 ? 9   LYS A HZ1  6  
ATOM   5851  H  HZ2  . LYS A 1 9  ? -32.591 8.296   -5.466  1.00 0.00 ? 9   LYS A HZ2  6  
ATOM   5852  H  HZ3  . LYS A 1 9  ? -31.775 7.076   -6.307  1.00 0.00 ? 9   LYS A HZ3  6  
ATOM   5853  N  N    . ALA A 1 10 ? -27.854 13.056  -4.585  1.00 0.00 ? 10  ALA A N    6  
ATOM   5854  C  CA   . ALA A 1 10 ? -26.733 12.399  -3.924  1.00 0.00 ? 10  ALA A CA   6  
ATOM   5855  C  C    . ALA A 1 10 ? -25.419 12.713  -4.632  1.00 0.00 ? 10  ALA A C    6  
ATOM   5856  O  O    . ALA A 1 10 ? -24.587 11.829  -4.836  1.00 0.00 ? 10  ALA A O    6  
ATOM   5857  C  CB   . ALA A 1 10 ? -26.960 10.896  -3.870  1.00 0.00 ? 10  ALA A CB   6  
ATOM   5858  H  H    . ALA A 1 10 ? -28.378 13.720  -4.090  1.00 0.00 ? 10  ALA A H    6  
ATOM   5859  H  HA   . ALA A 1 10 ? -26.681 12.767  -2.910  1.00 0.00 ? 10  ALA A HA   6  
ATOM   5860  H  HB1  . ALA A 1 10 ? -27.768 10.679  -3.186  1.00 0.00 ? 10  ALA A HB1  6  
ATOM   5861  H  HB2  . ALA A 1 10 ? -27.215 10.534  -4.855  1.00 0.00 ? 10  ALA A HB2  6  
ATOM   5862  H  HB3  . ALA A 1 10 ? -26.059 10.408  -3.530  1.00 0.00 ? 10  ALA A HB3  6  
ATOM   5863  N  N    . ARG A 1 11 ? -25.239 13.976  -5.004  1.00 0.00 ? 11  ARG A N    6  
ATOM   5864  C  CA   . ARG A 1 11 ? -24.027 14.405  -5.690  1.00 0.00 ? 11  ARG A CA   6  
ATOM   5865  C  C    . ARG A 1 11 ? -23.325 15.514  -4.911  1.00 0.00 ? 11  ARG A C    6  
ATOM   5866  O  O    . ARG A 1 11 ? -23.833 15.992  -3.898  1.00 0.00 ? 11  ARG A O    6  
ATOM   5867  C  CB   . ARG A 1 11 ? -24.360 14.891  -7.102  1.00 0.00 ? 11  ARG A CB   6  
ATOM   5868  C  CG   . ARG A 1 11 ? -24.864 13.791  -8.022  1.00 0.00 ? 11  ARG A CG   6  
ATOM   5869  C  CD   . ARG A 1 11 ? -25.628 14.361  -9.206  1.00 0.00 ? 11  ARG A CD   6  
ATOM   5870  N  NE   . ARG A 1 11 ? -26.016 13.324  -10.158 1.00 0.00 ? 11  ARG A NE   6  
ATOM   5871  C  CZ   . ARG A 1 11 ? -25.162 12.721  -10.977 1.00 0.00 ? 11  ARG A CZ   6  
ATOM   5872  N  NH1  . ARG A 1 11 ? -23.878 13.050  -10.959 1.00 0.00 ? 11  ARG A NH1  6  
ATOM   5873  N  NH2  . ARG A 1 11 ? -25.591 11.786  -11.815 1.00 0.00 ? 11  ARG A NH2  6  
ATOM   5874  H  H    . ARG A 1 11 ? -25.939 14.635  -4.813  1.00 0.00 ? 11  ARG A H    6  
ATOM   5875  H  HA   . ARG A 1 11 ? -23.365 13.555  -5.758  1.00 0.00 ? 11  ARG A HA   6  
ATOM   5876  H  HB2  . ARG A 1 11 ? -25.122 15.653  -7.038  1.00 0.00 ? 11  ARG A HB2  6  
ATOM   5877  H  HB3  . ARG A 1 11 ? -23.471 15.318  -7.541  1.00 0.00 ? 11  ARG A HB3  6  
ATOM   5878  H  HG2  . ARG A 1 11 ? -24.019 13.227  -8.390  1.00 0.00 ? 11  ARG A HG2  6  
ATOM   5879  H  HG3  . ARG A 1 11 ? -25.517 13.138  -7.462  1.00 0.00 ? 11  ARG A HG3  6  
ATOM   5880  H  HD2  . ARG A 1 11 ? -26.518 14.852  -8.840  1.00 0.00 ? 11  ARG A HD2  6  
ATOM   5881  H  HD3  . ARG A 1 11 ? -25.001 15.082  -9.708  1.00 0.00 ? 11  ARG A HD3  6  
ATOM   5882  H  HE   . ARG A 1 11 ? -26.961 13.066  -10.187 1.00 0.00 ? 11  ARG A HE   6  
ATOM   5883  H  HH11 . ARG A 1 11 ? -23.551 13.753  -10.328 1.00 0.00 ? 11  ARG A HH11 6  
ATOM   5884  H  HH12 . ARG A 1 11 ? -23.236 12.593  -11.576 1.00 0.00 ? 11  ARG A HH12 6  
ATOM   5885  H  HH21 . ARG A 1 11 ? -26.559 11.535  -11.830 1.00 0.00 ? 11  ARG A HH21 6  
ATOM   5886  H  HH22 . ARG A 1 11 ? -24.948 11.333  -12.430 1.00 0.00 ? 11  ARG A HH22 6  
ATOM   5887  N  N    . GLY A 1 12 ? -22.153 15.918  -5.393  1.00 0.00 ? 12  GLY A N    6  
ATOM   5888  C  CA   . GLY A 1 12 ? -21.400 16.966  -4.729  1.00 0.00 ? 12  GLY A CA   6  
ATOM   5889  C  C    . GLY A 1 12 ? -19.902 16.779  -4.865  1.00 0.00 ? 12  GLY A C    6  
ATOM   5890  O  O    . GLY A 1 12 ? -19.413 16.372  -5.920  1.00 0.00 ? 12  GLY A O    6  
ATOM   5891  H  H    . GLY A 1 12 ? -21.797 15.500  -6.205  1.00 0.00 ? 12  GLY A H    6  
ATOM   5892  H  HA2  . GLY A 1 12 ? -21.674 17.918  -5.159  1.00 0.00 ? 12  GLY A HA2  6  
ATOM   5893  H  HA3  . GLY A 1 12 ? -21.657 16.969  -3.680  1.00 0.00 ? 12  GLY A HA3  6  
ATOM   5894  N  N    . LEU A 1 13 ? -19.171 17.077  -3.797  1.00 0.00 ? 13  LEU A N    6  
ATOM   5895  C  CA   . LEU A 1 13 ? -17.719 16.941  -3.801  1.00 0.00 ? 13  LEU A CA   6  
ATOM   5896  C  C    . LEU A 1 13 ? -17.309 15.481  -3.974  1.00 0.00 ? 13  LEU A C    6  
ATOM   5897  O  O    . LEU A 1 13 ? -16.571 15.138  -4.896  1.00 0.00 ? 13  LEU A O    6  
ATOM   5898  C  CB   . LEU A 1 13 ? -17.131 17.497  -2.503  1.00 0.00 ? 13  LEU A CB   6  
ATOM   5899  C  CG   . LEU A 1 13 ? -16.916 19.010  -2.458  1.00 0.00 ? 13  LEU A CG   6  
ATOM   5900  C  CD1  . LEU A 1 13 ? -16.436 19.441  -1.081  1.00 0.00 ? 13  LEU A CD1  6  
ATOM   5901  C  CD2  . LEU A 1 13 ? -15.923 19.440  -3.529  1.00 0.00 ? 13  LEU A CD2  6  
ATOM   5902  H  H    . LEU A 1 13 ? -19.617 17.396  -2.985  1.00 0.00 ? 13  LEU A H    6  
ATOM   5903  H  HA   . LEU A 1 13 ? -17.335 17.511  -4.634  1.00 0.00 ? 13  LEU A HA   6  
ATOM   5904  H  HB2  . LEU A 1 13 ? -17.799 17.234  -1.698  1.00 0.00 ? 13  LEU A HB2  6  
ATOM   5905  H  HB3  . LEU A 1 13 ? -16.173 17.021  -2.344  1.00 0.00 ? 13  LEU A HB3  6  
ATOM   5906  H  HG   . LEU A 1 13 ? -17.856 19.507  -2.654  1.00 0.00 ? 13  LEU A HG   6  
ATOM   5907  H  HD11 . LEU A 1 13 ? -16.038 20.443  -1.135  1.00 0.00 ? 13  LEU A HD11 6  
ATOM   5908  H  HD12 . LEU A 1 13 ? -15.665 18.765  -0.741  1.00 0.00 ? 13  LEU A HD12 6  
ATOM   5909  H  HD13 . LEU A 1 13 ? -17.265 19.419  -0.388  1.00 0.00 ? 13  LEU A HD13 6  
ATOM   5910  H  HD21 . LEU A 1 13 ? -15.349 18.584  -3.851  1.00 0.00 ? 13  LEU A HD21 6  
ATOM   5911  H  HD22 . LEU A 1 13 ? -15.258 20.188  -3.123  1.00 0.00 ? 13  LEU A HD22 6  
ATOM   5912  H  HD23 . LEU A 1 13 ? -16.458 19.852  -4.371  1.00 0.00 ? 13  LEU A HD23 6  
ATOM   5913  N  N    . GLY A 1 14 ? -17.796 14.626  -3.080  1.00 0.00 ? 14  GLY A N    6  
ATOM   5914  C  CA   . GLY A 1 14 ? -17.471 13.213  -3.152  1.00 0.00 ? 14  GLY A CA   6  
ATOM   5915  C  C    . GLY A 1 14 ? -15.981 12.954  -3.045  1.00 0.00 ? 14  GLY A C    6  
ATOM   5916  O  O    . GLY A 1 14 ? -15.198 13.876  -2.815  1.00 0.00 ? 14  GLY A O    6  
ATOM   5917  H  H    . GLY A 1 14 ? -18.380 14.956  -2.365  1.00 0.00 ? 14  GLY A H    6  
ATOM   5918  H  HA2  . GLY A 1 14 ? -17.974 12.698  -2.347  1.00 0.00 ? 14  GLY A HA2  6  
ATOM   5919  H  HA3  . GLY A 1 14 ? -17.826 12.822  -4.094  1.00 0.00 ? 14  GLY A HA3  6  
ATOM   5920  N  N    . LYS A 1 15 ? -15.588 11.696  -3.212  1.00 0.00 ? 15  LYS A N    6  
ATOM   5921  C  CA   . LYS A 1 15 ? -14.182 11.317  -3.134  1.00 0.00 ? 15  LYS A CA   6  
ATOM   5922  C  C    . LYS A 1 15 ? -13.818 10.343  -4.250  1.00 0.00 ? 15  LYS A C    6  
ATOM   5923  O  O    . LYS A 1 15 ? -14.641 10.036  -5.112  1.00 0.00 ? 15  LYS A O    6  
ATOM   5924  C  CB   . LYS A 1 15 ? -13.878 10.686  -1.773  1.00 0.00 ? 15  LYS A CB   6  
ATOM   5925  C  CG   . LYS A 1 15 ? -14.214 11.587  -0.596  1.00 0.00 ? 15  LYS A CG   6  
ATOM   5926  C  CD   . LYS A 1 15 ? -13.093 12.573  -0.312  1.00 0.00 ? 15  LYS A CD   6  
ATOM   5927  C  CE   . LYS A 1 15 ? -12.051 11.978  0.622   1.00 0.00 ? 15  LYS A CE   6  
ATOM   5928  N  NZ   . LYS A 1 15 ? -11.301 13.031  1.361   1.00 0.00 ? 15  LYS A NZ   6  
ATOM   5929  H  H    . LYS A 1 15 ? -16.259 11.005  -3.394  1.00 0.00 ? 15  LYS A H    6  
ATOM   5930  H  HA   . LYS A 1 15 ? -13.590 12.213  -3.246  1.00 0.00 ? 15  LYS A HA   6  
ATOM   5931  H  HB2  . LYS A 1 15 ? -14.449 9.775   -1.676  1.00 0.00 ? 15  LYS A HB2  6  
ATOM   5932  H  HB3  . LYS A 1 15 ? -12.825 10.448  -1.727  1.00 0.00 ? 15  LYS A HB3  6  
ATOM   5933  H  HG2  . LYS A 1 15 ? -15.115 12.138  -0.822  1.00 0.00 ? 15  LYS A HG2  6  
ATOM   5934  H  HG3  . LYS A 1 15 ? -14.373 10.975  0.280   1.00 0.00 ? 15  LYS A HG3  6  
ATOM   5935  H  HD2  . LYS A 1 15 ? -12.616 12.841  -1.242  1.00 0.00 ? 15  LYS A HD2  6  
ATOM   5936  H  HD3  . LYS A 1 15 ? -13.512 13.458  0.148   1.00 0.00 ? 15  LYS A HD3  6  
ATOM   5937  H  HE2  . LYS A 1 15 ? -12.547 11.336  1.333   1.00 0.00 ? 15  LYS A HE2  6  
ATOM   5938  H  HE3  . LYS A 1 15 ? -11.354 11.396  0.037   1.00 0.00 ? 15  LYS A HE3  6  
ATOM   5939  H  HZ1  . LYS A 1 15 ? -11.532 12.989  2.374   1.00 0.00 ? 15  LYS A HZ1  6  
ATOM   5940  H  HZ2  . LYS A 1 15 ? -11.556 13.972  0.998   1.00 0.00 ? 15  LYS A HZ2  6  
ATOM   5941  H  HZ3  . LYS A 1 15 ? -10.278 12.892  1.243   1.00 0.00 ? 15  LYS A HZ3  6  
ATOM   5942  N  N    . TYR A 1 16 ? -12.580 9.860   -4.227  1.00 0.00 ? 16  TYR A N    6  
ATOM   5943  C  CA   . TYR A 1 16 ? -12.107 8.922   -5.237  1.00 0.00 ? 16  TYR A CA   6  
ATOM   5944  C  C    . TYR A 1 16 ? -12.587 7.506   -4.933  1.00 0.00 ? 16  TYR A C    6  
ATOM   5945  O  O    . TYR A 1 16 ? -12.333 6.972   -3.852  1.00 0.00 ? 16  TYR A O    6  
ATOM   5946  C  CB   . TYR A 1 16 ? -10.580 8.950   -5.314  1.00 0.00 ? 16  TYR A CB   6  
ATOM   5947  C  CG   . TYR A 1 16 ? -10.028 10.212  -5.937  1.00 0.00 ? 16  TYR A CG   6  
ATOM   5948  C  CD1  . TYR A 1 16 ? -10.238 11.451  -5.345  1.00 0.00 ? 16  TYR A CD1  6  
ATOM   5949  C  CD2  . TYR A 1 16 ? -9.298  10.165  -7.118  1.00 0.00 ? 16  TYR A CD2  6  
ATOM   5950  C  CE1  . TYR A 1 16 ? -9.736  12.607  -5.911  1.00 0.00 ? 16  TYR A CE1  6  
ATOM   5951  C  CE2  . TYR A 1 16 ? -8.791  11.316  -7.691  1.00 0.00 ? 16  TYR A CE2  6  
ATOM   5952  C  CZ   . TYR A 1 16 ? -9.013  12.534  -7.084  1.00 0.00 ? 16  TYR A CZ   6  
ATOM   5953  O  OH   . TYR A 1 16 ? -8.511  13.683  -7.651  1.00 0.00 ? 16  TYR A OH   6  
ATOM   5954  H  H    . TYR A 1 16 ? -11.970 10.143  -3.514  1.00 0.00 ? 16  TYR A H    6  
ATOM   5955  H  HA   . TYR A 1 16 ? -12.512 9.229   -6.191  1.00 0.00 ? 16  TYR A HA   6  
ATOM   5956  H  HB2  . TYR A 1 16 ? -10.175 8.868   -4.317  1.00 0.00 ? 16  TYR A HB2  6  
ATOM   5957  H  HB3  . TYR A 1 16 ? -10.241 8.112   -5.905  1.00 0.00 ? 16  TYR A HB3  6  
ATOM   5958  H  HD1  . TYR A 1 16 ? -10.805 11.505  -4.427  1.00 0.00 ? 16  TYR A HD1  6  
ATOM   5959  H  HD2  . TYR A 1 16 ? -9.126  9.209   -7.591  1.00 0.00 ? 16  TYR A HD2  6  
ATOM   5960  H  HE1  . TYR A 1 16 ? -9.909  13.562  -5.436  1.00 0.00 ? 16  TYR A HE1  6  
ATOM   5961  H  HE2  . TYR A 1 16 ? -8.225  11.259  -8.609  1.00 0.00 ? 16  TYR A HE2  6  
ATOM   5962  H  HH   . TYR A 1 16 ? -9.186  14.090  -8.200  1.00 0.00 ? 16  TYR A HH   6  
ATOM   5963  N  N    . ILE A 1 17 ? -13.280 6.904   -5.893  1.00 0.00 ? 17  ILE A N    6  
ATOM   5964  C  CA   . ILE A 1 17 ? -13.793 5.549   -5.729  1.00 0.00 ? 17  ILE A CA   6  
ATOM   5965  C  C    . ILE A 1 17 ? -12.771 4.515   -6.189  1.00 0.00 ? 17  ILE A C    6  
ATOM   5966  O  O    . ILE A 1 17 ? -12.448 4.429   -7.374  1.00 0.00 ? 17  ILE A O    6  
ATOM   5967  C  CB   . ILE A 1 17 ? -15.102 5.345   -6.514  1.00 0.00 ? 17  ILE A CB   6  
ATOM   5968  C  CG1  . ILE A 1 17 ? -16.080 6.486   -6.224  1.00 0.00 ? 17  ILE A CG1  6  
ATOM   5969  C  CG2  . ILE A 1 17 ? -15.727 4.003   -6.163  1.00 0.00 ? 17  ILE A CG2  6  
ATOM   5970  C  CD1  . ILE A 1 17 ? -16.468 6.592   -4.766  1.00 0.00 ? 17  ILE A CD1  6  
ATOM   5971  H  H    . ILE A 1 17 ? -13.449 7.381   -6.732  1.00 0.00 ? 17  ILE A H    6  
ATOM   5972  H  HA   . ILE A 1 17 ? -13.998 5.396   -4.680  1.00 0.00 ? 17  ILE A HA   6  
ATOM   5973  H  HB   . ILE A 1 17 ? -14.868 5.341   -7.568  1.00 0.00 ? 17  ILE A HB   6  
ATOM   5974  H  HG12 . ILE A 1 17 ? -15.629 7.421   -6.516  1.00 0.00 ? 17  ILE A HG12 6  
ATOM   5975  H  HG13 . ILE A 1 17 ? -16.982 6.331   -6.798  1.00 0.00 ? 17  ILE A HG13 6  
ATOM   5976  H  HG21 . ILE A 1 17 ? -16.654 3.884   -6.704  1.00 0.00 ? 17  ILE A HG21 6  
ATOM   5977  H  HG22 . ILE A 1 17 ? -15.048 3.208   -6.436  1.00 0.00 ? 17  ILE A HG22 6  
ATOM   5978  H  HG23 . ILE A 1 17 ? -15.921 3.962   -5.102  1.00 0.00 ? 17  ILE A HG23 6  
ATOM   5979  H  HD11 . ILE A 1 17 ? -17.511 6.334   -4.651  1.00 0.00 ? 17  ILE A HD11 6  
ATOM   5980  H  HD12 . ILE A 1 17 ? -15.862 5.917   -4.181  1.00 0.00 ? 17  ILE A HD12 6  
ATOM   5981  H  HD13 . ILE A 1 17 ? -16.310 7.605   -4.424  1.00 0.00 ? 17  ILE A HD13 6  
ATOM   5982  N  N    . CYS A 1 18 ? -12.267 3.729   -5.243  1.00 0.00 ? 18  CYS A N    6  
ATOM   5983  C  CA   . CYS A 1 18 ? -11.283 2.698   -5.549  1.00 0.00 ? 18  CYS A CA   6  
ATOM   5984  C  C    . CYS A 1 18 ? -11.776 1.793   -6.674  1.00 0.00 ? 18  CYS A C    6  
ATOM   5985  O  O    . CYS A 1 18 ? -12.872 1.238   -6.601  1.00 0.00 ? 18  CYS A O    6  
ATOM   5986  C  CB   . CYS A 1 18 ? -10.982 1.864   -4.302  1.00 0.00 ? 18  CYS A CB   6  
ATOM   5987  S  SG   . CYS A 1 18 ? -9.627  0.666   -4.518  1.00 0.00 ? 18  CYS A SG   6  
ATOM   5988  H  H    . CYS A 1 18 ? -12.564 3.846   -4.315  1.00 0.00 ? 18  CYS A H    6  
ATOM   5989  H  HA   . CYS A 1 18 ? -10.377 3.189   -5.870  1.00 0.00 ? 18  CYS A HA   6  
ATOM   5990  H  HB2  . CYS A 1 18 ? -10.709 2.526   -3.493  1.00 0.00 ? 18  CYS A HB2  6  
ATOM   5991  H  HB3  . CYS A 1 18 ? -11.869 1.313   -4.025  1.00 0.00 ? 18  CYS A HB3  6  
ATOM   5992  N  N    . GLN A 1 19 ? -10.958 1.649   -7.712  1.00 0.00 ? 19  GLN A N    6  
ATOM   5993  C  CA   . GLN A 1 19 ? -11.311 0.811   -8.852  1.00 0.00 ? 19  GLN A CA   6  
ATOM   5994  C  C    . GLN A 1 19 ? -10.970 -0.651  -8.579  1.00 0.00 ? 19  GLN A C    6  
ATOM   5995  O  O    . GLN A 1 19 ? -10.769 -1.436  -9.506  1.00 0.00 ? 19  GLN A O    6  
ATOM   5996  C  CB   . GLN A 1 19 ? -10.584 1.291   -10.109 1.00 0.00 ? 19  GLN A CB   6  
ATOM   5997  C  CG   . GLN A 1 19 ? -11.361 2.328   -10.903 1.00 0.00 ? 19  GLN A CG   6  
ATOM   5998  C  CD   . GLN A 1 19 ? -12.699 1.806   -11.391 1.00 0.00 ? 19  GLN A CD   6  
ATOM   5999  O  OE1  . GLN A 1 19 ? -12.760 0.963   -12.286 1.00 0.00 ? 19  GLN A OE1  6  
ATOM   6000  N  NE2  . GLN A 1 19 ? -13.779 2.306   -10.803 1.00 0.00 ? 19  GLN A NE2  6  
ATOM   6001  H  H    . GLN A 1 19 ? -10.097 2.117   -7.711  1.00 0.00 ? 19  GLN A H    6  
ATOM   6002  H  HA   . GLN A 1 19 ? -12.375 0.896   -9.008  1.00 0.00 ? 19  GLN A HA   6  
ATOM   6003  H  HB2  . GLN A 1 19 ? -9.638  1.725   -9.820  1.00 0.00 ? 19  GLN A HB2  6  
ATOM   6004  H  HB3  . GLN A 1 19 ? -10.400 0.441   -10.750 1.00 0.00 ? 19  GLN A HB3  6  
ATOM   6005  H  HG2  . GLN A 1 19 ? -11.536 3.188   -10.274 1.00 0.00 ? 19  GLN A HG2  6  
ATOM   6006  H  HG3  . GLN A 1 19 ? -10.772 2.623   -11.759 1.00 0.00 ? 19  GLN A HG3  6  
ATOM   6007  H  HE21 . GLN A 1 19 ? -13.654 2.976   -10.098 1.00 0.00 ? 19  GLN A HE21 6  
ATOM   6008  H  HE22 . GLN A 1 19 ? -14.657 1.988   -11.099 1.00 0.00 ? 19  GLN A HE22 6  
ATOM   6009  N  N    . LYS A 1 20 ? -10.906 -1.010  -7.302  1.00 0.00 ? 20  LYS A N    6  
ATOM   6010  C  CA   . LYS A 1 20 ? -10.590 -2.377  -6.906  1.00 0.00 ? 20  LYS A CA   6  
ATOM   6011  C  C    . LYS A 1 20 ? -11.655 -2.931  -5.964  1.00 0.00 ? 20  LYS A C    6  
ATOM   6012  O  O    . LYS A 1 20 ? -12.231 -3.989  -6.216  1.00 0.00 ? 20  LYS A O    6  
ATOM   6013  C  CB   . LYS A 1 20 ? -9.218  -2.430  -6.230  1.00 0.00 ? 20  LYS A CB   6  
ATOM   6014  C  CG   . LYS A 1 20 ? -8.813  -3.825  -5.786  1.00 0.00 ? 20  LYS A CG   6  
ATOM   6015  C  CD   . LYS A 1 20 ? -8.027  -4.548  -6.867  1.00 0.00 ? 20  LYS A CD   6  
ATOM   6016  C  CE   . LYS A 1 20 ? -8.877  -4.792  -8.104  1.00 0.00 ? 20  LYS A CE   6  
ATOM   6017  N  NZ   . LYS A 1 20 ? -8.742  -3.690  -9.097  1.00 0.00 ? 20  LYS A NZ   6  
ATOM   6018  H  H    . LYS A 1 20 ? -11.076 -0.339  -6.608  1.00 0.00 ? 20  LYS A H    6  
ATOM   6019  H  HA   . LYS A 1 20 ? -10.566 -2.984  -7.798  1.00 0.00 ? 20  LYS A HA   6  
ATOM   6020  H  HB2  . LYS A 1 20 ? -8.475  -2.065  -6.922  1.00 0.00 ? 20  LYS A HB2  6  
ATOM   6021  H  HB3  . LYS A 1 20 ? -9.234  -1.789  -5.360  1.00 0.00 ? 20  LYS A HB3  6  
ATOM   6022  H  HG2  . LYS A 1 20 ? -8.199  -3.747  -4.901  1.00 0.00 ? 20  LYS A HG2  6  
ATOM   6023  H  HG3  . LYS A 1 20 ? -9.703  -4.394  -5.559  1.00 0.00 ? 20  LYS A HG3  6  
ATOM   6024  H  HD2  . LYS A 1 20 ? -7.174  -3.947  -7.143  1.00 0.00 ? 20  LYS A HD2  6  
ATOM   6025  H  HD3  . LYS A 1 20 ? -7.689  -5.499  -6.479  1.00 0.00 ? 20  LYS A HD3  6  
ATOM   6026  H  HE2  . LYS A 1 20 ? -8.565  -5.718  -8.563  1.00 0.00 ? 20  LYS A HE2  6  
ATOM   6027  H  HE3  . LYS A 1 20 ? -9.912  -4.870  -7.804  1.00 0.00 ? 20  LYS A HE3  6  
ATOM   6028  H  HZ1  . LYS A 1 20 ? -9.454  -3.797  -9.848  1.00 0.00 ? 20  LYS A HZ1  6  
ATOM   6029  H  HZ2  . LYS A 1 20 ? -7.796  -3.711  -9.527  1.00 0.00 ? 20  LYS A HZ2  6  
ATOM   6030  H  HZ3  . LYS A 1 20 ? -8.880  -2.771  -8.631  1.00 0.00 ? 20  LYS A HZ3  6  
ATOM   6031  N  N    . CYS A 1 21 ? -11.912 -2.207  -4.879  1.00 0.00 ? 21  CYS A N    6  
ATOM   6032  C  CA   . CYS A 1 21 ? -12.908 -2.625  -3.900  1.00 0.00 ? 21  CYS A CA   6  
ATOM   6033  C  C    . CYS A 1 21 ? -14.175 -1.782  -4.019  1.00 0.00 ? 21  CYS A C    6  
ATOM   6034  O  O    . CYS A 1 21 ? -15.174 -2.046  -3.350  1.00 0.00 ? 21  CYS A O    6  
ATOM   6035  C  CB   . CYS A 1 21 ? -12.340 -2.513  -2.484  1.00 0.00 ? 21  CYS A CB   6  
ATOM   6036  S  SG   . CYS A 1 21 ? -11.963 -0.807  -1.966  1.00 0.00 ? 21  CYS A SG   6  
ATOM   6037  H  H    . CYS A 1 21 ? -11.419 -1.372  -4.733  1.00 0.00 ? 21  CYS A H    6  
ATOM   6038  H  HA   . CYS A 1 21 ? -13.157 -3.656  -4.098  1.00 0.00 ? 21  CYS A HA   6  
ATOM   6039  H  HB2  . CYS A 1 21 ? -13.056 -2.917  -1.784  1.00 0.00 ? 21  CYS A HB2  6  
ATOM   6040  H  HB3  . CYS A 1 21 ? -11.425 -3.084  -2.425  1.00 0.00 ? 21  CYS A HB3  6  
ATOM   6041  N  N    . HIS A 1 22 ? -14.126 -0.768  -4.877  1.00 0.00 ? 22  HIS A N    6  
ATOM   6042  C  CA   . HIS A 1 22 ? -15.269 0.113   -5.086  1.00 0.00 ? 22  HIS A CA   6  
ATOM   6043  C  C    . HIS A 1 22 ? -15.679 0.789   -3.781  1.00 0.00 ? 22  HIS A C    6  
ATOM   6044  O  O    . HIS A 1 22 ? -16.848 0.758   -3.395  1.00 0.00 ? 22  HIS A O    6  
ATOM   6045  C  CB   . HIS A 1 22 ? -16.448 -0.674  -5.659  1.00 0.00 ? 22  HIS A CB   6  
ATOM   6046  C  CG   . HIS A 1 22 ? -16.305 -0.993  -7.115  1.00 0.00 ? 22  HIS A CG   6  
ATOM   6047  N  ND1  . HIS A 1 22 ? -15.958 -2.243  -7.581  1.00 0.00 ? 22  HIS A ND1  6  
ATOM   6048  C  CD2  . HIS A 1 22 ? -16.465 -0.215  -8.212  1.00 0.00 ? 22  HIS A CD2  6  
ATOM   6049  C  CE1  . HIS A 1 22 ? -15.910 -2.221  -8.901  1.00 0.00 ? 22  HIS A CE1  6  
ATOM   6050  N  NE2  . HIS A 1 22 ? -16.213 -1.002  -9.309  1.00 0.00 ? 22  HIS A NE2  6  
ATOM   6051  H  H    . HIS A 1 22 ? -13.301 -0.609  -5.382  1.00 0.00 ? 22  HIS A H    6  
ATOM   6052  H  HA   . HIS A 1 22 ? -14.977 0.873   -5.794  1.00 0.00 ? 22  HIS A HA   6  
ATOM   6053  H  HB2  . HIS A 1 22 ? -16.544 -1.607  -5.124  1.00 0.00 ? 22  HIS A HB2  6  
ATOM   6054  H  HB3  . HIS A 1 22 ? -17.353 -0.097  -5.532  1.00 0.00 ? 22  HIS A HB3  6  
ATOM   6055  H  HD1  . HIS A 1 22 ? -15.774 -3.030  -7.027  1.00 0.00 ? 22  HIS A HD1  6  
ATOM   6056  H  HD2  . HIS A 1 22 ? -16.739 0.831   -8.222  1.00 0.00 ? 22  HIS A HD2  6  
ATOM   6057  H  HE1  . HIS A 1 22 ? -15.664 -3.057  -9.539  1.00 0.00 ? 22  HIS A HE1  6  
ATOM   6058  N  N    . ALA A 1 23 ? -14.710 1.398   -3.106  1.00 0.00 ? 23  ALA A N    6  
ATOM   6059  C  CA   . ALA A 1 23 ? -14.971 2.082   -1.845  1.00 0.00 ? 23  ALA A CA   6  
ATOM   6060  C  C    . ALA A 1 23 ? -14.287 3.444   -1.808  1.00 0.00 ? 23  ALA A C    6  
ATOM   6061  O  O    . ALA A 1 23 ? -13.122 3.575   -2.188  1.00 0.00 ? 23  ALA A O    6  
ATOM   6062  C  CB   . ALA A 1 23 ? -14.510 1.226   -0.675  1.00 0.00 ? 23  ALA A CB   6  
ATOM   6063  H  H    . ALA A 1 23 ? -13.799 1.388   -3.465  1.00 0.00 ? 23  ALA A H    6  
ATOM   6064  H  HA   . ALA A 1 23 ? -16.039 2.224   -1.757  1.00 0.00 ? 23  ALA A HA   6  
ATOM   6065  H  HB1  . ALA A 1 23 ? -15.013 0.270   -0.710  1.00 0.00 ? 23  ALA A HB1  6  
ATOM   6066  H  HB2  . ALA A 1 23 ? -13.443 1.074   -0.738  1.00 0.00 ? 23  ALA A HB2  6  
ATOM   6067  H  HB3  . ALA A 1 23 ? -14.750 1.725   0.252   1.00 0.00 ? 23  ALA A HB3  6  
ATOM   6068  N  N    . ILE A 1 24 ? -15.016 4.455   -1.350  1.00 0.00 ? 24  ILE A N    6  
ATOM   6069  C  CA   . ILE A 1 24 ? -14.478 5.807   -1.263  1.00 0.00 ? 24  ILE A CA   6  
ATOM   6070  C  C    . ILE A 1 24 ? -13.154 5.825   -0.508  1.00 0.00 ? 24  ILE A C    6  
ATOM   6071  O  O    . ILE A 1 24 ? -13.040 5.257   0.579   1.00 0.00 ? 24  ILE A O    6  
ATOM   6072  C  CB   . ILE A 1 24 ? -15.466 6.763   -0.568  1.00 0.00 ? 24  ILE A CB   6  
ATOM   6073  C  CG1  . ILE A 1 24 ? -16.581 7.171   -1.533  1.00 0.00 ? 24  ILE A CG1  6  
ATOM   6074  C  CG2  . ILE A 1 24 ? -14.736 7.991   -0.044  1.00 0.00 ? 24  ILE A CG2  6  
ATOM   6075  C  CD1  . ILE A 1 24 ? -17.511 8.223   -0.972  1.00 0.00 ? 24  ILE A CD1  6  
ATOM   6076  H  H    . ILE A 1 24 ? -15.938 4.288   -1.062  1.00 0.00 ? 24  ILE A H    6  
ATOM   6077  H  HA   . ILE A 1 24 ? -14.311 6.164   -2.269  1.00 0.00 ? 24  ILE A HA   6  
ATOM   6078  H  HB   . ILE A 1 24 ? -15.900 6.246   0.274   1.00 0.00 ? 24  ILE A HB   6  
ATOM   6079  H  HG12 . ILE A 1 24 ? -16.141 7.565   -2.435  1.00 0.00 ? 24  ILE A HG12 6  
ATOM   6080  H  HG13 . ILE A 1 24 ? -17.172 6.300   -1.777  1.00 0.00 ? 24  ILE A HG13 6  
ATOM   6081  H  HG21 . ILE A 1 24 ? -14.472 7.838   0.992   1.00 0.00 ? 24  ILE A HG21 6  
ATOM   6082  H  HG22 . ILE A 1 24 ? -13.838 8.149   -0.623  1.00 0.00 ? 24  ILE A HG22 6  
ATOM   6083  H  HG23 . ILE A 1 24 ? -15.377 8.855   -0.129  1.00 0.00 ? 24  ILE A HG23 6  
ATOM   6084  H  HD11 . ILE A 1 24 ? -17.407 8.260   0.102   1.00 0.00 ? 24  ILE A HD11 6  
ATOM   6085  H  HD12 . ILE A 1 24 ? -17.261 9.186   -1.392  1.00 0.00 ? 24  ILE A HD12 6  
ATOM   6086  H  HD13 . ILE A 1 24 ? -18.531 7.974   -1.226  1.00 0.00 ? 24  ILE A HD13 6  
ATOM   6087  N  N    . ILE A 1 25 ? -12.156 6.482   -1.089  1.00 0.00 ? 25  ILE A N    6  
ATOM   6088  C  CA   . ILE A 1 25 ? -10.840 6.576   -0.469  1.00 0.00 ? 25  ILE A CA   6  
ATOM   6089  C  C    . ILE A 1 25 ? -10.680 7.892   0.284   1.00 0.00 ? 25  ILE A C    6  
ATOM   6090  O  O    . ILE A 1 25 ? -10.427 8.936   -0.317  1.00 0.00 ? 25  ILE A O    6  
ATOM   6091  C  CB   . ILE A 1 25 ? -9.715  6.456   -1.515  1.00 0.00 ? 25  ILE A CB   6  
ATOM   6092  C  CG1  . ILE A 1 25 ? -9.946  5.233   -2.405  1.00 0.00 ? 25  ILE A CG1  6  
ATOM   6093  C  CG2  . ILE A 1 25 ? -8.361  6.369   -0.828  1.00 0.00 ? 25  ILE A CG2  6  
ATOM   6094  C  CD1  . ILE A 1 25 ? -9.388  5.390   -3.803  1.00 0.00 ? 25  ILE A CD1  6  
ATOM   6095  H  H    . ILE A 1 25 ? -12.308 6.914   -1.955  1.00 0.00 ? 25  ILE A H    6  
ATOM   6096  H  HA   . ILE A 1 25 ? -10.743 5.758   0.231   1.00 0.00 ? 25  ILE A HA   6  
ATOM   6097  H  HB   . ILE A 1 25 ? -9.726  7.345   -2.126  1.00 0.00 ? 25  ILE A HB   6  
ATOM   6098  H  HG12 . ILE A 1 25 ? -9.475  4.373   -1.955  1.00 0.00 ? 25  ILE A HG12 6  
ATOM   6099  H  HG13 . ILE A 1 25 ? -11.008 5.054   -2.490  1.00 0.00 ? 25  ILE A HG13 6  
ATOM   6100  H  HG21 . ILE A 1 25 ? -8.155  7.300   -0.319  1.00 0.00 ? 25  ILE A HG21 6  
ATOM   6101  H  HG22 . ILE A 1 25 ? -8.372  5.563   -0.110  1.00 0.00 ? 25  ILE A HG22 6  
ATOM   6102  H  HG23 . ILE A 1 25 ? -7.594  6.185   -1.565  1.00 0.00 ? 25  ILE A HG23 6  
ATOM   6103  H  HD11 . ILE A 1 25 ? -8.323  5.564   -3.748  1.00 0.00 ? 25  ILE A HD11 6  
ATOM   6104  H  HD12 . ILE A 1 25 ? -9.578  4.491   -4.370  1.00 0.00 ? 25  ILE A HD12 6  
ATOM   6105  H  HD13 . ILE A 1 25 ? -9.865  6.229   -4.288  1.00 0.00 ? 25  ILE A HD13 6  
ATOM   6106  N  N    . ASP A 1 26 ? -10.829 7.834   1.603   1.00 0.00 ? 26  ASP A N    6  
ATOM   6107  C  CA   . ASP A 1 26 ? -10.698 9.020   2.440   1.00 0.00 ? 26  ASP A CA   6  
ATOM   6108  C  C    . ASP A 1 26 ? -9.320  9.654   2.274   1.00 0.00 ? 26  ASP A C    6  
ATOM   6109  O  O    . ASP A 1 26 ? -9.204  10.846  1.992   1.00 0.00 ? 26  ASP A O    6  
ATOM   6110  C  CB   . ASP A 1 26 ? -10.935 8.664   3.908   1.00 0.00 ? 26  ASP A CB   6  
ATOM   6111  C  CG   . ASP A 1 26 ? -9.794  7.860   4.500   1.00 0.00 ? 26  ASP A CG   6  
ATOM   6112  O  OD1  . ASP A 1 26 ? -9.432  6.821   3.910   1.00 0.00 ? 26  ASP A OD1  6  
ATOM   6113  O  OD2  . ASP A 1 26 ? -9.264  8.269   5.555   1.00 0.00 ? 26  ASP A OD2  6  
ATOM   6114  H  H    . ASP A 1 26 ? -11.030 6.971   2.024   1.00 0.00 ? 26  ASP A H    6  
ATOM   6115  H  HA   . ASP A 1 26 ? -11.447 9.732   2.127   1.00 0.00 ? 26  ASP A HA   6  
ATOM   6116  H  HB2  . ASP A 1 26 ? -11.044 9.574   4.480   1.00 0.00 ? 26  ASP A HB2  6  
ATOM   6117  H  HB3  . ASP A 1 26 ? -11.841 8.082   3.989   1.00 0.00 ? 26  ASP A HB3  6  
ATOM   6118  N  N    . GLU A 1 27 ? -8.278  8.847   2.451   1.00 0.00 ? 27  GLU A N    6  
ATOM   6119  C  CA   . GLU A 1 27 ? -6.908  9.330   2.322   1.00 0.00 ? 27  GLU A CA   6  
ATOM   6120  C  C    . GLU A 1 27 ? -6.526  9.498   0.855   1.00 0.00 ? 27  GLU A C    6  
ATOM   6121  O  O    . GLU A 1 27 ? -7.358  9.327   -0.036  1.00 0.00 ? 27  GLU A O    6  
ATOM   6122  C  CB   . GLU A 1 27 ? -5.937  8.365   3.006   1.00 0.00 ? 27  GLU A CB   6  
ATOM   6123  C  CG   . GLU A 1 27 ? -5.942  6.969   2.406   1.00 0.00 ? 27  GLU A CG   6  
ATOM   6124  C  CD   . GLU A 1 27 ? -4.619  6.251   2.589   1.00 0.00 ? 27  GLU A CD   6  
ATOM   6125  O  OE1  . GLU A 1 27 ? -3.565  6.890   2.388   1.00 0.00 ? 27  GLU A OE1  6  
ATOM   6126  O  OE2  . GLU A 1 27 ? -4.638  5.051   2.934   1.00 0.00 ? 27  GLU A OE2  6  
ATOM   6127  H  H    . GLU A 1 27 ? -8.434  7.906   2.674   1.00 0.00 ? 27  GLU A H    6  
ATOM   6128  H  HA   . GLU A 1 27 ? -6.848  10.291  2.810   1.00 0.00 ? 27  GLU A HA   6  
ATOM   6129  H  HB2  . GLU A 1 27 ? -4.937  8.765   2.929   1.00 0.00 ? 27  GLU A HB2  6  
ATOM   6130  H  HB3  . GLU A 1 27 ? -6.204  8.285   4.050   1.00 0.00 ? 27  GLU A HB3  6  
ATOM   6131  H  HG2  . GLU A 1 27 ? -6.718  6.389   2.881   1.00 0.00 ? 27  GLU A HG2  6  
ATOM   6132  H  HG3  . GLU A 1 27 ? -6.149  7.047   1.348   1.00 0.00 ? 27  GLU A HG3  6  
ATOM   6133  N  N    . GLN A 1 28 ? -5.263  9.833   0.613   1.00 0.00 ? 28  GLN A N    6  
ATOM   6134  C  CA   . GLN A 1 28 ? -4.771  10.025  -0.746  1.00 0.00 ? 28  GLN A CA   6  
ATOM   6135  C  C    . GLN A 1 28 ? -4.917  8.746   -1.564  1.00 0.00 ? 28  GLN A C    6  
ATOM   6136  O  O    . GLN A 1 28 ? -4.322  7.713   -1.258  1.00 0.00 ? 28  GLN A O    6  
ATOM   6137  C  CB   . GLN A 1 28 ? -3.306  10.465  -0.724  1.00 0.00 ? 28  GLN A CB   6  
ATOM   6138  C  CG   . GLN A 1 28 ? -2.781  10.900  -2.082  1.00 0.00 ? 28  GLN A CG   6  
ATOM   6139  C  CD   . GLN A 1 28 ? -1.266  10.893  -2.152  1.00 0.00 ? 28  GLN A CD   6  
ATOM   6140  O  OE1  . GLN A 1 28 ? -0.658  9.918   -2.592  1.00 0.00 ? 28  GLN A OE1  6  
ATOM   6141  N  NE2  . GLN A 1 28 ? -0.649  11.985  -1.716  1.00 0.00 ? 28  GLN A NE2  6  
ATOM   6142  H  H    . GLN A 1 28 ? -4.648  9.954   1.365   1.00 0.00 ? 28  GLN A H    6  
ATOM   6143  H  HA   . GLN A 1 28 ? -5.364  10.801  -1.207  1.00 0.00 ? 28  GLN A HA   6  
ATOM   6144  H  HB2  . GLN A 1 28 ? -3.202  11.294  -0.039  1.00 0.00 ? 28  GLN A HB2  6  
ATOM   6145  H  HB3  . GLN A 1 28 ? -2.701  9.642   -0.375  1.00 0.00 ? 28  GLN A HB3  6  
ATOM   6146  H  HG2  . GLN A 1 28 ? -3.163  10.226  -2.835  1.00 0.00 ? 28  GLN A HG2  6  
ATOM   6147  H  HG3  . GLN A 1 28 ? -3.132  11.901  -2.286  1.00 0.00 ? 28  GLN A HG3  6  
ATOM   6148  H  HE21 . GLN A 1 28 ? -1.198  12.724  -1.378  1.00 0.00 ? 28  GLN A HE21 6  
ATOM   6149  H  HE22 . GLN A 1 28 ? 0.330   12.008  -1.749  1.00 0.00 ? 28  GLN A HE22 6  
ATOM   6150  N  N    . PRO A 1 29 ? -5.729  8.814   -2.630  1.00 0.00 ? 29  PRO A N    6  
ATOM   6151  C  CA   . PRO A 1 29 ? -5.972  7.670   -3.514  1.00 0.00 ? 29  PRO A CA   6  
ATOM   6152  C  C    . PRO A 1 29 ? -4.746  7.310   -4.347  1.00 0.00 ? 29  PRO A C    6  
ATOM   6153  O  O    . PRO A 1 29 ? -4.140  8.174   -4.983  1.00 0.00 ? 29  PRO A O    6  
ATOM   6154  C  CB   . PRO A 1 29 ? -7.109  8.155   -4.417  1.00 0.00 ? 29  PRO A CB   6  
ATOM   6155  C  CG   . PRO A 1 29 ? -6.985  9.640   -4.418  1.00 0.00 ? 29  PRO A CG   6  
ATOM   6156  C  CD   . PRO A 1 29 ? -6.471  10.013  -3.055  1.00 0.00 ? 29  PRO A CD   6  
ATOM   6157  H  HA   . PRO A 1 29 ? -6.296  6.802   -2.959  1.00 0.00 ? 29  PRO A HA   6  
ATOM   6158  H  HB2  . PRO A 1 29 ? -6.982  7.747   -5.410  1.00 0.00 ? 29  PRO A HB2  6  
ATOM   6159  H  HB3  . PRO A 1 29 ? -8.057  7.838   -4.010  1.00 0.00 ? 29  PRO A HB3  6  
ATOM   6160  H  HG2  . PRO A 1 29 ? -6.286  9.950   -5.180  1.00 0.00 ? 29  PRO A HG2  6  
ATOM   6161  H  HG3  . PRO A 1 29 ? -7.952  10.088  -4.588  1.00 0.00 ? 29  PRO A HG3  6  
ATOM   6162  H  HD2  . PRO A 1 29 ? -5.816  10.869  -3.120  1.00 0.00 ? 29  PRO A HD2  6  
ATOM   6163  H  HD3  . PRO A 1 29 ? -7.292  10.215  -2.384  1.00 0.00 ? 29  PRO A HD3  6  
ATOM   6164  N  N    . LEU A 1 30 ? -4.387  6.032   -4.340  1.00 0.00 ? 30  LEU A N    6  
ATOM   6165  C  CA   . LEU A 1 30 ? -3.233  5.557   -5.096  1.00 0.00 ? 30  LEU A CA   6  
ATOM   6166  C  C    . LEU A 1 30 ? -3.577  5.400   -6.574  1.00 0.00 ? 30  LEU A C    6  
ATOM   6167  O  O    . LEU A 1 30 ? -4.387  4.550   -6.945  1.00 0.00 ? 30  LEU A O    6  
ATOM   6168  C  CB   . LEU A 1 30 ? -2.741  4.224   -4.531  1.00 0.00 ? 30  LEU A CB   6  
ATOM   6169  C  CG   . LEU A 1 30 ? -1.989  3.318   -5.506  1.00 0.00 ? 30  LEU A CG   6  
ATOM   6170  C  CD1  . LEU A 1 30 ? -0.581  3.841   -5.743  1.00 0.00 ? 30  LEU A CD1  6  
ATOM   6171  C  CD2  . LEU A 1 30 ? -1.948  1.889   -4.983  1.00 0.00 ? 30  LEU A CD2  6  
ATOM   6172  H  H    . LEU A 1 30 ? -4.908  5.391   -3.814  1.00 0.00 ? 30  LEU A H    6  
ATOM   6173  H  HA   . LEU A 1 30 ? -2.448  6.292   -4.998  1.00 0.00 ? 30  LEU A HA   6  
ATOM   6174  H  HB2  . LEU A 1 30 ? -2.081  4.439   -3.704  1.00 0.00 ? 30  LEU A HB2  6  
ATOM   6175  H  HB3  . LEU A 1 30 ? -3.603  3.681   -4.170  1.00 0.00 ? 30  LEU A HB3  6  
ATOM   6176  H  HG   . LEU A 1 30 ? -2.507  3.313   -6.455  1.00 0.00 ? 30  LEU A HG   6  
ATOM   6177  H  HD11 . LEU A 1 30 ? -0.262  4.418   -4.888  1.00 0.00 ? 30  LEU A HD11 6  
ATOM   6178  H  HD12 . LEU A 1 30 ? -0.573  4.466   -6.624  1.00 0.00 ? 30  LEU A HD12 6  
ATOM   6179  H  HD13 . LEU A 1 30 ? 0.093   3.009   -5.887  1.00 0.00 ? 30  LEU A HD13 6  
ATOM   6180  H  HD21 . LEU A 1 30 ? -2.502  1.829   -4.058  1.00 0.00 ? 30  LEU A HD21 6  
ATOM   6181  H  HD22 . LEU A 1 30 ? -0.922  1.600   -4.807  1.00 0.00 ? 30  LEU A HD22 6  
ATOM   6182  H  HD23 . LEU A 1 30 ? -2.389  1.226   -5.712  1.00 0.00 ? 30  LEU A HD23 6  
ATOM   6183  N  N    . ILE A 1 31 ? -2.955  6.222   -7.412  1.00 0.00 ? 31  ILE A N    6  
ATOM   6184  C  CA   . ILE A 1 31 ? -3.194  6.172   -8.849  1.00 0.00 ? 31  ILE A CA   6  
ATOM   6185  C  C    . ILE A 1 31 ? -2.337  5.098   -9.511  1.00 0.00 ? 31  ILE A C    6  
ATOM   6186  O  O    . ILE A 1 31 ? -1.198  4.861   -9.108  1.00 0.00 ? 31  ILE A O    6  
ATOM   6187  C  CB   . ILE A 1 31 ? -2.901  7.529   -9.516  1.00 0.00 ? 31  ILE A CB   6  
ATOM   6188  C  CG1  . ILE A 1 31 ? -3.826  8.609   -8.951  1.00 0.00 ? 31  ILE A CG1  6  
ATOM   6189  C  CG2  . ILE A 1 31 ? -3.062  7.422   -11.025 1.00 0.00 ? 31  ILE A CG2  6  
ATOM   6190  C  CD1  . ILE A 1 31 ? -5.292  8.346   -9.212  1.00 0.00 ? 31  ILE A CD1  6  
ATOM   6191  H  H    . ILE A 1 31 ? -2.321  6.878   -7.055  1.00 0.00 ? 31  ILE A H    6  
ATOM   6192  H  HA   . ILE A 1 31 ? -4.236  5.933   -9.005  1.00 0.00 ? 31  ILE A HA   6  
ATOM   6193  H  HB   . ILE A 1 31 ? -1.877  7.795   -9.305  1.00 0.00 ? 31  ILE A HB   6  
ATOM   6194  H  HG12 . ILE A 1 31 ? -3.685  8.673   -7.884  1.00 0.00 ? 31  ILE A HG12 6  
ATOM   6195  H  HG13 . ILE A 1 31 ? -3.573  9.559   -9.400  1.00 0.00 ? 31  ILE A HG13 6  
ATOM   6196  H  HG21 . ILE A 1 31 ? -3.996  6.931   -11.254 1.00 0.00 ? 31  ILE A HG21 6  
ATOM   6197  H  HG22 . ILE A 1 31 ? -3.061  8.412   -11.457 1.00 0.00 ? 31  ILE A HG22 6  
ATOM   6198  H  HG23 . ILE A 1 31 ? -2.244  6.850   -11.435 1.00 0.00 ? 31  ILE A HG23 6  
ATOM   6199  H  HD11 . ILE A 1 31 ? -5.695  7.733   -8.419  1.00 0.00 ? 31  ILE A HD11 6  
ATOM   6200  H  HD12 . ILE A 1 31 ? -5.826  9.283   -9.249  1.00 0.00 ? 31  ILE A HD12 6  
ATOM   6201  H  HD13 . ILE A 1 31 ? -5.403  7.831   -10.155 1.00 0.00 ? 31  ILE A HD13 6  
ATOM   6202  N  N    . PHE A 1 32 ? -2.893  4.450   -10.530 1.00 0.00 ? 32  PHE A N    6  
ATOM   6203  C  CA   . PHE A 1 32 ? -2.180  3.401   -11.249 1.00 0.00 ? 32  PHE A CA   6  
ATOM   6204  C  C    . PHE A 1 32 ? -2.880  3.071   -12.564 1.00 0.00 ? 32  PHE A C    6  
ATOM   6205  O  O    . PHE A 1 32 ? -4.032  2.636   -12.576 1.00 0.00 ? 32  PHE A O    6  
ATOM   6206  C  CB   . PHE A 1 32 ? -2.074  2.143   -10.385 1.00 0.00 ? 32  PHE A CB   6  
ATOM   6207  C  CG   . PHE A 1 32 ? -1.386  0.999   -11.074 1.00 0.00 ? 32  PHE A CG   6  
ATOM   6208  C  CD1  . PHE A 1 32 ? -0.019  1.032   -11.302 1.00 0.00 ? 32  PHE A CD1  6  
ATOM   6209  C  CD2  . PHE A 1 32 ? -2.105  -0.109  -11.492 1.00 0.00 ? 32  PHE A CD2  6  
ATOM   6210  C  CE1  . PHE A 1 32 ? 0.616   -0.019  -11.937 1.00 0.00 ? 32  PHE A CE1  6  
ATOM   6211  C  CE2  . PHE A 1 32 ? -1.474  -1.163  -12.126 1.00 0.00 ? 32  PHE A CE2  6  
ATOM   6212  C  CZ   . PHE A 1 32 ? -0.112  -1.118  -12.348 1.00 0.00 ? 32  PHE A CZ   6  
ATOM   6213  H  H    . PHE A 1 32 ? -3.805  4.684   -10.804 1.00 0.00 ? 32  PHE A H    6  
ATOM   6214  H  HA   . PHE A 1 32 ? -1.187  3.764   -11.465 1.00 0.00 ? 32  PHE A HA   6  
ATOM   6215  H  HB2  . PHE A 1 32 ? -1.516  2.375   -9.490  1.00 0.00 ? 32  PHE A HB2  6  
ATOM   6216  H  HB3  . PHE A 1 32 ? -3.066  1.818   -10.111 1.00 0.00 ? 32  PHE A HB3  6  
ATOM   6217  H  HD1  . PHE A 1 32 ? 0.552   1.891   -10.980 1.00 0.00 ? 32  PHE A HD1  6  
ATOM   6218  H  HD2  . PHE A 1 32 ? -3.171  -0.145  -11.318 1.00 0.00 ? 32  PHE A HD2  6  
ATOM   6219  H  HE1  . PHE A 1 32 ? 1.681   0.019   -12.109 1.00 0.00 ? 32  PHE A HE1  6  
ATOM   6220  H  HE2  . PHE A 1 32 ? -2.047  -2.021  -12.446 1.00 0.00 ? 32  PHE A HE2  6  
ATOM   6221  H  HZ   . PHE A 1 32 ? 0.382   -1.940  -12.844 1.00 0.00 ? 32  PHE A HZ   6  
ATOM   6222  N  N    . LYS A 1 33 ? -2.176  3.281   -13.671 1.00 0.00 ? 33  LYS A N    6  
ATOM   6223  C  CA   . LYS A 1 33 ? -2.728  3.006   -14.993 1.00 0.00 ? 33  LYS A CA   6  
ATOM   6224  C  C    . LYS A 1 33 ? -3.942  3.888   -15.270 1.00 0.00 ? 33  LYS A C    6  
ATOM   6225  O  O    . LYS A 1 33 ? -4.883  3.469   -15.943 1.00 0.00 ? 33  LYS A O    6  
ATOM   6226  C  CB   . LYS A 1 33 ? -3.118  1.531   -15.108 1.00 0.00 ? 33  LYS A CB   6  
ATOM   6227  C  CG   . LYS A 1 33 ? -1.957  0.622   -15.473 1.00 0.00 ? 33  LYS A CG   6  
ATOM   6228  C  CD   . LYS A 1 33 ? -2.372  -0.840  -15.469 1.00 0.00 ? 33  LYS A CD   6  
ATOM   6229  C  CE   . LYS A 1 33 ? -1.176  -1.759  -15.668 1.00 0.00 ? 33  LYS A CE   6  
ATOM   6230  N  NZ   . LYS A 1 33 ? -0.930  -2.044  -17.109 1.00 0.00 ? 33  LYS A NZ   6  
ATOM   6231  H  H    . LYS A 1 33 ? -1.263  3.629   -13.597 1.00 0.00 ? 33  LYS A H    6  
ATOM   6232  H  HA   . LYS A 1 33 ? -1.964  3.226   -15.723 1.00 0.00 ? 33  LYS A HA   6  
ATOM   6233  H  HB2  . LYS A 1 33 ? -3.522  1.203   -14.162 1.00 0.00 ? 33  LYS A HB2  6  
ATOM   6234  H  HB3  . LYS A 1 33 ? -3.879  1.431   -15.869 1.00 0.00 ? 33  LYS A HB3  6  
ATOM   6235  H  HG2  . LYS A 1 33 ? -1.604  0.882   -16.460 1.00 0.00 ? 33  LYS A HG2  6  
ATOM   6236  H  HG3  . LYS A 1 33 ? -1.162  0.763   -14.755 1.00 0.00 ? 33  LYS A HG3  6  
ATOM   6237  H  HD2  . LYS A 1 33 ? -2.835  -1.072  -14.521 1.00 0.00 ? 33  LYS A HD2  6  
ATOM   6238  H  HD3  . LYS A 1 33 ? -3.080  -1.007  -16.268 1.00 0.00 ? 33  LYS A HD3  6  
ATOM   6239  H  HE2  . LYS A 1 33 ? -0.301  -1.286  -15.249 1.00 0.00 ? 33  LYS A HE2  6  
ATOM   6240  H  HE3  . LYS A 1 33 ? -1.364  -2.689  -15.152 1.00 0.00 ? 33  LYS A HE3  6  
ATOM   6241  H  HZ1  . LYS A 1 33 ? -0.489  -2.980  -17.217 1.00 0.00 ? 33  LYS A HZ1  6  
ATOM   6242  H  HZ2  . LYS A 1 33 ? -0.295  -1.327  -17.512 1.00 0.00 ? 33  LYS A HZ2  6  
ATOM   6243  H  HZ3  . LYS A 1 33 ? -1.827  -2.033  -17.634 1.00 0.00 ? 33  LYS A HZ3  6  
ATOM   6244  N  N    . ASN A 1 34 ? -3.912  5.109   -14.747 1.00 0.00 ? 34  ASN A N    6  
ATOM   6245  C  CA   . ASN A 1 34 ? -5.010  6.049   -14.940 1.00 0.00 ? 34  ASN A CA   6  
ATOM   6246  C  C    . ASN A 1 34 ? -6.276  5.557   -14.246 1.00 0.00 ? 34  ASN A C    6  
ATOM   6247  O  O    . ASN A 1 34 ? -7.358  5.556   -14.833 1.00 0.00 ? 34  ASN A O    6  
ATOM   6248  C  CB   . ASN A 1 34 ? -5.279  6.253   -16.432 1.00 0.00 ? 34  ASN A CB   6  
ATOM   6249  C  CG   . ASN A 1 34 ? -6.337  7.309   -16.690 1.00 0.00 ? 34  ASN A CG   6  
ATOM   6250  O  OD1  . ASN A 1 34 ? -7.515  6.994   -16.862 1.00 0.00 ? 34  ASN A OD1  6  
ATOM   6251  N  ND2  . ASN A 1 34 ? -5.920  8.569   -16.719 1.00 0.00 ? 34  ASN A ND2  6  
ATOM   6252  H  H    . ASN A 1 34 ? -3.134  5.385   -14.219 1.00 0.00 ? 34  ASN A H    6  
ATOM   6253  H  HA   . ASN A 1 34 ? -4.719  6.993   -14.504 1.00 0.00 ? 34  ASN A HA   6  
ATOM   6254  H  HB2  . ASN A 1 34 ? -4.365  6.561   -16.918 1.00 0.00 ? 34  ASN A HB2  6  
ATOM   6255  H  HB3  . ASN A 1 34 ? -5.614  5.321   -16.862 1.00 0.00 ? 34  ASN A HB3  6  
ATOM   6256  H  HD21 . ASN A 1 34 ? -4.966  8.745   -16.575 1.00 0.00 ? 34  ASN A HD21 6  
ATOM   6257  H  HD22 . ASN A 1 34 ? -6.583  9.272   -16.884 1.00 0.00 ? 34  ASN A HD22 6  
ATOM   6258  N  N    . ASP A 1 35 ? -6.133  5.139   -12.993 1.00 0.00 ? 35  ASP A N    6  
ATOM   6259  C  CA   . ASP A 1 35 ? -7.265  4.645   -12.217 1.00 0.00 ? 35  ASP A CA   6  
ATOM   6260  C  C    . ASP A 1 35 ? -6.967  4.706   -10.722 1.00 0.00 ? 35  ASP A C    6  
ATOM   6261  O  O    . ASP A 1 35 ? -5.872  4.374   -10.268 1.00 0.00 ? 35  ASP A O    6  
ATOM   6262  C  CB   . ASP A 1 35 ? -7.602  3.210   -12.625 1.00 0.00 ? 35  ASP A CB   6  
ATOM   6263  C  CG   . ASP A 1 35 ? -7.558  3.009   -14.127 1.00 0.00 ? 35  ASP A CG   6  
ATOM   6264  O  OD1  . ASP A 1 35 ? -8.505  3.448   -14.812 1.00 0.00 ? 35  ASP A OD1  6  
ATOM   6265  O  OD2  . ASP A 1 35 ? -6.577  2.411   -14.617 1.00 0.00 ? 35  ASP A OD2  6  
ATOM   6266  H  H    . ASP A 1 35 ? -5.245  5.164   -12.579 1.00 0.00 ? 35  ASP A H    6  
ATOM   6267  H  HA   . ASP A 1 35 ? -8.113  5.278   -12.429 1.00 0.00 ? 35  ASP A HA   6  
ATOM   6268  H  HB2  . ASP A 1 35 ? -6.891  2.536   -12.169 1.00 0.00 ? 35  ASP A HB2  6  
ATOM   6269  H  HB3  . ASP A 1 35 ? -8.596  2.968   -12.276 1.00 0.00 ? 35  ASP A HB3  6  
ATOM   6270  N  N    . PRO A 1 36 ? -7.964  5.141   -9.937  1.00 0.00 ? 36  PRO A N    6  
ATOM   6271  C  CA   . PRO A 1 36 ? -7.833  5.256   -8.482  1.00 0.00 ? 36  PRO A CA   6  
ATOM   6272  C  C    . PRO A 1 36 ? -7.756  3.896   -7.797  1.00 0.00 ? 36  PRO A C    6  
ATOM   6273  O  O    . PRO A 1 36 ? -8.342  2.920   -8.267  1.00 0.00 ? 36  PRO A O    6  
ATOM   6274  C  CB   . PRO A 1 36 ? -9.110  5.992   -8.068  1.00 0.00 ? 36  PRO A CB   6  
ATOM   6275  C  CG   . PRO A 1 36 ? -10.094 5.677   -9.141  1.00 0.00 ? 36  PRO A CG   6  
ATOM   6276  C  CD   . PRO A 1 36 ? -9.296  5.553   -10.410 1.00 0.00 ? 36  PRO A CD   6  
ATOM   6277  H  HA   . PRO A 1 36 ? -6.971  5.846   -8.207  1.00 0.00 ? 36  PRO A HA   6  
ATOM   6278  H  HB2  . PRO A 1 36 ? -9.443  5.627   -7.106  1.00 0.00 ? 36  PRO A HB2  6  
ATOM   6279  H  HB3  . PRO A 1 36 ? -8.916  7.052   -8.009  1.00 0.00 ? 36  PRO A HB3  6  
ATOM   6280  H  HG2  . PRO A 1 36 ? -10.593 4.746   -8.920  1.00 0.00 ? 36  PRO A HG2  6  
ATOM   6281  H  HG3  . PRO A 1 36 ? -10.812 6.479   -9.227  1.00 0.00 ? 36  PRO A HG3  6  
ATOM   6282  H  HD2  . PRO A 1 36 ? -9.727  4.801   -11.054 1.00 0.00 ? 36  PRO A HD2  6  
ATOM   6283  H  HD3  . PRO A 1 36 ? -9.247  6.505   -10.919 1.00 0.00 ? 36  PRO A HD3  6  
ATOM   6284  N  N    . TYR A 1 37 ? -7.032  3.839   -6.685  1.00 0.00 ? 37  TYR A N    6  
ATOM   6285  C  CA   . TYR A 1 37 ? -6.877  2.597   -5.937  1.00 0.00 ? 37  TYR A CA   6  
ATOM   6286  C  C    . TYR A 1 37 ? -6.399  2.874   -4.515  1.00 0.00 ? 37  TYR A C    6  
ATOM   6287  O  O    . TYR A 1 37 ? -5.965  3.982   -4.198  1.00 0.00 ? 37  TYR A O    6  
ATOM   6288  C  CB   . TYR A 1 37 ? -5.890  1.669   -6.647  1.00 0.00 ? 37  TYR A CB   6  
ATOM   6289  C  CG   . TYR A 1 37 ? -6.335  1.256   -8.031  1.00 0.00 ? 37  TYR A CG   6  
ATOM   6290  C  CD1  . TYR A 1 37 ? -7.492  0.510   -8.217  1.00 0.00 ? 37  TYR A CD1  6  
ATOM   6291  C  CD2  . TYR A 1 37 ? -5.600  1.614   -9.155  1.00 0.00 ? 37  TYR A CD2  6  
ATOM   6292  C  CE1  . TYR A 1 37 ? -7.902  0.130   -9.480  1.00 0.00 ? 37  TYR A CE1  6  
ATOM   6293  C  CE2  . TYR A 1 37 ? -6.003  1.240   -10.422 1.00 0.00 ? 37  TYR A CE2  6  
ATOM   6294  C  CZ   . TYR A 1 37 ? -7.155  0.497   -10.579 1.00 0.00 ? 37  TYR A CZ   6  
ATOM   6295  O  OH   . TYR A 1 37 ? -7.561  0.122   -11.839 1.00 0.00 ? 37  TYR A OH   6  
ATOM   6296  H  H    . TYR A 1 37 ? -6.589  4.650   -6.361  1.00 0.00 ? 37  TYR A H    6  
ATOM   6297  H  HA   . TYR A 1 37 ? -7.842  2.114   -5.893  1.00 0.00 ? 37  TYR A HA   6  
ATOM   6298  H  HB2  . TYR A 1 37 ? -4.939  2.170   -6.741  1.00 0.00 ? 37  TYR A HB2  6  
ATOM   6299  H  HB3  . TYR A 1 37 ? -5.762  0.772   -6.058  1.00 0.00 ? 37  TYR A HB3  6  
ATOM   6300  H  HD1  . TYR A 1 37 ? -8.076  0.224   -7.354  1.00 0.00 ? 37  TYR A HD1  6  
ATOM   6301  H  HD2  . TYR A 1 37 ? -4.698  2.195   -9.028  1.00 0.00 ? 37  TYR A HD2  6  
ATOM   6302  H  HE1  . TYR A 1 37 ? -8.805  -0.451  -9.604  1.00 0.00 ? 37  TYR A HE1  6  
ATOM   6303  H  HE2  . TYR A 1 37 ? -5.418  1.527   -11.283 1.00 0.00 ? 37  TYR A HE2  6  
ATOM   6304  H  HH   . TYR A 1 37 ? -8.514  0.005   -11.847 1.00 0.00 ? 37  TYR A HH   6  
ATOM   6305  N  N    . HIS A 1 38 ? -6.482  1.858   -3.661  1.00 0.00 ? 38  HIS A N    6  
ATOM   6306  C  CA   . HIS A 1 38 ? -6.057  1.990   -2.272  1.00 0.00 ? 38  HIS A CA   6  
ATOM   6307  C  C    . HIS A 1 38 ? -4.594  1.587   -2.111  1.00 0.00 ? 38  HIS A C    6  
ATOM   6308  O  O    . HIS A 1 38 ? -4.171  0.513   -2.539  1.00 0.00 ? 38  HIS A O    6  
ATOM   6309  C  CB   . HIS A 1 38 ? -6.938  1.133   -1.364  1.00 0.00 ? 38  HIS A CB   6  
ATOM   6310  C  CG   . HIS A 1 38 ? -8.193  1.821   -0.923  1.00 0.00 ? 38  HIS A CG   6  
ATOM   6311  N  ND1  . HIS A 1 38 ? -9.447  1.457   -1.366  1.00 0.00 ? 38  HIS A ND1  6  
ATOM   6312  C  CD2  . HIS A 1 38 ? -8.382  2.857   -0.072  1.00 0.00 ? 38  HIS A CD2  6  
ATOM   6313  C  CE1  . HIS A 1 38 ? -10.353 2.240   -0.808  1.00 0.00 ? 38  HIS A CE1  6  
ATOM   6314  N  NE2  . HIS A 1 38 ? -9.733  3.098   -0.018  1.00 0.00 ? 38  HIS A NE2  6  
ATOM   6315  H  H    . HIS A 1 38 ? -6.836  1.000   -3.973  1.00 0.00 ? 38  HIS A H    6  
ATOM   6316  H  HA   . HIS A 1 38 ? -6.164  3.026   -1.990  1.00 0.00 ? 38  HIS A HA   6  
ATOM   6317  H  HB2  . HIS A 1 38 ? -7.222  0.234   -1.892  1.00 0.00 ? 38  HIS A HB2  6  
ATOM   6318  H  HB3  . HIS A 1 38 ? -6.378  0.863   -0.480  1.00 0.00 ? 38  HIS A HB3  6  
ATOM   6319  H  HD2  . HIS A 1 38 ? -7.613  3.395   0.465   1.00 0.00 ? 38  HIS A HD2  6  
ATOM   6320  H  HE1  . HIS A 1 38 ? -11.419 2.188   -0.969  1.00 0.00 ? 38  HIS A HE1  6  
ATOM   6321  H  HE2  . HIS A 1 38 ? -10.161 3.845   0.450   1.00 0.00 ? 38  HIS A HE2  6  
ATOM   6322  N  N    . PRO A 1 39 ? -3.803  2.467   -1.479  1.00 0.00 ? 39  PRO A N    6  
ATOM   6323  C  CA   . PRO A 1 39 ? -2.376  2.224   -1.247  1.00 0.00 ? 39  PRO A CA   6  
ATOM   6324  C  C    . PRO A 1 39 ? -2.135  1.122   -0.221  1.00 0.00 ? 39  PRO A C    6  
ATOM   6325  O  O    . PRO A 1 39 ? -0.993  0.826   0.129   1.00 0.00 ? 39  PRO A O    6  
ATOM   6326  C  CB   . PRO A 1 39 ? -1.869  3.568   -0.718  1.00 0.00 ? 39  PRO A CB   6  
ATOM   6327  C  CG   . PRO A 1 39 ? -3.068  4.214   -0.115  1.00 0.00 ? 39  PRO A CG   6  
ATOM   6328  C  CD   . PRO A 1 39 ? -4.241  3.766   -0.943  1.00 0.00 ? 39  PRO A CD   6  
ATOM   6329  H  HA   . PRO A 1 39 ? -1.861  1.979   -2.164  1.00 0.00 ? 39  PRO A HA   6  
ATOM   6330  H  HB2  . PRO A 1 39 ? -1.097  3.399   0.020   1.00 0.00 ? 39  PRO A HB2  6  
ATOM   6331  H  HB3  . PRO A 1 39 ? -1.474  4.154   -1.534  1.00 0.00 ? 39  PRO A HB3  6  
ATOM   6332  H  HG2  . PRO A 1 39 ? -3.185  3.889   0.908   1.00 0.00 ? 39  PRO A HG2  6  
ATOM   6333  H  HG3  . PRO A 1 39 ? -2.967  5.288   -0.159  1.00 0.00 ? 39  PRO A HG3  6  
ATOM   6334  H  HD2  . PRO A 1 39 ? -5.118  3.652   -0.324  1.00 0.00 ? 39  PRO A HD2  6  
ATOM   6335  H  HD3  . PRO A 1 39 ? -4.429  4.469   -1.741  1.00 0.00 ? 39  PRO A HD3  6  
ATOM   6336  N  N    . ASP A 1 40 ? -3.218  0.518   0.257   1.00 0.00 ? 40  ASP A N    6  
ATOM   6337  C  CA   . ASP A 1 40 ? -3.124  -0.553  1.242   1.00 0.00 ? 40  ASP A CA   6  
ATOM   6338  C  C    . ASP A 1 40 ? -3.403  -1.908  0.600   1.00 0.00 ? 40  ASP A C    6  
ATOM   6339  O  O    . ASP A 1 40 ? -3.136  -2.954  1.193   1.00 0.00 ? 40  ASP A O    6  
ATOM   6340  C  CB   . ASP A 1 40 ? -4.104  -0.306  2.390   1.00 0.00 ? 40  ASP A CB   6  
ATOM   6341  C  CG   . ASP A 1 40 ? -5.536  -0.620  2.005   1.00 0.00 ? 40  ASP A CG   6  
ATOM   6342  O  OD1  . ASP A 1 40 ? -5.834  -1.803  1.742   1.00 0.00 ? 40  ASP A OD1  6  
ATOM   6343  O  OD2  . ASP A 1 40 ? -6.360  0.319   1.967   1.00 0.00 ? 40  ASP A OD2  6  
ATOM   6344  H  H    . ASP A 1 40 ? -4.101  0.799   -0.061  1.00 0.00 ? 40  ASP A H    6  
ATOM   6345  H  HA   . ASP A 1 40 ? -2.118  -0.555  1.635   1.00 0.00 ? 40  ASP A HA   6  
ATOM   6346  H  HB2  . ASP A 1 40 ? -3.831  -0.931  3.228   1.00 0.00 ? 40  ASP A HB2  6  
ATOM   6347  H  HB3  . ASP A 1 40 ? -4.048  0.731   2.686   1.00 0.00 ? 40  ASP A HB3  6  
ATOM   6348  N  N    . HIS A 1 41 ? -3.944  -1.882  -0.614  1.00 0.00 ? 41  HIS A N    6  
ATOM   6349  C  CA   . HIS A 1 41 ? -4.260  -3.109  -1.336  1.00 0.00 ? 41  HIS A CA   6  
ATOM   6350  C  C    . HIS A 1 41 ? -2.990  -3.781  -1.848  1.00 0.00 ? 41  HIS A C    6  
ATOM   6351  O  O    . HIS A 1 41 ? -2.807  -4.989  -1.691  1.00 0.00 ? 41  HIS A O    6  
ATOM   6352  C  CB   . HIS A 1 41 ? -5.199  -2.810  -2.505  1.00 0.00 ? 41  HIS A CB   6  
ATOM   6353  C  CG   . HIS A 1 41 ? -6.617  -2.567  -2.087  1.00 0.00 ? 41  HIS A CG   6  
ATOM   6354  N  ND1  . HIS A 1 41 ? -7.132  -3.001  -0.884  1.00 0.00 ? 41  HIS A ND1  6  
ATOM   6355  C  CD2  . HIS A 1 41 ? -7.629  -1.929  -2.720  1.00 0.00 ? 41  HIS A CD2  6  
ATOM   6356  C  CE1  . HIS A 1 41 ? -8.400  -2.642  -0.796  1.00 0.00 ? 41  HIS A CE1  6  
ATOM   6357  N  NE2  . HIS A 1 41 ? -8.726  -1.989  -1.897  1.00 0.00 ? 41  HIS A NE2  6  
ATOM   6358  H  H    . HIS A 1 41 ? -4.134  -1.017  -1.034  1.00 0.00 ? 41  HIS A H    6  
ATOM   6359  H  HA   . HIS A 1 41 ? -4.756  -3.779  -0.650  1.00 0.00 ? 41  HIS A HA   6  
ATOM   6360  H  HB2  . HIS A 1 41 ? -4.850  -1.928  -3.022  1.00 0.00 ? 41  HIS A HB2  6  
ATOM   6361  H  HB3  . HIS A 1 41 ? -5.192  -3.647  -3.188  1.00 0.00 ? 41  HIS A HB3  6  
ATOM   6362  H  HD1  . HIS A 1 41 ? -6.641  -3.499  -0.198  1.00 0.00 ? 41  HIS A HD1  6  
ATOM   6363  H  HD2  . HIS A 1 41 ? -7.583  -1.459  -3.693  1.00 0.00 ? 41  HIS A HD2  6  
ATOM   6364  H  HE1  . HIS A 1 41 ? -9.058  -2.846  0.035   1.00 0.00 ? 41  HIS A HE1  6  
ATOM   6365  N  N    . PHE A 1 42 ? -2.114  -2.992  -2.461  1.00 0.00 ? 42  PHE A N    6  
ATOM   6366  C  CA   . PHE A 1 42 ? -0.862  -3.511  -2.998  1.00 0.00 ? 42  PHE A CA   6  
ATOM   6367  C  C    . PHE A 1 42 ? 0.279   -3.313  -2.004  1.00 0.00 ? 42  PHE A C    6  
ATOM   6368  O  O    . PHE A 1 42 ? 0.153   -2.560  -1.040  1.00 0.00 ? 42  PHE A O    6  
ATOM   6369  C  CB   . PHE A 1 42 ? -0.525  -2.821  -4.322  1.00 0.00 ? 42  PHE A CB   6  
ATOM   6370  C  CG   . PHE A 1 42 ? -1.726  -2.562  -5.185  1.00 0.00 ? 42  PHE A CG   6  
ATOM   6371  C  CD1  . PHE A 1 42 ? -2.237  -3.558  -6.002  1.00 0.00 ? 42  PHE A CD1  6  
ATOM   6372  C  CD2  . PHE A 1 42 ? -2.344  -1.322  -5.181  1.00 0.00 ? 42  PHE A CD2  6  
ATOM   6373  C  CE1  . PHE A 1 42 ? -3.342  -3.323  -6.797  1.00 0.00 ? 42  PHE A CE1  6  
ATOM   6374  C  CE2  . PHE A 1 42 ? -3.450  -1.081  -5.975  1.00 0.00 ? 42  PHE A CE2  6  
ATOM   6375  C  CZ   . PHE A 1 42 ? -3.949  -2.082  -6.785  1.00 0.00 ? 42  PHE A CZ   6  
ATOM   6376  H  H    . PHE A 1 42 ? -2.316  -2.037  -2.556  1.00 0.00 ? 42  PHE A H    6  
ATOM   6377  H  HA   . PHE A 1 42 ? -0.990  -4.567  -3.175  1.00 0.00 ? 42  PHE A HA   6  
ATOM   6378  H  HB2  . PHE A 1 42 ? -0.054  -1.872  -4.115  1.00 0.00 ? 42  PHE A HB2  6  
ATOM   6379  H  HB3  . PHE A 1 42 ? 0.159   -3.443  -4.880  1.00 0.00 ? 42  PHE A HB3  6  
ATOM   6380  H  HD1  . PHE A 1 42 ? -1.763  -4.529  -6.013  1.00 0.00 ? 42  PHE A HD1  6  
ATOM   6381  H  HD2  . PHE A 1 42 ? -1.954  -0.537  -4.550  1.00 0.00 ? 42  PHE A HD2  6  
ATOM   6382  H  HE1  . PHE A 1 42 ? -3.730  -4.108  -7.429  1.00 0.00 ? 42  PHE A HE1  6  
ATOM   6383  H  HE2  . PHE A 1 42 ? -3.922  -0.110  -5.963  1.00 0.00 ? 42  PHE A HE2  6  
ATOM   6384  H  HZ   . PHE A 1 42 ? -4.813  -1.896  -7.405  1.00 0.00 ? 42  PHE A HZ   6  
ATOM   6385  N  N    . ASN A 1 43 ? 1.393   -3.997  -2.247  1.00 0.00 ? 43  ASN A N    6  
ATOM   6386  C  CA   . ASN A 1 43 ? 2.556   -3.899  -1.373  1.00 0.00 ? 43  ASN A CA   6  
ATOM   6387  C  C    . ASN A 1 43 ? 3.848   -3.913  -2.184  1.00 0.00 ? 43  ASN A C    6  
ATOM   6388  O  O    . ASN A 1 43 ? 3.919   -4.527  -3.249  1.00 0.00 ? 43  ASN A O    6  
ATOM   6389  C  CB   . ASN A 1 43 ? 2.561   -5.050  -0.365  1.00 0.00 ? 43  ASN A CB   6  
ATOM   6390  C  CG   . ASN A 1 43 ? 1.516   -4.872  0.720   1.00 0.00 ? 43  ASN A CG   6  
ATOM   6391  O  OD1  . ASN A 1 43 ? 0.348   -4.609  0.434   1.00 0.00 ? 43  ASN A OD1  6  
ATOM   6392  N  ND2  . ASN A 1 43 ? 1.933   -5.017  1.972   1.00 0.00 ? 43  ASN A ND2  6  
ATOM   6393  H  H    . ASN A 1 43 ? 1.433   -4.582  -3.032  1.00 0.00 ? 43  ASN A H    6  
ATOM   6394  H  HA   . ASN A 1 43 ? 2.490   -2.964  -0.838  1.00 0.00 ? 43  ASN A HA   6  
ATOM   6395  H  HB2  . ASN A 1 43 ? 2.360   -5.976  -0.884  1.00 0.00 ? 43  ASN A HB2  6  
ATOM   6396  H  HB3  . ASN A 1 43 ? 3.533   -5.107  0.102   1.00 0.00 ? 43  ASN A HB3  6  
ATOM   6397  H  HD21 . ASN A 1 43 ? 2.878   -5.227  2.125   1.00 0.00 ? 43  ASN A HD21 6  
ATOM   6398  H  HD22 . ASN A 1 43 ? 1.278   -4.908  2.693   1.00 0.00 ? 43  ASN A HD22 6  
ATOM   6399  N  N    . CYS A 1 44 ? 4.869   -3.233  -1.673  1.00 0.00 ? 44  CYS A N    6  
ATOM   6400  C  CA   . CYS A 1 44 ? 6.159   -3.166  -2.348  1.00 0.00 ? 44  CYS A CA   6  
ATOM   6401  C  C    . CYS A 1 44 ? 6.604   -4.551  -2.810  1.00 0.00 ? 44  CYS A C    6  
ATOM   6402  O  O    . CYS A 1 44 ? 6.210   -5.565  -2.234  1.00 0.00 ? 44  CYS A O    6  
ATOM   6403  C  CB   . CYS A 1 44 ? 7.214   -2.564  -1.418  1.00 0.00 ? 44  CYS A CB   6  
ATOM   6404  S  SG   . CYS A 1 44 ? 8.775   -2.125  -2.250  1.00 0.00 ? 44  CYS A SG   6  
ATOM   6405  H  H    . CYS A 1 44 ? 4.751   -2.763  -0.820  1.00 0.00 ? 44  CYS A H    6  
ATOM   6406  H  HA   . CYS A 1 44 ? 6.049   -2.530  -3.213  1.00 0.00 ? 44  CYS A HA   6  
ATOM   6407  H  HB2  . CYS A 1 44 ? 6.817   -1.664  -0.971  1.00 0.00 ? 44  CYS A HB2  6  
ATOM   6408  H  HB3  . CYS A 1 44 ? 7.445   -3.275  -0.639  1.00 0.00 ? 44  CYS A HB3  6  
ATOM   6409  N  N    . ALA A 1 45 ? 7.426   -4.585  -3.853  1.00 0.00 ? 45  ALA A N    6  
ATOM   6410  C  CA   . ALA A 1 45 ? 7.926   -5.844  -4.391  1.00 0.00 ? 45  ALA A CA   6  
ATOM   6411  C  C    . ALA A 1 45 ? 9.329   -6.144  -3.872  1.00 0.00 ? 45  ALA A C    6  
ATOM   6412  O  O    . ALA A 1 45 ? 9.767   -7.294  -3.870  1.00 0.00 ? 45  ALA A O    6  
ATOM   6413  C  CB   . ALA A 1 45 ? 7.920   -5.808  -5.912  1.00 0.00 ? 45  ALA A CB   6  
ATOM   6414  H  H    . ALA A 1 45 ? 7.705   -3.743  -4.270  1.00 0.00 ? 45  ALA A H    6  
ATOM   6415  H  HA   . ALA A 1 45 ? 7.259   -6.632  -4.071  1.00 0.00 ? 45  ALA A HA   6  
ATOM   6416  H  HB1  . ALA A 1 45 ? 8.938   -5.781  -6.274  1.00 0.00 ? 45  ALA A HB1  6  
ATOM   6417  H  HB2  . ALA A 1 45 ? 7.426   -6.690  -6.291  1.00 0.00 ? 45  ALA A HB2  6  
ATOM   6418  H  HB3  . ALA A 1 45 ? 7.395   -4.927  -6.248  1.00 0.00 ? 45  ALA A HB3  6  
ATOM   6419  N  N    . ASN A 1 46 ? 10.028  -5.103  -3.434  1.00 0.00 ? 46  ASN A N    6  
ATOM   6420  C  CA   . ASN A 1 46 ? 11.382  -5.255  -2.914  1.00 0.00 ? 46  ASN A CA   6  
ATOM   6421  C  C    . ASN A 1 46 ? 11.358  -5.694  -1.452  1.00 0.00 ? 46  ASN A C    6  
ATOM   6422  O  O    . ASN A 1 46 ? 11.758  -6.810  -1.121  1.00 0.00 ? 46  ASN A O    6  
ATOM   6423  C  CB   . ASN A 1 46 ? 12.154  -3.942  -3.051  1.00 0.00 ? 46  ASN A CB   6  
ATOM   6424  C  CG   . ASN A 1 46 ? 13.606  -4.078  -2.632  1.00 0.00 ? 46  ASN A CG   6  
ATOM   6425  O  OD1  . ASN A 1 46 ? 14.448  -4.528  -3.410  1.00 0.00 ? 46  ASN A OD1  6  
ATOM   6426  N  ND2  . ASN A 1 46 ? 13.904  -3.689  -1.398  1.00 0.00 ? 46  ASN A ND2  6  
ATOM   6427  H  H    . ASN A 1 46 ? 9.624   -4.210  -3.460  1.00 0.00 ? 46  ASN A H    6  
ATOM   6428  H  HA   . ASN A 1 46 ? 11.877  -6.016  -3.498  1.00 0.00 ? 46  ASN A HA   6  
ATOM   6429  H  HB2  . ASN A 1 46 ? 12.126  -3.620  -4.082  1.00 0.00 ? 46  ASN A HB2  6  
ATOM   6430  H  HB3  . ASN A 1 46 ? 11.689  -3.190  -2.431  1.00 0.00 ? 46  ASN A HB3  6  
ATOM   6431  H  HD21 . ASN A 1 46 ? 13.182  -3.340  -0.835  1.00 0.00 ? 46  ASN A HD21 6  
ATOM   6432  H  HD22 . ASN A 1 46 ? 14.835  -3.765  -1.102  1.00 0.00 ? 46  ASN A HD22 6  
ATOM   6433  N  N    . CYS A 1 47 ? 10.884  -4.808  -0.583  1.00 0.00 ? 47  CYS A N    6  
ATOM   6434  C  CA   . CYS A 1 47 ? 10.807  -5.102  0.843   1.00 0.00 ? 47  CYS A CA   6  
ATOM   6435  C  C    . CYS A 1 47 ? 9.538   -5.884  1.169   1.00 0.00 ? 47  CYS A C    6  
ATOM   6436  O  O    . CYS A 1 47 ? 9.554   -6.801  1.989   1.00 0.00 ? 47  CYS A O    6  
ATOM   6437  C  CB   . CYS A 1 47 ? 10.843  -3.805  1.655   1.00 0.00 ? 47  CYS A CB   6  
ATOM   6438  S  SG   . CYS A 1 47 ? 9.552   -2.605  1.196   1.00 0.00 ? 47  CYS A SG   6  
ATOM   6439  H  H    . CYS A 1 47 ? 10.580  -3.934  -0.907  1.00 0.00 ? 47  CYS A H    6  
ATOM   6440  H  HA   . CYS A 1 47 ? 11.663  -5.704  1.105   1.00 0.00 ? 47  CYS A HA   6  
ATOM   6441  H  HB2  . CYS A 1 47 ? 10.714  -4.041  2.702   1.00 0.00 ? 47  CYS A HB2  6  
ATOM   6442  H  HB3  . CYS A 1 47 ? 11.801  -3.328  1.515   1.00 0.00 ? 47  CYS A HB3  6  
ATOM   6443  N  N    . GLY A 1 48 ? 8.438   -5.514  0.520   1.00 0.00 ? 48  GLY A N    6  
ATOM   6444  C  CA   . GLY A 1 48 ? 7.175   -6.190  0.753   1.00 0.00 ? 48  GLY A CA   6  
ATOM   6445  C  C    . GLY A 1 48 ? 6.369   -5.546  1.864   1.00 0.00 ? 48  GLY A C    6  
ATOM   6446  O  O    . GLY A 1 48 ? 5.818   -6.236  2.722   1.00 0.00 ? 48  GLY A O    6  
ATOM   6447  H  H    . GLY A 1 48 ? 8.484   -4.775  -0.123  1.00 0.00 ? 48  GLY A H    6  
ATOM   6448  H  HA2  . GLY A 1 48 ? 6.595   -6.171  -0.157  1.00 0.00 ? 48  GLY A HA2  6  
ATOM   6449  H  HA3  . GLY A 1 48 ? 7.375   -7.218  1.019   1.00 0.00 ? 48  GLY A HA3  6  
ATOM   6450  N  N    . LYS A 1 49 ? 6.300   -4.220  1.850   1.00 0.00 ? 49  LYS A N    6  
ATOM   6451  C  CA   . LYS A 1 49 ? 5.556   -3.481  2.863   1.00 0.00 ? 49  LYS A CA   6  
ATOM   6452  C  C    . LYS A 1 49 ? 4.322   -2.820  2.257   1.00 0.00 ? 49  LYS A C    6  
ATOM   6453  O  O    . LYS A 1 49 ? 4.232   -2.649  1.042   1.00 0.00 ? 49  LYS A O    6  
ATOM   6454  C  CB   . LYS A 1 49 ? 6.450   -2.420  3.509   1.00 0.00 ? 49  LYS A CB   6  
ATOM   6455  C  CG   . LYS A 1 49 ? 6.629   -1.175  2.658   1.00 0.00 ? 49  LYS A CG   6  
ATOM   6456  C  CD   . LYS A 1 49 ? 7.246   -0.038  3.456   1.00 0.00 ? 49  LYS A CD   6  
ATOM   6457  C  CE   . LYS A 1 49 ? 6.186   0.763   4.195   1.00 0.00 ? 49  LYS A CE   6  
ATOM   6458  N  NZ   . LYS A 1 49 ? 6.616   2.170   4.428   1.00 0.00 ? 49  LYS A NZ   6  
ATOM   6459  H  H    . LYS A 1 49 ? 6.761   -3.725  1.139   1.00 0.00 ? 49  LYS A H    6  
ATOM   6460  H  HA   . LYS A 1 49 ? 5.240   -4.182  3.620   1.00 0.00 ? 49  LYS A HA   6  
ATOM   6461  H  HB2  . LYS A 1 49 ? 6.015   -2.126  4.453   1.00 0.00 ? 49  LYS A HB2  6  
ATOM   6462  H  HB3  . LYS A 1 49 ? 7.425   -2.850  3.690   1.00 0.00 ? 49  LYS A HB3  6  
ATOM   6463  H  HG2  . LYS A 1 49 ? 7.277   -1.409  1.826   1.00 0.00 ? 49  LYS A HG2  6  
ATOM   6464  H  HG3  . LYS A 1 49 ? 5.664   -0.861  2.288   1.00 0.00 ? 49  LYS A HG3  6  
ATOM   6465  H  HD2  . LYS A 1 49 ? 7.938   -0.449  4.176   1.00 0.00 ? 49  LYS A HD2  6  
ATOM   6466  H  HD3  . LYS A 1 49 ? 7.775   0.619   2.779   1.00 0.00 ? 49  LYS A HD3  6  
ATOM   6467  H  HE2  . LYS A 1 49 ? 5.280   0.765   3.608   1.00 0.00 ? 49  LYS A HE2  6  
ATOM   6468  H  HE3  . LYS A 1 49 ? 5.996   0.291   5.148   1.00 0.00 ? 49  LYS A HE3  6  
ATOM   6469  H  HZ1  . LYS A 1 49 ? 7.653   2.239   4.378   1.00 0.00 ? 49  LYS A HZ1  6  
ATOM   6470  H  HZ2  . LYS A 1 49 ? 6.303   2.488   5.367   1.00 0.00 ? 49  LYS A HZ2  6  
ATOM   6471  H  HZ3  . LYS A 1 49 ? 6.202   2.794   3.706   1.00 0.00 ? 49  LYS A HZ3  6  
ATOM   6472  N  N    . GLU A 1 50 ? 3.374   -2.451  3.113   1.00 0.00 ? 50  GLU A N    6  
ATOM   6473  C  CA   . GLU A 1 50 ? 2.146   -1.808  2.661   1.00 0.00 ? 50  GLU A CA   6  
ATOM   6474  C  C    . GLU A 1 50 ? 2.450   -0.496  1.945   1.00 0.00 ? 50  GLU A C    6  
ATOM   6475  O  O    . GLU A 1 50 ? 2.707   0.527   2.581   1.00 0.00 ? 50  GLU A O    6  
ATOM   6476  C  CB   . GLU A 1 50 ? 1.212   -1.551  3.846   1.00 0.00 ? 50  GLU A CB   6  
ATOM   6477  C  CG   . GLU A 1 50 ? -0.206  -1.189  3.437   1.00 0.00 ? 50  GLU A CG   6  
ATOM   6478  C  CD   . GLU A 1 50 ? -1.137  -1.047  4.625   1.00 0.00 ? 50  GLU A CD   6  
ATOM   6479  O  OE1  . GLU A 1 50 ? -1.585  -2.086  5.154   1.00 0.00 ? 50  GLU A OE1  6  
ATOM   6480  O  OE2  . GLU A 1 50 ? -1.419  0.102   5.025   1.00 0.00 ? 50  GLU A OE2  6  
ATOM   6481  H  H    . GLU A 1 50 ? 3.504   -2.614  4.071   1.00 0.00 ? 50  GLU A H    6  
ATOM   6482  H  HA   . GLU A 1 50 ? 1.657   -2.477  1.969   1.00 0.00 ? 50  GLU A HA   6  
ATOM   6483  H  HB2  . GLU A 1 50 ? 1.174   -2.440  4.458   1.00 0.00 ? 50  GLU A HB2  6  
ATOM   6484  H  HB3  . GLU A 1 50 ? 1.613   -0.738  4.434   1.00 0.00 ? 50  GLU A HB3  6  
ATOM   6485  H  HG2  . GLU A 1 50 ? -0.184  -0.252  2.902   1.00 0.00 ? 50  GLU A HG2  6  
ATOM   6486  H  HG3  . GLU A 1 50 ? -0.588  -1.964  2.789   1.00 0.00 ? 50  GLU A HG3  6  
ATOM   6487  N  N    . LEU A 1 51 ? 2.420   -0.533  0.617   1.00 0.00 ? 51  LEU A N    6  
ATOM   6488  C  CA   . LEU A 1 51 ? 2.692   0.653   -0.188  1.00 0.00 ? 51  LEU A CA   6  
ATOM   6489  C  C    . LEU A 1 51 ? 1.884   1.847   0.310   1.00 0.00 ? 51  LEU A C    6  
ATOM   6490  O  O    . LEU A 1 51 ? 1.048   1.716   1.205   1.00 0.00 ? 51  LEU A O    6  
ATOM   6491  C  CB   . LEU A 1 51 ? 2.369   0.381   -1.658  1.00 0.00 ? 51  LEU A CB   6  
ATOM   6492  C  CG   . LEU A 1 51 ? 3.321   -0.565  -2.391  1.00 0.00 ? 51  LEU A CG   6  
ATOM   6493  C  CD1  . LEU A 1 51 ? 2.744   -0.962  -3.740  1.00 0.00 ? 51  LEU A CD1  6  
ATOM   6494  C  CD2  . LEU A 1 51 ? 4.688   0.081   -2.562  1.00 0.00 ? 51  LEU A CD2  6  
ATOM   6495  H  H    . LEU A 1 51 ? 2.209   -1.376  0.167   1.00 0.00 ? 51  LEU A H    6  
ATOM   6496  H  HA   . LEU A 1 51 ? 3.744   0.882   -0.095  1.00 0.00 ? 51  LEU A HA   6  
ATOM   6497  H  HB2  . LEU A 1 51 ? 1.378   -0.044  -1.705  1.00 0.00 ? 51  LEU A HB2  6  
ATOM   6498  H  HB3  . LEU A 1 51 ? 2.377   1.329   -2.178  1.00 0.00 ? 51  LEU A HB3  6  
ATOM   6499  H  HG   . LEU A 1 51 ? 3.446   -1.465  -1.804  1.00 0.00 ? 51  LEU A HG   6  
ATOM   6500  H  HD11 . LEU A 1 51 ? 3.507   -0.874  -4.498  1.00 0.00 ? 51  LEU A HD11 6  
ATOM   6501  H  HD12 . LEU A 1 51 ? 1.917   -0.311  -3.984  1.00 0.00 ? 51  LEU A HD12 6  
ATOM   6502  H  HD13 . LEU A 1 51 ? 2.396   -1.984  -3.696  1.00 0.00 ? 51  LEU A HD13 6  
ATOM   6503  H  HD21 . LEU A 1 51 ? 4.868   0.763   -1.744  1.00 0.00 ? 51  LEU A HD21 6  
ATOM   6504  H  HD22 . LEU A 1 51 ? 4.715   0.623   -3.496  1.00 0.00 ? 51  LEU A HD22 6  
ATOM   6505  H  HD23 . LEU A 1 51 ? 5.449   -0.685  -2.567  1.00 0.00 ? 51  LEU A HD23 6  
ATOM   6506  N  N    . THR A 1 52 ? 2.137   3.013   -0.276  1.00 0.00 ? 52  THR A N    6  
ATOM   6507  C  CA   . THR A 1 52 ? 1.433   4.230   0.107   1.00 0.00 ? 52  THR A CA   6  
ATOM   6508  C  C    . THR A 1 52 ? 0.753   4.873   -1.096  1.00 0.00 ? 52  THR A C    6  
ATOM   6509  O  O    . THR A 1 52 ? 0.895   4.405   -2.226  1.00 0.00 ? 52  THR A O    6  
ATOM   6510  C  CB   . THR A 1 52 ? 2.389   5.253   0.749   1.00 0.00 ? 52  THR A CB   6  
ATOM   6511  O  OG1  . THR A 1 52 ? 3.513   5.480   -0.108  1.00 0.00 ? 52  THR A OG1  6  
ATOM   6512  C  CG2  . THR A 1 52 ? 2.870   4.765   2.107   1.00 0.00 ? 52  THR A CG2  6  
ATOM   6513  H  H    . THR A 1 52 ? 2.815   3.054   -0.983  1.00 0.00 ? 52  THR A H    6  
ATOM   6514  H  HA   . THR A 1 52 ? 0.681   3.965   0.835   1.00 0.00 ? 52  THR A HA   6  
ATOM   6515  H  HB   . THR A 1 52 ? 1.856   6.184   0.886   1.00 0.00 ? 52  THR A HB   6  
ATOM   6516  H  HG1  . THR A 1 52 ? 3.905   6.333   0.096   1.00 0.00 ? 52  THR A HG1  6  
ATOM   6517  H  HG21 . THR A 1 52 ? 2.818   3.687   2.142   1.00 0.00 ? 52  THR A HG21 6  
ATOM   6518  H  HG22 . THR A 1 52 ? 2.244   5.182   2.882   1.00 0.00 ? 52  THR A HG22 6  
ATOM   6519  H  HG23 . THR A 1 52 ? 3.891   5.081   2.261   1.00 0.00 ? 52  THR A HG23 6  
ATOM   6520  N  N    . ALA A 1 53 ? 0.014   5.949   -0.847  1.00 0.00 ? 53  ALA A N    6  
ATOM   6521  C  CA   . ALA A 1 53 ? -0.687  6.658   -1.911  1.00 0.00 ? 53  ALA A CA   6  
ATOM   6522  C  C    . ALA A 1 53 ? 0.295   7.225   -2.932  1.00 0.00 ? 53  ALA A C    6  
ATOM   6523  O  O    . ALA A 1 53 ? -0.001  7.283   -4.125  1.00 0.00 ? 53  ALA A O    6  
ATOM   6524  C  CB   . ALA A 1 53 ? -1.546  7.770   -1.328  1.00 0.00 ? 53  ALA A CB   6  
ATOM   6525  H  H    . ALA A 1 53 ? -0.061  6.274   0.074   1.00 0.00 ? 53  ALA A H    6  
ATOM   6526  H  HA   . ALA A 1 53 ? -1.340  5.955   -2.407  1.00 0.00 ? 53  ALA A HA   6  
ATOM   6527  H  HB1  . ALA A 1 53 ? -0.909  8.506   -0.858  1.00 0.00 ? 53  ALA A HB1  6  
ATOM   6528  H  HB2  . ALA A 1 53 ? -2.114  8.237   -2.118  1.00 0.00 ? 53  ALA A HB2  6  
ATOM   6529  H  HB3  . ALA A 1 53 ? -2.220  7.356   -0.594  1.00 0.00 ? 53  ALA A HB3  6  
ATOM   6530  N  N    . ASP A 1 54 ? 1.462   7.642   -2.454  1.00 0.00 ? 54  ASP A N    6  
ATOM   6531  C  CA   . ASP A 1 54 ? 2.487   8.204   -3.326  1.00 0.00 ? 54  ASP A CA   6  
ATOM   6532  C  C    . ASP A 1 54 ? 3.380   7.105   -3.894  1.00 0.00 ? 54  ASP A C    6  
ATOM   6533  O  O    . ASP A 1 54 ? 4.371   7.383   -4.568  1.00 0.00 ? 54  ASP A O    6  
ATOM   6534  C  CB   . ASP A 1 54 ? 3.335   9.222   -2.561  1.00 0.00 ? 54  ASP A CB   6  
ATOM   6535  C  CG   . ASP A 1 54 ? 2.530   10.428  -2.118  1.00 0.00 ? 54  ASP A CG   6  
ATOM   6536  O  OD1  . ASP A 1 54 ? 2.169   11.251  -2.984  1.00 0.00 ? 54  ASP A OD1  6  
ATOM   6537  O  OD2  . ASP A 1 54 ? 2.263   10.550  -0.904  1.00 0.00 ? 54  ASP A OD2  6  
ATOM   6538  H  H    . ASP A 1 54 ? 1.639   7.570   -1.493  1.00 0.00 ? 54  ASP A H    6  
ATOM   6539  H  HA   . ASP A 1 54 ? 1.990   8.705   -4.143  1.00 0.00 ? 54  ASP A HA   6  
ATOM   6540  H  HB2  . ASP A 1 54 ? 3.751   8.748   -1.684  1.00 0.00 ? 54  ASP A HB2  6  
ATOM   6541  H  HB3  . ASP A 1 54 ? 4.139   9.562   -3.197  1.00 0.00 ? 54  ASP A HB3  6  
ATOM   6542  N  N    . ALA A 1 55 ? 3.022   5.856   -3.615  1.00 0.00 ? 55  ALA A N    6  
ATOM   6543  C  CA   . ALA A 1 55 ? 3.789   4.715   -4.099  1.00 0.00 ? 55  ALA A CA   6  
ATOM   6544  C  C    . ALA A 1 55 ? 4.188   4.901   -5.559  1.00 0.00 ? 55  ALA A C    6  
ATOM   6545  O  O    . ALA A 1 55 ? 3.362   5.265   -6.397  1.00 0.00 ? 55  ALA A O    6  
ATOM   6546  C  CB   . ALA A 1 55 ? 2.991   3.431   -3.928  1.00 0.00 ? 55  ALA A CB   6  
ATOM   6547  H  H    . ALA A 1 55 ? 2.221   5.698   -3.073  1.00 0.00 ? 55  ALA A H    6  
ATOM   6548  H  HA   . ALA A 1 55 ? 4.685   4.637   -3.499  1.00 0.00 ? 55  ALA A HA   6  
ATOM   6549  H  HB1  . ALA A 1 55 ? 3.271   2.729   -4.699  1.00 0.00 ? 55  ALA A HB1  6  
ATOM   6550  H  HB2  . ALA A 1 55 ? 3.201   3.004   -2.958  1.00 0.00 ? 55  ALA A HB2  6  
ATOM   6551  H  HB3  . ALA A 1 55 ? 1.937   3.650   -4.005  1.00 0.00 ? 55  ALA A HB3  6  
ATOM   6552  N  N    . ARG A 1 56 ? 5.459   4.651   -5.857  1.00 0.00 ? 56  ARG A N    6  
ATOM   6553  C  CA   . ARG A 1 56 ? 5.967   4.793   -7.216  1.00 0.00 ? 56  ARG A CA   6  
ATOM   6554  C  C    . ARG A 1 56 ? 5.738   3.515   -8.019  1.00 0.00 ? 56  ARG A C    6  
ATOM   6555  O  O    . ARG A 1 56 ? 5.712   2.419   -7.462  1.00 0.00 ? 56  ARG A O    6  
ATOM   6556  C  CB   . ARG A 1 56 ? 7.458   5.133   -7.193  1.00 0.00 ? 56  ARG A CB   6  
ATOM   6557  C  CG   . ARG A 1 56 ? 7.777   6.425   -6.458  1.00 0.00 ? 56  ARG A CG   6  
ATOM   6558  C  CD   . ARG A 1 56 ? 7.480   7.643   -7.319  1.00 0.00 ? 56  ARG A CD   6  
ATOM   6559  N  NE   . ARG A 1 56 ? 8.329   8.780   -6.970  1.00 0.00 ? 56  ARG A NE   6  
ATOM   6560  C  CZ   . ARG A 1 56 ? 7.983   9.712   -6.089  1.00 0.00 ? 56  ARG A CZ   6  
ATOM   6561  N  NH1  . ARG A 1 56 ? 6.813   9.643   -5.470  1.00 0.00 ? 56  ARG A NH1  6  
ATOM   6562  N  NH2  . ARG A 1 56 ? 8.810   10.716  -5.825  1.00 0.00 ? 56  ARG A NH2  6  
ATOM   6563  H  H    . ARG A 1 56 ? 6.069   4.365   -5.146  1.00 0.00 ? 56  ARG A H    6  
ATOM   6564  H  HA   . ARG A 1 56 ? 5.429   5.602   -7.689  1.00 0.00 ? 56  ARG A HA   6  
ATOM   6565  H  HB2  . ARG A 1 56 ? 7.992   4.329   -6.709  1.00 0.00 ? 56  ARG A HB2  6  
ATOM   6566  H  HB3  . ARG A 1 56 ? 7.809   5.227   -8.209  1.00 0.00 ? 56  ARG A HB3  6  
ATOM   6567  H  HG2  . ARG A 1 56 ? 7.175   6.476   -5.562  1.00 0.00 ? 56  ARG A HG2  6  
ATOM   6568  H  HG3  . ARG A 1 56 ? 8.823   6.428   -6.193  1.00 0.00 ? 56  ARG A HG3  6  
ATOM   6569  H  HD2  . ARG A 1 56 ? 7.647   7.386   -8.354  1.00 0.00 ? 56  ARG A HD2  6  
ATOM   6570  H  HD3  . ARG A 1 56 ? 6.446   7.922   -7.180  1.00 0.00 ? 56  ARG A HD3  6  
ATOM   6571  H  HE   . ARG A 1 56 ? 9.198   8.850   -7.415  1.00 0.00 ? 56  ARG A HE   6  
ATOM   6572  H  HH11 . ARG A 1 56 ? 6.188   8.887   -5.667  1.00 0.00 ? 56  ARG A HH11 6  
ATOM   6573  H  HH12 . ARG A 1 56 ? 6.555   10.346  -4.807  1.00 0.00 ? 56  ARG A HH12 6  
ATOM   6574  H  HH21 . ARG A 1 56 ? 9.694   10.771  -6.289  1.00 0.00 ? 56  ARG A HH21 6  
ATOM   6575  H  HH22 . ARG A 1 56 ? 8.549   11.417  -5.162  1.00 0.00 ? 56  ARG A HH22 6  
ATOM   6576  N  N    . GLU A 1 57 ? 5.573   3.667   -9.329  1.00 0.00 ? 57  GLU A N    6  
ATOM   6577  C  CA   . GLU A 1 57 ? 5.345   2.525   -10.207 1.00 0.00 ? 57  GLU A CA   6  
ATOM   6578  C  C    . GLU A 1 57 ? 6.570   2.254   -11.075 1.00 0.00 ? 57  GLU A C    6  
ATOM   6579  O  O    . GLU A 1 57 ? 7.112   3.162   -11.707 1.00 0.00 ? 57  GLU A O    6  
ATOM   6580  C  CB   . GLU A 1 57 ? 4.123   2.771   -11.093 1.00 0.00 ? 57  GLU A CB   6  
ATOM   6581  C  CG   . GLU A 1 57 ? 3.850   1.647   -12.079 1.00 0.00 ? 57  GLU A CG   6  
ATOM   6582  C  CD   . GLU A 1 57 ? 2.884   2.054   -13.175 1.00 0.00 ? 57  GLU A CD   6  
ATOM   6583  O  OE1  . GLU A 1 57 ? 1.893   2.749   -12.865 1.00 0.00 ? 57  GLU A OE1  6  
ATOM   6584  O  OE2  . GLU A 1 57 ? 3.118   1.677   -14.342 1.00 0.00 ? 57  GLU A OE2  6  
ATOM   6585  H  H    . GLU A 1 57 ? 5.605   4.568   -9.714  1.00 0.00 ? 57  GLU A H    6  
ATOM   6586  H  HA   . GLU A 1 57 ? 5.161   1.662   -9.586  1.00 0.00 ? 57  GLU A HA   6  
ATOM   6587  H  HB2  . GLU A 1 57 ? 3.254   2.888   -10.463 1.00 0.00 ? 57  GLU A HB2  6  
ATOM   6588  H  HB3  . GLU A 1 57 ? 4.276   3.682   -11.652 1.00 0.00 ? 57  GLU A HB3  6  
ATOM   6589  H  HG2  . GLU A 1 57 ? 4.783   1.351   -12.535 1.00 0.00 ? 57  GLU A HG2  6  
ATOM   6590  H  HG3  . GLU A 1 57 ? 3.431   0.809   -11.543 1.00 0.00 ? 57  GLU A HG3  6  
ATOM   6591  N  N    . LEU A 1 58 ? 7.003   0.998   -11.101 1.00 0.00 ? 58  LEU A N    6  
ATOM   6592  C  CA   . LEU A 1 58 ? 8.165   0.605   -11.892 1.00 0.00 ? 58  LEU A CA   6  
ATOM   6593  C  C    . LEU A 1 58 ? 7.878   -0.664  -12.688 1.00 0.00 ? 58  LEU A C    6  
ATOM   6594  O  O    . LEU A 1 58 ? 7.437   -1.671  -12.135 1.00 0.00 ? 58  LEU A O    6  
ATOM   6595  C  CB   . LEU A 1 58 ? 9.375   0.387   -10.982 1.00 0.00 ? 58  LEU A CB   6  
ATOM   6596  C  CG   . LEU A 1 58 ? 10.220  1.625   -10.681 1.00 0.00 ? 58  LEU A CG   6  
ATOM   6597  C  CD1  . LEU A 1 58 ? 11.389  1.266   -9.776  1.00 0.00 ? 58  LEU A CD1  6  
ATOM   6598  C  CD2  . LEU A 1 58 ? 10.718  2.257   -11.972 1.00 0.00 ? 58  LEU A CD2  6  
ATOM   6599  H  H    . LEU A 1 58 ? 6.531   0.318   -10.578 1.00 0.00 ? 58  LEU A H    6  
ATOM   6600  H  HA   . LEU A 1 58 ? 8.383   1.407   -12.581 1.00 0.00 ? 58  LEU A HA   6  
ATOM   6601  H  HB2  . LEU A 1 58 ? 9.016   -0.004  -10.042 1.00 0.00 ? 58  LEU A HB2  6  
ATOM   6602  H  HB3  . LEU A 1 58 ? 10.015  -0.346  -11.454 1.00 0.00 ? 58  LEU A HB3  6  
ATOM   6603  H  HG   . LEU A 1 58 ? 9.610   2.353   -10.164 1.00 0.00 ? 58  LEU A HG   6  
ATOM   6604  H  HD11 . LEU A 1 58 ? 11.050  0.597   -8.999  1.00 0.00 ? 58  LEU A HD11 6  
ATOM   6605  H  HD12 . LEU A 1 58 ? 11.787  2.165   -9.329  1.00 0.00 ? 58  LEU A HD12 6  
ATOM   6606  H  HD13 . LEU A 1 58 ? 12.160  0.782   -10.358 1.00 0.00 ? 58  LEU A HD13 6  
ATOM   6607  H  HD21 . LEU A 1 58 ? 11.148  1.494   -12.604 1.00 0.00 ? 58  LEU A HD21 6  
ATOM   6608  H  HD22 . LEU A 1 58 ? 11.470  2.999   -11.743 1.00 0.00 ? 58  LEU A HD22 6  
ATOM   6609  H  HD23 . LEU A 1 58 ? 9.892   2.727   -12.485 1.00 0.00 ? 58  LEU A HD23 6  
ATOM   6610  N  N    . LYS A 1 59 ? 8.132   -0.608  -13.991 1.00 0.00 ? 59  LYS A N    6  
ATOM   6611  C  CA   . LYS A 1 59 ? 7.905   -1.753  -14.865 1.00 0.00 ? 59  LYS A CA   6  
ATOM   6612  C  C    . LYS A 1 59 ? 6.557   -2.403  -14.571 1.00 0.00 ? 59  LYS A C    6  
ATOM   6613  O  O    . LYS A 1 59 ? 6.438   -3.628  -14.555 1.00 0.00 ? 59  LYS A O    6  
ATOM   6614  C  CB   . LYS A 1 59 ? 9.027   -2.780  -14.696 1.00 0.00 ? 59  LYS A CB   6  
ATOM   6615  C  CG   . LYS A 1 59 ? 10.418  -2.195  -14.867 1.00 0.00 ? 59  LYS A CG   6  
ATOM   6616  C  CD   . LYS A 1 59 ? 10.661  -1.743  -16.297 1.00 0.00 ? 59  LYS A CD   6  
ATOM   6617  C  CE   . LYS A 1 59 ? 11.641  -0.581  -16.356 1.00 0.00 ? 59  LYS A CE   6  
ATOM   6618  N  NZ   . LYS A 1 59 ? 13.050  -1.049  -16.474 1.00 0.00 ? 59  LYS A NZ   6  
ATOM   6619  H  H    . LYS A 1 59 ? 8.483   0.224   -14.374 1.00 0.00 ? 59  LYS A H    6  
ATOM   6620  H  HA   . LYS A 1 59 ? 7.905   -1.397  -15.884 1.00 0.00 ? 59  LYS A HA   6  
ATOM   6621  H  HB2  . LYS A 1 59 ? 8.959   -3.210  -13.708 1.00 0.00 ? 59  LYS A HB2  6  
ATOM   6622  H  HB3  . LYS A 1 59 ? 8.896   -3.563  -15.430 1.00 0.00 ? 59  LYS A HB3  6  
ATOM   6623  H  HG2  . LYS A 1 59 ? 10.525  -1.345  -14.209 1.00 0.00 ? 59  LYS A HG2  6  
ATOM   6624  H  HG3  . LYS A 1 59 ? 11.150  -2.948  -14.608 1.00 0.00 ? 59  LYS A HG3  6  
ATOM   6625  H  HD2  . LYS A 1 59 ? 11.066  -2.569  -16.863 1.00 0.00 ? 59  LYS A HD2  6  
ATOM   6626  H  HD3  . LYS A 1 59 ? 9.721   -1.432  -16.732 1.00 0.00 ? 59  LYS A HD3  6  
ATOM   6627  H  HE2  . LYS A 1 59 ? 11.401  0.033   -17.211 1.00 0.00 ? 59  LYS A HE2  6  
ATOM   6628  H  HE3  . LYS A 1 59 ? 11.539  0.004   -15.453 1.00 0.00 ? 59  LYS A HE3  6  
ATOM   6629  H  HZ1  . LYS A 1 59 ? 13.561  -0.871  -15.586 1.00 0.00 ? 59  LYS A HZ1  6  
ATOM   6630  H  HZ2  . LYS A 1 59 ? 13.531  -0.542  -17.245 1.00 0.00 ? 59  LYS A HZ2  6  
ATOM   6631  H  HZ3  . LYS A 1 59 ? 13.072  -2.068  -16.677 1.00 0.00 ? 59  LYS A HZ3  6  
ATOM   6632  N  N    . GLY A 1 60 ? 5.544   -1.575  -14.339 1.00 0.00 ? 60  GLY A N    6  
ATOM   6633  C  CA   . GLY A 1 60 ? 4.217   -2.088  -14.049 1.00 0.00 ? 60  GLY A CA   6  
ATOM   6634  C  C    . GLY A 1 60 ? 4.004   -2.343  -12.570 1.00 0.00 ? 60  GLY A C    6  
ATOM   6635  O  O    . GLY A 1 60 ? 2.899   -2.171  -12.057 1.00 0.00 ? 60  GLY A O    6  
ATOM   6636  H  H    . GLY A 1 60 ? 5.698   -0.607  -14.364 1.00 0.00 ? 60  GLY A H    6  
ATOM   6637  H  HA2  . GLY A 1 60 ? 3.484   -1.373  -14.390 1.00 0.00 ? 60  GLY A HA2  6  
ATOM   6638  H  HA3  . GLY A 1 60 ? 4.078   -3.015  -14.586 1.00 0.00 ? 60  GLY A HA3  6  
ATOM   6639  N  N    . GLU A 1 61 ? 5.065   -2.757  -11.884 1.00 0.00 ? 61  GLU A N    6  
ATOM   6640  C  CA   . GLU A 1 61 ? 4.987   -3.039  -10.455 1.00 0.00 ? 61  GLU A CA   6  
ATOM   6641  C  C    . GLU A 1 61 ? 4.860   -1.748  -9.652  1.00 0.00 ? 61  GLU A C    6  
ATOM   6642  O  O    . GLU A 1 61 ? 4.913   -0.650  -10.208 1.00 0.00 ? 61  GLU A O    6  
ATOM   6643  C  CB   . GLU A 1 61 ? 6.223   -3.817  -9.998  1.00 0.00 ? 61  GLU A CB   6  
ATOM   6644  C  CG   . GLU A 1 61 ? 6.152   -5.304  -10.302 1.00 0.00 ? 61  GLU A CG   6  
ATOM   6645  C  CD   . GLU A 1 61 ? 5.441   -6.089  -9.217  1.00 0.00 ? 61  GLU A CD   6  
ATOM   6646  O  OE1  . GLU A 1 61 ? 5.268   -5.542  -8.107  1.00 0.00 ? 61  GLU A OE1  6  
ATOM   6647  O  OE2  . GLU A 1 61 ? 5.058   -7.249  -9.476  1.00 0.00 ? 61  GLU A OE2  6  
ATOM   6648  H  H    . GLU A 1 61 ? 5.919   -2.876  -12.349 1.00 0.00 ? 61  GLU A H    6  
ATOM   6649  H  HA   . GLU A 1 61 ? 4.109   -3.643  -10.284 1.00 0.00 ? 61  GLU A HA   6  
ATOM   6650  H  HB2  . GLU A 1 61 ? 7.093   -3.410  -10.492 1.00 0.00 ? 61  GLU A HB2  6  
ATOM   6651  H  HB3  . GLU A 1 61 ? 6.336   -3.695  -8.931  1.00 0.00 ? 61  GLU A HB3  6  
ATOM   6652  H  HG2  . GLU A 1 61 ? 5.622   -5.444  -11.232 1.00 0.00 ? 61  GLU A HG2  6  
ATOM   6653  H  HG3  . GLU A 1 61 ? 7.158   -5.687  -10.402 1.00 0.00 ? 61  GLU A HG3  6  
ATOM   6654  N  N    . LEU A 1 62 ? 4.691   -1.887  -8.342  1.00 0.00 ? 62  LEU A N    6  
ATOM   6655  C  CA   . LEU A 1 62 ? 4.556   -0.733  -7.461  1.00 0.00 ? 62  LEU A CA   6  
ATOM   6656  C  C    . LEU A 1 62 ? 5.470   -0.865  -6.246  1.00 0.00 ? 62  LEU A C    6  
ATOM   6657  O  O    . LEU A 1 62 ? 5.350   -1.810  -5.466  1.00 0.00 ? 62  LEU A O    6  
ATOM   6658  C  CB   . LEU A 1 62 ? 3.103   -0.581  -7.006  1.00 0.00 ? 62  LEU A CB   6  
ATOM   6659  C  CG   . LEU A 1 62 ? 2.105   -0.153  -8.082  1.00 0.00 ? 62  LEU A CG   6  
ATOM   6660  C  CD1  . LEU A 1 62 ? 0.682   -0.463  -7.644  1.00 0.00 ? 62  LEU A CD1  6  
ATOM   6661  C  CD2  . LEU A 1 62 ? 2.258   1.329   -8.394  1.00 0.00 ? 62  LEU A CD2  6  
ATOM   6662  H  H    . LEU A 1 62 ? 4.657   -2.787  -7.957  1.00 0.00 ? 62  LEU A H    6  
ATOM   6663  H  HA   . LEU A 1 62 ? 4.844   0.146   -8.019  1.00 0.00 ? 62  LEU A HA   6  
ATOM   6664  H  HB2  . LEU A 1 62 ? 2.779   -1.532  -6.613  1.00 0.00 ? 62  LEU A HB2  6  
ATOM   6665  H  HB3  . LEU A 1 62 ? 3.080   0.159   -6.219  1.00 0.00 ? 62  LEU A HB3  6  
ATOM   6666  H  HG   . LEU A 1 62 ? 2.303   -0.708  -8.989  1.00 0.00 ? 62  LEU A HG   6  
ATOM   6667  H  HD11 . LEU A 1 62 ? 0.695   -0.875  -6.647  1.00 0.00 ? 62  LEU A HD11 6  
ATOM   6668  H  HD12 . LEU A 1 62 ? 0.244   -1.179  -8.324  1.00 0.00 ? 62  LEU A HD12 6  
ATOM   6669  H  HD13 . LEU A 1 62 ? 0.097   0.445   -7.652  1.00 0.00 ? 62  LEU A HD13 6  
ATOM   6670  H  HD21 . LEU A 1 62 ? 3.268   1.640   -8.170  1.00 0.00 ? 62  LEU A HD21 6  
ATOM   6671  H  HD22 . LEU A 1 62 ? 1.564   1.896   -7.791  1.00 0.00 ? 62  LEU A HD22 6  
ATOM   6672  H  HD23 . LEU A 1 62 ? 2.051   1.500   -9.439  1.00 0.00 ? 62  LEU A HD23 6  
ATOM   6673  N  N    . TYR A 1 63 ? 6.380   0.090   -6.091  1.00 0.00 ? 63  TYR A N    6  
ATOM   6674  C  CA   . TYR A 1 63 ? 7.314   0.081   -4.971  1.00 0.00 ? 63  TYR A CA   6  
ATOM   6675  C  C    . TYR A 1 63 ? 7.095   1.291   -4.069  1.00 0.00 ? 63  TYR A C    6  
ATOM   6676  O  O    . TYR A 1 63 ? 6.490   2.283   -4.477  1.00 0.00 ? 63  TYR A O    6  
ATOM   6677  C  CB   . TYR A 1 63 ? 8.756   0.066   -5.483  1.00 0.00 ? 63  TYR A CB   6  
ATOM   6678  C  CG   . TYR A 1 63 ? 9.084   -1.141  -6.332  1.00 0.00 ? 63  TYR A CG   6  
ATOM   6679  C  CD1  . TYR A 1 63 ? 8.760   -1.173  -7.683  1.00 0.00 ? 63  TYR A CD1  6  
ATOM   6680  C  CD2  . TYR A 1 63 ? 9.717   -2.250  -5.784  1.00 0.00 ? 63  TYR A CD2  6  
ATOM   6681  C  CE1  . TYR A 1 63 ? 9.058   -2.273  -8.464  1.00 0.00 ? 63  TYR A CE1  6  
ATOM   6682  C  CE2  . TYR A 1 63 ? 10.019  -3.354  -6.557  1.00 0.00 ? 63  TYR A CE2  6  
ATOM   6683  C  CZ   . TYR A 1 63 ? 9.688   -3.361  -7.896  1.00 0.00 ? 63  TYR A CZ   6  
ATOM   6684  O  OH   . TYR A 1 63 ? 9.986   -4.460  -8.669  1.00 0.00 ? 63  TYR A OH   6  
ATOM   6685  H  H    . TYR A 1 63 ? 6.427   0.818   -6.746  1.00 0.00 ? 63  TYR A H    6  
ATOM   6686  H  HA   . TYR A 1 63 ? 7.136   -0.818  -4.399  1.00 0.00 ? 63  TYR A HA   6  
ATOM   6687  H  HB2  . TYR A 1 63 ? 8.928   0.947   -6.080  1.00 0.00 ? 63  TYR A HB2  6  
ATOM   6688  H  HB3  . TYR A 1 63 ? 9.430   0.071   -4.639  1.00 0.00 ? 63  TYR A HB3  6  
ATOM   6689  H  HD1  . TYR A 1 63 ? 8.267   -0.319  -8.125  1.00 0.00 ? 63  TYR A HD1  6  
ATOM   6690  H  HD2  . TYR A 1 63 ? 9.975   -2.241  -4.735  1.00 0.00 ? 63  TYR A HD2  6  
ATOM   6691  H  HE1  . TYR A 1 63 ? 8.799   -2.279  -9.512  1.00 0.00 ? 63  TYR A HE1  6  
ATOM   6692  H  HE2  . TYR A 1 63 ? 10.512  -4.207  -6.113  1.00 0.00 ? 63  TYR A HE2  6  
ATOM   6693  H  HH   . TYR A 1 63 ? 9.347   -4.533  -9.382  1.00 0.00 ? 63  TYR A HH   6  
ATOM   6694  N  N    . CYS A 1 64 ? 7.593   1.203   -2.840  1.00 0.00 ? 64  CYS A N    6  
ATOM   6695  C  CA   . CYS A 1 64 ? 7.454   2.289   -1.878  1.00 0.00 ? 64  CYS A CA   6  
ATOM   6696  C  C    . CYS A 1 64 ? 8.544   3.338   -2.081  1.00 0.00 ? 64  CYS A C    6  
ATOM   6697  O  O    . CYS A 1 64 ? 9.646   3.026   -2.534  1.00 0.00 ? 64  CYS A O    6  
ATOM   6698  C  CB   . CYS A 1 64 ? 7.515   1.745   -0.450  1.00 0.00 ? 64  CYS A CB   6  
ATOM   6699  S  SG   . CYS A 1 64 ? 9.154   1.116   0.037   1.00 0.00 ? 64  CYS A SG   6  
ATOM   6700  H  H    . CYS A 1 64 ? 8.067   0.386   -2.574  1.00 0.00 ? 64  CYS A H    6  
ATOM   6701  H  HA   . CYS A 1 64 ? 6.492   2.752   -2.037  1.00 0.00 ? 64  CYS A HA   6  
ATOM   6702  H  HB2  . CYS A 1 64 ? 7.248   2.533   0.239   1.00 0.00 ? 64  CYS A HB2  6  
ATOM   6703  H  HB3  . CYS A 1 64 ? 6.808   0.934   -0.352  1.00 0.00 ? 64  CYS A HB3  6  
ATOM   6704  N  N    . LEU A 1 65 ? 8.228   4.584   -1.743  1.00 0.00 ? 65  LEU A N    6  
ATOM   6705  C  CA   . LEU A 1 65 ? 9.180   5.680   -1.887  1.00 0.00 ? 65  LEU A CA   6  
ATOM   6706  C  C    . LEU A 1 65 ? 10.568  5.262   -1.412  1.00 0.00 ? 65  LEU A C    6  
ATOM   6707  O  O    . LEU A 1 65 ? 11.572  5.464   -2.095  1.00 0.00 ? 65  LEU A O    6  
ATOM   6708  C  CB   . LEU A 1 65 ? 8.705   6.901   -1.097  1.00 0.00 ? 65  LEU A CB   6  
ATOM   6709  C  CG   . LEU A 1 65 ? 7.850   7.907   -1.868  1.00 0.00 ? 65  LEU A CG   6  
ATOM   6710  C  CD1  . LEU A 1 65 ? 8.693   8.650   -2.893  1.00 0.00 ? 65  LEU A CD1  6  
ATOM   6711  C  CD2  . LEU A 1 65 ? 6.680   7.207   -2.544  1.00 0.00 ? 65  LEU A CD2  6  
ATOM   6712  H  H    . LEU A 1 65 ? 7.335   4.772   -1.388  1.00 0.00 ? 65  LEU A H    6  
ATOM   6713  H  HA   . LEU A 1 65 ? 9.233   5.937   -2.934  1.00 0.00 ? 65  LEU A HA   6  
ATOM   6714  H  HB2  . LEU A 1 65 ? 8.124   6.547   -0.260  1.00 0.00 ? 65  LEU A HB2  6  
ATOM   6715  H  HB3  . LEU A 1 65 ? 9.580   7.419   -0.733  1.00 0.00 ? 65  LEU A HB3  6  
ATOM   6716  H  HG   . LEU A 1 65 ? 7.450   8.636   -1.176  1.00 0.00 ? 65  LEU A HG   6  
ATOM   6717  H  HD11 . LEU A 1 65 ? 8.943   9.629   -2.513  1.00 0.00 ? 65  LEU A HD11 6  
ATOM   6718  H  HD12 . LEU A 1 65 ? 8.136   8.752   -3.813  1.00 0.00 ? 65  LEU A HD12 6  
ATOM   6719  H  HD13 . LEU A 1 65 ? 9.600   8.094   -3.083  1.00 0.00 ? 65  LEU A HD13 6  
ATOM   6720  H  HD21 . LEU A 1 65 ? 6.281   6.454   -1.881  1.00 0.00 ? 65  LEU A HD21 6  
ATOM   6721  H  HD22 . LEU A 1 65 ? 7.020   6.739   -3.457  1.00 0.00 ? 65  LEU A HD22 6  
ATOM   6722  H  HD23 . LEU A 1 65 ? 5.912   7.929   -2.774  1.00 0.00 ? 65  LEU A HD23 6  
ATOM   6723  N  N    . PRO A 1 66 ? 10.628  4.663   -0.213  1.00 0.00 ? 66  PRO A N    6  
ATOM   6724  C  CA   . PRO A 1 66 ? 11.887  4.201   0.379   1.00 0.00 ? 66  PRO A CA   6  
ATOM   6725  C  C    . PRO A 1 66 ? 12.729  3.396   -0.605  1.00 0.00 ? 66  PRO A C    6  
ATOM   6726  O  O    . PRO A 1 66 ? 13.876  3.745   -0.888  1.00 0.00 ? 66  PRO A O    6  
ATOM   6727  C  CB   . PRO A 1 66 ? 11.429  3.316   1.541   1.00 0.00 ? 66  PRO A CB   6  
ATOM   6728  C  CG   . PRO A 1 66 ? 10.084  3.839   1.907   1.00 0.00 ? 66  PRO A CG   6  
ATOM   6729  C  CD   . PRO A 1 66 ? 9.472   4.390   0.656   1.00 0.00 ? 66  PRO A CD   6  
ATOM   6730  H  HA   . PRO A 1 66 ? 12.472  5.026   0.761   1.00 0.00 ? 66  PRO A HA   6  
ATOM   6731  H  HB2  . PRO A 1 66 ? 11.379  2.287   1.214   1.00 0.00 ? 66  PRO A HB2  6  
ATOM   6732  H  HB3  . PRO A 1 66 ? 12.125  3.405   2.362   1.00 0.00 ? 66  PRO A HB3  6  
ATOM   6733  H  HG2  . PRO A 1 66 ? 9.471   3.037   2.292   1.00 0.00 ? 66  PRO A HG2  6  
ATOM   6734  H  HG3  . PRO A 1 66 ? 10.183  4.624   2.642   1.00 0.00 ? 66  PRO A HG3  6  
ATOM   6735  H  HD2  . PRO A 1 66 ? 8.816   3.658   0.208   1.00 0.00 ? 66  PRO A HD2  6  
ATOM   6736  H  HD3  . PRO A 1 66 ? 8.931   5.299   0.875   1.00 0.00 ? 66  PRO A HD3  6  
ATOM   6737  N  N    . CYS A 1 67 ? 12.154  2.317   -1.124  1.00 0.00 ? 67  CYS A N    6  
ATOM   6738  C  CA   . CYS A 1 67 ? 12.851  1.461   -2.076  1.00 0.00 ? 67  CYS A CA   6  
ATOM   6739  C  C    . CYS A 1 67 ? 13.098  2.198   -3.390  1.00 0.00 ? 67  CYS A C    6  
ATOM   6740  O  O    . CYS A 1 67 ? 14.228  2.262   -3.875  1.00 0.00 ? 67  CYS A O    6  
ATOM   6741  C  CB   . CYS A 1 67 ? 12.043  0.188   -2.337  1.00 0.00 ? 67  CYS A CB   6  
ATOM   6742  S  SG   . CYS A 1 67 ? 12.151  -1.047  -1.003  1.00 0.00 ? 67  CYS A SG   6  
ATOM   6743  H  H    . CYS A 1 67 ? 11.237  2.089   -0.860  1.00 0.00 ? 67  CYS A H    6  
ATOM   6744  H  HA   . CYS A 1 67 ? 13.803  1.191   -1.645  1.00 0.00 ? 67  CYS A HA   6  
ATOM   6745  H  HB2  . CYS A 1 67 ? 11.002  0.450   -2.457  1.00 0.00 ? 67  CYS A HB2  6  
ATOM   6746  H  HB3  . CYS A 1 67 ? 12.399  -0.276  -3.245  1.00 0.00 ? 67  CYS A HB3  6  
ATOM   6747  N  N    . HIS A 1 68 ? 12.033  2.752   -3.961  1.00 0.00 ? 68  HIS A N    6  
ATOM   6748  C  CA   . HIS A 1 68 ? 12.134  3.485   -5.218  1.00 0.00 ? 68  HIS A CA   6  
ATOM   6749  C  C    . HIS A 1 68 ? 13.427  4.293   -5.273  1.00 0.00 ? 68  HIS A C    6  
ATOM   6750  O  O    . HIS A 1 68 ? 14.038  4.433   -6.333  1.00 0.00 ? 68  HIS A O    6  
ATOM   6751  C  CB   . HIS A 1 68 ? 10.931  4.413   -5.389  1.00 0.00 ? 68  HIS A CB   6  
ATOM   6752  C  CG   . HIS A 1 68 ? 10.730  4.879   -6.798  1.00 0.00 ? 68  HIS A CG   6  
ATOM   6753  N  ND1  . HIS A 1 68 ? 10.962  6.178   -7.201  1.00 0.00 ? 68  HIS A ND1  6  
ATOM   6754  C  CD2  . HIS A 1 68 ? 10.319  4.212   -7.902  1.00 0.00 ? 68  HIS A CD2  6  
ATOM   6755  C  CE1  . HIS A 1 68 ? 10.700  6.289   -8.491  1.00 0.00 ? 68  HIS A CE1  6  
ATOM   6756  N  NE2  . HIS A 1 68 ? 10.309  5.110   -8.940  1.00 0.00 ? 68  HIS A NE2  6  
ATOM   6757  H  H    . HIS A 1 68 ? 11.159  2.666   -3.526  1.00 0.00 ? 68  HIS A H    6  
ATOM   6758  H  HA   . HIS A 1 68 ? 12.140  2.765   -6.022  1.00 0.00 ? 68  HIS A HA   6  
ATOM   6759  H  HB2  . HIS A 1 68 ? 10.036  3.892   -5.082  1.00 0.00 ? 68  HIS A HB2  6  
ATOM   6760  H  HB3  . HIS A 1 68 ? 11.066  5.285   -4.766  1.00 0.00 ? 68  HIS A HB3  6  
ATOM   6761  H  HD1  . HIS A 1 68 ? 11.270  6.909   -6.627  1.00 0.00 ? 68  HIS A HD1  6  
ATOM   6762  H  HD2  . HIS A 1 68 ? 10.049  3.167   -7.956  1.00 0.00 ? 68  HIS A HD2  6  
ATOM   6763  H  HE1  . HIS A 1 68 ? 10.791  7.190   -9.079  1.00 0.00 ? 68  HIS A HE1  6  
ATOM   6764  N  N    . ASP A 1 69 ? 13.837  4.823   -4.126  1.00 0.00 ? 69  ASP A N    6  
ATOM   6765  C  CA   . ASP A 1 69 ? 15.057  5.617   -4.044  1.00 0.00 ? 69  ASP A CA   6  
ATOM   6766  C  C    . ASP A 1 69 ? 16.291  4.739   -4.229  1.00 0.00 ? 69  ASP A C    6  
ATOM   6767  O  O    . ASP A 1 69 ? 17.218  5.096   -4.956  1.00 0.00 ? 69  ASP A O    6  
ATOM   6768  C  CB   . ASP A 1 69 ? 15.130  6.343   -2.699  1.00 0.00 ? 69  ASP A CB   6  
ATOM   6769  C  CG   . ASP A 1 69 ? 14.429  7.687   -2.728  1.00 0.00 ? 69  ASP A CG   6  
ATOM   6770  O  OD1  . ASP A 1 69 ? 14.668  8.460   -3.680  1.00 0.00 ? 69  ASP A OD1  6  
ATOM   6771  O  OD2  . ASP A 1 69 ? 13.642  7.965   -1.800  1.00 0.00 ? 69  ASP A OD2  6  
ATOM   6772  H  H    . ASP A 1 69 ? 13.306  4.676   -3.315  1.00 0.00 ? 69  ASP A H    6  
ATOM   6773  H  HA   . ASP A 1 69 ? 15.030  6.349   -4.836  1.00 0.00 ? 69  ASP A HA   6  
ATOM   6774  H  HB2  . ASP A 1 69 ? 14.662  5.731   -1.942  1.00 0.00 ? 69  ASP A HB2  6  
ATOM   6775  H  HB3  . ASP A 1 69 ? 16.166  6.502   -2.439  1.00 0.00 ? 69  ASP A HB3  6  
ATOM   6776  N  N    . LYS A 1 70 ? 16.296  3.587   -3.565  1.00 0.00 ? 70  LYS A N    6  
ATOM   6777  C  CA   . LYS A 1 70 ? 17.414  2.657   -3.655  1.00 0.00 ? 70  LYS A CA   6  
ATOM   6778  C  C    . LYS A 1 70 ? 17.647  2.224   -5.100  1.00 0.00 ? 70  LYS A C    6  
ATOM   6779  O  O    . LYS A 1 70 ? 18.786  2.155   -5.561  1.00 0.00 ? 70  LYS A O    6  
ATOM   6780  C  CB   . LYS A 1 70 ? 17.155  1.429   -2.780  1.00 0.00 ? 70  LYS A CB   6  
ATOM   6781  C  CG   . LYS A 1 70 ? 17.485  1.647   -1.313  1.00 0.00 ? 70  LYS A CG   6  
ATOM   6782  C  CD   . LYS A 1 70 ? 16.288  2.187   -0.547  1.00 0.00 ? 70  LYS A CD   6  
ATOM   6783  C  CE   . LYS A 1 70 ? 16.625  2.425   0.917   1.00 0.00 ? 70  LYS A CE   6  
ATOM   6784  N  NZ   . LYS A 1 70 ? 17.454  3.648   1.104   1.00 0.00 ? 70  LYS A NZ   6  
ATOM   6785  H  H    . LYS A 1 70 ? 15.527  3.358   -3.001  1.00 0.00 ? 70  LYS A H    6  
ATOM   6786  H  HA   . LYS A 1 70 ? 18.298  3.164   -3.297  1.00 0.00 ? 70  LYS A HA   6  
ATOM   6787  H  HB2  . LYS A 1 70 ? 16.112  1.161   -2.857  1.00 0.00 ? 70  LYS A HB2  6  
ATOM   6788  H  HB3  . LYS A 1 70 ? 17.756  0.608   -3.144  1.00 0.00 ? 70  LYS A HB3  6  
ATOM   6789  H  HG2  . LYS A 1 70 ? 17.783  0.706   -0.876  1.00 0.00 ? 70  LYS A HG2  6  
ATOM   6790  H  HG3  . LYS A 1 70 ? 18.298  2.355   -1.238  1.00 0.00 ? 70  LYS A HG3  6  
ATOM   6791  H  HD2  . LYS A 1 70 ? 15.980  3.122   -0.990  1.00 0.00 ? 70  LYS A HD2  6  
ATOM   6792  H  HD3  . LYS A 1 70 ? 15.480  1.472   -0.610  1.00 0.00 ? 70  LYS A HD3  6  
ATOM   6793  H  HE2  . LYS A 1 70 ? 15.706  2.535   1.471   1.00 0.00 ? 70  LYS A HE2  6  
ATOM   6794  H  HE3  . LYS A 1 70 ? 17.171  1.570   1.291   1.00 0.00 ? 70  LYS A HE3  6  
ATOM   6795  H  HZ1  . LYS A 1 70 ? 17.688  4.065   0.180   1.00 0.00 ? 70  LYS A HZ1  6  
ATOM   6796  H  HZ2  . LYS A 1 70 ? 18.337  3.410   1.598   1.00 0.00 ? 70  LYS A HZ2  6  
ATOM   6797  H  HZ3  . LYS A 1 70 ? 16.932  4.350   1.667   1.00 0.00 ? 70  LYS A HZ3  6  
ATOM   6798  N  N    . MET A 1 71 ? 16.561  1.935   -5.808  1.00 0.00 ? 71  MET A N    6  
ATOM   6799  C  CA   . MET A 1 71 ? 16.647  1.512   -7.201  1.00 0.00 ? 71  MET A CA   6  
ATOM   6800  C  C    . MET A 1 71 ? 17.694  2.329   -7.953  1.00 0.00 ? 71  MET A C    6  
ATOM   6801  O  O    . MET A 1 71 ? 18.560  1.774   -8.629  1.00 0.00 ? 71  MET A O    6  
ATOM   6802  C  CB   . MET A 1 71 ? 15.286  1.653   -7.885  1.00 0.00 ? 71  MET A CB   6  
ATOM   6803  C  CG   . MET A 1 71 ? 14.185  0.845   -7.218  1.00 0.00 ? 71  MET A CG   6  
ATOM   6804  S  SD   . MET A 1 71 ? 14.444  -0.934  -7.362  1.00 0.00 ? 71  MET A SD   6  
ATOM   6805  C  CE   . MET A 1 71 ? 13.107  -1.554  -6.344  1.00 0.00 ? 71  MET A CE   6  
ATOM   6806  H  H    . MET A 1 71 ? 15.679  2.009   -5.386  1.00 0.00 ? 71  MET A H    6  
ATOM   6807  H  HA   . MET A 1 71 ? 16.941  0.473   -7.214  1.00 0.00 ? 71  MET A HA   6  
ATOM   6808  H  HB2  . MET A 1 71 ? 14.997  2.693   -7.874  1.00 0.00 ? 71  MET A HB2  6  
ATOM   6809  H  HB3  . MET A 1 71 ? 15.375  1.323   -8.909  1.00 0.00 ? 71  MET A HB3  6  
ATOM   6810  H  HG2  . MET A 1 71 ? 14.149  1.105   -6.171  1.00 0.00 ? 71  MET A HG2  6  
ATOM   6811  H  HG3  . MET A 1 71 ? 13.242  1.097   -7.682  1.00 0.00 ? 71  MET A HG3  6  
ATOM   6812  H  HE1  . MET A 1 71 ? 12.575  -2.326  -6.879  1.00 0.00 ? 71  MET A HE1  6  
ATOM   6813  H  HE2  . MET A 1 71 ? 13.511  -1.962  -5.429  1.00 0.00 ? 71  MET A HE2  6  
ATOM   6814  H  HE3  . MET A 1 71 ? 12.429  -0.746  -6.110  1.00 0.00 ? 71  MET A HE3  6  
ATOM   6815  N  N    . GLY A 1 72 ? 17.607  3.650   -7.831  1.00 0.00 ? 72  GLY A N    6  
ATOM   6816  C  CA   . GLY A 1 72 ? 18.553  4.521   -8.505  1.00 0.00 ? 72  GLY A CA   6  
ATOM   6817  C  C    . GLY A 1 72 ? 19.953  4.406   -7.937  1.00 0.00 ? 72  GLY A C    6  
ATOM   6818  O  O    . GLY A 1 72 ? 20.363  5.217   -7.107  1.00 0.00 ? 72  GLY A O    6  
ATOM   6819  H  H    . GLY A 1 72 ? 16.896  4.037   -7.279  1.00 0.00 ? 72  GLY A H    6  
ATOM   6820  H  HA2  . GLY A 1 72 ? 18.578  4.263   -9.554  1.00 0.00 ? 72  GLY A HA2  6  
ATOM   6821  H  HA3  . GLY A 1 72 ? 18.218  5.543   -8.404  1.00 0.00 ? 72  GLY A HA3  6  
ATOM   6822  N  N    . VAL A 1 73 ? 20.691  3.394   -8.385  1.00 0.00 ? 73  VAL A N    6  
ATOM   6823  C  CA   . VAL A 1 73 ? 22.054  3.176   -7.915  1.00 0.00 ? 73  VAL A CA   6  
ATOM   6824  C  C    . VAL A 1 73 ? 23.064  3.878   -8.815  1.00 0.00 ? 73  VAL A C    6  
ATOM   6825  O  O    . VAL A 1 73 ? 22.711  4.401   -9.872  1.00 0.00 ? 73  VAL A O    6  
ATOM   6826  C  CB   . VAL A 1 73 ? 22.392  1.674   -7.855  1.00 0.00 ? 73  VAL A CB   6  
ATOM   6827  C  CG1  . VAL A 1 73 ? 21.457  0.954   -6.895  1.00 0.00 ? 73  VAL A CG1  6  
ATOM   6828  C  CG2  . VAL A 1 73 ? 22.324  1.057   -9.243  1.00 0.00 ? 73  VAL A CG2  6  
ATOM   6829  H  H    . VAL A 1 73 ? 20.309  2.781   -9.047  1.00 0.00 ? 73  VAL A H    6  
ATOM   6830  H  HA   . VAL A 1 73 ? 22.132  3.582   -6.917  1.00 0.00 ? 73  VAL A HA   6  
ATOM   6831  H  HB   . VAL A 1 73 ? 23.402  1.568   -7.486  1.00 0.00 ? 73  VAL A HB   6  
ATOM   6832  H  HG11 . VAL A 1 73 ? 22.039  0.393   -6.179  1.00 0.00 ? 73  VAL A HG11 6  
ATOM   6833  H  HG12 . VAL A 1 73 ? 20.846  1.678   -6.376  1.00 0.00 ? 73  VAL A HG12 6  
ATOM   6834  H  HG13 . VAL A 1 73 ? 20.823  0.279   -7.451  1.00 0.00 ? 73  VAL A HG13 6  
ATOM   6835  H  HG21 . VAL A 1 73 ? 22.421  -0.016  -9.164  1.00 0.00 ? 73  VAL A HG21 6  
ATOM   6836  H  HG22 . VAL A 1 73 ? 21.375  1.300   -9.699  1.00 0.00 ? 73  VAL A HG22 6  
ATOM   6837  H  HG23 . VAL A 1 73 ? 23.126  1.448   -9.851  1.00 0.00 ? 73  VAL A HG23 6  
ATOM   6838  N  N    . SER A 1 74 ? 24.323  3.884   -8.389  1.00 0.00 ? 74  SER A N    6  
ATOM   6839  C  CA   . SER A 1 74 ? 25.386  4.525   -9.155  1.00 0.00 ? 74  SER A CA   6  
ATOM   6840  C  C    . SER A 1 74 ? 26.376  3.490   -9.682  1.00 0.00 ? 74  SER A C    6  
ATOM   6841  O  O    . SER A 1 74 ? 26.640  3.421   -10.881 1.00 0.00 ? 74  SER A O    6  
ATOM   6842  C  CB   . SER A 1 74 ? 26.117  5.554   -8.291  1.00 0.00 ? 74  SER A CB   6  
ATOM   6843  O  OG   . SER A 1 74 ? 27.328  5.965   -8.902  1.00 0.00 ? 74  SER A OG   6  
ATOM   6844  H  H    . SER A 1 74 ? 24.542  3.450   -7.538  1.00 0.00 ? 74  SER A H    6  
ATOM   6845  H  HA   . SER A 1 74 ? 24.931  5.030   -9.994  1.00 0.00 ? 74  SER A HA   6  
ATOM   6846  H  HB2  . SER A 1 74 ? 25.486  6.419   -8.154  1.00 0.00 ? 74  SER A HB2  6  
ATOM   6847  H  HB3  . SER A 1 74 ? 26.343  5.117   -7.329  1.00 0.00 ? 74  SER A HB3  6  
ATOM   6848  H  HG   . SER A 1 74 ? 27.324  6.919   -9.011  1.00 0.00 ? 74  SER A HG   6  
ATOM   6849  N  N    . GLY A 1 75 ? 26.922  2.687   -8.773  1.00 0.00 ? 75  GLY A N    6  
ATOM   6850  C  CA   . GLY A 1 75 ? 27.877  1.666   -9.164  1.00 0.00 ? 75  GLY A CA   6  
ATOM   6851  C  C    . GLY A 1 75 ? 29.207  2.252   -9.595  1.00 0.00 ? 75  GLY A C    6  
ATOM   6852  O  O    . GLY A 1 75 ? 29.454  3.451   -9.463  1.00 0.00 ? 75  GLY A O    6  
ATOM   6853  H  H    . GLY A 1 75 ? 26.674  2.788   -7.830  1.00 0.00 ? 75  GLY A H    6  
ATOM   6854  H  HA2  . GLY A 1 75 ? 28.041  1.004   -8.327  1.00 0.00 ? 75  GLY A HA2  6  
ATOM   6855  H  HA3  . GLY A 1 75 ? 27.464  1.098   -9.984  1.00 0.00 ? 75  GLY A HA3  6  
ATOM   6856  N  N    . PRO A 1 76 ? 30.092  1.394   -10.123 1.00 0.00 ? 76  PRO A N    6  
ATOM   6857  C  CA   . PRO A 1 76 ? 31.419  1.810   -10.585 1.00 0.00 ? 76  PRO A CA   6  
ATOM   6858  C  C    . PRO A 1 76 ? 31.353  2.668   -11.844 1.00 0.00 ? 76  PRO A C    6  
ATOM   6859  O  O    . PRO A 1 76 ? 32.223  3.505   -12.082 1.00 0.00 ? 76  PRO A O    6  
ATOM   6860  C  CB   . PRO A 1 76 ? 32.124  0.483   -10.880 1.00 0.00 ? 76  PRO A CB   6  
ATOM   6861  C  CG   . PRO A 1 76 ? 31.022  -0.475  -11.172 1.00 0.00 ? 76  PRO A CG   6  
ATOM   6862  C  CD   . PRO A 1 76 ? 29.864  -0.049  -10.312 1.00 0.00 ? 76  PRO A CD   6  
ATOM   6863  H  HA   . PRO A 1 76 ? 31.958  2.343   -9.815  1.00 0.00 ? 76  PRO A HA   6  
ATOM   6864  H  HB2  . PRO A 1 76 ? 32.781  0.603   -11.730 1.00 0.00 ? 76  PRO A HB2  6  
ATOM   6865  H  HB3  . PRO A 1 76 ? 32.696  0.176   -10.017 1.00 0.00 ? 76  PRO A HB3  6  
ATOM   6866  H  HG2  . PRO A 1 76 ? 30.754  -0.419  -12.216 1.00 0.00 ? 76  PRO A HG2  6  
ATOM   6867  H  HG3  . PRO A 1 76 ? 31.330  -1.478  -10.915 1.00 0.00 ? 76  PRO A HG3  6  
ATOM   6868  H  HD2  . PRO A 1 76 ? 28.929  -0.229  -10.821 1.00 0.00 ? 76  PRO A HD2  6  
ATOM   6869  H  HD3  . PRO A 1 76 ? 29.886  -0.569  -9.365  1.00 0.00 ? 76  PRO A HD3  6  
ATOM   6870  N  N    . SER A 1 77 ? 30.314  2.456   -12.645 1.00 0.00 ? 77  SER A N    6  
ATOM   6871  C  CA   . SER A 1 77 ? 30.135  3.209   -13.881 1.00 0.00 ? 77  SER A CA   6  
ATOM   6872  C  C    . SER A 1 77 ? 29.881  4.684   -13.587 1.00 0.00 ? 77  SER A C    6  
ATOM   6873  O  O    . SER A 1 77 ? 28.769  5.076   -13.236 1.00 0.00 ? 77  SER A O    6  
ATOM   6874  C  CB   . SER A 1 77 ? 28.973  2.631   -14.692 1.00 0.00 ? 77  SER A CB   6  
ATOM   6875  O  OG   . SER A 1 77 ? 27.740  2.818   -14.019 1.00 0.00 ? 77  SER A OG   6  
ATOM   6876  H  H    . SER A 1 77 ? 29.653  1.774   -12.400 1.00 0.00 ? 77  SER A H    6  
ATOM   6877  H  HA   . SER A 1 77 ? 31.044  3.120   -14.457 1.00 0.00 ? 77  SER A HA   6  
ATOM   6878  H  HB2  . SER A 1 77 ? 28.926  3.125   -15.650 1.00 0.00 ? 77  SER A HB2  6  
ATOM   6879  H  HB3  . SER A 1 77 ? 29.133  1.573   -14.840 1.00 0.00 ? 77  SER A HB3  6  
ATOM   6880  H  HG   . SER A 1 77 ? 27.314  1.967   -13.889 1.00 0.00 ? 77  SER A HG   6  
ATOM   6881  N  N    . SER A 1 78 ? 30.922  5.498   -13.734 1.00 0.00 ? 78  SER A N    6  
ATOM   6882  C  CA   . SER A 1 78 ? 30.814  6.930   -13.480 1.00 0.00 ? 78  SER A CA   6  
ATOM   6883  C  C    . SER A 1 78 ? 29.458  7.461   -13.934 1.00 0.00 ? 78  SER A C    6  
ATOM   6884  O  O    . SER A 1 78 ? 28.985  7.137   -15.023 1.00 0.00 ? 78  SER A O    6  
ATOM   6885  C  CB   . SER A 1 78 ? 31.936  7.682   -14.198 1.00 0.00 ? 78  SER A CB   6  
ATOM   6886  O  OG   . SER A 1 78 ? 31.747  7.661   -15.603 1.00 0.00 ? 78  SER A OG   6  
ATOM   6887  H  H    . SER A 1 78 ? 31.784  5.125   -14.016 1.00 0.00 ? 78  SER A H    6  
ATOM   6888  H  HA   . SER A 1 78 ? 30.911  7.086   -12.416 1.00 0.00 ? 78  SER A HA   6  
ATOM   6889  H  HB2  . SER A 1 78 ? 31.950  8.708   -13.864 1.00 0.00 ? 78  SER A HB2  6  
ATOM   6890  H  HB3  . SER A 1 78 ? 32.883  7.216   -13.968 1.00 0.00 ? 78  SER A HB3  6  
ATOM   6891  H  HG   . SER A 1 78 ? 31.131  6.962   -15.833 1.00 0.00 ? 78  SER A HG   6  
ATOM   6892  N  N    . GLY A 1 79 ? 28.838  8.281   -13.091 1.00 0.00 ? 79  GLY A N    6  
ATOM   6893  C  CA   . GLY A 1 79 ? 27.543  8.844   -13.422 1.00 0.00 ? 79  GLY A CA   6  
ATOM   6894  C  C    . GLY A 1 79 ? 27.389  10.271  -12.933 1.00 0.00 ? 79  GLY A C    6  
ATOM   6895  O  O    . GLY A 1 79 ? 27.247  10.479  -11.729 1.00 0.00 ? 79  GLY A O    6  
ATOM   6896  H  H    . GLY A 1 79 ? 29.264  8.504   -12.237 1.00 0.00 ? 79  GLY A H    6  
ATOM   6897  H  HA2  . GLY A 1 79 ? 27.418  8.827   -14.494 1.00 0.00 ? 79  GLY A HA2  6  
ATOM   6898  H  HA3  . GLY A 1 79 ? 26.772  8.237   -12.970 1.00 0.00 ? 79  GLY A HA3  6  
HETATM 6899  ZN ZN   . ZN  B 2 .  ? -9.733  -0.279  -2.391  1.00 0.00 ? 201 ZN  A ZN   6  
HETATM 6900  ZN ZN   . ZN  C 2 .  ? 9.873   -1.034  -0.499  1.00 0.00 ? 401 ZN  A ZN   6  
ATOM   6901  N  N    . GLY A 1 1  ? -31.131 -10.873 -30.584 1.00 0.00 ? 1   GLY A N    7  
ATOM   6902  C  CA   . GLY A 1 1  ? -29.756 -10.520 -30.282 1.00 0.00 ? 1   GLY A CA   7  
ATOM   6903  C  C    . GLY A 1 1  ? -29.352 -10.912 -28.875 1.00 0.00 ? 1   GLY A C    7  
ATOM   6904  O  O    . GLY A 1 1  ? -29.637 -12.023 -28.427 1.00 0.00 ? 1   GLY A O    7  
ATOM   6905  H  H1   . GLY A 1 1  ? -31.491 -11.733 -30.283 1.00 0.00 ? 1   GLY A H1   7  
ATOM   6906  H  HA2  . GLY A 1 1  ? -29.106 -11.018 -30.985 1.00 0.00 ? 1   GLY A HA2  7  
ATOM   6907  H  HA3  . GLY A 1 1  ? -29.638 -9.451  -30.393 1.00 0.00 ? 1   GLY A HA3  7  
ATOM   6908  N  N    . SER A 1 2  ? -28.683 -10.000 -28.177 1.00 0.00 ? 2   SER A N    7  
ATOM   6909  C  CA   . SER A 1 2  ? -28.234 -10.259 -26.814 1.00 0.00 ? 2   SER A CA   7  
ATOM   6910  C  C    . SER A 1 2  ? -28.146 -8.962  -26.015 1.00 0.00 ? 2   SER A C    7  
ATOM   6911  O  O    . SER A 1 2  ? -28.071 -7.874  -26.585 1.00 0.00 ? 2   SER A O    7  
ATOM   6912  C  CB   . SER A 1 2  ? -26.872 -10.957 -26.828 1.00 0.00 ? 2   SER A CB   7  
ATOM   6913  O  OG   . SER A 1 2  ? -25.827 -10.030 -27.067 1.00 0.00 ? 2   SER A OG   7  
ATOM   6914  H  H    . SER A 1 2  ? -28.486 -9.133  -28.589 1.00 0.00 ? 2   SER A H    7  
ATOM   6915  H  HA   . SER A 1 2  ? -28.957 -10.909 -26.344 1.00 0.00 ? 2   SER A HA   7  
ATOM   6916  H  HB2  . SER A 1 2  ? -26.705 -11.432 -25.873 1.00 0.00 ? 2   SER A HB2  7  
ATOM   6917  H  HB3  . SER A 1 2  ? -26.861 -11.703 -27.608 1.00 0.00 ? 2   SER A HB3  7  
ATOM   6918  H  HG   . SER A 1 2  ? -25.467 -10.173 -27.945 1.00 0.00 ? 2   SER A HG   7  
ATOM   6919  N  N    . SER A 1 3  ? -28.155 -9.088  -24.692 1.00 0.00 ? 3   SER A N    7  
ATOM   6920  C  CA   . SER A 1 3  ? -28.081 -7.926  -23.814 1.00 0.00 ? 3   SER A CA   7  
ATOM   6921  C  C    . SER A 1 3  ? -27.060 -8.151  -22.702 1.00 0.00 ? 3   SER A C    7  
ATOM   6922  O  O    . SER A 1 3  ? -26.523 -9.247  -22.549 1.00 0.00 ? 3   SER A O    7  
ATOM   6923  C  CB   . SER A 1 3  ? -29.454 -7.629  -23.208 1.00 0.00 ? 3   SER A CB   7  
ATOM   6924  O  OG   . SER A 1 3  ? -30.200 -6.758  -24.040 1.00 0.00 ? 3   SER A OG   7  
ATOM   6925  H  H    . SER A 1 3  ? -28.217 -9.983  -24.298 1.00 0.00 ? 3   SER A H    7  
ATOM   6926  H  HA   . SER A 1 3  ? -27.768 -7.081  -24.408 1.00 0.00 ? 3   SER A HA   7  
ATOM   6927  H  HB2  . SER A 1 3  ? -30.000 -8.552  -23.091 1.00 0.00 ? 3   SER A HB2  7  
ATOM   6928  H  HB3  . SER A 1 3  ? -29.325 -7.162  -22.242 1.00 0.00 ? 3   SER A HB3  7  
ATOM   6929  H  HG   . SER A 1 3  ? -29.887 -6.832  -24.945 1.00 0.00 ? 3   SER A HG   7  
ATOM   6930  N  N    . GLY A 1 4  ? -26.797 -7.102  -21.928 1.00 0.00 ? 4   GLY A N    7  
ATOM   6931  C  CA   . GLY A 1 4  ? -25.841 -7.204  -20.840 1.00 0.00 ? 4   GLY A CA   7  
ATOM   6932  C  C    . GLY A 1 4  ? -25.169 -5.881  -20.533 1.00 0.00 ? 4   GLY A C    7  
ATOM   6933  O  O    . GLY A 1 4  ? -24.400 -5.365  -21.343 1.00 0.00 ? 4   GLY A O    7  
ATOM   6934  H  H    . GLY A 1 4  ? -27.255 -6.253  -22.097 1.00 0.00 ? 4   GLY A H    7  
ATOM   6935  H  HA2  . GLY A 1 4  ? -26.355 -7.550  -19.956 1.00 0.00 ? 4   GLY A HA2  7  
ATOM   6936  H  HA3  . GLY A 1 4  ? -25.083 -7.926  -21.109 1.00 0.00 ? 4   GLY A HA3  7  
ATOM   6937  N  N    . SER A 1 5  ? -25.461 -5.329  -19.359 1.00 0.00 ? 5   SER A N    7  
ATOM   6938  C  CA   . SER A 1 5  ? -24.884 -4.054  -18.949 1.00 0.00 ? 5   SER A CA   7  
ATOM   6939  C  C    . SER A 1 5  ? -24.844 -3.941  -17.428 1.00 0.00 ? 5   SER A C    7  
ATOM   6940  O  O    . SER A 1 5  ? -25.384 -4.788  -16.717 1.00 0.00 ? 5   SER A O    7  
ATOM   6941  C  CB   . SER A 1 5  ? -25.688 -2.893  -19.538 1.00 0.00 ? 5   SER A CB   7  
ATOM   6942  O  OG   . SER A 1 5  ? -25.688 -2.940  -20.954 1.00 0.00 ? 5   SER A OG   7  
ATOM   6943  H  H    . SER A 1 5  ? -26.082 -5.789  -18.757 1.00 0.00 ? 5   SER A H    7  
ATOM   6944  H  HA   . SER A 1 5  ? -23.874 -4.011  -19.328 1.00 0.00 ? 5   SER A HA   7  
ATOM   6945  H  HB2  . SER A 1 5  ? -26.707 -2.950  -19.188 1.00 0.00 ? 5   SER A HB2  7  
ATOM   6946  H  HB3  . SER A 1 5  ? -25.250 -1.958  -19.220 1.00 0.00 ? 5   SER A HB3  7  
ATOM   6947  H  HG   . SER A 1 5  ? -25.025 -2.334  -21.295 1.00 0.00 ? 5   SER A HG   7  
ATOM   6948  N  N    . SER A 1 6  ? -24.200 -2.887  -16.937 1.00 0.00 ? 6   SER A N    7  
ATOM   6949  C  CA   . SER A 1 6  ? -24.085 -2.663  -15.501 1.00 0.00 ? 6   SER A CA   7  
ATOM   6950  C  C    . SER A 1 6  ? -25.179 -1.719  -15.009 1.00 0.00 ? 6   SER A C    7  
ATOM   6951  O  O    . SER A 1 6  ? -25.874 -2.010  -14.036 1.00 0.00 ? 6   SER A O    7  
ATOM   6952  C  CB   . SER A 1 6  ? -22.709 -2.088  -15.161 1.00 0.00 ? 6   SER A CB   7  
ATOM   6953  O  OG   . SER A 1 6  ? -22.323 -2.433  -13.842 1.00 0.00 ? 6   SER A OG   7  
ATOM   6954  H  H    . SER A 1 6  ? -23.790 -2.247  -17.555 1.00 0.00 ? 6   SER A H    7  
ATOM   6955  H  HA   . SER A 1 6  ? -24.199 -3.616  -15.006 1.00 0.00 ? 6   SER A HA   7  
ATOM   6956  H  HB2  . SER A 1 6  ? -21.977 -2.479  -15.851 1.00 0.00 ? 6   SER A HB2  7  
ATOM   6957  H  HB3  . SER A 1 6  ? -22.741 -1.011  -15.244 1.00 0.00 ? 6   SER A HB3  7  
ATOM   6958  H  HG   . SER A 1 6  ? -22.073 -1.640  -13.363 1.00 0.00 ? 6   SER A HG   7  
ATOM   6959  N  N    . GLY A 1 7  ? -25.324 -0.586  -15.690 1.00 0.00 ? 7   GLY A N    7  
ATOM   6960  C  CA   . GLY A 1 7  ? -26.334 0.384   -15.308 1.00 0.00 ? 7   GLY A CA   7  
ATOM   6961  C  C    . GLY A 1 7  ? -26.045 1.024   -13.965 1.00 0.00 ? 7   GLY A C    7  
ATOM   6962  O  O    . GLY A 1 7  ? -26.919 1.087   -13.101 1.00 0.00 ? 7   GLY A O    7  
ATOM   6963  H  H    . GLY A 1 7  ? -24.741 -0.408  -16.457 1.00 0.00 ? 7   GLY A H    7  
ATOM   6964  H  HA2  . GLY A 1 7  ? -26.378 1.156   -16.062 1.00 0.00 ? 7   GLY A HA2  7  
ATOM   6965  H  HA3  . GLY A 1 7  ? -27.293 -0.112  -15.259 1.00 0.00 ? 7   GLY A HA3  7  
ATOM   6966  N  N    . GLU A 1 8  ? -24.816 1.498   -13.789 1.00 0.00 ? 8   GLU A N    7  
ATOM   6967  C  CA   . GLU A 1 8  ? -24.414 2.133   -12.540 1.00 0.00 ? 8   GLU A CA   7  
ATOM   6968  C  C    . GLU A 1 8  ? -23.674 3.441   -12.808 1.00 0.00 ? 8   GLU A C    7  
ATOM   6969  O  O    . GLU A 1 8  ? -22.553 3.440   -13.317 1.00 0.00 ? 8   GLU A O    7  
ATOM   6970  C  CB   . GLU A 1 8  ? -23.528 1.190   -11.724 1.00 0.00 ? 8   GLU A CB   7  
ATOM   6971  C  CG   . GLU A 1 8  ? -24.250 -0.054  -11.236 1.00 0.00 ? 8   GLU A CG   7  
ATOM   6972  C  CD   . GLU A 1 8  ? -23.405 -0.887  -10.291 1.00 0.00 ? 8   GLU A CD   7  
ATOM   6973  O  OE1  . GLU A 1 8  ? -23.325 -0.531  -9.097  1.00 0.00 ? 8   GLU A OE1  7  
ATOM   6974  O  OE2  . GLU A 1 8  ? -22.824 -1.894  -10.747 1.00 0.00 ? 8   GLU A OE2  7  
ATOM   6975  H  H    . GLU A 1 8  ? -24.164 1.417   -14.516 1.00 0.00 ? 8   GLU A H    7  
ATOM   6976  H  HA   . GLU A 1 8  ? -25.309 2.350   -11.975 1.00 0.00 ? 8   GLU A HA   7  
ATOM   6977  H  HB2  . GLU A 1 8  ? -22.693 0.881   -12.335 1.00 0.00 ? 8   GLU A HB2  7  
ATOM   6978  H  HB3  . GLU A 1 8  ? -23.153 1.724   -10.862 1.00 0.00 ? 8   GLU A HB3  7  
ATOM   6979  H  HG2  . GLU A 1 8  ? -25.150 0.246   -10.720 1.00 0.00 ? 8   GLU A HG2  7  
ATOM   6980  H  HG3  . GLU A 1 8  ? -24.512 -0.661  -12.091 1.00 0.00 ? 8   GLU A HG3  7  
ATOM   6981  N  N    . LYS A 1 9  ? -24.309 4.555   -12.462 1.00 0.00 ? 9   LYS A N    7  
ATOM   6982  C  CA   . LYS A 1 9  ? -23.713 5.870   -12.664 1.00 0.00 ? 9   LYS A CA   7  
ATOM   6983  C  C    . LYS A 1 9  ? -24.058 6.807   -11.510 1.00 0.00 ? 9   LYS A C    7  
ATOM   6984  O  O    . LYS A 1 9  ? -25.206 6.867   -11.069 1.00 0.00 ? 9   LYS A O    7  
ATOM   6985  C  CB   . LYS A 1 9  ? -24.193 6.474   -13.985 1.00 0.00 ? 9   LYS A CB   7  
ATOM   6986  C  CG   . LYS A 1 9  ? -23.305 6.130   -15.169 1.00 0.00 ? 9   LYS A CG   7  
ATOM   6987  C  CD   . LYS A 1 9  ? -24.034 6.326   -16.488 1.00 0.00 ? 9   LYS A CD   7  
ATOM   6988  C  CE   . LYS A 1 9  ? -23.067 6.645   -17.617 1.00 0.00 ? 9   LYS A CE   7  
ATOM   6989  N  NZ   . LYS A 1 9  ? -23.763 7.234   -18.794 1.00 0.00 ? 9   LYS A NZ   7  
ATOM   6990  H  H    . LYS A 1 9  ? -25.202 4.491   -12.060 1.00 0.00 ? 9   LYS A H    7  
ATOM   6991  H  HA   . LYS A 1 9  ? -22.642 5.746   -12.703 1.00 0.00 ? 9   LYS A HA   7  
ATOM   6992  H  HB2  . LYS A 1 9  ? -25.189 6.111   -14.192 1.00 0.00 ? 9   LYS A HB2  7  
ATOM   6993  H  HB3  . LYS A 1 9  ? -24.225 7.549   -13.886 1.00 0.00 ? 9   LYS A HB3  7  
ATOM   6994  H  HG2  . LYS A 1 9  ? -22.436 6.770   -15.152 1.00 0.00 ? 9   LYS A HG2  7  
ATOM   6995  H  HG3  . LYS A 1 9  ? -22.997 5.098   -15.088 1.00 0.00 ? 9   LYS A HG3  7  
ATOM   6996  H  HD2  . LYS A 1 9  ? -24.568 5.419   -16.732 1.00 0.00 ? 9   LYS A HD2  7  
ATOM   6997  H  HD3  . LYS A 1 9  ? -24.735 7.142   -16.384 1.00 0.00 ? 9   LYS A HD3  7  
ATOM   6998  H  HE2  . LYS A 1 9  ? -22.331 7.347   -17.256 1.00 0.00 ? 9   LYS A HE2  7  
ATOM   6999  H  HE3  . LYS A 1 9  ? -22.575 5.732   -17.920 1.00 0.00 ? 9   LYS A HE3  7  
ATOM   7000  H  HZ1  . LYS A 1 9  ? -24.793 7.206   -18.651 1.00 0.00 ? 9   LYS A HZ1  7  
ATOM   7001  H  HZ2  . LYS A 1 9  ? -23.530 6.697   -19.653 1.00 0.00 ? 9   LYS A HZ2  7  
ATOM   7002  H  HZ3  . LYS A 1 9  ? -23.469 8.223   -18.926 1.00 0.00 ? 9   LYS A HZ3  7  
ATOM   7003  N  N    . ALA A 1 10 ? -23.058 7.537   -11.027 1.00 0.00 ? 10  ALA A N    7  
ATOM   7004  C  CA   . ALA A 1 10 ? -23.257 8.472   -9.927  1.00 0.00 ? 10  ALA A CA   7  
ATOM   7005  C  C    . ALA A 1 10 ? -22.030 9.356   -9.729  1.00 0.00 ? 10  ALA A C    7  
ATOM   7006  O  O    . ALA A 1 10 ? -20.970 8.880   -9.322  1.00 0.00 ? 10  ALA A O    7  
ATOM   7007  C  CB   . ALA A 1 10 ? -23.580 7.719   -8.645  1.00 0.00 ? 10  ALA A CB   7  
ATOM   7008  H  H    . ALA A 1 10 ? -22.166 7.444   -11.420 1.00 0.00 ? 10  ALA A H    7  
ATOM   7009  H  HA   . ALA A 1 10 ? -24.104 9.098   -10.171 1.00 0.00 ? 10  ALA A HA   7  
ATOM   7010  H  HB1  . ALA A 1 10 ? -24.590 7.338   -8.697  1.00 0.00 ? 10  ALA A HB1  7  
ATOM   7011  H  HB2  . ALA A 1 10 ? -22.890 6.897   -8.527  1.00 0.00 ? 10  ALA A HB2  7  
ATOM   7012  H  HB3  . ALA A 1 10 ? -23.491 8.389   -7.803  1.00 0.00 ? 10  ALA A HB3  7  
ATOM   7013  N  N    . ARG A 1 11 ? -22.181 10.644  -10.020 1.00 0.00 ? 11  ARG A N    7  
ATOM   7014  C  CA   . ARG A 1 11 ? -21.084 11.593  -9.876  1.00 0.00 ? 11  ARG A CA   7  
ATOM   7015  C  C    . ARG A 1 11 ? -21.521 12.809  -9.064  1.00 0.00 ? 11  ARG A C    7  
ATOM   7016  O  O    . ARG A 1 11 ? -22.667 13.248  -9.152  1.00 0.00 ? 11  ARG A O    7  
ATOM   7017  C  CB   . ARG A 1 11 ? -20.582 12.038  -11.251 1.00 0.00 ? 11  ARG A CB   7  
ATOM   7018  C  CG   . ARG A 1 11 ? -19.894 10.932  -12.034 1.00 0.00 ? 11  ARG A CG   7  
ATOM   7019  C  CD   . ARG A 1 11 ? -19.534 11.387  -13.440 1.00 0.00 ? 11  ARG A CD   7  
ATOM   7020  N  NE   . ARG A 1 11 ? -19.495 10.273  -14.383 1.00 0.00 ? 11  ARG A NE   7  
ATOM   7021  C  CZ   . ARG A 1 11 ? -19.578 10.422  -15.700 1.00 0.00 ? 11  ARG A CZ   7  
ATOM   7022  N  NH1  . ARG A 1 11 ? -19.703 11.632  -16.228 1.00 0.00 ? 11  ARG A NH1  7  
ATOM   7023  N  NH2  . ARG A 1 11 ? -19.536 9.359   -16.494 1.00 0.00 ? 11  ARG A NH2  7  
ATOM   7024  H  H    . ARG A 1 11 ? -23.051 10.963  -10.340 1.00 0.00 ? 11  ARG A H    7  
ATOM   7025  H  HA   . ARG A 1 11 ? -20.281 11.096  -9.353  1.00 0.00 ? 11  ARG A HA   7  
ATOM   7026  H  HB2  . ARG A 1 11 ? -21.422 12.391  -11.831 1.00 0.00 ? 11  ARG A HB2  7  
ATOM   7027  H  HB3  . ARG A 1 11 ? -19.880 12.847  -11.119 1.00 0.00 ? 11  ARG A HB3  7  
ATOM   7028  H  HG2  . ARG A 1 11 ? -18.990 10.646  -11.518 1.00 0.00 ? 11  ARG A HG2  7  
ATOM   7029  H  HG3  . ARG A 1 11 ? -20.558 10.083  -12.099 1.00 0.00 ? 11  ARG A HG3  7  
ATOM   7030  H  HD2  . ARG A 1 11 ? -20.271 12.103  -13.773 1.00 0.00 ? 11  ARG A HD2  7  
ATOM   7031  H  HD3  . ARG A 1 11 ? -18.562 11.858  -13.413 1.00 0.00 ? 11  ARG A HD3  7  
ATOM   7032  H  HE   . ARG A 1 11 ? -19.404 9.370   -14.015 1.00 0.00 ? 11  ARG A HE   7  
ATOM   7033  H  HH11 . ARG A 1 11 ? -19.734 12.435  -15.632 1.00 0.00 ? 11  ARG A HH11 7  
ATOM   7034  H  HH12 . ARG A 1 11 ? -19.763 11.742  -17.220 1.00 0.00 ? 11  ARG A HH12 7  
ATOM   7035  H  HH21 . ARG A 1 11 ? -19.442 8.445   -16.100 1.00 0.00 ? 11  ARG A HH21 7  
ATOM   7036  H  HH22 . ARG A 1 11 ? -19.598 9.472   -17.485 1.00 0.00 ? 11  ARG A HH22 7  
ATOM   7037  N  N    . GLY A 1 12 ? -20.599 13.349  -8.273  1.00 0.00 ? 12  GLY A N    7  
ATOM   7038  C  CA   . GLY A 1 12 ? -20.908 14.508  -7.456  1.00 0.00 ? 12  GLY A CA   7  
ATOM   7039  C  C    . GLY A 1 12 ? -19.757 14.906  -6.554  1.00 0.00 ? 12  GLY A C    7  
ATOM   7040  O  O    . GLY A 1 12 ? -18.609 14.531  -6.798  1.00 0.00 ? 12  GLY A O    7  
ATOM   7041  H  H    . GLY A 1 12 ? -19.701 12.956  -8.243  1.00 0.00 ? 12  GLY A H    7  
ATOM   7042  H  HA2  . GLY A 1 12 ? -21.147 15.338  -8.105  1.00 0.00 ? 12  GLY A HA2  7  
ATOM   7043  H  HA3  . GLY A 1 12 ? -21.769 14.284  -6.844  1.00 0.00 ? 12  GLY A HA3  7  
ATOM   7044  N  N    . LEU A 1 13 ? -20.062 15.668  -5.510  1.00 0.00 ? 13  LEU A N    7  
ATOM   7045  C  CA   . LEU A 1 13 ? -19.043 16.119  -4.568  1.00 0.00 ? 13  LEU A CA   7  
ATOM   7046  C  C    . LEU A 1 13 ? -18.790 15.065  -3.494  1.00 0.00 ? 13  LEU A C    7  
ATOM   7047  O  O    . LEU A 1 13 ? -19.497 15.006  -2.489  1.00 0.00 ? 13  LEU A O    7  
ATOM   7048  C  CB   . LEU A 1 13 ? -19.469 17.436  -3.916  1.00 0.00 ? 13  LEU A CB   7  
ATOM   7049  C  CG   . LEU A 1 13 ? -18.338 18.384  -3.516  1.00 0.00 ? 13  LEU A CG   7  
ATOM   7050  C  CD1  . LEU A 1 13 ? -18.901 19.702  -3.009  1.00 0.00 ? 13  LEU A CD1  7  
ATOM   7051  C  CD2  . LEU A 1 13 ? -17.450 17.739  -2.461  1.00 0.00 ? 13  LEU A CD2  7  
ATOM   7052  H  H    . LEU A 1 13 ? -20.993 15.935  -5.368  1.00 0.00 ? 13  LEU A H    7  
ATOM   7053  H  HA   . LEU A 1 13 ? -18.129 16.279  -5.120  1.00 0.00 ? 13  LEU A HA   7  
ATOM   7054  H  HB2  . LEU A 1 13 ? -20.107 17.957  -4.613  1.00 0.00 ? 13  LEU A HB2  7  
ATOM   7055  H  HB3  . LEU A 1 13 ? -20.032 17.196  -3.025  1.00 0.00 ? 13  LEU A HB3  7  
ATOM   7056  H  HG   . LEU A 1 13 ? -17.729 18.593  -4.385  1.00 0.00 ? 13  LEU A HG   7  
ATOM   7057  H  HD11 . LEU A 1 13 ? -18.093 20.397  -2.841  1.00 0.00 ? 13  LEU A HD11 7  
ATOM   7058  H  HD12 . LEU A 1 13 ? -19.431 19.535  -2.083  1.00 0.00 ? 13  LEU A HD12 7  
ATOM   7059  H  HD13 . LEU A 1 13 ? -19.580 20.110  -3.744  1.00 0.00 ? 13  LEU A HD13 7  
ATOM   7060  H  HD21 . LEU A 1 13 ? -18.068 17.268  -1.711  1.00 0.00 ? 13  LEU A HD21 7  
ATOM   7061  H  HD22 . LEU A 1 13 ? -16.836 18.497  -1.997  1.00 0.00 ? 13  LEU A HD22 7  
ATOM   7062  H  HD23 . LEU A 1 13 ? -16.818 16.998  -2.927  1.00 0.00 ? 13  LEU A HD23 7  
ATOM   7063  N  N    . GLY A 1 14 ? -17.774 14.236  -3.713  1.00 0.00 ? 14  GLY A N    7  
ATOM   7064  C  CA   . GLY A 1 14 ? -17.444 13.197  -2.755  1.00 0.00 ? 14  GLY A CA   7  
ATOM   7065  C  C    . GLY A 1 14 ? -15.950 12.970  -2.637  1.00 0.00 ? 14  GLY A C    7  
ATOM   7066  O  O    . GLY A 1 14 ? -15.216 13.845  -2.177  1.00 0.00 ? 14  GLY A O    7  
ATOM   7067  H  H    . GLY A 1 14 ? -17.244 14.330  -4.533  1.00 0.00 ? 14  GLY A H    7  
ATOM   7068  H  HA2  . GLY A 1 14 ? -17.832 13.479  -1.788  1.00 0.00 ? 14  GLY A HA2  7  
ATOM   7069  H  HA3  . GLY A 1 14 ? -17.913 12.275  -3.066  1.00 0.00 ? 14  GLY A HA3  7  
ATOM   7070  N  N    . LYS A 1 15 ? -15.497 11.792  -3.053  1.00 0.00 ? 15  LYS A N    7  
ATOM   7071  C  CA   . LYS A 1 15 ? -14.081 11.451  -2.992  1.00 0.00 ? 15  LYS A CA   7  
ATOM   7072  C  C    . LYS A 1 15 ? -13.715 10.450  -4.083  1.00 0.00 ? 15  LYS A C    7  
ATOM   7073  O  O    . LYS A 1 15 ? -14.582 9.970   -4.814  1.00 0.00 ? 15  LYS A O    7  
ATOM   7074  C  CB   . LYS A 1 15 ? -13.733 10.874  -1.618  1.00 0.00 ? 15  LYS A CB   7  
ATOM   7075  C  CG   . LYS A 1 15 ? -13.293 11.924  -0.612  1.00 0.00 ? 15  LYS A CG   7  
ATOM   7076  C  CD   . LYS A 1 15 ? -13.673 11.531  0.806   1.00 0.00 ? 15  LYS A CD   7  
ATOM   7077  C  CE   . LYS A 1 15 ? -12.683 12.082  1.821   1.00 0.00 ? 15  LYS A CE   7  
ATOM   7078  N  NZ   . LYS A 1 15 ? -13.311 12.278  3.157   1.00 0.00 ? 15  LYS A NZ   7  
ATOM   7079  H  H    . LYS A 1 15 ? -16.132 11.136  -3.411  1.00 0.00 ? 15  LYS A H    7  
ATOM   7080  H  HA   . LYS A 1 15 ? -13.515 12.357  -3.147  1.00 0.00 ? 15  LYS A HA   7  
ATOM   7081  H  HB2  . LYS A 1 15 ? -14.601 10.369  -1.223  1.00 0.00 ? 15  LYS A HB2  7  
ATOM   7082  H  HB3  . LYS A 1 15 ? -12.932 10.159  -1.734  1.00 0.00 ? 15  LYS A HB3  7  
ATOM   7083  H  HG2  . LYS A 1 15 ? -12.220 12.035  -0.668  1.00 0.00 ? 15  LYS A HG2  7  
ATOM   7084  H  HG3  . LYS A 1 15 ? -13.767 12.864  -0.855  1.00 0.00 ? 15  LYS A HG3  7  
ATOM   7085  H  HD2  . LYS A 1 15 ? -14.654 11.922  1.028   1.00 0.00 ? 15  LYS A HD2  7  
ATOM   7086  H  HD3  . LYS A 1 15 ? -13.688 10.452  0.879   1.00 0.00 ? 15  LYS A HD3  7  
ATOM   7087  H  HE2  . LYS A 1 15 ? -11.862 11.388  1.917   1.00 0.00 ? 15  LYS A HE2  7  
ATOM   7088  H  HE3  . LYS A 1 15 ? -12.313 13.031  1.464   1.00 0.00 ? 15  LYS A HE3  7  
ATOM   7089  H  HZ1  . LYS A 1 15 ? -12.633 12.722  3.809   1.00 0.00 ? 15  LYS A HZ1  7  
ATOM   7090  H  HZ2  . LYS A 1 15 ? -13.603 11.361  3.553   1.00 0.00 ? 15  LYS A HZ2  7  
ATOM   7091  H  HZ3  . LYS A 1 15 ? -14.147 12.890  3.073   1.00 0.00 ? 15  LYS A HZ3  7  
ATOM   7092  N  N    . TYR A 1 16 ? -12.428 10.139  -4.186  1.00 0.00 ? 16  TYR A N    7  
ATOM   7093  C  CA   . TYR A 1 16 ? -11.948 9.195   -5.189  1.00 0.00 ? 16  TYR A CA   7  
ATOM   7094  C  C    . TYR A 1 16 ? -12.410 7.777   -4.867  1.00 0.00 ? 16  TYR A C    7  
ATOM   7095  O  O    . TYR A 1 16 ? -12.202 7.280   -3.760  1.00 0.00 ? 16  TYR A O    7  
ATOM   7096  C  CB   . TYR A 1 16 ? -10.421 9.239   -5.271  1.00 0.00 ? 16  TYR A CB   7  
ATOM   7097  C  CG   . TYR A 1 16 ? -9.887  10.485  -5.941  1.00 0.00 ? 16  TYR A CG   7  
ATOM   7098  C  CD1  . TYR A 1 16 ? -10.109 11.742  -5.392  1.00 0.00 ? 16  TYR A CD1  7  
ATOM   7099  C  CD2  . TYR A 1 16 ? -9.162  10.406  -7.124  1.00 0.00 ? 16  TYR A CD2  7  
ATOM   7100  C  CE1  . TYR A 1 16 ? -9.624  12.883  -6.001  1.00 0.00 ? 16  TYR A CE1  7  
ATOM   7101  C  CE2  . TYR A 1 16 ? -8.672  11.541  -7.739  1.00 0.00 ? 16  TYR A CE2  7  
ATOM   7102  C  CZ   . TYR A 1 16 ? -8.905  12.778  -7.174  1.00 0.00 ? 16  TYR A CZ   7  
ATOM   7103  O  OH   . TYR A 1 16 ? -8.420  13.911  -7.784  1.00 0.00 ? 16  TYR A OH   7  
ATOM   7104  H  H    . TYR A 1 16 ? -11.785 10.554  -3.575  1.00 0.00 ? 16  TYR A H    7  
ATOM   7105  H  HA   . TYR A 1 16 ? -12.359 9.487   -6.144  1.00 0.00 ? 16  TYR A HA   7  
ATOM   7106  H  HB2  . TYR A 1 16 ? -10.012 9.199   -4.274  1.00 0.00 ? 16  TYR A HB2  7  
ATOM   7107  H  HB3  . TYR A 1 16 ? -10.073 8.385   -5.833  1.00 0.00 ? 16  TYR A HB3  7  
ATOM   7108  H  HD1  . TYR A 1 16 ? -10.672 11.822  -4.474  1.00 0.00 ? 16  TYR A HD1  7  
ATOM   7109  H  HD2  . TYR A 1 16 ? -8.981  9.435   -7.564  1.00 0.00 ? 16  TYR A HD2  7  
ATOM   7110  H  HE1  . TYR A 1 16 ? -9.806  13.852  -5.559  1.00 0.00 ? 16  TYR A HE1  7  
ATOM   7111  H  HE2  . TYR A 1 16 ? -8.110  11.459  -8.657  1.00 0.00 ? 16  TYR A HE2  7  
ATOM   7112  H  HH   . TYR A 1 16 ? -7.476  13.815  -7.934  1.00 0.00 ? 16  TYR A HH   7  
ATOM   7113  N  N    . ILE A 1 17 ? -13.037 7.130   -5.844  1.00 0.00 ? 17  ILE A N    7  
ATOM   7114  C  CA   . ILE A 1 17 ? -13.527 5.769   -5.667  1.00 0.00 ? 17  ILE A CA   7  
ATOM   7115  C  C    . ILE A 1 17 ? -12.498 4.748   -6.140  1.00 0.00 ? 17  ILE A C    7  
ATOM   7116  O  O    . ILE A 1 17 ? -12.004 4.823   -7.265  1.00 0.00 ? 17  ILE A O    7  
ATOM   7117  C  CB   . ILE A 1 17 ? -14.846 5.542   -6.429  1.00 0.00 ? 17  ILE A CB   7  
ATOM   7118  C  CG1  . ILE A 1 17 ? -15.842 6.659   -6.112  1.00 0.00 ? 17  ILE A CG1  7  
ATOM   7119  C  CG2  . ILE A 1 17 ? -15.435 4.184   -6.076  1.00 0.00 ? 17  ILE A CG2  7  
ATOM   7120  C  CD1  . ILE A 1 17 ? -16.245 6.714   -4.655  1.00 0.00 ? 17  ILE A CD1  7  
ATOM   7121  H  H    . ILE A 1 17 ? -13.173 7.579   -6.704  1.00 0.00 ? 17  ILE A H    7  
ATOM   7122  H  HA   . ILE A 1 17 ? -13.712 5.616   -4.613  1.00 0.00 ? 17  ILE A HA   7  
ATOM   7123  H  HB   . ILE A 1 17 ? -14.631 5.550   -7.486  1.00 0.00 ? 17  ILE A HB   7  
ATOM   7124  H  HG12 . ILE A 1 17 ? -15.402 7.609   -6.370  1.00 0.00 ? 17  ILE A HG12 7  
ATOM   7125  H  HG13 . ILE A 1 17 ? -16.737 6.510   -6.699  1.00 0.00 ? 17  ILE A HG13 7  
ATOM   7126  H  HG21 . ILE A 1 17 ? -15.866 4.225   -5.087  1.00 0.00 ? 17  ILE A HG21 7  
ATOM   7127  H  HG22 . ILE A 1 17 ? -16.201 3.928   -6.792  1.00 0.00 ? 17  ILE A HG22 7  
ATOM   7128  H  HG23 . ILE A 1 17 ? -14.656 3.437   -6.099  1.00 0.00 ? 17  ILE A HG23 7  
ATOM   7129  H  HD11 . ILE A 1 17 ? -17.277 6.409   -4.554  1.00 0.00 ? 17  ILE A HD11 7  
ATOM   7130  H  HD12 . ILE A 1 17 ? -15.616 6.051   -4.081  1.00 0.00 ? 17  ILE A HD12 7  
ATOM   7131  H  HD13 . ILE A 1 17 ? -16.132 7.724   -4.288  1.00 0.00 ? 17  ILE A HD13 7  
ATOM   7132  N  N    . CYS A 1 18 ? -12.179 3.793   -5.273  1.00 0.00 ? 18  CYS A N    7  
ATOM   7133  C  CA   . CYS A 1 18 ? -11.209 2.755   -5.601  1.00 0.00 ? 18  CYS A CA   7  
ATOM   7134  C  C    . CYS A 1 18 ? -11.721 1.871   -6.736  1.00 0.00 ? 18  CYS A C    7  
ATOM   7135  O  O    . CYS A 1 18 ? -12.810 1.306   -6.652  1.00 0.00 ? 18  CYS A O    7  
ATOM   7136  C  CB   . CYS A 1 18 ? -10.911 1.898   -4.369  1.00 0.00 ? 18  CYS A CB   7  
ATOM   7137  S  SG   . CYS A 1 18 ? -9.529  0.732   -4.590  1.00 0.00 ? 18  CYS A SG   7  
ATOM   7138  H  H    . CYS A 1 18 ? -12.606 3.785   -4.390  1.00 0.00 ? 18  CYS A H    7  
ATOM   7139  H  HA   . CYS A 1 18 ? -10.299 3.239   -5.921  1.00 0.00 ? 18  CYS A HA   7  
ATOM   7140  H  HB2  . CYS A 1 18 ? -10.663 2.547   -3.541  1.00 0.00 ? 18  CYS A HB2  7  
ATOM   7141  H  HB3  . CYS A 1 18 ? -11.790 1.324   -4.118  1.00 0.00 ? 18  CYS A HB3  7  
ATOM   7142  N  N    . GLN A 1 19 ? -10.925 1.759   -7.795  1.00 0.00 ? 19  GLN A N    7  
ATOM   7143  C  CA   . GLN A 1 19 ? -11.298 0.945   -8.946  1.00 0.00 ? 19  GLN A CA   7  
ATOM   7144  C  C    . GLN A 1 19 ? -10.988 -0.527  -8.695  1.00 0.00 ? 19  GLN A C    7  
ATOM   7145  O  O    . GLN A 1 19 ? -10.887 -1.319  -9.632  1.00 0.00 ? 19  GLN A O    7  
ATOM   7146  C  CB   . GLN A 1 19 ? -10.563 1.428   -10.197 1.00 0.00 ? 19  GLN A CB   7  
ATOM   7147  C  CG   . GLN A 1 19 ? -11.321 2.490   -10.977 1.00 0.00 ? 19  GLN A CG   7  
ATOM   7148  C  CD   . GLN A 1 19 ? -12.672 2.003   -11.463 1.00 0.00 ? 19  GLN A CD   7  
ATOM   7149  O  OE1  . GLN A 1 19 ? -12.760 1.042   -12.228 1.00 0.00 ? 19  GLN A OE1  7  
ATOM   7150  N  NE2  . GLN A 1 19 ? -13.734 2.667   -11.022 1.00 0.00 ? 19  GLN A NE2  7  
ATOM   7151  H  H    . GLN A 1 19 ? -10.069 2.234   -7.802  1.00 0.00 ? 19  GLN A H    7  
ATOM   7152  H  HA   . GLN A 1 19 ? -12.361 1.055   -9.099  1.00 0.00 ? 19  GLN A HA   7  
ATOM   7153  H  HB2  . GLN A 1 19 ? -9.609  1.840   -9.904  1.00 0.00 ? 19  GLN A HB2  7  
ATOM   7154  H  HB3  . GLN A 1 19 ? -10.396 0.584   -10.850 1.00 0.00 ? 19  GLN A HB3  7  
ATOM   7155  H  HG2  . GLN A 1 19 ? -11.473 3.347   -10.339 1.00 0.00 ? 19  GLN A HG2  7  
ATOM   7156  H  HG3  . GLN A 1 19 ? -10.730 2.780   -11.833 1.00 0.00 ? 19  GLN A HG3  7  
ATOM   7157  H  HE21 . GLN A 1 19 ? -13.588 3.423   -10.416 1.00 0.00 ? 19  GLN A HE21 7  
ATOM   7158  H  HE22 . GLN A 1 19 ? -14.620 2.374   -11.320 1.00 0.00 ? 19  GLN A HE22 7  
ATOM   7159  N  N    . LYS A 1 20 ? -10.837 -0.887  -7.425  1.00 0.00 ? 20  LYS A N    7  
ATOM   7160  C  CA   . LYS A 1 20 ? -10.539 -2.264  -7.050  1.00 0.00 ? 20  LYS A CA   7  
ATOM   7161  C  C    . LYS A 1 20 ? -11.628 -2.828  -6.144  1.00 0.00 ? 20  LYS A C    7  
ATOM   7162  O  O    . LYS A 1 20 ? -12.183 -3.894  -6.413  1.00 0.00 ? 20  LYS A O    7  
ATOM   7163  C  CB   . LYS A 1 20 ? -9.183  -2.340  -6.344  1.00 0.00 ? 20  LYS A CB   7  
ATOM   7164  C  CG   . LYS A 1 20 ? -8.787  -3.749  -5.938  1.00 0.00 ? 20  LYS A CG   7  
ATOM   7165  C  CD   . LYS A 1 20 ? -8.033  -4.458  -7.050  1.00 0.00 ? 20  LYS A CD   7  
ATOM   7166  C  CE   . LYS A 1 20 ? -8.983  -5.157  -8.010  1.00 0.00 ? 20  LYS A CE   7  
ATOM   7167  N  NZ   . LYS A 1 20 ? -8.291  -6.205  -8.810  1.00 0.00 ? 20  LYS A NZ   7  
ATOM   7168  H  H    . LYS A 1 20 ? -10.930 -0.209  -6.723  1.00 0.00 ? 20  LYS A H    7  
ATOM   7169  H  HA   . LYS A 1 20 ? -10.498 -2.853  -7.954  1.00 0.00 ? 20  LYS A HA   7  
ATOM   7170  H  HB2  . LYS A 1 20 ? -8.424  -1.951  -7.006  1.00 0.00 ? 20  LYS A HB2  7  
ATOM   7171  H  HB3  . LYS A 1 20 ? -9.220  -1.728  -5.454  1.00 0.00 ? 20  LYS A HB3  7  
ATOM   7172  H  HG2  . LYS A 1 20 ? -8.154  -3.698  -5.065  1.00 0.00 ? 20  LYS A HG2  7  
ATOM   7173  H  HG3  . LYS A 1 20 ? -9.680  -4.311  -5.706  1.00 0.00 ? 20  LYS A HG3  7  
ATOM   7174  H  HD2  . LYS A 1 20 ? -7.453  -3.731  -7.601  1.00 0.00 ? 20  LYS A HD2  7  
ATOM   7175  H  HD3  . LYS A 1 20 ? -7.371  -5.192  -6.613  1.00 0.00 ? 20  LYS A HD3  7  
ATOM   7176  H  HE2  . LYS A 1 20 ? -9.776  -5.616  -7.441  1.00 0.00 ? 20  LYS A HE2  7  
ATOM   7177  H  HE3  . LYS A 1 20 ? -9.401  -4.421  -8.682  1.00 0.00 ? 20  LYS A HE3  7  
ATOM   7178  H  HZ1  . LYS A 1 20 ? -7.294  -5.946  -8.953  1.00 0.00 ? 20  LYS A HZ1  7  
ATOM   7179  H  HZ2  . LYS A 1 20 ? -8.747  -6.306  -9.739  1.00 0.00 ? 20  LYS A HZ2  7  
ATOM   7180  H  HZ3  . LYS A 1 20 ? -8.332  -7.119  -8.315  1.00 0.00 ? 20  LYS A HZ3  7  
ATOM   7181  N  N    . CYS A 1 21 ? -11.931 -2.107  -5.070  1.00 0.00 ? 21  CYS A N    7  
ATOM   7182  C  CA   . CYS A 1 21 ? -12.955 -2.535  -4.124  1.00 0.00 ? 21  CYS A CA   7  
ATOM   7183  C  C    . CYS A 1 21 ? -14.187 -1.640  -4.215  1.00 0.00 ? 21  CYS A C    7  
ATOM   7184  O  O    . CYS A 1 21 ? -15.165 -1.836  -3.492  1.00 0.00 ? 21  CYS A O    7  
ATOM   7185  C  CB   . CYS A 1 21 ? -12.401 -2.517  -2.698  1.00 0.00 ? 21  CYS A CB   7  
ATOM   7186  S  SG   . CYS A 1 21 ? -12.012 -0.851  -2.073  1.00 0.00 ? 21  CYS A SG   7  
ATOM   7187  H  H    . CYS A 1 21 ? -11.454 -1.265  -4.909  1.00 0.00 ? 21  CYS A H    7  
ATOM   7188  H  HA   . CYS A 1 21 ? -13.239 -3.545  -4.378  1.00 0.00 ? 21  CYS A HA   7  
ATOM   7189  H  HB2  . CYS A 1 21 ? -13.130 -2.955  -2.032  1.00 0.00 ? 21  CYS A HB2  7  
ATOM   7190  H  HB3  . CYS A 1 21 ? -11.494 -3.101  -2.665  1.00 0.00 ? 21  CYS A HB3  7  
ATOM   7191  N  N    . HIS A 1 22 ? -14.133 -0.656  -5.107  1.00 0.00 ? 22  HIS A N    7  
ATOM   7192  C  CA   . HIS A 1 22 ? -15.245 0.269   -5.293  1.00 0.00 ? 22  HIS A CA   7  
ATOM   7193  C  C    . HIS A 1 22 ? -15.672 0.880   -3.962  1.00 0.00 ? 22  HIS A C    7  
ATOM   7194  O  O    . HIS A 1 22 ? -16.854 0.883   -3.620  1.00 0.00 ? 22  HIS A O    7  
ATOM   7195  C  CB   . HIS A 1 22 ? -16.430 -0.448  -5.941  1.00 0.00 ? 22  HIS A CB   7  
ATOM   7196  C  CG   . HIS A 1 22 ? -16.250 -0.697  -7.407  1.00 0.00 ? 22  HIS A CG   7  
ATOM   7197  N  ND1  . HIS A 1 22 ? -15.872 -1.919  -7.922  1.00 0.00 ? 22  HIS A ND1  7  
ATOM   7198  C  CD2  . HIS A 1 22 ? -16.399 0.127   -8.470  1.00 0.00 ? 22  HIS A CD2  7  
ATOM   7199  C  CE1  . HIS A 1 22 ? -15.795 -1.836  -9.238  1.00 0.00 ? 22  HIS A CE1  7  
ATOM   7200  N  NE2  . HIS A 1 22 ? -16.111 -0.604  -9.596  1.00 0.00 ? 22  HIS A NE2  7  
ATOM   7201  H  H    . HIS A 1 22 ? -13.327 -0.551  -5.653  1.00 0.00 ? 22  HIS A H    7  
ATOM   7202  H  HA   . HIS A 1 22 ? -14.912 1.060   -5.948  1.00 0.00 ? 22  HIS A HA   7  
ATOM   7203  H  HB2  . HIS A 1 22 ? -16.572 -1.403  -5.458  1.00 0.00 ? 22  HIS A HB2  7  
ATOM   7204  H  HB3  . HIS A 1 22 ? -17.320 0.152   -5.813  1.00 0.00 ? 22  HIS A HB3  7  
ATOM   7205  H  HD1  . HIS A 1 22 ? -15.686 -2.727  -7.400  1.00 0.00 ? 22  HIS A HD1  7  
ATOM   7206  H  HD2  . HIS A 1 22 ? -16.691 1.168   -8.440  1.00 0.00 ? 22  HIS A HD2  7  
ATOM   7207  H  HE1  . HIS A 1 22 ? -15.522 -2.637  -9.908  1.00 0.00 ? 22  HIS A HE1  7  
ATOM   7208  N  N    . ALA A 1 23 ? -14.701 1.396   -3.215  1.00 0.00 ? 23  ALA A N    7  
ATOM   7209  C  CA   . ALA A 1 23 ? -14.977 2.011   -1.922  1.00 0.00 ? 23  ALA A CA   7  
ATOM   7210  C  C    . ALA A 1 23 ? -14.266 3.354   -1.790  1.00 0.00 ? 23  ALA A C    7  
ATOM   7211  O  O    . ALA A 1 23 ? -13.102 3.491   -2.168  1.00 0.00 ? 23  ALA A O    7  
ATOM   7212  C  CB   . ALA A 1 23 ? -14.560 1.078   -0.795  1.00 0.00 ? 23  ALA A CB   7  
ATOM   7213  H  H    . ALA A 1 23 ? -13.778 1.364   -3.542  1.00 0.00 ? 23  ALA A H    7  
ATOM   7214  H  HA   . ALA A 1 23 ? -16.043 2.171   -1.849  1.00 0.00 ? 23  ALA A HA   7  
ATOM   7215  H  HB1  . ALA A 1 23 ? -15.048 0.123   -0.921  1.00 0.00 ? 23  ALA A HB1  7  
ATOM   7216  H  HB2  . ALA A 1 23 ? -13.489 0.942   -0.817  1.00 0.00 ? 23  ALA A HB2  7  
ATOM   7217  H  HB3  . ALA A 1 23 ? -14.849 1.508   0.153   1.00 0.00 ? 23  ALA A HB3  7  
ATOM   7218  N  N    . ILE A 1 24 ? -14.974 4.342   -1.253  1.00 0.00 ? 24  ILE A N    7  
ATOM   7219  C  CA   . ILE A 1 24 ? -14.410 5.674   -1.071  1.00 0.00 ? 24  ILE A CA   7  
ATOM   7220  C  C    . ILE A 1 24 ? -12.989 5.599   -0.524  1.00 0.00 ? 24  ILE A C    7  
ATOM   7221  O  O    . ILE A 1 24 ? -12.665 4.717   0.272   1.00 0.00 ? 24  ILE A O    7  
ATOM   7222  C  CB   . ILE A 1 24 ? -15.271 6.525   -0.119  1.00 0.00 ? 24  ILE A CB   7  
ATOM   7223  C  CG1  . ILE A 1 24 ? -16.684 6.687   -0.682  1.00 0.00 ? 24  ILE A CG1  7  
ATOM   7224  C  CG2  . ILE A 1 24 ? -14.625 7.884   0.106   1.00 0.00 ? 24  ILE A CG2  7  
ATOM   7225  C  CD1  . ILE A 1 24 ? -16.764 7.649   -1.847  1.00 0.00 ? 24  ILE A CD1  7  
ATOM   7226  H  H    . ILE A 1 24 ? -15.896 4.171   -0.971  1.00 0.00 ? 24  ILE A H    7  
ATOM   7227  H  HA   . ILE A 1 24 ? -14.387 6.160   -2.036  1.00 0.00 ? 24  ILE A HA   7  
ATOM   7228  H  HB   . ILE A 1 24 ? -15.325 6.017   0.831   1.00 0.00 ? 24  ILE A HB   7  
ATOM   7229  H  HG12 . ILE A 1 24 ? -17.043 5.728   -1.020  1.00 0.00 ? 24  ILE A HG12 7  
ATOM   7230  H  HG13 . ILE A 1 24 ? -17.334 7.055   0.099   1.00 0.00 ? 24  ILE A HG13 7  
ATOM   7231  H  HG21 . ILE A 1 24 ? -13.890 8.065   -0.664  1.00 0.00 ? 24  ILE A HG21 7  
ATOM   7232  H  HG22 . ILE A 1 24 ? -15.382 8.652   0.068   1.00 0.00 ? 24  ILE A HG22 7  
ATOM   7233  H  HG23 . ILE A 1 24 ? -14.145 7.899   1.073   1.00 0.00 ? 24  ILE A HG23 7  
ATOM   7234  H  HD11 . ILE A 1 24 ? -17.143 8.600   -1.503  1.00 0.00 ? 24  ILE A HD11 7  
ATOM   7235  H  HD12 . ILE A 1 24 ? -15.780 7.784   -2.271  1.00 0.00 ? 24  ILE A HD12 7  
ATOM   7236  H  HD13 . ILE A 1 24 ? -17.428 7.248   -2.599  1.00 0.00 ? 24  ILE A HD13 7  
ATOM   7237  N  N    . ILE A 1 25 ? -12.145 6.531   -0.954  1.00 0.00 ? 25  ILE A N    7  
ATOM   7238  C  CA   . ILE A 1 25 ? -10.759 6.572   -0.505  1.00 0.00 ? 25  ILE A CA   7  
ATOM   7239  C  C    . ILE A 1 25 ? -10.487 7.823   0.324   1.00 0.00 ? 25  ILE A C    7  
ATOM   7240  O  O    . ILE A 1 25 ? -10.140 8.874   -0.216  1.00 0.00 ? 25  ILE A O    7  
ATOM   7241  C  CB   . ILE A 1 25 ? -9.780  6.533   -1.693  1.00 0.00 ? 25  ILE A CB   7  
ATOM   7242  C  CG1  . ILE A 1 25 ? -9.979  5.252   -2.505  1.00 0.00 ? 25  ILE A CG1  7  
ATOM   7243  C  CG2  . ILE A 1 25 ? -8.344  6.637   -1.200  1.00 0.00 ? 25  ILE A CG2  7  
ATOM   7244  C  CD1  . ILE A 1 25 ? -9.668  5.414   -3.976  1.00 0.00 ? 25  ILE A CD1  7  
ATOM   7245  H  H    . ILE A 1 25 ? -12.462 7.207   -1.588  1.00 0.00 ? 25  ILE A H    7  
ATOM   7246  H  HA   . ILE A 1 25 ? -10.582 5.701   0.110   1.00 0.00 ? 25  ILE A HA   7  
ATOM   7247  H  HB   . ILE A 1 25 ? -9.981  7.386   -2.324  1.00 0.00 ? 25  ILE A HB   7  
ATOM   7248  H  HG12 . ILE A 1 25 ? -9.335  4.481   -2.113  1.00 0.00 ? 25  ILE A HG12 7  
ATOM   7249  H  HG13 . ILE A 1 25 ? -11.008 4.935   -2.416  1.00 0.00 ? 25  ILE A HG13 7  
ATOM   7250  H  HG21 . ILE A 1 25 ? -7.811  7.364   -1.795  1.00 0.00 ? 25  ILE A HG21 7  
ATOM   7251  H  HG22 . ILE A 1 25 ? -8.341  6.947   -0.166  1.00 0.00 ? 25  ILE A HG22 7  
ATOM   7252  H  HG23 . ILE A 1 25 ? -7.862  5.675   -1.290  1.00 0.00 ? 25  ILE A HG23 7  
ATOM   7253  H  HD11 . ILE A 1 25 ? -10.562 5.235   -4.556  1.00 0.00 ? 25  ILE A HD11 7  
ATOM   7254  H  HD12 . ILE A 1 25 ? -9.312  6.416   -4.161  1.00 0.00 ? 25  ILE A HD12 7  
ATOM   7255  H  HD13 . ILE A 1 25 ? -8.906  4.703   -4.263  1.00 0.00 ? 25  ILE A HD13 7  
ATOM   7256  N  N    . ASP A 1 26 ? -10.644 7.702   1.637   1.00 0.00 ? 26  ASP A N    7  
ATOM   7257  C  CA   . ASP A 1 26 ? -10.412 8.822   2.541   1.00 0.00 ? 26  ASP A CA   7  
ATOM   7258  C  C    . ASP A 1 26 ? -9.040  9.442   2.298   1.00 0.00 ? 26  ASP A C    7  
ATOM   7259  O  O    . ASP A 1 26 ? -8.933  10.608  1.919   1.00 0.00 ? 26  ASP A O    7  
ATOM   7260  C  CB   . ASP A 1 26 ? -10.528 8.364   3.996   1.00 0.00 ? 26  ASP A CB   7  
ATOM   7261  C  CG   . ASP A 1 26 ? -9.686  9.204   4.936   1.00 0.00 ? 26  ASP A CG   7  
ATOM   7262  O  OD1  . ASP A 1 26 ? -10.096 10.344  5.242   1.00 0.00 ? 26  ASP A OD1  7  
ATOM   7263  O  OD2  . ASP A 1 26 ? -8.619  8.721   5.368   1.00 0.00 ? 26  ASP A OD2  7  
ATOM   7264  H  H    . ASP A 1 26 ? -10.922 6.838   2.008   1.00 0.00 ? 26  ASP A H    7  
ATOM   7265  H  HA   . ASP A 1 26 ? -11.169 9.567   2.347   1.00 0.00 ? 26  ASP A HA   7  
ATOM   7266  H  HB2  . ASP A 1 26 ? -11.560 8.433   4.307   1.00 0.00 ? 26  ASP A HB2  7  
ATOM   7267  H  HB3  . ASP A 1 26 ? -10.202 7.337   4.070   1.00 0.00 ? 26  ASP A HB3  7  
ATOM   7268  N  N    . GLU A 1 27 ? -7.992  8.654   2.520   1.00 0.00 ? 27  GLU A N    7  
ATOM   7269  C  CA   . GLU A 1 27 ? -6.627  9.127   2.327   1.00 0.00 ? 27  GLU A CA   7  
ATOM   7270  C  C    . GLU A 1 27 ? -6.316  9.302   0.843   1.00 0.00 ? 27  GLU A C    7  
ATOM   7271  O  O    . GLU A 1 27 ? -7.138  8.980   -0.015  1.00 0.00 ? 27  GLU A O    7  
ATOM   7272  C  CB   . GLU A 1 27 ? -5.631  8.150   2.955   1.00 0.00 ? 27  GLU A CB   7  
ATOM   7273  C  CG   . GLU A 1 27 ? -5.720  6.742   2.391   1.00 0.00 ? 27  GLU A CG   7  
ATOM   7274  C  CD   . GLU A 1 27 ? -4.552  5.871   2.809   1.00 0.00 ? 27  GLU A CD   7  
ATOM   7275  O  OE1  . GLU A 1 27 ? -3.476  6.428   3.111   1.00 0.00 ? 27  GLU A OE1  7  
ATOM   7276  O  OE2  . GLU A 1 27 ? -4.714  4.633   2.834   1.00 0.00 ? 27  GLU A OE2  7  
ATOM   7277  H  H    . GLU A 1 27 ? -8.141  7.734   2.822   1.00 0.00 ? 27  GLU A H    7  
ATOM   7278  H  HA   . GLU A 1 27 ? -6.535  10.085  2.816   1.00 0.00 ? 27  GLU A HA   7  
ATOM   7279  H  HB2  . GLU A 1 27 ? -4.629  8.520   2.790   1.00 0.00 ? 27  GLU A HB2  7  
ATOM   7280  H  HB3  . GLU A 1 27 ? -5.816  8.102   4.018   1.00 0.00 ? 27  GLU A HB3  7  
ATOM   7281  H  HG2  . GLU A 1 27 ? -6.634  6.285   2.741   1.00 0.00 ? 27  GLU A HG2  7  
ATOM   7282  H  HG3  . GLU A 1 27 ? -5.739  6.801   1.313   1.00 0.00 ? 27  GLU A HG3  7  
ATOM   7283  N  N    . GLN A 1 28 ? -5.125  9.814   0.549   1.00 0.00 ? 28  GLN A N    7  
ATOM   7284  C  CA   . GLN A 1 28 ? -4.707  10.033  -0.830  1.00 0.00 ? 28  GLN A CA   7  
ATOM   7285  C  C    . GLN A 1 28 ? -4.879  8.764   -1.659  1.00 0.00 ? 28  GLN A C    7  
ATOM   7286  O  O    . GLN A 1 28 ? -4.308  7.715   -1.358  1.00 0.00 ? 28  GLN A O    7  
ATOM   7287  C  CB   . GLN A 1 28 ? -3.249  10.493  -0.877  1.00 0.00 ? 28  GLN A CB   7  
ATOM   7288  C  CG   . GLN A 1 28 ? -2.863  11.158  -2.188  1.00 0.00 ? 28  GLN A CG   7  
ATOM   7289  C  CD   . GLN A 1 28 ? -1.377  11.445  -2.281  1.00 0.00 ? 28  GLN A CD   7  
ATOM   7290  O  OE1  . GLN A 1 28 ? -0.576  10.552  -2.557  1.00 0.00 ? 28  GLN A OE1  7  
ATOM   7291  N  NE2  . GLN A 1 28 ? -1.001  12.698  -2.049  1.00 0.00 ? 28  GLN A NE2  7  
ATOM   7292  H  H    . GLN A 1 28 ? -4.514  10.050  1.277   1.00 0.00 ? 28  GLN A H    7  
ATOM   7293  H  HA   . GLN A 1 28 ? -5.333  10.807  -1.247  1.00 0.00 ? 28  GLN A HA   7  
ATOM   7294  H  HB2  . GLN A 1 28 ? -3.081  11.198  -0.077  1.00 0.00 ? 28  GLN A HB2  7  
ATOM   7295  H  HB3  . GLN A 1 28 ? -2.609  9.636   -0.731  1.00 0.00 ? 28  GLN A HB3  7  
ATOM   7296  H  HG2  . GLN A 1 28 ? -3.138  10.505  -3.003  1.00 0.00 ? 28  GLN A HG2  7  
ATOM   7297  H  HG3  . GLN A 1 28 ? -3.401  12.090  -2.276  1.00 0.00 ? 28  GLN A HG3  7  
ATOM   7298  H  HE21 . GLN A 1 28 ? -1.694  13.356  -1.833  1.00 0.00 ? 28  GLN A HE21 7  
ATOM   7299  H  HE22 . GLN A 1 28 ? -0.047  12.911  -2.102  1.00 0.00 ? 28  GLN A HE22 7  
ATOM   7300  N  N    . PRO A 1 29 ? -5.684  8.858   -2.727  1.00 0.00 ? 29  PRO A N    7  
ATOM   7301  C  CA   . PRO A 1 29 ? -5.949  7.727   -3.621  1.00 0.00 ? 29  PRO A CA   7  
ATOM   7302  C  C    . PRO A 1 29 ? -4.729  7.347   -4.452  1.00 0.00 ? 29  PRO A C    7  
ATOM   7303  O  O    . PRO A 1 29 ? -4.110  8.198   -5.092  1.00 0.00 ? 29  PRO A O    7  
ATOM   7304  C  CB   . PRO A 1 29 ? -7.071  8.245   -4.525  1.00 0.00 ? 29  PRO A CB   7  
ATOM   7305  C  CG   . PRO A 1 29 ? -6.914  9.726   -4.513  1.00 0.00 ? 29  PRO A CG   7  
ATOM   7306  C  CD   . PRO A 1 29 ? -6.397  10.077  -3.145  1.00 0.00 ? 29  PRO A CD   7  
ATOM   7307  H  HA   . PRO A 1 29 ? -6.296  6.862   -3.075  1.00 0.00 ? 29  PRO A HA   7  
ATOM   7308  H  HB2  . PRO A 1 29 ? -6.950  7.842   -5.521  1.00 0.00 ? 29  PRO A HB2  7  
ATOM   7309  H  HB3  . PRO A 1 29 ? -8.028  7.947   -4.124  1.00 0.00 ? 29  PRO A HB3  7  
ATOM   7310  H  HG2  . PRO A 1 29 ? -6.206  10.027  -5.270  1.00 0.00 ? 29  PRO A HG2  7  
ATOM   7311  H  HG3  . PRO A 1 29 ? -7.871  10.198  -4.684  1.00 0.00 ? 29  PRO A HG3  7  
ATOM   7312  H  HD2  . PRO A 1 29 ? -5.723  10.919  -3.201  1.00 0.00 ? 29  PRO A HD2  7  
ATOM   7313  H  HD3  . PRO A 1 29 ? -7.217  10.292  -2.476  1.00 0.00 ? 29  PRO A HD3  7  
ATOM   7314  N  N    . LEU A 1 30 ? -4.388  6.063   -4.440  1.00 0.00 ? 30  LEU A N    7  
ATOM   7315  C  CA   . LEU A 1 30 ? -3.240  5.569   -5.193  1.00 0.00 ? 30  LEU A CA   7  
ATOM   7316  C  C    . LEU A 1 30 ? -3.575  5.445   -6.676  1.00 0.00 ? 30  LEU A C    7  
ATOM   7317  O  O    . LEU A 1 30 ? -4.338  4.566   -7.079  1.00 0.00 ? 30  LEU A O    7  
ATOM   7318  C  CB   . LEU A 1 30 ? -2.791  4.213   -4.645  1.00 0.00 ? 30  LEU A CB   7  
ATOM   7319  C  CG   . LEU A 1 30 ? -2.033  3.313   -5.621  1.00 0.00 ? 30  LEU A CG   7  
ATOM   7320  C  CD1  . LEU A 1 30 ? -0.595  3.782   -5.774  1.00 0.00 ? 30  LEU A CD1  7  
ATOM   7321  C  CD2  . LEU A 1 30 ? -2.076  1.865   -5.155  1.00 0.00 ? 30  LEU A CD2  7  
ATOM   7322  H  H    . LEU A 1 30 ? -4.919  5.432   -3.911  1.00 0.00 ? 30  LEU A H    7  
ATOM   7323  H  HA   . LEU A 1 30 ? -2.436  6.280   -5.076  1.00 0.00 ? 30  LEU A HA   7  
ATOM   7324  H  HB2  . LEU A 1 30 ? -2.149  4.396   -3.797  1.00 0.00 ? 30  LEU A HB2  7  
ATOM   7325  H  HB3  . LEU A 1 30 ? -3.673  3.681   -4.319  1.00 0.00 ? 30  LEU A HB3  7  
ATOM   7326  H  HG   . LEU A 1 30 ? -2.506  3.366   -6.592  1.00 0.00 ? 30  LEU A HG   7  
ATOM   7327  H  HD11 . LEU A 1 30 ? -0.154  3.916   -4.798  1.00 0.00 ? 30  LEU A HD11 7  
ATOM   7328  H  HD12 . LEU A 1 30 ? -0.577  4.721   -6.308  1.00 0.00 ? 30  LEU A HD12 7  
ATOM   7329  H  HD13 . LEU A 1 30 ? -0.031  3.044   -6.326  1.00 0.00 ? 30  LEU A HD13 7  
ATOM   7330  H  HD21 . LEU A 1 30 ? -2.455  1.824   -4.144  1.00 0.00 ? 30  LEU A HD21 7  
ATOM   7331  H  HD22 . LEU A 1 30 ? -1.080  1.448   -5.182  1.00 0.00 ? 30  LEU A HD22 7  
ATOM   7332  H  HD23 . LEU A 1 30 ? -2.723  1.296   -5.805  1.00 0.00 ? 30  LEU A HD23 7  
ATOM   7333  N  N    . ILE A 1 31 ? -2.999  6.329   -7.483  1.00 0.00 ? 31  ILE A N    7  
ATOM   7334  C  CA   . ILE A 1 31 ? -3.234  6.316   -8.922  1.00 0.00 ? 31  ILE A CA   7  
ATOM   7335  C  C    . ILE A 1 31 ? -2.395  5.242   -9.606  1.00 0.00 ? 31  ILE A C    7  
ATOM   7336  O  O    . ILE A 1 31 ? -1.174  5.198   -9.448  1.00 0.00 ? 31  ILE A O    7  
ATOM   7337  C  CB   . ILE A 1 31 ? -2.915  7.683   -9.556  1.00 0.00 ? 31  ILE A CB   7  
ATOM   7338  C  CG1  . ILE A 1 31 ? -3.745  8.783   -8.893  1.00 0.00 ? 31  ILE A CG1  7  
ATOM   7339  C  CG2  . ILE A 1 31 ? -3.176  7.644   -11.055 1.00 0.00 ? 31  ILE A CG2  7  
ATOM   7340  C  CD1  . ILE A 1 31 ? -5.232  8.649   -9.137  1.00 0.00 ? 31  ILE A CD1  7  
ATOM   7341  H  H    . ILE A 1 31 ? -2.400  7.005   -7.103  1.00 0.00 ? 31  ILE A H    7  
ATOM   7342  H  HA   . ILE A 1 31 ? -4.279  6.100   -9.086  1.00 0.00 ? 31  ILE A HA   7  
ATOM   7343  H  HB   . ILE A 1 31 ? -1.867  7.890   -9.403  1.00 0.00 ? 31  ILE A HB   7  
ATOM   7344  H  HG12 . ILE A 1 31 ? -3.581  8.757   -7.828  1.00 0.00 ? 31  ILE A HG12 7  
ATOM   7345  H  HG13 . ILE A 1 31 ? -3.430  9.743   -9.278  1.00 0.00 ? 31  ILE A HG13 7  
ATOM   7346  H  HG21 . ILE A 1 31 ? -3.689  8.547   -11.354 1.00 0.00 ? 31  ILE A HG21 7  
ATOM   7347  H  HG22 . ILE A 1 31 ? -2.237  7.574   -11.582 1.00 0.00 ? 31  ILE A HG22 7  
ATOM   7348  H  HG23 . ILE A 1 31 ? -3.788  6.787   -11.292 1.00 0.00 ? 31  ILE A HG23 7  
ATOM   7349  H  HD11 . ILE A 1 31 ? -5.663  9.628   -9.285  1.00 0.00 ? 31  ILE A HD11 7  
ATOM   7350  H  HD12 . ILE A 1 31 ? -5.400  8.043   -10.015 1.00 0.00 ? 31  ILE A HD12 7  
ATOM   7351  H  HD13 . ILE A 1 31 ? -5.696  8.179   -8.281  1.00 0.00 ? 31  ILE A HD13 7  
ATOM   7352  N  N    . PHE A 1 32 ? -3.057  4.379   -10.369 1.00 0.00 ? 32  PHE A N    7  
ATOM   7353  C  CA   . PHE A 1 32 ? -2.372  3.305   -11.080 1.00 0.00 ? 32  PHE A CA   7  
ATOM   7354  C  C    . PHE A 1 32 ? -3.014  3.058   -12.442 1.00 0.00 ? 32  PHE A C    7  
ATOM   7355  O  O    . PHE A 1 32 ? -4.229  2.889   -12.548 1.00 0.00 ? 32  PHE A O    7  
ATOM   7356  C  CB   . PHE A 1 32 ? -2.398  2.019   -10.251 1.00 0.00 ? 32  PHE A CB   7  
ATOM   7357  C  CG   . PHE A 1 32 ? -1.705  0.864   -10.915 1.00 0.00 ? 32  PHE A CG   7  
ATOM   7358  C  CD1  . PHE A 1 32 ? -0.398  0.984   -11.358 1.00 0.00 ? 32  PHE A CD1  7  
ATOM   7359  C  CD2  . PHE A 1 32 ? -2.361  -0.343  -11.096 1.00 0.00 ? 32  PHE A CD2  7  
ATOM   7360  C  CE1  . PHE A 1 32 ? 0.242   -0.077  -11.970 1.00 0.00 ? 32  PHE A CE1  7  
ATOM   7361  C  CE2  . PHE A 1 32 ? -1.727  -1.408  -11.708 1.00 0.00 ? 32  PHE A CE2  7  
ATOM   7362  C  CZ   . PHE A 1 32 ? -0.423  -1.275  -12.144 1.00 0.00 ? 32  PHE A CZ   7  
ATOM   7363  H  H    . PHE A 1 32 ? -4.029  4.466   -10.456 1.00 0.00 ? 32  PHE A H    7  
ATOM   7364  H  HA   . PHE A 1 32 ? -1.347  3.607   -11.227 1.00 0.00 ? 32  PHE A HA   7  
ATOM   7365  H  HB2  . PHE A 1 32 ? -1.909  2.199   -9.305  1.00 0.00 ? 32  PHE A HB2  7  
ATOM   7366  H  HB3  . PHE A 1 32 ? -3.424  1.735   -10.073 1.00 0.00 ? 32  PHE A HB3  7  
ATOM   7367  H  HD1  . PHE A 1 32 ? 0.124   1.920   -11.221 1.00 0.00 ? 32  PHE A HD1  7  
ATOM   7368  H  HD2  . PHE A 1 32 ? -3.381  -0.449  -10.755 1.00 0.00 ? 32  PHE A HD2  7  
ATOM   7369  H  HE1  . PHE A 1 32 ? 1.261   0.029   -12.310 1.00 0.00 ? 32  PHE A HE1  7  
ATOM   7370  H  HE2  . PHE A 1 32 ? -2.250  -2.344  -11.842 1.00 0.00 ? 32  PHE A HE2  7  
ATOM   7371  H  HZ   . PHE A 1 32 ? 0.074   -2.106  -12.622 1.00 0.00 ? 32  PHE A HZ   7  
ATOM   7372  N  N    . LYS A 1 33 ? -2.189  3.040   -13.483 1.00 0.00 ? 33  LYS A N    7  
ATOM   7373  C  CA   . LYS A 1 33 ? -2.673  2.814   -14.840 1.00 0.00 ? 33  LYS A CA   7  
ATOM   7374  C  C    . LYS A 1 33 ? -3.805  3.778   -15.181 1.00 0.00 ? 33  LYS A C    7  
ATOM   7375  O  O    . LYS A 1 33 ? -4.713  3.439   -15.939 1.00 0.00 ? 33  LYS A O    7  
ATOM   7376  C  CB   . LYS A 1 33 ? -3.153  1.370   -14.998 1.00 0.00 ? 33  LYS A CB   7  
ATOM   7377  C  CG   . LYS A 1 33 ? -2.026  0.351   -15.004 1.00 0.00 ? 33  LYS A CG   7  
ATOM   7378  C  CD   . LYS A 1 33 ? -2.540  -1.047  -15.306 1.00 0.00 ? 33  LYS A CD   7  
ATOM   7379  C  CE   . LYS A 1 33 ? -1.404  -2.057  -15.366 1.00 0.00 ? 33  LYS A CE   7  
ATOM   7380  N  NZ   . LYS A 1 33 ? -1.909  -3.452  -15.490 1.00 0.00 ? 33  LYS A NZ   7  
ATOM   7381  H  H    . LYS A 1 33 ? -1.230  3.182   -13.335 1.00 0.00 ? 33  LYS A H    7  
ATOM   7382  H  HA   . LYS A 1 33 ? -1.852  2.988   -15.518 1.00 0.00 ? 33  LYS A HA   7  
ATOM   7383  H  HB2  . LYS A 1 33 ? -3.820  1.133   -14.181 1.00 0.00 ? 33  LYS A HB2  7  
ATOM   7384  H  HB3  . LYS A 1 33 ? -3.694  1.283   -15.929 1.00 0.00 ? 33  LYS A HB3  7  
ATOM   7385  H  HG2  . LYS A 1 33 ? -1.306  0.629   -15.758 1.00 0.00 ? 33  LYS A HG2  7  
ATOM   7386  H  HG3  . LYS A 1 33 ? -1.551  0.348   -14.033 1.00 0.00 ? 33  LYS A HG3  7  
ATOM   7387  H  HD2  . LYS A 1 33 ? -3.229  -1.344  -14.529 1.00 0.00 ? 33  LYS A HD2  7  
ATOM   7388  H  HD3  . LYS A 1 33 ? -3.051  -1.035  -16.258 1.00 0.00 ? 33  LYS A HD3  7  
ATOM   7389  H  HE2  . LYS A 1 33 ? -0.784  -1.830  -16.220 1.00 0.00 ? 33  LYS A HE2  7  
ATOM   7390  H  HE3  . LYS A 1 33 ? -0.818  -1.974  -14.463 1.00 0.00 ? 33  LYS A HE3  7  
ATOM   7391  H  HZ1  . LYS A 1 33 ? -1.703  -3.984  -14.621 1.00 0.00 ? 33  LYS A HZ1  7  
ATOM   7392  H  HZ2  . LYS A 1 33 ? -1.448  -3.929  -16.292 1.00 0.00 ? 33  LYS A HZ2  7  
ATOM   7393  H  HZ3  . LYS A 1 33 ? -2.937  -3.448  -15.647 1.00 0.00 ? 33  LYS A HZ3  7  
ATOM   7394  N  N    . ASN A 1 34 ? -3.743  4.980   -14.618 1.00 0.00 ? 34  ASN A N    7  
ATOM   7395  C  CA   . ASN A 1 34 ? -4.763  5.993   -14.864 1.00 0.00 ? 34  ASN A CA   7  
ATOM   7396  C  C    . ASN A 1 34 ? -6.078  5.615   -14.191 1.00 0.00 ? 34  ASN A C    7  
ATOM   7397  O  O    . ASN A 1 34 ? -7.142  5.671   -14.808 1.00 0.00 ? 34  ASN A O    7  
ATOM   7398  C  CB   . ASN A 1 34 ? -4.980  6.173   -16.368 1.00 0.00 ? 34  ASN A CB   7  
ATOM   7399  C  CG   . ASN A 1 34 ? -5.632  7.501   -16.703 1.00 0.00 ? 34  ASN A CG   7  
ATOM   7400  O  OD1  . ASN A 1 34 ? -5.077  8.565   -16.426 1.00 0.00 ? 34  ASN A OD1  7  
ATOM   7401  N  ND2  . ASN A 1 34 ? -6.816  7.444   -17.301 1.00 0.00 ? 34  ASN A ND2  7  
ATOM   7402  H  H    . ASN A 1 34 ? -2.993  5.191   -14.023 1.00 0.00 ? 34  ASN A H    7  
ATOM   7403  H  HA   . ASN A 1 34 ? -4.412  6.924   -14.446 1.00 0.00 ? 34  ASN A HA   7  
ATOM   7404  H  HB2  . ASN A 1 34 ? -4.025  6.126   -16.871 1.00 0.00 ? 34  ASN A HB2  7  
ATOM   7405  H  HB3  . ASN A 1 34 ? -5.614  5.379   -16.732 1.00 0.00 ? 34  ASN A HB3  7  
ATOM   7406  H  HD21 . ASN A 1 34 ? -7.197  6.561   -17.491 1.00 0.00 ? 34  ASN A HD21 7  
ATOM   7407  H  HD22 . ASN A 1 34 ? -7.259  8.288   -17.530 1.00 0.00 ? 34  ASN A HD22 7  
ATOM   7408  N  N    . ASP A 1 35 ? -5.998  5.230   -12.922 1.00 0.00 ? 35  ASP A N    7  
ATOM   7409  C  CA   . ASP A 1 35 ? -7.182  4.845   -12.163 1.00 0.00 ? 35  ASP A CA   7  
ATOM   7410  C  C    . ASP A 1 35 ? -6.899  4.871   -10.664 1.00 0.00 ? 35  ASP A C    7  
ATOM   7411  O  O    . ASP A 1 35 ? -5.821  4.495   -10.204 1.00 0.00 ? 35  ASP A O    7  
ATOM   7412  C  CB   . ASP A 1 35 ? -7.650  3.450   -12.582 1.00 0.00 ? 35  ASP A CB   7  
ATOM   7413  C  CG   . ASP A 1 35 ? -8.555  3.485   -13.798 1.00 0.00 ? 35  ASP A CG   7  
ATOM   7414  O  OD1  . ASP A 1 35 ? -9.420  4.383   -13.868 1.00 0.00 ? 35  ASP A OD1  7  
ATOM   7415  O  OD2  . ASP A 1 35 ? -8.400  2.613   -14.678 1.00 0.00 ? 35  ASP A OD2  7  
ATOM   7416  H  H    . ASP A 1 35 ? -5.121  5.206   -12.484 1.00 0.00 ? 35  ASP A H    7  
ATOM   7417  H  HA   . ASP A 1 35 ? -7.963  5.557   -12.382 1.00 0.00 ? 35  ASP A HA   7  
ATOM   7418  H  HB2  . ASP A 1 35 ? -6.788  2.843   -12.816 1.00 0.00 ? 35  ASP A HB2  7  
ATOM   7419  H  HB3  . ASP A 1 35 ? -8.192  2.999   -11.764 1.00 0.00 ? 35  ASP A HB3  7  
ATOM   7420  N  N    . PRO A 1 36 ? -7.890  5.325   -9.883  1.00 0.00 ? 36  PRO A N    7  
ATOM   7421  C  CA   . PRO A 1 36 ? -7.772  5.412   -8.424  1.00 0.00 ? 36  PRO A CA   7  
ATOM   7422  C  C    . PRO A 1 36 ? -7.747  4.038   -7.762  1.00 0.00 ? 36  PRO A C    7  
ATOM   7423  O  O    . PRO A 1 36 ? -8.436  3.115   -8.198  1.00 0.00 ? 36  PRO A O    7  
ATOM   7424  C  CB   . PRO A 1 36 ? -9.029  6.182   -8.011  1.00 0.00 ? 36  PRO A CB   7  
ATOM   7425  C  CG   . PRO A 1 36 ? -10.010 5.917   -9.100  1.00 0.00 ? 36  PRO A CG   7  
ATOM   7426  C  CD   . PRO A 1 36 ? -9.203  5.789   -10.363 1.00 0.00 ? 36  PRO A CD   7  
ATOM   7427  H  HA   . PRO A 1 36 ? -6.894  5.968   -8.130  1.00 0.00 ? 36  PRO A HA   7  
ATOM   7428  H  HB2  . PRO A 1 36 ? -9.384  5.812   -7.060  1.00 0.00 ? 36  PRO A HB2  7  
ATOM   7429  H  HB3  . PRO A 1 36 ? -8.801  7.234   -7.933  1.00 0.00 ? 36  PRO A HB3  7  
ATOM   7430  H  HG2  . PRO A 1 36 ? -10.542 5.000   -8.900  1.00 0.00 ? 36  PRO A HG2  7  
ATOM   7431  H  HG3  . PRO A 1 36 ? -10.701 6.744   -9.180  1.00 0.00 ? 36  PRO A HG3  7  
ATOM   7432  H  HD2  . PRO A 1 36 ? -9.650  5.062   -11.024 1.00 0.00 ? 36  PRO A HD2  7  
ATOM   7433  H  HD3  . PRO A 1 36 ? -9.116  6.746   -10.854 1.00 0.00 ? 36  PRO A HD3  7  
ATOM   7434  N  N    . TYR A 1 37 ? -6.951  3.910   -6.706  1.00 0.00 ? 37  TYR A N    7  
ATOM   7435  C  CA   . TYR A 1 37 ? -6.836  2.648   -5.985  1.00 0.00 ? 37  TYR A CA   7  
ATOM   7436  C  C    . TYR A 1 37 ? -6.362  2.880   -4.554  1.00 0.00 ? 37  TYR A C    7  
ATOM   7437  O  O    . TYR A 1 37 ? -5.938  3.980   -4.198  1.00 0.00 ? 37  TYR A O    7  
ATOM   7438  C  CB   . TYR A 1 37 ? -5.868  1.709   -6.708  1.00 0.00 ? 37  TYR A CB   7  
ATOM   7439  C  CG   . TYR A 1 37 ? -6.348  1.284   -8.078  1.00 0.00 ? 37  TYR A CG   7  
ATOM   7440  C  CD1  . TYR A 1 37 ? -7.364  0.348   -8.220  1.00 0.00 ? 37  TYR A CD1  7  
ATOM   7441  C  CD2  . TYR A 1 37 ? -5.784  1.819   -9.230  1.00 0.00 ? 37  TYR A CD2  7  
ATOM   7442  C  CE1  . TYR A 1 37 ? -7.804  -0.045  -9.469  1.00 0.00 ? 37  TYR A CE1  7  
ATOM   7443  C  CE2  . TYR A 1 37 ? -6.219  1.434   -10.483 1.00 0.00 ? 37  TYR A CE2  7  
ATOM   7444  C  CZ   . TYR A 1 37 ? -7.229  0.501   -10.598 1.00 0.00 ? 37  TYR A CZ   7  
ATOM   7445  O  OH   . TYR A 1 37 ? -7.666  0.114   -11.844 1.00 0.00 ? 37  TYR A OH   7  
ATOM   7446  H  H    . TYR A 1 37 ? -6.427  4.681   -6.406  1.00 0.00 ? 37  TYR A H    7  
ATOM   7447  H  HA   . TYR A 1 37 ? -7.814  2.190   -5.959  1.00 0.00 ? 37  TYR A HA   7  
ATOM   7448  H  HB2  . TYR A 1 37 ? -4.918  2.207   -6.830  1.00 0.00 ? 37  TYR A HB2  7  
ATOM   7449  H  HB3  . TYR A 1 37 ? -5.729  0.819   -6.113  1.00 0.00 ? 37  TYR A HB3  7  
ATOM   7450  H  HD1  . TYR A 1 37 ? -7.813  -0.078  -7.334  1.00 0.00 ? 37  TYR A HD1  7  
ATOM   7451  H  HD2  . TYR A 1 37 ? -4.993  2.549   -9.137  1.00 0.00 ? 37  TYR A HD2  7  
ATOM   7452  H  HE1  . TYR A 1 37 ? -8.596  -0.774  -9.559  1.00 0.00 ? 37  TYR A HE1  7  
ATOM   7453  H  HE2  . TYR A 1 37 ? -5.768  1.861   -11.367 1.00 0.00 ? 37  TYR A HE2  7  
ATOM   7454  H  HH   . TYR A 1 37 ? -7.492  -0.822  -11.967 1.00 0.00 ? 37  TYR A HH   7  
ATOM   7455  N  N    . HIS A 1 38 ? -6.437  1.835   -3.736  1.00 0.00 ? 38  HIS A N    7  
ATOM   7456  C  CA   . HIS A 1 38 ? -6.015  1.923   -2.342  1.00 0.00 ? 38  HIS A CA   7  
ATOM   7457  C  C    . HIS A 1 38 ? -4.551  1.520   -2.191  1.00 0.00 ? 38  HIS A C    7  
ATOM   7458  O  O    . HIS A 1 38 ? -4.128  0.451   -2.631  1.00 0.00 ? 38  HIS A O    7  
ATOM   7459  C  CB   . HIS A 1 38 ? -6.895  1.032   -1.464  1.00 0.00 ? 38  HIS A CB   7  
ATOM   7460  C  CG   . HIS A 1 38 ? -8.164  1.693   -1.022  1.00 0.00 ? 38  HIS A CG   7  
ATOM   7461  N  ND1  . HIS A 1 38 ? -9.414  1.189   -1.310  1.00 0.00 ? 38  HIS A ND1  7  
ATOM   7462  C  CD2  . HIS A 1 38 ? -8.371  2.823   -0.307  1.00 0.00 ? 38  HIS A CD2  7  
ATOM   7463  C  CE1  . HIS A 1 38 ? -10.336 1.982   -0.792  1.00 0.00 ? 38  HIS A CE1  7  
ATOM   7464  N  NE2  . HIS A 1 38 ? -9.729  2.981   -0.178  1.00 0.00 ? 38  HIS A NE2  7  
ATOM   7465  H  H    . HIS A 1 38 ? -6.784  0.985   -4.077  1.00 0.00 ? 38  HIS A H    7  
ATOM   7466  H  HA   . HIS A 1 38 ? -6.128  2.949   -2.026  1.00 0.00 ? 38  HIS A HA   7  
ATOM   7467  H  HB2  . HIS A 1 38 ? -7.159  0.142   -2.016  1.00 0.00 ? 38  HIS A HB2  7  
ATOM   7468  H  HB3  . HIS A 1 38 ? -6.341  0.750   -0.580  1.00 0.00 ? 38  HIS A HB3  7  
ATOM   7469  H  HD2  . HIS A 1 38 ? -7.609  3.481   0.089   1.00 0.00 ? 38  HIS A HD2  7  
ATOM   7470  H  HE1  . HIS A 1 38 ? -11.404 1.838   -0.859  1.00 0.00 ? 38  HIS A HE1  7  
ATOM   7471  H  HE2  . HIS A 1 38 ? -10.178 3.757   0.217   1.00 0.00 ? 38  HIS A HE2  7  
ATOM   7472  N  N    . PRO A 1 39 ? -3.759  2.396   -1.556  1.00 0.00 ? 39  PRO A N    7  
ATOM   7473  C  CA   . PRO A 1 39 ? -2.330  2.153   -1.333  1.00 0.00 ? 39  PRO A CA   7  
ATOM   7474  C  C    . PRO A 1 39 ? -2.082  1.043   -0.318  1.00 0.00 ? 39  PRO A C    7  
ATOM   7475  O  O    . PRO A 1 39 ? -0.937  0.723   0.000   1.00 0.00 ? 39  PRO A O    7  
ATOM   7476  C  CB   . PRO A 1 39 ? -1.823  3.493   -0.795  1.00 0.00 ? 39  PRO A CB   7  
ATOM   7477  C  CG   . PRO A 1 39 ? -3.020  4.132   -0.180  1.00 0.00 ? 39  PRO A CG   7  
ATOM   7478  C  CD   . PRO A 1 39 ? -4.196  3.690   -1.006  1.00 0.00 ? 39  PRO A CD   7  
ATOM   7479  H  HA   . PRO A 1 39 ? -1.819  1.917   -2.255  1.00 0.00 ? 39  PRO A HA   7  
ATOM   7480  H  HB2  . PRO A 1 39 ? -1.047  3.319   -0.062  1.00 0.00 ? 39  PRO A HB2  7  
ATOM   7481  H  HB3  . PRO A 1 39 ? -1.432  4.087   -1.607  1.00 0.00 ? 39  PRO A HB3  7  
ATOM   7482  H  HG2  . PRO A 1 39 ? -3.131  3.798   0.840   1.00 0.00 ? 39  PRO A HG2  7  
ATOM   7483  H  HG3  . PRO A 1 39 ? -2.920  5.207   -0.215  1.00 0.00 ? 39  PRO A HG3  7  
ATOM   7484  H  HD2  . PRO A 1 39 ? -5.070  3.569   -0.384  1.00 0.00 ? 39  PRO A HD2  7  
ATOM   7485  H  HD3  . PRO A 1 39 ? -4.389  4.399   -1.798  1.00 0.00 ? 39  PRO A HD3  7  
ATOM   7486  N  N    . ASP A 1 40 ? -3.163  0.458   0.188   1.00 0.00 ? 40  ASP A N    7  
ATOM   7487  C  CA   . ASP A 1 40 ? -3.062  -0.618  1.167   1.00 0.00 ? 40  ASP A CA   7  
ATOM   7488  C  C    . ASP A 1 40 ? -3.328  -1.972  0.515   1.00 0.00 ? 40  ASP A C    7  
ATOM   7489  O  O    . ASP A 1 40 ? -2.982  -3.017  1.068   1.00 0.00 ? 40  ASP A O    7  
ATOM   7490  C  CB   . ASP A 1 40 ? -4.048  -0.388  2.313   1.00 0.00 ? 40  ASP A CB   7  
ATOM   7491  C  CG   . ASP A 1 40 ? -5.397  -1.031  2.055   1.00 0.00 ? 40  ASP A CG   7  
ATOM   7492  O  OD1  . ASP A 1 40 ? -6.165  -0.489  1.232   1.00 0.00 ? 40  ASP A OD1  7  
ATOM   7493  O  OD2  . ASP A 1 40 ? -5.684  -2.076  2.674   1.00 0.00 ? 40  ASP A OD2  7  
ATOM   7494  H  H    . ASP A 1 40 ? -4.049  0.757   -0.105  1.00 0.00 ? 40  ASP A H    7  
ATOM   7495  H  HA   . ASP A 1 40 ? -2.058  -0.614  1.562   1.00 0.00 ? 40  ASP A HA   7  
ATOM   7496  H  HB2  . ASP A 1 40 ? -3.639  -0.806  3.221   1.00 0.00 ? 40  ASP A HB2  7  
ATOM   7497  H  HB3  . ASP A 1 40 ? -4.195  0.674   2.445   1.00 0.00 ? 40  ASP A HB3  7  
ATOM   7498  N  N    . HIS A 1 41 ? -3.944  -1.945  -0.662  1.00 0.00 ? 41  HIS A N    7  
ATOM   7499  C  CA   . HIS A 1 41 ? -4.256  -3.171  -1.389  1.00 0.00 ? 41  HIS A CA   7  
ATOM   7500  C  C    . HIS A 1 41 ? -2.982  -3.848  -1.885  1.00 0.00 ? 41  HIS A C    7  
ATOM   7501  O  O    . HIS A 1 41 ? -2.797  -5.052  -1.704  1.00 0.00 ? 41  HIS A O    7  
ATOM   7502  C  CB   . HIS A 1 41 ? -5.179  -2.867  -2.570  1.00 0.00 ? 41  HIS A CB   7  
ATOM   7503  C  CG   . HIS A 1 41 ? -6.609  -2.664  -2.176  1.00 0.00 ? 41  HIS A CG   7  
ATOM   7504  N  ND1  . HIS A 1 41 ? -7.136  -3.128  -0.989  1.00 0.00 ? 41  HIS A ND1  7  
ATOM   7505  C  CD2  . HIS A 1 41 ? -7.625  -2.042  -2.819  1.00 0.00 ? 41  HIS A CD2  7  
ATOM   7506  C  CE1  . HIS A 1 41 ? -8.414  -2.801  -0.919  1.00 0.00 ? 41  HIS A CE1  7  
ATOM   7507  N  NE2  . HIS A 1 41 ? -8.736  -2.141  -2.017  1.00 0.00 ? 41  HIS A NE2  7  
ATOM   7508  H  H    . HIS A 1 41 ? -4.194  -1.082  -1.051  1.00 0.00 ? 41  HIS A H    7  
ATOM   7509  H  HA   . HIS A 1 41 ? -4.764  -3.839  -0.710  1.00 0.00 ? 41  HIS A HA   7  
ATOM   7510  H  HB2  . HIS A 1 41 ? -4.840  -1.967  -3.061  1.00 0.00 ? 41  HIS A HB2  7  
ATOM   7511  H  HB3  . HIS A 1 41 ? -5.140  -3.689  -3.270  1.00 0.00 ? 41  HIS A HB3  7  
ATOM   7512  H  HD1  . HIS A 1 41 ? -6.646  -3.624  -0.301  1.00 0.00 ? 41  HIS A HD1  7  
ATOM   7513  H  HD2  . HIS A 1 41 ? -7.573  -1.558  -3.784  1.00 0.00 ? 41  HIS A HD2  7  
ATOM   7514  H  HE1  . HIS A 1 41 ? -9.083  -3.033  -0.104  1.00 0.00 ? 41  HIS A HE1  7  
ATOM   7515  N  N    . PHE A 1 42 ? -2.108  -3.068  -2.510  1.00 0.00 ? 42  PHE A N    7  
ATOM   7516  C  CA   . PHE A 1 42 ? -0.852  -3.593  -3.033  1.00 0.00 ? 42  PHE A CA   7  
ATOM   7517  C  C    . PHE A 1 42 ? 0.283   -3.384  -2.035  1.00 0.00 ? 42  PHE A C    7  
ATOM   7518  O  O    . PHE A 1 42 ? 0.185   -2.554  -1.132  1.00 0.00 ? 42  PHE A O    7  
ATOM   7519  C  CB   . PHE A 1 42 ? -0.507  -2.918  -4.363  1.00 0.00 ? 42  PHE A CB   7  
ATOM   7520  C  CG   . PHE A 1 42 ? -1.703  -2.667  -5.235  1.00 0.00 ? 42  PHE A CG   7  
ATOM   7521  C  CD1  . PHE A 1 42 ? -2.161  -3.644  -6.104  1.00 0.00 ? 42  PHE A CD1  7  
ATOM   7522  C  CD2  . PHE A 1 42 ? -2.369  -1.453  -5.187  1.00 0.00 ? 42  PHE A CD2  7  
ATOM   7523  C  CE1  . PHE A 1 42 ? -3.262  -3.416  -6.909  1.00 0.00 ? 42  PHE A CE1  7  
ATOM   7524  C  CE2  . PHE A 1 42 ? -3.471  -1.219  -5.989  1.00 0.00 ? 42  PHE A CE2  7  
ATOM   7525  C  CZ   . PHE A 1 42 ? -3.917  -2.201  -6.851  1.00 0.00 ? 42  PHE A CZ   7  
ATOM   7526  H  H    . PHE A 1 42 ? -2.312  -2.116  -2.623  1.00 0.00 ? 42  PHE A H    7  
ATOM   7527  H  HA   . PHE A 1 42 ? -0.980  -4.651  -3.199  1.00 0.00 ? 42  PHE A HA   7  
ATOM   7528  H  HB2  . PHE A 1 42 ? -0.036  -1.967  -4.164  1.00 0.00 ? 42  PHE A HB2  7  
ATOM   7529  H  HB3  . PHE A 1 42 ? 0.179   -3.547  -4.910  1.00 0.00 ? 42  PHE A HB3  7  
ATOM   7530  H  HD1  . PHE A 1 42 ? -1.649  -4.595  -6.150  1.00 0.00 ? 42  PHE A HD1  7  
ATOM   7531  H  HD2  . PHE A 1 42 ? -2.021  -0.683  -4.514  1.00 0.00 ? 42  PHE A HD2  7  
ATOM   7532  H  HE1  . PHE A 1 42 ? -3.608  -4.186  -7.582  1.00 0.00 ? 42  PHE A HE1  7  
ATOM   7533  H  HE2  . PHE A 1 42 ? -3.981  -0.268  -5.942  1.00 0.00 ? 42  PHE A HE2  7  
ATOM   7534  H  HZ   . PHE A 1 42 ? -4.777  -2.021  -7.478  1.00 0.00 ? 42  PHE A HZ   7  
ATOM   7535  N  N    . ASN A 1 43 ? 1.359   -4.145  -2.204  1.00 0.00 ? 43  ASN A N    7  
ATOM   7536  C  CA   . ASN A 1 43 ? 2.513   -4.046  -1.317  1.00 0.00 ? 43  ASN A CA   7  
ATOM   7537  C  C    . ASN A 1 43 ? 3.814   -4.048  -2.115  1.00 0.00 ? 43  ASN A C    7  
ATOM   7538  O  O    . ASN A 1 43 ? 3.899   -4.655  -3.183  1.00 0.00 ? 43  ASN A O    7  
ATOM   7539  C  CB   . ASN A 1 43 ? 2.514   -5.202  -0.315  1.00 0.00 ? 43  ASN A CB   7  
ATOM   7540  C  CG   . ASN A 1 43 ? 1.633   -4.925  0.888   1.00 0.00 ? 43  ASN A CG   7  
ATOM   7541  O  OD1  . ASN A 1 43 ? 0.657   -4.180  0.799   1.00 0.00 ? 43  ASN A OD1  7  
ATOM   7542  N  ND2  . ASN A 1 43 ? 1.976   -5.524  2.022   1.00 0.00 ? 43  ASN A ND2  7  
ATOM   7543  H  H    . ASN A 1 43 ? 1.378   -4.790  -2.942  1.00 0.00 ? 43  ASN A H    7  
ATOM   7544  H  HA   . ASN A 1 43 ? 2.437   -3.114  -0.778  1.00 0.00 ? 43  ASN A HA   7  
ATOM   7545  H  HB2  . ASN A 1 43 ? 2.151   -6.094  -0.804  1.00 0.00 ? 43  ASN A HB2  7  
ATOM   7546  H  HB3  . ASN A 1 43 ? 3.522   -5.371  0.031   1.00 0.00 ? 43  ASN A HB3  7  
ATOM   7547  H  HD21 . ASN A 1 43 ? 2.767   -6.104  2.020   1.00 0.00 ? 43  ASN A HD21 7  
ATOM   7548  H  HD22 . ASN A 1 43 ? 1.424   -5.363  2.816   1.00 0.00 ? 43  ASN A HD22 7  
ATOM   7549  N  N    . CYS A 1 44 ? 4.825   -3.366  -1.588  1.00 0.00 ? 44  CYS A N    7  
ATOM   7550  C  CA   . CYS A 1 44 ? 6.122   -3.289  -2.249  1.00 0.00 ? 44  CYS A CA   7  
ATOM   7551  C  C    . CYS A 1 44 ? 6.569   -4.665  -2.733  1.00 0.00 ? 44  CYS A C    7  
ATOM   7552  O  O    . CYS A 1 44 ? 6.077   -5.690  -2.262  1.00 0.00 ? 44  CYS A O    7  
ATOM   7553  C  CB   . CYS A 1 44 ? 7.169   -2.705  -1.298  1.00 0.00 ? 44  CYS A CB   7  
ATOM   7554  S  SG   . CYS A 1 44 ? 8.723   -2.216  -2.112  1.00 0.00 ? 44  CYS A SG   7  
ATOM   7555  H  H    . CYS A 1 44 ? 4.696   -2.902  -0.733  1.00 0.00 ? 44  CYS A H    7  
ATOM   7556  H  HA   . CYS A 1 44 ? 6.021   -2.636  -3.103  1.00 0.00 ? 44  CYS A HA   7  
ATOM   7557  H  HB2  . CYS A 1 44 ? 6.759   -1.828  -0.819  1.00 0.00 ? 44  CYS A HB2  7  
ATOM   7558  H  HB3  . CYS A 1 44 ? 7.410   -3.441  -0.545  1.00 0.00 ? 44  CYS A HB3  7  
ATOM   7559  N  N    . ALA A 1 45 ? 7.506   -4.680  -3.675  1.00 0.00 ? 45  ALA A N    7  
ATOM   7560  C  CA   . ALA A 1 45 ? 8.021   -5.930  -4.221  1.00 0.00 ? 45  ALA A CA   7  
ATOM   7561  C  C    . ALA A 1 45 ? 9.408   -6.240  -3.667  1.00 0.00 ? 45  ALA A C    7  
ATOM   7562  O  O    . ALA A 1 45 ? 9.830   -7.395  -3.636  1.00 0.00 ? 45  ALA A O    7  
ATOM   7563  C  CB   . ALA A 1 45 ? 8.060   -5.866  -5.740  1.00 0.00 ? 45  ALA A CB   7  
ATOM   7564  H  H    . ALA A 1 45 ? 7.860   -3.830  -4.010  1.00 0.00 ? 45  ALA A H    7  
ATOM   7565  H  HA   . ALA A 1 45 ? 7.345   -6.722  -3.935  1.00 0.00 ? 45  ALA A HA   7  
ATOM   7566  H  HB1  . ALA A 1 45 ? 7.835   -4.859  -6.063  1.00 0.00 ? 45  ALA A HB1  7  
ATOM   7567  H  HB2  . ALA A 1 45 ? 9.044   -6.144  -6.087  1.00 0.00 ? 45  ALA A HB2  7  
ATOM   7568  H  HB3  . ALA A 1 45 ? 7.329   -6.547  -6.148  1.00 0.00 ? 45  ALA A HB3  7  
ATOM   7569  N  N    . ASN A 1 46 ? 10.112  -5.201  -3.230  1.00 0.00 ? 46  ASN A N    7  
ATOM   7570  C  CA   . ASN A 1 46 ? 11.452  -5.363  -2.679  1.00 0.00 ? 46  ASN A CA   7  
ATOM   7571  C  C    . ASN A 1 46 ? 11.390  -5.787  -1.214  1.00 0.00 ? 46  ASN A C    7  
ATOM   7572  O  O    . ASN A 1 46 ? 11.808  -6.889  -0.857  1.00 0.00 ? 46  ASN A O    7  
ATOM   7573  C  CB   . ASN A 1 46 ? 12.242  -4.059  -2.810  1.00 0.00 ? 46  ASN A CB   7  
ATOM   7574  C  CG   . ASN A 1 46 ? 13.703  -4.228  -2.440  1.00 0.00 ? 46  ASN A CG   7  
ATOM   7575  O  OD1  . ASN A 1 46 ? 14.481  -4.818  -3.190  1.00 0.00 ? 46  ASN A OD1  7  
ATOM   7576  N  ND2  . ASN A 1 46 ? 14.082  -3.710  -1.277  1.00 0.00 ? 46  ASN A ND2  7  
ATOM   7577  H  H    . ASN A 1 46 ? 9.722   -4.303  -3.281  1.00 0.00 ? 46  ASN A H    7  
ATOM   7578  H  HA   . ASN A 1 46 ? 11.952  -6.135  -3.244  1.00 0.00 ? 46  ASN A HA   7  
ATOM   7579  H  HB2  . ASN A 1 46 ? 12.188  -3.715  -3.833  1.00 0.00 ? 46  ASN A HB2  7  
ATOM   7580  H  HB3  . ASN A 1 46 ? 11.808  -3.315  -2.160  1.00 0.00 ? 46  ASN A HB3  7  
ATOM   7581  H  HD21 . ASN A 1 46 ? 13.408  -3.254  -0.731  1.00 0.00 ? 46  ASN A HD21 7  
ATOM   7582  H  HD22 . ASN A 1 46 ? 15.021  -3.805  -1.013  1.00 0.00 ? 46  ASN A HD22 7  
ATOM   7583  N  N    . CYS A 1 47 ? 10.865  -4.905  -0.370  1.00 0.00 ? 47  CYS A N    7  
ATOM   7584  C  CA   . CYS A 1 47 ? 10.747  -5.186  1.055   1.00 0.00 ? 47  CYS A CA   7  
ATOM   7585  C  C    . CYS A 1 47 ? 9.480   -5.985  1.349   1.00 0.00 ? 47  CYS A C    7  
ATOM   7586  O  O    . CYS A 1 47 ? 9.486   -6.896  2.175   1.00 0.00 ? 47  CYS A O    7  
ATOM   7587  C  CB   . CYS A 1 47 ? 10.737  -3.881  1.854   1.00 0.00 ? 47  CYS A CB   7  
ATOM   7588  S  SG   . CYS A 1 47 ? 9.434   -2.711  1.352   1.00 0.00 ? 47  CYS A SG   7  
ATOM   7589  H  H    . CYS A 1 47 ? 10.549  -4.042  -0.715  1.00 0.00 ? 47  CYS A H    7  
ATOM   7590  H  HA   . CYS A 1 47 ? 11.604  -5.772  1.350   1.00 0.00 ? 47  CYS A HA   7  
ATOM   7591  H  HB2  . CYS A 1 47 ? 10.587  -4.110  2.900   1.00 0.00 ? 47  CYS A HB2  7  
ATOM   7592  H  HB3  . CYS A 1 47 ? 11.689  -3.386  1.732   1.00 0.00 ? 47  CYS A HB3  7  
ATOM   7593  N  N    . GLY A 1 48 ? 8.395   -5.635  0.665   1.00 0.00 ? 48  GLY A N    7  
ATOM   7594  C  CA   . GLY A 1 48 ? 7.136   -6.329  0.866   1.00 0.00 ? 48  GLY A CA   7  
ATOM   7595  C  C    . GLY A 1 48 ? 6.293   -5.697  1.956   1.00 0.00 ? 48  GLY A C    7  
ATOM   7596  O  O    . GLY A 1 48 ? 5.742   -6.394  2.809   1.00 0.00 ? 48  GLY A O    7  
ATOM   7597  H  H    . GLY A 1 48 ? 8.449   -4.900  0.019   1.00 0.00 ? 48  GLY A H    7  
ATOM   7598  H  HA2  . GLY A 1 48 ? 6.578   -6.316  -0.058  1.00 0.00 ? 48  GLY A HA2  7  
ATOM   7599  H  HA3  . GLY A 1 48 ? 7.342   -7.354  1.136   1.00 0.00 ? 48  GLY A HA3  7  
ATOM   7600  N  N    . LYS A 1 49 ? 6.193   -4.372  1.931   1.00 0.00 ? 49  LYS A N    7  
ATOM   7601  C  CA   . LYS A 1 49 ? 5.412   -3.645  2.925   1.00 0.00 ? 49  LYS A CA   7  
ATOM   7602  C  C    . LYS A 1 49 ? 4.193   -2.989  2.285   1.00 0.00 ? 49  LYS A C    7  
ATOM   7603  O  O    . LYS A 1 49 ? 4.090   -2.911  1.061   1.00 0.00 ? 49  LYS A O    7  
ATOM   7604  C  CB   . LYS A 1 49 ? 6.278   -2.581  3.605   1.00 0.00 ? 49  LYS A CB   7  
ATOM   7605  C  CG   . LYS A 1 49 ? 6.351   -1.274  2.836   1.00 0.00 ? 49  LYS A CG   7  
ATOM   7606  C  CD   . LYS A 1 49 ? 7.050   -0.191  3.642   1.00 0.00 ? 49  LYS A CD   7  
ATOM   7607  C  CE   . LYS A 1 49 ? 6.064   0.594   4.493   1.00 0.00 ? 49  LYS A CE   7  
ATOM   7608  N  NZ   . LYS A 1 49 ? 5.499   1.758   3.757   1.00 0.00 ? 49  LYS A NZ   7  
ATOM   7609  H  H    . LYS A 1 49 ? 6.655   -3.871  1.226   1.00 0.00 ? 49  LYS A H    7  
ATOM   7610  H  HA   . LYS A 1 49 ? 5.077   -4.353  3.667   1.00 0.00 ? 49  LYS A HA   7  
ATOM   7611  H  HB2  . LYS A 1 49 ? 5.872   -2.377  4.585   1.00 0.00 ? 49  LYS A HB2  7  
ATOM   7612  H  HB3  . LYS A 1 49 ? 7.281   -2.967  3.714   1.00 0.00 ? 49  LYS A HB3  7  
ATOM   7613  H  HG2  . LYS A 1 49 ? 6.899   -1.436  1.920   1.00 0.00 ? 49  LYS A HG2  7  
ATOM   7614  H  HG3  . LYS A 1 49 ? 5.347   -0.946  2.604   1.00 0.00 ? 49  LYS A HG3  7  
ATOM   7615  H  HD2  . LYS A 1 49 ? 7.781   -0.652  4.290   1.00 0.00 ? 49  LYS A HD2  7  
ATOM   7616  H  HD3  . LYS A 1 49 ? 7.546   0.488   2.962   1.00 0.00 ? 49  LYS A HD3  7  
ATOM   7617  H  HE2  . LYS A 1 49 ? 5.258   -0.062  4.785   1.00 0.00 ? 49  LYS A HE2  7  
ATOM   7618  H  HE3  . LYS A 1 49 ? 6.575   0.950   5.376   1.00 0.00 ? 49  LYS A HE3  7  
ATOM   7619  H  HZ1  . LYS A 1 49 ? 6.258   2.423   3.503   1.00 0.00 ? 49  LYS A HZ1  7  
ATOM   7620  H  HZ2  . LYS A 1 49 ? 4.804   2.254   4.351   1.00 0.00 ? 49  LYS A HZ2  7  
ATOM   7621  H  HZ3  . LYS A 1 49 ? 5.029   1.437   2.886   1.00 0.00 ? 49  LYS A HZ3  7  
ATOM   7622  N  N    . GLU A 1 50 ? 3.272   -2.520  3.121   1.00 0.00 ? 50  GLU A N    7  
ATOM   7623  C  CA   . GLU A 1 50 ? 2.060   -1.871  2.634   1.00 0.00 ? 50  GLU A CA   7  
ATOM   7624  C  C    . GLU A 1 50 ? 2.393   -0.574  1.903   1.00 0.00 ? 50  GLU A C    7  
ATOM   7625  O  O    . GLU A 1 50 ? 2.681   0.448   2.527   1.00 0.00 ? 50  GLU A O    7  
ATOM   7626  C  CB   . GLU A 1 50 ? 1.107   -1.583  3.797   1.00 0.00 ? 50  GLU A CB   7  
ATOM   7627  C  CG   . GLU A 1 50 ? -0.281  -1.154  3.354   1.00 0.00 ? 50  GLU A CG   7  
ATOM   7628  C  CD   . GLU A 1 50 ? -1.303  -1.244  4.471   1.00 0.00 ? 50  GLU A CD   7  
ATOM   7629  O  OE1  . GLU A 1 50 ? -1.525  -2.361  4.982   1.00 0.00 ? 50  GLU A OE1  7  
ATOM   7630  O  OE2  . GLU A 1 50 ? -1.881  -0.198  4.833   1.00 0.00 ? 50  GLU A OE2  7  
ATOM   7631  H  H    . GLU A 1 50 ? 3.410   -2.612  4.086   1.00 0.00 ? 50  GLU A H    7  
ATOM   7632  H  HA   . GLU A 1 50 ? 1.576   -2.545  1.944   1.00 0.00 ? 50  GLU A HA   7  
ATOM   7633  H  HB2  . GLU A 1 50 ? 1.012   -2.475  4.398   1.00 0.00 ? 50  GLU A HB2  7  
ATOM   7634  H  HB3  . GLU A 1 50 ? 1.528   -0.794  4.404   1.00 0.00 ? 50  GLU A HB3  7  
ATOM   7635  H  HG2  . GLU A 1 50 ? -0.236  -0.132  3.010   1.00 0.00 ? 50  GLU A HG2  7  
ATOM   7636  H  HG3  . GLU A 1 50 ? -0.599  -1.792  2.543   1.00 0.00 ? 50  GLU A HG3  7  
ATOM   7637  N  N    . LEU A 1 51 ? 2.353   -0.623  0.576   1.00 0.00 ? 51  LEU A N    7  
ATOM   7638  C  CA   . LEU A 1 51 ? 2.652   0.547   -0.243  1.00 0.00 ? 51  LEU A CA   7  
ATOM   7639  C  C    . LEU A 1 51 ? 1.854   1.759   0.229   1.00 0.00 ? 51  LEU A C    7  
ATOM   7640  O  O    . LEU A 1 51 ? 0.993   1.648   1.102   1.00 0.00 ? 51  LEU A O    7  
ATOM   7641  C  CB   . LEU A 1 51 ? 2.341   0.258   -1.713  1.00 0.00 ? 51  LEU A CB   7  
ATOM   7642  C  CG   . LEU A 1 51 ? 3.312   -0.679  -2.432  1.00 0.00 ? 51  LEU A CG   7  
ATOM   7643  C  CD1  . LEU A 1 51 ? 2.735   -1.122  -3.768  1.00 0.00 ? 51  LEU A CD1  7  
ATOM   7644  C  CD2  . LEU A 1 51 ? 4.660   -0.002  -2.628  1.00 0.00 ? 51  LEU A CD2  7  
ATOM   7645  H  H    . LEU A 1 51 ? 2.118   -1.466  0.135   1.00 0.00 ? 51  LEU A H    7  
ATOM   7646  H  HA   . LEU A 1 51 ? 3.705   0.762   -0.141  1.00 0.00 ? 51  LEU A HA   7  
ATOM   7647  H  HB2  . LEU A 1 51 ? 1.358   -0.183  -1.762  1.00 0.00 ? 51  LEU A HB2  7  
ATOM   7648  H  HB3  . LEU A 1 51 ? 2.338   1.201   -2.240  1.00 0.00 ? 51  LEU A HB3  7  
ATOM   7649  H  HG   . LEU A 1 51 ? 3.465   -1.562  -1.826  1.00 0.00 ? 51  LEU A HG   7  
ATOM   7650  H  HD11 . LEU A 1 51 ? 2.452   -0.253  -4.343  1.00 0.00 ? 51  LEU A HD11 7  
ATOM   7651  H  HD12 . LEU A 1 51 ? 1.867   -1.740  -3.598  1.00 0.00 ? 51  LEU A HD12 7  
ATOM   7652  H  HD13 . LEU A 1 51 ? 3.479   -1.687  -4.311  1.00 0.00 ? 51  LEU A HD13 7  
ATOM   7653  H  HD21 . LEU A 1 51 ? 5.426   -0.755  -2.751  1.00 0.00 ? 51  LEU A HD21 7  
ATOM   7654  H  HD22 . LEU A 1 51 ? 4.888   0.605   -1.764  1.00 0.00 ? 51  LEU A HD22 7  
ATOM   7655  H  HD23 . LEU A 1 51 ? 4.625   0.622   -3.509  1.00 0.00 ? 51  LEU A HD23 7  
ATOM   7656  N  N    . THR A 1 52 ? 2.145   2.916   -0.357  1.00 0.00 ? 52  THR A N    7  
ATOM   7657  C  CA   . THR A 1 52 ? 1.455   4.149   0.002   1.00 0.00 ? 52  THR A CA   7  
ATOM   7658  C  C    . THR A 1 52 ? 0.780   4.775   -1.213  1.00 0.00 ? 52  THR A C    7  
ATOM   7659  O  O    . THR A 1 52 ? 0.932   4.294   -2.336  1.00 0.00 ? 52  THR A O    7  
ATOM   7660  C  CB   . THR A 1 52 ? 2.423   5.174   0.622   1.00 0.00 ? 52  THR A CB   7  
ATOM   7661  O  OG1  . THR A 1 52 ? 3.495   5.447   -0.286  1.00 0.00 ? 52  THR A OG1  7  
ATOM   7662  C  CG2  . THR A 1 52 ? 2.985   4.660   1.939   1.00 0.00 ? 52  THR A CG2  7  
ATOM   7663  H  H    . THR A 1 52 ? 2.841   2.941   -1.046  1.00 0.00 ? 52  THR A H    7  
ATOM   7664  H  HA   . THR A 1 52 ? 0.701   3.907   0.736   1.00 0.00 ? 52  THR A HA   7  
ATOM   7665  H  HB   . THR A 1 52 ? 1.880   6.089   0.812   1.00 0.00 ? 52  THR A HB   7  
ATOM   7666  H  HG1  . THR A 1 52 ? 3.138   5.787   -1.110  1.00 0.00 ? 52  THR A HG1  7  
ATOM   7667  H  HG21 . THR A 1 52 ? 2.831   3.593   2.004   1.00 0.00 ? 52  THR A HG21 7  
ATOM   7668  H  HG22 . THR A 1 52 ? 2.481   5.147   2.760   1.00 0.00 ? 52  THR A HG22 7  
ATOM   7669  H  HG23 . THR A 1 52 ? 4.042   4.875   1.987   1.00 0.00 ? 52  THR A HG23 7  
ATOM   7670  N  N    . ALA A 1 53 ? 0.034   5.850   -0.981  1.00 0.00 ? 53  ALA A N    7  
ATOM   7671  C  CA   . ALA A 1 53 ? -0.662  6.543   -2.058  1.00 0.00 ? 53  ALA A CA   7  
ATOM   7672  C  C    . ALA A 1 53 ? 0.325   7.188   -3.025  1.00 0.00 ? 53  ALA A C    7  
ATOM   7673  O  O    . ALA A 1 53 ? 0.017   7.388   -4.200  1.00 0.00 ? 53  ALA A O    7  
ATOM   7674  C  CB   . ALA A 1 53 ? -1.606  7.592   -1.488  1.00 0.00 ? 53  ALA A CB   7  
ATOM   7675  H  H    . ALA A 1 53 ? -0.049  6.186   -0.065  1.00 0.00 ? 53  ALA A H    7  
ATOM   7676  H  HA   . ALA A 1 53 ? -1.254  5.816   -2.595  1.00 0.00 ? 53  ALA A HA   7  
ATOM   7677  H  HB1  . ALA A 1 53 ? -2.261  7.129   -0.764  1.00 0.00 ? 53  ALA A HB1  7  
ATOM   7678  H  HB2  . ALA A 1 53 ? -1.031  8.370   -1.008  1.00 0.00 ? 53  ALA A HB2  7  
ATOM   7679  H  HB3  . ALA A 1 53 ? -2.194  8.019   -2.286  1.00 0.00 ? 53  ALA A HB3  7  
ATOM   7680  N  N    . ASP A 1 54 ? 1.512   7.510   -2.524  1.00 0.00 ? 54  ASP A N    7  
ATOM   7681  C  CA   . ASP A 1 54 ? 2.546   8.132   -3.344  1.00 0.00 ? 54  ASP A CA   7  
ATOM   7682  C  C    . ASP A 1 54 ? 3.495   7.081   -3.910  1.00 0.00 ? 54  ASP A C    7  
ATOM   7683  O  O    . ASP A 1 54 ? 4.576   7.407   -4.401  1.00 0.00 ? 54  ASP A O    7  
ATOM   7684  C  CB   . ASP A 1 54 ? 3.330   9.157   -2.523  1.00 0.00 ? 54  ASP A CB   7  
ATOM   7685  C  CG   . ASP A 1 54 ? 2.498   10.375  -2.170  1.00 0.00 ? 54  ASP A CG   7  
ATOM   7686  O  OD1  . ASP A 1 54 ? 2.160   11.148  -3.090  1.00 0.00 ? 54  ASP A OD1  7  
ATOM   7687  O  OD2  . ASP A 1 54 ? 2.187   10.555  -0.974  1.00 0.00 ? 54  ASP A OD2  7  
ATOM   7688  H  H    . ASP A 1 54 ? 1.698   7.326   -1.579  1.00 0.00 ? 54  ASP A H    7  
ATOM   7689  H  HA   . ASP A 1 54 ? 2.059   8.638   -4.163  1.00 0.00 ? 54  ASP A HA   7  
ATOM   7690  H  HB2  . ASP A 1 54 ? 3.664   8.695   -1.605  1.00 0.00 ? 54  ASP A HB2  7  
ATOM   7691  H  HB3  . ASP A 1 54 ? 4.189   9.482   -3.091  1.00 0.00 ? 54  ASP A HB3  7  
ATOM   7692  N  N    . ALA A 1 55 ? 3.085   5.819   -3.836  1.00 0.00 ? 55  ALA A N    7  
ATOM   7693  C  CA   . ALA A 1 55 ? 3.899   4.721   -4.342  1.00 0.00 ? 55  ALA A CA   7  
ATOM   7694  C  C    . ALA A 1 55 ? 4.252   4.931   -5.811  1.00 0.00 ? 55  ALA A C    7  
ATOM   7695  O  O    . ALA A 1 55 ? 3.405   5.324   -6.613  1.00 0.00 ? 55  ALA A O    7  
ATOM   7696  C  CB   . ALA A 1 55 ? 3.173   3.397   -4.156  1.00 0.00 ? 55  ALA A CB   7  
ATOM   7697  H  H    . ALA A 1 55 ? 2.214   5.623   -3.434  1.00 0.00 ? 55  ALA A H    7  
ATOM   7698  H  HA   . ALA A 1 55 ? 4.811   4.687   -3.764  1.00 0.00 ? 55  ALA A HA   7  
ATOM   7699  H  HB1  . ALA A 1 55 ? 3.547   2.904   -3.271  1.00 0.00 ? 55  ALA A HB1  7  
ATOM   7700  H  HB2  . ALA A 1 55 ? 2.114   3.579   -4.047  1.00 0.00 ? 55  ALA A HB2  7  
ATOM   7701  H  HB3  . ALA A 1 55 ? 3.343   2.769   -5.018  1.00 0.00 ? 55  ALA A HB3  7  
ATOM   7702  N  N    . ARG A 1 56 ? 5.508   4.666   -6.156  1.00 0.00 ? 56  ARG A N    7  
ATOM   7703  C  CA   . ARG A 1 56 ? 5.973   4.827   -7.528  1.00 0.00 ? 56  ARG A CA   7  
ATOM   7704  C  C    . ARG A 1 56 ? 5.868   3.513   -8.297  1.00 0.00 ? 56  ARG A C    7  
ATOM   7705  O  O    . ARG A 1 56 ? 6.193   2.449   -7.772  1.00 0.00 ? 56  ARG A O    7  
ATOM   7706  C  CB   . ARG A 1 56 ? 7.420   5.324   -7.543  1.00 0.00 ? 56  ARG A CB   7  
ATOM   7707  C  CG   . ARG A 1 56 ? 7.587   6.731   -6.992  1.00 0.00 ? 56  ARG A CG   7  
ATOM   7708  C  CD   . ARG A 1 56 ? 7.047   7.775   -7.957  1.00 0.00 ? 56  ARG A CD   7  
ATOM   7709  N  NE   . ARG A 1 56 ? 7.960   8.014   -9.071  1.00 0.00 ? 56  ARG A NE   7  
ATOM   7710  C  CZ   . ARG A 1 56 ? 7.561   8.392   -10.280 1.00 0.00 ? 56  ARG A CZ   7  
ATOM   7711  N  NH1  . ARG A 1 56 ? 6.272   8.574   -10.530 1.00 0.00 ? 56  ARG A NH1  7  
ATOM   7712  N  NH2  . ARG A 1 56 ? 8.452   8.589   -11.243 1.00 0.00 ? 56  ARG A NH2  7  
ATOM   7713  H  H    . ARG A 1 56 ? 6.137   4.355   -5.472  1.00 0.00 ? 56  ARG A H    7  
ATOM   7714  H  HA   . ARG A 1 56 ? 5.345   5.563   -8.007  1.00 0.00 ? 56  ARG A HA   7  
ATOM   7715  H  HB2  . ARG A 1 56 ? 8.025   4.655   -6.949  1.00 0.00 ? 56  ARG A HB2  7  
ATOM   7716  H  HB3  . ARG A 1 56 ? 7.781   5.315   -8.561  1.00 0.00 ? 56  ARG A HB3  7  
ATOM   7717  H  HG2  . ARG A 1 56 ? 7.049   6.808   -6.058  1.00 0.00 ? 56  ARG A HG2  7  
ATOM   7718  H  HG3  . ARG A 1 56 ? 8.636   6.919   -6.821  1.00 0.00 ? 56  ARG A HG3  7  
ATOM   7719  H  HD2  . ARG A 1 56 ? 6.101   7.431   -8.347  1.00 0.00 ? 56  ARG A HD2  7  
ATOM   7720  H  HD3  . ARG A 1 56 ? 6.900   8.700   -7.419  1.00 0.00 ? 56  ARG A HD3  7  
ATOM   7721  H  HE   . ARG A 1 56 ? 8.918   7.885   -8.909  1.00 0.00 ? 56  ARG A HE   7  
ATOM   7722  H  HH11 . ARG A 1 56 ? 5.598   8.427   -9.806  1.00 0.00 ? 56  ARG A HH11 7  
ATOM   7723  H  HH12 . ARG A 1 56 ? 5.974   8.860   -11.440 1.00 0.00 ? 56  ARG A HH12 7  
ATOM   7724  H  HH21 . ARG A 1 56 ? 9.425   8.453   -11.059 1.00 0.00 ? 56  ARG A HH21 7  
ATOM   7725  H  HH22 . ARG A 1 56 ? 8.151   8.874   -12.153 1.00 0.00 ? 56  ARG A HH22 7  
ATOM   7726  N  N    . GLU A 1 57 ? 5.410   3.597   -9.542  1.00 0.00 ? 57  GLU A N    7  
ATOM   7727  C  CA   . GLU A 1 57 ? 5.260   2.414   -10.381 1.00 0.00 ? 57  GLU A CA   7  
ATOM   7728  C  C    . GLU A 1 57 ? 6.525   2.162   -11.197 1.00 0.00 ? 57  GLU A C    7  
ATOM   7729  O  O    . GLU A 1 57 ? 7.067   3.075   -11.822 1.00 0.00 ? 57  GLU A O    7  
ATOM   7730  C  CB   . GLU A 1 57 ? 4.060   2.574   -11.317 1.00 0.00 ? 57  GLU A CB   7  
ATOM   7731  C  CG   . GLU A 1 57 ? 3.861   1.397   -12.257 1.00 0.00 ? 57  GLU A CG   7  
ATOM   7732  C  CD   . GLU A 1 57 ? 3.189   1.796   -13.557 1.00 0.00 ? 57  GLU A CD   7  
ATOM   7733  O  OE1  . GLU A 1 57 ? 3.208   3.000   -13.889 1.00 0.00 ? 57  GLU A OE1  7  
ATOM   7734  O  OE2  . GLU A 1 57 ? 2.643   0.906   -14.241 1.00 0.00 ? 57  GLU A OE2  7  
ATOM   7735  H  H    . GLU A 1 57 ? 5.167   4.474   -9.904  1.00 0.00 ? 57  GLU A H    7  
ATOM   7736  H  HA   . GLU A 1 57 ? 5.089   1.568   -9.734  1.00 0.00 ? 57  GLU A HA   7  
ATOM   7737  H  HB2  . GLU A 1 57 ? 3.167   2.688   -10.721 1.00 0.00 ? 57  GLU A HB2  7  
ATOM   7738  H  HB3  . GLU A 1 57 ? 4.201   3.464   -11.913 1.00 0.00 ? 57  GLU A HB3  7  
ATOM   7739  H  HG2  . GLU A 1 57 ? 4.825   0.968   -12.486 1.00 0.00 ? 57  GLU A HG2  7  
ATOM   7740  H  HG3  . GLU A 1 57 ? 3.247   0.658   -11.763 1.00 0.00 ? 57  GLU A HG3  7  
ATOM   7741  N  N    . LEU A 1 58 ? 6.991   0.918   -11.185 1.00 0.00 ? 58  LEU A N    7  
ATOM   7742  C  CA   . LEU A 1 58 ? 8.193   0.544   -11.922 1.00 0.00 ? 58  LEU A CA   7  
ATOM   7743  C  C    . LEU A 1 58 ? 7.967   -0.739  -12.716 1.00 0.00 ? 58  LEU A C    7  
ATOM   7744  O  O    . LEU A 1 58 ? 8.060   -1.841  -12.176 1.00 0.00 ? 58  LEU A O    7  
ATOM   7745  C  CB   . LEU A 1 58 ? 9.369   0.362   -10.961 1.00 0.00 ? 58  LEU A CB   7  
ATOM   7746  C  CG   . LEU A 1 58 ? 10.753  0.680   -11.527 1.00 0.00 ? 58  LEU A CG   7  
ATOM   7747  C  CD1  . LEU A 1 58 ? 10.836  2.139   -11.949 1.00 0.00 ? 58  LEU A CD1  7  
ATOM   7748  C  CD2  . LEU A 1 58 ? 11.834  0.357   -10.506 1.00 0.00 ? 58  LEU A CD2  7  
ATOM   7749  H  H    . LEU A 1 58 ? 6.516   0.234   -10.668 1.00 0.00 ? 58  LEU A H    7  
ATOM   7750  H  HA   . LEU A 1 58 ? 8.421   1.344   -12.611 1.00 0.00 ? 58  LEU A HA   7  
ATOM   7751  H  HB2  . LEU A 1 58 ? 9.204   1.006   -10.111 1.00 0.00 ? 58  LEU A HB2  7  
ATOM   7752  H  HB3  . LEU A 1 58 ? 9.372   -0.668  -10.635 1.00 0.00 ? 58  LEU A HB3  7  
ATOM   7753  H  HG   . LEU A 1 58 ? 10.926  0.070   -12.403 1.00 0.00 ? 58  LEU A HG   7  
ATOM   7754  H  HD11 . LEU A 1 58 ? 10.593  2.225   -12.997 1.00 0.00 ? 58  LEU A HD11 7  
ATOM   7755  H  HD12 . LEU A 1 58 ? 11.837  2.507   -11.780 1.00 0.00 ? 58  LEU A HD12 7  
ATOM   7756  H  HD13 . LEU A 1 58 ? 10.136  2.722   -11.368 1.00 0.00 ? 58  LEU A HD13 7  
ATOM   7757  H  HD21 . LEU A 1 58 ? 11.909  1.165   -9.794  1.00 0.00 ? 58  LEU A HD21 7  
ATOM   7758  H  HD22 . LEU A 1 58 ? 12.781  0.233   -11.011 1.00 0.00 ? 58  LEU A HD22 7  
ATOM   7759  H  HD23 . LEU A 1 58 ? 11.579  -0.556  -9.989  1.00 0.00 ? 58  LEU A HD23 7  
ATOM   7760  N  N    . LYS A 1 59 ? 7.673   -0.588  -14.003 1.00 0.00 ? 59  LYS A N    7  
ATOM   7761  C  CA   . LYS A 1 59 ? 7.437   -1.733  -14.874 1.00 0.00 ? 59  LYS A CA   7  
ATOM   7762  C  C    . LYS A 1 59 ? 6.206   -2.513  -14.426 1.00 0.00 ? 59  LYS A C    7  
ATOM   7763  O  O    . LYS A 1 59 ? 6.226   -3.742  -14.365 1.00 0.00 ? 59  LYS A O    7  
ATOM   7764  C  CB   . LYS A 1 59 ? 8.661   -2.652  -14.884 1.00 0.00 ? 59  LYS A CB   7  
ATOM   7765  C  CG   . LYS A 1 59 ? 9.677   -2.300  -15.957 1.00 0.00 ? 59  LYS A CG   7  
ATOM   7766  C  CD   . LYS A 1 59 ? 10.713  -1.315  -15.442 1.00 0.00 ? 59  LYS A CD   7  
ATOM   7767  C  CE   . LYS A 1 59 ? 10.284  0.123   -15.684 1.00 0.00 ? 59  LYS A CE   7  
ATOM   7768  N  NZ   . LYS A 1 59 ? 10.387  0.499   -17.121 1.00 0.00 ? 59  LYS A NZ   7  
ATOM   7769  H  H    . LYS A 1 59 ? 7.613   0.317   -14.377 1.00 0.00 ? 59  LYS A H    7  
ATOM   7770  H  HA   . LYS A 1 59 ? 7.269   -1.361  -15.874 1.00 0.00 ? 59  LYS A HA   7  
ATOM   7771  H  HB2  . LYS A 1 59 ? 9.149   -2.593  -13.923 1.00 0.00 ? 59  LYS A HB2  7  
ATOM   7772  H  HB3  . LYS A 1 59 ? 8.332   -3.668  -15.050 1.00 0.00 ? 59  LYS A HB3  7  
ATOM   7773  H  HG2  . LYS A 1 59 ? 10.180  -3.202  -16.274 1.00 0.00 ? 59  LYS A HG2  7  
ATOM   7774  H  HG3  . LYS A 1 59 ? 9.161   -1.859  -16.798 1.00 0.00 ? 59  LYS A HG3  7  
ATOM   7775  H  HD2  . LYS A 1 59 ? 10.845  -1.466  -14.381 1.00 0.00 ? 59  LYS A HD2  7  
ATOM   7776  H  HD3  . LYS A 1 59 ? 11.650  -1.493  -15.951 1.00 0.00 ? 59  LYS A HD3  7  
ATOM   7777  H  HE2  . LYS A 1 59 ? 9.260   0.238   -15.363 1.00 0.00 ? 59  LYS A HE2  7  
ATOM   7778  H  HE3  . LYS A 1 59 ? 10.918  0.777   -15.103 1.00 0.00 ? 59  LYS A HE3  7  
ATOM   7779  H  HZ1  . LYS A 1 59 ? 9.943   1.426   -17.281 1.00 0.00 ? 59  LYS A HZ1  7  
ATOM   7780  H  HZ2  . LYS A 1 59 ? 9.905   -0.209  -17.711 1.00 0.00 ? 59  LYS A HZ2  7  
ATOM   7781  H  HZ3  . LYS A 1 59 ? 11.385  0.550   -17.407 1.00 0.00 ? 59  LYS A HZ3  7  
ATOM   7782  N  N    . GLY A 1 60 ? 5.134   -1.791  -14.115 1.00 0.00 ? 60  GLY A N    7  
ATOM   7783  C  CA   . GLY A 1 60 ? 3.908   -2.433  -13.678 1.00 0.00 ? 60  GLY A CA   7  
ATOM   7784  C  C    . GLY A 1 60 ? 3.850   -2.610  -12.173 1.00 0.00 ? 60  GLY A C    7  
ATOM   7785  O  O    . GLY A 1 60 ? 2.801   -2.417  -11.560 1.00 0.00 ? 60  GLY A O    7  
ATOM   7786  H  H    . GLY A 1 60 ? 5.176   -0.814  -14.182 1.00 0.00 ? 60  GLY A H    7  
ATOM   7787  H  HA2  . GLY A 1 60 ? 3.068   -1.832  -13.992 1.00 0.00 ? 60  GLY A HA2  7  
ATOM   7788  H  HA3  . GLY A 1 60 ? 3.838   -3.405  -14.145 1.00 0.00 ? 60  GLY A HA3  7  
ATOM   7789  N  N    . GLU A 1 61 ? 4.981   -2.978  -11.578 1.00 0.00 ? 61  GLU A N    7  
ATOM   7790  C  CA   . GLU A 1 61 ? 5.052   -3.183  -10.136 1.00 0.00 ? 61  GLU A CA   7  
ATOM   7791  C  C    . GLU A 1 61 ? 4.979   -1.852  -9.394  1.00 0.00 ? 61  GLU A C    7  
ATOM   7792  O  O    . GLU A 1 61 ? 5.085   -0.784  -9.998  1.00 0.00 ? 61  GLU A O    7  
ATOM   7793  C  CB   . GLU A 1 61 ? 6.344   -3.915  -9.767  1.00 0.00 ? 61  GLU A CB   7  
ATOM   7794  C  CG   . GLU A 1 61 ? 6.314   -5.401  -10.084 1.00 0.00 ? 61  GLU A CG   7  
ATOM   7795  C  CD   . GLU A 1 61 ? 5.041   -6.073  -9.607  1.00 0.00 ? 61  GLU A CD   7  
ATOM   7796  O  OE1  . GLU A 1 61 ? 4.614   -5.793  -8.467  1.00 0.00 ? 61  GLU A OE1  7  
ATOM   7797  O  OE2  . GLU A 1 61 ? 4.472   -6.879  -10.373 1.00 0.00 ? 61  GLU A OE2  7  
ATOM   7798  H  H    . GLU A 1 61 ? 5.784   -3.116  -12.122 1.00 0.00 ? 61  GLU A H    7  
ATOM   7799  H  HA   . GLU A 1 61 ? 4.209   -3.791  -9.845  1.00 0.00 ? 61  GLU A HA   7  
ATOM   7800  H  HB2  . GLU A 1 61 ? 7.165   -3.468  -10.309 1.00 0.00 ? 61  GLU A HB2  7  
ATOM   7801  H  HB3  . GLU A 1 61 ? 6.519   -3.798  -8.707  1.00 0.00 ? 61  GLU A HB3  7  
ATOM   7802  H  HG2  . GLU A 1 61 ? 6.392   -5.529  -11.153 1.00 0.00 ? 61  GLU A HG2  7  
ATOM   7803  H  HG3  . GLU A 1 61 ? 7.156   -5.876  -9.603  1.00 0.00 ? 61  GLU A HG3  7  
ATOM   7804  N  N    . LEU A 1 62 ? 4.795   -1.924  -8.080  1.00 0.00 ? 62  LEU A N    7  
ATOM   7805  C  CA   . LEU A 1 62 ? 4.706   -0.725  -7.253  1.00 0.00 ? 62  LEU A CA   7  
ATOM   7806  C  C    . LEU A 1 62 ? 5.657   -0.813  -6.063  1.00 0.00 ? 62  LEU A C    7  
ATOM   7807  O  O    . LEU A 1 62 ? 5.502   -1.671  -5.194  1.00 0.00 ? 62  LEU A O    7  
ATOM   7808  C  CB   . LEU A 1 62 ? 3.272   -0.527  -6.761  1.00 0.00 ? 62  LEU A CB   7  
ATOM   7809  C  CG   . LEU A 1 62 ? 2.223   -0.255  -7.840  1.00 0.00 ? 62  LEU A CG   7  
ATOM   7810  C  CD1  . LEU A 1 62 ? 0.827   -0.547  -7.313  1.00 0.00 ? 62  LEU A CD1  7  
ATOM   7811  C  CD2  . LEU A 1 62 ? 2.321   1.183   -8.329  1.00 0.00 ? 62  LEU A CD2  7  
ATOM   7812  H  H    . LEU A 1 62 ? 4.718   -2.803  -7.655  1.00 0.00 ? 62  LEU A H    7  
ATOM   7813  H  HA   . LEU A 1 62 ? 4.989   0.120   -7.863  1.00 0.00 ? 62  LEU A HA   7  
ATOM   7814  H  HB2  . LEU A 1 62 ? 2.977   -1.420  -6.231  1.00 0.00 ? 62  LEU A HB2  7  
ATOM   7815  H  HB3  . LEU A 1 62 ? 3.270   0.311   -6.078  1.00 0.00 ? 62  LEU A HB3  7  
ATOM   7816  H  HG   . LEU A 1 62 ? 2.405   -0.908  -8.682  1.00 0.00 ? 62  LEU A HG   7  
ATOM   7817  H  HD11 . LEU A 1 62 ? 0.152   0.234   -7.629  1.00 0.00 ? 62  LEU A HD11 7  
ATOM   7818  H  HD12 . LEU A 1 62 ? 0.850   -0.588  -6.234  1.00 0.00 ? 62  LEU A HD12 7  
ATOM   7819  H  HD13 . LEU A 1 62 ? 0.487   -1.496  -7.702  1.00 0.00 ? 62  LEU A HD13 7  
ATOM   7820  H  HD21 . LEU A 1 62 ? 3.252   1.320   -8.858  1.00 0.00 ? 62  LEU A HD21 7  
ATOM   7821  H  HD22 . LEU A 1 62 ? 2.286   1.854   -7.482  1.00 0.00 ? 62  LEU A HD22 7  
ATOM   7822  H  HD23 . LEU A 1 62 ? 1.495   1.395   -8.991  1.00 0.00 ? 62  LEU A HD23 7  
ATOM   7823  N  N    . TYR A 1 63 ? 6.638   0.081   -6.030  1.00 0.00 ? 63  TYR A N    7  
ATOM   7824  C  CA   . TYR A 1 63 ? 7.614   0.105   -4.947  1.00 0.00 ? 63  TYR A CA   7  
ATOM   7825  C  C    . TYR A 1 63 ? 7.430   1.343   -4.074  1.00 0.00 ? 63  TYR A C    7  
ATOM   7826  O  O    . TYR A 1 63 ? 7.237   2.450   -4.579  1.00 0.00 ? 63  TYR A O    7  
ATOM   7827  C  CB   . TYR A 1 63 ? 9.035   0.073   -5.512  1.00 0.00 ? 63  TYR A CB   7  
ATOM   7828  C  CG   . TYR A 1 63 ? 9.320   -1.142  -6.365  1.00 0.00 ? 63  TYR A CG   7  
ATOM   7829  C  CD1  . TYR A 1 63 ? 8.947   -1.178  -7.703  1.00 0.00 ? 63  TYR A CD1  7  
ATOM   7830  C  CD2  . TYR A 1 63 ? 9.961   -2.255  -5.834  1.00 0.00 ? 63  TYR A CD2  7  
ATOM   7831  C  CE1  . TYR A 1 63 ? 9.204   -2.287  -8.487  1.00 0.00 ? 63  TYR A CE1  7  
ATOM   7832  C  CE2  . TYR A 1 63 ? 10.223  -3.367  -6.610  1.00 0.00 ? 63  TYR A CE2  7  
ATOM   7833  C  CZ   . TYR A 1 63 ? 9.843   -3.378  -7.936  1.00 0.00 ? 63  TYR A CZ   7  
ATOM   7834  O  OH   . TYR A 1 63 ? 10.102  -4.484  -8.712  1.00 0.00 ? 63  TYR A OH   7  
ATOM   7835  H  H    . TYR A 1 63 ? 6.710   0.741   -6.751  1.00 0.00 ? 63  TYR A H    7  
ATOM   7836  H  HA   . TYR A 1 63 ? 7.458   -0.775  -4.340  1.00 0.00 ? 63  TYR A HA   7  
ATOM   7837  H  HB2  . TYR A 1 63 ? 9.193   0.949   -6.121  1.00 0.00 ? 63  TYR A HB2  7  
ATOM   7838  H  HB3  . TYR A 1 63 ? 9.741   0.076   -4.693  1.00 0.00 ? 63  TYR A HB3  7  
ATOM   7839  H  HD1  . TYR A 1 63 ? 8.447   -0.322  -8.132  1.00 0.00 ? 63  TYR A HD1  7  
ATOM   7840  H  HD2  . TYR A 1 63 ? 10.257  -2.243  -4.795  1.00 0.00 ? 63  TYR A HD2  7  
ATOM   7841  H  HE1  . TYR A 1 63 ? 8.907   -2.296  -9.525  1.00 0.00 ? 63  TYR A HE1  7  
ATOM   7842  H  HE2  . TYR A 1 63 ? 10.723  -4.221  -6.179  1.00 0.00 ? 63  TYR A HE2  7  
ATOM   7843  H  HH   . TYR A 1 63 ? 10.987  -4.419  -9.077  1.00 0.00 ? 63  TYR A HH   7  
ATOM   7844  N  N    . CYS A 1 64 ? 7.491   1.148   -2.761  1.00 0.00 ? 64  CYS A N    7  
ATOM   7845  C  CA   . CYS A 1 64 ? 7.331   2.247   -1.816  1.00 0.00 ? 64  CYS A CA   7  
ATOM   7846  C  C    . CYS A 1 64 ? 8.427   3.291   -2.006  1.00 0.00 ? 64  CYS A C    7  
ATOM   7847  O  O    . CYS A 1 64 ? 9.553   2.964   -2.384  1.00 0.00 ? 64  CYS A O    7  
ATOM   7848  C  CB   . CYS A 1 64 ? 7.357   1.719   -0.380  1.00 0.00 ? 64  CYS A CB   7  
ATOM   7849  S  SG   . CYS A 1 64 ? 8.979   1.077   0.147   1.00 0.00 ? 64  CYS A SG   7  
ATOM   7850  H  H    . CYS A 1 64 ? 7.647   0.242   -2.419  1.00 0.00 ? 64  CYS A H    7  
ATOM   7851  H  HA   . CYS A 1 64 ? 6.374   2.709   -2.003  1.00 0.00 ? 64  CYS A HA   7  
ATOM   7852  H  HB2  . CYS A 1 64 ? 7.087   2.519   0.294   1.00 0.00 ? 64  CYS A HB2  7  
ATOM   7853  H  HB3  . CYS A 1 64 ? 6.639   0.918   -0.286  1.00 0.00 ? 64  CYS A HB3  7  
ATOM   7854  N  N    . LEU A 1 65 ? 8.090   4.549   -1.742  1.00 0.00 ? 65  LEU A N    7  
ATOM   7855  C  CA   . LEU A 1 65 ? 9.045   5.643   -1.883  1.00 0.00 ? 65  LEU A CA   7  
ATOM   7856  C  C    . LEU A 1 65 ? 10.428  5.224   -1.395  1.00 0.00 ? 65  LEU A C    7  
ATOM   7857  O  O    . LEU A 1 65 ? 11.435  5.397   -2.083  1.00 0.00 ? 65  LEU A O    7  
ATOM   7858  C  CB   . LEU A 1 65 ? 8.566   6.868   -1.103  1.00 0.00 ? 65  LEU A CB   7  
ATOM   7859  C  CG   . LEU A 1 65 ? 7.730   7.879   -1.888  1.00 0.00 ? 65  LEU A CG   7  
ATOM   7860  C  CD1  . LEU A 1 65 ? 8.530   8.442   -3.053  1.00 0.00 ? 65  LEU A CD1  7  
ATOM   7861  C  CD2  . LEU A 1 65 ? 6.443   7.237   -2.384  1.00 0.00 ? 65  LEU A CD2  7  
ATOM   7862  H  H    . LEU A 1 65 ? 7.178   4.747   -1.444  1.00 0.00 ? 65  LEU A H    7  
ATOM   7863  H  HA   . LEU A 1 65 ? 9.107   5.895   -2.931  1.00 0.00 ? 65  LEU A HA   7  
ATOM   7864  H  HB2  . LEU A 1 65 ? 7.969   6.519   -0.274  1.00 0.00 ? 65  LEU A HB2  7  
ATOM   7865  H  HB3  . LEU A 1 65 ? 9.439   7.381   -0.725  1.00 0.00 ? 65  LEU A HB3  7  
ATOM   7866  H  HG   . LEU A 1 65 ? 7.466   8.701   -1.237  1.00 0.00 ? 65  LEU A HG   7  
ATOM   7867  H  HD11 . LEU A 1 65 ? 8.454   7.774   -3.897  1.00 0.00 ? 65  LEU A HD11 7  
ATOM   7868  H  HD12 . LEU A 1 65 ? 9.565   8.541   -2.764  1.00 0.00 ? 65  LEU A HD12 7  
ATOM   7869  H  HD13 . LEU A 1 65 ? 8.137   9.412   -3.324  1.00 0.00 ? 65  LEU A HD13 7  
ATOM   7870  H  HD21 . LEU A 1 65 ? 6.235   6.352   -1.800  1.00 0.00 ? 65  LEU A HD21 7  
ATOM   7871  H  HD22 . LEU A 1 65 ? 6.553   6.965   -3.423  1.00 0.00 ? 65  LEU A HD22 7  
ATOM   7872  H  HD23 . LEU A 1 65 ? 5.628   7.937   -2.278  1.00 0.00 ? 65  LEU A HD23 7  
ATOM   7873  N  N    . PRO A 1 66 ? 10.482  4.658   -0.180  1.00 0.00 ? 66  PRO A N    7  
ATOM   7874  C  CA   . PRO A 1 66 ? 11.736  4.200   0.425   1.00 0.00 ? 66  PRO A CA   7  
ATOM   7875  C  C    . PRO A 1 66 ? 12.570  3.360   -0.535  1.00 0.00 ? 66  PRO A C    7  
ATOM   7876  O  O    . PRO A 1 66 ? 13.725  3.683   -0.817  1.00 0.00 ? 66  PRO A O    7  
ATOM   7877  C  CB   . PRO A 1 66 ? 11.268  3.352   1.611   1.00 0.00 ? 66  PRO A CB   7  
ATOM   7878  C  CG   . PRO A 1 66 ? 9.927   3.898   1.962   1.00 0.00 ? 66  PRO A CG   7  
ATOM   7879  C  CD   . PRO A 1 66 ? 9.322   4.421   0.695   1.00 0.00 ? 66  PRO A CD   7  
ATOM   7880  H  HA   . PRO A 1 66 ? 12.328  5.029   0.785   1.00 0.00 ? 66  PRO A HA   7  
ATOM   7881  H  HB2  . PRO A 1 66 ? 11.208  2.315   1.313   1.00 0.00 ? 66  PRO A HB2  7  
ATOM   7882  H  HB3  . PRO A 1 66 ? 11.964  3.458   2.430   1.00 0.00 ? 66  PRO A HB3  7  
ATOM   7883  H  HG2  . PRO A 1 66 ? 9.307   3.114   2.368   1.00 0.00 ? 66  PRO A HG2  7  
ATOM   7884  H  HG3  . PRO A 1 66 ? 10.034  4.702   2.675   1.00 0.00 ? 66  PRO A HG3  7  
ATOM   7885  H  HD2  . PRO A 1 66 ? 8.660   3.683   0.267   1.00 0.00 ? 66  PRO A HD2  7  
ATOM   7886  H  HD3  . PRO A 1 66 ? 8.790   5.341   0.888   1.00 0.00 ? 66  PRO A HD3  7  
ATOM   7887  N  N    . CYS A 1 67 ? 11.979  2.280   -1.035  1.00 0.00 ? 67  CYS A N    7  
ATOM   7888  C  CA   . CYS A 1 67 ? 12.668  1.392   -1.964  1.00 0.00 ? 67  CYS A CA   7  
ATOM   7889  C  C    . CYS A 1 67 ? 12.926  2.091   -3.295  1.00 0.00 ? 67  CYS A C    7  
ATOM   7890  O  O    . CYS A 1 67 ? 14.041  2.068   -3.816  1.00 0.00 ? 67  CYS A O    7  
ATOM   7891  C  CB   . CYS A 1 67 ? 11.845  0.122   -2.193  1.00 0.00 ? 67  CYS A CB   7  
ATOM   7892  S  SG   . CYS A 1 67 ? 11.955  -1.090  -0.838  1.00 0.00 ? 67  CYS A SG   7  
ATOM   7893  H  H    . CYS A 1 67 ? 11.057  2.074   -0.773  1.00 0.00 ? 67  CYS A H    7  
ATOM   7894  H  HA   . CYS A 1 67 ? 13.616  1.121   -1.524  1.00 0.00 ? 67  CYS A HA   7  
ATOM   7895  H  HB2  . CYS A 1 67 ? 10.806  0.392   -2.308  1.00 0.00 ? 67  CYS A HB2  7  
ATOM   7896  H  HB3  . CYS A 1 67 ? 12.188  -0.361  -3.096  1.00 0.00 ? 67  CYS A HB3  7  
ATOM   7897  N  N    . HIS A 1 68 ? 11.886  2.715   -3.841  1.00 0.00 ? 68  HIS A N    7  
ATOM   7898  C  CA   . HIS A 1 68 ? 11.999  3.422   -5.112  1.00 0.00 ? 68  HIS A CA   7  
ATOM   7899  C  C    . HIS A 1 68 ? 13.269  4.267   -5.151  1.00 0.00 ? 68  HIS A C    7  
ATOM   7900  O  O    . HIS A 1 68 ? 13.983  4.285   -6.154  1.00 0.00 ? 68  HIS A O    7  
ATOM   7901  C  CB   . HIS A 1 68 ? 10.775  4.310   -5.336  1.00 0.00 ? 68  HIS A CB   7  
ATOM   7902  C  CG   . HIS A 1 68 ? 10.567  4.692   -6.769  1.00 0.00 ? 68  HIS A CG   7  
ATOM   7903  N  ND1  . HIS A 1 68 ? 10.750  5.974   -7.241  1.00 0.00 ? 68  HIS A ND1  7  
ATOM   7904  C  CD2  . HIS A 1 68 ? 10.190  3.950   -7.837  1.00 0.00 ? 68  HIS A CD2  7  
ATOM   7905  C  CE1  . HIS A 1 68 ? 10.493  6.006   -8.536  1.00 0.00 ? 68  HIS A CE1  7  
ATOM   7906  N  NE2  . HIS A 1 68 ? 10.152  4.790   -8.923  1.00 0.00 ? 68  HIS A NE2  7  
ATOM   7907  H  H    . HIS A 1 68 ? 11.023  2.698   -3.378  1.00 0.00 ? 68  HIS A H    7  
ATOM   7908  H  HA   . HIS A 1 68 ? 12.048  2.685   -5.899  1.00 0.00 ? 68  HIS A HA   7  
ATOM   7909  H  HB2  . HIS A 1 68 ? 9.892   3.785   -5.001  1.00 0.00 ? 68  HIS A HB2  7  
ATOM   7910  H  HB3  . HIS A 1 68 ? 10.887  5.219   -4.763  1.00 0.00 ? 68  HIS A HB3  7  
ATOM   7911  H  HD1  . HIS A 1 68 ? 11.026  6.747   -6.705  1.00 0.00 ? 68  HIS A HD1  7  
ATOM   7912  H  HD2  . HIS A 1 68 ? 9.961   2.893   -7.836  1.00 0.00 ? 68  HIS A HD2  7  
ATOM   7913  H  HE1  . HIS A 1 68 ? 10.553  6.876   -9.172  1.00 0.00 ? 68  HIS A HE1  7  
ATOM   7914  N  N    . ASP A 1 69 ? 13.544  4.965   -4.055  1.00 0.00 ? 69  ASP A N    7  
ATOM   7915  C  CA   . ASP A 1 69 ? 14.727  5.812   -3.965  1.00 0.00 ? 69  ASP A CA   7  
ATOM   7916  C  C    . ASP A 1 69 ? 16.000  4.987   -4.131  1.00 0.00 ? 69  ASP A C    7  
ATOM   7917  O  O    . ASP A 1 69 ? 16.992  5.461   -4.684  1.00 0.00 ? 69  ASP A O    7  
ATOM   7918  C  CB   . ASP A 1 69 ? 14.753  6.548   -2.624  1.00 0.00 ? 69  ASP A CB   7  
ATOM   7919  C  CG   . ASP A 1 69 ? 15.918  7.512   -2.515  1.00 0.00 ? 69  ASP A CG   7  
ATOM   7920  O  OD1  . ASP A 1 69 ? 16.166  8.255   -3.487  1.00 0.00 ? 69  ASP A OD1  7  
ATOM   7921  O  OD2  . ASP A 1 69 ? 16.582  7.523   -1.457  1.00 0.00 ? 69  ASP A OD2  7  
ATOM   7922  H  H    . ASP A 1 69 ? 12.936  4.909   -3.288  1.00 0.00 ? 69  ASP A H    7  
ATOM   7923  H  HA   . ASP A 1 69 ? 14.678  6.538   -4.762  1.00 0.00 ? 69  ASP A HA   7  
ATOM   7924  H  HB2  . ASP A 1 69 ? 13.836  7.107   -2.510  1.00 0.00 ? 69  ASP A HB2  7  
ATOM   7925  H  HB3  . ASP A 1 69 ? 14.831  5.825   -1.825  1.00 0.00 ? 69  ASP A HB3  7  
ATOM   7926  N  N    . LYS A 1 70 ? 15.964  3.750   -3.646  1.00 0.00 ? 70  LYS A N    7  
ATOM   7927  C  CA   . LYS A 1 70 ? 17.113  2.858   -3.741  1.00 0.00 ? 70  LYS A CA   7  
ATOM   7928  C  C    . LYS A 1 70 ? 17.131  2.133   -5.083  1.00 0.00 ? 70  LYS A C    7  
ATOM   7929  O  O    . LYS A 1 70 ? 17.655  1.025   -5.193  1.00 0.00 ? 70  LYS A O    7  
ATOM   7930  C  CB   . LYS A 1 70 ? 17.089  1.839   -2.599  1.00 0.00 ? 70  LYS A CB   7  
ATOM   7931  C  CG   . LYS A 1 70 ? 16.919  2.468   -1.227  1.00 0.00 ? 70  LYS A CG   7  
ATOM   7932  C  CD   . LYS A 1 70 ? 16.344  1.477   -0.227  1.00 0.00 ? 70  LYS A CD   7  
ATOM   7933  C  CE   . LYS A 1 70 ? 16.074  2.136   1.117   1.00 0.00 ? 70  LYS A CE   7  
ATOM   7934  N  NZ   . LYS A 1 70 ? 17.330  2.369   1.882   1.00 0.00 ? 70  LYS A NZ   7  
ATOM   7935  H  H    . LYS A 1 70 ? 15.144  3.429   -3.216  1.00 0.00 ? 70  LYS A H    7  
ATOM   7936  H  HA   . LYS A 1 70 ? 18.007  3.458   -3.658  1.00 0.00 ? 70  LYS A HA   7  
ATOM   7937  H  HB2  . LYS A 1 70 ? 16.271  1.153   -2.762  1.00 0.00 ? 70  LYS A HB2  7  
ATOM   7938  H  HB3  . LYS A 1 70 ? 18.018  1.287   -2.606  1.00 0.00 ? 70  LYS A HB3  7  
ATOM   7939  H  HG2  . LYS A 1 70 ? 17.882  2.803   -0.872  1.00 0.00 ? 70  LYS A HG2  7  
ATOM   7940  H  HG3  . LYS A 1 70 ? 16.249  3.312   -1.308  1.00 0.00 ? 70  LYS A HG3  7  
ATOM   7941  H  HD2  . LYS A 1 70 ? 15.416  1.084   -0.616  1.00 0.00 ? 70  LYS A HD2  7  
ATOM   7942  H  HD3  . LYS A 1 70 ? 17.049  0.670   -0.088  1.00 0.00 ? 70  LYS A HD3  7  
ATOM   7943  H  HE2  . LYS A 1 70 ? 15.585  3.082   0.948   1.00 0.00 ? 70  LYS A HE2  7  
ATOM   7944  H  HE3  . LYS A 1 70 ? 15.425  1.493   1.694   1.00 0.00 ? 70  LYS A HE3  7  
ATOM   7945  H  HZ1  . LYS A 1 70 ? 17.144  2.298   2.903   1.00 0.00 ? 70  LYS A HZ1  7  
ATOM   7946  H  HZ2  . LYS A 1 70 ? 17.704  3.317   1.675   1.00 0.00 ? 70  LYS A HZ2  7  
ATOM   7947  H  HZ3  . LYS A 1 70 ? 18.045  1.661   1.621   1.00 0.00 ? 70  LYS A HZ3  7  
ATOM   7948  N  N    . MET A 1 71 ? 16.556  2.766   -6.100  1.00 0.00 ? 71  MET A N    7  
ATOM   7949  C  CA   . MET A 1 71 ? 16.508  2.182   -7.435  1.00 0.00 ? 71  MET A CA   7  
ATOM   7950  C  C    . MET A 1 71 ? 17.508  2.864   -8.363  1.00 0.00 ? 71  MET A C    7  
ATOM   7951  O  O    . MET A 1 71 ? 18.089  2.228   -9.241  1.00 0.00 ? 71  MET A O    7  
ATOM   7952  C  CB   . MET A 1 71 ? 15.097  2.295   -8.015  1.00 0.00 ? 71  MET A CB   7  
ATOM   7953  C  CG   . MET A 1 71 ? 14.070  1.446   -7.284  1.00 0.00 ? 71  MET A CG   7  
ATOM   7954  S  SD   . MET A 1 71 ? 14.057  -0.267  -7.847  1.00 0.00 ? 71  MET A SD   7  
ATOM   7955  C  CE   . MET A 1 71 ? 13.116  -1.047  -6.539  1.00 0.00 ? 71  MET A CE   7  
ATOM   7956  H  H    . MET A 1 71 ? 16.154  3.648   -5.950  1.00 0.00 ? 71  MET A H    7  
ATOM   7957  H  HA   . MET A 1 71 ? 16.769  1.138   -7.349  1.00 0.00 ? 71  MET A HA   7  
ATOM   7958  H  HB2  . MET A 1 71 ? 14.781  3.326   -7.964  1.00 0.00 ? 71  MET A HB2  7  
ATOM   7959  H  HB3  . MET A 1 71 ? 15.119  1.984   -9.048  1.00 0.00 ? 71  MET A HB3  7  
ATOM   7960  H  HG2  . MET A 1 71 ? 14.296  1.460   -6.228  1.00 0.00 ? 71  MET A HG2  7  
ATOM   7961  H  HG3  . MET A 1 71 ? 13.091  1.871   -7.446  1.00 0.00 ? 71  MET A HG3  7  
ATOM   7962  H  HE1  . MET A 1 71 ? 12.068  -1.054  -6.803  1.00 0.00 ? 71  MET A HE1  7  
ATOM   7963  H  HE2  . MET A 1 71 ? 13.459  -2.062  -6.404  1.00 0.00 ? 71  MET A HE2  7  
ATOM   7964  H  HE3  . MET A 1 71 ? 13.252  -0.495  -5.620  1.00 0.00 ? 71  MET A HE3  7  
ATOM   7965  N  N    . GLY A 1 72 ? 17.703  4.164   -8.163  1.00 0.00 ? 72  GLY A N    7  
ATOM   7966  C  CA   . GLY A 1 72 ? 18.633  4.911   -8.990  1.00 0.00 ? 72  GLY A CA   7  
ATOM   7967  C  C    . GLY A 1 72 ? 19.667  5.658   -8.171  1.00 0.00 ? 72  GLY A C    7  
ATOM   7968  O  O    . GLY A 1 72 ? 19.787  6.879   -8.273  1.00 0.00 ? 72  GLY A O    7  
ATOM   7969  H  H    . GLY A 1 72 ? 17.211  4.620   -7.448  1.00 0.00 ? 72  GLY A H    7  
ATOM   7970  H  HA2  . GLY A 1 72 ? 19.139  4.225   -9.652  1.00 0.00 ? 72  GLY A HA2  7  
ATOM   7971  H  HA3  . GLY A 1 72 ? 18.077  5.623   -9.583  1.00 0.00 ? 72  GLY A HA3  7  
ATOM   7972  N  N    . VAL A 1 73 ? 20.415  4.923   -7.354  1.00 0.00 ? 73  VAL A N    7  
ATOM   7973  C  CA   . VAL A 1 73 ? 21.444  5.523   -6.513  1.00 0.00 ? 73  VAL A CA   7  
ATOM   7974  C  C    . VAL A 1 73 ? 22.602  4.558   -6.289  1.00 0.00 ? 73  VAL A C    7  
ATOM   7975  O  O    . VAL A 1 73 ? 22.448  3.345   -6.427  1.00 0.00 ? 73  VAL A O    7  
ATOM   7976  C  CB   . VAL A 1 73 ? 20.874  5.950   -5.147  1.00 0.00 ? 73  VAL A CB   7  
ATOM   7977  C  CG1  . VAL A 1 73 ? 19.969  7.163   -5.302  1.00 0.00 ? 73  VAL A CG1  7  
ATOM   7978  C  CG2  . VAL A 1 73 ? 20.126  4.796   -4.498  1.00 0.00 ? 73  VAL A CG2  7  
ATOM   7979  H  H    . VAL A 1 73 ? 20.272  3.955   -7.316  1.00 0.00 ? 73  VAL A H    7  
ATOM   7980  H  HA   . VAL A 1 73 ? 21.814  6.405   -7.016  1.00 0.00 ? 73  VAL A HA   7  
ATOM   7981  H  HB   . VAL A 1 73 ? 21.698  6.224   -4.505  1.00 0.00 ? 73  VAL A HB   7  
ATOM   7982  H  HG11 . VAL A 1 73 ? 20.253  7.713   -6.187  1.00 0.00 ? 73  VAL A HG11 7  
ATOM   7983  H  HG12 . VAL A 1 73 ? 18.943  6.838   -5.391  1.00 0.00 ? 73  VAL A HG12 7  
ATOM   7984  H  HG13 . VAL A 1 73 ? 20.071  7.801   -4.436  1.00 0.00 ? 73  VAL A HG13 7  
ATOM   7985  H  HG21 . VAL A 1 73 ? 19.159  5.139   -4.162  1.00 0.00 ? 73  VAL A HG21 7  
ATOM   7986  H  HG22 . VAL A 1 73 ? 19.995  4.001   -5.218  1.00 0.00 ? 73  VAL A HG22 7  
ATOM   7987  H  HG23 . VAL A 1 73 ? 20.691  4.428   -3.655  1.00 0.00 ? 73  VAL A HG23 7  
ATOM   7988  N  N    . SER A 1 74 ? 23.763  5.105   -5.941  1.00 0.00 ? 74  SER A N    7  
ATOM   7989  C  CA   . SER A 1 74 ? 24.949  4.293   -5.701  1.00 0.00 ? 74  SER A CA   7  
ATOM   7990  C  C    . SER A 1 74 ? 25.344  3.522   -6.957  1.00 0.00 ? 74  SER A C    7  
ATOM   7991  O  O    . SER A 1 74 ? 25.869  2.412   -6.879  1.00 0.00 ? 74  SER A O    7  
ATOM   7992  C  CB   . SER A 1 74 ? 24.701  3.318   -4.548  1.00 0.00 ? 74  SER A CB   7  
ATOM   7993  O  OG   . SER A 1 74 ? 25.047  3.902   -3.304  1.00 0.00 ? 74  SER A OG   7  
ATOM   7994  H  H    . SER A 1 74 ? 23.822  6.079   -5.848  1.00 0.00 ? 74  SER A H    7  
ATOM   7995  H  HA   . SER A 1 74 ? 25.757  4.957   -5.432  1.00 0.00 ? 74  SER A HA   7  
ATOM   7996  H  HB2  . SER A 1 74 ? 23.656  3.048   -4.527  1.00 0.00 ? 74  SER A HB2  7  
ATOM   7997  H  HB3  . SER A 1 74 ? 25.299  2.431   -4.695  1.00 0.00 ? 74  SER A HB3  7  
ATOM   7998  H  HG   . SER A 1 74 ? 25.820  4.460   -3.415  1.00 0.00 ? 74  SER A HG   7  
ATOM   7999  N  N    . GLY A 1 75 ? 25.087  4.121   -8.116  1.00 0.00 ? 75  GLY A N    7  
ATOM   8000  C  CA   . GLY A 1 75 ? 25.421  3.478   -9.373  1.00 0.00 ? 75  GLY A CA   7  
ATOM   8001  C  C    . GLY A 1 75 ? 25.766  4.475   -10.462 1.00 0.00 ? 75  GLY A C    7  
ATOM   8002  O  O    . GLY A 1 75 ? 26.880  4.995   -10.526 1.00 0.00 ? 75  GLY A O    7  
ATOM   8003  H  H    . GLY A 1 75 ? 24.667  5.006   -8.118  1.00 0.00 ? 75  GLY A H    7  
ATOM   8004  H  HA2  . GLY A 1 75 ? 26.267  2.824   -9.217  1.00 0.00 ? 75  GLY A HA2  7  
ATOM   8005  H  HA3  . GLY A 1 75 ? 24.577  2.886   -9.697  1.00 0.00 ? 75  GLY A HA3  7  
ATOM   8006  N  N    . PRO A 1 76 ? 24.794  4.754   -11.343 1.00 0.00 ? 76  PRO A N    7  
ATOM   8007  C  CA   . PRO A 1 76 ? 24.977  5.697   -12.451 1.00 0.00 ? 76  PRO A CA   7  
ATOM   8008  C  C    . PRO A 1 76 ? 25.091  7.140   -11.971 1.00 0.00 ? 76  PRO A C    7  
ATOM   8009  O  O    . PRO A 1 76 ? 24.111  7.733   -11.521 1.00 0.00 ? 76  PRO A O    7  
ATOM   8010  C  CB   . PRO A 1 76 ? 23.710  5.510   -13.289 1.00 0.00 ? 76  PRO A CB   7  
ATOM   8011  C  CG   . PRO A 1 76 ? 22.691  5.006   -12.326 1.00 0.00 ? 76  PRO A CG   7  
ATOM   8012  C  CD   . PRO A 1 76 ? 23.442  4.171   -11.326 1.00 0.00 ? 76  PRO A CD   7  
ATOM   8013  H  HA   . PRO A 1 76 ? 25.844  5.447   -13.045 1.00 0.00 ? 76  PRO A HA   7  
ATOM   8014  H  HB2  . PRO A 1 76 ? 23.415  6.458   -13.717 1.00 0.00 ? 76  PRO A HB2  7  
ATOM   8015  H  HB3  . PRO A 1 76 ? 23.896  4.796   -14.076 1.00 0.00 ? 76  PRO A HB3  7  
ATOM   8016  H  HG2  . PRO A 1 76 ? 22.208  5.836   -11.834 1.00 0.00 ? 76  PRO A HG2  7  
ATOM   8017  H  HG3  . PRO A 1 76 ? 21.962  4.401   -12.846 1.00 0.00 ? 76  PRO A HG3  7  
ATOM   8018  H  HD2  . PRO A 1 76 ? 22.995  4.261   -10.347 1.00 0.00 ? 76  PRO A HD2  7  
ATOM   8019  H  HD3  . PRO A 1 76 ? 23.465  3.137   -11.639 1.00 0.00 ? 76  PRO A HD3  7  
ATOM   8020  N  N    . SER A 1 77 ? 26.293  7.698   -12.070 1.00 0.00 ? 77  SER A N    7  
ATOM   8021  C  CA   . SER A 1 77 ? 26.535  9.071   -11.643 1.00 0.00 ? 77  SER A CA   7  
ATOM   8022  C  C    . SER A 1 77 ? 26.409  10.036  -12.818 1.00 0.00 ? 77  SER A C    7  
ATOM   8023  O  O    . SER A 1 77 ? 25.797  11.098  -12.701 1.00 0.00 ? 77  SER A O    7  
ATOM   8024  C  CB   . SER A 1 77 ? 27.925  9.195   -11.015 1.00 0.00 ? 77  SER A CB   7  
ATOM   8025  O  OG   . SER A 1 77 ? 28.940  9.105   -12.000 1.00 0.00 ? 77  SER A OG   7  
ATOM   8026  H  H    . SER A 1 77 ? 27.035  7.173   -12.437 1.00 0.00 ? 77  SER A H    7  
ATOM   8027  H  HA   . SER A 1 77 ? 25.791  9.325   -10.903 1.00 0.00 ? 77  SER A HA   7  
ATOM   8028  H  HB2  . SER A 1 77 ? 28.008  10.148  -10.516 1.00 0.00 ? 77  SER A HB2  7  
ATOM   8029  H  HB3  . SER A 1 77 ? 28.064  8.399   -10.297 1.00 0.00 ? 77  SER A HB3  7  
ATOM   8030  H  HG   . SER A 1 77 ? 29.489  9.892   -11.966 1.00 0.00 ? 77  SER A HG   7  
ATOM   8031  N  N    . SER A 1 78 ? 26.992  9.658   -13.952 1.00 0.00 ? 78  SER A N    7  
ATOM   8032  C  CA   . SER A 1 78 ? 26.948  10.491  -15.148 1.00 0.00 ? 78  SER A CA   7  
ATOM   8033  C  C    . SER A 1 78 ? 26.771  9.635   -16.399 1.00 0.00 ? 78  SER A C    7  
ATOM   8034  O  O    . SER A 1 78 ? 27.526  8.693   -16.632 1.00 0.00 ? 78  SER A O    7  
ATOM   8035  C  CB   . SER A 1 78 ? 28.227  11.323  -15.263 1.00 0.00 ? 78  SER A CB   7  
ATOM   8036  O  OG   . SER A 1 78 ? 28.057  12.396  -16.172 1.00 0.00 ? 78  SER A OG   7  
ATOM   8037  H  H    . SER A 1 78 ? 27.464  8.800   -13.982 1.00 0.00 ? 78  SER A H    7  
ATOM   8038  H  HA   . SER A 1 78 ? 26.103  11.156  -15.058 1.00 0.00 ? 78  SER A HA   7  
ATOM   8039  H  HB2  . SER A 1 78 ? 28.480  11.725  -14.294 1.00 0.00 ? 78  SER A HB2  7  
ATOM   8040  H  HB3  . SER A 1 78 ? 29.032  10.694  -15.613 1.00 0.00 ? 78  SER A HB3  7  
ATOM   8041  H  HG   . SER A 1 78 ? 27.309  12.215  -16.746 1.00 0.00 ? 78  SER A HG   7  
ATOM   8042  N  N    . GLY A 1 79 ? 25.765  9.972   -17.201 1.00 0.00 ? 79  GLY A N    7  
ATOM   8043  C  CA   . GLY A 1 79 ? 25.506  9.226   -18.418 1.00 0.00 ? 79  GLY A CA   7  
ATOM   8044  C  C    . GLY A 1 79 ? 26.320  9.731   -19.593 1.00 0.00 ? 79  GLY A C    7  
ATOM   8045  O  O    . GLY A 1 79 ? 25.844  9.663   -20.725 1.00 0.00 ? 79  GLY A O    7  
ATOM   8046  H  H    . GLY A 1 79 ? 25.196  10.734  -16.964 1.00 0.00 ? 79  GLY A H    7  
ATOM   8047  H  HA2  . GLY A 1 79 ? 25.744  8.187   -18.248 1.00 0.00 ? 79  GLY A HA2  7  
ATOM   8048  H  HA3  . GLY A 1 79 ? 24.456  9.309   -18.661 1.00 0.00 ? 79  GLY A HA3  7  
HETATM 8049  ZN ZN   . ZN  B 2 .  ? -9.737  -0.417  -2.574  1.00 0.00 ? 201 ZN  A ZN   7  
HETATM 8050  ZN ZN   . ZN  C 2 .  ? 9.685   -1.094  -0.312  1.00 0.00 ? 401 ZN  A ZN   7  
ATOM   8051  N  N    . GLY A 1 1  ? -2.792  -11.397 -28.990 1.00 0.00 ? 1   GLY A N    8  
ATOM   8052  C  CA   . GLY A 1 1  ? -3.587  -10.349 -29.603 1.00 0.00 ? 1   GLY A CA   8  
ATOM   8053  C  C    . GLY A 1 1  ? -3.282  -8.980  -29.030 1.00 0.00 ? 1   GLY A C    8  
ATOM   8054  O  O    . GLY A 1 1  ? -2.157  -8.713  -28.606 1.00 0.00 ? 1   GLY A O    8  
ATOM   8055  H  H1   . GLY A 1 1  ? -2.107  -11.861 -29.515 1.00 0.00 ? 1   GLY A H1   8  
ATOM   8056  H  HA2  . GLY A 1 1  ? -3.388  -10.336 -30.664 1.00 0.00 ? 1   GLY A HA2  8  
ATOM   8057  H  HA3  . GLY A 1 1  ? -4.633  -10.568 -29.445 1.00 0.00 ? 1   GLY A HA3  8  
ATOM   8058  N  N    . SER A 1 2  ? -4.285  -8.108  -29.017 1.00 0.00 ? 2   SER A N    8  
ATOM   8059  C  CA   . SER A 1 2  ? -4.117  -6.756  -28.497 1.00 0.00 ? 2   SER A CA   8  
ATOM   8060  C  C    . SER A 1 2  ? -5.469  -6.074  -28.312 1.00 0.00 ? 2   SER A C    8  
ATOM   8061  O  O    . SER A 1 2  ? -6.175  -5.797  -29.282 1.00 0.00 ? 2   SER A O    8  
ATOM   8062  C  CB   . SER A 1 2  ? -3.240  -5.930  -29.439 1.00 0.00 ? 2   SER A CB   8  
ATOM   8063  O  OG   . SER A 1 2  ? -1.865  -6.131  -29.164 1.00 0.00 ? 2   SER A OG   8  
ATOM   8064  H  H    . SER A 1 2  ? -5.159  -8.380  -29.369 1.00 0.00 ? 2   SER A H    8  
ATOM   8065  H  HA   . SER A 1 2  ? -3.630  -6.829  -27.536 1.00 0.00 ? 2   SER A HA   8  
ATOM   8066  H  HB2  . SER A 1 2  ? -3.437  -6.222  -30.459 1.00 0.00 ? 2   SER A HB2  8  
ATOM   8067  H  HB3  . SER A 1 2  ? -3.471  -4.882  -29.314 1.00 0.00 ? 2   SER A HB3  8  
ATOM   8068  H  HG   . SER A 1 2  ? -1.761  -6.442  -28.261 1.00 0.00 ? 2   SER A HG   8  
ATOM   8069  N  N    . SER A 1 3  ? -5.823  -5.804  -27.059 1.00 0.00 ? 3   SER A N    8  
ATOM   8070  C  CA   . SER A 1 3  ? -7.091  -5.157  -26.745 1.00 0.00 ? 3   SER A CA   8  
ATOM   8071  C  C    . SER A 1 3  ? -7.148  -4.759  -25.274 1.00 0.00 ? 3   SER A C    8  
ATOM   8072  O  O    . SER A 1 3  ? -6.325  -5.193  -24.469 1.00 0.00 ? 3   SER A O    8  
ATOM   8073  C  CB   . SER A 1 3  ? -8.259  -6.088  -27.079 1.00 0.00 ? 3   SER A CB   8  
ATOM   8074  O  OG   . SER A 1 3  ? -8.447  -7.056  -26.062 1.00 0.00 ? 3   SER A OG   8  
ATOM   8075  H  H    . SER A 1 3  ? -5.217  -6.049  -26.329 1.00 0.00 ? 3   SER A H    8  
ATOM   8076  H  HA   . SER A 1 3  ? -7.168  -4.266  -27.350 1.00 0.00 ? 3   SER A HA   8  
ATOM   8077  H  HB2  . SER A 1 3  ? -9.163  -5.506  -27.178 1.00 0.00 ? 3   SER A HB2  8  
ATOM   8078  H  HB3  . SER A 1 3  ? -8.055  -6.597  -28.011 1.00 0.00 ? 3   SER A HB3  8  
ATOM   8079  H  HG   . SER A 1 3  ? -7.607  -7.474  -25.858 1.00 0.00 ? 3   SER A HG   8  
ATOM   8080  N  N    . GLY A 1 4  ? -8.128  -3.929  -24.929 1.00 0.00 ? 4   GLY A N    8  
ATOM   8081  C  CA   . GLY A 1 4  ? -8.276  -3.485  -23.555 1.00 0.00 ? 4   GLY A CA   8  
ATOM   8082  C  C    . GLY A 1 4  ? -8.578  -2.003  -23.454 1.00 0.00 ? 4   GLY A C    8  
ATOM   8083  O  O    . GLY A 1 4  ? -7.853  -1.176  -24.006 1.00 0.00 ? 4   GLY A O    8  
ATOM   8084  H  H    . GLY A 1 4  ? -8.756  -3.615  -25.614 1.00 0.00 ? 4   GLY A H    8  
ATOM   8085  H  HA2  . GLY A 1 4  ? -9.080  -4.038  -23.094 1.00 0.00 ? 4   GLY A HA2  8  
ATOM   8086  H  HA3  . GLY A 1 4  ? -7.359  -3.691  -23.022 1.00 0.00 ? 4   GLY A HA3  8  
ATOM   8087  N  N    . SER A 1 5  ? -9.653  -1.667  -22.748 1.00 0.00 ? 5   SER A N    8  
ATOM   8088  C  CA   . SER A 1 5  ? -10.052 -0.275  -22.581 1.00 0.00 ? 5   SER A CA   8  
ATOM   8089  C  C    . SER A 1 5  ? -10.830 -0.085  -21.282 1.00 0.00 ? 5   SER A C    8  
ATOM   8090  O  O    . SER A 1 5  ? -11.502 -1.001  -20.808 1.00 0.00 ? 5   SER A O    8  
ATOM   8091  C  CB   . SER A 1 5  ? -10.903 0.180   -23.769 1.00 0.00 ? 5   SER A CB   8  
ATOM   8092  O  OG   . SER A 1 5  ? -10.088 0.579   -24.857 1.00 0.00 ? 5   SER A OG   8  
ATOM   8093  H  H    . SER A 1 5  ? -10.191 -2.373  -22.331 1.00 0.00 ? 5   SER A H    8  
ATOM   8094  H  HA   . SER A 1 5  ? -9.156  0.325   -22.541 1.00 0.00 ? 5   SER A HA   8  
ATOM   8095  H  HB2  . SER A 1 5  ? -11.535 -0.634  -24.088 1.00 0.00 ? 5   SER A HB2  8  
ATOM   8096  H  HB3  . SER A 1 5  ? -11.517 1.016   -23.468 1.00 0.00 ? 5   SER A HB3  8  
ATOM   8097  H  HG   . SER A 1 5  ? -9.309  0.018   -24.896 1.00 0.00 ? 5   SER A HG   8  
ATOM   8098  N  N    . SER A 1 6  ? -10.733 1.112   -20.711 1.00 0.00 ? 6   SER A N    8  
ATOM   8099  C  CA   . SER A 1 6  ? -11.423 1.422   -19.465 1.00 0.00 ? 6   SER A CA   8  
ATOM   8100  C  C    . SER A 1 6  ? -11.751 2.910   -19.381 1.00 0.00 ? 6   SER A C    8  
ATOM   8101  O  O    . SER A 1 6  ? -10.927 3.758   -19.720 1.00 0.00 ? 6   SER A O    8  
ATOM   8102  C  CB   . SER A 1 6  ? -10.567 1.009   -18.266 1.00 0.00 ? 6   SER A CB   8  
ATOM   8103  O  OG   . SER A 1 6  ? -9.273  1.582   -18.341 1.00 0.00 ? 6   SER A OG   8  
ATOM   8104  H  H    . SER A 1 6  ? -10.181 1.801   -21.137 1.00 0.00 ? 6   SER A H    8  
ATOM   8105  H  HA   . SER A 1 6  ? -12.346 0.861   -19.448 1.00 0.00 ? 6   SER A HA   8  
ATOM   8106  H  HB2  . SER A 1 6  ? -11.042 1.341   -17.356 1.00 0.00 ? 6   SER A HB2  8  
ATOM   8107  H  HB3  . SER A 1 6  ? -10.471 -0.067  -18.250 1.00 0.00 ? 6   SER A HB3  8  
ATOM   8108  H  HG   . SER A 1 6  ? -8.635  0.987   -17.942 1.00 0.00 ? 6   SER A HG   8  
ATOM   8109  N  N    . GLY A 1 7  ? -12.961 3.219   -18.926 1.00 0.00 ? 7   GLY A N    8  
ATOM   8110  C  CA   . GLY A 1 7  ? -13.378 4.604   -18.806 1.00 0.00 ? 7   GLY A CA   8  
ATOM   8111  C  C    . GLY A 1 7  ? -14.786 4.740   -18.261 1.00 0.00 ? 7   GLY A C    8  
ATOM   8112  O  O    . GLY A 1 7  ? -15.719 4.124   -18.775 1.00 0.00 ? 7   GLY A O    8  
ATOM   8113  H  H    . GLY A 1 7  ? -13.577 2.500   -18.671 1.00 0.00 ? 7   GLY A H    8  
ATOM   8114  H  HA2  . GLY A 1 7  ? -12.696 5.117   -18.145 1.00 0.00 ? 7   GLY A HA2  8  
ATOM   8115  H  HA3  . GLY A 1 7  ? -13.336 5.066   -19.781 1.00 0.00 ? 7   GLY A HA3  8  
ATOM   8116  N  N    . GLU A 1 8  ? -14.939 5.549   -17.217 1.00 0.00 ? 8   GLU A N    8  
ATOM   8117  C  CA   . GLU A 1 8  ? -16.243 5.761   -16.601 1.00 0.00 ? 8   GLU A CA   8  
ATOM   8118  C  C    . GLU A 1 8  ? -16.218 6.978   -15.680 1.00 0.00 ? 8   GLU A C    8  
ATOM   8119  O  O    . GLU A 1 8  ? -15.198 7.284   -15.063 1.00 0.00 ? 8   GLU A O    8  
ATOM   8120  C  CB   . GLU A 1 8  ? -16.668 4.521   -15.813 1.00 0.00 ? 8   GLU A CB   8  
ATOM   8121  C  CG   . GLU A 1 8  ? -18.173 4.320   -15.759 1.00 0.00 ? 8   GLU A CG   8  
ATOM   8122  C  CD   . GLU A 1 8  ? -18.737 3.784   -17.060 1.00 0.00 ? 8   GLU A CD   8  
ATOM   8123  O  OE1  . GLU A 1 8  ? -18.520 4.427   -18.109 1.00 0.00 ? 8   GLU A OE1  8  
ATOM   8124  O  OE2  . GLU A 1 8  ? -19.396 2.724   -17.031 1.00 0.00 ? 8   GLU A OE2  8  
ATOM   8125  H  H    . GLU A 1 8  ? -14.156 6.012   -16.852 1.00 0.00 ? 8   GLU A H    8  
ATOM   8126  H  HA   . GLU A 1 8  ? -16.958 5.937   -17.390 1.00 0.00 ? 8   GLU A HA   8  
ATOM   8127  H  HB2  . GLU A 1 8  ? -16.225 3.649   -16.270 1.00 0.00 ? 8   GLU A HB2  8  
ATOM   8128  H  HB3  . GLU A 1 8  ? -16.302 4.610   -14.800 1.00 0.00 ? 8   GLU A HB3  8  
ATOM   8129  H  HG2  . GLU A 1 8  ? -18.402 3.619   -14.970 1.00 0.00 ? 8   GLU A HG2  8  
ATOM   8130  H  HG3  . GLU A 1 8  ? -18.643 5.268   -15.543 1.00 0.00 ? 8   GLU A HG3  8  
ATOM   8131  N  N    . LYS A 1 9  ? -17.349 7.671   -15.594 1.00 0.00 ? 9   LYS A N    8  
ATOM   8132  C  CA   . LYS A 1 9  ? -17.459 8.854   -14.750 1.00 0.00 ? 9   LYS A CA   8  
ATOM   8133  C  C    . LYS A 1 9  ? -18.546 8.671   -13.696 1.00 0.00 ? 9   LYS A C    8  
ATOM   8134  O  O    . LYS A 1 9  ? -19.706 8.424   -14.023 1.00 0.00 ? 9   LYS A O    8  
ATOM   8135  C  CB   . LYS A 1 9  ? -17.764 10.088  -15.603 1.00 0.00 ? 9   LYS A CB   8  
ATOM   8136  C  CG   . LYS A 1 9  ? -16.729 10.353  -16.682 1.00 0.00 ? 9   LYS A CG   8  
ATOM   8137  C  CD   . LYS A 1 9  ? -16.979 11.678  -17.382 1.00 0.00 ? 9   LYS A CD   8  
ATOM   8138  C  CE   . LYS A 1 9  ? -18.195 11.606  -18.292 1.00 0.00 ? 9   LYS A CE   8  
ATOM   8139  N  NZ   . LYS A 1 9  ? -18.587 12.950  -18.801 1.00 0.00 ? 9   LYS A NZ   8  
ATOM   8140  H  H    . LYS A 1 9  ? -18.129 7.378   -16.111 1.00 0.00 ? 9   LYS A H    8  
ATOM   8141  H  HA   . LYS A 1 9  ? -16.512 8.997   -14.252 1.00 0.00 ? 9   LYS A HA   8  
ATOM   8142  H  HB2  . LYS A 1 9  ? -18.724 9.953   -16.080 1.00 0.00 ? 9   LYS A HB2  8  
ATOM   8143  H  HB3  . LYS A 1 9  ? -17.811 10.954  -14.958 1.00 0.00 ? 9   LYS A HB3  8  
ATOM   8144  H  HG2  . LYS A 1 9  ? -15.748 10.377  -16.229 1.00 0.00 ? 9   LYS A HG2  8  
ATOM   8145  H  HG3  . LYS A 1 9  ? -16.771 9.557   -17.411 1.00 0.00 ? 9   LYS A HG3  8  
ATOM   8146  H  HD2  . LYS A 1 9  ? -17.145 12.443  -16.638 1.00 0.00 ? 9   LYS A HD2  8  
ATOM   8147  H  HD3  . LYS A 1 9  ? -16.111 11.932  -17.974 1.00 0.00 ? 9   LYS A HD3  8  
ATOM   8148  H  HE2  . LYS A 1 9  ? -17.964 10.967  -19.131 1.00 0.00 ? 9   LYS A HE2  8  
ATOM   8149  H  HE3  . LYS A 1 9  ? -19.020 11.186  -17.736 1.00 0.00 ? 9   LYS A HE3  8  
ATOM   8150  H  HZ1  . LYS A 1 9  ? -18.897 13.553  -18.012 1.00 0.00 ? 9   LYS A HZ1  8  
ATOM   8151  H  HZ2  . LYS A 1 9  ? -19.369 12.860  -19.481 1.00 0.00 ? 9   LYS A HZ2  8  
ATOM   8152  H  HZ3  . LYS A 1 9  ? -17.780 13.403  -19.274 1.00 0.00 ? 9   LYS A HZ3  8  
ATOM   8153  N  N    . ALA A 1 10 ? -18.163 8.795   -12.429 1.00 0.00 ? 10  ALA A N    8  
ATOM   8154  C  CA   . ALA A 1 10 ? -19.105 8.646   -11.328 1.00 0.00 ? 10  ALA A CA   8  
ATOM   8155  C  C    . ALA A 1 10 ? -19.870 9.942   -11.081 1.00 0.00 ? 10  ALA A C    8  
ATOM   8156  O  O    . ALA A 1 10 ? -19.465 11.010  -11.540 1.00 0.00 ? 10  ALA A O    8  
ATOM   8157  C  CB   . ALA A 1 10 ? -18.377 8.212   -10.064 1.00 0.00 ? 10  ALA A CB   8  
ATOM   8158  H  H    . ALA A 1 10 ? -17.224 8.992   -12.231 1.00 0.00 ? 10  ALA A H    8  
ATOM   8159  H  HA   . ALA A 1 10 ? -19.809 7.870   -11.593 1.00 0.00 ? 10  ALA A HA   8  
ATOM   8160  H  HB1  . ALA A 1 10 ? -17.348 8.538   -10.113 1.00 0.00 ? 10  ALA A HB1  8  
ATOM   8161  H  HB2  . ALA A 1 10 ? -18.855 8.654   -9.203  1.00 0.00 ? 10  ALA A HB2  8  
ATOM   8162  H  HB3  . ALA A 1 10 ? -18.410 7.136   -9.982  1.00 0.00 ? 10  ALA A HB3  8  
ATOM   8163  N  N    . ARG A 1 11 ? -20.977 9.841   -10.353 1.00 0.00 ? 11  ARG A N    8  
ATOM   8164  C  CA   . ARG A 1 11 ? -21.800 11.005  -10.047 1.00 0.00 ? 11  ARG A CA   8  
ATOM   8165  C  C    . ARG A 1 11 ? -21.759 11.322  -8.555  1.00 0.00 ? 11  ARG A C    8  
ATOM   8166  O  O    . ARG A 1 11 ? -21.835 10.424  -7.717  1.00 0.00 ? 11  ARG A O    8  
ATOM   8167  C  CB   . ARG A 1 11 ? -23.245 10.766  -10.489 1.00 0.00 ? 11  ARG A CB   8  
ATOM   8168  C  CG   . ARG A 1 11 ? -23.859 9.504   -9.907  1.00 0.00 ? 11  ARG A CG   8  
ATOM   8169  C  CD   . ARG A 1 11 ? -23.607 8.299   -10.799 1.00 0.00 ? 11  ARG A CD   8  
ATOM   8170  N  NE   . ARG A 1 11 ? -23.718 7.041   -10.064 1.00 0.00 ? 11  ARG A NE   8  
ATOM   8171  C  CZ   . ARG A 1 11 ? -23.456 5.853   -10.597 1.00 0.00 ? 11  ARG A CZ   8  
ATOM   8172  N  NH1  . ARG A 1 11 ? -23.070 5.761   -11.863 1.00 0.00 ? 11  ARG A NH1  8  
ATOM   8173  N  NH2  . ARG A 1 11 ? -23.580 4.754   -9.865  1.00 0.00 ? 11  ARG A NH2  8  
ATOM   8174  H  H    . ARG A 1 11 ? -21.249 8.962   -10.014 1.00 0.00 ? 11  ARG A H    8  
ATOM   8175  H  HA   . ARG A 1 11 ? -21.400 11.846  -10.592 1.00 0.00 ? 11  ARG A HA   8  
ATOM   8176  H  HB2  . ARG A 1 11 ? -23.847 11.608  -10.182 1.00 0.00 ? 11  ARG A HB2  8  
ATOM   8177  H  HB3  . ARG A 1 11 ? -23.270 10.689  -11.566 1.00 0.00 ? 11  ARG A HB3  8  
ATOM   8178  H  HG2  . ARG A 1 11 ? -23.424 9.317   -8.936  1.00 0.00 ? 11  ARG A HG2  8  
ATOM   8179  H  HG3  . ARG A 1 11 ? -24.924 9.648   -9.804  1.00 0.00 ? 11  ARG A HG3  8  
ATOM   8180  H  HD2  . ARG A 1 11 ? -24.331 8.302   -11.599 1.00 0.00 ? 11  ARG A HD2  8  
ATOM   8181  H  HD3  . ARG A 1 11 ? -22.612 8.376   -11.213 1.00 0.00 ? 11  ARG A HD3  8  
ATOM   8182  H  HE   . ARG A 1 11 ? -24.001 7.086   -9.128  1.00 0.00 ? 11  ARG A HE   8  
ATOM   8183  H  HH11 . ARG A 1 11 ? -22.975 6.587   -12.417 1.00 0.00 ? 11  ARG A HH11 8  
ATOM   8184  H  HH12 . ARG A 1 11 ? -22.873 4.865   -12.261 1.00 0.00 ? 11  ARG A HH12 8  
ATOM   8185  H  HH21 . ARG A 1 11 ? -23.871 4.819   -8.910  1.00 0.00 ? 11  ARG A HH21 8  
ATOM   8186  H  HH22 . ARG A 1 11 ? -23.384 3.860   -10.267 1.00 0.00 ? 11  ARG A HH22 8  
ATOM   8187  N  N    . GLY A 1 12 ? -21.639 12.606  -8.231  1.00 0.00 ? 12  GLY A N    8  
ATOM   8188  C  CA   . GLY A 1 12 ? -21.590 13.019  -6.840  1.00 0.00 ? 12  GLY A CA   8  
ATOM   8189  C  C    . GLY A 1 12 ? -20.189 13.387  -6.394  1.00 0.00 ? 12  GLY A C    8  
ATOM   8190  O  O    . GLY A 1 12 ? -19.483 12.569  -5.801  1.00 0.00 ? 12  GLY A O    8  
ATOM   8191  H  H    . GLY A 1 12 ? -21.583 13.278  -8.941  1.00 0.00 ? 12  GLY A H    8  
ATOM   8192  H  HA2  . GLY A 1 12 ? -22.236 13.874  -6.707  1.00 0.00 ? 12  GLY A HA2  8  
ATOM   8193  H  HA3  . GLY A 1 12 ? -21.951 12.208  -6.223  1.00 0.00 ? 12  GLY A HA3  8  
ATOM   8194  N  N    . LEU A 1 13 ? -19.784 14.619  -6.679  1.00 0.00 ? 13  LEU A N    8  
ATOM   8195  C  CA   . LEU A 1 13 ? -18.456 15.094  -6.305  1.00 0.00 ? 13  LEU A CA   8  
ATOM   8196  C  C    . LEU A 1 13 ? -18.180 14.830  -4.828  1.00 0.00 ? 13  LEU A C    8  
ATOM   8197  O  O    . LEU A 1 13 ? -18.735 15.496  -3.954  1.00 0.00 ? 13  LEU A O    8  
ATOM   8198  C  CB   . LEU A 1 13 ? -18.325 16.589  -6.601  1.00 0.00 ? 13  LEU A CB   8  
ATOM   8199  C  CG   . LEU A 1 13 ? -19.460 17.476  -6.089  1.00 0.00 ? 13  LEU A CG   8  
ATOM   8200  C  CD1  . LEU A 1 13 ? -18.944 18.871  -5.770  1.00 0.00 ? 13  LEU A CD1  8  
ATOM   8201  C  CD2  . LEU A 1 13 ? -20.587 17.542  -7.109  1.00 0.00 ? 13  LEU A CD2  8  
ATOM   8202  H  H    . LEU A 1 13 ? -20.390 15.225  -7.153  1.00 0.00 ? 13  LEU A H    8  
ATOM   8203  H  HA   . LEU A 1 13 ? -17.732 14.553  -6.896  1.00 0.00 ? 13  LEU A HA   8  
ATOM   8204  H  HB2  . LEU A 1 13 ? -17.407 16.935  -6.153  1.00 0.00 ? 13  LEU A HB2  8  
ATOM   8205  H  HB3  . LEU A 1 13 ? -18.268 16.709  -7.673  1.00 0.00 ? 13  LEU A HB3  8  
ATOM   8206  H  HG   . LEU A 1 13 ? -19.857 17.052  -5.177  1.00 0.00 ? 13  LEU A HG   8  
ATOM   8207  H  HD11 . LEU A 1 13 ? -18.198 19.154  -6.498  1.00 0.00 ? 13  LEU A HD11 8  
ATOM   8208  H  HD12 . LEU A 1 13 ? -18.505 18.876  -4.784  1.00 0.00 ? 13  LEU A HD12 8  
ATOM   8209  H  HD13 . LEU A 1 13 ? -19.764 19.574  -5.803  1.00 0.00 ? 13  LEU A HD13 8  
ATOM   8210  H  HD21 . LEU A 1 13 ? -20.807 18.575  -7.335  1.00 0.00 ? 13  LEU A HD21 8  
ATOM   8211  H  HD22 . LEU A 1 13 ? -21.469 17.068  -6.702  1.00 0.00 ? 13  LEU A HD22 8  
ATOM   8212  H  HD23 . LEU A 1 13 ? -20.286 17.032  -8.011  1.00 0.00 ? 13  LEU A HD23 8  
ATOM   8213  N  N    . GLY A 1 14 ? -17.317 13.856  -4.556  1.00 0.00 ? 14  GLY A N    8  
ATOM   8214  C  CA   . GLY A 1 14 ? -16.981 13.523  -3.184  1.00 0.00 ? 14  GLY A CA   8  
ATOM   8215  C  C    . GLY A 1 14 ? -15.520 13.158  -3.018  1.00 0.00 ? 14  GLY A C    8  
ATOM   8216  O  O    . GLY A 1 14 ? -14.721 13.962  -2.537  1.00 0.00 ? 14  GLY A O    8  
ATOM   8217  H  H    . GLY A 1 14 ? -16.906 13.358  -5.294  1.00 0.00 ? 14  GLY A H    8  
ATOM   8218  H  HA2  . GLY A 1 14 ? -17.204 14.372  -2.555  1.00 0.00 ? 14  GLY A HA2  8  
ATOM   8219  H  HA3  . GLY A 1 14 ? -17.588 12.686  -2.870  1.00 0.00 ? 14  GLY A HA3  8  
ATOM   8220  N  N    . LYS A 1 15 ? -15.167 11.939  -3.414  1.00 0.00 ? 15  LYS A N    8  
ATOM   8221  C  CA   . LYS A 1 15 ? -13.792 11.467  -3.306  1.00 0.00 ? 15  LYS A CA   8  
ATOM   8222  C  C    . LYS A 1 15 ? -13.482 10.443  -4.393  1.00 0.00 ? 15  LYS A C    8  
ATOM   8223  O  O    . LYS A 1 15 ? -14.339 10.116  -5.215  1.00 0.00 ? 15  LYS A O    8  
ATOM   8224  C  CB   . LYS A 1 15 ? -13.549 10.852  -1.927  1.00 0.00 ? 15  LYS A CB   8  
ATOM   8225  C  CG   . LYS A 1 15 ? -13.768 11.823  -0.780  1.00 0.00 ? 15  LYS A CG   8  
ATOM   8226  C  CD   . LYS A 1 15 ? -12.667 12.869  -0.718  1.00 0.00 ? 15  LYS A CD   8  
ATOM   8227  C  CE   . LYS A 1 15 ? -13.135 14.129  -0.006  1.00 0.00 ? 15  LYS A CE   8  
ATOM   8228  N  NZ   . LYS A 1 15 ? -11.995 15.013  0.364   1.00 0.00 ? 15  LYS A NZ   8  
ATOM   8229  H  H    . LYS A 1 15 ? -15.849 11.343  -3.789  1.00 0.00 ? 15  LYS A H    8  
ATOM   8230  H  HA   . LYS A 1 15 ? -13.139 12.317  -3.432  1.00 0.00 ? 15  LYS A HA   8  
ATOM   8231  H  HB2  . LYS A 1 15 ? -14.220 10.016  -1.795  1.00 0.00 ? 15  LYS A HB2  8  
ATOM   8232  H  HB3  . LYS A 1 15 ? -12.530 10.495  -1.879  1.00 0.00 ? 15  LYS A HB3  8  
ATOM   8233  H  HG2  . LYS A 1 15 ? -14.715 12.322  -0.918  1.00 0.00 ? 15  LYS A HG2  8  
ATOM   8234  H  HG3  . LYS A 1 15 ? -13.781 11.272  0.150   1.00 0.00 ? 15  LYS A HG3  8  
ATOM   8235  H  HD2  . LYS A 1 15 ? -11.823 12.460  -0.182  1.00 0.00 ? 15  LYS A HD2  8  
ATOM   8236  H  HD3  . LYS A 1 15 ? -12.367 13.124  -1.724  1.00 0.00 ? 15  LYS A HD3  8  
ATOM   8237  H  HE2  . LYS A 1 15 ? -13.800 14.670  -0.661  1.00 0.00 ? 15  LYS A HE2  8  
ATOM   8238  H  HE3  . LYS A 1 15 ? -13.665 13.845  0.890   1.00 0.00 ? 15  LYS A HE3  8  
ATOM   8239  H  HZ1  . LYS A 1 15 ? -11.210 14.882  -0.305  1.00 0.00 ? 15  LYS A HZ1  8  
ATOM   8240  H  HZ2  . LYS A 1 15 ? -11.661 14.783  1.322   1.00 0.00 ? 15  LYS A HZ2  8  
ATOM   8241  H  HZ3  . LYS A 1 15 ? -12.293 16.009  0.342   1.00 0.00 ? 15  LYS A HZ3  8  
ATOM   8242  N  N    . TYR A 1 16 ? -12.252 9.940   -4.392  1.00 0.00 ? 16  TYR A N    8  
ATOM   8243  C  CA   . TYR A 1 16 ? -11.829 8.953   -5.379  1.00 0.00 ? 16  TYR A CA   8  
ATOM   8244  C  C    . TYR A 1 16 ? -12.324 7.560   -5.003  1.00 0.00 ? 16  TYR A C    8  
ATOM   8245  O  O    . TYR A 1 16 ? -11.983 7.033   -3.943  1.00 0.00 ? 16  TYR A O    8  
ATOM   8246  C  CB   . TYR A 1 16 ? -10.305 8.949   -5.505  1.00 0.00 ? 16  TYR A CB   8  
ATOM   8247  C  CG   . TYR A 1 16 ? -9.751  10.172  -6.200  1.00 0.00 ? 16  TYR A CG   8  
ATOM   8248  C  CD1  . TYR A 1 16 ? -9.844  11.429  -5.615  1.00 0.00 ? 16  TYR A CD1  8  
ATOM   8249  C  CD2  . TYR A 1 16 ? -9.136  10.071  -7.442  1.00 0.00 ? 16  TYR A CD2  8  
ATOM   8250  C  CE1  . TYR A 1 16 ? -9.340  12.550  -6.246  1.00 0.00 ? 16  TYR A CE1  8  
ATOM   8251  C  CE2  . TYR A 1 16 ? -8.628  11.186  -8.080  1.00 0.00 ? 16  TYR A CE2  8  
ATOM   8252  C  CZ   . TYR A 1 16 ? -8.733  12.423  -7.478  1.00 0.00 ? 16  TYR A CZ   8  
ATOM   8253  O  OH   . TYR A 1 16 ? -8.229  13.536  -8.112  1.00 0.00 ? 16  TYR A OH   8  
ATOM   8254  H  H    . TYR A 1 16 ? -11.614 10.239  -3.712  1.00 0.00 ? 16  TYR A H    8  
ATOM   8255  H  HA   . TYR A 1 16 ? -12.258 9.231   -6.330  1.00 0.00 ? 16  TYR A HA   8  
ATOM   8256  H  HB2  . TYR A 1 16 ? -9.869  8.903   -4.519  1.00 0.00 ? 16  TYR A HB2  8  
ATOM   8257  H  HB3  . TYR A 1 16 ? -10.000 8.080   -6.069  1.00 0.00 ? 16  TYR A HB3  8  
ATOM   8258  H  HD1  . TYR A 1 16 ? -10.320 11.525  -4.650  1.00 0.00 ? 16  TYR A HD1  8  
ATOM   8259  H  HD2  . TYR A 1 16 ? -9.056  9.101   -7.910  1.00 0.00 ? 16  TYR A HD2  8  
ATOM   8260  H  HE1  . TYR A 1 16 ? -9.421  13.518  -5.776  1.00 0.00 ? 16  TYR A HE1  8  
ATOM   8261  H  HE2  . TYR A 1 16 ? -8.153  11.087  -9.045  1.00 0.00 ? 16  TYR A HE2  8  
ATOM   8262  H  HH   . TYR A 1 16 ? -8.076  13.335  -9.038  1.00 0.00 ? 16  TYR A HH   8  
ATOM   8263  N  N    . ILE A 1 17 ? -13.128 6.968   -5.879  1.00 0.00 ? 17  ILE A N    8  
ATOM   8264  C  CA   . ILE A 1 17 ? -13.669 5.636   -5.641  1.00 0.00 ? 17  ILE A CA   8  
ATOM   8265  C  C    . ILE A 1 17 ? -12.692 4.557   -6.097  1.00 0.00 ? 17  ILE A C    8  
ATOM   8266  O  O    . ILE A 1 17 ? -12.403 4.428   -7.287  1.00 0.00 ? 17  ILE A O    8  
ATOM   8267  C  CB   . ILE A 1 17 ? -15.013 5.436   -6.366  1.00 0.00 ? 17  ILE A CB   8  
ATOM   8268  C  CG1  . ILE A 1 17 ? -15.983 6.564   -6.009  1.00 0.00 ? 17  ILE A CG1  8  
ATOM   8269  C  CG2  . ILE A 1 17 ? -15.610 4.083   -6.010  1.00 0.00 ? 17  ILE A CG2  8  
ATOM   8270  C  CD1  . ILE A 1 17 ? -16.469 6.512   -4.578  1.00 0.00 ? 17  ILE A CD1  8  
ATOM   8271  H  H    . ILE A 1 17 ? -13.363 7.439   -6.706  1.00 0.00 ? 17  ILE A H    8  
ATOM   8272  H  HA   . ILE A 1 17 ? -13.836 5.529   -4.579  1.00 0.00 ? 17  ILE A HA   8  
ATOM   8273  H  HB   . ILE A 1 17 ? -14.828 5.452   -7.430  1.00 0.00 ? 17  ILE A HB   8  
ATOM   8274  H  HG12 . ILE A 1 17 ? -15.492 7.512   -6.159  1.00 0.00 ? 17  ILE A HG12 8  
ATOM   8275  H  HG13 . ILE A 1 17 ? -16.846 6.503   -6.656  1.00 0.00 ? 17  ILE A HG13 8  
ATOM   8276  H  HG21 . ILE A 1 17 ? -16.231 4.184   -5.132  1.00 0.00 ? 17  ILE A HG21 8  
ATOM   8277  H  HG22 . ILE A 1 17 ? -16.210 3.726   -6.834  1.00 0.00 ? 17  ILE A HG22 8  
ATOM   8278  H  HG23 . ILE A 1 17 ? -14.816 3.379   -5.810  1.00 0.00 ? 17  ILE A HG23 8  
ATOM   8279  H  HD11 . ILE A 1 17 ? -16.724 7.508   -4.248  1.00 0.00 ? 17  ILE A HD11 8  
ATOM   8280  H  HD12 . ILE A 1 17 ? -17.339 5.877   -4.515  1.00 0.00 ? 17  ILE A HD12 8  
ATOM   8281  H  HD13 . ILE A 1 17 ? -15.687 6.114   -3.946  1.00 0.00 ? 17  ILE A HD13 8  
ATOM   8282  N  N    . CYS A 1 18 ? -12.187 3.782   -5.143  1.00 0.00 ? 18  CYS A N    8  
ATOM   8283  C  CA   . CYS A 1 18 ? -11.244 2.713   -5.445  1.00 0.00 ? 18  CYS A CA   8  
ATOM   8284  C  C    . CYS A 1 18 ? -11.807 1.775   -6.510  1.00 0.00 ? 18  CYS A C    8  
ATOM   8285  O  O    . CYS A 1 18 ? -12.901 1.234   -6.357  1.00 0.00 ? 18  CYS A O    8  
ATOM   8286  C  CB   . CYS A 1 18 ? -10.913 1.923   -4.177  1.00 0.00 ? 18  CYS A CB   8  
ATOM   8287  S  SG   . CYS A 1 18 ? -9.577  0.702   -4.389  1.00 0.00 ? 18  CYS A SG   8  
ATOM   8288  H  H    . CYS A 1 18 ? -12.455 3.934   -4.212  1.00 0.00 ? 18  CYS A H    8  
ATOM   8289  H  HA   . CYS A 1 18 ? -10.339 3.165   -5.823  1.00 0.00 ? 18  CYS A HA   8  
ATOM   8290  H  HB2  . CYS A 1 18 ? -10.608 2.611   -3.403  1.00 0.00 ? 18  CYS A HB2  8  
ATOM   8291  H  HB3  . CYS A 1 18 ? -11.796 1.392   -3.853  1.00 0.00 ? 18  CYS A HB3  8  
ATOM   8292  N  N    . GLN A 1 19 ? -11.050 1.589   -7.586  1.00 0.00 ? 19  GLN A N    8  
ATOM   8293  C  CA   . GLN A 1 19 ? -11.474 0.718   -8.676  1.00 0.00 ? 19  GLN A CA   8  
ATOM   8294  C  C    . GLN A 1 19 ? -11.135 -0.738  -8.372  1.00 0.00 ? 19  GLN A C    8  
ATOM   8295  O  O    . GLN A 1 19 ? -10.958 -1.548  -9.281  1.00 0.00 ? 19  GLN A O    8  
ATOM   8296  C  CB   . GLN A 1 19 ? -10.811 1.145   -9.986  1.00 0.00 ? 19  GLN A CB   8  
ATOM   8297  C  CG   . GLN A 1 19 ? -11.614 2.171   -10.768 1.00 0.00 ? 19  GLN A CG   8  
ATOM   8298  C  CD   . GLN A 1 19 ? -12.982 1.658   -11.172 1.00 0.00 ? 19  GLN A CD   8  
ATOM   8299  O  OE1  . GLN A 1 19 ? -13.099 0.753   -11.999 1.00 0.00 ? 19  GLN A OE1  8  
ATOM   8300  N  NE2  . GLN A 1 19 ? -14.027 2.233   -10.588 1.00 0.00 ? 19  GLN A NE2  8  
ATOM   8301  H  H    . GLN A 1 19 ? -10.187 2.049   -7.649  1.00 0.00 ? 19  GLN A H    8  
ATOM   8302  H  HA   . GLN A 1 19 ? -12.544 0.812   -8.778  1.00 0.00 ? 19  GLN A HA   8  
ATOM   8303  H  HB2  . GLN A 1 19 ? -9.843  1.570   -9.764  1.00 0.00 ? 19  GLN A HB2  8  
ATOM   8304  H  HB3  . GLN A 1 19 ? -10.678 0.273   -10.610 1.00 0.00 ? 19  GLN A HB3  8  
ATOM   8305  H  HG2  . GLN A 1 19 ? -11.744 3.051   -10.156 1.00 0.00 ? 19  GLN A HG2  8  
ATOM   8306  H  HG3  . GLN A 1 19 ? -11.066 2.434   -11.661 1.00 0.00 ? 19  GLN A HG3  8  
ATOM   8307  H  HE21 . GLN A 1 19 ? -13.858 2.949   -9.939  1.00 0.00 ? 19  GLN A HE21 8  
ATOM   8308  H  HE22 . GLN A 1 19 ? -14.922 1.921   -10.830 1.00 0.00 ? 19  GLN A HE22 8  
ATOM   8309  N  N    . LYS A 1 20 ? -11.047 -1.064  -7.087  1.00 0.00 ? 20  LYS A N    8  
ATOM   8310  C  CA   . LYS A 1 20 ? -10.731 -2.422  -6.661  1.00 0.00 ? 20  LYS A CA   8  
ATOM   8311  C  C    . LYS A 1 20 ? -11.754 -2.927  -5.649  1.00 0.00 ? 20  LYS A C    8  
ATOM   8312  O  O    . LYS A 1 20 ? -12.303 -4.020  -5.799  1.00 0.00 ? 20  LYS A O    8  
ATOM   8313  C  CB   . LYS A 1 20 ? -9.327  -2.474  -6.053  1.00 0.00 ? 20  LYS A CB   8  
ATOM   8314  C  CG   . LYS A 1 20 ? -8.932  -3.853  -5.554  1.00 0.00 ? 20  LYS A CG   8  
ATOM   8315  C  CD   . LYS A 1 20 ? -8.319  -4.693  -6.662  1.00 0.00 ? 20  LYS A CD   8  
ATOM   8316  C  CE   . LYS A 1 20 ? -8.311  -6.170  -6.302  1.00 0.00 ? 20  LYS A CE   8  
ATOM   8317  N  NZ   . LYS A 1 20 ? -7.995  -7.026  -7.479  1.00 0.00 ? 20  LYS A NZ   8  
ATOM   8318  H  H    . LYS A 1 20 ? -11.199 -0.373  -6.407  1.00 0.00 ? 20  LYS A H    8  
ATOM   8319  H  HA   . LYS A 1 20 ? -10.760 -3.058  -7.533  1.00 0.00 ? 20  LYS A HA   8  
ATOM   8320  H  HB2  . LYS A 1 20 ? -8.612  -2.166  -6.801  1.00 0.00 ? 20  LYS A HB2  8  
ATOM   8321  H  HB3  . LYS A 1 20 ? -9.284  -1.786  -5.220  1.00 0.00 ? 20  LYS A HB3  8  
ATOM   8322  H  HG2  . LYS A 1 20 ? -8.209  -3.744  -4.758  1.00 0.00 ? 20  LYS A HG2  8  
ATOM   8323  H  HG3  . LYS A 1 20 ? -9.811  -4.356  -5.177  1.00 0.00 ? 20  LYS A HG3  8  
ATOM   8324  H  HD2  . LYS A 1 20 ? -8.896  -4.557  -7.565  1.00 0.00 ? 20  LYS A HD2  8  
ATOM   8325  H  HD3  . LYS A 1 20 ? -7.303  -4.366  -6.829  1.00 0.00 ? 20  LYS A HD3  8  
ATOM   8326  H  HE2  . LYS A 1 20 ? -7.569  -6.337  -5.536  1.00 0.00 ? 20  LYS A HE2  8  
ATOM   8327  H  HE3  . LYS A 1 20 ? -9.286  -6.440  -5.923  1.00 0.00 ? 20  LYS A HE3  8  
ATOM   8328  H  HZ1  . LYS A 1 20 ? -8.873  -7.322  -7.952  1.00 0.00 ? 20  LYS A HZ1  8  
ATOM   8329  H  HZ2  . LYS A 1 20 ? -7.476  -7.875  -7.174  1.00 0.00 ? 20  LYS A HZ2  8  
ATOM   8330  H  HZ3  . LYS A 1 20 ? -7.408  -6.499  -8.157  1.00 0.00 ? 20  LYS A HZ3  8  
ATOM   8331  N  N    . CYS A 1 21 ? -12.008 -2.126  -4.620  1.00 0.00 ? 21  CYS A N    8  
ATOM   8332  C  CA   . CYS A 1 21 ? -12.966 -2.491  -3.584  1.00 0.00 ? 21  CYS A CA   8  
ATOM   8333  C  C    . CYS A 1 21 ? -14.222 -1.630  -3.677  1.00 0.00 ? 21  CYS A C    8  
ATOM   8334  O  O    . CYS A 1 21 ? -15.184 -1.833  -2.936  1.00 0.00 ? 21  CYS A O    8  
ATOM   8335  C  CB   . CYS A 1 21 ? -12.333 -2.340  -2.199  1.00 0.00 ? 21  CYS A CB   8  
ATOM   8336  S  SG   . CYS A 1 21 ? -11.982 -0.617  -1.725  1.00 0.00 ? 21  CYS A SG   8  
ATOM   8337  H  H    . CYS A 1 21 ? -11.538 -1.267  -4.556  1.00 0.00 ? 21  CYS A H    8  
ATOM   8338  H  HA   . CYS A 1 21 ? -13.240 -3.524  -3.734  1.00 0.00 ? 21  CYS A HA   8  
ATOM   8339  H  HB2  . CYS A 1 21 ? -13.003 -2.754  -1.459  1.00 0.00 ? 21  CYS A HB2  8  
ATOM   8340  H  HB3  . CYS A 1 21 ? -11.400 -2.884  -2.177  1.00 0.00 ? 21  CYS A HB3  8  
ATOM   8341  N  N    . HIS A 1 22 ? -14.207 -0.668  -4.594  1.00 0.00 ? 22  HIS A N    8  
ATOM   8342  C  CA   . HIS A 1 22 ? -15.345 0.224   -4.786  1.00 0.00 ? 22  HIS A CA   8  
ATOM   8343  C  C    . HIS A 1 22 ? -15.677 0.967   -3.495  1.00 0.00 ? 22  HIS A C    8  
ATOM   8344  O  O    . HIS A 1 22 ? -16.818 0.953   -3.036  1.00 0.00 ? 22  HIS A O    8  
ATOM   8345  C  CB   . HIS A 1 22 ? -16.565 -0.566  -5.261  1.00 0.00 ? 22  HIS A CB   8  
ATOM   8346  C  CG   . HIS A 1 22 ? -16.510 -0.939  -6.710  1.00 0.00 ? 22  HIS A CG   8  
ATOM   8347  N  ND1  . HIS A 1 22 ? -16.207 -2.211  -7.150  1.00 0.00 ? 22  HIS A ND1  8  
ATOM   8348  C  CD2  . HIS A 1 22 ? -16.723 -0.199  -7.823  1.00 0.00 ? 22  HIS A CD2  8  
ATOM   8349  C  CE1  . HIS A 1 22 ? -16.235 -2.236  -8.470  1.00 0.00 ? 22  HIS A CE1  8  
ATOM   8350  N  NE2  . HIS A 1 22 ? -16.546 -1.028  -8.904  1.00 0.00 ? 22  HIS A NE2  8  
ATOM   8351  H  H    . HIS A 1 22 ? -13.412 -0.555  -5.155  1.00 0.00 ? 22  HIS A H    8  
ATOM   8352  H  HA   . HIS A 1 22 ? -15.078 0.945   -5.543  1.00 0.00 ? 22  HIS A HA   8  
ATOM   8353  H  HB2  . HIS A 1 22 ? -16.640 -1.478  -4.687  1.00 0.00 ? 22  HIS A HB2  8  
ATOM   8354  H  HB3  . HIS A 1 22 ? -17.454 0.027   -5.103  1.00 0.00 ? 22  HIS A HB3  8  
ATOM   8355  H  HD1  . HIS A 1 22 ? -16.001 -2.979  -6.579  1.00 0.00 ? 22  HIS A HD1  8  
ATOM   8356  H  HD2  . HIS A 1 22 ? -16.984 0.850   -7.857  1.00 0.00 ? 22  HIS A HD2  8  
ATOM   8357  H  HE1  . HIS A 1 22 ? -16.037 -3.098  -9.090  1.00 0.00 ? 22  HIS A HE1  8  
ATOM   8358  N  N    . ALA A 1 23 ? -14.671 1.614   -2.916  1.00 0.00 ? 23  ALA A N    8  
ATOM   8359  C  CA   . ALA A 1 23 ? -14.856 2.363   -1.679  1.00 0.00 ? 23  ALA A CA   8  
ATOM   8360  C  C    . ALA A 1 23 ? -14.133 3.705   -1.737  1.00 0.00 ? 23  ALA A C    8  
ATOM   8361  O  O    . ALA A 1 23 ? -12.994 3.787   -2.197  1.00 0.00 ? 23  ALA A O    8  
ATOM   8362  C  CB   . ALA A 1 23 ? -14.367 1.549   -0.490  1.00 0.00 ? 23  ALA A CB   8  
ATOM   8363  H  H    . ALA A 1 23 ? -13.783 1.587   -3.330  1.00 0.00 ? 23  ALA A H    8  
ATOM   8364  H  HA   . ALA A 1 23 ? -15.914 2.541   -1.552  1.00 0.00 ? 23  ALA A HA   8  
ATOM   8365  H  HB1  . ALA A 1 23 ? -13.318 1.326   -0.615  1.00 0.00 ? 23  ALA A HB1  8  
ATOM   8366  H  HB2  . ALA A 1 23 ? -14.510 2.116   0.417   1.00 0.00 ? 23  ALA A HB2  8  
ATOM   8367  H  HB3  . ALA A 1 23 ? -14.927 0.627   -0.432  1.00 0.00 ? 23  ALA A HB3  8  
ATOM   8368  N  N    . ILE A 1 24 ? -14.802 4.752   -1.268  1.00 0.00 ? 24  ILE A N    8  
ATOM   8369  C  CA   . ILE A 1 24 ? -14.223 6.090   -1.266  1.00 0.00 ? 24  ILE A CA   8  
ATOM   8370  C  C    . ILE A 1 24 ? -12.856 6.096   -0.589  1.00 0.00 ? 24  ILE A C    8  
ATOM   8371  O  O    . ILE A 1 24 ? -12.700 5.586   0.521   1.00 0.00 ? 24  ILE A O    8  
ATOM   8372  C  CB   . ILE A 1 24 ? -15.141 7.100   -0.554  1.00 0.00 ? 24  ILE A CB   8  
ATOM   8373  C  CG1  . ILE A 1 24 ? -16.284 7.524   -1.478  1.00 0.00 ? 24  ILE A CG1  8  
ATOM   8374  C  CG2  . ILE A 1 24 ? -14.342 8.313   -0.100  1.00 0.00 ? 24  ILE A CG2  8  
ATOM   8375  C  CD1  . ILE A 1 24 ? -17.146 8.628   -0.907  1.00 0.00 ? 24  ILE A CD1  8  
ATOM   8376  H  H    . ILE A 1 24 ? -15.707 4.623   -0.914  1.00 0.00 ? 24  ILE A H    8  
ATOM   8377  H  HA   . ILE A 1 24 ? -14.105 6.403   -2.294  1.00 0.00 ? 24  ILE A HA   8  
ATOM   8378  H  HB   . ILE A 1 24 ? -15.553 6.623   0.322   1.00 0.00 ? 24  ILE A HB   8  
ATOM   8379  H  HG12 . ILE A 1 24 ? -15.873 7.875   -2.412  1.00 0.00 ? 24  ILE A HG12 8  
ATOM   8380  H  HG13 . ILE A 1 24 ? -16.919 6.670   -1.668  1.00 0.00 ? 24  ILE A HG13 8  
ATOM   8381  H  HG21 . ILE A 1 24 ? -13.986 8.153   0.907   1.00 0.00 ? 24  ILE A HG21 8  
ATOM   8382  H  HG22 . ILE A 1 24 ? -13.500 8.457   -0.760  1.00 0.00 ? 24  ILE A HG22 8  
ATOM   8383  H  HG23 . ILE A 1 24 ? -14.973 9.189   -0.124  1.00 0.00 ? 24  ILE A HG23 8  
ATOM   8384  H  HD11 . ILE A 1 24 ? -18.173 8.472   -1.202  1.00 0.00 ? 24  ILE A HD11 8  
ATOM   8385  H  HD12 . ILE A 1 24 ? -17.075 8.620   0.170   1.00 0.00 ? 24  ILE A HD12 8  
ATOM   8386  H  HD13 . ILE A 1 24 ? -16.805 9.582   -1.283  1.00 0.00 ? 24  ILE A HD13 8  
ATOM   8387  N  N    . ILE A 1 25 ? -11.870 6.678   -1.264  1.00 0.00 ? 25  ILE A N    8  
ATOM   8388  C  CA   . ILE A 1 25 ? -10.518 6.753   -0.726  1.00 0.00 ? 25  ILE A CA   8  
ATOM   8389  C  C    . ILE A 1 25 ? -10.290 8.071   0.006   1.00 0.00 ? 25  ILE A C    8  
ATOM   8390  O  O    . ILE A 1 25 ? -9.759  9.025   -0.563  1.00 0.00 ? 25  ILE A O    8  
ATOM   8391  C  CB   . ILE A 1 25 ? -9.461  6.606   -1.836  1.00 0.00 ? 25  ILE A CB   8  
ATOM   8392  C  CG1  . ILE A 1 25 ? -9.737  5.353   -2.670  1.00 0.00 ? 25  ILE A CG1  8  
ATOM   8393  C  CG2  . ILE A 1 25 ? -8.065  6.551   -1.235  1.00 0.00 ? 25  ILE A CG2  8  
ATOM   8394  C  CD1  . ILE A 1 25 ? -9.250  5.458   -4.099  1.00 0.00 ? 25  ILE A CD1  8  
ATOM   8395  H  H    . ILE A 1 25 ? -12.057 7.066   -2.144  1.00 0.00 ? 25  ILE A H    8  
ATOM   8396  H  HA   . ILE A 1 25 ? -10.392 5.939   -0.026  1.00 0.00 ? 25  ILE A HA   8  
ATOM   8397  H  HB   . ILE A 1 25 ? -9.518  7.474   -2.474  1.00 0.00 ? 25  ILE A HB   8  
ATOM   8398  H  HG12 . ILE A 1 25 ? -9.246  4.508   -2.214  1.00 0.00 ? 25  ILE A HG12 8  
ATOM   8399  H  HG13 . ILE A 1 25 ? -10.803 5.174   -2.695  1.00 0.00 ? 25  ILE A HG13 8  
ATOM   8400  H  HG21 . ILE A 1 25 ? -8.135  6.599   -0.158  1.00 0.00 ? 25  ILE A HG21 8  
ATOM   8401  H  HG22 . ILE A 1 25 ? -7.585  5.627   -1.523  1.00 0.00 ? 25  ILE A HG22 8  
ATOM   8402  H  HG23 . ILE A 1 25 ? -7.484  7.386   -1.596  1.00 0.00 ? 25  ILE A HG23 8  
ATOM   8403  H  HD11 . ILE A 1 25 ? -8.178  5.326   -4.124  1.00 0.00 ? 25  ILE A HD11 8  
ATOM   8404  H  HD12 . ILE A 1 25 ? -9.722  4.695   -4.698  1.00 0.00 ? 25  ILE A HD12 8  
ATOM   8405  H  HD13 . ILE A 1 25 ? -9.501  6.432   -4.494  1.00 0.00 ? 25  ILE A HD13 8  
ATOM   8406  N  N    . ASP A 1 26 ? -10.692 8.116   1.271   1.00 0.00 ? 26  ASP A N    8  
ATOM   8407  C  CA   . ASP A 1 26 ? -10.530 9.317   2.083   1.00 0.00 ? 26  ASP A CA   8  
ATOM   8408  C  C    . ASP A 1 26 ? -9.123  9.889   1.931   1.00 0.00 ? 26  ASP A C    8  
ATOM   8409  O  O    . ASP A 1 26 ? -8.953  11.068  1.623   1.00 0.00 ? 26  ASP A O    8  
ATOM   8410  C  CB   . ASP A 1 26 ? -10.812 9.006   3.554   1.00 0.00 ? 26  ASP A CB   8  
ATOM   8411  C  CG   . ASP A 1 26 ? -11.908 7.973   3.727   1.00 0.00 ? 26  ASP A CG   8  
ATOM   8412  O  OD1  . ASP A 1 26 ? -11.712 6.820   3.289   1.00 0.00 ? 26  ASP A OD1  8  
ATOM   8413  O  OD2  . ASP A 1 26 ? -12.961 8.318   4.302   1.00 0.00 ? 26  ASP A OD2  8  
ATOM   8414  H  H    . ASP A 1 26 ? -11.109 7.323   1.669   1.00 0.00 ? 26  ASP A H    8  
ATOM   8415  H  HA   . ASP A 1 26 ? -11.242 10.051  1.736   1.00 0.00 ? 26  ASP A HA   8  
ATOM   8416  H  HB2  . ASP A 1 26 ? -9.910  8.628   4.014   1.00 0.00 ? 26  ASP A HB2  8  
ATOM   8417  H  HB3  . ASP A 1 26 ? -11.114 9.914   4.055   1.00 0.00 ? 26  ASP A HB3  8  
ATOM   8418  N  N    . GLU A 1 27 ? -8.120  9.045   2.152   1.00 0.00 ? 27  GLU A N    8  
ATOM   8419  C  CA   . GLU A 1 27 ? -6.729  9.468   2.041   1.00 0.00 ? 27  GLU A CA   8  
ATOM   8420  C  C    . GLU A 1 27 ? -6.290  9.520   0.581   1.00 0.00 ? 27  GLU A C    8  
ATOM   8421  O  O    . GLU A 1 27 ? -7.054  9.173   -0.320  1.00 0.00 ? 27  GLU A O    8  
ATOM   8422  C  CB   . GLU A 1 27 ? -5.820  8.518   2.825   1.00 0.00 ? 27  GLU A CB   8  
ATOM   8423  C  CG   . GLU A 1 27 ? -5.868  7.082   2.329   1.00 0.00 ? 27  GLU A CG   8  
ATOM   8424  C  CD   . GLU A 1 27 ? -4.628  6.294   2.702   1.00 0.00 ? 27  GLU A CD   8  
ATOM   8425  O  OE1  . GLU A 1 27 ? -3.592  6.464   2.025   1.00 0.00 ? 27  GLU A OE1  8  
ATOM   8426  O  OE2  . GLU A 1 27 ? -4.692  5.508   3.669   1.00 0.00 ? 27  GLU A OE2  8  
ATOM   8427  H  H    . GLU A 1 27 ? -8.320  8.117   2.394   1.00 0.00 ? 27  GLU A H    8  
ATOM   8428  H  HA   . GLU A 1 27 ? -6.649  10.458  2.464   1.00 0.00 ? 27  GLU A HA   8  
ATOM   8429  H  HB2  . GLU A 1 27 ? -4.802  8.869   2.749   1.00 0.00 ? 27  GLU A HB2  8  
ATOM   8430  H  HB3  . GLU A 1 27 ? -6.119  8.528   3.862   1.00 0.00 ? 27  GLU A HB3  8  
ATOM   8431  H  HG2  . GLU A 1 27 ? -6.729  6.594   2.761   1.00 0.00 ? 27  GLU A HG2  8  
ATOM   8432  H  HG3  . GLU A 1 27 ? -5.963  7.090   1.253   1.00 0.00 ? 27  GLU A HG3  8  
ATOM   8433  N  N    . GLN A 1 28 ? -5.055  9.956   0.355   1.00 0.00 ? 28  GLN A N    8  
ATOM   8434  C  CA   . GLN A 1 28 ? -4.515  10.054  -0.996  1.00 0.00 ? 28  GLN A CA   8  
ATOM   8435  C  C    . GLN A 1 28 ? -4.737  8.757   -1.767  1.00 0.00 ? 28  GLN A C    8  
ATOM   8436  O  O    . GLN A 1 28 ? -4.175  7.711   -1.444  1.00 0.00 ? 28  GLN A O    8  
ATOM   8437  C  CB   . GLN A 1 28 ? -3.022  10.384  -0.948  1.00 0.00 ? 28  GLN A CB   8  
ATOM   8438  C  CG   . GLN A 1 28 ? -2.426  10.703  -2.310  1.00 0.00 ? 28  GLN A CG   8  
ATOM   8439  C  CD   . GLN A 1 28 ? -2.519  12.176  -2.656  1.00 0.00 ? 28  GLN A CD   8  
ATOM   8440  O  OE1  . GLN A 1 28 ? -3.582  12.787  -2.543  1.00 0.00 ? 28  GLN A OE1  8  
ATOM   8441  N  NE2  . GLN A 1 28 ? -1.402  12.756  -3.082  1.00 0.00 ? 28  GLN A NE2  8  
ATOM   8442  H  H    . GLN A 1 28 ? -4.494  10.217  1.114   1.00 0.00 ? 28  GLN A H    8  
ATOM   8443  H  HA   . GLN A 1 28 ? -5.035  10.853  -1.503  1.00 0.00 ? 28  GLN A HA   8  
ATOM   8444  H  HB2  . GLN A 1 28 ? -2.875  11.238  -0.305  1.00 0.00 ? 28  GLN A HB2  8  
ATOM   8445  H  HB3  . GLN A 1 28 ? -2.492  9.538   -0.537  1.00 0.00 ? 28  GLN A HB3  8  
ATOM   8446  H  HG2  . GLN A 1 28 ? -1.385  10.415  -2.309  1.00 0.00 ? 28  GLN A HG2  8  
ATOM   8447  H  HG3  . GLN A 1 28 ? -2.955  10.137  -3.062  1.00 0.00 ? 28  GLN A HG3  8  
ATOM   8448  H  HE21 . GLN A 1 28 ? -0.593  12.207  -3.148  1.00 0.00 ? 28  GLN A HE21 8  
ATOM   8449  H  HE22 . GLN A 1 28 ? -1.434  13.707  -3.314  1.00 0.00 ? 28  GLN A HE22 8  
ATOM   8450  N  N    . PRO A 1 29 ? -5.577  8.825   -2.811  1.00 0.00 ? 29  PRO A N    8  
ATOM   8451  C  CA   . PRO A 1 29 ? -5.893  7.665   -3.650  1.00 0.00 ? 29  PRO A CA   8  
ATOM   8452  C  C    . PRO A 1 29 ? -4.708  7.229   -4.505  1.00 0.00 ? 29  PRO A C    8  
ATOM   8453  O  O    . PRO A 1 29 ? -4.118  8.037   -5.224  1.00 0.00 ? 29  PRO A O    8  
ATOM   8454  C  CB   . PRO A 1 29 ? -7.036  8.168   -4.535  1.00 0.00 ? 29  PRO A CB   8  
ATOM   8455  C  CG   . PRO A 1 29 ? -6.852  9.646   -4.587  1.00 0.00 ? 29  PRO A CG   8  
ATOM   8456  C  CD   . PRO A 1 29 ? -6.283  10.040  -3.252  1.00 0.00 ? 29  PRO A CD   8  
ATOM   8457  H  HA   . PRO A 1 29 ? -6.235  6.829   -3.058  1.00 0.00 ? 29  PRO A HA   8  
ATOM   8458  H  HB2  . PRO A 1 29 ? -6.956  7.724   -5.517  1.00 0.00 ? 29  PRO A HB2  8  
ATOM   8459  H  HB3  . PRO A 1 29 ? -7.983  7.904   -4.090  1.00 0.00 ? 29  PRO A HB3  8  
ATOM   8460  H  HG2  . PRO A 1 29 ? -6.165  9.903   -5.379  1.00 0.00 ? 29  PRO A HG2  8  
ATOM   8461  H  HG3  . PRO A 1 29 ? -7.806  10.128  -4.744  1.00 0.00 ? 29  PRO A HG3  8  
ATOM   8462  H  HD2  . PRO A 1 29 ? -5.596  10.866  -3.364  1.00 0.00 ? 29  PRO A HD2  8  
ATOM   8463  H  HD3  . PRO A 1 29 ? -7.075  10.296  -2.565  1.00 0.00 ? 29  PRO A HD3  8  
ATOM   8464  N  N    . LEU A 1 30 ? -4.365  5.949   -4.424  1.00 0.00 ? 30  LEU A N    8  
ATOM   8465  C  CA   . LEU A 1 30 ? -3.251  5.405   -5.192  1.00 0.00 ? 30  LEU A CA   8  
ATOM   8466  C  C    . LEU A 1 30 ? -3.634  5.231   -6.659  1.00 0.00 ? 30  LEU A C    8  
ATOM   8467  O  O    . LEU A 1 30 ? -4.414  4.344   -7.006  1.00 0.00 ? 30  LEU A O    8  
ATOM   8468  C  CB   . LEU A 1 30 ? -2.808  4.063   -4.607  1.00 0.00 ? 30  LEU A CB   8  
ATOM   8469  C  CG   . LEU A 1 30 ? -2.049  3.134   -5.555  1.00 0.00 ? 30  LEU A CG   8  
ATOM   8470  C  CD1  . LEU A 1 30 ? -0.625  3.625   -5.757  1.00 0.00 ? 30  LEU A CD1  8  
ATOM   8471  C  CD2  . LEU A 1 30 ? -2.053  1.709   -5.022  1.00 0.00 ? 30  LEU A CD2  8  
ATOM   8472  H  H    . LEU A 1 30 ? -4.873  5.354   -3.834  1.00 0.00 ? 30  LEU A H    8  
ATOM   8473  H  HA   . LEU A 1 30 ? -2.431  6.105   -5.127  1.00 0.00 ? 30  LEU A HA   8  
ATOM   8474  H  HB2  . LEU A 1 30 ? -2.169  4.266   -3.761  1.00 0.00 ? 30  LEU A HB2  8  
ATOM   8475  H  HB3  . LEU A 1 30 ? -3.694  3.542   -4.270  1.00 0.00 ? 30  LEU A HB3  8  
ATOM   8476  H  HG   . LEU A 1 30 ? -2.541  3.133   -6.518  1.00 0.00 ? 30  LEU A HG   8  
ATOM   8477  H  HD11 . LEU A 1 30 ? -0.227  3.973   -4.815  1.00 0.00 ? 30  LEU A HD11 8  
ATOM   8478  H  HD12 . LEU A 1 30 ? -0.621  4.436   -6.470  1.00 0.00 ? 30  LEU A HD12 8  
ATOM   8479  H  HD13 . LEU A 1 30 ? -0.014  2.816   -6.130  1.00 0.00 ? 30  LEU A HD13 8  
ATOM   8480  H  HD21 . LEU A 1 30 ? -1.039  1.399   -4.816  1.00 0.00 ? 30  LEU A HD21 8  
ATOM   8481  H  HD22 . LEU A 1 30 ? -2.488  1.050   -5.759  1.00 0.00 ? 30  LEU A HD22 8  
ATOM   8482  H  HD23 . LEU A 1 30 ? -2.634  1.666   -4.113  1.00 0.00 ? 30  LEU A HD23 8  
ATOM   8483  N  N    . ILE A 1 31 ? -3.077  6.081   -7.515  1.00 0.00 ? 31  ILE A N    8  
ATOM   8484  C  CA   . ILE A 1 31 ? -3.358  6.019   -8.944  1.00 0.00 ? 31  ILE A CA   8  
ATOM   8485  C  C    . ILE A 1 31 ? -2.553  4.911   -9.614  1.00 0.00 ? 31  ILE A C    8  
ATOM   8486  O  O    . ILE A 1 31 ? -1.398  4.668   -9.263  1.00 0.00 ? 31  ILE A O    8  
ATOM   8487  C  CB   . ILE A 1 31 ? -3.044  7.358   -9.638  1.00 0.00 ? 31  ILE A CB   8  
ATOM   8488  C  CG1  . ILE A 1 31 ? -3.923  8.472   -9.065  1.00 0.00 ? 31  ILE A CG1  8  
ATOM   8489  C  CG2  . ILE A 1 31 ? -3.248  7.236   -11.141 1.00 0.00 ? 31  ILE A CG2  8  
ATOM   8490  C  CD1  . ILE A 1 31 ? -5.405  8.191   -9.177  1.00 0.00 ? 31  ILE A CD1  8  
ATOM   8491  H  H    . ILE A 1 31 ? -2.463  6.766   -7.178  1.00 0.00 ? 31  ILE A H    8  
ATOM   8492  H  HA   . ILE A 1 31 ? -4.410  5.810   -9.068  1.00 0.00 ? 31  ILE A HA   8  
ATOM   8493  H  HB   . ILE A 1 31 ? -2.008  7.598   -9.457  1.00 0.00 ? 31  ILE A HB   8  
ATOM   8494  H  HG12 . ILE A 1 31 ? -3.689  8.605   -8.020  1.00 0.00 ? 31  ILE A HG12 8  
ATOM   8495  H  HG13 . ILE A 1 31 ? -3.717  9.391   -9.595  1.00 0.00 ? 31  ILE A HG13 8  
ATOM   8496  H  HG21 . ILE A 1 31 ? -3.097  8.200   -11.604 1.00 0.00 ? 31  ILE A HG21 8  
ATOM   8497  H  HG22 . ILE A 1 31 ? -2.538  6.529   -11.543 1.00 0.00 ? 31  ILE A HG22 8  
ATOM   8498  H  HG23 . ILE A 1 31 ? -4.252  6.893   -11.342 1.00 0.00 ? 31  ILE A HG23 8  
ATOM   8499  H  HD11 . ILE A 1 31 ? -5.655  7.982   -10.207 1.00 0.00 ? 31  ILE A HD11 8  
ATOM   8500  H  HD12 . ILE A 1 31 ? -5.658  7.340   -8.564  1.00 0.00 ? 31  ILE A HD12 8  
ATOM   8501  H  HD13 . ILE A 1 31 ? -5.961  9.055   -8.841  1.00 0.00 ? 31  ILE A HD13 8  
ATOM   8502  N  N    . PHE A 1 32 ? -3.169  4.243   -10.583 1.00 0.00 ? 32  PHE A N    8  
ATOM   8503  C  CA   . PHE A 1 32 ? -2.510  3.160   -11.305 1.00 0.00 ? 32  PHE A CA   8  
ATOM   8504  C  C    . PHE A 1 32 ? -3.229  2.865   -12.618 1.00 0.00 ? 32  PHE A C    8  
ATOM   8505  O  O    . PHE A 1 32 ? -4.367  2.394   -12.624 1.00 0.00 ? 32  PHE A O    8  
ATOM   8506  C  CB   . PHE A 1 32 ? -2.463  1.898   -10.441 1.00 0.00 ? 32  PHE A CB   8  
ATOM   8507  C  CG   . PHE A 1 32 ? -1.759  0.747   -11.101 1.00 0.00 ? 32  PHE A CG   8  
ATOM   8508  C  CD1  . PHE A 1 32 ? -0.376  0.721   -11.188 1.00 0.00 ? 32  PHE A CD1  8  
ATOM   8509  C  CD2  . PHE A 1 32 ? -2.479  -0.310  -11.633 1.00 0.00 ? 32  PHE A CD2  8  
ATOM   8510  C  CE1  . PHE A 1 32 ? 0.274   -0.337  -11.795 1.00 0.00 ? 32  PHE A CE1  8  
ATOM   8511  C  CE2  . PHE A 1 32 ? -1.835  -1.371  -12.241 1.00 0.00 ? 32  PHE A CE2  8  
ATOM   8512  C  CZ   . PHE A 1 32 ? -0.456  -1.384  -12.321 1.00 0.00 ? 32  PHE A CZ   8  
ATOM   8513  H  H    . PHE A 1 32 ? -4.091  4.483   -10.818 1.00 0.00 ? 32  PHE A H    8  
ATOM   8514  H  HA   . PHE A 1 32 ? -1.502  3.475   -11.523 1.00 0.00 ? 32  PHE A HA   8  
ATOM   8515  H  HB2  . PHE A 1 32 ? -1.944  2.120   -9.521  1.00 0.00 ? 32  PHE A HB2  8  
ATOM   8516  H  HB3  . PHE A 1 32 ? -3.471  1.587   -10.216 1.00 0.00 ? 32  PHE A HB3  8  
ATOM   8517  H  HD1  . PHE A 1 32 ? 0.197   1.539   -10.776 1.00 0.00 ? 32  PHE A HD1  8  
ATOM   8518  H  HD2  . PHE A 1 32 ? -3.558  -0.300  -11.571 1.00 0.00 ? 32  PHE A HD2  8  
ATOM   8519  H  HE1  . PHE A 1 32 ? 1.352   -0.345  -11.856 1.00 0.00 ? 32  PHE A HE1  8  
ATOM   8520  H  HE2  . PHE A 1 32 ? -2.409  -2.188  -12.652 1.00 0.00 ? 32  PHE A HE2  8  
ATOM   8521  H  HZ   . PHE A 1 32 ? 0.050   -2.212  -12.796 1.00 0.00 ? 32  PHE A HZ   8  
ATOM   8522  N  N    . LYS A 1 33 ? -2.557  3.146   -13.729 1.00 0.00 ? 33  LYS A N    8  
ATOM   8523  C  CA   . LYS A 1 33 ? -3.129  2.911   -15.050 1.00 0.00 ? 33  LYS A CA   8  
ATOM   8524  C  C    . LYS A 1 33 ? -4.352  3.793   -15.278 1.00 0.00 ? 33  LYS A C    8  
ATOM   8525  O  O    . LYS A 1 33 ? -5.347  3.354   -15.853 1.00 0.00 ? 33  LYS A O    8  
ATOM   8526  C  CB   . LYS A 1 33 ? -3.514  1.438   -15.207 1.00 0.00 ? 33  LYS A CB   8  
ATOM   8527  C  CG   . LYS A 1 33 ? -2.347  0.482   -15.028 1.00 0.00 ? 33  LYS A CG   8  
ATOM   8528  C  CD   . LYS A 1 33 ? -2.577  -0.824  -15.769 1.00 0.00 ? 33  LYS A CD   8  
ATOM   8529  C  CE   . LYS A 1 33 ? -1.372  -1.746  -15.661 1.00 0.00 ? 33  LYS A CE   8  
ATOM   8530  N  NZ   . LYS A 1 33 ? -1.744  -3.172  -15.876 1.00 0.00 ? 33  LYS A NZ   8  
ATOM   8531  H  H    . LYS A 1 33 ? -1.654  3.520   -13.660 1.00 0.00 ? 33  LYS A H    8  
ATOM   8532  H  HA   . LYS A 1 33 ? -2.379  3.159   -15.785 1.00 0.00 ? 33  LYS A HA   8  
ATOM   8533  H  HB2  . LYS A 1 33 ? -4.267  1.194   -14.472 1.00 0.00 ? 33  LYS A HB2  8  
ATOM   8534  H  HB3  . LYS A 1 33 ? -3.925  1.289   -16.195 1.00 0.00 ? 33  LYS A HB3  8  
ATOM   8535  H  HG2  . LYS A 1 33 ? -1.450  0.947   -15.411 1.00 0.00 ? 33  LYS A HG2  8  
ATOM   8536  H  HG3  . LYS A 1 33 ? -2.224  0.272   -13.975 1.00 0.00 ? 33  LYS A HG3  8  
ATOM   8537  H  HD2  . LYS A 1 33 ? -3.436  -1.322  -15.344 1.00 0.00 ? 33  LYS A HD2  8  
ATOM   8538  H  HD3  . LYS A 1 33 ? -2.762  -0.609  -16.811 1.00 0.00 ? 33  LYS A HD3  8  
ATOM   8539  H  HE2  . LYS A 1 33 ? -0.646  -1.456  -16.404 1.00 0.00 ? 33  LYS A HE2  8  
ATOM   8540  H  HE3  . LYS A 1 33 ? -0.941  -1.640  -14.676 1.00 0.00 ? 33  LYS A HE3  8  
ATOM   8541  H  HZ1  . LYS A 1 33 ? -1.140  -3.591  -16.612 1.00 0.00 ? 33  LYS A HZ1  8  
ATOM   8542  H  HZ2  . LYS A 1 33 ? -2.737  -3.241  -16.177 1.00 0.00 ? 33  LYS A HZ2  8  
ATOM   8543  H  HZ3  . LYS A 1 33 ? -1.621  -3.710  -14.994 1.00 0.00 ? 33  LYS A HZ3  8  
ATOM   8544  N  N    . ASN A 1 34 ? -4.270  5.040   -14.825 1.00 0.00 ? 34  ASN A N    8  
ATOM   8545  C  CA   . ASN A 1 34 ? -5.370  5.984   -14.981 1.00 0.00 ? 34  ASN A CA   8  
ATOM   8546  C  C    . ASN A 1 34 ? -6.610  5.503   -14.234 1.00 0.00 ? 34  ASN A C    8  
ATOM   8547  O  O    . ASN A 1 34 ? -7.709  5.474   -14.788 1.00 0.00 ? 34  ASN A O    8  
ATOM   8548  C  CB   . ASN A 1 34 ? -5.697  6.178   -16.463 1.00 0.00 ? 34  ASN A CB   8  
ATOM   8549  C  CG   . ASN A 1 34 ? -4.622  6.958   -17.195 1.00 0.00 ? 34  ASN A CG   8  
ATOM   8550  O  OD1  . ASN A 1 34 ? -4.810  8.125   -17.538 1.00 0.00 ? 34  ASN A OD1  8  
ATOM   8551  N  ND2  . ASN A 1 34 ? -3.486  6.314   -17.438 1.00 0.00 ? 34  ASN A ND2  8  
ATOM   8552  H  H    . ASN A 1 34 ? -3.450  5.332   -14.375 1.00 0.00 ? 34  ASN A H    8  
ATOM   8553  H  HA   . ASN A 1 34 ? -5.057  6.930   -14.564 1.00 0.00 ? 34  ASN A HA   8  
ATOM   8554  H  HB2  . ASN A 1 34 ? -5.796  5.211   -16.933 1.00 0.00 ? 34  ASN A HB2  8  
ATOM   8555  H  HB3  . ASN A 1 34 ? -6.630  6.715   -16.553 1.00 0.00 ? 34  ASN A HB3  8  
ATOM   8556  H  HD21 . ASN A 1 34 ? -3.406  5.385   -17.135 1.00 0.00 ? 34  ASN A HD21 8  
ATOM   8557  H  HD22 . ASN A 1 34 ? -2.774  6.794   -17.909 1.00 0.00 ? 34  ASN A HD22 8  
ATOM   8558  N  N    . ASP A 1 35 ? -6.425  5.128   -12.973 1.00 0.00 ? 35  ASP A N    8  
ATOM   8559  C  CA   . ASP A 1 35 ? -7.529  4.649   -12.148 1.00 0.00 ? 35  ASP A CA   8  
ATOM   8560  C  C    . ASP A 1 35 ? -7.162  4.697   -10.668 1.00 0.00 ? 35  ASP A C    8  
ATOM   8561  O  O    . ASP A 1 35 ? -6.053  4.343   -10.267 1.00 0.00 ? 35  ASP A O    8  
ATOM   8562  C  CB   . ASP A 1 35 ? -7.910  3.223   -12.546 1.00 0.00 ? 35  ASP A CB   8  
ATOM   8563  C  CG   . ASP A 1 35 ? -8.259  3.106   -14.017 1.00 0.00 ? 35  ASP A CG   8  
ATOM   8564  O  OD1  . ASP A 1 35 ? -9.311  3.644   -14.421 1.00 0.00 ? 35  ASP A OD1  8  
ATOM   8565  O  OD2  . ASP A 1 35 ? -7.481  2.475   -14.763 1.00 0.00 ? 35  ASP A OD2  8  
ATOM   8566  H  H    . ASP A 1 35 ? -5.525  5.174   -12.587 1.00 0.00 ? 35  ASP A H    8  
ATOM   8567  H  HA   . ASP A 1 35 ? -8.375  5.298   -12.317 1.00 0.00 ? 35  ASP A HA   8  
ATOM   8568  H  HB2  . ASP A 1 35 ? -7.079  2.564   -12.339 1.00 0.00 ? 35  ASP A HB2  8  
ATOM   8569  H  HB3  . ASP A 1 35 ? -8.765  2.910   -11.966 1.00 0.00 ? 35  ASP A HB3  8  
ATOM   8570  N  N    . PRO A 1 36 ? -8.114  5.145   -9.836  1.00 0.00 ? 36  PRO A N    8  
ATOM   8571  C  CA   . PRO A 1 36 ? -7.914  5.250   -8.388  1.00 0.00 ? 36  PRO A CA   8  
ATOM   8572  C  C    . PRO A 1 36 ? -7.830  3.885   -7.714  1.00 0.00 ? 36  PRO A C    8  
ATOM   8573  O  O    . PRO A 1 36 ? -8.419  2.912   -8.185  1.00 0.00 ? 36  PRO A O    8  
ATOM   8574  C  CB   . PRO A 1 36 ? -9.157  6.006   -7.912  1.00 0.00 ? 36  PRO A CB   8  
ATOM   8575  C  CG   . PRO A 1 36 ? -10.194 5.715   -8.941  1.00 0.00 ? 36  PRO A CG   8  
ATOM   8576  C  CD   . PRO A 1 36 ? -9.459  5.584   -10.245 1.00 0.00 ? 36  PRO A CD   8  
ATOM   8577  H  HA   . PRO A 1 36 ? -7.029  5.823   -8.150  1.00 0.00 ? 36  PRO A HA   8  
ATOM   8578  H  HB2  . PRO A 1 36 ? -9.451  5.642   -6.938  1.00 0.00 ? 36  PRO A HB2  8  
ATOM   8579  H  HB3  . PRO A 1 36 ? -8.941  7.063   -7.858  1.00 0.00 ? 36  PRO A HB3  8  
ATOM   8580  H  HG2  . PRO A 1 36 ? -10.700 4.792   -8.701  1.00 0.00 ? 36  PRO A HG2  8  
ATOM   8581  H  HG3  . PRO A 1 36 ? -10.901 6.530   -8.989  1.00 0.00 ? 36  PRO A HG3  8  
ATOM   8582  H  HD2  . PRO A 1 36 ? -9.932  4.843   -10.873 1.00 0.00 ? 36  PRO A HD2  8  
ATOM   8583  H  HD3  . PRO A 1 36 ? -9.415  6.537   -10.751 1.00 0.00 ? 36  PRO A HD3  8  
ATOM   8584  N  N    . TYR A 1 37 ? -7.096  3.820   -6.609  1.00 0.00 ? 37  TYR A N    8  
ATOM   8585  C  CA   . TYR A 1 37 ? -6.933  2.573   -5.871  1.00 0.00 ? 37  TYR A CA   8  
ATOM   8586  C  C    . TYR A 1 37 ? -6.422  2.839   -4.458  1.00 0.00 ? 37  TYR A C    8  
ATOM   8587  O  O    . TYR A 1 37 ? -6.000  3.950   -4.137  1.00 0.00 ? 37  TYR A O    8  
ATOM   8588  C  CB   . TYR A 1 37 ? -5.969  1.642   -6.607  1.00 0.00 ? 37  TYR A CB   8  
ATOM   8589  C  CG   . TYR A 1 37 ? -6.481  1.183   -7.954  1.00 0.00 ? 37  TYR A CG   8  
ATOM   8590  C  CD1  . TYR A 1 37 ? -7.595  0.358   -8.051  1.00 0.00 ? 37  TYR A CD1  8  
ATOM   8591  C  CD2  . TYR A 1 37 ? -5.851  1.574   -9.129  1.00 0.00 ? 37  TYR A CD2  8  
ATOM   8592  C  CE1  . TYR A 1 37 ? -8.066  -0.064  -9.279  1.00 0.00 ? 37  TYR A CE1  8  
ATOM   8593  C  CE2  . TYR A 1 37 ? -6.316  1.158   -10.361 1.00 0.00 ? 37  TYR A CE2  8  
ATOM   8594  C  CZ   . TYR A 1 37 ? -7.423  0.338   -10.432 1.00 0.00 ? 37  TYR A CZ   8  
ATOM   8595  O  OH   . TYR A 1 37 ? -7.890  -0.079  -11.657 1.00 0.00 ? 37  TYR A OH   8  
ATOM   8596  H  H    . TYR A 1 37 ? -6.650  4.630   -6.282  1.00 0.00 ? 37  TYR A H    8  
ATOM   8597  H  HA   . TYR A 1 37 ? -7.901  2.097   -5.808  1.00 0.00 ? 37  TYR A HA   8  
ATOM   8598  H  HB2  . TYR A 1 37 ? -5.034  2.156   -6.767  1.00 0.00 ? 37  TYR A HB2  8  
ATOM   8599  H  HB3  . TYR A 1 37 ? -5.794  0.765   -6.002  1.00 0.00 ? 37  TYR A HB3  8  
ATOM   8600  H  HD1  . TYR A 1 37 ? -8.097  0.045   -7.147  1.00 0.00 ? 37  TYR A HD1  8  
ATOM   8601  H  HD2  . TYR A 1 37 ? -4.984  2.216   -9.071  1.00 0.00 ? 37  TYR A HD2  8  
ATOM   8602  H  HE1  . TYR A 1 37 ? -8.933  -0.706  -9.335  1.00 0.00 ? 37  TYR A HE1  8  
ATOM   8603  H  HE2  . TYR A 1 37 ? -5.813  1.473   -11.264 1.00 0.00 ? 37  TYR A HE2  8  
ATOM   8604  H  HH   . TYR A 1 37 ? -8.245  0.672   -12.137 1.00 0.00 ? 37  TYR A HH   8  
ATOM   8605  N  N    . HIS A 1 38 ? -6.463  1.810   -3.618  1.00 0.00 ? 38  HIS A N    8  
ATOM   8606  C  CA   . HIS A 1 38 ? -6.003  1.930   -2.239  1.00 0.00 ? 38  HIS A CA   8  
ATOM   8607  C  C    . HIS A 1 38 ? -4.537  1.524   -2.118  1.00 0.00 ? 38  HIS A C    8  
ATOM   8608  O  O    . HIS A 1 38 ? -4.126  0.452   -2.563  1.00 0.00 ? 38  HIS A O    8  
ATOM   8609  C  CB   . HIS A 1 38 ? -6.861  1.065   -1.315  1.00 0.00 ? 38  HIS A CB   8  
ATOM   8610  C  CG   . HIS A 1 38 ? -8.147  1.717   -0.910  1.00 0.00 ? 38  HIS A CG   8  
ATOM   8611  N  ND1  . HIS A 1 38 ? -9.386  1.198   -1.224  1.00 0.00 ? 38  HIS A ND1  8  
ATOM   8612  C  CD2  . HIS A 1 38 ? -8.383  2.851   -0.209  1.00 0.00 ? 38  HIS A CD2  8  
ATOM   8613  C  CE1  . HIS A 1 38 ? -10.327 1.986   -0.736  1.00 0.00 ? 38  HIS A CE1  8  
ATOM   8614  N  NE2  . HIS A 1 38 ? -9.745  2.996   -0.115  1.00 0.00 ? 38  HIS A NE2  8  
ATOM   8615  H  H    . HIS A 1 38 ? -6.810  0.949   -3.933  1.00 0.00 ? 38  HIS A H    8  
ATOM   8616  H  HA   . HIS A 1 38 ? -6.102  2.964   -1.945  1.00 0.00 ? 38  HIS A HA   8  
ATOM   8617  H  HB2  . HIS A 1 38 ? -7.103  0.141   -1.820  1.00 0.00 ? 38  HIS A HB2  8  
ATOM   8618  H  HB3  . HIS A 1 38 ? -6.302  0.844   -0.417  1.00 0.00 ? 38  HIS A HB3  8  
ATOM   8619  H  HD2  . HIS A 1 38 ? -7.638  3.518   0.201   1.00 0.00 ? 38  HIS A HD2  8  
ATOM   8620  H  HE1  . HIS A 1 38 ? -11.392 1.831   -0.828  1.00 0.00 ? 38  HIS A HE1  8  
ATOM   8621  H  HE2  . HIS A 1 38 ? -10.211 3.770   0.263   1.00 0.00 ? 38  HIS A HE2  8  
ATOM   8622  N  N    . PRO A 1 39 ? -3.728  2.399   -1.502  1.00 0.00 ? 39  PRO A N    8  
ATOM   8623  C  CA   . PRO A 1 39 ? -2.296  2.153   -1.309  1.00 0.00 ? 39  PRO A CA   8  
ATOM   8624  C  C    . PRO A 1 39 ? -2.030  1.045   -0.296  1.00 0.00 ? 39  PRO A C    8  
ATOM   8625  O  O    . PRO A 1 39 ? -0.879  0.750   0.027   1.00 0.00 ? 39  PRO A O    8  
ATOM   8626  C  CB   . PRO A 1 39 ? -1.774  3.493   -0.785  1.00 0.00 ? 39  PRO A CB   8  
ATOM   8627  C  CG   . PRO A 1 39 ? -2.956  4.137   -0.146  1.00 0.00 ? 39  PRO A CG   8  
ATOM   8628  C  CD   . PRO A 1 39 ? -4.150  3.696   -0.946  1.00 0.00 ? 39  PRO A CD   8  
ATOM   8629  H  HA   . PRO A 1 39 ? -1.806  1.913   -2.241  1.00 0.00 ? 39  PRO A HA   8  
ATOM   8630  H  HB2  . PRO A 1 39 ? -0.983  3.319   -0.069  1.00 0.00 ? 39  PRO A HB2  8  
ATOM   8631  H  HB3  . PRO A 1 39 ? -1.399  4.084   -1.607  1.00 0.00 ? 39  PRO A HB3  8  
ATOM   8632  H  HG2  . PRO A 1 39 ? -3.047  3.806   0.877   1.00 0.00 ? 39  PRO A HG2  8  
ATOM   8633  H  HG3  . PRO A 1 39 ? -2.855  5.212   -0.187  1.00 0.00 ? 39  PRO A HG3  8  
ATOM   8634  H  HD2  . PRO A 1 39 ? -5.012  3.579   -0.306  1.00 0.00 ? 39  PRO A HD2  8  
ATOM   8635  H  HD3  . PRO A 1 39 ? -4.358  4.403   -1.736  1.00 0.00 ? 39  PRO A HD3  8  
ATOM   8636  N  N    . ASP A 1 40 ? -3.100  0.434   0.201   1.00 0.00 ? 40  ASP A N    8  
ATOM   8637  C  CA   . ASP A 1 40 ? -2.981  -0.643  1.176   1.00 0.00 ? 40  ASP A CA   8  
ATOM   8638  C  C    . ASP A 1 40 ? -3.286  -1.993  0.535   1.00 0.00 ? 40  ASP A C    8  
ATOM   8639  O  O    . ASP A 1 40 ? -2.976  -3.044  1.097   1.00 0.00 ? 40  ASP A O    8  
ATOM   8640  C  CB   . ASP A 1 40 ? -3.925  -0.399  2.355   1.00 0.00 ? 40  ASP A CB   8  
ATOM   8641  C  CG   . ASP A 1 40 ? -3.426  -1.035  3.637   1.00 0.00 ? 40  ASP A CG   8  
ATOM   8642  O  OD1  . ASP A 1 40 ? -3.270  -2.274  3.664   1.00 0.00 ? 40  ASP A OD1  8  
ATOM   8643  O  OD2  . ASP A 1 40 ? -3.191  -0.294  4.614   1.00 0.00 ? 40  ASP A OD2  8  
ATOM   8644  H  H    . ASP A 1 40 ? -3.991  0.714   -0.096  1.00 0.00 ? 40  ASP A H    8  
ATOM   8645  H  HA   . ASP A 1 40 ? -1.964  -0.653  1.538   1.00 0.00 ? 40  ASP A HA   8  
ATOM   8646  H  HB2  . ASP A 1 40 ? -4.022  0.664   2.516   1.00 0.00 ? 40  ASP A HB2  8  
ATOM   8647  H  HB3  . ASP A 1 40 ? -4.895  -0.814  2.122   1.00 0.00 ? 40  ASP A HB3  8  
ATOM   8648  N  N    . HIS A 1 41 ? -3.898  -1.957  -0.645  1.00 0.00 ? 41  HIS A N    8  
ATOM   8649  C  CA   . HIS A 1 41 ? -4.246  -3.178  -1.363  1.00 0.00 ? 41  HIS A CA   8  
ATOM   8650  C  C    . HIS A 1 41 ? -2.997  -3.857  -1.917  1.00 0.00 ? 41  HIS A C    8  
ATOM   8651  O  O    . HIS A 1 41 ? -2.829  -5.070  -1.790  1.00 0.00 ? 41  HIS A O    8  
ATOM   8652  C  CB   . HIS A 1 41 ? -5.218  -2.866  -2.502  1.00 0.00 ? 41  HIS A CB   8  
ATOM   8653  C  CG   . HIS A 1 41 ? -6.633  -2.680  -2.047  1.00 0.00 ? 41  HIS A CG   8  
ATOM   8654  N  ND1  . HIS A 1 41 ? -7.107  -3.166  -0.847  1.00 0.00 ? 41  HIS A ND1  8  
ATOM   8655  C  CD2  . HIS A 1 41 ? -7.678  -2.056  -2.638  1.00 0.00 ? 41  HIS A CD2  8  
ATOM   8656  C  CE1  . HIS A 1 41 ? -8.384  -2.850  -0.720  1.00 0.00 ? 41  HIS A CE1  8  
ATOM   8657  N  NE2  . HIS A 1 41 ? -8.754  -2.176  -1.794  1.00 0.00 ? 41  HIS A NE2  8  
ATOM   8658  H  H    . HIS A 1 41 ? -4.119  -1.089  -1.042  1.00 0.00 ? 41  HIS A H    8  
ATOM   8659  H  HA   . HIS A 1 41 ? -4.725  -3.848  -0.666  1.00 0.00 ? 41  HIS A HA   8  
ATOM   8660  H  HB2  . HIS A 1 41 ? -4.906  -1.956  -2.993  1.00 0.00 ? 41  HIS A HB2  8  
ATOM   8661  H  HB3  . HIS A 1 41 ? -5.201  -3.678  -3.214  1.00 0.00 ? 41  HIS A HB3  8  
ATOM   8662  H  HD1  . HIS A 1 41 ? -6.586  -3.668  -0.187  1.00 0.00 ? 41  HIS A HD1  8  
ATOM   8663  H  HD2  . HIS A 1 41 ? -7.668  -1.557  -3.597  1.00 0.00 ? 41  HIS A HD2  8  
ATOM   8664  H  HE1  . HIS A 1 41 ? -9.017  -3.099  0.118   1.00 0.00 ? 41  HIS A HE1  8  
ATOM   8665  N  N    . PHE A 1 42 ? -2.123  -3.068  -2.533  1.00 0.00 ? 42  PHE A N    8  
ATOM   8666  C  CA   . PHE A 1 42 ? -0.890  -3.593  -3.108  1.00 0.00 ? 42  PHE A CA   8  
ATOM   8667  C  C    . PHE A 1 42 ? 0.275   -3.431  -2.136  1.00 0.00 ? 42  PHE A C    8  
ATOM   8668  O  O    . PHE A 1 42 ? 0.260   -2.555  -1.273  1.00 0.00 ? 42  PHE A O    8  
ATOM   8669  C  CB   . PHE A 1 42 ? -0.573  -2.882  -4.425  1.00 0.00 ? 42  PHE A CB   8  
ATOM   8670  C  CG   . PHE A 1 42 ? -1.782  -2.648  -5.286  1.00 0.00 ? 42  PHE A CG   8  
ATOM   8671  C  CD1  . PHE A 1 42 ? -2.252  -3.643  -6.128  1.00 0.00 ? 42  PHE A CD1  8  
ATOM   8672  C  CD2  . PHE A 1 42 ? -2.448  -1.434  -5.253  1.00 0.00 ? 42  PHE A CD2  8  
ATOM   8673  C  CE1  . PHE A 1 42 ? -3.364  -3.431  -6.922  1.00 0.00 ? 42  PHE A CE1  8  
ATOM   8674  C  CE2  . PHE A 1 42 ? -3.560  -1.216  -6.044  1.00 0.00 ? 42  PHE A CE2  8  
ATOM   8675  C  CZ   . PHE A 1 42 ? -4.018  -2.216  -6.880  1.00 0.00 ? 42  PHE A CZ   8  
ATOM   8676  H  H    . PHE A 1 42 ? -2.313  -2.108  -2.603  1.00 0.00 ? 42  PHE A H    8  
ATOM   8677  H  HA   . PHE A 1 42 ? -1.038  -4.644  -3.302  1.00 0.00 ? 42  PHE A HA   8  
ATOM   8678  H  HB2  . PHE A 1 42 ? -0.129  -1.922  -4.210  1.00 0.00 ? 42  PHE A HB2  8  
ATOM   8679  H  HB3  . PHE A 1 42 ? 0.127   -3.480  -4.989  1.00 0.00 ? 42  PHE A HB3  8  
ATOM   8680  H  HD1  . PHE A 1 42 ? -1.740  -4.595  -6.162  1.00 0.00 ? 42  PHE A HD1  8  
ATOM   8681  H  HD2  . PHE A 1 42 ? -2.090  -0.650  -4.601  1.00 0.00 ? 42  PHE A HD2  8  
ATOM   8682  H  HE1  . PHE A 1 42 ? -3.719  -4.215  -7.574  1.00 0.00 ? 42  PHE A HE1  8  
ATOM   8683  H  HE2  . PHE A 1 42 ? -4.070  -0.265  -6.010  1.00 0.00 ? 42  PHE A HE2  8  
ATOM   8684  H  HZ   . PHE A 1 42 ? -4.887  -2.049  -7.498  1.00 0.00 ? 42  PHE A HZ   8  
ATOM   8685  N  N    . ASN A 1 43 ? 1.284   -4.284  -2.285  1.00 0.00 ? 43  ASN A N    8  
ATOM   8686  C  CA   . ASN A 1 43 ? 2.458   -4.237  -1.420  1.00 0.00 ? 43  ASN A CA   8  
ATOM   8687  C  C    . ASN A 1 43 ? 3.739   -4.182  -2.245  1.00 0.00 ? 43  ASN A C    8  
ATOM   8688  O  O    . ASN A 1 43 ? 3.793   -4.694  -3.364  1.00 0.00 ? 43  ASN A O    8  
ATOM   8689  C  CB   . ASN A 1 43 ? 2.485   -5.455  -0.495  1.00 0.00 ? 43  ASN A CB   8  
ATOM   8690  C  CG   . ASN A 1 43 ? 1.570   -5.292  0.703   1.00 0.00 ? 43  ASN A CG   8  
ATOM   8691  O  OD1  . ASN A 1 43 ? 0.379   -5.017  0.556   1.00 0.00 ? 43  ASN A OD1  8  
ATOM   8692  N  ND2  . ASN A 1 43 ? 2.125   -5.461  1.898   1.00 0.00 ? 43  ASN A ND2  8  
ATOM   8693  H  H    . ASN A 1 43 ? 1.238   -4.961  -2.992  1.00 0.00 ? 43  ASN A H    8  
ATOM   8694  H  HA   . ASN A 1 43 ? 2.391   -3.342  -0.820  1.00 0.00 ? 43  ASN A HA   8  
ATOM   8695  H  HB2  . ASN A 1 43 ? 2.168   -6.327  -1.049  1.00 0.00 ? 43  ASN A HB2  8  
ATOM   8696  H  HB3  . ASN A 1 43 ? 3.492   -5.607  -0.138  1.00 0.00 ? 43  ASN A HB3  8  
ATOM   8697  H  HD21 . ASN A 1 43 ? 3.080   -5.678  1.939   1.00 0.00 ? 43  ASN A HD21 8  
ATOM   8698  H  HD22 . ASN A 1 43 ? 1.556   -5.362  2.690   1.00 0.00 ? 43  ASN A HD22 8  
ATOM   8699  N  N    . CYS A 1 44 ? 4.771   -3.559  -1.686  1.00 0.00 ? 44  CYS A N    8  
ATOM   8700  C  CA   . CYS A 1 44 ? 6.053   -3.436  -2.368  1.00 0.00 ? 44  CYS A CA   8  
ATOM   8701  C  C    . CYS A 1 44 ? 6.511   -4.787  -2.912  1.00 0.00 ? 44  CYS A C    8  
ATOM   8702  O  O    . CYS A 1 44 ? 6.004   -5.834  -2.509  1.00 0.00 ? 44  CYS A O    8  
ATOM   8703  C  CB   . CYS A 1 44 ? 7.110   -2.873  -1.416  1.00 0.00 ? 44  CYS A CB   8  
ATOM   8704  S  SG   . CYS A 1 44 ? 8.665   -2.391  -2.233  1.00 0.00 ? 44  CYS A SG   8  
ATOM   8705  H  H    . CYS A 1 44 ? 4.667   -3.170  -0.791  1.00 0.00 ? 44  CYS A H    8  
ATOM   8706  H  HA   . CYS A 1 44 ? 5.926   -2.754  -3.195  1.00 0.00 ? 44  CYS A HA   8  
ATOM   8707  H  HB2  . CYS A 1 44 ? 6.711   -1.996  -0.927  1.00 0.00 ? 44  CYS A HB2  8  
ATOM   8708  H  HB3  . CYS A 1 44 ? 7.346   -3.618  -0.671  1.00 0.00 ? 44  CYS A HB3  8  
ATOM   8709  N  N    . ALA A 1 45 ? 7.473   -4.754  -3.828  1.00 0.00 ? 45  ALA A N    8  
ATOM   8710  C  CA   . ALA A 1 45 ? 8.001   -5.975  -4.425  1.00 0.00 ? 45  ALA A CA   8  
ATOM   8711  C  C    . ALA A 1 45 ? 9.421   -6.251  -3.944  1.00 0.00 ? 45  ALA A C    8  
ATOM   8712  O  O    . ALA A 1 45 ? 9.888   -7.389  -3.978  1.00 0.00 ? 45  ALA A O    8  
ATOM   8713  C  CB   . ALA A 1 45 ? 7.965   -5.878  -5.943  1.00 0.00 ? 45  ALA A CB   8  
ATOM   8714  H  H    . ALA A 1 45 ? 7.837   -3.889  -4.109  1.00 0.00 ? 45  ALA A H    8  
ATOM   8715  H  HA   . ALA A 1 45 ? 7.364   -6.795  -4.126  1.00 0.00 ? 45  ALA A HA   8  
ATOM   8716  H  HB1  . ALA A 1 45 ? 8.877   -6.290  -6.351  1.00 0.00 ? 45  ALA A HB1  8  
ATOM   8717  H  HB2  . ALA A 1 45 ? 7.119   -6.434  -6.319  1.00 0.00 ? 45  ALA A HB2  8  
ATOM   8718  H  HB3  . ALA A 1 45 ? 7.875   -4.843  -6.236  1.00 0.00 ? 45  ALA A HB3  8  
ATOM   8719  N  N    . ASN A 1 46 ? 10.104  -5.203  -3.497  1.00 0.00 ? 46  ASN A N    8  
ATOM   8720  C  CA   . ASN A 1 46 ? 11.473  -5.333  -3.010  1.00 0.00 ? 46  ASN A CA   8  
ATOM   8721  C  C    . ASN A 1 46 ? 11.493  -5.844  -1.573  1.00 0.00 ? 46  ASN A C    8  
ATOM   8722  O  O    . ASN A 1 46 ? 12.075  -6.888  -1.281  1.00 0.00 ? 46  ASN A O    8  
ATOM   8723  C  CB   . ASN A 1 46 ? 12.197  -3.988  -3.095  1.00 0.00 ? 46  ASN A CB   8  
ATOM   8724  C  CG   . ASN A 1 46 ? 13.656  -4.090  -2.697  1.00 0.00 ? 46  ASN A CG   8  
ATOM   8725  O  OD1  . ASN A 1 46 ? 14.508  -4.456  -3.507  1.00 0.00 ? 46  ASN A OD1  8  
ATOM   8726  N  ND2  . ASN A 1 46 ? 13.951  -3.767  -1.443  1.00 0.00 ? 46  ASN A ND2  8  
ATOM   8727  H  H    . ASN A 1 46 ? 9.678   -4.320  -3.495  1.00 0.00 ? 46  ASN A H    8  
ATOM   8728  H  HA   . ASN A 1 46 ? 11.982  -6.046  -3.640  1.00 0.00 ? 46  ASN A HA   8  
ATOM   8729  H  HB2  . ASN A 1 46 ? 12.146  -3.622  -4.111  1.00 0.00 ? 46  ASN A HB2  8  
ATOM   8730  H  HB3  . ASN A 1 46 ? 11.712  -3.282  -2.438  1.00 0.00 ? 46  ASN A HB3  8  
ATOM   8731  H  HD21 . ASN A 1 46 ? 13.221  -3.484  -0.853  1.00 0.00 ? 46  ASN A HD21 8  
ATOM   8732  H  HD22 . ASN A 1 46 ? 14.887  -3.824  -1.159  1.00 0.00 ? 46  ASN A HD22 8  
ATOM   8733  N  N    . CYS A 1 47 ? 10.851  -5.100  -0.678  1.00 0.00 ? 47  CYS A N    8  
ATOM   8734  C  CA   . CYS A 1 47 ? 10.794  -5.476  0.730   1.00 0.00 ? 47  CYS A CA   8  
ATOM   8735  C  C    . CYS A 1 47 ? 9.556   -6.320  1.017   1.00 0.00 ? 47  CYS A C    8  
ATOM   8736  O  O    . CYS A 1 47 ? 9.642   -7.375  1.645   1.00 0.00 ? 47  CYS A O    8  
ATOM   8737  C  CB   . CYS A 1 47 ? 10.789  -4.227  1.613   1.00 0.00 ? 47  CYS A CB   8  
ATOM   8738  S  SG   . CYS A 1 47 ? 9.575   -2.966  1.111   1.00 0.00 ? 47  CYS A SG   8  
ATOM   8739  H  H    . CYS A 1 47 ? 10.405  -4.277  -0.971  1.00 0.00 ? 47  CYS A H    8  
ATOM   8740  H  HA   . CYS A 1 47 ? 11.673  -6.061  0.953   1.00 0.00 ? 47  CYS A HA   8  
ATOM   8741  H  HB2  . CYS A 1 47 ? 10.562  -4.515  2.629   1.00 0.00 ? 47  CYS A HB2  8  
ATOM   8742  H  HB3  . CYS A 1 47 ? 11.768  -3.771  1.584   1.00 0.00 ? 47  CYS A HB3  8  
ATOM   8743  N  N    . GLY A 1 48 ? 8.403   -5.848  0.553   1.00 0.00 ? 48  GLY A N    8  
ATOM   8744  C  CA   . GLY A 1 48 ? 7.164   -6.571  0.769   1.00 0.00 ? 48  GLY A CA   8  
ATOM   8745  C  C    . GLY A 1 48 ? 6.309   -5.945  1.853   1.00 0.00 ? 48  GLY A C    8  
ATOM   8746  O  O    . GLY A 1 48 ? 5.680   -6.649  2.643   1.00 0.00 ? 48  GLY A O    8  
ATOM   8747  H  H    . GLY A 1 48 ? 8.394   -5.001  0.059   1.00 0.00 ? 48  GLY A H    8  
ATOM   8748  H  HA2  . GLY A 1 48 ? 6.603   -6.586  -0.153  1.00 0.00 ? 48  GLY A HA2  8  
ATOM   8749  H  HA3  . GLY A 1 48 ? 7.398   -7.586  1.053   1.00 0.00 ? 48  GLY A HA3  8  
ATOM   8750  N  N    . LYS A 1 49 ? 6.286   -4.617  1.894   1.00 0.00 ? 49  LYS A N    8  
ATOM   8751  C  CA   . LYS A 1 49 ? 5.503   -3.895  2.889   1.00 0.00 ? 49  LYS A CA   8  
ATOM   8752  C  C    . LYS A 1 49 ? 4.291   -3.227  2.248   1.00 0.00 ? 49  LYS A C    8  
ATOM   8753  O  O    . LYS A 1 49 ? 4.205   -3.119  1.025   1.00 0.00 ? 49  LYS A O    8  
ATOM   8754  C  CB   . LYS A 1 49 ? 6.370   -2.842  3.584   1.00 0.00 ? 49  LYS A CB   8  
ATOM   8755  C  CG   . LYS A 1 49 ? 6.639   -1.615  2.730   1.00 0.00 ? 49  LYS A CG   8  
ATOM   8756  C  CD   . LYS A 1 49 ? 7.335   -0.523  3.525   1.00 0.00 ? 49  LYS A CD   8  
ATOM   8757  C  CE   . LYS A 1 49 ? 6.332   0.371   4.238   1.00 0.00 ? 49  LYS A CE   8  
ATOM   8758  N  NZ   . LYS A 1 49 ? 6.997   1.520   4.914   1.00 0.00 ? 49  LYS A NZ   8  
ATOM   8759  H  H    . LYS A 1 49 ? 6.809   -4.110  1.237   1.00 0.00 ? 49  LYS A H    8  
ATOM   8760  H  HA   . LYS A 1 49 ? 5.160   -4.608  3.623   1.00 0.00 ? 49  LYS A HA   8  
ATOM   8761  H  HB2  . LYS A 1 49 ? 5.872   -2.523  4.488   1.00 0.00 ? 49  LYS A HB2  8  
ATOM   8762  H  HB3  . LYS A 1 49 ? 7.319   -3.289  3.844   1.00 0.00 ? 49  LYS A HB3  8  
ATOM   8763  H  HG2  . LYS A 1 49 ? 7.269   -1.897  1.899   1.00 0.00 ? 49  LYS A HG2  8  
ATOM   8764  H  HG3  . LYS A 1 49 ? 5.699   -1.234  2.358   1.00 0.00 ? 49  LYS A HG3  8  
ATOM   8765  H  HD2  . LYS A 1 49 ? 7.979   -0.981  4.261   1.00 0.00 ? 49  LYS A HD2  8  
ATOM   8766  H  HD3  . LYS A 1 49 ? 7.927   0.079   2.851   1.00 0.00 ? 49  LYS A HD3  8  
ATOM   8767  H  HE2  . LYS A 1 49 ? 5.628   0.750   3.513   1.00 0.00 ? 49  LYS A HE2  8  
ATOM   8768  H  HE3  . LYS A 1 49 ? 5.807   -0.216  4.977   1.00 0.00 ? 49  LYS A HE3  8  
ATOM   8769  H  HZ1  . LYS A 1 49 ? 7.781   1.873   4.329   1.00 0.00 ? 49  LYS A HZ1  8  
ATOM   8770  H  HZ2  . LYS A 1 49 ? 7.374   1.222   5.836   1.00 0.00 ? 49  LYS A HZ2  8  
ATOM   8771  H  HZ3  . LYS A 1 49 ? 6.315   2.291   5.063   1.00 0.00 ? 49  LYS A HZ3  8  
ATOM   8772  N  N    . GLU A 1 50 ? 3.356   -2.781  3.082   1.00 0.00 ? 50  GLU A N    8  
ATOM   8773  C  CA   . GLU A 1 50 ? 2.149   -2.124  2.594   1.00 0.00 ? 50  GLU A CA   8  
ATOM   8774  C  C    . GLU A 1 50 ? 2.490   -0.812  1.893   1.00 0.00 ? 50  GLU A C    8  
ATOM   8775  O  O    . GLU A 1 50 ? 2.794   0.191   2.540   1.00 0.00 ? 50  GLU A O    8  
ATOM   8776  C  CB   . GLU A 1 50 ? 1.183   -1.860  3.751   1.00 0.00 ? 50  GLU A CB   8  
ATOM   8777  C  CG   . GLU A 1 50 ? -0.123  -1.216  3.318   1.00 0.00 ? 50  GLU A CG   8  
ATOM   8778  C  CD   . GLU A 1 50 ? -0.052  0.299   3.311   1.00 0.00 ? 50  GLU A CD   8  
ATOM   8779  O  OE1  . GLU A 1 50 ? 0.813   0.855   4.020   1.00 0.00 ? 50  GLU A OE1  8  
ATOM   8780  O  OE2  . GLU A 1 50 ? -0.862  0.928   2.599   1.00 0.00 ? 50  GLU A OE2  8  
ATOM   8781  H  H    . GLU A 1 50 ? 3.482   -2.897  4.047   1.00 0.00 ? 50  GLU A H    8  
ATOM   8782  H  HA   . GLU A 1 50 ? 1.675   -2.785  1.885   1.00 0.00 ? 50  GLU A HA   8  
ATOM   8783  H  HB2  . GLU A 1 50 ? 0.955   -2.799  4.235   1.00 0.00 ? 50  GLU A HB2  8  
ATOM   8784  H  HB3  . GLU A 1 50 ? 1.664   -1.206  4.463   1.00 0.00 ? 50  GLU A HB3  8  
ATOM   8785  H  HG2  . GLU A 1 50 ? -0.364  -1.554  2.321   1.00 0.00 ? 50  GLU A HG2  8  
ATOM   8786  H  HG3  . GLU A 1 50 ? -0.904  -1.522  3.999   1.00 0.00 ? 50  GLU A HG3  8  
ATOM   8787  N  N    . LEU A 1 51 ? 2.436   -0.827  0.565   1.00 0.00 ? 51  LEU A N    8  
ATOM   8788  C  CA   . LEU A 1 51 ? 2.739   0.361   -0.226  1.00 0.00 ? 51  LEU A CA   8  
ATOM   8789  C  C    . LEU A 1 51 ? 1.968   1.571   0.292   1.00 0.00 ? 51  LEU A C    8  
ATOM   8790  O  O    . LEU A 1 51 ? 1.145   1.455   1.200   1.00 0.00 ? 51  LEU A O    8  
ATOM   8791  C  CB   . LEU A 1 51 ? 2.400   0.117   -1.698  1.00 0.00 ? 51  LEU A CB   8  
ATOM   8792  C  CG   . LEU A 1 51 ? 3.360   -0.791  -2.466  1.00 0.00 ? 51  LEU A CG   8  
ATOM   8793  C  CD1  . LEU A 1 51 ? 2.765   -1.181  -3.811  1.00 0.00 ? 51  LEU A CD1  8  
ATOM   8794  C  CD2  . LEU A 1 51 ? 4.706   -0.106  -2.655  1.00 0.00 ? 51  LEU A CD2  8  
ATOM   8795  H  H    . LEU A 1 51 ? 2.187   -1.655  0.106   1.00 0.00 ? 51  LEU A H    8  
ATOM   8796  H  HA   . LEU A 1 51 ? 3.797   0.557   -0.137  1.00 0.00 ? 51  LEU A HA   8  
ATOM   8797  H  HB2  . LEU A 1 51 ? 1.418   -0.328  -1.741  1.00 0.00 ? 51  LEU A HB2  8  
ATOM   8798  H  HB3  . LEU A 1 51 ? 2.380   1.076   -2.195  1.00 0.00 ? 51  LEU A HB3  8  
ATOM   8799  H  HG   . LEU A 1 51 ? 3.522   -1.697  -1.898  1.00 0.00 ? 51  LEU A HG   8  
ATOM   8800  H  HD11 . LEU A 1 51 ? 3.361   -1.965  -4.254  1.00 0.00 ? 51  LEU A HD11 8  
ATOM   8801  H  HD12 . LEU A 1 51 ? 2.759   -0.321  -4.464  1.00 0.00 ? 51  LEU A HD12 8  
ATOM   8802  H  HD13 . LEU A 1 51 ? 1.754   -1.532  -3.668  1.00 0.00 ? 51  LEU A HD13 8  
ATOM   8803  H  HD21 . LEU A 1 51 ? 4.925   0.500   -1.788  1.00 0.00 ? 51  LEU A HD21 8  
ATOM   8804  H  HD22 . LEU A 1 51 ? 4.670   0.522   -3.533  1.00 0.00 ? 51  LEU A HD22 8  
ATOM   8805  H  HD23 . LEU A 1 51 ? 5.476   -0.853  -2.777  1.00 0.00 ? 51  LEU A HD23 8  
ATOM   8806  N  N    . THR A 1 52 ? 2.239   2.733   -0.294  1.00 0.00 ? 52  THR A N    8  
ATOM   8807  C  CA   . THR A 1 52 ? 1.572   3.965   0.107   1.00 0.00 ? 52  THR A CA   8  
ATOM   8808  C  C    . THR A 1 52 ? 0.962   4.677   -1.096  1.00 0.00 ? 52  THR A C    8  
ATOM   8809  O  O    . THR A 1 52 ? 1.154   4.260   -2.238  1.00 0.00 ? 52  THR A O    8  
ATOM   8810  C  CB   . THR A 1 52 ? 2.543   4.925   0.819   1.00 0.00 ? 52  THR A CB   8  
ATOM   8811  O  OG1  . THR A 1 52 ? 3.636   5.248   -0.048  1.00 0.00 ? 52  THR A OG1  8  
ATOM   8812  C  CG2  . THR A 1 52 ? 3.074   4.304   2.103   1.00 0.00 ? 52  THR A CG2  8  
ATOM   8813  H  H    . THR A 1 52 ? 2.906   2.762   -1.012  1.00 0.00 ? 52  THR A H    8  
ATOM   8814  H  HA   . THR A 1 52 ? 0.783   3.707   0.798   1.00 0.00 ? 52  THR A HA   8  
ATOM   8815  H  HB   . THR A 1 52 ? 2.011   5.832   1.068   1.00 0.00 ? 52  THR A HB   8  
ATOM   8816  H  HG1  . THR A 1 52 ? 3.297   5.603   -0.873  1.00 0.00 ? 52  THR A HG1  8  
ATOM   8817  H  HG21 . THR A 1 52 ? 2.989   3.229   2.045   1.00 0.00 ? 52  THR A HG21 8  
ATOM   8818  H  HG22 . THR A 1 52 ? 2.499   4.667   2.942   1.00 0.00 ? 52  THR A HG22 8  
ATOM   8819  H  HG23 . THR A 1 52 ? 4.110   4.577   2.232   1.00 0.00 ? 52  THR A HG23 8  
ATOM   8820  N  N    . ALA A 1 53 ? 0.228   5.752   -0.831  1.00 0.00 ? 53  ALA A N    8  
ATOM   8821  C  CA   . ALA A 1 53 ? -0.407  6.523   -1.893  1.00 0.00 ? 53  ALA A CA   8  
ATOM   8822  C  C    . ALA A 1 53 ? 0.634   7.144   -2.819  1.00 0.00 ? 53  ALA A C    8  
ATOM   8823  O  O    . ALA A 1 53 ? 0.443   7.198   -4.034  1.00 0.00 ? 53  ALA A O    8  
ATOM   8824  C  CB   . ALA A 1 53 ? -1.299  7.604   -1.299  1.00 0.00 ? 53  ALA A CB   8  
ATOM   8825  H  H    . ALA A 1 53 ? 0.112   6.035   0.100   1.00 0.00 ? 53  ALA A H    8  
ATOM   8826  H  HA   . ALA A 1 53 ? -1.030  5.852   -2.466  1.00 0.00 ? 53  ALA A HA   8  
ATOM   8827  H  HB1  . ALA A 1 53 ? -1.749  8.176   -2.097  1.00 0.00 ? 53  ALA A HB1  8  
ATOM   8828  H  HB2  . ALA A 1 53 ? -2.074  7.144   -0.704  1.00 0.00 ? 53  ALA A HB2  8  
ATOM   8829  H  HB3  . ALA A 1 53 ? -0.707  8.257   -0.677  1.00 0.00 ? 53  ALA A HB3  8  
ATOM   8830  N  N    . ASP A 1 54 ? 1.733   7.611   -2.237  1.00 0.00 ? 54  ASP A N    8  
ATOM   8831  C  CA   . ASP A 1 54 ? 2.804   8.227   -3.010  1.00 0.00 ? 54  ASP A CA   8  
ATOM   8832  C  C    . ASP A 1 54 ? 3.606   7.172   -3.766  1.00 0.00 ? 54  ASP A C    8  
ATOM   8833  O  O    . ASP A 1 54 ? 4.495   7.498   -4.552  1.00 0.00 ? 54  ASP A O    8  
ATOM   8834  C  CB   . ASP A 1 54 ? 3.729   9.027   -2.092  1.00 0.00 ? 54  ASP A CB   8  
ATOM   8835  C  CG   . ASP A 1 54 ? 3.807   8.442   -0.696  1.00 0.00 ? 54  ASP A CG   8  
ATOM   8836  O  OD1  . ASP A 1 54 ? 2.791   8.498   0.028   1.00 0.00 ? 54  ASP A OD1  8  
ATOM   8837  O  OD2  . ASP A 1 54 ? 4.884   7.929   -0.326  1.00 0.00 ? 54  ASP A OD2  8  
ATOM   8838  H  H    . ASP A 1 54 ? 1.826   7.538   -1.264  1.00 0.00 ? 54  ASP A H    8  
ATOM   8839  H  HA   . ASP A 1 54 ? 2.353   8.899   -3.725  1.00 0.00 ? 54  ASP A HA   8  
ATOM   8840  H  HB2  . ASP A 1 54 ? 4.724   9.037   -2.514  1.00 0.00 ? 54  ASP A HB2  8  
ATOM   8841  H  HB3  . ASP A 1 54 ? 3.364   10.041  -2.019  1.00 0.00 ? 54  ASP A HB3  8  
ATOM   8842  N  N    . ALA A 1 55 ? 3.285   5.905   -3.522  1.00 0.00 ? 55  ALA A N    8  
ATOM   8843  C  CA   . ALA A 1 55 ? 3.974   4.802   -4.180  1.00 0.00 ? 55  ALA A CA   8  
ATOM   8844  C  C    . ALA A 1 55 ? 4.197   5.098   -5.659  1.00 0.00 ? 55  ALA A C    8  
ATOM   8845  O  O    . ALA A 1 55 ? 3.413   5.813   -6.283  1.00 0.00 ? 55  ALA A O    8  
ATOM   8846  C  CB   . ALA A 1 55 ? 3.186   3.512   -4.010  1.00 0.00 ? 55  ALA A CB   8  
ATOM   8847  H  H    . ALA A 1 55 ? 2.567   5.709   -2.885  1.00 0.00 ? 55  ALA A H    8  
ATOM   8848  H  HA   . ALA A 1 55 ? 4.934   4.675   -3.700  1.00 0.00 ? 55  ALA A HA   8  
ATOM   8849  H  HB1  . ALA A 1 55 ? 2.173   3.662   -4.355  1.00 0.00 ? 55  ALA A HB1  8  
ATOM   8850  H  HB2  . ALA A 1 55 ? 3.651   2.728   -4.589  1.00 0.00 ? 55  ALA A HB2  8  
ATOM   8851  H  HB3  . ALA A 1 55 ? 3.174   3.232   -2.968  1.00 0.00 ? 55  ALA A HB3  8  
ATOM   8852  N  N    . ARG A 1 56 ? 5.270   4.544   -6.214  1.00 0.00 ? 56  ARG A N    8  
ATOM   8853  C  CA   . ARG A 1 56 ? 5.596   4.751   -7.619  1.00 0.00 ? 56  ARG A CA   8  
ATOM   8854  C  C    . ARG A 1 56 ? 5.383   3.470   -8.421  1.00 0.00 ? 56  ARG A C    8  
ATOM   8855  O  O    . ARG A 1 56 ? 5.415   2.370   -7.870  1.00 0.00 ? 56  ARG A O    8  
ATOM   8856  C  CB   . ARG A 1 56 ? 7.044   5.221   -7.765  1.00 0.00 ? 56  ARG A CB   8  
ATOM   8857  C  CG   . ARG A 1 56 ? 7.378   6.438   -6.917  1.00 0.00 ? 56  ARG A CG   8  
ATOM   8858  C  CD   . ARG A 1 56 ? 6.943   7.727   -7.597  1.00 0.00 ? 56  ARG A CD   8  
ATOM   8859  N  NE   . ARG A 1 56 ? 7.669   7.961   -8.842  1.00 0.00 ? 56  ARG A NE   8  
ATOM   8860  C  CZ   . ARG A 1 56 ? 7.842   9.165   -9.376  1.00 0.00 ? 56  ARG A CZ   8  
ATOM   8861  N  NH1  . ARG A 1 56 ? 7.345   10.238  -8.776  1.00 0.00 ? 56  ARG A NH1  8  
ATOM   8862  N  NH2  . ARG A 1 56 ? 8.515   9.297   -10.512 1.00 0.00 ? 56  ARG A NH2  8  
ATOM   8863  H  H    . ARG A 1 56 ? 5.857   3.984   -5.664  1.00 0.00 ? 56  ARG A H    8  
ATOM   8864  H  HA   . ARG A 1 56 ? 4.938   5.516   -8.004  1.00 0.00 ? 56  ARG A HA   8  
ATOM   8865  H  HB2  . ARG A 1 56 ? 7.703   4.416   -7.475  1.00 0.00 ? 56  ARG A HB2  8  
ATOM   8866  H  HB3  . ARG A 1 56 ? 7.227   5.470   -8.800  1.00 0.00 ? 56  ARG A HB3  8  
ATOM   8867  H  HG2  . ARG A 1 56 ? 6.868   6.354   -5.968  1.00 0.00 ? 56  ARG A HG2  8  
ATOM   8868  H  HG3  . ARG A 1 56 ? 8.445   6.469   -6.754  1.00 0.00 ? 56  ARG A HG3  8  
ATOM   8869  H  HD2  . ARG A 1 56 ? 5.887   7.665   -7.813  1.00 0.00 ? 56  ARG A HD2  8  
ATOM   8870  H  HD3  . ARG A 1 56 ? 7.124   8.551   -6.924  1.00 0.00 ? 56  ARG A HD3  8  
ATOM   8871  H  HE   . ARG A 1 56 ? 8.045   7.182   -9.302  1.00 0.00 ? 56  ARG A HE   8  
ATOM   8872  H  HH11 . ARG A 1 56 ? 6.838   10.141  -7.920  1.00 0.00 ? 56  ARG A HH11 8  
ATOM   8873  H  HH12 . ARG A 1 56 ? 7.478   11.143  -9.180  1.00 0.00 ? 56  ARG A HH12 8  
ATOM   8874  H  HH21 . ARG A 1 56 ? 8.892   8.491   -10.967 1.00 0.00 ? 56  ARG A HH21 8  
ATOM   8875  H  HH22 . ARG A 1 56 ? 8.645   10.204  -10.913 1.00 0.00 ? 56  ARG A HH22 8  
ATOM   8876  N  N    . GLU A 1 57 ? 5.165   3.622   -9.723  1.00 0.00 ? 57  GLU A N    8  
ATOM   8877  C  CA   . GLU A 1 57 ? 4.946   2.477   -10.599 1.00 0.00 ? 57  GLU A CA   8  
ATOM   8878  C  C    . GLU A 1 57 ? 6.196   2.172   -11.419 1.00 0.00 ? 57  GLU A C    8  
ATOM   8879  O  O    . GLU A 1 57 ? 6.619   2.976   -12.250 1.00 0.00 ? 57  GLU A O    8  
ATOM   8880  C  CB   . GLU A 1 57 ? 3.762   2.741   -11.533 1.00 0.00 ? 57  GLU A CB   8  
ATOM   8881  C  CG   . GLU A 1 57 ? 3.487   1.604   -12.503 1.00 0.00 ? 57  GLU A CG   8  
ATOM   8882  C  CD   . GLU A 1 57 ? 2.538   2.003   -13.616 1.00 0.00 ? 57  GLU A CD   8  
ATOM   8883  O  OE1  . GLU A 1 57 ? 1.454   2.542   -13.307 1.00 0.00 ? 57  GLU A OE1  8  
ATOM   8884  O  OE2  . GLU A 1 57 ? 2.879   1.777   -14.796 1.00 0.00 ? 57  GLU A OE2  8  
ATOM   8885  H  H    . GLU A 1 57 ? 5.152   4.525   -10.104 1.00 0.00 ? 57  GLU A H    8  
ATOM   8886  H  HA   . GLU A 1 57 ? 4.719   1.623   -9.979  1.00 0.00 ? 57  GLU A HA   8  
ATOM   8887  H  HB2  . GLU A 1 57 ? 2.877   2.899   -10.936 1.00 0.00 ? 57  GLU A HB2  8  
ATOM   8888  H  HB3  . GLU A 1 57 ? 3.964   3.634   -12.106 1.00 0.00 ? 57  GLU A HB3  8  
ATOM   8889  H  HG2  . GLU A 1 57 ? 4.422   1.290   -12.944 1.00 0.00 ? 57  GLU A HG2  8  
ATOM   8890  H  HG3  . GLU A 1 57 ? 3.053   0.779   -11.957 1.00 0.00 ? 57  GLU A HG3  8  
ATOM   8891  N  N    . LEU A 1 58 ? 6.783   1.004   -11.179 1.00 0.00 ? 58  LEU A N    8  
ATOM   8892  C  CA   . LEU A 1 58 ? 7.986   0.591   -11.894 1.00 0.00 ? 58  LEU A CA   8  
ATOM   8893  C  C    . LEU A 1 58 ? 7.708   -0.628  -12.767 1.00 0.00 ? 58  LEU A C    8  
ATOM   8894  O  O    . LEU A 1 58 ? 7.232   -1.656  -12.285 1.00 0.00 ? 58  LEU A O    8  
ATOM   8895  C  CB   . LEU A 1 58 ? 9.109   0.278   -10.904 1.00 0.00 ? 58  LEU A CB   8  
ATOM   8896  C  CG   . LEU A 1 58 ? 10.013  1.451   -10.521 1.00 0.00 ? 58  LEU A CG   8  
ATOM   8897  C  CD1  . LEU A 1 58 ? 10.890  1.854   -11.696 1.00 0.00 ? 58  LEU A CD1  8  
ATOM   8898  C  CD2  . LEU A 1 58 ? 9.180   2.632   -10.043 1.00 0.00 ? 58  LEU A CD2  8  
ATOM   8899  H  H    . LEU A 1 58 ? 6.400   0.406   -10.505 1.00 0.00 ? 58  LEU A H    8  
ATOM   8900  H  HA   . LEU A 1 58 ? 8.293   1.410   -12.526 1.00 0.00 ? 58  LEU A HA   8  
ATOM   8901  H  HB2  . LEU A 1 58 ? 8.657   -0.099  -9.999  1.00 0.00 ? 58  LEU A HB2  8  
ATOM   8902  H  HB3  . LEU A 1 58 ? 9.730   -0.490  -11.342 1.00 0.00 ? 58  LEU A HB3  8  
ATOM   8903  H  HG   . LEU A 1 58 ? 10.661  1.148   -9.710  1.00 0.00 ? 58  LEU A HG   8  
ATOM   8904  H  HD11 . LEU A 1 58 ? 11.300  0.970   -12.159 1.00 0.00 ? 58  LEU A HD11 8  
ATOM   8905  H  HD12 . LEU A 1 58 ? 11.694  2.484   -11.345 1.00 0.00 ? 58  LEU A HD12 8  
ATOM   8906  H  HD13 . LEU A 1 58 ? 10.297  2.398   -12.417 1.00 0.00 ? 58  LEU A HD13 8  
ATOM   8907  H  HD21 . LEU A 1 58 ? 8.593   2.335   -9.187  1.00 0.00 ? 58  LEU A HD21 8  
ATOM   8908  H  HD22 . LEU A 1 58 ? 8.522   2.952   -10.838 1.00 0.00 ? 58  LEU A HD22 8  
ATOM   8909  H  HD23 . LEU A 1 58 ? 9.835   3.445   -9.767  1.00 0.00 ? 58  LEU A HD23 8  
ATOM   8910  N  N    . LYS A 1 59 ? 8.010   -0.507  -14.056 1.00 0.00 ? 59  LYS A N    8  
ATOM   8911  C  CA   . LYS A 1 59 ? 7.797   -1.599  -14.998 1.00 0.00 ? 59  LYS A CA   8  
ATOM   8912  C  C    . LYS A 1 59 ? 6.496   -2.334  -14.693 1.00 0.00 ? 59  LYS A C    8  
ATOM   8913  O  O    . LYS A 1 59 ? 6.423   -3.558  -14.799 1.00 0.00 ? 59  LYS A O    8  
ATOM   8914  C  CB   . LYS A 1 59 ? 8.972   -2.578  -14.949 1.00 0.00 ? 59  LYS A CB   8  
ATOM   8915  C  CG   . LYS A 1 59 ? 10.214  -2.074  -15.663 1.00 0.00 ? 59  LYS A CG   8  
ATOM   8916  C  CD   . LYS A 1 59 ? 10.975  -1.069  -14.814 1.00 0.00 ? 59  LYS A CD   8  
ATOM   8917  C  CE   . LYS A 1 59 ? 11.790  -1.758  -13.731 1.00 0.00 ? 59  LYS A CE   8  
ATOM   8918  N  NZ   . LYS A 1 59 ? 13.034  -2.370  -14.277 1.00 0.00 ? 59  LYS A NZ   8  
ATOM   8919  H  H    . LYS A 1 59 ? 8.387   0.338   -14.381 1.00 0.00 ? 59  LYS A H    8  
ATOM   8920  H  HA   . LYS A 1 59 ? 7.733   -1.175  -15.988 1.00 0.00 ? 59  LYS A HA   8  
ATOM   8921  H  HB2  . LYS A 1 59 ? 9.226   -2.766  -13.916 1.00 0.00 ? 59  LYS A HB2  8  
ATOM   8922  H  HB3  . LYS A 1 59 ? 8.670   -3.508  -15.411 1.00 0.00 ? 59  LYS A HB3  8  
ATOM   8923  H  HG2  . LYS A 1 59 ? 10.861  -2.911  -15.876 1.00 0.00 ? 59  LYS A HG2  8  
ATOM   8924  H  HG3  . LYS A 1 59 ? 9.919   -1.599  -16.588 1.00 0.00 ? 59  LYS A HG3  8  
ATOM   8925  H  HD2  . LYS A 1 59 ? 11.644  -0.507  -15.449 1.00 0.00 ? 59  LYS A HD2  8  
ATOM   8926  H  HD3  . LYS A 1 59 ? 10.269  -0.396  -14.348 1.00 0.00 ? 59  LYS A HD3  8  
ATOM   8927  H  HE2  . LYS A 1 59 ? 12.057  -1.030  -12.981 1.00 0.00 ? 59  LYS A HE2  8  
ATOM   8928  H  HE3  . LYS A 1 59 ? 11.186  -2.532  -13.282 1.00 0.00 ? 59  LYS A HE3  8  
ATOM   8929  H  HZ1  . LYS A 1 59 ? 13.699  -1.626  -14.570 1.00 0.00 ? 59  LYS A HZ1  8  
ATOM   8930  H  HZ2  . LYS A 1 59 ? 12.808  -2.961  -15.103 1.00 0.00 ? 59  LYS A HZ2  8  
ATOM   8931  H  HZ3  . LYS A 1 59 ? 13.488  -2.962  -13.554 1.00 0.00 ? 59  LYS A HZ3  8  
ATOM   8932  N  N    . GLY A 1 60 ? 5.469   -1.579  -14.315 1.00 0.00 ? 60  GLY A N    8  
ATOM   8933  C  CA   . GLY A 1 60 ? 4.184   -2.177  -14.002 1.00 0.00 ? 60  GLY A CA   8  
ATOM   8934  C  C    . GLY A 1 60 ? 3.995   -2.401  -12.515 1.00 0.00 ? 60  GLY A C    8  
ATOM   8935  O  O    . GLY A 1 60 ? 2.898   -2.221  -11.988 1.00 0.00 ? 60  GLY A O    8  
ATOM   8936  H  H    . GLY A 1 60 ? 5.584   -0.608  -14.248 1.00 0.00 ? 60  GLY A H    8  
ATOM   8937  H  HA2  . GLY A 1 60 ? 3.400   -1.526  -14.360 1.00 0.00 ? 60  GLY A HA2  8  
ATOM   8938  H  HA3  . GLY A 1 60 ? 4.109   -3.127  -14.510 1.00 0.00 ? 60  GLY A HA3  8  
ATOM   8939  N  N    . GLU A 1 61 ? 5.068   -2.797  -11.837 1.00 0.00 ? 61  GLU A N    8  
ATOM   8940  C  CA   . GLU A 1 61 ? 5.014   -3.049  -10.402 1.00 0.00 ? 61  GLU A CA   8  
ATOM   8941  C  C    . GLU A 1 61 ? 4.903   -1.741  -9.624  1.00 0.00 ? 61  GLU A C    8  
ATOM   8942  O  O    . GLU A 1 61 ? 4.981   -0.655  -10.199 1.00 0.00 ? 61  GLU A O    8  
ATOM   8943  C  CB   . GLU A 1 61 ? 6.256   -3.820  -9.950  1.00 0.00 ? 61  GLU A CB   8  
ATOM   8944  C  CG   . GLU A 1 61 ? 6.160   -5.319  -10.183 1.00 0.00 ? 61  GLU A CG   8  
ATOM   8945  C  CD   . GLU A 1 61 ? 5.200   -5.998  -9.227  1.00 0.00 ? 61  GLU A CD   8  
ATOM   8946  O  OE1  . GLU A 1 61 ? 5.334   -5.788  -8.003  1.00 0.00 ? 61  GLU A OE1  8  
ATOM   8947  O  OE2  . GLU A 1 61 ? 4.314   -6.740  -9.702  1.00 0.00 ? 61  GLU A OE2  8  
ATOM   8948  H  H    . GLU A 1 61 ? 5.915   -2.924  -12.313 1.00 0.00 ? 61  GLU A H    8  
ATOM   8949  H  HA   . GLU A 1 61 ? 4.138   -3.648  -10.203 1.00 0.00 ? 61  GLU A HA   8  
ATOM   8950  H  HB2  . GLU A 1 61 ? 7.113   -3.446  -10.489 1.00 0.00 ? 61  GLU A HB2  8  
ATOM   8951  H  HB3  . GLU A 1 61 ? 6.404   -3.651  -8.893  1.00 0.00 ? 61  GLU A HB3  8  
ATOM   8952  H  HG2  . GLU A 1 61 ? 5.821   -5.491  -11.194 1.00 0.00 ? 61  GLU A HG2  8  
ATOM   8953  H  HG3  . GLU A 1 61 ? 7.141   -5.753  -10.055 1.00 0.00 ? 61  GLU A HG3  8  
ATOM   8954  N  N    . LEU A 1 62 ? 4.719   -1.853  -8.313  1.00 0.00 ? 62  LEU A N    8  
ATOM   8955  C  CA   . LEU A 1 62 ? 4.597   -0.680  -7.455  1.00 0.00 ? 62  LEU A CA   8  
ATOM   8956  C  C    . LEU A 1 62 ? 5.507   -0.799  -6.236  1.00 0.00 ? 62  LEU A C    8  
ATOM   8957  O  O    . LEU A 1 62 ? 5.288   -1.641  -5.365  1.00 0.00 ? 62  LEU A O    8  
ATOM   8958  C  CB   . LEU A 1 62 ? 3.145   -0.501  -7.006  1.00 0.00 ? 62  LEU A CB   8  
ATOM   8959  C  CG   . LEU A 1 62 ? 2.116   -0.311  -8.121  1.00 0.00 ? 62  LEU A CG   8  
ATOM   8960  C  CD1  . LEU A 1 62 ? 0.707   -0.510  -7.586  1.00 0.00 ? 62  LEU A CD1  8  
ATOM   8961  C  CD2  . LEU A 1 62 ? 2.260   1.067   -8.750  1.00 0.00 ? 62  LEU A CD2  8  
ATOM   8962  H  H    . LEU A 1 62 ? 4.665   -2.745  -7.912  1.00 0.00 ? 62  LEU A H    8  
ATOM   8963  H  HA   . LEU A 1 62 ? 4.896   0.184   -8.029  1.00 0.00 ? 62  LEU A HA   8  
ATOM   8964  H  HB2  . LEU A 1 62 ? 2.863   -1.378  -6.442  1.00 0.00 ? 62  LEU A HB2  8  
ATOM   8965  H  HB3  . LEU A 1 62 ? 3.103   0.367   -6.363  1.00 0.00 ? 62  LEU A HB3  8  
ATOM   8966  H  HG   . LEU A 1 62 ? 2.288   -1.051  -8.891  1.00 0.00 ? 62  LEU A HG   8  
ATOM   8967  H  HD11 . LEU A 1 62 ? 0.374   0.395   -7.102  1.00 0.00 ? 62  LEU A HD11 8  
ATOM   8968  H  HD12 . LEU A 1 62 ? 0.703   -1.322  -6.874  1.00 0.00 ? 62  LEU A HD12 8  
ATOM   8969  H  HD13 . LEU A 1 62 ? 0.042   -0.747  -8.404  1.00 0.00 ? 62  LEU A HD13 8  
ATOM   8970  H  HD21 . LEU A 1 62 ? 2.111   0.993   -9.817  1.00 0.00 ? 62  LEU A HD21 8  
ATOM   8971  H  HD22 . LEU A 1 62 ? 3.250   1.452   -8.551  1.00 0.00 ? 62  LEU A HD22 8  
ATOM   8972  H  HD23 . LEU A 1 62 ? 1.523   1.734   -8.328  1.00 0.00 ? 62  LEU A HD23 8  
ATOM   8973  N  N    . TYR A 1 63 ? 6.526   0.050   -6.181  1.00 0.00 ? 63  TYR A N    8  
ATOM   8974  C  CA   . TYR A 1 63 ? 7.470   0.040   -5.069  1.00 0.00 ? 63  TYR A CA   8  
ATOM   8975  C  C    . TYR A 1 63 ? 7.225   1.222   -4.136  1.00 0.00 ? 63  TYR A C    8  
ATOM   8976  O  O    . TYR A 1 63 ? 6.733   2.269   -4.557  1.00 0.00 ? 63  TYR A O    8  
ATOM   8977  C  CB   . TYR A 1 63 ? 8.907   0.079   -5.592  1.00 0.00 ? 63  TYR A CB   8  
ATOM   8978  C  CG   . TYR A 1 63 ? 9.230   -1.040  -6.557  1.00 0.00 ? 63  TYR A CG   8  
ATOM   8979  C  CD1  . TYR A 1 63 ? 8.607   -1.117  -7.796  1.00 0.00 ? 63  TYR A CD1  8  
ATOM   8980  C  CD2  . TYR A 1 63 ? 10.158  -2.021  -6.228  1.00 0.00 ? 63  TYR A CD2  8  
ATOM   8981  C  CE1  . TYR A 1 63 ? 8.899   -2.138  -8.680  1.00 0.00 ? 63  TYR A CE1  8  
ATOM   8982  C  CE2  . TYR A 1 63 ? 10.457  -3.044  -7.106  1.00 0.00 ? 63  TYR A CE2  8  
ATOM   8983  C  CZ   . TYR A 1 63 ? 9.825   -3.099  -8.331  1.00 0.00 ? 63  TYR A CZ   8  
ATOM   8984  O  OH   . TYR A 1 63 ? 10.120  -4.117  -9.208  1.00 0.00 ? 63  TYR A OH   8  
ATOM   8985  H  H    . TYR A 1 63 ? 6.649   0.699   -6.905  1.00 0.00 ? 63  TYR A H    8  
ATOM   8986  H  HA   . TYR A 1 63 ? 7.323   -0.877  -4.518  1.00 0.00 ? 63  TYR A HA   8  
ATOM   8987  H  HB2  . TYR A 1 63 ? 9.072   1.014   -6.104  1.00 0.00 ? 63  TYR A HB2  8  
ATOM   8988  H  HB3  . TYR A 1 63 ? 9.589   0.005   -4.758  1.00 0.00 ? 63  TYR A HB3  8  
ATOM   8989  H  HD1  . TYR A 1 63 ? 7.882   -0.363  -8.067  1.00 0.00 ? 63  TYR A HD1  8  
ATOM   8990  H  HD2  . TYR A 1 63 ? 10.651  -1.975  -5.267  1.00 0.00 ? 63  TYR A HD2  8  
ATOM   8991  H  HE1  . TYR A 1 63 ? 8.405   -2.181  -9.639  1.00 0.00 ? 63  TYR A HE1  8  
ATOM   8992  H  HE2  . TYR A 1 63 ? 11.182  -3.797  -6.832  1.00 0.00 ? 63  TYR A HE2  8  
ATOM   8993  H  HH   . TYR A 1 63 ? 10.367  -3.746  -10.058 1.00 0.00 ? 63  TYR A HH   8  
ATOM   8994  N  N    . CYS A 1 64 ? 7.572   1.046   -2.866  1.00 0.00 ? 64  CYS A N    8  
ATOM   8995  C  CA   . CYS A 1 64 ? 7.391   2.095   -1.870  1.00 0.00 ? 64  CYS A CA   8  
ATOM   8996  C  C    . CYS A 1 64 ? 8.483   3.154   -1.992  1.00 0.00 ? 64  CYS A C    8  
ATOM   8997  O  O    . CYS A 1 64 ? 9.628   2.846   -2.327  1.00 0.00 ? 64  CYS A O    8  
ATOM   8998  C  CB   . CYS A 1 64 ? 7.400   1.498   -0.461  1.00 0.00 ? 64  CYS A CB   8  
ATOM   8999  S  SG   . CYS A 1 64 ? 9.021   0.856   0.065   1.00 0.00 ? 64  CYS A SG   8  
ATOM   9000  H  H    . CYS A 1 64 ? 7.960   0.188   -2.590  1.00 0.00 ? 64  CYS A H    8  
ATOM   9001  H  HA   . CYS A 1 64 ? 6.434   2.561   -2.049  1.00 0.00 ? 64  CYS A HA   8  
ATOM   9002  H  HB2  . CYS A 1 64 ? 7.104   2.260   0.245   1.00 0.00 ? 64  CYS A HB2  8  
ATOM   9003  H  HB3  . CYS A 1 64 ? 6.693   0.682   -0.421  1.00 0.00 ? 64  CYS A HB3  8  
ATOM   9004  N  N    . LEU A 1 65 ? 8.122   4.403   -1.718  1.00 0.00 ? 65  LEU A N    8  
ATOM   9005  C  CA   . LEU A 1 65 ? 9.070   5.509   -1.796  1.00 0.00 ? 65  LEU A CA   8  
ATOM   9006  C  C    . LEU A 1 65 ? 10.441  5.088   -1.276  1.00 0.00 ? 65  LEU A C    8  
ATOM   9007  O  O    . LEU A 1 65 ? 11.467  5.292   -1.924  1.00 0.00 ? 65  LEU A O    8  
ATOM   9008  C  CB   . LEU A 1 65 ? 8.554   6.706   -0.996  1.00 0.00 ? 65  LEU A CB   8  
ATOM   9009  C  CG   . LEU A 1 65 ? 7.730   7.730   -1.777  1.00 0.00 ? 65  LEU A CG   8  
ATOM   9010  C  CD1  . LEU A 1 65 ? 8.636   8.612   -2.623  1.00 0.00 ? 65  LEU A CD1  8  
ATOM   9011  C  CD2  . LEU A 1 65 ? 6.698   7.031   -2.650  1.00 0.00 ? 65  LEU A CD2  8  
ATOM   9012  H  H    . LEU A 1 65 ? 7.196   4.586   -1.456  1.00 0.00 ? 65  LEU A H    8  
ATOM   9013  H  HA   . LEU A 1 65 ? 9.163   5.792   -2.833  1.00 0.00 ? 65  LEU A HA   8  
ATOM   9014  H  HB2  . LEU A 1 65 ? 7.937   6.328   -0.195  1.00 0.00 ? 65  LEU A HB2  8  
ATOM   9015  H  HB3  . LEU A 1 65 ? 9.410   7.218   -0.579  1.00 0.00 ? 65  LEU A HB3  8  
ATOM   9016  H  HG   . LEU A 1 65 ? 7.203   8.367   -1.080  1.00 0.00 ? 65  LEU A HG   8  
ATOM   9017  H  HD11 . LEU A 1 65 ? 8.987   8.053   -3.477  1.00 0.00 ? 65  LEU A HD11 8  
ATOM   9018  H  HD12 . LEU A 1 65 ? 9.481   8.932   -2.030  1.00 0.00 ? 65  LEU A HD12 8  
ATOM   9019  H  HD13 . LEU A 1 65 ? 8.084   9.477   -2.960  1.00 0.00 ? 65  LEU A HD13 8  
ATOM   9020  H  HD21 . LEU A 1 65 ? 7.126   6.127   -3.059  1.00 0.00 ? 65  LEU A HD21 8  
ATOM   9021  H  HD22 . LEU A 1 65 ? 6.405   7.687   -3.457  1.00 0.00 ? 65  LEU A HD22 8  
ATOM   9022  H  HD23 . LEU A 1 65 ? 5.832   6.782   -2.055  1.00 0.00 ? 65  LEU A HD23 8  
ATOM   9023  N  N    . PRO A 1 66 ? 10.460  4.485   -0.078  1.00 0.00 ? 66  PRO A N    8  
ATOM   9024  C  CA   . PRO A 1 66 ? 11.698  4.021   0.554   1.00 0.00 ? 66  PRO A CA   8  
ATOM   9025  C  C    . PRO A 1 66 ? 12.573  3.218   -0.403  1.00 0.00 ? 66  PRO A C    8  
ATOM   9026  O  O    . PRO A 1 66 ? 13.752  3.521   -0.585  1.00 0.00 ? 66  PRO A O    8  
ATOM   9027  C  CB   . PRO A 1 66 ? 11.201  3.132   1.697   1.00 0.00 ? 66  PRO A CB   8  
ATOM   9028  C  CG   . PRO A 1 66 ? 9.844   3.654   2.020   1.00 0.00 ? 66  PRO A CG   8  
ATOM   9029  C  CD   . PRO A 1 66 ? 9.275   4.210   0.751   1.00 0.00 ? 66  PRO A CD   8  
ATOM   9030  H  HA   . PRO A 1 66 ? 12.270  4.843   0.959   1.00 0.00 ? 66  PRO A HA   8  
ATOM   9031  H  HB2  . PRO A 1 66 ? 11.161  2.104   1.366   1.00 0.00 ? 66  PRO A HB2  8  
ATOM   9032  H  HB3  . PRO A 1 66 ? 11.868  3.218   2.542   1.00 0.00 ? 66  PRO A HB3  8  
ATOM   9033  H  HG2  . PRO A 1 66 ? 9.218   2.852   2.382   1.00 0.00 ? 66  PRO A HG2  8  
ATOM   9034  H  HG3  . PRO A 1 66 ? 9.919   4.436   2.761   1.00 0.00 ? 66  PRO A HG3  8  
ATOM   9035  H  HD2  . PRO A 1 66 ? 8.635   3.480   0.278   1.00 0.00 ? 66  PRO A HD2  8  
ATOM   9036  H  HD3  . PRO A 1 66 ? 8.728   5.119   0.955   1.00 0.00 ? 66  PRO A HD3  8  
ATOM   9037  N  N    . CYS A 1 67 ? 11.987  2.193   -1.014  1.00 0.00 ? 67  CYS A N    8  
ATOM   9038  C  CA   . CYS A 1 67 ? 12.712  1.347   -1.953  1.00 0.00 ? 67  CYS A CA   8  
ATOM   9039  C  C    . CYS A 1 67 ? 12.953  2.078   -3.271  1.00 0.00 ? 67  CYS A C    8  
ATOM   9040  O  O    . CYS A 1 67 ? 13.964  1.861   -3.939  1.00 0.00 ? 67  CYS A O    8  
ATOM   9041  C  CB   . CYS A 1 67 ? 11.937  0.053   -2.209  1.00 0.00 ? 67  CYS A CB   8  
ATOM   9042  S  SG   . CYS A 1 67 ? 12.160  -1.215  -0.921  1.00 0.00 ? 67  CYS A SG   8  
ATOM   9043  H  H    . CYS A 1 67 ? 11.043  2.001   -0.828  1.00 0.00 ? 67  CYS A H    8  
ATOM   9044  H  HA   . CYS A 1 67 ? 13.667  1.103   -1.512  1.00 0.00 ? 67  CYS A HA   8  
ATOM   9045  H  HB2  . CYS A 1 67 ? 10.882  0.280   -2.266  1.00 0.00 ? 67  CYS A HB2  8  
ATOM   9046  H  HB3  . CYS A 1 67 ? 12.260  -0.372  -3.148  1.00 0.00 ? 67  CYS A HB3  8  
ATOM   9047  N  N    . HIS A 1 68 ? 12.015  2.946   -3.639  1.00 0.00 ? 68  HIS A N    8  
ATOM   9048  C  CA   . HIS A 1 68 ? 12.125  3.710   -4.877  1.00 0.00 ? 68  HIS A CA   8  
ATOM   9049  C  C    . HIS A 1 68 ? 13.271  4.714   -4.795  1.00 0.00 ? 68  HIS A C    8  
ATOM   9050  O  O    . HIS A 1 68 ? 13.722  5.240   -5.813  1.00 0.00 ? 68  HIS A O    8  
ATOM   9051  C  CB   . HIS A 1 68 ? 10.813  4.439   -5.169  1.00 0.00 ? 68  HIS A CB   8  
ATOM   9052  C  CG   . HIS A 1 68 ? 10.739  5.007   -6.553  1.00 0.00 ? 68  HIS A CG   8  
ATOM   9053  N  ND1  . HIS A 1 68 ? 10.741  6.361   -6.811  1.00 0.00 ? 68  HIS A ND1  8  
ATOM   9054  C  CD2  . HIS A 1 68 ? 10.662  4.395   -7.758  1.00 0.00 ? 68  HIS A CD2  8  
ATOM   9055  C  CE1  . HIS A 1 68 ? 10.667  6.558   -8.115  1.00 0.00 ? 68  HIS A CE1  8  
ATOM   9056  N  NE2  . HIS A 1 68 ? 10.618  5.381   -8.713  1.00 0.00 ? 68  HIS A NE2  8  
ATOM   9057  H  H    . HIS A 1 68 ? 11.232  3.075   -3.065  1.00 0.00 ? 68  HIS A H    8  
ATOM   9058  H  HA   . HIS A 1 68 ? 12.328  3.016   -5.678  1.00 0.00 ? 68  HIS A HA   8  
ATOM   9059  H  HB2  . HIS A 1 68 ? 9.991   3.748   -5.050  1.00 0.00 ? 68  HIS A HB2  8  
ATOM   9060  H  HB3  . HIS A 1 68 ? 10.697  5.253   -4.468  1.00 0.00 ? 68  HIS A HB3  8  
ATOM   9061  H  HD1  . HIS A 1 68 ? 10.789  7.072   -6.139  1.00 0.00 ? 68  HIS A HD1  8  
ATOM   9062  H  HD2  . HIS A 1 68 ? 10.638  3.329   -7.936  1.00 0.00 ? 68  HIS A HD2  8  
ATOM   9063  H  HE1  . HIS A 1 68 ? 10.650  7.518   -8.610  1.00 0.00 ? 68  HIS A HE1  8  
ATOM   9064  N  N    . ASP A 1 69 ? 13.737  4.975   -3.579  1.00 0.00 ? 69  ASP A N    8  
ATOM   9065  C  CA   . ASP A 1 69 ? 14.831  5.915   -3.365  1.00 0.00 ? 69  ASP A CA   8  
ATOM   9066  C  C    . ASP A 1 69 ? 16.175  5.269   -3.686  1.00 0.00 ? 69  ASP A C    8  
ATOM   9067  O  O    . ASP A 1 69 ? 17.034  5.880   -4.321  1.00 0.00 ? 69  ASP A O    8  
ATOM   9068  C  CB   . ASP A 1 69 ? 14.824  6.417   -1.920  1.00 0.00 ? 69  ASP A CB   8  
ATOM   9069  C  CG   . ASP A 1 69 ? 15.895  7.460   -1.664  1.00 0.00 ? 69  ASP A CG   8  
ATOM   9070  O  OD1  . ASP A 1 69 ? 15.935  8.463   -2.407  1.00 0.00 ? 69  ASP A OD1  8  
ATOM   9071  O  OD2  . ASP A 1 69 ? 16.693  7.273   -0.722  1.00 0.00 ? 69  ASP A OD2  8  
ATOM   9072  H  H    . ASP A 1 69 ? 13.336  4.523   -2.806  1.00 0.00 ? 69  ASP A H    8  
ATOM   9073  H  HA   . ASP A 1 69 ? 14.682  6.754   -4.028  1.00 0.00 ? 69  ASP A HA   8  
ATOM   9074  H  HB2  . ASP A 1 69 ? 13.862  6.856   -1.702  1.00 0.00 ? 69  ASP A HB2  8  
ATOM   9075  H  HB3  . ASP A 1 69 ? 14.994  5.583   -1.255  1.00 0.00 ? 69  ASP A HB3  8  
ATOM   9076  N  N    . LYS A 1 70 ? 16.350  4.029   -3.241  1.00 0.00 ? 70  LYS A N    8  
ATOM   9077  C  CA   . LYS A 1 70 ? 17.589  3.298   -3.480  1.00 0.00 ? 70  LYS A CA   8  
ATOM   9078  C  C    . LYS A 1 70 ? 17.695  2.872   -4.941  1.00 0.00 ? 70  LYS A C    8  
ATOM   9079  O  O    . LYS A 1 70 ? 18.788  2.612   -5.443  1.00 0.00 ? 70  LYS A O    8  
ATOM   9080  C  CB   . LYS A 1 70 ? 17.663  2.068   -2.572  1.00 0.00 ? 70  LYS A CB   8  
ATOM   9081  C  CG   . LYS A 1 70 ? 16.950  0.852   -3.137  1.00 0.00 ? 70  LYS A CG   8  
ATOM   9082  C  CD   . LYS A 1 70 ? 16.659  -0.176  -2.056  1.00 0.00 ? 70  LYS A CD   8  
ATOM   9083  C  CE   . LYS A 1 70 ? 15.658  -1.217  -2.531  1.00 0.00 ? 70  LYS A CE   8  
ATOM   9084  N  NZ   . LYS A 1 70 ? 16.322  -2.334  -3.258  1.00 0.00 ? 70  LYS A NZ   8  
ATOM   9085  H  H    . LYS A 1 70 ? 15.628  3.594   -2.740  1.00 0.00 ? 70  LYS A H    8  
ATOM   9086  H  HA   . LYS A 1 70 ? 18.412  3.956   -3.249  1.00 0.00 ? 70  LYS A HA   8  
ATOM   9087  H  HB2  . LYS A 1 70 ? 18.701  1.812   -2.417  1.00 0.00 ? 70  LYS A HB2  8  
ATOM   9088  H  HB3  . LYS A 1 70 ? 17.215  2.312   -1.620  1.00 0.00 ? 70  LYS A HB3  8  
ATOM   9089  H  HG2  . LYS A 1 70 ? 16.017  1.166   -3.581  1.00 0.00 ? 70  LYS A HG2  8  
ATOM   9090  H  HG3  . LYS A 1 70 ? 17.576  0.398   -3.893  1.00 0.00 ? 70  LYS A HG3  8  
ATOM   9091  H  HD2  . LYS A 1 70 ? 17.579  -0.673  -1.787  1.00 0.00 ? 70  LYS A HD2  8  
ATOM   9092  H  HD3  . LYS A 1 70 ? 16.255  0.331   -1.190  1.00 0.00 ? 70  LYS A HD3  8  
ATOM   9093  H  HE2  . LYS A 1 70 ? 15.138  -1.616  -1.674  1.00 0.00 ? 70  LYS A HE2  8  
ATOM   9094  H  HE3  . LYS A 1 70 ? 14.949  -0.740  -3.192  1.00 0.00 ? 70  LYS A HE3  8  
ATOM   9095  H  HZ1  . LYS A 1 70 ? 17.315  -2.093  -3.452  1.00 0.00 ? 70  LYS A HZ1  8  
ATOM   9096  H  HZ2  . LYS A 1 70 ? 15.838  -2.511  -4.161  1.00 0.00 ? 70  LYS A HZ2  8  
ATOM   9097  H  HZ3  . LYS A 1 70 ? 16.292  -3.201  -2.685  1.00 0.00 ? 70  LYS A HZ3  8  
ATOM   9098  N  N    . MET A 1 71 ? 16.553  2.803   -5.617  1.00 0.00 ? 71  MET A N    8  
ATOM   9099  C  CA   . MET A 1 71 ? 16.520  2.410   -7.022  1.00 0.00 ? 71  MET A CA   8  
ATOM   9100  C  C    . MET A 1 71 ? 17.481  3.260   -7.847  1.00 0.00 ? 71  MET A C    8  
ATOM   9101  O  O    . MET A 1 71 ? 18.128  2.765   -8.769  1.00 0.00 ? 71  MET A O    8  
ATOM   9102  C  CB   . MET A 1 71 ? 15.100  2.542   -7.576  1.00 0.00 ? 71  MET A CB   8  
ATOM   9103  C  CG   . MET A 1 71 ? 14.163  1.436   -7.117  1.00 0.00 ? 71  MET A CG   8  
ATOM   9104  S  SD   . MET A 1 71 ? 14.511  -0.144  -7.914  1.00 0.00 ? 71  MET A SD   8  
ATOM   9105  C  CE   . MET A 1 71 ? 13.450  -1.238  -6.972  1.00 0.00 ? 71  MET A CE   8  
ATOM   9106  H  H    . MET A 1 71 ? 15.713  3.021   -5.163  1.00 0.00 ? 71  MET A H    8  
ATOM   9107  H  HA   . MET A 1 71 ? 16.827  1.377   -7.084  1.00 0.00 ? 71  MET A HA   8  
ATOM   9108  H  HB2  . MET A 1 71 ? 14.688  3.488   -7.259  1.00 0.00 ? 71  MET A HB2  8  
ATOM   9109  H  HB3  . MET A 1 71 ? 15.144  2.521   -8.655  1.00 0.00 ? 71  MET A HB3  8  
ATOM   9110  H  HG2  . MET A 1 71 ? 14.267  1.314   -6.049  1.00 0.00 ? 71  MET A HG2  8  
ATOM   9111  H  HG3  . MET A 1 71 ? 13.149  1.725   -7.347  1.00 0.00 ? 71  MET A HG3  8  
ATOM   9112  H  HE1  . MET A 1 71 ? 13.223  -2.114  -7.561  1.00 0.00 ? 71  MET A HE1  8  
ATOM   9113  H  HE2  . MET A 1 71 ? 13.955  -1.535  -6.065  1.00 0.00 ? 71  MET A HE2  8  
ATOM   9114  H  HE3  . MET A 1 71 ? 12.533  -0.724  -6.724  1.00 0.00 ? 71  MET A HE3  8  
ATOM   9115  N  N    . GLY A 1 72 ? 17.570  4.543   -7.509  1.00 0.00 ? 72  GLY A N    8  
ATOM   9116  C  CA   . GLY A 1 72 ? 18.454  5.440   -8.228  1.00 0.00 ? 72  GLY A CA   8  
ATOM   9117  C  C    . GLY A 1 72 ? 19.690  5.802   -7.428  1.00 0.00 ? 72  GLY A C    8  
ATOM   9118  O  O    . GLY A 1 72 ? 19.865  6.954   -7.030  1.00 0.00 ? 72  GLY A O    8  
ATOM   9119  H  H    . GLY A 1 72 ? 17.030  4.883   -6.764  1.00 0.00 ? 72  GLY A H    8  
ATOM   9120  H  HA2  . GLY A 1 72 ? 18.760  4.965   -9.149  1.00 0.00 ? 72  GLY A HA2  8  
ATOM   9121  H  HA3  . GLY A 1 72 ? 17.915  6.346   -8.465  1.00 0.00 ? 72  GLY A HA3  8  
ATOM   9122  N  N    . VAL A 1 73 ? 20.549  4.816   -7.191  1.00 0.00 ? 73  VAL A N    8  
ATOM   9123  C  CA   . VAL A 1 73 ? 21.775  5.036   -6.433  1.00 0.00 ? 73  VAL A CA   8  
ATOM   9124  C  C    . VAL A 1 73 ? 23.005  4.695   -7.266  1.00 0.00 ? 73  VAL A C    8  
ATOM   9125  O  O    . VAL A 1 73 ? 23.968  5.460   -7.311  1.00 0.00 ? 73  VAL A O    8  
ATOM   9126  C  CB   . VAL A 1 73 ? 21.794  4.196   -5.141  1.00 0.00 ? 73  VAL A CB   8  
ATOM   9127  C  CG1  . VAL A 1 73 ? 20.684  4.639   -4.200  1.00 0.00 ? 73  VAL A CG1  8  
ATOM   9128  C  CG2  . VAL A 1 73 ? 21.668  2.716   -5.467  1.00 0.00 ? 73  VAL A CG2  8  
ATOM   9129  H  H    . VAL A 1 73 ? 20.354  3.919   -7.535  1.00 0.00 ? 73  VAL A H    8  
ATOM   9130  H  HA   . VAL A 1 73 ? 21.815  6.080   -6.159  1.00 0.00 ? 73  VAL A HA   8  
ATOM   9131  H  HB   . VAL A 1 73 ? 22.740  4.356   -4.646  1.00 0.00 ? 73  VAL A HB   8  
ATOM   9132  H  HG11 . VAL A 1 73 ? 19.790  4.845   -4.770  1.00 0.00 ? 73  VAL A HG11 8  
ATOM   9133  H  HG12 . VAL A 1 73 ? 20.484  3.855   -3.485  1.00 0.00 ? 73  VAL A HG12 8  
ATOM   9134  H  HG13 . VAL A 1 73 ? 20.991  5.533   -3.677  1.00 0.00 ? 73  VAL A HG13 8  
ATOM   9135  H  HG21 . VAL A 1 73 ? 22.639  2.323   -5.733  1.00 0.00 ? 73  VAL A HG21 8  
ATOM   9136  H  HG22 . VAL A 1 73 ? 21.291  2.187   -4.604  1.00 0.00 ? 73  VAL A HG22 8  
ATOM   9137  H  HG23 . VAL A 1 73 ? 20.987  2.585   -6.295  1.00 0.00 ? 73  VAL A HG23 8  
ATOM   9138  N  N    . SER A 1 74 ? 22.966  3.542   -7.925  1.00 0.00 ? 74  SER A N    8  
ATOM   9139  C  CA   . SER A 1 74 ? 24.079  3.097   -8.755  1.00 0.00 ? 74  SER A CA   8  
ATOM   9140  C  C    . SER A 1 74 ? 24.397  4.127   -9.834  1.00 0.00 ? 74  SER A C    8  
ATOM   9141  O  O    . SER A 1 74 ? 23.497  4.690   -10.456 1.00 0.00 ? 74  SER A O    8  
ATOM   9142  C  CB   . SER A 1 74 ? 23.755  1.748   -9.401  1.00 0.00 ? 74  SER A CB   8  
ATOM   9143  O  OG   . SER A 1 74 ? 24.823  1.305   -10.220 1.00 0.00 ? 74  SER A OG   8  
ATOM   9144  H  H    . SER A 1 74 ? 22.169  2.975   -7.849  1.00 0.00 ? 74  SER A H    8  
ATOM   9145  H  HA   . SER A 1 74 ? 24.943  2.983   -8.117  1.00 0.00 ? 74  SER A HA   8  
ATOM   9146  H  HB2  . SER A 1 74 ? 23.581  1.015   -8.628  1.00 0.00 ? 74  SER A HB2  8  
ATOM   9147  H  HB3  . SER A 1 74 ? 22.867  1.848   -10.009 1.00 0.00 ? 74  SER A HB3  8  
ATOM   9148  H  HG   . SER A 1 74 ? 25.504  0.909   -9.672  1.00 0.00 ? 74  SER A HG   8  
ATOM   9149  N  N    . GLY A 1 75 ? 25.687  4.369   -10.051 1.00 0.00 ? 75  GLY A N    8  
ATOM   9150  C  CA   . GLY A 1 75 ? 26.103  5.331   -11.055 1.00 0.00 ? 75  GLY A CA   8  
ATOM   9151  C  C    . GLY A 1 75 ? 26.486  4.672   -12.365 1.00 0.00 ? 75  GLY A C    8  
ATOM   9152  O  O    . GLY A 1 75 ? 26.147  3.518   -12.627 1.00 0.00 ? 75  GLY A O    8  
ATOM   9153  H  H    . GLY A 1 75 ? 26.361  3.890   -9.525  1.00 0.00 ? 75  GLY A H    8  
ATOM   9154  H  HA2  . GLY A 1 75 ? 25.292  6.021   -11.235 1.00 0.00 ? 75  GLY A HA2  8  
ATOM   9155  H  HA3  . GLY A 1 75 ? 26.953  5.881   -10.680 1.00 0.00 ? 75  GLY A HA3  8  
ATOM   9156  N  N    . PRO A 1 76 ? 27.209  5.415   -13.216 1.00 0.00 ? 76  PRO A N    8  
ATOM   9157  C  CA   . PRO A 1 76 ? 27.654  4.917   -14.521 1.00 0.00 ? 76  PRO A CA   8  
ATOM   9158  C  C    . PRO A 1 76 ? 28.727  3.841   -14.396 1.00 0.00 ? 76  PRO A C    8  
ATOM   9159  O  O    . PRO A 1 76 ? 29.101  3.207   -15.382 1.00 0.00 ? 76  PRO A O    8  
ATOM   9160  C  CB   . PRO A 1 76 ? 28.225  6.164   -15.201 1.00 0.00 ? 76  PRO A CB   8  
ATOM   9161  C  CG   . PRO A 1 76 ? 28.632  7.055   -14.078 1.00 0.00 ? 76  PRO A CG   8  
ATOM   9162  C  CD   . PRO A 1 76 ? 27.649  6.799   -12.969 1.00 0.00 ? 76  PRO A CD   8  
ATOM   9163  H  HA   . PRO A 1 76 ? 26.828  4.535   -15.102 1.00 0.00 ? 76  PRO A HA   8  
ATOM   9164  H  HB2  . PRO A 1 76 ? 29.072  5.887   -15.814 1.00 0.00 ? 76  PRO A HB2  8  
ATOM   9165  H  HB3  . PRO A 1 76 ? 27.465  6.624   -15.814 1.00 0.00 ? 76  PRO A HB3  8  
ATOM   9166  H  HG2  . PRO A 1 76 ? 29.633  6.808   -13.757 1.00 0.00 ? 76  PRO A HG2  8  
ATOM   9167  H  HG3  . PRO A 1 76 ? 28.582  8.087   -14.392 1.00 0.00 ? 76  PRO A HG3  8  
ATOM   9168  H  HD2  . PRO A 1 76 ? 28.134  6.884   -12.008 1.00 0.00 ? 76  PRO A HD2  8  
ATOM   9169  H  HD3  . PRO A 1 76 ? 26.818  7.485   -13.036 1.00 0.00 ? 76  PRO A HD3  8  
ATOM   9170  N  N    . SER A 1 77 ? 29.216  3.638   -13.177 1.00 0.00 ? 77  SER A N    8  
ATOM   9171  C  CA   . SER A 1 77 ? 30.248  2.640   -12.924 1.00 0.00 ? 77  SER A CA   8  
ATOM   9172  C  C    . SER A 1 77 ? 29.857  1.291   -13.519 1.00 0.00 ? 77  SER A C    8  
ATOM   9173  O  O    . SER A 1 77 ? 28.796  0.748   -13.211 1.00 0.00 ? 77  SER A O    8  
ATOM   9174  C  CB   . SER A 1 77 ? 30.490  2.495   -11.420 1.00 0.00 ? 77  SER A CB   8  
ATOM   9175  O  OG   . SER A 1 77 ? 29.463  1.733   -10.809 1.00 0.00 ? 77  SER A OG   8  
ATOM   9176  H  H    . SER A 1 77 ? 28.877  4.175   -12.430 1.00 0.00 ? 77  SER A H    8  
ATOM   9177  H  HA   . SER A 1 77 ? 31.159  2.978   -13.395 1.00 0.00 ? 77  SER A HA   8  
ATOM   9178  H  HB2  . SER A 1 77 ? 31.435  2.001   -11.255 1.00 0.00 ? 77  SER A HB2  8  
ATOM   9179  H  HB3  . SER A 1 77 ? 30.513  3.476   -10.966 1.00 0.00 ? 77  SER A HB3  8  
ATOM   9180  H  HG   . SER A 1 77 ? 28.684  1.739   -11.369 1.00 0.00 ? 77  SER A HG   8  
ATOM   9181  N  N    . SER A 1 78 ? 30.722  0.756   -14.375 1.00 0.00 ? 78  SER A N    8  
ATOM   9182  C  CA   . SER A 1 78 ? 30.467  -0.528  -15.017 1.00 0.00 ? 78  SER A CA   8  
ATOM   9183  C  C    . SER A 1 78 ? 30.017  -1.568  -13.995 1.00 0.00 ? 78  SER A C    8  
ATOM   9184  O  O    . SER A 1 78 ? 29.101  -2.349  -14.249 1.00 0.00 ? 78  SER A O    8  
ATOM   9185  C  CB   . SER A 1 78 ? 31.722  -1.018  -15.742 1.00 0.00 ? 78  SER A CB   8  
ATOM   9186  O  OG   . SER A 1 78 ? 32.105  -0.116  -16.765 1.00 0.00 ? 78  SER A OG   8  
ATOM   9187  H  H    . SER A 1 78 ? 31.551  1.237   -14.580 1.00 0.00 ? 78  SER A H    8  
ATOM   9188  H  HA   . SER A 1 78 ? 29.677  -0.386  -15.740 1.00 0.00 ? 78  SER A HA   8  
ATOM   9189  H  HB2  . SER A 1 78 ? 32.532  -1.106  -15.035 1.00 0.00 ? 78  SER A HB2  8  
ATOM   9190  H  HB3  . SER A 1 78 ? 31.524  -1.984  -16.185 1.00 0.00 ? 78  SER A HB3  8  
ATOM   9191  H  HG   . SER A 1 78 ? 32.851  -0.478  -17.249 1.00 0.00 ? 78  SER A HG   8  
ATOM   9192  N  N    . GLY A 1 79 ? 30.671  -1.571  -12.837 1.00 0.00 ? 79  GLY A N    8  
ATOM   9193  C  CA   . GLY A 1 79 ? 30.326  -2.518  -11.793 1.00 0.00 ? 79  GLY A CA   8  
ATOM   9194  C  C    . GLY A 1 79 ? 31.021  -3.853  -11.969 1.00 0.00 ? 79  GLY A C    8  
ATOM   9195  O  O    . GLY A 1 79 ? 32.010  -4.108  -11.282 1.00 0.00 ? 79  GLY A O    8  
ATOM   9196  H  H    . GLY A 1 79 ? 31.393  -0.925  -12.690 1.00 0.00 ? 79  GLY A H    8  
ATOM   9197  H  HA2  . GLY A 1 79 ? 30.605  -2.101  -10.837 1.00 0.00 ? 79  GLY A HA2  8  
ATOM   9198  H  HA3  . GLY A 1 79 ? 29.257  -2.677  -11.807 1.00 0.00 ? 79  GLY A HA3  8  
HETATM 9199  ZN ZN   . ZN  B 2 .  ? -9.715  -0.479  -2.386  1.00 0.00 ? 201 ZN  A ZN   8  
HETATM 9200  ZN ZN   . ZN  C 2 .  ? 9.829   -1.301  -0.497  1.00 0.00 ? 401 ZN  A ZN   8  
ATOM   9201  N  N    . GLY A 1 1  ? -8.454  -20.965 8.874   1.00 0.00 ? 1   GLY A N    9  
ATOM   9202  C  CA   . GLY A 1 1  ? -8.547  -19.714 8.144   1.00 0.00 ? 1   GLY A CA   9  
ATOM   9203  C  C    . GLY A 1 1  ? -8.342  -18.505 9.036   1.00 0.00 ? 1   GLY A C    9  
ATOM   9204  O  O    . GLY A 1 1  ? -8.450  -18.602 10.258  1.00 0.00 ? 1   GLY A O    9  
ATOM   9205  H  H1   . GLY A 1 1  ? -8.485  -20.961 9.854   1.00 0.00 ? 1   GLY A H1   9  
ATOM   9206  H  HA2  . GLY A 1 1  ? -7.796  -19.707 7.368   1.00 0.00 ? 1   GLY A HA2  9  
ATOM   9207  H  HA3  . GLY A 1 1  ? -9.523  -19.649 7.687   1.00 0.00 ? 1   GLY A HA3  9  
ATOM   9208  N  N    . SER A 1 2  ? -8.046  -17.364 8.423   1.00 0.00 ? 2   SER A N    9  
ATOM   9209  C  CA   . SER A 1 2  ? -7.820  -16.132 9.171   1.00 0.00 ? 2   SER A CA   9  
ATOM   9210  C  C    . SER A 1 2  ? -8.812  -15.051 8.749   1.00 0.00 ? 2   SER A C    9  
ATOM   9211  O  O    . SER A 1 2  ? -8.620  -14.379 7.736   1.00 0.00 ? 2   SER A O    9  
ATOM   9212  C  CB   . SER A 1 2  ? -6.389  -15.636 8.959   1.00 0.00 ? 2   SER A CB   9  
ATOM   9213  O  OG   . SER A 1 2  ? -5.493  -16.263 9.861   1.00 0.00 ? 2   SER A OG   9  
ATOM   9214  H  H    . SER A 1 2  ? -7.974  -17.350 7.446   1.00 0.00 ? 2   SER A H    9  
ATOM   9215  H  HA   . SER A 1 2  ? -7.966  -16.348 10.218  1.00 0.00 ? 2   SER A HA   9  
ATOM   9216  H  HB2  . SER A 1 2  ? -6.079  -15.860 7.949   1.00 0.00 ? 2   SER A HB2  9  
ATOM   9217  H  HB3  . SER A 1 2  ? -6.353  -14.568 9.118   1.00 0.00 ? 2   SER A HB3  9  
ATOM   9218  H  HG   . SER A 1 2  ? -5.005  -16.950 9.402   1.00 0.00 ? 2   SER A HG   9  
ATOM   9219  N  N    . SER A 1 3  ? -9.873  -14.892 9.534   1.00 0.00 ? 3   SER A N    9  
ATOM   9220  C  CA   . SER A 1 3  ? -10.897 -13.896 9.241   1.00 0.00 ? 3   SER A CA   9  
ATOM   9221  C  C    . SER A 1 3  ? -11.234 -13.081 10.486  1.00 0.00 ? 3   SER A C    9  
ATOM   9222  O  O    . SER A 1 3  ? -11.333 -13.620 11.587  1.00 0.00 ? 3   SER A O    9  
ATOM   9223  C  CB   . SER A 1 3  ? -12.159 -14.575 8.705   1.00 0.00 ? 3   SER A CB   9  
ATOM   9224  O  OG   . SER A 1 3  ? -12.926 -13.679 7.919   1.00 0.00 ? 3   SER A OG   9  
ATOM   9225  H  H    . SER A 1 3  ? -9.969  -15.459 10.327  1.00 0.00 ? 3   SER A H    9  
ATOM   9226  H  HA   . SER A 1 3  ? -10.507 -13.232 8.484   1.00 0.00 ? 3   SER A HA   9  
ATOM   9227  H  HB2  . SER A 1 3  ? -11.879 -15.420 8.095   1.00 0.00 ? 3   SER A HB2  9  
ATOM   9228  H  HB3  . SER A 1 3  ? -12.762 -14.914 9.535   1.00 0.00 ? 3   SER A HB3  9  
ATOM   9229  H  HG   . SER A 1 3  ? -13.595 -14.169 7.436   1.00 0.00 ? 3   SER A HG   9  
ATOM   9230  N  N    . GLY A 1 4  ? -11.410 -11.776 10.301  1.00 0.00 ? 4   GLY A N    9  
ATOM   9231  C  CA   . GLY A 1 4  ? -11.733 -10.906 11.417  1.00 0.00 ? 4   GLY A CA   9  
ATOM   9232  C  C    . GLY A 1 4  ? -11.265 -9.481  11.196  1.00 0.00 ? 4   GLY A C    9  
ATOM   9233  O  O    . GLY A 1 4  ? -10.125 -9.139  11.513  1.00 0.00 ? 4   GLY A O    9  
ATOM   9234  H  H    . GLY A 1 4  ? -11.318 -11.401 9.400   1.00 0.00 ? 4   GLY A H    9  
ATOM   9235  H  HA2  . GLY A 1 4  ? -12.804 -10.904 11.559  1.00 0.00 ? 4   GLY A HA2  9  
ATOM   9236  H  HA3  . GLY A 1 4  ? -11.263 -11.293 12.308  1.00 0.00 ? 4   GLY A HA3  9  
ATOM   9237  N  N    . SER A 1 5  ? -12.144 -8.649  10.649  1.00 0.00 ? 5   SER A N    9  
ATOM   9238  C  CA   . SER A 1 5  ? -11.813 -7.254  10.381  1.00 0.00 ? 5   SER A CA   9  
ATOM   9239  C  C    . SER A 1 5  ? -13.075 -6.401  10.299  1.00 0.00 ? 5   SER A C    9  
ATOM   9240  O  O    . SER A 1 5  ? -14.189 -6.924  10.264  1.00 0.00 ? 5   SER A O    9  
ATOM   9241  C  CB   . SER A 1 5  ? -11.020 -7.138  9.077   1.00 0.00 ? 5   SER A CB   9  
ATOM   9242  O  OG   . SER A 1 5  ? -9.820  -7.888  9.142   1.00 0.00 ? 5   SER A OG   9  
ATOM   9243  H  H    . SER A 1 5  ? -13.037 -8.981  10.418  1.00 0.00 ? 5   SER A H    9  
ATOM   9244  H  HA   . SER A 1 5  ? -11.202 -6.896  11.196  1.00 0.00 ? 5   SER A HA   9  
ATOM   9245  H  HB2  . SER A 1 5  ? -11.620 -7.510  8.260   1.00 0.00 ? 5   SER A HB2  9  
ATOM   9246  H  HB3  . SER A 1 5  ? -10.774 -6.101  8.900   1.00 0.00 ? 5   SER A HB3  9  
ATOM   9247  H  HG   . SER A 1 5  ? -9.628  -8.260  8.278   1.00 0.00 ? 5   SER A HG   9  
ATOM   9248  N  N    . SER A 1 6  ? -12.892 -5.085  10.270  1.00 0.00 ? 6   SER A N    9  
ATOM   9249  C  CA   . SER A 1 6  ? -14.015 -4.158  10.197  1.00 0.00 ? 6   SER A CA   9  
ATOM   9250  C  C    . SER A 1 6  ? -13.734 -3.042  9.196   1.00 0.00 ? 6   SER A C    9  
ATOM   9251  O  O    . SER A 1 6  ? -12.626 -2.926  8.674   1.00 0.00 ? 6   SER A O    9  
ATOM   9252  C  CB   . SER A 1 6  ? -14.302 -3.562  11.576  1.00 0.00 ? 6   SER A CB   9  
ATOM   9253  O  OG   . SER A 1 6  ? -13.186 -2.835  12.060  1.00 0.00 ? 6   SER A OG   9  
ATOM   9254  H  H    . SER A 1 6  ? -11.979 -4.729  10.301  1.00 0.00 ? 6   SER A H    9  
ATOM   9255  H  HA   . SER A 1 6  ? -14.881 -4.712  9.867   1.00 0.00 ? 6   SER A HA   9  
ATOM   9256  H  HB2  . SER A 1 6  ? -15.148 -2.895  11.508  1.00 0.00 ? 6   SER A HB2  9  
ATOM   9257  H  HB3  . SER A 1 6  ? -14.526 -4.359  12.271  1.00 0.00 ? 6   SER A HB3  9  
ATOM   9258  H  HG   . SER A 1 6  ? -12.882 -2.226  11.383  1.00 0.00 ? 6   SER A HG   9  
ATOM   9259  N  N    . GLY A 1 7  ? -14.747 -2.222  8.933   1.00 0.00 ? 7   GLY A N    9  
ATOM   9260  C  CA   . GLY A 1 7  ? -14.590 -1.125  7.996   1.00 0.00 ? 7   GLY A CA   9  
ATOM   9261  C  C    . GLY A 1 7  ? -15.919 -0.564  7.532   1.00 0.00 ? 7   GLY A C    9  
ATOM   9262  O  O    . GLY A 1 7  ? -16.635 -1.204  6.761   1.00 0.00 ? 7   GLY A O    9  
ATOM   9263  H  H    . GLY A 1 7  ? -15.608 -2.363  9.379   1.00 0.00 ? 7   GLY A H    9  
ATOM   9264  H  HA2  . GLY A 1 7  ? -14.025 -0.338  8.471   1.00 0.00 ? 7   GLY A HA2  9  
ATOM   9265  H  HA3  . GLY A 1 7  ? -14.042 -1.479  7.135   1.00 0.00 ? 7   GLY A HA3  9  
ATOM   9266  N  N    . GLU A 1 8  ? -16.252 0.633   8.003   1.00 0.00 ? 8   GLU A N    9  
ATOM   9267  C  CA   . GLU A 1 8  ? -17.506 1.278   7.633   1.00 0.00 ? 8   GLU A CA   9  
ATOM   9268  C  C    . GLU A 1 8  ? -17.684 1.291   6.117   1.00 0.00 ? 8   GLU A C    9  
ATOM   9269  O  O    . GLU A 1 8  ? -16.748 1.014   5.368   1.00 0.00 ? 8   GLU A O    9  
ATOM   9270  C  CB   . GLU A 1 8  ? -17.549 2.708   8.175   1.00 0.00 ? 8   GLU A CB   9  
ATOM   9271  C  CG   . GLU A 1 8  ? -18.953 3.198   8.488   1.00 0.00 ? 8   GLU A CG   9  
ATOM   9272  C  CD   . GLU A 1 8  ? -18.960 4.555   9.165   1.00 0.00 ? 8   GLU A CD   9  
ATOM   9273  O  OE1  . GLU A 1 8  ? -18.751 4.604   10.395  1.00 0.00 ? 8   GLU A OE1  9  
ATOM   9274  O  OE2  . GLU A 1 8  ? -19.175 5.567   8.466   1.00 0.00 ? 8   GLU A OE2  9  
ATOM   9275  H  H    . GLU A 1 8  ? -15.640 1.094   8.614   1.00 0.00 ? 8   GLU A H    9  
ATOM   9276  H  HA   . GLU A 1 8  ? -18.313 0.712   8.073   1.00 0.00 ? 8   GLU A HA   9  
ATOM   9277  H  HB2  . GLU A 1 8  ? -16.963 2.755   9.080   1.00 0.00 ? 8   GLU A HB2  9  
ATOM   9278  H  HB3  . GLU A 1 8  ? -17.115 3.371   7.441   1.00 0.00 ? 8   GLU A HB3  9  
ATOM   9279  H  HG2  . GLU A 1 8  ? -19.510 3.271   7.565   1.00 0.00 ? 8   GLU A HG2  9  
ATOM   9280  H  HG3  . GLU A 1 8  ? -19.433 2.484   9.141   1.00 0.00 ? 8   GLU A HG3  9  
ATOM   9281  N  N    . LYS A 1 9  ? -18.894 1.615   5.673   1.00 0.00 ? 9   LYS A N    9  
ATOM   9282  C  CA   . LYS A 1 9  ? -19.197 1.666   4.247   1.00 0.00 ? 9   LYS A CA   9  
ATOM   9283  C  C    . LYS A 1 9  ? -19.662 3.060   3.839   1.00 0.00 ? 9   LYS A C    9  
ATOM   9284  O  O    . LYS A 1 9  ? -20.417 3.710   4.562   1.00 0.00 ? 9   LYS A O    9  
ATOM   9285  C  CB   . LYS A 1 9  ? -20.273 0.635   3.897   1.00 0.00 ? 9   LYS A CB   9  
ATOM   9286  C  CG   . LYS A 1 9  ? -21.567 0.820   4.671   1.00 0.00 ? 9   LYS A CG   9  
ATOM   9287  C  CD   . LYS A 1 9  ? -21.555 0.034   5.972   1.00 0.00 ? 9   LYS A CD   9  
ATOM   9288  C  CE   . LYS A 1 9  ? -21.804 -1.447  5.731   1.00 0.00 ? 9   LYS A CE   9  
ATOM   9289  N  NZ   . LYS A 1 9  ? -23.214 -1.716  5.334   1.00 0.00 ? 9   LYS A NZ   9  
ATOM   9290  H  H    . LYS A 1 9  ? -19.600 1.827   6.319   1.00 0.00 ? 9   LYS A H    9  
ATOM   9291  H  HA   . LYS A 1 9  ? -18.294 1.428   3.707   1.00 0.00 ? 9   LYS A HA   9  
ATOM   9292  H  HB2  . LYS A 1 9  ? -20.495 0.709   2.843   1.00 0.00 ? 9   LYS A HB2  9  
ATOM   9293  H  HB3  . LYS A 1 9  ? -19.890 -0.353  4.108   1.00 0.00 ? 9   LYS A HB3  9  
ATOM   9294  H  HG2  . LYS A 1 9  ? -21.694 1.868   4.897   1.00 0.00 ? 9   LYS A HG2  9  
ATOM   9295  H  HG3  . LYS A 1 9  ? -22.392 0.478   4.062   1.00 0.00 ? 9   LYS A HG3  9  
ATOM   9296  H  HD2  . LYS A 1 9  ? -20.593 0.154   6.446   1.00 0.00 ? 9   LYS A HD2  9  
ATOM   9297  H  HD3  . LYS A 1 9  ? -22.329 0.419   6.622   1.00 0.00 ? 9   LYS A HD3  9  
ATOM   9298  H  HE2  . LYS A 1 9  ? -21.147 -1.785  4.944   1.00 0.00 ? 9   LYS A HE2  9  
ATOM   9299  H  HE3  . LYS A 1 9  ? -21.585 -1.988  6.640   1.00 0.00 ? 9   LYS A HE3  9  
ATOM   9300  H  HZ1  . LYS A 1 9  ? -23.721 -0.819  5.190   1.00 0.00 ? 9   LYS A HZ1  9  
ATOM   9301  H  HZ2  . LYS A 1 9  ? -23.697 -2.258  6.079   1.00 0.00 ? 9   LYS A HZ2  9  
ATOM   9302  H  HZ3  . LYS A 1 9  ? -23.239 -2.262  4.450   1.00 0.00 ? 9   LYS A HZ3  9  
ATOM   9303  N  N    . ALA A 1 10 ? -19.208 3.513   2.675   1.00 0.00 ? 10  ALA A N    9  
ATOM   9304  C  CA   . ALA A 1 10 ? -19.580 4.829   2.170   1.00 0.00 ? 10  ALA A CA   9  
ATOM   9305  C  C    . ALA A 1 10 ? -19.759 4.805   0.656   1.00 0.00 ? 10  ALA A C    9  
ATOM   9306  O  O    . ALA A 1 10 ? -19.264 3.905   -0.023  1.00 0.00 ? 10  ALA A O    9  
ATOM   9307  C  CB   . ALA A 1 10 ? -18.533 5.861   2.563   1.00 0.00 ? 10  ALA A CB   9  
ATOM   9308  H  H    . ALA A 1 10 ? -18.609 2.949   2.144   1.00 0.00 ? 10  ALA A H    9  
ATOM   9309  H  HA   . ALA A 1 10 ? -20.517 5.110   2.629   1.00 0.00 ? 10  ALA A HA   9  
ATOM   9310  H  HB1  . ALA A 1 10 ? -18.603 6.713   1.902   1.00 0.00 ? 10  ALA A HB1  9  
ATOM   9311  H  HB2  . ALA A 1 10 ? -18.706 6.179   3.580   1.00 0.00 ? 10  ALA A HB2  9  
ATOM   9312  H  HB3  . ALA A 1 10 ? -17.549 5.423   2.485   1.00 0.00 ? 10  ALA A HB3  9  
ATOM   9313  N  N    . ARG A 1 11 ? -20.470 5.798   0.133   1.00 0.00 ? 11  ARG A N    9  
ATOM   9314  C  CA   . ARG A 1 11 ? -20.715 5.889   -1.302  1.00 0.00 ? 11  ARG A CA   9  
ATOM   9315  C  C    . ARG A 1 11 ? -21.155 7.298   -1.689  1.00 0.00 ? 11  ARG A C    9  
ATOM   9316  O  O    . ARG A 1 11 ? -21.470 8.120   -0.830  1.00 0.00 ? 11  ARG A O    9  
ATOM   9317  C  CB   . ARG A 1 11 ? -21.781 4.877   -1.723  1.00 0.00 ? 11  ARG A CB   9  
ATOM   9318  C  CG   . ARG A 1 11 ? -23.157 5.163   -1.144  1.00 0.00 ? 11  ARG A CG   9  
ATOM   9319  C  CD   . ARG A 1 11 ? -24.151 4.070   -1.502  1.00 0.00 ? 11  ARG A CD   9  
ATOM   9320  N  NE   . ARG A 1 11 ? -25.299 4.056   -0.598  1.00 0.00 ? 11  ARG A NE   9  
ATOM   9321  C  CZ   . ARG A 1 11 ? -26.471 3.514   -0.908  1.00 0.00 ? 11  ARG A CZ   9  
ATOM   9322  N  NH1  . ARG A 1 11 ? -26.651 2.946   -2.092  1.00 0.00 ? 11  ARG A NH1  9  
ATOM   9323  N  NH2  . ARG A 1 11 ? -27.468 3.541   -0.032  1.00 0.00 ? 11  ARG A NH2  9  
ATOM   9324  H  H    . ARG A 1 11 ? -20.839 6.486   0.725   1.00 0.00 ? 11  ARG A H    9  
ATOM   9325  H  HA   . ARG A 1 11 ? -19.792 5.660   -1.812  1.00 0.00 ? 11  ARG A HA   9  
ATOM   9326  H  HB2  . ARG A 1 11 ? -21.861 4.882   -2.801  1.00 0.00 ? 11  ARG A HB2  9  
ATOM   9327  H  HB3  . ARG A 1 11 ? -21.475 3.894   -1.398  1.00 0.00 ? 11  ARG A HB3  9  
ATOM   9328  H  HG2  . ARG A 1 11 ? -23.079 5.224   -0.068  1.00 0.00 ? 11  ARG A HG2  9  
ATOM   9329  H  HG3  . ARG A 1 11 ? -23.513 6.104   -1.535  1.00 0.00 ? 11  ARG A HG3  9  
ATOM   9330  H  HD2  . ARG A 1 11 ? -24.501 4.236   -2.510  1.00 0.00 ? 11  ARG A HD2  9  
ATOM   9331  H  HD3  . ARG A 1 11 ? -23.650 3.115   -1.448  1.00 0.00 ? 11  ARG A HD3  9  
ATOM   9332  H  HE   . ARG A 1 11 ? -25.188 4.471   0.282   1.00 0.00 ? 11  ARG A HE   9  
ATOM   9333  H  HH11 . ARG A 1 11 ? -25.902 2.923   -2.754  1.00 0.00 ? 11  ARG A HH11 9  
ATOM   9334  H  HH12 . ARG A 1 11 ? -27.535 2.538   -2.322  1.00 0.00 ? 11  ARG A HH12 9  
ATOM   9335  H  HH21 . ARG A 1 11 ? -27.336 3.969   0.862   1.00 0.00 ? 11  ARG A HH21 9  
ATOM   9336  H  HH22 . ARG A 1 11 ? -28.350 3.134   -0.266  1.00 0.00 ? 11  ARG A HH22 9  
ATOM   9337  N  N    . GLY A 1 12 ? -21.173 7.570   -2.991  1.00 0.00 ? 12  GLY A N    9  
ATOM   9338  C  CA   . GLY A 1 12 ? -21.575 8.879   -3.470  1.00 0.00 ? 12  GLY A CA   9  
ATOM   9339  C  C    . GLY A 1 12 ? -20.414 9.669   -4.041  1.00 0.00 ? 12  GLY A C    9  
ATOM   9340  O  O    . GLY A 1 12 ? -19.627 9.146   -4.832  1.00 0.00 ? 12  GLY A O    9  
ATOM   9341  H  H    . GLY A 1 12 ? -20.912 6.875   -3.631  1.00 0.00 ? 12  GLY A H    9  
ATOM   9342  H  HA2  . GLY A 1 12 ? -22.325 8.756   -4.237  1.00 0.00 ? 12  GLY A HA2  9  
ATOM   9343  H  HA3  . GLY A 1 12 ? -22.003 9.435   -2.648  1.00 0.00 ? 12  GLY A HA3  9  
ATOM   9344  N  N    . LEU A 1 13 ? -20.306 10.932  -3.643  1.00 0.00 ? 13  LEU A N    9  
ATOM   9345  C  CA   . LEU A 1 13 ? -19.233 11.796  -4.122  1.00 0.00 ? 13  LEU A CA   9  
ATOM   9346  C  C    . LEU A 1 13 ? -18.467 12.411  -2.955  1.00 0.00 ? 13  LEU A C    9  
ATOM   9347  O  O    . LEU A 1 13 ? -18.890 12.317  -1.803  1.00 0.00 ? 13  LEU A O    9  
ATOM   9348  C  CB   . LEU A 1 13 ? -19.802 12.903  -5.012  1.00 0.00 ? 13  LEU A CB   9  
ATOM   9349  C  CG   . LEU A 1 13 ? -20.388 14.114  -4.286  1.00 0.00 ? 13  LEU A CG   9  
ATOM   9350  C  CD1  . LEU A 1 13 ? -20.277 15.360  -5.151  1.00 0.00 ? 13  LEU A CD1  9  
ATOM   9351  C  CD2  . LEU A 1 13 ? -21.837 13.857  -3.902  1.00 0.00 ? 13  LEU A CD2  9  
ATOM   9352  H  H    . LEU A 1 13 ? -20.963 11.292  -3.012  1.00 0.00 ? 13  LEU A H    9  
ATOM   9353  H  HA   . LEU A 1 13 ? -18.555 11.191  -4.703  1.00 0.00 ? 13  LEU A HA   9  
ATOM   9354  H  HB2  . LEU A 1 13 ? -19.007 13.253  -5.652  1.00 0.00 ? 13  LEU A HB2  9  
ATOM   9355  H  HB3  . LEU A 1 13 ? -20.585 12.469  -5.618  1.00 0.00 ? 13  LEU A HB3  9  
ATOM   9356  H  HG   . LEU A 1 13 ? -19.826 14.288  -3.378  1.00 0.00 ? 13  LEU A HG   9  
ATOM   9357  H  HD11 . LEU A 1 13 ? -19.624 15.161  -5.987  1.00 0.00 ? 13  LEU A HD11 9  
ATOM   9358  H  HD12 . LEU A 1 13 ? -19.872 16.171  -4.563  1.00 0.00 ? 13  LEU A HD12 9  
ATOM   9359  H  HD13 . LEU A 1 13 ? -21.256 15.633  -5.515  1.00 0.00 ? 13  LEU A HD13 9  
ATOM   9360  H  HD21 . LEU A 1 13 ? -22.079 12.820  -4.085  1.00 0.00 ? 13  LEU A HD21 9  
ATOM   9361  H  HD22 . LEU A 1 13 ? -22.484 14.487  -4.495  1.00 0.00 ? 13  LEU A HD22 9  
ATOM   9362  H  HD23 . LEU A 1 13 ? -21.977 14.080  -2.855  1.00 0.00 ? 13  LEU A HD23 9  
ATOM   9363  N  N    . GLY A 1 14 ? -17.338 13.042  -3.261  1.00 0.00 ? 14  GLY A N    9  
ATOM   9364  C  CA   . GLY A 1 14 ? -16.532 13.664  -2.228  1.00 0.00 ? 14  GLY A CA   9  
ATOM   9365  C  C    . GLY A 1 14 ? -15.068 13.284  -2.326  1.00 0.00 ? 14  GLY A C    9  
ATOM   9366  O  O    . GLY A 1 14 ? -14.187 14.087  -2.018  1.00 0.00 ? 14  GLY A O    9  
ATOM   9367  H  H    . GLY A 1 14 ? -17.050 13.085  -4.197  1.00 0.00 ? 14  GLY A H    9  
ATOM   9368  H  HA2  . GLY A 1 14 ? -16.621 14.737  -2.314  1.00 0.00 ? 14  GLY A HA2  9  
ATOM   9369  H  HA3  . GLY A 1 14 ? -16.907 13.358  -1.262  1.00 0.00 ? 14  GLY A HA3  9  
ATOM   9370  N  N    . LYS A 1 15 ? -14.805 12.054  -2.756  1.00 0.00 ? 15  LYS A N    9  
ATOM   9371  C  CA   . LYS A 1 15 ? -13.438 11.567  -2.895  1.00 0.00 ? 15  LYS A CA   9  
ATOM   9372  C  C    . LYS A 1 15 ? -13.337 10.542  -4.020  1.00 0.00 ? 15  LYS A C    9  
ATOM   9373  O  O    . LYS A 1 15 ? -14.349 10.113  -4.575  1.00 0.00 ? 15  LYS A O    9  
ATOM   9374  C  CB   . LYS A 1 15 ? -12.960 10.946  -1.580  1.00 0.00 ? 15  LYS A CB   9  
ATOM   9375  C  CG   . LYS A 1 15 ? -12.673 11.968  -0.494  1.00 0.00 ? 15  LYS A CG   9  
ATOM   9376  C  CD   . LYS A 1 15 ? -13.906 12.246  0.350   1.00 0.00 ? 15  LYS A CD   9  
ATOM   9377  C  CE   . LYS A 1 15 ? -13.993 11.300  1.538   1.00 0.00 ? 15  LYS A CE   9  
ATOM   9378  N  NZ   . LYS A 1 15 ? -13.089 11.716  2.646   1.00 0.00 ? 15  LYS A NZ   9  
ATOM   9379  H  H    . LYS A 1 15 ? -15.550 11.460  -2.987  1.00 0.00 ? 15  LYS A H    9  
ATOM   9380  H  HA   . LYS A 1 15 ? -12.808 12.411  -3.134  1.00 0.00 ? 15  LYS A HA   9  
ATOM   9381  H  HB2  . LYS A 1 15 ? -13.721 10.270  -1.218  1.00 0.00 ? 15  LYS A HB2  9  
ATOM   9382  H  HB3  . LYS A 1 15 ? -12.055 10.387  -1.768  1.00 0.00 ? 15  LYS A HB3  9  
ATOM   9383  H  HG2  . LYS A 1 15 ? -11.890 11.589  0.146   1.00 0.00 ? 15  LYS A HG2  9  
ATOM   9384  H  HG3  . LYS A 1 15 ? -12.349 12.889  -0.956  1.00 0.00 ? 15  LYS A HG3  9  
ATOM   9385  H  HD2  . LYS A 1 15 ? -13.860 13.261  0.715   1.00 0.00 ? 15  LYS A HD2  9  
ATOM   9386  H  HD3  . LYS A 1 15 ? -14.787 12.121  -0.263  1.00 0.00 ? 15  LYS A HD3  9  
ATOM   9387  H  HE2  . LYS A 1 15 ? -15.010 11.289  1.900   1.00 0.00 ? 15  LYS A HE2  9  
ATOM   9388  H  HE3  . LYS A 1 15 ? -13.716 10.308  1.213   1.00 0.00 ? 15  LYS A HE3  9  
ATOM   9389  H  HZ1  . LYS A 1 15 ? -13.328 12.679  2.959   1.00 0.00 ? 15  LYS A HZ1  9  
ATOM   9390  H  HZ2  . LYS A 1 15 ? -12.100 11.704  2.324   1.00 0.00 ? 15  LYS A HZ2  9  
ATOM   9391  H  HZ3  . LYS A 1 15 ? -13.188 11.067  3.452   1.00 0.00 ? 15  LYS A HZ3  9  
ATOM   9392  N  N    . TYR A 1 16 ? -12.111 10.154  -4.351  1.00 0.00 ? 16  TYR A N    9  
ATOM   9393  C  CA   . TYR A 1 16 ? -11.878 9.180   -5.411  1.00 0.00 ? 16  TYR A CA   9  
ATOM   9394  C  C    . TYR A 1 16 ? -12.352 7.792   -4.990  1.00 0.00 ? 16  TYR A C    9  
ATOM   9395  O  O    . TYR A 1 16 ? -12.043 7.325   -3.893  1.00 0.00 ? 16  TYR A O    9  
ATOM   9396  C  CB   . TYR A 1 16 ? -10.392 9.135   -5.774  1.00 0.00 ? 16  TYR A CB   9  
ATOM   9397  C  CG   . TYR A 1 16 ? -9.919  10.350  -6.538  1.00 0.00 ? 16  TYR A CG   9  
ATOM   9398  C  CD1  . TYR A 1 16 ? -9.962  11.615  -5.965  1.00 0.00 ? 16  TYR A CD1  9  
ATOM   9399  C  CD2  . TYR A 1 16 ? -9.429  10.234  -7.833  1.00 0.00 ? 16  TYR A CD2  9  
ATOM   9400  C  CE1  . TYR A 1 16 ? -9.531  12.729  -6.659  1.00 0.00 ? 16  TYR A CE1  9  
ATOM   9401  C  CE2  . TYR A 1 16 ? -8.994  11.342  -8.534  1.00 0.00 ? 16  TYR A CE2  9  
ATOM   9402  C  CZ   . TYR A 1 16 ? -9.047  12.587  -7.943  1.00 0.00 ? 16  TYR A CZ   9  
ATOM   9403  O  OH   . TYR A 1 16 ? -8.616  13.694  -8.639  1.00 0.00 ? 16  TYR A OH   9  
ATOM   9404  H  H    . TYR A 1 16 ? -11.343 10.532  -3.873  1.00 0.00 ? 16  TYR A H    9  
ATOM   9405  H  HA   . TYR A 1 16 ? -12.441 9.492   -6.278  1.00 0.00 ? 16  TYR A HA   9  
ATOM   9406  H  HB2  . TYR A 1 16 ? -9.810  9.065   -4.868  1.00 0.00 ? 16  TYR A HB2  9  
ATOM   9407  H  HB3  . TYR A 1 16 ? -10.204 8.264   -6.385  1.00 0.00 ? 16  TYR A HB3  9  
ATOM   9408  H  HD1  . TYR A 1 16 ? -10.341 11.723  -4.959  1.00 0.00 ? 16  TYR A HD1  9  
ATOM   9409  H  HD2  . TYR A 1 16 ? -9.389  9.257   -8.293  1.00 0.00 ? 16  TYR A HD2  9  
ATOM   9410  H  HE1  . TYR A 1 16 ? -9.572  13.705  -6.197  1.00 0.00 ? 16  TYR A HE1  9  
ATOM   9411  H  HE2  . TYR A 1 16 ? -8.616  11.231  -9.540  1.00 0.00 ? 16  TYR A HE2  9  
ATOM   9412  H  HH   . TYR A 1 16 ? -8.239  14.329  -8.027  1.00 0.00 ? 16  TYR A HH   9  
ATOM   9413  N  N    . ILE A 1 17 ? -13.104 7.139   -5.869  1.00 0.00 ? 17  ILE A N    9  
ATOM   9414  C  CA   . ILE A 1 17 ? -13.620 5.805   -5.590  1.00 0.00 ? 17  ILE A CA   9  
ATOM   9415  C  C    . ILE A 1 17 ? -12.630 4.730   -6.025  1.00 0.00 ? 17  ILE A C    9  
ATOM   9416  O  O    . ILE A 1 17 ? -12.147 4.737   -7.158  1.00 0.00 ? 17  ILE A O    9  
ATOM   9417  C  CB   . ILE A 1 17 ? -14.967 5.563   -6.297  1.00 0.00 ? 17  ILE A CB   9  
ATOM   9418  C  CG1  . ILE A 1 17 ? -15.989 6.619   -5.870  1.00 0.00 ? 17  ILE A CG1  9  
ATOM   9419  C  CG2  . ILE A 1 17 ? -15.483 4.165   -5.990  1.00 0.00 ? 17  ILE A CG2  9  
ATOM   9420  C  CD1  . ILE A 1 17 ? -16.466 6.456   -4.444  1.00 0.00 ? 17  ILE A CD1  9  
ATOM   9421  H  H    . ILE A 1 17 ? -13.317 7.564   -6.725  1.00 0.00 ? 17  ILE A H    9  
ATOM   9422  H  HA   . ILE A 1 17 ? -13.777 5.724   -4.524  1.00 0.00 ? 17  ILE A HA   9  
ATOM   9423  H  HB   . ILE A 1 17 ? -14.807 5.636   -7.362  1.00 0.00 ? 17  ILE A HB   9  
ATOM   9424  H  HG12 . ILE A 1 17 ? -15.545 7.598   -5.961  1.00 0.00 ? 17  ILE A HG12 9  
ATOM   9425  H  HG13 . ILE A 1 17 ? -16.851 6.557   -6.519  1.00 0.00 ? 17  ILE A HG13 9  
ATOM   9426  H  HG21 . ILE A 1 17 ? -14.890 3.437   -6.526  1.00 0.00 ? 17  ILE A HG21 9  
ATOM   9427  H  HG22 . ILE A 1 17 ? -15.407 3.978   -4.930  1.00 0.00 ? 17  ILE A HG22 9  
ATOM   9428  H  HG23 . ILE A 1 17 ? -16.514 4.085   -6.298  1.00 0.00 ? 17  ILE A HG23 9  
ATOM   9429  H  HD11 . ILE A 1 17 ? -15.615 6.339   -3.790  1.00 0.00 ? 17  ILE A HD11 9  
ATOM   9430  H  HD12 . ILE A 1 17 ? -17.029 7.329   -4.151  1.00 0.00 ? 17  ILE A HD12 9  
ATOM   9431  H  HD13 . ILE A 1 17 ? -17.097 5.581   -4.373  1.00 0.00 ? 17  ILE A HD13 9  
ATOM   9432  N  N    . CYS A 1 18 ? -12.332 3.806   -5.119  1.00 0.00 ? 18  CYS A N    9  
ATOM   9433  C  CA   . CYS A 1 18 ? -11.400 2.722   -5.408  1.00 0.00 ? 18  CYS A CA   9  
ATOM   9434  C  C    . CYS A 1 18 ? -11.968 1.786   -6.471  1.00 0.00 ? 18  CYS A C    9  
ATOM   9435  O  O    . CYS A 1 18 ? -13.044 1.215   -6.298  1.00 0.00 ? 18  CYS A O    9  
ATOM   9436  C  CB   . CYS A 1 18 ? -11.089 1.935   -4.134  1.00 0.00 ? 18  CYS A CB   9  
ATOM   9437  S  SG   . CYS A 1 18 ? -9.653  0.824   -4.278  1.00 0.00 ? 18  CYS A SG   9  
ATOM   9438  H  H    . CYS A 1 18 ? -12.749 3.853   -4.232  1.00 0.00 ? 18  CYS A H    9  
ATOM   9439  H  HA   . CYS A 1 18 ? -10.488 3.161   -5.782  1.00 0.00 ? 18  CYS A HA   9  
ATOM   9440  H  HB2  . CYS A 1 18 ? -10.886 2.630   -3.331  1.00 0.00 ? 18  CYS A HB2  9  
ATOM   9441  H  HB3  . CYS A 1 18 ? -11.946 1.333   -3.873  1.00 0.00 ? 18  CYS A HB3  9  
ATOM   9442  N  N    . GLN A 1 19 ? -11.236 1.635   -7.570  1.00 0.00 ? 19  GLN A N    9  
ATOM   9443  C  CA   . GLN A 1 19 ? -11.667 0.769   -8.661  1.00 0.00 ? 19  GLN A CA   9  
ATOM   9444  C  C    . GLN A 1 19 ? -11.368 -0.693  -8.346  1.00 0.00 ? 19  GLN A C    9  
ATOM   9445  O  O    . GLN A 1 19 ? -11.409 -1.550  -9.228  1.00 0.00 ? 19  GLN A O    9  
ATOM   9446  C  CB   . GLN A 1 19 ? -10.976 1.174   -9.965  1.00 0.00 ? 19  GLN A CB   9  
ATOM   9447  C  CG   . GLN A 1 19 ? -11.704 2.272   -10.724 1.00 0.00 ? 19  GLN A CG   9  
ATOM   9448  C  CD   . GLN A 1 19 ? -13.123 1.885   -11.091 1.00 0.00 ? 19  GLN A CD   9  
ATOM   9449  O  OE1  . GLN A 1 19 ? -13.344 0.968   -11.882 1.00 0.00 ? 19  GLN A OE1  9  
ATOM   9450  N  NE2  . GLN A 1 19 ? -14.095 2.584   -10.517 1.00 0.00 ? 19  GLN A NE2  9  
ATOM   9451  H  H    . GLN A 1 19 ? -10.387 2.118   -7.650  1.00 0.00 ? 19  GLN A H    9  
ATOM   9452  H  HA   . GLN A 1 19 ? -12.733 0.889   -8.778  1.00 0.00 ? 19  GLN A HA   9  
ATOM   9453  H  HB2  . GLN A 1 19 ? -9.980  1.522   -9.737  1.00 0.00 ? 19  GLN A HB2  9  
ATOM   9454  H  HB3  . GLN A 1 19 ? -10.908 0.307   -10.606 1.00 0.00 ? 19  GLN A HB3  9  
ATOM   9455  H  HG2  . GLN A 1 19 ? -11.737 3.157   -10.107 1.00 0.00 ? 19  GLN A HG2  9  
ATOM   9456  H  HG3  . GLN A 1 19 ? -11.158 2.487   -11.631 1.00 0.00 ? 19  GLN A HG3  9  
ATOM   9457  H  HE21 . GLN A 1 19 ? -13.844 3.302   -9.898  1.00 0.00 ? 19  GLN A HE21 9  
ATOM   9458  H  HE22 . GLN A 1 19 ? -15.021 2.357   -10.737 1.00 0.00 ? 19  GLN A HE22 9  
ATOM   9459  N  N    . LYS A 1 20 ? -11.066 -0.970  -7.082  1.00 0.00 ? 20  LYS A N    9  
ATOM   9460  C  CA   . LYS A 1 20 ? -10.761 -2.329  -6.649  1.00 0.00 ? 20  LYS A CA   9  
ATOM   9461  C  C    . LYS A 1 20 ? -11.852 -2.864  -5.728  1.00 0.00 ? 20  LYS A C    9  
ATOM   9462  O  O    . LYS A 1 20 ? -12.459 -3.899  -6.004  1.00 0.00 ? 20  LYS A O    9  
ATOM   9463  C  CB   . LYS A 1 20 ? -9.410  -2.366  -5.931  1.00 0.00 ? 20  LYS A CB   9  
ATOM   9464  C  CG   . LYS A 1 20 ? -9.048  -3.736  -5.384  1.00 0.00 ? 20  LYS A CG   9  
ATOM   9465  C  CD   . LYS A 1 20 ? -8.400  -4.607  -6.447  1.00 0.00 ? 20  LYS A CD   9  
ATOM   9466  C  CE   . LYS A 1 20 ? -8.203  -6.033  -5.955  1.00 0.00 ? 20  LYS A CE   9  
ATOM   9467  N  NZ   . LYS A 1 20 ? -7.622  -6.908  -7.011  1.00 0.00 ? 20  LYS A NZ   9  
ATOM   9468  H  H    . LYS A 1 20 ? -11.049 -0.244  -6.424  1.00 0.00 ? 20  LYS A H    9  
ATOM   9469  H  HA   . LYS A 1 20 ? -10.709 -2.954  -7.528  1.00 0.00 ? 20  LYS A HA   9  
ATOM   9470  H  HB2  . LYS A 1 20 ? -8.639  -2.063  -6.624  1.00 0.00 ? 20  LYS A HB2  9  
ATOM   9471  H  HB3  . LYS A 1 20 ? -9.435  -1.667  -5.107  1.00 0.00 ? 20  LYS A HB3  9  
ATOM   9472  H  HG2  . LYS A 1 20 ? -8.358  -3.615  -4.563  1.00 0.00 ? 20  LYS A HG2  9  
ATOM   9473  H  HG3  . LYS A 1 20 ? -9.948  -4.222  -5.033  1.00 0.00 ? 20  LYS A HG3  9  
ATOM   9474  H  HD2  . LYS A 1 20 ? -9.033  -4.624  -7.322  1.00 0.00 ? 20  LYS A HD2  9  
ATOM   9475  H  HD3  . LYS A 1 20 ? -7.437  -4.188  -6.705  1.00 0.00 ? 20  LYS A HD3  9  
ATOM   9476  H  HE2  . LYS A 1 20 ? -7.539  -6.018  -5.106  1.00 0.00 ? 20  LYS A HE2  9  
ATOM   9477  H  HE3  . LYS A 1 20 ? -9.162  -6.431  -5.656  1.00 0.00 ? 20  LYS A HE3  9  
ATOM   9478  H  HZ1  . LYS A 1 20 ? -6.621  -6.669  -7.162  1.00 0.00 ? 20  LYS A HZ1  9  
ATOM   9479  H  HZ2  . LYS A 1 20 ? -8.137  -6.779  -7.905  1.00 0.00 ? 20  LYS A HZ2  9  
ATOM   9480  H  HZ3  . LYS A 1 20 ? -7.690  -7.906  -6.725  1.00 0.00 ? 20  LYS A HZ3  9  
ATOM   9481  N  N    . CYS A 1 21 ? -12.098 -2.152  -4.633  1.00 0.00 ? 21  CYS A N    9  
ATOM   9482  C  CA   . CYS A 1 21 ? -13.118 -2.555  -3.672  1.00 0.00 ? 21  CYS A CA   9  
ATOM   9483  C  C    . CYS A 1 21 ? -14.382 -1.716  -3.836  1.00 0.00 ? 21  CYS A C    9  
ATOM   9484  O  O    . CYS A 1 21 ? -15.411 -1.998  -3.222  1.00 0.00 ? 21  CYS A O    9  
ATOM   9485  C  CB   . CYS A 1 21 ? -12.584 -2.419  -2.244  1.00 0.00 ? 21  CYS A CB   9  
ATOM   9486  S  SG   . CYS A 1 21 ? -12.161 -0.713  -1.768  1.00 0.00 ? 21  CYS A SG   9  
ATOM   9487  H  H    . CYS A 1 21 ? -11.581 -1.336  -4.467  1.00 0.00 ? 21  CYS A H    9  
ATOM   9488  H  HA   . CYS A 1 21 ? -13.360 -3.590  -3.859  1.00 0.00 ? 21  CYS A HA   9  
ATOM   9489  H  HB2  . CYS A 1 21 ? -13.333 -2.777  -1.553  1.00 0.00 ? 21  CYS A HB2  9  
ATOM   9490  H  HB3  . CYS A 1 21 ? -11.692 -3.020  -2.143  1.00 0.00 ? 21  CYS A HB3  9  
ATOM   9491  N  N    . HIS A 1 22 ? -14.296 -0.683  -4.668  1.00 0.00 ? 22  HIS A N    9  
ATOM   9492  C  CA   . HIS A 1 22 ? -15.433 0.197   -4.914  1.00 0.00 ? 22  HIS A CA   9  
ATOM   9493  C  C    . HIS A 1 22 ? -15.880 0.879   -3.625  1.00 0.00 ? 22  HIS A C    9  
ATOM   9494  O  O    . HIS A 1 22 ? -17.051 0.815   -3.252  1.00 0.00 ? 22  HIS A O    9  
ATOM   9495  C  CB   . HIS A 1 22 ? -16.595 -0.593  -5.517  1.00 0.00 ? 22  HIS A CB   9  
ATOM   9496  C  CG   . HIS A 1 22 ? -16.422 -0.894  -6.973  1.00 0.00 ? 22  HIS A CG   9  
ATOM   9497  N  ND1  . HIS A 1 22 ? -16.118 -2.152  -7.451  1.00 0.00 ? 22  HIS A ND1  9  
ATOM   9498  C  CD2  . HIS A 1 22 ? -16.514 -0.093  -8.061  1.00 0.00 ? 22  HIS A CD2  9  
ATOM   9499  C  CE1  . HIS A 1 22 ? -16.029 -2.111  -8.768  1.00 0.00 ? 22  HIS A CE1  9  
ATOM   9500  N  NE2  . HIS A 1 22 ? -16.265 -0.873  -9.163  1.00 0.00 ? 22  HIS A NE2  9  
ATOM   9501  H  H    . HIS A 1 22 ? -13.448 -0.509  -5.128  1.00 0.00 ? 22  HIS A H    9  
ATOM   9502  H  HA   . HIS A 1 22 ? -15.120 0.954   -5.617  1.00 0.00 ? 22  HIS A HA   9  
ATOM   9503  H  HB2  . HIS A 1 22 ? -16.693 -1.532  -4.993  1.00 0.00 ? 22  HIS A HB2  9  
ATOM   9504  H  HB3  . HIS A 1 22 ? -17.507 -0.024  -5.401  1.00 0.00 ? 22  HIS A HB3  9  
ATOM   9505  H  HD1  . HIS A 1 22 ? -15.986 -2.955  -6.905  1.00 0.00 ? 22  HIS A HD1  9  
ATOM   9506  H  HD2  . HIS A 1 22 ? -16.740 0.964   -8.062  1.00 0.00 ? 22  HIS A HD2  9  
ATOM   9507  H  HE1  . HIS A 1 22 ? -15.802 -2.947  -9.413  1.00 0.00 ? 22  HIS A HE1  9  
ATOM   9508  N  N    . ALA A 1 23 ? -14.940 1.531   -2.949  1.00 0.00 ? 23  ALA A N    9  
ATOM   9509  C  CA   . ALA A 1 23 ? -15.238 2.226   -1.702  1.00 0.00 ? 23  ALA A CA   9  
ATOM   9510  C  C    . ALA A 1 23 ? -14.456 3.531   -1.601  1.00 0.00 ? 23  ALA A C    9  
ATOM   9511  O  O    . ALA A 1 23 ? -13.265 3.577   -1.912  1.00 0.00 ? 23  ALA A O    9  
ATOM   9512  C  CB   . ALA A 1 23 ? -14.930 1.330   -0.512  1.00 0.00 ? 23  ALA A CB   9  
ATOM   9513  H  H    . ALA A 1 23 ? -14.024 1.546   -3.297  1.00 0.00 ? 23  ALA A H    9  
ATOM   9514  H  HA   . ALA A 1 23 ? -16.295 2.450   -1.689  1.00 0.00 ? 23  ALA A HA   9  
ATOM   9515  H  HB1  . ALA A 1 23 ? -13.868 1.136   -0.473  1.00 0.00 ? 23  ALA A HB1  9  
ATOM   9516  H  HB2  . ALA A 1 23 ? -15.240 1.821   0.398   1.00 0.00 ? 23  ALA A HB2  9  
ATOM   9517  H  HB3  . ALA A 1 23 ? -15.463 0.397   -0.617  1.00 0.00 ? 23  ALA A HB3  9  
ATOM   9518  N  N    . ILE A 1 24 ? -15.132 4.588   -1.164  1.00 0.00 ? 24  ILE A N    9  
ATOM   9519  C  CA   . ILE A 1 24 ? -14.499 5.894   -1.022  1.00 0.00 ? 24  ILE A CA   9  
ATOM   9520  C  C    . ILE A 1 24 ? -13.062 5.757   -0.531  1.00 0.00 ? 24  ILE A C    9  
ATOM   9521  O  O    . ILE A 1 24 ? -12.731 4.823   0.199   1.00 0.00 ? 24  ILE A O    9  
ATOM   9522  C  CB   . ILE A 1 24 ? -15.279 6.794   -0.046  1.00 0.00 ? 24  ILE A CB   9  
ATOM   9523  C  CG1  . ILE A 1 24 ? -16.699 7.034   -0.564  1.00 0.00 ? 24  ILE A CG1  9  
ATOM   9524  C  CG2  . ILE A 1 24 ? -14.552 8.115   0.152   1.00 0.00 ? 24  ILE A CG2  9  
ATOM   9525  C  CD1  . ILE A 1 24 ? -16.772 8.054   -1.678  1.00 0.00 ? 24  ILE A CD1  9  
ATOM   9526  H  H    . ILE A 1 24 ? -16.078 4.488   -0.932  1.00 0.00 ? 24  ILE A H    9  
ATOM   9527  H  HA   . ILE A 1 24 ? -14.493 6.369   -1.993  1.00 0.00 ? 24  ILE A HA   9  
ATOM   9528  H  HB   . ILE A 1 24 ? -15.331 6.292   0.908   1.00 0.00 ? 24  ILE A HB   9  
ATOM   9529  H  HG12 . ILE A 1 24 ? -17.101 6.105   -0.938  1.00 0.00 ? 24  ILE A HG12 9  
ATOM   9530  H  HG13 . ILE A 1 24 ? -17.316 7.386   0.251   1.00 0.00 ? 24  ILE A HG13 9  
ATOM   9531  H  HG21 . ILE A 1 24 ? -15.272 8.897   0.343   1.00 0.00 ? 24  ILE A HG21 9  
ATOM   9532  H  HG22 . ILE A 1 24 ? -13.880 8.033   0.993   1.00 0.00 ? 24  ILE A HG22 9  
ATOM   9533  H  HG23 . ILE A 1 24 ? -13.988 8.354   -0.737  1.00 0.00 ? 24  ILE A HG23 9  
ATOM   9534  H  HD11 . ILE A 1 24 ? -16.541 9.033   -1.286  1.00 0.00 ? 24  ILE A HD11 9  
ATOM   9535  H  HD12 . ILE A 1 24 ? -16.061 7.797   -2.449  1.00 0.00 ? 24  ILE A HD12 9  
ATOM   9536  H  HD13 . ILE A 1 24 ? -17.769 8.060   -2.096  1.00 0.00 ? 24  ILE A HD13 9  
ATOM   9537  N  N    . ILE A 1 25 ? -12.213 6.695   -0.936  1.00 0.00 ? 25  ILE A N    9  
ATOM   9538  C  CA   . ILE A 1 25 ? -10.811 6.681   -0.536  1.00 0.00 ? 25  ILE A CA   9  
ATOM   9539  C  C    . ILE A 1 25 ? -10.460 7.921   0.280   1.00 0.00 ? 25  ILE A C    9  
ATOM   9540  O  O    . ILE A 1 25 ? -9.982  8.918   -0.262  1.00 0.00 ? 25  ILE A O    9  
ATOM   9541  C  CB   . ILE A 1 25 ? -9.877  6.603   -1.757  1.00 0.00 ? 25  ILE A CB   9  
ATOM   9542  C  CG1  . ILE A 1 25 ? -10.126 5.309   -2.535  1.00 0.00 ? 25  ILE A CG1  9  
ATOM   9543  C  CG2  . ILE A 1 25 ? -8.423  6.692   -1.319  1.00 0.00 ? 25  ILE A CG2  9  
ATOM   9544  C  CD1  . ILE A 1 25 ? -9.827  5.425   -4.013  1.00 0.00 ? 25  ILE A CD1  9  
ATOM   9545  H  H    . ILE A 1 25 ? -12.536 7.414   -1.518  1.00 0.00 ? 25  ILE A H    9  
ATOM   9546  H  HA   . ILE A 1 25 ? -10.648 5.804   0.074   1.00 0.00 ? 25  ILE A HA   9  
ATOM   9547  H  HB   . ILE A 1 25 ? -10.087 7.445   -2.398  1.00 0.00 ? 25  ILE A HB   9  
ATOM   9548  H  HG12 . ILE A 1 25 ? -9.502  4.527   -2.132  1.00 0.00 ? 25  ILE A HG12 9  
ATOM   9549  H  HG13 . ILE A 1 25 ? -11.164 5.027   -2.427  1.00 0.00 ? 25  ILE A HG13 9  
ATOM   9550  H  HG21 . ILE A 1 25 ? -8.377  6.999   -0.284  1.00 0.00 ? 25  ILE A HG21 9  
ATOM   9551  H  HG22 . ILE A 1 25 ? -7.955  5.724   -1.426  1.00 0.00 ? 25  ILE A HG22 9  
ATOM   9552  H  HG23 . ILE A 1 25 ? -7.905  7.413   -1.932  1.00 0.00 ? 25  ILE A HG23 9  
ATOM   9553  H  HD11 . ILE A 1 25 ? -9.237  4.578   -4.330  1.00 0.00 ? 25  ILE A HD11 9  
ATOM   9554  H  HD12 . ILE A 1 25 ? -10.753 5.447   -4.568  1.00 0.00 ? 25  ILE A HD12 9  
ATOM   9555  H  HD13 . ILE A 1 25 ? -9.275  6.336   -4.198  1.00 0.00 ? 25  ILE A HD13 9  
ATOM   9556  N  N    . ASP A 1 26 ? -10.699 7.851   1.585   1.00 0.00 ? 26  ASP A N    9  
ATOM   9557  C  CA   . ASP A 1 26 ? -10.406 8.967   2.477   1.00 0.00 ? 26  ASP A CA   9  
ATOM   9558  C  C    . ASP A 1 26 ? -9.047  9.580   2.152   1.00 0.00 ? 26  ASP A C    9  
ATOM   9559  O  O    . ASP A 1 26 ? -8.961  10.732  1.730   1.00 0.00 ? 26  ASP A O    9  
ATOM   9560  C  CB   . ASP A 1 26 ? -10.435 8.504   3.934   1.00 0.00 ? 26  ASP A CB   9  
ATOM   9561  C  CG   . ASP A 1 26 ? -9.765  9.492   4.869   1.00 0.00 ? 26  ASP A CG   9  
ATOM   9562  O  OD1  . ASP A 1 26 ? -8.518  9.563   4.861   1.00 0.00 ? 26  ASP A OD1  9  
ATOM   9563  O  OD2  . ASP A 1 26 ? -10.487 10.193  5.609   1.00 0.00 ? 26  ASP A OD2  9  
ATOM   9564  H  H    . ASP A 1 26 ? -11.082 7.029   1.957   1.00 0.00 ? 26  ASP A H    9  
ATOM   9565  H  HA   . ASP A 1 26 ? -11.169 9.717   2.332   1.00 0.00 ? 26  ASP A HA   9  
ATOM   9566  H  HB2  . ASP A 1 26 ? -11.462 8.382   4.246   1.00 0.00 ? 26  ASP A HB2  9  
ATOM   9567  H  HB3  . ASP A 1 26 ? -9.924  7.556   4.014   1.00 0.00 ? 26  ASP A HB3  9  
ATOM   9568  N  N    . GLU A 1 27 ? -7.989  8.800   2.353   1.00 0.00 ? 27  GLU A N    9  
ATOM   9569  C  CA   . GLU A 1 27 ? -6.635  9.268   2.082   1.00 0.00 ? 27  GLU A CA   9  
ATOM   9570  C  C    . GLU A 1 27 ? -6.400  9.419   0.582   1.00 0.00 ? 27  GLU A C    9  
ATOM   9571  O  O    . GLU A 1 27 ? -7.268  9.092   -0.227  1.00 0.00 ? 27  GLU A O    9  
ATOM   9572  C  CB   . GLU A 1 27 ? -5.609  8.299   2.675   1.00 0.00 ? 27  GLU A CB   9  
ATOM   9573  C  CG   . GLU A 1 27 ? -5.715  6.888   2.122   1.00 0.00 ? 27  GLU A CG   9  
ATOM   9574  C  CD   . GLU A 1 27 ? -4.469  6.063   2.386   1.00 0.00 ? 27  GLU A CD   9  
ATOM   9575  O  OE1  . GLU A 1 27 ? -3.391  6.441   1.883   1.00 0.00 ? 27  GLU A OE1  9  
ATOM   9576  O  OE2  . GLU A 1 27 ? -4.573  5.041   3.095   1.00 0.00 ? 27  GLU A OE2  9  
ATOM   9577  H  H    . GLU A 1 27 ? -8.122  7.890   2.691   1.00 0.00 ? 27  GLU A H    9  
ATOM   9578  H  HA   . GLU A 1 27 ? -6.517  10.233  2.552   1.00 0.00 ? 27  GLU A HA   9  
ATOM   9579  H  HB2  . GLU A 1 27 ? -4.617  8.672   2.467   1.00 0.00 ? 27  GLU A HB2  9  
ATOM   9580  H  HB3  . GLU A 1 27 ? -5.750  8.255   3.745   1.00 0.00 ? 27  GLU A HB3  9  
ATOM   9581  H  HG2  . GLU A 1 27 ? -6.557  6.396   2.584   1.00 0.00 ? 27  GLU A HG2  9  
ATOM   9582  H  HG3  . GLU A 1 27 ? -5.872  6.944   1.055   1.00 0.00 ? 27  GLU A HG3  9  
ATOM   9583  N  N    . GLN A 1 28 ? -5.222  9.916   0.220   1.00 0.00 ? 28  GLN A N    9  
ATOM   9584  C  CA   . GLN A 1 28 ? -4.874  10.111  -1.182  1.00 0.00 ? 28  GLN A CA   9  
ATOM   9585  C  C    . GLN A 1 28 ? -5.057  8.820   -1.973  1.00 0.00 ? 28  GLN A C    9  
ATOM   9586  O  O    . GLN A 1 28 ? -4.511  7.771   -1.632  1.00 0.00 ? 28  GLN A O    9  
ATOM   9587  C  CB   . GLN A 1 28 ? -3.429  10.599  -1.308  1.00 0.00 ? 28  GLN A CB   9  
ATOM   9588  C  CG   . GLN A 1 28 ? -3.115  11.227  -2.656  1.00 0.00 ? 28  GLN A CG   9  
ATOM   9589  C  CD   . GLN A 1 28 ? -3.734  12.601  -2.819  1.00 0.00 ? 28  GLN A CD   9  
ATOM   9590  O  OE1  . GLN A 1 28 ? -4.699  12.945  -2.135  1.00 0.00 ? 28  GLN A OE1  9  
ATOM   9591  N  NE2  . GLN A 1 28 ? -3.182  13.396  -3.727  1.00 0.00 ? 28  GLN A NE2  9  
ATOM   9592  H  H    . GLN A 1 28 ? -4.572  10.157  0.912   1.00 0.00 ? 28  GLN A H    9  
ATOM   9593  H  HA   . GLN A 1 28 ? -5.534  10.863  -1.586  1.00 0.00 ? 28  GLN A HA   9  
ATOM   9594  H  HB2  . GLN A 1 28 ? -3.242  11.335  -0.539  1.00 0.00 ? 28  GLN A HB2  9  
ATOM   9595  H  HB3  . GLN A 1 28 ? -2.765  9.761   -1.162  1.00 0.00 ? 28  GLN A HB3  9  
ATOM   9596  H  HG2  . GLN A 1 28 ? -2.043  11.319  -2.755  1.00 0.00 ? 28  GLN A HG2  9  
ATOM   9597  H  HG3  . GLN A 1 28 ? -3.493  10.583  -3.436  1.00 0.00 ? 28  GLN A HG3  9  
ATOM   9598  H  HE21 . GLN A 1 28 ? -2.416  13.055  -4.236  1.00 0.00 ? 28  GLN A HE21 9  
ATOM   9599  H  HE22 . GLN A 1 28 ? -3.563  14.289  -3.854  1.00 0.00 ? 28  GLN A HE22 9  
ATOM   9600  N  N    . PRO A 1 29 ? -5.845  8.896   -3.056  1.00 0.00 ? 29  PRO A N    9  
ATOM   9601  C  CA   . PRO A 1 29 ? -6.119  7.743   -3.919  1.00 0.00 ? 29  PRO A CA   9  
ATOM   9602  C  C    . PRO A 1 29 ? -4.894  7.314   -4.719  1.00 0.00 ? 29  PRO A C    9  
ATOM   9603  O  O    . PRO A 1 29 ? -4.258  8.132   -5.387  1.00 0.00 ? 29  PRO A O    9  
ATOM   9604  C  CB   . PRO A 1 29 ? -7.218  8.253   -4.855  1.00 0.00 ? 29  PRO A CB   9  
ATOM   9605  C  CG   . PRO A 1 29 ? -7.033  9.731   -4.886  1.00 0.00 ? 29  PRO A CG   9  
ATOM   9606  C  CD   . PRO A 1 29 ? -6.529  10.114  -3.522  1.00 0.00 ? 29  PRO A CD   9  
ATOM   9607  H  HA   . PRO A 1 29 ? -6.489  6.902   -3.351  1.00 0.00 ? 29  PRO A HA   9  
ATOM   9608  H  HB2  . PRO A 1 29 ? -7.090  7.817   -5.835  1.00 0.00 ? 29  PRO A HB2  9  
ATOM   9609  H  HB3  . PRO A 1 29 ? -8.186  7.985   -4.459  1.00 0.00 ? 29  PRO A HB3  9  
ATOM   9610  H  HG2  . PRO A 1 29 ? -6.308  9.994   -5.641  1.00 0.00 ? 29  PRO A HG2  9  
ATOM   9611  H  HG3  . PRO A 1 29 ? -7.978  10.214  -5.086  1.00 0.00 ? 29  PRO A HG3  9  
ATOM   9612  H  HD2  . PRO A 1 29 ? -5.838  10.941  -3.594  1.00 0.00 ? 29  PRO A HD2  9  
ATOM   9613  H  HD3  . PRO A 1 29 ? -7.354  10.365  -2.872  1.00 0.00 ? 29  PRO A HD3  9  
ATOM   9614  N  N    . LEU A 1 30 ? -4.567  6.028   -4.649  1.00 0.00 ? 30  LEU A N    9  
ATOM   9615  C  CA   . LEU A 1 30 ? -3.418  5.491   -5.368  1.00 0.00 ? 30  LEU A CA   9  
ATOM   9616  C  C    . LEU A 1 30 ? -3.748  5.281   -6.843  1.00 0.00 ? 30  LEU A C    9  
ATOM   9617  O  O    . LEU A 1 30 ? -4.490  4.365   -7.198  1.00 0.00 ? 30  LEU A O    9  
ATOM   9618  C  CB   . LEU A 1 30 ? -2.971  4.169   -4.740  1.00 0.00 ? 30  LEU A CB   9  
ATOM   9619  C  CG   . LEU A 1 30 ? -2.215  3.210   -5.661  1.00 0.00 ? 30  LEU A CG   9  
ATOM   9620  C  CD1  . LEU A 1 30 ? -0.787  3.689   -5.873  1.00 0.00 ? 30  LEU A CD1  9  
ATOM   9621  C  CD2  . LEU A 1 30 ? -2.228  1.800   -5.089  1.00 0.00 ? 30  LEU A CD2  9  
ATOM   9622  H  H    . LEU A 1 30 ? -5.112  5.426   -4.101  1.00 0.00 ? 30  LEU A H    9  
ATOM   9623  H  HA   . LEU A 1 30 ? -2.614  6.207   -5.290  1.00 0.00 ? 30  LEU A HA   9  
ATOM   9624  H  HB2  . LEU A 1 30 ? -2.329  4.400   -3.905  1.00 0.00 ? 30  LEU A HB2  9  
ATOM   9625  H  HB3  . LEU A 1 30 ? -3.854  3.659   -4.383  1.00 0.00 ? 30  LEU A HB3  9  
ATOM   9626  H  HG   . LEU A 1 30 ? -2.705  3.186   -6.625  1.00 0.00 ? 30  LEU A HG   9  
ATOM   9627  H  HD11 . LEU A 1 30 ? -0.328  3.886   -4.916  1.00 0.00 ? 30  LEU A HD11 9  
ATOM   9628  H  HD12 . LEU A 1 30 ? -0.794  4.594   -6.462  1.00 0.00 ? 30  LEU A HD12 9  
ATOM   9629  H  HD13 . LEU A 1 30 ? -0.226  2.926   -6.392  1.00 0.00 ? 30  LEU A HD13 9  
ATOM   9630  H  HD21 . LEU A 1 30 ? -2.722  1.135   -5.783  1.00 0.00 ? 30  LEU A HD21 9  
ATOM   9631  H  HD22 . LEU A 1 30 ? -2.760  1.798   -4.149  1.00 0.00 ? 30  LEU A HD22 9  
ATOM   9632  H  HD23 . LEU A 1 30 ? -1.214  1.467   -4.930  1.00 0.00 ? 30  LEU A HD23 9  
ATOM   9633  N  N    . ILE A 1 31 ? -3.190  6.133   -7.696  1.00 0.00 ? 31  ILE A N    9  
ATOM   9634  C  CA   . ILE A 1 31 ? -3.422  6.038   -9.131  1.00 0.00 ? 31  ILE A CA   9  
ATOM   9635  C  C    . ILE A 1 31 ? -2.544  4.963   -9.761  1.00 0.00 ? 31  ILE A C    9  
ATOM   9636  O  O    . ILE A 1 31 ? -1.337  4.911   -9.519  1.00 0.00 ? 31  ILE A O    9  
ATOM   9637  C  CB   . ILE A 1 31 ? -3.153  7.382   -9.835  1.00 0.00 ? 31  ILE A CB   9  
ATOM   9638  C  CG1  . ILE A 1 31 ? -4.012  8.487   -9.218  1.00 0.00 ? 31  ILE A CG1  9  
ATOM   9639  C  CG2  . ILE A 1 31 ? -3.427  7.262   -11.327 1.00 0.00 ? 31  ILE A CG2  9  
ATOM   9640  C  CD1  . ILE A 1 31 ? -5.497  8.289   -9.431  1.00 0.00 ? 31  ILE A CD1  9  
ATOM   9641  H  H    . ILE A 1 31 ? -2.608  6.842   -7.351  1.00 0.00 ? 31  ILE A H    9  
ATOM   9642  H  HA   . ILE A 1 31 ? -4.459  5.776   -9.284  1.00 0.00 ? 31  ILE A HA   9  
ATOM   9643  H  HB   . ILE A 1 31 ? -2.111  7.629   -9.703  1.00 0.00 ? 31  ILE A HB   9  
ATOM   9644  H  HG12 . ILE A 1 31 ? -3.833  8.522   -8.155  1.00 0.00 ? 31  ILE A HG12 9  
ATOM   9645  H  HG13 . ILE A 1 31 ? -3.737  9.434   -9.657  1.00 0.00 ? 31  ILE A HG13 9  
ATOM   9646  H  HG21 . ILE A 1 31 ? -4.308  6.658   -11.484 1.00 0.00 ? 31  ILE A HG21 9  
ATOM   9647  H  HG22 . ILE A 1 31 ? -3.587  8.245   -11.743 1.00 0.00 ? 31  ILE A HG22 9  
ATOM   9648  H  HG23 . ILE A 1 31 ? -2.581  6.799   -11.812 1.00 0.00 ? 31  ILE A HG23 9  
ATOM   9649  H  HD11 . ILE A 1 31 ? -5.941  9.217   -9.759  1.00 0.00 ? 31  ILE A HD11 9  
ATOM   9650  H  HD12 . ILE A 1 31 ? -5.655  7.528   -10.181 1.00 0.00 ? 31  ILE A HD12 9  
ATOM   9651  H  HD13 . ILE A 1 31 ? -5.956  7.979   -8.503  1.00 0.00 ? 31  ILE A HD13 9  
ATOM   9652  N  N    . PHE A 1 32 ? -3.156  4.105   -10.571 1.00 0.00 ? 32  PHE A N    9  
ATOM   9653  C  CA   . PHE A 1 32 ? -2.429  3.030   -11.236 1.00 0.00 ? 32  PHE A CA   9  
ATOM   9654  C  C    . PHE A 1 32 ? -3.108  2.646   -12.548 1.00 0.00 ? 32  PHE A C    9  
ATOM   9655  O  O    . PHE A 1 32 ? -4.266  2.227   -12.562 1.00 0.00 ? 32  PHE A O    9  
ATOM   9656  C  CB   . PHE A 1 32 ? -2.333  1.808   -10.321 1.00 0.00 ? 32  PHE A CB   9  
ATOM   9657  C  CG   . PHE A 1 32 ? -1.570  0.664   -10.926 1.00 0.00 ? 32  PHE A CG   9  
ATOM   9658  C  CD1  . PHE A 1 32 ? -0.221  0.791   -11.215 1.00 0.00 ? 32  PHE A CD1  9  
ATOM   9659  C  CD2  . PHE A 1 32 ? -2.201  -0.537  -11.205 1.00 0.00 ? 32  PHE A CD2  9  
ATOM   9660  C  CE1  . PHE A 1 32 ? 0.484   -0.259  -11.773 1.00 0.00 ? 32  PHE A CE1  9  
ATOM   9661  C  CE2  . PHE A 1 32 ? -1.502  -1.591  -11.762 1.00 0.00 ? 32  PHE A CE2  9  
ATOM   9662  C  CZ   . PHE A 1 32 ? -0.157  -1.452  -12.045 1.00 0.00 ? 32  PHE A CZ   9  
ATOM   9663  H  H    . PHE A 1 32 ? -4.120  4.197   -10.724 1.00 0.00 ? 32  PHE A H    9  
ATOM   9664  H  HA   . PHE A 1 32 ? -1.434  3.387   -11.451 1.00 0.00 ? 32  PHE A HA   9  
ATOM   9665  H  HB2  . PHE A 1 32 ? -1.836  2.091   -9.406  1.00 0.00 ? 32  PHE A HB2  9  
ATOM   9666  H  HB3  . PHE A 1 32 ? -3.329  1.459   -10.092 1.00 0.00 ? 32  PHE A HB3  9  
ATOM   9667  H  HD1  . PHE A 1 32 ? 0.282   1.723   -11.001 1.00 0.00 ? 32  PHE A HD1  9  
ATOM   9668  H  HD2  . PHE A 1 32 ? -3.254  -0.647  -10.984 1.00 0.00 ? 32  PHE A HD2  9  
ATOM   9669  H  HE1  . PHE A 1 32 ? 1.535   -0.148  -11.993 1.00 0.00 ? 32  PHE A HE1  9  
ATOM   9670  H  HE2  . PHE A 1 32 ? -2.006  -2.522  -11.974 1.00 0.00 ? 32  PHE A HE2  9  
ATOM   9671  H  HZ   . PHE A 1 32 ? 0.391   -2.274  -12.481 1.00 0.00 ? 32  PHE A HZ   9  
ATOM   9672  N  N    . LYS A 1 33 ? -2.379  2.791   -13.649 1.00 0.00 ? 33  LYS A N    9  
ATOM   9673  C  CA   . LYS A 1 33 ? -2.908  2.459   -14.967 1.00 0.00 ? 33  LYS A CA   9  
ATOM   9674  C  C    . LYS A 1 33 ? -4.083  3.364   -15.325 1.00 0.00 ? 33  LYS A C    9  
ATOM   9675  O  O    . LYS A 1 33 ? -4.991  2.959   -16.049 1.00 0.00 ? 33  LYS A O    9  
ATOM   9676  C  CB   . LYS A 1 33 ? -3.348  0.994   -15.008 1.00 0.00 ? 33  LYS A CB   9  
ATOM   9677  C  CG   . LYS A 1 33 ? -2.213  0.012   -14.772 1.00 0.00 ? 33  LYS A CG   9  
ATOM   9678  C  CD   . LYS A 1 33 ? -2.660  -1.422  -15.001 1.00 0.00 ? 33  LYS A CD   9  
ATOM   9679  C  CE   . LYS A 1 33 ? -1.477  -2.378  -15.024 1.00 0.00 ? 33  LYS A CE   9  
ATOM   9680  N  NZ   . LYS A 1 33 ? -1.888  -3.759  -15.399 1.00 0.00 ? 33  LYS A NZ   9  
ATOM   9681  H  H    . LYS A 1 33 ? -1.462  3.130   -13.574 1.00 0.00 ? 33  LYS A H    9  
ATOM   9682  H  HA   . LYS A 1 33 ? -2.120  2.611   -15.688 1.00 0.00 ? 33  LYS A HA   9  
ATOM   9683  H  HB2  . LYS A 1 33 ? -4.099  0.834   -14.249 1.00 0.00 ? 33  LYS A HB2  9  
ATOM   9684  H  HB3  . LYS A 1 33 ? -3.779  0.787   -15.977 1.00 0.00 ? 33  LYS A HB3  9  
ATOM   9685  H  HG2  . LYS A 1 33 ? -1.405  0.239   -15.452 1.00 0.00 ? 33  LYS A HG2  9  
ATOM   9686  H  HG3  . LYS A 1 33 ? -1.868  0.113   -13.753 1.00 0.00 ? 33  LYS A HG3  9  
ATOM   9687  H  HD2  . LYS A 1 33 ? -3.328  -1.714  -14.204 1.00 0.00 ? 33  LYS A HD2  9  
ATOM   9688  H  HD3  . LYS A 1 33 ? -3.179  -1.482  -15.948 1.00 0.00 ? 33  LYS A HD3  9  
ATOM   9689  H  HE2  . LYS A 1 33 ? -0.756  -2.019  -15.742 1.00 0.00 ? 33  LYS A HE2  9  
ATOM   9690  H  HE3  . LYS A 1 33 ? -1.029  -2.398  -14.042 1.00 0.00 ? 33  LYS A HE3  9  
ATOM   9691  H  HZ1  . LYS A 1 33 ? -2.882  -3.766  -15.705 1.00 0.00 ? 33  LYS A HZ1  9  
ATOM   9692  H  HZ2  . LYS A 1 33 ? -1.783  -4.396  -14.584 1.00 0.00 ? 33  LYS A HZ2  9  
ATOM   9693  H  HZ3  . LYS A 1 33 ? -1.294  -4.110  -16.178 1.00 0.00 ? 33  LYS A HZ3  9  
ATOM   9694  N  N    . ASN A 1 34 ? -4.058  4.590   -14.813 1.00 0.00 ? 34  ASN A N    9  
ATOM   9695  C  CA   . ASN A 1 34 ? -5.121  5.552   -15.080 1.00 0.00 ? 34  ASN A CA   9  
ATOM   9696  C  C    . ASN A 1 34 ? -6.412  5.145   -14.376 1.00 0.00 ? 34  ASN A C    9  
ATOM   9697  O  O    . ASN A 1 34 ? -7.484  5.130   -14.982 1.00 0.00 ? 34  ASN A O    9  
ATOM   9698  C  CB   . ASN A 1 34 ? -5.364  5.670   -16.586 1.00 0.00 ? 34  ASN A CB   9  
ATOM   9699  C  CG   . ASN A 1 34 ? -5.995  6.995   -16.968 1.00 0.00 ? 34  ASN A CG   9  
ATOM   9700  O  OD1  . ASN A 1 34 ? -5.540  8.057   -16.542 1.00 0.00 ? 34  ASN A OD1  9  
ATOM   9701  N  ND2  . ASN A 1 34 ? -7.048  6.938   -17.774 1.00 0.00 ? 34  ASN A ND2  9  
ATOM   9702  H  H    . ASN A 1 34 ? -3.307  4.855   -14.242 1.00 0.00 ? 34  ASN A H    9  
ATOM   9703  H  HA   . ASN A 1 34 ? -4.804  6.511   -14.699 1.00 0.00 ? 34  ASN A HA   9  
ATOM   9704  H  HB2  . ASN A 1 34 ? -4.420  5.580   -17.105 1.00 0.00 ? 34  ASN A HB2  9  
ATOM   9705  H  HB3  . ASN A 1 34 ? -6.021  4.874   -16.903 1.00 0.00 ? 34  ASN A HB3  9  
ATOM   9706  H  HD21 . ASN A 1 34 ? -7.355  6.057   -18.073 1.00 0.00 ? 34  ASN A HD21 9  
ATOM   9707  H  HD22 . ASN A 1 34 ? -7.475  7.780   -18.037 1.00 0.00 ? 34  ASN A HD22 9  
ATOM   9708  N  N    . ASP A 1 35 ? -6.302  4.817   -13.094 1.00 0.00 ? 35  ASP A N    9  
ATOM   9709  C  CA   . ASP A 1 35 ? -7.460  4.412   -12.306 1.00 0.00 ? 35  ASP A CA   9  
ATOM   9710  C  C    . ASP A 1 35 ? -7.163  4.509   -10.813 1.00 0.00 ? 35  ASP A C    9  
ATOM   9711  O  O    . ASP A 1 35 ? -6.073  4.173   -10.349 1.00 0.00 ? 35  ASP A O    9  
ATOM   9712  C  CB   . ASP A 1 35 ? -7.873  2.983   -12.664 1.00 0.00 ? 35  ASP A CB   9  
ATOM   9713  C  CG   . ASP A 1 35 ? -8.140  2.812   -14.147 1.00 0.00 ? 35  ASP A CG   9  
ATOM   9714  O  OD1  . ASP A 1 35 ? -9.135  3.384   -14.640 1.00 0.00 ? 35  ASP A OD1  9  
ATOM   9715  O  OD2  . ASP A 1 35 ? -7.355  2.107   -14.814 1.00 0.00 ? 35  ASP A OD2  9  
ATOM   9716  H  H    . ASP A 1 35 ? -5.420  4.848   -12.666 1.00 0.00 ? 35  ASP A H    9  
ATOM   9717  H  HA   . ASP A 1 35 ? -8.273  5.081   -12.542 1.00 0.00 ? 35  ASP A HA   9  
ATOM   9718  H  HB2  . ASP A 1 35 ? -7.082  2.304   -12.380 1.00 0.00 ? 35  ASP A HB2  9  
ATOM   9719  H  HB3  . ASP A 1 35 ? -8.772  2.729   -12.123 1.00 0.00 ? 35  ASP A HB3  9  
ATOM   9720  N  N    . PRO A 1 36 ? -8.153  4.980   -10.041 1.00 0.00 ? 36  PRO A N    9  
ATOM   9721  C  CA   . PRO A 1 36 ? -8.022  5.133   -8.589  1.00 0.00 ? 36  PRO A CA   9  
ATOM   9722  C  C    . PRO A 1 36 ? -7.966  3.791   -7.868  1.00 0.00 ? 36  PRO A C    9  
ATOM   9723  O  O    . PRO A 1 36 ? -8.577  2.815   -8.303  1.00 0.00 ? 36  PRO A O    9  
ATOM   9724  C  CB   . PRO A 1 36 ? -9.288  5.898   -8.197  1.00 0.00 ? 36  PRO A CB   9  
ATOM   9725  C  CG   . PRO A 1 36 ? -10.275 5.569   -9.262  1.00 0.00 ? 36  PRO A CG   9  
ATOM   9726  C  CD   . PRO A 1 36 ? -9.479  5.399   -10.527 1.00 0.00 ? 36  PRO A CD   9  
ATOM   9727  H  HA   . PRO A 1 36 ? -7.151  5.716   -8.329  1.00 0.00 ? 36  PRO A HA   9  
ATOM   9728  H  HB2  . PRO A 1 36 ? -9.627  5.565   -7.226  1.00 0.00 ? 36  PRO A HB2  9  
ATOM   9729  H  HB3  . PRO A 1 36 ? -9.078  6.957   -8.167  1.00 0.00 ? 36  PRO A HB3  9  
ATOM   9730  H  HG2  . PRO A 1 36 ? -10.789 4.652   -9.016  1.00 0.00 ? 36  PRO A HG2  9  
ATOM   9731  H  HG3  . PRO A 1 36 ? -10.981 6.379   -9.371  1.00 0.00 ? 36  PRO A HG3  9  
ATOM   9732  H  HD2  . PRO A 1 36 ? -9.920  4.636   -11.151 1.00 0.00 ? 36  PRO A HD2  9  
ATOM   9733  H  HD3  . PRO A 1 36 ? -9.415  6.335   -11.061 1.00 0.00 ? 36  PRO A HD3  9  
ATOM   9734  N  N    . TYR A 1 37 ? -7.229  3.748   -6.763  1.00 0.00 ? 37  TYR A N    9  
ATOM   9735  C  CA   . TYR A 1 37 ? -7.092  2.525   -5.982  1.00 0.00 ? 37  TYR A CA   9  
ATOM   9736  C  C    . TYR A 1 37 ? -6.590  2.831   -4.574  1.00 0.00 ? 37  TYR A C    9  
ATOM   9737  O  O    . TYR A 1 37 ? -6.180  3.953   -4.279  1.00 0.00 ? 37  TYR A O    9  
ATOM   9738  C  CB   . TYR A 1 37 ? -6.135  1.555   -6.678  1.00 0.00 ? 37  TYR A CB   9  
ATOM   9739  C  CG   . TYR A 1 37 ? -6.621  1.093   -8.032  1.00 0.00 ? 37  TYR A CG   9  
ATOM   9740  C  CD1  . TYR A 1 37 ? -7.788  0.350   -8.158  1.00 0.00 ? 37  TYR A CD1  9  
ATOM   9741  C  CD2  . TYR A 1 37 ? -5.913  1.399   -9.188  1.00 0.00 ? 37  TYR A CD2  9  
ATOM   9742  C  CE1  . TYR A 1 37 ? -8.235  -0.076  -9.394  1.00 0.00 ? 37  TYR A CE1  9  
ATOM   9743  C  CE2  . TYR A 1 37 ? -6.353  0.980   -10.428 1.00 0.00 ? 37  TYR A CE2  9  
ATOM   9744  C  CZ   . TYR A 1 37 ? -7.514  0.242   -10.526 1.00 0.00 ? 37  TYR A CZ   9  
ATOM   9745  O  OH   . TYR A 1 37 ? -7.957  -0.179  -11.759 1.00 0.00 ? 37  TYR A OH   9  
ATOM   9746  H  H    . TYR A 1 37 ? -6.765  4.559   -6.466  1.00 0.00 ? 37  TYR A H    9  
ATOM   9747  H  HA   . TYR A 1 37 ? -8.067  2.065   -5.912  1.00 0.00 ? 37  TYR A HA   9  
ATOM   9748  H  HB2  . TYR A 1 37 ? -5.181  2.040   -6.816  1.00 0.00 ? 37  TYR A HB2  9  
ATOM   9749  H  HB3  . TYR A 1 37 ? -6.004  0.682   -6.056  1.00 0.00 ? 37  TYR A HB3  9  
ATOM   9750  H  HD1  . TYR A 1 37 ? -8.351  0.103   -7.269  1.00 0.00 ? 37  TYR A HD1  9  
ATOM   9751  H  HD2  . TYR A 1 37 ? -5.003  1.977   -9.108  1.00 0.00 ? 37  TYR A HD2  9  
ATOM   9752  H  HE1  . TYR A 1 37 ? -9.145  -0.653  -9.470  1.00 0.00 ? 37  TYR A HE1  9  
ATOM   9753  H  HE2  . TYR A 1 37 ? -5.789  1.228   -11.315 1.00 0.00 ? 37  TYR A HE2  9  
ATOM   9754  H  HH   . TYR A 1 37 ? -8.076  0.582   -12.333 1.00 0.00 ? 37  TYR A HH   9  
ATOM   9755  N  N    . HIS A 1 38 ? -6.626  1.822   -3.708  1.00 0.00 ? 38  HIS A N    9  
ATOM   9756  C  CA   . HIS A 1 38 ? -6.173  1.981   -2.331  1.00 0.00 ? 38  HIS A CA   9  
ATOM   9757  C  C    . HIS A 1 38 ? -4.702  1.601   -2.195  1.00 0.00 ? 38  HIS A C    9  
ATOM   9758  O  O    . HIS A 1 38 ? -4.272  0.527   -2.615  1.00 0.00 ? 38  HIS A O    9  
ATOM   9759  C  CB   . HIS A 1 38 ? -7.022  1.125   -1.391  1.00 0.00 ? 38  HIS A CB   9  
ATOM   9760  C  CG   . HIS A 1 38 ? -8.305  1.780   -0.978  1.00 0.00 ? 38  HIS A CG   9  
ATOM   9761  N  ND1  . HIS A 1 38 ? -9.523  1.135   -1.007  1.00 0.00 ? 38  HIS A ND1  9  
ATOM   9762  C  CD2  . HIS A 1 38 ? -8.554  3.031   -0.523  1.00 0.00 ? 38  HIS A CD2  9  
ATOM   9763  C  CE1  . HIS A 1 38 ? -10.466 1.960   -0.589  1.00 0.00 ? 38  HIS A CE1  9  
ATOM   9764  N  NE2  . HIS A 1 38 ? -9.904  3.117   -0.289  1.00 0.00 ? 38  HIS A NE2  9  
ATOM   9765  H  H    . HIS A 1 38 ? -6.964  0.951   -4.003  1.00 0.00 ? 38  HIS A H    9  
ATOM   9766  H  HA   . HIS A 1 38 ? -6.290  3.020   -2.061  1.00 0.00 ? 38  HIS A HA   9  
ATOM   9767  H  HB2  . HIS A 1 38 ? -7.269  0.197   -1.884  1.00 0.00 ? 38  HIS A HB2  9  
ATOM   9768  H  HB3  . HIS A 1 38 ? -6.455  0.912   -0.496  1.00 0.00 ? 38  HIS A HB3  9  
ATOM   9769  H  HD2  . HIS A 1 38 ? -7.826  3.816   -0.373  1.00 0.00 ? 38  HIS A HD2  9  
ATOM   9770  H  HE1  . HIS A 1 38 ? -11.517 1.729   -0.506  1.00 0.00 ? 38  HIS A HE1  9  
ATOM   9771  H  HE2  . HIS A 1 38 ? -10.388 3.931   -0.037  1.00 0.00 ? 38  HIS A HE2  9  
ATOM   9772  N  N    . PRO A 1 39 ? -3.910  2.502   -1.594  1.00 0.00 ? 39  PRO A N    9  
ATOM   9773  C  CA   . PRO A 1 39 ? -2.475  2.283   -1.390  1.00 0.00 ? 39  PRO A CA   9  
ATOM   9774  C  C    . PRO A 1 39 ? -2.196  1.201   -0.352  1.00 0.00 ? 39  PRO A C    9  
ATOM   9775  O  O    . PRO A 1 39 ? -1.042  0.915   -0.035  1.00 0.00 ? 39  PRO A O    9  
ATOM   9776  C  CB   . PRO A 1 39 ? -1.977  3.642   -0.892  1.00 0.00 ? 39  PRO A CB   9  
ATOM   9777  C  CG   . PRO A 1 39 ? -3.172  4.281   -0.273  1.00 0.00 ? 39  PRO A CG   9  
ATOM   9778  C  CD   . PRO A 1 39 ? -4.355  3.804   -1.069  1.00 0.00 ? 39  PRO A CD   9  
ATOM   9779  H  HA   . PRO A 1 39 ? -1.977  2.031   -2.314  1.00 0.00 ? 39  PRO A HA   9  
ATOM   9780  H  HB2  . PRO A 1 39 ? -1.187  3.496   -0.169  1.00 0.00 ? 39  PRO A HB2  9  
ATOM   9781  H  HB3  . PRO A 1 39 ? -1.607  4.221   -1.725  1.00 0.00 ? 39  PRO A HB3  9  
ATOM   9782  H  HG2  . PRO A 1 39 ? -3.262  3.970   0.757   1.00 0.00 ? 39  PRO A HG2  9  
ATOM   9783  H  HG3  . PRO A 1 39 ? -3.087  5.356   -0.336  1.00 0.00 ? 39  PRO A HG3  9  
ATOM   9784  H  HD2  . PRO A 1 39 ? -5.218  3.687   -0.429  1.00 0.00 ? 39  PRO A HD2  9  
ATOM   9785  H  HD3  . PRO A 1 39 ? -4.570  4.491   -1.874  1.00 0.00 ? 39  PRO A HD3  9  
ATOM   9786  N  N    . ASP A 1 40 ? -3.260  0.603   0.172   1.00 0.00 ? 40  ASP A N    9  
ATOM   9787  C  CA   . ASP A 1 40 ? -3.129  -0.450  1.173   1.00 0.00 ? 40  ASP A CA   9  
ATOM   9788  C  C    . ASP A 1 40 ? -3.422  -1.818  0.565   1.00 0.00 ? 40  ASP A C    9  
ATOM   9789  O  O    . ASP A 1 40 ? -3.090  -2.851  1.147   1.00 0.00 ? 40  ASP A O    9  
ATOM   9790  C  CB   . ASP A 1 40 ? -4.074  -0.187  2.347   1.00 0.00 ? 40  ASP A CB   9  
ATOM   9791  C  CG   . ASP A 1 40 ? -5.503  0.048   1.898   1.00 0.00 ? 40  ASP A CG   9  
ATOM   9792  O  OD1  . ASP A 1 40 ? -6.108  -0.886  1.332   1.00 0.00 ? 40  ASP A OD1  9  
ATOM   9793  O  OD2  . ASP A 1 40 ? -6.016  1.167   2.112   1.00 0.00 ? 40  ASP A OD2  9  
ATOM   9794  H  H    . ASP A 1 40 ? -4.155  0.874   -0.122  1.00 0.00 ? 40  ASP A H    9  
ATOM   9795  H  HA   . ASP A 1 40 ? -2.112  -0.440  1.534   1.00 0.00 ? 40  ASP A HA   9  
ATOM   9796  H  HB2  . ASP A 1 40 ? -4.061  -1.041  3.009   1.00 0.00 ? 40  ASP A HB2  9  
ATOM   9797  H  HB3  . ASP A 1 40 ? -3.736  0.686   2.884   1.00 0.00 ? 40  ASP A HB3  9  
ATOM   9798  N  N    . HIS A 1 41 ? -4.045  -1.817  -0.609  1.00 0.00 ? 41  HIS A N    9  
ATOM   9799  C  CA   . HIS A 1 41 ? -4.383  -3.058  -1.296  1.00 0.00 ? 41  HIS A CA   9  
ATOM   9800  C  C    . HIS A 1 41 ? -3.128  -3.744  -1.827  1.00 0.00 ? 41  HIS A C    9  
ATOM   9801  O  O    . HIS A 1 41 ? -2.947  -4.950  -1.655  1.00 0.00 ? 41  HIS A O    9  
ATOM   9802  C  CB   . HIS A 1 41 ? -5.352  -2.782  -2.446  1.00 0.00 ? 41  HIS A CB   9  
ATOM   9803  C  CG   . HIS A 1 41 ? -6.772  -2.606  -2.004  1.00 0.00 ? 41  HIS A CG   9  
ATOM   9804  N  ND1  . HIS A 1 41 ? -7.255  -3.101  -0.811  1.00 0.00 ? 41  HIS A ND1  9  
ATOM   9805  C  CD2  . HIS A 1 41 ? -7.815  -1.983  -2.602  1.00 0.00 ? 41  HIS A CD2  9  
ATOM   9806  C  CE1  . HIS A 1 41 ? -8.535  -2.792  -0.695  1.00 0.00 ? 41  HIS A CE1  9  
ATOM   9807  N  NE2  . HIS A 1 41 ? -8.898  -2.113  -1.768  1.00 0.00 ? 41  HIS A NE2  9  
ATOM   9808  H  H    . HIS A 1 41 ? -4.283  -0.961  -1.023  1.00 0.00 ? 41  HIS A H    9  
ATOM   9809  H  HA   . HIS A 1 41 ? -4.861  -3.713  -0.583  1.00 0.00 ? 41  HIS A HA   9  
ATOM   9810  H  HB2  . HIS A 1 41 ? -5.049  -1.878  -2.954  1.00 0.00 ? 41  HIS A HB2  9  
ATOM   9811  H  HB3  . HIS A 1 41 ? -5.320  -3.608  -3.142  1.00 0.00 ? 41  HIS A HB3  9  
ATOM   9812  H  HD1  . HIS A 1 41 ? -6.738  -3.605  -0.149  1.00 0.00 ? 41  HIS A HD1  9  
ATOM   9813  H  HD2  . HIS A 1 41 ? -7.798  -1.478  -3.557  1.00 0.00 ? 41  HIS A HD2  9  
ATOM   9814  H  HE1  . HIS A 1 41 ? -9.174  -3.050  0.135   1.00 0.00 ? 41  HIS A HE1  9  
ATOM   9815  N  N    . PHE A 1 42 ? -2.263  -2.969  -2.472  1.00 0.00 ? 42  PHE A N    9  
ATOM   9816  C  CA   . PHE A 1 42 ? -1.025  -3.502  -3.029  1.00 0.00 ? 42  PHE A CA   9  
ATOM   9817  C  C    . PHE A 1 42 ? 0.132   -3.328  -2.050  1.00 0.00 ? 42  PHE A C    9  
ATOM   9818  O  O    . PHE A 1 42 ? 0.054   -2.529  -1.118  1.00 0.00 ? 42  PHE A O    9  
ATOM   9819  C  CB   . PHE A 1 42 ? -0.697  -2.808  -4.353  1.00 0.00 ? 42  PHE A CB   9  
ATOM   9820  C  CG   . PHE A 1 42 ? -1.898  -2.585  -5.227  1.00 0.00 ? 42  PHE A CG   9  
ATOM   9821  C  CD1  . PHE A 1 42 ? -2.316  -3.562  -6.116  1.00 0.00 ? 42  PHE A CD1  9  
ATOM   9822  C  CD2  . PHE A 1 42 ? -2.608  -1.397  -5.160  1.00 0.00 ? 42  PHE A CD2  9  
ATOM   9823  C  CE1  . PHE A 1 42 ? -3.420  -3.359  -6.922  1.00 0.00 ? 42  PHE A CE1  9  
ATOM   9824  C  CE2  . PHE A 1 42 ? -3.714  -1.189  -5.962  1.00 0.00 ? 42  PHE A CE2  9  
ATOM   9825  C  CZ   . PHE A 1 42 ? -4.120  -2.171  -6.845  1.00 0.00 ? 42  PHE A CZ   9  
ATOM   9826  H  H    . PHE A 1 42 ? -2.463  -2.014  -2.577  1.00 0.00 ? 42  PHE A H    9  
ATOM   9827  H  HA   . PHE A 1 42 ? -1.172  -4.555  -3.211  1.00 0.00 ? 42  PHE A HA   9  
ATOM   9828  H  HB2  . PHE A 1 42 ? -0.254  -1.846  -4.147  1.00 0.00 ? 42  PHE A HB2  9  
ATOM   9829  H  HB3  . PHE A 1 42 ? 0.008   -3.414  -4.903  1.00 0.00 ? 42  PHE A HB3  9  
ATOM   9830  H  HD1  . PHE A 1 42 ? -1.768  -4.492  -6.177  1.00 0.00 ? 42  PHE A HD1  9  
ATOM   9831  H  HD2  . PHE A 1 42 ? -2.292  -0.628  -4.471  1.00 0.00 ? 42  PHE A HD2  9  
ATOM   9832  H  HE1  . PHE A 1 42 ? -3.735  -4.129  -7.611  1.00 0.00 ? 42  PHE A HE1  9  
ATOM   9833  H  HE2  . PHE A 1 42 ? -4.259  -0.259  -5.901  1.00 0.00 ? 42  PHE A HE2  9  
ATOM   9834  H  HZ   . PHE A 1 42 ? -4.984  -2.011  -7.473  1.00 0.00 ? 42  PHE A HZ   9  
ATOM   9835  N  N    . ASN A 1 43 ? 1.203   -4.083  -2.269  1.00 0.00 ? 43  ASN A N    9  
ATOM   9836  C  CA   . ASN A 1 43 ? 2.376   -4.013  -1.406  1.00 0.00 ? 43  ASN A CA   9  
ATOM   9837  C  C    . ASN A 1 43 ? 3.660   -4.010  -2.231  1.00 0.00 ? 43  ASN A C    9  
ATOM   9838  O  O    . ASN A 1 43 ? 3.707   -4.569  -3.327  1.00 0.00 ? 43  ASN A O    9  
ATOM   9839  C  CB   . ASN A 1 43 ? 2.387   -5.191  -0.429  1.00 0.00 ? 43  ASN A CB   9  
ATOM   9840  C  CG   . ASN A 1 43 ? 1.400   -5.008  0.708   1.00 0.00 ? 43  ASN A CG   9  
ATOM   9841  O  OD1  . ASN A 1 43 ? 0.191   -4.940  0.489   1.00 0.00 ? 43  ASN A OD1  9  
ATOM   9842  N  ND2  . ASN A 1 43 ? 1.914   -4.928  1.930   1.00 0.00 ? 43  ASN A ND2  9  
ATOM   9843  H  H    . ASN A 1 43 ? 1.205   -4.701  -3.029  1.00 0.00 ? 43  ASN A H    9  
ATOM   9844  H  HA   . ASN A 1 43 ? 2.321   -3.092  -0.845  1.00 0.00 ? 43  ASN A HA   9  
ATOM   9845  H  HB2  . ASN A 1 43 ? 2.130   -6.095  -0.962  1.00 0.00 ? 43  ASN A HB2  9  
ATOM   9846  H  HB3  . ASN A 1 43 ? 3.377   -5.295  -0.010  1.00 0.00 ? 43  ASN A HB3  9  
ATOM   9847  H  HD21 . ASN A 1 43 ? 2.887   -4.990  2.028   1.00 0.00 ? 43  ASN A HD21 9  
ATOM   9848  H  HD22 . ASN A 1 43 ? 1.298   -4.810  2.683   1.00 0.00 ? 43  ASN A HD22 9  
ATOM   9849  N  N    . CYS A 1 44 ? 4.699   -3.379  -1.696  1.00 0.00 ? 44  CYS A N    9  
ATOM   9850  C  CA   . CYS A 1 44 ? 5.984   -3.303  -2.381  1.00 0.00 ? 44  CYS A CA   9  
ATOM   9851  C  C    . CYS A 1 44 ? 6.399   -4.672  -2.912  1.00 0.00 ? 44  CYS A C    9  
ATOM   9852  O  O    . CYS A 1 44 ? 5.893   -5.701  -2.467  1.00 0.00 ? 44  CYS A O    9  
ATOM   9853  C  CB   . CYS A 1 44 ? 7.059   -2.763  -1.435  1.00 0.00 ? 44  CYS A CB   9  
ATOM   9854  S  SG   . CYS A 1 44 ? 8.660   -2.434  -2.240  1.00 0.00 ? 44  CYS A SG   9  
ATOM   9855  H  H    . CYS A 1 44 ? 4.600   -2.952  -0.818  1.00 0.00 ? 44  CYS A H    9  
ATOM   9856  H  HA   . CYS A 1 44 ? 5.876   -2.625  -3.214  1.00 0.00 ? 44  CYS A HA   9  
ATOM   9857  H  HB2  . CYS A 1 44 ? 6.713   -1.836  -1.002  1.00 0.00 ? 44  CYS A HB2  9  
ATOM   9858  H  HB3  . CYS A 1 44 ? 7.228   -3.482  -0.647  1.00 0.00 ? 44  CYS A HB3  9  
ATOM   9859  N  N    . ALA A 1 45 ? 7.323   -4.674  -3.867  1.00 0.00 ? 45  ALA A N    9  
ATOM   9860  C  CA   . ALA A 1 45 ? 7.808   -5.916  -4.458  1.00 0.00 ? 45  ALA A CA   9  
ATOM   9861  C  C    . ALA A 1 45 ? 9.210   -6.249  -3.961  1.00 0.00 ? 45  ALA A C    9  
ATOM   9862  O  O    . ALA A 1 45 ? 9.615   -7.411  -3.950  1.00 0.00 ? 45  ALA A O    9  
ATOM   9863  C  CB   . ALA A 1 45 ? 7.793   -5.819  -5.976  1.00 0.00 ? 45  ALA A CB   9  
ATOM   9864  H  H    . ALA A 1 45 ? 7.688   -3.821  -4.181  1.00 0.00 ? 45  ALA A H    9  
ATOM   9865  H  HA   . ALA A 1 45 ? 7.135   -6.709  -4.166  1.00 0.00 ? 45  ALA A HA   9  
ATOM   9866  H  HB1  . ALA A 1 45 ? 7.399   -4.857  -6.271  1.00 0.00 ? 45  ALA A HB1  9  
ATOM   9867  H  HB2  . ALA A 1 45 ? 8.799   -5.927  -6.353  1.00 0.00 ? 45  ALA A HB2  9  
ATOM   9868  H  HB3  . ALA A 1 45 ? 7.170   -6.602  -6.381  1.00 0.00 ? 45  ALA A HB3  9  
ATOM   9869  N  N    . ASN A 1 46 ? 9.948   -5.222  -3.551  1.00 0.00 ? 46  ASN A N    9  
ATOM   9870  C  CA   . ASN A 1 46 ? 11.306  -5.406  -3.054  1.00 0.00 ? 46  ASN A CA   9  
ATOM   9871  C  C    . ASN A 1 46 ? 11.295  -5.898  -1.610  1.00 0.00 ? 46  ASN A C    9  
ATOM   9872  O  O    . ASN A 1 46 ? 11.756  -7.001  -1.314  1.00 0.00 ? 46  ASN A O    9  
ATOM   9873  C  CB   . ASN A 1 46 ? 12.090  -4.096  -3.152  1.00 0.00 ? 46  ASN A CB   9  
ATOM   9874  C  CG   . ASN A 1 46 ? 13.526  -4.245  -2.689  1.00 0.00 ? 46  ASN A CG   9  
ATOM   9875  O  OD1  . ASN A 1 46 ? 14.393  -4.676  -3.450  1.00 0.00 ? 46  ASN A OD1  9  
ATOM   9876  N  ND2  . ASN A 1 46 ? 13.784  -3.889  -1.436  1.00 0.00 ? 46  ASN A ND2  9  
ATOM   9877  H  H    . ASN A 1 46 ? 9.569   -4.318  -3.584  1.00 0.00 ? 46  ASN A H    9  
ATOM   9878  H  HA   . ASN A 1 46 ? 11.787  -6.150  -3.671  1.00 0.00 ? 46  ASN A HA   9  
ATOM   9879  H  HB2  . ASN A 1 46 ? 12.096  -3.763  -4.180  1.00 0.00 ? 46  ASN A HB2  9  
ATOM   9880  H  HB3  . ASN A 1 46 ? 11.609  -3.349  -2.539  1.00 0.00 ? 46  ASN A HB3  9  
ATOM   9881  H  HD21 . ASN A 1 46 ? 13.044  -3.555  -0.888  1.00 0.00 ? 46  ASN A HD21 9  
ATOM   9882  H  HD22 . ASN A 1 46 ? 14.705  -3.975  -1.111  1.00 0.00 ? 46  ASN A HD22 9  
ATOM   9883  N  N    . CYS A 1 47 ? 10.765  -5.073  -0.713  1.00 0.00 ? 47  CYS A N    9  
ATOM   9884  C  CA   . CYS A 1 47 ? 10.692  -5.422  0.700   1.00 0.00 ? 47  CYS A CA   9  
ATOM   9885  C  C    . CYS A 1 47 ? 9.428   -6.224  0.998   1.00 0.00 ? 47  CYS A C    9  
ATOM   9886  O  O    . CYS A 1 47 ? 9.487   -7.291  1.608   1.00 0.00 ? 47  CYS A O    9  
ATOM   9887  C  CB   . CYS A 1 47 ? 10.722  -4.158  1.562   1.00 0.00 ? 47  CYS A CB   9  
ATOM   9888  S  SG   . CYS A 1 47 ? 9.501   -2.897  1.075   1.00 0.00 ? 47  CYS A SG   9  
ATOM   9889  H  H    . CYS A 1 47 ? 10.413  -4.206  -1.010  1.00 0.00 ? 47  CYS A H    9  
ATOM   9890  H  HA   . CYS A 1 47 ? 11.553  -6.029  0.937   1.00 0.00 ? 47  CYS A HA   9  
ATOM   9891  H  HB2  . CYS A 1 47 ? 10.523  -4.427  2.589   1.00 0.00 ? 47  CYS A HB2  9  
ATOM   9892  H  HB3  . CYS A 1 47 ? 11.702  -3.710  1.496   1.00 0.00 ? 47  CYS A HB3  9  
ATOM   9893  N  N    . GLY A 1 48 ? 8.286   -5.702  0.563   1.00 0.00 ? 48  GLY A N    9  
ATOM   9894  C  CA   . GLY A 1 48 ? 7.024   -6.382  0.792   1.00 0.00 ? 48  GLY A CA   9  
ATOM   9895  C  C    . GLY A 1 48 ? 6.213   -5.740  1.900   1.00 0.00 ? 48  GLY A C    9  
ATOM   9896  O  O    . GLY A 1 48 ? 5.673   -6.431  2.765   1.00 0.00 ? 48  GLY A O    9  
ATOM   9897  H  H    . GLY A 1 48 ? 8.300   -4.847  0.082   1.00 0.00 ? 48  GLY A H    9  
ATOM   9898  H  HA2  . GLY A 1 48 ? 6.447   -6.363  -0.120  1.00 0.00 ? 48  GLY A HA2  9  
ATOM   9899  H  HA3  . GLY A 1 48 ? 7.225   -7.409  1.058   1.00 0.00 ? 48  GLY A HA3  9  
ATOM   9900  N  N    . LYS A 1 49 ? 6.127   -4.414  1.877   1.00 0.00 ? 49  LYS A N    9  
ATOM   9901  C  CA   . LYS A 1 49 ? 5.376   -3.678  2.887   1.00 0.00 ? 49  LYS A CA   9  
ATOM   9902  C  C    . LYS A 1 49 ? 4.150   -3.010  2.274   1.00 0.00 ? 49  LYS A C    9  
ATOM   9903  O  O    . LYS A 1 49 ? 4.011   -2.949  1.053   1.00 0.00 ? 49  LYS A O    9  
ATOM   9904  C  CB   . LYS A 1 49 ? 6.268   -2.623  3.547   1.00 0.00 ? 49  LYS A CB   9  
ATOM   9905  C  CG   . LYS A 1 49 ? 6.632   -1.472  2.625   1.00 0.00 ? 49  LYS A CG   9  
ATOM   9906  C  CD   . LYS A 1 49 ? 7.407   -0.392  3.361   1.00 0.00 ? 49  LYS A CD   9  
ATOM   9907  C  CE   . LYS A 1 49 ? 8.787   -0.881  3.776   1.00 0.00 ? 49  LYS A CE   9  
ATOM   9908  N  NZ   . LYS A 1 49 ? 9.478   0.097   4.661   1.00 0.00 ? 49  LYS A NZ   9  
ATOM   9909  H  H    . LYS A 1 49 ? 6.580   -3.919  1.162   1.00 0.00 ? 49  LYS A H    9  
ATOM   9910  H  HA   . LYS A 1 49 ? 5.051   -4.382  3.637   1.00 0.00 ? 49  LYS A HA   9  
ATOM   9911  H  HB2  . LYS A 1 49 ? 5.752   -2.220  4.406   1.00 0.00 ? 49  LYS A HB2  9  
ATOM   9912  H  HB3  . LYS A 1 49 ? 7.182   -3.097  3.876   1.00 0.00 ? 49  LYS A HB3  9  
ATOM   9913  H  HG2  . LYS A 1 49 ? 7.241   -1.849  1.817   1.00 0.00 ? 49  LYS A HG2  9  
ATOM   9914  H  HG3  . LYS A 1 49 ? 5.725   -1.043  2.225   1.00 0.00 ? 49  LYS A HG3  9  
ATOM   9915  H  HD2  . LYS A 1 49 ? 7.521   0.463   2.712   1.00 0.00 ? 49  LYS A HD2  9  
ATOM   9916  H  HD3  . LYS A 1 49 ? 6.856   -0.105  4.245   1.00 0.00 ? 49  LYS A HD3  9  
ATOM   9917  H  HE2  . LYS A 1 49 ? 8.679   -1.816  4.303   1.00 0.00 ? 49  LYS A HE2  9  
ATOM   9918  H  HE3  . LYS A 1 49 ? 9.382   -1.034  2.888   1.00 0.00 ? 49  LYS A HE3  9  
ATOM   9919  H  HZ1  . LYS A 1 49 ? 10.069  -0.404  5.354   1.00 0.00 ? 49  LYS A HZ1  9  
ATOM   9920  H  HZ2  . LYS A 1 49 ? 8.780   0.674   5.171   1.00 0.00 ? 49  LYS A HZ2  9  
ATOM   9921  H  HZ3  . LYS A 1 49 ? 10.084  0.725   4.095   1.00 0.00 ? 49  LYS A HZ3  9  
ATOM   9922  N  N    . GLU A 1 50 ? 3.264   -2.510  3.130   1.00 0.00 ? 50  GLU A N    9  
ATOM   9923  C  CA   . GLU A 1 50 ? 2.049   -1.847  2.670   1.00 0.00 ? 50  GLU A CA   9  
ATOM   9924  C  C    . GLU A 1 50 ? 2.382   -0.553  1.933   1.00 0.00 ? 50  GLU A C    9  
ATOM   9925  O  O    . GLU A 1 50 ? 2.699   0.464   2.552   1.00 0.00 ? 50  GLU A O    9  
ATOM   9926  C  CB   . GLU A 1 50 ? 1.125   -1.550  3.853   1.00 0.00 ? 50  GLU A CB   9  
ATOM   9927  C  CG   . GLU A 1 50 ? -0.340  -1.440  3.467   1.00 0.00 ? 50  GLU A CG   9  
ATOM   9928  C  CD   . GLU A 1 50 ? -1.051  -2.779  3.485   1.00 0.00 ? 50  GLU A CD   9  
ATOM   9929  O  OE1  . GLU A 1 50 ? -0.807  -3.591  2.567   1.00 0.00 ? 50  GLU A OE1  9  
ATOM   9930  O  OE2  . GLU A 1 50 ? -1.850  -3.016  4.414   1.00 0.00 ? 50  GLU A OE2  9  
ATOM   9931  H  H    . GLU A 1 50 ? 3.430   -2.590  4.092   1.00 0.00 ? 50  GLU A H    9  
ATOM   9932  H  HA   . GLU A 1 50 ? 1.544   -2.515  1.989   1.00 0.00 ? 50  GLU A HA   9  
ATOM   9933  H  HB2  . GLU A 1 50 ? 1.226   -2.341  4.581   1.00 0.00 ? 50  GLU A HB2  9  
ATOM   9934  H  HB3  . GLU A 1 50 ? 1.428   -0.616  4.304   1.00 0.00 ? 50  GLU A HB3  9  
ATOM   9935  H  HG2  . GLU A 1 50 ? -0.834  -0.779  4.164   1.00 0.00 ? 50  GLU A HG2  9  
ATOM   9936  H  HG3  . GLU A 1 50 ? -0.408  -1.026  2.472   1.00 0.00 ? 50  GLU A HG3  9  
ATOM   9937  N  N    . LEU A 1 51 ? 2.308   -0.598  0.607   1.00 0.00 ? 51  LEU A N    9  
ATOM   9938  C  CA   . LEU A 1 51 ? 2.602   0.570   -0.216  1.00 0.00 ? 51  LEU A CA   9  
ATOM   9939  C  C    . LEU A 1 51 ? 1.824   1.788   0.271   1.00 0.00 ? 51  LEU A C    9  
ATOM   9940  O  O    . LEU A 1 51 ? 1.004   1.691   1.184   1.00 0.00 ? 51  LEU A O    9  
ATOM   9941  C  CB   . LEU A 1 51 ? 2.262   0.285   -1.680  1.00 0.00 ? 51  LEU A CB   9  
ATOM   9942  C  CG   . LEU A 1 51 ? 3.219   -0.649  -2.421  1.00 0.00 ? 51  LEU A CG   9  
ATOM   9943  C  CD1  . LEU A 1 51 ? 2.626   -1.071  -3.756  1.00 0.00 ? 51  LEU A CD1  9  
ATOM   9944  C  CD2  . LEU A 1 51 ? 4.570   0.022   -2.624  1.00 0.00 ? 51  LEU A CD2  9  
ATOM   9945  H  H    . LEU A 1 51 ? 2.050   -1.436  0.171   1.00 0.00 ? 51  LEU A H    9  
ATOM   9946  H  HA   . LEU A 1 51 ? 3.659   0.776   -0.133  1.00 0.00 ? 51  LEU A HA   9  
ATOM   9947  H  HB2  . LEU A 1 51 ? 1.279   -0.157  -1.711  1.00 0.00 ? 51  LEU A HB2  9  
ATOM   9948  H  HB3  . LEU A 1 51 ? 2.248   1.229   -2.205  1.00 0.00 ? 51  LEU A HB3  9  
ATOM   9949  H  HG   . LEU A 1 51 ? 3.373   -1.541  -1.828  1.00 0.00 ? 51  LEU A HG   9  
ATOM   9950  H  HD11 . LEU A 1 51 ? 3.035   -2.027  -4.046  1.00 0.00 ? 51  LEU A HD11 9  
ATOM   9951  H  HD12 . LEU A 1 51 ? 2.869   -0.334  -4.507  1.00 0.00 ? 51  LEU A HD12 9  
ATOM   9952  H  HD13 . LEU A 1 51 ? 1.553   -1.151  -3.664  1.00 0.00 ? 51  LEU A HD13 9  
ATOM   9953  H  HD21 . LEU A 1 51 ? 4.775   0.675   -1.789  1.00 0.00 ? 51  LEU A HD21 9  
ATOM   9954  H  HD22 . LEU A 1 51 ? 4.552   0.599   -3.537  1.00 0.00 ? 51  LEU A HD22 9  
ATOM   9955  H  HD23 . LEU A 1 51 ? 5.340   -0.732  -2.689  1.00 0.00 ? 51  LEU A HD23 9  
ATOM   9956  N  N    . THR A 1 52 ? 2.085   2.936   -0.347  1.00 0.00 ? 52  THR A N    9  
ATOM   9957  C  CA   . THR A 1 52 ? 1.409   4.174   0.021   1.00 0.00 ? 52  THR A CA   9  
ATOM   9958  C  C    . THR A 1 52 ? 0.798   4.851   -1.200  1.00 0.00 ? 52  THR A C    9  
ATOM   9959  O  O    . THR A 1 52 ? 1.006   4.416   -2.332  1.00 0.00 ? 52  THR A O    9  
ATOM   9960  C  CB   . THR A 1 52 ? 2.374   5.157   0.711   1.00 0.00 ? 52  THR A CB   9  
ATOM   9961  O  OG1  . THR A 1 52 ? 3.456   5.480   -0.169  1.00 0.00 ? 52  THR A OG1  9  
ATOM   9962  C  CG2  . THR A 1 52 ? 2.922   4.563   2.000   1.00 0.00 ? 52  THR A CG2  9  
ATOM   9963  H  H    . THR A 1 52 ? 2.749   2.950   -1.068  1.00 0.00 ? 52  THR A H    9  
ATOM   9964  H  HA   . THR A 1 52 ? 0.620   3.928   0.717   1.00 0.00 ? 52  THR A HA   9  
ATOM   9965  H  HB   . THR A 1 52 ? 1.832   6.061   0.951   1.00 0.00 ? 52  THR A HB   9  
ATOM   9966  H  HG1  . THR A 1 52 ? 4.096   6.024   0.297   1.00 0.00 ? 52  THR A HG1  9  
ATOM   9967  H  HG21 . THR A 1 52 ? 3.557   3.721   1.767   1.00 0.00 ? 52  THR A HG21 9  
ATOM   9968  H  HG22 . THR A 1 52 ? 2.103   4.235   2.622   1.00 0.00 ? 52  THR A HG22 9  
ATOM   9969  H  HG23 . THR A 1 52 ? 3.496   5.311   2.525   1.00 0.00 ? 52  THR A HG23 9  
ATOM   9970  N  N    . ALA A 1 53 ? 0.044   5.919   -0.962  1.00 0.00 ? 53  ALA A N    9  
ATOM   9971  C  CA   . ALA A 1 53 ? -0.595  6.659   -2.044  1.00 0.00 ? 53  ALA A CA   9  
ATOM   9972  C  C    . ALA A 1 53 ? 0.443   7.282   -2.971  1.00 0.00 ? 53  ALA A C    9  
ATOM   9973  O  O    . ALA A 1 53 ? 0.248   7.345   -4.185  1.00 0.00 ? 53  ALA A O    9  
ATOM   9974  C  CB   . ALA A 1 53 ? -1.513  7.732   -1.479  1.00 0.00 ? 53  ALA A CB   9  
ATOM   9975  H  H    . ALA A 1 53 ? -0.085  6.218   -0.038  1.00 0.00 ? 53  ALA A H    9  
ATOM   9976  H  HA   . ALA A 1 53 ? -1.199  5.965   -2.611  1.00 0.00 ? 53  ALA A HA   9  
ATOM   9977  H  HB1  . ALA A 1 53 ? -2.360  7.264   -0.998  1.00 0.00 ? 53  ALA A HB1  9  
ATOM   9978  H  HB2  . ALA A 1 53 ? -0.972  8.326   -0.757  1.00 0.00 ? 53  ALA A HB2  9  
ATOM   9979  H  HB3  . ALA A 1 53 ? -1.860  8.367   -2.280  1.00 0.00 ? 53  ALA A HB3  9  
ATOM   9980  N  N    . ASP A 1 54 ? 1.546   7.744   -2.391  1.00 0.00 ? 54  ASP A N    9  
ATOM   9981  C  CA   . ASP A 1 54 ? 2.615   8.362   -3.166  1.00 0.00 ? 54  ASP A CA   9  
ATOM   9982  C  C    . ASP A 1 54 ? 3.572   7.307   -3.710  1.00 0.00 ? 54  ASP A C    9  
ATOM   9983  O  O    . ASP A 1 54 ? 4.669   7.626   -4.167  1.00 0.00 ? 54  ASP A O    9  
ATOM   9984  C  CB   . ASP A 1 54 ? 3.381   9.368   -2.305  1.00 0.00 ? 54  ASP A CB   9  
ATOM   9985  C  CG   . ASP A 1 54 ? 2.537   10.569  -1.927  1.00 0.00 ? 54  ASP A CG   9  
ATOM   9986  O  OD1  . ASP A 1 54 ? 2.146   11.329  -2.837  1.00 0.00 ? 54  ASP A OD1  9  
ATOM   9987  O  OD2  . ASP A 1 54 ? 2.266   10.749  -0.721  1.00 0.00 ? 54  ASP A OD2  9  
ATOM   9988  H  H    . ASP A 1 54 ? 1.643   7.665   -1.419  1.00 0.00 ? 54  ASP A H    9  
ATOM   9989  H  HA   . ASP A 1 54 ? 2.164   8.884   -3.996  1.00 0.00 ? 54  ASP A HA   9  
ATOM   9990  H  HB2  . ASP A 1 54 ? 3.707   8.881   -1.397  1.00 0.00 ? 54  ASP A HB2  9  
ATOM   9991  H  HB3  . ASP A 1 54 ? 4.245   9.715   -2.851  1.00 0.00 ? 54  ASP A HB3  9  
ATOM   9992  N  N    . ALA A 1 55 ? 3.150   6.048   -3.657  1.00 0.00 ? 55  ALA A N    9  
ATOM   9993  C  CA   . ALA A 1 55 ? 3.969   4.946   -4.145  1.00 0.00 ? 55  ALA A CA   9  
ATOM   9994  C  C    . ALA A 1 55 ? 4.528   5.249   -5.531  1.00 0.00 ? 55  ALA A C    9  
ATOM   9995  O  O    . ALA A 1 55 ? 4.180   6.259   -6.143  1.00 0.00 ? 55  ALA A O    9  
ATOM   9996  C  CB   . ALA A 1 55 ? 3.159   3.658   -4.171  1.00 0.00 ? 55  ALA A CB   9  
ATOM   9997  H  H    . ALA A 1 55 ? 2.265   5.856   -3.281  1.00 0.00 ? 55  ALA A H    9  
ATOM   9998  H  HA   . ALA A 1 55 ? 4.792   4.811   -3.458  1.00 0.00 ? 55  ALA A HA   9  
ATOM   9999  H  HB1  . ALA A 1 55 ? 2.106   3.896   -4.205  1.00 0.00 ? 55  ALA A HB1  9  
ATOM   10000 H  HB2  . ALA A 1 55 ? 3.427   3.082   -5.045  1.00 0.00 ? 55  ALA A HB2  9  
ATOM   10001 H  HB3  . ALA A 1 55 ? 3.370   3.082   -3.282  1.00 0.00 ? 55  ALA A HB3  9  
ATOM   10002 N  N    . ARG A 1 56 ? 5.396   4.369   -6.020  1.00 0.00 ? 56  ARG A N    9  
ATOM   10003 C  CA   . ARG A 1 56 ? 6.004   4.545   -7.333  1.00 0.00 ? 56  ARG A CA   9  
ATOM   10004 C  C    . ARG A 1 56 ? 5.776   3.315   -8.207  1.00 0.00 ? 56  ARG A C    9  
ATOM   10005 O  O    . ARG A 1 56 ? 5.743   2.189   -7.712  1.00 0.00 ? 56  ARG A O    9  
ATOM   10006 C  CB   . ARG A 1 56 ? 7.504   4.813   -7.192  1.00 0.00 ? 56  ARG A CB   9  
ATOM   10007 C  CG   . ARG A 1 56 ? 7.834   5.924   -6.209  1.00 0.00 ? 56  ARG A CG   9  
ATOM   10008 C  CD   . ARG A 1 56 ? 7.694   7.296   -6.851  1.00 0.00 ? 56  ARG A CD   9  
ATOM   10009 N  NE   . ARG A 1 56 ? 7.360   8.327   -5.872  1.00 0.00 ? 56  ARG A NE   9  
ATOM   10010 C  CZ   . ARG A 1 56 ? 7.550   9.625   -6.079  1.00 0.00 ? 56  ARG A CZ   9  
ATOM   10011 N  NH1  . ARG A 1 56 ? 8.067   10.049  -7.224  1.00 0.00 ? 56  ARG A NH1  9  
ATOM   10012 N  NH2  . ARG A 1 56 ? 7.221   10.503  -5.139  1.00 0.00 ? 56  ARG A NH2  9  
ATOM   10013 H  H    . ARG A 1 56 ? 5.633   3.584   -5.484  1.00 0.00 ? 56  ARG A H    9  
ATOM   10014 H  HA   . ARG A 1 56 ? 5.538   5.398   -7.803  1.00 0.00 ? 56  ARG A HA   9  
ATOM   10015 H  HB2  . ARG A 1 56 ? 7.989   3.909   -6.855  1.00 0.00 ? 56  ARG A HB2  9  
ATOM   10016 H  HB3  . ARG A 1 56 ? 7.901   5.086   -8.158  1.00 0.00 ? 56  ARG A HB3  9  
ATOM   10017 H  HG2  . ARG A 1 56 ? 7.159   5.862   -5.368  1.00 0.00 ? 56  ARG A HG2  9  
ATOM   10018 H  HG3  . ARG A 1 56 ? 8.851   5.799   -5.867  1.00 0.00 ? 56  ARG A HG3  9  
ATOM   10019 H  HD2  . ARG A 1 56 ? 8.628   7.553   -7.327  1.00 0.00 ? 56  ARG A HD2  9  
ATOM   10020 H  HD3  . ARG A 1 56 ? 6.912   7.252   -7.594  1.00 0.00 ? 56  ARG A HD3  9  
ATOM   10021 H  HE   . ARG A 1 56 ? 6.977   8.036   -5.019  1.00 0.00 ? 56  ARG A HE   9  
ATOM   10022 H  HH11 . ARG A 1 56 ? 8.314   9.390   -7.934  1.00 0.00 ? 56  ARG A HH11 9  
ATOM   10023 H  HH12 . ARG A 1 56 ? 8.207   11.027  -7.378  1.00 0.00 ? 56  ARG A HH12 9  
ATOM   10024 H  HH21 . ARG A 1 56 ? 6.831   10.187  -4.275  1.00 0.00 ? 56  ARG A HH21 9  
ATOM   10025 H  HH22 . ARG A 1 56 ? 7.364   11.480  -5.296  1.00 0.00 ? 56  ARG A HH22 9  
ATOM   10026 N  N    . GLU A 1 57 ? 5.620   3.540   -9.507  1.00 0.00 ? 57  GLU A N    9  
ATOM   10027 C  CA   . GLU A 1 57 ? 5.394   2.450   -10.449 1.00 0.00 ? 57  GLU A CA   9  
ATOM   10028 C  C    . GLU A 1 57 ? 6.648   2.175   -11.274 1.00 0.00 ? 57  GLU A C    9  
ATOM   10029 O  O    . GLU A 1 57 ? 7.152   3.057   -11.971 1.00 0.00 ? 57  GLU A O    9  
ATOM   10030 C  CB   . GLU A 1 57 ? 4.223   2.782   -11.376 1.00 0.00 ? 57  GLU A CB   9  
ATOM   10031 C  CG   . GLU A 1 57 ? 3.972   1.728   -12.441 1.00 0.00 ? 57  GLU A CG   9  
ATOM   10032 C  CD   . GLU A 1 57 ? 3.216   2.275   -13.637 1.00 0.00 ? 57  GLU A CD   9  
ATOM   10033 O  OE1  . GLU A 1 57 ? 3.717   3.228   -14.269 1.00 0.00 ? 57  GLU A OE1  9  
ATOM   10034 O  OE2  . GLU A 1 57 ? 2.124   1.751   -13.939 1.00 0.00 ? 57  GLU A OE2  9  
ATOM   10035 H  H    . GLU A 1 57 ? 5.657   4.461   -9.841  1.00 0.00 ? 57  GLU A H    9  
ATOM   10036 H  HA   . GLU A 1 57 ? 5.151   1.566   -9.880  1.00 0.00 ? 57  GLU A HA   9  
ATOM   10037 H  HB2  . GLU A 1 57 ? 3.327   2.884   -10.782 1.00 0.00 ? 57  GLU A HB2  9  
ATOM   10038 H  HB3  . GLU A 1 57 ? 4.425   3.721   -11.869 1.00 0.00 ? 57  GLU A HB3  9  
ATOM   10039 H  HG2  . GLU A 1 57 ? 4.923   1.345   -12.781 1.00 0.00 ? 57  GLU A HG2  9  
ATOM   10040 H  HG3  . GLU A 1 57 ? 3.396   0.925   -12.006 1.00 0.00 ? 57  GLU A HG3  9  
ATOM   10041 N  N    . LEU A 1 58 ? 7.146   0.947   -11.189 1.00 0.00 ? 58  LEU A N    9  
ATOM   10042 C  CA   . LEU A 1 58 ? 8.342   0.554   -11.927 1.00 0.00 ? 58  LEU A CA   9  
ATOM   10043 C  C    . LEU A 1 58 ? 8.084   -0.704  -12.752 1.00 0.00 ? 58  LEU A C    9  
ATOM   10044 O  O    . LEU A 1 58 ? 7.659   -1.730  -12.222 1.00 0.00 ? 58  LEU A O    9  
ATOM   10045 C  CB   . LEU A 1 58 ? 9.505   0.316   -10.963 1.00 0.00 ? 58  LEU A CB   9  
ATOM   10046 C  CG   . LEU A 1 58 ? 10.398  1.524   -10.677 1.00 0.00 ? 58  LEU A CG   9  
ATOM   10047 C  CD1  . LEU A 1 58 ? 11.313  1.803   -11.859 1.00 0.00 ? 58  LEU A CD1  9  
ATOM   10048 C  CD2  . LEU A 1 58 ? 9.552   2.747   -10.354 1.00 0.00 ? 58  LEU A CD2  9  
ATOM   10049 H  H    . LEU A 1 58 ? 6.701   0.288   -10.618 1.00 0.00 ? 58  LEU A H    9  
ATOM   10050 H  HA   . LEU A 1 58 ? 8.599   1.362   -12.596 1.00 0.00 ? 58  LEU A HA   9  
ATOM   10051 H  HB2  . LEU A 1 58 ? 9.093   -0.020  -10.024 1.00 0.00 ? 58  LEU A HB2  9  
ATOM   10052 H  HB3  . LEU A 1 58 ? 10.126  -0.464  -11.381 1.00 0.00 ? 58  LEU A HB3  9  
ATOM   10053 H  HG   . LEU A 1 58 ? 11.019  1.309   -9.819  1.00 0.00 ? 58  LEU A HG   9  
ATOM   10054 H  HD11 . LEU A 1 58 ? 10.735  2.220   -12.671 1.00 0.00 ? 58  LEU A HD11 9  
ATOM   10055 H  HD12 . LEU A 1 58 ? 11.775  0.882   -12.183 1.00 0.00 ? 58  LEU A HD12 9  
ATOM   10056 H  HD13 . LEU A 1 58 ? 12.079  2.505   -11.564 1.00 0.00 ? 58  LEU A HD13 9  
ATOM   10057 H  HD21 . LEU A 1 58 ? 8.605   2.431   -9.944  1.00 0.00 ? 58  LEU A HD21 9  
ATOM   10058 H  HD22 . LEU A 1 58 ? 9.383   3.316   -11.256 1.00 0.00 ? 58  LEU A HD22 9  
ATOM   10059 H  HD23 . LEU A 1 58 ? 10.070  3.361   -9.632  1.00 0.00 ? 58  LEU A HD23 9  
ATOM   10060 N  N    . LYS A 1 59 ? 8.347   -0.617  -14.051 1.00 0.00 ? 59  LYS A N    9  
ATOM   10061 C  CA   . LYS A 1 59 ? 8.147   -1.748  -14.950 1.00 0.00 ? 59  LYS A CA   9  
ATOM   10062 C  C    . LYS A 1 59 ? 6.798   -2.413  -14.696 1.00 0.00 ? 59  LYS A C    9  
ATOM   10063 O  O    . LYS A 1 59 ? 6.682   -3.637  -14.736 1.00 0.00 ? 59  LYS A O    9  
ATOM   10064 C  CB   . LYS A 1 59 ? 9.273   -2.769  -14.775 1.00 0.00 ? 59  LYS A CB   9  
ATOM   10065 C  CG   . LYS A 1 59 ? 10.643  -2.237  -15.160 1.00 0.00 ? 59  LYS A CG   9  
ATOM   10066 C  CD   . LYS A 1 59 ? 11.316  -1.534  -13.993 1.00 0.00 ? 59  LYS A CD   9  
ATOM   10067 C  CE   . LYS A 1 59 ? 12.259  -0.441  -14.471 1.00 0.00 ? 59  LYS A CE   9  
ATOM   10068 N  NZ   . LYS A 1 59 ? 11.521  0.704   -15.074 1.00 0.00 ? 59  LYS A NZ   9  
ATOM   10069 H  H    . LYS A 1 59 ? 8.684   0.229   -14.415 1.00 0.00 ? 59  LYS A H    9  
ATOM   10070 H  HA   . LYS A 1 59 ? 8.166   -1.374  -15.963 1.00 0.00 ? 59  LYS A HA   9  
ATOM   10071 H  HB2  . LYS A 1 59 ? 9.307   -3.076  -13.740 1.00 0.00 ? 59  LYS A HB2  9  
ATOM   10072 H  HB3  . LYS A 1 59 ? 9.059   -3.632  -15.390 1.00 0.00 ? 59  LYS A HB3  9  
ATOM   10073 H  HG2  . LYS A 1 59 ? 11.264  -3.063  -15.476 1.00 0.00 ? 59  LYS A HG2  9  
ATOM   10074 H  HG3  . LYS A 1 59 ? 10.530  -1.537  -15.975 1.00 0.00 ? 59  LYS A HG3  9  
ATOM   10075 H  HD2  . LYS A 1 59 ? 10.558  -1.091  -13.365 1.00 0.00 ? 59  LYS A HD2  9  
ATOM   10076 H  HD3  . LYS A 1 59 ? 11.879  -2.260  -13.423 1.00 0.00 ? 59  LYS A HD3  9  
ATOM   10077 H  HE2  . LYS A 1 59 ? 12.832  -0.085  -13.629 1.00 0.00 ? 59  LYS A HE2  9  
ATOM   10078 H  HE3  . LYS A 1 59 ? 12.927  -0.858  -15.210 1.00 0.00 ? 59  LYS A HE3  9  
ATOM   10079 H  HZ1  . LYS A 1 59 ? 10.549  0.735   -14.706 1.00 0.00 ? 59  LYS A HZ1  9  
ATOM   10080 H  HZ2  . LYS A 1 59 ? 11.485  0.600   -16.108 1.00 0.00 ? 59  LYS A HZ2  9  
ATOM   10081 H  HZ3  . LYS A 1 59 ? 11.998  1.598   -14.842 1.00 0.00 ? 59  LYS A HZ3  9  
ATOM   10082 N  N    . GLY A 1 60 ? 5.781   -1.597  -14.437 1.00 0.00 ? 60  GLY A N    9  
ATOM   10083 C  CA   . GLY A 1 60 ? 4.453   -2.126  -14.182 1.00 0.00 ? 60  GLY A CA   9  
ATOM   10084 C  C    . GLY A 1 60 ? 4.194   -2.354  -12.706 1.00 0.00 ? 60  GLY A C    9  
ATOM   10085 O  O    . GLY A 1 60 ? 3.091   -2.106  -12.218 1.00 0.00 ? 60  GLY A O    9  
ATOM   10086 H  H    . GLY A 1 60 ? 5.933   -0.629  -14.418 1.00 0.00 ? 60  GLY A H    9  
ATOM   10087 H  HA2  . GLY A 1 60 ? 3.721   -1.429  -14.562 1.00 0.00 ? 60  GLY A HA2  9  
ATOM   10088 H  HA3  . GLY A 1 60 ? 4.346   -3.066  -14.703 1.00 0.00 ? 60  GLY A HA3  9  
ATOM   10089 N  N    . GLU A 1 61 ? 5.211   -2.829  -11.994 1.00 0.00 ? 61  GLU A N    9  
ATOM   10090 C  CA   . GLU A 1 61 ? 5.085   -3.092  -10.565 1.00 0.00 ? 61  GLU A CA   9  
ATOM   10091 C  C    . GLU A 1 61 ? 4.941   -1.790  -9.782  1.00 0.00 ? 61  GLU A C    9  
ATOM   10092 O  O    . GLU A 1 61 ? 4.986   -0.700  -10.354 1.00 0.00 ? 61  GLU A O    9  
ATOM   10093 C  CB   . GLU A 1 61 ? 6.300   -3.872  -10.059 1.00 0.00 ? 61  GLU A CB   9  
ATOM   10094 C  CG   . GLU A 1 61 ? 6.376   -5.294  -10.591 1.00 0.00 ? 61  GLU A CG   9  
ATOM   10095 C  CD   . GLU A 1 61 ? 7.787   -5.849  -10.575 1.00 0.00 ? 61  GLU A CD   9  
ATOM   10096 O  OE1  . GLU A 1 61 ? 8.553   -5.547  -11.514 1.00 0.00 ? 61  GLU A OE1  9  
ATOM   10097 O  OE2  . GLU A 1 61 ? 8.125   -6.584  -9.624  1.00 0.00 ? 61  GLU A OE2  9  
ATOM   10098 H  H    . GLU A 1 61 ? 6.065   -3.007  -12.440 1.00 0.00 ? 61  GLU A H    9  
ATOM   10099 H  HA   . GLU A 1 61 ? 4.198   -3.689  -10.415 1.00 0.00 ? 61  GLU A HA   9  
ATOM   10100 H  HB2  . GLU A 1 61 ? 7.198   -3.350  -10.356 1.00 0.00 ? 61  GLU A HB2  9  
ATOM   10101 H  HB3  . GLU A 1 61 ? 6.261   -3.916  -8.981  1.00 0.00 ? 61  GLU A HB3  9  
ATOM   10102 H  HG2  . GLU A 1 61 ? 5.750   -5.927  -9.981  1.00 0.00 ? 61  GLU A HG2  9  
ATOM   10103 H  HG3  . GLU A 1 61 ? 6.012   -5.304  -11.608 1.00 0.00 ? 61  GLU A HG3  9  
ATOM   10104 N  N    . LEU A 1 62 ? 4.766   -1.912  -8.471  1.00 0.00 ? 62  LEU A N    9  
ATOM   10105 C  CA   . LEU A 1 62 ? 4.614   -0.746  -7.608  1.00 0.00 ? 62  LEU A CA   9  
ATOM   10106 C  C    . LEU A 1 62 ? 5.529   -0.846  -6.391  1.00 0.00 ? 62  LEU A C    9  
ATOM   10107 O  O    . LEU A 1 62 ? 5.365   -1.729  -5.550  1.00 0.00 ? 62  LEU A O    9  
ATOM   10108 C  CB   . LEU A 1 62 ? 3.159   -0.606  -7.157  1.00 0.00 ? 62  LEU A CB   9  
ATOM   10109 C  CG   . LEU A 1 62 ? 2.144   -0.287  -8.254  1.00 0.00 ? 62  LEU A CG   9  
ATOM   10110 C  CD1  . LEU A 1 62 ? 0.741   -0.671  -7.811  1.00 0.00 ? 62  LEU A CD1  9  
ATOM   10111 C  CD2  . LEU A 1 62 ? 2.204   1.188   -8.624  1.00 0.00 ? 62  LEU A CD2  9  
ATOM   10112 H  H    . LEU A 1 62 ? 4.739   -2.806  -8.073  1.00 0.00 ? 62  LEU A H    9  
ATOM   10113 H  HA   . LEU A 1 62 ? 4.891   0.128   -8.180  1.00 0.00 ? 62  LEU A HA   9  
ATOM   10114 H  HB2  . LEU A 1 62 ? 2.866   -1.537  -6.696  1.00 0.00 ? 62  LEU A HB2  9  
ATOM   10115 H  HB3  . LEU A 1 62 ? 3.116   0.186   -6.423  1.00 0.00 ? 62  LEU A HB3  9  
ATOM   10116 H  HG   . LEU A 1 62 ? 2.384   -0.864  -9.137  1.00 0.00 ? 62  LEU A HG   9  
ATOM   10117 H  HD11 . LEU A 1 62 ? 0.324   0.122   -7.209  1.00 0.00 ? 62  LEU A HD11 9  
ATOM   10118 H  HD12 . LEU A 1 62 ? 0.783   -1.580  -7.231  1.00 0.00 ? 62  LEU A HD12 9  
ATOM   10119 H  HD13 . LEU A 1 62 ? 0.119   -0.828  -8.681  1.00 0.00 ? 62  LEU A HD13 9  
ATOM   10120 H  HD21 . LEU A 1 62 ? 1.399   1.714   -8.132  1.00 0.00 ? 62  LEU A HD21 9  
ATOM   10121 H  HD22 . LEU A 1 62 ? 2.103   1.296   -9.694  1.00 0.00 ? 62  LEU A HD22 9  
ATOM   10122 H  HD23 . LEU A 1 62 ? 3.150   1.600   -8.307  1.00 0.00 ? 62  LEU A HD23 9  
ATOM   10123 N  N    . TYR A 1 63 ? 6.490   0.067   -6.304  1.00 0.00 ? 63  TYR A N    9  
ATOM   10124 C  CA   . TYR A 1 63 ? 7.431   0.081   -5.190  1.00 0.00 ? 63  TYR A CA   9  
ATOM   10125 C  C    . TYR A 1 63 ? 7.161   1.264   -4.265  1.00 0.00 ? 63  TYR A C    9  
ATOM   10126 O  O    . TYR A 1 63 ? 6.608   2.281   -4.682  1.00 0.00 ? 63  TYR A O    9  
ATOM   10127 C  CB   . TYR A 1 63 ? 8.868   0.144   -5.710  1.00 0.00 ? 63  TYR A CB   9  
ATOM   10128 C  CG   . TYR A 1 63 ? 9.230   -1.001  -6.628  1.00 0.00 ? 63  TYR A CG   9  
ATOM   10129 C  CD1  . TYR A 1 63 ? 8.760   -1.045  -7.935  1.00 0.00 ? 63  TYR A CD1  9  
ATOM   10130 C  CD2  . TYR A 1 63 ? 10.041  -2.041  -6.189  1.00 0.00 ? 63  TYR A CD2  9  
ATOM   10131 C  CE1  . TYR A 1 63 ? 9.088   -2.089  -8.778  1.00 0.00 ? 63  TYR A CE1  9  
ATOM   10132 C  CE2  . TYR A 1 63 ? 10.375  -3.088  -7.026  1.00 0.00 ? 63  TYR A CE2  9  
ATOM   10133 C  CZ   . TYR A 1 63 ? 9.896   -3.108  -8.319  1.00 0.00 ? 63  TYR A CZ   9  
ATOM   10134 O  OH   . TYR A 1 63 ? 10.225  -4.151  -9.154  1.00 0.00 ? 63  TYR A OH   9  
ATOM   10135 H  H    . TYR A 1 63 ? 6.571   0.746   -7.006  1.00 0.00 ? 63  TYR A H    9  
ATOM   10136 H  HA   . TYR A 1 63 ? 7.300   -0.835  -4.633  1.00 0.00 ? 63  TYR A HA   9  
ATOM   10137 H  HB2  . TYR A 1 63 ? 9.006   1.063   -6.258  1.00 0.00 ? 63  TYR A HB2  9  
ATOM   10138 H  HB3  . TYR A 1 63 ? 9.548   0.124   -4.871  1.00 0.00 ? 63  TYR A HB3  9  
ATOM   10139 H  HD1  . TYR A 1 63 ? 8.128   -0.245  -8.293  1.00 0.00 ? 63  TYR A HD1  9  
ATOM   10140 H  HD2  . TYR A 1 63 ? 10.415  -2.022  -5.176  1.00 0.00 ? 63  TYR A HD2  9  
ATOM   10141 H  HE1  . TYR A 1 63 ? 8.713   -2.105  -9.791  1.00 0.00 ? 63  TYR A HE1  9  
ATOM   10142 H  HE2  . TYR A 1 63 ? 11.007  -3.887  -6.666  1.00 0.00 ? 63  TYR A HE2  9  
ATOM   10143 H  HH   . TYR A 1 63 ? 9.469   -4.372  -9.703  1.00 0.00 ? 63  TYR A HH   9  
ATOM   10144 N  N    . CYS A 1 64 ? 7.557   1.122   -3.004  1.00 0.00 ? 64  CYS A N    9  
ATOM   10145 C  CA   . CYS A 1 64 ? 7.360   2.176   -2.017  1.00 0.00 ? 64  CYS A CA   9  
ATOM   10146 C  C    . CYS A 1 64 ? 8.453   3.235   -2.126  1.00 0.00 ? 64  CYS A C    9  
ATOM   10147 O  O    . CYS A 1 64 ? 9.566   2.951   -2.570  1.00 0.00 ? 64  CYS A O    9  
ATOM   10148 C  CB   . CYS A 1 64 ? 7.345   1.586   -0.605  1.00 0.00 ? 64  CYS A CB   9  
ATOM   10149 S  SG   . CYS A 1 64 ? 8.947   0.907   -0.067  1.00 0.00 ? 64  CYS A SG   9  
ATOM   10150 H  H    . CYS A 1 64 ? 7.993   0.287   -2.730  1.00 0.00 ? 64  CYS A H    9  
ATOM   10151 H  HA   . CYS A 1 64 ? 6.405   2.641   -2.213  1.00 0.00 ? 64  CYS A HA   9  
ATOM   10152 H  HB2  . CYS A 1 64 ? 7.064   2.358   0.096   1.00 0.00 ? 64  CYS A HB2  9  
ATOM   10153 H  HB3  . CYS A 1 64 ? 6.619   0.788   -0.565  1.00 0.00 ? 64  CYS A HB3  9  
ATOM   10154 N  N    . LEU A 1 65 ? 8.128   4.457   -1.718  1.00 0.00 ? 65  LEU A N    9  
ATOM   10155 C  CA   . LEU A 1 65 ? 9.082   5.559   -1.768  1.00 0.00 ? 65  LEU A CA   9  
ATOM   10156 C  C    . LEU A 1 65 ? 10.456  5.115   -1.275  1.00 0.00 ? 65  LEU A C    9  
ATOM   10157 O  O    . LEU A 1 65 ? 11.479  5.347   -1.919  1.00 0.00 ? 65  LEU A O    9  
ATOM   10158 C  CB   . LEU A 1 65 ? 8.581   6.733   -0.925  1.00 0.00 ? 65  LEU A CB   9  
ATOM   10159 C  CG   . LEU A 1 65 ? 7.752   7.785   -1.664  1.00 0.00 ? 65  LEU A CG   9  
ATOM   10160 C  CD1  . LEU A 1 65 ? 8.598   8.489   -2.714  1.00 0.00 ? 65  LEU A CD1  9  
ATOM   10161 C  CD2  . LEU A 1 65 ? 6.528   7.146   -2.304  1.00 0.00 ? 65  LEU A CD2  9  
ATOM   10162 H  H    . LEU A 1 65 ? 7.226   4.623   -1.373  1.00 0.00 ? 65  LEU A H    9  
ATOM   10163 H  HA   . LEU A 1 65 ? 9.168   5.876   -2.797  1.00 0.00 ? 65  LEU A HA   9  
ATOM   10164 H  HB2  . LEU A 1 65 ? 7.972   6.332   -0.130  1.00 0.00 ? 65  LEU A HB2  9  
ATOM   10165 H  HB3  . LEU A 1 65 ? 9.444   7.228   -0.502  1.00 0.00 ? 65  LEU A HB3  9  
ATOM   10166 H  HG   . LEU A 1 65 ? 7.412   8.528   -0.957  1.00 0.00 ? 65  LEU A HG   9  
ATOM   10167 H  HD11 . LEU A 1 65 ? 8.824   7.802   -3.514  1.00 0.00 ? 65  LEU A HD11 9  
ATOM   10168 H  HD12 . LEU A 1 65 ? 9.517   8.834   -2.264  1.00 0.00 ? 65  LEU A HD12 9  
ATOM   10169 H  HD13 . LEU A 1 65 ? 8.052   9.334   -3.108  1.00 0.00 ? 65  LEU A HD13 9  
ATOM   10170 H  HD21 . LEU A 1 65 ? 5.689   7.822   -2.227  1.00 0.00 ? 65  LEU A HD21 9  
ATOM   10171 H  HD22 . LEU A 1 65 ? 6.295   6.223   -1.792  1.00 0.00 ? 65  LEU A HD22 9  
ATOM   10172 H  HD23 . LEU A 1 65 ? 6.731   6.941   -3.344  1.00 0.00 ? 65  LEU A HD23 9  
ATOM   10173 N  N    . PRO A 1 66 ? 10.480  4.457   -0.107  1.00 0.00 ? 66  PRO A N    9  
ATOM   10174 C  CA   . PRO A 1 66 ? 11.721  3.963   0.497   1.00 0.00 ? 66  PRO A CA   9  
ATOM   10175 C  C    . PRO A 1 66 ? 12.590  3.205   -0.501  1.00 0.00 ? 66  PRO A C    9  
ATOM   10176 O  O    . PRO A 1 66 ? 13.690  3.643   -0.841  1.00 0.00 ? 66  PRO A O    9  
ATOM   10177 C  CB   . PRO A 1 66 ? 11.229  3.022   1.600   1.00 0.00 ? 66  PRO A CB   9  
ATOM   10178 C  CG   . PRO A 1 66 ? 9.874   3.530   1.954   1.00 0.00 ? 66  PRO A CG   9  
ATOM   10179 C  CD   . PRO A 1 66 ? 9.299   4.144   0.715   1.00 0.00 ? 66  PRO A CD   9  
ATOM   10180 H  HA   . PRO A 1 66 ? 12.296  4.765   0.936   1.00 0.00 ? 66  PRO A HA   9  
ATOM   10181 H  HB2  . PRO A 1 66 ? 11.187  2.011   1.222   1.00 0.00 ? 66  PRO A HB2  9  
ATOM   10182 H  HB3  . PRO A 1 66 ? 11.901  3.069   2.444   1.00 0.00 ? 66  PRO A HB3  9  
ATOM   10183 H  HG2  . PRO A 1 66 ? 9.250   2.712   2.281   1.00 0.00 ? 66  PRO A HG2  9  
ATOM   10184 H  HG3  . PRO A 1 66 ? 9.953   4.277   2.729   1.00 0.00 ? 66  PRO A HG3  9  
ATOM   10185 H  HD2  . PRO A 1 66 ? 8.656   3.437   0.212   1.00 0.00 ? 66  PRO A HD2  9  
ATOM   10186 H  HD3  . PRO A 1 66 ? 8.754   5.043   0.962   1.00 0.00 ? 66  PRO A HD3  9  
ATOM   10187 N  N    . CYS A 1 67 ? 12.090  2.065   -0.968  1.00 0.00 ? 67  CYS A N    9  
ATOM   10188 C  CA   . CYS A 1 67 ? 12.820  1.246   -1.927  1.00 0.00 ? 67  CYS A CA   9  
ATOM   10189 C  C    . CYS A 1 67 ? 13.150  2.044   -3.185  1.00 0.00 ? 67  CYS A C    9  
ATOM   10190 O  O    . CYS A 1 67 ? 14.293  2.059   -3.643  1.00 0.00 ? 67  CYS A O    9  
ATOM   10191 C  CB   . CYS A 1 67 ? 12.004  0.006   -2.296  1.00 0.00 ? 67  CYS A CB   9  
ATOM   10192 S  SG   . CYS A 1 67 ? 12.002  -1.291  -1.016  1.00 0.00 ? 67  CYS A SG   9  
ATOM   10193 H  H    . CYS A 1 67 ? 11.208  1.768   -0.659  1.00 0.00 ? 67  CYS A H    9  
ATOM   10194 H  HA   . CYS A 1 67 ? 13.743  0.933   -1.462  1.00 0.00 ? 67  CYS A HA   9  
ATOM   10195 H  HB2  . CYS A 1 67 ? 10.978  0.298   -2.467  1.00 0.00 ? 67  CYS A HB2  9  
ATOM   10196 H  HB3  . CYS A 1 67 ? 12.406  -0.425  -3.200  1.00 0.00 ? 67  CYS A HB3  9  
ATOM   10197 N  N    . HIS A 1 68 ? 12.140  2.707   -3.739  1.00 0.00 ? 68  HIS A N    9  
ATOM   10198 C  CA   . HIS A 1 68 ? 12.321  3.509   -4.944  1.00 0.00 ? 68  HIS A CA   9  
ATOM   10199 C  C    . HIS A 1 68 ? 13.623  4.302   -4.878  1.00 0.00 ? 68  HIS A C    9  
ATOM   10200 O  O    . HIS A 1 68 ? 14.398  4.323   -5.835  1.00 0.00 ? 68  HIS A O    9  
ATOM   10201 C  CB   . HIS A 1 68 ? 11.140  4.461   -5.132  1.00 0.00 ? 68  HIS A CB   9  
ATOM   10202 C  CG   . HIS A 1 68 ? 11.016  4.995   -6.526  1.00 0.00 ? 68  HIS A CG   9  
ATOM   10203 N  ND1  . HIS A 1 68 ? 10.869  6.336   -6.808  1.00 0.00 ? 68  HIS A ND1  9  
ATOM   10204 C  CD2  . HIS A 1 68 ? 11.020  4.359   -7.721  1.00 0.00 ? 68  HIS A CD2  9  
ATOM   10205 C  CE1  . HIS A 1 68 ? 10.786  6.503   -8.116  1.00 0.00 ? 68  HIS A CE1  9  
ATOM   10206 N  NE2  . HIS A 1 68 ? 10.875  5.318   -8.693  1.00 0.00 ? 68  HIS A NE2  9  
ATOM   10207 H  H    . HIS A 1 68 ? 11.252  2.657   -3.328  1.00 0.00 ? 68  HIS A H    9  
ATOM   10208 H  HA   . HIS A 1 68 ? 12.367  2.836   -5.787  1.00 0.00 ? 68  HIS A HA   9  
ATOM   10209 H  HB2  . HIS A 1 68 ? 10.224  3.939   -4.895  1.00 0.00 ? 68  HIS A HB2  9  
ATOM   10210 H  HB3  . HIS A 1 68 ? 11.253  5.302   -4.463  1.00 0.00 ? 68  HIS A HB3  9  
ATOM   10211 H  HD1  . HIS A 1 68 ? 10.829  7.059   -6.147  1.00 0.00 ? 68  HIS A HD1  9  
ATOM   10212 H  HD2  . HIS A 1 68 ? 11.118  3.294   -7.881  1.00 0.00 ? 68  HIS A HD2  9  
ATOM   10213 H  HE1  . HIS A 1 68 ? 10.666  7.446   -8.627  1.00 0.00 ? 68  HIS A HE1  9  
ATOM   10214 N  N    . ASP A 1 69 ? 13.857  4.953   -3.744  1.00 0.00 ? 69  ASP A N    9  
ATOM   10215 C  CA   . ASP A 1 69 ? 15.065  5.747   -3.553  1.00 0.00 ? 69  ASP A CA   9  
ATOM   10216 C  C    . ASP A 1 69 ? 16.310  4.929   -3.881  1.00 0.00 ? 69  ASP A C    9  
ATOM   10217 O  O    . ASP A 1 69 ? 17.185  5.380   -4.621  1.00 0.00 ? 69  ASP A O    9  
ATOM   10218 C  CB   . ASP A 1 69 ? 15.141  6.260   -2.114  1.00 0.00 ? 69  ASP A CB   9  
ATOM   10219 C  CG   . ASP A 1 69 ? 16.274  7.247   -1.911  1.00 0.00 ? 69  ASP A CG   9  
ATOM   10220 O  OD1  . ASP A 1 69 ? 16.149  8.398   -2.378  1.00 0.00 ? 69  ASP A OD1  9  
ATOM   10221 O  OD2  . ASP A 1 69 ? 17.286  6.868   -1.285  1.00 0.00 ? 69  ASP A OD2  9  
ATOM   10222 H  H    . ASP A 1 69 ? 13.201  4.897   -3.017  1.00 0.00 ? 69  ASP A H    9  
ATOM   10223 H  HA   . ASP A 1 69 ? 15.017  6.591   -4.224  1.00 0.00 ? 69  ASP A HA   9  
ATOM   10224 H  HB2  . ASP A 1 69 ? 14.212  6.751   -1.864  1.00 0.00 ? 69  ASP A HB2  9  
ATOM   10225 H  HB3  . ASP A 1 69 ? 15.292  5.423   -1.448  1.00 0.00 ? 69  ASP A HB3  9  
ATOM   10226 N  N    . LYS A 1 70 ? 16.384  3.725   -3.325  1.00 0.00 ? 70  LYS A N    9  
ATOM   10227 C  CA   . LYS A 1 70 ? 17.522  2.843   -3.558  1.00 0.00 ? 70  LYS A CA   9  
ATOM   10228 C  C    . LYS A 1 70 ? 17.774  2.662   -5.052  1.00 0.00 ? 70  LYS A C    9  
ATOM   10229 O  O    . LYS A 1 70 ? 18.870  2.284   -5.464  1.00 0.00 ? 70  LYS A O    9  
ATOM   10230 C  CB   . LYS A 1 70 ? 17.281  1.481   -2.903  1.00 0.00 ? 70  LYS A CB   9  
ATOM   10231 C  CG   . LYS A 1 70 ? 17.069  1.558   -1.401  1.00 0.00 ? 70  LYS A CG   9  
ATOM   10232 C  CD   . LYS A 1 70 ? 17.371  0.231   -0.726  1.00 0.00 ? 70  LYS A CD   9  
ATOM   10233 C  CE   . LYS A 1 70 ? 16.135  -0.653  -0.656  1.00 0.00 ? 70  LYS A CE   9  
ATOM   10234 N  NZ   . LYS A 1 70 ? 16.196  -1.602  0.490   1.00 0.00 ? 70  LYS A NZ   9  
ATOM   10235 H  H    . LYS A 1 70 ? 15.655  3.421   -2.744  1.00 0.00 ? 70  LYS A H    9  
ATOM   10236 H  HA   . LYS A 1 70 ? 18.392  3.299   -3.111  1.00 0.00 ? 70  LYS A HA   9  
ATOM   10237 H  HB2  . LYS A 1 70 ? 16.404  1.032   -3.346  1.00 0.00 ? 70  LYS A HB2  9  
ATOM   10238 H  HB3  . LYS A 1 70 ? 18.135  0.847   -3.092  1.00 0.00 ? 70  LYS A HB3  9  
ATOM   10239 H  HG2  . LYS A 1 70 ? 17.723  2.314   -0.992  1.00 0.00 ? 70  LYS A HG2  9  
ATOM   10240 H  HG3  . LYS A 1 70 ? 16.040  1.825   -1.205  1.00 0.00 ? 70  LYS A HG3  9  
ATOM   10241 H  HD2  . LYS A 1 70 ? 18.135  -0.284  -1.289  1.00 0.00 ? 70  LYS A HD2  9  
ATOM   10242 H  HD3  . LYS A 1 70 ? 17.725  0.419   0.278   1.00 0.00 ? 70  LYS A HD3  9  
ATOM   10243 H  HE2  . LYS A 1 70 ? 15.264  -0.024  -0.545  1.00 0.00 ? 70  LYS A HE2  9  
ATOM   10244 H  HE3  . LYS A 1 70 ? 16.058  -1.215  -1.574  1.00 0.00 ? 70  LYS A HE3  9  
ATOM   10245 H  HZ1  . LYS A 1 70 ? 15.376  -2.243  0.467   1.00 0.00 ? 70  LYS A HZ1  9  
ATOM   10246 H  HZ2  . LYS A 1 70 ? 16.187  -1.079  1.389   1.00 0.00 ? 70  LYS A HZ2  9  
ATOM   10247 H  HZ3  . LYS A 1 70 ? 17.066  -2.168  0.439   1.00 0.00 ? 70  LYS A HZ3  9  
ATOM   10248 N  N    . MET A 1 71 ? 16.752  2.937   -5.857  1.00 0.00 ? 71  MET A N    9  
ATOM   10249 C  CA   . MET A 1 71 ? 16.865  2.807   -7.305  1.00 0.00 ? 71  MET A CA   9  
ATOM   10250 C  C    . MET A 1 71 ? 17.541  4.033   -7.910  1.00 0.00 ? 71  MET A C    9  
ATOM   10251 O  O    . MET A 1 71 ? 17.147  4.510   -8.973  1.00 0.00 ? 71  MET A O    9  
ATOM   10252 C  CB   . MET A 1 71 ? 15.482  2.612   -7.930  1.00 0.00 ? 71  MET A CB   9  
ATOM   10253 C  CG   . MET A 1 71 ? 14.689  1.475   -7.307  1.00 0.00 ? 71  MET A CG   9  
ATOM   10254 S  SD   . MET A 1 71 ? 15.606  -0.077  -7.274  1.00 0.00 ? 71  MET A SD   9  
ATOM   10255 C  CE   . MET A 1 71 ? 14.513  -1.095  -6.286  1.00 0.00 ? 71  MET A CE   9  
ATOM   10256 H  H    . MET A 1 71 ? 15.903  3.234   -5.469  1.00 0.00 ? 71  MET A H    9  
ATOM   10257 H  HA   . MET A 1 71 ? 17.470  1.937   -7.513  1.00 0.00 ? 71  MET A HA   9  
ATOM   10258 H  HB2  . MET A 1 71 ? 14.916  3.524   -7.814  1.00 0.00 ? 71  MET A HB2  9  
ATOM   10259 H  HB3  . MET A 1 71 ? 15.602  2.403   -8.983  1.00 0.00 ? 71  MET A HB3  9  
ATOM   10260 H  HG2  . MET A 1 71 ? 14.432  1.746   -6.294  1.00 0.00 ? 71  MET A HG2  9  
ATOM   10261 H  HG3  . MET A 1 71 ? 13.784  1.331   -7.879  1.00 0.00 ? 71  MET A HG3  9  
ATOM   10262 H  HE1  . MET A 1 71 ? 14.229  -1.970  -6.851  1.00 0.00 ? 71  MET A HE1  9  
ATOM   10263 H  HE2  . MET A 1 71 ? 15.023  -1.399  -5.384  1.00 0.00 ? 71  MET A HE2  9  
ATOM   10264 H  HE3  . MET A 1 71 ? 13.630  -0.530  -6.028  1.00 0.00 ? 71  MET A HE3  9  
ATOM   10265 N  N    . GLY A 1 72 ? 18.562  4.539   -7.224  1.00 0.00 ? 72  GLY A N    9  
ATOM   10266 C  CA   . GLY A 1 72 ? 19.276  5.706   -7.710  1.00 0.00 ? 72  GLY A CA   9  
ATOM   10267 C  C    . GLY A 1 72 ? 20.760  5.645   -7.407  1.00 0.00 ? 72  GLY A C    9  
ATOM   10268 O  O    . GLY A 1 72 ? 21.401  6.675   -7.201  1.00 0.00 ? 72  GLY A O    9  
ATOM   10269 H  H    . GLY A 1 72 ? 18.833  4.117   -6.382  1.00 0.00 ? 72  GLY A H    9  
ATOM   10270 H  HA2  . GLY A 1 72 ? 19.139  5.779   -8.778  1.00 0.00 ? 72  GLY A HA2  9  
ATOM   10271 H  HA3  . GLY A 1 72 ? 18.861  6.587   -7.243  1.00 0.00 ? 72  GLY A HA3  9  
ATOM   10272 N  N    . VAL A 1 73 ? 21.307  4.434   -7.379  1.00 0.00 ? 73  VAL A N    9  
ATOM   10273 C  CA   . VAL A 1 73 ? 22.725  4.243   -7.098  1.00 0.00 ? 73  VAL A CA   9  
ATOM   10274 C  C    . VAL A 1 73 ? 23.360  3.287   -8.102  1.00 0.00 ? 73  VAL A C    9  
ATOM   10275 O  O    . VAL A 1 73 ? 22.677  2.731   -8.963  1.00 0.00 ? 73  VAL A O    9  
ATOM   10276 C  CB   . VAL A 1 73 ? 22.947  3.698   -5.675  1.00 0.00 ? 73  VAL A CB   9  
ATOM   10277 C  CG1  . VAL A 1 73 ? 22.457  4.697   -4.638  1.00 0.00 ? 73  VAL A CG1  9  
ATOM   10278 C  CG2  . VAL A 1 73 ? 22.252  2.355   -5.505  1.00 0.00 ? 73  VAL A CG2  9  
ATOM   10279 H  H    . VAL A 1 73 ? 20.744  3.651   -7.551  1.00 0.00 ? 73  VAL A H    9  
ATOM   10280 H  HA   . VAL A 1 73 ? 23.213  5.204   -7.173  1.00 0.00 ? 73  VAL A HA   9  
ATOM   10281 H  HB   . VAL A 1 73 ? 24.007  3.551   -5.528  1.00 0.00 ? 73  VAL A HB   9  
ATOM   10282 H  HG11 . VAL A 1 73 ? 21.997  4.166   -3.817  1.00 0.00 ? 73  VAL A HG11 9  
ATOM   10283 H  HG12 . VAL A 1 73 ? 23.293  5.274   -4.271  1.00 0.00 ? 73  VAL A HG12 9  
ATOM   10284 H  HG13 . VAL A 1 73 ? 21.733  5.358   -5.090  1.00 0.00 ? 73  VAL A HG13 9  
ATOM   10285 H  HG21 . VAL A 1 73 ? 21.209  2.517   -5.277  1.00 0.00 ? 73  VAL A HG21 9  
ATOM   10286 H  HG22 . VAL A 1 73 ? 22.336  1.787   -6.420  1.00 0.00 ? 73  VAL A HG22 9  
ATOM   10287 H  HG23 . VAL A 1 73 ? 22.717  1.808   -4.698  1.00 0.00 ? 73  VAL A HG23 9  
ATOM   10288 N  N    . SER A 1 74 ? 24.670  3.099   -7.985  1.00 0.00 ? 74  SER A N    9  
ATOM   10289 C  CA   . SER A 1 74 ? 25.399  2.212   -8.884  1.00 0.00 ? 74  SER A CA   9  
ATOM   10290 C  C    . SER A 1 74 ? 25.336  2.723   -10.320 1.00 0.00 ? 74  SER A C    9  
ATOM   10291 O  O    . SER A 1 74 ? 25.018  1.976   -11.244 1.00 0.00 ? 74  SER A O    9  
ATOM   10292 C  CB   . SER A 1 74 ? 24.827  0.794   -8.810  1.00 0.00 ? 74  SER A CB   9  
ATOM   10293 O  OG   . SER A 1 74 ? 25.771  -0.161  -9.263  1.00 0.00 ? 74  SER A OG   9  
ATOM   10294 H  H    . SER A 1 74 ? 25.159  3.570   -7.278  1.00 0.00 ? 74  SER A H    9  
ATOM   10295 H  HA   . SER A 1 74 ? 26.430  2.191   -8.566  1.00 0.00 ? 74  SER A HA   9  
ATOM   10296 H  HB2  . SER A 1 74 ? 24.565  0.567   -7.788  1.00 0.00 ? 74  SER A HB2  9  
ATOM   10297 H  HB3  . SER A 1 74 ? 23.944  0.733   -9.430  1.00 0.00 ? 74  SER A HB3  9  
ATOM   10298 H  HG   . SER A 1 74 ? 26.651  0.222   -9.238  1.00 0.00 ? 74  SER A HG   9  
ATOM   10299 N  N    . GLY A 1 75 ? 25.643  4.005   -10.499 1.00 0.00 ? 75  GLY A N    9  
ATOM   10300 C  CA   . GLY A 1 75 ? 25.616  4.596   -11.824 1.00 0.00 ? 75  GLY A CA   9  
ATOM   10301 C  C    . GLY A 1 75 ? 26.709  4.053   -12.723 1.00 0.00 ? 75  GLY A C    9  
ATOM   10302 O  O    . GLY A 1 75 ? 27.164  2.919   -12.568 1.00 0.00 ? 75  GLY A O    9  
ATOM   10303 H  H    . GLY A 1 75 ? 25.889  4.553   -9.725  1.00 0.00 ? 75  GLY A H    9  
ATOM   10304 H  HA2  . GLY A 1 75 ? 24.657  4.393   -12.277 1.00 0.00 ? 75  GLY A HA2  9  
ATOM   10305 H  HA3  . GLY A 1 75 ? 25.740  5.665   -11.731 1.00 0.00 ? 75  GLY A HA3  9  
ATOM   10306 N  N    . PRO A 1 76 ? 27.145  4.872   -13.691 1.00 0.00 ? 76  PRO A N    9  
ATOM   10307 C  CA   . PRO A 1 76 ? 28.196  4.489   -14.639 1.00 0.00 ? 76  PRO A CA   9  
ATOM   10308 C  C    . PRO A 1 76 ? 29.565  4.383   -13.976 1.00 0.00 ? 76  PRO A C    9  
ATOM   10309 O  O    . PRO A 1 76 ? 30.582  4.226   -14.651 1.00 0.00 ? 76  PRO A O    9  
ATOM   10310 C  CB   . PRO A 1 76 ? 28.184  5.627   -15.662 1.00 0.00 ? 76  PRO A CB   9  
ATOM   10311 C  CG   . PRO A 1 76 ? 27.636  6.797   -14.920 1.00 0.00 ? 76  PRO A CG   9  
ATOM   10312 C  CD   . PRO A 1 76 ? 26.648  6.237   -13.935 1.00 0.00 ? 76  PRO A CD   9  
ATOM   10313 H  HA   . PRO A 1 76 ? 27.964  3.556   -15.133 1.00 0.00 ? 76  PRO A HA   9  
ATOM   10314 H  HB2  . PRO A 1 76 ? 29.191  5.814   -16.008 1.00 0.00 ? 76  PRO A HB2  9  
ATOM   10315 H  HB3  . PRO A 1 76 ? 27.554  5.359   -16.497 1.00 0.00 ? 76  PRO A HB3  9  
ATOM   10316 H  HG2  . PRO A 1 76 ? 28.432  7.310   -14.402 1.00 0.00 ? 76  PRO A HG2  9  
ATOM   10317 H  HG3  . PRO A 1 76 ? 27.140  7.467   -15.607 1.00 0.00 ? 76  PRO A HG3  9  
ATOM   10318 H  HD2  . PRO A 1 76 ? 26.652  6.817   -13.024 1.00 0.00 ? 76  PRO A HD2  9  
ATOM   10319 H  HD3  . PRO A 1 76 ? 25.657  6.214   -14.365 1.00 0.00 ? 76  PRO A HD3  9  
ATOM   10320 N  N    . SER A 1 77 ? 29.583  4.470   -12.649 1.00 0.00 ? 77  SER A N    9  
ATOM   10321 C  CA   . SER A 1 77 ? 30.828  4.387   -11.895 1.00 0.00 ? 77  SER A CA   9  
ATOM   10322 C  C    . SER A 1 77 ? 31.814  3.442   -12.575 1.00 0.00 ? 77  SER A C    9  
ATOM   10323 O  O    . SER A 1 77 ? 31.451  2.340   -12.987 1.00 0.00 ? 77  SER A O    9  
ATOM   10324 C  CB   . SER A 1 77 ? 30.553  3.913   -10.466 1.00 0.00 ? 77  SER A CB   9  
ATOM   10325 O  OG   . SER A 1 77 ? 31.504  4.445   -9.561  1.00 0.00 ? 77  SER A OG   9  
ATOM   10326 H  H    . SER A 1 77 ? 28.739  4.595   -12.167 1.00 0.00 ? 77  SER A H    9  
ATOM   10327 H  HA   . SER A 1 77 ? 31.261  5.376   -11.860 1.00 0.00 ? 77  SER A HA   9  
ATOM   10328 H  HB2  . SER A 1 77 ? 29.568  4.237   -10.166 1.00 0.00 ? 77  SER A HB2  9  
ATOM   10329 H  HB3  . SER A 1 77 ? 30.604  2.835   -10.432 1.00 0.00 ? 77  SER A HB3  9  
ATOM   10330 H  HG   . SER A 1 77 ? 32.174  3.783   -9.375  1.00 0.00 ? 77  SER A HG   9  
ATOM   10331 N  N    . SER A 1 78 ? 33.063  3.882   -12.689 1.00 0.00 ? 78  SER A N    9  
ATOM   10332 C  CA   . SER A 1 78 ? 34.101  3.078   -13.323 1.00 0.00 ? 78  SER A CA   9  
ATOM   10333 C  C    . SER A 1 78 ? 33.920  1.599   -12.994 1.00 0.00 ? 78  SER A C    9  
ATOM   10334 O  O    . SER A 1 78 ? 33.506  1.243   -11.892 1.00 0.00 ? 78  SER A O    9  
ATOM   10335 C  CB   . SER A 1 78 ? 35.486  3.547   -12.871 1.00 0.00 ? 78  SER A CB   9  
ATOM   10336 O  OG   . SER A 1 78 ? 35.675  3.316   -11.485 1.00 0.00 ? 78  SER A OG   9  
ATOM   10337 H  H    . SER A 1 78 ? 33.290  4.770   -12.341 1.00 0.00 ? 78  SER A H    9  
ATOM   10338 H  HA   . SER A 1 78 ? 34.017  3.210   -14.391 1.00 0.00 ? 78  SER A HA   9  
ATOM   10339 H  HB2  . SER A 1 78 ? 36.243  3.008   -13.420 1.00 0.00 ? 78  SER A HB2  9  
ATOM   10340 H  HB3  . SER A 1 78 ? 35.585  4.605   -13.064 1.00 0.00 ? 78  SER A HB3  9  
ATOM   10341 H  HG   . SER A 1 78 ? 35.353  4.071   -10.988 1.00 0.00 ? 78  SER A HG   9  
ATOM   10342 N  N    . GLY A 1 79 ? 34.234  0.742   -13.961 1.00 0.00 ? 79  GLY A N    9  
ATOM   10343 C  CA   . GLY A 1 79 ? 34.099  -0.689  -13.756 1.00 0.00 ? 79  GLY A CA   9  
ATOM   10344 C  C    . GLY A 1 79 ? 32.718  -1.199  -14.116 1.00 0.00 ? 79  GLY A C    9  
ATOM   10345 O  O    . GLY A 1 79 ? 31.819  -0.388  -14.334 1.00 0.00 ? 79  GLY A O    9  
ATOM   10346 H  H    . GLY A 1 79 ? 34.560  1.083   -14.820 1.00 0.00 ? 79  GLY A H    9  
ATOM   10347 H  HA2  . GLY A 1 79 ? 34.831  -1.199  -14.365 1.00 0.00 ? 79  GLY A HA2  9  
ATOM   10348 H  HA3  . GLY A 1 79 ? 34.293  -0.911  -12.717 1.00 0.00 ? 79  GLY A HA3  9  
HETATM 10349 ZN ZN   . ZN  B 2 .  ? -9.892  -0.381  -2.300  1.00 0.00 ? 201 ZN  A ZN   9  
HETATM 10350 ZN ZN   . ZN  C 2 .  ? 9.725   -1.233  -0.544  1.00 0.00 ? 401 ZN  A ZN   9  
ATOM   10351 N  N    . GLY A 1 1  ? -8.318  8.904   30.991  1.00 0.00 ? 1   GLY A N    10 
ATOM   10352 C  CA   . GLY A 1 1  ? -8.246  9.005   29.545  1.00 0.00 ? 1   GLY A CA   10 
ATOM   10353 C  C    . GLY A 1 1  ? -9.566  9.423   28.926  1.00 0.00 ? 1   GLY A C    10 
ATOM   10354 O  O    . GLY A 1 1  ? -10.466 8.601   28.753  1.00 0.00 ? 1   GLY A O    10 
ATOM   10355 H  H1   . GLY A 1 1  ? -9.128  9.193   31.460  1.00 0.00 ? 1   GLY A H1   10 
ATOM   10356 H  HA2  . GLY A 1 1  ? -7.492  9.731   29.283  1.00 0.00 ? 1   GLY A HA2  10 
ATOM   10357 H  HA3  . GLY A 1 1  ? -7.962  8.044   29.142  1.00 0.00 ? 1   GLY A HA3  10 
ATOM   10358 N  N    . SER A 1 2  ? -9.682  10.704  28.594  1.00 0.00 ? 2   SER A N    10 
ATOM   10359 C  CA   . SER A 1 2  ? -10.903 11.231  27.996  1.00 0.00 ? 2   SER A CA   10 
ATOM   10360 C  C    . SER A 1 2  ? -10.608 12.477  27.167  1.00 0.00 ? 2   SER A C    10 
ATOM   10361 O  O    . SER A 1 2  ? -10.044 13.450  27.667  1.00 0.00 ? 2   SER A O    10 
ATOM   10362 C  CB   . SER A 1 2  ? -11.928 11.559  29.084  1.00 0.00 ? 2   SER A CB   10 
ATOM   10363 O  OG   . SER A 1 2  ? -13.142 12.021  28.518  1.00 0.00 ? 2   SER A OG   10 
ATOM   10364 H  H    . SER A 1 2  ? -8.929  11.310  28.756  1.00 0.00 ? 2   SER A H    10 
ATOM   10365 H  HA   . SER A 1 2  ? -11.310 10.470  27.348  1.00 0.00 ? 2   SER A HA   10 
ATOM   10366 H  HB2  . SER A 1 2  ? -12.129 10.672  29.664  1.00 0.00 ? 2   SER A HB2  10 
ATOM   10367 H  HB3  . SER A 1 2  ? -11.530 12.329  29.729  1.00 0.00 ? 2   SER A HB3  10 
ATOM   10368 H  HG   . SER A 1 2  ? -13.455 12.785  29.008  1.00 0.00 ? 2   SER A HG   10 
ATOM   10369 N  N    . SER A 1 3  ? -10.995 12.440  25.895  1.00 0.00 ? 3   SER A N    10 
ATOM   10370 C  CA   . SER A 1 3  ? -10.769 13.563  24.994  1.00 0.00 ? 3   SER A CA   10 
ATOM   10371 C  C    . SER A 1 3  ? -11.943 13.735  24.035  1.00 0.00 ? 3   SER A C    10 
ATOM   10372 O  O    . SER A 1 3  ? -12.836 12.891  23.972  1.00 0.00 ? 3   SER A O    10 
ATOM   10373 C  CB   . SER A 1 3  ? -9.476  13.358  24.203  1.00 0.00 ? 3   SER A CB   10 
ATOM   10374 O  OG   . SER A 1 3  ? -8.340  13.652  24.998  1.00 0.00 ? 3   SER A OG   10 
ATOM   10375 H  H    . SER A 1 3  ? -11.440 11.635  25.555  1.00 0.00 ? 3   SER A H    10 
ATOM   10376 H  HA   . SER A 1 3  ? -10.676 14.456  25.594  1.00 0.00 ? 3   SER A HA   10 
ATOM   10377 H  HB2  . SER A 1 3  ? -9.416  12.331  23.876  1.00 0.00 ? 3   SER A HB2  10 
ATOM   10378 H  HB3  . SER A 1 3  ? -9.476  14.011  23.342  1.00 0.00 ? 3   SER A HB3  10 
ATOM   10379 H  HG   . SER A 1 3  ? -8.005  12.842  25.390  1.00 0.00 ? 3   SER A HG   10 
ATOM   10380 N  N    . GLY A 1 4  ? -11.934 14.836  23.289  1.00 0.00 ? 4   GLY A N    10 
ATOM   10381 C  CA   . GLY A 1 4  ? -13.002 15.100  22.343  1.00 0.00 ? 4   GLY A CA   10 
ATOM   10382 C  C    . GLY A 1 4  ? -12.490 15.297  20.930  1.00 0.00 ? 4   GLY A C    10 
ATOM   10383 O  O    . GLY A 1 4  ? -11.618 16.132  20.690  1.00 0.00 ? 4   GLY A O    10 
ATOM   10384 H  H    . GLY A 1 4  ? -11.195 15.474  23.382  1.00 0.00 ? 4   GLY A H    10 
ATOM   10385 H  HA2  . GLY A 1 4  ? -13.690 14.268  22.353  1.00 0.00 ? 4   GLY A HA2  10 
ATOM   10386 H  HA3  . GLY A 1 4  ? -13.528 15.992  22.651  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   10387 N  N    . SER A 1 5  ? -13.032 14.527  19.993  1.00 0.00 ? 5   SER A N    10 
ATOM   10388 C  CA   . SER A 1 5  ? -12.621 14.617  18.597  1.00 0.00 ? 5   SER A CA   10 
ATOM   10389 C  C    . SER A 1 5  ? -13.834 14.627  17.672  1.00 0.00 ? 5   SER A C    10 
ATOM   10390 O  O    . SER A 1 5  ? -14.959 14.375  18.104  1.00 0.00 ? 5   SER A O    10 
ATOM   10391 C  CB   . SER A 1 5  ? -11.701 13.448  18.237  1.00 0.00 ? 5   SER A CB   10 
ATOM   10392 O  OG   . SER A 1 5  ? -10.489 13.510  18.968  1.00 0.00 ? 5   SER A OG   10 
ATOM   10393 H  H    . SER A 1 5  ? -13.724 13.880  20.247  1.00 0.00 ? 5   SER A H    10 
ATOM   10394 H  HA   . SER A 1 5  ? -12.079 15.542  18.470  1.00 0.00 ? 5   SER A HA   10 
ATOM   10395 H  HB2  . SER A 1 5  ? -12.199 12.518  18.467  1.00 0.00 ? 5   SER A HB2  10 
ATOM   10396 H  HB3  . SER A 1 5  ? -11.474 13.484  17.182  1.00 0.00 ? 5   SER A HB3  10 
ATOM   10397 H  HG   . SER A 1 5  ? -10.103 14.385  18.876  1.00 0.00 ? 5   SER A HG   10 
ATOM   10398 N  N    . SER A 1 6  ? -13.597 14.921  16.398  1.00 0.00 ? 6   SER A N    10 
ATOM   10399 C  CA   . SER A 1 6  ? -14.670 14.968  15.412  1.00 0.00 ? 6   SER A CA   10 
ATOM   10400 C  C    . SER A 1 6  ? -14.221 14.351  14.090  1.00 0.00 ? 6   SER A C    10 
ATOM   10401 O  O    . SER A 1 6  ? -13.035 14.103  13.880  1.00 0.00 ? 6   SER A O    10 
ATOM   10402 C  CB   . SER A 1 6  ? -15.121 16.412  15.186  1.00 0.00 ? 6   SER A CB   10 
ATOM   10403 O  OG   . SER A 1 6  ? -16.243 16.468  14.322  1.00 0.00 ? 6   SER A OG   10 
ATOM   10404 H  H    . SER A 1 6  ? -12.678 15.113  16.115  1.00 0.00 ? 6   SER A H    10 
ATOM   10405 H  HA   . SER A 1 6  ? -15.501 14.397  15.798  1.00 0.00 ? 6   SER A HA   10 
ATOM   10406 H  HB2  . SER A 1 6  ? -15.390 16.855  16.134  1.00 0.00 ? 6   SER A HB2  10 
ATOM   10407 H  HB3  . SER A 1 6  ? -14.312 16.974  14.743  1.00 0.00 ? 6   SER A HB3  10 
ATOM   10408 H  HG   . SER A 1 6  ? -15.982 16.855  13.483  1.00 0.00 ? 6   SER A HG   10 
ATOM   10409 N  N    . GLY A 1 7  ? -15.180 14.107  13.203  1.00 0.00 ? 7   GLY A N    10 
ATOM   10410 C  CA   . GLY A 1 7  ? -14.865 13.521  11.913  1.00 0.00 ? 7   GLY A CA   10 
ATOM   10411 C  C    . GLY A 1 7  ? -16.084 12.935  11.229  1.00 0.00 ? 7   GLY A C    10 
ATOM   10412 O  O    . GLY A 1 7  ? -16.555 11.860  11.600  1.00 0.00 ? 7   GLY A O    10 
ATOM   10413 H  H    . GLY A 1 7  ? -16.110 14.326  13.425  1.00 0.00 ? 7   GLY A H    10 
ATOM   10414 H  HA2  . GLY A 1 7  ? -14.441 14.284  11.277  1.00 0.00 ? 7   GLY A HA2  10 
ATOM   10415 H  HA3  . GLY A 1 7  ? -14.135 12.738  12.054  1.00 0.00 ? 7   GLY A HA3  10 
ATOM   10416 N  N    . GLU A 1 8  ? -16.597 13.643  10.227  1.00 0.00 ? 8   GLU A N    10 
ATOM   10417 C  CA   . GLU A 1 8  ? -17.771 13.186  9.492   1.00 0.00 ? 8   GLU A CA   10 
ATOM   10418 C  C    . GLU A 1 8  ? -17.376 12.209  8.389   1.00 0.00 ? 8   GLU A C    10 
ATOM   10419 O  O    . GLU A 1 8  ? -16.192 11.970  8.150   1.00 0.00 ? 8   GLU A O    10 
ATOM   10420 C  CB   . GLU A 1 8  ? -18.518 14.378  8.890   1.00 0.00 ? 8   GLU A CB   10 
ATOM   10421 C  CG   . GLU A 1 8  ? -19.336 15.160  9.904   1.00 0.00 ? 8   GLU A CG   10 
ATOM   10422 C  CD   . GLU A 1 8  ? -19.927 16.430  9.323   1.00 0.00 ? 8   GLU A CD   10 
ATOM   10423 O  OE1  . GLU A 1 8  ? -19.166 17.216  8.721   1.00 0.00 ? 8   GLU A OE1  10 
ATOM   10424 O  OE2  . GLU A 1 8  ? -21.149 16.637  9.471   1.00 0.00 ? 8   GLU A OE2  10 
ATOM   10425 H  H    . GLU A 1 8  ? -16.177 14.492  9.978   1.00 0.00 ? 8   GLU A H    10 
ATOM   10426 H  HA   . GLU A 1 8  ? -18.422 12.680  10.189  1.00 0.00 ? 8   GLU A HA   10 
ATOM   10427 H  HB2  . GLU A 1 8  ? -17.800 15.049  8.442   1.00 0.00 ? 8   GLU A HB2  10 
ATOM   10428 H  HB3  . GLU A 1 8  ? -19.187 14.017  8.122   1.00 0.00 ? 8   GLU A HB3  10 
ATOM   10429 H  HG2  . GLU A 1 8  ? -20.142 14.535  10.257  1.00 0.00 ? 8   GLU A HG2  10 
ATOM   10430 H  HG3  . GLU A 1 8  ? -18.697 15.425  10.734  1.00 0.00 ? 8   GLU A HG3  10 
ATOM   10431 N  N    . LYS A 1 9  ? -18.376 11.646  7.719   1.00 0.00 ? 9   LYS A N    10 
ATOM   10432 C  CA   . LYS A 1 9  ? -18.135 10.695  6.641   1.00 0.00 ? 9   LYS A CA   10 
ATOM   10433 C  C    . LYS A 1 9  ? -19.085 10.945  5.473   1.00 0.00 ? 9   LYS A C    10 
ATOM   10434 O  O    . LYS A 1 9  ? -20.193 11.448  5.659   1.00 0.00 ? 9   LYS A O    10 
ATOM   10435 C  CB   . LYS A 1 9  ? -18.302 9.262   7.150   1.00 0.00 ? 9   LYS A CB   10 
ATOM   10436 C  CG   . LYS A 1 9  ? -17.036 8.679   7.753   1.00 0.00 ? 9   LYS A CG   10 
ATOM   10437 C  CD   . LYS A 1 9  ? -17.327 7.417   8.548   1.00 0.00 ? 9   LYS A CD   10 
ATOM   10438 C  CE   . LYS A 1 9  ? -17.869 7.743   9.932   1.00 0.00 ? 9   LYS A CE   10 
ATOM   10439 N  NZ   . LYS A 1 9  ? -19.339 7.976   9.910   1.00 0.00 ? 9   LYS A NZ   10 
ATOM   10440 H  H    . LYS A 1 9  ? -19.299 11.877  7.956   1.00 0.00 ? 9   LYS A H    10 
ATOM   10441 H  HA   . LYS A 1 9  ? -17.121 10.831  6.299   1.00 0.00 ? 9   LYS A HA   10 
ATOM   10442 H  HB2  . LYS A 1 9  ? -19.075 9.248   7.904   1.00 0.00 ? 9   LYS A HB2  10 
ATOM   10443 H  HB3  . LYS A 1 9  ? -18.606 8.633   6.325   1.00 0.00 ? 9   LYS A HB3  10 
ATOM   10444 H  HG2  . LYS A 1 9  ? -16.346 8.440   6.958   1.00 0.00 ? 9   LYS A HG2  10 
ATOM   10445 H  HG3  . LYS A 1 9  ? -16.591 9.413   8.410   1.00 0.00 ? 9   LYS A HG3  10 
ATOM   10446 H  HD2  . LYS A 1 9  ? -18.059 6.828   8.017   1.00 0.00 ? 9   LYS A HD2  10 
ATOM   10447 H  HD3  . LYS A 1 9  ? -16.412 6.850   8.653   1.00 0.00 ? 9   LYS A HD3  10 
ATOM   10448 H  HE2  . LYS A 1 9  ? -17.654 6.916   10.592  1.00 0.00 ? 9   LYS A HE2  10 
ATOM   10449 H  HE3  . LYS A 1 9  ? -17.377 8.632   10.297  1.00 0.00 ? 9   LYS A HE3  10 
ATOM   10450 H  HZ1  . LYS A 1 9  ? -19.776 7.432   9.139   1.00 0.00 ? 9   LYS A HZ1  10 
ATOM   10451 H  HZ2  . LYS A 1 9  ? -19.538 8.986   9.763   1.00 0.00 ? 9   LYS A HZ2  10 
ATOM   10452 H  HZ3  . LYS A 1 9  ? -19.762 7.679   10.813  1.00 0.00 ? 9   LYS A HZ3  10 
ATOM   10453 N  N    . ALA A 1 10 ? -18.644 10.589  4.271   1.00 0.00 ? 10  ALA A N    10 
ATOM   10454 C  CA   . ALA A 1 10 ? -19.456 10.772  3.075   1.00 0.00 ? 10  ALA A CA   10 
ATOM   10455 C  C    . ALA A 1 10 ? -19.499 9.496   2.240   1.00 0.00 ? 10  ALA A C    10 
ATOM   10456 O  O    . ALA A 1 10 ? -18.585 8.673   2.299   1.00 0.00 ? 10  ALA A O    10 
ATOM   10457 C  CB   . ALA A 1 10 ? -18.921 11.929  2.245   1.00 0.00 ? 10  ALA A CB   10 
ATOM   10458 H  H    . ALA A 1 10 ? -17.752 10.193  4.187   1.00 0.00 ? 10  ALA A H    10 
ATOM   10459 H  HA   . ALA A 1 10 ? -20.461 11.019  3.388   1.00 0.00 ? 10  ALA A HA   10 
ATOM   10460 H  HB1  . ALA A 1 10 ? -19.602 12.765  2.313   1.00 0.00 ? 10  ALA A HB1  10 
ATOM   10461 H  HB2  . ALA A 1 10 ? -17.952 12.223  2.620   1.00 0.00 ? 10  ALA A HB2  10 
ATOM   10462 H  HB3  . ALA A 1 10 ? -18.831 11.621  1.214   1.00 0.00 ? 10  ALA A HB3  10 
ATOM   10463 N  N    . ARG A 1 11 ? -20.567 9.337   1.465   1.00 0.00 ? 11  ARG A N    10 
ATOM   10464 C  CA   . ARG A 1 11 ? -20.729 8.160   0.620   1.00 0.00 ? 11  ARG A CA   10 
ATOM   10465 C  C    . ARG A 1 11 ? -21.317 8.541   -0.736  1.00 0.00 ? 11  ARG A C    10 
ATOM   10466 O  O    . ARG A 1 11 ? -22.359 9.190   -0.812  1.00 0.00 ? 11  ARG A O    10 
ATOM   10467 C  CB   . ARG A 1 11 ? -21.630 7.133   1.308   1.00 0.00 ? 11  ARG A CB   10 
ATOM   10468 C  CG   . ARG A 1 11 ? -21.118 6.687   2.668   1.00 0.00 ? 11  ARG A CG   10 
ATOM   10469 C  CD   . ARG A 1 11 ? -21.808 5.414   3.133   1.00 0.00 ? 11  ARG A CD   10 
ATOM   10470 N  NE   . ARG A 1 11 ? -20.951 4.614   4.004   1.00 0.00 ? 11  ARG A NE   10 
ATOM   10471 C  CZ   . ARG A 1 11 ? -21.338 3.478   4.574   1.00 0.00 ? 11  ARG A CZ   10 
ATOM   10472 N  NH1  . ARG A 1 11 ? -22.561 3.011   4.364   1.00 0.00 ? 11  ARG A NH1  10 
ATOM   10473 N  NH2  . ARG A 1 11 ? -20.501 2.807   5.354   1.00 0.00 ? 11  ARG A NH2  10 
ATOM   10474 H  H    . ARG A 1 11 ? -21.262 10.028  1.461   1.00 0.00 ? 11  ARG A H    10 
ATOM   10475 H  HA   . ARG A 1 11 ? -19.754 7.725   0.467   1.00 0.00 ? 11  ARG A HA   10 
ATOM   10476 H  HB2  . ARG A 1 11 ? -22.612 7.564   1.442   1.00 0.00 ? 11  ARG A HB2  10 
ATOM   10477 H  HB3  . ARG A 1 11 ? -21.712 6.263   0.675   1.00 0.00 ? 11  ARG A HB3  10 
ATOM   10478 H  HG2  . ARG A 1 11 ? -20.056 6.503   2.599   1.00 0.00 ? 11  ARG A HG2  10 
ATOM   10479 H  HG3  . ARG A 1 11 ? -21.304 7.471   3.387   1.00 0.00 ? 11  ARG A HG3  10 
ATOM   10480 H  HD2  . ARG A 1 11 ? -22.704 5.683   3.673   1.00 0.00 ? 11  ARG A HD2  10 
ATOM   10481 H  HD3  . ARG A 1 11 ? -22.073 4.827   2.266   1.00 0.00 ? 11  ARG A HD3  10 
ATOM   10482 H  HE   . ARG A 1 11 ? -20.043 4.941   4.173   1.00 0.00 ? 11  ARG A HE   10 
ATOM   10483 H  HH11 . ARG A 1 11 ? -23.194 3.514   3.776   1.00 0.00 ? 11  ARG A HH11 10 
ATOM   10484 H  HH12 . ARG A 1 11 ? -22.850 2.155   4.793   1.00 0.00 ? 11  ARG A HH12 10 
ATOM   10485 H  HH21 . ARG A 1 11 ? -19.578 3.156   5.514   1.00 0.00 ? 11  ARG A HH21 10 
ATOM   10486 H  HH22 . ARG A 1 11 ? -20.793 1.953   5.782   1.00 0.00 ? 11  ARG A HH22 10 
ATOM   10487 N  N    . GLY A 1 12 ? -20.639 8.132   -1.805  1.00 0.00 ? 12  GLY A N    10 
ATOM   10488 C  CA   . GLY A 1 12 ? -21.109 8.441   -3.143  1.00 0.00 ? 12  GLY A CA   10 
ATOM   10489 C  C    . GLY A 1 12 ? -20.162 9.356   -3.893  1.00 0.00 ? 12  GLY A C    10 
ATOM   10490 O  O    . GLY A 1 12 ? -19.041 8.966   -4.224  1.00 0.00 ? 12  GLY A O    10 
ATOM   10491 H  H    . GLY A 1 12 ? -19.814 7.618   -1.683  1.00 0.00 ? 12  GLY A H    10 
ATOM   10492 H  HA2  . GLY A 1 12 ? -21.216 7.519   -3.696  1.00 0.00 ? 12  GLY A HA2  10 
ATOM   10493 H  HA3  . GLY A 1 12 ? -22.074 8.920   -3.072  1.00 0.00 ? 12  GLY A HA3  10 
ATOM   10494 N  N    . LEU A 1 13 ? -20.612 10.576  -4.163  1.00 0.00 ? 13  LEU A N    10 
ATOM   10495 C  CA   . LEU A 1 13 ? -19.797 11.551  -4.881  1.00 0.00 ? 13  LEU A CA   10 
ATOM   10496 C  C    . LEU A 1 13 ? -19.118 12.513  -3.912  1.00 0.00 ? 13  LEU A C    10 
ATOM   10497 O  O    . LEU A 1 13 ? -19.771 13.355  -3.298  1.00 0.00 ? 13  LEU A O    10 
ATOM   10498 C  CB   . LEU A 1 13 ? -20.659 12.333  -5.874  1.00 0.00 ? 13  LEU A CB   10 
ATOM   10499 C  CG   . LEU A 1 13 ? -21.145 11.556  -7.098  1.00 0.00 ? 13  LEU A CG   10 
ATOM   10500 C  CD1  . LEU A 1 13 ? -22.358 12.236  -7.714  1.00 0.00 ? 13  LEU A CD1  10 
ATOM   10501 C  CD2  . LEU A 1 13 ? -20.028 11.423  -8.123  1.00 0.00 ? 13  LEU A CD2  10 
ATOM   10502 H  H    . LEU A 1 13 ? -21.513 10.829  -3.874  1.00 0.00 ? 13  LEU A H    10 
ATOM   10503 H  HA   . LEU A 1 13 ? -19.037 11.010  -5.425  1.00 0.00 ? 13  LEU A HA   10 
ATOM   10504 H  HB2  . LEU A 1 13 ? -21.527 12.693  -5.345  1.00 0.00 ? 13  LEU A HB2  10 
ATOM   10505 H  HB3  . LEU A 1 13 ? -20.077 13.174  -6.224  1.00 0.00 ? 13  LEU A HB3  10 
ATOM   10506 H  HG   . LEU A 1 13 ? -21.439 10.562  -6.792  1.00 0.00 ? 13  LEU A HG   10 
ATOM   10507 H  HD11 . LEU A 1 13 ? -22.988 11.494  -8.180  1.00 0.00 ? 13  LEU A HD11 10 
ATOM   10508 H  HD12 . LEU A 1 13 ? -22.032 12.949  -8.457  1.00 0.00 ? 13  LEU A HD12 10 
ATOM   10509 H  HD13 . LEU A 1 13 ? -22.914 12.748  -6.943  1.00 0.00 ? 13  LEU A HD13 10 
ATOM   10510 H  HD21 . LEU A 1 13 ? -20.436 11.537  -9.116  1.00 0.00 ? 13  LEU A HD21 10 
ATOM   10511 H  HD22 . LEU A 1 13 ? -19.570 10.449  -8.032  1.00 0.00 ? 13  LEU A HD22 10 
ATOM   10512 H  HD23 . LEU A 1 13 ? -19.286 12.188  -7.949  1.00 0.00 ? 13  LEU A HD23 10 
ATOM   10513 N  N    . GLY A 1 14 ? -17.801 12.381  -3.780  1.00 0.00 ? 14  GLY A N    10 
ATOM   10514 C  CA   . GLY A 1 14 ? -17.055 13.247  -2.886  1.00 0.00 ? 14  GLY A CA   10 
ATOM   10515 C  C    . GLY A 1 14 ? -15.556 13.066  -3.021  1.00 0.00 ? 14  GLY A C    10 
ATOM   10516 O  O    . GLY A 1 14 ? -14.816 14.040  -3.163  1.00 0.00 ? 14  GLY A O    10 
ATOM   10517 H  H    . GLY A 1 14 ? -17.333 11.691  -4.295  1.00 0.00 ? 14  GLY A H    10 
ATOM   10518 H  HA2  . GLY A 1 14 ? -17.305 14.274  -3.105  1.00 0.00 ? 14  GLY A HA2  10 
ATOM   10519 H  HA3  . GLY A 1 14 ? -17.342 13.026  -1.868  1.00 0.00 ? 14  GLY A HA3  10 
ATOM   10520 N  N    . LYS A 1 15 ? -15.105 11.817  -2.976  1.00 0.00 ? 15  LYS A N    10 
ATOM   10521 C  CA   . LYS A 1 15 ? -13.685 11.511  -3.094  1.00 0.00 ? 15  LYS A CA   10 
ATOM   10522 C  C    . LYS A 1 15 ? -13.440 10.480  -4.192  1.00 0.00 ? 15  LYS A C    10 
ATOM   10523 O  O    . LYS A 1 15 ? -14.360 10.099  -4.915  1.00 0.00 ? 15  LYS A O    10 
ATOM   10524 C  CB   . LYS A 1 15 ? -13.142 10.991  -1.761  1.00 0.00 ? 15  LYS A CB   10 
ATOM   10525 C  CG   . LYS A 1 15 ? -12.800 12.092  -0.772  1.00 0.00 ? 15  LYS A CG   10 
ATOM   10526 C  CD   . LYS A 1 15 ? -14.039 12.597  -0.051  1.00 0.00 ? 15  LYS A CD   10 
ATOM   10527 C  CE   . LYS A 1 15 ? -14.305 11.804  1.220   1.00 0.00 ? 15  LYS A CE   10 
ATOM   10528 N  NZ   . LYS A 1 15 ? -13.558 12.354  2.384   1.00 0.00 ? 15  LYS A NZ   10 
ATOM   10529 H  H    . LYS A 1 15 ? -15.745 11.082  -2.861  1.00 0.00 ? 15  LYS A H    10 
ATOM   10530 H  HA   . LYS A 1 15 ? -13.169 12.423  -3.352  1.00 0.00 ? 15  LYS A HA   10 
ATOM   10531 H  HB2  . LYS A 1 15 ? -13.883 10.348  -1.310  1.00 0.00 ? 15  LYS A HB2  10 
ATOM   10532 H  HB3  . LYS A 1 15 ? -12.246 10.416  -1.951  1.00 0.00 ? 15  LYS A HB3  10 
ATOM   10533 H  HG2  . LYS A 1 15 ? -12.104 11.706  -0.043  1.00 0.00 ? 15  LYS A HG2  10 
ATOM   10534 H  HG3  . LYS A 1 15 ? -12.346 12.915  -1.306  1.00 0.00 ? 15  LYS A HG3  10 
ATOM   10535 H  HD2  . LYS A 1 15 ? -13.895 13.635  0.210   1.00 0.00 ? 15  LYS A HD2  10 
ATOM   10536 H  HD3  . LYS A 1 15 ? -14.891 12.504  -0.708  1.00 0.00 ? 15  LYS A HD3  10 
ATOM   10537 H  HE2  . LYS A 1 15 ? -15.363 11.836  1.433   1.00 0.00 ? 15  LYS A HE2  10 
ATOM   10538 H  HE3  . LYS A 1 15 ? -14.002 10.780  1.059   1.00 0.00 ? 15  LYS A HE3  10 
ATOM   10539 H  HZ1  . LYS A 1 15 ? -13.562 11.669  3.167   1.00 0.00 ? 15  LYS A HZ1  10 
ATOM   10540 H  HZ2  . LYS A 1 15 ? -14.003 13.236  2.709   1.00 0.00 ? 15  LYS A HZ2  10 
ATOM   10541 H  HZ3  . LYS A 1 15 ? -12.574 12.553  2.116   1.00 0.00 ? 15  LYS A HZ3  10 
ATOM   10542 N  N    . TYR A 1 16 ? -12.195 10.032  -4.308  1.00 0.00 ? 16  TYR A N    10 
ATOM   10543 C  CA   . TYR A 1 16 ? -11.829 9.046   -5.318  1.00 0.00 ? 16  TYR A CA   10 
ATOM   10544 C  C    . TYR A 1 16 ? -12.360 7.664   -4.948  1.00 0.00 ? 16  TYR A C    10 
ATOM   10545 O  O    . TYR A 1 16 ? -12.130 7.175   -3.841  1.00 0.00 ? 16  TYR A O    10 
ATOM   10546 C  CB   . TYR A 1 16 ? -10.310 8.993   -5.483  1.00 0.00 ? 16  TYR A CB   10 
ATOM   10547 C  CG   . TYR A 1 16 ? -9.733  10.208  -6.174  1.00 0.00 ? 16  TYR A CG   10 
ATOM   10548 C  CD1  . TYR A 1 16 ? -9.952  11.486  -5.672  1.00 0.00 ? 16  TYR A CD1  10 
ATOM   10549 C  CD2  . TYR A 1 16 ? -8.972  10.080  -7.329  1.00 0.00 ? 16  TYR A CD2  10 
ATOM   10550 C  CE1  . TYR A 1 16 ? -9.428  12.599  -6.300  1.00 0.00 ? 16  TYR A CE1  10 
ATOM   10551 C  CE2  . TYR A 1 16 ? -8.442  11.187  -7.963  1.00 0.00 ? 16  TYR A CE2  10 
ATOM   10552 C  CZ   . TYR A 1 16 ? -8.674  12.445  -7.445  1.00 0.00 ? 16  TYR A CZ   10 
ATOM   10553 O  OH   . TYR A 1 16 ? -8.149  13.550  -8.074  1.00 0.00 ? 16  TYR A OH   10 
ATOM   10554 H  H    . TYR A 1 16 ? -11.505 10.373  -3.702  1.00 0.00 ? 16  TYR A H    10 
ATOM   10555 H  HA   . TYR A 1 16 ? -12.273 9.350   -6.255  1.00 0.00 ? 16  TYR A HA   10 
ATOM   10556 H  HB2  . TYR A 1 16 ? -9.851  8.917   -4.510  1.00 0.00 ? 16  TYR A HB2  10 
ATOM   10557 H  HB3  . TYR A 1 16 ? -10.048 8.123   -6.068  1.00 0.00 ? 16  TYR A HB3  10 
ATOM   10558 H  HD1  . TYR A 1 16 ? -10.543 11.603  -4.776  1.00 0.00 ? 16  TYR A HD1  10 
ATOM   10559 H  HD2  . TYR A 1 16 ? -8.793  9.093   -7.732  1.00 0.00 ? 16  TYR A HD2  10 
ATOM   10560 H  HE1  . TYR A 1 16 ? -9.608  13.584  -5.895  1.00 0.00 ? 16  TYR A HE1  10 
ATOM   10561 H  HE2  . TYR A 1 16 ? -7.852  11.067  -8.859  1.00 0.00 ? 16  TYR A HE2  10 
ATOM   10562 H  HH   . TYR A 1 16 ? -8.287  13.474  -9.021  1.00 0.00 ? 16  TYR A HH   10 
ATOM   10563 N  N    . ILE A 1 17 ? -13.070 7.040   -5.882  1.00 0.00 ? 17  ILE A N    10 
ATOM   10564 C  CA   . ILE A 1 17 ? -13.632 5.715   -5.655  1.00 0.00 ? 17  ILE A CA   10 
ATOM   10565 C  C    . ILE A 1 17 ? -12.666 4.624   -6.105  1.00 0.00 ? 17  ILE A C    10 
ATOM   10566 O  O    . ILE A 1 17 ? -12.384 4.481   -7.295  1.00 0.00 ? 17  ILE A O    10 
ATOM   10567 C  CB   . ILE A 1 17 ? -14.971 5.537   -6.396  1.00 0.00 ? 17  ILE A CB   10 
ATOM   10568 C  CG1  . ILE A 1 17 ? -15.893 6.726   -6.121  1.00 0.00 ? 17  ILE A CG1  10 
ATOM   10569 C  CG2  . ILE A 1 17 ? -15.638 4.234   -5.979  1.00 0.00 ? 17  ILE A CG2  10 
ATOM   10570 C  CD1  . ILE A 1 17 ? -16.214 6.915   -4.655  1.00 0.00 ? 17  ILE A CD1  10 
ATOM   10571 H  H    . ILE A 1 17 ? -13.219 7.482   -6.743  1.00 0.00 ? 17  ILE A H    10 
ATOM   10572 H  HA   . ILE A 1 17 ? -13.813 5.606   -4.595  1.00 0.00 ? 17  ILE A HA   10 
ATOM   10573 H  HB   . ILE A 1 17 ? -14.767 5.486   -7.454  1.00 0.00 ? 17  ILE A HB   10 
ATOM   10574 H  HG12 . ILE A 1 17 ? -15.422 7.629   -6.475  1.00 0.00 ? 17  ILE A HG12 10 
ATOM   10575 H  HG13 . ILE A 1 17 ? -16.824 6.579   -6.649  1.00 0.00 ? 17  ILE A HG13 10 
ATOM   10576 H  HG21 . ILE A 1 17 ? -16.209 4.396   -5.076  1.00 0.00 ? 17  ILE A HG21 10 
ATOM   10577 H  HG22 . ILE A 1 17 ? -16.297 3.900   -6.766  1.00 0.00 ? 17  ILE A HG22 10 
ATOM   10578 H  HG23 . ILE A 1 17 ? -14.883 3.485   -5.798  1.00 0.00 ? 17  ILE A HG23 10 
ATOM   10579 H  HD11 . ILE A 1 17 ? -15.933 7.912   -4.350  1.00 0.00 ? 17  ILE A HD11 10 
ATOM   10580 H  HD12 . ILE A 1 17 ? -17.273 6.774   -4.496  1.00 0.00 ? 17  ILE A HD12 10 
ATOM   10581 H  HD13 . ILE A 1 17 ? -15.663 6.192   -4.070  1.00 0.00 ? 17  ILE A HD13 10 
ATOM   10582 N  N    . CYS A 1 18 ? -12.163 3.855   -5.145  1.00 0.00 ? 18  CYS A N    10 
ATOM   10583 C  CA   . CYS A 1 18 ? -11.229 2.775   -5.441  1.00 0.00 ? 18  CYS A CA   10 
ATOM   10584 C  C    . CYS A 1 18 ? -11.799 1.838   -6.502  1.00 0.00 ? 18  CYS A C    10 
ATOM   10585 O  O    . CYS A 1 18 ? -12.899 1.307   -6.348  1.00 0.00 ? 18  CYS A O    10 
ATOM   10586 C  CB   . CYS A 1 18 ? -10.908 1.988   -4.169  1.00 0.00 ? 18  CYS A CB   10 
ATOM   10587 S  SG   . CYS A 1 18 ? -9.594  0.743   -4.377  1.00 0.00 ? 18  CYS A SG   10 
ATOM   10588 H  H    . CYS A 1 18 ? -12.426 4.018   -4.214  1.00 0.00 ? 18  CYS A H    10 
ATOM   10589 H  HA   . CYS A 1 18 ? -10.320 3.217   -5.819  1.00 0.00 ? 18  CYS A HA   10 
ATOM   10590 H  HB2  . CYS A 1 18 ? -10.589 2.676   -3.400  1.00 0.00 ? 18  CYS A HB2  10 
ATOM   10591 H  HB3  . CYS A 1 18 ? -11.799 1.474   -3.838  1.00 0.00 ? 18  CYS A HB3  10 
ATOM   10592 N  N    . GLN A 1 19 ? -11.043 1.641   -7.577  1.00 0.00 ? 19  GLN A N    10 
ATOM   10593 C  CA   . GLN A 1 19 ? -11.474 0.768   -8.663  1.00 0.00 ? 19  GLN A CA   10 
ATOM   10594 C  C    . GLN A 1 19 ? -11.167 -0.691  -8.343  1.00 0.00 ? 19  GLN A C    10 
ATOM   10595 O  O    . GLN A 1 19 ? -11.126 -1.538  -9.236  1.00 0.00 ? 19  GLN A O    10 
ATOM   10596 C  CB   . GLN A 1 19 ? -10.789 1.171   -9.970  1.00 0.00 ? 19  GLN A CB   10 
ATOM   10597 C  CG   . GLN A 1 19 ? -11.570 2.197   -10.775 1.00 0.00 ? 19  GLN A CG   10 
ATOM   10598 C  CD   . GLN A 1 19 ? -12.919 1.677   -11.232 1.00 0.00 ? 19  GLN A CD   10 
ATOM   10599 O  OE1  . GLN A 1 19 ? -12.999 0.765   -12.055 1.00 0.00 ? 19  GLN A OE1  10 
ATOM   10600 N  NE2  . GLN A 1 19 ? -13.989 2.255   -10.698 1.00 0.00 ? 19  GLN A NE2  10 
ATOM   10601 H  H    . GLN A 1 19 ? -10.177 2.092   -7.641  1.00 0.00 ? 19  GLN A H    10 
ATOM   10602 H  HA   . GLN A 1 19 ? -12.541 0.882   -8.776  1.00 0.00 ? 19  GLN A HA   10 
ATOM   10603 H  HB2  . GLN A 1 19 ? -9.819  1.587   -9.742  1.00 0.00 ? 19  GLN A HB2  10 
ATOM   10604 H  HB3  . GLN A 1 19 ? -10.660 0.290   -10.581 1.00 0.00 ? 19  GLN A HB3  10 
ATOM   10605 H  HG2  . GLN A 1 19 ? -11.729 3.072   -10.162 1.00 0.00 ? 19  GLN A HG2  10 
ATOM   10606 H  HG3  . GLN A 1 19 ? -10.992 2.468   -11.646 1.00 0.00 ? 19  GLN A HG3  10 
ATOM   10607 H  HE21 . GLN A 1 19 ? -13.849 2.976   -10.049 1.00 0.00 ? 19  GLN A HE21 10 
ATOM   10608 H  HE22 . GLN A 1 19 ? -14.873 1.939   -10.975 1.00 0.00 ? 19  GLN A HE22 10 
ATOM   10609 N  N    . LYS A 1 20 ? -10.953 -0.979  -7.064  1.00 0.00 ? 20  LYS A N    10 
ATOM   10610 C  CA   . LYS A 1 20 ? -10.651 -2.336  -6.625  1.00 0.00 ? 20  LYS A CA   10 
ATOM   10611 C  C    . LYS A 1 20 ? -11.704 -2.837  -5.642  1.00 0.00 ? 20  LYS A C    10 
ATOM   10612 O  O    . LYS A 1 20 ? -12.250 -3.929  -5.803  1.00 0.00 ? 20  LYS A O    10 
ATOM   10613 C  CB   . LYS A 1 20 ? -9.266  -2.388  -5.975  1.00 0.00 ? 20  LYS A CB   10 
ATOM   10614 C  CG   . LYS A 1 20 ? -8.866  -3.776  -5.506  1.00 0.00 ? 20  LYS A CG   10 
ATOM   10615 C  CD   . LYS A 1 20 ? -8.207  -4.572  -6.620  1.00 0.00 ? 20  LYS A CD   10 
ATOM   10616 C  CE   . LYS A 1 20 ? -8.047  -6.036  -6.238  1.00 0.00 ? 20  LYS A CE   10 
ATOM   10617 N  NZ   . LYS A 1 20 ? -6.844  -6.259  -5.390  1.00 0.00 ? 20  LYS A NZ   10 
ATOM   10618 H  H    . LYS A 1 20 ? -11.000 -0.260  -6.398  1.00 0.00 ? 20  LYS A H    10 
ATOM   10619 H  HA   . LYS A 1 20 ? -10.655 -2.975  -7.495  1.00 0.00 ? 20  LYS A HA   10 
ATOM   10620 H  HB2  . LYS A 1 20 ? -8.533  -2.047  -6.691  1.00 0.00 ? 20  LYS A HB2  10 
ATOM   10621 H  HB3  . LYS A 1 20 ? -9.258  -1.726  -5.121  1.00 0.00 ? 20  LYS A HB3  10 
ATOM   10622 H  HG2  . LYS A 1 20 ? -8.170  -3.682  -4.685  1.00 0.00 ? 20  LYS A HG2  10 
ATOM   10623 H  HG3  . LYS A 1 20 ? -9.750  -4.302  -5.173  1.00 0.00 ? 20  LYS A HG3  10 
ATOM   10624 H  HD2  . LYS A 1 20 ? -8.820  -4.509  -7.507  1.00 0.00 ? 20  LYS A HD2  10 
ATOM   10625 H  HD3  . LYS A 1 20 ? -7.232  -4.153  -6.822  1.00 0.00 ? 20  LYS A HD3  10 
ATOM   10626 H  HE2  . LYS A 1 20 ? -8.924  -6.351  -5.694  1.00 0.00 ? 20  LYS A HE2  10 
ATOM   10627 H  HE3  . LYS A 1 20 ? -7.954  -6.621  -7.141  1.00 0.00 ? 20  LYS A HE3  10 
ATOM   10628 H  HZ1  . LYS A 1 20 ? -6.403  -5.348  -5.148  1.00 0.00 ? 20  LYS A HZ1  10 
ATOM   10629 H  HZ2  . LYS A 1 20 ? -6.150  -6.842  -5.899  1.00 0.00 ? 20  LYS A HZ2  10 
ATOM   10630 H  HZ3  . LYS A 1 20 ? -7.111  -6.747  -4.511  1.00 0.00 ? 20  LYS A HZ3  10 
ATOM   10631 N  N    . CYS A 1 21 ? -11.987 -2.031  -4.623  1.00 0.00 ? 21  CYS A N    10 
ATOM   10632 C  CA   . CYS A 1 21 ? -12.976 -2.391  -3.615  1.00 0.00 ? 21  CYS A CA   10 
ATOM   10633 C  C    . CYS A 1 21 ? -14.230 -1.533  -3.751  1.00 0.00 ? 21  CYS A C    10 
ATOM   10634 O  O    . CYS A 1 21 ? -15.209 -1.725  -3.029  1.00 0.00 ? 21  CYS A O    10 
ATOM   10635 C  CB   . CYS A 1 21 ? -12.386 -2.232  -2.212  1.00 0.00 ? 21  CYS A CB   10 
ATOM   10636 S  SG   . CYS A 1 21 ? -12.008 -0.509  -1.756  1.00 0.00 ? 21  CYS A SG   10 
ATOM   10637 H  H    . CYS A 1 21 ? -11.519 -1.172  -4.548  1.00 0.00 ? 21  CYS A H    10 
ATOM   10638 H  HA   . CYS A 1 21 ? -13.245 -3.425  -3.767  1.00 0.00 ? 21  CYS A HA   10 
ATOM   10639 H  HB2  . CYS A 1 21 ? -13.090 -2.615  -1.488  1.00 0.00 ? 21  CYS A HB2  10 
ATOM   10640 H  HB3  . CYS A 1 21 ? -11.468 -2.798  -2.149  1.00 0.00 ? 21  CYS A HB3  10 
ATOM   10641 N  N    . HIS A 1 22 ? -14.194 -0.585  -4.683  1.00 0.00 ? 22  HIS A N    10 
ATOM   10642 C  CA   . HIS A 1 22 ? -15.327 0.303   -4.915  1.00 0.00 ? 22  HIS A CA   10 
ATOM   10643 C  C    . HIS A 1 22 ? -15.713 1.038   -3.636  1.00 0.00 ? 22  HIS A C    10 
ATOM   10644 O  O    . HIS A 1 22 ? -16.887 1.098   -3.272  1.00 0.00 ? 22  HIS A O    10 
ATOM   10645 C  CB   . HIS A 1 22 ? -16.524 -0.491  -5.441  1.00 0.00 ? 22  HIS A CB   10 
ATOM   10646 C  CG   . HIS A 1 22 ? -16.417 -0.844  -6.893  1.00 0.00 ? 22  HIS A CG   10 
ATOM   10647 N  ND1  . HIS A 1 22 ? -16.101 -2.111  -7.337  1.00 0.00 ? 22  HIS A ND1  10 
ATOM   10648 C  CD2  . HIS A 1 22 ? -16.588 -0.089  -8.003  1.00 0.00 ? 22  HIS A CD2  10 
ATOM   10649 C  CE1  . HIS A 1 22 ? -16.080 -2.119  -8.658  1.00 0.00 ? 22  HIS A CE1  10 
ATOM   10650 N  NE2  . HIS A 1 22 ? -16.373 -0.904  -9.087  1.00 0.00 ? 22  HIS A NE2  10 
ATOM   10651 H  H    . HIS A 1 22 ? -13.386 -0.481  -5.227  1.00 0.00 ? 22  HIS A H    10 
ATOM   10652 H  HA   . HIS A 1 22 ? -15.033 1.028   -5.658  1.00 0.00 ? 22  HIS A HA   10 
ATOM   10653 H  HB2  . HIS A 1 22 ? -16.612 -1.410  -4.882  1.00 0.00 ? 22  HIS A HB2  10 
ATOM   10654 H  HB3  . HIS A 1 22 ? -17.423 0.094   -5.307  1.00 0.00 ? 22  HIS A HB3  10 
ATOM   10655 H  HD1  . HIS A 1 22 ? -15.917 -2.887  -6.769  1.00 0.00 ? 22  HIS A HD1  10 
ATOM   10656 H  HD2  . HIS A 1 22 ? -16.845 0.960   -8.032  1.00 0.00 ? 22  HIS A HD2  10 
ATOM   10657 H  HE1  . HIS A 1 22 ? -15.862 -2.973  -9.282  1.00 0.00 ? 22  HIS A HE1  10 
ATOM   10658 N  N    . ALA A 1 23 ? -14.716 1.597   -2.957  1.00 0.00 ? 23  ALA A N    10 
ATOM   10659 C  CA   . ALA A 1 23 ? -14.950 2.329   -1.719  1.00 0.00 ? 23  ALA A CA   10 
ATOM   10660 C  C    . ALA A 1 23 ? -14.198 3.655   -1.714  1.00 0.00 ? 23  ALA A C    10 
ATOM   10661 O  O    . ALA A 1 23 ? -13.028 3.717   -2.093  1.00 0.00 ? 23  ALA A O    10 
ATOM   10662 C  CB   . ALA A 1 23 ? -14.543 1.485   -0.520  1.00 0.00 ? 23  ALA A CB   10 
ATOM   10663 H  H    . ALA A 1 23 ? -13.801 1.515   -3.298  1.00 0.00 ? 23  ALA A H    10 
ATOM   10664 H  HA   . ALA A 1 23 ? -16.010 2.528   -1.644  1.00 0.00 ? 23  ALA A HA   10 
ATOM   10665 H  HB1  . ALA A 1 23 ? -13.484 1.275   -0.572  1.00 0.00 ? 23  ALA A HB1  10 
ATOM   10666 H  HB2  . ALA A 1 23 ? -14.759 2.024   0.390   1.00 0.00 ? 23  ALA A HB2  10 
ATOM   10667 H  HB3  . ALA A 1 23 ? -15.095 0.557   -0.530  1.00 0.00 ? 23  ALA A HB3  10 
ATOM   10668 N  N    . ILE A 1 24 ? -14.876 4.714   -1.285  1.00 0.00 ? 24  ILE A N    10 
ATOM   10669 C  CA   . ILE A 1 24 ? -14.271 6.039   -1.232  1.00 0.00 ? 24  ILE A CA   10 
ATOM   10670 C  C    . ILE A 1 24 ? -12.916 5.996   -0.532  1.00 0.00 ? 24  ILE A C    10 
ATOM   10671 O  O    . ILE A 1 24 ? -12.778 5.405   0.540   1.00 0.00 ? 24  ILE A O    10 
ATOM   10672 C  CB   . ILE A 1 24 ? -15.181 7.045   -0.503  1.00 0.00 ? 24  ILE A CB   10 
ATOM   10673 C  CG1  . ILE A 1 24 ? -16.252 7.580   -1.456  1.00 0.00 ? 24  ILE A CG1  10 
ATOM   10674 C  CG2  . ILE A 1 24 ? -14.355 8.187   0.070   1.00 0.00 ? 24  ILE A CG2  10 
ATOM   10675 C  CD1  . ILE A 1 24 ? -17.059 8.722   -0.878  1.00 0.00 ? 24  ILE A CD1  10 
ATOM   10676 H  H    . ILE A 1 24 ? -15.806 4.601   -0.997  1.00 0.00 ? 24  ILE A H    10 
ATOM   10677 H  HA   . ILE A 1 24 ? -14.129 6.381   -2.247  1.00 0.00 ? 24  ILE A HA   10 
ATOM   10678 H  HB   . ILE A 1 24 ? -15.661 6.534   0.317   1.00 0.00 ? 24  ILE A HB   10 
ATOM   10679 H  HG12 . ILE A 1 24 ? -15.778 7.933   -2.358  1.00 0.00 ? 24  ILE A HG12 10 
ATOM   10680 H  HG13 . ILE A 1 24 ? -16.935 6.780   -1.702  1.00 0.00 ? 24  ILE A HG13 10 
ATOM   10681 H  HG21 . ILE A 1 24 ? -15.002 9.024   0.289   1.00 0.00 ? 24  ILE A HG21 10 
ATOM   10682 H  HG22 . ILE A 1 24 ? -13.871 7.861   0.978   1.00 0.00 ? 24  ILE A HG22 10 
ATOM   10683 H  HG23 . ILE A 1 24 ? -13.609 8.489   -0.649  1.00 0.00 ? 24  ILE A HG23 10 
ATOM   10684 H  HD11 . ILE A 1 24 ? -16.604 9.661   -1.156  1.00 0.00 ? 24  ILE A HD11 10 
ATOM   10685 H  HD12 . ILE A 1 24 ? -18.067 8.681   -1.262  1.00 0.00 ? 24  ILE A HD12 10 
ATOM   10686 H  HD13 . ILE A 1 24 ? -17.080 8.638   0.199   1.00 0.00 ? 24  ILE A HD13 10 
ATOM   10687 N  N    . ILE A 1 25 ? -11.920 6.628   -1.144  1.00 0.00 ? 25  ILE A N    10 
ATOM   10688 C  CA   . ILE A 1 25 ? -10.578 6.665   -0.578  1.00 0.00 ? 25  ILE A CA   10 
ATOM   10689 C  C    . ILE A 1 25 ? -10.343 7.956   0.198   1.00 0.00 ? 25  ILE A C    10 
ATOM   10690 O  O    . ILE A 1 25 ? -9.782  8.917   -0.330  1.00 0.00 ? 25  ILE A O    10 
ATOM   10691 C  CB   . ILE A 1 25 ? -9.502  6.534   -1.672  1.00 0.00 ? 25  ILE A CB   10 
ATOM   10692 C  CG1  . ILE A 1 25 ? -9.786  5.317   -2.554  1.00 0.00 ? 25  ILE A CG1  10 
ATOM   10693 C  CG2  . ILE A 1 25 ? -8.119  6.430   -1.046  1.00 0.00 ? 25  ILE A CG2  10 
ATOM   10694 C  CD1  . ILE A 1 25 ? -9.241  5.448   -3.959  1.00 0.00 ? 25  ILE A CD1  10 
ATOM   10695 H  H    . ILE A 1 25 ? -12.093 7.080   -1.995  1.00 0.00 ? 25  ILE A H    10 
ATOM   10696 H  HA   . ILE A 1 25 ? -10.478 5.828   0.098   1.00 0.00 ? 25  ILE A HA   10 
ATOM   10697 H  HB   . ILE A 1 25 ? -9.529  7.425   -2.281  1.00 0.00 ? 25  ILE A HB   10 
ATOM   10698 H  HG12 . ILE A 1 25 ? -9.339  4.443   -2.107  1.00 0.00 ? 25  ILE A HG12 10 
ATOM   10699 H  HG13 . ILE A 1 25 ? -10.855 5.174   -2.624  1.00 0.00 ? 25  ILE A HG13 10 
ATOM   10700 H  HG21 . ILE A 1 25 ? -8.209  6.448   0.030   1.00 0.00 ? 25  ILE A HG21 10 
ATOM   10701 H  HG22 . ILE A 1 25 ? -7.655  5.504   -1.351  1.00 0.00 ? 25  ILE A HG22 10 
ATOM   10702 H  HG23 . ILE A 1 25 ? -7.513  7.262   -1.371  1.00 0.00 ? 25  ILE A HG23 10 
ATOM   10703 H  HD11 . ILE A 1 25 ? -9.524  6.407   -4.367  1.00 0.00 ? 25  ILE A HD11 10 
ATOM   10704 H  HD12 . ILE A 1 25 ? -8.164  5.368   -3.937  1.00 0.00 ? 25  ILE A HD12 10 
ATOM   10705 H  HD13 . ILE A 1 25 ? -9.647  4.661   -4.578  1.00 0.00 ? 25  ILE A HD13 10 
ATOM   10706 N  N    . ASP A 1 26 ? -10.774 7.972   1.454   1.00 0.00 ? 26  ASP A N    10 
ATOM   10707 C  CA   . ASP A 1 26 ? -10.609 9.144   2.305   1.00 0.00 ? 26  ASP A CA   10 
ATOM   10708 C  C    . ASP A 1 26 ? -9.204  9.722   2.168   1.00 0.00 ? 26  ASP A C    10 
ATOM   10709 O  O    . ASP A 1 26 ? -9.034  10.923  1.962   1.00 0.00 ? 26  ASP A O    10 
ATOM   10710 C  CB   . ASP A 1 26 ? -10.885 8.784   3.766   1.00 0.00 ? 26  ASP A CB   10 
ATOM   10711 C  CG   . ASP A 1 26 ? -12.360 8.854   4.111   1.00 0.00 ? 26  ASP A CG   10 
ATOM   10712 O  OD1  . ASP A 1 26 ? -12.887 9.980   4.233   1.00 0.00 ? 26  ASP A OD1  10 
ATOM   10713 O  OD2  . ASP A 1 26 ? -12.986 7.784   4.260   1.00 0.00 ? 26  ASP A OD2  10 
ATOM   10714 H  H    . ASP A 1 26 ? -11.214 7.175   1.819   1.00 0.00 ? 26  ASP A H    10 
ATOM   10715 H  HA   . ASP A 1 26 ? -11.323 9.889   1.987   1.00 0.00 ? 26  ASP A HA   10 
ATOM   10716 H  HB2  . ASP A 1 26 ? -10.538 7.778   3.954   1.00 0.00 ? 26  ASP A HB2  10 
ATOM   10717 H  HB3  . ASP A 1 26 ? -10.351 9.470   4.406   1.00 0.00 ? 26  ASP A HB3  10 
ATOM   10718 N  N    . GLU A 1 27 ? -8.200  8.858   2.284   1.00 0.00 ? 27  GLU A N    10 
ATOM   10719 C  CA   . GLU A 1 27 ? -6.810  9.284   2.174   1.00 0.00 ? 27  GLU A CA   10 
ATOM   10720 C  C    . GLU A 1 27 ? -6.389  9.395   0.711   1.00 0.00 ? 27  GLU A C    10 
ATOM   10721 O  O    . GLU A 1 27 ? -7.164  9.085   -0.193  1.00 0.00 ? 27  GLU A O    10 
ATOM   10722 C  CB   . GLU A 1 27 ? -5.893  8.302   2.907   1.00 0.00 ? 27  GLU A CB   10 
ATOM   10723 C  CG   . GLU A 1 27 ? -5.964  6.884   2.367   1.00 0.00 ? 27  GLU A CG   10 
ATOM   10724 C  CD   . GLU A 1 27 ? -4.741  6.062   2.725   1.00 0.00 ? 27  GLU A CD   10 
ATOM   10725 O  OE1  . GLU A 1 27 ? -3.643  6.647   2.830   1.00 0.00 ? 27  GLU A OE1  10 
ATOM   10726 O  OE2  . GLU A 1 27 ? -4.882  4.834   2.902   1.00 0.00 ? 27  GLU A OE2  10 
ATOM   10727 H  H    . GLU A 1 27 ? -8.399  7.913   2.447   1.00 0.00 ? 27  GLU A H    10 
ATOM   10728 H  HA   . GLU A 1 27 ? -6.723  10.256  2.635   1.00 0.00 ? 27  GLU A HA   10 
ATOM   10729 H  HB2  . GLU A 1 27 ? -4.874  8.648   2.822   1.00 0.00 ? 27  GLU A HB2  10 
ATOM   10730 H  HB3  . GLU A 1 27 ? -6.171  8.281   3.951   1.00 0.00 ? 27  GLU A HB3  10 
ATOM   10731 H  HG2  . GLU A 1 27 ? -6.837  6.399   2.776   1.00 0.00 ? 27  GLU A HG2  10 
ATOM   10732 H  HG3  . GLU A 1 27 ? -6.048  6.926   1.291   1.00 0.00 ? 27  GLU A HG3  10 
ATOM   10733 N  N    . GLN A 1 28 ? -5.156  9.838   0.489   1.00 0.00 ? 28  GLN A N    10 
ATOM   10734 C  CA   . GLN A 1 28 ? -4.632  9.991   -0.863  1.00 0.00 ? 28  GLN A CA   10 
ATOM   10735 C  C    . GLN A 1 28 ? -4.840  8.717   -1.675  1.00 0.00 ? 28  GLN A C    10 
ATOM   10736 O  O    . GLN A 1 28 ? -4.276  7.664   -1.378  1.00 0.00 ? 28  GLN A O    10 
ATOM   10737 C  CB   . GLN A 1 28 ? -3.144  10.345  -0.820  1.00 0.00 ? 28  GLN A CB   10 
ATOM   10738 C  CG   . GLN A 1 28 ? -2.594  10.824  -2.153  1.00 0.00 ? 28  GLN A CG   10 
ATOM   10739 C  CD   . GLN A 1 28 ? -1.385  11.726  -1.995  1.00 0.00 ? 28  GLN A CD   10 
ATOM   10740 O  OE1  . GLN A 1 28 ? -0.962  12.026  -0.878  1.00 0.00 ? 28  GLN A OE1  10 
ATOM   10741 N  NE2  . GLN A 1 28 ? -0.823  12.164  -3.115  1.00 0.00 ? 28  GLN A NE2  10 
ATOM   10742 H  H    . GLN A 1 28 ? -4.586  10.069  1.251   1.00 0.00 ? 28  GLN A H    10 
ATOM   10743 H  HA   . GLN A 1 28 ? -5.170  10.798  -1.338  1.00 0.00 ? 28  GLN A HA   10 
ATOM   10744 H  HB2  . GLN A 1 28 ? -2.994  11.127  -0.090  1.00 0.00 ? 28  GLN A HB2  10 
ATOM   10745 H  HB3  . GLN A 1 28 ? -2.587  9.470   -0.519  1.00 0.00 ? 28  GLN A HB3  10 
ATOM   10746 H  HG2  . GLN A 1 28 ? -2.307  9.964   -2.740  1.00 0.00 ? 28  GLN A HG2  10 
ATOM   10747 H  HG3  . GLN A 1 28 ? -3.367  11.371  -2.672  1.00 0.00 ? 28  GLN A HG3  10 
ATOM   10748 H  HE21 . GLN A 1 28 ? -1.215  11.885  -3.970  1.00 0.00 ? 28  GLN A HE21 10 
ATOM   10749 H  HE22 . GLN A 1 28 ? -0.041  12.749  -3.043  1.00 0.00 ? 28  GLN A HE22 10 
ATOM   10750 N  N    . PRO A 1 29 ? -5.670  8.812   -2.725  1.00 0.00 ? 29  PRO A N    10 
ATOM   10751 C  CA   . PRO A 1 29 ? -5.971  7.677   -3.601  1.00 0.00 ? 29  PRO A CA   10 
ATOM   10752 C  C    . PRO A 1 29 ? -4.776  7.272   -4.458  1.00 0.00 ? 29  PRO A C    10 
ATOM   10753 O  O    . PRO A 1 29 ? -4.204  8.096   -5.173  1.00 0.00 ? 29  PRO A O    10 
ATOM   10754 C  CB   . PRO A 1 29 ? -7.108  8.201   -4.483  1.00 0.00 ? 29  PRO A CB   10 
ATOM   10755 C  CG   . PRO A 1 29 ? -6.931  9.680   -4.489  1.00 0.00 ? 29  PRO A CG   10 
ATOM   10756 C  CD   . PRO A 1 29 ? -6.377  10.037  -3.137  1.00 0.00 ? 29  PRO A CD   10 
ATOM   10757 H  HA   . PRO A 1 29 ? -6.315  6.822   -3.038  1.00 0.00 ? 29  PRO A HA   10 
ATOM   10758 H  HB2  . PRO A 1 29 ? -7.016  7.787   -5.477  1.00 0.00 ? 29  PRO A HB2  10 
ATOM   10759 H  HB3  . PRO A 1 29 ? -8.059  7.919   -4.056  1.00 0.00 ? 29  PRO A HB3  10 
ATOM   10760 H  HG2  . PRO A 1 29 ? -6.237  9.964   -5.266  1.00 0.00 ? 29  PRO A HG2  10 
ATOM   10761 H  HG3  . PRO A 1 29 ? -7.885  10.163  -4.642  1.00 0.00 ? 29  PRO A HG3  10 
ATOM   10762 H  HD2  . PRO A 1 29 ? -5.693  10.869  -3.218  1.00 0.00 ? 29  PRO A HD2  10 
ATOM   10763 H  HD3  . PRO A 1 29 ? -7.177  10.269  -2.451  1.00 0.00 ? 29  PRO A HD3  10 
ATOM   10764 N  N    . LEU A 1 30 ? -4.404  5.999   -4.381  1.00 0.00 ? 30  LEU A N    10 
ATOM   10765 C  CA   . LEU A 1 30 ? -3.276  5.484   -5.150  1.00 0.00 ? 30  LEU A CA   10 
ATOM   10766 C  C    . LEU A 1 30 ? -3.646  5.330   -6.622  1.00 0.00 ? 30  LEU A C    10 
ATOM   10767 O  O    . LEU A 1 30 ? -4.428  4.450   -6.987  1.00 0.00 ? 30  LEU A O    10 
ATOM   10768 C  CB   . LEU A 1 30 ? -2.819  4.139   -4.584  1.00 0.00 ? 30  LEU A CB   10 
ATOM   10769 C  CG   . LEU A 1 30 ? -2.048  3.233   -5.545  1.00 0.00 ? 30  LEU A CG   10 
ATOM   10770 C  CD1  . LEU A 1 30 ? -0.627  3.741   -5.734  1.00 0.00 ? 30  LEU A CD1  10 
ATOM   10771 C  CD2  . LEU A 1 30 ? -2.040  1.799   -5.035  1.00 0.00 ? 30  LEU A CD2  10 
ATOM   10772 H  H    . LEU A 1 30 ? -4.898  5.390   -3.794  1.00 0.00 ? 30  LEU A H    10 
ATOM   10773 H  HA   . LEU A 1 30 ? -2.467  6.195   -5.068  1.00 0.00 ? 30  LEU A HA   10 
ATOM   10774 H  HB2  . LEU A 1 30 ? -2.183  4.337   -3.735  1.00 0.00 ? 30  LEU A HB2  10 
ATOM   10775 H  HB3  . LEU A 1 30 ? -3.698  3.603   -4.255  1.00 0.00 ? 30  LEU A HB3  10 
ATOM   10776 H  HG   . LEU A 1 30 ? -2.537  3.244   -6.509  1.00 0.00 ? 30  LEU A HG   10 
ATOM   10777 H  HD11 . LEU A 1 30 ? -0.644  4.649   -6.318  1.00 0.00 ? 30  LEU A HD11 10 
ATOM   10778 H  HD12 . LEU A 1 30 ? -0.043  2.993   -6.248  1.00 0.00 ? 30  LEU A HD12 10 
ATOM   10779 H  HD13 . LEU A 1 30 ? -0.185  3.942   -4.769  1.00 0.00 ? 30  LEU A HD13 10 
ATOM   10780 H  HD21 . LEU A 1 30 ? -1.028  1.508   -4.797  1.00 0.00 ? 30  LEU A HD21 10 
ATOM   10781 H  HD22 . LEU A 1 30 ? -2.433  1.144   -5.799  1.00 0.00 ? 30  LEU A HD22 10 
ATOM   10782 H  HD23 . LEU A 1 30 ? -2.654  1.729   -4.150  1.00 0.00 ? 30  LEU A HD23 10 
ATOM   10783 N  N    . ILE A 1 31 ? -3.079  6.188   -7.463  1.00 0.00 ? 31  ILE A N    10 
ATOM   10784 C  CA   . ILE A 1 31 ? -3.347  6.144   -8.895  1.00 0.00 ? 31  ILE A CA   10 
ATOM   10785 C  C    . ILE A 1 31 ? -2.459  5.117   -9.589  1.00 0.00 ? 31  ILE A C    10 
ATOM   10786 O  O    . ILE A 1 31 ? -1.268  5.011   -9.296  1.00 0.00 ? 31  ILE A O    10 
ATOM   10787 C  CB   . ILE A 1 31 ? -3.129  7.521   -9.551  1.00 0.00 ? 31  ILE A CB   10 
ATOM   10788 C  CG1  . ILE A 1 31 ? -4.022  8.572   -8.889  1.00 0.00 ? 31  ILE A CG1  10 
ATOM   10789 C  CG2  . ILE A 1 31 ? -3.408  7.446   -11.044 1.00 0.00 ? 31  ILE A CG2  10 
ATOM   10790 C  CD1  . ILE A 1 31 ? -5.499  8.266   -8.997  1.00 0.00 ? 31  ILE A CD1  10 
ATOM   10791 H  H    . ILE A 1 31 ? -2.465  6.866   -7.112  1.00 0.00 ? 31  ILE A H    10 
ATOM   10792 H  HA   . ILE A 1 31 ? -4.381  5.862   -9.032  1.00 0.00 ? 31  ILE A HA   10 
ATOM   10793 H  HB   . ILE A 1 31 ? -2.095  7.799   -9.416  1.00 0.00 ? 31  ILE A HB   10 
ATOM   10794 H  HG12 . ILE A 1 31 ? -3.774  8.638   -7.841  1.00 0.00 ? 31  ILE A HG12 10 
ATOM   10795 H  HG13 . ILE A 1 31 ? -3.845  9.530   -9.357  1.00 0.00 ? 31  ILE A HG13 10 
ATOM   10796 H  HG21 . ILE A 1 31 ? -4.446  7.194   -11.204 1.00 0.00 ? 31  ILE A HG21 10 
ATOM   10797 H  HG22 . ILE A 1 31 ? -3.197  8.402   -11.498 1.00 0.00 ? 31  ILE A HG22 10 
ATOM   10798 H  HG23 . ILE A 1 31 ? -2.781  6.689   -11.491 1.00 0.00 ? 31  ILE A HG23 10 
ATOM   10799 H  HD11 . ILE A 1 31 ? -6.065  9.039   -8.499  1.00 0.00 ? 31  ILE A HD11 10 
ATOM   10800 H  HD12 . ILE A 1 31 ? -5.783  8.225   -10.038 1.00 0.00 ? 31  ILE A HD12 10 
ATOM   10801 H  HD13 . ILE A 1 31 ? -5.704  7.313   -8.530  1.00 0.00 ? 31  ILE A HD13 10 
ATOM   10802 N  N    . PHE A 1 32 ? -3.047  4.362   -10.512 1.00 0.00 ? 32  PHE A N    10 
ATOM   10803 C  CA   . PHE A 1 32 ? -2.309  3.343   -11.249 1.00 0.00 ? 32  PHE A CA   10 
ATOM   10804 C  C    . PHE A 1 32 ? -3.012  3.006   -12.561 1.00 0.00 ? 32  PHE A C    10 
ATOM   10805 O  O    . PHE A 1 32 ? -4.168  2.581   -12.568 1.00 0.00 ? 32  PHE A O    10 
ATOM   10806 C  CB   . PHE A 1 32 ? -2.155  2.080   -10.400 1.00 0.00 ? 32  PHE A CB   10 
ATOM   10807 C  CG   . PHE A 1 32 ? -1.524  0.934   -11.138 1.00 0.00 ? 32  PHE A CG   10 
ATOM   10808 C  CD1  . PHE A 1 32 ? -0.173  0.953   -11.448 1.00 0.00 ? 32  PHE A CD1  10 
ATOM   10809 C  CD2  . PHE A 1 32 ? -2.280  -0.161  -11.522 1.00 0.00 ? 32  PHE A CD2  10 
ATOM   10810 C  CE1  . PHE A 1 32 ? 0.410   -0.100  -12.128 1.00 0.00 ? 32  PHE A CE1  10 
ATOM   10811 C  CE2  . PHE A 1 32 ? -1.702  -1.217  -12.202 1.00 0.00 ? 32  PHE A CE2  10 
ATOM   10812 C  CZ   . PHE A 1 32 ? -0.355  -1.186  -12.504 1.00 0.00 ? 32  PHE A CZ   10 
ATOM   10813 H  H    . PHE A 1 32 ? -4.000  4.494   -10.701 1.00 0.00 ? 32  PHE A H    10 
ATOM   10814 H  HA   . PHE A 1 32 ? -1.330  3.739   -11.471 1.00 0.00 ? 32  PHE A HA   10 
ATOM   10815 H  HB2  . PHE A 1 32 ? -1.537  2.303   -9.544  1.00 0.00 ? 32  PHE A HB2  10 
ATOM   10816 H  HB3  . PHE A 1 32 ? -3.130  1.762   -10.062 1.00 0.00 ? 32  PHE A HB3  10 
ATOM   10817 H  HD1  . PHE A 1 32 ? 0.427   1.801   -11.153 1.00 0.00 ? 32  PHE A HD1  10 
ATOM   10818 H  HD2  . PHE A 1 32 ? -3.335  -0.186  -11.286 1.00 0.00 ? 32  PHE A HD2  10 
ATOM   10819 H  HE1  . PHE A 1 32 ? 1.464   -0.073  -12.363 1.00 0.00 ? 32  PHE A HE1  10 
ATOM   10820 H  HE2  . PHE A 1 32 ? -2.304  -2.065  -12.495 1.00 0.00 ? 32  PHE A HE2  10 
ATOM   10821 H  HZ   . PHE A 1 32 ? 0.098   -2.009  -13.036 1.00 0.00 ? 32  PHE A HZ   10 
ATOM   10822 N  N    . LYS A 1 33 ? -2.306  3.198   -13.670 1.00 0.00 ? 33  LYS A N    10 
ATOM   10823 C  CA   . LYS A 1 33 ? -2.859  2.914   -14.989 1.00 0.00 ? 33  LYS A CA   10 
ATOM   10824 C  C    . LYS A 1 33 ? -4.060  3.808   -15.279 1.00 0.00 ? 33  LYS A C    10 
ATOM   10825 O  O    . LYS A 1 33 ? -4.972  3.421   -16.009 1.00 0.00 ? 33  LYS A O    10 
ATOM   10826 C  CB   . LYS A 1 33 ? -3.270  1.443   -15.086 1.00 0.00 ? 33  LYS A CB   10 
ATOM   10827 C  CG   . LYS A 1 33 ? -2.149  0.528   -15.550 1.00 0.00 ? 33  LYS A CG   10 
ATOM   10828 C  CD   . LYS A 1 33 ? -2.571  -0.931  -15.517 1.00 0.00 ? 33  LYS A CD   10 
ATOM   10829 C  CE   . LYS A 1 33 ? -1.379  -1.860  -15.687 1.00 0.00 ? 33  LYS A CE   10 
ATOM   10830 N  NZ   . LYS A 1 33 ? -1.129  -2.186  -17.118 1.00 0.00 ? 33  LYS A NZ   10 
ATOM   10831 H  H    . LYS A 1 33 ? -1.389  3.539   -13.600 1.00 0.00 ? 33  LYS A H    10 
ATOM   10832 H  HA   . LYS A 1 33 ? -2.091  3.114   -15.721 1.00 0.00 ? 33  LYS A HA   10 
ATOM   10833 H  HB2  . LYS A 1 33 ? -3.600  1.109   -14.114 1.00 0.00 ? 33  LYS A HB2  10 
ATOM   10834 H  HB3  . LYS A 1 33 ? -4.089  1.356   -15.785 1.00 0.00 ? 33  LYS A HB3  10 
ATOM   10835 H  HG2  . LYS A 1 33 ? -1.878  0.790   -16.562 1.00 0.00 ? 33  LYS A HG2  10 
ATOM   10836 H  HG3  . LYS A 1 33 ? -1.296  0.662   -14.900 1.00 0.00 ? 33  LYS A HG3  10 
ATOM   10837 H  HD2  . LYS A 1 33 ? -3.043  -1.139  -14.568 1.00 0.00 ? 33  LYS A HD2  10 
ATOM   10838 H  HD3  . LYS A 1 33 ? -3.274  -1.112  -16.318 1.00 0.00 ? 33  LYS A HD3  10 
ATOM   10839 H  HE2  . LYS A 1 33 ? -0.503  -1.379  -15.278 1.00 0.00 ? 33  LYS A HE2  10 
ATOM   10840 H  HE3  . LYS A 1 33 ? -1.572  -2.775  -15.146 1.00 0.00 ? 33  LYS A HE3  10 
ATOM   10841 H  HZ1  . LYS A 1 33 ? -0.162  -1.912  -17.384 1.00 0.00 ? 33  LYS A HZ1  10 
ATOM   10842 H  HZ2  . LYS A 1 33 ? -1.801  -1.673  -17.724 1.00 0.00 ? 33  LYS A HZ2  10 
ATOM   10843 H  HZ3  . LYS A 1 33 ? -1.245  -3.207  -17.278 1.00 0.00 ? 33  LYS A HZ3  10 
ATOM   10844 N  N    . ASN A 1 34 ? -4.053  5.006   -14.703 1.00 0.00 ? 34  ASN A N    10 
ATOM   10845 C  CA   . ASN A 1 34 ? -5.142  5.956   -14.901 1.00 0.00 ? 34  ASN A CA   10 
ATOM   10846 C  C    . ASN A 1 34 ? -6.409  5.487   -14.190 1.00 0.00 ? 34  ASN A C    10 
ATOM   10847 O  O    . ASN A 1 34 ? -7.492  5.474   -14.775 1.00 0.00 ? 34  ASN A O    10 
ATOM   10848 C  CB   . ASN A 1 34 ? -5.421  6.140   -16.394 1.00 0.00 ? 34  ASN A CB   10 
ATOM   10849 C  CG   . ASN A 1 34 ? -6.106  7.459   -16.696 1.00 0.00 ? 34  ASN A CG   10 
ATOM   10850 O  OD1  . ASN A 1 34 ? -7.143  7.779   -16.115 1.00 0.00 ? 34  ASN A OD1  10 
ATOM   10851 N  ND2  . ASN A 1 34 ? -5.528  8.231   -17.609 1.00 0.00 ? 34  ASN A ND2  10 
ATOM   10852 H  H    . ASN A 1 34 ? -3.298  5.258   -14.131 1.00 0.00 ? 34  ASN A H    10 
ATOM   10853 H  HA   . ASN A 1 34 ? -4.837  6.902   -14.481 1.00 0.00 ? 34  ASN A HA   10 
ATOM   10854 H  HB2  . ASN A 1 34 ? -4.486  6.111   -16.935 1.00 0.00 ? 34  ASN A HB2  10 
ATOM   10855 H  HB3  . ASN A 1 34 ? -6.056  5.338   -16.738 1.00 0.00 ? 34  ASN A HB3  10 
ATOM   10856 H  HD21 . ASN A 1 34 ? -4.703  7.911   -18.031 1.00 0.00 ? 34  ASN A HD21 10 
ATOM   10857 H  HD22 . ASN A 1 34 ? -5.949  9.089   -17.823 1.00 0.00 ? 34  ASN A HD22 10 
ATOM   10858 N  N    . ASP A 1 35 ? -6.264  5.104   -12.927 1.00 0.00 ? 35  ASP A N    10 
ATOM   10859 C  CA   . ASP A 1 35 ? -7.395  4.636   -12.135 1.00 0.00 ? 35  ASP A CA   10 
ATOM   10860 C  C    . ASP A 1 35 ? -7.078  4.699   -10.644 1.00 0.00 ? 35  ASP A C    10 
ATOM   10861 O  O    . ASP A 1 35 ? -5.977  4.368   -10.204 1.00 0.00 ? 35  ASP A O    10 
ATOM   10862 C  CB   . ASP A 1 35 ? -7.766  3.206   -12.531 1.00 0.00 ? 35  ASP A CB   10 
ATOM   10863 C  CG   . ASP A 1 35 ? -7.908  3.039   -14.031 1.00 0.00 ? 35  ASP A CG   10 
ATOM   10864 O  OD1  . ASP A 1 35 ? -8.905  3.539   -14.591 1.00 0.00 ? 35  ASP A OD1  10 
ATOM   10865 O  OD2  . ASP A 1 35 ? -7.023  2.407   -14.644 1.00 0.00 ? 35  ASP A OD2  10 
ATOM   10866 H  H    . ASP A 1 35 ? -5.374  5.137   -12.516 1.00 0.00 ? 35  ASP A H    10 
ATOM   10867 H  HA   . ASP A 1 35 ? -8.234  5.285   -12.339 1.00 0.00 ? 35  ASP A HA   10 
ATOM   10868 H  HB2  . ASP A 1 35 ? -6.996  2.532   -12.184 1.00 0.00 ? 35  ASP A HB2  10 
ATOM   10869 H  HB3  . ASP A 1 35 ? -8.705  2.943   -12.066 1.00 0.00 ? 35  ASP A HB3  10 
ATOM   10870 N  N    . PRO A 1 36 ? -8.065  5.134   -9.847  1.00 0.00 ? 36  PRO A N    10 
ATOM   10871 C  CA   . PRO A 1 36 ? -7.915  5.251   -8.393  1.00 0.00 ? 36  PRO A CA   10 
ATOM   10872 C  C    . PRO A 1 36 ? -7.829  3.891   -7.708  1.00 0.00 ? 36  PRO A C    10 
ATOM   10873 O  O    . PRO A 1 36 ? -8.444  2.922   -8.152  1.00 0.00 ? 36  PRO A O    10 
ATOM   10874 C  CB   . PRO A 1 36 ? -9.187  5.987   -7.963  1.00 0.00 ? 36  PRO A CB   10 
ATOM   10875 C  CG   . PRO A 1 36 ? -10.184 5.670   -9.023  1.00 0.00 ? 36  PRO A CG   10 
ATOM   10876 C  CD   . PRO A 1 36 ? -9.403  5.546   -10.303 1.00 0.00 ? 36  PRO A CD   10 
ATOM   10877 H  HA   . PRO A 1 36 ? -7.049  5.841   -8.130  1.00 0.00 ? 36  PRO A HA   10 
ATOM   10878 H  HB2  . PRO A 1 36 ? -9.507  5.623   -6.997  1.00 0.00 ? 36  PRO A HB2  10 
ATOM   10879 H  HB3  . PRO A 1 36 ? -8.992  7.047   -7.908  1.00 0.00 ? 36  PRO A HB3  10 
ATOM   10880 H  HG2  . PRO A 1 36 ? -10.680 4.740   -8.795  1.00 0.00 ? 36  PRO A HG2  10 
ATOM   10881 H  HG3  . PRO A 1 36 ? -10.904 6.472   -9.101  1.00 0.00 ? 36  PRO A HG3  10 
ATOM   10882 H  HD2  . PRO A 1 36 ? -9.842  4.793   -10.940 1.00 0.00 ? 36  PRO A HD2  10 
ATOM   10883 H  HD3  . PRO A 1 36 ? -9.361  6.497   -10.813 1.00 0.00 ? 36  PRO A HD3  10 
ATOM   10884 N  N    . TYR A 1 37 ? -7.062  3.827   -6.625  1.00 0.00 ? 37  TYR A N    10 
ATOM   10885 C  CA   . TYR A 1 37 ? -6.895  2.585   -5.880  1.00 0.00 ? 37  TYR A CA   10 
ATOM   10886 C  C    . TYR A 1 37 ? -6.386  2.861   -4.468  1.00 0.00 ? 37  TYR A C    10 
ATOM   10887 O  O    . TYR A 1 37 ? -5.932  3.965   -4.164  1.00 0.00 ? 37  TYR A O    10 
ATOM   10888 C  CB   . TYR A 1 37 ? -5.925  1.655   -6.610  1.00 0.00 ? 37  TYR A CB   10 
ATOM   10889 C  CG   . TYR A 1 37 ? -6.402  1.241   -7.984  1.00 0.00 ? 37  TYR A CG   10 
ATOM   10890 C  CD1  . TYR A 1 37 ? -7.563  0.494   -8.143  1.00 0.00 ? 37  TYR A CD1  10 
ATOM   10891 C  CD2  . TYR A 1 37 ? -5.692  1.599   -9.124  1.00 0.00 ? 37  TYR A CD2  10 
ATOM   10892 C  CE1  . TYR A 1 37 ? -8.001  0.114   -9.397  1.00 0.00 ? 37  TYR A CE1  10 
ATOM   10893 C  CE2  . TYR A 1 37 ? -6.124  1.224   -10.382 1.00 0.00 ? 37  TYR A CE2  10 
ATOM   10894 C  CZ   . TYR A 1 37 ? -7.279  0.481   -10.513 1.00 0.00 ? 37  TYR A CZ   10 
ATOM   10895 O  OH   . TYR A 1 37 ? -7.714  0.105   -11.763 1.00 0.00 ? 37  TYR A OH   10 
ATOM   10896 H  H    . TYR A 1 37 ? -6.597  4.634   -6.320  1.00 0.00 ? 37  TYR A H    10 
ATOM   10897 H  HA   . TYR A 1 37 ? -7.860  2.104   -5.815  1.00 0.00 ? 37  TYR A HA   10 
ATOM   10898 H  HB2  . TYR A 1 37 ? -4.976  2.154   -6.726  1.00 0.00 ? 37  TYR A HB2  10 
ATOM   10899 H  HB3  . TYR A 1 37 ? -5.786  0.758   -6.024  1.00 0.00 ? 37  TYR A HB3  10 
ATOM   10900 H  HD1  . TYR A 1 37 ? -8.126  0.209   -7.267  1.00 0.00 ? 37  TYR A HD1  10 
ATOM   10901 H  HD2  . TYR A 1 37 ? -4.788  2.180   -9.019  1.00 0.00 ? 37  TYR A HD2  10 
ATOM   10902 H  HE1  . TYR A 1 37 ? -8.906  -0.467  -9.499  1.00 0.00 ? 37  TYR A HE1  10 
ATOM   10903 H  HE2  . TYR A 1 37 ? -5.559  1.511   -11.256 1.00 0.00 ? 37  TYR A HE2  10 
ATOM   10904 H  HH   . TYR A 1 37 ? -7.040  -0.431  -12.188 1.00 0.00 ? 37  TYR A HH   10 
ATOM   10905 N  N    . HIS A 1 38 ? -6.465  1.850   -3.609  1.00 0.00 ? 38  HIS A N    10 
ATOM   10906 C  CA   . HIS A 1 38 ? -6.011  1.982   -2.229  1.00 0.00 ? 38  HIS A CA   10 
ATOM   10907 C  C    . HIS A 1 38 ? -4.557  1.541   -2.091  1.00 0.00 ? 38  HIS A C    10 
ATOM   10908 O  O    . HIS A 1 38 ? -4.171  0.450   -2.511  1.00 0.00 ? 38  HIS A O    10 
ATOM   10909 C  CB   . HIS A 1 38 ? -6.898  1.155   -1.298  1.00 0.00 ? 38  HIS A CB   10 
ATOM   10910 C  CG   . HIS A 1 38 ? -8.156  1.857   -0.889  1.00 0.00 ? 38  HIS A CG   10 
ATOM   10911 N  ND1  . HIS A 1 38 ? -9.414  1.413   -1.239  1.00 0.00 ? 38  HIS A ND1  10 
ATOM   10912 C  CD2  . HIS A 1 38 ? -8.345  2.976   -0.152  1.00 0.00 ? 38  HIS A CD2  10 
ATOM   10913 C  CE1  . HIS A 1 38 ? -10.322 2.230   -0.738  1.00 0.00 ? 38  HIS A CE1  10 
ATOM   10914 N  NE2  . HIS A 1 38 ? -9.700  3.188   -0.073  1.00 0.00 ? 38  HIS A NE2  10 
ATOM   10915 H  H    . HIS A 1 38 ? -6.836  0.995   -3.911  1.00 0.00 ? 38  HIS A H    10 
ATOM   10916 H  HA   . HIS A 1 38 ? -6.087  3.022   -1.954  1.00 0.00 ? 38  HIS A HA   10 
ATOM   10917 H  HB2  . HIS A 1 38 ? -7.177  0.238   -1.797  1.00 0.00 ? 38  HIS A HB2  10 
ATOM   10918 H  HB3  . HIS A 1 38 ? -6.343  0.916   -0.402  1.00 0.00 ? 38  HIS A HB3  10 
ATOM   10919 H  HD2  . HIS A 1 38 ? -7.574  3.591   0.291   1.00 0.00 ? 38  HIS A HD2  10 
ATOM   10920 H  HE1  . HIS A 1 38 ? -11.392 2.133   -0.851  1.00 0.00 ? 38  HIS A HE1  10 
ATOM   10921 H  HE2  . HIS A 1 38 ? -10.133 3.971   0.324   1.00 0.00 ? 38  HIS A HE2  10 
ATOM   10922 N  N    . PRO A 1 39 ? -3.730  2.408   -1.488  1.00 0.00 ? 39  PRO A N    10 
ATOM   10923 C  CA   . PRO A 1 39 ? -2.306  2.131   -1.280  1.00 0.00 ? 39  PRO A CA   10 
ATOM   10924 C  C    . PRO A 1 39 ? -2.074  1.037   -0.243  1.00 0.00 ? 39  PRO A C    10 
ATOM   10925 O  O    . PRO A 1 39 ? -0.933  0.695   0.067   1.00 0.00 ? 39  PRO A O    10 
ATOM   10926 C  CB   . PRO A 1 39 ? -1.753  3.468   -0.781  1.00 0.00 ? 39  PRO A CB   10 
ATOM   10927 C  CG   . PRO A 1 39 ? -2.922  4.154   -0.164  1.00 0.00 ? 39  PRO A CG   10 
ATOM   10928 C  CD   . PRO A 1 39 ? -4.123  3.727   -0.962  1.00 0.00 ? 39  PRO A CD   10 
ATOM   10929 H  HA   . PRO A 1 39 ? -1.816  1.859   -2.204  1.00 0.00 ? 39  PRO A HA   10 
ATOM   10930 H  HB2  . PRO A 1 39 ? -0.971  3.288   -0.056  1.00 0.00 ? 39  PRO A HB2  10 
ATOM   10931 H  HB3  . PRO A 1 39 ? -1.358  4.031   -1.613  1.00 0.00 ? 39  PRO A HB3  10 
ATOM   10932 H  HG2  . PRO A 1 39 ? -3.027  3.847   0.866   1.00 0.00 ? 39  PRO A HG2  10 
ATOM   10933 H  HG3  . PRO A 1 39 ? -2.793  5.225   -0.225  1.00 0.00 ? 39  PRO A HG3  10 
ATOM   10934 H  HD2  . PRO A 1 39 ? -4.990  3.645   -0.324  1.00 0.00 ? 39  PRO A HD2  10 
ATOM   10935 H  HD3  . PRO A 1 39 ? -4.308  4.423   -1.767  1.00 0.00 ? 39  PRO A HD3  10 
ATOM   10936 N  N    . ASP A 1 40 ? -3.162  0.492   0.289   1.00 0.00 ? 40  ASP A N    10 
ATOM   10937 C  CA   . ASP A 1 40 ? -3.077  -0.564  1.290   1.00 0.00 ? 40  ASP A CA   10 
ATOM   10938 C  C    . ASP A 1 40 ? -3.412  -1.921  0.679   1.00 0.00 ? 40  ASP A C    10 
ATOM   10939 O  O    . ASP A 1 40 ? -3.248  -2.960  1.319   1.00 0.00 ? 40  ASP A O    10 
ATOM   10940 C  CB   . ASP A 1 40 ? -4.022  -0.269  2.456   1.00 0.00 ? 40  ASP A CB   10 
ATOM   10941 C  CG   . ASP A 1 40 ? -5.326  0.355   2.000   1.00 0.00 ? 40  ASP A CG   10 
ATOM   10942 O  OD1  . ASP A 1 40 ? -5.336  1.572   1.720   1.00 0.00 ? 40  ASP A OD1  10 
ATOM   10943 O  OD2  . ASP A 1 40 ? -6.337  -0.374  1.923   1.00 0.00 ? 40  ASP A OD2  10 
ATOM   10944 H  H    . ASP A 1 40 ? -4.044  0.808   0.000   1.00 0.00 ? 40  ASP A H    10 
ATOM   10945 H  HA   . ASP A 1 40 ? -2.062  -0.590  1.659   1.00 0.00 ? 40  ASP A HA   10 
ATOM   10946 H  HB2  . ASP A 1 40 ? -4.246  -1.191  2.972   1.00 0.00 ? 40  ASP A HB2  10 
ATOM   10947 H  HB3  . ASP A 1 40 ? -3.537  0.412   3.140   1.00 0.00 ? 40  ASP A HB3  10 
ATOM   10948 N  N    . HIS A 1 41 ? -3.884  -1.904  -0.564  1.00 0.00 ? 41  HIS A N    10 
ATOM   10949 C  CA   . HIS A 1 41 ? -4.243  -3.134  -1.262  1.00 0.00 ? 41  HIS A CA   10 
ATOM   10950 C  C    . HIS A 1 41 ? -3.000  -3.836  -1.800  1.00 0.00 ? 41  HIS A C    10 
ATOM   10951 O  O    . HIS A 1 41 ? -2.848  -5.049  -1.653  1.00 0.00 ? 41  HIS A O    10 
ATOM   10952 C  CB   . HIS A 1 41 ? -5.209  -2.831  -2.408  1.00 0.00 ? 41  HIS A CB   10 
ATOM   10953 C  CG   . HIS A 1 41 ? -6.611  -2.565  -1.955  1.00 0.00 ? 41  HIS A CG   10 
ATOM   10954 N  ND1  . HIS A 1 41 ? -7.095  -2.967  -0.728  1.00 0.00 ? 41  HIS A ND1  10 
ATOM   10955 C  CD2  . HIS A 1 41 ? -7.636  -1.932  -2.573  1.00 0.00 ? 41  HIS A CD2  10 
ATOM   10956 C  CE1  . HIS A 1 41 ? -8.357  -2.594  -0.611  1.00 0.00 ? 41  HIS A CE1  10 
ATOM   10957 N  NE2  . HIS A 1 41 ? -8.709  -1.963  -1.717  1.00 0.00 ? 41  HIS A NE2  10 
ATOM   10958 H  H    . HIS A 1 41 ? -3.993  -1.045  -1.022  1.00 0.00 ? 41  HIS A H    10 
ATOM   10959 H  HA   . HIS A 1 41 ? -4.732  -3.786  -0.554  1.00 0.00 ? 41  HIS A HA   10 
ATOM   10960 H  HB2  . HIS A 1 41 ? -4.862  -1.958  -2.941  1.00 0.00 ? 41  HIS A HB2  10 
ATOM   10961 H  HB3  . HIS A 1 41 ? -5.231  -3.674  -3.083  1.00 0.00 ? 41  HIS A HB3  10 
ATOM   10962 H  HD1  . HIS A 1 41 ? -6.589  -3.454  -0.045  1.00 0.00 ? 41  HIS A HD1  10 
ATOM   10963 H  HD2  . HIS A 1 41 ? -7.614  -1.485  -3.557  1.00 0.00 ? 41  HIS A HD2  10 
ATOM   10964 H  HE1  . HIS A 1 41 ? -8.993  -2.773  0.243   1.00 0.00 ? 41  HIS A HE1  10 
ATOM   10965 N  N    . PHE A 1 42 ? -2.115  -3.066  -2.423  1.00 0.00 ? 42  PHE A N    10 
ATOM   10966 C  CA   . PHE A 1 42 ? -0.886  -3.615  -2.985  1.00 0.00 ? 42  PHE A CA   10 
ATOM   10967 C  C    . PHE A 1 42 ? 0.281   -3.437  -2.018  1.00 0.00 ? 42  PHE A C    10 
ATOM   10968 O  O    . PHE A 1 42 ? 0.180   -2.703  -1.036  1.00 0.00 ? 42  PHE A O    10 
ATOM   10969 C  CB   . PHE A 1 42 ? -0.564  -2.939  -4.320  1.00 0.00 ? 42  PHE A CB   10 
ATOM   10970 C  CG   . PHE A 1 42 ? -1.776  -2.680  -5.168  1.00 0.00 ? 42  PHE A CG   10 
ATOM   10971 C  CD1  . PHE A 1 42 ? -2.291  -3.674  -5.986  1.00 0.00 ? 42  PHE A CD1  10 
ATOM   10972 C  CD2  . PHE A 1 42 ? -2.401  -1.444  -5.149  1.00 0.00 ? 42  PHE A CD2  10 
ATOM   10973 C  CE1  . PHE A 1 42 ? -3.406  -3.439  -6.768  1.00 0.00 ? 42  PHE A CE1  10 
ATOM   10974 C  CE2  . PHE A 1 42 ? -3.517  -1.204  -5.928  1.00 0.00 ? 42  PHE A CE2  10 
ATOM   10975 C  CZ   . PHE A 1 42 ? -4.019  -2.202  -6.740  1.00 0.00 ? 42  PHE A CZ   10 
ATOM   10976 H  H    . PHE A 1 42 ? -2.293  -2.106  -2.509  1.00 0.00 ? 42  PHE A H    10 
ATOM   10977 H  HA   . PHE A 1 42 ? -1.041  -4.669  -3.153  1.00 0.00 ? 42  PHE A HA   10 
ATOM   10978 H  HB2  . PHE A 1 42 ? -0.085  -1.991  -4.129  1.00 0.00 ? 42  PHE A HB2  10 
ATOM   10979 H  HB3  . PHE A 1 42 ? 0.107   -3.570  -4.882  1.00 0.00 ? 42  PHE A HB3  10 
ATOM   10980 H  HD1  . PHE A 1 42 ? -1.811  -4.642  -6.009  1.00 0.00 ? 42  PHE A HD1  10 
ATOM   10981 H  HD2  . PHE A 1 42 ? -2.009  -0.662  -4.516  1.00 0.00 ? 42  PHE A HD2  10 
ATOM   10982 H  HE1  . PHE A 1 42 ? -3.796  -4.222  -7.401  1.00 0.00 ? 42  PHE A HE1  10 
ATOM   10983 H  HE2  . PHE A 1 42 ? -3.994  -0.235  -5.904  1.00 0.00 ? 42  PHE A HE2  10 
ATOM   10984 H  HZ   . PHE A 1 42 ? -4.891  -2.017  -7.349  1.00 0.00 ? 42  PHE A HZ   10 
ATOM   10985 N  N    . ASN A 1 43 ? 1.387   -4.115  -2.304  1.00 0.00 ? 43  ASN A N    10 
ATOM   10986 C  CA   . ASN A 1 43 ? 2.573   -4.034  -1.460  1.00 0.00 ? 43  ASN A CA   10 
ATOM   10987 C  C    . ASN A 1 43 ? 3.841   -3.972  -2.306  1.00 0.00 ? 43  ASN A C    10 
ATOM   10988 O  O    . ASN A 1 43 ? 3.883   -4.497  -3.420  1.00 0.00 ? 43  ASN A O    10 
ATOM   10989 C  CB   . ASN A 1 43 ? 2.636   -5.236  -0.515  1.00 0.00 ? 43  ASN A CB   10 
ATOM   10990 C  CG   . ASN A 1 43 ? 1.561   -5.189  0.553   1.00 0.00 ? 43  ASN A CG   10 
ATOM   10991 O  OD1  . ASN A 1 43 ? 0.377   -5.038  0.251   1.00 0.00 ? 43  ASN A OD1  10 
ATOM   10992 N  ND2  . ASN A 1 43 ? 1.969   -5.319  1.810   1.00 0.00 ? 43  ASN A ND2  10 
ATOM   10993 H  H    . ASN A 1 43 ? 1.407   -4.685  -3.102  1.00 0.00 ? 43  ASN A H    10 
ATOM   10994 H  HA   . ASN A 1 43 ? 2.501   -3.131  -0.873  1.00 0.00 ? 43  ASN A HA   10 
ATOM   10995 H  HB2  . ASN A 1 43 ? 2.507   -6.143  -1.088  1.00 0.00 ? 43  ASN A HB2  10 
ATOM   10996 H  HB3  . ASN A 1 43 ? 3.600   -5.256  -0.030  1.00 0.00 ? 43  ASN A HB3  10 
ATOM   10997 H  HD21 . ASN A 1 43 ? 2.928   -5.436  1.975   1.00 0.00 ? 43  ASN A HD21 10 
ATOM   10998 H  HD22 . ASN A 1 43 ? 1.295   -5.293  2.520   1.00 0.00 ? 43  ASN A HD22 10 
ATOM   10999 N  N    . CYS A 1 44 ? 4.872   -3.328  -1.771  1.00 0.00 ? 44  CYS A N    10 
ATOM   11000 C  CA   . CYS A 1 44 ? 6.142   -3.196  -2.476  1.00 0.00 ? 44  CYS A CA   10 
ATOM   11001 C  C    . CYS A 1 44 ? 6.624   -4.551  -2.986  1.00 0.00 ? 44  CYS A C    10 
ATOM   11002 O  O    . CYS A 1 44 ? 6.197   -5.597  -2.498  1.00 0.00 ? 44  CYS A O    10 
ATOM   11003 C  CB   . CYS A 1 44 ? 7.198   -2.579  -1.557  1.00 0.00 ? 44  CYS A CB   10 
ATOM   11004 S  SG   . CYS A 1 44 ? 8.701   -2.021  -2.422  1.00 0.00 ? 44  CYS A SG   10 
ATOM   11005 H  H    . CYS A 1 44 ? 4.778   -2.930  -0.880  1.00 0.00 ? 44  CYS A H    10 
ATOM   11006 H  HA   . CYS A 1 44 ? 5.986   -2.542  -3.321  1.00 0.00 ? 44  CYS A HA   10 
ATOM   11007 H  HB2  . CYS A 1 44 ? 6.771   -1.723  -1.056  1.00 0.00 ? 44  CYS A HB2  10 
ATOM   11008 H  HB3  . CYS A 1 44 ? 7.494   -3.311  -0.820  1.00 0.00 ? 44  CYS A HB3  10 
ATOM   11009 N  N    . ALA A 1 45 ? 7.516   -4.524  -3.970  1.00 0.00 ? 45  ALA A N    10 
ATOM   11010 C  CA   . ALA A 1 45 ? 8.058   -5.749  -4.544  1.00 0.00 ? 45  ALA A CA   10 
ATOM   11011 C  C    . ALA A 1 45 ? 9.459   -6.032  -4.011  1.00 0.00 ? 45  ALA A C    10 
ATOM   11012 O  O    . ALA A 1 45 ? 9.906   -7.178  -3.994  1.00 0.00 ? 45  ALA A O    10 
ATOM   11013 C  CB   . ALA A 1 45 ? 8.079   -5.656  -6.063  1.00 0.00 ? 45  ALA A CB   10 
ATOM   11014 H  H    . ALA A 1 45 ? 7.818   -3.659  -4.317  1.00 0.00 ? 45  ALA A H    10 
ATOM   11015 H  HA   . ALA A 1 45 ? 7.406   -6.565  -4.267  1.00 0.00 ? 45  ALA A HA   10 
ATOM   11016 H  HB1  . ALA A 1 45 ? 7.906   -6.636  -6.485  1.00 0.00 ? 45  ALA A HB1  10 
ATOM   11017 H  HB2  . ALA A 1 45 ? 7.304   -4.980  -6.392  1.00 0.00 ? 45  ALA A HB2  10 
ATOM   11018 H  HB3  . ALA A 1 45 ? 9.040   -5.288  -6.388  1.00 0.00 ? 45  ALA A HB3  10 
ATOM   11019 N  N    . ASN A 1 46 ? 10.146  -4.981  -3.577  1.00 0.00 ? 46  ASN A N    10 
ATOM   11020 C  CA   . ASN A 1 46 ? 11.496  -5.117  -3.045  1.00 0.00 ? 46  ASN A CA   10 
ATOM   11021 C  C    . ASN A 1 46 ? 11.464  -5.585  -1.593  1.00 0.00 ? 46  ASN A C    10 
ATOM   11022 O  O    . ASN A 1 46 ? 11.921  -6.683  -1.273  1.00 0.00 ? 46  ASN A O    10 
ATOM   11023 C  CB   . ASN A 1 46 ? 12.244  -3.786  -3.146  1.00 0.00 ? 46  ASN A CB   10 
ATOM   11024 C  CG   . ASN A 1 46 ? 13.732  -3.938  -2.896  1.00 0.00 ? 46  ASN A CG   10 
ATOM   11025 O  OD1  . ASN A 1 46 ? 14.459  -4.486  -3.725  1.00 0.00 ? 46  ASN A OD1  10 
ATOM   11026 N  ND2  . ASN A 1 46 ? 14.192  -3.452  -1.749  1.00 0.00 ? 46  ASN A ND2  10 
ATOM   11027 H  H    . ASN A 1 46 ? 9.735   -4.092  -3.617  1.00 0.00 ? 46  ASN A H    10 
ATOM   11028 H  HA   . ASN A 1 46 ? 12.013  -5.856  -3.638  1.00 0.00 ? 46  ASN A HA   10 
ATOM   11029 H  HB2  . ASN A 1 46 ? 12.105  -3.377  -4.136  1.00 0.00 ? 46  ASN A HB2  10 
ATOM   11030 H  HB3  . ASN A 1 46 ? 11.843  -3.098  -2.417  1.00 0.00 ? 46  ASN A HB3  10 
ATOM   11031 H  HD21 . ASN A 1 46 ? 13.554  -3.028  -1.137  1.00 0.00 ? 46  ASN A HD21 10 
ATOM   11032 H  HD22 . ASN A 1 46 ? 15.150  -3.536  -1.562  1.00 0.00 ? 46  ASN A HD22 10 
ATOM   11033 N  N    . CYS A 1 47 ? 10.920  -4.746  -0.718  1.00 0.00 ? 47  CYS A N    10 
ATOM   11034 C  CA   . CYS A 1 47 ? 10.827  -5.072  0.700   1.00 0.00 ? 47  CYS A CA   10 
ATOM   11035 C  C    . CYS A 1 47 ? 9.578   -5.900  0.986   1.00 0.00 ? 47  CYS A C    10 
ATOM   11036 O  O    . CYS A 1 47 ? 9.602   -6.816  1.807   1.00 0.00 ? 47  CYS A O    10 
ATOM   11037 C  CB   . CYS A 1 47 ? 10.807  -3.793  1.538   1.00 0.00 ? 47  CYS A CB   10 
ATOM   11038 S  SG   . CYS A 1 47 ? 9.375   -2.714  1.215   1.00 0.00 ? 47  CYS A SG   10 
ATOM   11039 H  H    . CYS A 1 47 ? 10.573  -3.884  -1.034  1.00 0.00 ? 47  CYS A H    10 
ATOM   11040 H  HA   . CYS A 1 47 ? 11.698  -5.652  0.965   1.00 0.00 ? 47  CYS A HA   10 
ATOM   11041 H  HB2  . CYS A 1 47 ? 10.788  -4.058  2.586   1.00 0.00 ? 47  CYS A HB2  10 
ATOM   11042 H  HB3  . CYS A 1 47 ? 11.702  -3.223  1.334   1.00 0.00 ? 47  CYS A HB3  10 
ATOM   11043 N  N    . GLY A 1 48 ? 8.486   -5.572  0.302   1.00 0.00 ? 48  GLY A N    10 
ATOM   11044 C  CA   . GLY A 1 48 ? 7.243   -6.295  0.496   1.00 0.00 ? 48  GLY A CA   10 
ATOM   11045 C  C    . GLY A 1 48 ? 6.411   -5.723  1.627   1.00 0.00 ? 48  GLY A C    10 
ATOM   11046 O  O    . GLY A 1 48 ? 5.859   -6.466  2.438   1.00 0.00 ? 48  GLY A O    10 
ATOM   11047 H  H    . GLY A 1 48 ? 8.526   -4.832  -0.341  1.00 0.00 ? 48  GLY A H    10 
ATOM   11048 H  HA2  . GLY A 1 48 ? 6.668   -6.252  -0.417  1.00 0.00 ? 48  GLY A HA2  10 
ATOM   11049 H  HA3  . GLY A 1 48 ? 7.471   -7.327  0.718   1.00 0.00 ? 48  GLY A HA3  10 
ATOM   11050 N  N    . LYS A 1 49 ? 6.322   -4.399  1.684   1.00 0.00 ? 49  LYS A N    10 
ATOM   11051 C  CA   . LYS A 1 49 ? 5.553   -3.727  2.724   1.00 0.00 ? 49  LYS A CA   10 
ATOM   11052 C  C    . LYS A 1 49 ? 4.346   -3.007  2.129   1.00 0.00 ? 49  LYS A C    10 
ATOM   11053 O  O    . LYS A 1 49 ? 4.229   -2.877  0.911   1.00 0.00 ? 49  LYS A O    10 
ATOM   11054 C  CB   . LYS A 1 49 ? 6.436   -2.729  3.476   1.00 0.00 ? 49  LYS A CB   10 
ATOM   11055 C  CG   . LYS A 1 49 ? 6.876   -1.547  2.629   1.00 0.00 ? 49  LYS A CG   10 
ATOM   11056 C  CD   . LYS A 1 49 ? 5.888   -0.396  2.721   1.00 0.00 ? 49  LYS A CD   10 
ATOM   11057 C  CE   . LYS A 1 49 ? 6.131   0.448   3.964   1.00 0.00 ? 49  LYS A CE   10 
ATOM   11058 N  NZ   . LYS A 1 49 ? 7.161   1.497   3.729   1.00 0.00 ? 49  LYS A NZ   10 
ATOM   11059 H  H    . LYS A 1 49 ? 6.786   -3.860  1.008   1.00 0.00 ? 49  LYS A H    10 
ATOM   11060 H  HA   . LYS A 1 49 ? 5.203   -4.478  3.416   1.00 0.00 ? 49  LYS A HA   10 
ATOM   11061 H  HB2  . LYS A 1 49 ? 5.887   -2.351  4.326   1.00 0.00 ? 49  LYS A HB2  10 
ATOM   11062 H  HB3  . LYS A 1 49 ? 7.319   -3.242  3.827   1.00 0.00 ? 49  LYS A HB3  10 
ATOM   11063 H  HG2  . LYS A 1 49 ? 7.841   -1.208  2.974   1.00 0.00 ? 49  LYS A HG2  10 
ATOM   11064 H  HG3  . LYS A 1 49 ? 6.951   -1.863  1.598   1.00 0.00 ? 49  LYS A HG3  10 
ATOM   11065 H  HD2  . LYS A 1 49 ? 5.996   0.230   1.848   1.00 0.00 ? 49  LYS A HD2  10 
ATOM   11066 H  HD3  . LYS A 1 49 ? 4.885   -0.796  2.759   1.00 0.00 ? 49  LYS A HD3  10 
ATOM   11067 H  HE2  . LYS A 1 49 ? 5.204   0.923   4.247   1.00 0.00 ? 49  LYS A HE2  10 
ATOM   11068 H  HE3  . LYS A 1 49 ? 6.463   -0.199  4.762   1.00 0.00 ? 49  LYS A HE3  10 
ATOM   11069 H  HZ1  . LYS A 1 49 ? 7.959   1.366   4.383   1.00 0.00 ? 49  LYS A HZ1  10 
ATOM   11070 H  HZ2  . LYS A 1 49 ? 6.752   2.440   3.884   1.00 0.00 ? 49  LYS A HZ2  10 
ATOM   11071 H  HZ3  . LYS A 1 49 ? 7.513   1.440   2.752   1.00 0.00 ? 49  LYS A HZ3  10 
ATOM   11072 N  N    . GLU A 1 50 ? 3.454   -2.541  2.997   1.00 0.00 ? 50  GLU A N    10 
ATOM   11073 C  CA   . GLU A 1 50 ? 2.257   -1.834  2.555   1.00 0.00 ? 50  GLU A CA   10 
ATOM   11074 C  C    . GLU A 1 50 ? 2.625   -0.557  1.805   1.00 0.00 ? 50  GLU A C    10 
ATOM   11075 O  O    . GLU A 1 50 ? 3.074   0.421   2.404   1.00 0.00 ? 50  GLU A O    10 
ATOM   11076 C  CB   . GLU A 1 50 ? 1.366   -1.497  3.753   1.00 0.00 ? 50  GLU A CB   10 
ATOM   11077 C  CG   . GLU A 1 50 ? -0.079  -1.219  3.377   1.00 0.00 ? 50  GLU A CG   10 
ATOM   11078 C  CD   . GLU A 1 50 ? -1.036  -1.449  4.530   1.00 0.00 ? 50  GLU A CD   10 
ATOM   11079 O  OE1  . GLU A 1 50 ? -0.582  -1.426  5.693   1.00 0.00 ? 50  GLU A OE1  10 
ATOM   11080 O  OE2  . GLU A 1 50 ? -2.241  -1.652  4.270   1.00 0.00 ? 50  GLU A OE2  10 
ATOM   11081 H  H    . GLU A 1 50 ? 3.603   -2.677  3.956   1.00 0.00 ? 50  GLU A H    10 
ATOM   11082 H  HA   . GLU A 1 50 ? 1.714   -2.486  1.887   1.00 0.00 ? 50  GLU A HA   10 
ATOM   11083 H  HB2  . GLU A 1 50 ? 1.385   -2.325  4.445   1.00 0.00 ? 50  GLU A HB2  10 
ATOM   11084 H  HB3  . GLU A 1 50 ? 1.763   -0.620  4.244   1.00 0.00 ? 50  GLU A HB3  10 
ATOM   11085 H  HG2  . GLU A 1 50 ? -0.165  -0.191  3.058   1.00 0.00 ? 50  GLU A HG2  10 
ATOM   11086 H  HG3  . GLU A 1 50 ? -0.358  -1.871  2.562   1.00 0.00 ? 50  GLU A HG3  10 
ATOM   11087 N  N    . LEU A 1 51 ? 2.434   -0.575  0.491   1.00 0.00 ? 51  LEU A N    10 
ATOM   11088 C  CA   . LEU A 1 51 ? 2.746   0.581   -0.343  1.00 0.00 ? 51  LEU A CA   10 
ATOM   11089 C  C    . LEU A 1 51 ? 1.985   1.815   0.130   1.00 0.00 ? 51  LEU A C    10 
ATOM   11090 O  O    . LEU A 1 51 ? 1.181   1.744   1.061   1.00 0.00 ? 51  LEU A O    10 
ATOM   11091 C  CB   . LEU A 1 51 ? 2.404   0.287   -1.805  1.00 0.00 ? 51  LEU A CB   10 
ATOM   11092 C  CG   . LEU A 1 51 ? 3.356   -0.658  -2.539  1.00 0.00 ? 51  LEU A CG   10 
ATOM   11093 C  CD1  . LEU A 1 51 ? 2.779   -1.054  -3.890  1.00 0.00 ? 51  LEU A CD1  10 
ATOM   11094 C  CD2  . LEU A 1 51 ? 4.723   -0.011  -2.710  1.00 0.00 ? 51  LEU A CD2  10 
ATOM   11095 H  H    . LEU A 1 51 ? 2.074   -1.383  0.070   1.00 0.00 ? 51  LEU A H    10 
ATOM   11096 H  HA   . LEU A 1 51 ? 3.805   0.773   -0.261  1.00 0.00 ? 51  LEU A HA   10 
ATOM   11097 H  HB2  . LEU A 1 51 ? 1.418   -0.150  -1.833  1.00 0.00 ? 51  LEU A HB2  10 
ATOM   11098 H  HB3  . LEU A 1 51 ? 2.395   1.228   -2.337  1.00 0.00 ? 51  LEU A HB3  10 
ATOM   11099 H  HG   . LEU A 1 51 ? 3.482   -1.559  -1.954  1.00 0.00 ? 51  LEU A HG   10 
ATOM   11100 H  HD11 . LEU A 1 51 ? 3.248   -0.469  -4.666  1.00 0.00 ? 51  LEU A HD11 10 
ATOM   11101 H  HD12 . LEU A 1 51 ? 1.715   -0.871  -3.893  1.00 0.00 ? 51  LEU A HD12 10 
ATOM   11102 H  HD13 . LEU A 1 51 ? 2.964   -2.103  -4.067  1.00 0.00 ? 51  LEU A HD13 10 
ATOM   11103 H  HD21 . LEU A 1 51 ? 4.818   0.368   -3.717  1.00 0.00 ? 51  LEU A HD21 10 
ATOM   11104 H  HD22 . LEU A 1 51 ? 5.494   -0.747  -2.529  1.00 0.00 ? 51  LEU A HD22 10 
ATOM   11105 H  HD23 . LEU A 1 51 ? 4.827   0.801   -2.007  1.00 0.00 ? 51  LEU A HD23 10 
ATOM   11106 N  N    . THR A 1 52 ? 2.241   2.947   -0.518  1.00 0.00 ? 52  THR A N    10 
ATOM   11107 C  CA   . THR A 1 52 ? 1.580   4.197   -0.165  1.00 0.00 ? 52  THR A CA   10 
ATOM   11108 C  C    . THR A 1 52 ? 0.860   4.797   -1.367  1.00 0.00 ? 52  THR A C    10 
ATOM   11109 O  O    . THR A 1 52 ? 0.998   4.314   -2.490  1.00 0.00 ? 52  THR A O    10 
ATOM   11110 C  CB   . THR A 1 52 ? 2.584   5.228   0.385   1.00 0.00 ? 52  THR A CB   10 
ATOM   11111 O  OG1  . THR A 1 52 ? 3.621   5.462   -0.575  1.00 0.00 ? 52  THR A OG1  10 
ATOM   11112 C  CG2  . THR A 1 52 ? 3.195   4.744   1.692   1.00 0.00 ? 52  THR A CG2  10 
ATOM   11113 H  H    . THR A 1 52 ? 2.891   2.940   -1.252  1.00 0.00 ? 52  THR A H    10 
ATOM   11114 H  HA   . THR A 1 52 ? 0.855   3.984   0.607   1.00 0.00 ? 52  THR A HA   10 
ATOM   11115 H  HB   . THR A 1 52 ? 2.060   6.154   0.570   1.00 0.00 ? 52  THR A HB   10 
ATOM   11116 H  HG1  . THR A 1 52 ? 4.440   5.665   -0.117  1.00 0.00 ? 52  THR A HG1  10 
ATOM   11117 H  HG21 . THR A 1 52 ? 4.106   5.290   1.886   1.00 0.00 ? 52  THR A HG21 10 
ATOM   11118 H  HG22 . THR A 1 52 ? 3.414   3.690   1.618   1.00 0.00 ? 52  THR A HG22 10 
ATOM   11119 H  HG23 . THR A 1 52 ? 2.496   4.911   2.498   1.00 0.00 ? 52  THR A HG23 10 
ATOM   11120 N  N    . ALA A 1 53 ? 0.091   5.854   -1.124  1.00 0.00 ? 53  ALA A N    10 
ATOM   11121 C  CA   . ALA A 1 53 ? -0.648  6.522   -2.188  1.00 0.00 ? 53  ALA A CA   10 
ATOM   11122 C  C    . ALA A 1 53 ? 0.299   7.110   -3.229  1.00 0.00 ? 53  ALA A C    10 
ATOM   11123 O  O    . ALA A 1 53 ? -0.078  7.304   -4.385  1.00 0.00 ? 53  ALA A O    10 
ATOM   11124 C  CB   . ALA A 1 53 ? -1.540  7.610   -1.608  1.00 0.00 ? 53  ALA A CB   10 
ATOM   11125 H  H    . ALA A 1 53 ? 0.021   6.193   -0.208  1.00 0.00 ? 53  ALA A H    10 
ATOM   11126 H  HA   . ALA A 1 53 ? -1.281  5.788   -2.666  1.00 0.00 ? 53  ALA A HA   10 
ATOM   11127 H  HB1  . ALA A 1 53 ? -2.144  7.194   -0.814  1.00 0.00 ? 53  ALA A HB1  10 
ATOM   11128 H  HB2  . ALA A 1 53 ? -0.927  8.406   -1.215  1.00 0.00 ? 53  ALA A HB2  10 
ATOM   11129 H  HB3  . ALA A 1 53 ? -2.183  7.998   -2.383  1.00 0.00 ? 53  ALA A HB3  10 
ATOM   11130 N  N    . ASP A 1 54 ? 1.528   7.393   -2.811  1.00 0.00 ? 54  ASP A N    10 
ATOM   11131 C  CA   . ASP A 1 54 ? 2.528   7.959   -3.708  1.00 0.00 ? 54  ASP A CA   10 
ATOM   11132 C  C    . ASP A 1 54 ? 3.509   6.887   -4.173  1.00 0.00 ? 54  ASP A C    10 
ATOM   11133 O  O    . ASP A 1 54 ? 4.631   7.192   -4.577  1.00 0.00 ? 54  ASP A O    10 
ATOM   11134 C  CB   . ASP A 1 54 ? 3.284   9.092   -3.012  1.00 0.00 ? 54  ASP A CB   10 
ATOM   11135 C  CG   . ASP A 1 54 ? 2.466   10.366  -2.926  1.00 0.00 ? 54  ASP A CG   10 
ATOM   11136 O  OD1  . ASP A 1 54 ? 1.594   10.452  -2.036  1.00 0.00 ? 54  ASP A OD1  10 
ATOM   11137 O  OD2  . ASP A 1 54 ? 2.699   11.277  -3.747  1.00 0.00 ? 54  ASP A OD2  10 
ATOM   11138 H  H    . ASP A 1 54 ? 1.768   7.215   -1.877  1.00 0.00 ? 54  ASP A H    10 
ATOM   11139 H  HA   . ASP A 1 54 ? 2.014   8.357   -4.569  1.00 0.00 ? 54  ASP A HA   10 
ATOM   11140 H  HB2  . ASP A 1 54 ? 3.541   8.783   -2.009  1.00 0.00 ? 54  ASP A HB2  10 
ATOM   11141 H  HB3  . ASP A 1 54 ? 4.189   9.303   -3.562  1.00 0.00 ? 54  ASP A HB3  10 
ATOM   11142 N  N    . ALA A 1 55 ? 3.079   5.632   -4.112  1.00 0.00 ? 55  ALA A N    10 
ATOM   11143 C  CA   . ALA A 1 55 ? 3.919   4.515   -4.528  1.00 0.00 ? 55  ALA A CA   10 
ATOM   11144 C  C    . ALA A 1 55 ? 4.283   4.623   -6.005  1.00 0.00 ? 55  ALA A C    10 
ATOM   11145 O  O    . ALA A 1 55 ? 3.407   4.702   -6.866  1.00 0.00 ? 55  ALA A O    10 
ATOM   11146 C  CB   . ALA A 1 55 ? 3.216   3.194   -4.251  1.00 0.00 ? 55  ALA A CB   10 
ATOM   11147 H  H    . ALA A 1 55 ? 2.175   5.452   -3.781  1.00 0.00 ? 55  ALA A H    10 
ATOM   11148 H  HA   . ALA A 1 55 ? 4.825   4.543   -3.941  1.00 0.00 ? 55  ALA A HA   10 
ATOM   11149 H  HB1  . ALA A 1 55 ? 2.453   3.030   -4.999  1.00 0.00 ? 55  ALA A HB1  10 
ATOM   11150 H  HB2  . ALA A 1 55 ? 3.935   2.390   -4.286  1.00 0.00 ? 55  ALA A HB2  10 
ATOM   11151 H  HB3  . ALA A 1 55 ? 2.760   3.228   -3.273  1.00 0.00 ? 55  ALA A HB3  10 
ATOM   11152 N  N    . ARG A 1 56 ? 5.581   4.626   -6.291  1.00 0.00 ? 56  ARG A N    10 
ATOM   11153 C  CA   . ARG A 1 56 ? 6.061   4.727   -7.664  1.00 0.00 ? 56  ARG A CA   10 
ATOM   11154 C  C    . ARG A 1 56 ? 5.792   3.434   -8.429  1.00 0.00 ? 56  ARG A C    10 
ATOM   11155 O  O    . ARG A 1 56 ? 5.752   2.353   -7.844  1.00 0.00 ? 56  ARG A O    10 
ATOM   11156 C  CB   . ARG A 1 56 ? 7.558   5.040   -7.682  1.00 0.00 ? 56  ARG A CB   10 
ATOM   11157 C  CG   . ARG A 1 56 ? 7.926   6.297   -6.910  1.00 0.00 ? 56  ARG A CG   10 
ATOM   11158 C  CD   . ARG A 1 56 ? 7.551   7.553   -7.680  1.00 0.00 ? 56  ARG A CD   10 
ATOM   11159 N  NE   . ARG A 1 56 ? 8.288   7.667   -8.935  1.00 0.00 ? 56  ARG A NE   10 
ATOM   11160 C  CZ   . ARG A 1 56 ? 8.445   8.809   -9.595  1.00 0.00 ? 56  ARG A CZ   10 
ATOM   11161 N  NH1  . ARG A 1 56 ? 7.920   9.930   -9.120  1.00 0.00 ? 56  ARG A NH1  10 
ATOM   11162 N  NH2  . ARG A 1 56 ? 9.129   8.832   -10.731 1.00 0.00 ? 56  ARG A NH2  10 
ATOM   11163 H  H    . ARG A 1 56 ? 6.232   4.561   -5.561  1.00 0.00 ? 56  ARG A H    10 
ATOM   11164 H  HA   . ARG A 1 56 ? 5.527   5.533   -8.144  1.00 0.00 ? 56  ARG A HA   10 
ATOM   11165 H  HB2  . ARG A 1 56 ? 8.094   4.208   -7.248  1.00 0.00 ? 56  ARG A HB2  10 
ATOM   11166 H  HB3  . ARG A 1 56 ? 7.874   5.167   -8.706  1.00 0.00 ? 56  ARG A HB3  10 
ATOM   11167 H  HG2  . ARG A 1 56 ? 7.401   6.296   -5.966  1.00 0.00 ? 56  ARG A HG2  10 
ATOM   11168 H  HG3  . ARG A 1 56 ? 8.991   6.299   -6.731  1.00 0.00 ? 56  ARG A HG3  10 
ATOM   11169 H  HD2  . ARG A 1 56 ? 6.493   7.525   -7.896  1.00 0.00 ? 56  ARG A HD2  10 
ATOM   11170 H  HD3  . ARG A 1 56 ? 7.769   8.414   -7.065  1.00 0.00 ? 56  ARG A HD3  10 
ATOM   11171 H  HE   . ARG A 1 56 ? 8.684   6.851   -9.304  1.00 0.00 ? 56  ARG A HE   10 
ATOM   11172 H  HH11 . ARG A 1 56 ? 7.405   9.916   -8.263  1.00 0.00 ? 56  ARG A HH11 10 
ATOM   11173 H  HH12 . ARG A 1 56 ? 8.041   10.789  -9.617  1.00 0.00 ? 56  ARG A HH12 10 
ATOM   11174 H  HH21 . ARG A 1 56 ? 9.527   7.989   -11.092 1.00 0.00 ? 56  ARG A HH21 10 
ATOM   11175 H  HH22 . ARG A 1 56 ? 9.247   9.692   -11.227 1.00 0.00 ? 56  ARG A HH22 10 
ATOM   11176 N  N    . GLU A 1 57 ? 5.607   3.557   -9.740  1.00 0.00 ? 57  GLU A N    10 
ATOM   11177 C  CA   . GLU A 1 57 ? 5.341   2.398   -10.585 1.00 0.00 ? 57  GLU A CA   10 
ATOM   11178 C  C    . GLU A 1 57 ? 6.562   2.049   -11.431 1.00 0.00 ? 57  GLU A C    10 
ATOM   11179 O  O    . GLU A 1 57 ? 7.194   2.926   -12.021 1.00 0.00 ? 57  GLU A O    10 
ATOM   11180 C  CB   . GLU A 1 57 ? 4.138   2.666   -11.492 1.00 0.00 ? 57  GLU A CB   10 
ATOM   11181 C  CG   . GLU A 1 57 ? 3.768   1.488   -12.377 1.00 0.00 ? 57  GLU A CG   10 
ATOM   11182 C  CD   . GLU A 1 57 ? 2.940   1.899   -13.579 1.00 0.00 ? 57  GLU A CD   10 
ATOM   11183 O  OE1  . GLU A 1 57 ? 1.943   2.628   -13.392 1.00 0.00 ? 57  GLU A OE1  10 
ATOM   11184 O  OE2  . GLU A 1 57 ? 3.289   1.491   -14.706 1.00 0.00 ? 57  GLU A OE2  10 
ATOM   11185 H  H    . GLU A 1 57 ? 5.651   4.446   -10.149 1.00 0.00 ? 57  GLU A H    10 
ATOM   11186 H  HA   . GLU A 1 57 ? 5.114   1.563   -9.940  1.00 0.00 ? 57  GLU A HA   10 
ATOM   11187 H  HB2  . GLU A 1 57 ? 3.285   2.909   -10.876 1.00 0.00 ? 57  GLU A HB2  10 
ATOM   11188 H  HB3  . GLU A 1 57 ? 4.363   3.510   -12.127 1.00 0.00 ? 57  GLU A HB3  10 
ATOM   11189 H  HG2  . GLU A 1 57 ? 4.676   1.019   -12.728 1.00 0.00 ? 57  GLU A HG2  10 
ATOM   11190 H  HG3  . GLU A 1 57 ? 3.201   0.779   -11.792 1.00 0.00 ? 57  GLU A HG3  10 
ATOM   11191 N  N    . LEU A 1 58 ? 6.888   0.762   -11.484 1.00 0.00 ? 58  LEU A N    10 
ATOM   11192 C  CA   . LEU A 1 58 ? 8.034   0.295   -12.257 1.00 0.00 ? 58  LEU A CA   10 
ATOM   11193 C  C    . LEU A 1 58 ? 7.660   -0.913  -13.110 1.00 0.00 ? 58  LEU A C    10 
ATOM   11194 O  O    . LEU A 1 58 ? 7.349   -1.983  -12.587 1.00 0.00 ? 58  LEU A O    10 
ATOM   11195 C  CB   . LEU A 1 58 ? 9.192   -0.063  -11.324 1.00 0.00 ? 58  LEU A CB   10 
ATOM   11196 C  CG   . LEU A 1 58 ? 9.936   1.115   -10.695 1.00 0.00 ? 58  LEU A CG   10 
ATOM   11197 C  CD1  . LEU A 1 58 ? 10.676  0.671   -9.442  1.00 0.00 ? 58  LEU A CD1  10 
ATOM   11198 C  CD2  . LEU A 1 58 ? 10.901  1.733   -11.696 1.00 0.00 ? 58  LEU A CD2  10 
ATOM   11199 H  H    . LEU A 1 58 ? 6.347   0.110   -10.993 1.00 0.00 ? 58  LEU A H    10 
ATOM   11200 H  HA   . LEU A 1 58 ? 8.343   1.099   -12.909 1.00 0.00 ? 58  LEU A HA   10 
ATOM   11201 H  HB2  . LEU A 1 58 ? 8.796   -0.670  -10.524 1.00 0.00 ? 58  LEU A HB2  10 
ATOM   11202 H  HB3  . LEU A 1 58 ? 9.907   -0.641  -11.893 1.00 0.00 ? 58  LEU A HB3  10 
ATOM   11203 H  HG   . LEU A 1 58 ? 9.219   1.873   -10.407 1.00 0.00 ? 58  LEU A HG   10 
ATOM   11204 H  HD11 . LEU A 1 58 ? 11.453  1.384   -9.212  1.00 0.00 ? 58  LEU A HD11 10 
ATOM   11205 H  HD12 . LEU A 1 58 ? 11.116  -0.300  -9.610  1.00 0.00 ? 58  LEU A HD12 10 
ATOM   11206 H  HD13 . LEU A 1 58 ? 9.982   0.614   -8.616  1.00 0.00 ? 58  LEU A HD13 10 
ATOM   11207 H  HD21 . LEU A 1 58 ? 11.916  1.540   -11.383 1.00 0.00 ? 58  LEU A HD21 10 
ATOM   11208 H  HD22 . LEU A 1 58 ? 10.736  2.800   -11.743 1.00 0.00 ? 58  LEU A HD22 10 
ATOM   11209 H  HD23 . LEU A 1 58 ? 10.735  1.299   -12.670 1.00 0.00 ? 58  LEU A HD23 10 
ATOM   11210 N  N    . LYS A 1 59 ? 7.694   -0.736  -14.426 1.00 0.00 ? 59  LYS A N    10 
ATOM   11211 C  CA   . LYS A 1 59 ? 7.362   -1.811  -15.353 1.00 0.00 ? 59  LYS A CA   10 
ATOM   11212 C  C    . LYS A 1 59 ? 6.085   -2.526  -14.922 1.00 0.00 ? 59  LYS A C    10 
ATOM   11213 O  O    . LYS A 1 59 ? 5.995   -3.751  -14.988 1.00 0.00 ? 59  LYS A O    10 
ATOM   11214 C  CB   . LYS A 1 59 ? 8.516   -2.814  -15.437 1.00 0.00 ? 59  LYS A CB   10 
ATOM   11215 C  CG   . LYS A 1 59 ? 9.819   -2.202  -15.922 1.00 0.00 ? 59  LYS A CG   10 
ATOM   11216 C  CD   . LYS A 1 59 ? 11.024  -2.923  -15.342 1.00 0.00 ? 59  LYS A CD   10 
ATOM   11217 C  CE   . LYS A 1 59 ? 12.272  -2.056  -15.396 1.00 0.00 ? 59  LYS A CE   10 
ATOM   11218 N  NZ   . LYS A 1 59 ? 13.008  -2.221  -16.680 1.00 0.00 ? 59  LYS A NZ   10 
ATOM   11219 H  H    . LYS A 1 59 ? 7.950   0.141   -14.783 1.00 0.00 ? 59  LYS A H    10 
ATOM   11220 H  HA   . LYS A 1 59 ? 7.205   -1.374  -16.327 1.00 0.00 ? 59  LYS A HA   10 
ATOM   11221 H  HB2  . LYS A 1 59 ? 8.683   -3.235  -14.456 1.00 0.00 ? 59  LYS A HB2  10 
ATOM   11222 H  HB3  . LYS A 1 59 ? 8.239   -3.606  -16.117 1.00 0.00 ? 59  LYS A HB3  10 
ATOM   11223 H  HG2  . LYS A 1 59 ? 9.857   -2.268  -17.000 1.00 0.00 ? 59  LYS A HG2  10 
ATOM   11224 H  HG3  . LYS A 1 59 ? 9.853   -1.164  -15.622 1.00 0.00 ? 59  LYS A HG3  10 
ATOM   11225 H  HD2  . LYS A 1 59 ? 10.820  -3.177  -14.313 1.00 0.00 ? 59  LYS A HD2  10 
ATOM   11226 H  HD3  . LYS A 1 59 ? 11.199  -3.827  -15.909 1.00 0.00 ? 59  LYS A HD3  10 
ATOM   11227 H  HE2  . LYS A 1 59 ? 11.980  -1.022  -15.288 1.00 0.00 ? 59  LYS A HE2  10 
ATOM   11228 H  HE3  . LYS A 1 59 ? 12.922  -2.333  -14.579 1.00 0.00 ? 59  LYS A HE3  10 
ATOM   11229 H  HZ1  . LYS A 1 59 ? 12.656  -1.541  -17.383 1.00 0.00 ? 59  LYS A HZ1  10 
ATOM   11230 H  HZ2  . LYS A 1 59 ? 12.872  -3.184  -17.048 1.00 0.00 ? 59  LYS A HZ2  10 
ATOM   11231 H  HZ3  . LYS A 1 59 ? 14.024  -2.058  -16.533 1.00 0.00 ? 59  LYS A HZ3  10 
ATOM   11232 N  N    . GLY A 1 60 ? 5.098   -1.750  -14.483 1.00 0.00 ? 60  GLY A N    10 
ATOM   11233 C  CA   . GLY A 1 60 ? 3.839   -2.327  -14.050 1.00 0.00 ? 60  GLY A CA   10 
ATOM   11234 C  C    . GLY A 1 60 ? 3.764   -2.493  -12.545 1.00 0.00 ? 60  GLY A C    10 
ATOM   11235 O  O    . GLY A 1 60 ? 2.730   -2.224  -11.935 1.00 0.00 ? 60  GLY A O    10 
ATOM   11236 H  H    . GLY A 1 60 ? 5.227   -0.779  -14.452 1.00 0.00 ? 60  GLY A H    10 
ATOM   11237 H  HA2  . GLY A 1 60 ? 3.032   -1.685  -14.371 1.00 0.00 ? 60  GLY A HA2  10 
ATOM   11238 H  HA3  . GLY A 1 60 ? 3.721   -3.295  -14.513 1.00 0.00 ? 60  GLY A HA3  10 
ATOM   11239 N  N    . GLU A 1 61 ? 4.863   -2.940  -11.945 1.00 0.00 ? 61  GLU A N    10 
ATOM   11240 C  CA   . GLU A 1 61 ? 4.916   -3.144  -10.502 1.00 0.00 ? 61  GLU A CA   10 
ATOM   11241 C  C    . GLU A 1 61 ? 4.755   -1.821  -9.759  1.00 0.00 ? 61  GLU A C    10 
ATOM   11242 O  O    . GLU A 1 61 ? 4.682   -0.755  -10.374 1.00 0.00 ? 61  GLU A O    10 
ATOM   11243 C  CB   . GLU A 1 61 ? 6.238   -3.806  -10.106 1.00 0.00 ? 61  GLU A CB   10 
ATOM   11244 C  CG   . GLU A 1 61 ? 6.318   -5.276  -10.481 1.00 0.00 ? 61  GLU A CG   10 
ATOM   11245 C  CD   . GLU A 1 61 ? 5.365   -6.136  -9.675  1.00 0.00 ? 61  GLU A CD   10 
ATOM   11246 O  OE1  . GLU A 1 61 ? 5.464   -6.124  -8.430  1.00 0.00 ? 61  GLU A OE1  10 
ATOM   11247 O  OE2  . GLU A 1 61 ? 4.520   -6.821  -10.288 1.00 0.00 ? 61  GLU A OE2  10 
ATOM   11248 H  H    . GLU A 1 61 ? 5.657   -3.137  -12.485 1.00 0.00 ? 61  GLU A H    10 
ATOM   11249 H  HA   . GLU A 1 61 ? 4.101   -3.797  -10.230 1.00 0.00 ? 61  GLU A HA   10 
ATOM   11250 H  HB2  . GLU A 1 61 ? 7.048   -3.286  -10.596 1.00 0.00 ? 61  GLU A HB2  10 
ATOM   11251 H  HB3  . GLU A 1 61 ? 6.362   -3.721  -9.037  1.00 0.00 ? 61  GLU A HB3  10 
ATOM   11252 H  HG2  . GLU A 1 61 ? 6.076   -5.382  -11.528 1.00 0.00 ? 61  GLU A HG2  10 
ATOM   11253 H  HG3  . GLU A 1 61 ? 7.326   -5.624  -10.309 1.00 0.00 ? 61  GLU A HG3  10 
ATOM   11254 N  N    . LEU A 1 62 ? 4.700   -1.896  -8.434  1.00 0.00 ? 62  LEU A N    10 
ATOM   11255 C  CA   . LEU A 1 62 ? 4.547   -0.705  -7.606  1.00 0.00 ? 62  LEU A CA   10 
ATOM   11256 C  C    . LEU A 1 62 ? 5.414   -0.797  -6.354  1