data_2CP2
# 
_entry.id   2CP2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CP2         
RCSB  RCSB024468   
WWPDB D_1000024468 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001003730.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CP2 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Saito, K.'                                              1 
'Koshiba, S.'                                            2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the 1st CAP-Gly domain in human CLIP-115/CYLN2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Saito, K.'    1 
primary 'Koshiba, S.'  2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Yokoyama, S.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           CLIP-115 
_entity.formula_weight             9748.722 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CAP-Gly domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'KIAA0291; similar rodent cytoplasmic linker protein CLIP-115 and restin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFT
RPSKLTRQPSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFT
RPSKLTRQPSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001003730.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  ALA n 
1 9  ALA n 
1 10 GLU n 
1 11 VAL n 
1 12 GLY n 
1 13 ASP n 
1 14 ASP n 
1 15 PHE n 
1 16 LEU n 
1 17 GLY n 
1 18 ASP n 
1 19 PHE n 
1 20 VAL n 
1 21 VAL n 
1 22 GLY n 
1 23 GLU n 
1 24 ARG n 
1 25 VAL n 
1 26 TRP n 
1 27 VAL n 
1 28 ASN n 
1 29 GLY n 
1 30 VAL n 
1 31 LYS n 
1 32 PRO n 
1 33 GLY n 
1 34 VAL n 
1 35 VAL n 
1 36 GLN n 
1 37 TYR n 
1 38 LEU n 
1 39 GLY n 
1 40 GLU n 
1 41 THR n 
1 42 GLN n 
1 43 PHE n 
1 44 ALA n 
1 45 PRO n 
1 46 GLY n 
1 47 GLN n 
1 48 TRP n 
1 49 ALA n 
1 50 GLY n 
1 51 VAL n 
1 52 VAL n 
1 53 LEU n 
1 54 ASP n 
1 55 ASP n 
1 56 PRO n 
1 57 VAL n 
1 58 GLY n 
1 59 LYS n 
1 60 ASN n 
1 61 ASP n 
1 62 GLY n 
1 63 ALA n 
1 64 VAL n 
1 65 GLY n 
1 66 GLY n 
1 67 VAL n 
1 68 ARG n 
1 69 TYR n 
1 70 PHE n 
1 71 GLU n 
1 72 CYS n 
1 73 PRO n 
1 74 ALA n 
1 75 LEU n 
1 76 GLN n 
1 77 GLY n 
1 78 ILE n 
1 79 PHE n 
1 80 THR n 
1 81 ARG n 
1 82 PRO n 
1 83 SER n 
1 84 LYS n 
1 85 LEU n 
1 86 THR n 
1 87 ARG n 
1 88 GLN n 
1 89 PRO n 
1 90 SER n 
1 91 GLY n 
1 92 PRO n 
1 93 SER n 
1 94 SER n 
1 95 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA fh25236' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040301-88 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CYLN2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UDT6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTR
QP
;
_struct_ref.pdbx_align_begin           68 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CP2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 89 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UDT6 
_struct_ref_seq.db_align_beg                  68 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  149 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       89 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CP2 GLY A 1  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 1  1  
1 2CP2 SER A 2  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 2  2  
1 2CP2 SER A 3  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 3  3  
1 2CP2 GLY A 4  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 4  4  
1 2CP2 SER A 5  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 5  5  
1 2CP2 SER A 6  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 6  6  
1 2CP2 GLY A 7  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 7  7  
1 2CP2 SER A 90 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 90 8  
1 2CP2 GLY A 91 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 91 9  
1 2CP2 PRO A 92 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 92 10 
1 2CP2 SER A 93 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 93 11 
1 2CP2 SER A 94 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 94 12 
1 2CP2 GLY A 95 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 95 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM protein, 20mM d-Tris-HCl, pH7.0, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2CP2 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2CP2 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CP2 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5        'Johnson, B.A.' 3 
'structure solution' CNS     1.1      'Brunger, A.T.' 4 
refinement           CNS     1.1      ?               5 
# 
_exptl.entry_id          2CP2 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CP2 
_struct.title                     'Solution structure of the 1st CAP-Gly domain in human CLIP-115/CYLN2' 
_struct.pdbx_descriptor           CLIP-115 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CP2 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;microtubule binding, cytoskeleton associated protein, CYLN2, KIAA0291, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 28 ? VAL A 30 ? ASN A 28 VAL A 30 5 ? 3 
HELX_P HELX_P2 2 ARG A 81 ? LEU A 85 ? ARG A 81 LEU A 85 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 24 ? TRP A 26 ? ARG A 24 TRP A 26 
A 2 PRO A 32 ? GLU A 40 ? PRO A 32 GLU A 40 
A 3 GLN A 47 ? LEU A 53 ? GLN A 47 LEU A 53 
A 4 GLY A 77 ? THR A 80 ? GLY A 77 THR A 80 
B 1 ALA A 63 ? VAL A 64 ? ALA A 63 VAL A 64 
B 2 VAL A 67 ? ARG A 68 ? VAL A 67 ARG A 68 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 25 ? N VAL A 25 O GLY A 33 ? O GLY A 33 
A 2 3 N GLY A 39 ? N GLY A 39 O TRP A 48 ? O TRP A 48 
A 3 4 N ALA A 49 ? N ALA A 49 O THR A 80 ? O THR A 80 
B 1 2 N VAL A 64 ? N VAL A 64 O VAL A 67 ? O VAL A 67 
# 
_database_PDB_matrix.entry_id          2CP2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CP2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -24.886 -4.615  -3.764  1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -24.910 -4.651  -5.252  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -23.635 -4.108  -5.867  1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -22.761 -4.873  -6.276  1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -24.634 -5.552  -3.388  1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? -25.821 -4.346  -3.397  1.00 0.00 ? 1  GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? -24.185 -3.921  -3.435  1.00 0.00 ? 1  GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? -25.045 -5.673  -5.574  1.00 0.00 ? 1  GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? -25.745 -4.062  -5.602  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 10    N N    . SER A 1 2  ? -23.528 -2.786  -5.932  1.00 0.00 ? 2  SER A N    1  
ATOM 11    C CA   . SER A 1 2  ? -22.351 -2.141  -6.500  1.00 0.00 ? 2  SER A CA   1  
ATOM 12    C C    . SER A 1 2  ? -21.097 -2.509  -5.715  1.00 0.00 ? 2  SER A C    1  
ATOM 13    O O    . SER A 1 2  ? -20.116 -2.990  -6.283  1.00 0.00 ? 2  SER A O    1  
ATOM 14    C CB   . SER A 1 2  ? -22.532 -0.621  -6.514  1.00 0.00 ? 2  SER A CB   1  
ATOM 15    O OG   . SER A 1 2  ? -23.051 -0.180  -7.756  1.00 0.00 ? 2  SER A OG   1  
ATOM 16    H H    . SER A 1 2  ? -24.258 -2.229  -5.588  1.00 0.00 ? 2  SER A H    1  
ATOM 17    H HA   . SER A 1 2  ? -22.241 -2.490  -7.516  1.00 0.00 ? 2  SER A HA   1  
ATOM 18    H HB2  . SER A 1 2  ? -23.218 -0.336  -5.730  1.00 0.00 ? 2  SER A HB2  1  
ATOM 19    H HB3  . SER A 1 2  ? -21.577 -0.145  -6.347  1.00 0.00 ? 2  SER A HB3  1  
ATOM 20    H HG   . SER A 1 2  ? -22.338 0.168   -8.296  1.00 0.00 ? 2  SER A HG   1  
ATOM 21    N N    . SER A 1 3  ? -21.134 -2.279  -4.407  1.00 0.00 ? 3  SER A N    1  
ATOM 22    C CA   . SER A 1 3  ? -20.000 -2.587  -3.544  1.00 0.00 ? 3  SER A CA   1  
ATOM 23    C C    . SER A 1 3  ? -19.683 -4.078  -3.574  1.00 0.00 ? 3  SER A C    1  
ATOM 24    O O    . SER A 1 3  ? -20.224 -4.854  -2.785  1.00 0.00 ? 3  SER A O    1  
ATOM 25    C CB   . SER A 1 3  ? -20.290 -2.143  -2.109  1.00 0.00 ? 3  SER A CB   1  
ATOM 26    O OG   . SER A 1 3  ? -21.681 -2.162  -1.840  1.00 0.00 ? 3  SER A OG   1  
ATOM 27    H H    . SER A 1 3  ? -21.944 -1.893  -4.013  1.00 0.00 ? 3  SER A H    1  
ATOM 28    H HA   . SER A 1 3  ? -19.144 -2.041  -3.915  1.00 0.00 ? 3  SER A HA   1  
ATOM 29    H HB2  . SER A 1 3  ? -19.793 -2.811  -1.420  1.00 0.00 ? 3  SER A HB2  1  
ATOM 30    H HB3  . SER A 1 3  ? -19.920 -1.138  -1.963  1.00 0.00 ? 3  SER A HB3  1  
ATOM 31    H HG   . SER A 1 3  ? -22.025 -1.266  -1.870  1.00 0.00 ? 3  SER A HG   1  
ATOM 32    N N    . GLY A 1 4  ? -18.802 -4.473  -4.487  1.00 0.00 ? 4  GLY A N    1  
ATOM 33    C CA   . GLY A 1 4  ? -18.428 -5.870  -4.603  1.00 0.00 ? 4  GLY A CA   1  
ATOM 34    C C    . GLY A 1 4  ? -17.465 -6.120  -5.745  1.00 0.00 ? 4  GLY A C    1  
ATOM 35    O O    . GLY A 1 4  ? -17.721 -6.958  -6.609  1.00 0.00 ? 4  GLY A O    1  
ATOM 36    H H    . GLY A 1 4  ? -18.403 -3.809  -5.088  1.00 0.00 ? 4  GLY A H    1  
ATOM 37    H HA2  . GLY A 1 4  ? -17.963 -6.184  -3.680  1.00 0.00 ? 4  GLY A HA2  1  
ATOM 38    H HA3  . GLY A 1 4  ? -19.320 -6.457  -4.762  1.00 0.00 ? 4  GLY A HA3  1  
ATOM 39    N N    . SER A 1 5  ? -16.354 -5.391  -5.751  1.00 0.00 ? 5  SER A N    1  
ATOM 40    C CA   . SER A 1 5  ? -15.349 -5.537  -6.798  1.00 0.00 ? 5  SER A CA   1  
ATOM 41    C C    . SER A 1 5  ? -14.465 -6.752  -6.537  1.00 0.00 ? 5  SER A C    1  
ATOM 42    O O    . SER A 1 5  ? -14.656 -7.473  -5.558  1.00 0.00 ? 5  SER A O    1  
ATOM 43    C CB   . SER A 1 5  ? -14.488 -4.275  -6.887  1.00 0.00 ? 5  SER A CB   1  
ATOM 44    O OG   . SER A 1 5  ? -15.082 -3.311  -7.738  1.00 0.00 ? 5  SER A OG   1  
ATOM 45    H H    . SER A 1 5  ? -16.207 -4.738  -5.035  1.00 0.00 ? 5  SER A H    1  
ATOM 46    H HA   . SER A 1 5  ? -15.865 -5.676  -7.735  1.00 0.00 ? 5  SER A HA   1  
ATOM 47    H HB2  . SER A 1 5  ? -14.377 -3.847  -5.902  1.00 0.00 ? 5  SER A HB2  1  
ATOM 48    H HB3  . SER A 1 5  ? -13.515 -4.533  -7.279  1.00 0.00 ? 5  SER A HB3  1  
ATOM 49    H HG   . SER A 1 5  ? -14.540 -2.519  -7.753  1.00 0.00 ? 5  SER A HG   1  
ATOM 50    N N    . SER A 1 6  ? -13.498 -6.974  -7.421  1.00 0.00 ? 6  SER A N    1  
ATOM 51    C CA   . SER A 1 6  ? -12.583 -8.102  -7.288  1.00 0.00 ? 6  SER A CA   1  
ATOM 52    C C    . SER A 1 6  ? -11.132 -7.637  -7.350  1.00 0.00 ? 6  SER A C    1  
ATOM 53    O O    . SER A 1 6  ? -10.808 -6.676  -8.046  1.00 0.00 ? 6  SER A O    1  
ATOM 54    C CB   . SER A 1 6  ? -12.849 -9.133  -8.386  1.00 0.00 ? 6  SER A CB   1  
ATOM 55    O OG   . SER A 1 6  ? -12.442 -10.429 -7.980  1.00 0.00 ? 6  SER A OG   1  
ATOM 56    H H    . SER A 1 6  ? -13.396 -6.364  -8.182  1.00 0.00 ? 6  SER A H    1  
ATOM 57    H HA   . SER A 1 6  ? -12.761 -8.561  -6.326  1.00 0.00 ? 6  SER A HA   1  
ATOM 58    H HB2  . SER A 1 6  ? -13.904 -9.154  -8.611  1.00 0.00 ? 6  SER A HB2  1  
ATOM 59    H HB3  . SER A 1 6  ? -12.298 -8.859  -9.274  1.00 0.00 ? 6  SER A HB3  1  
ATOM 60    H HG   . SER A 1 6  ? -12.738 -10.589 -7.081  1.00 0.00 ? 6  SER A HG   1  
ATOM 61    N N    . GLY A 1 7  ? -10.263 -8.327  -6.618  1.00 0.00 ? 7  GLY A N    1  
ATOM 62    C CA   . GLY A 1 7  ? -8.856  -7.969  -6.605  1.00 0.00 ? 7  GLY A CA   1  
ATOM 63    C C    . GLY A 1 7  ? -7.994  -8.984  -7.328  1.00 0.00 ? 7  GLY A C    1  
ATOM 64    O O    . GLY A 1 7  ? -7.160  -9.650  -6.715  1.00 0.00 ? 7  GLY A O    1  
ATOM 65    H H    . GLY A 1 7  ? -10.579 -9.084  -6.083  1.00 0.00 ? 7  GLY A H    1  
ATOM 66    H HA2  . GLY A 1 7  ? -8.736  -7.007  -7.079  1.00 0.00 ? 7  GLY A HA2  1  
ATOM 67    H HA3  . GLY A 1 7  ? -8.524  -7.897  -5.579  1.00 0.00 ? 7  GLY A HA3  1  
ATOM 68    N N    . ALA A 1 8  ? -8.195  -9.104  -8.636  1.00 0.00 ? 8  ALA A N    1  
ATOM 69    C CA   . ALA A 1 8  ? -7.431  -10.045 -9.445  1.00 0.00 ? 8  ALA A CA   1  
ATOM 70    C C    . ALA A 1 8  ? -6.300  -9.339  -10.187 1.00 0.00 ? 8  ALA A C    1  
ATOM 71    O O    . ALA A 1 8  ? -6.235  -8.111  -10.218 1.00 0.00 ? 8  ALA A O    1  
ATOM 72    C CB   . ALA A 1 8  ? -8.345  -10.759 -10.429 1.00 0.00 ? 8  ALA A CB   1  
ATOM 73    H H    . ALA A 1 8  ? -8.876  -8.545  -9.068  1.00 0.00 ? 8  ALA A H    1  
ATOM 74    H HA   . ALA A 1 8  ? -7.006  -10.784 -8.782  1.00 0.00 ? 8  ALA A HA   1  
ATOM 75    H HB1  . ALA A 1 8  ? -9.159  -10.105 -10.705 1.00 0.00 ? 8  ALA A HB1  1  
ATOM 76    H HB2  . ALA A 1 8  ? -8.741  -11.652 -9.969  1.00 0.00 ? 8  ALA A HB2  1  
ATOM 77    H HB3  . ALA A 1 8  ? -7.783  -11.028 -11.312 1.00 0.00 ? 8  ALA A HB3  1  
ATOM 78    N N    . ALA A 1 9  ? -5.410  -10.126 -10.783 1.00 0.00 ? 9  ALA A N    1  
ATOM 79    C CA   . ALA A 1 9  ? -4.282  -9.578  -11.526 1.00 0.00 ? 9  ALA A CA   1  
ATOM 80    C C    . ALA A 1 9  ? -3.398  -8.719  -10.627 1.00 0.00 ? 9  ALA A C    1  
ATOM 81    O O    . ALA A 1 9  ? -2.787  -7.752  -11.082 1.00 0.00 ? 9  ALA A O    1  
ATOM 82    C CB   . ALA A 1 9  ? -4.777  -8.766  -12.713 1.00 0.00 ? 9  ALA A CB   1  
ATOM 83    H H    . ALA A 1 9  ? -5.515  -11.099 -10.723 1.00 0.00 ? 9  ALA A H    1  
ATOM 84    H HA   . ALA A 1 9  ? -3.698  -10.405 -11.904 1.00 0.00 ? 9  ALA A HA   1  
ATOM 85    H HB1  . ALA A 1 9  ? -5.279  -7.878  -12.359 1.00 0.00 ? 9  ALA A HB1  1  
ATOM 86    H HB2  . ALA A 1 9  ? -5.465  -9.361  -13.295 1.00 0.00 ? 9  ALA A HB2  1  
ATOM 87    H HB3  . ALA A 1 9  ? -3.937  -8.481  -13.330 1.00 0.00 ? 9  ALA A HB3  1  
ATOM 88    N N    . GLU A 1 10 ? -3.334  -9.080  -9.349  1.00 0.00 ? 10 GLU A N    1  
ATOM 89    C CA   . GLU A 1 10 ? -2.525  -8.341  -8.387  1.00 0.00 ? 10 GLU A CA   1  
ATOM 90    C C    . GLU A 1 10 ? -2.194  -9.209  -7.177  1.00 0.00 ? 10 GLU A C    1  
ATOM 91    O O    . GLU A 1 10 ? -3.069  -9.866  -6.613  1.00 0.00 ? 10 GLU A O    1  
ATOM 92    C CB   . GLU A 1 10 ? -3.256  -7.075  -7.939  1.00 0.00 ? 10 GLU A CB   1  
ATOM 93    C CG   . GLU A 1 10 ? -2.356  -5.854  -7.842  1.00 0.00 ? 10 GLU A CG   1  
ATOM 94    C CD   . GLU A 1 10 ? -2.006  -5.279  -9.201  1.00 0.00 ? 10 GLU A CD   1  
ATOM 95    O OE1  . GLU A 1 10 ? -2.928  -5.105  -10.026 1.00 0.00 ? 10 GLU A OE1  1  
ATOM 96    O OE2  . GLU A 1 10 ? -0.813  -5.003  -9.440  1.00 0.00 ? 10 GLU A OE2  1  
ATOM 97    H H    . GLU A 1 10 ? -3.844  -9.860  -9.047  1.00 0.00 ? 10 GLU A H    1  
ATOM 98    H HA   . GLU A 1 10 ? -1.604  -8.061  -8.876  1.00 0.00 ? 10 GLU A HA   1  
ATOM 99    H HB2  . GLU A 1 10 ? -4.044  -6.859  -8.645  1.00 0.00 ? 10 GLU A HB2  1  
ATOM 100   H HB3  . GLU A 1 10 ? -3.694  -7.250  -6.967  1.00 0.00 ? 10 GLU A HB3  1  
ATOM 101   H HG2  . GLU A 1 10 ? -2.861  -5.094  -7.266  1.00 0.00 ? 10 GLU A HG2  1  
ATOM 102   H HG3  . GLU A 1 10 ? -1.441  -6.136  -7.341  1.00 0.00 ? 10 GLU A HG3  1  
ATOM 103   N N    . VAL A 1 11 ? -0.924  -9.206  -6.783  1.00 0.00 ? 11 VAL A N    1  
ATOM 104   C CA   . VAL A 1 11 ? -0.477  -9.993  -5.640  1.00 0.00 ? 11 VAL A CA   1  
ATOM 105   C C    . VAL A 1 11 ? 0.521   -9.212  -4.792  1.00 0.00 ? 11 VAL A C    1  
ATOM 106   O O    . VAL A 1 11 ? 1.366   -8.487  -5.319  1.00 0.00 ? 11 VAL A O    1  
ATOM 107   C CB   . VAL A 1 11 ? 0.172   -11.315 -6.088  1.00 0.00 ? 11 VAL A CB   1  
ATOM 108   C CG1  . VAL A 1 11 ? -0.887  -12.297 -6.564  1.00 0.00 ? 11 VAL A CG1  1  
ATOM 109   C CG2  . VAL A 1 11 ? 1.204   -11.061 -7.177  1.00 0.00 ? 11 VAL A CG2  1  
ATOM 110   H H    . VAL A 1 11 ? -0.273  -8.662  -7.273  1.00 0.00 ? 11 VAL A H    1  
ATOM 111   H HA   . VAL A 1 11 ? -1.342  -10.227 -5.036  1.00 0.00 ? 11 VAL A HA   1  
ATOM 112   H HB   . VAL A 1 11 ? 0.678   -11.750 -5.238  1.00 0.00 ? 11 VAL A HB   1  
ATOM 113   H HG11 . VAL A 1 11 ? -1.350  -11.919 -7.463  1.00 0.00 ? 11 VAL A HG11 1  
ATOM 114   H HG12 . VAL A 1 11 ? -1.636  -12.419 -5.796  1.00 0.00 ? 11 VAL A HG12 1  
ATOM 115   H HG13 . VAL A 1 11 ? -0.425  -13.252 -6.772  1.00 0.00 ? 11 VAL A HG13 1  
ATOM 116   H HG21 . VAL A 1 11 ? 0.747   -11.205 -8.145  1.00 0.00 ? 11 VAL A HG21 1  
ATOM 117   H HG22 . VAL A 1 11 ? 2.027   -11.750 -7.062  1.00 0.00 ? 11 VAL A HG22 1  
ATOM 118   H HG23 . VAL A 1 11 ? 1.568   -10.047 -7.099  1.00 0.00 ? 11 VAL A HG23 1  
ATOM 119   N N    . GLY A 1 12 ? 0.418   -9.364  -3.476  1.00 0.00 ? 12 GLY A N    1  
ATOM 120   C CA   . GLY A 1 12 ? 1.318   -8.666  -2.576  1.00 0.00 ? 12 GLY A CA   1  
ATOM 121   C C    . GLY A 1 12 ? 2.656   -9.366  -2.438  1.00 0.00 ? 12 GLY A C    1  
ATOM 122   O O    . GLY A 1 12 ? 2.870   -10.430 -3.017  1.00 0.00 ? 12 GLY A O    1  
ATOM 123   H H    . GLY A 1 12 ? -0.274  -9.954  -3.112  1.00 0.00 ? 12 GLY A H    1  
ATOM 124   H HA2  . GLY A 1 12 ? 1.483   -7.668  -2.952  1.00 0.00 ? 12 GLY A HA2  1  
ATOM 125   H HA3  . GLY A 1 12 ? 0.856   -8.601  -1.602  1.00 0.00 ? 12 GLY A HA3  1  
ATOM 126   N N    . ASP A 1 13 ? 3.560   -8.765  -1.669  1.00 0.00 ? 13 ASP A N    1  
ATOM 127   C CA   . ASP A 1 13 ? 4.883   -9.337  -1.457  1.00 0.00 ? 13 ASP A CA   1  
ATOM 128   C C    . ASP A 1 13 ? 4.854   -10.381 -0.345  1.00 0.00 ? 13 ASP A C    1  
ATOM 129   O O    . ASP A 1 13 ? 3.785   -10.787 0.110   1.00 0.00 ? 13 ASP A O    1  
ATOM 130   C CB   . ASP A 1 13 ? 5.888   -8.235  -1.114  1.00 0.00 ? 13 ASP A CB   1  
ATOM 131   C CG   . ASP A 1 13 ? 7.237   -8.458  -1.769  1.00 0.00 ? 13 ASP A CG   1  
ATOM 132   O OD1  . ASP A 1 13 ? 7.330   -8.304  -3.005  1.00 0.00 ? 13 ASP A OD1  1  
ATOM 133   O OD2  . ASP A 1 13 ? 8.201   -8.788  -1.046  1.00 0.00 ? 13 ASP A OD2  1  
ATOM 134   H H    . ASP A 1 13 ? 3.329   -7.918  -1.234  1.00 0.00 ? 13 ASP A H    1  
ATOM 135   H HA   . ASP A 1 13 ? 5.188   -9.816  -2.375  1.00 0.00 ? 13 ASP A HA   1  
ATOM 136   H HB2  . ASP A 1 13 ? 5.499   -7.285  -1.449  1.00 0.00 ? 13 ASP A HB2  1  
ATOM 137   H HB3  . ASP A 1 13 ? 6.028   -8.205  -0.043  1.00 0.00 ? 13 ASP A HB3  1  
ATOM 138   N N    . ASP A 1 14 ? 6.035   -10.812 0.088   1.00 0.00 ? 14 ASP A N    1  
ATOM 139   C CA   . ASP A 1 14 ? 6.143   -11.808 1.146   1.00 0.00 ? 14 ASP A CA   1  
ATOM 140   C C    . ASP A 1 14 ? 6.611   -11.169 2.450   1.00 0.00 ? 14 ASP A C    1  
ATOM 141   O O    . ASP A 1 14 ? 6.126   -11.510 3.530   1.00 0.00 ? 14 ASP A O    1  
ATOM 142   C CB   . ASP A 1 14 ? 7.112   -12.918 0.734   1.00 0.00 ? 14 ASP A CB   1  
ATOM 143   C CG   . ASP A 1 14 ? 6.430   -14.013 -0.064  1.00 0.00 ? 14 ASP A CG   1  
ATOM 144   O OD1  . ASP A 1 14 ? 5.657   -13.682 -0.987  1.00 0.00 ? 14 ASP A OD1  1  
ATOM 145   O OD2  . ASP A 1 14 ? 6.671   -15.202 0.235   1.00 0.00 ? 14 ASP A OD2  1  
ATOM 146   H H    . ASP A 1 14 ? 6.852   -10.451 -0.315  1.00 0.00 ? 14 ASP A H    1  
ATOM 147   H HA   . ASP A 1 14 ? 5.164   -12.236 1.300   1.00 0.00 ? 14 ASP A HA   1  
ATOM 148   H HB2  . ASP A 1 14 ? 7.898   -12.494 0.127   1.00 0.00 ? 14 ASP A HB2  1  
ATOM 149   H HB3  . ASP A 1 14 ? 7.544   -13.358 1.620   1.00 0.00 ? 14 ASP A HB3  1  
ATOM 150   N N    . PHE A 1 15 ? 7.556   -10.241 2.343   1.00 0.00 ? 15 PHE A N    1  
ATOM 151   C CA   . PHE A 1 15 ? 8.089   -9.554  3.513   1.00 0.00 ? 15 PHE A CA   1  
ATOM 152   C C    . PHE A 1 15 ? 7.401   -8.208  3.716   1.00 0.00 ? 15 PHE A C    1  
ATOM 153   O O    . PHE A 1 15 ? 7.235   -7.436  2.771   1.00 0.00 ? 15 PHE A O    1  
ATOM 154   C CB   . PHE A 1 15 ? 9.598   -9.352  3.369   1.00 0.00 ? 15 PHE A CB   1  
ATOM 155   C CG   . PHE A 1 15 ? 10.311  -9.189  4.681   1.00 0.00 ? 15 PHE A CG   1  
ATOM 156   C CD1  . PHE A 1 15 ? 10.203  -8.010  5.402   1.00 0.00 ? 15 PHE A CD1  1  
ATOM 157   C CD2  . PHE A 1 15 ? 11.089  -10.215 5.194   1.00 0.00 ? 15 PHE A CD2  1  
ATOM 158   C CE1  . PHE A 1 15 ? 10.857  -7.857  6.609   1.00 0.00 ? 15 PHE A CE1  1  
ATOM 159   C CE2  . PHE A 1 15 ? 11.745  -10.067 6.400   1.00 0.00 ? 15 PHE A CE2  1  
ATOM 160   C CZ   . PHE A 1 15 ? 11.630  -8.888  7.109   1.00 0.00 ? 15 PHE A CZ   1  
ATOM 161   H H    . PHE A 1 15 ? 7.903   -10.012 1.455   1.00 0.00 ? 15 PHE A H    1  
ATOM 162   H HA   . PHE A 1 15 ? 7.900   -10.175 4.376   1.00 0.00 ? 15 PHE A HA   1  
ATOM 163   H HB2  . PHE A 1 15 ? 10.023  -10.207 2.865   1.00 0.00 ? 15 PHE A HB2  1  
ATOM 164   H HB3  . PHE A 1 15 ? 9.780   -8.465  2.779   1.00 0.00 ? 15 PHE A HB3  1  
ATOM 165   H HD1  . PHE A 1 15 ? 9.600   -7.203  5.011   1.00 0.00 ? 15 PHE A HD1  1  
ATOM 166   H HD2  . PHE A 1 15 ? 11.180  -11.138 4.641   1.00 0.00 ? 15 PHE A HD2  1  
ATOM 167   H HE1  . PHE A 1 15 ? 10.765  -6.934  7.161   1.00 0.00 ? 15 PHE A HE1  1  
ATOM 168   H HE2  . PHE A 1 15 ? 12.347  -10.876 6.790   1.00 0.00 ? 15 PHE A HE2  1  
ATOM 169   H HZ   . PHE A 1 15 ? 12.142  -8.771  8.053   1.00 0.00 ? 15 PHE A HZ   1  
ATOM 170   N N    . LEU A 1 16 ? 7.003   -7.934  4.954   1.00 0.00 ? 16 LEU A N    1  
ATOM 171   C CA   . LEU A 1 16 ? 6.333   -6.680  5.281   1.00 0.00 ? 16 LEU A CA   1  
ATOM 172   C C    . LEU A 1 16 ? 7.347   -5.606  5.665   1.00 0.00 ? 16 LEU A C    1  
ATOM 173   O O    . LEU A 1 16 ? 8.095   -5.761  6.630   1.00 0.00 ? 16 LEU A O    1  
ATOM 174   C CB   . LEU A 1 16 ? 5.336   -6.894  6.423   1.00 0.00 ? 16 LEU A CB   1  
ATOM 175   C CG   . LEU A 1 16 ? 3.870   -6.980  5.995   1.00 0.00 ? 16 LEU A CG   1  
ATOM 176   C CD1  . LEU A 1 16 ? 3.120   -7.986  6.854   1.00 0.00 ? 16 LEU A CD1  1  
ATOM 177   C CD2  . LEU A 1 16 ? 3.212   -5.611  6.076   1.00 0.00 ? 16 LEU A CD2  1  
ATOM 178   H H    . LEU A 1 16 ? 7.164   -8.589  5.665   1.00 0.00 ? 16 LEU A H    1  
ATOM 179   H HA   . LEU A 1 16 ? 5.796   -6.354  4.403   1.00 0.00 ? 16 LEU A HA   1  
ATOM 180   H HB2  . LEU A 1 16 ? 5.596   -7.812  6.932   1.00 0.00 ? 16 LEU A HB2  1  
ATOM 181   H HB3  . LEU A 1 16 ? 5.436   -6.077  7.121   1.00 0.00 ? 16 LEU A HB3  1  
ATOM 182   H HG   . LEU A 1 16 ? 3.821   -7.315  4.969   1.00 0.00 ? 16 LEU A HG   1  
ATOM 183   H HD11 . LEU A 1 16 ? 3.797   -8.763  7.173   1.00 0.00 ? 16 LEU A HD11 1  
ATOM 184   H HD12 . LEU A 1 16 ? 2.316   -8.422  6.279   1.00 0.00 ? 16 LEU A HD12 1  
ATOM 185   H HD13 . LEU A 1 16 ? 2.711   -7.486  7.721   1.00 0.00 ? 16 LEU A HD13 1  
ATOM 186   H HD21 . LEU A 1 16 ? 3.293   -5.114  5.121   1.00 0.00 ? 16 LEU A HD21 1  
ATOM 187   H HD22 . LEU A 1 16 ? 3.705   -5.019  6.832   1.00 0.00 ? 16 LEU A HD22 1  
ATOM 188   H HD23 . LEU A 1 16 ? 2.170   -5.727  6.334   1.00 0.00 ? 16 LEU A HD23 1  
ATOM 189   N N    . GLY A 1 17 ? 7.365   -4.518  4.903   1.00 0.00 ? 17 GLY A N    1  
ATOM 190   C CA   . GLY A 1 17 ? 8.290   -3.435  5.179   1.00 0.00 ? 17 GLY A CA   1  
ATOM 191   C C    . GLY A 1 17 ? 8.097   -2.846  6.563   1.00 0.00 ? 17 GLY A C    1  
ATOM 192   O O    . GLY A 1 17 ? 7.011   -2.932  7.136   1.00 0.00 ? 17 GLY A O    1  
ATOM 193   H H    . GLY A 1 17 ? 6.745   -4.449  4.147   1.00 0.00 ? 17 GLY A H    1  
ATOM 194   H HA2  . GLY A 1 17 ? 9.300   -3.808  5.097   1.00 0.00 ? 17 GLY A HA2  1  
ATOM 195   H HA3  . GLY A 1 17 ? 8.145   -2.655  4.446   1.00 0.00 ? 17 GLY A HA3  1  
ATOM 196   N N    . ASP A 1 18 ? 9.154   -2.246  7.101   1.00 0.00 ? 18 ASP A N    1  
ATOM 197   C CA   . ASP A 1 18 ? 9.095   -1.641  8.427   1.00 0.00 ? 18 ASP A CA   1  
ATOM 198   C C    . ASP A 1 18 ? 8.347   -0.312  8.386   1.00 0.00 ? 18 ASP A C    1  
ATOM 199   O O    . ASP A 1 18 ? 8.935   0.751   8.587   1.00 0.00 ? 18 ASP A O    1  
ATOM 200   C CB   . ASP A 1 18 ? 10.508  -1.431  8.977   1.00 0.00 ? 18 ASP A CB   1  
ATOM 201   C CG   . ASP A 1 18 ? 10.524  -1.276  10.485  1.00 0.00 ? 18 ASP A CG   1  
ATOM 202   O OD1  . ASP A 1 18 ? 10.143  -2.237  11.184  1.00 0.00 ? 18 ASP A OD1  1  
ATOM 203   O OD2  . ASP A 1 18 ? 10.919  -0.192  10.966  1.00 0.00 ? 18 ASP A OD2  1  
ATOM 204   H H    . ASP A 1 18 ? 9.992   -2.210  6.596   1.00 0.00 ? 18 ASP A H    1  
ATOM 205   H HA   . ASP A 1 18 ? 8.563   -2.319  9.077   1.00 0.00 ? 18 ASP A HA   1  
ATOM 206   H HB2  . ASP A 1 18 ? 11.120  -2.280  8.715   1.00 0.00 ? 18 ASP A HB2  1  
ATOM 207   H HB3  . ASP A 1 18 ? 10.929  -0.539  8.536   1.00 0.00 ? 18 ASP A HB3  1  
ATOM 208   N N    . PHE A 1 19 ? 7.046   -0.380  8.121   1.00 0.00 ? 19 PHE A N    1  
ATOM 209   C CA   . PHE A 1 19 ? 6.216   0.818   8.053   1.00 0.00 ? 19 PHE A CA   1  
ATOM 210   C C    . PHE A 1 19 ? 5.148   0.803   9.142   1.00 0.00 ? 19 PHE A C    1  
ATOM 211   O O    . PHE A 1 19 ? 4.319   -0.105  9.200   1.00 0.00 ? 19 PHE A O    1  
ATOM 212   C CB   . PHE A 1 19 ? 5.555   0.927   6.677   1.00 0.00 ? 19 PHE A CB   1  
ATOM 213   C CG   . PHE A 1 19 ? 6.535   0.925   5.538   1.00 0.00 ? 19 PHE A CG   1  
ATOM 214   C CD1  . PHE A 1 19 ? 7.234   2.074   5.206   1.00 0.00 ? 19 PHE A CD1  1  
ATOM 215   C CD2  . PHE A 1 19 ? 6.757   -0.227  4.800   1.00 0.00 ? 19 PHE A CD2  1  
ATOM 216   C CE1  . PHE A 1 19 ? 8.136   2.076   4.159   1.00 0.00 ? 19 PHE A CE1  1  
ATOM 217   C CE2  . PHE A 1 19 ? 7.658   -0.232  3.752   1.00 0.00 ? 19 PHE A CE2  1  
ATOM 218   C CZ   . PHE A 1 19 ? 8.348   0.921   3.431   1.00 0.00 ? 19 PHE A CZ   1  
ATOM 219   H H    . PHE A 1 19 ? 6.635   -1.255  7.968   1.00 0.00 ? 19 PHE A H    1  
ATOM 220   H HA   . PHE A 1 19 ? 6.856   1.674   8.204   1.00 0.00 ? 19 PHE A HA   1  
ATOM 221   H HB2  . PHE A 1 19 ? 4.885   0.091   6.540   1.00 0.00 ? 19 PHE A HB2  1  
ATOM 222   H HB3  . PHE A 1 19 ? 4.991   1.847   6.629   1.00 0.00 ? 19 PHE A HB3  1  
ATOM 223   H HD1  . PHE A 1 19 ? 7.069   2.978   5.775   1.00 0.00 ? 19 PHE A HD1  1  
ATOM 224   H HD2  . PHE A 1 19 ? 6.217   -1.129  5.051   1.00 0.00 ? 19 PHE A HD2  1  
ATOM 225   H HE1  . PHE A 1 19 ? 8.674   2.978   3.911   1.00 0.00 ? 19 PHE A HE1  1  
ATOM 226   H HE2  . PHE A 1 19 ? 7.821   -1.136  3.185   1.00 0.00 ? 19 PHE A HE2  1  
ATOM 227   H HZ   . PHE A 1 19 ? 9.052   0.919   2.612   1.00 0.00 ? 19 PHE A HZ   1  
ATOM 228   N N    . VAL A 1 20 ? 5.177   1.813   10.004  1.00 0.00 ? 20 VAL A N    1  
ATOM 229   C CA   . VAL A 1 20 ? 4.212   1.916   11.093  1.00 0.00 ? 20 VAL A CA   1  
ATOM 230   C C    . VAL A 1 20 ? 2.921   2.575   10.621  1.00 0.00 ? 20 VAL A C    1  
ATOM 231   O O    . VAL A 1 20 ? 2.848   3.099   9.509   1.00 0.00 ? 20 VAL A O    1  
ATOM 232   C CB   . VAL A 1 20 ? 4.782   2.721   12.275  1.00 0.00 ? 20 VAL A CB   1  
ATOM 233   C CG1  . VAL A 1 20 ? 5.856   1.921   12.998  1.00 0.00 ? 20 VAL A CG1  1  
ATOM 234   C CG2  . VAL A 1 20 ? 5.334   4.055   11.797  1.00 0.00 ? 20 VAL A CG2  1  
ATOM 235   H H    . VAL A 1 20 ? 5.863   2.507   9.906   1.00 0.00 ? 20 VAL A H    1  
ATOM 236   H HA   . VAL A 1 20 ? 3.990   0.917   11.438  1.00 0.00 ? 20 VAL A HA   1  
ATOM 237   H HB   . VAL A 1 20 ? 3.981   2.916   12.972  1.00 0.00 ? 20 VAL A HB   1  
ATOM 238   H HG11 . VAL A 1 20 ? 5.727   0.870   12.783  1.00 0.00 ? 20 VAL A HG11 1  
ATOM 239   H HG12 . VAL A 1 20 ? 5.771   2.085   14.062  1.00 0.00 ? 20 VAL A HG12 1  
ATOM 240   H HG13 . VAL A 1 20 ? 6.831   2.241   12.661  1.00 0.00 ? 20 VAL A HG13 1  
ATOM 241   H HG21 . VAL A 1 20 ? 4.882   4.312   10.849  1.00 0.00 ? 20 VAL A HG21 1  
ATOM 242   H HG22 . VAL A 1 20 ? 6.404   3.981   11.676  1.00 0.00 ? 20 VAL A HG22 1  
ATOM 243   H HG23 . VAL A 1 20 ? 5.105   4.821   12.524  1.00 0.00 ? 20 VAL A HG23 1  
ATOM 244   N N    . VAL A 1 21 ? 1.901   2.546   11.474  1.00 0.00 ? 21 VAL A N    1  
ATOM 245   C CA   . VAL A 1 21 ? 0.611   3.140   11.143  1.00 0.00 ? 21 VAL A CA   1  
ATOM 246   C C    . VAL A 1 21 ? 0.567   4.612   11.541  1.00 0.00 ? 21 VAL A C    1  
ATOM 247   O O    . VAL A 1 21 ? 0.529   4.944   12.726  1.00 0.00 ? 21 VAL A O    1  
ATOM 248   C CB   . VAL A 1 21 ? -0.545  2.398   11.840  1.00 0.00 ? 21 VAL A CB   1  
ATOM 249   C CG1  . VAL A 1 21 ? -1.886  2.901   11.331  1.00 0.00 ? 21 VAL A CG1  1  
ATOM 250   C CG2  . VAL A 1 21 ? -0.416  0.896   11.632  1.00 0.00 ? 21 VAL A CG2  1  
ATOM 251   H H    . VAL A 1 21 ? 2.020   2.114   12.346  1.00 0.00 ? 21 VAL A H    1  
ATOM 252   H HA   . VAL A 1 21 ? 0.472   3.061   10.075  1.00 0.00 ? 21 VAL A HA   1  
ATOM 253   H HB   . VAL A 1 21 ? -0.488  2.600   12.900  1.00 0.00 ? 21 VAL A HB   1  
ATOM 254   H HG11 . VAL A 1 21 ? -1.814  3.117   10.276  1.00 0.00 ? 21 VAL A HG11 1  
ATOM 255   H HG12 . VAL A 1 21 ? -2.159  3.800   11.864  1.00 0.00 ? 21 VAL A HG12 1  
ATOM 256   H HG13 . VAL A 1 21 ? -2.640  2.144   11.493  1.00 0.00 ? 21 VAL A HG13 1  
ATOM 257   H HG21 . VAL A 1 21 ? -1.073  0.380   12.318  1.00 0.00 ? 21 VAL A HG21 1  
ATOM 258   H HG22 . VAL A 1 21 ? 0.604   0.593   11.815  1.00 0.00 ? 21 VAL A HG22 1  
ATOM 259   H HG23 . VAL A 1 21 ? -0.689  0.649   10.617  1.00 0.00 ? 21 VAL A HG23 1  
ATOM 260   N N    . GLY A 1 22 ? 0.572   5.490   10.543  1.00 0.00 ? 22 GLY A N    1  
ATOM 261   C CA   . GLY A 1 22 ? 0.531   6.916   10.809  1.00 0.00 ? 22 GLY A CA   1  
ATOM 262   C C    . GLY A 1 22 ? 1.790   7.627   10.352  1.00 0.00 ? 22 GLY A C    1  
ATOM 263   O O    . GLY A 1 22 ? 2.217   8.603   10.967  1.00 0.00 ? 22 GLY A O    1  
ATOM 264   H H    . GLY A 1 22 ? 0.603   5.166   9.619   1.00 0.00 ? 22 GLY A H    1  
ATOM 265   H HA2  . GLY A 1 22 ? -0.316  7.342   10.293  1.00 0.00 ? 22 GLY A HA2  1  
ATOM 266   H HA3  . GLY A 1 22 ? 0.409   7.070   11.870  1.00 0.00 ? 22 GLY A HA3  1  
ATOM 267   N N    . GLU A 1 23 ? 2.386   7.135   9.270   1.00 0.00 ? 23 GLU A N    1  
ATOM 268   C CA   . GLU A 1 23 ? 3.604   7.729   8.732   1.00 0.00 ? 23 GLU A CA   1  
ATOM 269   C C    . GLU A 1 23 ? 3.415   8.126   7.271   1.00 0.00 ? 23 GLU A C    1  
ATOM 270   O O    . GLU A 1 23 ? 2.448   7.719   6.627   1.00 0.00 ? 23 GLU A O    1  
ATOM 271   C CB   . GLU A 1 23 ? 4.774   6.750   8.858   1.00 0.00 ? 23 GLU A CB   1  
ATOM 272   C CG   . GLU A 1 23 ? 4.596   5.482   8.041   1.00 0.00 ? 23 GLU A CG   1  
ATOM 273   C CD   . GLU A 1 23 ? 5.897   4.723   7.854   1.00 0.00 ? 23 GLU A CD   1  
ATOM 274   O OE1  . GLU A 1 23 ? 6.212   3.867   8.707   1.00 0.00 ? 23 GLU A OE1  1  
ATOM 275   O OE2  . GLU A 1 23 ? 6.598   4.986   6.855   1.00 0.00 ? 23 GLU A OE2  1  
ATOM 276   H H    . GLU A 1 23 ? 1.998   6.353   8.823   1.00 0.00 ? 23 GLU A H    1  
ATOM 277   H HA   . GLU A 1 23 ? 3.823   8.615   9.308   1.00 0.00 ? 23 GLU A HA   1  
ATOM 278   H HB2  . GLU A 1 23 ? 5.677   7.243   8.528   1.00 0.00 ? 23 GLU A HB2  1  
ATOM 279   H HB3  . GLU A 1 23 ? 4.885   6.472   9.896   1.00 0.00 ? 23 GLU A HB3  1  
ATOM 280   H HG2  . GLU A 1 23 ? 3.893   4.838   8.547   1.00 0.00 ? 23 GLU A HG2  1  
ATOM 281   H HG3  . GLU A 1 23 ? 4.208   5.745   7.068   1.00 0.00 ? 23 GLU A HG3  1  
ATOM 282   N N    . ARG A 1 24 ? 4.343   8.926   6.756   1.00 0.00 ? 24 ARG A N    1  
ATOM 283   C CA   . ARG A 1 24 ? 4.279   9.378   5.371   1.00 0.00 ? 24 ARG A CA   1  
ATOM 284   C C    . ARG A 1 24 ? 5.231   8.577   4.490   1.00 0.00 ? 24 ARG A C    1  
ATOM 285   O O    . ARG A 1 24 ? 6.447   8.613   4.680   1.00 0.00 ? 24 ARG A O    1  
ATOM 286   C CB   . ARG A 1 24 ? 4.618   10.868  5.283   1.00 0.00 ? 24 ARG A CB   1  
ATOM 287   C CG   . ARG A 1 24 ? 3.599   11.764  5.970   1.00 0.00 ? 24 ARG A CG   1  
ATOM 288   C CD   . ARG A 1 24 ? 2.563   12.285  4.986   1.00 0.00 ? 24 ARG A CD   1  
ATOM 289   N NE   . ARG A 1 24 ? 2.906   13.613  4.483   1.00 0.00 ? 24 ARG A NE   1  
ATOM 290   C CZ   . ARG A 1 24 ? 2.385   14.145  3.379   1.00 0.00 ? 24 ARG A CZ   1  
ATOM 291   N NH1  . ARG A 1 24 ? 1.497   13.466  2.662   1.00 0.00 ? 24 ARG A NH1  1  
ATOM 292   N NH2  . ARG A 1 24 ? 2.751   15.359  2.991   1.00 0.00 ? 24 ARG A NH2  1  
ATOM 293   H H    . ARG A 1 24 ? 5.089   9.217   7.320   1.00 0.00 ? 24 ARG A H    1  
ATOM 294   H HA   . ARG A 1 24 ? 3.269   9.227   5.020   1.00 0.00 ? 24 ARG A HA   1  
ATOM 295   H HB2  . ARG A 1 24 ? 5.579   11.034  5.744   1.00 0.00 ? 24 ARG A HB2  1  
ATOM 296   H HB3  . ARG A 1 24 ? 4.672   11.152  4.244   1.00 0.00 ? 24 ARG A HB3  1  
ATOM 297   H HG2  . ARG A 1 24 ? 3.096   11.199  6.740   1.00 0.00 ? 24 ARG A HG2  1  
ATOM 298   H HG3  . ARG A 1 24 ? 4.114   12.603  6.414   1.00 0.00 ? 24 ARG A HG3  1  
ATOM 299   H HD2  . ARG A 1 24 ? 2.501   11.601  4.153   1.00 0.00 ? 24 ARG A HD2  1  
ATOM 300   H HD3  . ARG A 1 24 ? 1.607   12.335  5.484   1.00 0.00 ? 24 ARG A HD3  1  
ATOM 301   H HE   . ARG A 1 24 ? 3.560   14.137  4.993   1.00 0.00 ? 24 ARG A HE   1  
ATOM 302   H HH11 . ARG A 1 24 ? 1.217   12.550  2.949   1.00 0.00 ? 24 ARG A HH11 1  
ATOM 303   H HH12 . ARG A 1 24 ? 1.110   13.871  1.834   1.00 0.00 ? 24 ARG A HH12 1  
ATOM 304   H HH21 . ARG A 1 24 ? 3.419   15.875  3.528   1.00 0.00 ? 24 ARG A HH21 1  
ATOM 305   H HH22 . ARG A 1 24 ? 2.359   15.759  2.163   1.00 0.00 ? 24 ARG A HH22 1  
ATOM 306   N N    . VAL A 1 25 ? 4.670   7.851   3.528   1.00 0.00 ? 25 VAL A N    1  
ATOM 307   C CA   . VAL A 1 25 ? 5.470   7.041   2.618   1.00 0.00 ? 25 VAL A CA   1  
ATOM 308   C C    . VAL A 1 25 ? 5.140   7.360   1.163   1.00 0.00 ? 25 VAL A C    1  
ATOM 309   O O    . VAL A 1 25 ? 3.989   7.629   0.822   1.00 0.00 ? 25 VAL A O    1  
ATOM 310   C CB   . VAL A 1 25 ? 5.249   5.536   2.864   1.00 0.00 ? 25 VAL A CB   1  
ATOM 311   C CG1  . VAL A 1 25 ? 5.753   5.141   4.243   1.00 0.00 ? 25 VAL A CG1  1  
ATOM 312   C CG2  . VAL A 1 25 ? 3.779   5.179   2.703   1.00 0.00 ? 25 VAL A CG2  1  
ATOM 313   H H    . VAL A 1 25 ? 3.696   7.863   3.427   1.00 0.00 ? 25 VAL A H    1  
ATOM 314   H HA   . VAL A 1 25 ? 6.511   7.264   2.798   1.00 0.00 ? 25 VAL A HA   1  
ATOM 315   H HB   . VAL A 1 25 ? 5.814   4.985   2.128   1.00 0.00 ? 25 VAL A HB   1  
ATOM 316   H HG11 . VAL A 1 25 ? 6.226   4.171   4.189   1.00 0.00 ? 25 VAL A HG11 1  
ATOM 317   H HG12 . VAL A 1 25 ? 4.922   5.097   4.932   1.00 0.00 ? 25 VAL A HG12 1  
ATOM 318   H HG13 . VAL A 1 25 ? 6.469   5.872   4.588   1.00 0.00 ? 25 VAL A HG13 1  
ATOM 319   H HG21 . VAL A 1 25 ? 3.609   4.177   3.070   1.00 0.00 ? 25 VAL A HG21 1  
ATOM 320   H HG22 . VAL A 1 25 ? 3.508   5.230   1.659   1.00 0.00 ? 25 VAL A HG22 1  
ATOM 321   H HG23 . VAL A 1 25 ? 3.175   5.875   3.266   1.00 0.00 ? 25 VAL A HG23 1  
ATOM 322   N N    . TRP A 1 26 ? 6.159   7.328   0.310   1.00 0.00 ? 26 TRP A N    1  
ATOM 323   C CA   . TRP A 1 26 ? 5.978   7.614   -1.108  1.00 0.00 ? 26 TRP A CA   1  
ATOM 324   C C    . TRP A 1 26 ? 5.630   6.345   -1.881  1.00 0.00 ? 26 TRP A C    1  
ATOM 325   O O    . TRP A 1 26 ? 6.434   5.417   -1.963  1.00 0.00 ? 26 TRP A O    1  
ATOM 326   C CB   . TRP A 1 26 ? 7.244   8.248   -1.687  1.00 0.00 ? 26 TRP A CB   1  
ATOM 327   C CG   . TRP A 1 26 ? 7.335   9.722   -1.442  1.00 0.00 ? 26 TRP A CG   1  
ATOM 328   C CD1  . TRP A 1 26 ? 7.248   10.716  -2.375  1.00 0.00 ? 26 TRP A CD1  1  
ATOM 329   C CD2  . TRP A 1 26 ? 7.533   10.372  -0.181  1.00 0.00 ? 26 TRP A CD2  1  
ATOM 330   N NE1  . TRP A 1 26 ? 7.379   11.943  -1.771  1.00 0.00 ? 26 TRP A NE1  1  
ATOM 331   C CE2  . TRP A 1 26 ? 7.556   11.758  -0.424  1.00 0.00 ? 26 TRP A CE2  1  
ATOM 332   C CE3  . TRP A 1 26 ? 7.693   9.916   1.131   1.00 0.00 ? 26 TRP A CE3  1  
ATOM 333   C CZ2  . TRP A 1 26 ? 7.731   12.691  0.595   1.00 0.00 ? 26 TRP A CZ2  1  
ATOM 334   C CZ3  . TRP A 1 26 ? 7.868   10.842  2.141   1.00 0.00 ? 26 TRP A CZ3  1  
ATOM 335   C CH2  . TRP A 1 26 ? 7.885   12.216  1.869   1.00 0.00 ? 26 TRP A CH2  1  
ATOM 336   H H    . TRP A 1 26 ? 7.054   7.106   0.643   1.00 0.00 ? 26 TRP A H    1  
ATOM 337   H HA   . TRP A 1 26 ? 5.160   8.314   -1.202  1.00 0.00 ? 26 TRP A HA   1  
ATOM 338   H HB2  . TRP A 1 26 ? 8.108   7.781   -1.241  1.00 0.00 ? 26 TRP A HB2  1  
ATOM 339   H HB3  . TRP A 1 26 ? 7.263   8.084   -2.755  1.00 0.00 ? 26 TRP A HB3  1  
ATOM 340   H HD1  . TRP A 1 26 ? 7.098   10.547  -3.431  1.00 0.00 ? 26 TRP A HD1  1  
ATOM 341   H HE1  . TRP A 1 26 ? 7.351   12.808  -2.229  1.00 0.00 ? 26 TRP A HE1  1  
ATOM 342   H HE3  . TRP A 1 26 ? 7.683   8.860   1.360   1.00 0.00 ? 26 TRP A HE3  1  
ATOM 343   H HZ2  . TRP A 1 26 ? 7.746   13.753  0.402   1.00 0.00 ? 26 TRP A HZ2  1  
ATOM 344   H HZ3  . TRP A 1 26 ? 7.994   10.508  3.161   1.00 0.00 ? 26 TRP A HZ3  1  
ATOM 345   H HH2  . TRP A 1 26 ? 8.025   12.904  2.689   1.00 0.00 ? 26 TRP A HH2  1  
ATOM 346   N N    . VAL A 1 27 ? 4.427   6.314   -2.445  1.00 0.00 ? 27 VAL A N    1  
ATOM 347   C CA   . VAL A 1 27 ? 3.973   5.160   -3.212  1.00 0.00 ? 27 VAL A CA   1  
ATOM 348   C C    . VAL A 1 27 ? 4.511   5.202   -4.638  1.00 0.00 ? 27 VAL A C    1  
ATOM 349   O O    . VAL A 1 27 ? 4.131   6.063   -5.431  1.00 0.00 ? 27 VAL A O    1  
ATOM 350   C CB   . VAL A 1 27 ? 2.434   5.086   -3.258  1.00 0.00 ? 27 VAL A CB   1  
ATOM 351   C CG1  . VAL A 1 27 ? 1.981   3.775   -3.881  1.00 0.00 ? 27 VAL A CG1  1  
ATOM 352   C CG2  . VAL A 1 27 ? 1.850   5.254   -1.865  1.00 0.00 ? 27 VAL A CG2  1  
ATOM 353   H H    . VAL A 1 27 ? 3.831   7.086   -2.344  1.00 0.00 ? 27 VAL A H    1  
ATOM 354   H HA   . VAL A 1 27 ? 4.341   4.269   -2.723  1.00 0.00 ? 27 VAL A HA   1  
ATOM 355   H HB   . VAL A 1 27 ? 2.074   5.895   -3.876  1.00 0.00 ? 27 VAL A HB   1  
ATOM 356   H HG11 . VAL A 1 27 ? 2.562   3.577   -4.769  1.00 0.00 ? 27 VAL A HG11 1  
ATOM 357   H HG12 . VAL A 1 27 ? 0.935   3.843   -4.142  1.00 0.00 ? 27 VAL A HG12 1  
ATOM 358   H HG13 . VAL A 1 27 ? 2.123   2.972   -3.172  1.00 0.00 ? 27 VAL A HG13 1  
ATOM 359   H HG21 . VAL A 1 27 ? 2.152   4.423   -1.245  1.00 0.00 ? 27 VAL A HG21 1  
ATOM 360   H HG22 . VAL A 1 27 ? 0.772   5.284   -1.928  1.00 0.00 ? 27 VAL A HG22 1  
ATOM 361   H HG23 . VAL A 1 27 ? 2.210   6.176   -1.431  1.00 0.00 ? 27 VAL A HG23 1  
ATOM 362   N N    . ASN A 1 28 ? 5.399   4.266   -4.958  1.00 0.00 ? 28 ASN A N    1  
ATOM 363   C CA   . ASN A 1 28 ? 5.990   4.195   -6.289  1.00 0.00 ? 28 ASN A CA   1  
ATOM 364   C C    . ASN A 1 28 ? 6.744   5.479   -6.619  1.00 0.00 ? 28 ASN A C    1  
ATOM 365   O O    . ASN A 1 28 ? 6.834   5.876   -7.781  1.00 0.00 ? 28 ASN A O    1  
ATOM 366   C CB   . ASN A 1 28 ? 4.907   3.940   -7.338  1.00 0.00 ? 28 ASN A CB   1  
ATOM 367   C CG   . ASN A 1 28 ? 4.494   2.483   -7.403  1.00 0.00 ? 28 ASN A CG   1  
ATOM 368   O OD1  . ASN A 1 28 ? 4.023   1.914   -6.419  1.00 0.00 ? 28 ASN A OD1  1  
ATOM 369   N ND2  . ASN A 1 28 ? 4.673   1.869   -8.568  1.00 0.00 ? 28 ASN A ND2  1  
ATOM 370   H H    . ASN A 1 28 ? 5.662   3.607   -4.282  1.00 0.00 ? 28 ASN A H    1  
ATOM 371   H HA   . ASN A 1 28 ? 6.688   3.370   -6.298  1.00 0.00 ? 28 ASN A HA   1  
ATOM 372   H HB2  . ASN A 1 28 ? 4.035   4.531   -7.098  1.00 0.00 ? 28 ASN A HB2  1  
ATOM 373   H HB3  . ASN A 1 28 ? 5.278   4.235   -8.309  1.00 0.00 ? 28 ASN A HB3  1  
ATOM 374   H HD21 . ASN A 1 28 ? 5.053   2.385   -9.309  1.00 0.00 ? 28 ASN A HD21 1  
ATOM 375   H HD22 . ASN A 1 28 ? 4.415   0.927   -8.639  1.00 0.00 ? 28 ASN A HD22 1  
ATOM 376   N N    . GLY A 1 29 ? 7.283   6.125   -5.591  1.00 0.00 ? 29 GLY A N    1  
ATOM 377   C CA   . GLY A 1 29 ? 8.020   7.358   -5.793  1.00 0.00 ? 29 GLY A CA   1  
ATOM 378   C C    . GLY A 1 29 ? 7.182   8.436   -6.452  1.00 0.00 ? 29 GLY A C    1  
ATOM 379   O O    . GLY A 1 29 ? 7.689   9.228   -7.245  1.00 0.00 ? 29 GLY A O    1  
ATOM 380   H H    . GLY A 1 29 ? 7.179   5.762   -4.686  1.00 0.00 ? 29 GLY A H    1  
ATOM 381   H HA2  . GLY A 1 29 ? 8.365   7.720   -4.836  1.00 0.00 ? 29 GLY A HA2  1  
ATOM 382   H HA3  . GLY A 1 29 ? 8.877   7.153   -6.418  1.00 0.00 ? 29 GLY A HA3  1  
ATOM 383   N N    . VAL A 1 30 ? 5.894   8.466   -6.122  1.00 0.00 ? 30 VAL A N    1  
ATOM 384   C CA   . VAL A 1 30 ? 4.984   9.453   -6.686  1.00 0.00 ? 30 VAL A CA   1  
ATOM 385   C C    . VAL A 1 30 ? 4.682   10.560  -5.682  1.00 0.00 ? 30 VAL A C    1  
ATOM 386   O O    . VAL A 1 30 ? 5.067   11.713  -5.878  1.00 0.00 ? 30 VAL A O    1  
ATOM 387   C CB   . VAL A 1 30 ? 3.660   8.807   -7.134  1.00 0.00 ? 30 VAL A CB   1  
ATOM 388   C CG1  . VAL A 1 30 ? 2.806   9.809   -7.897  1.00 0.00 ? 30 VAL A CG1  1  
ATOM 389   C CG2  . VAL A 1 30 ? 3.928   7.571   -7.979  1.00 0.00 ? 30 VAL A CG2  1  
ATOM 390   H H    . VAL A 1 30 ? 5.550   7.807   -5.484  1.00 0.00 ? 30 VAL A H    1  
ATOM 391   H HA   . VAL A 1 30 ? 5.460   9.889   -7.554  1.00 0.00 ? 30 VAL A HA   1  
ATOM 392   H HB   . VAL A 1 30 ? 3.115   8.503   -6.252  1.00 0.00 ? 30 VAL A HB   1  
ATOM 393   H HG11 . VAL A 1 30 ? 3.204   9.934   -8.894  1.00 0.00 ? 30 VAL A HG11 1  
ATOM 394   H HG12 . VAL A 1 30 ? 2.819   10.758  -7.383  1.00 0.00 ? 30 VAL A HG12 1  
ATOM 395   H HG13 . VAL A 1 30 ? 1.791   9.445   -7.956  1.00 0.00 ? 30 VAL A HG13 1  
ATOM 396   H HG21 . VAL A 1 30 ? 3.032   6.971   -8.034  1.00 0.00 ? 30 VAL A HG21 1  
ATOM 397   H HG22 . VAL A 1 30 ? 4.722   6.993   -7.529  1.00 0.00 ? 30 VAL A HG22 1  
ATOM 398   H HG23 . VAL A 1 30 ? 4.220   7.872   -8.974  1.00 0.00 ? 30 VAL A HG23 1  
ATOM 399   N N    . LYS A 1 31 ? 3.990   10.202  -4.605  1.00 0.00 ? 31 LYS A N    1  
ATOM 400   C CA   . LYS A 1 31 ? 3.636   11.165  -3.569  1.00 0.00 ? 31 LYS A CA   1  
ATOM 401   C C    . LYS A 1 31 ? 3.519   10.482  -2.208  1.00 0.00 ? 31 LYS A C    1  
ATOM 402   O O    . LYS A 1 31 ? 3.219   9.291   -2.126  1.00 0.00 ? 31 LYS A O    1  
ATOM 403   C CB   . LYS A 1 31 ? 2.320   11.861  -3.918  1.00 0.00 ? 31 LYS A CB   1  
ATOM 404   C CG   . LYS A 1 31 ? 2.481   13.011  -4.899  1.00 0.00 ? 31 LYS A CG   1  
ATOM 405   C CD   . LYS A 1 31 ? 1.134   13.550  -5.351  1.00 0.00 ? 31 LYS A CD   1  
ATOM 406   C CE   . LYS A 1 31 ? 1.149   13.924  -6.825  1.00 0.00 ? 31 LYS A CE   1  
ATOM 407   N NZ   . LYS A 1 31 ? 0.373   15.167  -7.091  1.00 0.00 ? 31 LYS A NZ   1  
ATOM 408   H H    . LYS A 1 31 ? 3.712   9.267   -4.505  1.00 0.00 ? 31 LYS A H    1  
ATOM 409   H HA   . LYS A 1 31 ? 4.422   11.903  -3.521  1.00 0.00 ? 31 LYS A HA   1  
ATOM 410   H HB2  . LYS A 1 31 ? 1.647   11.136  -4.354  1.00 0.00 ? 31 LYS A HB2  1  
ATOM 411   H HB3  . LYS A 1 31 ? 1.879   12.249  -3.012  1.00 0.00 ? 31 LYS A HB3  1  
ATOM 412   H HG2  . LYS A 1 31 ? 3.034   13.805  -4.419  1.00 0.00 ? 31 LYS A HG2  1  
ATOM 413   H HG3  . LYS A 1 31 ? 3.027   12.660  -5.762  1.00 0.00 ? 31 LYS A HG3  1  
ATOM 414   H HD2  . LYS A 1 31 ? 0.381   12.793  -5.191  1.00 0.00 ? 31 LYS A HD2  1  
ATOM 415   H HD3  . LYS A 1 31 ? 0.895   14.428  -4.769  1.00 0.00 ? 31 LYS A HD3  1  
ATOM 416   H HE2  . LYS A 1 31 ? 2.174   14.078  -7.133  1.00 0.00 ? 31 LYS A HE2  1  
ATOM 417   H HE3  . LYS A 1 31 ? 0.721   13.113  -7.394  1.00 0.00 ? 31 LYS A HE3  1  
ATOM 418   H HZ1  . LYS A 1 31 ? -0.646  14.960  -7.084  1.00 0.00 ? 31 LYS A HZ1  1  
ATOM 419   H HZ2  . LYS A 1 31 ? 0.631   15.557  -8.020  1.00 0.00 ? 31 LYS A HZ2  1  
ATOM 420   H HZ3  . LYS A 1 31 ? 0.576   15.879  -6.360  1.00 0.00 ? 31 LYS A HZ3  1  
ATOM 421   N N    . PRO A 1 32 ? 3.755   11.232  -1.117  1.00 0.00 ? 32 PRO A N    1  
ATOM 422   C CA   . PRO A 1 32 ? 3.675   10.693  0.244   1.00 0.00 ? 32 PRO A CA   1  
ATOM 423   C C    . PRO A 1 32 ? 2.241   10.387  0.662   1.00 0.00 ? 32 PRO A C    1  
ATOM 424   O O    . PRO A 1 32 ? 1.319   11.143  0.354   1.00 0.00 ? 32 PRO A O    1  
ATOM 425   C CB   . PRO A 1 32 ? 4.255   11.817  1.105   1.00 0.00 ? 32 PRO A CB   1  
ATOM 426   C CG   . PRO A 1 32 ? 4.012   13.059  0.320   1.00 0.00 ? 32 PRO A CG   1  
ATOM 427   C CD   . PRO A 1 32 ? 4.119   12.662  -1.127  1.00 0.00 ? 32 PRO A CD   1  
ATOM 428   H HA   . PRO A 1 32 ? 4.278   9.804   0.353   1.00 0.00 ? 32 PRO A HA   1  
ATOM 429   H HB2  . PRO A 1 32 ? 3.743   11.845  2.058   1.00 0.00 ? 32 PRO A HB2  1  
ATOM 430   H HB3  . PRO A 1 32 ? 5.312   11.648  1.260   1.00 0.00 ? 32 PRO A HB3  1  
ATOM 431   H HG2  . PRO A 1 32 ? 3.024   13.441  0.532   1.00 0.00 ? 32 PRO A HG2  1  
ATOM 432   H HG3  . PRO A 1 32 ? 4.761   13.799  0.562   1.00 0.00 ? 32 PRO A HG3  1  
ATOM 433   H HD2  . PRO A 1 32 ? 3.426   13.232  -1.727  1.00 0.00 ? 32 PRO A HD2  1  
ATOM 434   H HD3  . PRO A 1 32 ? 5.130   12.799  -1.482  1.00 0.00 ? 32 PRO A HD3  1  
ATOM 435   N N    . GLY A 1 33 ? 2.060   9.275   1.366   1.00 0.00 ? 33 GLY A N    1  
ATOM 436   C CA   . GLY A 1 33 ? 0.735   8.889   1.816   1.00 0.00 ? 33 GLY A CA   1  
ATOM 437   C C    . GLY A 1 33 ? 0.727   8.412   3.254   1.00 0.00 ? 33 GLY A C    1  
ATOM 438   O O    . GLY A 1 33 ? 1.712   7.852   3.736   1.00 0.00 ? 33 GLY A O    1  
ATOM 439   H H    . GLY A 1 33 ? 2.832   8.712   1.583   1.00 0.00 ? 33 GLY A H    1  
ATOM 440   H HA2  . GLY A 1 33 ? 0.074   9.739   1.725   1.00 0.00 ? 33 GLY A HA2  1  
ATOM 441   H HA3  . GLY A 1 33 ? 0.370   8.094   1.183   1.00 0.00 ? 33 GLY A HA3  1  
ATOM 442   N N    . VAL A 1 34 ? -0.388  8.635   3.943   1.00 0.00 ? 34 VAL A N    1  
ATOM 443   C CA   . VAL A 1 34 ? -0.520  8.224   5.336   1.00 0.00 ? 34 VAL A CA   1  
ATOM 444   C C    . VAL A 1 34 ? -0.971  6.771   5.440   1.00 0.00 ? 34 VAL A C    1  
ATOM 445   O O    . VAL A 1 34 ? -2.073  6.421   5.017   1.00 0.00 ? 34 VAL A O    1  
ATOM 446   C CB   . VAL A 1 34 ? -1.523  9.115   6.092   1.00 0.00 ? 34 VAL A CB   1  
ATOM 447   C CG1  . VAL A 1 34 ? -1.499  8.804   7.580   1.00 0.00 ? 34 VAL A CG1  1  
ATOM 448   C CG2  . VAL A 1 34 ? -1.224  10.586  5.843   1.00 0.00 ? 34 VAL A CG2  1  
ATOM 449   H H    . VAL A 1 34 ? -1.139  9.085   3.505   1.00 0.00 ? 34 VAL A H    1  
ATOM 450   H HA   . VAL A 1 34 ? 0.447   8.325   5.807   1.00 0.00 ? 34 VAL A HA   1  
ATOM 451   H HB   . VAL A 1 34 ? -2.515  8.904   5.719   1.00 0.00 ? 34 VAL A HB   1  
ATOM 452   H HG11 . VAL A 1 34 ? -0.537  8.394   7.847   1.00 0.00 ? 34 VAL A HG11 1  
ATOM 453   H HG12 . VAL A 1 34 ? -2.273  8.085   7.810   1.00 0.00 ? 34 VAL A HG12 1  
ATOM 454   H HG13 . VAL A 1 34 ? -1.672  9.711   8.140   1.00 0.00 ? 34 VAL A HG13 1  
ATOM 455   H HG21 . VAL A 1 34 ? -1.080  10.750  4.785   1.00 0.00 ? 34 VAL A HG21 1  
ATOM 456   H HG22 . VAL A 1 34 ? -0.327  10.866  6.375   1.00 0.00 ? 34 VAL A HG22 1  
ATOM 457   H HG23 . VAL A 1 34 ? -2.051  11.186  6.191   1.00 0.00 ? 34 VAL A HG23 1  
ATOM 458   N N    . VAL A 1 35 ? -0.113  5.930   6.007   1.00 0.00 ? 35 VAL A N    1  
ATOM 459   C CA   . VAL A 1 35 ? -0.423  4.514   6.167   1.00 0.00 ? 35 VAL A CA   1  
ATOM 460   C C    . VAL A 1 35 ? -1.426  4.296   7.294   1.00 0.00 ? 35 VAL A C    1  
ATOM 461   O O    . VAL A 1 35 ? -1.227  4.763   8.415   1.00 0.00 ? 35 VAL A O    1  
ATOM 462   C CB   . VAL A 1 35 ? 0.845   3.690   6.457   1.00 0.00 ? 35 VAL A CB   1  
ATOM 463   C CG1  . VAL A 1 35 ? 0.535   2.202   6.422   1.00 0.00 ? 35 VAL A CG1  1  
ATOM 464   C CG2  . VAL A 1 35 ? 1.946   4.037   5.468   1.00 0.00 ? 35 VAL A CG2  1  
ATOM 465   H H    . VAL A 1 35 ? 0.750   6.269   6.325   1.00 0.00 ? 35 VAL A H    1  
ATOM 466   H HA   . VAL A 1 35 ? -0.854  4.160   5.241   1.00 0.00 ? 35 VAL A HA   1  
ATOM 467   H HB   . VAL A 1 35 ? 1.192   3.939   7.450   1.00 0.00 ? 35 VAL A HB   1  
ATOM 468   H HG11 . VAL A 1 35 ? -0.521  2.049   6.583   1.00 0.00 ? 35 VAL A HG11 1  
ATOM 469   H HG12 . VAL A 1 35 ? 1.094   1.699   7.197   1.00 0.00 ? 35 VAL A HG12 1  
ATOM 470   H HG13 . VAL A 1 35 ? 0.814   1.799   5.459   1.00 0.00 ? 35 VAL A HG13 1  
ATOM 471   H HG21 . VAL A 1 35 ? 1.506   4.409   4.554   1.00 0.00 ? 35 VAL A HG21 1  
ATOM 472   H HG22 . VAL A 1 35 ? 2.529   3.153   5.253   1.00 0.00 ? 35 VAL A HG22 1  
ATOM 473   H HG23 . VAL A 1 35 ? 2.587   4.796   5.893   1.00 0.00 ? 35 VAL A HG23 1  
ATOM 474   N N    . GLN A 1 36 ? -2.506  3.583   6.989   1.00 0.00 ? 36 GLN A N    1  
ATOM 475   C CA   . GLN A 1 36 ? -3.542  3.302   7.976   1.00 0.00 ? 36 GLN A CA   1  
ATOM 476   C C    . GLN A 1 36 ? -3.647  1.804   8.244   1.00 0.00 ? 36 GLN A C    1  
ATOM 477   O O    . GLN A 1 36 ? -3.829  1.378   9.383   1.00 0.00 ? 36 GLN A O    1  
ATOM 478   C CB   . GLN A 1 36 ? -4.891  3.845   7.499   1.00 0.00 ? 36 GLN A CB   1  
ATOM 479   C CG   . GLN A 1 36 ? -5.202  5.239   8.016   1.00 0.00 ? 36 GLN A CG   1  
ATOM 480   C CD   . GLN A 1 36 ? -5.401  5.274   9.519   1.00 0.00 ? 36 GLN A CD   1  
ATOM 481   O OE1  . GLN A 1 36 ? -6.484  4.972   10.020  1.00 0.00 ? 36 GLN A OE1  1  
ATOM 482   N NE2  . GLN A 1 36 ? -4.354  5.643   10.246  1.00 0.00 ? 36 GLN A NE2  1  
ATOM 483   H H    . GLN A 1 36 ? -2.608  3.237   6.078   1.00 0.00 ? 36 GLN A H    1  
ATOM 484   H HA   . GLN A 1 36 ? -3.267  3.801   8.895   1.00 0.00 ? 36 GLN A HA   1  
ATOM 485   H HB2  . GLN A 1 36 ? -4.891  3.876   6.420   1.00 0.00 ? 36 GLN A HB2  1  
ATOM 486   H HB3  . GLN A 1 36 ? -5.673  3.178   7.833   1.00 0.00 ? 36 GLN A HB3  1  
ATOM 487   H HG2  . GLN A 1 36 ? -4.382  5.895   7.763   1.00 0.00 ? 36 GLN A HG2  1  
ATOM 488   H HG3  . GLN A 1 36 ? -6.105  5.593   7.540   1.00 0.00 ? 36 GLN A HG3  1  
ATOM 489   H HE21 . GLN A 1 36 ? -3.522  5.869   9.779   1.00 0.00 ? 36 GLN A HE21 1  
ATOM 490   H HE22 . GLN A 1 36 ? -4.455  5.673   11.221  1.00 0.00 ? 36 GLN A HE22 1  
ATOM 491   N N    . TYR A 1 37 ? -3.533  1.010   7.183   1.00 0.00 ? 37 TYR A N    1  
ATOM 492   C CA   . TYR A 1 37 ? -3.615  -0.441  7.304   1.00 0.00 ? 37 TYR A CA   1  
ATOM 493   C C    . TYR A 1 37 ? -2.318  -1.100  6.843   1.00 0.00 ? 37 TYR A C    1  
ATOM 494   O O    . TYR A 1 37 ? -1.687  -0.649  5.889   1.00 0.00 ? 37 TYR A O    1  
ATOM 495   C CB   . TYR A 1 37 ? -4.792  -0.975  6.486   1.00 0.00 ? 37 TYR A CB   1  
ATOM 496   C CG   . TYR A 1 37 ? -5.546  -2.095  7.168   1.00 0.00 ? 37 TYR A CG   1  
ATOM 497   C CD1  . TYR A 1 37 ? -6.198  -1.884  8.376   1.00 0.00 ? 37 TYR A CD1  1  
ATOM 498   C CD2  . TYR A 1 37 ? -5.605  -3.363  6.603   1.00 0.00 ? 37 TYR A CD2  1  
ATOM 499   C CE1  . TYR A 1 37 ? -6.888  -2.904  9.003   1.00 0.00 ? 37 TYR A CE1  1  
ATOM 500   C CE2  . TYR A 1 37 ? -6.293  -4.389  7.224   1.00 0.00 ? 37 TYR A CE2  1  
ATOM 501   C CZ   . TYR A 1 37 ? -6.932  -4.154  8.423   1.00 0.00 ? 37 TYR A CZ   1  
ATOM 502   O OH   . TYR A 1 37 ? -7.618  -5.173  9.044   1.00 0.00 ? 37 TYR A OH   1  
ATOM 503   H H    . TYR A 1 37 ? -3.389  1.409   6.300   1.00 0.00 ? 37 TYR A H    1  
ATOM 504   H HA   . TYR A 1 37 ? -3.775  -0.679  8.345   1.00 0.00 ? 37 TYR A HA   1  
ATOM 505   H HB2  . TYR A 1 37 ? -5.489  -0.171  6.303   1.00 0.00 ? 37 TYR A HB2  1  
ATOM 506   H HB3  . TYR A 1 37 ? -4.425  -1.349  5.541   1.00 0.00 ? 37 TYR A HB3  1  
ATOM 507   H HD1  . TYR A 1 37 ? -6.161  -0.904  8.828   1.00 0.00 ? 37 TYR A HD1  1  
ATOM 508   H HD2  . TYR A 1 37 ? -5.103  -3.544  5.664   1.00 0.00 ? 37 TYR A HD2  1  
ATOM 509   H HE1  . TYR A 1 37 ? -7.389  -2.720  9.942   1.00 0.00 ? 37 TYR A HE1  1  
ATOM 510   H HE2  . TYR A 1 37 ? -6.327  -5.368  6.770   1.00 0.00 ? 37 TYR A HE2  1  
ATOM 511   H HH   . TYR A 1 37 ? -8.429  -4.828  9.423   1.00 0.00 ? 37 TYR A HH   1  
ATOM 512   N N    . LEU A 1 38 ? -1.930  -2.172  7.528   1.00 0.00 ? 38 LEU A N    1  
ATOM 513   C CA   . LEU A 1 38 ? -0.709  -2.893  7.189   1.00 0.00 ? 38 LEU A CA   1  
ATOM 514   C C    . LEU A 1 38 ? -0.874  -4.388  7.440   1.00 0.00 ? 38 LEU A C    1  
ATOM 515   O O    . LEU A 1 38 ? -1.237  -4.807  8.539   1.00 0.00 ? 38 LEU A O    1  
ATOM 516   C CB   . LEU A 1 38 ? 0.470   -2.354  8.001   1.00 0.00 ? 38 LEU A CB   1  
ATOM 517   C CG   . LEU A 1 38 ? 0.980   -0.979  7.568   1.00 0.00 ? 38 LEU A CG   1  
ATOM 518   C CD1  . LEU A 1 38 ? 1.514   -0.207  8.765   1.00 0.00 ? 38 LEU A CD1  1  
ATOM 519   C CD2  . LEU A 1 38 ? 2.054   -1.122  6.500   1.00 0.00 ? 38 LEU A CD2  1  
ATOM 520   H H    . LEU A 1 38 ? -2.477  -2.484  8.278   1.00 0.00 ? 38 LEU A H    1  
ATOM 521   H HA   . LEU A 1 38 ? -0.512  -2.736  6.138   1.00 0.00 ? 38 LEU A HA   1  
ATOM 522   H HB2  . LEU A 1 38 ? 0.167   -2.294  9.037   1.00 0.00 ? 38 LEU A HB2  1  
ATOM 523   H HB3  . LEU A 1 38 ? 1.285   -3.057  7.921   1.00 0.00 ? 38 LEU A HB3  1  
ATOM 524   H HG   . LEU A 1 38 ? 0.160   -0.415  7.146   1.00 0.00 ? 38 LEU A HG   1  
ATOM 525   H HD11 . LEU A 1 38 ? 2.286   0.474   8.438   1.00 0.00 ? 38 LEU A HD11 1  
ATOM 526   H HD12 . LEU A 1 38 ? 1.924   -0.899  9.485   1.00 0.00 ? 38 LEU A HD12 1  
ATOM 527   H HD13 . LEU A 1 38 ? 0.710   0.353   9.220   1.00 0.00 ? 38 LEU A HD13 1  
ATOM 528   H HD21 . LEU A 1 38 ? 1.957   -0.321  5.783   1.00 0.00 ? 38 LEU A HD21 1  
ATOM 529   H HD22 . LEU A 1 38 ? 1.939   -2.071  5.999   1.00 0.00 ? 38 LEU A HD22 1  
ATOM 530   H HD23 . LEU A 1 38 ? 3.029   -1.075  6.963   1.00 0.00 ? 38 LEU A HD23 1  
ATOM 531   N N    . GLY A 1 39 ? -0.605  -5.188  6.414   1.00 0.00 ? 39 GLY A N    1  
ATOM 532   C CA   . GLY A 1 39 ? -0.730  -6.629  6.545   1.00 0.00 ? 39 GLY A CA   1  
ATOM 533   C C    . GLY A 1 39 ? -1.267  -7.281  5.286   1.00 0.00 ? 39 GLY A C    1  
ATOM 534   O O    . GLY A 1 39 ? -0.926  -6.877  4.175   1.00 0.00 ? 39 GLY A O    1  
ATOM 535   H H    . GLY A 1 39 ? -0.320  -4.799  5.561   1.00 0.00 ? 39 GLY A H    1  
ATOM 536   H HA2  . GLY A 1 39 ? 0.243   -7.044  6.766   1.00 0.00 ? 39 GLY A HA2  1  
ATOM 537   H HA3  . GLY A 1 39 ? -1.398  -6.848  7.364   1.00 0.00 ? 39 GLY A HA3  1  
ATOM 538   N N    . GLU A 1 40 ? -2.110  -8.294  5.461   1.00 0.00 ? 40 GLU A N    1  
ATOM 539   C CA   . GLU A 1 40 ? -2.695  -9.005  4.331   1.00 0.00 ? 40 GLU A CA   1  
ATOM 540   C C    . GLU A 1 40 ? -4.092  -8.476  4.019   1.00 0.00 ? 40 GLU A C    1  
ATOM 541   O O    . GLU A 1 40 ? -4.951  -8.408  4.899   1.00 0.00 ? 40 GLU A O    1  
ATOM 542   C CB   . GLU A 1 40 ? -2.759  -10.505 4.623   1.00 0.00 ? 40 GLU A CB   1  
ATOM 543   C CG   . GLU A 1 40 ? -1.410  -11.116 4.966   1.00 0.00 ? 40 GLU A CG   1  
ATOM 544   C CD   . GLU A 1 40 ? -1.262  -11.412 6.445   1.00 0.00 ? 40 GLU A CD   1  
ATOM 545   O OE1  . GLU A 1 40 ? -1.915  -10.723 7.256   1.00 0.00 ? 40 GLU A OE1  1  
ATOM 546   O OE2  . GLU A 1 40 ? -0.492  -12.332 6.793   1.00 0.00 ? 40 GLU A OE2  1  
ATOM 547   H H    . GLU A 1 40 ? -2.342  -8.570  6.372   1.00 0.00 ? 40 GLU A H    1  
ATOM 548   H HA   . GLU A 1 40 ? -2.062  -8.841  3.473   1.00 0.00 ? 40 GLU A HA   1  
ATOM 549   H HB2  . GLU A 1 40 ? -3.427  -10.670 5.456   1.00 0.00 ? 40 GLU A HB2  1  
ATOM 550   H HB3  . GLU A 1 40 ? -3.150  -11.013 3.754   1.00 0.00 ? 40 GLU A HB3  1  
ATOM 551   H HG2  . GLU A 1 40 ? -1.298  -12.040 4.418   1.00 0.00 ? 40 GLU A HG2  1  
ATOM 552   H HG3  . GLU A 1 40 ? -0.632  -10.427 4.671   1.00 0.00 ? 40 GLU A HG3  1  
ATOM 553   N N    . THR A 1 41 ? -4.311  -8.104  2.763   1.00 0.00 ? 41 THR A N    1  
ATOM 554   C CA   . THR A 1 41 ? -5.604  -7.581  2.335   1.00 0.00 ? 41 THR A CA   1  
ATOM 555   C C    . THR A 1 41 ? -6.593  -8.715  2.088   1.00 0.00 ? 41 THR A C    1  
ATOM 556   O O    . THR A 1 41 ? -6.274  -9.886  2.288   1.00 0.00 ? 41 THR A O    1  
ATOM 557   C CB   . THR A 1 41 ? -5.443  -6.742  1.066   1.00 0.00 ? 41 THR A CB   1  
ATOM 558   O OG1  . THR A 1 41 ? -4.502  -7.334  0.190   1.00 0.00 ? 41 THR A OG1  1  
ATOM 559   C CG2  . THR A 1 41 ? -4.989  -5.325  1.340   1.00 0.00 ? 41 THR A CG2  1  
ATOM 560   H H    . THR A 1 41 ? -3.587  -8.183  2.108   1.00 0.00 ? 41 THR A H    1  
ATOM 561   H HA   . THR A 1 41 ? -5.985  -6.953  3.125   1.00 0.00 ? 41 THR A HA   1  
ATOM 562   H HB   . THR A 1 41 ? -6.396  -6.692  0.558   1.00 0.00 ? 41 THR A HB   1  
ATOM 563   H HG1  . THR A 1 41 ? -4.417  -6.795  -0.600  1.00 0.00 ? 41 THR A HG1  1  
ATOM 564   H HG21 . THR A 1 41 ? -5.844  -4.665  1.334   1.00 0.00 ? 41 THR A HG21 1  
ATOM 565   H HG22 . THR A 1 41 ? -4.291  -5.017  0.575   1.00 0.00 ? 41 THR A HG22 1  
ATOM 566   H HG23 . THR A 1 41 ? -4.508  -5.281  2.305   1.00 0.00 ? 41 THR A HG23 1  
ATOM 567   N N    . GLN A 1 42 ? -7.797  -8.358  1.650   1.00 0.00 ? 42 GLN A N    1  
ATOM 568   C CA   . GLN A 1 42 ? -8.834  -9.345  1.376   1.00 0.00 ? 42 GLN A CA   1  
ATOM 569   C C    . GLN A 1 42 ? -9.113  -9.443  -0.121  1.00 0.00 ? 42 GLN A C    1  
ATOM 570   O O    . GLN A 1 42 ? -9.460  -10.509 -0.630  1.00 0.00 ? 42 GLN A O    1  
ATOM 571   C CB   . GLN A 1 42 ? -10.120 -8.986  2.123   1.00 0.00 ? 42 GLN A CB   1  
ATOM 572   C CG   . GLN A 1 42 ? -10.016 -9.156  3.630   1.00 0.00 ? 42 GLN A CG   1  
ATOM 573   C CD   . GLN A 1 42 ? -11.246 -9.809  4.229   1.00 0.00 ? 42 GLN A CD   1  
ATOM 574   O OE1  . GLN A 1 42 ? -11.707 -10.845 3.755   1.00 0.00 ? 42 GLN A OE1  1  
ATOM 575   N NE2  . GLN A 1 42 ? -11.785 -9.201  5.280   1.00 0.00 ? 42 GLN A NE2  1  
ATOM 576   H H    . GLN A 1 42 ? -7.993  -7.408  1.509   1.00 0.00 ? 42 GLN A H    1  
ATOM 577   H HA   . GLN A 1 42 ? -8.482  -10.303 1.727   1.00 0.00 ? 42 GLN A HA   1  
ATOM 578   H HB2  . GLN A 1 42 ? -10.367 -7.955  1.914   1.00 0.00 ? 42 GLN A HB2  1  
ATOM 579   H HB3  . GLN A 1 42 ? -10.920 -9.618  1.765   1.00 0.00 ? 42 GLN A HB3  1  
ATOM 580   H HG2  . GLN A 1 42 ? -9.157  -9.772  3.851   1.00 0.00 ? 42 GLN A HG2  1  
ATOM 581   H HG3  . GLN A 1 42 ? -9.885  -8.183  4.080   1.00 0.00 ? 42 GLN A HG3  1  
ATOM 582   H HE21 . GLN A 1 42 ? -11.364 -8.377  5.605   1.00 0.00 ? 42 GLN A HE21 1  
ATOM 583   H HE22 . GLN A 1 42 ? -12.581 -9.601  5.689   1.00 0.00 ? 42 GLN A HE22 1  
ATOM 584   N N    . PHE A 1 43 ? -8.961  -8.323  -0.821  1.00 0.00 ? 43 PHE A N    1  
ATOM 585   C CA   . PHE A 1 43 ? -9.198  -8.284  -2.260  1.00 0.00 ? 43 PHE A CA   1  
ATOM 586   C C    . PHE A 1 43 ? -8.150  -9.104  -3.007  1.00 0.00 ? 43 PHE A C    1  
ATOM 587   O O    . PHE A 1 43 ? -8.431  -9.675  -4.061  1.00 0.00 ? 43 PHE A O    1  
ATOM 588   C CB   . PHE A 1 43 ? -9.189  -6.837  -2.761  1.00 0.00 ? 43 PHE A CB   1  
ATOM 589   C CG   . PHE A 1 43 ? -7.847  -6.169  -2.652  1.00 0.00 ? 43 PHE A CG   1  
ATOM 590   C CD1  . PHE A 1 43 ? -6.898  -6.327  -3.648  1.00 0.00 ? 43 PHE A CD1  1  
ATOM 591   C CD2  . PHE A 1 43 ? -7.536  -5.384  -1.553  1.00 0.00 ? 43 PHE A CD2  1  
ATOM 592   C CE1  . PHE A 1 43 ? -5.663  -5.714  -3.552  1.00 0.00 ? 43 PHE A CE1  1  
ATOM 593   C CE2  . PHE A 1 43 ? -6.303  -4.768  -1.451  1.00 0.00 ? 43 PHE A CE2  1  
ATOM 594   C CZ   . PHE A 1 43 ? -5.365  -4.933  -2.452  1.00 0.00 ? 43 PHE A CZ   1  
ATOM 595   H H    . PHE A 1 43 ? -8.684  -7.505  -0.359  1.00 0.00 ? 43 PHE A H    1  
ATOM 596   H HA   . PHE A 1 43 ? -10.171 -8.712  -2.445  1.00 0.00 ? 43 PHE A HA   1  
ATOM 597   H HB2  . PHE A 1 43 ? -9.483  -6.822  -3.800  1.00 0.00 ? 43 PHE A HB2  1  
ATOM 598   H HB3  . PHE A 1 43 ? -9.896  -6.261  -2.184  1.00 0.00 ? 43 PHE A HB3  1  
ATOM 599   H HD1  . PHE A 1 43 ? -7.129  -6.936  -4.510  1.00 0.00 ? 43 PHE A HD1  1  
ATOM 600   H HD2  . PHE A 1 43 ? -8.269  -5.255  -0.770  1.00 0.00 ? 43 PHE A HD2  1  
ATOM 601   H HE1  . PHE A 1 43 ? -4.932  -5.844  -4.337  1.00 0.00 ? 43 PHE A HE1  1  
ATOM 602   H HE2  . PHE A 1 43 ? -6.073  -4.159  -0.591  1.00 0.00 ? 43 PHE A HE2  1  
ATOM 603   H HZ   . PHE A 1 43 ? -4.402  -4.453  -2.375  1.00 0.00 ? 43 PHE A HZ   1  
ATOM 604   N N    . ALA A 1 44 ? -6.943  -9.156  -2.456  1.00 0.00 ? 44 ALA A N    1  
ATOM 605   C CA   . ALA A 1 44 ? -5.853  -9.906  -3.070  1.00 0.00 ? 44 ALA A CA   1  
ATOM 606   C C    . ALA A 1 44 ? -4.912  -10.473 -2.012  1.00 0.00 ? 44 ALA A C    1  
ATOM 607   O O    . ALA A 1 44 ? -4.729  -9.880  -0.949  1.00 0.00 ? 44 ALA A O    1  
ATOM 608   C CB   . ALA A 1 44 ? -5.088  -9.020  -4.041  1.00 0.00 ? 44 ALA A CB   1  
ATOM 609   H H    . ALA A 1 44 ? -6.780  -8.680  -1.614  1.00 0.00 ? 44 ALA A H    1  
ATOM 610   H HA   . ALA A 1 44 ? -6.286  -10.723 -3.630  1.00 0.00 ? 44 ALA A HA   1  
ATOM 611   H HB1  . ALA A 1 44 ? -4.861  -8.077  -3.567  1.00 0.00 ? 44 ALA A HB1  1  
ATOM 612   H HB2  . ALA A 1 44 ? -5.690  -8.845  -4.921  1.00 0.00 ? 44 ALA A HB2  1  
ATOM 613   H HB3  . ALA A 1 44 ? -4.168  -9.510  -4.327  1.00 0.00 ? 44 ALA A HB3  1  
ATOM 614   N N    . PRO A 1 45 ? -4.298  -11.638 -2.291  1.00 0.00 ? 45 PRO A N    1  
ATOM 615   C CA   . PRO A 1 45 ? -3.372  -12.285 -1.357  1.00 0.00 ? 45 PRO A CA   1  
ATOM 616   C C    . PRO A 1 45 ? -2.044  -11.540 -1.249  1.00 0.00 ? 45 PRO A C    1  
ATOM 617   O O    . PRO A 1 45 ? -1.914  -10.412 -1.723  1.00 0.00 ? 45 PRO A O    1  
ATOM 618   C CB   . PRO A 1 45 ? -3.160  -13.669 -1.972  1.00 0.00 ? 45 PRO A CB   1  
ATOM 619   C CG   . PRO A 1 45 ? -3.401  -13.476 -3.428  1.00 0.00 ? 45 PRO A CG   1  
ATOM 620   C CD   . PRO A 1 45 ? -4.460  -12.413 -3.536  1.00 0.00 ? 45 PRO A CD   1  
ATOM 621   H HA   . PRO A 1 45 ? -3.807  -12.386 -0.374  1.00 0.00 ? 45 PRO A HA   1  
ATOM 622   H HB2  . PRO A 1 45 ? -2.150  -14.001 -1.777  1.00 0.00 ? 45 PRO A HB2  1  
ATOM 623   H HB3  . PRO A 1 45 ? -3.864  -14.367 -1.544  1.00 0.00 ? 45 PRO A HB3  1  
ATOM 624   H HG2  . PRO A 1 45 ? -2.492  -13.149 -3.911  1.00 0.00 ? 45 PRO A HG2  1  
ATOM 625   H HG3  . PRO A 1 45 ? -3.751  -14.398 -3.867  1.00 0.00 ? 45 PRO A HG3  1  
ATOM 626   H HD2  . PRO A 1 45 ? -4.283  -11.792 -4.402  1.00 0.00 ? 45 PRO A HD2  1  
ATOM 627   H HD3  . PRO A 1 45 ? -5.441  -12.861 -3.586  1.00 0.00 ? 45 PRO A HD3  1  
ATOM 628   N N    . GLY A 1 46 ? -1.063  -12.181 -0.622  1.00 0.00 ? 46 GLY A N    1  
ATOM 629   C CA   . GLY A 1 46 ? 0.242   -11.565 -0.463  1.00 0.00 ? 46 GLY A CA   1  
ATOM 630   C C    . GLY A 1 46 ? 0.226   -10.420 0.531   1.00 0.00 ? 46 GLY A C    1  
ATOM 631   O O    . GLY A 1 46 ? -0.835  -10.016 1.005   1.00 0.00 ? 46 GLY A O    1  
ATOM 632   H H    . GLY A 1 46 ? -1.226  -13.078 -0.264  1.00 0.00 ? 46 GLY A H    1  
ATOM 633   H HA2  . GLY A 1 46 ? 0.941   -12.314 -0.123  1.00 0.00 ? 46 GLY A HA2  1  
ATOM 634   H HA3  . GLY A 1 46 ? 0.569   -11.190 -1.421  1.00 0.00 ? 46 GLY A HA3  1  
ATOM 635   N N    . GLN A 1 47 ? 1.407   -9.899  0.847   1.00 0.00 ? 47 GLN A N    1  
ATOM 636   C CA   . GLN A 1 47 ? 1.526   -8.794  1.792   1.00 0.00 ? 47 GLN A CA   1  
ATOM 637   C C    . GLN A 1 47 ? 1.083   -7.482  1.153   1.00 0.00 ? 47 GLN A C    1  
ATOM 638   O O    . GLN A 1 47 ? 1.456   -7.173  0.021   1.00 0.00 ? 47 GLN A O    1  
ATOM 639   C CB   . GLN A 1 47 ? 2.968   -8.672  2.287   1.00 0.00 ? 47 GLN A CB   1  
ATOM 640   C CG   . GLN A 1 47 ? 3.492   -9.937  2.949   1.00 0.00 ? 47 GLN A CG   1  
ATOM 641   C CD   . GLN A 1 47 ? 2.845   -10.202 4.295   1.00 0.00 ? 47 GLN A CD   1  
ATOM 642   O OE1  . GLN A 1 47 ? 1.626   -10.117 4.437   1.00 0.00 ? 47 GLN A OE1  1  
ATOM 643   N NE2  . GLN A 1 47 ? 3.661   -10.525 5.291   1.00 0.00 ? 47 GLN A NE2  1  
ATOM 644   H H    . GLN A 1 47 ? 2.217   -10.265 0.436   1.00 0.00 ? 47 GLN A H    1  
ATOM 645   H HA   . GLN A 1 47 ? 0.883   -9.006  2.633   1.00 0.00 ? 47 GLN A HA   1  
ATOM 646   H HB2  . GLN A 1 47 ? 3.607   -8.440  1.449   1.00 0.00 ? 47 GLN A HB2  1  
ATOM 647   H HB3  . GLN A 1 47 ? 3.023   -7.867  3.005   1.00 0.00 ? 47 GLN A HB3  1  
ATOM 648   H HG2  . GLN A 1 47 ? 3.293   -10.777 2.301   1.00 0.00 ? 47 GLN A HG2  1  
ATOM 649   H HG3  . GLN A 1 47 ? 4.558   -9.838  3.092   1.00 0.00 ? 47 GLN A HG3  1  
ATOM 650   H HE21 . GLN A 1 47 ? 4.623   -10.573 5.104   1.00 0.00 ? 47 GLN A HE21 1  
ATOM 651   H HE22 . GLN A 1 47 ? 3.270   -10.702 6.171   1.00 0.00 ? 47 GLN A HE22 1  
ATOM 652   N N    . TRP A 1 48 ? 0.285   -6.713  1.887   1.00 0.00 ? 48 TRP A N    1  
ATOM 653   C CA   . TRP A 1 48 ? -0.210  -5.434  1.392   1.00 0.00 ? 48 TRP A CA   1  
ATOM 654   C C    . TRP A 1 48 ? -0.072  -4.350  2.455   1.00 0.00 ? 48 TRP A C    1  
ATOM 655   O O    . TRP A 1 48 ? 0.049   -4.644  3.644   1.00 0.00 ? 48 TRP A O    1  
ATOM 656   C CB   . TRP A 1 48 ? -1.673  -5.562  0.964   1.00 0.00 ? 48 TRP A CB   1  
ATOM 657   C CG   . TRP A 1 48 ? -1.843  -6.156  -0.400  1.00 0.00 ? 48 TRP A CG   1  
ATOM 658   C CD1  . TRP A 1 48 ? -1.917  -7.482  -0.709  1.00 0.00 ? 48 TRP A CD1  1  
ATOM 659   C CD2  . TRP A 1 48 ? -1.962  -5.446  -1.638  1.00 0.00 ? 48 TRP A CD2  1  
ATOM 660   N NE1  . TRP A 1 48 ? -2.074  -7.642  -2.064  1.00 0.00 ? 48 TRP A NE1  1  
ATOM 661   C CE2  . TRP A 1 48 ? -2.104  -6.407  -2.656  1.00 0.00 ? 48 TRP A CE2  1  
ATOM 662   C CE3  . TRP A 1 48 ? -1.962  -4.092  -1.984  1.00 0.00 ? 48 TRP A CE3  1  
ATOM 663   C CZ2  . TRP A 1 48 ? -2.246  -6.057  -3.997  1.00 0.00 ? 48 TRP A CZ2  1  
ATOM 664   C CZ3  . TRP A 1 48 ? -2.103  -3.746  -3.316  1.00 0.00 ? 48 TRP A CZ3  1  
ATOM 665   C CH2  . TRP A 1 48 ? -2.243  -4.724  -4.307  1.00 0.00 ? 48 TRP A CH2  1  
ATOM 666   H H    . TRP A 1 48 ? 0.022   -7.013  2.781   1.00 0.00 ? 48 TRP A H    1  
ATOM 667   H HA   . TRP A 1 48 ? 0.384   -5.157  0.534   1.00 0.00 ? 48 TRP A HA   1  
ATOM 668   H HB2  . TRP A 1 48 ? -2.194  -6.192  1.669   1.00 0.00 ? 48 TRP A HB2  1  
ATOM 669   H HB3  . TRP A 1 48 ? -2.128  -4.583  0.960   1.00 0.00 ? 48 TRP A HB3  1  
ATOM 670   H HD1  . TRP A 1 48 ? -1.858  -8.278  0.017   1.00 0.00 ? 48 TRP A HD1  1  
ATOM 671   H HE1  . TRP A 1 48 ? -2.152  -8.501  -2.530  1.00 0.00 ? 48 TRP A HE1  1  
ATOM 672   H HE3  . TRP A 1 48 ? -1.856  -3.323  -1.234  1.00 0.00 ? 48 TRP A HE3  1  
ATOM 673   H HZ2  . TRP A 1 48 ? -2.355  -6.798  -4.774  1.00 0.00 ? 48 TRP A HZ2  1  
ATOM 674   H HZ3  . TRP A 1 48 ? -2.105  -2.704  -3.601  1.00 0.00 ? 48 TRP A HZ3  1  
ATOM 675   H HH2  . TRP A 1 48 ? -2.349  -4.407  -5.334  1.00 0.00 ? 48 TRP A HH2  1  
ATOM 676   N N    . ALA A 1 49 ? -0.091  -3.094  2.019   1.00 0.00 ? 49 ALA A N    1  
ATOM 677   C CA   . ALA A 1 49 ? 0.032   -1.966  2.934   1.00 0.00 ? 49 ALA A CA   1  
ATOM 678   C C    . ALA A 1 49 ? -0.891  -0.824  2.525   1.00 0.00 ? 49 ALA A C    1  
ATOM 679   O O    . ALA A 1 49 ? -0.640  -0.132  1.538   1.00 0.00 ? 49 ALA A O    1  
ATOM 680   C CB   . ALA A 1 49 ? 1.474   -1.487  2.990   1.00 0.00 ? 49 ALA A CB   1  
ATOM 681   H H    . ALA A 1 49 ? -0.190  -2.922  1.059   1.00 0.00 ? 49 ALA A H    1  
ATOM 682   H HA   . ALA A 1 49 ? -0.248  -2.305  3.921   1.00 0.00 ? 49 ALA A HA   1  
ATOM 683   H HB1  . ALA A 1 49 ? 1.506   -0.487  3.396   1.00 0.00 ? 49 ALA A HB1  1  
ATOM 684   H HB2  . ALA A 1 49 ? 1.892   -1.483  1.994   1.00 0.00 ? 49 ALA A HB2  1  
ATOM 685   H HB3  . ALA A 1 49 ? 2.050   -2.149  3.619   1.00 0.00 ? 49 ALA A HB3  1  
ATOM 686   N N    . GLY A 1 50 ? -1.962  -0.631  3.289   1.00 0.00 ? 50 GLY A N    1  
ATOM 687   C CA   . GLY A 1 50 ? -2.906  0.428   2.990   1.00 0.00 ? 50 GLY A CA   1  
ATOM 688   C C    . GLY A 1 50 ? -2.326  1.809   3.226   1.00 0.00 ? 50 GLY A C    1  
ATOM 689   O O    . GLY A 1 50 ? -1.719  2.065   4.266   1.00 0.00 ? 50 GLY A O    1  
ATOM 690   H H    . GLY A 1 50 ? -2.110  -1.213  4.063   1.00 0.00 ? 50 GLY A H    1  
ATOM 691   H HA2  . GLY A 1 50 ? -3.205  0.348   1.955   1.00 0.00 ? 50 GLY A HA2  1  
ATOM 692   H HA3  . GLY A 1 50 ? -3.778  0.305   3.615   1.00 0.00 ? 50 GLY A HA3  1  
ATOM 693   N N    . VAL A 1 51 ? -2.510  2.700   2.256   1.00 0.00 ? 51 VAL A N    1  
ATOM 694   C CA   . VAL A 1 51 ? -2.000  4.062   2.363   1.00 0.00 ? 51 VAL A CA   1  
ATOM 695   C C    . VAL A 1 51 ? -3.045  5.075   1.911   1.00 0.00 ? 51 VAL A C    1  
ATOM 696   O O    . VAL A 1 51 ? -3.756  4.853   0.931   1.00 0.00 ? 51 VAL A O    1  
ATOM 697   C CB   . VAL A 1 51 ? -0.721  4.250   1.525   1.00 0.00 ? 51 VAL A CB   1  
ATOM 698   C CG1  . VAL A 1 51 ? -0.088  5.603   1.813   1.00 0.00 ? 51 VAL A CG1  1  
ATOM 699   C CG2  . VAL A 1 51 ? 0.265   3.123   1.794   1.00 0.00 ? 51 VAL A CG2  1  
ATOM 700   H H    . VAL A 1 51 ? -3.001  2.435   1.451   1.00 0.00 ? 51 VAL A H    1  
ATOM 701   H HA   . VAL A 1 51 ? -1.757  4.247   3.400   1.00 0.00 ? 51 VAL A HA   1  
ATOM 702   H HB   . VAL A 1 51 ? -0.993  4.221   0.480   1.00 0.00 ? 51 VAL A HB   1  
ATOM 703   H HG11 . VAL A 1 51 ? 0.459   5.937   0.943   1.00 0.00 ? 51 VAL A HG11 1  
ATOM 704   H HG12 . VAL A 1 51 ? 0.587   5.514   2.651   1.00 0.00 ? 51 VAL A HG12 1  
ATOM 705   H HG13 . VAL A 1 51 ? -0.861  6.319   2.048   1.00 0.00 ? 51 VAL A HG13 1  
ATOM 706   H HG21 . VAL A 1 51 ? 1.273   3.493   1.682   1.00 0.00 ? 51 VAL A HG21 1  
ATOM 707   H HG22 . VAL A 1 51 ? 0.096   2.321   1.090   1.00 0.00 ? 51 VAL A HG22 1  
ATOM 708   H HG23 . VAL A 1 51 ? 0.126   2.756   2.800   1.00 0.00 ? 51 VAL A HG23 1  
ATOM 709   N N    . VAL A 1 52 ? -3.133  6.189   2.631   1.00 0.00 ? 52 VAL A N    1  
ATOM 710   C CA   . VAL A 1 52 ? -4.092  7.237   2.303   1.00 0.00 ? 52 VAL A CA   1  
ATOM 711   C C    . VAL A 1 52 ? -3.393  8.455   1.710   1.00 0.00 ? 52 VAL A C    1  
ATOM 712   O O    . VAL A 1 52 ? -2.466  9.004   2.306   1.00 0.00 ? 52 VAL A O    1  
ATOM 713   C CB   . VAL A 1 52 ? -4.895  7.673   3.543   1.00 0.00 ? 52 VAL A CB   1  
ATOM 714   C CG1  . VAL A 1 52 ? -6.019  8.617   3.147   1.00 0.00 ? 52 VAL A CG1  1  
ATOM 715   C CG2  . VAL A 1 52 ? -5.441  6.458   4.279   1.00 0.00 ? 52 VAL A CG2  1  
ATOM 716   H H    . VAL A 1 52 ? -2.539  6.308   3.402   1.00 0.00 ? 52 VAL A H    1  
ATOM 717   H HA   . VAL A 1 52 ? -4.784  6.840   1.574   1.00 0.00 ? 52 VAL A HA   1  
ATOM 718   H HB   . VAL A 1 52 ? -4.229  8.202   4.209   1.00 0.00 ? 52 VAL A HB   1  
ATOM 719   H HG11 . VAL A 1 52 ? -6.116  9.393   3.893   1.00 0.00 ? 52 VAL A HG11 1  
ATOM 720   H HG12 . VAL A 1 52 ? -6.945  8.066   3.079   1.00 0.00 ? 52 VAL A HG12 1  
ATOM 721   H HG13 . VAL A 1 52 ? -5.794  9.063   2.190   1.00 0.00 ? 52 VAL A HG13 1  
ATOM 722   H HG21 . VAL A 1 52 ? -5.517  5.627   3.595   1.00 0.00 ? 52 VAL A HG21 1  
ATOM 723   H HG22 . VAL A 1 52 ? -6.418  6.688   4.677   1.00 0.00 ? 52 VAL A HG22 1  
ATOM 724   H HG23 . VAL A 1 52 ? -4.774  6.199   5.089   1.00 0.00 ? 52 VAL A HG23 1  
ATOM 725   N N    . LEU A 1 53 ? -3.842  8.873   0.532   1.00 0.00 ? 53 LEU A N    1  
ATOM 726   C CA   . LEU A 1 53 ? -3.260  10.028  -0.144  1.00 0.00 ? 53 LEU A CA   1  
ATOM 727   C C    . LEU A 1 53 ? -3.818  11.328  0.424   1.00 0.00 ? 53 LEU A C    1  
ATOM 728   O O    . LEU A 1 53 ? -4.937  11.364  0.937   1.00 0.00 ? 53 LEU A O    1  
ATOM 729   C CB   . LEU A 1 53 ? -3.531  9.955   -1.648  1.00 0.00 ? 53 LEU A CB   1  
ATOM 730   C CG   . LEU A 1 53 ? -2.535  9.111   -2.445  1.00 0.00 ? 53 LEU A CG   1  
ATOM 731   C CD1  . LEU A 1 53 ? -3.007  8.947   -3.882  1.00 0.00 ? 53 LEU A CD1  1  
ATOM 732   C CD2  . LEU A 1 53 ? -1.152  9.742   -2.404  1.00 0.00 ? 53 LEU A CD2  1  
ATOM 733   H H    . LEU A 1 53 ? -4.584  8.394   0.105   1.00 0.00 ? 53 LEU A H    1  
ATOM 734   H HA   . LEU A 1 53 ? -2.193  10.004  0.022   1.00 0.00 ? 53 LEU A HA   1  
ATOM 735   H HB2  . LEU A 1 53 ? -4.519  9.544   -1.795  1.00 0.00 ? 53 LEU A HB2  1  
ATOM 736   H HB3  . LEU A 1 53 ? -3.515  10.959  -2.043  1.00 0.00 ? 53 LEU A HB3  1  
ATOM 737   H HG   . LEU A 1 53 ? -2.471  8.129   -2.001  1.00 0.00 ? 53 LEU A HG   1  
ATOM 738   H HD11 . LEU A 1 53 ? -2.724  7.970   -4.244  1.00 0.00 ? 53 LEU A HD11 1  
ATOM 739   H HD12 . LEU A 1 53 ? -2.548  9.707   -4.500  1.00 0.00 ? 53 LEU A HD12 1  
ATOM 740   H HD13 . LEU A 1 53 ? -4.080  9.051   -3.923  1.00 0.00 ? 53 LEU A HD13 1  
ATOM 741   H HD21 . LEU A 1 53 ? -0.583  9.310   -1.594  1.00 0.00 ? 53 LEU A HD21 1  
ATOM 742   H HD22 . LEU A 1 53 ? -1.245  10.806  -2.251  1.00 0.00 ? 53 LEU A HD22 1  
ATOM 743   H HD23 . LEU A 1 53 ? -0.643  9.556   -3.339  1.00 0.00 ? 53 LEU A HD23 1  
ATOM 744   N N    . ASP A 1 54 ? -3.032  12.395  0.328   1.00 0.00 ? 54 ASP A N    1  
ATOM 745   C CA   . ASP A 1 54 ? -3.448  13.700  0.831   1.00 0.00 ? 54 ASP A CA   1  
ATOM 746   C C    . ASP A 1 54 ? -4.596  14.263  -0.001  1.00 0.00 ? 54 ASP A C    1  
ATOM 747   O O    . ASP A 1 54 ? -5.451  14.984  0.512   1.00 0.00 ? 54 ASP A O    1  
ATOM 748   C CB   . ASP A 1 54 ? -2.268  14.673  0.820   1.00 0.00 ? 54 ASP A CB   1  
ATOM 749   C CG   . ASP A 1 54 ? -2.278  15.607  2.014   1.00 0.00 ? 54 ASP A CG   1  
ATOM 750   O OD1  . ASP A 1 54 ? -2.106  15.117  3.151   1.00 0.00 ? 54 ASP A OD1  1  
ATOM 751   O OD2  . ASP A 1 54 ? -2.456  16.827  1.813   1.00 0.00 ? 54 ASP A OD2  1  
ATOM 752   H H    . ASP A 1 54 ? -2.151  12.303  -0.092  1.00 0.00 ? 54 ASP A H    1  
ATOM 753   H HA   . ASP A 1 54 ? -3.786  13.569  1.848   1.00 0.00 ? 54 ASP A HA   1  
ATOM 754   H HB2  . ASP A 1 54 ? -1.346  14.113  0.833   1.00 0.00 ? 54 ASP A HB2  1  
ATOM 755   H HB3  . ASP A 1 54 ? -2.311  15.269  -0.080  1.00 0.00 ? 54 ASP A HB3  1  
ATOM 756   N N    . ASP A 1 55 ? -4.608  13.927  -1.287  1.00 0.00 ? 55 ASP A N    1  
ATOM 757   C CA   . ASP A 1 55 ? -5.650  14.399  -2.190  1.00 0.00 ? 55 ASP A CA   1  
ATOM 758   C C    . ASP A 1 55 ? -6.300  13.231  -2.929  1.00 0.00 ? 55 ASP A C    1  
ATOM 759   O O    . ASP A 1 55 ? -5.769  12.121  -2.940  1.00 0.00 ? 55 ASP A O    1  
ATOM 760   C CB   . ASP A 1 55 ? -5.068  15.396  -3.196  1.00 0.00 ? 55 ASP A CB   1  
ATOM 761   C CG   . ASP A 1 55 ? -5.282  16.836  -2.772  1.00 0.00 ? 55 ASP A CG   1  
ATOM 762   O OD1  . ASP A 1 55 ? -5.146  17.126  -1.564  1.00 0.00 ? 55 ASP A OD1  1  
ATOM 763   O OD2  . ASP A 1 55 ? -5.585  17.674  -3.647  1.00 0.00 ? 55 ASP A OD2  1  
ATOM 764   H H    . ASP A 1 55 ? -3.898  13.349  -1.636  1.00 0.00 ? 55 ASP A H    1  
ATOM 765   H HA   . ASP A 1 55 ? -6.402  14.898  -1.597  1.00 0.00 ? 55 ASP A HA   1  
ATOM 766   H HB2  . ASP A 1 55 ? -4.008  15.223  -3.292  1.00 0.00 ? 55 ASP A HB2  1  
ATOM 767   H HB3  . ASP A 1 55 ? -5.542  15.249  -4.155  1.00 0.00 ? 55 ASP A HB3  1  
ATOM 768   N N    . PRO A 1 56 ? -7.463  13.468  -3.560  1.00 0.00 ? 56 PRO A N    1  
ATOM 769   C CA   . PRO A 1 56 ? -8.185  12.429  -4.302  1.00 0.00 ? 56 PRO A CA   1  
ATOM 770   C C    . PRO A 1 56 ? -7.434  11.987  -5.554  1.00 0.00 ? 56 PRO A C    1  
ATOM 771   O O    . PRO A 1 56 ? -7.708  12.461  -6.656  1.00 0.00 ? 56 PRO A O    1  
ATOM 772   C CB   . PRO A 1 56 ? -9.503  13.109  -4.683  1.00 0.00 ? 56 PRO A CB   1  
ATOM 773   C CG   . PRO A 1 56 ? -9.198  14.566  -4.673  1.00 0.00 ? 56 PRO A CG   1  
ATOM 774   C CD   . PRO A 1 56 ? -8.166  14.765  -3.598  1.00 0.00 ? 56 PRO A CD   1  
ATOM 775   H HA   . PRO A 1 56 ? -8.386  11.568  -3.682  1.00 0.00 ? 56 PRO A HA   1  
ATOM 776   H HB2  . PRO A 1 56 ? -9.812  12.777  -5.663  1.00 0.00 ? 56 PRO A HB2  1  
ATOM 777   H HB3  . PRO A 1 56 ? -10.262 12.861  -3.956  1.00 0.00 ? 56 PRO A HB3  1  
ATOM 778   H HG2  . PRO A 1 56 ? -8.802  14.866  -5.632  1.00 0.00 ? 56 PRO A HG2  1  
ATOM 779   H HG3  . PRO A 1 56 ? -10.090 15.128  -4.442  1.00 0.00 ? 56 PRO A HG3  1  
ATOM 780   H HD2  . PRO A 1 56 ? -7.490  15.563  -3.865  1.00 0.00 ? 56 PRO A HD2  1  
ATOM 781   H HD3  . PRO A 1 56 ? -8.642  14.973  -2.651  1.00 0.00 ? 56 PRO A HD3  1  
ATOM 782   N N    . VAL A 1 57 ? -6.484  11.073  -5.375  1.00 0.00 ? 57 VAL A N    1  
ATOM 783   C CA   . VAL A 1 57 ? -5.693  10.565  -6.488  1.00 0.00 ? 57 VAL A CA   1  
ATOM 784   C C    . VAL A 1 57 ? -5.188  9.154   -6.206  1.00 0.00 ? 57 VAL A C    1  
ATOM 785   O O    . VAL A 1 57 ? -4.118  8.762   -6.671  1.00 0.00 ? 57 VAL A O    1  
ATOM 786   C CB   . VAL A 1 57 ? -4.489  11.479  -6.786  1.00 0.00 ? 57 VAL A CB   1  
ATOM 787   C CG1  . VAL A 1 57 ? -4.942  12.749  -7.488  1.00 0.00 ? 57 VAL A CG1  1  
ATOM 788   C CG2  . VAL A 1 57 ? -3.738  11.806  -5.505  1.00 0.00 ? 57 VAL A CG2  1  
ATOM 789   H H    . VAL A 1 57 ? -6.312  10.732  -4.472  1.00 0.00 ? 57 VAL A H    1  
ATOM 790   H HA   . VAL A 1 57 ? -6.325  10.543  -7.364  1.00 0.00 ? 57 VAL A HA   1  
ATOM 791   H HB   . VAL A 1 57 ? -3.817  10.950  -7.446  1.00 0.00 ? 57 VAL A HB   1  
ATOM 792   H HG11 . VAL A 1 57 ? -4.150  13.109  -8.128  1.00 0.00 ? 57 VAL A HG11 1  
ATOM 793   H HG12 . VAL A 1 57 ? -5.180  13.503  -6.751  1.00 0.00 ? 57 VAL A HG12 1  
ATOM 794   H HG13 . VAL A 1 57 ? -5.818  12.539  -8.083  1.00 0.00 ? 57 VAL A HG13 1  
ATOM 795   H HG21 . VAL A 1 57 ? -2.675  11.784  -5.694  1.00 0.00 ? 57 VAL A HG21 1  
ATOM 796   H HG22 . VAL A 1 57 ? -3.984  11.079  -4.746  1.00 0.00 ? 57 VAL A HG22 1  
ATOM 797   H HG23 . VAL A 1 57 ? -4.021  12.791  -5.163  1.00 0.00 ? 57 VAL A HG23 1  
ATOM 798   N N    . GLY A 1 58 ? -5.967  8.396   -5.442  1.00 0.00 ? 58 GLY A N    1  
ATOM 799   C CA   . GLY A 1 58 ? -5.582  7.036   -5.109  1.00 0.00 ? 58 GLY A CA   1  
ATOM 800   C C    . GLY A 1 58 ? -6.220  6.012   -6.027  1.00 0.00 ? 58 GLY A C    1  
ATOM 801   O O    . GLY A 1 58 ? -6.088  6.094   -7.247  1.00 0.00 ? 58 GLY A O    1  
ATOM 802   H H    . GLY A 1 58 ? -6.809  8.761   -5.099  1.00 0.00 ? 58 GLY A H    1  
ATOM 803   H HA2  . GLY A 1 58 ? -4.508  6.949   -5.184  1.00 0.00 ? 58 GLY A HA2  1  
ATOM 804   H HA3  . GLY A 1 58 ? -5.879  6.828   -4.092  1.00 0.00 ? 58 GLY A HA3  1  
ATOM 805   N N    . LYS A 1 59 ? -6.915  5.044   -5.437  1.00 0.00 ? 59 LYS A N    1  
ATOM 806   C CA   . LYS A 1 59 ? -7.576  3.999   -6.209  1.00 0.00 ? 59 LYS A CA   1  
ATOM 807   C C    . LYS A 1 59 ? -8.910  3.615   -5.575  1.00 0.00 ? 59 LYS A C    1  
ATOM 808   O O    . LYS A 1 59 ? -9.954  3.664   -6.225  1.00 0.00 ? 59 LYS A O    1  
ATOM 809   C CB   . LYS A 1 59 ? -6.675  2.767   -6.316  1.00 0.00 ? 59 LYS A CB   1  
ATOM 810   C CG   . LYS A 1 59 ? -5.817  2.749   -7.572  1.00 0.00 ? 59 LYS A CG   1  
ATOM 811   C CD   . LYS A 1 59 ? -6.023  1.472   -8.373  1.00 0.00 ? 59 LYS A CD   1  
ATOM 812   C CE   . LYS A 1 59 ? -6.062  1.751   -9.867  1.00 0.00 ? 59 LYS A CE   1  
ATOM 813   N NZ   . LYS A 1 59 ? -4.706  2.024   -10.417 1.00 0.00 ? 59 LYS A NZ   1  
ATOM 814   H H    . LYS A 1 59 ? -6.984  5.033   -4.459  1.00 0.00 ? 59 LYS A H    1  
ATOM 815   H HA   . LYS A 1 59 ? -7.761  4.386   -7.200  1.00 0.00 ? 59 LYS A HA   1  
ATOM 816   H HB2  . LYS A 1 59 ? -6.020  2.740   -5.458  1.00 0.00 ? 59 LYS A HB2  1  
ATOM 817   H HB3  . LYS A 1 59 ? -7.293  1.881   -6.313  1.00 0.00 ? 59 LYS A HB3  1  
ATOM 818   H HG2  . LYS A 1 59 ? -6.083  3.594   -8.189  1.00 0.00 ? 59 LYS A HG2  1  
ATOM 819   H HG3  . LYS A 1 59 ? -4.778  2.822   -7.287  1.00 0.00 ? 59 LYS A HG3  1  
ATOM 820   H HD2  . LYS A 1 59 ? -5.208  0.794   -8.165  1.00 0.00 ? 59 LYS A HD2  1  
ATOM 821   H HD3  . LYS A 1 59 ? -6.956  1.017   -8.075  1.00 0.00 ? 59 LYS A HD3  1  
ATOM 822   H HE2  . LYS A 1 59 ? -6.478  0.891   -10.370 1.00 0.00 ? 59 LYS A HE2  1  
ATOM 823   H HE3  . LYS A 1 59 ? -6.693  2.610   -10.042 1.00 0.00 ? 59 LYS A HE3  1  
ATOM 824   H HZ1  . LYS A 1 59 ? -4.305  1.157   -10.829 1.00 0.00 ? 59 LYS A HZ1  1  
ATOM 825   H HZ2  . LYS A 1 59 ? -4.074  2.358   -9.662  1.00 0.00 ? 59 LYS A HZ2  1  
ATOM 826   H HZ3  . LYS A 1 59 ? -4.760  2.753   -11.157 1.00 0.00 ? 59 LYS A HZ3  1  
ATOM 827   N N    . ASN A 1 60 ? -8.866  3.235   -4.302  1.00 0.00 ? 60 ASN A N    1  
ATOM 828   C CA   . ASN A 1 60 ? -10.071 2.843   -3.581  1.00 0.00 ? 60 ASN A CA   1  
ATOM 829   C C    . ASN A 1 60 ? -10.479 3.918   -2.578  1.00 0.00 ? 60 ASN A C    1  
ATOM 830   O O    . ASN A 1 60 ? -9.839  4.964   -2.480  1.00 0.00 ? 60 ASN A O    1  
ATOM 831   C CB   . ASN A 1 60 ? -9.849  1.513   -2.858  1.00 0.00 ? 60 ASN A CB   1  
ATOM 832   C CG   . ASN A 1 60 ? -9.558  0.376   -3.817  1.00 0.00 ? 60 ASN A CG   1  
ATOM 833   O OD1  . ASN A 1 60 ? -10.354 0.083   -4.710  1.00 0.00 ? 60 ASN A OD1  1  
ATOM 834   N ND2  . ASN A 1 60 ? -8.414  -0.273  -3.636  1.00 0.00 ? 60 ASN A ND2  1  
ATOM 835   H H    . ASN A 1 60 ? -8.004  3.217   -3.838  1.00 0.00 ? 60 ASN A H    1  
ATOM 836   H HA   . ASN A 1 60 ? -10.865 2.722   -4.303  1.00 0.00 ? 60 ASN A HA   1  
ATOM 837   H HB2  . ASN A 1 60 ? -9.012  1.614   -2.184  1.00 0.00 ? 60 ASN A HB2  1  
ATOM 838   H HB3  . ASN A 1 60 ? -10.735 1.266   -2.291  1.00 0.00 ? 60 ASN A HB3  1  
ATOM 839   H HD21 . ASN A 1 60 ? -7.829  0.015   -2.905  1.00 0.00 ? 60 ASN A HD21 1  
ATOM 840   H HD22 . ASN A 1 60 ? -8.201  -1.013  -4.243  1.00 0.00 ? 60 ASN A HD22 1  
ATOM 841   N N    . ASP A 1 61 ? -11.549 3.651   -1.836  1.00 0.00 ? 61 ASP A N    1  
ATOM 842   C CA   . ASP A 1 61 ? -12.043 4.595   -0.839  1.00 0.00 ? 61 ASP A CA   1  
ATOM 843   C C    . ASP A 1 61 ? -12.126 3.941   0.536   1.00 0.00 ? 61 ASP A C    1  
ATOM 844   O O    . ASP A 1 61 ? -12.989 4.280   1.345   1.00 0.00 ? 61 ASP A O    1  
ATOM 845   C CB   . ASP A 1 61 ? -13.419 5.126   -1.247  1.00 0.00 ? 61 ASP A CB   1  
ATOM 846   C CG   . ASP A 1 61 ? -14.430 4.015   -1.448  1.00 0.00 ? 61 ASP A CG   1  
ATOM 847   O OD1  . ASP A 1 61 ? -14.885 3.436   -0.439  1.00 0.00 ? 61 ASP A OD1  1  
ATOM 848   O OD2  . ASP A 1 61 ? -14.769 3.724   -2.615  1.00 0.00 ? 61 ASP A OD2  1  
ATOM 849   H H    . ASP A 1 61 ? -12.017 2.799   -1.960  1.00 0.00 ? 61 ASP A H    1  
ATOM 850   H HA   . ASP A 1 61 ? -11.349 5.420   -0.791  1.00 0.00 ? 61 ASP A HA   1  
ATOM 851   H HB2  . ASP A 1 61 ? -13.786 5.786   -0.476  1.00 0.00 ? 61 ASP A HB2  1  
ATOM 852   H HB3  . ASP A 1 61 ? -13.325 5.675   -2.173  1.00 0.00 ? 61 ASP A HB3  1  
ATOM 853   N N    . GLY A 1 62 ? -11.221 3.001   0.794   1.00 0.00 ? 62 GLY A N    1  
ATOM 854   C CA   . GLY A 1 62 ? -11.210 2.314   2.072   1.00 0.00 ? 62 GLY A CA   1  
ATOM 855   C C    . GLY A 1 62 ? -11.935 0.984   2.022   1.00 0.00 ? 62 GLY A C    1  
ATOM 856   O O    . GLY A 1 62 ? -11.584 0.051   2.745   1.00 0.00 ? 62 GLY A O    1  
ATOM 857   H H    . GLY A 1 62 ? -10.557 2.773   0.111   1.00 0.00 ? 62 GLY A H    1  
ATOM 858   H HA2  . GLY A 1 62 ? -10.184 2.143   2.366   1.00 0.00 ? 62 GLY A HA2  1  
ATOM 859   H HA3  . GLY A 1 62 ? -11.684 2.943   2.811   1.00 0.00 ? 62 GLY A HA3  1  
ATOM 860   N N    . ALA A 1 63 ? -12.949 0.897   1.168   1.00 0.00 ? 63 ALA A N    1  
ATOM 861   C CA   . ALA A 1 63 ? -13.726 -0.329  1.027   1.00 0.00 ? 63 ALA A CA   1  
ATOM 862   C C    . ALA A 1 63 ? -13.501 -0.966  -0.340  1.00 0.00 ? 63 ALA A C    1  
ATOM 863   O O    . ALA A 1 63 ? -13.738 -0.341  -1.374  1.00 0.00 ? 63 ALA A O    1  
ATOM 864   C CB   . ALA A 1 63 ? -15.206 -0.043  1.241   1.00 0.00 ? 63 ALA A CB   1  
ATOM 865   H H    . ALA A 1 63 ? -13.181 1.676   0.620   1.00 0.00 ? 63 ALA A H    1  
ATOM 866   H HA   . ALA A 1 63 ? -13.403 -1.019  1.793   1.00 0.00 ? 63 ALA A HA   1  
ATOM 867   H HB1  . ALA A 1 63 ? -15.317 0.874   1.802   1.00 0.00 ? 63 ALA A HB1  1  
ATOM 868   H HB2  . ALA A 1 63 ? -15.654 -0.857  1.790   1.00 0.00 ? 63 ALA A HB2  1  
ATOM 869   H HB3  . ALA A 1 63 ? -15.694 0.059   0.284   1.00 0.00 ? 63 ALA A HB3  1  
ATOM 870   N N    . VAL A 1 64 ? -13.044 -2.214  -0.337  1.00 0.00 ? 64 VAL A N    1  
ATOM 871   C CA   . VAL A 1 64 ? -12.787 -2.937  -1.576  1.00 0.00 ? 64 VAL A CA   1  
ATOM 872   C C    . VAL A 1 64 ? -13.490 -4.290  -1.579  1.00 0.00 ? 64 VAL A C    1  
ATOM 873   O O    . VAL A 1 64 ? -13.038 -5.236  -0.935  1.00 0.00 ? 64 VAL A O    1  
ATOM 874   C CB   . VAL A 1 64 ? -11.279 -3.155  -1.797  1.00 0.00 ? 64 VAL A CB   1  
ATOM 875   C CG1  . VAL A 1 64 ? -11.019 -3.728  -3.183  1.00 0.00 ? 64 VAL A CG1  1  
ATOM 876   C CG2  . VAL A 1 64 ? -10.516 -1.854  -1.600  1.00 0.00 ? 64 VAL A CG2  1  
ATOM 877   H H    . VAL A 1 64 ? -12.875 -2.660  0.520   1.00 0.00 ? 64 VAL A H    1  
ATOM 878   H HA   . VAL A 1 64 ? -13.167 -2.342  -2.394  1.00 0.00 ? 64 VAL A HA   1  
ATOM 879   H HB   . VAL A 1 64 ? -10.928 -3.868  -1.067  1.00 0.00 ? 64 VAL A HB   1  
ATOM 880   H HG11 . VAL A 1 64 ? -10.010 -4.110  -3.231  1.00 0.00 ? 64 VAL A HG11 1  
ATOM 881   H HG12 . VAL A 1 64 ? -11.147 -2.953  -3.923  1.00 0.00 ? 64 VAL A HG12 1  
ATOM 882   H HG13 . VAL A 1 64 ? -11.716 -4.530  -3.376  1.00 0.00 ? 64 VAL A HG13 1  
ATOM 883   H HG21 . VAL A 1 64 ? -10.155 -1.800  -0.583  1.00 0.00 ? 64 VAL A HG21 1  
ATOM 884   H HG22 . VAL A 1 64 ? -11.173 -1.019  -1.793  1.00 0.00 ? 64 VAL A HG22 1  
ATOM 885   H HG23 . VAL A 1 64 ? -9.680  -1.819  -2.282  1.00 0.00 ? 64 VAL A HG23 1  
ATOM 886   N N    . GLY A 1 65 ? -14.599 -4.374  -2.307  1.00 0.00 ? 65 GLY A N    1  
ATOM 887   C CA   . GLY A 1 65 ? -15.346 -5.615  -2.379  1.00 0.00 ? 65 GLY A CA   1  
ATOM 888   C C    . GLY A 1 65 ? -16.164 -5.874  -1.130  1.00 0.00 ? 65 GLY A C    1  
ATOM 889   O O    . GLY A 1 65 ? -16.427 -7.024  -0.778  1.00 0.00 ? 65 GLY A O    1  
ATOM 890   H H    . GLY A 1 65 ? -14.911 -3.587  -2.800  1.00 0.00 ? 65 GLY A H    1  
ATOM 891   H HA2  . GLY A 1 65 ? -16.011 -5.573  -3.229  1.00 0.00 ? 65 GLY A HA2  1  
ATOM 892   H HA3  . GLY A 1 65 ? -14.653 -6.432  -2.518  1.00 0.00 ? 65 GLY A HA3  1  
ATOM 893   N N    . GLY A 1 66 ? -16.568 -4.801  -0.457  1.00 0.00 ? 66 GLY A N    1  
ATOM 894   C CA   . GLY A 1 66 ? -17.358 -4.938  0.753   1.00 0.00 ? 66 GLY A CA   1  
ATOM 895   C C    . GLY A 1 66 ? -16.512 -4.863  2.009   1.00 0.00 ? 66 GLY A C    1  
ATOM 896   O O    . GLY A 1 66 ? -16.991 -4.445  3.063   1.00 0.00 ? 66 GLY A O    1  
ATOM 897   H H    . GLY A 1 66 ? -16.329 -3.909  -0.785  1.00 0.00 ? 66 GLY A H    1  
ATOM 898   H HA2  . GLY A 1 66 ? -18.095 -4.149  0.781   1.00 0.00 ? 66 GLY A HA2  1  
ATOM 899   H HA3  . GLY A 1 66 ? -17.867 -5.891  0.731   1.00 0.00 ? 66 GLY A HA3  1  
ATOM 900   N N    . VAL A 1 67 ? -15.252 -5.269  1.896   1.00 0.00 ? 67 VAL A N    1  
ATOM 901   C CA   . VAL A 1 67 ? -14.338 -5.245  3.032   1.00 0.00 ? 67 VAL A CA   1  
ATOM 902   C C    . VAL A 1 67 ? -13.825 -3.835  3.295   1.00 0.00 ? 67 VAL A C    1  
ATOM 903   O O    . VAL A 1 67 ? -13.227 -3.207  2.422   1.00 0.00 ? 67 VAL A O    1  
ATOM 904   C CB   . VAL A 1 67 ? -13.136 -6.182  2.804   1.00 0.00 ? 67 VAL A CB   1  
ATOM 905   C CG1  . VAL A 1 67 ? -12.302 -6.299  4.071   1.00 0.00 ? 67 VAL A CG1  1  
ATOM 906   C CG2  . VAL A 1 67 ? -13.606 -7.551  2.338   1.00 0.00 ? 67 VAL A CG2  1  
ATOM 907   H H    . VAL A 1 67 ? -14.929 -5.591  1.029   1.00 0.00 ? 67 VAL A H    1  
ATOM 908   H HA   . VAL A 1 67 ? -14.877 -5.591  3.902   1.00 0.00 ? 67 VAL A HA   1  
ATOM 909   H HB   . VAL A 1 67 ? -12.514 -5.756  2.031   1.00 0.00 ? 67 VAL A HB   1  
ATOM 910   H HG11 . VAL A 1 67 ? -12.023 -5.312  4.411   1.00 0.00 ? 67 VAL A HG11 1  
ATOM 911   H HG12 . VAL A 1 67 ? -11.412 -6.874  3.864   1.00 0.00 ? 67 VAL A HG12 1  
ATOM 912   H HG13 . VAL A 1 67 ? -12.880 -6.794  4.838   1.00 0.00 ? 67 VAL A HG13 1  
ATOM 913   H HG21 . VAL A 1 67 ? -14.374 -7.432  1.588   1.00 0.00 ? 67 VAL A HG21 1  
ATOM 914   H HG22 . VAL A 1 67 ? -14.006 -8.099  3.178   1.00 0.00 ? 67 VAL A HG22 1  
ATOM 915   H HG23 . VAL A 1 67 ? -12.773 -8.094  1.917   1.00 0.00 ? 67 VAL A HG23 1  
ATOM 916   N N    . ARG A 1 68 ? -14.061 -3.341  4.506   1.00 0.00 ? 68 ARG A N    1  
ATOM 917   C CA   . ARG A 1 68 ? -13.623 -2.003  4.886   1.00 0.00 ? 68 ARG A CA   1  
ATOM 918   C C    . ARG A 1 68 ? -12.411 -2.069  5.810   1.00 0.00 ? 68 ARG A C    1  
ATOM 919   O O    . ARG A 1 68 ? -12.516 -2.500  6.958   1.00 0.00 ? 68 ARG A O    1  
ATOM 920   C CB   . ARG A 1 68 ? -14.764 -1.245  5.569   1.00 0.00 ? 68 ARG A CB   1  
ATOM 921   C CG   . ARG A 1 68 ? -14.986 0.151   5.011   1.00 0.00 ? 68 ARG A CG   1  
ATOM 922   C CD   . ARG A 1 68 ? -15.452 1.115   6.090   1.00 0.00 ? 68 ARG A CD   1  
ATOM 923   N NE   . ARG A 1 68 ? -16.370 2.123   5.565   1.00 0.00 ? 68 ARG A NE   1  
ATOM 924   C CZ   . ARG A 1 68 ? -15.988 3.156   4.817   1.00 0.00 ? 68 ARG A CZ   1  
ATOM 925   N NH1  . ARG A 1 68 ? -14.709 3.322   4.505   1.00 0.00 ? 68 ARG A NH1  1  
ATOM 926   N NH2  . ARG A 1 68 ? -16.888 4.027   4.380   1.00 0.00 ? 68 ARG A NH2  1  
ATOM 927   H H    . ARG A 1 68 ? -14.543 -3.890  5.161   1.00 0.00 ? 68 ARG A H    1  
ATOM 928   H HA   . ARG A 1 68 ? -13.344 -1.478  3.984   1.00 0.00 ? 68 ARG A HA   1  
ATOM 929   H HB2  . ARG A 1 68 ? -15.679 -1.809  5.447   1.00 0.00 ? 68 ARG A HB2  1  
ATOM 930   H HB3  . ARG A 1 68 ? -14.542 -1.156  6.625   1.00 0.00 ? 68 ARG A HB3  1  
ATOM 931   H HG2  . ARG A 1 68 ? -14.059 0.514   4.594   1.00 0.00 ? 68 ARG A HG2  1  
ATOM 932   H HG3  . ARG A 1 68 ? -15.738 0.102   4.236   1.00 0.00 ? 68 ARG A HG3  1  
ATOM 933   H HD2  . ARG A 1 68 ? -15.952 0.555   6.865   1.00 0.00 ? 68 ARG A HD2  1  
ATOM 934   H HD3  . ARG A 1 68 ? -14.587 1.612   6.507   1.00 0.00 ? 68 ARG A HD3  1  
ATOM 935   H HE   . ARG A 1 68 ? -17.321 2.025   5.780   1.00 0.00 ? 68 ARG A HE   1  
ATOM 936   H HH11 . ARG A 1 68 ? -14.025 2.670   4.832   1.00 0.00 ? 68 ARG A HH11 1  
ATOM 937   H HH12 . ARG A 1 68 ? -14.428 4.101   3.944   1.00 0.00 ? 68 ARG A HH12 1  
ATOM 938   H HH21 . ARG A 1 68 ? -17.853 3.906   4.612   1.00 0.00 ? 68 ARG A HH21 1  
ATOM 939   H HH22 . ARG A 1 68 ? -16.602 4.803   3.819   1.00 0.00 ? 68 ARG A HH22 1  
ATOM 940   N N    . TYR A 1 69 ? -11.261 -1.641  5.299   1.00 0.00 ? 69 TYR A N    1  
ATOM 941   C CA   . TYR A 1 69 ? -10.029 -1.652  6.079   1.00 0.00 ? 69 TYR A CA   1  
ATOM 942   C C    . TYR A 1 69 ? -9.927  -0.409  6.956   1.00 0.00 ? 69 TYR A C    1  
ATOM 943   O O    . TYR A 1 69 ? -9.974  -0.498  8.183   1.00 0.00 ? 69 TYR A O    1  
ATOM 944   C CB   . TYR A 1 69 ? -8.814  -1.737  5.152   1.00 0.00 ? 69 TYR A CB   1  
ATOM 945   C CG   . TYR A 1 69 ? -8.935  -2.809  4.093   1.00 0.00 ? 69 TYR A CG   1  
ATOM 946   C CD1  . TYR A 1 69 ? -9.604  -2.564  2.901   1.00 0.00 ? 69 TYR A CD1  1  
ATOM 947   C CD2  . TYR A 1 69 ? -8.378  -4.068  4.286   1.00 0.00 ? 69 TYR A CD2  1  
ATOM 948   C CE1  . TYR A 1 69 ? -9.716  -3.542  1.930   1.00 0.00 ? 69 TYR A CE1  1  
ATOM 949   C CE2  . TYR A 1 69 ? -8.486  -5.050  3.320   1.00 0.00 ? 69 TYR A CE2  1  
ATOM 950   C CZ   . TYR A 1 69 ? -9.155  -4.784  2.145   1.00 0.00 ? 69 TYR A CZ   1  
ATOM 951   O OH   . TYR A 1 69 ? -9.264  -5.760  1.182   1.00 0.00 ? 69 TYR A OH   1  
ATOM 952   H H    . TYR A 1 69 ? -11.240 -1.310  4.378   1.00 0.00 ? 69 TYR A H    1  
ATOM 953   H HA   . TYR A 1 69 ? -10.045 -2.526  6.714   1.00 0.00 ? 69 TYR A HA   1  
ATOM 954   H HB2  . TYR A 1 69 ? -8.688  -0.789  4.649   1.00 0.00 ? 69 TYR A HB2  1  
ATOM 955   H HB3  . TYR A 1 69 ? -7.934  -1.947  5.741   1.00 0.00 ? 69 TYR A HB3  1  
ATOM 956   H HD1  . TYR A 1 69 ? -10.043 -1.591  2.735   1.00 0.00 ? 69 TYR A HD1  1  
ATOM 957   H HD2  . TYR A 1 69 ? -7.855  -4.274  5.208   1.00 0.00 ? 69 TYR A HD2  1  
ATOM 958   H HE1  . TYR A 1 69 ? -10.240 -3.333  1.011   1.00 0.00 ? 69 TYR A HE1  1  
ATOM 959   H HE2  . TYR A 1 69 ? -8.046  -6.023  3.489   1.00 0.00 ? 69 TYR A HE2  1  
ATOM 960   H HH   . TYR A 1 69 ? -10.139 -5.725  0.789   1.00 0.00 ? 69 TYR A HH   1  
ATOM 961   N N    . PHE A 1 70 ? -9.786  0.750   6.320   1.00 0.00 ? 70 PHE A N    1  
ATOM 962   C CA   . PHE A 1 70 ? -9.677  2.011   7.042   1.00 0.00 ? 70 PHE A CA   1  
ATOM 963   C C    . PHE A 1 70 ? -10.732 3.003   6.566   1.00 0.00 ? 70 PHE A C    1  
ATOM 964   O O    . PHE A 1 70 ? -11.306 2.847   5.488   1.00 0.00 ? 70 PHE A O    1  
ATOM 965   C CB   . PHE A 1 70 ? -8.281  2.608   6.861   1.00 0.00 ? 70 PHE A CB   1  
ATOM 966   C CG   . PHE A 1 70 ? -7.851  2.707   5.425   1.00 0.00 ? 70 PHE A CG   1  
ATOM 967   C CD1  . PHE A 1 70 ? -7.199  1.652   4.809   1.00 0.00 ? 70 PHE A CD1  1  
ATOM 968   C CD2  . PHE A 1 70 ? -8.102  3.857   4.692   1.00 0.00 ? 70 PHE A CD2  1  
ATOM 969   C CE1  . PHE A 1 70 ? -6.804  1.740   3.487   1.00 0.00 ? 70 PHE A CE1  1  
ATOM 970   C CE2  . PHE A 1 70 ? -7.709  3.951   3.370   1.00 0.00 ? 70 PHE A CE2  1  
ATOM 971   C CZ   . PHE A 1 70 ? -7.059  2.891   2.767   1.00 0.00 ? 70 PHE A CZ   1  
ATOM 972   H H    . PHE A 1 70 ? -9.754  0.755   5.340   1.00 0.00 ? 70 PHE A H    1  
ATOM 973   H HA   . PHE A 1 70 ? -9.838  1.808   8.090   1.00 0.00 ? 70 PHE A HA   1  
ATOM 974   H HB2  . PHE A 1 70 ? -8.264  3.602   7.281   1.00 0.00 ? 70 PHE A HB2  1  
ATOM 975   H HB3  . PHE A 1 70 ? -7.562  1.991   7.381   1.00 0.00 ? 70 PHE A HB3  1  
ATOM 976   H HD1  . PHE A 1 70 ? -7.000  0.751   5.371   1.00 0.00 ? 70 PHE A HD1  1  
ATOM 977   H HD2  . PHE A 1 70 ? -8.610  4.685   5.162   1.00 0.00 ? 70 PHE A HD2  1  
ATOM 978   H HE1  . PHE A 1 70 ? -6.296  0.910   3.018   1.00 0.00 ? 70 PHE A HE1  1  
ATOM 979   H HE2  . PHE A 1 70 ? -7.908  4.852   2.809   1.00 0.00 ? 70 PHE A HE2  1  
ATOM 980   H HZ   . PHE A 1 70 ? -6.751  2.962   1.734   1.00 0.00 ? 70 PHE A HZ   1  
ATOM 981   N N    . GLU A 1 71 ? -10.985 4.026   7.379   1.00 0.00 ? 71 GLU A N    1  
ATOM 982   C CA   . GLU A 1 71 ? -11.972 5.045   7.041   1.00 0.00 ? 71 GLU A CA   1  
ATOM 983   C C    . GLU A 1 71 ? -11.291 6.326   6.567   1.00 0.00 ? 71 GLU A C    1  
ATOM 984   O O    . GLU A 1 71 ? -10.534 6.949   7.311   1.00 0.00 ? 71 GLU A O    1  
ATOM 985   C CB   . GLU A 1 71 ? -12.860 5.343   8.249   1.00 0.00 ? 71 GLU A CB   1  
ATOM 986   C CG   . GLU A 1 71 ? -14.275 5.756   7.877   1.00 0.00 ? 71 GLU A CG   1  
ATOM 987   C CD   . GLU A 1 71 ? -15.051 6.308   9.057   1.00 0.00 ? 71 GLU A CD   1  
ATOM 988   O OE1  . GLU A 1 71 ? -14.629 7.345   9.611   1.00 0.00 ? 71 GLU A OE1  1  
ATOM 989   O OE2  . GLU A 1 71 ? -16.079 5.704   9.426   1.00 0.00 ? 71 GLU A OE2  1  
ATOM 990   H H    . GLU A 1 71 ? -10.495 4.096   8.224   1.00 0.00 ? 71 GLU A H    1  
ATOM 991   H HA   . GLU A 1 71 ? -12.585 4.660   6.240   1.00 0.00 ? 71 GLU A HA   1  
ATOM 992   H HB2  . GLU A 1 71 ? -12.918 4.459   8.866   1.00 0.00 ? 71 GLU A HB2  1  
ATOM 993   H HB3  . GLU A 1 71 ? -12.414 6.143   8.822   1.00 0.00 ? 71 GLU A HB3  1  
ATOM 994   H HG2  . GLU A 1 71 ? -14.225 6.516   7.111   1.00 0.00 ? 71 GLU A HG2  1  
ATOM 995   H HG3  . GLU A 1 71 ? -14.799 4.893   7.492   1.00 0.00 ? 71 GLU A HG3  1  
ATOM 996   N N    . CYS A 1 72 ? -11.567 6.712   5.326   1.00 0.00 ? 72 CYS A N    1  
ATOM 997   C CA   . CYS A 1 72 ? -10.981 7.919   4.754   1.00 0.00 ? 72 CYS A CA   1  
ATOM 998   C C    . CYS A 1 72 ? -11.741 8.350   3.502   1.00 0.00 ? 72 CYS A C    1  
ATOM 999   O O    . CYS A 1 72 ? -12.566 7.602   2.977   1.00 0.00 ? 72 CYS A O    1  
ATOM 1000  C CB   . CYS A 1 72 ? -9.507  7.683   4.415   1.00 0.00 ? 72 CYS A CB   1  
ATOM 1001  S SG   . CYS A 1 72 ? -8.361  8.219   5.707   1.00 0.00 ? 72 CYS A SG   1  
ATOM 1002  H H    . CYS A 1 72 ? -12.178 6.172   4.782   1.00 0.00 ? 72 CYS A H    1  
ATOM 1003  H HA   . CYS A 1 72 ? -11.051 8.702   5.491   1.00 0.00 ? 72 CYS A HA   1  
ATOM 1004  H HB2  . CYS A 1 72 ? -9.347  6.629   4.252   1.00 0.00 ? 72 CYS A HB2  1  
ATOM 1005  H HB3  . CYS A 1 72 ? -9.262  8.224   3.513   1.00 0.00 ? 72 CYS A HB3  1  
ATOM 1006  H HG   . CYS A 1 72 ? -7.965  9.048   5.427   1.00 0.00 ? 72 CYS A HG   1  
ATOM 1007  N N    . PRO A 1 73 ? -11.473 9.570   3.005   1.00 0.00 ? 73 PRO A N    1  
ATOM 1008  C CA   . PRO A 1 73 ? -12.136 10.100  1.808   1.00 0.00 ? 73 PRO A CA   1  
ATOM 1009  C C    . PRO A 1 73 ? -12.060 9.137   0.629   1.00 0.00 ? 73 PRO A C    1  
ATOM 1010  O O    . PRO A 1 73 ? -11.301 8.167   0.655   1.00 0.00 ? 73 PRO A O    1  
ATOM 1011  C CB   . PRO A 1 73 ? -11.354 11.379  1.504   1.00 0.00 ? 73 PRO A CB   1  
ATOM 1012  C CG   . PRO A 1 73 ? -10.789 11.799  2.817   1.00 0.00 ? 73 PRO A CG   1  
ATOM 1013  C CD   . PRO A 1 73 ? -10.502 10.528  3.569   1.00 0.00 ? 73 PRO A CD   1  
ATOM 1014  H HA   . PRO A 1 73 ? -13.169 10.344  2.006   1.00 0.00 ? 73 PRO A HA   1  
ATOM 1015  H HB2  . PRO A 1 73 ? -10.574 11.166  0.787   1.00 0.00 ? 73 PRO A HB2  1  
ATOM 1016  H HB3  . PRO A 1 73 ? -12.022 12.128  1.107   1.00 0.00 ? 73 PRO A HB3  1  
ATOM 1017  H HG2  . PRO A 1 73 ? -9.877  12.357  2.664   1.00 0.00 ? 73 PRO A HG2  1  
ATOM 1018  H HG3  . PRO A 1 73 ? -11.510 12.396  3.354   1.00 0.00 ? 73 PRO A HG3  1  
ATOM 1019  H HD2  . PRO A 1 73 ? -9.488  10.202  3.386   1.00 0.00 ? 73 PRO A HD2  1  
ATOM 1020  H HD3  . PRO A 1 73 ? -10.669 10.668  4.626   1.00 0.00 ? 73 PRO A HD3  1  
ATOM 1021  N N    . ALA A 1 74 ? -12.850 9.409   -0.403  1.00 0.00 ? 74 ALA A N    1  
ATOM 1022  C CA   . ALA A 1 74 ? -12.873 8.566   -1.593  1.00 0.00 ? 74 ALA A CA   1  
ATOM 1023  C C    . ALA A 1 74 ? -11.719 8.908   -2.529  1.00 0.00 ? 74 ALA A C    1  
ATOM 1024  O O    . ALA A 1 74 ? -11.212 10.029  -2.522  1.00 0.00 ? 74 ALA A O    1  
ATOM 1025  C CB   . ALA A 1 74 ? -14.203 8.711   -2.317  1.00 0.00 ? 74 ALA A CB   1  
ATOM 1026  H H    . ALA A 1 74 ? -13.433 10.197  -0.365  1.00 0.00 ? 74 ALA A H    1  
ATOM 1027  H HA   . ALA A 1 74 ? -12.773 7.539   -1.275  1.00 0.00 ? 74 ALA A HA   1  
ATOM 1028  H HB1  . ALA A 1 74 ? -14.048 8.596   -3.379  1.00 0.00 ? 74 ALA A HB1  1  
ATOM 1029  H HB2  . ALA A 1 74 ? -14.617 9.688   -2.116  1.00 0.00 ? 74 ALA A HB2  1  
ATOM 1030  H HB3  . ALA A 1 74 ? -14.887 7.951   -1.968  1.00 0.00 ? 74 ALA A HB3  1  
ATOM 1031  N N    . LEU A 1 75 ? -11.310 7.933   -3.335  1.00 0.00 ? 75 LEU A N    1  
ATOM 1032  C CA   . LEU A 1 75 ? -10.215 8.130   -4.278  1.00 0.00 ? 75 LEU A CA   1  
ATOM 1033  C C    . LEU A 1 75 ? -8.927  8.503   -3.549  1.00 0.00 ? 75 LEU A C    1  
ATOM 1034  O O    . LEU A 1 75 ? -8.079  9.212   -4.092  1.00 0.00 ? 75 LEU A O    1  
ATOM 1035  C CB   . LEU A 1 75 ? -10.576 9.219   -5.289  1.00 0.00 ? 75 LEU A CB   1  
ATOM 1036  C CG   . LEU A 1 75 ? -11.870 8.976   -6.067  1.00 0.00 ? 75 LEU A CG   1  
ATOM 1037  C CD1  . LEU A 1 75 ? -12.414 10.284  -6.621  1.00 0.00 ? 75 LEU A CD1  1  
ATOM 1038  C CD2  . LEU A 1 75 ? -11.636 7.975   -7.190  1.00 0.00 ? 75 LEU A CD2  1  
ATOM 1039  H H    . LEU A 1 75 ? -11.754 7.060   -3.293  1.00 0.00 ? 75 LEU A H    1  
ATOM 1040  H HA   . LEU A 1 75 ? -10.060 7.200   -4.803  1.00 0.00 ? 75 LEU A HA   1  
ATOM 1041  H HB2  . LEU A 1 75 ? -10.669 10.155  -4.759  1.00 0.00 ? 75 LEU A HB2  1  
ATOM 1042  H HB3  . LEU A 1 75 ? -9.767  9.305   -5.999  1.00 0.00 ? 75 LEU A HB3  1  
ATOM 1043  H HG   . LEU A 1 75 ? -12.612 8.563   -5.399  1.00 0.00 ? 75 LEU A HG   1  
ATOM 1044  H HD11 . LEU A 1 75 ? -13.128 10.699  -5.926  1.00 0.00 ? 75 LEU A HD11 1  
ATOM 1045  H HD12 . LEU A 1 75 ? -12.897 10.099  -7.569  1.00 0.00 ? 75 LEU A HD12 1  
ATOM 1046  H HD13 . LEU A 1 75 ? -11.600 10.981  -6.762  1.00 0.00 ? 75 LEU A HD13 1  
ATOM 1047  H HD21 . LEU A 1 75 ? -10.613 8.047   -7.527  1.00 0.00 ? 75 LEU A HD21 1  
ATOM 1048  H HD22 . LEU A 1 75 ? -12.304 8.193   -8.011  1.00 0.00 ? 75 LEU A HD22 1  
ATOM 1049  H HD23 . LEU A 1 75 ? -11.827 6.977   -6.827  1.00 0.00 ? 75 LEU A HD23 1  
ATOM 1050  N N    . GLN A 1 76 ? -8.789  8.024   -2.318  1.00 0.00 ? 76 GLN A N    1  
ATOM 1051  C CA   . GLN A 1 76 ? -7.605  8.308   -1.515  1.00 0.00 ? 76 GLN A CA   1  
ATOM 1052  C C    . GLN A 1 76 ? -7.011  7.027   -0.943  1.00 0.00 ? 76 GLN A C    1  
ATOM 1053  O O    . GLN A 1 76 ? -5.795  6.838   -0.943  1.00 0.00 ? 76 GLN A O    1  
ATOM 1054  C CB   . GLN A 1 76 ? -7.951  9.275   -0.381  1.00 0.00 ? 76 GLN A CB   1  
ATOM 1055  C CG   . GLN A 1 76 ? -8.150  10.710  -0.844  1.00 0.00 ? 76 GLN A CG   1  
ATOM 1056  C CD   . GLN A 1 76 ? -7.550  11.719  0.113   1.00 0.00 ? 76 GLN A CD   1  
ATOM 1057  O OE1  . GLN A 1 76 ? -6.938  12.703  -0.305  1.00 0.00 ? 76 GLN A OE1  1  
ATOM 1058  N NE2  . GLN A 1 76 ? -7.721  11.482  1.409   1.00 0.00 ? 76 GLN A NE2  1  
ATOM 1059  H H    . GLN A 1 76 ? -9.500  7.467   -1.940  1.00 0.00 ? 76 GLN A H    1  
ATOM 1060  H HA   . GLN A 1 76 ? -6.874  8.770   -2.159  1.00 0.00 ? 76 GLN A HA   1  
ATOM 1061  H HB2  . GLN A 1 76 ? -8.863  8.943   0.094   1.00 0.00 ? 76 GLN A HB2  1  
ATOM 1062  H HB3  . GLN A 1 76 ? -7.152  9.262   0.344   1.00 0.00 ? 76 GLN A HB3  1  
ATOM 1063  H HG2  . GLN A 1 76 ? -7.683  10.831  -1.810  1.00 0.00 ? 76 GLN A HG2  1  
ATOM 1064  H HG3  . GLN A 1 76 ? -9.210  10.903  -0.931  1.00 0.00 ? 76 GLN A HG3  1  
ATOM 1065  H HE21 . GLN A 1 76 ? -8.218  10.678  1.671   1.00 0.00 ? 76 GLN A HE21 1  
ATOM 1066  H HE22 . GLN A 1 76 ? -7.343  12.119  2.050   1.00 0.00 ? 76 GLN A HE22 1  
ATOM 1067  N N    . GLY A 1 77 ? -7.880  6.150   -0.455  1.00 0.00 ? 77 GLY A N    1  
ATOM 1068  C CA   . GLY A 1 77 ? -7.428  4.895   0.115   1.00 0.00 ? 77 GLY A CA   1  
ATOM 1069  C C    . GLY A 1 77 ? -6.817  3.972   -0.921  1.00 0.00 ? 77 GLY A C    1  
ATOM 1070  O O    . GLY A 1 77 ? -7.442  2.997   -1.339  1.00 0.00 ? 77 GLY A O    1  
ATOM 1071  H H    . GLY A 1 77 ? -8.836  6.358   -0.484  1.00 0.00 ? 77 GLY A H    1  
ATOM 1072  H HA2  . GLY A 1 77 ? -6.690  5.103   0.875   1.00 0.00 ? 77 GLY A HA2  1  
ATOM 1073  H HA3  . GLY A 1 77 ? -8.271  4.396   0.573   1.00 0.00 ? 77 GLY A HA3  1  
ATOM 1074  N N    . ILE A 1 78 ? -5.593  4.279   -1.336  1.00 0.00 ? 78 ILE A N    1  
ATOM 1075  C CA   . ILE A 1 78 ? -4.898  3.471   -2.329  1.00 0.00 ? 78 ILE A CA   1  
ATOM 1076  C C    . ILE A 1 78 ? -4.138  2.323   -1.668  1.00 0.00 ? 78 ILE A C    1  
ATOM 1077  O O    . ILE A 1 78 ? -3.507  2.503   -0.627  1.00 0.00 ? 78 ILE A O    1  
ATOM 1078  C CB   . ILE A 1 78 ? -3.912  4.320   -3.158  1.00 0.00 ? 78 ILE A CB   1  
ATOM 1079  C CG1  . ILE A 1 78 ? -3.279  3.476   -4.266  1.00 0.00 ? 78 ILE A CG1  1  
ATOM 1080  C CG2  . ILE A 1 78 ? -2.839  4.921   -2.261  1.00 0.00 ? 78 ILE A CG2  1  
ATOM 1081  C CD1  . ILE A 1 78 ? -2.871  4.282   -5.481  1.00 0.00 ? 78 ILE A CD1  1  
ATOM 1082  H H    . ILE A 1 78 ? -5.147  5.069   -0.965  1.00 0.00 ? 78 ILE A H    1  
ATOM 1083  H HA   . ILE A 1 78 ? -5.637  3.059   -3.000  1.00 0.00 ? 78 ILE A HA   1  
ATOM 1084  H HB   . ILE A 1 78 ? -4.465  5.133   -3.607  1.00 0.00 ? 78 ILE A HB   1  
ATOM 1085  H HG12 . ILE A 1 78 ? -2.395  2.991   -3.879  1.00 0.00 ? 78 ILE A HG12 1  
ATOM 1086  H HG13 . ILE A 1 78 ? -3.986  2.725   -4.586  1.00 0.00 ? 78 ILE A HG13 1  
ATOM 1087  H HG21 . ILE A 1 78 ? -2.643  5.938   -2.567  1.00 0.00 ? 78 ILE A HG21 1  
ATOM 1088  H HG22 . ILE A 1 78 ? -1.933  4.339   -2.345  1.00 0.00 ? 78 ILE A HG22 1  
ATOM 1089  H HG23 . ILE A 1 78 ? -3.180  4.912   -1.236  1.00 0.00 ? 78 ILE A HG23 1  
ATOM 1090  H HD11 . ILE A 1 78 ? -2.553  5.265   -5.171  1.00 0.00 ? 78 ILE A HD11 1  
ATOM 1091  H HD12 . ILE A 1 78 ? -3.712  4.370   -6.152  1.00 0.00 ? 78 ILE A HD12 1  
ATOM 1092  H HD13 . ILE A 1 78 ? -2.058  3.782   -5.986  1.00 0.00 ? 78 ILE A HD13 1  
ATOM 1093  N N    . PHE A 1 79 ? -4.205  1.145   -2.279  1.00 0.00 ? 79 PHE A N    1  
ATOM 1094  C CA   . PHE A 1 79 ? -3.526  -0.031  -1.749  1.00 0.00 ? 79 PHE A CA   1  
ATOM 1095  C C    . PHE A 1 79 ? -2.336  -0.413  -2.623  1.00 0.00 ? 79 PHE A C    1  
ATOM 1096  O O    . PHE A 1 79 ? -2.411  -0.355  -3.850  1.00 0.00 ? 79 PHE A O    1  
ATOM 1097  C CB   . PHE A 1 79 ? -4.499  -1.206  -1.648  1.00 0.00 ? 79 PHE A CB   1  
ATOM 1098  C CG   . PHE A 1 79 ? -5.203  -1.290  -0.324  1.00 0.00 ? 79 PHE A CG   1  
ATOM 1099  C CD1  . PHE A 1 79 ? -4.495  -1.550  0.838   1.00 0.00 ? 79 PHE A CD1  1  
ATOM 1100  C CD2  . PHE A 1 79 ? -6.575  -1.108  -0.243  1.00 0.00 ? 79 PHE A CD2  1  
ATOM 1101  C CE1  . PHE A 1 79 ? -5.141  -1.627  2.057   1.00 0.00 ? 79 PHE A CE1  1  
ATOM 1102  C CE2  . PHE A 1 79 ? -7.227  -1.185  0.974   1.00 0.00 ? 79 PHE A CE2  1  
ATOM 1103  C CZ   . PHE A 1 79 ? -6.509  -1.445  2.125   1.00 0.00 ? 79 PHE A CZ   1  
ATOM 1104  H H    . PHE A 1 79 ? -4.726  1.064   -3.106  1.00 0.00 ? 79 PHE A H    1  
ATOM 1105  H HA   . PHE A 1 79 ? -3.166  0.213   -0.760  1.00 0.00 ? 79 PHE A HA   1  
ATOM 1106  H HB2  . PHE A 1 79 ? -5.249  -1.110  -2.418  1.00 0.00 ? 79 PHE A HB2  1  
ATOM 1107  H HB3  . PHE A 1 79 ? -3.955  -2.128  -1.795  1.00 0.00 ? 79 PHE A HB3  1  
ATOM 1108  H HD1  . PHE A 1 79 ? -3.425  -1.693  0.785   1.00 0.00 ? 79 PHE A HD1  1  
ATOM 1109  H HD2  . PHE A 1 79 ? -7.137  -0.906  -1.142  1.00 0.00 ? 79 PHE A HD2  1  
ATOM 1110  H HE1  . PHE A 1 79 ? -4.577  -1.830  2.955   1.00 0.00 ? 79 PHE A HE1  1  
ATOM 1111  H HE2  . PHE A 1 79 ? -8.295  -1.040  1.025   1.00 0.00 ? 79 PHE A HE2  1  
ATOM 1112  H HZ   . PHE A 1 79 ? -7.015  -1.504  3.077   1.00 0.00 ? 79 PHE A HZ   1  
ATOM 1113  N N    . THR A 1 80 ? -1.241  -0.806  -1.982  1.00 0.00 ? 80 THR A N    1  
ATOM 1114  C CA   . THR A 1 80 ? -0.034  -1.200  -2.700  1.00 0.00 ? 80 THR A CA   1  
ATOM 1115  C C    . THR A 1 80 ? 0.871   -2.051  -1.815  1.00 0.00 ? 80 THR A C    1  
ATOM 1116  O O    . THR A 1 80 ? 0.665   -2.141  -0.605  1.00 0.00 ? 80 THR A O    1  
ATOM 1117  C CB   . THR A 1 80 ? 0.724   0.037   -3.184  1.00 0.00 ? 80 THR A CB   1  
ATOM 1118  O OG1  . THR A 1 80 ? 1.882   -0.336  -3.909  1.00 0.00 ? 80 THR A OG1  1  
ATOM 1119  C CG2  . THR A 1 80 ? 1.162   0.949   -2.059  1.00 0.00 ? 80 THR A CG2  1  
ATOM 1120  H H    . THR A 1 80 ? -1.243  -0.832  -1.003  1.00 0.00 ? 80 THR A H    1  
ATOM 1121  H HA   . THR A 1 80 ? -0.333  -1.785  -3.556  1.00 0.00 ? 80 THR A HA   1  
ATOM 1122  H HB   . THR A 1 80 ? 0.082   0.607   -3.840  1.00 0.00 ? 80 THR A HB   1  
ATOM 1123  H HG1  . THR A 1 80 ? 1.624   -0.721  -4.749  1.00 0.00 ? 80 THR A HG1  1  
ATOM 1124  H HG21 . THR A 1 80 ? 0.848   0.531   -1.113  1.00 0.00 ? 80 THR A HG21 1  
ATOM 1125  H HG22 . THR A 1 80 ? 0.712   1.923   -2.189  1.00 0.00 ? 80 THR A HG22 1  
ATOM 1126  H HG23 . THR A 1 80 ? 2.237   1.044   -2.069  1.00 0.00 ? 80 THR A HG23 1  
ATOM 1127  N N    . ARG A 1 81 ? 1.873   -2.675  -2.426  1.00 0.00 ? 81 ARG A N    1  
ATOM 1128  C CA   . ARG A 1 81 ? 2.808   -3.519  -1.691  1.00 0.00 ? 81 ARG A CA   1  
ATOM 1129  C C    . ARG A 1 81 ? 3.697   -2.677  -0.776  1.00 0.00 ? 81 ARG A C    1  
ATOM 1130  O O    . ARG A 1 81 ? 4.090   -1.566  -1.132  1.00 0.00 ? 81 ARG A O    1  
ATOM 1131  C CB   . ARG A 1 81 ? 3.672   -4.323  -2.664  1.00 0.00 ? 81 ARG A CB   1  
ATOM 1132  C CG   . ARG A 1 81 ? 2.875   -5.273  -3.544  1.00 0.00 ? 81 ARG A CG   1  
ATOM 1133  C CD   . ARG A 1 81 ? 3.453   -5.349  -4.947  1.00 0.00 ? 81 ARG A CD   1  
ATOM 1134  N NE   . ARG A 1 81 ? 2.421   -5.591  -5.953  1.00 0.00 ? 81 ARG A NE   1  
ATOM 1135  C CZ   . ARG A 1 81 ? 1.595   -4.652  -6.407  1.00 0.00 ? 81 ARG A CZ   1  
ATOM 1136  N NH1  . ARG A 1 81 ? 1.677   -3.408  -5.951  1.00 0.00 ? 81 ARG A NH1  1  
ATOM 1137  N NH2  . ARG A 1 81 ? 0.684   -4.957  -7.322  1.00 0.00 ? 81 ARG A NH2  1  
ATOM 1138  H H    . ARG A 1 81 ? 1.986   -2.565  -3.393  1.00 0.00 ? 81 ARG A H    1  
ATOM 1139  H HA   . ARG A 1 81 ? 2.231   -4.202  -1.086  1.00 0.00 ? 81 ARG A HA   1  
ATOM 1140  H HB2  . ARG A 1 81 ? 4.209   -3.638  -3.302  1.00 0.00 ? 81 ARG A HB2  1  
ATOM 1141  H HB3  . ARG A 1 81 ? 4.384   -4.905  -2.096  1.00 0.00 ? 81 ARG A HB3  1  
ATOM 1142  H HG2  . ARG A 1 81 ? 2.894   -6.258  -3.103  1.00 0.00 ? 81 ARG A HG2  1  
ATOM 1143  H HG3  . ARG A 1 81 ? 1.855   -4.921  -3.602  1.00 0.00 ? 81 ARG A HG3  1  
ATOM 1144  H HD2  . ARG A 1 81 ? 3.948   -4.417  -5.171  1.00 0.00 ? 81 ARG A HD2  1  
ATOM 1145  H HD3  . ARG A 1 81 ? 4.173   -6.155  -4.982  1.00 0.00 ? 81 ARG A HD3  1  
ATOM 1146  H HE   . ARG A 1 81 ? 2.338   -6.501  -6.306  1.00 0.00 ? 81 ARG A HE   1  
ATOM 1147  H HH11 . ARG A 1 81 ? 2.361   -3.172  -5.262  1.00 0.00 ? 81 ARG A HH11 1  
ATOM 1148  H HH12 . ARG A 1 81 ? 1.053   -2.707  -6.297  1.00 0.00 ? 81 ARG A HH12 1  
ATOM 1149  H HH21 . ARG A 1 81 ? 0.618   -5.892  -7.669  1.00 0.00 ? 81 ARG A HH21 1  
ATOM 1150  H HH22 . ARG A 1 81 ? 0.063   -4.251  -7.664  1.00 0.00 ? 81 ARG A HH22 1  
ATOM 1151  N N    . PRO A 1 82 ? 4.029   -3.199  0.419   1.00 0.00 ? 82 PRO A N    1  
ATOM 1152  C CA   . PRO A 1 82 ? 4.876   -2.485  1.381   1.00 0.00 ? 82 PRO A CA   1  
ATOM 1153  C C    . PRO A 1 82 ? 6.191   -2.024  0.763   1.00 0.00 ? 82 PRO A C    1  
ATOM 1154  O O    . PRO A 1 82 ? 6.631   -0.896  0.986   1.00 0.00 ? 82 PRO A O    1  
ATOM 1155  C CB   . PRO A 1 82 ? 5.135   -3.529  2.472   1.00 0.00 ? 82 PRO A CB   1  
ATOM 1156  C CG   . PRO A 1 82 ? 3.984   -4.468  2.379   1.00 0.00 ? 82 PRO A CG   1  
ATOM 1157  C CD   . PRO A 1 82 ? 3.606   -4.517  0.926   1.00 0.00 ? 82 PRO A CD   1  
ATOM 1158  H HA   . PRO A 1 82 ? 4.362   -1.636  1.806   1.00 0.00 ? 82 PRO A HA   1  
ATOM 1159  H HB2  . PRO A 1 82 ? 6.073   -4.030  2.277   1.00 0.00 ? 82 PRO A HB2  1  
ATOM 1160  H HB3  . PRO A 1 82 ? 5.173   -3.043  3.435   1.00 0.00 ? 82 PRO A HB3  1  
ATOM 1161  H HG2  . PRO A 1 82 ? 4.281   -5.447  2.724   1.00 0.00 ? 82 PRO A HG2  1  
ATOM 1162  H HG3  . PRO A 1 82 ? 3.159   -4.096  2.969   1.00 0.00 ? 82 PRO A HG3  1  
ATOM 1163  H HD2  . PRO A 1 82 ? 4.139   -5.312  0.424   1.00 0.00 ? 82 PRO A HD2  1  
ATOM 1164  H HD3  . PRO A 1 82 ? 2.539   -4.648  0.817   1.00 0.00 ? 82 PRO A HD3  1  
ATOM 1165  N N    . SER A 1 83 ? 6.813   -2.903  -0.015  1.00 0.00 ? 83 SER A N    1  
ATOM 1166  C CA   . SER A 1 83 ? 8.079   -2.587  -0.666  1.00 0.00 ? 83 SER A CA   1  
ATOM 1167  C C    . SER A 1 83 ? 7.930   -1.382  -1.590  1.00 0.00 ? 83 SER A C    1  
ATOM 1168  O O    . SER A 1 83 ? 8.856   -0.585  -1.742  1.00 0.00 ? 83 SER A O    1  
ATOM 1169  C CB   . SER A 1 83 ? 8.585   -3.793  -1.460  1.00 0.00 ? 83 SER A CB   1  
ATOM 1170  O OG   . SER A 1 83 ? 7.576   -4.299  -2.316  1.00 0.00 ? 83 SER A OG   1  
ATOM 1171  H H    . SER A 1 83 ? 6.413   -3.787  -0.154  1.00 0.00 ? 83 SER A H    1  
ATOM 1172  H HA   . SER A 1 83 ? 8.797   -2.348  0.104   1.00 0.00 ? 83 SER A HA   1  
ATOM 1173  H HB2  . SER A 1 83 ? 9.433   -3.497  -2.060  1.00 0.00 ? 83 SER A HB2  1  
ATOM 1174  H HB3  . SER A 1 83 ? 8.883   -4.572  -0.774  1.00 0.00 ? 83 SER A HB3  1  
ATOM 1175  H HG   . SER A 1 83 ? 7.820   -5.179  -2.612  1.00 0.00 ? 83 SER A HG   1  
ATOM 1176  N N    . LYS A 1 84 ? 6.759   -1.256  -2.206  1.00 0.00 ? 84 LYS A N    1  
ATOM 1177  C CA   . LYS A 1 84 ? 6.488   -0.148  -3.114  1.00 0.00 ? 84 LYS A CA   1  
ATOM 1178  C C    . LYS A 1 84 ? 6.582   1.188   -2.387  1.00 0.00 ? 84 LYS A C    1  
ATOM 1179  O O    . LYS A 1 84 ? 6.942   2.205   -2.980  1.00 0.00 ? 84 LYS A O    1  
ATOM 1180  C CB   . LYS A 1 84 ? 5.103   -0.304  -3.743  1.00 0.00 ? 84 LYS A CB   1  
ATOM 1181  C CG   . LYS A 1 84 ? 4.934   -1.592  -4.533  1.00 0.00 ? 84 LYS A CG   1  
ATOM 1182  C CD   . LYS A 1 84 ? 5.173   -1.370  -6.017  1.00 0.00 ? 84 LYS A CD   1  
ATOM 1183  C CE   . LYS A 1 84 ? 5.686   -2.632  -6.693  1.00 0.00 ? 84 LYS A CE   1  
ATOM 1184  N NZ   . LYS A 1 84 ? 6.076   -2.384  -8.109  1.00 0.00 ? 84 LYS A NZ   1  
ATOM 1185  H H    . LYS A 1 84 ? 6.060   -1.924  -2.043  1.00 0.00 ? 84 LYS A H    1  
ATOM 1186  H HA   . LYS A 1 84 ? 7.234   -0.173  -3.896  1.00 0.00 ? 84 LYS A HA   1  
ATOM 1187  H HB2  . LYS A 1 84 ? 4.361   -0.289  -2.959  1.00 0.00 ? 84 LYS A HB2  1  
ATOM 1188  H HB3  . LYS A 1 84 ? 4.927   0.528   -4.409  1.00 0.00 ? 84 LYS A HB3  1  
ATOM 1189  H HG2  . LYS A 1 84 ? 5.642   -2.321  -4.169  1.00 0.00 ? 84 LYS A HG2  1  
ATOM 1190  H HG3  . LYS A 1 84 ? 3.929   -1.961  -4.390  1.00 0.00 ? 84 LYS A HG3  1  
ATOM 1191  H HD2  . LYS A 1 84 ? 4.244   -1.077  -6.482  1.00 0.00 ? 84 LYS A HD2  1  
ATOM 1192  H HD3  . LYS A 1 84 ? 5.903   -0.584  -6.141  1.00 0.00 ? 84 LYS A HD3  1  
ATOM 1193  H HE2  . LYS A 1 84 ? 6.547   -2.991  -6.151  1.00 0.00 ? 84 LYS A HE2  1  
ATOM 1194  H HE3  . LYS A 1 84 ? 4.908   -3.380  -6.669  1.00 0.00 ? 84 LYS A HE3  1  
ATOM 1195  H HZ1  . LYS A 1 84 ? 7.100   -2.210  -8.172  1.00 0.00 ? 84 LYS A HZ1  1  
ATOM 1196  H HZ2  . LYS A 1 84 ? 5.571   -1.555  -8.480  1.00 0.00 ? 84 LYS A HZ2  1  
ATOM 1197  H HZ3  . LYS A 1 84 ? 5.840   -3.211  -8.695  1.00 0.00 ? 84 LYS A HZ3  1  
ATOM 1198  N N    . LEU A 1 85 ? 6.257   1.179   -1.098  1.00 0.00 ? 85 LEU A N    1  
ATOM 1199  C CA   . LEU A 1 85 ? 6.305   2.392   -0.289  1.00 0.00 ? 85 LEU A CA   1  
ATOM 1200  C C    . LEU A 1 85 ? 7.742   2.736   0.091   1.00 0.00 ? 85 LEU A C    1  
ATOM 1201  O O    . LEU A 1 85 ? 8.596   1.855   0.187   1.00 0.00 ? 85 LEU A O    1  
ATOM 1202  C CB   . LEU A 1 85 ? 5.458   2.222   0.974   1.00 0.00 ? 85 LEU A CB   1  
ATOM 1203  C CG   . LEU A 1 85 ? 4.090   1.572   0.754   1.00 0.00 ? 85 LEU A CG   1  
ATOM 1204  C CD1  . LEU A 1 85 ? 3.425   1.266   2.087   1.00 0.00 ? 85 LEU A CD1  1  
ATOM 1205  C CD2  . LEU A 1 85 ? 3.203   2.472   -0.093  1.00 0.00 ? 85 LEU A CD2  1  
ATOM 1206  H H    . LEU A 1 85 ? 5.978   0.338   -0.681  1.00 0.00 ? 85 LEU A H    1  
ATOM 1207  H HA   . LEU A 1 85 ? 5.899   3.200   -0.879  1.00 0.00 ? 85 LEU A HA   1  
ATOM 1208  H HB2  . LEU A 1 85 ? 6.013   1.617   1.675   1.00 0.00 ? 85 LEU A HB2  1  
ATOM 1209  H HB3  . LEU A 1 85 ? 5.300   3.197   1.410   1.00 0.00 ? 85 LEU A HB3  1  
ATOM 1210  H HG   . LEU A 1 85 ? 4.224   0.639   0.225   1.00 0.00 ? 85 LEU A HG   1  
ATOM 1211  H HD11 . LEU A 1 85 ? 4.178   1.192   2.857   1.00 0.00 ? 85 LEU A HD11 1  
ATOM 1212  H HD12 . LEU A 1 85 ? 2.890   0.331   2.015   1.00 0.00 ? 85 LEU A HD12 1  
ATOM 1213  H HD13 . LEU A 1 85 ? 2.733   2.058   2.334   1.00 0.00 ? 85 LEU A HD13 1  
ATOM 1214  H HD21 . LEU A 1 85 ? 2.178   2.143   -0.015  1.00 0.00 ? 85 LEU A HD21 1  
ATOM 1215  H HD22 . LEU A 1 85 ? 3.520   2.422   -1.124  1.00 0.00 ? 85 LEU A HD22 1  
ATOM 1216  H HD23 . LEU A 1 85 ? 3.284   3.490   0.260   1.00 0.00 ? 85 LEU A HD23 1  
ATOM 1217  N N    . THR A 1 86 ? 7.999   4.021   0.308   1.00 0.00 ? 86 THR A N    1  
ATOM 1218  C CA   . THR A 1 86 ? 9.332   4.481   0.679   1.00 0.00 ? 86 THR A CA   1  
ATOM 1219  C C    . THR A 1 86 ? 9.253   5.705   1.585   1.00 0.00 ? 86 THR A C    1  
ATOM 1220  O O    . THR A 1 86 ? 8.226   6.380   1.645   1.00 0.00 ? 86 THR A O    1  
ATOM 1221  C CB   . THR A 1 86 ? 10.148  4.812   -0.572  1.00 0.00 ? 86 THR A CB   1  
ATOM 1222  O OG1  . THR A 1 86 ? 9.461   5.745   -1.387  1.00 0.00 ? 86 THR A OG1  1  
ATOM 1223  C CG2  . THR A 1 86 ? 10.456  3.599   -1.424  1.00 0.00 ? 86 THR A CG2  1  
ATOM 1224  H H    . THR A 1 86 ? 7.276   4.676   0.216   1.00 0.00 ? 86 THR A H    1  
ATOM 1225  H HA   . THR A 1 86 ? 9.822   3.681   1.215   1.00 0.00 ? 86 THR A HA   1  
ATOM 1226  H HB   . THR A 1 86 ? 11.088  5.253   -0.271  1.00 0.00 ? 86 THR A HB   1  
ATOM 1227  H HG1  . THR A 1 86 ? 10.074  6.134   -2.015  1.00 0.00 ? 86 THR A HG1  1  
ATOM 1228  H HG21 . THR A 1 86 ? 9.686   3.479   -2.172  1.00 0.00 ? 86 THR A HG21 1  
ATOM 1229  H HG22 . THR A 1 86 ? 10.493  2.720   -0.798  1.00 0.00 ? 86 THR A HG22 1  
ATOM 1230  H HG23 . THR A 1 86 ? 11.411  3.734   -1.910  1.00 0.00 ? 86 THR A HG23 1  
ATOM 1231  N N    . ARG A 1 87 ? 10.344  5.983   2.293   1.00 0.00 ? 87 ARG A N    1  
ATOM 1232  C CA   . ARG A 1 87 ? 10.397  7.125   3.198   1.00 0.00 ? 87 ARG A CA   1  
ATOM 1233  C C    . ARG A 1 87 ? 11.091  8.312   2.537   1.00 0.00 ? 87 ARG A C    1  
ATOM 1234  O O    . ARG A 1 87 ? 11.758  9.102   3.205   1.00 0.00 ? 87 ARG A O    1  
ATOM 1235  C CB   . ARG A 1 87 ? 11.124  6.746   4.488   1.00 0.00 ? 87 ARG A CB   1  
ATOM 1236  C CG   . ARG A 1 87 ? 10.215  6.139   5.544   1.00 0.00 ? 87 ARG A CG   1  
ATOM 1237  C CD   . ARG A 1 87 ? 10.840  6.214   6.928   1.00 0.00 ? 87 ARG A CD   1  
ATOM 1238  N NE   . ARG A 1 87 ? 9.866   5.948   7.984   1.00 0.00 ? 87 ARG A NE   1  
ATOM 1239  C CZ   . ARG A 1 87 ? 10.070  6.232   9.268   1.00 0.00 ? 87 ARG A CZ   1  
ATOM 1240  N NH1  . ARG A 1 87 ? 11.208  6.790   9.660   1.00 0.00 ? 87 ARG A NH1  1  
ATOM 1241  N NH2  . ARG A 1 87 ? 9.132   5.957   10.164  1.00 0.00 ? 87 ARG A NH2  1  
ATOM 1242  H H    . ARG A 1 87 ? 11.131  5.407   2.204   1.00 0.00 ? 87 ARG A H    1  
ATOM 1243  H HA   . ARG A 1 87 ? 9.382   7.405   3.437   1.00 0.00 ? 87 ARG A HA   1  
ATOM 1244  H HB2  . ARG A 1 87 ? 11.898  6.028   4.254   1.00 0.00 ? 87 ARG A HB2  1  
ATOM 1245  H HB3  . ARG A 1 87 ? 11.582  7.631   4.904   1.00 0.00 ? 87 ARG A HB3  1  
ATOM 1246  H HG2  . ARG A 1 87 ? 9.280   6.678   5.553   1.00 0.00 ? 87 ARG A HG2  1  
ATOM 1247  H HG3  . ARG A 1 87 ? 10.034  5.103   5.296   1.00 0.00 ? 87 ARG A HG3  1  
ATOM 1248  H HD2  . ARG A 1 87 ? 11.634  5.483   6.991   1.00 0.00 ? 87 ARG A HD2  1  
ATOM 1249  H HD3  . ARG A 1 87 ? 11.251  7.203   7.070   1.00 0.00 ? 87 ARG A HD3  1  
ATOM 1250  H HE   . ARG A 1 87 ? 9.017   5.536   7.722   1.00 0.00 ? 87 ARG A HE   1  
ATOM 1251  H HH11 . ARG A 1 87 ? 11.920  7.000   8.989   1.00 0.00 ? 87 ARG A HH11 1  
ATOM 1252  H HH12 . ARG A 1 87 ? 11.355  7.000   10.626  1.00 0.00 ? 87 ARG A HH12 1  
ATOM 1253  H HH21 . ARG A 1 87 ? 8.271   5.537   9.874   1.00 0.00 ? 87 ARG A HH21 1  
ATOM 1254  H HH22 . ARG A 1 87 ? 9.284   6.169   11.129  1.00 0.00 ? 87 ARG A HH22 1  
ATOM 1255  N N    . GLN A 1 88 ? 10.930  8.429   1.224   1.00 0.00 ? 88 GLN A N    1  
ATOM 1256  C CA   . GLN A 1 88 ? 11.541  9.521   0.473   1.00 0.00 ? 88 GLN A CA   1  
ATOM 1257  C C    . GLN A 1 88 ? 11.124  9.471   -0.995  1.00 0.00 ? 88 GLN A C    1  
ATOM 1258  O O    . GLN A 1 88 ? 10.901  8.395   -1.550  1.00 0.00 ? 88 GLN A O    1  
ATOM 1259  C CB   . GLN A 1 88 ? 13.066  9.455   0.590   1.00 0.00 ? 88 GLN A CB   1  
ATOM 1260  C CG   . GLN A 1 88 ? 13.665  10.608  1.380   1.00 0.00 ? 88 GLN A CG   1  
ATOM 1261  C CD   . GLN A 1 88 ? 14.783  11.309  0.633   1.00 0.00 ? 88 GLN A CD   1  
ATOM 1262  O OE1  . GLN A 1 88 ? 14.748  12.525  0.438   1.00 0.00 ? 88 GLN A OE1  1  
ATOM 1263  N NE2  . GLN A 1 88 ? 15.783  10.545  0.210   1.00 0.00 ? 88 GLN A NE2  1  
ATOM 1264  H H    . GLN A 1 88 ? 10.386  7.768   0.748   1.00 0.00 ? 88 GLN A H    1  
ATOM 1265  H HA   . GLN A 1 88 ? 11.196  10.450  0.902   1.00 0.00 ? 88 GLN A HA   1  
ATOM 1266  H HB2  . GLN A 1 88 ? 13.338  8.532   1.081   1.00 0.00 ? 88 GLN A HB2  1  
ATOM 1267  H HB3  . GLN A 1 88 ? 13.495  9.465   -0.402  1.00 0.00 ? 88 GLN A HB3  1  
ATOM 1268  H HG2  . GLN A 1 88 ? 12.886  11.327  1.588   1.00 0.00 ? 88 GLN A HG2  1  
ATOM 1269  H HG3  . GLN A 1 88 ? 14.058  10.225  2.310   1.00 0.00 ? 88 GLN A HG3  1  
ATOM 1270  H HE21 . GLN A 1 88 ? 15.743  9.585   0.401   1.00 0.00 ? 88 GLN A HE21 1  
ATOM 1271  H HE22 . GLN A 1 88 ? 16.519  10.972  -0.276  1.00 0.00 ? 88 GLN A HE22 1  
ATOM 1272  N N    . PRO A 1 89 ? 11.014  10.642  -1.647  1.00 0.00 ? 89 PRO A N    1  
ATOM 1273  C CA   . PRO A 1 89 ? 10.622  10.726  -3.057  1.00 0.00 ? 89 PRO A CA   1  
ATOM 1274  C C    . PRO A 1 89 ? 11.722  10.241  -3.996  1.00 0.00 ? 89 PRO A C    1  
ATOM 1275  O O    . PRO A 1 89 ? 12.778  10.864  -4.105  1.00 0.00 ? 89 PRO A O    1  
ATOM 1276  C CB   . PRO A 1 89 ? 10.365  12.220  -3.263  1.00 0.00 ? 89 PRO A CB   1  
ATOM 1277  C CG   . PRO A 1 89 ? 11.224  12.893  -2.250  1.00 0.00 ? 89 PRO A CG   1  
ATOM 1278  C CD   . PRO A 1 89 ? 11.263  11.974  -1.061  1.00 0.00 ? 89 PRO A CD   1  
ATOM 1279  H HA   . PRO A 1 89 ? 9.716   10.172  -3.250  1.00 0.00 ? 89 PRO A HA   1  
ATOM 1280  H HB2  . PRO A 1 89 ? 10.644  12.501  -4.269  1.00 0.00 ? 89 PRO A HB2  1  
ATOM 1281  H HB3  . PRO A 1 89 ? 9.320   12.436  -3.100  1.00 0.00 ? 89 PRO A HB3  1  
ATOM 1282  H HG2  . PRO A 1 89 ? 12.219  13.035  -2.647  1.00 0.00 ? 89 PRO A HG2  1  
ATOM 1283  H HG3  . PRO A 1 89 ? 10.791  13.844  -1.975  1.00 0.00 ? 89 PRO A HG3  1  
ATOM 1284  H HD2  . PRO A 1 89 ? 12.233  12.010  -0.586  1.00 0.00 ? 89 PRO A HD2  1  
ATOM 1285  H HD3  . PRO A 1 89 ? 10.487  12.234  -0.356  1.00 0.00 ? 89 PRO A HD3  1  
ATOM 1286  N N    . SER A 1 90 ? 11.467  9.124   -4.669  1.00 0.00 ? 90 SER A N    1  
ATOM 1287  C CA   . SER A 1 90 ? 12.436  8.554   -5.598  1.00 0.00 ? 90 SER A CA   1  
ATOM 1288  C C    . SER A 1 90 ? 11.957  8.697   -7.040  1.00 0.00 ? 90 SER A C    1  
ATOM 1289  O O    . SER A 1 90 ? 10.897  9.268   -7.298  1.00 0.00 ? 90 SER A O    1  
ATOM 1290  C CB   . SER A 1 90 ? 12.679  7.079   -5.274  1.00 0.00 ? 90 SER A CB   1  
ATOM 1291  O OG   . SER A 1 90 ? 11.455  6.392   -5.076  1.00 0.00 ? 90 SER A OG   1  
ATOM 1292  H H    . SER A 1 90 ? 10.608  8.673   -4.539  1.00 0.00 ? 90 SER A H    1  
ATOM 1293  H HA   . SER A 1 90 ? 13.363  9.095   -5.486  1.00 0.00 ? 90 SER A HA   1  
ATOM 1294  H HB2  . SER A 1 90 ? 13.208  6.615   -6.093  1.00 0.00 ? 90 SER A HB2  1  
ATOM 1295  H HB3  . SER A 1 90 ? 13.271  7.004   -4.373  1.00 0.00 ? 90 SER A HB3  1  
ATOM 1296  H HG   . SER A 1 90 ? 11.134  6.561   -4.187  1.00 0.00 ? 90 SER A HG   1  
ATOM 1297  N N    . GLY A 1 91 ? 12.744  8.175   -7.975  1.00 0.00 ? 91 GLY A N    1  
ATOM 1298  C CA   . GLY A 1 91 ? 12.382  8.256   -9.378  1.00 0.00 ? 91 GLY A CA   1  
ATOM 1299  C C    . GLY A 1 91 ? 13.510  7.822   -10.296 1.00 0.00 ? 91 GLY A C    1  
ATOM 1300  O O    . GLY A 1 91 ? 13.365  6.857   -11.045 1.00 0.00 ? 91 GLY A O    1  
ATOM 1301  H H    . GLY A 1 91 ? 13.577  7.732   -7.710  1.00 0.00 ? 91 GLY A H    1  
ATOM 1302  H HA2  . GLY A 1 91 ? 11.525  7.621   -9.554  1.00 0.00 ? 91 GLY A HA2  1  
ATOM 1303  H HA3  . GLY A 1 91 ? 12.115  9.275   -9.611  1.00 0.00 ? 91 GLY A HA3  1  
ATOM 1304  N N    . PRO A 1 92 ? 14.657  8.522   -10.258 1.00 0.00 ? 92 PRO A N    1  
ATOM 1305  C CA   . PRO A 1 92 ? 15.812  8.191   -11.102 1.00 0.00 ? 92 PRO A CA   1  
ATOM 1306  C C    . PRO A 1 92 ? 16.466  6.875   -10.696 1.00 0.00 ? 92 PRO A C    1  
ATOM 1307  O O    . PRO A 1 92 ? 17.022  6.162   -11.534 1.00 0.00 ? 92 PRO A O    1  
ATOM 1308  C CB   . PRO A 1 92 ? 16.771  9.359   -10.868 1.00 0.00 ? 92 PRO A CB   1  
ATOM 1309  C CG   . PRO A 1 92 ? 16.403  9.892   -9.526  1.00 0.00 ? 92 PRO A CG   1  
ATOM 1310  C CD   . PRO A 1 92 ? 14.919  9.687   -9.394  1.00 0.00 ? 92 PRO A CD   1  
ATOM 1311  H HA   . PRO A 1 92 ? 15.538  8.149   -12.146 1.00 0.00 ? 92 PRO A HA   1  
ATOM 1312  H HB2  . PRO A 1 92 ? 17.790  9.000   -10.885 1.00 0.00 ? 92 PRO A HB2  1  
ATOM 1313  H HB3  . PRO A 1 92 ? 16.632  10.103  -11.639 1.00 0.00 ? 92 PRO A HB3  1  
ATOM 1314  H HG2  . PRO A 1 92 ? 16.927  9.344   -8.758  1.00 0.00 ? 92 PRO A HG2  1  
ATOM 1315  H HG3  . PRO A 1 92 ? 16.642  10.943  -9.471  1.00 0.00 ? 92 PRO A HG3  1  
ATOM 1316  H HD2  . PRO A 1 92 ? 14.658  9.473   -8.368  1.00 0.00 ? 92 PRO A HD2  1  
ATOM 1317  H HD3  . PRO A 1 92 ? 14.385  10.556  -9.748  1.00 0.00 ? 92 PRO A HD3  1  
ATOM 1318  N N    . SER A 1 93 ? 16.396  6.556   -9.409  1.00 0.00 ? 93 SER A N    1  
ATOM 1319  C CA   . SER A 1 93 ? 16.983  5.324   -8.893  1.00 0.00 ? 93 SER A CA   1  
ATOM 1320  C C    . SER A 1 93 ? 16.022  4.621   -7.940  1.00 0.00 ? 93 SER A C    1  
ATOM 1321  O O    . SER A 1 93 ? 15.277  5.268   -7.203  1.00 0.00 ? 93 SER A O    1  
ATOM 1322  C CB   . SER A 1 93 ? 18.301  5.623   -8.175  1.00 0.00 ? 93 SER A CB   1  
ATOM 1323  O OG   . SER A 1 93 ? 18.071  6.093   -6.859  1.00 0.00 ? 93 SER A OG   1  
ATOM 1324  H H    . SER A 1 93 ? 15.940  7.165   -8.789  1.00 0.00 ? 93 SER A H    1  
ATOM 1325  H HA   . SER A 1 93 ? 17.179  4.675   -9.732  1.00 0.00 ? 93 SER A HA   1  
ATOM 1326  H HB2  . SER A 1 93 ? 18.893  4.721   -8.124  1.00 0.00 ? 93 SER A HB2  1  
ATOM 1327  H HB3  . SER A 1 93 ? 18.844  6.379   -8.725  1.00 0.00 ? 93 SER A HB3  1  
ATOM 1328  H HG   . SER A 1 93 ? 18.649  5.631   -6.248  1.00 0.00 ? 93 SER A HG   1  
ATOM 1329  N N    . SER A 1 94 ? 16.043  3.293   -7.961  1.00 0.00 ? 94 SER A N    1  
ATOM 1330  C CA   . SER A 1 94 ? 15.172  2.501   -7.098  1.00 0.00 ? 94 SER A CA   1  
ATOM 1331  C C    . SER A 1 94 ? 15.992  1.657   -6.126  1.00 0.00 ? 94 SER A C    1  
ATOM 1332  O O    . SER A 1 94 ? 15.579  0.565   -5.735  1.00 0.00 ? 94 SER A O    1  
ATOM 1333  C CB   . SER A 1 94 ? 14.268  1.599   -7.942  1.00 0.00 ? 94 SER A CB   1  
ATOM 1334  O OG   . SER A 1 94 ? 12.902  1.917   -7.743  1.00 0.00 ? 94 SER A OG   1  
ATOM 1335  H H    . SER A 1 94 ? 16.658  2.833   -8.569  1.00 0.00 ? 94 SER A H    1  
ATOM 1336  H HA   . SER A 1 94 ? 14.557  3.184   -6.532  1.00 0.00 ? 94 SER A HA   1  
ATOM 1337  H HB2  . SER A 1 94 ? 14.505  1.732   -8.988  1.00 0.00 ? 94 SER A HB2  1  
ATOM 1338  H HB3  . SER A 1 94 ? 14.429  0.567   -7.665  1.00 0.00 ? 94 SER A HB3  1  
ATOM 1339  H HG   . SER A 1 94 ? 12.712  2.775   -8.130  1.00 0.00 ? 94 SER A HG   1  
ATOM 1340  N N    . GLY A 1 95 ? 17.156  2.172   -5.740  1.00 0.00 ? 95 GLY A N    1  
ATOM 1341  C CA   . GLY A 1 95 ? 18.016  1.453   -4.817  1.00 0.00 ? 95 GLY A CA   1  
ATOM 1342  C C    . GLY A 1 95 ? 18.193  2.184   -3.502  1.00 0.00 ? 95 GLY A C    1  
ATOM 1343  O O    . GLY A 1 95 ? 18.697  1.565   -2.541  1.00 0.00 ? 95 GLY A O    1  
ATOM 1344  O OXT  . GLY A 1 95 ? 17.830  3.377   -3.431  1.00 0.00 ? 95 GLY A OXT  1  
ATOM 1345  H H    . GLY A 1 95 ? 17.433  3.046   -6.085  1.00 0.00 ? 95 GLY A H    1  
ATOM 1346  H HA2  . GLY A 1 95 ? 17.584  0.483   -4.622  1.00 0.00 ? 95 GLY A HA2  1  
ATOM 1347  H HA3  . GLY A 1 95 ? 18.984  1.319   -5.275  1.00 0.00 ? 95 GLY A HA3  1  
ATOM 1348  N N    . GLY A 1 1  ? -9.430  -11.632 -28.490 1.00 0.00 ? 1  GLY A N    2  
ATOM 1349  C CA   . GLY A 1 1  ? -9.879  -10.356 -27.867 1.00 0.00 ? 1  GLY A CA   2  
ATOM 1350  C C    . GLY A 1 1  ? -9.155  -10.058 -26.569 1.00 0.00 ? 1  GLY A C    2  
ATOM 1351  O O    . GLY A 1 1  ? -8.497  -10.931 -26.002 1.00 0.00 ? 1  GLY A O    2  
ATOM 1352  H H1   . GLY A 1 1  ? -10.243 -12.138 -28.896 1.00 0.00 ? 1  GLY A H1   2  
ATOM 1353  H H2   . GLY A 1 1  ? -8.979  -12.240 -27.777 1.00 0.00 ? 1  GLY A H2   2  
ATOM 1354  H H3   . GLY A 1 1  ? -8.743  -11.437 -29.247 1.00 0.00 ? 1  GLY A H3   2  
ATOM 1355  H HA2  . GLY A 1 1  ? -9.701  -9.547  -28.561 1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1356  H HA3  . GLY A 1 1  ? -10.939 -10.420 -27.670 1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1357  N N    . SER A 1 2  ? -9.276  -8.822  -26.097 1.00 0.00 ? 2  SER A N    2  
ATOM 1358  C CA   . SER A 1 2  ? -8.628  -8.410  -24.857 1.00 0.00 ? 2  SER A CA   2  
ATOM 1359  C C    . SER A 1 2  ? -9.358  -8.982  -23.646 1.00 0.00 ? 2  SER A C    2  
ATOM 1360  O O    . SER A 1 2  ? -10.411 -9.604  -23.780 1.00 0.00 ? 2  SER A O    2  
ATOM 1361  C CB   . SER A 1 2  ? -8.579  -6.884  -24.765 1.00 0.00 ? 2  SER A CB   2  
ATOM 1362  O OG   . SER A 1 2  ? -8.067  -6.317  -25.958 1.00 0.00 ? 2  SER A OG   2  
ATOM 1363  H H    . SER A 1 2  ? -9.814  -8.171  -26.593 1.00 0.00 ? 2  SER A H    2  
ATOM 1364  H HA   . SER A 1 2  ? -7.618  -8.793  -24.868 1.00 0.00 ? 2  SER A HA   2  
ATOM 1365  H HB2  . SER A 1 2  ? -9.576  -6.504  -24.600 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1366  H HB3  . SER A 1 2  ? -7.944  -6.595  -23.941 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1367  H HG   . SER A 1 2  ? -7.496  -5.576  -25.741 1.00 0.00 ? 2  SER A HG   2  
ATOM 1368  N N    . SER A 1 3  ? -8.790  -8.767  -22.464 1.00 0.00 ? 3  SER A N    2  
ATOM 1369  C CA   . SER A 1 3  ? -9.387  -9.261  -21.228 1.00 0.00 ? 3  SER A CA   2  
ATOM 1370  C C    . SER A 1 3  ? -8.944  -8.420  -20.036 1.00 0.00 ? 3  SER A C    2  
ATOM 1371  O O    . SER A 1 3  ? -7.946  -7.703  -20.104 1.00 0.00 ? 3  SER A O    2  
ATOM 1372  C CB   . SER A 1 3  ? -9.006  -10.725 -21.003 1.00 0.00 ? 3  SER A CB   2  
ATOM 1373  O OG   . SER A 1 3  ? -9.361  -11.150 -19.699 1.00 0.00 ? 3  SER A OG   2  
ATOM 1374  H H    . SER A 1 3  ? -7.951  -8.264  -22.421 1.00 0.00 ? 3  SER A H    2  
ATOM 1375  H HA   . SER A 1 3  ? -10.459 -9.189  -21.326 1.00 0.00 ? 3  SER A HA   2  
ATOM 1376  H HB2  . SER A 1 3  ? -9.522  -11.344 -21.723 1.00 0.00 ? 3  SER A HB2  2  
ATOM 1377  H HB3  . SER A 1 3  ? -7.939  -10.841 -21.128 1.00 0.00 ? 3  SER A HB3  2  
ATOM 1378  H HG   . SER A 1 3  ? -8.778  -10.737 -19.057 1.00 0.00 ? 3  SER A HG   2  
ATOM 1379  N N    . GLY A 1 4  ? -9.695  -8.510  -18.943 1.00 0.00 ? 4  GLY A N    2  
ATOM 1380  C CA   . GLY A 1 4  ? -9.363  -7.753  -17.750 1.00 0.00 ? 4  GLY A CA   2  
ATOM 1381  C C    . GLY A 1 4  ? -10.385 -7.935  -16.644 1.00 0.00 ? 4  GLY A C    2  
ATOM 1382  O O    . GLY A 1 4  ? -11.499 -8.397  -16.891 1.00 0.00 ? 4  GLY A O    2  
ATOM 1383  H H    . GLY A 1 4  ? -10.479 -9.098  -18.945 1.00 0.00 ? 4  GLY A H    2  
ATOM 1384  H HA2  . GLY A 1 4  ? -8.398  -8.074  -17.389 1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1385  H HA3  . GLY A 1 4  ? -9.310  -6.705  -18.006 1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1386  N N    . SER A 1 5  ? -10.004 -7.572  -15.424 1.00 0.00 ? 5  SER A N    2  
ATOM 1387  C CA   . SER A 1 5  ? -10.894 -7.698  -14.276 1.00 0.00 ? 5  SER A CA   2  
ATOM 1388  C C    . SER A 1 5  ? -11.115 -6.345  -13.607 1.00 0.00 ? 5  SER A C    2  
ATOM 1389  O O    . SER A 1 5  ? -10.291 -5.438  -13.731 1.00 0.00 ? 5  SER A O    2  
ATOM 1390  C CB   . SER A 1 5  ? -10.320 -8.691  -13.265 1.00 0.00 ? 5  SER A CB   2  
ATOM 1391  O OG   . SER A 1 5  ? -10.821 -9.998  -13.493 1.00 0.00 ? 5  SER A OG   2  
ATOM 1392  H H    . SER A 1 5  ? -9.103  -7.210  -15.292 1.00 0.00 ? 5  SER A H    2  
ATOM 1393  H HA   . SER A 1 5  ? -11.844 -8.069  -14.632 1.00 0.00 ? 5  SER A HA   2  
ATOM 1394  H HB2  . SER A 1 5  ? -9.244  -8.712  -13.355 1.00 0.00 ? 5  SER A HB2  2  
ATOM 1395  H HB3  . SER A 1 5  ? -10.592 -8.384  -12.267 1.00 0.00 ? 5  SER A HB3  2  
ATOM 1396  H HG   . SER A 1 5  ? -11.734 -10.046 -13.203 1.00 0.00 ? 5  SER A HG   2  
ATOM 1397  N N    . SER A 1 6  ? -12.232 -6.215  -12.899 1.00 0.00 ? 6  SER A N    2  
ATOM 1398  C CA   . SER A 1 6  ? -12.561 -4.973  -12.211 1.00 0.00 ? 6  SER A CA   2  
ATOM 1399  C C    . SER A 1 6  ? -12.398 -5.126  -10.702 1.00 0.00 ? 6  SER A C    2  
ATOM 1400  O O    . SER A 1 6  ? -13.162 -5.843  -10.055 1.00 0.00 ? 6  SER A O    2  
ATOM 1401  C CB   . SER A 1 6  ? -13.992 -4.546  -12.540 1.00 0.00 ? 6  SER A CB   2  
ATOM 1402  O OG   . SER A 1 6  ? -14.312 -4.830  -13.891 1.00 0.00 ? 6  SER A OG   2  
ATOM 1403  H H    . SER A 1 6  ? -12.850 -6.973  -12.838 1.00 0.00 ? 6  SER A H    2  
ATOM 1404  H HA   . SER A 1 6  ? -11.879 -4.210  -12.558 1.00 0.00 ? 6  SER A HA   2  
ATOM 1405  H HB2  . SER A 1 6  ? -14.681 -5.079  -11.901 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1406  H HB3  . SER A 1 6  ? -14.097 -3.484  -12.374 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1407  H HG   . SER A 1 6  ? -15.255 -4.711  -14.029 1.00 0.00 ? 6  SER A HG   2  
ATOM 1408  N N    . GLY A 1 7  ? -11.397 -4.450  -10.148 1.00 0.00 ? 7  GLY A N    2  
ATOM 1409  C CA   . GLY A 1 7  ? -11.152 -4.525  -8.720  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1410  C C    . GLY A 1 7  ? -9.919  -5.339  -8.384  1.00 0.00 ? 7  GLY A C    2  
ATOM 1411  O O    . GLY A 1 7  ? -8.811  -4.804  -8.324  1.00 0.00 ? 7  GLY A O    2  
ATOM 1412  H H    . GLY A 1 7  ? -10.820 -3.895  -10.714 1.00 0.00 ? 7  GLY A H    2  
ATOM 1413  H HA2  . GLY A 1 7  ? -11.026 -3.524  -8.334  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1414  H HA3  . GLY A 1 7  ? -12.009 -4.977  -8.242  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1415  N N    . ALA A 1 8  ? -10.109 -6.635  -8.164  1.00 0.00 ? 8  ALA A N    2  
ATOM 1416  C CA   . ALA A 1 8  ? -9.003  -7.525  -7.832  1.00 0.00 ? 8  ALA A CA   2  
ATOM 1417  C C    . ALA A 1 8  ? -8.172  -7.853  -9.068  1.00 0.00 ? 8  ALA A C    2  
ATOM 1418  O O    . ALA A 1 8  ? -8.645  -8.521  -9.987  1.00 0.00 ? 8  ALA A O    2  
ATOM 1419  C CB   . ALA A 1 8  ? -9.528  -8.802  -7.192  1.00 0.00 ? 8  ALA A CB   2  
ATOM 1420  H H    . ALA A 1 8  ? -11.016 -7.003  -8.225  1.00 0.00 ? 8  ALA A H    2  
ATOM 1421  H HA   . ALA A 1 8  ? -8.375  -7.022  -7.112  1.00 0.00 ? 8  ALA A HA   2  
ATOM 1422  H HB1  . ALA A 1 8  ? -9.578  -9.583  -7.937  1.00 0.00 ? 8  ALA A HB1  2  
ATOM 1423  H HB2  . ALA A 1 8  ? -10.513 -8.624  -6.790  1.00 0.00 ? 8  ALA A HB2  2  
ATOM 1424  H HB3  . ALA A 1 8  ? -8.863  -9.106  -6.397  1.00 0.00 ? 8  ALA A HB3  2  
ATOM 1425  N N    . ALA A 1 9  ? -6.931  -7.379  -9.082  1.00 0.00 ? 9  ALA A N    2  
ATOM 1426  C CA   . ALA A 1 9  ? -6.034  -7.622  -10.205 1.00 0.00 ? 9  ALA A CA   2  
ATOM 1427  C C    . ALA A 1 9  ? -4.575  -7.573  -9.764  1.00 0.00 ? 9  ALA A C    2  
ATOM 1428  O O    . ALA A 1 9  ? -3.856  -8.569  -9.850  1.00 0.00 ? 9  ALA A O    2  
ATOM 1429  C CB   . ALA A 1 9  ? -6.286  -6.607  -11.311 1.00 0.00 ? 9  ALA A CB   2  
ATOM 1430  H H    . ALA A 1 9  ? -6.610  -6.854  -8.320  1.00 0.00 ? 9  ALA A H    2  
ATOM 1431  H HA   . ALA A 1 9  ? -6.248  -8.605  -10.597 1.00 0.00 ? 9  ALA A HA   2  
ATOM 1432  H HB1  . ALA A 1 9  ? -5.724  -6.886  -12.190 1.00 0.00 ? 9  ALA A HB1  2  
ATOM 1433  H HB2  . ALA A 1 9  ? -5.973  -5.628  -10.979 1.00 0.00 ? 9  ALA A HB2  2  
ATOM 1434  H HB3  . ALA A 1 9  ? -7.339  -6.588  -11.547 1.00 0.00 ? 9  ALA A HB3  2  
ATOM 1435  N N    . GLU A 1 10 ? -4.144  -6.408  -9.290  1.00 0.00 ? 10 GLU A N    2  
ATOM 1436  C CA   . GLU A 1 10 ? -2.770  -6.230  -8.834  1.00 0.00 ? 10 GLU A CA   2  
ATOM 1437  C C    . GLU A 1 10 ? -2.451  -7.179  -7.683  1.00 0.00 ? 10 GLU A C    2  
ATOM 1438  O O    . GLU A 1 10 ? -3.251  -7.342  -6.760  1.00 0.00 ? 10 GLU A O    2  
ATOM 1439  C CB   . GLU A 1 10 ? -2.540  -4.782  -8.397  1.00 0.00 ? 10 GLU A CB   2  
ATOM 1440  C CG   . GLU A 1 10 ? -1.910  -3.915  -9.475  1.00 0.00 ? 10 GLU A CG   2  
ATOM 1441  C CD   . GLU A 1 10 ? -1.140  -2.741  -8.903  1.00 0.00 ? 10 GLU A CD   2  
ATOM 1442  O OE1  . GLU A 1 10 ? -0.621  -2.864  -7.773  1.00 0.00 ? 10 GLU A OE1  2  
ATOM 1443  O OE2  . GLU A 1 10 ? -1.055  -1.697  -9.584  1.00 0.00 ? 10 GLU A OE2  2  
ATOM 1444  H H    . GLU A 1 10 ? -4.764  -5.651  -9.246  1.00 0.00 ? 10 GLU A H    2  
ATOM 1445  H HA   . GLU A 1 10 ? -2.115  -6.455  -9.661  1.00 0.00 ? 10 GLU A HA   2  
ATOM 1446  H HB2  . GLU A 1 10 ? -3.490  -4.344  -8.125  1.00 0.00 ? 10 GLU A HB2  2  
ATOM 1447  H HB3  . GLU A 1 10 ? -1.890  -4.775  -7.535  1.00 0.00 ? 10 GLU A HB3  2  
ATOM 1448  H HG2  . GLU A 1 10 ? -1.231  -4.522  -10.055 1.00 0.00 ? 10 GLU A HG2  2  
ATOM 1449  H HG3  . GLU A 1 10 ? -2.691  -3.536  -10.117 1.00 0.00 ? 10 GLU A HG3  2  
ATOM 1450  N N    . VAL A 1 11 ? -1.279  -7.801  -7.743  1.00 0.00 ? 11 VAL A N    2  
ATOM 1451  C CA   . VAL A 1 11 ? -0.855  -8.733  -6.705  1.00 0.00 ? 11 VAL A CA   2  
ATOM 1452  C C    . VAL A 1 11 ? -0.048  -8.022  -5.624  1.00 0.00 ? 11 VAL A C    2  
ATOM 1453  O O    . VAL A 1 11 ? 0.384   -6.883  -5.806  1.00 0.00 ? 11 VAL A O    2  
ATOM 1454  C CB   . VAL A 1 11 ? -0.007  -9.878  -7.291  1.00 0.00 ? 11 VAL A CB   2  
ATOM 1455  C CG1  . VAL A 1 11 ? -0.852  -10.755 -8.203  1.00 0.00 ? 11 VAL A CG1  2  
ATOM 1456  C CG2  . VAL A 1 11 ? 1.197   -9.323  -8.036  1.00 0.00 ? 11 VAL A CG2  2  
ATOM 1457  H H    . VAL A 1 11 ? -0.685  -7.630  -8.503  1.00 0.00 ? 11 VAL A H    2  
ATOM 1458  H HA   . VAL A 1 11 ? -1.740  -9.160  -6.258  1.00 0.00 ? 11 VAL A HA   2  
ATOM 1459  H HB   . VAL A 1 11 ? 0.351   -10.488 -6.475  1.00 0.00 ? 11 VAL A HB   2  
ATOM 1460  H HG11 . VAL A 1 11 ? -0.243  -11.114 -9.021  1.00 0.00 ? 11 VAL A HG11 2  
ATOM 1461  H HG12 . VAL A 1 11 ? -1.676  -10.177 -8.595  1.00 0.00 ? 11 VAL A HG12 2  
ATOM 1462  H HG13 . VAL A 1 11 ? -1.234  -11.595 -7.643  1.00 0.00 ? 11 VAL A HG13 2  
ATOM 1463  H HG21 . VAL A 1 11 ? 0.878   -8.919  -8.985  1.00 0.00 ? 11 VAL A HG21 2  
ATOM 1464  H HG22 . VAL A 1 11 ? 1.913   -10.115 -8.203  1.00 0.00 ? 11 VAL A HG22 2  
ATOM 1465  H HG23 . VAL A 1 11 ? 1.656   -8.543  -7.447  1.00 0.00 ? 11 VAL A HG23 2  
ATOM 1466  N N    . GLY A 1 12 ? 0.152   -8.701  -4.499  1.00 0.00 ? 12 GLY A N    2  
ATOM 1467  C CA   . GLY A 1 12 ? 0.906   -8.118  -3.405  1.00 0.00 ? 12 GLY A CA   2  
ATOM 1468  C C    . GLY A 1 12 ? 2.280   -8.740  -3.252  1.00 0.00 ? 12 GLY A C    2  
ATOM 1469  O O    . GLY A 1 12 ? 2.659   -9.623  -4.022  1.00 0.00 ? 12 GLY A O    2  
ATOM 1470  H H    . GLY A 1 12 ? -0.216  -9.605  -4.411  1.00 0.00 ? 12 GLY A H    2  
ATOM 1471  H HA2  . GLY A 1 12 ? 1.021   -7.059  -3.585  1.00 0.00 ? 12 GLY A HA2  2  
ATOM 1472  H HA3  . GLY A 1 12 ? 0.356   -8.259  -2.487  1.00 0.00 ? 12 GLY A HA3  2  
ATOM 1473  N N    . ASP A 1 13 ? 3.029   -8.279  -2.255  1.00 0.00 ? 13 ASP A N    2  
ATOM 1474  C CA   . ASP A 1 13 ? 4.370   -8.796  -2.003  1.00 0.00 ? 13 ASP A CA   2  
ATOM 1475  C C    . ASP A 1 13 ? 4.438   -9.490  -0.647  1.00 0.00 ? 13 ASP A C    2  
ATOM 1476  O O    . ASP A 1 13 ? 3.741   -9.110  0.293   1.00 0.00 ? 13 ASP A O    2  
ATOM 1477  C CB   . ASP A 1 13 ? 5.395   -7.662  -2.062  1.00 0.00 ? 13 ASP A CB   2  
ATOM 1478  C CG   . ASP A 1 13 ? 6.059   -7.552  -3.420  1.00 0.00 ? 13 ASP A CG   2  
ATOM 1479  O OD1  . ASP A 1 13 ? 6.445   -8.601  -3.979  1.00 0.00 ? 13 ASP A OD1  2  
ATOM 1480  O OD2  . ASP A 1 13 ? 6.194   -6.418  -3.926  1.00 0.00 ? 13 ASP A OD2  2  
ATOM 1481  H H    . ASP A 1 13 ? 2.672   -7.574  -1.676  1.00 0.00 ? 13 ASP A H    2  
ATOM 1482  H HA   . ASP A 1 13 ? 4.599   -9.515  -2.775  1.00 0.00 ? 13 ASP A HA   2  
ATOM 1483  H HB2  . ASP A 1 13 ? 4.900   -6.726  -1.848  1.00 0.00 ? 13 ASP A HB2  2  
ATOM 1484  H HB3  . ASP A 1 13 ? 6.161   -7.837  -1.321  1.00 0.00 ? 13 ASP A HB3  2  
ATOM 1485  N N    . ASP A 1 14 ? 5.284   -10.511 -0.554  1.00 0.00 ? 14 ASP A N    2  
ATOM 1486  C CA   . ASP A 1 14 ? 5.445   -11.259 0.689   1.00 0.00 ? 14 ASP A CA   2  
ATOM 1487  C C    . ASP A 1 14 ? 6.675   -10.783 1.455   1.00 0.00 ? 14 ASP A C    2  
ATOM 1488  O O    . ASP A 1 14 ? 7.349   -11.571 2.117   1.00 0.00 ? 14 ASP A O    2  
ATOM 1489  C CB   . ASP A 1 14 ? 5.559   -12.756 0.395   1.00 0.00 ? 14 ASP A CB   2  
ATOM 1490  C CG   . ASP A 1 14 ? 4.849   -13.604 1.433   1.00 0.00 ? 14 ASP A CG   2  
ATOM 1491  O OD1  . ASP A 1 14 ? 3.760   -13.196 1.889   1.00 0.00 ? 14 ASP A OD1  2  
ATOM 1492  O OD2  . ASP A 1 14 ? 5.383   -14.675 1.791   1.00 0.00 ? 14 ASP A OD2  2  
ATOM 1493  H H    . ASP A 1 14 ? 5.813   -10.767 -1.337  1.00 0.00 ? 14 ASP A H    2  
ATOM 1494  H HA   . ASP A 1 14 ? 4.568   -11.085 1.295   1.00 0.00 ? 14 ASP A HA   2  
ATOM 1495  H HB2  . ASP A 1 14 ? 5.122   -12.962 -0.570  1.00 0.00 ? 14 ASP A HB2  2  
ATOM 1496  H HB3  . ASP A 1 14 ? 6.602   -13.035 0.381   1.00 0.00 ? 14 ASP A HB3  2  
ATOM 1497  N N    . PHE A 1 15 ? 6.961   -9.488  1.358   1.00 0.00 ? 15 PHE A N    2  
ATOM 1498  C CA   . PHE A 1 15 ? 8.110   -8.906  2.042   1.00 0.00 ? 15 PHE A CA   2  
ATOM 1499  C C    . PHE A 1 15 ? 7.681   -8.204  3.326   1.00 0.00 ? 15 PHE A C    2  
ATOM 1500  O O    . PHE A 1 15 ? 8.209   -8.481  4.403   1.00 0.00 ? 15 PHE A O    2  
ATOM 1501  C CB   . PHE A 1 15 ? 8.829   -7.918  1.122   1.00 0.00 ? 15 PHE A CB   2  
ATOM 1502  C CG   . PHE A 1 15 ? 10.036  -7.280  1.750   1.00 0.00 ? 15 PHE A CG   2  
ATOM 1503  C CD1  . PHE A 1 15 ? 9.901   -6.164  2.560   1.00 0.00 ? 15 PHE A CD1  2  
ATOM 1504  C CD2  . PHE A 1 15 ? 11.303  -7.795  1.528   1.00 0.00 ? 15 PHE A CD2  2  
ATOM 1505  C CE1  . PHE A 1 15 ? 11.008  -5.574  3.139   1.00 0.00 ? 15 PHE A CE1  2  
ATOM 1506  C CE2  . PHE A 1 15 ? 12.414  -7.209  2.105   1.00 0.00 ? 15 PHE A CE2  2  
ATOM 1507  C CZ   . PHE A 1 15 ? 12.266  -6.097  2.912   1.00 0.00 ? 15 PHE A CZ   2  
ATOM 1508  H H    . PHE A 1 15 ? 6.386   -8.911  0.815   1.00 0.00 ? 15 PHE A H    2  
ATOM 1509  H HA   . PHE A 1 15 ? 8.787   -9.709  2.293   1.00 0.00 ? 15 PHE A HA   2  
ATOM 1510  H HB2  . PHE A 1 15 ? 9.154   -8.437  0.232   1.00 0.00 ? 15 PHE A HB2  2  
ATOM 1511  H HB3  . PHE A 1 15 ? 8.142   -7.132  0.842   1.00 0.00 ? 15 PHE A HB3  2  
ATOM 1512  H HD1  . PHE A 1 15 ? 8.918   -5.754  2.739   1.00 0.00 ? 15 PHE A HD1  2  
ATOM 1513  H HD2  . PHE A 1 15 ? 11.419  -8.664  0.899   1.00 0.00 ? 15 PHE A HD2  2  
ATOM 1514  H HE1  . PHE A 1 15 ? 10.890  -4.704  3.769   1.00 0.00 ? 15 PHE A HE1  2  
ATOM 1515  H HE2  . PHE A 1 15 ? 13.396  -7.620  1.926   1.00 0.00 ? 15 PHE A HE2  2  
ATOM 1516  H HZ   . PHE A 1 15 ? 13.133  -5.638  3.363   1.00 0.00 ? 15 PHE A HZ   2  
ATOM 1517  N N    . LEU A 1 16 ? 6.720   -7.295  3.204   1.00 0.00 ? 16 LEU A N    2  
ATOM 1518  C CA   . LEU A 1 16 ? 6.218   -6.551  4.355   1.00 0.00 ? 16 LEU A CA   2  
ATOM 1519  C C    . LEU A 1 16 ? 7.322   -5.699  4.973   1.00 0.00 ? 16 LEU A C    2  
ATOM 1520  O O    . LEU A 1 16 ? 8.164   -6.200  5.719   1.00 0.00 ? 16 LEU A O    2  
ATOM 1521  C CB   . LEU A 1 16 ? 5.647   -7.513  5.402   1.00 0.00 ? 16 LEU A CB   2  
ATOM 1522  C CG   . LEU A 1 16 ? 4.203   -7.232  5.819   1.00 0.00 ? 16 LEU A CG   2  
ATOM 1523  C CD1  . LEU A 1 16 ? 3.711   -8.295  6.789   1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1524  C CD2  . LEU A 1 16 ? 4.089   -5.847  6.439   1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1525  H H    . LEU A 1 16 ? 6.338   -7.117  2.319   1.00 0.00 ? 16 LEU A H    2  
ATOM 1526  H HA   . LEU A 1 16 ? 5.429   -5.901  4.010   1.00 0.00 ? 16 LEU A HA   2  
ATOM 1527  H HB2  . LEU A 1 16 ? 5.696   -8.515  5.001   1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1528  H HB3  . LEU A 1 16 ? 6.268   -7.467  6.284   1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1529  H HG   . LEU A 1 16 ? 3.570   -7.261  4.944   1.00 0.00 ? 16 LEU A HG   2  
ATOM 1530  H HD11 . LEU A 1 16 ? 2.678   -8.104  7.038   1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1531  H HD12 . LEU A 1 16 ? 4.310   -8.266  7.689   1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1532  H HD13 . LEU A 1 16 ? 3.798   -9.269  6.332   1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1533  H HD21 . LEU A 1 16 ? 4.861   -5.208  6.037   1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1534  H HD22 . LEU A 1 16 ? 4.205   -5.922  7.510   1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1535  H HD23 . LEU A 1 16 ? 3.120   -5.430  6.210   1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1536  N N    . GLY A 1 17 ? 7.313   -4.408  4.658   1.00 0.00 ? 17 GLY A N    2  
ATOM 1537  C CA   . GLY A 1 17 ? 8.317   -3.507  5.191   1.00 0.00 ? 17 GLY A CA   2  
ATOM 1538  C C    . GLY A 1 17 ? 8.151   -3.264  6.678   1.00 0.00 ? 17 GLY A C    2  
ATOM 1539  O O    . GLY A 1 17 ? 7.263   -3.835  7.311   1.00 0.00 ? 17 GLY A O    2  
ATOM 1540  H H    . GLY A 1 17 ? 6.617   -4.065  4.059   1.00 0.00 ? 17 GLY A H    2  
ATOM 1541  H HA2  . GLY A 1 17 ? 9.294   -3.930  5.013   1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1542  H HA3  . GLY A 1 17 ? 8.247   -2.561  4.673   1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1543  N N    . ASP A 1 18 ? 9.008   -2.416  7.237   1.00 0.00 ? 18 ASP A N    2  
ATOM 1544  C CA   . ASP A 1 18 ? 8.953   -2.099  8.658   1.00 0.00 ? 18 ASP A CA   2  
ATOM 1545  C C    . ASP A 1 18 ? 8.236   -0.773  8.894   1.00 0.00 ? 18 ASP A C    2  
ATOM 1546  O O    . ASP A 1 18 ? 8.541   -0.050  9.841   1.00 0.00 ? 18 ASP A O    2  
ATOM 1547  C CB   . ASP A 1 18 ? 10.365  -2.038  9.244   1.00 0.00 ? 18 ASP A CB   2  
ATOM 1548  C CG   . ASP A 1 18 ? 10.826  -3.379  9.781   1.00 0.00 ? 18 ASP A CG   2  
ATOM 1549  O OD1  . ASP A 1 18 ? 11.197  -4.250  8.965   1.00 0.00 ? 18 ASP A OD1  2  
ATOM 1550  O OD2  . ASP A 1 18 ? 10.818  -3.560  11.017  1.00 0.00 ? 18 ASP A OD2  2  
ATOM 1551  H H    . ASP A 1 18 ? 9.694   -1.993  6.679   1.00 0.00 ? 18 ASP A H    2  
ATOM 1552  H HA   . ASP A 1 18 ? 8.401   -2.885  9.152   1.00 0.00 ? 18 ASP A HA   2  
ATOM 1553  H HB2  . ASP A 1 18 ? 11.054  -1.724  8.474   1.00 0.00 ? 18 ASP A HB2  2  
ATOM 1554  H HB3  . ASP A 1 18 ? 10.382  -1.323  10.052  1.00 0.00 ? 18 ASP A HB3  2  
ATOM 1555  N N    . PHE A 1 19 ? 7.281   -0.460  8.023   1.00 0.00 ? 19 PHE A N    2  
ATOM 1556  C CA   . PHE A 1 19 ? 6.521   0.779   8.135   1.00 0.00 ? 19 PHE A CA   2  
ATOM 1557  C C    . PHE A 1 19 ? 5.466   0.672   9.230   1.00 0.00 ? 19 PHE A C    2  
ATOM 1558  O O    . PHE A 1 19 ? 4.987   -0.419  9.542   1.00 0.00 ? 19 PHE A O    2  
ATOM 1559  C CB   . PHE A 1 19 ? 5.856   1.115   6.799   1.00 0.00 ? 19 PHE A CB   2  
ATOM 1560  C CG   . PHE A 1 19 ? 6.819   1.176   5.649   1.00 0.00 ? 19 PHE A CG   2  
ATOM 1561  C CD1  . PHE A 1 19 ? 7.178   0.024   4.967   1.00 0.00 ? 19 PHE A CD1  2  
ATOM 1562  C CD2  . PHE A 1 19 ? 7.366   2.385   5.250   1.00 0.00 ? 19 PHE A CD2  2  
ATOM 1563  C CE1  . PHE A 1 19 ? 8.064   0.077   3.909   1.00 0.00 ? 19 PHE A CE1  2  
ATOM 1564  C CE2  . PHE A 1 19 ? 8.253   2.444   4.191   1.00 0.00 ? 19 PHE A CE2  2  
ATOM 1565  C CZ   . PHE A 1 19 ? 8.602   1.288   3.519   1.00 0.00 ? 19 PHE A CZ   2  
ATOM 1566  H H    . PHE A 1 19 ? 7.083   -1.078  7.288   1.00 0.00 ? 19 PHE A H    2  
ATOM 1567  H HA   . PHE A 1 19 ? 7.211   1.568   8.393   1.00 0.00 ? 19 PHE A HA   2  
ATOM 1568  H HB2  . PHE A 1 19 ? 5.116   0.363   6.574   1.00 0.00 ? 19 PHE A HB2  2  
ATOM 1569  H HB3  . PHE A 1 19 ? 5.371   2.077   6.880   1.00 0.00 ? 19 PHE A HB3  2  
ATOM 1570  H HD1  . PHE A 1 19 ? 6.757   -0.924  5.270   1.00 0.00 ? 19 PHE A HD1  2  
ATOM 1571  H HD2  . PHE A 1 19 ? 7.094   3.289   5.774   1.00 0.00 ? 19 PHE A HD2  2  
ATOM 1572  H HE1  . PHE A 1 19 ? 8.335   -0.828  3.384   1.00 0.00 ? 19 PHE A HE1  2  
ATOM 1573  H HE2  . PHE A 1 19 ? 8.673   3.392   3.890   1.00 0.00 ? 19 PHE A HE2  2  
ATOM 1574  H HZ   . PHE A 1 19 ? 9.296   1.331   2.692   1.00 0.00 ? 19 PHE A HZ   2  
ATOM 1575  N N    . VAL A 1 20 ? 5.107   1.812   9.812   1.00 0.00 ? 20 VAL A N    2  
ATOM 1576  C CA   . VAL A 1 20 ? 4.107   1.848   10.873  1.00 0.00 ? 20 VAL A CA   2  
ATOM 1577  C C    . VAL A 1 20 ? 2.875   2.637   10.442  1.00 0.00 ? 20 VAL A C    2  
ATOM 1578  O O    . VAL A 1 20 ? 2.852   3.229   9.364   1.00 0.00 ? 20 VAL A O    2  
ATOM 1579  C CB   . VAL A 1 20 ? 4.676   2.472   12.160  1.00 0.00 ? 20 VAL A CB   2  
ATOM 1580  C CG1  . VAL A 1 20 ? 5.781   1.597   12.736  1.00 0.00 ? 20 VAL A CG1  2  
ATOM 1581  C CG2  . VAL A 1 20 ? 5.186   3.880   11.892  1.00 0.00 ? 20 VAL A CG2  2  
ATOM 1582  H H    . VAL A 1 20 ? 5.524   2.649   9.521   1.00 0.00 ? 20 VAL A H    2  
ATOM 1583  H HA   . VAL A 1 20 ? 3.813   0.830   11.090  1.00 0.00 ? 20 VAL A HA   2  
ATOM 1584  H HB   . VAL A 1 20 ? 3.881   2.533   12.889  1.00 0.00 ? 20 VAL A HB   2  
ATOM 1585  H HG11 . VAL A 1 20 ? 5.446   0.571   12.770  1.00 0.00 ? 20 VAL A HG11 2  
ATOM 1586  H HG12 . VAL A 1 20 ? 6.021   1.931   13.734  1.00 0.00 ? 20 VAL A HG12 2  
ATOM 1587  H HG13 . VAL A 1 20 ? 6.659   1.669   12.111  1.00 0.00 ? 20 VAL A HG13 2  
ATOM 1588  H HG21 . VAL A 1 20 ? 5.882   3.859   11.066  1.00 0.00 ? 20 VAL A HG21 2  
ATOM 1589  H HG22 . VAL A 1 20 ? 5.685   4.255   12.773  1.00 0.00 ? 20 VAL A HG22 2  
ATOM 1590  H HG23 . VAL A 1 20 ? 4.355   4.523   11.647  1.00 0.00 ? 20 VAL A HG23 2  
ATOM 1591  N N    . VAL A 1 21 ? 1.854   2.639   11.292  1.00 0.00 ? 21 VAL A N    2  
ATOM 1592  C CA   . VAL A 1 21 ? 0.619   3.355   10.999  1.00 0.00 ? 21 VAL A CA   2  
ATOM 1593  C C    . VAL A 1 21 ? 0.702   4.806   11.458  1.00 0.00 ? 21 VAL A C    2  
ATOM 1594  O O    . VAL A 1 21 ? 1.154   5.091   12.568  1.00 0.00 ? 21 VAL A O    2  
ATOM 1595  C CB   . VAL A 1 21 ? -0.593  2.684   11.674  1.00 0.00 ? 21 VAL A CB   2  
ATOM 1596  C CG1  . VAL A 1 21 ? -1.890  3.321   11.199  1.00 0.00 ? 21 VAL A CG1  2  
ATOM 1597  C CG2  . VAL A 1 21 ? -0.594  1.187   11.401  1.00 0.00 ? 21 VAL A CG2  2  
ATOM 1598  H H    . VAL A 1 21 ? 1.933   2.148   12.136  1.00 0.00 ? 21 VAL A H    2  
ATOM 1599  H HA   . VAL A 1 21 ? 0.466   3.334   9.930   1.00 0.00 ? 21 VAL A HA   2  
ATOM 1600  H HB   . VAL A 1 21 ? -0.514  2.834   12.741  1.00 0.00 ? 21 VAL A HB   2  
ATOM 1601  H HG11 . VAL A 1 21 ? -1.910  3.337   10.120  1.00 0.00 ? 21 VAL A HG11 2  
ATOM 1602  H HG12 . VAL A 1 21 ? -1.953  4.332   11.576  1.00 0.00 ? 21 VAL A HG12 2  
ATOM 1603  H HG13 . VAL A 1 21 ? -2.728  2.747   11.567  1.00 0.00 ? 21 VAL A HG13 2  
ATOM 1604  H HG21 . VAL A 1 21 ? -1.445  0.733   11.889  1.00 0.00 ? 21 VAL A HG21 2  
ATOM 1605  H HG22 . VAL A 1 21 ? 0.316   0.751   11.785  1.00 0.00 ? 21 VAL A HG22 2  
ATOM 1606  H HG23 . VAL A 1 21 ? -0.655  1.015   10.337  1.00 0.00 ? 21 VAL A HG23 2  
ATOM 1607  N N    . GLY A 1 22 ? 0.263   5.720   10.599  1.00 0.00 ? 22 GLY A N    2  
ATOM 1608  C CA   . GLY A 1 22 ? 0.297   7.131   10.935  1.00 0.00 ? 22 GLY A CA   2  
ATOM 1609  C C    . GLY A 1 22 ? 1.400   7.877   10.209  1.00 0.00 ? 22 GLY A C    2  
ATOM 1610  O O    . GLY A 1 22 ? 1.291   9.078   9.968   1.00 0.00 ? 22 GLY A O    2  
ATOM 1611  H H    . GLY A 1 22 ? -0.086  5.434   9.729   1.00 0.00 ? 22 GLY A H    2  
ATOM 1612  H HA2  . GLY A 1 22 ? -0.653  7.575   10.677  1.00 0.00 ? 22 GLY A HA2  2  
ATOM 1613  H HA3  . GLY A 1 22 ? 0.450   7.233   12.000  1.00 0.00 ? 22 GLY A HA3  2  
ATOM 1614  N N    . GLU A 1 23 ? 2.464   7.162   9.859   1.00 0.00 ? 23 GLU A N    2  
ATOM 1615  C CA   . GLU A 1 23 ? 3.591   7.763   9.156   1.00 0.00 ? 23 GLU A CA   2  
ATOM 1616  C C    . GLU A 1 23 ? 3.245   8.024   7.694   1.00 0.00 ? 23 GLU A C    2  
ATOM 1617  O O    . GLU A 1 23 ? 2.188   7.614   7.213   1.00 0.00 ? 23 GLU A O    2  
ATOM 1618  C CB   . GLU A 1 23 ? 4.819   6.855   9.246   1.00 0.00 ? 23 GLU A CB   2  
ATOM 1619  C CG   . GLU A 1 23 ? 4.554   5.428   8.796   1.00 0.00 ? 23 GLU A CG   2  
ATOM 1620  C CD   . GLU A 1 23 ? 5.688   4.859   7.966   1.00 0.00 ? 23 GLU A CD   2  
ATOM 1621  O OE1  . GLU A 1 23 ? 6.848   4.919   8.423   1.00 0.00 ? 23 GLU A OE1  2  
ATOM 1622  O OE2  . GLU A 1 23 ? 5.415   4.352   6.857   1.00 0.00 ? 23 GLU A OE2  2  
ATOM 1623  H H    . GLU A 1 23 ? 2.492   6.206   10.079  1.00 0.00 ? 23 GLU A H    2  
ATOM 1624  H HA   . GLU A 1 23 ? 3.815   8.705   9.634   1.00 0.00 ? 23 GLU A HA   2  
ATOM 1625  H HB2  . GLU A 1 23 ? 5.602   7.266   8.627   1.00 0.00 ? 23 GLU A HB2  2  
ATOM 1626  H HB3  . GLU A 1 23 ? 5.158   6.829   10.271  1.00 0.00 ? 23 GLU A HB3  2  
ATOM 1627  H HG2  . GLU A 1 23 ? 4.422   4.806   9.669   1.00 0.00 ? 23 GLU A HG2  2  
ATOM 1628  H HG3  . GLU A 1 23 ? 3.651   5.413   8.204   1.00 0.00 ? 23 GLU A HG3  2  
ATOM 1629  N N    . ARG A 1 24 ? 4.142   8.708   6.992   1.00 0.00 ? 24 ARG A N    2  
ATOM 1630  C CA   . ARG A 1 24 ? 3.933   9.024   5.584   1.00 0.00 ? 24 ARG A CA   2  
ATOM 1631  C C    . ARG A 1 24 ? 4.913   8.254   4.702   1.00 0.00 ? 24 ARG A C    2  
ATOM 1632  O O    . ARG A 1 24 ? 6.092   8.127   5.033   1.00 0.00 ? 24 ARG A O    2  
ATOM 1633  C CB   . ARG A 1 24 ? 4.088   10.529  5.349   1.00 0.00 ? 24 ARG A CB   2  
ATOM 1634  C CG   . ARG A 1 24 ? 2.764   11.257  5.182   1.00 0.00 ? 24 ARG A CG   2  
ATOM 1635  C CD   . ARG A 1 24 ? 2.035   11.399  6.508   1.00 0.00 ? 24 ARG A CD   2  
ATOM 1636  N NE   . ARG A 1 24 ? 1.133   12.548  6.517   1.00 0.00 ? 24 ARG A NE   2  
ATOM 1637  C CZ   . ARG A 1 24 ? 1.544   13.813  6.477   1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1638  N NH1  . ARG A 1 24 ? 2.840   14.095  6.424   1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1639  N NH2  . ARG A 1 24 ? 0.657   14.799  6.488   1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1640  H H    . ARG A 1 24 ? 4.966   9.007   7.432   1.00 0.00 ? 24 ARG A H    2  
ATOM 1641  H HA   . ARG A 1 24 ? 2.927   8.730   5.324   1.00 0.00 ? 24 ARG A HA   2  
ATOM 1642  H HB2  . ARG A 1 24 ? 4.607   10.961  6.192   1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1643  H HB3  . ARG A 1 24 ? 4.675   10.686  4.456   1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1644  H HG2  . ARG A 1 24 ? 2.954   12.242  4.781   1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1645  H HG3  . ARG A 1 24 ? 2.142   10.701  4.496   1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1646  H HD2  . ARG A 1 24 ? 1.460   10.501  6.685   1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1647  H HD3  . ARG A 1 24 ? 2.765   11.519  7.294   1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1648  H HE   . ARG A 1 24 ? 0.171   12.367  6.554   1.00 0.00 ? 24 ARG A HE   2  
ATOM 1649  H HH11 . ARG A 1 24 ? 3.514   13.357  6.415   1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1650  H HH12 . ARG A 1 24 ? 3.143   15.048  6.394   1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1651  H HH21 . ARG A 1 24 ? -0.320  14.592  6.527   1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1652  H HH22 . ARG A 1 24 ? 0.967   15.749  6.458   1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1653  N N    . VAL A 1 25 ? 4.417   7.744   3.580   1.00 0.00 ? 25 VAL A N    2  
ATOM 1654  C CA   . VAL A 1 25 ? 5.248   6.988   2.652   1.00 0.00 ? 25 VAL A CA   2  
ATOM 1655  C C    . VAL A 1 25 ? 4.972   7.396   1.210   1.00 0.00 ? 25 VAL A C    2  
ATOM 1656  O O    . VAL A 1 25 ? 3.826   7.637   0.831   1.00 0.00 ? 25 VAL A O    2  
ATOM 1657  C CB   . VAL A 1 25 ? 5.017   5.472   2.797   1.00 0.00 ? 25 VAL A CB   2  
ATOM 1658  C CG1  . VAL A 1 25 ? 5.472   4.991   4.166   1.00 0.00 ? 25 VAL A CG1  2  
ATOM 1659  C CG2  . VAL A 1 25 ? 3.554   5.129   2.563   1.00 0.00 ? 25 VAL A CG2  2  
ATOM 1660  H H    . VAL A 1 25 ? 3.469   7.879   3.372   1.00 0.00 ? 25 VAL A H    2  
ATOM 1661  H HA   . VAL A 1 25 ? 6.283   7.197   2.884   1.00 0.00 ? 25 VAL A HA   2  
ATOM 1662  H HB   . VAL A 1 25 ? 5.608   4.964   2.049   1.00 0.00 ? 25 VAL A HB   2  
ATOM 1663  H HG11 . VAL A 1 25 ? 4.647   5.048   4.860   1.00 0.00 ? 25 VAL A HG11 2  
ATOM 1664  H HG12 . VAL A 1 25 ? 6.282   5.614   4.516   1.00 0.00 ? 25 VAL A HG12 2  
ATOM 1665  H HG13 . VAL A 1 25 ? 5.812   3.968   4.094   1.00 0.00 ? 25 VAL A HG13 2  
ATOM 1666  H HG21 . VAL A 1 25 ? 3.423   4.058   2.606   1.00 0.00 ? 25 VAL A HG21 2  
ATOM 1667  H HG22 . VAL A 1 25 ? 3.251   5.490   1.591   1.00 0.00 ? 25 VAL A HG22 2  
ATOM 1668  H HG23 . VAL A 1 25 ? 2.949   5.597   3.325   1.00 0.00 ? 25 VAL A HG23 2  
ATOM 1669  N N    . TRP A 1 26 ? 6.030   7.472   0.409   1.00 0.00 ? 26 TRP A N    2  
ATOM 1670  C CA   . TRP A 1 26 ? 5.902   7.852   -0.993  1.00 0.00 ? 26 TRP A CA   2  
ATOM 1671  C C    . TRP A 1 26 ? 5.637   6.630   -1.866  1.00 0.00 ? 26 TRP A C    2  
ATOM 1672  O O    . TRP A 1 26 ? 6.506   5.774   -2.034  1.00 0.00 ? 26 TRP A O    2  
ATOM 1673  C CB   . TRP A 1 26 ? 7.168   8.568   -1.467  1.00 0.00 ? 26 TRP A CB   2  
ATOM 1674  C CG   . TRP A 1 26 ? 7.189   10.026  -1.125  1.00 0.00 ? 26 TRP A CG   2  
ATOM 1675  C CD1  . TRP A 1 26 ? 7.105   11.073  -1.996  1.00 0.00 ? 26 TRP A CD1  2  
ATOM 1676  C CD2  . TRP A 1 26 ? 7.304   10.598  0.183   1.00 0.00 ? 26 TRP A CD2  2  
ATOM 1677  N NE1  . TRP A 1 26 ? 7.159   12.262  -1.310  1.00 0.00 ? 26 TRP A NE1  2  
ATOM 1678  C CE2  . TRP A 1 26 ? 7.282   11.998  0.029   1.00 0.00 ? 26 TRP A CE2  2  
ATOM 1679  C CE3  . TRP A 1 26 ? 7.424   10.063  1.469   1.00 0.00 ? 26 TRP A CE3  2  
ATOM 1680  C CZ2  . TRP A 1 26 ? 7.375   12.867  1.112   1.00 0.00 ? 26 TRP A CZ2  2  
ATOM 1681  C CZ3  . TRP A 1 26 ? 7.515   10.929  2.544   1.00 0.00 ? 26 TRP A CZ3  2  
ATOM 1682  C CH2  . TRP A 1 26 ? 7.490   12.317  2.360   1.00 0.00 ? 26 TRP A CH2  2  
ATOM 1683  H H    . TRP A 1 26 ? 6.919   7.269   0.769   1.00 0.00 ? 26 TRP A H    2  
ATOM 1684  H HA   . TRP A 1 26 ? 5.064   8.528   -1.078  1.00 0.00 ? 26 TRP A HA   2  
ATOM 1685  H HB2  . TRP A 1 26 ? 8.029   8.104   -1.007  1.00 0.00 ? 26 TRP A HB2  2  
ATOM 1686  H HB3  . TRP A 1 26 ? 7.246   8.474   -2.540  1.00 0.00 ? 26 TRP A HB3  2  
ATOM 1687  H HD1  . TRP A 1 26 ? 7.008   10.968  -3.067  1.00 0.00 ? 26 TRP A HD1  2  
ATOM 1688  H HE1  . TRP A 1 26 ? 7.117   13.155  -1.714  1.00 0.00 ? 26 TRP A HE1  2  
ATOM 1689  H HE3  . TRP A 1 26 ? 7.445   8.995   1.630   1.00 0.00 ? 26 TRP A HE3  2  
ATOM 1690  H HZ2  . TRP A 1 26 ? 7.356   13.940  0.988   1.00 0.00 ? 26 TRP A HZ2  2  
ATOM 1691  H HZ3  . TRP A 1 26 ? 7.609   10.533  3.545   1.00 0.00 ? 26 TRP A HZ3  2  
ATOM 1692  H HH2  . TRP A 1 26 ? 7.565   12.954  3.228   1.00 0.00 ? 26 TRP A HH2  2  
ATOM 1693  N N    . VAL A 1 27 ? 4.431   6.555   -2.419  1.00 0.00 ? 27 VAL A N    2  
ATOM 1694  C CA   . VAL A 1 27 ? 4.051   5.437   -3.276  1.00 0.00 ? 27 VAL A CA   2  
ATOM 1695  C C    . VAL A 1 27 ? 4.619   5.604   -4.680  1.00 0.00 ? 27 VAL A C    2  
ATOM 1696  O O    . VAL A 1 27 ? 4.287   6.555   -5.386  1.00 0.00 ? 27 VAL A O    2  
ATOM 1697  C CB   . VAL A 1 27 ? 2.519   5.293   -3.366  1.00 0.00 ? 27 VAL A CB   2  
ATOM 1698  C CG1  . VAL A 1 27 ? 2.143   4.027   -4.121  1.00 0.00 ? 27 VAL A CG1  2  
ATOM 1699  C CG2  . VAL A 1 27 ? 1.896   5.297   -1.978  1.00 0.00 ? 27 VAL A CG2  2  
ATOM 1700  H H    . VAL A 1 27 ? 3.781   7.267   -2.248  1.00 0.00 ? 27 VAL A H    2  
ATOM 1701  H HA   . VAL A 1 27 ? 4.452   4.533   -2.840  1.00 0.00 ? 27 VAL A HA   2  
ATOM 1702  H HB   . VAL A 1 27 ? 2.131   6.140   -3.914  1.00 0.00 ? 27 VAL A HB   2  
ATOM 1703  H HG11 . VAL A 1 27 ? 2.076   3.201   -3.428  1.00 0.00 ? 27 VAL A HG11 2  
ATOM 1704  H HG12 . VAL A 1 27 ? 2.898   3.813   -4.865  1.00 0.00 ? 27 VAL A HG12 2  
ATOM 1705  H HG13 . VAL A 1 27 ? 1.190   4.167   -4.607  1.00 0.00 ? 27 VAL A HG13 2  
ATOM 1706  H HG21 . VAL A 1 27 ? 1.645   4.286   -1.693  1.00 0.00 ? 27 VAL A HG21 2  
ATOM 1707  H HG22 . VAL A 1 27 ? 1.001   5.901   -1.986  1.00 0.00 ? 27 VAL A HG22 2  
ATOM 1708  H HG23 . VAL A 1 27 ? 2.600   5.708   -1.268  1.00 0.00 ? 27 VAL A HG23 2  
ATOM 1709  N N    . ASN A 1 28 ? 5.478   4.672   -5.080  1.00 0.00 ? 28 ASN A N    2  
ATOM 1710  C CA   . ASN A 1 28 ? 6.094   4.715   -6.402  1.00 0.00 ? 28 ASN A CA   2  
ATOM 1711  C C    . ASN A 1 28 ? 6.896   5.999   -6.589  1.00 0.00 ? 28 ASN A C    2  
ATOM 1712  O O    . ASN A 1 28 ? 7.061   6.481   -7.710  1.00 0.00 ? 28 ASN A O    2  
ATOM 1713  C CB   . ASN A 1 28 ? 5.023   4.607   -7.489  1.00 0.00 ? 28 ASN A CB   2  
ATOM 1714  C CG   . ASN A 1 28 ? 4.130   3.396   -7.301  1.00 0.00 ? 28 ASN A CG   2  
ATOM 1715  O OD1  . ASN A 1 28 ? 4.308   2.617   -6.366  1.00 0.00 ? 28 ASN A OD1  2  
ATOM 1716  N ND2  . ASN A 1 28 ? 3.160   3.232   -8.194  1.00 0.00 ? 28 ASN A ND2  2  
ATOM 1717  H H    . ASN A 1 28 ? 5.705   3.937   -4.472  1.00 0.00 ? 28 ASN A H    2  
ATOM 1718  H HA   . ASN A 1 28 ? 6.763   3.871   -6.483  1.00 0.00 ? 28 ASN A HA   2  
ATOM 1719  H HB2  . ASN A 1 28 ? 4.407   5.492   -7.467  1.00 0.00 ? 28 ASN A HB2  2  
ATOM 1720  H HB3  . ASN A 1 28 ? 5.505   4.531   -8.453  1.00 0.00 ? 28 ASN A HB3  2  
ATOM 1721  H HD21 . ASN A 1 28 ? 3.076   3.893   -8.914  1.00 0.00 ? 28 ASN A HD21 2  
ATOM 1722  H HD22 . ASN A 1 28 ? 2.567   2.459   -8.097  1.00 0.00 ? 28 ASN A HD22 2  
ATOM 1723  N N    . GLY A 1 29 ? 7.395   6.548   -5.485  1.00 0.00 ? 29 GLY A N    2  
ATOM 1724  C CA   . GLY A 1 29 ? 8.175   7.771   -5.552  1.00 0.00 ? 29 GLY A CA   2  
ATOM 1725  C C    . GLY A 1 29 ? 7.417   8.910   -6.206  1.00 0.00 ? 29 GLY A C    2  
ATOM 1726  O O    . GLY A 1 29 ? 8.016   9.781   -6.837  1.00 0.00 ? 29 GLY A O    2  
ATOM 1727  H H    . GLY A 1 29 ? 7.234   6.120   -4.619  1.00 0.00 ? 29 GLY A H    2  
ATOM 1728  H HA2  . GLY A 1 29 ? 8.448   8.064   -4.549  1.00 0.00 ? 29 GLY A HA2  2  
ATOM 1729  H HA3  . GLY A 1 29 ? 9.075   7.581   -6.118  1.00 0.00 ? 29 GLY A HA3  2  
ATOM 1730  N N    . VAL A 1 30 ? 6.097   8.903   -6.056  1.00 0.00 ? 30 VAL A N    2  
ATOM 1731  C CA   . VAL A 1 30 ? 5.257   9.942   -6.638  1.00 0.00 ? 30 VAL A CA   2  
ATOM 1732  C C    . VAL A 1 30 ? 4.821   10.953  -5.582  1.00 0.00 ? 30 VAL A C    2  
ATOM 1733  O O    . VAL A 1 30 ? 5.221   12.117  -5.622  1.00 0.00 ? 30 VAL A O    2  
ATOM 1734  C CB   . VAL A 1 30 ? 4.004   9.344   -7.306  1.00 0.00 ? 30 VAL A CB   2  
ATOM 1735  C CG1  . VAL A 1 30 ? 3.246   10.415  -8.075  1.00 0.00 ? 30 VAL A CG1  2  
ATOM 1736  C CG2  . VAL A 1 30 ? 4.387   8.190   -8.221  1.00 0.00 ? 30 VAL A CG2  2  
ATOM 1737  H H    . VAL A 1 30 ? 5.677   8.181   -5.542  1.00 0.00 ? 30 VAL A H    2  
ATOM 1738  H HA   . VAL A 1 30 ? 5.834   10.453  -7.395  1.00 0.00 ? 30 VAL A HA   2  
ATOM 1739  H HB   . VAL A 1 30 ? 3.356   8.962   -6.532  1.00 0.00 ? 30 VAL A HB   2  
ATOM 1740  H HG11 . VAL A 1 30 ? 3.514   11.389  -7.695  1.00 0.00 ? 30 VAL A HG11 2  
ATOM 1741  H HG12 . VAL A 1 30 ? 2.184   10.261  -7.954  1.00 0.00 ? 30 VAL A HG12 2  
ATOM 1742  H HG13 . VAL A 1 30 ? 3.501   10.355  -9.123  1.00 0.00 ? 30 VAL A HG13 2  
ATOM 1743  H HG21 . VAL A 1 30 ? 3.500   7.634   -8.489  1.00 0.00 ? 30 VAL A HG21 2  
ATOM 1744  H HG22 . VAL A 1 30 ? 5.079   7.539   -7.708  1.00 0.00 ? 30 VAL A HG22 2  
ATOM 1745  H HG23 . VAL A 1 30 ? 4.853   8.578   -9.114  1.00 0.00 ? 30 VAL A HG23 2  
ATOM 1746  N N    . LYS A 1 31 ? 4.001   10.501  -4.639  1.00 0.00 ? 31 LYS A N    2  
ATOM 1747  C CA   . LYS A 1 31 ? 3.511   11.366  -3.574  1.00 0.00 ? 31 LYS A CA   2  
ATOM 1748  C C    . LYS A 1 31 ? 3.384   10.596  -2.261  1.00 0.00 ? 31 LYS A C    2  
ATOM 1749  O O    . LYS A 1 31 ? 3.157   9.386   -2.262  1.00 0.00 ? 31 LYS A O    2  
ATOM 1750  C CB   . LYS A 1 31 ? 2.158   11.968  -3.958  1.00 0.00 ? 31 LYS A CB   2  
ATOM 1751  C CG   . LYS A 1 31 ? 2.267   13.159  -4.897  1.00 0.00 ? 31 LYS A CG   2  
ATOM 1752  C CD   . LYS A 1 31 ? 1.136   13.173  -5.913  1.00 0.00 ? 31 LYS A CD   2  
ATOM 1753  C CE   . LYS A 1 31 ? 0.964   14.550  -6.534  1.00 0.00 ? 31 LYS A CE   2  
ATOM 1754  N NZ   . LYS A 1 31 ? -0.402  14.739  -7.095  1.00 0.00 ? 31 LYS A NZ   2  
ATOM 1755  H H    . LYS A 1 31 ? 3.718   9.563   -4.662  1.00 0.00 ? 31 LYS A H    2  
ATOM 1756  H HA   . LYS A 1 31 ? 4.226   12.165  -3.441  1.00 0.00 ? 31 LYS A HA   2  
ATOM 1757  H HB2  . LYS A 1 31 ? 1.564   11.207  -4.443  1.00 0.00 ? 31 LYS A HB2  2  
ATOM 1758  H HB3  . LYS A 1 31 ? 1.653   12.291  -3.059  1.00 0.00 ? 31 LYS A HB3  2  
ATOM 1759  H HG2  . LYS A 1 31 ? 2.227   14.068  -4.316  1.00 0.00 ? 31 LYS A HG2  2  
ATOM 1760  H HG3  . LYS A 1 31 ? 3.210   13.106  -5.421  1.00 0.00 ? 31 LYS A HG3  2  
ATOM 1761  H HD2  . LYS A 1 31 ? 1.357   12.462  -6.694  1.00 0.00 ? 31 LYS A HD2  2  
ATOM 1762  H HD3  . LYS A 1 31 ? 0.218   12.894  -5.418  1.00 0.00 ? 31 LYS A HD3  2  
ATOM 1763  H HE2  . LYS A 1 31 ? 1.139   15.298  -5.776  1.00 0.00 ? 31 LYS A HE2  2  
ATOM 1764  H HE3  . LYS A 1 31 ? 1.689   14.666  -7.328  1.00 0.00 ? 31 LYS A HE3  2  
ATOM 1765  H HZ1  . LYS A 1 31 ? -0.573  14.056  -7.861  1.00 0.00 ? 31 LYS A HZ1  2  
ATOM 1766  H HZ2  . LYS A 1 31 ? -0.503  15.701  -7.475  1.00 0.00 ? 31 LYS A HZ2  2  
ATOM 1767  H HZ3  . LYS A 1 31 ? -1.117  14.597  -6.352  1.00 0.00 ? 31 LYS A HZ3  2  
ATOM 1768  N N    . PRO A 1 32 ? 3.532   11.291  -1.120  1.00 0.00 ? 32 PRO A N    2  
ATOM 1769  C CA   . PRO A 1 32 ? 3.433   10.665  0.202   1.00 0.00 ? 32 PRO A CA   2  
ATOM 1770  C C    . PRO A 1 32 ? 2.004   10.262  0.548   1.00 0.00 ? 32 PRO A C    2  
ATOM 1771  O O    . PRO A 1 32 ? 1.045   10.810  0.004   1.00 0.00 ? 32 PRO A O    2  
ATOM 1772  C CB   . PRO A 1 32 ? 3.923   11.761  1.151   1.00 0.00 ? 32 PRO A CB   2  
ATOM 1773  C CG   . PRO A 1 32 ? 3.634   13.035  0.435   1.00 0.00 ? 32 PRO A CG   2  
ATOM 1774  C CD   . PRO A 1 32 ? 3.806   12.737  -1.029  1.00 0.00 ? 32 PRO A CD   2  
ATOM 1775  H HA   . PRO A 1 32 ? 4.078   9.802   0.281   1.00 0.00 ? 32 PRO A HA   2  
ATOM 1776  H HB2  . PRO A 1 32 ? 3.382   11.700  2.086   1.00 0.00 ? 32 PRO A HB2  2  
ATOM 1777  H HB3  . PRO A 1 32 ? 4.983   11.641  1.328   1.00 0.00 ? 32 PRO A HB3  2  
ATOM 1778  H HG2  . PRO A 1 32 ? 2.620   13.348  0.638   1.00 0.00 ? 32 PRO A HG2  2  
ATOM 1779  H HG3  . PRO A 1 32 ? 4.332   13.798  0.747   1.00 0.00 ? 32 PRO A HG3  2  
ATOM 1780  H HD2  . PRO A 1 32 ? 3.095   13.302  -1.615  1.00 0.00 ? 32 PRO A HD2  2  
ATOM 1781  H HD3  . PRO A 1 32 ? 4.816   12.959  -1.343  1.00 0.00 ? 32 PRO A HD3  2  
ATOM 1782  N N    . GLY A 1 33 ? 1.869   9.302   1.456   1.00 0.00 ? 33 GLY A N    2  
ATOM 1783  C CA   . GLY A 1 33 ? 0.552   8.841   1.859   1.00 0.00 ? 33 GLY A CA   2  
ATOM 1784  C C    . GLY A 1 33 ? 0.521   8.361   3.296   1.00 0.00 ? 33 GLY A C    2  
ATOM 1785  O O    . GLY A 1 33 ? 1.455   7.705   3.759   1.00 0.00 ? 33 GLY A O    2  
ATOM 1786  H H    . GLY A 1 33 ? 2.668   8.902   1.856   1.00 0.00 ? 33 GLY A H    2  
ATOM 1787  H HA2  . GLY A 1 33 ? -0.150  9.653   1.748   1.00 0.00 ? 33 GLY A HA2  2  
ATOM 1788  H HA3  . GLY A 1 33 ? 0.254   8.029   1.213   1.00 0.00 ? 33 GLY A HA3  2  
ATOM 1789  N N    . VAL A 1 34 ? -0.554  8.688   4.005   1.00 0.00 ? 34 VAL A N    2  
ATOM 1790  C CA   . VAL A 1 34 ? -0.703  8.286   5.399   1.00 0.00 ? 34 VAL A CA   2  
ATOM 1791  C C    . VAL A 1 34 ? -1.056  6.806   5.509   1.00 0.00 ? 34 VAL A C    2  
ATOM 1792  O O    . VAL A 1 34 ? -2.124  6.379   5.075   1.00 0.00 ? 34 VAL A O    2  
ATOM 1793  C CB   . VAL A 1 34 ? -1.788  9.114   6.112   1.00 0.00 ? 34 VAL A CB   2  
ATOM 1794  C CG1  . VAL A 1 34 ? -1.783  8.830   7.606   1.00 0.00 ? 34 VAL A CG1  2  
ATOM 1795  C CG2  . VAL A 1 34 ? -1.590  10.598  5.841   1.00 0.00 ? 34 VAL A CG2  2  
ATOM 1796  H H    . VAL A 1 34 ? -1.264  9.213   3.581   1.00 0.00 ? 34 VAL A H    2  
ATOM 1797  H HA   . VAL A 1 34 ? 0.240   8.459   5.899   1.00 0.00 ? 34 VAL A HA   2  
ATOM 1798  H HB   . VAL A 1 34 ? -2.751  8.824   5.717   1.00 0.00 ? 34 VAL A HB   2  
ATOM 1799  H HG11 . VAL A 1 34 ? -2.514  8.069   7.830   1.00 0.00 ? 34 VAL A HG11 2  
ATOM 1800  H HG12 . VAL A 1 34 ? -2.026  9.735   8.144   1.00 0.00 ? 34 VAL A HG12 2  
ATOM 1801  H HG13 . VAL A 1 34 ? -0.802  8.486   7.903   1.00 0.00 ? 34 VAL A HG13 2  
ATOM 1802  H HG21 . VAL A 1 34 ? -1.846  11.163  6.726   1.00 0.00 ? 34 VAL A HG21 2  
ATOM 1803  H HG22 . VAL A 1 34 ? -2.227  10.903  5.024   1.00 0.00 ? 34 VAL A HG22 2  
ATOM 1804  H HG23 . VAL A 1 34 ? -0.558  10.782  5.582   1.00 0.00 ? 34 VAL A HG23 2  
ATOM 1805  N N    . VAL A 1 35 ? -0.149  6.029   6.094   1.00 0.00 ? 35 VAL A N    2  
ATOM 1806  C CA   . VAL A 1 35 ? -0.365  4.597   6.262   1.00 0.00 ? 35 VAL A CA   2  
ATOM 1807  C C    . VAL A 1 35 ? -1.411  4.323   7.337   1.00 0.00 ? 35 VAL A C    2  
ATOM 1808  O O    . VAL A 1 35 ? -1.256  4.736   8.487   1.00 0.00 ? 35 VAL A O    2  
ATOM 1809  C CB   . VAL A 1 35 ? 0.942   3.870   6.634   1.00 0.00 ? 35 VAL A CB   2  
ATOM 1810  C CG1  . VAL A 1 35 ? 0.732   2.364   6.648   1.00 0.00 ? 35 VAL A CG1  2  
ATOM 1811  C CG2  . VAL A 1 35 ? 2.058   4.250   5.673   1.00 0.00 ? 35 VAL A CG2  2  
ATOM 1812  H H    . VAL A 1 35 ? 0.685   6.428   6.420   1.00 0.00 ? 35 VAL A H    2  
ATOM 1813  H HA   . VAL A 1 35 ? -0.718  4.201   5.321   1.00 0.00 ? 35 VAL A HA   2  
ATOM 1814  H HB   . VAL A 1 35 ? 1.231   4.179   7.628   1.00 0.00 ? 35 VAL A HB   2  
ATOM 1815  H HG11 . VAL A 1 35 ? 1.596   1.883   7.080   1.00 0.00 ? 35 VAL A HG11 2  
ATOM 1816  H HG12 . VAL A 1 35 ? 0.590   2.010   5.637   1.00 0.00 ? 35 VAL A HG12 2  
ATOM 1817  H HG13 . VAL A 1 35 ? -0.143  2.128   7.236   1.00 0.00 ? 35 VAL A HG13 2  
ATOM 1818  H HG21 . VAL A 1 35 ? 2.973   4.404   6.227   1.00 0.00 ? 35 VAL A HG21 2  
ATOM 1819  H HG22 . VAL A 1 35 ? 1.795   5.159   5.154   1.00 0.00 ? 35 VAL A HG22 2  
ATOM 1820  H HG23 . VAL A 1 35 ? 2.202   3.456   4.955   1.00 0.00 ? 35 VAL A HG23 2  
ATOM 1821  N N    . GLN A 1 36 ? -2.474  3.623   6.957   1.00 0.00 ? 36 GLN A N    2  
ATOM 1822  C CA   . GLN A 1 36 ? -3.547  3.293   7.890   1.00 0.00 ? 36 GLN A CA   2  
ATOM 1823  C C    . GLN A 1 36 ? -3.593  1.792   8.157   1.00 0.00 ? 36 GLN A C    2  
ATOM 1824  O O    . GLN A 1 36 ? -3.628  1.357   9.308   1.00 0.00 ? 36 GLN A O    2  
ATOM 1825  C CB   . GLN A 1 36 ? -4.893  3.766   7.340   1.00 0.00 ? 36 GLN A CB   2  
ATOM 1826  C CG   . GLN A 1 36 ? -5.199  5.223   7.649   1.00 0.00 ? 36 GLN A CG   2  
ATOM 1827  C CD   . GLN A 1 36 ? -5.455  5.463   9.124   1.00 0.00 ? 36 GLN A CD   2  
ATOM 1828  O OE1  . GLN A 1 36 ? -6.585  5.344   9.596   1.00 0.00 ? 36 GLN A OE1  2  
ATOM 1829  N NE2  . GLN A 1 36 ? -4.403  5.806   9.859   1.00 0.00 ? 36 GLN A NE2  2  
ATOM 1830  H H    . GLN A 1 36 ? -2.541  3.320   6.028   1.00 0.00 ? 36 GLN A H    2  
ATOM 1831  H HA   . GLN A 1 36 ? -3.347  3.805   8.819   1.00 0.00 ? 36 GLN A HA   2  
ATOM 1832  H HB2  . GLN A 1 36 ? -4.895  3.640   6.266   1.00 0.00 ? 36 GLN A HB2  2  
ATOM 1833  H HB3  . GLN A 1 36 ? -5.677  3.158   7.765   1.00 0.00 ? 36 GLN A HB3  2  
ATOM 1834  H HG2  . GLN A 1 36 ? -4.358  5.827   7.342   1.00 0.00 ? 36 GLN A HG2  2  
ATOM 1835  H HG3  . GLN A 1 36 ? -6.076  5.519   7.092   1.00 0.00 ? 36 GLN A HG3  2  
ATOM 1836  H HE21 . GLN A 1 36 ? -3.533  5.883   9.414   1.00 0.00 ? 36 GLN A HE21 2  
ATOM 1837  H HE22 . GLN A 1 36 ? -4.540  5.968   10.815  1.00 0.00 ? 36 GLN A HE22 2  
ATOM 1838  N N    . TYR A 1 37 ? -3.592  1.004   7.086   1.00 0.00 ? 37 TYR A N    2  
ATOM 1839  C CA   . TYR A 1 37 ? -3.635  -0.448  7.205   1.00 0.00 ? 37 TYR A CA   2  
ATOM 1840  C C    . TYR A 1 37 ? -2.277  -1.062  6.880   1.00 0.00 ? 37 TYR A C    2  
ATOM 1841  O O    . TYR A 1 37 ? -1.519  -0.524  6.072   1.00 0.00 ? 37 TYR A O    2  
ATOM 1842  C CB   . TYR A 1 37 ? -4.703  -1.026  6.275   1.00 0.00 ? 37 TYR A CB   2  
ATOM 1843  C CG   . TYR A 1 37 ? -5.259  -2.353  6.742   1.00 0.00 ? 37 TYR A CG   2  
ATOM 1844  C CD1  . TYR A 1 37 ? -6.357  -2.408  7.590   1.00 0.00 ? 37 TYR A CD1  2  
ATOM 1845  C CD2  . TYR A 1 37 ? -4.685  -3.550  6.332   1.00 0.00 ? 37 TYR A CD2  2  
ATOM 1846  C CE1  . TYR A 1 37 ? -6.868  -3.619  8.018   1.00 0.00 ? 37 TYR A CE1  2  
ATOM 1847  C CE2  . TYR A 1 37 ? -5.190  -4.765  6.756   1.00 0.00 ? 37 TYR A CE2  2  
ATOM 1848  C CZ   . TYR A 1 37 ? -6.281  -4.794  7.599   1.00 0.00 ? 37 TYR A CZ   2  
ATOM 1849  O OH   . TYR A 1 37 ? -6.787  -6.001  8.022   1.00 0.00 ? 37 TYR A OH   2  
ATOM 1850  H H    . TYR A 1 37 ? -3.563  1.410   6.194   1.00 0.00 ? 37 TYR A H    2  
ATOM 1851  H HA   . TYR A 1 37 ? -3.890  -0.690  8.226   1.00 0.00 ? 37 TYR A HA   2  
ATOM 1852  H HB2  . TYR A 1 37 ? -5.525  -0.329  6.206   1.00 0.00 ? 37 TYR A HB2  2  
ATOM 1853  H HB3  . TYR A 1 37 ? -4.277  -1.171  5.294   1.00 0.00 ? 37 TYR A HB3  2  
ATOM 1854  H HD1  . TYR A 1 37 ? -6.816  -1.486  7.916   1.00 0.00 ? 37 TYR A HD1  2  
ATOM 1855  H HD2  . TYR A 1 37 ? -3.830  -3.524  5.673   1.00 0.00 ? 37 TYR A HD2  2  
ATOM 1856  H HE1  . TYR A 1 37 ? -7.723  -3.641  8.677   1.00 0.00 ? 37 TYR A HE1  2  
ATOM 1857  H HE2  . TYR A 1 37 ? -4.729  -5.685  6.428   1.00 0.00 ? 37 TYR A HE2  2  
ATOM 1858  H HH   . TYR A 1 37 ? -7.185  -6.461  7.280   1.00 0.00 ? 37 TYR A HH   2  
ATOM 1859  N N    . LEU A 1 38 ? -1.975  -2.190  7.514   1.00 0.00 ? 38 LEU A N    2  
ATOM 1860  C CA   . LEU A 1 38 ? -0.708  -2.877  7.292   1.00 0.00 ? 38 LEU A CA   2  
ATOM 1861  C C    . LEU A 1 38 ? -0.851  -4.375  7.543   1.00 0.00 ? 38 LEU A C    2  
ATOM 1862  O O    . LEU A 1 38 ? -0.833  -4.826  8.689   1.00 0.00 ? 38 LEU A O    2  
ATOM 1863  C CB   . LEU A 1 38 ? 0.377   -2.296  8.200   1.00 0.00 ? 38 LEU A CB   2  
ATOM 1864  C CG   . LEU A 1 38 ? 1.066   -1.041  7.663   1.00 0.00 ? 38 LEU A CG   2  
ATOM 1865  C CD1  . LEU A 1 38 ? 1.910   -0.390  8.748   1.00 0.00 ? 38 LEU A CD1  2  
ATOM 1866  C CD2  . LEU A 1 38 ? 1.921   -1.379  6.451   1.00 0.00 ? 38 LEU A CD2  2  
ATOM 1867  H H    . LEU A 1 38 ? -2.621  -2.570  8.145   1.00 0.00 ? 38 LEU A H    2  
ATOM 1868  H HA   . LEU A 1 38 ? -0.425  -2.723  6.262   1.00 0.00 ? 38 LEU A HA   2  
ATOM 1869  H HB2  . LEU A 1 38 ? -0.072  -2.057  9.152   1.00 0.00 ? 38 LEU A HB2  2  
ATOM 1870  H HB3  . LEU A 1 38 ? 1.130   -3.054  8.355   1.00 0.00 ? 38 LEU A HB3  2  
ATOM 1871  H HG   . LEU A 1 38 ? 0.314   -0.328  7.355   1.00 0.00 ? 38 LEU A HG   2  
ATOM 1872  H HD11 . LEU A 1 38 ? 2.940   -0.697  8.636   1.00 0.00 ? 38 LEU A HD11 2  
ATOM 1873  H HD12 . LEU A 1 38 ? 1.548   -0.696  9.718   1.00 0.00 ? 38 LEU A HD12 2  
ATOM 1874  H HD13 . LEU A 1 38 ? 1.843   0.684   8.661   1.00 0.00 ? 38 LEU A HD13 2  
ATOM 1875  H HD21 . LEU A 1 38 ? 1.981   -0.519  5.802   1.00 0.00 ? 38 LEU A HD21 2  
ATOM 1876  H HD22 . LEU A 1 38 ? 1.475   -2.203  5.915   1.00 0.00 ? 38 LEU A HD22 2  
ATOM 1877  H HD23 . LEU A 1 38 ? 2.912   -1.656  6.776   1.00 0.00 ? 38 LEU A HD23 2  
ATOM 1878  N N    . GLY A 1 39 ? -0.991  -5.141  6.467   1.00 0.00 ? 39 GLY A N    2  
ATOM 1879  C CA   . GLY A 1 39 ? -1.135  -6.579  6.593   1.00 0.00 ? 39 GLY A CA   2  
ATOM 1880  C C    . GLY A 1 39 ? -1.675  -7.222  5.331   1.00 0.00 ? 39 GLY A C    2  
ATOM 1881  O O    . GLY A 1 39 ? -1.485  -6.702  4.232   1.00 0.00 ? 39 GLY A O    2  
ATOM 1882  H H    . GLY A 1 39 ? -0.997  -4.725  5.579   1.00 0.00 ? 39 GLY A H    2  
ATOM 1883  H HA2  . GLY A 1 39 ? -0.169  -7.008  6.816   1.00 0.00 ? 39 GLY A HA2  2  
ATOM 1884  H HA3  . GLY A 1 39 ? -1.809  -6.792  7.410   1.00 0.00 ? 39 GLY A HA3  2  
ATOM 1885  N N    . GLU A 1 40 ? -2.351  -8.355  5.488   1.00 0.00 ? 40 GLU A N    2  
ATOM 1886  C CA   . GLU A 1 40 ? -2.921  -9.070  4.353   1.00 0.00 ? 40 GLU A CA   2  
ATOM 1887  C C    . GLU A 1 40 ? -4.250  -8.452  3.932   1.00 0.00 ? 40 GLU A C    2  
ATOM 1888  O O    . GLU A 1 40 ? -4.889  -7.740  4.706   1.00 0.00 ? 40 GLU A O    2  
ATOM 1889  C CB   . GLU A 1 40 ? -3.120  -10.546 4.700   1.00 0.00 ? 40 GLU A CB   2  
ATOM 1890  C CG   . GLU A 1 40 ? -1.821  -11.290 4.961   1.00 0.00 ? 40 GLU A CG   2  
ATOM 1891  C CD   . GLU A 1 40 ? -1.910  -12.218 6.157   1.00 0.00 ? 40 GLU A CD   2  
ATOM 1892  O OE1  . GLU A 1 40 ? -1.682  -11.748 7.291   1.00 0.00 ? 40 GLU A OE1  2  
ATOM 1893  O OE2  . GLU A 1 40 ? -2.206  -13.415 5.959   1.00 0.00 ? 40 GLU A OE2  2  
ATOM 1894  H H    . GLU A 1 40 ? -2.469  -8.719  6.391   1.00 0.00 ? 40 GLU A H    2  
ATOM 1895  H HA   . GLU A 1 40 ? -2.226  -8.994  3.531   1.00 0.00 ? 40 GLU A HA   2  
ATOM 1896  H HB2  . GLU A 1 40 ? -3.735  -10.616 5.586   1.00 0.00 ? 40 GLU A HB2  2  
ATOM 1897  H HB3  . GLU A 1 40 ? -3.630  -11.032 3.881   1.00 0.00 ? 40 GLU A HB3  2  
ATOM 1898  H HG2  . GLU A 1 40 ? -1.576  -11.877 4.088   1.00 0.00 ? 40 GLU A HG2  2  
ATOM 1899  H HG3  . GLU A 1 40 ? -1.038  -10.569 5.140   1.00 0.00 ? 40 GLU A HG3  2  
ATOM 1900  N N    . THR A 1 41 ? -4.662  -8.729  2.698   1.00 0.00 ? 41 THR A N    2  
ATOM 1901  C CA   . THR A 1 41 ? -5.916  -8.200  2.173   1.00 0.00 ? 41 THR A CA   2  
ATOM 1902  C C    . THR A 1 41 ? -6.897  -9.327  1.871   1.00 0.00 ? 41 THR A C    2  
ATOM 1903  O O    . THR A 1 41 ? -6.602  -10.500 2.104   1.00 0.00 ? 41 THR A O    2  
ATOM 1904  C CB   . THR A 1 41 ? -5.657  -7.382  0.906   1.00 0.00 ? 41 THR A CB   2  
ATOM 1905  O OG1  . THR A 1 41 ? -4.751  -8.055  0.051   1.00 0.00 ? 41 THR A OG1  2  
ATOM 1906  C CG2  . THR A 1 41 ? -5.089  -6.008  1.187   1.00 0.00 ? 41 THR A CG2  2  
ATOM 1907  H H    . THR A 1 41 ? -4.108  -9.302  2.128   1.00 0.00 ? 41 THR A H    2  
ATOM 1908  H HA   . THR A 1 41 ? -6.345  -7.556  2.925   1.00 0.00 ? 41 THR A HA   2  
ATOM 1909  H HB   . THR A 1 41 ? -6.590  -7.252  0.378   1.00 0.00 ? 41 THR A HB   2  
ATOM 1910  H HG1  . THR A 1 41 ? -4.683  -7.580  -0.782  1.00 0.00 ? 41 THR A HG1  2  
ATOM 1911  H HG21 . THR A 1 41 ? -5.864  -5.266  1.065   1.00 0.00 ? 41 THR A HG21 2  
ATOM 1912  H HG22 . THR A 1 41 ? -4.283  -5.804  0.498   1.00 0.00 ? 41 THR A HG22 2  
ATOM 1913  H HG23 . THR A 1 41 ? -4.714  -5.973  2.199   1.00 0.00 ? 41 THR A HG23 2  
ATOM 1914  N N    . GLN A 1 42 ? -8.066  -8.966  1.353   1.00 0.00 ? 42 GLN A N    2  
ATOM 1915  C CA   . GLN A 1 42 ? -9.092  -9.947  1.021   1.00 0.00 ? 42 GLN A CA   2  
ATOM 1916  C C    . GLN A 1 42 ? -9.271  -10.061 -0.490  1.00 0.00 ? 42 GLN A C    2  
ATOM 1917  O O    . GLN A 1 42 ? -9.618  -11.124 -1.004  1.00 0.00 ? 42 GLN A O    2  
ATOM 1918  C CB   . GLN A 1 42 ? -10.421 -9.566  1.675   1.00 0.00 ? 42 GLN A CB   2  
ATOM 1919  C CG   . GLN A 1 42 ? -10.578 -10.100 3.090   1.00 0.00 ? 42 GLN A CG   2  
ATOM 1920  C CD   . GLN A 1 42 ? -11.461 -11.332 3.153   1.00 0.00 ? 42 GLN A CD   2  
ATOM 1921  O OE1  . GLN A 1 42 ? -12.520 -11.383 2.530   1.00 0.00 ? 42 GLN A OE1  2  
ATOM 1922  N NE2  . GLN A 1 42 ? -11.026 -12.332 3.911   1.00 0.00 ? 42 GLN A NE2  2  
ATOM 1923  H H    . GLN A 1 42 ? -8.243  -8.015  1.191   1.00 0.00 ? 42 GLN A H    2  
ATOM 1924  H HA   . GLN A 1 42 ? -8.772  -10.903 1.407   1.00 0.00 ? 42 GLN A HA   2  
ATOM 1925  H HB2  . GLN A 1 42 ? -10.498 -8.489  1.709   1.00 0.00 ? 42 GLN A HB2  2  
ATOM 1926  H HB3  . GLN A 1 42 ? -11.230 -9.957  1.075   1.00 0.00 ? 42 GLN A HB3  2  
ATOM 1927  H HG2  . GLN A 1 42 ? -9.603  -10.355 3.475   1.00 0.00 ? 42 GLN A HG2  2  
ATOM 1928  H HG3  . GLN A 1 42 ? -11.017 -9.329  3.705   1.00 0.00 ? 42 GLN A HG3  2  
ATOM 1929  H HE21 . GLN A 1 42 ? -10.173 -12.221 4.380   1.00 0.00 ? 42 GLN A HE21 2  
ATOM 1930  H HE22 . GLN A 1 42 ? -11.577 -13.141 3.971   1.00 0.00 ? 42 GLN A HE22 2  
ATOM 1931  N N    . PHE A 1 43 ? -9.031  -8.961  -1.196  1.00 0.00 ? 43 PHE A N    2  
ATOM 1932  C CA   . PHE A 1 43 ? -9.166  -8.941  -2.647  1.00 0.00 ? 43 PHE A CA   2  
ATOM 1933  C C    . PHE A 1 43 ? -8.083  -9.786  -3.309  1.00 0.00 ? 43 PHE A C    2  
ATOM 1934  O O    . PHE A 1 43 ? -8.354  -10.542 -4.243  1.00 0.00 ? 43 PHE A O    2  
ATOM 1935  C CB   . PHE A 1 43 ? -9.101  -7.502  -3.168  1.00 0.00 ? 43 PHE A CB   2  
ATOM 1936  C CG   . PHE A 1 43 ? -7.750  -6.862  -3.011  1.00 0.00 ? 43 PHE A CG   2  
ATOM 1937  C CD1  . PHE A 1 43 ? -6.766  -7.052  -3.967  1.00 0.00 ? 43 PHE A CD1  2  
ATOM 1938  C CD2  . PHE A 1 43 ? -7.466  -6.072  -1.909  1.00 0.00 ? 43 PHE A CD2  2  
ATOM 1939  C CE1  . PHE A 1 43 ? -5.522  -6.465  -3.826  1.00 0.00 ? 43 PHE A CE1  2  
ATOM 1940  C CE2  . PHE A 1 43 ? -6.225  -5.482  -1.763  1.00 0.00 ? 43 PHE A CE2  2  
ATOM 1941  C CZ   . PHE A 1 43 ? -5.251  -5.679  -2.724  1.00 0.00 ? 43 PHE A CZ   2  
ATOM 1942  H H    . PHE A 1 43 ? -8.757  -8.143  -0.729  1.00 0.00 ? 43 PHE A H    2  
ATOM 1943  H HA   . PHE A 1 43 ? -10.132 -9.358  -2.894  1.00 0.00 ? 43 PHE A HA   2  
ATOM 1944  H HB2  . PHE A 1 43 ? -9.350  -7.495  -4.219  1.00 0.00 ? 43 PHE A HB2  2  
ATOM 1945  H HB3  . PHE A 1 43 ? -9.819  -6.900  -2.630  1.00 0.00 ? 43 PHE A HB3  2  
ATOM 1946  H HD1  . PHE A 1 43 ? -6.975  -7.666  -4.830  1.00 0.00 ? 43 PHE A HD1  2  
ATOM 1947  H HD2  . PHE A 1 43 ? -8.227  -5.918  -1.157  1.00 0.00 ? 43 PHE A HD2  2  
ATOM 1948  H HE1  . PHE A 1 43 ? -4.762  -6.621  -4.579  1.00 0.00 ? 43 PHE A HE1  2  
ATOM 1949  H HE2  . PHE A 1 43 ? -6.016  -4.868  -0.899  1.00 0.00 ? 43 PHE A HE2  2  
ATOM 1950  H HZ   . PHE A 1 43 ? -4.281  -5.219  -2.613  1.00 0.00 ? 43 PHE A HZ   2  
ATOM 1951  N N    . ALA A 1 44 ? -6.855  -9.656  -2.817  1.00 0.00 ? 44 ALA A N    2  
ATOM 1952  C CA   . ALA A 1 44 ? -5.730  -10.408 -3.360  1.00 0.00 ? 44 ALA A CA   2  
ATOM 1953  C C    . ALA A 1 44 ? -4.841  -10.951 -2.245  1.00 0.00 ? 44 ALA A C    2  
ATOM 1954  O O    . ALA A 1 44 ? -4.788  -10.385 -1.152  1.00 0.00 ? 44 ALA A O    2  
ATOM 1955  C CB   . ALA A 1 44 ? -4.920  -9.535  -4.306  1.00 0.00 ? 44 ALA A CB   2  
ATOM 1956  H H    . ALA A 1 44 ? -6.701  -9.038  -2.072  1.00 0.00 ? 44 ALA A H    2  
ATOM 1957  H HA   . ALA A 1 44 ? -6.127  -11.239 -3.927  1.00 0.00 ? 44 ALA A HA   2  
ATOM 1958  H HB1  . ALA A 1 44 ? -4.184  -10.140 -4.814  1.00 0.00 ? 44 ALA A HB1  2  
ATOM 1959  H HB2  . ALA A 1 44 ? -4.419  -8.761  -3.741  1.00 0.00 ? 44 ALA A HB2  2  
ATOM 1960  H HB3  . ALA A 1 44 ? -5.578  -9.082  -5.032  1.00 0.00 ? 44 ALA A HB3  2  
ATOM 1961  N N    . PRO A 1 45 ? -4.129  -12.060 -2.506  1.00 0.00 ? 45 PRO A N    2  
ATOM 1962  C CA   . PRO A 1 45 ? -3.240  -12.678 -1.517  1.00 0.00 ? 45 PRO A CA   2  
ATOM 1963  C C    . PRO A 1 45 ? -1.985  -11.848 -1.267  1.00 0.00 ? 45 PRO A C    2  
ATOM 1964  O O    . PRO A 1 45 ? -1.899  -10.693 -1.685  1.00 0.00 ? 45 PRO A O    2  
ATOM 1965  C CB   . PRO A 1 45 ? -2.875  -14.018 -2.158  1.00 0.00 ? 45 PRO A CB   2  
ATOM 1966  C CG   . PRO A 1 45 ? -3.011  -13.786 -3.622  1.00 0.00 ? 45 PRO A CG   2  
ATOM 1967  C CD   . PRO A 1 45 ? -4.134  -12.798 -3.784  1.00 0.00 ? 45 PRO A CD   2  
ATOM 1968  H HA   . PRO A 1 45 ? -3.748  -12.850 -0.580  1.00 0.00 ? 45 PRO A HA   2  
ATOM 1969  H HB2  . PRO A 1 45 ? -1.863  -14.285 -1.891  1.00 0.00 ? 45 PRO A HB2  2  
ATOM 1970  H HB3  . PRO A 1 45 ? -3.557  -14.782 -1.816  1.00 0.00 ? 45 PRO A HB3  2  
ATOM 1971  H HG2  . PRO A 1 45 ? -2.092  -13.376 -4.016  1.00 0.00 ? 45 PRO A HG2  2  
ATOM 1972  H HG3  . PRO A 1 45 ? -3.254  -14.713 -4.121  1.00 0.00 ? 45 PRO A HG3  2  
ATOM 1973  H HD2  . PRO A 1 45 ? -3.936  -12.133 -4.612  1.00 0.00 ? 45 PRO A HD2  2  
ATOM 1974  H HD3  . PRO A 1 45 ? -5.072  -13.312 -3.927  1.00 0.00 ? 45 PRO A HD3  2  
ATOM 1975  N N    . GLY A 1 46 ? -1.013  -12.444 -0.584  1.00 0.00 ? 46 GLY A N    2  
ATOM 1976  C CA   . GLY A 1 46 ? 0.224   -11.746 -0.291  1.00 0.00 ? 46 GLY A CA   2  
ATOM 1977  C C    . GLY A 1 46 ? 0.028   -10.602 0.685   1.00 0.00 ? 46 GLY A C    2  
ATOM 1978  O O    . GLY A 1 46 ? -1.099  -10.172 0.930   1.00 0.00 ? 46 GLY A O    2  
ATOM 1979  H H    . GLY A 1 46 ? -1.138  -13.366 -0.275  1.00 0.00 ? 46 GLY A H    2  
ATOM 1980  H HA2  . GLY A 1 46 ? 0.930   -12.446 0.130   1.00 0.00 ? 46 GLY A HA2  2  
ATOM 1981  H HA3  . GLY A 1 46 ? 0.629   -11.353 -1.212  1.00 0.00 ? 46 GLY A HA3  2  
ATOM 1982  N N    . GLN A 1 47 ? 1.129   -10.108 1.244   1.00 0.00 ? 47 GLN A N    2  
ATOM 1983  C CA   . GLN A 1 47 ? 1.074   -9.008  2.199   1.00 0.00 ? 47 GLN A CA   2  
ATOM 1984  C C    . GLN A 1 47 ? 0.816   -7.684  1.488   1.00 0.00 ? 47 GLN A C    2  
ATOM 1985  O O    . GLN A 1 47 ? 1.367   -7.424  0.419   1.00 0.00 ? 47 GLN A O    2  
ATOM 1986  C CB   . GLN A 1 47 ? 2.378   -8.929  2.994   1.00 0.00 ? 47 GLN A CB   2  
ATOM 1987  C CG   . GLN A 1 47 ? 2.872   -10.277 3.492   1.00 0.00 ? 47 GLN A CG   2  
ATOM 1988  C CD   . GLN A 1 47 ? 1.861   -10.974 4.381   1.00 0.00 ? 47 GLN A CD   2  
ATOM 1989  O OE1  . GLN A 1 47 ? 1.488   -12.122 4.135   1.00 0.00 ? 47 GLN A OE1  2  
ATOM 1990  N NE2  . GLN A 1 47 ? 1.411   -10.283 5.421   1.00 0.00 ? 47 GLN A NE2  2  
ATOM 1991  H H    . GLN A 1 47 ? 1.999   -10.495 1.008   1.00 0.00 ? 47 GLN A H    2  
ATOM 1992  H HA   . GLN A 1 47 ? 0.259   -9.202  2.881   1.00 0.00 ? 47 GLN A HA   2  
ATOM 1993  H HB2  . GLN A 1 47 ? 3.144   -8.499  2.364   1.00 0.00 ? 47 GLN A HB2  2  
ATOM 1994  H HB3  . GLN A 1 47 ? 2.227   -8.286  3.849   1.00 0.00 ? 47 GLN A HB3  2  
ATOM 1995  H HG2  . GLN A 1 47 ? 3.075   -10.908 2.640   1.00 0.00 ? 47 GLN A HG2  2  
ATOM 1996  H HG3  . GLN A 1 47 ? 3.781   -10.128 4.054   1.00 0.00 ? 47 GLN A HG3  2  
ATOM 1997  H HE21 . GLN A 1 47 ? 1.752   -9.374  5.556   1.00 0.00 ? 47 GLN A HE21 2  
ATOM 1998  H HE22 . GLN A 1 47 ? 0.756   -10.710 6.013   1.00 0.00 ? 47 GLN A HE22 2  
ATOM 1999  N N    . TRP A 1 48 ? -0.028  -6.851  2.089   1.00 0.00 ? 48 TRP A N    2  
ATOM 2000  C CA   . TRP A 1 48 ? -0.361  -5.553  1.512   1.00 0.00 ? 48 TRP A CA   2  
ATOM 2001  C C    . TRP A 1 48 ? -0.166  -4.438  2.534   1.00 0.00 ? 48 TRP A C    2  
ATOM 2002  O O    . TRP A 1 48 ? 0.204   -4.690  3.680   1.00 0.00 ? 48 TRP A O    2  
ATOM 2003  C CB   . TRP A 1 48 ? -1.804  -5.552  1.007   1.00 0.00 ? 48 TRP A CB   2  
ATOM 2004  C CG   . TRP A 1 48 ? -1.962  -6.178  -0.344  1.00 0.00 ? 48 TRP A CG   2  
ATOM 2005  C CD1  . TRP A 1 48 ? -2.150  -7.501  -0.614  1.00 0.00 ? 48 TRP A CD1  2  
ATOM 2006  C CD2  . TRP A 1 48 ? -1.944  -5.507  -1.609  1.00 0.00 ? 48 TRP A CD2  2  
ATOM 2007  N NE1  . TRP A 1 48 ? -2.250  -7.697  -1.971  1.00 0.00 ? 48 TRP A NE1  2  
ATOM 2008  C CE2  . TRP A 1 48 ? -2.127  -6.486  -2.603  1.00 0.00 ? 48 TRP A CE2  2  
ATOM 2009  C CE3  . TRP A 1 48 ? -1.791  -4.172  -1.998  1.00 0.00 ? 48 TRP A CE3  2  
ATOM 2010  C CZ2  . TRP A 1 48 ? -2.162  -6.174  -3.960  1.00 0.00 ? 48 TRP A CZ2  2  
ATOM 2011  C CZ3  . TRP A 1 48 ? -1.827  -3.865  -3.345  1.00 0.00 ? 48 TRP A CZ3  2  
ATOM 2012  C CH2  . TRP A 1 48 ? -2.011  -4.861  -4.311  1.00 0.00 ? 48 TRP A CH2  2  
ATOM 2013  H H    . TRP A 1 48 ? -0.437  -7.115  2.939   1.00 0.00 ? 48 TRP A H    2  
ATOM 2014  H HA   . TRP A 1 48 ? 0.303   -5.381  0.678   1.00 0.00 ? 48 TRP A HA   2  
ATOM 2015  H HB2  . TRP A 1 48 ? -2.422  -6.101  1.702   1.00 0.00 ? 48 TRP A HB2  2  
ATOM 2016  H HB3  . TRP A 1 48 ? -2.157  -4.535  0.947   1.00 0.00 ? 48 TRP A HB3  2  
ATOM 2017  H HD1  . TRP A 1 48 ? -2.208  -8.271  0.139   1.00 0.00 ? 48 TRP A HD1  2  
ATOM 2018  H HE1  . TRP A 1 48 ? -2.388  -8.560  -2.413  1.00 0.00 ? 48 TRP A HE1  2  
ATOM 2019  H HE3  . TRP A 1 48 ? -1.648  -3.391  -1.266  1.00 0.00 ? 48 TRP A HE3  2  
ATOM 2020  H HZ2  . TRP A 1 48 ? -2.304  -6.930  -4.717  1.00 0.00 ? 48 TRP A HZ2  2  
ATOM 2021  H HZ3  . TRP A 1 48 ? -1.710  -2.839  -3.663  1.00 0.00 ? 48 TRP A HZ3  2  
ATOM 2022  H HH2  . TRP A 1 48 ? -2.031  -4.573  -5.352  1.00 0.00 ? 48 TRP A HH2  2  
ATOM 2023  N N    . ALA A 1 49 ? -0.418  -3.203  2.110   1.00 0.00 ? 49 ALA A N    2  
ATOM 2024  C CA   . ALA A 1 49 ? -0.271  -2.050  2.989   1.00 0.00 ? 49 ALA A CA   2  
ATOM 2025  C C    . ALA A 1 49 ? -1.129  -0.883  2.511   1.00 0.00 ? 49 ALA A C    2  
ATOM 2026  O O    . ALA A 1 49 ? -0.822  -0.245  1.505   1.00 0.00 ? 49 ALA A O    2  
ATOM 2027  C CB   . ALA A 1 49 ? 1.190   -1.633  3.071   1.00 0.00 ? 49 ALA A CB   2  
ATOM 2028  H H    . ALA A 1 49 ? -0.710  -3.066  1.184   1.00 0.00 ? 49 ALA A H    2  
ATOM 2029  H HA   . ALA A 1 49 ? -0.594  -2.340  3.977   1.00 0.00 ? 49 ALA A HA   2  
ATOM 2030  H HB1  . ALA A 1 49 ? 1.252   -0.581  3.305   1.00 0.00 ? 49 ALA A HB1  2  
ATOM 2031  H HB2  . ALA A 1 49 ? 1.672   -1.819  2.122   1.00 0.00 ? 49 ALA A HB2  2  
ATOM 2032  H HB3  . ALA A 1 49 ? 1.683   -2.204  3.844   1.00 0.00 ? 49 ALA A HB3  2  
ATOM 2033  N N    . GLY A 1 50 ? -2.206  -0.610  3.240   1.00 0.00 ? 50 GLY A N    2  
ATOM 2034  C CA   . GLY A 1 50 ? -3.092  0.479   2.875   1.00 0.00 ? 50 GLY A CA   2  
ATOM 2035  C C    . GLY A 1 50 ? -2.502  1.839   3.193   1.00 0.00 ? 50 GLY A C    2  
ATOM 2036  O O    . GLY A 1 50 ? -1.931  2.039   4.265   1.00 0.00 ? 50 GLY A O    2  
ATOM 2037  H H    . GLY A 1 50 ? -2.401  -1.153  4.032   1.00 0.00 ? 50 GLY A H    2  
ATOM 2038  H HA2  . GLY A 1 50 ? -3.293  0.426   1.814   1.00 0.00 ? 50 GLY A HA2  2  
ATOM 2039  H HA3  . GLY A 1 50 ? -4.022  0.368   3.413   1.00 0.00 ? 50 GLY A HA3  2  
ATOM 2040  N N    . VAL A 1 51 ? -2.638  2.774   2.258   1.00 0.00 ? 51 VAL A N    2  
ATOM 2041  C CA   . VAL A 1 51 ? -2.113  4.121   2.444   1.00 0.00 ? 51 VAL A CA   2  
ATOM 2042  C C    . VAL A 1 51 ? -3.121  5.172   1.993   1.00 0.00 ? 51 VAL A C    2  
ATOM 2043  O O    . VAL A 1 51 ? -3.882  4.951   1.050   1.00 0.00 ? 51 VAL A O    2  
ATOM 2044  C CB   . VAL A 1 51 ? -0.797  4.324   1.671   1.00 0.00 ? 51 VAL A CB   2  
ATOM 2045  C CG1  . VAL A 1 51 ? -0.161  5.656   2.037   1.00 0.00 ? 51 VAL A CG1  2  
ATOM 2046  C CG2  . VAL A 1 51 ? 0.162   3.174   1.939   1.00 0.00 ? 51 VAL A CG2  2  
ATOM 2047  H H    . VAL A 1 51 ? -3.103  2.553   1.425   1.00 0.00 ? 51 VAL A H    2  
ATOM 2048  H HA   . VAL A 1 51 ? -1.912  4.259   3.497   1.00 0.00 ? 51 VAL A HA   2  
ATOM 2049  H HB   . VAL A 1 51 ? -1.022  4.338   0.614   1.00 0.00 ? 51 VAL A HB   2  
ATOM 2050  H HG11 . VAL A 1 51 ? 0.051   5.675   3.096   1.00 0.00 ? 51 VAL A HG11 2  
ATOM 2051  H HG12 . VAL A 1 51 ? -0.840  6.459   1.792   1.00 0.00 ? 51 VAL A HG12 2  
ATOM 2052  H HG13 . VAL A 1 51 ? 0.758   5.780   1.484   1.00 0.00 ? 51 VAL A HG13 2  
ATOM 2053  H HG21 . VAL A 1 51 ? -0.067  2.730   2.896   1.00 0.00 ? 51 VAL A HG21 2  
ATOM 2054  H HG22 . VAL A 1 51 ? 1.176   3.546   1.948   1.00 0.00 ? 51 VAL A HG22 2  
ATOM 2055  H HG23 . VAL A 1 51 ? 0.059   2.430   1.162   1.00 0.00 ? 51 VAL A HG23 2  
ATOM 2056  N N    . VAL A 1 52 ? -3.122  6.315   2.670   1.00 0.00 ? 52 VAL A N    2  
ATOM 2057  C CA   . VAL A 1 52 ? -4.037  7.400   2.338   1.00 0.00 ? 52 VAL A CA   2  
ATOM 2058  C C    . VAL A 1 52 ? -3.292  8.574   1.711   1.00 0.00 ? 52 VAL A C    2  
ATOM 2059  O O    . VAL A 1 52 ? -2.624  9.340   2.404   1.00 0.00 ? 52 VAL A O    2  
ATOM 2060  C CB   . VAL A 1 52 ? -4.796  7.896   3.584   1.00 0.00 ? 52 VAL A CB   2  
ATOM 2061  C CG1  . VAL A 1 52 ? -5.880  8.888   3.190   1.00 0.00 ? 52 VAL A CG1  2  
ATOM 2062  C CG2  . VAL A 1 52 ? -5.389  6.723   4.350   1.00 0.00 ? 52 VAL A CG2  2  
ATOM 2063  H H    . VAL A 1 52 ? -2.492  6.431   3.412   1.00 0.00 ? 52 VAL A H    2  
ATOM 2064  H HA   . VAL A 1 52 ? -4.759  7.023   1.629   1.00 0.00 ? 52 VAL A HA   2  
ATOM 2065  H HB   . VAL A 1 52 ? -4.095  8.404   4.230   1.00 0.00 ? 52 VAL A HB   2  
ATOM 2066  H HG11 . VAL A 1 52 ? -5.597  9.387   2.275   1.00 0.00 ? 52 VAL A HG11 2  
ATOM 2067  H HG12 . VAL A 1 52 ? -6.003  9.618   3.975   1.00 0.00 ? 52 VAL A HG12 2  
ATOM 2068  H HG13 . VAL A 1 52 ? -6.812  8.362   3.039   1.00 0.00 ? 52 VAL A HG13 2  
ATOM 2069  H HG21 . VAL A 1 52 ? -4.667  5.921   4.396   1.00 0.00 ? 52 VAL A HG21 2  
ATOM 2070  H HG22 . VAL A 1 52 ? -6.280  6.378   3.846   1.00 0.00 ? 52 VAL A HG22 2  
ATOM 2071  H HG23 . VAL A 1 52 ? -5.641  7.039   5.352   1.00 0.00 ? 52 VAL A HG23 2  
ATOM 2072  N N    . LEU A 1 53 ? -3.411  8.706   0.393   1.00 0.00 ? 53 LEU A N    2  
ATOM 2073  C CA   . LEU A 1 53 ? -2.748  9.786   -0.328  1.00 0.00 ? 53 LEU A CA   2  
ATOM 2074  C C    . LEU A 1 53 ? -3.220  11.146  0.174   1.00 0.00 ? 53 LEU A C    2  
ATOM 2075  O O    . LEU A 1 53 ? -4.402  11.339  0.458   1.00 0.00 ? 53 LEU A O    2  
ATOM 2076  C CB   . LEU A 1 53 ? -3.015  9.663   -1.830  1.00 0.00 ? 53 LEU A CB   2  
ATOM 2077  C CG   . LEU A 1 53 ? -2.335  8.476   -2.514  1.00 0.00 ? 53 LEU A CG   2  
ATOM 2078  C CD1  . LEU A 1 53 ? -2.941  8.231   -3.887  1.00 0.00 ? 53 LEU A CD1  2  
ATOM 2079  C CD2  . LEU A 1 53 ? -0.836  8.716   -2.625  1.00 0.00 ? 53 LEU A CD2  2  
ATOM 2080  H H    . LEU A 1 53 ? -3.957  8.062   -0.104  1.00 0.00 ? 53 LEU A H    2  
ATOM 2081  H HA   . LEU A 1 53 ? -1.687  9.699   -0.152  1.00 0.00 ? 53 LEU A HA   2  
ATOM 2082  H HB2  . LEU A 1 53 ? -4.083  9.574   -1.978  1.00 0.00 ? 53 LEU A HB2  2  
ATOM 2083  H HB3  . LEU A 1 53 ? -2.678  10.569  -2.310  1.00 0.00 ? 53 LEU A HB3  2  
ATOM 2084  H HG   . LEU A 1 53 ? -2.488  7.589   -1.918  1.00 0.00 ? 53 LEU A HG   2  
ATOM 2085  H HD11 . LEU A 1 53 ? -2.985  7.169   -4.076  1.00 0.00 ? 53 LEU A HD11 2  
ATOM 2086  H HD12 . LEU A 1 53 ? -2.329  8.706   -4.640  1.00 0.00 ? 53 LEU A HD12 2  
ATOM 2087  H HD13 . LEU A 1 53 ? -3.938  8.645   -3.919  1.00 0.00 ? 53 LEU A HD13 2  
ATOM 2088  H HD21 . LEU A 1 53 ? -0.311  7.783   -2.480  1.00 0.00 ? 53 LEU A HD21 2  
ATOM 2089  H HD22 . LEU A 1 53 ? -0.528  9.424   -1.870  1.00 0.00 ? 53 LEU A HD22 2  
ATOM 2090  H HD23 . LEU A 1 53 ? -0.607  9.109   -3.604  1.00 0.00 ? 53 LEU A HD23 2  
ATOM 2091  N N    . ASP A 1 54 ? -2.288  12.088  0.282   1.00 0.00 ? 54 ASP A N    2  
ATOM 2092  C CA   . ASP A 1 54 ? -2.609  13.431  0.750   1.00 0.00 ? 54 ASP A CA   2  
ATOM 2093  C C    . ASP A 1 54 ? -3.636  14.095  -0.162  1.00 0.00 ? 54 ASP A C    2  
ATOM 2094  O O    . ASP A 1 54 ? -4.447  14.906  0.286   1.00 0.00 ? 54 ASP A O    2  
ATOM 2095  C CB   . ASP A 1 54 ? -1.341  14.286  0.817   1.00 0.00 ? 54 ASP A CB   2  
ATOM 2096  C CG   . ASP A 1 54 ? -0.701  14.263  2.192   1.00 0.00 ? 54 ASP A CG   2  
ATOM 2097  O OD1  . ASP A 1 54 ? -1.118  15.067  3.053   1.00 0.00 ? 54 ASP A OD1  2  
ATOM 2098  O OD2  . ASP A 1 54 ? 0.216   13.444  2.406   1.00 0.00 ? 54 ASP A OD2  2  
ATOM 2099  H H    . ASP A 1 54 ? -1.363  11.873  0.040   1.00 0.00 ? 54 ASP A H    2  
ATOM 2100  H HA   . ASP A 1 54 ? -3.027  13.346  1.741   1.00 0.00 ? 54 ASP A HA   2  
ATOM 2101  H HB2  . ASP A 1 54 ? -0.624  13.912  0.102   1.00 0.00 ? 54 ASP A HB2  2  
ATOM 2102  H HB3  . ASP A 1 54 ? -1.589  15.308  0.571   1.00 0.00 ? 54 ASP A HB3  2  
ATOM 2103  N N    . ASP A 1 55 ? -3.595  13.745  -1.444  1.00 0.00 ? 55 ASP A N    2  
ATOM 2104  C CA   . ASP A 1 55 ? -4.522  14.307  -2.419  1.00 0.00 ? 55 ASP A CA   2  
ATOM 2105  C C    . ASP A 1 55 ? -5.427  13.223  -2.999  1.00 0.00 ? 55 ASP A C    2  
ATOM 2106  O O    . ASP A 1 55 ? -5.117  12.034  -2.916  1.00 0.00 ? 55 ASP A O    2  
ATOM 2107  C CB   . ASP A 1 55 ? -3.751  14.998  -3.546  1.00 0.00 ? 55 ASP A CB   2  
ATOM 2108  C CG   . ASP A 1 55 ? -3.450  16.451  -3.235  1.00 0.00 ? 55 ASP A CG   2  
ATOM 2109  O OD1  . ASP A 1 55 ? -2.725  16.709  -2.252  1.00 0.00 ? 55 ASP A OD1  2  
ATOM 2110  O OD2  . ASP A 1 55 ? -3.940  17.330  -3.975  1.00 0.00 ? 55 ASP A OD2  2  
ATOM 2111  H H    . ASP A 1 55 ? -2.926  13.094  -1.741  1.00 0.00 ? 55 ASP A H    2  
ATOM 2112  H HA   . ASP A 1 55 ? -5.134  15.038  -1.914  1.00 0.00 ? 55 ASP A HA   2  
ATOM 2113  H HB2  . ASP A 1 55 ? -2.816  14.481  -3.703  1.00 0.00 ? 55 ASP A HB2  2  
ATOM 2114  H HB3  . ASP A 1 55 ? -4.337  14.956  -4.453  1.00 0.00 ? 55 ASP A HB3  2  
ATOM 2115  N N    . PRO A 1 56 ? -6.564  13.620  -3.596  1.00 0.00 ? 56 PRO A N    2  
ATOM 2116  C CA   . PRO A 1 56 ? -7.515  12.677  -4.191  1.00 0.00 ? 56 PRO A CA   2  
ATOM 2117  C C    . PRO A 1 56 ? -6.985  12.055  -5.479  1.00 0.00 ? 56 PRO A C    2  
ATOM 2118  O O    . PRO A 1 56 ? -7.560  12.237  -6.552  1.00 0.00 ? 56 PRO A O    2  
ATOM 2119  C CB   . PRO A 1 56 ? -8.741  13.546  -4.479  1.00 0.00 ? 56 PRO A CB   2  
ATOM 2120  C CG   . PRO A 1 56 ? -8.195  14.919  -4.659  1.00 0.00 ? 56 PRO A CG   2  
ATOM 2121  C CD   . PRO A 1 56 ? -7.010  15.020  -3.739  1.00 0.00 ? 56 PRO A CD   2  
ATOM 2122  H HA   . PRO A 1 56 ? -7.781  11.893  -3.496  1.00 0.00 ? 56 PRO A HA   2  
ATOM 2123  H HB2  . PRO A 1 56 ? -9.234  13.193  -5.372  1.00 0.00 ? 56 PRO A HB2  2  
ATOM 2124  H HB3  . PRO A 1 56 ? -9.423  13.500  -3.642  1.00 0.00 ? 56 PRO A HB3  2  
ATOM 2125  H HG2  . PRO A 1 56 ? -7.885  15.058  -5.685  1.00 0.00 ? 56 PRO A HG2  2  
ATOM 2126  H HG3  . PRO A 1 56 ? -8.942  15.650  -4.390  1.00 0.00 ? 56 PRO A HG3  2  
ATOM 2127  H HD2  . PRO A 1 56 ? -6.236  15.627  -4.184  1.00 0.00 ? 56 PRO A HD2  2  
ATOM 2128  H HD3  . PRO A 1 56 ? -7.308  15.428  -2.784  1.00 0.00 ? 56 PRO A HD3  2  
ATOM 2129  N N    . VAL A 1 57 ? -5.884  11.319  -5.365  1.00 0.00 ? 57 VAL A N    2  
ATOM 2130  C CA   . VAL A 1 57 ? -5.276  10.671  -6.520  1.00 0.00 ? 57 VAL A CA   2  
ATOM 2131  C C    . VAL A 1 57 ? -5.078  9.178   -6.273  1.00 0.00 ? 57 VAL A C    2  
ATOM 2132  O O    . VAL A 1 57 ? -4.147  8.571   -6.799  1.00 0.00 ? 57 VAL A O    2  
ATOM 2133  C CB   . VAL A 1 57 ? -3.918  11.305  -6.872  1.00 0.00 ? 57 VAL A CB   2  
ATOM 2134  C CG1  . VAL A 1 57 ? -4.103  12.741  -7.338  1.00 0.00 ? 57 VAL A CG1  2  
ATOM 2135  C CG2  . VAL A 1 57 ? -2.975  11.241  -5.680  1.00 0.00 ? 57 VAL A CG2  2  
ATOM 2136  H H    . VAL A 1 57 ? -5.471  11.210  -4.483  1.00 0.00 ? 57 VAL A H    2  
ATOM 2137  H HA   . VAL A 1 57 ? -5.939  10.799  -7.364  1.00 0.00 ? 57 VAL A HA   2  
ATOM 2138  H HB   . VAL A 1 57 ? -3.479  10.741  -7.681  1.00 0.00 ? 57 VAL A HB   2  
ATOM 2139  H HG11 . VAL A 1 57 ? -4.265  13.380  -6.482  1.00 0.00 ? 57 VAL A HG11 2  
ATOM 2140  H HG12 . VAL A 1 57 ? -4.957  12.798  -7.997  1.00 0.00 ? 57 VAL A HG12 2  
ATOM 2141  H HG13 . VAL A 1 57 ? -3.219  13.065  -7.866  1.00 0.00 ? 57 VAL A HG13 2  
ATOM 2142  H HG21 . VAL A 1 57 ? -2.980  12.191  -5.165  1.00 0.00 ? 57 VAL A HG21 2  
ATOM 2143  H HG22 . VAL A 1 57 ? -1.975  11.023  -6.023  1.00 0.00 ? 57 VAL A HG22 2  
ATOM 2144  H HG23 . VAL A 1 57 ? -3.300  10.464  -5.005  1.00 0.00 ? 57 VAL A HG23 2  
ATOM 2145  N N    . GLY A 1 58 ? -5.959  8.596   -5.467  1.00 0.00 ? 58 GLY A N    2  
ATOM 2146  C CA   . GLY A 1 58 ? -5.862  7.180   -5.163  1.00 0.00 ? 58 GLY A CA   2  
ATOM 2147  C C    . GLY A 1 58 ? -6.746  6.333   -6.059  1.00 0.00 ? 58 GLY A C    2  
ATOM 2148  O O    . GLY A 1 58 ? -6.871  6.605   -7.253  1.00 0.00 ? 58 GLY A O    2  
ATOM 2149  H H    . GLY A 1 58 ? -6.681  9.131   -5.076  1.00 0.00 ? 58 GLY A H    2  
ATOM 2150  H HA2  . GLY A 1 58 ? -4.837  6.865   -5.286  1.00 0.00 ? 58 GLY A HA2  2  
ATOM 2151  H HA3  . GLY A 1 58 ? -6.155  7.022   -4.136  1.00 0.00 ? 58 GLY A HA3  2  
ATOM 2152  N N    . LYS A 1 59 ? -7.358  5.305   -5.482  1.00 0.00 ? 59 LYS A N    2  
ATOM 2153  C CA   . LYS A 1 59 ? -8.233  4.416   -6.236  1.00 0.00 ? 59 LYS A CA   2  
ATOM 2154  C C    . LYS A 1 59 ? -9.510  4.117   -5.455  1.00 0.00 ? 59 LYS A C    2  
ATOM 2155  O O    . LYS A 1 59 ? -10.605 4.492   -5.872  1.00 0.00 ? 59 LYS A O    2  
ATOM 2156  C CB   . LYS A 1 59 ? -7.508  3.110   -6.566  1.00 0.00 ? 59 LYS A CB   2  
ATOM 2157  C CG   . LYS A 1 59 ? -6.142  3.316   -7.200  1.00 0.00 ? 59 LYS A CG   2  
ATOM 2158  C CD   . LYS A 1 59 ? -5.817  2.212   -8.194  1.00 0.00 ? 59 LYS A CD   2  
ATOM 2159  C CE   . LYS A 1 59 ? -4.357  1.794   -8.108  1.00 0.00 ? 59 LYS A CE   2  
ATOM 2160  N NZ   . LYS A 1 59 ? -3.600  2.167   -9.334  1.00 0.00 ? 59 LYS A NZ   2  
ATOM 2161  H H    . LYS A 1 59 ? -7.218  5.140   -4.526  1.00 0.00 ? 59 LYS A H    2  
ATOM 2162  H HA   . LYS A 1 59 ? -8.497  4.914   -7.157  1.00 0.00 ? 59 LYS A HA   2  
ATOM 2163  H HB2  . LYS A 1 59 ? -7.376  2.544   -5.655  1.00 0.00 ? 59 LYS A HB2  2  
ATOM 2164  H HB3  . LYS A 1 59 ? -8.116  2.537   -7.250  1.00 0.00 ? 59 LYS A HB3  2  
ATOM 2165  H HG2  . LYS A 1 59 ? -6.135  4.265   -7.717  1.00 0.00 ? 59 LYS A HG2  2  
ATOM 2166  H HG3  . LYS A 1 59 ? -5.392  3.322   -6.423  1.00 0.00 ? 59 LYS A HG3  2  
ATOM 2167  H HD2  . LYS A 1 59 ? -6.438  1.355   -7.981  1.00 0.00 ? 59 LYS A HD2  2  
ATOM 2168  H HD3  . LYS A 1 59 ? -6.022  2.569   -9.192  1.00 0.00 ? 59 LYS A HD3  2  
ATOM 2169  H HE2  . LYS A 1 59 ? -3.904  2.279   -7.256  1.00 0.00 ? 59 LYS A HE2  2  
ATOM 2170  H HE3  . LYS A 1 59 ? -4.310  0.723   -7.978  1.00 0.00 ? 59 LYS A HE3  2  
ATOM 2171  H HZ1  . LYS A 1 59 ? -2.746  1.580   -9.420  1.00 0.00 ? 59 LYS A HZ1  2  
ATOM 2172  H HZ2  . LYS A 1 59 ? -3.316  3.166   -9.290  1.00 0.00 ? 59 LYS A HZ2  2  
ATOM 2173  H HZ3  . LYS A 1 59 ? -4.192  2.024   -10.178 1.00 0.00 ? 59 LYS A HZ3  2  
ATOM 2174  N N    . ASN A 1 60 ? -9.359  3.442   -4.321  1.00 0.00 ? 60 ASN A N    2  
ATOM 2175  C CA   . ASN A 1 60 ? -10.499 3.093   -3.482  1.00 0.00 ? 60 ASN A CA   2  
ATOM 2176  C C    . ASN A 1 60 ? -10.727 4.149   -2.405  1.00 0.00 ? 60 ASN A C    2  
ATOM 2177  O O    . ASN A 1 60 ? -9.983  5.127   -2.314  1.00 0.00 ? 60 ASN A O    2  
ATOM 2178  C CB   . ASN A 1 60 ? -10.280 1.725   -2.832  1.00 0.00 ? 60 ASN A CB   2  
ATOM 2179  C CG   . ASN A 1 60 ? -9.980  0.642   -3.849  1.00 0.00 ? 60 ASN A CG   2  
ATOM 2180  O OD1  . ASN A 1 60 ? -10.637 0.550   -4.887  1.00 0.00 ? 60 ASN A OD1  2  
ATOM 2181  N ND2  . ASN A 1 60 ? -8.983  -0.184  -3.557  1.00 0.00 ? 60 ASN A ND2  2  
ATOM 2182  H H    . ASN A 1 60 ? -8.459  3.171   -4.042  1.00 0.00 ? 60 ASN A H    2  
ATOM 2183  H HA   . ASN A 1 60 ? -11.373 3.046   -4.114  1.00 0.00 ? 60 ASN A HA   2  
ATOM 2184  H HB2  . ASN A 1 60 ? -9.449  1.788   -2.146  1.00 0.00 ? 60 ASN A HB2  2  
ATOM 2185  H HB3  . ASN A 1 60 ? -11.170 1.446   -2.287  1.00 0.00 ? 60 ASN A HB3  2  
ATOM 2186  H HD21 . ASN A 1 60 ? -8.504  -0.051  -2.713  1.00 0.00 ? 60 ASN A HD21 2  
ATOM 2187  H HD22 . ASN A 1 60 ? -8.767  -0.894  -4.198  1.00 0.00 ? 60 ASN A HD22 2  
ATOM 2188  N N    . ASP A 1 61 ? -11.759 3.945   -1.593  1.00 0.00 ? 61 ASP A N    2  
ATOM 2189  C CA   . ASP A 1 61 ? -12.085 4.880   -0.522  1.00 0.00 ? 61 ASP A CA   2  
ATOM 2190  C C    . ASP A 1 61 ? -12.017 4.193   0.838   1.00 0.00 ? 61 ASP A C    2  
ATOM 2191  O O    . ASP A 1 61 ? -12.771 4.528   1.752   1.00 0.00 ? 61 ASP A O    2  
ATOM 2192  C CB   . ASP A 1 61 ? -13.479 5.470   -0.740  1.00 0.00 ? 61 ASP A CB   2  
ATOM 2193  C CG   . ASP A 1 61 ? -14.549 4.401   -0.847  1.00 0.00 ? 61 ASP A CG   2  
ATOM 2194  O OD1  . ASP A 1 61 ? -15.014 3.918   0.208   1.00 0.00 ? 61 ASP A OD1  2  
ATOM 2195  O OD2  . ASP A 1 61 ? -14.923 4.047   -1.984  1.00 0.00 ? 61 ASP A OD2  2  
ATOM 2196  H H    . ASP A 1 61 ? -12.314 3.148   -1.717  1.00 0.00 ? 61 ASP A H    2  
ATOM 2197  H HA   . ASP A 1 61 ? -11.359 5.679   -0.546  1.00 0.00 ? 61 ASP A HA   2  
ATOM 2198  H HB2  . ASP A 1 61 ? -13.724 6.116   0.091   1.00 0.00 ? 61 ASP A HB2  2  
ATOM 2199  H HB3  . ASP A 1 61 ? -13.481 6.048   -1.652  1.00 0.00 ? 61 ASP A HB3  2  
ATOM 2200  N N    . GLY A 1 62 ? -11.109 3.231   0.964   1.00 0.00 ? 62 GLY A N    2  
ATOM 2201  C CA   . GLY A 1 62 ? -10.960 2.513   2.216   1.00 0.00 ? 62 GLY A CA   2  
ATOM 2202  C C    . GLY A 1 62 ? -11.866 1.300   2.301   1.00 0.00 ? 62 GLY A C    2  
ATOM 2203  O O    . GLY A 1 62 ? -12.253 0.881   3.392   1.00 0.00 ? 62 GLY A O    2  
ATOM 2204  H H    . GLY A 1 62 ? -10.536 3.007   0.201   1.00 0.00 ? 62 GLY A H    2  
ATOM 2205  H HA2  . GLY A 1 62 ? -9.934  2.189   2.312   1.00 0.00 ? 62 GLY A HA2  2  
ATOM 2206  H HA3  . GLY A 1 62 ? -11.193 3.180   3.031   1.00 0.00 ? 62 GLY A HA3  2  
ATOM 2207  N N    . ALA A 1 63 ? -12.204 0.734   1.147   1.00 0.00 ? 63 ALA A N    2  
ATOM 2208  C CA   . ALA A 1 63 ? -13.070 -0.438  1.094   1.00 0.00 ? 63 ALA A CA   2  
ATOM 2209  C C    . ALA A 1 63 ? -12.917 -1.175  -0.231  1.00 0.00 ? 63 ALA A C    2  
ATOM 2210  O O    . ALA A 1 63 ? -13.031 -0.577  -1.302  1.00 0.00 ? 63 ALA A O    2  
ATOM 2211  C CB   . ALA A 1 63 ? -14.521 -0.031  1.310   1.00 0.00 ? 63 ALA A CB   2  
ATOM 2212  H H    . ALA A 1 63 ? -11.863 1.114   0.310   1.00 0.00 ? 63 ALA A H    2  
ATOM 2213  H HA   . ALA A 1 63 ? -12.783 -1.100  1.898   1.00 0.00 ? 63 ALA A HA   2  
ATOM 2214  H HB1  . ALA A 1 63 ? -14.710 0.906   0.809   1.00 0.00 ? 63 ALA A HB1  2  
ATOM 2215  H HB2  . ALA A 1 63 ? -14.709 0.081   2.368   1.00 0.00 ? 63 ALA A HB2  2  
ATOM 2216  H HB3  . ALA A 1 63 ? -15.172 -0.793  0.907   1.00 0.00 ? 63 ALA A HB3  2  
ATOM 2217  N N    . VAL A 1 64 ? -12.659 -2.475  -0.154  1.00 0.00 ? 64 VAL A N    2  
ATOM 2218  C CA   . VAL A 1 64 ? -12.490 -3.294  -1.347  1.00 0.00 ? 64 VAL A CA   2  
ATOM 2219  C C    . VAL A 1 64 ? -13.309 -4.577  -1.255  1.00 0.00 ? 64 VAL A C    2  
ATOM 2220  O O    . VAL A 1 64 ? -13.035 -5.441  -0.421  1.00 0.00 ? 64 VAL A O    2  
ATOM 2221  C CB   . VAL A 1 64 ? -11.011 -3.658  -1.575  1.00 0.00 ? 64 VAL A CB   2  
ATOM 2222  C CG1  . VAL A 1 64 ? -10.830 -4.341  -2.923  1.00 0.00 ? 64 VAL A CG1  2  
ATOM 2223  C CG2  . VAL A 1 64 ? -10.134 -2.419  -1.475  1.00 0.00 ? 64 VAL A CG2  2  
ATOM 2224  H H    . VAL A 1 64 ? -12.580 -2.895  0.729   1.00 0.00 ? 64 VAL A H    2  
ATOM 2225  H HA   . VAL A 1 64 ? -12.833 -2.721  -2.196  1.00 0.00 ? 64 VAL A HA   2  
ATOM 2226  H HB   . VAL A 1 64 ? -10.708 -4.349  -0.803  1.00 0.00 ? 64 VAL A HB   2  
ATOM 2227  H HG11 . VAL A 1 64 ? -11.388 -3.806  -3.675  1.00 0.00 ? 64 VAL A HG11 2  
ATOM 2228  H HG12 . VAL A 1 64 ? -11.189 -5.358  -2.861  1.00 0.00 ? 64 VAL A HG12 2  
ATOM 2229  H HG13 . VAL A 1 64 ? -9.782  -4.345  -3.186  1.00 0.00 ? 64 VAL A HG13 2  
ATOM 2230  H HG21 . VAL A 1 64 ? -9.107  -2.716  -1.331  1.00 0.00 ? 64 VAL A HG21 2  
ATOM 2231  H HG22 . VAL A 1 64 ? -10.456 -1.817  -0.638  1.00 0.00 ? 64 VAL A HG22 2  
ATOM 2232  H HG23 . VAL A 1 64 ? -10.219 -1.843  -2.385  1.00 0.00 ? 64 VAL A HG23 2  
ATOM 2233  N N    . GLY A 1 65 ? -14.314 -4.695  -2.115  1.00 0.00 ? 65 GLY A N    2  
ATOM 2234  C CA   . GLY A 1 65 ? -15.157 -5.876  -2.113  1.00 0.00 ? 65 GLY A CA   2  
ATOM 2235  C C    . GLY A 1 65 ? -16.033 -5.962  -0.879  1.00 0.00 ? 65 GLY A C    2  
ATOM 2236  O O    . GLY A 1 65 ? -16.404 -7.054  -0.447  1.00 0.00 ? 65 GLY A O    2  
ATOM 2237  H H    . GLY A 1 65 ? -14.485 -3.974  -2.757  1.00 0.00 ? 65 GLY A H    2  
ATOM 2238  H HA2  . GLY A 1 65 ? -15.789 -5.856  -2.988  1.00 0.00 ? 65 GLY A HA2  2  
ATOM 2239  H HA3  . GLY A 1 65 ? -14.529 -6.753  -2.157  1.00 0.00 ? 65 GLY A HA3  2  
ATOM 2240  N N    . GLY A 1 66 ? -16.366 -4.808  -0.311  1.00 0.00 ? 66 GLY A N    2  
ATOM 2241  C CA   . GLY A 1 66 ? -17.201 -4.779  0.876   1.00 0.00 ? 66 GLY A CA   2  
ATOM 2242  C C    . GLY A 1 66 ? -16.392 -4.675  2.154   1.00 0.00 ? 66 GLY A C    2  
ATOM 2243  O O    . GLY A 1 66 ? -16.866 -4.135  3.154   1.00 0.00 ? 66 GLY A O    2  
ATOM 2244  H H    . GLY A 1 66 ? -16.041 -3.968  -0.699  1.00 0.00 ? 66 GLY A H    2  
ATOM 2245  H HA2  . GLY A 1 66 ? -17.866 -3.929  0.814   1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2246  H HA3  . GLY A 1 66 ? -17.792 -5.683  0.909   1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2247  N N    . VAL A 1 67 ? -15.169 -5.194  2.121   1.00 0.00 ? 67 VAL A N    2  
ATOM 2248  C CA   . VAL A 1 67 ? -14.293 -5.157  3.286   1.00 0.00 ? 67 VAL A CA   2  
ATOM 2249  C C    . VAL A 1 67 ? -13.655 -3.782  3.450   1.00 0.00 ? 67 VAL A C    2  
ATOM 2250  O O    . VAL A 1 67 ? -13.060 -3.246  2.515   1.00 0.00 ? 67 VAL A O    2  
ATOM 2251  C CB   . VAL A 1 67 ? -13.180 -6.217  3.186   1.00 0.00 ? 67 VAL A CB   2  
ATOM 2252  C CG1  . VAL A 1 67 ? -12.402 -6.300  4.489   1.00 0.00 ? 67 VAL A CG1  2  
ATOM 2253  C CG2  . VAL A 1 67 ? -13.765 -7.572  2.818   1.00 0.00 ? 67 VAL A CG2  2  
ATOM 2254  H H    . VAL A 1 67 ? -14.848 -5.611  1.295   1.00 0.00 ? 67 VAL A H    2  
ATOM 2255  H HA   . VAL A 1 67 ? -14.890 -5.374  4.160   1.00 0.00 ? 67 VAL A HA   2  
ATOM 2256  H HB   . VAL A 1 67 ? -12.497 -5.920  2.404   1.00 0.00 ? 67 VAL A HB   2  
ATOM 2257  H HG11 . VAL A 1 67 ? -12.304 -5.313  4.915   1.00 0.00 ? 67 VAL A HG11 2  
ATOM 2258  H HG12 . VAL A 1 67 ? -11.419 -6.707  4.297   1.00 0.00 ? 67 VAL A HG12 2  
ATOM 2259  H HG13 . VAL A 1 67 ? -12.926 -6.940  5.182   1.00 0.00 ? 67 VAL A HG13 2  
ATOM 2260  H HG21 . VAL A 1 67 ? -13.864 -7.643  1.744   1.00 0.00 ? 67 VAL A HG21 2  
ATOM 2261  H HG22 . VAL A 1 67 ? -14.737 -7.682  3.276   1.00 0.00 ? 67 VAL A HG22 2  
ATOM 2262  H HG23 . VAL A 1 67 ? -13.110 -8.355  3.171   1.00 0.00 ? 67 VAL A HG23 2  
ATOM 2263  N N    . ARG A 1 68 ? -13.783 -3.216  4.646   1.00 0.00 ? 68 ARG A N    2  
ATOM 2264  C CA   . ARG A 1 68 ? -13.217 -1.902  4.934   1.00 0.00 ? 68 ARG A CA   2  
ATOM 2265  C C    . ARG A 1 68 ? -11.871 -2.032  5.637   1.00 0.00 ? 68 ARG A C    2  
ATOM 2266  O O    . ARG A 1 68 ? -11.722 -2.812  6.578   1.00 0.00 ? 68 ARG A O    2  
ATOM 2267  C CB   . ARG A 1 68 ? -14.181 -1.088  5.798   1.00 0.00 ? 68 ARG A CB   2  
ATOM 2268  C CG   . ARG A 1 68 ? -13.956 0.413   5.709   1.00 0.00 ? 68 ARG A CG   2  
ATOM 2269  C CD   . ARG A 1 68 ? -14.932 1.176   6.589   1.00 0.00 ? 68 ARG A CD   2  
ATOM 2270  N NE   . ARG A 1 68 ? -16.179 1.479   5.890   1.00 0.00 ? 68 ARG A NE   2  
ATOM 2271  C CZ   . ARG A 1 68 ? -16.262 2.297   4.844   1.00 0.00 ? 68 ARG A CZ   2  
ATOM 2272  N NH1  . ARG A 1 68 ? -15.175 2.894   4.371   1.00 0.00 ? 68 ARG A NH1  2  
ATOM 2273  N NH2  . ARG A 1 68 ? -17.436 2.519   4.268   1.00 0.00 ? 68 ARG A NH2  2  
ATOM 2274  H H    . ARG A 1 68 ? -14.267 -3.692  5.351   1.00 0.00 ? 68 ARG A H    2  
ATOM 2275  H HA   . ARG A 1 68 ? -13.071 -1.392  3.993   1.00 0.00 ? 68 ARG A HA   2  
ATOM 2276  H HB2  . ARG A 1 68 ? -15.195 -1.297  5.482   1.00 0.00 ? 68 ARG A HB2  2  
ATOM 2277  H HB3  . ARG A 1 68 ? -14.062 -1.388  6.831   1.00 0.00 ? 68 ARG A HB3  2  
ATOM 2278  H HG2  . ARG A 1 68 ? -12.949 0.635   6.029   1.00 0.00 ? 68 ARG A HG2  2  
ATOM 2279  H HG3  . ARG A 1 68 ? -14.088 0.727   4.685   1.00 0.00 ? 68 ARG A HG3  2  
ATOM 2280  H HD2  . ARG A 1 68 ? -15.155 0.577   7.460   1.00 0.00 ? 68 ARG A HD2  2  
ATOM 2281  H HD3  . ARG A 1 68 ? -14.470 2.102   6.899   1.00 0.00 ? 68 ARG A HD3  2  
ATOM 2282  H HE   . ARG A 1 68 ? -16.997 1.051   6.219   1.00 0.00 ? 68 ARG A HE   2  
ATOM 2283  H HH11 . ARG A 1 68 ? -14.287 2.731   4.801   1.00 0.00 ? 68 ARG A HH11 2  
ATOM 2284  H HH12 . ARG A 1 68 ? -15.245 3.508   3.585   1.00 0.00 ? 68 ARG A HH12 2  
ATOM 2285  H HH21 . ARG A 1 68 ? -18.258 2.070   4.620   1.00 0.00 ? 68 ARG A HH21 2  
ATOM 2286  H HH22 . ARG A 1 68 ? -17.499 3.134   3.482   1.00 0.00 ? 68 ARG A HH22 2  
ATOM 2287  N N    . TYR A 1 69 ? -10.890 -1.262  5.174   1.00 0.00 ? 69 TYR A N    2  
ATOM 2288  C CA   . TYR A 1 69 ? -9.555  -1.291  5.760   1.00 0.00 ? 69 TYR A CA   2  
ATOM 2289  C C    . TYR A 1 69 ? -9.318  -0.065  6.635   1.00 0.00 ? 69 TYR A C    2  
ATOM 2290  O O    . TYR A 1 69 ? -8.851  -0.180  7.769   1.00 0.00 ? 69 TYR A O    2  
ATOM 2291  C CB   . TYR A 1 69 ? -8.495  -1.359  4.659   1.00 0.00 ? 69 TYR A CB   2  
ATOM 2292  C CG   . TYR A 1 69 ? -8.590  -2.601  3.803   1.00 0.00 ? 69 TYR A CG   2  
ATOM 2293  C CD1  . TYR A 1 69 ? -9.602  -2.745  2.863   1.00 0.00 ? 69 TYR A CD1  2  
ATOM 2294  C CD2  . TYR A 1 69 ? -7.666  -3.631  3.935   1.00 0.00 ? 69 TYR A CD2  2  
ATOM 2295  C CE1  . TYR A 1 69 ? -9.693  -3.878  2.078   1.00 0.00 ? 69 TYR A CE1  2  
ATOM 2296  C CE2  . TYR A 1 69 ? -7.749  -4.768  3.154   1.00 0.00 ? 69 TYR A CE2  2  
ATOM 2297  C CZ   . TYR A 1 69 ? -8.764  -4.887  2.227   1.00 0.00 ? 69 TYR A CZ   2  
ATOM 2298  O OH   . TYR A 1 69 ? -8.851  -6.018  1.448   1.00 0.00 ? 69 TYR A OH   2  
ATOM 2299  H H    . TYR A 1 69 ? -11.070 -0.660  4.422   1.00 0.00 ? 69 TYR A H    2  
ATOM 2300  H HA   . TYR A 1 69 ? -9.481  -2.176  6.374   1.00 0.00 ? 69 TYR A HA   2  
ATOM 2301  H HB2  . TYR A 1 69 ? -8.603  -0.502  4.011   1.00 0.00 ? 69 TYR A HB2  2  
ATOM 2302  H HB3  . TYR A 1 69 ? -7.515  -1.341  5.112   1.00 0.00 ? 69 TYR A HB3  2  
ATOM 2303  H HD1  . TYR A 1 69 ? -10.327 -1.953  2.747   1.00 0.00 ? 69 TYR A HD1  2  
ATOM 2304  H HD2  . TYR A 1 69 ? -6.873  -3.536  4.661   1.00 0.00 ? 69 TYR A HD2  2  
ATOM 2305  H HE1  . TYR A 1 69 ? -10.487 -3.971  1.352   1.00 0.00 ? 69 TYR A HE1  2  
ATOM 2306  H HE2  . TYR A 1 69 ? -7.022  -5.558  3.271   1.00 0.00 ? 69 TYR A HE2  2  
ATOM 2307  H HH   . TYR A 1 69 ? -8.113  -6.041  0.834   1.00 0.00 ? 69 TYR A HH   2  
ATOM 2308  N N    . PHE A 1 70 ? -9.643  1.108   6.102   1.00 0.00 ? 70 PHE A N    2  
ATOM 2309  C CA   . PHE A 1 70 ? -9.465  2.356   6.836   1.00 0.00 ? 70 PHE A CA   2  
ATOM 2310  C C    . PHE A 1 70 ? -10.492 3.396   6.399   1.00 0.00 ? 70 PHE A C    2  
ATOM 2311  O O    . PHE A 1 70 ? -10.793 3.526   5.212   1.00 0.00 ? 70 PHE A O    2  
ATOM 2312  C CB   . PHE A 1 70 ? -8.050  2.899   6.624   1.00 0.00 ? 70 PHE A CB   2  
ATOM 2313  C CG   . PHE A 1 70 ? -7.637  2.955   5.181   1.00 0.00 ? 70 PHE A CG   2  
ATOM 2314  C CD1  . PHE A 1 70 ? -8.111  3.957   4.349   1.00 0.00 ? 70 PHE A CD1  2  
ATOM 2315  C CD2  . PHE A 1 70 ? -6.776  2.005   4.657   1.00 0.00 ? 70 PHE A CD2  2  
ATOM 2316  C CE1  . PHE A 1 70 ? -7.732  4.011   3.021   1.00 0.00 ? 70 PHE A CE1  2  
ATOM 2317  C CE2  . PHE A 1 70 ? -6.393  2.053   3.329   1.00 0.00 ? 70 PHE A CE2  2  
ATOM 2318  C CZ   . PHE A 1 70 ? -6.872  3.058   2.511   1.00 0.00 ? 70 PHE A CZ   2  
ATOM 2319  H H    . PHE A 1 70 ? -10.011 1.136   5.194   1.00 0.00 ? 70 PHE A H    2  
ATOM 2320  H HA   . PHE A 1 70 ? -9.607  2.147   7.885   1.00 0.00 ? 70 PHE A HA   2  
ATOM 2321  H HB2  . PHE A 1 70 ? -7.993  3.900   7.024   1.00 0.00 ? 70 PHE A HB2  2  
ATOM 2322  H HB3  . PHE A 1 70 ? -7.348  2.267   7.147   1.00 0.00 ? 70 PHE A HB3  2  
ATOM 2323  H HD1  . PHE A 1 70 ? -8.783  4.703   4.747   1.00 0.00 ? 70 PHE A HD1  2  
ATOM 2324  H HD2  . PHE A 1 70 ? -6.400  1.220   5.296   1.00 0.00 ? 70 PHE A HD2  2  
ATOM 2325  H HE1  . PHE A 1 70 ? -8.109  4.796   2.383   1.00 0.00 ? 70 PHE A HE1  2  
ATOM 2326  H HE2  . PHE A 1 70 ? -5.720  1.308   2.933   1.00 0.00 ? 70 PHE A HE2  2  
ATOM 2327  H HZ   . PHE A 1 70 ? -6.574  3.099   1.473   1.00 0.00 ? 70 PHE A HZ   2  
ATOM 2328  N N    . GLU A 1 71 ? -11.027 4.134   7.366   1.00 0.00 ? 71 GLU A N    2  
ATOM 2329  C CA   . GLU A 1 71 ? -12.020 5.163   7.083   1.00 0.00 ? 71 GLU A CA   2  
ATOM 2330  C C    . GLU A 1 71 ? -11.350 6.466   6.664   1.00 0.00 ? 71 GLU A C    2  
ATOM 2331  O O    . GLU A 1 71 ? -10.769 7.171   7.489   1.00 0.00 ? 71 GLU A O    2  
ATOM 2332  C CB   . GLU A 1 71 ? -12.903 5.402   8.309   1.00 0.00 ? 71 GLU A CB   2  
ATOM 2333  C CG   . GLU A 1 71 ? -13.958 4.327   8.518   1.00 0.00 ? 71 GLU A CG   2  
ATOM 2334  C CD   . GLU A 1 71 ? -15.116 4.806   9.371   1.00 0.00 ? 71 GLU A CD   2  
ATOM 2335  O OE1  . GLU A 1 71 ? -15.421 6.016   9.333   1.00 0.00 ? 71 GLU A OE1  2  
ATOM 2336  O OE2  . GLU A 1 71 ? -15.719 3.970   10.078  1.00 0.00 ? 71 GLU A OE2  2  
ATOM 2337  H H    . GLU A 1 71 ? -10.747 3.983   8.294   1.00 0.00 ? 71 GLU A H    2  
ATOM 2338  H HA   . GLU A 1 71 ? -12.638 4.812   6.269   1.00 0.00 ? 71 GLU A HA   2  
ATOM 2339  H HB2  . GLU A 1 71 ? -12.277 5.436   9.188   1.00 0.00 ? 71 GLU A HB2  2  
ATOM 2340  H HB3  . GLU A 1 71 ? -13.405 6.351   8.198   1.00 0.00 ? 71 GLU A HB3  2  
ATOM 2341  H HG2  . GLU A 1 71 ? -14.341 4.024   7.555   1.00 0.00 ? 71 GLU A HG2  2  
ATOM 2342  H HG3  . GLU A 1 71 ? -13.499 3.479   9.004   1.00 0.00 ? 71 GLU A HG3  2  
ATOM 2343  N N    . CYS A 1 72 ? -11.434 6.782   5.376   1.00 0.00 ? 72 CYS A N    2  
ATOM 2344  C CA   . CYS A 1 72 ? -10.835 8.002   4.846   1.00 0.00 ? 72 CYS A CA   2  
ATOM 2345  C C    . CYS A 1 72 ? -11.646 8.541   3.671   1.00 0.00 ? 72 CYS A C    2  
ATOM 2346  O O    . CYS A 1 72 ? -12.496 7.842   3.119   1.00 0.00 ? 72 CYS A O    2  
ATOM 2347  C CB   . CYS A 1 72 ? -9.393  7.738   4.407   1.00 0.00 ? 72 CYS A CB   2  
ATOM 2348  S SG   . CYS A 1 72 ? -8.163  8.029   5.701   1.00 0.00 ? 72 CYS A SG   2  
ATOM 2349  H H    . CYS A 1 72 ? -11.910 6.180   4.766   1.00 0.00 ? 72 CYS A H    2  
ATOM 2350  H HA   . CYS A 1 72 ? -10.832 8.738   5.636   1.00 0.00 ? 72 CYS A HA   2  
ATOM 2351  H HB2  . CYS A 1 72 ? -9.303  6.708   4.095   1.00 0.00 ? 72 CYS A HB2  2  
ATOM 2352  H HB3  . CYS A 1 72 ? -9.154  8.384   3.575   1.00 0.00 ? 72 CYS A HB3  2  
ATOM 2353  H HG   . CYS A 1 72 ? -7.820  7.176   5.981   1.00 0.00 ? 72 CYS A HG   2  
ATOM 2354  N N    . PRO A 1 73 ? -11.393 9.800   3.272   1.00 0.00 ? 73 PRO A N    2  
ATOM 2355  C CA   . PRO A 1 73 ? -12.105 10.433  2.156   1.00 0.00 ? 73 PRO A CA   2  
ATOM 2356  C C    . PRO A 1 73 ? -12.077 9.578   0.893   1.00 0.00 ? 73 PRO A C    2  
ATOM 2357  O O    . PRO A 1 73 ? -11.320 8.612   0.802   1.00 0.00 ? 73 PRO A O    2  
ATOM 2358  C CB   . PRO A 1 73 ? -11.336 11.737  1.937   1.00 0.00 ? 73 PRO A CB   2  
ATOM 2359  C CG   . PRO A 1 73 ? -10.712 12.036  3.255   1.00 0.00 ? 73 PRO A CG   2  
ATOM 2360  C CD   . PRO A 1 73 ? -10.395 10.703  3.876   1.00 0.00 ? 73 PRO A CD   2  
ATOM 2361  H HA   . PRO A 1 73 ? -13.129 10.655  2.416   1.00 0.00 ? 73 PRO A HA   2  
ATOM 2362  H HB2  . PRO A 1 73 ? -10.588 11.593  1.169   1.00 0.00 ? 73 PRO A HB2  2  
ATOM 2363  H HB3  . PRO A 1 73 ? -12.020 12.517  1.638   1.00 0.00 ? 73 PRO A HB3  2  
ATOM 2364  H HG2  . PRO A 1 73 ? -9.807  12.608  3.114   1.00 0.00 ? 73 PRO A HG2  2  
ATOM 2365  H HG3  . PRO A 1 73 ? -11.409 12.581  3.876   1.00 0.00 ? 73 PRO A HG3  2  
ATOM 2366  H HD2  . PRO A 1 73 ? -9.392  10.397  3.618   1.00 0.00 ? 73 PRO A HD2  2  
ATOM 2367  H HD3  . PRO A 1 73 ? -10.515 10.748  4.948   1.00 0.00 ? 73 PRO A HD3  2  
ATOM 2368  N N    . ALA A 1 74 ? -12.908 9.942   -0.079  1.00 0.00 ? 74 ALA A N    2  
ATOM 2369  C CA   . ALA A 1 74 ? -12.978 9.209   -1.336  1.00 0.00 ? 74 ALA A CA   2  
ATOM 2370  C C    . ALA A 1 74 ? -11.748 9.475   -2.197  1.00 0.00 ? 74 ALA A C    2  
ATOM 2371  O O    . ALA A 1 74 ? -11.156 10.552  -2.135  1.00 0.00 ? 74 ALA A O    2  
ATOM 2372  C CB   . ALA A 1 74 ? -14.245 9.581   -2.093  1.00 0.00 ? 74 ALA A CB   2  
ATOM 2373  H H    . ALA A 1 74 ? -13.487 10.721  0.053   1.00 0.00 ? 74 ALA A H    2  
ATOM 2374  H HA   . ALA A 1 74 ? -13.022 8.154   -1.105  1.00 0.00 ? 74 ALA A HA   2  
ATOM 2375  H HB1  . ALA A 1 74 ? -14.654 8.700   -2.565  1.00 0.00 ? 74 ALA A HB1  2  
ATOM 2376  H HB2  . ALA A 1 74 ? -14.010 10.317  -2.847  1.00 0.00 ? 74 ALA A HB2  2  
ATOM 2377  H HB3  . ALA A 1 74 ? -14.969 9.989   -1.404  1.00 0.00 ? 74 ALA A HB3  2  
ATOM 2378  N N    . LEU A 1 75 ? -11.369 8.486   -3.000  1.00 0.00 ? 75 LEU A N    2  
ATOM 2379  C CA   . LEU A 1 75 ? -10.209 8.613   -3.874  1.00 0.00 ? 75 LEU A CA   2  
ATOM 2380  C C    . LEU A 1 75 ? -8.939  8.847   -3.063  1.00 0.00 ? 75 LEU A C    2  
ATOM 2381  O O    . LEU A 1 75 ? -8.015  9.522   -3.519  1.00 0.00 ? 75 LEU A O    2  
ATOM 2382  C CB   . LEU A 1 75 ? -10.415 9.760   -4.866  1.00 0.00 ? 75 LEU A CB   2  
ATOM 2383  C CG   . LEU A 1 75 ? -11.735 9.722   -5.635  1.00 0.00 ? 75 LEU A CG   2  
ATOM 2384  C CD1  . LEU A 1 75 ? -12.125 11.117  -6.097  1.00 0.00 ? 75 LEU A CD1  2  
ATOM 2385  C CD2  . LEU A 1 75 ? -11.633 8.776   -6.821  1.00 0.00 ? 75 LEU A CD2  2  
ATOM 2386  H H    . LEU A 1 75 ? -11.882 7.651   -3.006  1.00 0.00 ? 75 LEU A H    2  
ATOM 2387  H HA   . LEU A 1 75 ? -10.106 7.689   -4.424  1.00 0.00 ? 75 LEU A HA   2  
ATOM 2388  H HB2  . LEU A 1 75 ? -10.365 10.692  -4.320  1.00 0.00 ? 75 LEU A HB2  2  
ATOM 2389  H HB3  . LEU A 1 75 ? -9.607  9.739   -5.582  1.00 0.00 ? 75 LEU A HB3  2  
ATOM 2390  H HG   . LEU A 1 75 ? -12.515 9.358   -4.982  1.00 0.00 ? 75 LEU A HG   2  
ATOM 2391  H HD11 . LEU A 1 75 ? -11.235 11.676  -6.346  1.00 0.00 ? 75 LEU A HD11 2  
ATOM 2392  H HD12 . LEU A 1 75 ? -12.657 11.624  -5.304  1.00 0.00 ? 75 LEU A HD12 2  
ATOM 2393  H HD13 . LEU A 1 75 ? -12.760 11.046  -6.968  1.00 0.00 ? 75 LEU A HD13 2  
ATOM 2394  H HD21 . LEU A 1 75 ? -12.607 8.655   -7.272  1.00 0.00 ? 75 LEU A HD21 2  
ATOM 2395  H HD22 . LEU A 1 75 ? -11.271 7.815   -6.485  1.00 0.00 ? 75 LEU A HD22 2  
ATOM 2396  H HD23 . LEU A 1 75 ? -10.948 9.184   -7.550  1.00 0.00 ? 75 LEU A HD23 2  
ATOM 2397  N N    . GLN A 1 76 ? -8.899  8.285   -1.860  1.00 0.00 ? 76 GLN A N    2  
ATOM 2398  C CA   . GLN A 1 76 ? -7.742  8.431   -0.985  1.00 0.00 ? 76 GLN A CA   2  
ATOM 2399  C C    . GLN A 1 76 ? -7.426  7.118   -0.275  1.00 0.00 ? 76 GLN A C    2  
ATOM 2400  O O    . GLN A 1 76 ? -6.862  7.114   0.819   1.00 0.00 ? 76 GLN A O    2  
ATOM 2401  C CB   . GLN A 1 76 ? -7.990  9.535   0.045   1.00 0.00 ? 76 GLN A CB   2  
ATOM 2402  C CG   . GLN A 1 76 ? -7.887  10.938  -0.529  1.00 0.00 ? 76 GLN A CG   2  
ATOM 2403  C CD   . GLN A 1 76 ? -7.890  12.008  0.545   1.00 0.00 ? 76 GLN A CD   2  
ATOM 2404  O OE1  . GLN A 1 76 ? -8.708  12.927  0.520   1.00 0.00 ? 76 GLN A OE1  2  
ATOM 2405  N NE2  . GLN A 1 76 ? -6.971  11.894  1.497   1.00 0.00 ? 76 GLN A NE2  2  
ATOM 2406  H H    . GLN A 1 76 ? -9.667  7.757   -1.553  1.00 0.00 ? 76 GLN A H    2  
ATOM 2407  H HA   . GLN A 1 76 ? -6.897  8.707   -1.598  1.00 0.00 ? 76 GLN A HA   2  
ATOM 2408  H HB2  . GLN A 1 76 ? -8.980  9.409   0.458   1.00 0.00 ? 76 GLN A HB2  2  
ATOM 2409  H HB3  . GLN A 1 76 ? -7.264  9.439   0.840   1.00 0.00 ? 76 GLN A HB3  2  
ATOM 2410  H HG2  . GLN A 1 76 ? -6.968  11.017  -1.091  1.00 0.00 ? 76 GLN A HG2  2  
ATOM 2411  H HG3  . GLN A 1 76 ? -8.726  11.107  -1.188  1.00 0.00 ? 76 GLN A HG3  2  
ATOM 2412  H HE21 . GLN A 1 76 ? -6.351  11.136  1.453   1.00 0.00 ? 76 GLN A HE21 2  
ATOM 2413  H HE22 . GLN A 1 76 ? -6.950  12.571  2.204   1.00 0.00 ? 76 GLN A HE22 2  
ATOM 2414  N N    . GLY A 1 77 ? -7.791  6.007   -0.905  1.00 0.00 ? 77 GLY A N    2  
ATOM 2415  C CA   . GLY A 1 77 ? -7.537  4.703   -0.319  1.00 0.00 ? 77 GLY A CA   2  
ATOM 2416  C C    . GLY A 1 77 ? -6.852  3.760   -1.287  1.00 0.00 ? 77 GLY A C    2  
ATOM 2417  O O    . GLY A 1 77 ? -7.352  2.669   -1.561  1.00 0.00 ? 77 GLY A O    2  
ATOM 2418  H H    . GLY A 1 77 ? -8.237  6.070   -1.775  1.00 0.00 ? 77 GLY A H    2  
ATOM 2419  H HA2  . GLY A 1 77 ? -6.910  4.827   0.551   1.00 0.00 ? 77 GLY A HA2  2  
ATOM 2420  H HA3  . GLY A 1 77 ? -8.478  4.268   -0.015  1.00 0.00 ? 77 GLY A HA3  2  
ATOM 2421  N N    . ILE A 1 78 ? -5.704  4.183   -1.807  1.00 0.00 ? 78 ILE A N    2  
ATOM 2422  C CA   . ILE A 1 78 ? -4.948  3.371   -2.752  1.00 0.00 ? 78 ILE A CA   2  
ATOM 2423  C C    . ILE A 1 78 ? -4.252  2.211   -2.048  1.00 0.00 ? 78 ILE A C    2  
ATOM 2424  O O    . ILE A 1 78 ? -3.739  2.361   -0.939  1.00 0.00 ? 78 ILE A O    2  
ATOM 2425  C CB   . ILE A 1 78 ? -3.897  4.216   -3.500  1.00 0.00 ? 78 ILE A CB   2  
ATOM 2426  C CG1  . ILE A 1 78 ? -3.188  3.372   -4.562  1.00 0.00 ? 78 ILE A CG1  2  
ATOM 2427  C CG2  . ILE A 1 78 ? -2.889  4.802   -2.520  1.00 0.00 ? 78 ILE A CG2  2  
ATOM 2428  C CD1  . ILE A 1 78 ? -2.427  4.194   -5.579  1.00 0.00 ? 78 ILE A CD1  2  
ATOM 2429  H H    . ILE A 1 78 ? -5.359  5.063   -1.550  1.00 0.00 ? 78 ILE A H    2  
ATOM 2430  H HA   . ILE A 1 78 ? -5.642  2.974   -3.479  1.00 0.00 ? 78 ILE A HA   2  
ATOM 2431  H HB   . ILE A 1 78 ? -4.406  5.036   -3.985  1.00 0.00 ? 78 ILE A HB   2  
ATOM 2432  H HG12 . ILE A 1 78 ? -2.484  2.713   -4.076  1.00 0.00 ? 78 ILE A HG12 2  
ATOM 2433  H HG13 . ILE A 1 78 ? -3.922  2.782   -5.091  1.00 0.00 ? 78 ILE A HG13 2  
ATOM 2434  H HG21 . ILE A 1 78 ? -2.142  5.361   -3.064  1.00 0.00 ? 78 ILE A HG21 2  
ATOM 2435  H HG22 . ILE A 1 78 ? -2.413  4.003   -1.973  1.00 0.00 ? 78 ILE A HG22 2  
ATOM 2436  H HG23 . ILE A 1 78 ? -3.399  5.459   -1.830  1.00 0.00 ? 78 ILE A HG23 2  
ATOM 2437  H HD11 . ILE A 1 78 ? -1.447  4.430   -5.191  1.00 0.00 ? 78 ILE A HD11 2  
ATOM 2438  H HD12 . ILE A 1 78 ? -2.966  5.110   -5.777  1.00 0.00 ? 78 ILE A HD12 2  
ATOM 2439  H HD13 . ILE A 1 78 ? -2.327  3.630   -6.494  1.00 0.00 ? 78 ILE A HD13 2  
ATOM 2440  N N    . PHE A 1 79 ? -4.236  1.054   -2.701  1.00 0.00 ? 79 PHE A N    2  
ATOM 2441  C CA   . PHE A 1 79 ? -3.602  -0.134  -2.140  1.00 0.00 ? 79 PHE A CA   2  
ATOM 2442  C C    . PHE A 1 79 ? -2.380  -0.535  -2.961  1.00 0.00 ? 79 PHE A C    2  
ATOM 2443  O O    . PHE A 1 79 ? -2.484  -0.797  -4.159  1.00 0.00 ? 79 PHE A O    2  
ATOM 2444  C CB   . PHE A 1 79 ? -4.598  -1.294  -2.087  1.00 0.00 ? 79 PHE A CB   2  
ATOM 2445  C CG   . PHE A 1 79 ? -5.622  -1.155  -0.997  1.00 0.00 ? 79 PHE A CG   2  
ATOM 2446  C CD1  . PHE A 1 79 ? -6.618  -0.197  -1.081  1.00 0.00 ? 79 PHE A CD1  2  
ATOM 2447  C CD2  . PHE A 1 79 ? -5.587  -1.985  0.113   1.00 0.00 ? 79 PHE A CD2  2  
ATOM 2448  C CE1  . PHE A 1 79 ? -7.562  -0.068  -0.079  1.00 0.00 ? 79 PHE A CE1  2  
ATOM 2449  C CE2  . PHE A 1 79 ? -6.528  -1.861  1.118   1.00 0.00 ? 79 PHE A CE2  2  
ATOM 2450  C CZ   . PHE A 1 79 ? -7.517  -0.901  1.021   1.00 0.00 ? 79 PHE A CZ   2  
ATOM 2451  H H    . PHE A 1 79 ? -4.661  0.997   -3.583  1.00 0.00 ? 79 PHE A H    2  
ATOM 2452  H HA   . PHE A 1 79 ? -3.284  0.103   -1.136  1.00 0.00 ? 79 PHE A HA   2  
ATOM 2453  H HB2  . PHE A 1 79 ? -5.123  -1.351  -3.029  1.00 0.00 ? 79 PHE A HB2  2  
ATOM 2454  H HB3  . PHE A 1 79 ? -4.059  -2.215  -1.924  1.00 0.00 ? 79 PHE A HB3  2  
ATOM 2455  H HD1  . PHE A 1 79 ? -6.656  0.455   -1.941  1.00 0.00 ? 79 PHE A HD1  2  
ATOM 2456  H HD2  . PHE A 1 79 ? -4.815  -2.736  0.189   1.00 0.00 ? 79 PHE A HD2  2  
ATOM 2457  H HE1  . PHE A 1 79 ? -8.333  0.684   -0.157  1.00 0.00 ? 79 PHE A HE1  2  
ATOM 2458  H HE2  . PHE A 1 79 ? -6.490  -2.515  1.977   1.00 0.00 ? 79 PHE A HE2  2  
ATOM 2459  H HZ   . PHE A 1 79 ? -8.252  -0.803  1.805   1.00 0.00 ? 79 PHE A HZ   2  
ATOM 2460  N N    . THR A 1 80 ? -1.223  -0.581  -2.308  1.00 0.00 ? 80 THR A N    2  
ATOM 2461  C CA   . THR A 1 80 ? 0.018   -0.950  -2.978  1.00 0.00 ? 80 THR A CA   2  
ATOM 2462  C C    . THR A 1 80 ? 0.881   -1.829  -2.078  1.00 0.00 ? 80 THR A C    2  
ATOM 2463  O O    . THR A 1 80 ? 0.596   -1.988  -0.891  1.00 0.00 ? 80 THR A O    2  
ATOM 2464  C CB   . THR A 1 80 ? 0.795   0.303   -3.384  1.00 0.00 ? 80 THR A CB   2  
ATOM 2465  O OG1  . THR A 1 80 ? 2.034   -0.045  -3.975  1.00 0.00 ? 80 THR A OG1  2  
ATOM 2466  C CG2  . THR A 1 80 ? 1.084   1.232   -2.224  1.00 0.00 ? 80 THR A CG2  2  
ATOM 2467  H H    . THR A 1 80 ? -1.204  -0.361  -1.353  1.00 0.00 ? 80 THR A H    2  
ATOM 2468  H HA   . THR A 1 80 ? -0.239  -1.507  -3.865  1.00 0.00 ? 80 THR A HA   2  
ATOM 2469  H HB   . THR A 1 80 ? 0.215   0.854   -4.111  1.00 0.00 ? 80 THR A HB   2  
ATOM 2470  H HG1  . THR A 1 80 ? 2.363   0.697   -4.490  1.00 0.00 ? 80 THR A HG1  2  
ATOM 2471  H HG21 . THR A 1 80 ? 0.611   2.186   -2.400  1.00 0.00 ? 80 THR A HG21 2  
ATOM 2472  H HG22 . THR A 1 80 ? 2.152   1.370   -2.132  1.00 0.00 ? 80 THR A HG22 2  
ATOM 2473  H HG23 . THR A 1 80 ? 0.697   0.800   -1.313  1.00 0.00 ? 80 THR A HG23 2  
ATOM 2474  N N    . ARG A 1 81 ? 1.937   -2.398  -2.651  1.00 0.00 ? 81 ARG A N    2  
ATOM 2475  C CA   . ARG A 1 81 ? 2.841   -3.261  -1.901  1.00 0.00 ? 81 ARG A CA   2  
ATOM 2476  C C    . ARG A 1 81 ? 3.762   -2.435  -1.004  1.00 0.00 ? 81 ARG A C    2  
ATOM 2477  O O    . ARG A 1 81 ? 4.258   -1.386  -1.411  1.00 0.00 ? 81 ARG A O    2  
ATOM 2478  C CB   . ARG A 1 81 ? 3.675   -4.116  -2.857  1.00 0.00 ? 81 ARG A CB   2  
ATOM 2479  C CG   . ARG A 1 81 ? 2.859   -4.750  -3.973  1.00 0.00 ? 81 ARG A CG   2  
ATOM 2480  C CD   . ARG A 1 81 ? 3.713   -5.670  -4.832  1.00 0.00 ? 81 ARG A CD   2  
ATOM 2481  N NE   . ARG A 1 81 ? 3.042   -6.033  -6.078  1.00 0.00 ? 81 ARG A NE   2  
ATOM 2482  C CZ   . ARG A 1 81 ? 2.931   -5.218  -7.124  1.00 0.00 ? 81 ARG A CZ   2  
ATOM 2483  N NH1  . ARG A 1 81 ? 3.442   -3.995  -7.080  1.00 0.00 ? 81 ARG A NH1  2  
ATOM 2484  N NH2  . ARG A 1 81 ? 2.306   -5.629  -8.220  1.00 0.00 ? 81 ARG A NH2  2  
ATOM 2485  H H    . ARG A 1 81 ? 2.111   -2.233  -3.602  1.00 0.00 ? 81 ARG A H    2  
ATOM 2486  H HA   . ARG A 1 81 ? 2.239   -3.910  -1.284  1.00 0.00 ? 81 ARG A HA   2  
ATOM 2487  H HB2  . ARG A 1 81 ? 4.436   -3.496  -3.304  1.00 0.00 ? 81 ARG A HB2  2  
ATOM 2488  H HB3  . ARG A 1 81 ? 4.149   -4.906  -2.294  1.00 0.00 ? 81 ARG A HB3  2  
ATOM 2489  H HG2  . ARG A 1 81 ? 2.056   -5.325  -3.537  1.00 0.00 ? 81 ARG A HG2  2  
ATOM 2490  H HG3  . ARG A 1 81 ? 2.450   -3.968  -4.595  1.00 0.00 ? 81 ARG A HG3  2  
ATOM 2491  H HD2  . ARG A 1 81 ? 4.639   -5.165  -5.067  1.00 0.00 ? 81 ARG A HD2  2  
ATOM 2492  H HD3  . ARG A 1 81 ? 3.926   -6.569  -4.272  1.00 0.00 ? 81 ARG A HD3  2  
ATOM 2493  H HE   . ARG A 1 81 ? 2.656   -6.931  -6.137  1.00 0.00 ? 81 ARG A HE   2  
ATOM 2494  H HH11 . ARG A 1 81 ? 3.915   -3.679  -6.257  1.00 0.00 ? 81 ARG A HH11 2  
ATOM 2495  H HH12 . ARG A 1 81 ? 3.355   -3.388  -7.870  1.00 0.00 ? 81 ARG A HH12 2  
ATOM 2496  H HH21 . ARG A 1 81 ? 1.919   -6.550  -8.259  1.00 0.00 ? 81 ARG A HH21 2  
ATOM 2497  H HH22 . ARG A 1 81 ? 2.221   -5.017  -9.007  1.00 0.00 ? 81 ARG A HH22 2  
ATOM 2498  N N    . PRO A 1 82 ? 4.005   -2.900  0.236   1.00 0.00 ? 82 PRO A N    2  
ATOM 2499  C CA   . PRO A 1 82 ? 4.873   -2.194  1.185   1.00 0.00 ? 82 PRO A CA   2  
ATOM 2500  C C    . PRO A 1 82 ? 6.243   -1.878  0.594   1.00 0.00 ? 82 PRO A C    2  
ATOM 2501  O O    . PRO A 1 82 ? 6.771   -0.781  0.777   1.00 0.00 ? 82 PRO A O    2  
ATOM 2502  C CB   . PRO A 1 82 ? 5.009   -3.181  2.347   1.00 0.00 ? 82 PRO A CB   2  
ATOM 2503  C CG   . PRO A 1 82 ? 3.789   -4.030  2.270   1.00 0.00 ? 82 PRO A CG   2  
ATOM 2504  C CD   . PRO A 1 82 ? 3.458   -4.145  0.809   1.00 0.00 ? 82 PRO A CD   2  
ATOM 2505  H HA   . PRO A 1 82 ? 4.416   -1.281  1.536   1.00 0.00 ? 82 PRO A HA   2  
ATOM 2506  H HB2  . PRO A 1 82 ? 5.908   -3.766  2.222   1.00 0.00 ? 82 PRO A HB2  2  
ATOM 2507  H HB3  . PRO A 1 82 ? 5.053   -2.638  3.280   1.00 0.00 ? 82 PRO A HB3  2  
ATOM 2508  H HG2  . PRO A 1 82 ? 3.993   -5.006  2.686   1.00 0.00 ? 82 PRO A HG2  2  
ATOM 2509  H HG3  . PRO A 1 82 ? 2.977   -3.557  2.802   1.00 0.00 ? 82 PRO A HG3  2  
ATOM 2510  H HD2  . PRO A 1 82 ? 3.939   -5.011  0.379   1.00 0.00 ? 82 PRO A HD2  2  
ATOM 2511  H HD3  . PRO A 1 82 ? 2.389   -4.196  0.667   1.00 0.00 ? 82 PRO A HD3  2  
ATOM 2512  N N    . SER A 1 83 ? 6.814   -2.847  -0.114  1.00 0.00 ? 83 SER A N    2  
ATOM 2513  C CA   . SER A 1 83 ? 8.124   -2.674  -0.733  1.00 0.00 ? 83 SER A CA   2  
ATOM 2514  C C    . SER A 1 83 ? 8.121   -1.490  -1.696  1.00 0.00 ? 83 SER A C    2  
ATOM 2515  O O    . SER A 1 83 ? 9.117   -0.776  -1.820  1.00 0.00 ? 83 SER A O    2  
ATOM 2516  C CB   . SER A 1 83 ? 8.534   -3.947  -1.474  1.00 0.00 ? 83 SER A CB   2  
ATOM 2517  O OG   . SER A 1 83 ? 8.193   -5.103  -0.728  1.00 0.00 ? 83 SER A OG   2  
ATOM 2518  H H    . SER A 1 83 ? 6.343   -3.700  -0.224  1.00 0.00 ? 83 SER A H    2  
ATOM 2519  H HA   . SER A 1 83 ? 8.838   -2.480  0.053   1.00 0.00 ? 83 SER A HA   2  
ATOM 2520  H HB2  . SER A 1 83 ? 8.027   -3.986  -2.426  1.00 0.00 ? 83 SER A HB2  2  
ATOM 2521  H HB3  . SER A 1 83 ? 9.602   -3.938  -1.635  1.00 0.00 ? 83 SER A HB3  2  
ATOM 2522  H HG   . SER A 1 83 ? 8.172   -5.865  -1.310  1.00 0.00 ? 83 SER A HG   2  
ATOM 2523  N N    . LYS A 1 84 ? 6.997   -1.288  -2.375  1.00 0.00 ? 84 LYS A N    2  
ATOM 2524  C CA   . LYS A 1 84 ? 6.866   -0.191  -3.326  1.00 0.00 ? 84 LYS A CA   2  
ATOM 2525  C C    . LYS A 1 84 ? 6.911   1.157   -2.613  1.00 0.00 ? 84 LYS A C    2  
ATOM 2526  O O    . LYS A 1 84 ? 7.366   2.153   -3.175  1.00 0.00 ? 84 LYS A O    2  
ATOM 2527  C CB   . LYS A 1 84 ? 5.560   -0.322  -4.112  1.00 0.00 ? 84 LYS A CB   2  
ATOM 2528  C CG   . LYS A 1 84 ? 5.563   -1.467  -5.111  1.00 0.00 ? 84 LYS A CG   2  
ATOM 2529  C CD   . LYS A 1 84 ? 6.661   -1.296  -6.149  1.00 0.00 ? 84 LYS A CD   2  
ATOM 2530  C CE   . LYS A 1 84 ? 6.190   -1.717  -7.532  1.00 0.00 ? 84 LYS A CE   2  
ATOM 2531  N NZ   . LYS A 1 84 ? 6.662   -3.084  -7.888  1.00 0.00 ? 84 LYS A NZ   2  
ATOM 2532  H H    . LYS A 1 84 ? 6.237   -1.891  -2.232  1.00 0.00 ? 84 LYS A H    2  
ATOM 2533  H HA   . LYS A 1 84 ? 7.696   -0.248  -4.014  1.00 0.00 ? 84 LYS A HA   2  
ATOM 2534  H HB2  . LYS A 1 84 ? 4.750   -0.483  -3.415  1.00 0.00 ? 84 LYS A HB2  2  
ATOM 2535  H HB3  . LYS A 1 84 ? 5.383   0.597   -4.650  1.00 0.00 ? 84 LYS A HB3  2  
ATOM 2536  H HG2  . LYS A 1 84 ? 5.725   -2.394  -4.582  1.00 0.00 ? 84 LYS A HG2  2  
ATOM 2537  H HG3  . LYS A 1 84 ? 4.607   -1.498  -5.612  1.00 0.00 ? 84 LYS A HG3  2  
ATOM 2538  H HD2  . LYS A 1 84 ? 6.955   -0.258  -6.182  1.00 0.00 ? 84 LYS A HD2  2  
ATOM 2539  H HD3  . LYS A 1 84 ? 7.508   -1.903  -5.867  1.00 0.00 ? 84 LYS A HD3  2  
ATOM 2540  H HE2  . LYS A 1 84 ? 5.110   -1.703  -7.551  1.00 0.00 ? 84 LYS A HE2  2  
ATOM 2541  H HE3  . LYS A 1 84 ? 6.571   -1.014  -8.258  1.00 0.00 ? 84 LYS A HE3  2  
ATOM 2542  H HZ1  . LYS A 1 84 ? 5.959   -3.792  -7.594  1.00 0.00 ? 84 LYS A HZ1  2  
ATOM 2543  H HZ2  . LYS A 1 84 ? 7.562   -3.287  -7.411  1.00 0.00 ? 84 LYS A HZ2  2  
ATOM 2544  H HZ3  . LYS A 1 84 ? 6.802   -3.157  -8.917  1.00 0.00 ? 84 LYS A HZ3  2  
ATOM 2545  N N    . LEU A 1 85 ? 6.435   1.181   -1.372  1.00 0.00 ? 85 LEU A N    2  
ATOM 2546  C CA   . LEU A 1 85 ? 6.420   2.406   -0.582  1.00 0.00 ? 85 LEU A CA   2  
ATOM 2547  C C    . LEU A 1 85 ? 7.836   2.821   -0.194  1.00 0.00 ? 85 LEU A C    2  
ATOM 2548  O O    . LEU A 1 85 ? 8.735   1.985   -0.097  1.00 0.00 ? 85 LEU A O    2  
ATOM 2549  C CB   . LEU A 1 85 ? 5.569   2.217   0.675   1.00 0.00 ? 85 LEU A CB   2  
ATOM 2550  C CG   . LEU A 1 85 ? 4.161   1.677   0.428   1.00 0.00 ? 85 LEU A CG   2  
ATOM 2551  C CD1  . LEU A 1 85 ? 3.558   1.146   1.720   1.00 0.00 ? 85 LEU A CD1  2  
ATOM 2552  C CD2  . LEU A 1 85 ? 3.273   2.758   -0.172  1.00 0.00 ? 85 LEU A CD2  2  
ATOM 2553  H H    . LEU A 1 85 ? 6.085   0.354   -0.977  1.00 0.00 ? 85 LEU A H    2  
ATOM 2554  H HA   . LEU A 1 85 ? 5.984   3.185   -1.188  1.00 0.00 ? 85 LEU A HA   2  
ATOM 2555  H HB2  . LEU A 1 85 ? 6.085   1.534   1.335   1.00 0.00 ? 85 LEU A HB2  2  
ATOM 2556  H HB3  . LEU A 1 85 ? 5.482   3.173   1.172   1.00 0.00 ? 85 LEU A HB3  2  
ATOM 2557  H HG   . LEU A 1 85 ? 4.214   0.858   -0.276  1.00 0.00 ? 85 LEU A HG   2  
ATOM 2558  H HD11 . LEU A 1 85 ? 3.191   1.971   2.311   1.00 0.00 ? 85 LEU A HD11 2  
ATOM 2559  H HD12 . LEU A 1 85 ? 4.314   0.613   2.277   1.00 0.00 ? 85 LEU A HD12 2  
ATOM 2560  H HD13 . LEU A 1 85 ? 2.742   0.477   1.488   1.00 0.00 ? 85 LEU A HD13 2  
ATOM 2561  H HD21 . LEU A 1 85 ? 2.284   2.358   -0.341  1.00 0.00 ? 85 LEU A HD21 2  
ATOM 2562  H HD22 . LEU A 1 85 ? 3.694   3.089   -1.109  1.00 0.00 ? 85 LEU A HD22 2  
ATOM 2563  H HD23 . LEU A 1 85 ? 3.212   3.593   0.511   1.00 0.00 ? 85 LEU A HD23 2  
ATOM 2564  N N    . THR A 1 86 ? 8.028   4.117   0.028   1.00 0.00 ? 86 THR A N    2  
ATOM 2565  C CA   . THR A 1 86 ? 9.334   4.644   0.406   1.00 0.00 ? 86 THR A CA   2  
ATOM 2566  C C    . THR A 1 86 ? 9.194   5.746   1.451   1.00 0.00 ? 86 THR A C    2  
ATOM 2567  O O    . THR A 1 86 ? 8.109   6.293   1.648   1.00 0.00 ? 86 THR A O    2  
ATOM 2568  C CB   . THR A 1 86 ? 10.067  5.181   -0.824  1.00 0.00 ? 86 THR A CB   2  
ATOM 2569  O OG1  . THR A 1 86 ? 9.272   6.138   -1.502  1.00 0.00 ? 86 THR A OG1  2  
ATOM 2570  C CG2  . THR A 1 86 ? 10.435  4.102   -1.820  1.00 0.00 ? 86 THR A CG2  2  
ATOM 2571  H H    . THR A 1 86 ? 7.272   4.735   -0.065  1.00 0.00 ? 86 THR A H    2  
ATOM 2572  H HA   . THR A 1 86 ? 9.907   3.833   0.831   1.00 0.00 ? 86 THR A HA   2  
ATOM 2573  H HB   . THR A 1 86 ? 10.979  5.662   -0.505  1.00 0.00 ? 86 THR A HB   2  
ATOM 2574  H HG1  . THR A 1 86 ? 9.720   6.987   -1.497  1.00 0.00 ? 86 THR A HG1  2  
ATOM 2575  H HG21 . THR A 1 86 ? 9.566   3.841   -2.406  1.00 0.00 ? 86 THR A HG21 2  
ATOM 2576  H HG22 . THR A 1 86 ? 10.788  3.229   -1.291  1.00 0.00 ? 86 THR A HG22 2  
ATOM 2577  H HG23 . THR A 1 86 ? 11.213  4.466   -2.473  1.00 0.00 ? 86 THR A HG23 2  
ATOM 2578  N N    . ARG A 1 87 ? 10.297  6.067   2.118   1.00 0.00 ? 87 ARG A N    2  
ATOM 2579  C CA   . ARG A 1 87 ? 10.296  7.105   3.142   1.00 0.00 ? 87 ARG A CA   2  
ATOM 2580  C C    . ARG A 1 87 ? 10.917  8.395   2.613   1.00 0.00 ? 87 ARG A C    2  
ATOM 2581  O O    . ARG A 1 87 ? 11.484  9.180   3.373   1.00 0.00 ? 87 ARG A O    2  
ATOM 2582  C CB   . ARG A 1 87 ? 11.057  6.626   4.382   1.00 0.00 ? 87 ARG A CB   2  
ATOM 2583  C CG   . ARG A 1 87 ? 10.188  6.523   5.626   1.00 0.00 ? 87 ARG A CG   2  
ATOM 2584  C CD   . ARG A 1 87 ? 10.327  7.754   6.506   1.00 0.00 ? 87 ARG A CD   2  
ATOM 2585  N NE   . ARG A 1 87 ? 9.184   7.919   7.401   1.00 0.00 ? 87 ARG A NE   2  
ATOM 2586  C CZ   . ARG A 1 87 ? 9.201   8.680   8.493   1.00 0.00 ? 87 ARG A CZ   2  
ATOM 2587  N NH1  . ARG A 1 87 ? 10.298  9.347   8.828   1.00 0.00 ? 87 ARG A NH1  2  
ATOM 2588  N NH2  . ARG A 1 87 ? 8.117   8.775   9.251   1.00 0.00 ? 87 ARG A NH2  2  
ATOM 2589  H H    . ARG A 1 87 ? 11.133  5.595   1.916   1.00 0.00 ? 87 ARG A H    2  
ATOM 2590  H HA   . ARG A 1 87 ? 9.270   7.299   3.414   1.00 0.00 ? 87 ARG A HA   2  
ATOM 2591  H HB2  . ARG A 1 87 ? 11.473  5.651   4.180   1.00 0.00 ? 87 ARG A HB2  2  
ATOM 2592  H HB3  . ARG A 1 87 ? 11.862  7.316   4.589   1.00 0.00 ? 87 ARG A HB3  2  
ATOM 2593  H HG2  . ARG A 1 87 ? 9.156   6.423   5.324   1.00 0.00 ? 87 ARG A HG2  2  
ATOM 2594  H HG3  . ARG A 1 87 ? 10.487  5.652   6.190   1.00 0.00 ? 87 ARG A HG3  2  
ATOM 2595  H HD2  . ARG A 1 87 ? 11.225  7.658   7.099   1.00 0.00 ? 87 ARG A HD2  2  
ATOM 2596  H HD3  . ARG A 1 87 ? 10.407  8.627   5.873   1.00 0.00 ? 87 ARG A HD3  2  
ATOM 2597  H HE   . ARG A 1 87 ? 8.361   7.438   7.176   1.00 0.00 ? 87 ARG A HE   2  
ATOM 2598  H HH11 . ARG A 1 87 ? 11.118  9.281   8.260   1.00 0.00 ? 87 ARG A HH11 2  
ATOM 2599  H HH12 . ARG A 1 87 ? 10.304  9.918   9.649   1.00 0.00 ? 87 ARG A HH12 2  
ATOM 2600  H HH21 . ARG A 1 87 ? 7.288   8.275   9.002   1.00 0.00 ? 87 ARG A HH21 2  
ATOM 2601  H HH22 . ARG A 1 87 ? 8.129   9.348   10.071  1.00 0.00 ? 87 ARG A HH22 2  
ATOM 2602  N N    . GLN A 1 88 ? 10.805  8.608   1.305   1.00 0.00 ? 88 GLN A N    2  
ATOM 2603  C CA   . GLN A 1 88 ? 11.354  9.804   0.675   1.00 0.00 ? 88 GLN A CA   2  
ATOM 2604  C C    . GLN A 1 88 ? 11.071  9.808   -0.825  1.00 0.00 ? 88 GLN A C    2  
ATOM 2605  O O    . GLN A 1 88 ? 11.000  8.752   -1.454  1.00 0.00 ? 88 GLN A O    2  
ATOM 2606  C CB   . GLN A 1 88 ? 12.863  9.890   0.920   1.00 0.00 ? 88 GLN A CB   2  
ATOM 2607  C CG   . GLN A 1 88 ? 13.622  8.651   0.477   1.00 0.00 ? 88 GLN A CG   2  
ATOM 2608  C CD   . GLN A 1 88 ? 14.988  8.542   1.127   1.00 0.00 ? 88 GLN A CD   2  
ATOM 2609  O OE1  . GLN A 1 88 ? 15.305  7.541   1.770   1.00 0.00 ? 88 GLN A OE1  2  
ATOM 2610  N NE2  . GLN A 1 88 ? 15.806  9.575   0.960   1.00 0.00 ? 88 GLN A NE2  2  
ATOM 2611  H H    . GLN A 1 88 ? 10.341  7.947   0.750   1.00 0.00 ? 88 GLN A H    2  
ATOM 2612  H HA   . GLN A 1 88 ? 10.876  10.663  1.122   1.00 0.00 ? 88 GLN A HA   2  
ATOM 2613  H HB2  . GLN A 1 88 ? 13.255  10.738  0.380   1.00 0.00 ? 88 GLN A HB2  2  
ATOM 2614  H HB3  . GLN A 1 88 ? 13.036  10.034  1.976   1.00 0.00 ? 88 GLN A HB3  2  
ATOM 2615  H HG2  . GLN A 1 88 ? 13.045  7.777   0.741   1.00 0.00 ? 88 GLN A HG2  2  
ATOM 2616  H HG3  . GLN A 1 88 ? 13.751  8.686   -0.594  1.00 0.00 ? 88 GLN A HG3  2  
ATOM 2617  H HE21 . GLN A 1 88 ? 15.488  10.338  0.436   1.00 0.00 ? 88 GLN A HE21 2  
ATOM 2618  H HE22 . GLN A 1 88 ? 16.696  9.530   1.369   1.00 0.00 ? 88 GLN A HE22 2  
ATOM 2619  N N    . PRO A 1 89 ? 10.903  11.002  -1.420  1.00 0.00 ? 89 PRO A N    2  
ATOM 2620  C CA   . PRO A 1 89 ? 10.627  11.137  -2.854  1.00 0.00 ? 89 PRO A CA   2  
ATOM 2621  C C    . PRO A 1 89 ? 11.841  10.795  -3.712  1.00 0.00 ? 89 PRO A C    2  
ATOM 2622  O O    . PRO A 1 89 ? 12.820  11.538  -3.746  1.00 0.00 ? 89 PRO A O    2  
ATOM 2623  C CB   . PRO A 1 89 ? 10.265  12.616  -3.008  1.00 0.00 ? 89 PRO A CB   2  
ATOM 2624  C CG   . PRO A 1 89 ? 10.966  13.294  -1.883  1.00 0.00 ? 89 PRO A CG   2  
ATOM 2625  C CD   . PRO A 1 89 ? 10.972  12.312  -0.744  1.00 0.00 ? 89 PRO A CD   2  
ATOM 2626  H HA   . PRO A 1 89 ? 9.791   10.525  -3.155  1.00 0.00 ? 89 PRO A HA   2  
ATOM 2627  H HB2  . PRO A 1 89 ? 10.612  12.976  -3.966  1.00 0.00 ? 89 PRO A HB2  2  
ATOM 2628  H HB3  . PRO A 1 89 ? 9.195   12.736  -2.936  1.00 0.00 ? 89 PRO A HB3  2  
ATOM 2629  H HG2  . PRO A 1 89 ? 11.977  13.538  -2.173  1.00 0.00 ? 89 PRO A HG2  2  
ATOM 2630  H HG3  . PRO A 1 89 ? 10.429  14.189  -1.602  1.00 0.00 ? 89 PRO A HG3  2  
ATOM 2631  H HD2  . PRO A 1 89 ? 11.884  12.403  -0.173  1.00 0.00 ? 89 PRO A HD2  2  
ATOM 2632  H HD3  . PRO A 1 89 ? 10.111  12.463  -0.111  1.00 0.00 ? 89 PRO A HD3  2  
ATOM 2633  N N    . SER A 1 90 ? 11.768  9.662   -4.404  1.00 0.00 ? 90 SER A N    2  
ATOM 2634  C CA   . SER A 1 90 ? 12.861  9.220   -5.263  1.00 0.00 ? 90 SER A CA   2  
ATOM 2635  C C    . SER A 1 90 ? 12.701  9.772   -6.676  1.00 0.00 ? 90 SER A C    2  
ATOM 2636  O O    . SER A 1 90 ? 13.546  10.526  -7.158  1.00 0.00 ? 90 SER A O    2  
ATOM 2637  C CB   . SER A 1 90 ? 12.919  7.692   -5.304  1.00 0.00 ? 90 SER A CB   2  
ATOM 2638  O OG   . SER A 1 90 ? 14.259  7.232   -5.327  1.00 0.00 ? 90 SER A OG   2  
ATOM 2639  H H    . SER A 1 90 ? 10.960  9.110   -4.336  1.00 0.00 ? 90 SER A H    2  
ATOM 2640  H HA   . SER A 1 90 ? 13.783  9.595   -4.845  1.00 0.00 ? 90 SER A HA   2  
ATOM 2641  H HB2  . SER A 1 90 ? 12.430  7.291   -4.429  1.00 0.00 ? 90 SER A HB2  2  
ATOM 2642  H HB3  . SER A 1 90 ? 12.415  7.338   -6.191  1.00 0.00 ? 90 SER A HB3  2  
ATOM 2643  H HG   . SER A 1 90 ? 14.346  6.467   -4.753  1.00 0.00 ? 90 SER A HG   2  
ATOM 2644  N N    . GLY A 1 91 ? 11.610  9.393   -7.334  1.00 0.00 ? 91 GLY A N    2  
ATOM 2645  C CA   . GLY A 1 91 ? 11.360  9.859   -8.685  1.00 0.00 ? 91 GLY A CA   2  
ATOM 2646  C C    . GLY A 1 91 ? 12.321  9.259   -9.695  1.00 0.00 ? 91 GLY A C    2  
ATOM 2647  O O    . GLY A 1 91 ? 12.786  8.133   -9.516  1.00 0.00 ? 91 GLY A O    2  
ATOM 2648  H H    . GLY A 1 91 ? 10.971  8.789   -6.900  1.00 0.00 ? 91 GLY A H    2  
ATOM 2649  H HA2  . GLY A 1 91 ? 10.350  9.595   -8.963  1.00 0.00 ? 91 GLY A HA2  2  
ATOM 2650  H HA3  . GLY A 1 91 ? 11.458  10.934  -8.707  1.00 0.00 ? 91 GLY A HA3  2  
ATOM 2651  N N    . PRO A 1 92 ? 12.641  9.992   -10.774 1.00 0.00 ? 92 PRO A N    2  
ATOM 2652  C CA   . PRO A 1 92 ? 13.560  9.511   -11.812 1.00 0.00 ? 92 PRO A CA   2  
ATOM 2653  C C    . PRO A 1 92 ? 14.996  9.404   -11.308 1.00 0.00 ? 92 PRO A C    2  
ATOM 2654  O O    . PRO A 1 92 ? 15.724  10.395  -11.264 1.00 0.00 ? 92 PRO A O    2  
ATOM 2655  C CB   . PRO A 1 92 ? 13.454  10.577  -12.905 1.00 0.00 ? 92 PRO A CB   2  
ATOM 2656  C CG   . PRO A 1 92 ? 13.018  11.809  -12.194 1.00 0.00 ? 92 PRO A CG   2  
ATOM 2657  C CD   . PRO A 1 92 ? 12.135  11.346  -11.068 1.00 0.00 ? 92 PRO A CD   2  
ATOM 2658  H HA   . PRO A 1 92 ? 13.246  8.555   -12.203 1.00 0.00 ? 92 PRO A HA   2  
ATOM 2659  H HB2  . PRO A 1 92 ? 14.418  10.711  -13.374 1.00 0.00 ? 92 PRO A HB2  2  
ATOM 2660  H HB3  . PRO A 1 92 ? 12.728  10.269  -13.643 1.00 0.00 ? 92 PRO A HB3  2  
ATOM 2661  H HG2  . PRO A 1 92 ? 13.877  12.334  -11.805 1.00 0.00 ? 92 PRO A HG2  2  
ATOM 2662  H HG3  . PRO A 1 92 ? 12.461  12.445  -12.867 1.00 0.00 ? 92 PRO A HG3  2  
ATOM 2663  H HD2  . PRO A 1 92 ? 12.246  11.994  -10.211 1.00 0.00 ? 92 PRO A HD2  2  
ATOM 2664  H HD3  . PRO A 1 92 ? 11.104  11.310  -11.386 1.00 0.00 ? 92 PRO A HD3  2  
ATOM 2665  N N    . SER A 1 93 ? 15.396  8.194   -10.931 1.00 0.00 ? 93 SER A N    2  
ATOM 2666  C CA   . SER A 1 93 ? 16.745  7.958   -10.431 1.00 0.00 ? 93 SER A CA   2  
ATOM 2667  C C    . SER A 1 93 ? 17.127  6.488   -10.569 1.00 0.00 ? 93 SER A C    2  
ATOM 2668  O O    . SER A 1 93 ? 16.375  5.601   -10.165 1.00 0.00 ? 93 SER A O    2  
ATOM 2669  C CB   . SER A 1 93 ? 16.852  8.389   -8.967  1.00 0.00 ? 93 SER A CB   2  
ATOM 2670  O OG   . SER A 1 93 ? 16.811  9.800   -8.845  1.00 0.00 ? 93 SER A OG   2  
ATOM 2671  H H    . SER A 1 93 ? 14.769  7.443   -10.989 1.00 0.00 ? 93 SER A H    2  
ATOM 2672  H HA   . SER A 1 93 ? 17.426  8.552   -11.021 1.00 0.00 ? 93 SER A HA   2  
ATOM 2673  H HB2  . SER A 1 93 ? 16.028  7.969   -8.409  1.00 0.00 ? 93 SER A HB2  2  
ATOM 2674  H HB3  . SER A 1 93 ? 17.785  8.032   -8.555  1.00 0.00 ? 93 SER A HB3  2  
ATOM 2675  H HG   . SER A 1 93 ? 16.284  10.041  -8.080  1.00 0.00 ? 93 SER A HG   2  
ATOM 2676  N N    . SER A 1 94 ? 18.299  6.238   -11.142 1.00 0.00 ? 94 SER A N    2  
ATOM 2677  C CA   . SER A 1 94 ? 18.782  4.875   -11.334 1.00 0.00 ? 94 SER A CA   2  
ATOM 2678  C C    . SER A 1 94 ? 20.212  4.726   -10.826 1.00 0.00 ? 94 SER A C    2  
ATOM 2679  O O    . SER A 1 94 ? 21.014  5.656   -10.920 1.00 0.00 ? 94 SER A O    2  
ATOM 2680  C CB   . SER A 1 94 ? 18.711  4.490   -12.813 1.00 0.00 ? 94 SER A CB   2  
ATOM 2681  O OG   . SER A 1 94 ? 19.469  5.382   -13.610 1.00 0.00 ? 94 SER A OG   2  
ATOM 2682  H H    . SER A 1 94 ? 18.855  6.987   -11.444 1.00 0.00 ? 94 SER A H    2  
ATOM 2683  H HA   . SER A 1 94 ? 18.141  4.215   -10.769 1.00 0.00 ? 94 SER A HA   2  
ATOM 2684  H HB2  . SER A 1 94 ? 19.100  3.492   -12.942 1.00 0.00 ? 94 SER A HB2  2  
ATOM 2685  H HB3  . SER A 1 94 ? 17.682  4.519   -13.141 1.00 0.00 ? 94 SER A HB3  2  
ATOM 2686  H HG   . SER A 1 94 ? 20.071  4.882   -14.167 1.00 0.00 ? 94 SER A HG   2  
ATOM 2687  N N    . GLY A 1 95 ? 20.526  3.553   -10.288 1.00 0.00 ? 95 GLY A N    2  
ATOM 2688  C CA   . GLY A 1 95 ? 21.859  3.305   -9.774  1.00 0.00 ? 95 GLY A CA   2  
ATOM 2689  C C    . GLY A 1 95 ? 22.896  3.201   -10.875 1.00 0.00 ? 95 GLY A C    2  
ATOM 2690  O O    . GLY A 1 95 ? 22.818  3.990   -11.841 1.00 0.00 ? 95 GLY A O    2  
ATOM 2691  O OXT  . GLY A 1 95 ? 23.786  2.331   -10.772 1.00 0.00 ? 95 GLY A OXT  2  
ATOM 2692  H H    . GLY A 1 95 ? 19.845  2.849   -10.240 1.00 0.00 ? 95 GLY A H    2  
ATOM 2693  H HA2  . GLY A 1 95 ? 22.133  4.113   -9.112  1.00 0.00 ? 95 GLY A HA2  2  
ATOM 2694  H HA3  . GLY A 1 95 ? 21.852  2.381   -9.214  1.00 0.00 ? 95 GLY A HA3  2  
ATOM 2695  N N    . GLY A 1 1  ? -9.363  1.473   -24.510 1.00 0.00 ? 1  GLY A N    3  
ATOM 2696  C CA   . GLY A 1 1  ? -8.515  0.274   -24.270 1.00 0.00 ? 1  GLY A CA   3  
ATOM 2697  C C    . GLY A 1 1  ? -8.557  -0.186  -22.825 1.00 0.00 ? 1  GLY A C    3  
ATOM 2698  O O    . GLY A 1 1  ? -9.627  -0.249  -22.218 1.00 0.00 ? 1  GLY A O    3  
ATOM 2699  H H1   . GLY A 1 1  ? -10.292 1.186   -24.881 1.00 0.00 ? 1  GLY A H1   3  
ATOM 2700  H H2   . GLY A 1 1  ? -8.906  2.102   -25.200 1.00 0.00 ? 1  GLY A H2   3  
ATOM 2701  H H3   . GLY A 1 1  ? -9.504  1.996   -23.622 1.00 0.00 ? 1  GLY A H3   3  
ATOM 2702  H HA2  . GLY A 1 1  ? -8.859  -0.531  -24.902 1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2703  H HA3  . GLY A 1 1  ? -7.494  0.510   -24.530 1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2704  N N    . SER A 1 2  ? -7.391  -0.508  -22.274 1.00 0.00 ? 2  SER A N    3  
ATOM 2705  C CA   . SER A 1 2  ? -7.299  -0.966  -20.892 1.00 0.00 ? 2  SER A CA   3  
ATOM 2706  C C    . SER A 1 2  ? -6.315  -0.110  -20.101 1.00 0.00 ? 2  SER A C    3  
ATOM 2707  O O    . SER A 1 2  ? -5.400  0.485   -20.669 1.00 0.00 ? 2  SER A O    3  
ATOM 2708  C CB   . SER A 1 2  ? -6.869  -2.433  -20.846 1.00 0.00 ? 2  SER A CB   3  
ATOM 2709  O OG   . SER A 1 2  ? -7.309  -3.130  -21.998 1.00 0.00 ? 2  SER A OG   3  
ATOM 2710  H H    . SER A 1 2  ? -6.574  -0.437  -22.810 1.00 0.00 ? 2  SER A H    3  
ATOM 2711  H HA   . SER A 1 2  ? -8.278  -0.872  -20.446 1.00 0.00 ? 2  SER A HA   3  
ATOM 2712  H HB2  . SER A 1 2  ? -5.791  -2.489  -20.798 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2713  H HB3  . SER A 1 2  ? -7.294  -2.903  -19.971 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2714  H HG   . SER A 1 2  ? -8.096  -3.638  -21.785 1.00 0.00 ? 2  SER A HG   3  
ATOM 2715  N N    . SER A 1 3  ? -6.511  -0.054  -18.788 1.00 0.00 ? 3  SER A N    3  
ATOM 2716  C CA   . SER A 1 3  ? -5.640  0.729   -17.918 1.00 0.00 ? 3  SER A CA   3  
ATOM 2717  C C    . SER A 1 3  ? -4.526  -0.138  -17.342 1.00 0.00 ? 3  SER A C    3  
ATOM 2718  O O    . SER A 1 3  ? -3.365  0.271   -17.304 1.00 0.00 ? 3  SER A O    3  
ATOM 2719  C CB   . SER A 1 3  ? -6.451  1.359   -16.784 1.00 0.00 ? 3  SER A CB   3  
ATOM 2720  O OG   . SER A 1 3  ? -7.078  0.365   -15.992 1.00 0.00 ? 3  SER A OG   3  
ATOM 2721  H H    . SER A 1 3  ? -7.258  -0.551  -18.394 1.00 0.00 ? 3  SER A H    3  
ATOM 2722  H HA   . SER A 1 3  ? -5.198  1.515   -18.512 1.00 0.00 ? 3  SER A HA   3  
ATOM 2723  H HB2  . SER A 1 3  ? -5.793  1.939   -16.154 1.00 0.00 ? 3  SER A HB2  3  
ATOM 2724  H HB3  . SER A 1 3  ? -7.210  2.003   -17.201 1.00 0.00 ? 3  SER A HB3  3  
ATOM 2725  H HG   . SER A 1 3  ? -6.434  -0.027  -15.399 1.00 0.00 ? 3  SER A HG   3  
ATOM 2726  N N    . GLY A 1 4  ? -4.886  -1.337  -16.894 1.00 0.00 ? 4  GLY A N    3  
ATOM 2727  C CA   . GLY A 1 4  ? -3.904  -2.241  -16.326 1.00 0.00 ? 4  GLY A CA   3  
ATOM 2728  C C    . GLY A 1 4  ? -4.536  -3.491  -15.744 1.00 0.00 ? 4  GLY A C    3  
ATOM 2729  O O    . GLY A 1 4  ? -4.252  -4.603  -16.188 1.00 0.00 ? 4  GLY A O    3  
ATOM 2730  H H    . GLY A 1 4  ? -5.825  -1.608  -16.950 1.00 0.00 ? 4  GLY A H    3  
ATOM 2731  H HA2  . GLY A 1 4  ? -3.207  -2.530  -17.099 1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2732  H HA3  . GLY A 1 4  ? -3.365  -1.726  -15.544 1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2733  N N    . SER A 1 5  ? -5.396  -3.307  -14.746 1.00 0.00 ? 5  SER A N    3  
ATOM 2734  C CA   . SER A 1 5  ? -6.069  -4.428  -14.102 1.00 0.00 ? 5  SER A CA   3  
ATOM 2735  C C    . SER A 1 5  ? -7.093  -3.935  -13.085 1.00 0.00 ? 5  SER A C    3  
ATOM 2736  O O    . SER A 1 5  ? -6.901  -2.900  -12.448 1.00 0.00 ? 5  SER A O    3  
ATOM 2737  C CB   . SER A 1 5  ? -5.048  -5.338  -13.417 1.00 0.00 ? 5  SER A CB   3  
ATOM 2738  O OG   . SER A 1 5  ? -5.692  -6.334  -12.641 1.00 0.00 ? 5  SER A OG   3  
ATOM 2739  H H    . SER A 1 5  ? -5.581  -2.396  -14.437 1.00 0.00 ? 5  SER A H    3  
ATOM 2740  H HA   . SER A 1 5  ? -6.582  -4.990  -14.868 1.00 0.00 ? 5  SER A HA   3  
ATOM 2741  H HB2  . SER A 1 5  ? -4.439  -5.821  -14.165 1.00 0.00 ? 5  SER A HB2  3  
ATOM 2742  H HB3  . SER A 1 5  ? -4.419  -4.745  -12.768 1.00 0.00 ? 5  SER A HB3  3  
ATOM 2743  H HG   . SER A 1 5  ? -5.487  -7.200  -12.999 1.00 0.00 ? 5  SER A HG   3  
ATOM 2744  N N    . SER A 1 6  ? -8.181  -4.685  -12.938 1.00 0.00 ? 6  SER A N    3  
ATOM 2745  C CA   . SER A 1 6  ? -9.235  -4.324  -11.998 1.00 0.00 ? 6  SER A CA   3  
ATOM 2746  C C    . SER A 1 6  ? -8.833  -4.672  -10.569 1.00 0.00 ? 6  SER A C    3  
ATOM 2747  O O    . SER A 1 6  ? -7.979  -5.531  -10.345 1.00 0.00 ? 6  SER A O    3  
ATOM 2748  C CB   . SER A 1 6  ? -10.539 -5.039  -12.361 1.00 0.00 ? 6  SER A CB   3  
ATOM 2749  O OG   . SER A 1 6  ? -11.499 -4.904  -11.329 1.00 0.00 ? 6  SER A OG   3  
ATOM 2750  H H    . SER A 1 6  ? -8.277  -5.499  -13.474 1.00 0.00 ? 6  SER A H    3  
ATOM 2751  H HA   . SER A 1 6  ? -9.389  -3.258  -12.065 1.00 0.00 ? 6  SER A HA   3  
ATOM 2752  H HB2  . SER A 1 6  ? -10.940 -4.611  -13.267 1.00 0.00 ? 6  SER A HB2  3  
ATOM 2753  H HB3  . SER A 1 6  ? -10.339 -6.089  -12.516 1.00 0.00 ? 6  SER A HB3  3  
ATOM 2754  H HG   . SER A 1 6  ? -11.227 -5.420  -10.567 1.00 0.00 ? 6  SER A HG   3  
ATOM 2755  N N    . GLY A 1 7  ? -9.453  -4.001  -9.604  1.00 0.00 ? 7  GLY A N    3  
ATOM 2756  C CA   . GLY A 1 7  ? -9.146  -4.254  -8.209  1.00 0.00 ? 7  GLY A CA   3  
ATOM 2757  C C    . GLY A 1 7  ? -9.736  -5.559  -7.712  1.00 0.00 ? 7  GLY A C    3  
ATOM 2758  O O    . GLY A 1 7  ? -10.728 -5.562  -6.982  1.00 0.00 ? 7  GLY A O    3  
ATOM 2759  H H    . GLY A 1 7  ? -10.125 -3.328  -9.841  1.00 0.00 ? 7  GLY A H    3  
ATOM 2760  H HA2  . GLY A 1 7  ? -8.073  -4.288  -8.088  1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2761  H HA3  . GLY A 1 7  ? -9.539  -3.444  -7.612  1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2762  N N    . ALA A 1 8  ? -9.125  -6.671  -8.107  1.00 0.00 ? 8  ALA A N    3  
ATOM 2763  C CA   . ALA A 1 8  ? -9.596  -7.988  -7.697  1.00 0.00 ? 8  ALA A CA   3  
ATOM 2764  C C    . ALA A 1 8  ? -8.568  -9.066  -8.029  1.00 0.00 ? 8  ALA A C    3  
ATOM 2765  O O    . ALA A 1 8  ? -8.305  -9.955  -7.220  1.00 0.00 ? 8  ALA A O    3  
ATOM 2766  C CB   . ALA A 1 8  ? -10.926 -8.303  -8.364  1.00 0.00 ? 8  ALA A CB   3  
ATOM 2767  H H    . ALA A 1 8  ? -8.338  -6.603  -8.687  1.00 0.00 ? 8  ALA A H    3  
ATOM 2768  H HA   . ALA A 1 8  ? -9.751  -7.969  -6.628  1.00 0.00 ? 8  ALA A HA   3  
ATOM 2769  H HB1  . ALA A 1 8  ? -11.402 -7.383  -8.672  1.00 0.00 ? 8  ALA A HB1  3  
ATOM 2770  H HB2  . ALA A 1 8  ? -11.566 -8.821  -7.664  1.00 0.00 ? 8  ALA A HB2  3  
ATOM 2771  H HB3  . ALA A 1 8  ? -10.757 -8.928  -9.228  1.00 0.00 ? 8  ALA A HB3  3  
ATOM 2772  N N    . ALA A 1 9  ? -7.993  -8.978  -9.223  1.00 0.00 ? 9  ALA A N    3  
ATOM 2773  C CA   . ALA A 1 9  ? -6.994  -9.946  -9.661  1.00 0.00 ? 9  ALA A CA   3  
ATOM 2774  C C    . ALA A 1 9  ? -5.582  -9.406  -9.462  1.00 0.00 ? 9  ALA A C    3  
ATOM 2775  O O    . ALA A 1 9  ? -4.669  -9.732  -10.221 1.00 0.00 ? 9  ALA A O    3  
ATOM 2776  C CB   . ALA A 1 9  ? -7.220  -10.313 -11.121 1.00 0.00 ? 9  ALA A CB   3  
ATOM 2777  H H    . ALA A 1 9  ? -8.245  -8.247  -9.823  1.00 0.00 ? 9  ALA A H    3  
ATOM 2778  H HA   . ALA A 1 9  ? -7.113  -10.841 -9.067  1.00 0.00 ? 9  ALA A HA   3  
ATOM 2779  H HB1  . ALA A 1 9  ? -6.548  -9.741  -11.743 1.00 0.00 ? 9  ALA A HB1  3  
ATOM 2780  H HB2  . ALA A 1 9  ? -8.241  -10.090 -11.393 1.00 0.00 ? 9  ALA A HB2  3  
ATOM 2781  H HB3  . ALA A 1 9  ? -7.032  -11.367 -11.260 1.00 0.00 ? 9  ALA A HB3  3  
ATOM 2782  N N    . GLU A 1 10 ? -5.410  -8.577  -8.437  1.00 0.00 ? 10 GLU A N    3  
ATOM 2783  C CA   . GLU A 1 10 ? -4.109  -7.992  -8.138  1.00 0.00 ? 10 GLU A CA   3  
ATOM 2784  C C    . GLU A 1 10 ? -3.532  -8.574  -6.852  1.00 0.00 ? 10 GLU A C    3  
ATOM 2785  O O    . GLU A 1 10 ? -4.140  -8.476  -5.786  1.00 0.00 ? 10 GLU A O    3  
ATOM 2786  C CB   . GLU A 1 10 ? -4.227  -6.472  -8.013  1.00 0.00 ? 10 GLU A CB   3  
ATOM 2787  C CG   . GLU A 1 10 ? -4.329  -5.757  -9.351  1.00 0.00 ? 10 GLU A CG   3  
ATOM 2788  C CD   . GLU A 1 10 ? -3.207  -4.761  -9.571  1.00 0.00 ? 10 GLU A CD   3  
ATOM 2789  O OE1  . GLU A 1 10 ? -2.069  -5.046  -9.143  1.00 0.00 ? 10 GLU A OE1  3  
ATOM 2790  O OE2  . GLU A 1 10 ? -3.467  -3.696  -10.169 1.00 0.00 ? 10 GLU A OE2  3  
ATOM 2791  H H    . GLU A 1 10 ? -6.177  -8.355  -7.868  1.00 0.00 ? 10 GLU A H    3  
ATOM 2792  H HA   . GLU A 1 10 ? -3.443  -8.226  -8.955  1.00 0.00 ? 10 GLU A HA   3  
ATOM 2793  H HB2  . GLU A 1 10 ? -5.109  -6.236  -7.437  1.00 0.00 ? 10 GLU A HB2  3  
ATOM 2794  H HB3  . GLU A 1 10 ? -3.358  -6.096  -7.494  1.00 0.00 ? 10 GLU A HB3  3  
ATOM 2795  H HG2  . GLU A 1 10 ? -4.295  -6.493  -10.141 1.00 0.00 ? 10 GLU A HG2  3  
ATOM 2796  H HG3  . GLU A 1 10 ? -5.271  -5.231  -9.393  1.00 0.00 ? 10 GLU A HG3  3  
ATOM 2797  N N    . VAL A 1 11 ? -2.355  -9.184  -6.960  1.00 0.00 ? 11 VAL A N    3  
ATOM 2798  C CA   . VAL A 1 11 ? -1.696  -9.783  -5.806  1.00 0.00 ? 11 VAL A CA   3  
ATOM 2799  C C    . VAL A 1 11 ? -0.680  -8.825  -5.194  1.00 0.00 ? 11 VAL A C    3  
ATOM 2800  O O    . VAL A 1 11 ? -0.290  -7.837  -5.816  1.00 0.00 ? 11 VAL A O    3  
ATOM 2801  C CB   . VAL A 1 11 ? -0.984  -11.095 -6.185  1.00 0.00 ? 11 VAL A CB   3  
ATOM 2802  C CG1  . VAL A 1 11 ? -1.994  -12.151 -6.605  1.00 0.00 ? 11 VAL A CG1  3  
ATOM 2803  C CG2  . VAL A 1 11 ? 0.034   -10.851 -7.288  1.00 0.00 ? 11 VAL A CG2  3  
ATOM 2804  H H    . VAL A 1 11 ? -1.920  -9.231  -7.837  1.00 0.00 ? 11 VAL A H    3  
ATOM 2805  H HA   . VAL A 1 11 ? -2.453  -10.008 -5.069  1.00 0.00 ? 11 VAL A HA   3  
ATOM 2806  H HB   . VAL A 1 11 ? -0.458  -11.460 -5.314  1.00 0.00 ? 11 VAL A HB   3  
ATOM 2807  H HG11 . VAL A 1 11 ? -2.966  -11.898 -6.205  1.00 0.00 ? 11 VAL A HG11 3  
ATOM 2808  H HG12 . VAL A 1 11 ? -1.688  -13.114 -6.226  1.00 0.00 ? 11 VAL A HG12 3  
ATOM 2809  H HG13 . VAL A 1 11 ? -2.047  -12.189 -7.683  1.00 0.00 ? 11 VAL A HG13 3  
ATOM 2810  H HG21 . VAL A 1 11 ? 0.686   -10.038 -7.004  1.00 0.00 ? 11 VAL A HG21 3  
ATOM 2811  H HG22 . VAL A 1 11 ? -0.481  -10.596 -8.203  1.00 0.00 ? 11 VAL A HG22 3  
ATOM 2812  H HG23 . VAL A 1 11 ? 0.620   -11.745 -7.442  1.00 0.00 ? 11 VAL A HG23 3  
ATOM 2813  N N    . GLY A 1 12 ? -0.253  -9.125  -3.971  1.00 0.00 ? 12 GLY A N    3  
ATOM 2814  C CA   . GLY A 1 12 ? 0.714   -8.281  -3.295  1.00 0.00 ? 12 GLY A CA   3  
ATOM 2815  C C    . GLY A 1 12 ? 2.080   -8.931  -3.191  1.00 0.00 ? 12 GLY A C    3  
ATOM 2816  O O    . GLY A 1 12 ? 2.285   -10.041 -3.684  1.00 0.00 ? 12 GLY A O    3  
ATOM 2817  H H    . GLY A 1 12 ? -0.598  -9.925  -3.524  1.00 0.00 ? 12 GLY A H    3  
ATOM 2818  H HA2  . GLY A 1 12 ? 0.811   -7.353  -3.841  1.00 0.00 ? 12 GLY A HA2  3  
ATOM 2819  H HA3  . GLY A 1 12 ? 0.355   -8.064  -2.301  1.00 0.00 ? 12 GLY A HA3  3  
ATOM 2820  N N    . ASP A 1 13 ? 3.014   -8.241  -2.547  1.00 0.00 ? 13 ASP A N    3  
ATOM 2821  C CA   . ASP A 1 13 ? 4.367   -8.758  -2.380  1.00 0.00 ? 13 ASP A CA   3  
ATOM 2822  C C    . ASP A 1 13 ? 4.461   -9.648  -1.144  1.00 0.00 ? 13 ASP A C    3  
ATOM 2823  O O    . ASP A 1 13 ? 3.603   -9.595  -0.263  1.00 0.00 ? 13 ASP A O    3  
ATOM 2824  C CB   . ASP A 1 13 ? 5.367   -7.605  -2.269  1.00 0.00 ? 13 ASP A CB   3  
ATOM 2825  C CG   . ASP A 1 13 ? 6.782   -8.032  -2.610  1.00 0.00 ? 13 ASP A CG   3  
ATOM 2826  O OD1  . ASP A 1 13 ? 7.021   -8.416  -3.774  1.00 0.00 ? 13 ASP A OD1  3  
ATOM 2827  O OD2  . ASP A 1 13 ? 7.649   -7.981  -1.713  1.00 0.00 ? 13 ASP A OD2  3  
ATOM 2828  H H    . ASP A 1 13 ? 2.789   -7.362  -2.176  1.00 0.00 ? 13 ASP A H    3  
ATOM 2829  H HA   . ASP A 1 13 ? 4.608   -9.348  -3.252  1.00 0.00 ? 13 ASP A HA   3  
ATOM 2830  H HB2  . ASP A 1 13 ? 5.076   -6.818  -2.947  1.00 0.00 ? 13 ASP A HB2  3  
ATOM 2831  H HB3  . ASP A 1 13 ? 5.358   -7.225  -1.258  1.00 0.00 ? 13 ASP A HB3  3  
ATOM 2832  N N    . ASP A 1 14 ? 5.509   -10.464 -1.086  1.00 0.00 ? 14 ASP A N    3  
ATOM 2833  C CA   . ASP A 1 14 ? 5.714   -11.364 0.042   1.00 0.00 ? 14 ASP A CA   3  
ATOM 2834  C C    . ASP A 1 14 ? 6.855   -10.875 0.928   1.00 0.00 ? 14 ASP A C    3  
ATOM 2835  O O    . ASP A 1 14 ? 7.662   -11.668 1.413   1.00 0.00 ? 14 ASP A O    3  
ATOM 2836  C CB   . ASP A 1 14 ? 6.009   -12.781 -0.458  1.00 0.00 ? 14 ASP A CB   3  
ATOM 2837  C CG   . ASP A 1 14 ? 4.871   -13.352 -1.280  1.00 0.00 ? 14 ASP A CG   3  
ATOM 2838  O OD1  . ASP A 1 14 ? 4.086   -12.559 -1.839  1.00 0.00 ? 14 ASP A OD1  3  
ATOM 2839  O OD2  . ASP A 1 14 ? 4.766   -14.594 -1.366  1.00 0.00 ? 14 ASP A OD2  3  
ATOM 2840  H H    . ASP A 1 14 ? 6.158   -10.459 -1.820  1.00 0.00 ? 14 ASP A H    3  
ATOM 2841  H HA   . ASP A 1 14 ? 4.804   -11.380 0.623   1.00 0.00 ? 14 ASP A HA   3  
ATOM 2842  H HB2  . ASP A 1 14 ? 6.898   -12.762 -1.070  1.00 0.00 ? 14 ASP A HB2  3  
ATOM 2843  H HB3  . ASP A 1 14 ? 6.176   -13.427 0.391   1.00 0.00 ? 14 ASP A HB3  3  
ATOM 2844  N N    . PHE A 1 15 ? 6.917   -9.564  1.134   1.00 0.00 ? 15 PHE A N    3  
ATOM 2845  C CA   . PHE A 1 15 ? 7.959   -8.969  1.962   1.00 0.00 ? 15 PHE A CA   3  
ATOM 2846  C C    . PHE A 1 15 ? 7.573   -7.558  2.394   1.00 0.00 ? 15 PHE A C    3  
ATOM 2847  O O    . PHE A 1 15 ? 7.550   -6.634  1.580   1.00 0.00 ? 15 PHE A O    3  
ATOM 2848  C CB   . PHE A 1 15 ? 9.288   -8.939  1.202   1.00 0.00 ? 15 PHE A CB   3  
ATOM 2849  C CG   . PHE A 1 15 ? 10.468  -9.341  2.040   1.00 0.00 ? 15 PHE A CG   3  
ATOM 2850  C CD1  . PHE A 1 15 ? 10.722  -8.713  3.250   1.00 0.00 ? 15 PHE A CD1  3  
ATOM 2851  C CD2  . PHE A 1 15 ? 11.323  -10.346 1.618   1.00 0.00 ? 15 PHE A CD2  3  
ATOM 2852  C CE1  . PHE A 1 15 ? 11.807  -9.081  4.022   1.00 0.00 ? 15 PHE A CE1  3  
ATOM 2853  C CE2  . PHE A 1 15 ? 12.410  -10.718 2.386   1.00 0.00 ? 15 PHE A CE2  3  
ATOM 2854  C CZ   . PHE A 1 15 ? 12.652  -10.085 3.590   1.00 0.00 ? 15 PHE A CZ   3  
ATOM 2855  H H    . PHE A 1 15 ? 6.245   -8.983  0.721   1.00 0.00 ? 15 PHE A H    3  
ATOM 2856  H HA   . PHE A 1 15 ? 8.073   -9.583  2.843   1.00 0.00 ? 15 PHE A HA   3  
ATOM 2857  H HB2  . PHE A 1 15 ? 9.230   -9.617  0.364   1.00 0.00 ? 15 PHE A HB2  3  
ATOM 2858  H HB3  . PHE A 1 15 ? 9.464   -7.937  0.838   1.00 0.00 ? 15 PHE A HB3  3  
ATOM 2859  H HD1  . PHE A 1 15 ? 10.062  -7.929  3.588   1.00 0.00 ? 15 PHE A HD1  3  
ATOM 2860  H HD2  . PHE A 1 15 ? 11.135  -10.841 0.677   1.00 0.00 ? 15 PHE A HD2  3  
ATOM 2861  H HE1  . PHE A 1 15 ? 11.994  -8.585  4.963   1.00 0.00 ? 15 PHE A HE1  3  
ATOM 2862  H HE2  . PHE A 1 15 ? 13.069  -11.504 2.046   1.00 0.00 ? 15 PHE A HE2  3  
ATOM 2863  H HZ   . PHE A 1 15 ? 13.501  -10.374 4.193   1.00 0.00 ? 15 PHE A HZ   3  
ATOM 2864  N N    . LEU A 1 16 ? 7.271   -7.399  3.678   1.00 0.00 ? 16 LEU A N    3  
ATOM 2865  C CA   . LEU A 1 16 ? 6.885   -6.100  4.219   1.00 0.00 ? 16 LEU A CA   3  
ATOM 2866  C C    . LEU A 1 16 ? 8.041   -5.109  4.126   1.00 0.00 ? 16 LEU A C    3  
ATOM 2867  O O    . LEU A 1 16 ? 9.103   -5.427  3.592   1.00 0.00 ? 16 LEU A O    3  
ATOM 2868  C CB   . LEU A 1 16 ? 6.434   -6.243  5.674   1.00 0.00 ? 16 LEU A CB   3  
ATOM 2869  C CG   . LEU A 1 16 ? 4.940   -6.512  5.864   1.00 0.00 ? 16 LEU A CG   3  
ATOM 2870  C CD1  . LEU A 1 16 ? 4.697   -7.294  7.145   1.00 0.00 ? 16 LEU A CD1  3  
ATOM 2871  C CD2  . LEU A 1 16 ? 4.163   -5.205  5.880   1.00 0.00 ? 16 LEU A CD2  3  
ATOM 2872  H H    . LEU A 1 16 ? 7.308   -8.174  4.277   1.00 0.00 ? 16 LEU A H    3  
ATOM 2873  H HA   . LEU A 1 16 ? 6.061   -5.728  3.629   1.00 0.00 ? 16 LEU A HA   3  
ATOM 2874  H HB2  . LEU A 1 16 ? 6.985   -7.058  6.120   1.00 0.00 ? 16 LEU A HB2  3  
ATOM 2875  H HB3  . LEU A 1 16 ? 6.681   -5.333  6.197   1.00 0.00 ? 16 LEU A HB3  3  
ATOM 2876  H HG   . LEU A 1 16 ? 4.579   -7.107  5.036   1.00 0.00 ? 16 LEU A HG   3  
ATOM 2877  H HD11 . LEU A 1 16 ? 4.449   -6.610  7.943   1.00 0.00 ? 16 LEU A HD11 3  
ATOM 2878  H HD12 . LEU A 1 16 ? 5.590   -7.844  7.406   1.00 0.00 ? 16 LEU A HD12 3  
ATOM 2879  H HD13 . LEU A 1 16 ? 3.881   -7.985  6.996   1.00 0.00 ? 16 LEU A HD13 3  
ATOM 2880  H HD21 . LEU A 1 16 ? 3.208   -5.348  5.394   1.00 0.00 ? 16 LEU A HD21 3  
ATOM 2881  H HD22 . LEU A 1 16 ? 4.723   -4.446  5.354   1.00 0.00 ? 16 LEU A HD22 3  
ATOM 2882  H HD23 . LEU A 1 16 ? 4.003   -4.893  6.902   1.00 0.00 ? 16 LEU A HD23 3  
ATOM 2883  N N    . GLY A 1 17 ? 7.826   -3.907  4.652   1.00 0.00 ? 17 GLY A N    3  
ATOM 2884  C CA   . GLY A 1 17 ? 8.858   -2.887  4.619   1.00 0.00 ? 17 GLY A CA   3  
ATOM 2885  C C    . GLY A 1 17 ? 9.120   -2.277  5.984   1.00 0.00 ? 17 GLY A C    3  
ATOM 2886  O O    . GLY A 1 17 ? 9.658   -1.174  6.082   1.00 0.00 ? 17 GLY A O    3  
ATOM 2887  H H    . GLY A 1 17 ? 6.959   -3.710  5.065   1.00 0.00 ? 17 GLY A H    3  
ATOM 2888  H HA2  . GLY A 1 17 ? 9.774   -3.329  4.254   1.00 0.00 ? 17 GLY A HA2  3  
ATOM 2889  H HA3  . GLY A 1 17 ? 8.554   -2.105  3.940   1.00 0.00 ? 17 GLY A HA3  3  
ATOM 2890  N N    . ASP A 1 18 ? 8.741   -2.994  7.037   1.00 0.00 ? 18 ASP A N    3  
ATOM 2891  C CA   . ASP A 1 18 ? 8.939   -2.515  8.401   1.00 0.00 ? 18 ASP A CA   3  
ATOM 2892  C C    . ASP A 1 18 ? 8.285   -1.151  8.603   1.00 0.00 ? 18 ASP A C    3  
ATOM 2893  O O    . ASP A 1 18 ? 8.756   -0.337  9.397   1.00 0.00 ? 18 ASP A O    3  
ATOM 2894  C CB   . ASP A 1 18 ? 10.435  -2.431  8.721   1.00 0.00 ? 18 ASP A CB   3  
ATOM 2895  C CG   . ASP A 1 18 ? 10.785  -3.113  10.028  1.00 0.00 ? 18 ASP A CG   3  
ATOM 2896  O OD1  . ASP A 1 18 ? 10.130  -2.813  11.049  1.00 0.00 ? 18 ASP A OD1  3  
ATOM 2897  O OD2  . ASP A 1 18 ? 11.714  -3.948  10.032  1.00 0.00 ? 18 ASP A OD2  3  
ATOM 2898  H H    . ASP A 1 18 ? 8.319   -3.867  6.896   1.00 0.00 ? 18 ASP A H    3  
ATOM 2899  H HA   . ASP A 1 18 ? 8.478   -3.224  9.072   1.00 0.00 ? 18 ASP A HA   3  
ATOM 2900  H HB2  . ASP A 1 18 ? 10.993  -2.906  7.928   1.00 0.00 ? 18 ASP A HB2  3  
ATOM 2901  H HB3  . ASP A 1 18 ? 10.726  -1.393  8.788   1.00 0.00 ? 18 ASP A HB3  3  
ATOM 2902  N N    . PHE A 1 19 ? 7.198   -0.908  7.879   1.00 0.00 ? 19 PHE A N    3  
ATOM 2903  C CA   . PHE A 1 19 ? 6.480   0.357   7.978   1.00 0.00 ? 19 PHE A CA   3  
ATOM 2904  C C    . PHE A 1 19 ? 5.513   0.345   9.159   1.00 0.00 ? 19 PHE A C    3  
ATOM 2905  O O    . PHE A 1 19 ? 5.158   -0.717  9.672   1.00 0.00 ? 19 PHE A O    3  
ATOM 2906  C CB   . PHE A 1 19 ? 5.717   0.638   6.683   1.00 0.00 ? 19 PHE A CB   3  
ATOM 2907  C CG   . PHE A 1 19 ? 6.607   0.994   5.527   1.00 0.00 ? 19 PHE A CG   3  
ATOM 2908  C CD1  . PHE A 1 19 ? 7.053   2.294   5.354   1.00 0.00 ? 19 PHE A CD1  3  
ATOM 2909  C CD2  . PHE A 1 19 ? 7.000   0.028   4.615   1.00 0.00 ? 19 PHE A CD2  3  
ATOM 2910  C CE1  . PHE A 1 19 ? 7.873   2.625   4.292   1.00 0.00 ? 19 PHE A CE1  3  
ATOM 2911  C CE2  . PHE A 1 19 ? 7.820   0.352   3.550   1.00 0.00 ? 19 PHE A CE2  3  
ATOM 2912  C CZ   . PHE A 1 19 ? 8.257   1.652   3.389   1.00 0.00 ? 19 PHE A CZ   3  
ATOM 2913  H H    . PHE A 1 19 ? 6.871   -1.596  7.263   1.00 0.00 ? 19 PHE A H    3  
ATOM 2914  H HA   . PHE A 1 19 ? 7.207   1.139   8.133   1.00 0.00 ? 19 PHE A HA   3  
ATOM 2915  H HB2  . PHE A 1 19 ? 5.152   -0.241  6.408   1.00 0.00 ? 19 PHE A HB2  3  
ATOM 2916  H HB3  . PHE A 1 19 ? 5.036   1.461   6.845   1.00 0.00 ? 19 PHE A HB3  3  
ATOM 2917  H HD1  . PHE A 1 19 ? 6.754   3.055   6.059   1.00 0.00 ? 19 PHE A HD1  3  
ATOM 2918  H HD2  . PHE A 1 19 ? 6.658   -0.989  4.740   1.00 0.00 ? 19 PHE A HD2  3  
ATOM 2919  H HE1  . PHE A 1 19 ? 8.213   3.643   4.168   1.00 0.00 ? 19 PHE A HE1  3  
ATOM 2920  H HE2  . PHE A 1 19 ? 8.118   -0.410  2.846   1.00 0.00 ? 19 PHE A HE2  3  
ATOM 2921  H HZ   . PHE A 1 19 ? 8.898   1.909   2.559   1.00 0.00 ? 19 PHE A HZ   3  
ATOM 2922  N N    . VAL A 1 20 ? 5.092   1.531   9.584   1.00 0.00 ? 20 VAL A N    3  
ATOM 2923  C CA   . VAL A 1 20 ? 4.167   1.658   10.704  1.00 0.00 ? 20 VAL A CA   3  
ATOM 2924  C C    . VAL A 1 20 ? 2.921   2.438   10.301  1.00 0.00 ? 20 VAL A C    3  
ATOM 2925  O O    . VAL A 1 20 ? 2.790   2.869   9.156   1.00 0.00 ? 20 VAL A O    3  
ATOM 2926  C CB   . VAL A 1 20 ? 4.830   2.358   11.905  1.00 0.00 ? 20 VAL A CB   3  
ATOM 2927  C CG1  . VAL A 1 20 ? 5.932   1.488   12.490  1.00 0.00 ? 20 VAL A CG1  3  
ATOM 2928  C CG2  . VAL A 1 20 ? 5.375   3.718   11.496  1.00 0.00 ? 20 VAL A CG2  3  
ATOM 2929  H H    . VAL A 1 20 ? 5.412   2.341   9.135   1.00 0.00 ? 20 VAL A H    3  
ATOM 2930  H HA   . VAL A 1 20 ? 3.875   0.663   11.010  1.00 0.00 ? 20 VAL A HA   3  
ATOM 2931  H HB   . VAL A 1 20 ? 4.080   2.509   12.667  1.00 0.00 ? 20 VAL A HB   3  
ATOM 2932  H HG11 . VAL A 1 20 ? 6.766   1.453   11.804  1.00 0.00 ? 20 VAL A HG11 3  
ATOM 2933  H HG12 . VAL A 1 20 ? 5.556   0.488   12.649  1.00 0.00 ? 20 VAL A HG12 3  
ATOM 2934  H HG13 . VAL A 1 20 ? 6.258   1.903   13.432  1.00 0.00 ? 20 VAL A HG13 3  
ATOM 2935  H HG21 . VAL A 1 20 ? 4.554   4.376   11.252  1.00 0.00 ? 20 VAL A HG21 3  
ATOM 2936  H HG22 . VAL A 1 20 ? 6.014   3.605   10.632  1.00 0.00 ? 20 VAL A HG22 3  
ATOM 2937  H HG23 . VAL A 1 20 ? 5.944   4.138   12.312  1.00 0.00 ? 20 VAL A HG23 3  
ATOM 2938  N N    . VAL A 1 21 ? 2.007   2.617   11.251  1.00 0.00 ? 21 VAL A N    3  
ATOM 2939  C CA   . VAL A 1 21 ? 0.772   3.346   10.995  1.00 0.00 ? 21 VAL A CA   3  
ATOM 2940  C C    . VAL A 1 21 ? 0.853   4.769   11.534  1.00 0.00 ? 21 VAL A C    3  
ATOM 2941  O O    . VAL A 1 21 ? 1.061   4.980   12.729  1.00 0.00 ? 21 VAL A O    3  
ATOM 2942  C CB   . VAL A 1 21 ? -0.441  2.637   11.628  1.00 0.00 ? 21 VAL A CB   3  
ATOM 2943  C CG1  . VAL A 1 21 ? -1.737  3.300   11.188  1.00 0.00 ? 21 VAL A CG1  3  
ATOM 2944  C CG2  . VAL A 1 21 ? -0.441  1.159   11.270  1.00 0.00 ? 21 VAL A CG2  3  
ATOM 2945  H H    . VAL A 1 21 ? 2.170   2.249   12.144  1.00 0.00 ? 21 VAL A H    3  
ATOM 2946  H HA   . VAL A 1 21 ? 0.622   3.384   9.925   1.00 0.00 ? 21 VAL A HA   3  
ATOM 2947  H HB   . VAL A 1 21 ? -0.363  2.726   12.702  1.00 0.00 ? 21 VAL A HB   3  
ATOM 2948  H HG11 . VAL A 1 21 ? -2.545  2.965   11.822  1.00 0.00 ? 21 VAL A HG11 3  
ATOM 2949  H HG12 . VAL A 1 21 ? -1.949  3.033   10.164  1.00 0.00 ? 21 VAL A HG12 3  
ATOM 2950  H HG13 . VAL A 1 21 ? -1.638  4.373   11.268  1.00 0.00 ? 21 VAL A HG13 3  
ATOM 2951  H HG21 . VAL A 1 21 ? 0.563   0.769   11.349  1.00 0.00 ? 21 VAL A HG21 3  
ATOM 2952  H HG22 . VAL A 1 21 ? -0.797  1.033   10.258  1.00 0.00 ? 21 VAL A HG22 3  
ATOM 2953  H HG23 . VAL A 1 21 ? -1.089  0.624   11.949  1.00 0.00 ? 21 VAL A HG23 3  
ATOM 2954  N N    . GLY A 1 22 ? 0.686   5.744   10.646  1.00 0.00 ? 22 GLY A N    3  
ATOM 2955  C CA   . GLY A 1 22 ? 0.744   7.136   11.052  1.00 0.00 ? 22 GLY A CA   3  
ATOM 2956  C C    . GLY A 1 22 ? 1.955   7.855   10.490  1.00 0.00 ? 22 GLY A C    3  
ATOM 2957  O O    . GLY A 1 22 ? 2.471   8.788   11.104  1.00 0.00 ? 22 GLY A O    3  
ATOM 2958  H H    . GLY A 1 22 ? 0.524   5.515   9.707   1.00 0.00 ? 22 GLY A H    3  
ATOM 2959  H HA2  . GLY A 1 22 ? -0.149  7.637   10.708  1.00 0.00 ? 22 GLY A HA2  3  
ATOM 2960  H HA3  . GLY A 1 22 ? 0.779   7.184   12.130  1.00 0.00 ? 22 GLY A HA3  3  
ATOM 2961  N N    . GLU A 1 23 ? 2.410   7.418   9.320   1.00 0.00 ? 23 GLU A N    3  
ATOM 2962  C CA   . GLU A 1 23 ? 3.569   8.025   8.676   1.00 0.00 ? 23 GLU A CA   3  
ATOM 2963  C C    . GLU A 1 23 ? 3.310   8.248   7.189   1.00 0.00 ? 23 GLU A C    3  
ATOM 2964  O O    . GLU A 1 23 ? 2.532   7.524   6.568   1.00 0.00 ? 23 GLU A O    3  
ATOM 2965  C CB   . GLU A 1 23 ? 4.804   7.143   8.863   1.00 0.00 ? 23 GLU A CB   3  
ATOM 2966  C CG   . GLU A 1 23 ? 4.631   5.731   8.330   1.00 0.00 ? 23 GLU A CG   3  
ATOM 2967  C CD   . GLU A 1 23 ? 5.939   5.113   7.878   1.00 0.00 ? 23 GLU A CD   3  
ATOM 2968  O OE1  . GLU A 1 23 ? 6.768   5.842   7.294   1.00 0.00 ? 23 GLU A OE1  3  
ATOM 2969  O OE2  . GLU A 1 23 ? 6.133   3.900   8.105   1.00 0.00 ? 23 GLU A OE2  3  
ATOM 2970  H H    . GLU A 1 23 ? 1.956   6.669   8.880   1.00 0.00 ? 23 GLU A H    3  
ATOM 2971  H HA   . GLU A 1 23 ? 3.746   8.981   9.145   1.00 0.00 ? 23 GLU A HA   3  
ATOM 2972  H HB2  . GLU A 1 23 ? 5.639   7.598   8.350   1.00 0.00 ? 23 GLU A HB2  3  
ATOM 2973  H HB3  . GLU A 1 23 ? 5.032   7.082   9.917   1.00 0.00 ? 23 GLU A HB3  3  
ATOM 2974  H HG2  . GLU A 1 23 ? 4.210   5.115   9.110   1.00 0.00 ? 23 GLU A HG2  3  
ATOM 2975  H HG3  . GLU A 1 23 ? 3.952   5.757   7.489   1.00 0.00 ? 23 GLU A HG3  3  
ATOM 2976  N N    . ARG A 1 24 ? 3.966   9.256   6.624   1.00 0.00 ? 24 ARG A N    3  
ATOM 2977  C CA   . ARG A 1 24 ? 3.807   9.575   5.209   1.00 0.00 ? 24 ARG A CA   3  
ATOM 2978  C C    . ARG A 1 24 ? 4.810   8.800   4.361   1.00 0.00 ? 24 ARG A C    3  
ATOM 2979  O O    . ARG A 1 24 ? 5.991   9.145   4.307   1.00 0.00 ? 24 ARG A O    3  
ATOM 2980  C CB   . ARG A 1 24 ? 3.977   11.080  4.983   1.00 0.00 ? 24 ARG A CB   3  
ATOM 2981  C CG   . ARG A 1 24 ? 2.721   11.762  4.463   1.00 0.00 ? 24 ARG A CG   3  
ATOM 2982  C CD   . ARG A 1 24 ? 1.998   12.521  5.566   1.00 0.00 ? 24 ARG A CD   3  
ATOM 2983  N NE   . ARG A 1 24 ? 2.104   13.967  5.395   1.00 0.00 ? 24 ARG A NE   3  
ATOM 2984  C CZ   . ARG A 1 24 ? 1.877   14.848  6.368   1.00 0.00 ? 24 ARG A CZ   3  
ATOM 2985  N NH1  . ARG A 1 24 ? 1.529   14.432  7.579   1.00 0.00 ? 24 ARG A NH1  3  
ATOM 2986  N NH2  . ARG A 1 24 ? 1.996   16.146  6.128   1.00 0.00 ? 24 ARG A NH2  3  
ATOM 2987  H H    . ARG A 1 24 ? 4.572   9.799   7.171   1.00 0.00 ? 24 ARG A H    3  
ATOM 2988  H HA   . ARG A 1 24 ? 2.808   9.287   4.916   1.00 0.00 ? 24 ARG A HA   3  
ATOM 2989  H HB2  . ARG A 1 24 ? 4.253   11.544  5.918   1.00 0.00 ? 24 ARG A HB2  3  
ATOM 2990  H HB3  . ARG A 1 24 ? 4.769   11.239  4.265   1.00 0.00 ? 24 ARG A HB3  3  
ATOM 2991  H HG2  . ARG A 1 24 ? 2.997   12.457  3.684   1.00 0.00 ? 24 ARG A HG2  3  
ATOM 2992  H HG3  . ARG A 1 24 ? 2.057   11.012  4.059   1.00 0.00 ? 24 ARG A HG3  3  
ATOM 2993  H HD2  . ARG A 1 24 ? 0.955   12.243  5.552   1.00 0.00 ? 24 ARG A HD2  3  
ATOM 2994  H HD3  . ARG A 1 24 ? 2.429   12.246  6.517   1.00 0.00 ? 24 ARG A HD3  3  
ATOM 2995  H HE   . ARG A 1 24 ? 2.359   14.301  4.509   1.00 0.00 ? 24 ARG A HE   3  
ATOM 2996  H HH11 . ARG A 1 24 ? 1.437   13.454  7.767   1.00 0.00 ? 24 ARG A HH11 3  
ATOM 2997  H HH12 . ARG A 1 24 ? 1.359   15.098  8.306   1.00 0.00 ? 24 ARG A HH12 3  
ATOM 2998  H HH21 . ARG A 1 24 ? 2.258   16.464  5.217   1.00 0.00 ? 24 ARG A HH21 3  
ATOM 2999  H HH22 . ARG A 1 24 ? 1.825   16.807  6.858   1.00 0.00 ? 24 ARG A HH22 3  
ATOM 3000  N N    . VAL A 1 25 ? 4.332   7.750   3.701   1.00 0.00 ? 25 VAL A N    3  
ATOM 3001  C CA   . VAL A 1 25 ? 5.187   6.926   2.855   1.00 0.00 ? 25 VAL A CA   3  
ATOM 3002  C C    . VAL A 1 25 ? 4.934   7.206   1.378   1.00 0.00 ? 25 VAL A C    3  
ATOM 3003  O O    . VAL A 1 25 ? 3.791   7.379   0.956   1.00 0.00 ? 25 VAL A O    3  
ATOM 3004  C CB   . VAL A 1 25 ? 4.967   5.426   3.126   1.00 0.00 ? 25 VAL A CB   3  
ATOM 3005  C CG1  . VAL A 1 25 ? 5.408   5.066   4.536   1.00 0.00 ? 25 VAL A CG1  3  
ATOM 3006  C CG2  . VAL A 1 25 ? 3.509   5.052   2.904   1.00 0.00 ? 25 VAL A CG2  3  
ATOM 3007  H H    . VAL A 1 25 ? 3.383   7.525   3.783   1.00 0.00 ? 25 VAL A H    3  
ATOM 3008  H HA   . VAL A 1 25 ? 6.216   7.164   3.086   1.00 0.00 ? 25 VAL A HA   3  
ATOM 3009  H HB   . VAL A 1 25 ? 5.570   4.862   2.430   1.00 0.00 ? 25 VAL A HB   3  
ATOM 3010  H HG11 . VAL A 1 25 ? 4.764   4.293   4.929   1.00 0.00 ? 25 VAL A HG11 3  
ATOM 3011  H HG12 . VAL A 1 25 ? 5.346   5.941   5.167   1.00 0.00 ? 25 VAL A HG12 3  
ATOM 3012  H HG13 . VAL A 1 25 ? 6.426   4.710   4.515   1.00 0.00 ? 25 VAL A HG13 3  
ATOM 3013  H HG21 . VAL A 1 25 ? 3.392   3.982   2.998   1.00 0.00 ? 25 VAL A HG21 3  
ATOM 3014  H HG22 . VAL A 1 25 ? 3.205   5.361   1.914   1.00 0.00 ? 25 VAL A HG22 3  
ATOM 3015  H HG23 . VAL A 1 25 ? 2.894   5.547   3.640   1.00 0.00 ? 25 VAL A HG23 3  
ATOM 3016  N N    . TRP A 1 26 ? 6.008   7.249   0.596   1.00 0.00 ? 26 TRP A N    3  
ATOM 3017  C CA   . TRP A 1 26 ? 5.900   7.508   -0.835  1.00 0.00 ? 26 TRP A CA   3  
ATOM 3018  C C    . TRP A 1 26 ? 5.452   6.256   -1.583  1.00 0.00 ? 26 TRP A C    3  
ATOM 3019  O O    . TRP A 1 26 ? 6.144   5.238   -1.580  1.00 0.00 ? 26 TRP A O    3  
ATOM 3020  C CB   . TRP A 1 26 ? 7.242   7.993   -1.389  1.00 0.00 ? 26 TRP A CB   3  
ATOM 3021  C CG   . TRP A 1 26 ? 7.421   9.478   -1.293  1.00 0.00 ? 26 TRP A CG   3  
ATOM 3022  C CD1  . TRP A 1 26 ? 7.482   10.365  -2.330  1.00 0.00 ? 26 TRP A CD1  3  
ATOM 3023  C CD2  . TRP A 1 26 ? 7.565   10.249  -0.096  1.00 0.00 ? 26 TRP A CD2  3  
ATOM 3024  N NE1  . TRP A 1 26 ? 7.654   11.641  -1.850  1.00 0.00 ? 26 TRP A NE1  3  
ATOM 3025  C CE2  . TRP A 1 26 ? 7.708   11.595  -0.481  1.00 0.00 ? 26 TRP A CE2  3  
ATOM 3026  C CE3  . TRP A 1 26 ? 7.586   9.932   1.266   1.00 0.00 ? 26 TRP A CE3  3  
ATOM 3027  C CZ2  . TRP A 1 26 ? 7.870   12.622  0.446   1.00 0.00 ? 26 TRP A CZ2  3  
ATOM 3028  C CZ3  . TRP A 1 26 ? 7.746   10.953  2.184   1.00 0.00 ? 26 TRP A CZ3  3  
ATOM 3029  C CH2  . TRP A 1 26 ? 7.885   12.284  1.771   1.00 0.00 ? 26 TRP A CH2  3  
ATOM 3030  H H    . TRP A 1 26 ? 6.892   7.102   0.990   1.00 0.00 ? 26 TRP A H    3  
ATOM 3031  H HA   . TRP A 1 26 ? 5.162   8.281   -0.978  1.00 0.00 ? 26 TRP A HA   3  
ATOM 3032  H HB2  . TRP A 1 26 ? 8.042   7.525   -0.837  1.00 0.00 ? 26 TRP A HB2  3  
ATOM 3033  H HB3  . TRP A 1 26 ? 7.316   7.714   -2.430  1.00 0.00 ? 26 TRP A HB3  3  
ATOM 3034  H HD1  . TRP A 1 26 ? 7.405   10.089  -3.371  1.00 0.00 ? 26 TRP A HD1  3  
ATOM 3035  H HE1  . TRP A 1 26 ? 7.726   12.450  -2.397  1.00 0.00 ? 26 TRP A HE1  3  
ATOM 3036  H HE3  . TRP A 1 26 ? 7.479   8.913   1.603   1.00 0.00 ? 26 TRP A HE3  3  
ATOM 3037  H HZ2  . TRP A 1 26 ? 7.977   13.654  0.143   1.00 0.00 ? 26 TRP A HZ2  3  
ATOM 3038  H HZ3  . TRP A 1 26 ? 7.764   10.727  3.240   1.00 0.00 ? 26 TRP A HZ3  3  
ATOM 3039  H HH2  . TRP A 1 26 ? 8.009   13.048  2.524   1.00 0.00 ? 26 TRP A HH2  3  
ATOM 3040  N N    . VAL A 1 27 ? 4.289   6.339   -2.221  1.00 0.00 ? 27 VAL A N    3  
ATOM 3041  C CA   . VAL A 1 27 ? 3.748   5.213   -2.972  1.00 0.00 ? 27 VAL A CA   3  
ATOM 3042  C C    . VAL A 1 27 ? 4.372   5.127   -4.360  1.00 0.00 ? 27 VAL A C    3  
ATOM 3043  O O    . VAL A 1 27 ? 4.051   5.919   -5.246  1.00 0.00 ? 27 VAL A O    3  
ATOM 3044  C CB   . VAL A 1 27 ? 2.218   5.317   -3.116  1.00 0.00 ? 27 VAL A CB   3  
ATOM 3045  C CG1  . VAL A 1 27 ? 1.650   4.043   -3.722  1.00 0.00 ? 27 VAL A CG1  3  
ATOM 3046  C CG2  . VAL A 1 27 ? 1.574   5.608   -1.768  1.00 0.00 ? 27 VAL A CG2  3  
ATOM 3047  H H    . VAL A 1 27 ? 3.782   7.178   -2.185  1.00 0.00 ? 27 VAL A H    3  
ATOM 3048  H HA   . VAL A 1 27 ? 3.977   4.308   -2.428  1.00 0.00 ? 27 VAL A HA   3  
ATOM 3049  H HB   . VAL A 1 27 ? 1.994   6.137   -3.782  1.00 0.00 ? 27 VAL A HB   3  
ATOM 3050  H HG11 . VAL A 1 27 ? 2.312   3.217   -3.509  1.00 0.00 ? 27 VAL A HG11 3  
ATOM 3051  H HG12 . VAL A 1 27 ? 1.556   4.164   -4.791  1.00 0.00 ? 27 VAL A HG12 3  
ATOM 3052  H HG13 . VAL A 1 27 ? 0.678   3.844   -3.297  1.00 0.00 ? 27 VAL A HG13 3  
ATOM 3053  H HG21 . VAL A 1 27 ? 0.615   5.113   -1.713  1.00 0.00 ? 27 VAL A HG21 3  
ATOM 3054  H HG22 . VAL A 1 27 ? 1.435   6.674   -1.659  1.00 0.00 ? 27 VAL A HG22 3  
ATOM 3055  H HG23 . VAL A 1 27 ? 2.213   5.244   -0.977  1.00 0.00 ? 27 VAL A HG23 3  
ATOM 3056  N N    . ASN A 1 28 ? 5.264   4.159   -4.543  1.00 0.00 ? 28 ASN A N    3  
ATOM 3057  C CA   . ASN A 1 28 ? 5.935   3.969   -5.824  1.00 0.00 ? 28 ASN A CA   3  
ATOM 3058  C C    . ASN A 1 28 ? 6.718   5.216   -6.221  1.00 0.00 ? 28 ASN A C    3  
ATOM 3059  O O    . ASN A 1 28 ? 6.827   5.543   -7.403  1.00 0.00 ? 28 ASN A O    3  
ATOM 3060  C CB   . ASN A 1 28 ? 4.913   3.627   -6.911  1.00 0.00 ? 28 ASN A CB   3  
ATOM 3061  C CG   . ASN A 1 28 ? 4.440   2.189   -6.827  1.00 0.00 ? 28 ASN A CG   3  
ATOM 3062  O OD1  . ASN A 1 28 ? 3.559   1.859   -6.034  1.00 0.00 ? 28 ASN A OD1  3  
ATOM 3063  N ND2  . ASN A 1 28 ? 5.026   1.325   -7.648  1.00 0.00 ? 28 ASN A ND2  3  
ATOM 3064  H H    . ASN A 1 28 ? 5.478   3.559   -3.798  1.00 0.00 ? 28 ASN A H    3  
ATOM 3065  H HA   . ASN A 1 28 ? 6.624   3.145   -5.719  1.00 0.00 ? 28 ASN A HA   3  
ATOM 3066  H HB2  . ASN A 1 28 ? 4.056   4.275   -6.807  1.00 0.00 ? 28 ASN A HB2  3  
ATOM 3067  H HB3  . ASN A 1 28 ? 5.363   3.783   -7.881  1.00 0.00 ? 28 ASN A HB3  3  
ATOM 3068  H HD21 . ASN A 1 28 ? 5.721   1.658   -8.253  1.00 0.00 ? 28 ASN A HD21 3  
ATOM 3069  H HD22 . ASN A 1 28 ? 4.739   0.388   -7.616  1.00 0.00 ? 28 ASN A HD22 3  
ATOM 3070  N N    . GLY A 1 29 ? 7.261   5.909   -5.226  1.00 0.00 ? 29 GLY A N    3  
ATOM 3071  C CA   . GLY A 1 29 ? 8.026   7.113   -5.492  1.00 0.00 ? 29 GLY A CA   3  
ATOM 3072  C C    . GLY A 1 29 ? 7.213   8.172   -6.210  1.00 0.00 ? 29 GLY A C    3  
ATOM 3073  O O    . GLY A 1 29 ? 7.764   8.998   -6.938  1.00 0.00 ? 29 GLY A O    3  
ATOM 3074  H H    . GLY A 1 29 ? 7.141   5.601   -4.303  1.00 0.00 ? 29 GLY A H    3  
ATOM 3075  H HA2  . GLY A 1 29 ? 8.377   7.518   -4.554  1.00 0.00 ? 29 GLY A HA2  3  
ATOM 3076  H HA3  . GLY A 1 29 ? 8.881   6.855   -6.101  1.00 0.00 ? 29 GLY A HA3  3  
ATOM 3077  N N    . VAL A 1 30 ? 5.901   8.148   -6.006  1.00 0.00 ? 30 VAL A N    3  
ATOM 3078  C CA   . VAL A 1 30 ? 5.011   9.113   -6.639  1.00 0.00 ? 30 VAL A CA   3  
ATOM 3079  C C    . VAL A 1 30 ? 4.659   10.246  -5.681  1.00 0.00 ? 30 VAL A C    3  
ATOM 3080  O O    . VAL A 1 30 ? 4.907   11.417  -5.968  1.00 0.00 ? 30 VAL A O    3  
ATOM 3081  C CB   . VAL A 1 30 ? 3.711   8.446   -7.128  1.00 0.00 ? 30 VAL A CB   3  
ATOM 3082  C CG1  . VAL A 1 30 ? 2.868   9.432   -7.922  1.00 0.00 ? 30 VAL A CG1  3  
ATOM 3083  C CG2  . VAL A 1 30 ? 4.023   7.210   -7.960  1.00 0.00 ? 30 VAL A CG2  3  
ATOM 3084  H H    . VAL A 1 30 ? 5.521   7.465   -5.414  1.00 0.00 ? 30 VAL A H    3  
ATOM 3085  H HA   . VAL A 1 30 ? 5.524   9.527   -7.496  1.00 0.00 ? 30 VAL A HA   3  
ATOM 3086  H HB   . VAL A 1 30 ? 3.142   8.137   -6.263  1.00 0.00 ? 30 VAL A HB   3  
ATOM 3087  H HG11 . VAL A 1 30 ? 2.028   8.915   -8.363  1.00 0.00 ? 30 VAL A HG11 3  
ATOM 3088  H HG12 . VAL A 1 30 ? 3.469   9.872   -8.704  1.00 0.00 ? 30 VAL A HG12 3  
ATOM 3089  H HG13 . VAL A 1 30 ? 2.508   10.210  -7.265  1.00 0.00 ? 30 VAL A HG13 3  
ATOM 3090  H HG21 . VAL A 1 30 ? 5.035   6.889   -7.763  1.00 0.00 ? 30 VAL A HG21 3  
ATOM 3091  H HG22 . VAL A 1 30 ? 3.919   7.447   -9.008  1.00 0.00 ? 30 VAL A HG22 3  
ATOM 3092  H HG23 . VAL A 1 30 ? 3.336   6.418   -7.699  1.00 0.00 ? 30 VAL A HG23 3  
ATOM 3093  N N    . LYS A 1 31 ? 4.079   9.888   -4.539  1.00 0.00 ? 31 LYS A N    3  
ATOM 3094  C CA   . LYS A 1 31 ? 3.692   10.874  -3.536  1.00 0.00 ? 31 LYS A CA   3  
ATOM 3095  C C    . LYS A 1 31 ? 3.519   10.220  -2.168  1.00 0.00 ? 31 LYS A C    3  
ATOM 3096  O O    . LYS A 1 31 ? 3.129   9.056   -2.073  1.00 0.00 ? 31 LYS A O    3  
ATOM 3097  C CB   . LYS A 1 31 ? 2.395   11.571  -3.950  1.00 0.00 ? 31 LYS A CB   3  
ATOM 3098  C CG   . LYS A 1 31 ? 2.581   12.600  -5.053  1.00 0.00 ? 31 LYS A CG   3  
ATOM 3099  C CD   . LYS A 1 31 ? 1.623   13.769  -4.892  1.00 0.00 ? 31 LYS A CD   3  
ATOM 3100  C CE   . LYS A 1 31 ? 1.199   14.331  -6.240  1.00 0.00 ? 31 LYS A CE   3  
ATOM 3101  N NZ   . LYS A 1 31 ? -0.202  14.835  -6.216  1.00 0.00 ? 31 LYS A NZ   3  
ATOM 3102  H H    . LYS A 1 31 ? 3.907   8.939   -4.367  1.00 0.00 ? 31 LYS A H    3  
ATOM 3103  H HA   . LYS A 1 31 ? 4.482   11.609  -3.474  1.00 0.00 ? 31 LYS A HA   3  
ATOM 3104  H HB2  . LYS A 1 31 ? 1.695   10.825  -4.298  1.00 0.00 ? 31 LYS A HB2  3  
ATOM 3105  H HB3  . LYS A 1 31 ? 1.978   12.070  -3.088  1.00 0.00 ? 31 LYS A HB3  3  
ATOM 3106  H HG2  . LYS A 1 31 ? 3.595   12.972  -5.018  1.00 0.00 ? 31 LYS A HG2  3  
ATOM 3107  H HG3  . LYS A 1 31 ? 2.402   12.127  -6.008  1.00 0.00 ? 31 LYS A HG3  3  
ATOM 3108  H HD2  . LYS A 1 31 ? 0.745   13.432  -4.363  1.00 0.00 ? 31 LYS A HD2  3  
ATOM 3109  H HD3  . LYS A 1 31 ? 2.112   14.547  -4.324  1.00 0.00 ? 31 LYS A HD3  3  
ATOM 3110  H HE2  . LYS A 1 31 ? 1.861   15.145  -6.500  1.00 0.00 ? 31 LYS A HE2  3  
ATOM 3111  H HE3  . LYS A 1 31 ? 1.280   13.551  -6.982  1.00 0.00 ? 31 LYS A HE3  3  
ATOM 3112  H HZ1  . LYS A 1 31 ? -0.673  14.622  -7.118  1.00 0.00 ? 31 LYS A HZ1  3  
ATOM 3113  H HZ2  . LYS A 1 31 ? -0.209  15.864  -6.068  1.00 0.00 ? 31 LYS A HZ2  3  
ATOM 3114  H HZ3  . LYS A 1 31 ? -0.731  14.382  -5.444  1.00 0.00 ? 31 LYS A HZ3  3  
ATOM 3115  N N    . PRO A 1 32 ? 3.806   10.963  -1.085  1.00 0.00 ? 32 PRO A N    3  
ATOM 3116  C CA   . PRO A 1 32 ? 3.679   10.447  0.281   1.00 0.00 ? 32 PRO A CA   3  
ATOM 3117  C C    . PRO A 1 32 ? 2.224   10.261  0.697   1.00 0.00 ? 32 PRO A C    3  
ATOM 3118  O O    . PRO A 1 32 ? 1.340   10.988  0.243   1.00 0.00 ? 32 PRO A O    3  
ATOM 3119  C CB   . PRO A 1 32 ? 4.344   11.531  1.132   1.00 0.00 ? 32 PRO A CB   3  
ATOM 3120  C CG   . PRO A 1 32 ? 4.199   12.780  0.334   1.00 0.00 ? 32 PRO A CG   3  
ATOM 3121  C CD   . PRO A 1 32 ? 4.277   12.360  -1.109  1.00 0.00 ? 32 PRO A CD   3  
ATOM 3122  H HA   . PRO A 1 32 ? 4.210   9.514   0.403   1.00 0.00 ? 32 PRO A HA   3  
ATOM 3123  H HB2  . PRO A 1 32 ? 3.835   11.608  2.084   1.00 0.00 ? 32 PRO A HB2  3  
ATOM 3124  H HB3  . PRO A 1 32 ? 5.384   11.282  1.290   1.00 0.00 ? 32 PRO A HB3  3  
ATOM 3125  H HG2  . PRO A 1 32 ? 3.243   13.238  0.539   1.00 0.00 ? 32 PRO A HG2  3  
ATOM 3126  H HG3  . PRO A 1 32 ? 5.002   13.462  0.570   1.00 0.00 ? 32 PRO A HG3  3  
ATOM 3127  H HD2  . PRO A 1 32 ? 3.629   12.976  -1.716  1.00 0.00 ? 32 PRO A HD2  3  
ATOM 3128  H HD3  . PRO A 1 32 ? 5.295   12.418  -1.464  1.00 0.00 ? 32 PRO A HD3  3  
ATOM 3129  N N    . GLY A 1 33 ? 1.983   9.283   1.564   1.00 0.00 ? 33 GLY A N    3  
ATOM 3130  C CA   . GLY A 1 33 ? 0.632   9.019   2.027   1.00 0.00 ? 33 GLY A CA   3  
ATOM 3131  C C    . GLY A 1 33 ? 0.601   8.464   3.438   1.00 0.00 ? 33 GLY A C    3  
ATOM 3132  O O    . GLY A 1 33 ? 1.530   7.776   3.862   1.00 0.00 ? 33 GLY A O    3  
ATOM 3133  H H    . GLY A 1 33 ? 2.726   8.736   1.892   1.00 0.00 ? 33 GLY A H    3  
ATOM 3134  H HA2  . GLY A 1 33 ? 0.069   9.940   2.002   1.00 0.00 ? 33 GLY A HA2  3  
ATOM 3135  H HA3  . GLY A 1 33 ? 0.168   8.307   1.361   1.00 0.00 ? 33 GLY A HA3  3  
ATOM 3136  N N    . VAL A 1 34 ? -0.469  8.763   4.165   1.00 0.00 ? 34 VAL A N    3  
ATOM 3137  C CA   . VAL A 1 34 ? -0.619  8.290   5.537   1.00 0.00 ? 34 VAL A CA   3  
ATOM 3138  C C    . VAL A 1 34 ? -0.962  6.804   5.572   1.00 0.00 ? 34 VAL A C    3  
ATOM 3139  O O    . VAL A 1 34 ? -1.957  6.373   4.989   1.00 0.00 ? 34 VAL A O    3  
ATOM 3140  C CB   . VAL A 1 34 ? -1.711  9.075   6.286   1.00 0.00 ? 34 VAL A CB   3  
ATOM 3141  C CG1  . VAL A 1 34 ? -1.715  8.709   7.762   1.00 0.00 ? 34 VAL A CG1  3  
ATOM 3142  C CG2  . VAL A 1 34 ? -1.516  10.572  6.101   1.00 0.00 ? 34 VAL A CG2  3  
ATOM 3143  H H    . VAL A 1 34 ? -1.177  9.315   3.771   1.00 0.00 ? 34 VAL A H    3  
ATOM 3144  H HA   . VAL A 1 34 ? 0.321   8.444   6.046   1.00 0.00 ? 34 VAL A HA   3  
ATOM 3145  H HB   . VAL A 1 34 ? -2.671  8.804   5.869   1.00 0.00 ? 34 VAL A HB   3  
ATOM 3146  H HG11 . VAL A 1 34 ? -1.240  7.749   7.897   1.00 0.00 ? 34 VAL A HG11 3  
ATOM 3147  H HG12 . VAL A 1 34 ? -2.734  8.659   8.118   1.00 0.00 ? 34 VAL A HG12 3  
ATOM 3148  H HG13 . VAL A 1 34 ? -1.175  9.459   8.320   1.00 0.00 ? 34 VAL A HG13 3  
ATOM 3149  H HG21 . VAL A 1 34 ? -2.120  10.915  5.274   1.00 0.00 ? 34 VAL A HG21 3  
ATOM 3150  H HG22 . VAL A 1 34 ? -0.475  10.777  5.896   1.00 0.00 ? 34 VAL A HG22 3  
ATOM 3151  H HG23 . VAL A 1 34 ? -1.814  11.088  7.002   1.00 0.00 ? 34 VAL A HG23 3  
ATOM 3152  N N    . VAL A 1 35 ? -0.132  6.027   6.259   1.00 0.00 ? 35 VAL A N    3  
ATOM 3153  C CA   . VAL A 1 35 ? -0.348  4.589   6.370   1.00 0.00 ? 35 VAL A CA   3  
ATOM 3154  C C    . VAL A 1 35 ? -1.419  4.273   7.409   1.00 0.00 ? 35 VAL A C    3  
ATOM 3155  O O    . VAL A 1 35 ? -1.328  4.703   8.559   1.00 0.00 ? 35 VAL A O    3  
ATOM 3156  C CB   . VAL A 1 35 ? 0.951   3.854   6.750   1.00 0.00 ? 35 VAL A CB   3  
ATOM 3157  C CG1  . VAL A 1 35 ? 0.757   2.348   6.663   1.00 0.00 ? 35 VAL A CG1  3  
ATOM 3158  C CG2  . VAL A 1 35 ? 2.099   4.304   5.860   1.00 0.00 ? 35 VAL A CG2  3  
ATOM 3159  H H    . VAL A 1 35 ? 0.644   6.430   6.702   1.00 0.00 ? 35 VAL A H    3  
ATOM 3160  H HA   . VAL A 1 35 ? -0.675  4.226   5.408   1.00 0.00 ? 35 VAL A HA   3  
ATOM 3161  H HB   . VAL A 1 35 ? 1.196   4.104   7.772   1.00 0.00 ? 35 VAL A HB   3  
ATOM 3162  H HG11 . VAL A 1 35 ? -0.257  2.099   6.937   1.00 0.00 ? 35 VAL A HG11 3  
ATOM 3163  H HG12 . VAL A 1 35 ? 1.443   1.857   7.339   1.00 0.00 ? 35 VAL A HG12 3  
ATOM 3164  H HG13 . VAL A 1 35 ? 0.949   2.018   5.653   1.00 0.00 ? 35 VAL A HG13 3  
ATOM 3165  H HG21 . VAL A 1 35 ? 2.428   5.285   6.166   1.00 0.00 ? 35 VAL A HG21 3  
ATOM 3166  H HG22 . VAL A 1 35 ? 1.766   4.339   4.833   1.00 0.00 ? 35 VAL A HG22 3  
ATOM 3167  H HG23 . VAL A 1 35 ? 2.918   3.606   5.948   1.00 0.00 ? 35 VAL A HG23 3  
ATOM 3168  N N    . GLN A 1 36 ? -2.434  3.521   6.995   1.00 0.00 ? 36 GLN A N    3  
ATOM 3169  C CA   . GLN A 1 36 ? -3.524  3.149   7.890   1.00 0.00 ? 36 GLN A CA   3  
ATOM 3170  C C    . GLN A 1 36 ? -3.582  1.636   8.075   1.00 0.00 ? 36 GLN A C    3  
ATOM 3171  O O    . GLN A 1 36 ? -3.818  1.145   9.179   1.00 0.00 ? 36 GLN A O    3  
ATOM 3172  C CB   . GLN A 1 36 ? -4.859  3.661   7.343   1.00 0.00 ? 36 GLN A CB   3  
ATOM 3173  C CG   . GLN A 1 36 ? -5.295  4.986   7.948   1.00 0.00 ? 36 GLN A CG   3  
ATOM 3174  C CD   . GLN A 1 36 ? -5.648  4.866   9.418   1.00 0.00 ? 36 GLN A CD   3  
ATOM 3175  O OE1  . GLN A 1 36 ? -6.789  4.573   9.773   1.00 0.00 ? 36 GLN A OE1  3  
ATOM 3176  N NE2  . GLN A 1 36 ? -4.665  5.093   10.282  1.00 0.00 ? 36 GLN A NE2  3  
ATOM 3177  H H    . GLN A 1 36 ? -2.450  3.210   6.066   1.00 0.00 ? 36 GLN A H    3  
ATOM 3178  H HA   . GLN A 1 36 ? -3.337  3.610   8.848   1.00 0.00 ? 36 GLN A HA   3  
ATOM 3179  H HB2  . GLN A 1 36 ? -4.771  3.790   6.274   1.00 0.00 ? 36 GLN A HB2  3  
ATOM 3180  H HB3  . GLN A 1 36 ? -5.624  2.927   7.546   1.00 0.00 ? 36 GLN A HB3  3  
ATOM 3181  H HG2  . GLN A 1 36 ? -4.490  5.697   7.844   1.00 0.00 ? 36 GLN A HG2  3  
ATOM 3182  H HG3  . GLN A 1 36 ? -6.162  5.342   7.413   1.00 0.00 ? 36 GLN A HG3  3  
ATOM 3183  H HE21 . GLN A 1 36 ? -3.780  5.321   9.928   1.00 0.00 ? 36 GLN A HE21 3  
ATOM 3184  H HE22 . GLN A 1 36 ? -4.864  5.023   11.239  1.00 0.00 ? 36 GLN A HE22 3  
ATOM 3185  N N    . TYR A 1 37 ? -3.367  0.903   6.987   1.00 0.00 ? 37 TYR A N    3  
ATOM 3186  C CA   . TYR A 1 37 ? -3.396  -0.555  7.031   1.00 0.00 ? 37 TYR A CA   3  
ATOM 3187  C C    . TYR A 1 37 ? -2.019  -1.136  6.726   1.00 0.00 ? 37 TYR A C    3  
ATOM 3188  O O    . TYR A 1 37 ? -1.281  -0.606  5.895   1.00 0.00 ? 37 TYR A O    3  
ATOM 3189  C CB   . TYR A 1 37 ? -4.424  -1.094  6.033   1.00 0.00 ? 37 TYR A CB   3  
ATOM 3190  C CG   . TYR A 1 37 ? -5.194  -2.290  6.544   1.00 0.00 ? 37 TYR A CG   3  
ATOM 3191  C CD1  . TYR A 1 37 ? -6.319  -2.126  7.344   1.00 0.00 ? 37 TYR A CD1  3  
ATOM 3192  C CD2  . TYR A 1 37 ? -4.798  -3.584  6.229   1.00 0.00 ? 37 TYR A CD2  3  
ATOM 3193  C CE1  . TYR A 1 37 ? -7.026  -3.217  7.814   1.00 0.00 ? 37 TYR A CE1  3  
ATOM 3194  C CE2  . TYR A 1 37 ? -5.500  -4.680  6.694   1.00 0.00 ? 37 TYR A CE2  3  
ATOM 3195  C CZ   . TYR A 1 37 ? -6.613  -4.490  7.486   1.00 0.00 ? 37 TYR A CZ   3  
ATOM 3196  O OH   . TYR A 1 37 ? -7.314  -5.578  7.952   1.00 0.00 ? 37 TYR A OH   3  
ATOM 3197  H H    . TYR A 1 37 ? -3.185  1.352   6.136   1.00 0.00 ? 37 TYR A H    3  
ATOM 3198  H HA   . TYR A 1 37 ? -3.686  -0.851  8.027   1.00 0.00 ? 37 TYR A HA   3  
ATOM 3199  H HB2  . TYR A 1 37 ? -5.135  -0.316  5.804   1.00 0.00 ? 37 TYR A HB2  3  
ATOM 3200  H HB3  . TYR A 1 37 ? -3.914  -1.389  5.127   1.00 0.00 ? 37 TYR A HB3  3  
ATOM 3201  H HD1  . TYR A 1 37 ? -6.640  -1.127  7.598   1.00 0.00 ? 37 TYR A HD1  3  
ATOM 3202  H HD2  . TYR A 1 37 ? -3.925  -3.728  5.609   1.00 0.00 ? 37 TYR A HD2  3  
ATOM 3203  H HE1  . TYR A 1 37 ? -7.898  -3.068  8.433   1.00 0.00 ? 37 TYR A HE1  3  
ATOM 3204  H HE2  . TYR A 1 37 ? -5.175  -5.677  6.437   1.00 0.00 ? 37 TYR A HE2  3  
ATOM 3205  H HH   . TYR A 1 37 ? -7.403  -5.519  8.906   1.00 0.00 ? 37 TYR A HH   3  
ATOM 3206  N N    . LEU A 1 38 ? -1.681  -2.228  7.402   1.00 0.00 ? 38 LEU A N    3  
ATOM 3207  C CA   . LEU A 1 38 ? -0.393  -2.883  7.204   1.00 0.00 ? 38 LEU A CA   3  
ATOM 3208  C C    . LEU A 1 38 ? -0.483  -4.371  7.529   1.00 0.00 ? 38 LEU A C    3  
ATOM 3209  O O    . LEU A 1 38 ? -0.779  -4.752  8.661   1.00 0.00 ? 38 LEU A O    3  
ATOM 3210  C CB   . LEU A 1 38 ? 0.678   -2.223  8.076   1.00 0.00 ? 38 LEU A CB   3  
ATOM 3211  C CG   . LEU A 1 38 ? 1.045   -0.792  7.679   1.00 0.00 ? 38 LEU A CG   3  
ATOM 3212  C CD1  . LEU A 1 38 ? 1.914   -0.149  8.748   1.00 0.00 ? 38 LEU A CD1  3  
ATOM 3213  C CD2  . LEU A 1 38 ? 1.755   -0.780  6.333   1.00 0.00 ? 38 LEU A CD2  3  
ATOM 3214  H H    . LEU A 1 38 ? -2.313  -2.604  8.051   1.00 0.00 ? 38 LEU A H    3  
ATOM 3215  H HA   . LEU A 1 38 ? -0.120  -2.768  6.167   1.00 0.00 ? 38 LEU A HA   3  
ATOM 3216  H HB2  . LEU A 1 38 ? 0.323   -2.211  9.098   1.00 0.00 ? 38 LEU A HB2  3  
ATOM 3217  H HB3  . LEU A 1 38 ? 1.571   -2.826  8.031   1.00 0.00 ? 38 LEU A HB3  3  
ATOM 3218  H HG   . LEU A 1 38 ? 0.142   -0.208  7.587   1.00 0.00 ? 38 LEU A HG   3  
ATOM 3219  H HD11 . LEU A 1 38 ? 2.623   0.519   8.282   1.00 0.00 ? 38 LEU A HD11 3  
ATOM 3220  H HD12 . LEU A 1 38 ? 2.446   -0.917  9.290   1.00 0.00 ? 38 LEU A HD12 3  
ATOM 3221  H HD13 . LEU A 1 38 ? 1.290   0.408   9.432   1.00 0.00 ? 38 LEU A HD13 3  
ATOM 3222  H HD21 . LEU A 1 38 ? 1.435   0.081   5.765   1.00 0.00 ? 38 LEU A HD21 3  
ATOM 3223  H HD22 . LEU A 1 38 ? 1.512   -1.681  5.789   1.00 0.00 ? 38 LEU A HD22 3  
ATOM 3224  H HD23 . LEU A 1 38 ? 2.822   -0.731  6.490   1.00 0.00 ? 38 LEU A HD23 3  
ATOM 3225  N N    . GLY A 1 39 ? -0.225  -5.205  6.528   1.00 0.00 ? 39 GLY A N    3  
ATOM 3226  C CA   . GLY A 1 39 ? -0.282  -6.641  6.726   1.00 0.00 ? 39 GLY A CA   3  
ATOM 3227  C C    . GLY A 1 39 ? -0.699  -7.385  5.472   1.00 0.00 ? 39 GLY A C    3  
ATOM 3228  O O    . GLY A 1 39 ? 0.142   -7.749  4.650   1.00 0.00 ? 39 GLY A O    3  
ATOM 3229  H H    . GLY A 1 39 ? 0.006   -4.844  5.646   1.00 0.00 ? 39 GLY A H    3  
ATOM 3230  H HA2  . GLY A 1 39 ? 0.694   -6.991  7.030   1.00 0.00 ? 39 GLY A HA2  3  
ATOM 3231  H HA3  . GLY A 1 39 ? -0.990  -6.857  7.511   1.00 0.00 ? 39 GLY A HA3  3  
ATOM 3232  N N    . GLU A 1 40 ? -2.000  -7.610  5.326   1.00 0.00 ? 40 GLU A N    3  
ATOM 3233  C CA   . GLU A 1 40 ? -2.528  -8.315  4.164   1.00 0.00 ? 40 GLU A CA   3  
ATOM 3234  C C    . GLU A 1 40 ? -3.947  -7.854  3.845   1.00 0.00 ? 40 GLU A C    3  
ATOM 3235  O O    . GLU A 1 40 ? -4.572  -7.147  4.635   1.00 0.00 ? 40 GLU A O    3  
ATOM 3236  C CB   . GLU A 1 40 ? -2.513  -9.826  4.407   1.00 0.00 ? 40 GLU A CB   3  
ATOM 3237  C CG   . GLU A 1 40 ? -1.162  -10.471 4.144   1.00 0.00 ? 40 GLU A CG   3  
ATOM 3238  C CD   . GLU A 1 40 ? -1.275  -11.947 3.815   1.00 0.00 ? 40 GLU A CD   3  
ATOM 3239  O OE1  . GLU A 1 40 ? -1.257  -12.768 4.757   1.00 0.00 ? 40 GLU A OE1  3  
ATOM 3240  O OE2  . GLU A 1 40 ? -1.383  -12.282 2.618   1.00 0.00 ? 40 GLU A OE2  3  
ATOM 3241  H H    . GLU A 1 40 ? -2.620  -7.296  6.016   1.00 0.00 ? 40 GLU A H    3  
ATOM 3242  H HA   . GLU A 1 40 ? -1.892  -8.090  3.322   1.00 0.00 ? 40 GLU A HA   3  
ATOM 3243  H HB2  . GLU A 1 40 ? -2.785  -10.016 5.434   1.00 0.00 ? 40 GLU A HB2  3  
ATOM 3244  H HB3  . GLU A 1 40 ? -3.241  -10.291 3.759   1.00 0.00 ? 40 GLU A HB3  3  
ATOM 3245  H HG2  . GLU A 1 40 ? -0.693  -9.968  3.312   1.00 0.00 ? 40 GLU A HG2  3  
ATOM 3246  H HG3  . GLU A 1 40 ? -0.547  -10.359 5.025   1.00 0.00 ? 40 GLU A HG3  3  
ATOM 3247  N N    . THR A 1 41 ? -4.448  -8.259  2.682   1.00 0.00 ? 41 THR A N    3  
ATOM 3248  C CA   . THR A 1 41 ? -5.793  -7.888  2.259   1.00 0.00 ? 41 THR A CA   3  
ATOM 3249  C C    . THR A 1 41 ? -6.683  -9.120  2.134   1.00 0.00 ? 41 THR A C    3  
ATOM 3250  O O    . THR A 1 41 ? -6.253  -10.240 2.405   1.00 0.00 ? 41 THR A O    3  
ATOM 3251  C CB   . THR A 1 41 ? -5.743  -7.144  0.924   1.00 0.00 ? 41 THR A CB   3  
ATOM 3252  O OG1  . THR A 1 41 ? -4.974  -7.864  -0.023  1.00 0.00 ? 41 THR A OG1  3  
ATOM 3253  C CG2  . THR A 1 41 ? -5.151  -5.755  1.036   1.00 0.00 ? 41 THR A CG2  3  
ATOM 3254  H H    . THR A 1 41 ? -3.901  -8.822  2.095   1.00 0.00 ? 41 THR A H    3  
ATOM 3255  H HA   . THR A 1 41 ? -6.208  -7.233  3.011   1.00 0.00 ? 41 THR A HA   3  
ATOM 3256  H HB   . THR A 1 41 ? -6.748  -7.044  0.541   1.00 0.00 ? 41 THR A HB   3  
ATOM 3257  H HG1  . THR A 1 41 ? -5.323  -8.753  -0.108  1.00 0.00 ? 41 THR A HG1  3  
ATOM 3258  H HG21 . THR A 1 41 ? -4.434  -5.732  1.844   1.00 0.00 ? 41 THR A HG21 3  
ATOM 3259  H HG22 . THR A 1 41 ? -5.938  -5.043  1.233   1.00 0.00 ? 41 THR A HG22 3  
ATOM 3260  H HG23 . THR A 1 41 ? -4.658  -5.498  0.110   1.00 0.00 ? 41 THR A HG23 3  
ATOM 3261  N N    . GLN A 1 42 ? -7.929  -8.905  1.721   1.00 0.00 ? 42 GLN A N    3  
ATOM 3262  C CA   . GLN A 1 42 ? -8.880  -9.998  1.559   1.00 0.00 ? 42 GLN A CA   3  
ATOM 3263  C C    . GLN A 1 42 ? -9.182  -10.243 0.085   1.00 0.00 ? 42 GLN A C    3  
ATOM 3264  O O    . GLN A 1 42 ? -9.409  -11.379 -0.332  1.00 0.00 ? 42 GLN A O    3  
ATOM 3265  C CB   . GLN A 1 42 ? -10.176 -9.689  2.313   1.00 0.00 ? 42 GLN A CB   3  
ATOM 3266  C CG   . GLN A 1 42 ? -10.173 -10.175 3.752   1.00 0.00 ? 42 GLN A CG   3  
ATOM 3267  C CD   . GLN A 1 42 ? -10.573 -11.631 3.878   1.00 0.00 ? 42 GLN A CD   3  
ATOM 3268  O OE1  . GLN A 1 42 ? -11.493 -12.094 3.203   1.00 0.00 ? 42 GLN A OE1  3  
ATOM 3269  N NE2  . GLN A 1 42 ? -9.883  -12.363 4.744   1.00 0.00 ? 42 GLN A NE2  3  
ATOM 3270  H H    . GLN A 1 42 ? -8.214  -7.989  1.520   1.00 0.00 ? 42 GLN A H    3  
ATOM 3271  H HA   . GLN A 1 42 ? -8.436  -10.888 1.977   1.00 0.00 ? 42 GLN A HA   3  
ATOM 3272  H HB2  . GLN A 1 42 ? -10.331 -8.620  2.316   1.00 0.00 ? 42 GLN A HB2  3  
ATOM 3273  H HB3  . GLN A 1 42 ? -10.999 -10.161 1.797   1.00 0.00 ? 42 GLN A HB3  3  
ATOM 3274  H HG2  . GLN A 1 42 ? -9.179  -10.054 4.157   1.00 0.00 ? 42 GLN A HG2  3  
ATOM 3275  H HG3  . GLN A 1 42 ? -10.867 -9.575  4.323   1.00 0.00 ? 42 GLN A HG3  3  
ATOM 3276  H HE21 . GLN A 1 42 ? -9.164  -11.927 5.248   1.00 0.00 ? 42 GLN A HE21 3  
ATOM 3277  H HE22 . GLN A 1 42 ? -10.121 -13.308 4.845   1.00 0.00 ? 42 GLN A HE22 3  
ATOM 3278  N N    . PHE A 1 43 ? -9.185  -9.171  -0.701  1.00 0.00 ? 43 PHE A N    3  
ATOM 3279  C CA   . PHE A 1 43 ? -9.458  -9.272  -2.130  1.00 0.00 ? 43 PHE A CA   3  
ATOM 3280  C C    . PHE A 1 43 ? -8.419  -10.146 -2.824  1.00 0.00 ? 43 PHE A C    3  
ATOM 3281  O O    . PHE A 1 43 ? -8.719  -10.821 -3.808  1.00 0.00 ? 43 PHE A O    3  
ATOM 3282  C CB   . PHE A 1 43 ? -9.479  -7.880  -2.765  1.00 0.00 ? 43 PHE A CB   3  
ATOM 3283  C CG   . PHE A 1 43 ? -8.169  -7.153  -2.659  1.00 0.00 ? 43 PHE A CG   3  
ATOM 3284  C CD1  . PHE A 1 43 ? -7.116  -7.468  -3.504  1.00 0.00 ? 43 PHE A CD1  3  
ATOM 3285  C CD2  . PHE A 1 43 ? -7.991  -6.153  -1.716  1.00 0.00 ? 43 PHE A CD2  3  
ATOM 3286  C CE1  . PHE A 1 43 ? -5.910  -6.800  -3.409  1.00 0.00 ? 43 PHE A CE1  3  
ATOM 3287  C CE2  . PHE A 1 43 ? -6.787  -5.482  -1.617  1.00 0.00 ? 43 PHE A CE2  3  
ATOM 3288  C CZ   . PHE A 1 43 ? -5.745  -5.806  -2.464  1.00 0.00 ? 43 PHE A CZ   3  
ATOM 3289  H H    . PHE A 1 43 ? -8.997  -8.292  -0.310  1.00 0.00 ? 43 PHE A H    3  
ATOM 3290  H HA   . PHE A 1 43 ? -10.431 -9.726  -2.249  1.00 0.00 ? 43 PHE A HA   3  
ATOM 3291  H HB2  . PHE A 1 43 ? -9.722  -7.974  -3.812  1.00 0.00 ? 43 PHE A HB2  3  
ATOM 3292  H HB3  . PHE A 1 43 ? -10.234 -7.280  -2.277  1.00 0.00 ? 43 PHE A HB3  3  
ATOM 3293  H HD1  . PHE A 1 43 ? -7.244  -8.245  -4.243  1.00 0.00 ? 43 PHE A HD1  3  
ATOM 3294  H HD2  . PHE A 1 43 ? -8.804  -5.899  -1.053  1.00 0.00 ? 43 PHE A HD2  3  
ATOM 3295  H HE1  . PHE A 1 43 ? -5.097  -7.056  -4.073  1.00 0.00 ? 43 PHE A HE1  3  
ATOM 3296  H HE2  . PHE A 1 43 ? -6.661  -4.705  -0.877  1.00 0.00 ? 43 PHE A HE2  3  
ATOM 3297  H HZ   . PHE A 1 43 ? -4.803  -5.283  -2.388  1.00 0.00 ? 43 PHE A HZ   3  
ATOM 3298  N N    . ALA A 1 44 ? -7.196  -10.127 -2.304  1.00 0.00 ? 44 ALA A N    3  
ATOM 3299  C CA   . ALA A 1 44 ? -6.112  -10.918 -2.873  1.00 0.00 ? 44 ALA A CA   3  
ATOM 3300  C C    . ALA A 1 44 ? -5.052  -11.234 -1.822  1.00 0.00 ? 44 ALA A C    3  
ATOM 3301  O O    . ALA A 1 44 ? -4.852  -10.468 -0.880  1.00 0.00 ? 44 ALA A O    3  
ATOM 3302  C CB   . ALA A 1 44 ? -5.487  -10.185 -4.051  1.00 0.00 ? 44 ALA A CB   3  
ATOM 3303  H H    . ALA A 1 44 ? -7.018  -9.569  -1.519  1.00 0.00 ? 44 ALA A H    3  
ATOM 3304  H HA   . ALA A 1 44 ? -6.532  -11.845 -3.238  1.00 0.00 ? 44 ALA A HA   3  
ATOM 3305  H HB1  . ALA A 1 44 ? -4.631  -10.739 -4.406  1.00 0.00 ? 44 ALA A HB1  3  
ATOM 3306  H HB2  . ALA A 1 44 ? -5.175  -9.200  -3.738  1.00 0.00 ? 44 ALA A HB2  3  
ATOM 3307  H HB3  . ALA A 1 44 ? -6.214  -10.096 -4.846  1.00 0.00 ? 44 ALA A HB3  3  
ATOM 3308  N N    . PRO A 1 45 ? -4.354  -12.374 -1.971  1.00 0.00 ? 45 PRO A N    3  
ATOM 3309  C CA   . PRO A 1 45 ? -3.311  -12.789 -1.028  1.00 0.00 ? 45 PRO A CA   3  
ATOM 3310  C C    . PRO A 1 45 ? -2.070  -11.907 -1.113  1.00 0.00 ? 45 PRO A C    3  
ATOM 3311  O O    . PRO A 1 45 ? -2.037  -10.937 -1.871  1.00 0.00 ? 45 PRO A O    3  
ATOM 3312  C CB   . PRO A 1 45 ? -2.981  -14.217 -1.467  1.00 0.00 ? 45 PRO A CB   3  
ATOM 3313  C CG   . PRO A 1 45 ? -3.348  -14.264 -2.910  1.00 0.00 ? 45 PRO A CG   3  
ATOM 3314  C CD   . PRO A 1 45 ? -4.529  -13.346 -3.067  1.00 0.00 ? 45 PRO A CD   3  
ATOM 3315  H HA   . PRO A 1 45 ? -3.676  -12.796 -0.011  1.00 0.00 ? 45 PRO A HA   3  
ATOM 3316  H HB2  . PRO A 1 45 ? -1.928  -14.409 -1.319  1.00 0.00 ? 45 PRO A HB2  3  
ATOM 3317  H HB3  . PRO A 1 45 ? -3.565  -14.918 -0.889  1.00 0.00 ? 45 PRO A HB3  3  
ATOM 3318  H HG2  . PRO A 1 45 ? -2.521  -13.917 -3.511  1.00 0.00 ? 45 PRO A HG2  3  
ATOM 3319  H HG3  . PRO A 1 45 ? -3.618  -15.272 -3.188  1.00 0.00 ? 45 PRO A HG3  3  
ATOM 3320  H HD2  . PRO A 1 45 ? -4.499  -12.852 -4.027  1.00 0.00 ? 45 PRO A HD2  3  
ATOM 3321  H HD3  . PRO A 1 45 ? -5.451  -13.894 -2.951  1.00 0.00 ? 45 PRO A HD3  3  
ATOM 3322  N N    . GLY A 1 46 ? -1.051  -12.248 -0.332  1.00 0.00 ? 46 GLY A N    3  
ATOM 3323  C CA   . GLY A 1 46 ? 0.177   -11.477 -0.334  1.00 0.00 ? 46 GLY A CA   3  
ATOM 3324  C C    . GLY A 1 46 ? 0.120   -10.291 0.608   1.00 0.00 ? 46 GLY A C    3  
ATOM 3325  O O    . GLY A 1 46 ? -0.953  -9.917  1.082   1.00 0.00 ? 46 GLY A O    3  
ATOM 3326  H H    . GLY A 1 46 ? -1.134  -13.032 0.251   1.00 0.00 ? 46 GLY A H    3  
ATOM 3327  H HA2  . GLY A 1 46 ? 0.994   -12.119 -0.038  1.00 0.00 ? 46 GLY A HA2  3  
ATOM 3328  H HA3  . GLY A 1 46 ? 0.362   -11.118 -1.336  1.00 0.00 ? 46 GLY A HA3  3  
ATOM 3329  N N    . GLN A 1 47 ? 1.279   -9.698  0.880   1.00 0.00 ? 47 GLN A N    3  
ATOM 3330  C CA   . GLN A 1 47 ? 1.357   -8.547  1.772   1.00 0.00 ? 47 GLN A CA   3  
ATOM 3331  C C    . GLN A 1 47 ? 0.819   -7.293  1.091   1.00 0.00 ? 47 GLN A C    3  
ATOM 3332  O O    . GLN A 1 47 ? 1.064   -7.064  -0.093  1.00 0.00 ? 47 GLN A O    3  
ATOM 3333  C CB   . GLN A 1 47 ? 2.802   -8.318  2.220   1.00 0.00 ? 47 GLN A CB   3  
ATOM 3334  C CG   . GLN A 1 47 ? 3.433   -9.533  2.880   1.00 0.00 ? 47 GLN A CG   3  
ATOM 3335  C CD   . GLN A 1 47 ? 3.131   -9.611  4.364   1.00 0.00 ? 47 GLN A CD   3  
ATOM 3336  O OE1  . GLN A 1 47 ? 2.813   -8.605  4.999   1.00 0.00 ? 47 GLN A OE1  3  
ATOM 3337  N NE2  . GLN A 1 47 ? 3.229   -10.811 4.925   1.00 0.00 ? 47 GLN A NE2  3  
ATOM 3338  H H    . GLN A 1 47 ? 2.100   -10.043 0.472   1.00 0.00 ? 47 GLN A H    3  
ATOM 3339  H HA   . GLN A 1 47 ? 0.750   -8.759  2.641   1.00 0.00 ? 47 GLN A HA   3  
ATOM 3340  H HB2  . GLN A 1 47 ? 3.396   -8.055  1.357   1.00 0.00 ? 47 GLN A HB2  3  
ATOM 3341  H HB3  . GLN A 1 47 ? 2.823   -7.500  2.924   1.00 0.00 ? 47 GLN A HB3  3  
ATOM 3342  H HG2  . GLN A 1 47 ? 3.054   -10.424 2.405   1.00 0.00 ? 47 GLN A HG2  3  
ATOM 3343  H HG3  . GLN A 1 47 ? 4.504   -9.482  2.747   1.00 0.00 ? 47 GLN A HG3  3  
ATOM 3344  H HE21 . GLN A 1 47 ? 3.488   -11.567 4.359   1.00 0.00 ? 47 GLN A HE21 3  
ATOM 3345  H HE22 . GLN A 1 47 ? 3.040   -10.890 5.884   1.00 0.00 ? 47 GLN A HE22 3  
ATOM 3346  N N    . TRP A 1 48 ? 0.084   -6.484  1.848   1.00 0.00 ? 48 TRP A N    3  
ATOM 3347  C CA   . TRP A 1 48 ? -0.489  -5.253  1.316   1.00 0.00 ? 48 TRP A CA   3  
ATOM 3348  C C    . TRP A 1 48 ? -0.327  -4.105  2.307   1.00 0.00 ? 48 TRP A C    3  
ATOM 3349  O O    . TRP A 1 48 ? 0.003   -4.321  3.474   1.00 0.00 ? 48 TRP A O    3  
ATOM 3350  C CB   . TRP A 1 48 ? -1.971  -5.454  0.990   1.00 0.00 ? 48 TRP A CB   3  
ATOM 3351  C CG   . TRP A 1 48 ? -2.201  -6.120  -0.332  1.00 0.00 ? 48 TRP A CG   3  
ATOM 3352  C CD1  . TRP A 1 48 ? -2.313  -7.459  -0.566  1.00 0.00 ? 48 TRP A CD1  3  
ATOM 3353  C CD2  . TRP A 1 48 ? -2.348  -5.476  -1.603  1.00 0.00 ? 48 TRP A CD2  3  
ATOM 3354  N NE1  . TRP A 1 48 ? -2.521  -7.690  -1.904  1.00 0.00 ? 48 TRP A NE1  3  
ATOM 3355  C CE2  . TRP A 1 48 ? -2.546  -6.487  -2.562  1.00 0.00 ? 48 TRP A CE2  3  
ATOM 3356  C CE3  . TRP A 1 48 ? -2.332  -4.143  -2.024  1.00 0.00 ? 48 TRP A CE3  3  
ATOM 3357  C CZ2  . TRP A 1 48 ? -2.727  -6.207  -3.914  1.00 0.00 ? 48 TRP A CZ2  3  
ATOM 3358  C CZ3  . TRP A 1 48 ? -2.511  -3.866  -3.366  1.00 0.00 ? 48 TRP A CZ3  3  
ATOM 3359  C CH2  . TRP A 1 48 ? -2.707  -4.893  -4.297  1.00 0.00 ? 48 TRP A CH2  3  
ATOM 3360  H H    . TRP A 1 48 ? -0.077  -6.721  2.784   1.00 0.00 ? 48 TRP A H    3  
ATOM 3361  H HA   . TRP A 1 48 ? 0.040   -5.005  0.408   1.00 0.00 ? 48 TRP A HA   3  
ATOM 3362  H HB2  . TRP A 1 48 ? -2.420  -6.069  1.755   1.00 0.00 ? 48 TRP A HB2  3  
ATOM 3363  H HB3  . TRP A 1 48 ? -2.462  -4.493  0.971   1.00 0.00 ? 48 TRP A HB3  3  
ATOM 3364  H HD1  . TRP A 1 48 ? -2.246  -8.217  0.200   1.00 0.00 ? 48 TRP A HD1  3  
ATOM 3365  H HE1  . TRP A 1 48 ? -2.634  -8.569  -2.319  1.00 0.00 ? 48 TRP A HE1  3  
ATOM 3366  H HE3  . TRP A 1 48 ? -2.183  -3.337  -1.320  1.00 0.00 ? 48 TRP A HE3  3  
ATOM 3367  H HZ2  . TRP A 1 48 ? -2.880  -6.987  -4.645  1.00 0.00 ? 48 TRP A HZ2  3  
ATOM 3368  H HZ3  . TRP A 1 48 ? -2.501  -2.842  -3.709  1.00 0.00 ? 48 TRP A HZ3  3  
ATOM 3369  H HH2  . TRP A 1 48 ? -2.842  -4.631  -5.336  1.00 0.00 ? 48 TRP A HH2  3  
ATOM 3370  N N    . ALA A 1 49 ? -0.560  -2.885  1.836   1.00 0.00 ? 49 ALA A N    3  
ATOM 3371  C CA   . ALA A 1 49 ? -0.440  -1.704  2.681   1.00 0.00 ? 49 ALA A CA   3  
ATOM 3372  C C    . ALA A 1 49 ? -1.494  -0.661  2.321   1.00 0.00 ? 49 ALA A C    3  
ATOM 3373  O O    . ALA A 1 49 ? -1.558  -0.197  1.183   1.00 0.00 ? 49 ALA A O    3  
ATOM 3374  C CB   . ALA A 1 49 ? 0.954   -1.109  2.561   1.00 0.00 ? 49 ALA A CB   3  
ATOM 3375  H H    . ALA A 1 49 ? -0.820  -2.776  0.897   1.00 0.00 ? 49 ALA A H    3  
ATOM 3376  H HA   . ALA A 1 49 ? -0.587  -2.010  3.706   1.00 0.00 ? 49 ALA A HA   3  
ATOM 3377  H HB1  . ALA A 1 49 ? 0.983   -0.424  1.725   1.00 0.00 ? 49 ALA A HB1  3  
ATOM 3378  H HB2  . ALA A 1 49 ? 1.671   -1.901  2.401   1.00 0.00 ? 49 ALA A HB2  3  
ATOM 3379  H HB3  . ALA A 1 49 ? 1.200   -0.579  3.468   1.00 0.00 ? 49 ALA A HB3  3  
ATOM 3380  N N    . GLY A 1 50 ? -2.318  -0.299  3.298   1.00 0.00 ? 50 GLY A N    3  
ATOM 3381  C CA   . GLY A 1 50 ? -3.358  0.686   3.064   1.00 0.00 ? 50 GLY A CA   3  
ATOM 3382  C C    . GLY A 1 50 ? -2.883  2.103   3.320   1.00 0.00 ? 50 GLY A C    3  
ATOM 3383  O O    . GLY A 1 50 ? -2.998  2.611   4.435   1.00 0.00 ? 50 GLY A O    3  
ATOM 3384  H H    . GLY A 1 50 ? -2.220  -0.703  4.186   1.00 0.00 ? 50 GLY A H    3  
ATOM 3385  H HA2  . GLY A 1 50 ? -3.688  0.608   2.039   1.00 0.00 ? 50 GLY A HA2  3  
ATOM 3386  H HA3  . GLY A 1 50 ? -4.193  0.475   3.717   1.00 0.00 ? 50 GLY A HA3  3  
ATOM 3387  N N    . VAL A 1 51 ? -2.349  2.742   2.285   1.00 0.00 ? 51 VAL A N    3  
ATOM 3388  C CA   . VAL A 1 51 ? -1.854  4.108   2.402   1.00 0.00 ? 51 VAL A CA   3  
ATOM 3389  C C    . VAL A 1 51 ? -2.901  5.113   1.937   1.00 0.00 ? 51 VAL A C    3  
ATOM 3390  O O    . VAL A 1 51 ? -3.662  4.847   1.006   1.00 0.00 ? 51 VAL A O    3  
ATOM 3391  C CB   . VAL A 1 51 ? -0.565  4.311   1.585   1.00 0.00 ? 51 VAL A CB   3  
ATOM 3392  C CG1  . VAL A 1 51 ? 0.045   5.674   1.876   1.00 0.00 ? 51 VAL A CG1  3  
ATOM 3393  C CG2  . VAL A 1 51 ? 0.432   3.200   1.877   1.00 0.00 ? 51 VAL A CG2  3  
ATOM 3394  H H    . VAL A 1 51 ? -2.285  2.283   1.422   1.00 0.00 ? 51 VAL A H    3  
ATOM 3395  H HA   . VAL A 1 51 ? -1.629  4.292   3.443   1.00 0.00 ? 51 VAL A HA   3  
ATOM 3396  H HB   . VAL A 1 51 ? -0.818  4.272   0.536   1.00 0.00 ? 51 VAL A HB   3  
ATOM 3397  H HG11 . VAL A 1 51 ? 1.121   5.597   1.868   1.00 0.00 ? 51 VAL A HG11 3  
ATOM 3398  H HG12 . VAL A 1 51 ? -0.285  6.016   2.845   1.00 0.00 ? 51 VAL A HG12 3  
ATOM 3399  H HG13 . VAL A 1 51 ? -0.271  6.378   1.120   1.00 0.00 ? 51 VAL A HG13 3  
ATOM 3400  H HG21 . VAL A 1 51 ? 0.239   2.362   1.223   1.00 0.00 ? 51 VAL A HG21 3  
ATOM 3401  H HG22 . VAL A 1 51 ? 0.330   2.885   2.905   1.00 0.00 ? 51 VAL A HG22 3  
ATOM 3402  H HG23 . VAL A 1 51 ? 1.436   3.563   1.710   1.00 0.00 ? 51 VAL A HG23 3  
ATOM 3403  N N    . VAL A 1 52 ? -2.934  6.271   2.589   1.00 0.00 ? 52 VAL A N    3  
ATOM 3404  C CA   . VAL A 1 52 ? -3.887  7.318   2.242   1.00 0.00 ? 52 VAL A CA   3  
ATOM 3405  C C    . VAL A 1 52 ? -3.179  8.528   1.642   1.00 0.00 ? 52 VAL A C    3  
ATOM 3406  O O    . VAL A 1 52 ? -2.392  9.194   2.315   1.00 0.00 ? 52 VAL A O    3  
ATOM 3407  C CB   . VAL A 1 52 ? -4.701  7.770   3.470   1.00 0.00 ? 52 VAL A CB   3  
ATOM 3408  C CG1  . VAL A 1 52 ? -5.799  8.739   3.060   1.00 0.00 ? 52 VAL A CG1  3  
ATOM 3409  C CG2  . VAL A 1 52 ? -5.287  6.567   4.197   1.00 0.00 ? 52 VAL A CG2  3  
ATOM 3410  H H    . VAL A 1 52 ? -2.301  6.425   3.322   1.00 0.00 ? 52 VAL A H    3  
ATOM 3411  H HA   . VAL A 1 52 ? -4.574  6.916   1.510   1.00 0.00 ? 52 VAL A HA   3  
ATOM 3412  H HB   . VAL A 1 52 ? -4.034  8.283   4.149   1.00 0.00 ? 52 VAL A HB   3  
ATOM 3413  H HG11 . VAL A 1 52 ? -5.429  9.392   2.283   1.00 0.00 ? 52 VAL A HG11 3  
ATOM 3414  H HG12 . VAL A 1 52 ? -6.095  9.329   3.914   1.00 0.00 ? 52 VAL A HG12 3  
ATOM 3415  H HG13 . VAL A 1 52 ? -6.649  8.186   2.692   1.00 0.00 ? 52 VAL A HG13 3  
ATOM 3416  H HG21 . VAL A 1 52 ? -6.334  6.472   3.948   1.00 0.00 ? 52 VAL A HG21 3  
ATOM 3417  H HG22 . VAL A 1 52 ? -5.182  6.705   5.263   1.00 0.00 ? 52 VAL A HG22 3  
ATOM 3418  H HG23 . VAL A 1 52 ? -4.762  5.672   3.897   1.00 0.00 ? 52 VAL A HG23 3  
ATOM 3419  N N    . LEU A 1 53 ? -3.463  8.806   0.375   1.00 0.00 ? 53 LEU A N    3  
ATOM 3420  C CA   . LEU A 1 53 ? -2.852  9.936   -0.316  1.00 0.00 ? 53 LEU A CA   3  
ATOM 3421  C C    . LEU A 1 53 ? -3.516  11.247  0.093   1.00 0.00 ? 53 LEU A C    3  
ATOM 3422  O O    . LEU A 1 53 ? -4.742  11.333  0.177   1.00 0.00 ? 53 LEU A O    3  
ATOM 3423  C CB   . LEU A 1 53 ? -2.955  9.751   -1.831  1.00 0.00 ? 53 LEU A CB   3  
ATOM 3424  C CG   . LEU A 1 53 ? -2.241  8.516   -2.382  1.00 0.00 ? 53 LEU A CG   3  
ATOM 3425  C CD1  . LEU A 1 53 ? -2.901  8.048   -3.669  1.00 0.00 ? 53 LEU A CD1  3  
ATOM 3426  C CD2  . LEU A 1 53 ? -0.767  8.812   -2.614  1.00 0.00 ? 53 LEU A CD2  3  
ATOM 3427  H H    . LEU A 1 53 ? -4.098  8.237   -0.109  1.00 0.00 ? 53 LEU A H    3  
ATOM 3428  H HA   . LEU A 1 53 ? -1.811  9.972   -0.036  1.00 0.00 ? 53 LEU A HA   3  
ATOM 3429  H HB2  . LEU A 1 53 ? -4.001  9.685   -2.094  1.00 0.00 ? 53 LEU A HB2  3  
ATOM 3430  H HB3  . LEU A 1 53 ? -2.535  10.624  -2.309  1.00 0.00 ? 53 LEU A HB3  3  
ATOM 3431  H HG   . LEU A 1 53 ? -2.312  7.715   -1.661  1.00 0.00 ? 53 LEU A HG   3  
ATOM 3432  H HD11 . LEU A 1 53 ? -3.399  8.882   -4.143  1.00 0.00 ? 53 LEU A HD11 3  
ATOM 3433  H HD12 . LEU A 1 53 ? -3.625  7.279   -3.444  1.00 0.00 ? 53 LEU A HD12 3  
ATOM 3434  H HD13 . LEU A 1 53 ? -2.150  7.651   -4.336  1.00 0.00 ? 53 LEU A HD13 3  
ATOM 3435  H HD21 . LEU A 1 53 ? -0.228  8.706   -1.684  1.00 0.00 ? 53 LEU A HD21 3  
ATOM 3436  H HD22 . LEU A 1 53 ? -0.656  9.822   -2.980  1.00 0.00 ? 53 LEU A HD22 3  
ATOM 3437  H HD23 . LEU A 1 53 ? -0.370  8.120   -3.341  1.00 0.00 ? 53 LEU A HD23 3  
ATOM 3438  N N    . ASP A 1 54 ? -2.700  12.264  0.349   1.00 0.00 ? 54 ASP A N    3  
ATOM 3439  C CA   . ASP A 1 54 ? -3.209  13.570  0.749   1.00 0.00 ? 54 ASP A CA   3  
ATOM 3440  C C    . ASP A 1 54 ? -4.065  14.182  -0.354  1.00 0.00 ? 54 ASP A C    3  
ATOM 3441  O O    . ASP A 1 54 ? -5.013  14.919  -0.082  1.00 0.00 ? 54 ASP A O    3  
ATOM 3442  C CB   . ASP A 1 54 ? -2.050  14.508  1.092   1.00 0.00 ? 54 ASP A CB   3  
ATOM 3443  C CG   . ASP A 1 54 ? -2.374  15.426  2.255   1.00 0.00 ? 54 ASP A CG   3  
ATOM 3444  O OD1  . ASP A 1 54 ? -2.589  14.913  3.374   1.00 0.00 ? 54 ASP A OD1  3  
ATOM 3445  O OD2  . ASP A 1 54 ? -2.413  16.657  2.048   1.00 0.00 ? 54 ASP A OD2  3  
ATOM 3446  H H    . ASP A 1 54 ? -1.733  12.133  0.264   1.00 0.00 ? 54 ASP A H    3  
ATOM 3447  H HA   . ASP A 1 54 ? -3.821  13.432  1.628   1.00 0.00 ? 54 ASP A HA   3  
ATOM 3448  H HB2  . ASP A 1 54 ? -1.184  13.920  1.353   1.00 0.00 ? 54 ASP A HB2  3  
ATOM 3449  H HB3  . ASP A 1 54 ? -1.821  15.117  0.230   1.00 0.00 ? 54 ASP A HB3  3  
ATOM 3450  N N    . ASP A 1 55 ? -3.724  13.873  -1.602  1.00 0.00 ? 55 ASP A N    3  
ATOM 3451  C CA   . ASP A 1 55 ? -4.462  14.393  -2.747  1.00 0.00 ? 55 ASP A CA   3  
ATOM 3452  C C    . ASP A 1 55 ? -5.334  13.306  -3.371  1.00 0.00 ? 55 ASP A C    3  
ATOM 3453  O O    . ASP A 1 55 ? -5.039  12.116  -3.253  1.00 0.00 ? 55 ASP A O    3  
ATOM 3454  C CB   . ASP A 1 55 ? -3.494  14.949  -3.792  1.00 0.00 ? 55 ASP A CB   3  
ATOM 3455  C CG   . ASP A 1 55 ? -2.548  15.983  -3.213  1.00 0.00 ? 55 ASP A CG   3  
ATOM 3456  O OD1  . ASP A 1 55 ? -2.938  17.167  -3.134  1.00 0.00 ? 55 ASP A OD1  3  
ATOM 3457  O OD2  . ASP A 1 55 ? -1.418  15.608  -2.838  1.00 0.00 ? 55 ASP A OD2  3  
ATOM 3458  H H    . ASP A 1 55 ? -2.959  13.280  -1.754  1.00 0.00 ? 55 ASP A H    3  
ATOM 3459  H HA   . ASP A 1 55 ? -5.099  15.191  -2.396  1.00 0.00 ? 55 ASP A HA   3  
ATOM 3460  H HB2  . ASP A 1 55 ? -2.908  14.139  -4.199  1.00 0.00 ? 55 ASP A HB2  3  
ATOM 3461  H HB3  . ASP A 1 55 ? -4.060  15.412  -4.588  1.00 0.00 ? 55 ASP A HB3  3  
ATOM 3462  N N    . PRO A 1 56 ? -6.427  13.702  -4.047  1.00 0.00 ? 56 PRO A N    3  
ATOM 3463  C CA   . PRO A 1 56 ? -7.343  12.755  -4.691  1.00 0.00 ? 56 PRO A CA   3  
ATOM 3464  C C    . PRO A 1 56 ? -6.710  12.065  -5.896  1.00 0.00 ? 56 PRO A C    3  
ATOM 3465  O O    . PRO A 1 56 ? -7.159  12.233  -7.029  1.00 0.00 ? 56 PRO A O    3  
ATOM 3466  C CB   . PRO A 1 56 ? -8.514  13.636  -5.132  1.00 0.00 ? 56 PRO A CB   3  
ATOM 3467  C CG   . PRO A 1 56 ? -7.931  14.998  -5.279  1.00 0.00 ? 56 PRO A CG   3  
ATOM 3468  C CD   . PRO A 1 56 ? -6.853  15.102  -4.236  1.00 0.00 ? 56 PRO A CD   3  
ATOM 3469  H HA   . PRO A 1 56 ? -7.694  12.009  -3.994  1.00 0.00 ? 56 PRO A HA   3  
ATOM 3470  H HB2  . PRO A 1 56 ? -8.910  13.272  -6.069  1.00 0.00 ? 56 PRO A HB2  3  
ATOM 3471  H HB3  . PRO A 1 56 ? -9.286  13.618  -4.378  1.00 0.00 ? 56 PRO A HB3  3  
ATOM 3472  H HG2  . PRO A 1 56 ? -7.509  15.112  -6.267  1.00 0.00 ? 56 PRO A HG2  3  
ATOM 3473  H HG3  . PRO A 1 56 ? -8.692  15.745  -5.107  1.00 0.00 ? 56 PRO A HG3  3  
ATOM 3474  H HD2  . PRO A 1 56 ? -6.036  15.708  -4.596  1.00 0.00 ? 56 PRO A HD2  3  
ATOM 3475  H HD3  . PRO A 1 56 ? -7.253  15.510  -3.319  1.00 0.00 ? 56 PRO A HD3  3  
ATOM 3476  N N    . VAL A 1 57 ? -5.663  11.287  -5.640  1.00 0.00 ? 57 VAL A N    3  
ATOM 3477  C CA   . VAL A 1 57 ? -4.967  10.571  -6.702  1.00 0.00 ? 57 VAL A CA   3  
ATOM 3478  C C    . VAL A 1 57 ? -4.770  9.103   -6.338  1.00 0.00 ? 57 VAL A C    3  
ATOM 3479  O O    . VAL A 1 57 ? -3.794  8.476   -6.750  1.00 0.00 ? 57 VAL A O    3  
ATOM 3480  C CB   . VAL A 1 57 ? -3.594  11.202  -7.000  1.00 0.00 ? 57 VAL A CB   3  
ATOM 3481  C CG1  . VAL A 1 57 ? -3.759  12.523  -7.734  1.00 0.00 ? 57 VAL A CG1  3  
ATOM 3482  C CG2  . VAL A 1 57 ? -2.804  11.394  -5.714  1.00 0.00 ? 57 VAL A CG2  3  
ATOM 3483  H H    . VAL A 1 57 ? -5.351  11.192  -4.716  1.00 0.00 ? 57 VAL A H    3  
ATOM 3484  H HA   . VAL A 1 57 ? -5.569  10.632  -7.597  1.00 0.00 ? 57 VAL A HA   3  
ATOM 3485  H HB   . VAL A 1 57 ? -3.041  10.527  -7.639  1.00 0.00 ? 57 VAL A HB   3  
ATOM 3486  H HG11 . VAL A 1 57 ? -4.114  12.335  -8.738  1.00 0.00 ? 57 VAL A HG11 3  
ATOM 3487  H HG12 . VAL A 1 57 ? -2.809  13.033  -7.778  1.00 0.00 ? 57 VAL A HG12 3  
ATOM 3488  H HG13 . VAL A 1 57 ? -4.475  13.138  -7.210  1.00 0.00 ? 57 VAL A HG13 3  
ATOM 3489  H HG21 . VAL A 1 57 ? -1.812  11.747  -5.950  1.00 0.00 ? 57 VAL A HG21 3  
ATOM 3490  H HG22 . VAL A 1 57 ? -2.736  10.452  -5.189  1.00 0.00 ? 57 VAL A HG22 3  
ATOM 3491  H HG23 . VAL A 1 57 ? -3.306  12.118  -5.089  1.00 0.00 ? 57 VAL A HG23 3  
ATOM 3492  N N    . GLY A 1 58 ? -5.703  8.561   -5.562  1.00 0.00 ? 58 GLY A N    3  
ATOM 3493  C CA   . GLY A 1 58 ? -5.613  7.170   -5.155  1.00 0.00 ? 58 GLY A CA   3  
ATOM 3494  C C    . GLY A 1 58 ? -6.388  6.246   -6.073  1.00 0.00 ? 58 GLY A C    3  
ATOM 3495  O O    . GLY A 1 58 ? -6.468  6.482   -7.279  1.00 0.00 ? 58 GLY A O    3  
ATOM 3496  H H    . GLY A 1 58 ? -6.458  9.109   -5.264  1.00 0.00 ? 58 GLY A H    3  
ATOM 3497  H HA2  . GLY A 1 58 ? -4.576  6.873   -5.155  1.00 0.00 ? 58 GLY A HA2  3  
ATOM 3498  H HA3  . GLY A 1 58 ? -6.005  7.075   -4.152  1.00 0.00 ? 58 GLY A HA3  3  
ATOM 3499  N N    . LYS A 1 59 ? -6.960  5.191   -5.502  1.00 0.00 ? 59 LYS A N    3  
ATOM 3500  C CA   . LYS A 1 59 ? -7.732  4.227   -6.278  1.00 0.00 ? 59 LYS A CA   3  
ATOM 3501  C C    . LYS A 1 59 ? -9.059  3.916   -5.592  1.00 0.00 ? 59 LYS A C    3  
ATOM 3502  O O    . LYS A 1 59 ? -10.124 4.041   -6.195  1.00 0.00 ? 59 LYS A O    3  
ATOM 3503  C CB   . LYS A 1 59 ? -6.931  2.939   -6.471  1.00 0.00 ? 59 LYS A CB   3  
ATOM 3504  C CG   . LYS A 1 59 ? -5.904  3.023   -7.589  1.00 0.00 ? 59 LYS A CG   3  
ATOM 3505  C CD   . LYS A 1 59 ? -5.553  1.646   -8.128  1.00 0.00 ? 59 LYS A CD   3  
ATOM 3506  C CE   . LYS A 1 59 ? -4.670  1.740   -9.363  1.00 0.00 ? 59 LYS A CE   3  
ATOM 3507  N NZ   . LYS A 1 59 ? -4.454  0.408   -9.992  1.00 0.00 ? 59 LYS A NZ   3  
ATOM 3508  H H    . LYS A 1 59 ? -6.860  5.058   -4.536  1.00 0.00 ? 59 LYS A H    3  
ATOM 3509  H HA   . LYS A 1 59 ? -7.933  4.664   -7.244  1.00 0.00 ? 59 LYS A HA   3  
ATOM 3510  H HB2  . LYS A 1 59 ? -6.413  2.709   -5.552  1.00 0.00 ? 59 LYS A HB2  3  
ATOM 3511  H HB3  . LYS A 1 59 ? -7.614  2.135   -6.701  1.00 0.00 ? 59 LYS A HB3  3  
ATOM 3512  H HG2  . LYS A 1 59 ? -6.309  3.621   -8.392  1.00 0.00 ? 59 LYS A HG2  3  
ATOM 3513  H HG3  . LYS A 1 59 ? -5.008  3.490   -7.206  1.00 0.00 ? 59 LYS A HG3  3  
ATOM 3514  H HD2  . LYS A 1 59 ? -5.027  1.094   -7.363  1.00 0.00 ? 59 LYS A HD2  3  
ATOM 3515  H HD3  . LYS A 1 59 ? -6.465  1.128   -8.386  1.00 0.00 ? 59 LYS A HD3  3  
ATOM 3516  H HE2  . LYS A 1 59 ? -5.144  2.394   -10.079 1.00 0.00 ? 59 LYS A HE2  3  
ATOM 3517  H HE3  . LYS A 1 59 ? -3.715  2.154   -9.076  1.00 0.00 ? 59 LYS A HE3  3  
ATOM 3518  H HZ1  . LYS A 1 59 ? -5.136  0.263   -10.765 1.00 0.00 ? 59 LYS A HZ1  3  
ATOM 3519  H HZ2  . LYS A 1 59 ? -4.579  -0.345  -9.288  1.00 0.00 ? 59 LYS A HZ2  3  
ATOM 3520  H HZ3  . LYS A 1 59 ? -3.490  0.349   -10.378 1.00 0.00 ? 59 LYS A HZ3  3  
ATOM 3521  N N    . ASN A 1 60 ? -8.986  3.510   -4.329  1.00 0.00 ? 60 ASN A N    3  
ATOM 3522  C CA   . ASN A 1 60 ? -10.182 3.180   -3.562  1.00 0.00 ? 60 ASN A CA   3  
ATOM 3523  C C    . ASN A 1 60 ? -10.469 4.251   -2.515  1.00 0.00 ? 60 ASN A C    3  
ATOM 3524  O O    . ASN A 1 60 ? -9.840  5.310   -2.506  1.00 0.00 ? 60 ASN A O    3  
ATOM 3525  C CB   . ASN A 1 60 ? -10.018 1.819   -2.884  1.00 0.00 ? 60 ASN A CB   3  
ATOM 3526  C CG   . ASN A 1 60 ? -9.549  0.746   -3.847  1.00 0.00 ? 60 ASN A CG   3  
ATOM 3527  O OD1  . ASN A 1 60 ? -10.221 0.444   -4.834  1.00 0.00 ? 60 ASN A OD1  3  
ATOM 3528  N ND2  . ASN A 1 60 ? -8.391  0.162   -3.563  1.00 0.00 ? 60 ASN A ND2  3  
ATOM 3529  H H    . ASN A 1 60 ? -8.107  3.429   -3.903  1.00 0.00 ? 60 ASN A H    3  
ATOM 3530  H HA   . ASN A 1 60 ? -11.014 3.132   -4.248  1.00 0.00 ? 60 ASN A HA   3  
ATOM 3531  H HB2  . ASN A 1 60 ? -9.293  1.904   -2.088  1.00 0.00 ? 60 ASN A HB2  3  
ATOM 3532  H HB3  . ASN A 1 60 ? -10.968 1.514   -2.468  1.00 0.00 ? 60 ASN A HB3  3  
ATOM 3533  H HD21 . ASN A 1 60 ? -7.910  0.453   -2.760  1.00 0.00 ? 60 ASN A HD21 3  
ATOM 3534  H HD22 . ASN A 1 60 ? -8.063  -0.535  -4.169  1.00 0.00 ? 60 ASN A HD22 3  
ATOM 3535  N N    . ASP A 1 61 ? -11.424 3.970   -1.633  1.00 0.00 ? 61 ASP A N    3  
ATOM 3536  C CA   . ASP A 1 61 ? -11.794 4.908   -0.582  1.00 0.00 ? 61 ASP A CA   3  
ATOM 3537  C C    . ASP A 1 61 ? -11.824 4.218   0.778   1.00 0.00 ? 61 ASP A C    3  
ATOM 3538  O O    . ASP A 1 61 ? -12.599 4.593   1.658   1.00 0.00 ? 61 ASP A O    3  
ATOM 3539  C CB   . ASP A 1 61 ? -13.160 5.529   -0.882  1.00 0.00 ? 61 ASP A CB   3  
ATOM 3540  C CG   . ASP A 1 61 ? -14.225 4.483   -1.144  1.00 0.00 ? 61 ASP A CG   3  
ATOM 3541  O OD1  . ASP A 1 61 ? -14.704 3.867   -0.168  1.00 0.00 ? 61 ASP A OD1  3  
ATOM 3542  O OD2  . ASP A 1 61 ? -14.581 4.281   -2.323  1.00 0.00 ? 61 ASP A OD2  3  
ATOM 3543  H H    . ASP A 1 61 ? -11.889 3.109   -1.692  1.00 0.00 ? 61 ASP A H    3  
ATOM 3544  H HA   . ASP A 1 61 ? -11.050 5.691   -0.559  1.00 0.00 ? 61 ASP A HA   3  
ATOM 3545  H HB2  . ASP A 1 61 ? -13.469 6.128   -0.038  1.00 0.00 ? 61 ASP A HB2  3  
ATOM 3546  H HB3  . ASP A 1 61 ? -13.077 6.160   -1.755  1.00 0.00 ? 61 ASP A HB3  3  
ATOM 3547  N N    . GLY A 1 62 ? -10.976 3.209   0.943   1.00 0.00 ? 62 GLY A N    3  
ATOM 3548  C CA   . GLY A 1 62 ? -10.921 2.484   2.198   1.00 0.00 ? 62 GLY A CA   3  
ATOM 3549  C C    . GLY A 1 62 ? -11.581 1.121   2.111   1.00 0.00 ? 62 GLY A C    3  
ATOM 3550  O O    . GLY A 1 62 ? -11.210 0.196   2.833   1.00 0.00 ? 62 GLY A O    3  
ATOM 3551  H H    . GLY A 1 62 ? -10.381 2.954   0.206   1.00 0.00 ? 62 GLY A H    3  
ATOM 3552  H HA2  . GLY A 1 62 ? -9.887  2.352   2.481   1.00 0.00 ? 62 GLY A HA2  3  
ATOM 3553  H HA3  . GLY A 1 62 ? -11.420 3.065   2.959   1.00 0.00 ? 62 GLY A HA3  3  
ATOM 3554  N N    . ALA A 1 63 ? -12.563 0.998   1.223   1.00 0.00 ? 63 ALA A N    3  
ATOM 3555  C CA   . ALA A 1 63 ? -13.277 -0.260  1.044   1.00 0.00 ? 63 ALA A CA   3  
ATOM 3556  C C    . ALA A 1 63 ? -12.923 -0.907  -0.292  1.00 0.00 ? 63 ALA A C    3  
ATOM 3557  O O    . ALA A 1 63 ? -12.968 -0.260  -1.338  1.00 0.00 ? 63 ALA A O    3  
ATOM 3558  C CB   . ALA A 1 63 ? -14.778 -0.033  1.141   1.00 0.00 ? 63 ALA A CB   3  
ATOM 3559  H H    . ALA A 1 63 ? -12.814 1.771   0.676   1.00 0.00 ? 63 ALA A H    3  
ATOM 3560  H HA   . ALA A 1 63 ? -12.985 -0.926  1.843   1.00 0.00 ? 63 ALA A HA   3  
ATOM 3561  H HB1  . ALA A 1 63 ? -15.046 0.167   2.168   1.00 0.00 ? 63 ALA A HB1  3  
ATOM 3562  H HB2  . ALA A 1 63 ? -15.298 -0.916  0.798   1.00 0.00 ? 63 ALA A HB2  3  
ATOM 3563  H HB3  . ALA A 1 63 ? -15.055 0.809   0.526   1.00 0.00 ? 63 ALA A HB3  3  
ATOM 3564  N N    . VAL A 1 64 ? -12.572 -2.188  -0.248  1.00 0.00 ? 64 VAL A N    3  
ATOM 3565  C CA   . VAL A 1 64 ? -12.211 -2.924  -1.455  1.00 0.00 ? 64 VAL A CA   3  
ATOM 3566  C C    . VAL A 1 64 ? -13.014 -4.215  -1.570  1.00 0.00 ? 64 VAL A C    3  
ATOM 3567  O O    . VAL A 1 64 ? -12.882 -5.116  -0.740  1.00 0.00 ? 64 VAL A O    3  
ATOM 3568  C CB   . VAL A 1 64 ? -10.709 -3.262  -1.480  1.00 0.00 ? 64 VAL A CB   3  
ATOM 3569  C CG1  . VAL A 1 64 ? -10.323 -3.891  -2.810  1.00 0.00 ? 64 VAL A CG1  3  
ATOM 3570  C CG2  . VAL A 1 64 ? -9.875  -2.018  -1.208  1.00 0.00 ? 64 VAL A CG2  3  
ATOM 3571  H H    . VAL A 1 64 ? -12.555 -2.650  0.616   1.00 0.00 ? 64 VAL A H    3  
ATOM 3572  H HA   . VAL A 1 64 ? -12.433 -2.296  -2.306  1.00 0.00 ? 64 VAL A HA   3  
ATOM 3573  H HB   . VAL A 1 64 ? -10.509 -3.980  -0.698  1.00 0.00 ? 64 VAL A HB   3  
ATOM 3574  H HG11 . VAL A 1 64 ? -9.325  -3.579  -3.080  1.00 0.00 ? 64 VAL A HG11 3  
ATOM 3575  H HG12 . VAL A 1 64 ? -11.017 -3.572  -3.573  1.00 0.00 ? 64 VAL A HG12 3  
ATOM 3576  H HG13 . VAL A 1 64 ? -10.352 -4.967  -2.722  1.00 0.00 ? 64 VAL A HG13 3  
ATOM 3577  H HG21 . VAL A 1 64 ? -10.491 -1.265  -0.741  1.00 0.00 ? 64 VAL A HG21 3  
ATOM 3578  H HG22 . VAL A 1 64 ? -9.486  -1.636  -2.140  1.00 0.00 ? 64 VAL A HG22 3  
ATOM 3579  H HG23 . VAL A 1 64 ? -9.055  -2.271  -0.552  1.00 0.00 ? 64 VAL A HG23 3  
ATOM 3580  N N    . GLY A 1 65 ? -13.847 -4.299  -2.602  1.00 0.00 ? 65 GLY A N    3  
ATOM 3581  C CA   . GLY A 1 65 ? -14.658 -5.484  -2.806  1.00 0.00 ? 65 GLY A CA   3  
ATOM 3582  C C    . GLY A 1 65 ? -15.818 -5.568  -1.834  1.00 0.00 ? 65 GLY A C    3  
ATOM 3583  O O    . GLY A 1 65 ? -16.875 -4.983  -2.067  1.00 0.00 ? 65 GLY A O    3  
ATOM 3584  H H    . GLY A 1 65 ? -13.909 -3.550  -3.231  1.00 0.00 ? 65 GLY A H    3  
ATOM 3585  H HA2  . GLY A 1 65 ? -15.047 -5.472  -3.814  1.00 0.00 ? 65 GLY A HA2  3  
ATOM 3586  H HA3  . GLY A 1 65 ? -14.036 -6.358  -2.683  1.00 0.00 ? 65 GLY A HA3  3  
ATOM 3587  N N    . GLY A 1 66 ? -15.620 -6.297  -0.740  1.00 0.00 ? 66 GLY A N    3  
ATOM 3588  C CA   . GLY A 1 66 ? -16.666 -6.442  0.255   1.00 0.00 ? 66 GLY A CA   3  
ATOM 3589  C C    . GLY A 1 66 ? -16.128 -6.414  1.672   1.00 0.00 ? 66 GLY A C    3  
ATOM 3590  O O    . GLY A 1 66 ? -16.726 -6.991  2.580   1.00 0.00 ? 66 GLY A O    3  
ATOM 3591  H H    . GLY A 1 66 ? -14.756 -6.740  -0.608  1.00 0.00 ? 66 GLY A H    3  
ATOM 3592  H HA2  . GLY A 1 66 ? -17.374 -5.635  0.134   1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3593  H HA3  . GLY A 1 66 ? -17.175 -7.380  0.092   1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3594  N N    . VAL A 1 67 ? -14.996 -5.744  1.861   1.00 0.00 ? 67 VAL A N    3  
ATOM 3595  C CA   . VAL A 1 67 ? -14.378 -5.645  3.177   1.00 0.00 ? 67 VAL A CA   3  
ATOM 3596  C C    . VAL A 1 67 ? -13.776 -4.261  3.399   1.00 0.00 ? 67 VAL A C    3  
ATOM 3597  O O    . VAL A 1 67 ? -13.007 -3.768  2.573   1.00 0.00 ? 67 VAL A O    3  
ATOM 3598  C CB   . VAL A 1 67 ? -13.277 -6.705  3.364   1.00 0.00 ? 67 VAL A CB   3  
ATOM 3599  C CG1  . VAL A 1 67 ? -12.785 -6.718  4.803   1.00 0.00 ? 67 VAL A CG1  3  
ATOM 3600  C CG2  . VAL A 1 67 ? -13.784 -8.079  2.954   1.00 0.00 ? 67 VAL A CG2  3  
ATOM 3601  H H    . VAL A 1 67 ? -14.566 -5.306  1.098   1.00 0.00 ? 67 VAL A H    3  
ATOM 3602  H HA   . VAL A 1 67 ? -15.144 -5.816  3.920   1.00 0.00 ? 67 VAL A HA   3  
ATOM 3603  H HB   . VAL A 1 67 ? -12.445 -6.447  2.726   1.00 0.00 ? 67 VAL A HB   3  
ATOM 3604  H HG11 . VAL A 1 67 ? -13.631 -6.685  5.473   1.00 0.00 ? 67 VAL A HG11 3  
ATOM 3605  H HG12 . VAL A 1 67 ? -12.155 -5.858  4.975   1.00 0.00 ? 67 VAL A HG12 3  
ATOM 3606  H HG13 . VAL A 1 67 ? -12.220 -7.621  4.982   1.00 0.00 ? 67 VAL A HG13 3  
ATOM 3607  H HG21 . VAL A 1 67 ? -14.856 -8.122  3.085   1.00 0.00 ? 67 VAL A HG21 3  
ATOM 3608  H HG22 . VAL A 1 67 ? -13.316 -8.834  3.568   1.00 0.00 ? 67 VAL A HG22 3  
ATOM 3609  H HG23 . VAL A 1 67 ? -13.541 -8.258  1.917   1.00 0.00 ? 67 VAL A HG23 3  
ATOM 3610  N N    . ARG A 1 68 ? -14.131 -3.639  4.518   1.00 0.00 ? 68 ARG A N    3  
ATOM 3611  C CA   . ARG A 1 68 ? -13.626 -2.311  4.848   1.00 0.00 ? 68 ARG A CA   3  
ATOM 3612  C C    . ARG A 1 68 ? -12.326 -2.405  5.640   1.00 0.00 ? 68 ARG A C    3  
ATOM 3613  O O    . ARG A 1 68 ? -12.151 -3.306  6.461   1.00 0.00 ? 68 ARG A O    3  
ATOM 3614  C CB   . ARG A 1 68 ? -14.670 -1.530  5.647   1.00 0.00 ? 68 ARG A CB   3  
ATOM 3615  C CG   . ARG A 1 68 ? -14.742 -0.057  5.277   1.00 0.00 ? 68 ARG A CG   3  
ATOM 3616  C CD   . ARG A 1 68 ? -15.179 0.794   6.458   1.00 0.00 ? 68 ARG A CD   3  
ATOM 3617  N NE   . ARG A 1 68 ? -16.614 1.066   6.436   1.00 0.00 ? 68 ARG A NE   3  
ATOM 3618  C CZ   . ARG A 1 68 ? -17.305 1.487   7.493   1.00 0.00 ? 68 ARG A CZ   3  
ATOM 3619  N NH1  . ARG A 1 68 ? -16.697 1.686   8.656   1.00 0.00 ? 68 ARG A NH1  3  
ATOM 3620  N NH2  . ARG A 1 68 ? -18.608 1.711   7.386   1.00 0.00 ? 68 ARG A NH2  3  
ATOM 3621  H H    . ARG A 1 68 ? -14.747 -4.084  5.137   1.00 0.00 ? 68 ARG A H    3  
ATOM 3622  H HA   . ARG A 1 68 ? -13.432 -1.791  3.922   1.00 0.00 ? 68 ARG A HA   3  
ATOM 3623  H HB2  . ARG A 1 68 ? -15.643 -1.970  5.475   1.00 0.00 ? 68 ARG A HB2  3  
ATOM 3624  H HB3  . ARG A 1 68 ? -14.430 -1.603  6.701   1.00 0.00 ? 68 ARG A HB3  3  
ATOM 3625  H HG2  . ARG A 1 68 ? -13.766 0.271   4.952   1.00 0.00 ? 68 ARG A HG2  3  
ATOM 3626  H HG3  . ARG A 1 68 ? -15.452 0.067   4.472   1.00 0.00 ? 68 ARG A HG3  3  
ATOM 3627  H HD2  . ARG A 1 68 ? -14.936 0.271   7.371   1.00 0.00 ? 68 ARG A HD2  3  
ATOM 3628  H HD3  . ARG A 1 68 ? -14.643 1.731   6.427   1.00 0.00 ? 68 ARG A HD3  3  
ATOM 3629  H HE   . ARG A 1 68 ? -17.088 0.927   5.590   1.00 0.00 ? 68 ARG A HE   3  
ATOM 3630  H HH11 . ARG A 1 68 ? -15.715 1.519   8.743   1.00 0.00 ? 68 ARG A HH11 3  
ATOM 3631  H HH12 . ARG A 1 68 ? -17.222 2.003   9.446   1.00 0.00 ? 68 ARG A HH12 3  
ATOM 3632  H HH21 . ARG A 1 68 ? -19.071 1.563   6.513   1.00 0.00 ? 68 ARG A HH21 3  
ATOM 3633  H HH22 . ARG A 1 68 ? -19.127 2.027   8.181   1.00 0.00 ? 68 ARG A HH22 3  
ATOM 3634  N N    . TYR A 1 69 ? -11.416 -1.469  5.388   1.00 0.00 ? 69 TYR A N    3  
ATOM 3635  C CA   . TYR A 1 69 ? -10.131 -1.446  6.078   1.00 0.00 ? 69 TYR A CA   3  
ATOM 3636  C C    . TYR A 1 69 ? -9.990  -0.184  6.922   1.00 0.00 ? 69 TYR A C    3  
ATOM 3637  O O    . TYR A 1 69 ? -9.984  -0.245  8.152   1.00 0.00 ? 69 TYR A O    3  
ATOM 3638  C CB   . TYR A 1 69 ? -8.985  -1.529  5.069   1.00 0.00 ? 69 TYR A CB   3  
ATOM 3639  C CG   . TYR A 1 69 ? -9.051  -2.748  4.177   1.00 0.00 ? 69 TYR A CG   3  
ATOM 3640  C CD1  . TYR A 1 69 ? -9.994  -2.840  3.161   1.00 0.00 ? 69 TYR A CD1  3  
ATOM 3641  C CD2  . TYR A 1 69 ? -8.167  -3.807  4.349   1.00 0.00 ? 69 TYR A CD2  3  
ATOM 3642  C CE1  . TYR A 1 69 ? -10.058 -3.952  2.344   1.00 0.00 ? 69 TYR A CE1  3  
ATOM 3643  C CE2  . TYR A 1 69 ? -8.224  -4.923  3.536   1.00 0.00 ? 69 TYR A CE2  3  
ATOM 3644  C CZ   . TYR A 1 69 ? -9.170  -4.990  2.535   1.00 0.00 ? 69 TYR A CZ   3  
ATOM 3645  O OH   . TYR A 1 69 ? -9.229  -6.100  1.723   1.00 0.00 ? 69 TYR A OH   3  
ATOM 3646  H H    . TYR A 1 69 ? -11.614 -0.777  4.722   1.00 0.00 ? 69 TYR A H    3  
ATOM 3647  H HA   . TYR A 1 69 ? -10.089 -2.306  6.730   1.00 0.00 ? 69 TYR A HA   3  
ATOM 3648  H HB2  . TYR A 1 69 ? -9.008  -0.655  4.436   1.00 0.00 ? 69 TYR A HB2  3  
ATOM 3649  H HB3  . TYR A 1 69 ? -8.047  -1.557  5.602   1.00 0.00 ? 69 TYR A HB3  3  
ATOM 3650  H HD1  . TYR A 1 69 ? -10.688 -2.025  3.015   1.00 0.00 ? 69 TYR A HD1  3  
ATOM 3651  H HD2  . TYR A 1 69 ? -7.428  -3.751  5.134   1.00 0.00 ? 69 TYR A HD2  3  
ATOM 3652  H HE1  . TYR A 1 69 ? -10.798 -4.005  1.560   1.00 0.00 ? 69 TYR A HE1  3  
ATOM 3653  H HE2  . TYR A 1 69 ? -7.529  -5.736  3.685   1.00 0.00 ? 69 TYR A HE2  3  
ATOM 3654  H HH   . TYR A 1 69 ? -8.610  -5.999  0.997   1.00 0.00 ? 69 TYR A HH   3  
ATOM 3655  N N    . PHE A 1 70 ? -9.877  0.960   6.255   1.00 0.00 ? 70 PHE A N    3  
ATOM 3656  C CA   . PHE A 1 70 ? -9.735  2.237   6.944   1.00 0.00 ? 70 PHE A CA   3  
ATOM 3657  C C    . PHE A 1 70 ? -10.737 3.257   6.411   1.00 0.00 ? 70 PHE A C    3  
ATOM 3658  O O    . PHE A 1 70 ? -11.219 3.139   5.285   1.00 0.00 ? 70 PHE A O    3  
ATOM 3659  C CB   . PHE A 1 70 ? -8.311  2.773   6.782   1.00 0.00 ? 70 PHE A CB   3  
ATOM 3660  C CG   . PHE A 1 70 ? -7.828  2.774   5.360   1.00 0.00 ? 70 PHE A CG   3  
ATOM 3661  C CD1  . PHE A 1 70 ? -7.225  1.649   4.818   1.00 0.00 ? 70 PHE A CD1  3  
ATOM 3662  C CD2  . PHE A 1 70 ? -7.974  3.899   4.565   1.00 0.00 ? 70 PHE A CD2  3  
ATOM 3663  C CE1  . PHE A 1 70 ? -6.779  1.647   3.511   1.00 0.00 ? 70 PHE A CE1  3  
ATOM 3664  C CE2  . PHE A 1 70 ? -7.530  3.903   3.257   1.00 0.00 ? 70 PHE A CE2  3  
ATOM 3665  C CZ   . PHE A 1 70 ? -6.932  2.775   2.729   1.00 0.00 ? 70 PHE A CZ   3  
ATOM 3666  H H    . PHE A 1 70 ? -9.888  0.944   5.274   1.00 0.00 ? 70 PHE A H    3  
ATOM 3667  H HA   . PHE A 1 70 ? -9.930  2.071   7.992   1.00 0.00 ? 70 PHE A HA   3  
ATOM 3668  H HB2  . PHE A 1 70 ? -8.272  3.788   7.147   1.00 0.00 ? 70 PHE A HB2  3  
ATOM 3669  H HB3  . PHE A 1 70 ? -7.636  2.161   7.364   1.00 0.00 ? 70 PHE A HB3  3  
ATOM 3670  H HD1  . PHE A 1 70 ? -7.105  0.767   5.429   1.00 0.00 ? 70 PHE A HD1  3  
ATOM 3671  H HD2  . PHE A 1 70 ? -8.442  4.781   4.977   1.00 0.00 ? 70 PHE A HD2  3  
ATOM 3672  H HE1  . PHE A 1 70 ? -6.312  0.764   3.100   1.00 0.00 ? 70 PHE A HE1  3  
ATOM 3673  H HE2  . PHE A 1 70 ? -7.651  4.786   2.647   1.00 0.00 ? 70 PHE A HE2  3  
ATOM 3674  H HZ   . PHE A 1 70 ? -6.584  2.776   1.706   1.00 0.00 ? 70 PHE A HZ   3  
ATOM 3675  N N    . GLU A 1 71 ? -11.047 4.257   7.230   1.00 0.00 ? 71 GLU A N    3  
ATOM 3676  C CA   . GLU A 1 71 ? -11.991 5.298   6.842   1.00 0.00 ? 71 GLU A CA   3  
ATOM 3677  C C    . GLU A 1 71 ? -11.259 6.564   6.410   1.00 0.00 ? 71 GLU A C    3  
ATOM 3678  O O    . GLU A 1 71 ? -10.604 7.221   7.219   1.00 0.00 ? 71 GLU A O    3  
ATOM 3679  C CB   . GLU A 1 71 ? -12.939 5.613   8.001   1.00 0.00 ? 71 GLU A CB   3  
ATOM 3680  C CG   . GLU A 1 71 ? -14.091 6.526   7.613   1.00 0.00 ? 71 GLU A CG   3  
ATOM 3681  C CD   . GLU A 1 71 ? -14.976 6.879   8.792   1.00 0.00 ? 71 GLU A CD   3  
ATOM 3682  O OE1  . GLU A 1 71 ? -14.652 7.849   9.508   1.00 0.00 ? 71 GLU A OE1  3  
ATOM 3683  O OE2  . GLU A 1 71 ? -15.994 6.186   8.999   1.00 0.00 ? 71 GLU A OE2  3  
ATOM 3684  H H    . GLU A 1 71 ? -10.630 4.297   8.116   1.00 0.00 ? 71 GLU A H    3  
ATOM 3685  H HA   . GLU A 1 71 ? -12.568 4.927   6.008   1.00 0.00 ? 71 GLU A HA   3  
ATOM 3686  H HB2  . GLU A 1 71 ? -13.352 4.688   8.375   1.00 0.00 ? 71 GLU A HB2  3  
ATOM 3687  H HB3  . GLU A 1 71 ? -12.379 6.093   8.789   1.00 0.00 ? 71 GLU A HB3  3  
ATOM 3688  H HG2  . GLU A 1 71 ? -13.688 7.438   7.199   1.00 0.00 ? 71 GLU A HG2  3  
ATOM 3689  H HG3  . GLU A 1 71 ? -14.693 6.028   6.867   1.00 0.00 ? 71 GLU A HG3  3  
ATOM 3690  N N    . CYS A 1 72 ? -11.377 6.901   5.129   1.00 0.00 ? 72 CYS A N    3  
ATOM 3691  C CA   . CYS A 1 72 ? -10.725 8.090   4.590   1.00 0.00 ? 72 CYS A CA   3  
ATOM 3692  C C    . CYS A 1 72 ? -11.471 8.610   3.363   1.00 0.00 ? 72 CYS A C    3  
ATOM 3693  O O    . CYS A 1 72 ? -12.329 7.922   2.810   1.00 0.00 ? 72 CYS A O    3  
ATOM 3694  C CB   . CYS A 1 72 ? -9.273  7.778   4.224   1.00 0.00 ? 72 CYS A CB   3  
ATOM 3695  S SG   . CYS A 1 72 ? -8.090  8.111   5.552   1.00 0.00 ? 72 CYS A SG   3  
ATOM 3696  H H    . CYS A 1 72 ? -11.913 6.338   4.533   1.00 0.00 ? 72 CYS A H    3  
ATOM 3697  H HA   . CYS A 1 72 ? -10.740 8.851   5.355   1.00 0.00 ? 72 CYS A HA   3  
ATOM 3698  H HB2  . CYS A 1 72 ? -9.191  6.734   3.966   1.00 0.00 ? 72 CYS A HB2  3  
ATOM 3699  H HB3  . CYS A 1 72 ? -8.988  8.377   3.371   1.00 0.00 ? 72 CYS A HB3  3  
ATOM 3700  H HG   . CYS A 1 72 ? -7.227  7.808   5.261   1.00 0.00 ? 72 CYS A HG   3  
ATOM 3701  N N    . PRO A 1 73 ? -11.152 9.839   2.922   1.00 0.00 ? 73 PRO A N    3  
ATOM 3702  C CA   . PRO A 1 73 ? -11.797 10.451  1.754   1.00 0.00 ? 73 PRO A CA   3  
ATOM 3703  C C    . PRO A 1 73 ? -11.764 9.540   0.532   1.00 0.00 ? 73 PRO A C    3  
ATOM 3704  O O    . PRO A 1 73 ? -11.077 8.519   0.524   1.00 0.00 ? 73 PRO A O    3  
ATOM 3705  C CB   . PRO A 1 73 ? -10.963 11.710  1.506   1.00 0.00 ? 73 PRO A CB   3  
ATOM 3706  C CG   . PRO A 1 73 ? -10.375 12.042  2.834   1.00 0.00 ? 73 PRO A CG   3  
ATOM 3707  C CD   . PRO A 1 73 ? -10.141 10.728  3.524   1.00 0.00 ? 73 PRO A CD   3  
ATOM 3708  H HA   . PRO A 1 73 ? -12.819 10.728  1.967   1.00 0.00 ? 73 PRO A HA   3  
ATOM 3709  H HB2  . PRO A 1 73 ? -10.196 11.497  0.776   1.00 0.00 ? 73 PRO A HB2  3  
ATOM 3710  H HB3  . PRO A 1 73 ? -11.601 12.503  1.148   1.00 0.00 ? 73 PRO A HB3  3  
ATOM 3711  H HG2  . PRO A 1 73 ? -9.442  12.569  2.701   1.00 0.00 ? 73 PRO A HG2  3  
ATOM 3712  H HG3  . PRO A 1 73 ? -11.069 12.645  3.402   1.00 0.00 ? 73 PRO A HG3  3  
ATOM 3713  H HD2  . PRO A 1 73 ? -9.142  10.368  3.321   1.00 0.00 ? 73 PRO A HD2  3  
ATOM 3714  H HD3  . PRO A 1 73 ? -10.298 10.826  4.588   1.00 0.00 ? 73 PRO A HD3  3  
ATOM 3715  N N    . ALA A 1 74 ? -12.511 9.918   -0.501  1.00 0.00 ? 74 ALA A N    3  
ATOM 3716  C CA   . ALA A 1 74 ? -12.568 9.136   -1.730  1.00 0.00 ? 74 ALA A CA   3  
ATOM 3717  C C    . ALA A 1 74 ? -11.366 9.426   -2.622  1.00 0.00 ? 74 ALA A C    3  
ATOM 3718  O O    . ALA A 1 74 ? -10.793 10.515  -2.574  1.00 0.00 ? 74 ALA A O    3  
ATOM 3719  C CB   . ALA A 1 74 ? -13.862 9.419   -2.476  1.00 0.00 ? 74 ALA A CB   3  
ATOM 3720  H H    . ALA A 1 74 ? -13.036 10.742  -0.435  1.00 0.00 ? 74 ALA A H    3  
ATOM 3721  H HA   . ALA A 1 74 ? -12.557 8.089   -1.459  1.00 0.00 ? 74 ALA A HA   3  
ATOM 3722  H HB1  . ALA A 1 74 ? -13.909 8.805   -3.363  1.00 0.00 ? 74 ALA A HB1  3  
ATOM 3723  H HB2  . ALA A 1 74 ? -13.895 10.461  -2.757  1.00 0.00 ? 74 ALA A HB2  3  
ATOM 3724  H HB3  . ALA A 1 74 ? -14.703 9.192   -1.837  1.00 0.00 ? 74 ALA A HB3  3  
ATOM 3725  N N    . LEU A 1 75 ? -10.989 8.446   -3.436  1.00 0.00 ? 75 LEU A N    3  
ATOM 3726  C CA   . LEU A 1 75 ? -9.855  8.597   -4.341  1.00 0.00 ? 75 LEU A CA   3  
ATOM 3727  C C    . LEU A 1 75 ? -8.572  8.882   -3.566  1.00 0.00 ? 75 LEU A C    3  
ATOM 3728  O O    . LEU A 1 75 ? -7.654  9.521   -4.080  1.00 0.00 ? 75 LEU A O    3  
ATOM 3729  C CB   . LEU A 1 75 ? -10.120 9.723   -5.340  1.00 0.00 ? 75 LEU A CB   3  
ATOM 3730  C CG   . LEU A 1 75 ? -11.151 9.398   -6.424  1.00 0.00 ? 75 LEU A CG   3  
ATOM 3731  C CD1  . LEU A 1 75 ? -11.296 10.565  -7.389  1.00 0.00 ? 75 LEU A CD1  3  
ATOM 3732  C CD2  . LEU A 1 75 ? -10.756 8.133   -7.170  1.00 0.00 ? 75 LEU A CD2  3  
ATOM 3733  H H    . LEU A 1 75 ? -11.485 7.601   -3.429  1.00 0.00 ? 75 LEU A H    3  
ATOM 3734  H HA   . LEU A 1 75 ? -9.736  7.669   -4.880  1.00 0.00 ? 75 LEU A HA   3  
ATOM 3735  H HB2  . LEU A 1 75 ? -10.465 10.588  -4.792  1.00 0.00 ? 75 LEU A HB2  3  
ATOM 3736  H HB3  . LEU A 1 75 ? -9.189  9.973   -5.825  1.00 0.00 ? 75 LEU A HB3  3  
ATOM 3737  H HG   . LEU A 1 75 ? -12.111 9.229   -5.958  1.00 0.00 ? 75 LEU A HG   3  
ATOM 3738  H HD11 . LEU A 1 75 ? -12.183 10.428  -7.988  1.00 0.00 ? 75 LEU A HD11 3  
ATOM 3739  H HD12 . LEU A 1 75 ? -10.430 10.610  -8.032  1.00 0.00 ? 75 LEU A HD12 3  
ATOM 3740  H HD13 . LEU A 1 75 ? -11.378 11.485  -6.830  1.00 0.00 ? 75 LEU A HD13 3  
ATOM 3741  H HD21 . LEU A 1 75 ? -11.063 8.213   -8.202  1.00 0.00 ? 75 LEU A HD21 3  
ATOM 3742  H HD22 . LEU A 1 75 ? -11.241 7.281   -6.716  1.00 0.00 ? 75 LEU A HD22 3  
ATOM 3743  H HD23 . LEU A 1 75 ? -9.685  8.005   -7.122  1.00 0.00 ? 75 LEU A HD23 3  
ATOM 3744  N N    . GLN A 1 76 ? -8.515  8.405   -2.327  1.00 0.00 ? 76 GLN A N    3  
ATOM 3745  C CA   . GLN A 1 76 ? -7.344  8.610   -1.481  1.00 0.00 ? 76 GLN A CA   3  
ATOM 3746  C C    . GLN A 1 76 ? -6.847  7.289   -0.906  1.00 0.00 ? 76 GLN A C    3  
ATOM 3747  O O    . GLN A 1 76 ? -5.643  7.038   -0.847  1.00 0.00 ? 76 GLN A O    3  
ATOM 3748  C CB   . GLN A 1 76 ? -7.670  9.584   -0.349  1.00 0.00 ? 76 GLN A CB   3  
ATOM 3749  C CG   . GLN A 1 76 ? -7.524  11.045  -0.741  1.00 0.00 ? 76 GLN A CG   3  
ATOM 3750  C CD   . GLN A 1 76 ? -7.694  11.985  0.436   1.00 0.00 ? 76 GLN A CD   3  
ATOM 3751  O OE1  . GLN A 1 76 ? -8.497  12.917  0.390   1.00 0.00 ? 76 GLN A OE1  3  
ATOM 3752  N NE2  . GLN A 1 76 ? -6.936  11.745  1.500   1.00 0.00 ? 76 GLN A NE2  3  
ATOM 3753  H H    . GLN A 1 76 ? -9.278  7.903   -1.972  1.00 0.00 ? 76 GLN A H    3  
ATOM 3754  H HA   . GLN A 1 76 ? -6.565  9.034   -2.095  1.00 0.00 ? 76 GLN A HA   3  
ATOM 3755  H HB2  . GLN A 1 76 ? -8.688  9.420   -0.030  1.00 0.00 ? 76 GLN A HB2  3  
ATOM 3756  H HB3  . GLN A 1 76 ? -7.007  9.389   0.481   1.00 0.00 ? 76 GLN A HB3  3  
ATOM 3757  H HG2  . GLN A 1 76 ? -6.541  11.196  -1.162  1.00 0.00 ? 76 GLN A HG2  3  
ATOM 3758  H HG3  . GLN A 1 76 ? -8.272  11.282  -1.484  1.00 0.00 ? 76 GLN A HG3  3  
ATOM 3759  H HE21 . GLN A 1 76 ? -6.318  10.986  1.466   1.00 0.00 ? 76 GLN A HE21 3  
ATOM 3760  H HE22 . GLN A 1 76 ? -7.027  12.337  2.276   1.00 0.00 ? 76 GLN A HE22 3  
ATOM 3761  N N    . GLY A 1 77 ? -7.783  6.448   -0.482  1.00 0.00 ? 77 GLY A N    3  
ATOM 3762  C CA   . GLY A 1 77 ? -7.424  5.162   0.085   1.00 0.00 ? 77 GLY A CA   3  
ATOM 3763  C C    . GLY A 1 77 ? -6.920  4.187   -0.961  1.00 0.00 ? 77 GLY A C    3  
ATOM 3764  O O    . GLY A 1 77 ? -7.659  3.310   -1.408  1.00 0.00 ? 77 GLY A O    3  
ATOM 3765  H H    . GLY A 1 77 ? -8.725  6.705   -0.555  1.00 0.00 ? 77 GLY A H    3  
ATOM 3766  H HA2  . GLY A 1 77 ? -6.651  5.310   0.826   1.00 0.00 ? 77 GLY A HA2  3  
ATOM 3767  H HA3  . GLY A 1 77 ? -8.293  4.739   0.567   1.00 0.00 ? 77 GLY A HA3  3  
ATOM 3768  N N    . ILE A 1 78 ? -5.659  4.340   -1.351  1.00 0.00 ? 78 ILE A N    3  
ATOM 3769  C CA   . ILE A 1 78 ? -5.057  3.466   -2.350  1.00 0.00 ? 78 ILE A CA   3  
ATOM 3770  C C    . ILE A 1 78 ? -4.407  2.250   -1.697  1.00 0.00 ? 78 ILE A C    3  
ATOM 3771  O O    . ILE A 1 78 ? -3.956  2.315   -0.553  1.00 0.00 ? 78 ILE A O    3  
ATOM 3772  C CB   . ILE A 1 78 ? -4.001  4.216   -3.190  1.00 0.00 ? 78 ILE A CB   3  
ATOM 3773  C CG1  . ILE A 1 78 ? -3.469  3.316   -4.307  1.00 0.00 ? 78 ILE A CG1  3  
ATOM 3774  C CG2  . ILE A 1 78 ? -2.862  4.703   -2.305  1.00 0.00 ? 78 ILE A CG2  3  
ATOM 3775  C CD1  . ILE A 1 78 ? -2.994  4.080   -5.523  1.00 0.00 ? 78 ILE A CD1  3  
ATOM 3776  H H    . ILE A 1 78 ? -5.120  5.058   -0.957  1.00 0.00 ? 78 ILE A H    3  
ATOM 3777  H HA   . ILE A 1 78 ? -5.840  3.130   -3.013  1.00 0.00 ? 78 ILE A HA   3  
ATOM 3778  H HB   . ILE A 1 78 ? -4.475  5.080   -3.630  1.00 0.00 ? 78 ILE A HB   3  
ATOM 3779  H HG12 . ILE A 1 78 ? -2.637  2.741   -3.931  1.00 0.00 ? 78 ILE A HG12 3  
ATOM 3780  H HG13 . ILE A 1 78 ? -4.254  2.642   -4.622  1.00 0.00 ? 78 ILE A HG13 3  
ATOM 3781  H HG21 . ILE A 1 78 ? -3.184  4.710   -1.274  1.00 0.00 ? 78 ILE A HG21 3  
ATOM 3782  H HG22 . ILE A 1 78 ? -2.579  5.703   -2.600  1.00 0.00 ? 78 ILE A HG22 3  
ATOM 3783  H HG23 . ILE A 1 78 ? -2.015  4.043   -2.414  1.00 0.00 ? 78 ILE A HG23 3  
ATOM 3784  H HD11 . ILE A 1 78 ? -2.919  3.407   -6.365  1.00 0.00 ? 78 ILE A HD11 3  
ATOM 3785  H HD12 . ILE A 1 78 ? -2.024  4.511   -5.322  1.00 0.00 ? 78 ILE A HD12 3  
ATOM 3786  H HD13 . ILE A 1 78 ? -3.697  4.867   -5.752  1.00 0.00 ? 78 ILE A HD13 3  
ATOM 3787  N N    . PHE A 1 79 ? -4.365  1.142   -2.429  1.00 0.00 ? 79 PHE A N    3  
ATOM 3788  C CA   . PHE A 1 79 ? -3.772  -0.090  -1.920  1.00 0.00 ? 79 PHE A CA   3  
ATOM 3789  C C    . PHE A 1 79 ? -2.578  -0.511  -2.772  1.00 0.00 ? 79 PHE A C    3  
ATOM 3790  O O    . PHE A 1 79 ? -2.649  -0.515  -4.001  1.00 0.00 ? 79 PHE A O    3  
ATOM 3791  C CB   . PHE A 1 79 ? -4.815  -1.209  -1.891  1.00 0.00 ? 79 PHE A CB   3  
ATOM 3792  C CG   . PHE A 1 79 ? -5.419  -1.431  -0.534  1.00 0.00 ? 79 PHE A CG   3  
ATOM 3793  C CD1  . PHE A 1 79 ? -4.753  -2.184  0.420   1.00 0.00 ? 79 PHE A CD1  3  
ATOM 3794  C CD2  . PHE A 1 79 ? -6.652  -0.886  -0.212  1.00 0.00 ? 79 PHE A CD2  3  
ATOM 3795  C CE1  . PHE A 1 79 ? -5.306  -2.391  1.669   1.00 0.00 ? 79 PHE A CE1  3  
ATOM 3796  C CE2  . PHE A 1 79 ? -7.210  -1.090  1.037   1.00 0.00 ? 79 PHE A CE2  3  
ATOM 3797  C CZ   . PHE A 1 79 ? -6.536  -1.843  1.978   1.00 0.00 ? 79 PHE A CZ   3  
ATOM 3798  H H    . PHE A 1 79 ? -4.742  1.152   -3.334  1.00 0.00 ? 79 PHE A H    3  
ATOM 3799  H HA   . PHE A 1 79 ? -3.431  0.098   -0.913  1.00 0.00 ? 79 PHE A HA   3  
ATOM 3800  H HB2  . PHE A 1 79 ? -5.615  -0.963  -2.574  1.00 0.00 ? 79 PHE A HB2  3  
ATOM 3801  H HB3  . PHE A 1 79 ? -4.353  -2.133  -2.205  1.00 0.00 ? 79 PHE A HB3  3  
ATOM 3802  H HD1  . PHE A 1 79 ? -3.792  -2.614  0.179   1.00 0.00 ? 79 PHE A HD1  3  
ATOM 3803  H HD2  . PHE A 1 79 ? -7.179  -0.298  -0.947  1.00 0.00 ? 79 PHE A HD2  3  
ATOM 3804  H HE1  . PHE A 1 79 ? -4.777  -2.980  2.404   1.00 0.00 ? 79 PHE A HE1  3  
ATOM 3805  H HE2  . PHE A 1 79 ? -8.171  -0.659  1.276   1.00 0.00 ? 79 PHE A HE2  3  
ATOM 3806  H HZ   . PHE A 1 79 ? -6.970  -2.003  2.954   1.00 0.00 ? 79 PHE A HZ   3  
ATOM 3807  N N    . THR A 1 80 ? -1.483  -0.867  -2.109  1.00 0.00 ? 80 THR A N    3  
ATOM 3808  C CA   . THR A 1 80 ? -0.272  -1.292  -2.803  1.00 0.00 ? 80 THR A CA   3  
ATOM 3809  C C    . THR A 1 80 ? 0.600   -2.154  -1.897  1.00 0.00 ? 80 THR A C    3  
ATOM 3810  O O    . THR A 1 80 ? 0.318   -2.305  -0.708  1.00 0.00 ? 80 THR A O    3  
ATOM 3811  C CB   . THR A 1 80 ? 0.519   -0.075  -3.285  1.00 0.00 ? 80 THR A CB   3  
ATOM 3812  O OG1  . THR A 1 80 ? 1.729   -0.476  -3.903  1.00 0.00 ? 80 THR A OG1  3  
ATOM 3813  C CG2  . THR A 1 80 ? 0.869   0.890   -2.173  1.00 0.00 ? 80 THR A CG2  3  
ATOM 3814  H H    . THR A 1 80 ? -1.487  -0.844  -1.129  1.00 0.00 ? 80 THR A H    3  
ATOM 3815  H HA   . THR A 1 80 ? -0.570  -1.879  -3.660  1.00 0.00 ? 80 THR A HA   3  
ATOM 3816  H HB   . THR A 1 80 ? -0.073  0.460   -4.013  1.00 0.00 ? 80 THR A HB   3  
ATOM 3817  H HG1  . THR A 1 80 ? 2.177   0.295   -4.259  1.00 0.00 ? 80 THR A HG1  3  
ATOM 3818  H HG21 . THR A 1 80 ? 1.653   1.554   -2.506  1.00 0.00 ? 80 THR A HG21 3  
ATOM 3819  H HG22 . THR A 1 80 ? 1.208   0.336   -1.310  1.00 0.00 ? 80 THR A HG22 3  
ATOM 3820  H HG23 . THR A 1 80 ? -0.005  1.468   -1.909  1.00 0.00 ? 80 THR A HG23 3  
ATOM 3821  N N    . ARG A 1 81 ? 1.661   -2.719  -2.465  1.00 0.00 ? 81 ARG A N    3  
ATOM 3822  C CA   . ARG A 1 81 ? 2.573   -3.567  -1.706  1.00 0.00 ? 81 ARG A CA   3  
ATOM 3823  C C    . ARG A 1 81 ? 3.497   -2.724  -0.829  1.00 0.00 ? 81 ARG A C    3  
ATOM 3824  O O    . ARG A 1 81 ? 3.926   -1.641  -1.228  1.00 0.00 ? 81 ARG A O    3  
ATOM 3825  C CB   . ARG A 1 81 ? 3.403   -4.435  -2.654  1.00 0.00 ? 81 ARG A CB   3  
ATOM 3826  C CG   . ARG A 1 81 ? 2.587   -5.070  -3.769  1.00 0.00 ? 81 ARG A CG   3  
ATOM 3827  C CD   . ARG A 1 81 ? 2.986   -4.529  -5.133  1.00 0.00 ? 81 ARG A CD   3  
ATOM 3828  N NE   . ARG A 1 81 ? 2.392   -5.300  -6.223  1.00 0.00 ? 81 ARG A NE   3  
ATOM 3829  C CZ   . ARG A 1 81 ? 2.351   -4.884  -7.487  1.00 0.00 ? 81 ARG A CZ   3  
ATOM 3830  N NH1  . ARG A 1 81 ? 2.867   -3.709  -7.824  1.00 0.00 ? 81 ARG A NH1  3  
ATOM 3831  N NH2  . ARG A 1 81 ? 1.792   -5.646  -8.416  1.00 0.00 ? 81 ARG A NH2  3  
ATOM 3832  H H    . ARG A 1 81 ? 1.833   -2.562  -3.417  1.00 0.00 ? 81 ARG A H    3  
ATOM 3833  H HA   . ARG A 1 81 ? 1.978   -4.207  -1.074  1.00 0.00 ? 81 ARG A HA   3  
ATOM 3834  H HB2  . ARG A 1 81 ? 4.174   -3.824  -3.101  1.00 0.00 ? 81 ARG A HB2  3  
ATOM 3835  H HB3  . ARG A 1 81 ? 3.868   -5.225  -2.083  1.00 0.00 ? 81 ARG A HB3  3  
ATOM 3836  H HG2  . ARG A 1 81 ? 2.748   -6.138  -3.757  1.00 0.00 ? 81 ARG A HG2  3  
ATOM 3837  H HG3  . ARG A 1 81 ? 1.541   -4.860  -3.601  1.00 0.00 ? 81 ARG A HG3  3  
ATOM 3838  H HD2  . ARG A 1 81 ? 2.658   -3.503  -5.209  1.00 0.00 ? 81 ARG A HD2  3  
ATOM 3839  H HD3  . ARG A 1 81 ? 4.063   -4.570  -5.220  1.00 0.00 ? 81 ARG A HD3  3  
ATOM 3840  H HE   . ARG A 1 81 ? 2.004   -6.171  -6.002  1.00 0.00 ? 81 ARG A HE   3  
ATOM 3841  H HH11 . ARG A 1 81 ? 3.290   -3.128  -7.128  1.00 0.00 ? 81 ARG A HH11 3  
ATOM 3842  H HH12 . ARG A 1 81 ? 2.833   -3.403  -8.775  1.00 0.00 ? 81 ARG A HH12 3  
ATOM 3843  H HH21 . ARG A 1 81 ? 1.403   -6.533  -8.168  1.00 0.00 ? 81 ARG A HH21 3  
ATOM 3844  H HH22 . ARG A 1 81 ? 1.761   -5.335  -9.367  1.00 0.00 ? 81 ARG A HH22 3  
ATOM 3845  N N    . PRO A 1 82 ? 3.818   -3.210  0.384   1.00 0.00 ? 82 PRO A N    3  
ATOM 3846  C CA   . PRO A 1 82 ? 4.696   -2.492  1.314   1.00 0.00 ? 82 PRO A CA   3  
ATOM 3847  C C    . PRO A 1 82 ? 6.028   -2.112  0.677   1.00 0.00 ? 82 PRO A C    3  
ATOM 3848  O O    . PRO A 1 82 ? 6.532   -1.007  0.880   1.00 0.00 ? 82 PRO A O    3  
ATOM 3849  C CB   . PRO A 1 82 ? 4.916   -3.497  2.449   1.00 0.00 ? 82 PRO A CB   3  
ATOM 3850  C CG   . PRO A 1 82 ? 3.731   -4.397  2.394   1.00 0.00 ? 82 PRO A CG   3  
ATOM 3851  C CD   . PRO A 1 82 ? 3.352   -4.494  0.943   1.00 0.00 ? 82 PRO A CD   3  
ATOM 3852  H HA   . PRO A 1 82 ? 4.218   -1.605  1.702   1.00 0.00 ? 82 PRO A HA   3  
ATOM 3853  H HB2  . PRO A 1 82 ? 5.835   -4.039  2.279   1.00 0.00 ? 82 PRO A HB2  3  
ATOM 3854  H HB3  . PRO A 1 82 ? 4.969   -2.974  3.391   1.00 0.00 ? 82 PRO A HB3  3  
ATOM 3855  H HG2  . PRO A 1 82 ? 3.995   -5.373  2.778   1.00 0.00 ? 82 PRO A HG2  3  
ATOM 3856  H HG3  . PRO A 1 82 ? 2.920   -3.974  2.966   1.00 0.00 ? 82 PRO A HG3  3  
ATOM 3857  H HD2  . PRO A 1 82 ? 3.858   -5.325  0.473   1.00 0.00 ? 82 PRO A HD2  3  
ATOM 3858  H HD3  . PRO A 1 82 ? 2.282   -4.593  0.839   1.00 0.00 ? 82 PRO A HD3  3  
ATOM 3859  N N    . SER A 1 83 ? 6.595   -3.035  -0.093  1.00 0.00 ? 83 SER A N    3  
ATOM 3860  C CA   . SER A 1 83 ? 7.870   -2.798  -0.761  1.00 0.00 ? 83 SER A CA   3  
ATOM 3861  C C    . SER A 1 83 ? 7.783   -1.593  -1.693  1.00 0.00 ? 83 SER A C    3  
ATOM 3862  O O    . SER A 1 83 ? 8.759   -0.865  -1.873  1.00 0.00 ? 83 SER A O    3  
ATOM 3863  C CB   . SER A 1 83 ? 8.294   -4.038  -1.550  1.00 0.00 ? 83 SER A CB   3  
ATOM 3864  O OG   . SER A 1 83 ? 7.487   -4.210  -2.703  1.00 0.00 ? 83 SER A OG   3  
ATOM 3865  H H    . SER A 1 83 ? 6.144   -3.898  -0.217  1.00 0.00 ? 83 SER A H    3  
ATOM 3866  H HA   . SER A 1 83 ? 8.608   -2.597  0.001   1.00 0.00 ? 83 SER A HA   3  
ATOM 3867  H HB2  . SER A 1 83 ? 9.323   -3.931  -1.860  1.00 0.00 ? 83 SER A HB2  3  
ATOM 3868  H HB3  . SER A 1 83 ? 8.196   -4.912  -0.923  1.00 0.00 ? 83 SER A HB3  3  
ATOM 3869  H HG   . SER A 1 83 ? 7.829   -4.938  -3.226  1.00 0.00 ? 83 SER A HG   3  
ATOM 3870  N N    . LYS A 1 84 ? 6.610   -1.389  -2.281  1.00 0.00 ? 84 LYS A N    3  
ATOM 3871  C CA   . LYS A 1 84 ? 6.397   -0.272  -3.195  1.00 0.00 ? 84 LYS A CA   3  
ATOM 3872  C C    . LYS A 1 84 ? 6.523   1.061   -2.464  1.00 0.00 ? 84 LYS A C    3  
ATOM 3873  O O    . LYS A 1 84 ? 6.946   2.060   -3.045  1.00 0.00 ? 84 LYS A O    3  
ATOM 3874  C CB   . LYS A 1 84 ? 5.021   -0.379  -3.853  1.00 0.00 ? 84 LYS A CB   3  
ATOM 3875  C CG   . LYS A 1 84 ? 4.792   -1.698  -4.574  1.00 0.00 ? 84 LYS A CG   3  
ATOM 3876  C CD   . LYS A 1 84 ? 5.304   -1.647  -6.005  1.00 0.00 ? 84 LYS A CD   3  
ATOM 3877  C CE   . LYS A 1 84 ? 5.957   -2.958  -6.410  1.00 0.00 ? 84 LYS A CE   3  
ATOM 3878  N NZ   . LYS A 1 84 ? 7.147   -2.740  -7.278  1.00 0.00 ? 84 LYS A NZ   3  
ATOM 3879  H H    . LYS A 1 84 ? 5.869   -2.004  -2.098  1.00 0.00 ? 84 LYS A H    3  
ATOM 3880  H HA   . LYS A 1 84 ? 7.157   -0.323  -3.961  1.00 0.00 ? 84 LYS A HA   3  
ATOM 3881  H HB2  . LYS A 1 84 ? 4.262   -0.274  -3.092  1.00 0.00 ? 84 LYS A HB2  3  
ATOM 3882  H HB3  . LYS A 1 84 ? 4.914   0.421   -4.570  1.00 0.00 ? 84 LYS A HB3  3  
ATOM 3883  H HG2  . LYS A 1 84 ? 5.312   -2.482  -4.044  1.00 0.00 ? 84 LYS A HG2  3  
ATOM 3884  H HG3  . LYS A 1 84 ? 3.733   -1.911  -4.587  1.00 0.00 ? 84 LYS A HG3  3  
ATOM 3885  H HD2  . LYS A 1 84 ? 4.473   -1.451  -6.667  1.00 0.00 ? 84 LYS A HD2  3  
ATOM 3886  H HD3  . LYS A 1 84 ? 6.029   -0.851  -6.090  1.00 0.00 ? 84 LYS A HD3  3  
ATOM 3887  H HE2  . LYS A 1 84 ? 6.266   -3.482  -5.518  1.00 0.00 ? 84 LYS A HE2  3  
ATOM 3888  H HE3  . LYS A 1 84 ? 5.235   -3.556  -6.946  1.00 0.00 ? 84 LYS A HE3  3  
ATOM 3889  H HZ1  . LYS A 1 84 ? 7.885   -3.440  -7.056  1.00 0.00 ? 84 LYS A HZ1  3  
ATOM 3890  H HZ2  . LYS A 1 84 ? 7.533   -1.786  -7.125  1.00 0.00 ? 84 LYS A HZ2  3  
ATOM 3891  H HZ3  . LYS A 1 84 ? 6.883   -2.839  -8.280  1.00 0.00 ? 84 LYS A HZ3  3  
ATOM 3892  N N    . LEU A 1 85 ? 6.154   1.067   -1.188  1.00 0.00 ? 85 LEU A N    3  
ATOM 3893  C CA   . LEU A 1 85 ? 6.226   2.278   -0.377  1.00 0.00 ? 85 LEU A CA   3  
ATOM 3894  C C    . LEU A 1 85 ? 7.669   2.589   0.007   1.00 0.00 ? 85 LEU A C    3  
ATOM 3895  O O    . LEU A 1 85 ? 8.484   1.684   0.184   1.00 0.00 ? 85 LEU A O    3  
ATOM 3896  C CB   . LEU A 1 85 ? 5.371   2.126   0.882   1.00 0.00 ? 85 LEU A CB   3  
ATOM 3897  C CG   . LEU A 1 85 ? 3.970   1.557   0.650   1.00 0.00 ? 85 LEU A CG   3  
ATOM 3898  C CD1  . LEU A 1 85 ? 3.292   1.250   1.976   1.00 0.00 ? 85 LEU A CD1  3  
ATOM 3899  C CD2  . LEU A 1 85 ? 3.131   2.528   -0.167  1.00 0.00 ? 85 LEU A CD2  3  
ATOM 3900  H H    . LEU A 1 85 ? 5.825   0.238   -0.780  1.00 0.00 ? 85 LEU A H    3  
ATOM 3901  H HA   . LEU A 1 85 ? 5.838   3.095   -0.968  1.00 0.00 ? 85 LEU A HA   3  
ATOM 3902  H HB2  . LEU A 1 85 ? 5.893   1.475   1.569   1.00 0.00 ? 85 LEU A HB2  3  
ATOM 3903  H HB3  . LEU A 1 85 ? 5.269   3.097   1.342   1.00 0.00 ? 85 LEU A HB3  3  
ATOM 3904  H HG   . LEU A 1 85 ? 4.051   0.634   0.094   1.00 0.00 ? 85 LEU A HG   3  
ATOM 3905  H HD11 . LEU A 1 85 ? 3.481   0.221   2.246   1.00 0.00 ? 85 LEU A HD11 3  
ATOM 3906  H HD12 . LEU A 1 85 ? 2.228   1.408   1.881   1.00 0.00 ? 85 LEU A HD12 3  
ATOM 3907  H HD13 . LEU A 1 85 ? 3.686   1.902   2.742   1.00 0.00 ? 85 LEU A HD13 3  
ATOM 3908  H HD21 . LEU A 1 85 ? 3.528   2.592   -1.170  1.00 0.00 ? 85 LEU A HD21 3  
ATOM 3909  H HD22 . LEU A 1 85 ? 3.159   3.504   0.293   1.00 0.00 ? 85 LEU A HD22 3  
ATOM 3910  H HD23 . LEU A 1 85 ? 2.111   2.178   -0.206  1.00 0.00 ? 85 LEU A HD23 3  
ATOM 3911  N N    . THR A 1 86 ? 7.978   3.876   0.134   1.00 0.00 ? 86 THR A N    3  
ATOM 3912  C CA   . THR A 1 86 ? 9.323   4.307   0.497   1.00 0.00 ? 86 THR A CA   3  
ATOM 3913  C C    . THR A 1 86 ? 9.276   5.487   1.462   1.00 0.00 ? 86 THR A C    3  
ATOM 3914  O O    . THR A 1 86 ? 8.250   6.155   1.591   1.00 0.00 ? 86 THR A O    3  
ATOM 3915  C CB   . THR A 1 86 ? 10.114  4.689   -0.756  1.00 0.00 ? 86 THR A CB   3  
ATOM 3916  O OG1  . THR A 1 86 ? 9.308   5.438   -1.648  1.00 0.00 ? 86 THR A OG1  3  
ATOM 3917  C CG2  . THR A 1 86 ? 10.647  3.492   -1.514  1.00 0.00 ? 86 THR A CG2  3  
ATOM 3918  H H    . THR A 1 86 ? 7.285   4.552   -0.021  1.00 0.00 ? 86 THR A H    3  
ATOM 3919  H HA   . THR A 1 86 ? 9.815   3.479   0.983   1.00 0.00 ? 86 THR A HA   3  
ATOM 3920  H HB   . THR A 1 86 ? 10.956  5.298   -0.464  1.00 0.00 ? 86 THR A HB   3  
ATOM 3921  H HG1  . THR A 1 86 ? 9.594   6.354   -1.643  1.00 0.00 ? 86 THR A HG1  3  
ATOM 3922  H HG21 . THR A 1 86 ? 11.684  3.660   -1.767  1.00 0.00 ? 86 THR A HG21 3  
ATOM 3923  H HG22 . THR A 1 86 ? 10.074  3.354   -2.419  1.00 0.00 ? 86 THR A HG22 3  
ATOM 3924  H HG23 . THR A 1 86 ? 10.566  2.609   -0.897  1.00 0.00 ? 86 THR A HG23 3  
ATOM 3925  N N    . ARG A 1 87 ? 10.393  5.737   2.137   1.00 0.00 ? 87 ARG A N    3  
ATOM 3926  C CA   . ARG A 1 87 ? 10.480  6.838   3.090   1.00 0.00 ? 87 ARG A CA   3  
ATOM 3927  C C    . ARG A 1 87 ? 11.237  8.019   2.490   1.00 0.00 ? 87 ARG A C    3  
ATOM 3928  O O    . ARG A 1 87 ? 11.891  8.779   3.206   1.00 0.00 ? 87 ARG A O    3  
ATOM 3929  C CB   . ARG A 1 87 ? 11.169  6.370   4.376   1.00 0.00 ? 87 ARG A CB   3  
ATOM 3930  C CG   . ARG A 1 87 ? 10.236  6.304   5.576   1.00 0.00 ? 87 ARG A CG   3  
ATOM 3931  C CD   . ARG A 1 87 ? 10.653  7.277   6.670   1.00 0.00 ? 87 ARG A CD   3  
ATOM 3932  N NE   . ARG A 1 87 ? 10.685  6.640   7.985   1.00 0.00 ? 87 ARG A NE   3  
ATOM 3933  C CZ   . ARG A 1 87 ? 10.742  7.312   9.132   1.00 0.00 ? 87 ARG A CZ   3  
ATOM 3934  N NH1  . ARG A 1 87 ? 10.770  8.640   9.132   1.00 0.00 ? 87 ARG A NH1  3  
ATOM 3935  N NH2  . ARG A 1 87 ? 10.769  6.656   10.284  1.00 0.00 ? 87 ARG A NH2  3  
ATOM 3936  H H    . ARG A 1 87 ? 11.178  5.169   1.990   1.00 0.00 ? 87 ARG A H    3  
ATOM 3937  H HA   . ARG A 1 87 ? 9.475   7.152   3.325   1.00 0.00 ? 87 ARG A HA   3  
ATOM 3938  H HB2  . ARG A 1 87 ? 11.578  5.384   4.212   1.00 0.00 ? 87 ARG A HB2  3  
ATOM 3939  H HB3  . ARG A 1 87 ? 11.976  7.049   4.609   1.00 0.00 ? 87 ARG A HB3  3  
ATOM 3940  H HG2  . ARG A 1 87 ? 9.235   6.549   5.254   1.00 0.00 ? 87 ARG A HG2  3  
ATOM 3941  H HG3  . ARG A 1 87 ? 10.251  5.300   5.975   1.00 0.00 ? 87 ARG A HG3  3  
ATOM 3942  H HD2  . ARG A 1 87 ? 11.637  7.658   6.442   1.00 0.00 ? 87 ARG A HD2  3  
ATOM 3943  H HD3  . ARG A 1 87 ? 9.948   8.095   6.693   1.00 0.00 ? 87 ARG A HD3  3  
ATOM 3944  H HE   . ARG A 1 87 ? 10.662  5.661   8.014   1.00 0.00 ? 87 ARG A HE   3  
ATOM 3945  H HH11 . ARG A 1 87 ? 10.750  9.140   8.267   1.00 0.00 ? 87 ARG A HH11 3  
ATOM 3946  H HH12 . ARG A 1 87 ? 10.813  9.138   9.997   1.00 0.00 ? 87 ARG A HH12 3  
ATOM 3947  H HH21 . ARG A 1 87 ? 10.745  5.656   10.290  1.00 0.00 ? 87 ARG A HH21 3  
ATOM 3948  H HH22 . ARG A 1 87 ? 10.811  7.160   11.146  1.00 0.00 ? 87 ARG A HH22 3  
ATOM 3949  N N    . GLN A 1 88 ? 11.143  8.169   1.172   1.00 0.00 ? 88 GLN A N    3  
ATOM 3950  C CA   . GLN A 1 88 ? 11.819  9.259   0.478   1.00 0.00 ? 88 GLN A CA   3  
ATOM 3951  C C    . GLN A 1 88 ? 11.471  9.257   -1.008  1.00 0.00 ? 88 GLN A C    3  
ATOM 3952  O O    . GLN A 1 88 ? 11.210  8.205   -1.592  1.00 0.00 ? 88 GLN A O    3  
ATOM 3953  C CB   . GLN A 1 88 ? 13.334  9.145   0.658   1.00 0.00 ? 88 GLN A CB   3  
ATOM 3954  C CG   . GLN A 1 88 ? 13.919  7.863   0.090   1.00 0.00 ? 88 GLN A CG   3  
ATOM 3955  C CD   . GLN A 1 88 ? 15.403  7.724   0.370   1.00 0.00 ? 88 GLN A CD   3  
ATOM 3956  O OE1  . GLN A 1 88 ? 15.852  6.716   0.914   1.00 0.00 ? 88 GLN A OE1  3  
ATOM 3957  N NE2  . GLN A 1 88 ? 16.172  8.742   0.000   1.00 0.00 ? 88 GLN A NE2  3  
ATOM 3958  H H    . GLN A 1 88 ? 10.607  7.533   0.655   1.00 0.00 ? 88 GLN A H    3  
ATOM 3959  H HA   . GLN A 1 88 ? 11.483  10.189  0.912   1.00 0.00 ? 88 GLN A HA   3  
ATOM 3960  H HB2  . GLN A 1 88 ? 13.807  9.982   0.165   1.00 0.00 ? 88 GLN A HB2  3  
ATOM 3961  H HB3  . GLN A 1 88 ? 13.563  9.183   1.712   1.00 0.00 ? 88 GLN A HB3  3  
ATOM 3962  H HG2  . GLN A 1 88 ? 13.406  7.021   0.529   1.00 0.00 ? 88 GLN A HG2  3  
ATOM 3963  H HG3  . GLN A 1 88 ? 13.768  7.857   -0.980  1.00 0.00 ? 88 GLN A HG3  3  
ATOM 3964  H HE21 . GLN A 1 88 ? 15.746  9.514   -0.427  1.00 0.00 ? 88 GLN A HE21 3  
ATOM 3965  H HE22 . GLN A 1 88 ? 17.136  8.679   0.170   1.00 0.00 ? 88 GLN A HE22 3  
ATOM 3966  N N    . PRO A 1 89 ? 11.462  10.441  -1.643  1.00 0.00 ? 89 PRO A N    3  
ATOM 3967  C CA   . PRO A 1 89 ? 11.144  10.571  -3.069  1.00 0.00 ? 89 PRO A CA   3  
ATOM 3968  C C    . PRO A 1 89 ? 12.242  10.003  -3.962  1.00 0.00 ? 89 PRO A C    3  
ATOM 3969  O O    . PRO A 1 89 ? 13.427  10.108  -3.648  1.00 0.00 ? 89 PRO A O    3  
ATOM 3970  C CB   . PRO A 1 89 ? 11.021  12.083  -3.270  1.00 0.00 ? 89 PRO A CB   3  
ATOM 3971  C CG   . PRO A 1 89 ? 11.868  12.676  -2.199  1.00 0.00 ? 89 PRO A CG   3  
ATOM 3972  C CD   . PRO A 1 89 ? 11.761  11.746  -1.022  1.00 0.00 ? 89 PRO A CD   3  
ATOM 3973  H HA   . PRO A 1 89 ? 10.203  10.096  -3.309  1.00 0.00 ? 89 PRO A HA   3  
ATOM 3974  H HB2  . PRO A 1 89 ? 11.382  12.349  -4.253  1.00 0.00 ? 89 PRO A HB2  3  
ATOM 3975  H HB3  . PRO A 1 89 ? 9.988   12.380  -3.166  1.00 0.00 ? 89 PRO A HB3  3  
ATOM 3976  H HG2  . PRO A 1 89 ? 12.893  12.741  -2.534  1.00 0.00 ? 89 PRO A HG2  3  
ATOM 3977  H HG3  . PRO A 1 89 ? 11.495  13.656  -1.936  1.00 0.00 ? 89 PRO A HG3  3  
ATOM 3978  H HD2  . PRO A 1 89 ? 12.697  11.711  -0.483  1.00 0.00 ? 89 PRO A HD2  3  
ATOM 3979  H HD3  . PRO A 1 89 ? 10.959  12.054  -0.368  1.00 0.00 ? 89 PRO A HD3  3  
ATOM 3980  N N    . SER A 1 90 ? 11.839  9.399   -5.075  1.00 0.00 ? 90 SER A N    3  
ATOM 3981  C CA   . SER A 1 90 ? 12.789  8.813   -6.014  1.00 0.00 ? 90 SER A CA   3  
ATOM 3982  C C    . SER A 1 90 ? 12.743  9.535   -7.356  1.00 0.00 ? 90 SER A C    3  
ATOM 3983  O O    . SER A 1 90 ? 11.667  9.826   -7.880  1.00 0.00 ? 90 SER A O    3  
ATOM 3984  C CB   . SER A 1 90 ? 12.490  7.326   -6.211  1.00 0.00 ? 90 SER A CB   3  
ATOM 3985  O OG   . SER A 1 90 ? 11.099  7.098   -6.352  1.00 0.00 ? 90 SER A OG   3  
ATOM 3986  H H    . SER A 1 90 ? 10.880  9.347   -5.270  1.00 0.00 ? 90 SER A H    3  
ATOM 3987  H HA   . SER A 1 90 ? 13.778  8.920   -5.595  1.00 0.00 ? 90 SER A HA   3  
ATOM 3988  H HB2  . SER A 1 90 ? 12.990  6.976   -7.103  1.00 0.00 ? 90 SER A HB2  3  
ATOM 3989  H HB3  . SER A 1 90 ? 12.849  6.772   -5.357  1.00 0.00 ? 90 SER A HB3  3  
ATOM 3990  H HG   . SER A 1 90 ? 10.946  6.177   -6.574  1.00 0.00 ? 90 SER A HG   3  
ATOM 3991  N N    . GLY A 1 91 ? 13.917  9.824   -7.908  1.00 0.00 ? 91 GLY A N    3  
ATOM 3992  C CA   . GLY A 1 91 ? 13.989  10.510  -9.185  1.00 0.00 ? 91 GLY A CA   3  
ATOM 3993  C C    . GLY A 1 91 ? 15.159  10.045  -10.030 1.00 0.00 ? 91 GLY A C    3  
ATOM 3994  O O    . GLY A 1 91 ? 16.159  9.564   -9.497  1.00 0.00 ? 91 GLY A O    3  
ATOM 3995  H H    . GLY A 1 91 ? 14.742  9.568   -7.445  1.00 0.00 ? 91 GLY A H    3  
ATOM 3996  H HA2  . GLY A 1 91 ? 13.072  10.330  -9.728  1.00 0.00 ? 91 GLY A HA2  3  
ATOM 3997  H HA3  . GLY A 1 91 ? 14.086  11.570  -9.006  1.00 0.00 ? 91 GLY A HA3  3  
ATOM 3998  N N    . PRO A 1 92 ? 15.064  10.176  -11.364 1.00 0.00 ? 92 PRO A N    3  
ATOM 3999  C CA   . PRO A 1 92 ? 16.135  9.761   -12.276 1.00 0.00 ? 92 PRO A CA   3  
ATOM 4000  C C    . PRO A 1 92 ? 17.362  10.661  -12.178 1.00 0.00 ? 92 PRO A C    3  
ATOM 4001  O O    . PRO A 1 92 ? 17.433  11.538  -11.316 1.00 0.00 ? 92 PRO A O    3  
ATOM 4002  C CB   . PRO A 1 92 ? 15.492  9.883   -13.659 1.00 0.00 ? 92 PRO A CB   3  
ATOM 4003  C CG   . PRO A 1 92 ? 14.422  10.906  -13.491 1.00 0.00 ? 92 PRO A CG   3  
ATOM 4004  C CD   . PRO A 1 92 ? 13.908  10.740  -12.087 1.00 0.00 ? 92 PRO A CD   3  
ATOM 4005  H HA   . PRO A 1 92 ? 16.427  8.735   -12.102 1.00 0.00 ? 92 PRO A HA   3  
ATOM 4006  H HB2  . PRO A 1 92 ? 16.234  10.201  -14.377 1.00 0.00 ? 92 PRO A HB2  3  
ATOM 4007  H HB3  . PRO A 1 92 ? 15.082  8.929   -13.955 1.00 0.00 ? 92 PRO A HB3  3  
ATOM 4008  H HG2  . PRO A 1 92 ? 14.835  11.894  -13.624 1.00 0.00 ? 92 PRO A HG2  3  
ATOM 4009  H HG3  . PRO A 1 92 ? 13.629  10.730  -14.202 1.00 0.00 ? 92 PRO A HG3  3  
ATOM 4010  H HD2  . PRO A 1 92 ? 13.625  11.696  -11.673 1.00 0.00 ? 92 PRO A HD2  3  
ATOM 4011  H HD3  . PRO A 1 92 ? 13.073  10.055  -12.070 1.00 0.00 ? 92 PRO A HD3  3  
ATOM 4012  N N    . SER A 1 93 ? 18.327  10.438  -13.065 1.00 0.00 ? 93 SER A N    3  
ATOM 4013  C CA   . SER A 1 93 ? 19.551  11.230  -13.077 1.00 0.00 ? 93 SER A CA   3  
ATOM 4014  C C    . SER A 1 93 ? 19.572  12.182  -14.269 1.00 0.00 ? 93 SER A C    3  
ATOM 4015  O O    . SER A 1 93 ? 19.529  11.751  -15.421 1.00 0.00 ? 93 SER A O    3  
ATOM 4016  C CB   . SER A 1 93 ? 20.775  10.313  -13.120 1.00 0.00 ? 93 SER A CB   3  
ATOM 4017  O OG   . SER A 1 93 ? 21.821  10.819  -12.308 1.00 0.00 ? 93 SER A OG   3  
ATOM 4018  H H    . SER A 1 93 ? 18.211  9.724   -13.726 1.00 0.00 ? 93 SER A H    3  
ATOM 4019  H HA   . SER A 1 93 ? 19.579  11.811  -12.167 1.00 0.00 ? 93 SER A HA   3  
ATOM 4020  H HB2  . SER A 1 93 ? 20.501  9.333   -12.760 1.00 0.00 ? 93 SER A HB2  3  
ATOM 4021  H HB3  . SER A 1 93 ? 21.129  10.237  -14.137 1.00 0.00 ? 93 SER A HB3  3  
ATOM 4022  H HG   . SER A 1 93 ? 21.540  10.827  -11.390 1.00 0.00 ? 93 SER A HG   3  
ATOM 4023  N N    . SER A 1 94 ? 19.637  13.478  -13.983 1.00 0.00 ? 94 SER A N    3  
ATOM 4024  C CA   . SER A 1 94 ? 19.663  14.492  -15.031 1.00 0.00 ? 94 SER A CA   3  
ATOM 4025  C C    . SER A 1 94 ? 21.004  14.490  -15.756 1.00 0.00 ? 94 SER A C    3  
ATOM 4026  O O    . SER A 1 94 ? 22.011  14.954  -15.221 1.00 0.00 ? 94 SER A O    3  
ATOM 4027  C CB   . SER A 1 94 ? 19.393  15.875  -14.437 1.00 0.00 ? 94 SER A CB   3  
ATOM 4028  O OG   . SER A 1 94 ? 18.610  16.664  -15.317 1.00 0.00 ? 94 SER A OG   3  
ATOM 4029  H H    . SER A 1 94 ? 19.667  13.760  -13.044 1.00 0.00 ? 94 SER A H    3  
ATOM 4030  H HA   . SER A 1 94 ? 18.883  14.256  -15.739 1.00 0.00 ? 94 SER A HA   3  
ATOM 4031  H HB2  . SER A 1 94 ? 18.861  15.767  -13.503 1.00 0.00 ? 94 SER A HB2  3  
ATOM 4032  H HB3  . SER A 1 94 ? 20.332  16.379  -14.260 1.00 0.00 ? 94 SER A HB3  3  
ATOM 4033  H HG   . SER A 1 94 ? 18.952  16.582  -16.210 1.00 0.00 ? 94 SER A HG   3  
ATOM 4034  N N    . GLY A 1 95 ? 21.010  13.964  -16.976 1.00 0.00 ? 95 GLY A N    3  
ATOM 4035  C CA   . GLY A 1 95 ? 22.233  13.913  -17.756 1.00 0.00 ? 95 GLY A CA   3  
ATOM 4036  C C    . GLY A 1 95 ? 21.969  13.767  -19.241 1.00 0.00 ? 95 GLY A C    3  
ATOM 4037  O O    . GLY A 1 95 ? 20.800  13.917  -19.654 1.00 0.00 ? 95 GLY A O    3  
ATOM 4038  O OXT  . GLY A 1 95 ? 22.931  13.503  -19.992 1.00 0.00 ? 95 GLY A OXT  3  
ATOM 4039  H H    . GLY A 1 95 ? 20.177  13.609  -17.351 1.00 0.00 ? 95 GLY A H    3  
ATOM 4040  H HA2  . GLY A 1 95 ? 22.793  14.821  -17.588 1.00 0.00 ? 95 GLY A HA2  3  
ATOM 4041  H HA3  . GLY A 1 95 ? 22.824  13.072  -17.422 1.00 0.00 ? 95 GLY A HA3  3  
ATOM 4042  N N    . GLY A 1 1  ? -13.882 -23.487 -9.634  1.00 0.00 ? 1  GLY A N    4  
ATOM 4043  C CA   . GLY A 1 1  ? -14.210 -23.562 -11.084 1.00 0.00 ? 1  GLY A CA   4  
ATOM 4044  C C    . GLY A 1 1  ? -13.299 -22.695 -11.931 1.00 0.00 ? 1  GLY A C    4  
ATOM 4045  O O    . GLY A 1 1  ? -12.268 -23.158 -12.417 1.00 0.00 ? 1  GLY A O    4  
ATOM 4046  H H1   . GLY A 1 1  ? -14.547 -24.070 -9.086  1.00 0.00 ? 1  GLY A H1   4  
ATOM 4047  H H2   . GLY A 1 1  ? -13.949 -22.503 -9.303  1.00 0.00 ? 1  GLY A H2   4  
ATOM 4048  H H3   . GLY A 1 1  ? -12.915 -23.832 -9.468  1.00 0.00 ? 1  GLY A H3   4  
ATOM 4049  H HA2  . GLY A 1 1  ? -14.119 -24.588 -11.410 1.00 0.00 ? 1  GLY A HA2  4  
ATOM 4050  H HA3  . GLY A 1 1  ? -15.231 -23.240 -11.229 1.00 0.00 ? 1  GLY A HA3  4  
ATOM 4051  N N    . SER A 1 2  ? -13.682 -21.435 -12.109 1.00 0.00 ? 2  SER A N    4  
ATOM 4052  C CA   . SER A 1 2  ? -12.893 -20.501 -12.903 1.00 0.00 ? 2  SER A CA   4  
ATOM 4053  C C    . SER A 1 2  ? -12.925 -19.104 -12.291 1.00 0.00 ? 2  SER A C    4  
ATOM 4054  O O    . SER A 1 2  ? -11.889 -18.555 -11.917 1.00 0.00 ? 2  SER A O    4  
ATOM 4055  C CB   . SER A 1 2  ? -13.414 -20.454 -14.339 1.00 0.00 ? 2  SER A CB   4  
ATOM 4056  O OG   . SER A 1 2  ? -14.829 -20.398 -14.368 1.00 0.00 ? 2  SER A OG   4  
ATOM 4057  H H    . SER A 1 2  ? -14.516 -21.125 -11.695 1.00 0.00 ? 2  SER A H    4  
ATOM 4058  H HA   . SER A 1 2  ? -11.872 -20.854 -12.910 1.00 0.00 ? 2  SER A HA   4  
ATOM 4059  H HB2  . SER A 1 2  ? -13.022 -19.577 -14.834 1.00 0.00 ? 2  SER A HB2  4  
ATOM 4060  H HB3  . SER A 1 2  ? -13.090 -21.339 -14.867 1.00 0.00 ? 2  SER A HB3  4  
ATOM 4061  H HG   . SER A 1 2  ? -15.189 -21.254 -14.122 1.00 0.00 ? 2  SER A HG   4  
ATOM 4062  N N    . SER A 1 3  ? -14.121 -18.534 -12.194 1.00 0.00 ? 3  SER A N    4  
ATOM 4063  C CA   . SER A 1 3  ? -14.289 -17.200 -11.629 1.00 0.00 ? 3  SER A CA   4  
ATOM 4064  C C    . SER A 1 3  ? -14.900 -17.275 -10.233 1.00 0.00 ? 3  SER A C    4  
ATOM 4065  O O    . SER A 1 3  ? -15.278 -18.349 -9.766  1.00 0.00 ? 3  SER A O    4  
ATOM 4066  C CB   . SER A 1 3  ? -15.171 -16.344 -12.540 1.00 0.00 ? 3  SER A CB   4  
ATOM 4067  O OG   . SER A 1 3  ? -14.387 -15.612 -13.466 1.00 0.00 ? 3  SER A OG   4  
ATOM 4068  H H    . SER A 1 3  ? -14.911 -19.021 -12.511 1.00 0.00 ? 3  SER A H    4  
ATOM 4069  H HA   . SER A 1 3  ? -13.313 -16.746 -11.558 1.00 0.00 ? 3  SER A HA   4  
ATOM 4070  H HB2  . SER A 1 3  ? -15.848 -16.983 -13.086 1.00 0.00 ? 3  SER A HB2  4  
ATOM 4071  H HB3  . SER A 1 3  ? -15.739 -15.649 -11.937 1.00 0.00 ? 3  SER A HB3  4  
ATOM 4072  H HG   . SER A 1 3  ? -14.917 -14.905 -13.844 1.00 0.00 ? 3  SER A HG   4  
ATOM 4073  N N    . GLY A 1 4  ? -14.994 -16.125 -9.572  1.00 0.00 ? 4  GLY A N    4  
ATOM 4074  C CA   . GLY A 1 4  ? -15.560 -16.082 -8.236  1.00 0.00 ? 4  GLY A CA   4  
ATOM 4075  C C    . GLY A 1 4  ? -14.514 -16.279 -7.157  1.00 0.00 ? 4  GLY A C    4  
ATOM 4076  O O    . GLY A 1 4  ? -14.749 -16.988 -6.178  1.00 0.00 ? 4  GLY A O    4  
ATOM 4077  H H    . GLY A 1 4  ? -14.676 -15.300 -9.995  1.00 0.00 ? 4  GLY A H    4  
ATOM 4078  H HA2  . GLY A 1 4  ? -16.036 -15.124 -8.090  1.00 0.00 ? 4  GLY A HA2  4  
ATOM 4079  H HA3  . GLY A 1 4  ? -16.304 -16.859 -8.148  1.00 0.00 ? 4  GLY A HA3  4  
ATOM 4080  N N    . SER A 1 5  ? -13.356 -15.651 -7.335  1.00 0.00 ? 5  SER A N    4  
ATOM 4081  C CA   . SER A 1 5  ? -12.271 -15.761 -6.368  1.00 0.00 ? 5  SER A CA   4  
ATOM 4082  C C    . SER A 1 5  ? -11.765 -14.382 -5.958  1.00 0.00 ? 5  SER A C    4  
ATOM 4083  O O    . SER A 1 5  ? -12.338 -13.361 -6.340  1.00 0.00 ? 5  SER A O    4  
ATOM 4084  C CB   . SER A 1 5  ? -11.121 -16.585 -6.952  1.00 0.00 ? 5  SER A CB   4  
ATOM 4085  O OG   . SER A 1 5  ? -10.528 -17.406 -5.962  1.00 0.00 ? 5  SER A OG   4  
ATOM 4086  H H    . SER A 1 5  ? -13.230 -15.101 -8.136  1.00 0.00 ? 5  SER A H    4  
ATOM 4087  H HA   . SER A 1 5  ? -12.655 -16.265 -5.494  1.00 0.00 ? 5  SER A HA   4  
ATOM 4088  H HB2  . SER A 1 5  ? -11.498 -17.215 -7.744  1.00 0.00 ? 5  SER A HB2  4  
ATOM 4089  H HB3  . SER A 1 5  ? -10.369 -15.919 -7.349  1.00 0.00 ? 5  SER A HB3  4  
ATOM 4090  H HG   . SER A 1 5  ? -9.571  -17.354 -6.033  1.00 0.00 ? 5  SER A HG   4  
ATOM 4091  N N    . SER A 1 6  ? -10.689 -14.359 -5.179  1.00 0.00 ? 6  SER A N    4  
ATOM 4092  C CA   . SER A 1 6  ? -10.107 -13.104 -4.717  1.00 0.00 ? 6  SER A CA   4  
ATOM 4093  C C    . SER A 1 6  ? -9.243  -12.472 -5.804  1.00 0.00 ? 6  SER A C    4  
ATOM 4094  O O    . SER A 1 6  ? -8.231  -13.039 -6.214  1.00 0.00 ? 6  SER A O    4  
ATOM 4095  C CB   . SER A 1 6  ? -9.270  -13.340 -3.458  1.00 0.00 ? 6  SER A CB   4  
ATOM 4096  O OG   . SER A 1 6  ? -8.589  -14.580 -3.522  1.00 0.00 ? 6  SER A OG   4  
ATOM 4097  H H    . SER A 1 6  ? -10.277 -15.206 -4.908  1.00 0.00 ? 6  SER A H    4  
ATOM 4098  H HA   . SER A 1 6  ? -10.916 -12.430 -4.480  1.00 0.00 ? 6  SER A HA   4  
ATOM 4099  H HB2  . SER A 1 6  ? -8.542  -12.548 -3.359  1.00 0.00 ? 6  SER A HB2  4  
ATOM 4100  H HB3  . SER A 1 6  ? -9.918  -13.342 -2.594  1.00 0.00 ? 6  SER A HB3  4  
ATOM 4101  H HG   . SER A 1 6  ? -7.831  -14.560 -2.933  1.00 0.00 ? 6  SER A HG   4  
ATOM 4102  N N    . GLY A 1 7  ? -9.651  -11.295 -6.267  1.00 0.00 ? 7  GLY A N    4  
ATOM 4103  C CA   . GLY A 1 7  ? -8.904  -10.606 -7.302  1.00 0.00 ? 7  GLY A CA   4  
ATOM 4104  C C    . GLY A 1 7  ? -9.103  -9.104  -7.260  1.00 0.00 ? 7  GLY A C    4  
ATOM 4105  O O    . GLY A 1 7  ? -9.842  -8.592  -6.419  1.00 0.00 ? 7  GLY A O    4  
ATOM 4106  H H    . GLY A 1 7  ? -10.466 -10.891 -5.902  1.00 0.00 ? 7  GLY A H    4  
ATOM 4107  H HA2  . GLY A 1 7  ? -7.853  -10.822 -7.177  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 4108  H HA3  . GLY A 1 7  ? -9.223  -10.974 -8.266  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 4109  N N    . ALA A 1 8  ? -8.444  -8.396  -8.170  1.00 0.00 ? 8  ALA A N    4  
ATOM 4110  C CA   . ALA A 1 8  ? -8.552  -6.943  -8.235  1.00 0.00 ? 8  ALA A CA   4  
ATOM 4111  C C    . ALA A 1 8  ? -7.809  -6.390  -9.445  1.00 0.00 ? 8  ALA A C    4  
ATOM 4112  O O    . ALA A 1 8  ? -8.402  -5.742  -10.308 1.00 0.00 ? 8  ALA A O    4  
ATOM 4113  C CB   . ALA A 1 8  ? -8.019  -6.318  -6.954  1.00 0.00 ? 8  ALA A CB   4  
ATOM 4114  H H    . ALA A 1 8  ? -7.870  -8.861  -8.815  1.00 0.00 ? 8  ALA A H    4  
ATOM 4115  H HA   . ALA A 1 8  ? -9.599  -6.691  -8.321  1.00 0.00 ? 8  ALA A HA   4  
ATOM 4116  H HB1  . ALA A 1 8  ? -8.794  -6.321  -6.202  1.00 0.00 ? 8  ALA A HB1  4  
ATOM 4117  H HB2  . ALA A 1 8  ? -7.712  -5.302  -7.151  1.00 0.00 ? 8  ALA A HB2  4  
ATOM 4118  H HB3  . ALA A 1 8  ? -7.173  -6.888  -6.602  1.00 0.00 ? 8  ALA A HB3  4  
ATOM 4119  N N    . ALA A 1 9  ? -6.507  -6.650  -9.504  1.00 0.00 ? 9  ALA A N    4  
ATOM 4120  C CA   . ALA A 1 9  ? -5.682  -6.178  -10.609 1.00 0.00 ? 9  ALA A CA   4  
ATOM 4121  C C    . ALA A 1 9  ? -4.281  -6.775  -10.542 1.00 0.00 ? 9  ALA A C    4  
ATOM 4122  O O    . ALA A 1 9  ? -3.717  -7.176  -11.561 1.00 0.00 ? 9  ALA A O    4  
ATOM 4123  C CB   . ALA A 1 9  ? -5.610  -4.658  -10.602 1.00 0.00 ? 9  ALA A CB   4  
ATOM 4124  H H    . ALA A 1 9  ? -6.091  -7.172  -8.786  1.00 0.00 ? 9  ALA A H    4  
ATOM 4125  H HA   . ALA A 1 9  ? -6.151  -6.488  -11.531 1.00 0.00 ? 9  ALA A HA   4  
ATOM 4126  H HB1  . ALA A 1 9  ? -6.580  -4.251  -10.851 1.00 0.00 ? 9  ALA A HB1  4  
ATOM 4127  H HB2  . ALA A 1 9  ? -4.884  -4.328  -11.330 1.00 0.00 ? 9  ALA A HB2  4  
ATOM 4128  H HB3  . ALA A 1 9  ? -5.317  -4.316  -9.620  1.00 0.00 ? 9  ALA A HB3  4  
ATOM 4129  N N    . GLU A 1 10 ? -3.724  -6.832  -9.337  1.00 0.00 ? 10 GLU A N    4  
ATOM 4130  C CA   . GLU A 1 10 ? -2.387  -7.381  -9.138  1.00 0.00 ? 10 GLU A CA   4  
ATOM 4131  C C    . GLU A 1 10 ? -2.238  -7.951  -7.731  1.00 0.00 ? 10 GLU A C    4  
ATOM 4132  O O    . GLU A 1 10 ? -3.109  -7.770  -6.881  1.00 0.00 ? 10 GLU A O    4  
ATOM 4133  C CB   . GLU A 1 10 ? -1.329  -6.302  -9.382  1.00 0.00 ? 10 GLU A CB   4  
ATOM 4134  C CG   . GLU A 1 10 ? -0.163  -6.776  -10.234 1.00 0.00 ? 10 GLU A CG   4  
ATOM 4135  C CD   . GLU A 1 10 ? -0.253  -6.289  -11.667 1.00 0.00 ? 10 GLU A CD   4  
ATOM 4136  O OE1  . GLU A 1 10 ? -0.560  -5.096  -11.870 1.00 0.00 ? 10 GLU A OE1  4  
ATOM 4137  O OE2  . GLU A 1 10 ? -0.014  -7.101  -12.585 1.00 0.00 ? 10 GLU A OE2  4  
ATOM 4138  H H    . GLU A 1 10 ? -4.222  -6.496  -8.564  1.00 0.00 ? 10 GLU A H    4  
ATOM 4139  H HA   . GLU A 1 10 ? -2.247  -8.177  -9.853  1.00 0.00 ? 10 GLU A HA   4  
ATOM 4140  H HB2  . GLU A 1 10 ? -1.794  -5.464  -9.881  1.00 0.00 ? 10 GLU A HB2  4  
ATOM 4141  H HB3  . GLU A 1 10 ? -0.941  -5.971  -8.430  1.00 0.00 ? 10 GLU A HB3  4  
ATOM 4142  H HG2  . GLU A 1 10 ? 0.755   -6.407  -9.801  1.00 0.00 ? 10 GLU A HG2  4  
ATOM 4143  H HG3  . GLU A 1 10 ? -0.151  -7.856  -10.235 1.00 0.00 ? 10 GLU A HG3  4  
ATOM 4144  N N    . VAL A 1 11 ? -1.127  -8.641  -7.494  1.00 0.00 ? 11 VAL A N    4  
ATOM 4145  C CA   . VAL A 1 11 ? -0.863  -9.238  -6.190  1.00 0.00 ? 11 VAL A CA   4  
ATOM 4146  C C    . VAL A 1 11 ? 0.042   -8.345  -5.349  1.00 0.00 ? 11 VAL A C    4  
ATOM 4147  O O    . VAL A 1 11 ? 0.458   -7.274  -5.791  1.00 0.00 ? 11 VAL A O    4  
ATOM 4148  C CB   . VAL A 1 11 ? -0.209  -10.625 -6.329  1.00 0.00 ? 11 VAL A CB   4  
ATOM 4149  C CG1  . VAL A 1 11 ? -1.193  -11.624 -6.918  1.00 0.00 ? 11 VAL A CG1  4  
ATOM 4150  C CG2  . VAL A 1 11 ? 1.049   -10.539 -7.179  1.00 0.00 ? 11 VAL A CG2  4  
ATOM 4151  H H    . VAL A 1 11 ? -0.469  -8.752  -8.211  1.00 0.00 ? 11 VAL A H    4  
ATOM 4152  H HA   . VAL A 1 11 ? -1.808  -9.358  -5.680  1.00 0.00 ? 11 VAL A HA   4  
ATOM 4153  H HB   . VAL A 1 11 ? 0.070   -10.969 -5.344  1.00 0.00 ? 11 VAL A HB   4  
ATOM 4154  H HG11 . VAL A 1 11 ? -2.202  -11.270 -6.765  1.00 0.00 ? 11 VAL A HG11 4  
ATOM 4155  H HG12 . VAL A 1 11 ? -1.070  -12.581 -6.433  1.00 0.00 ? 11 VAL A HG12 4  
ATOM 4156  H HG13 . VAL A 1 11 ? -1.006  -11.731 -7.977  1.00 0.00 ? 11 VAL A HG13 4  
ATOM 4157  H HG21 . VAL A 1 11 ? 1.811   -11.180 -6.761  1.00 0.00 ? 11 VAL A HG21 4  
ATOM 4158  H HG22 . VAL A 1 11 ? 1.404   -9.520  -7.195  1.00 0.00 ? 11 VAL A HG22 4  
ATOM 4159  H HG23 . VAL A 1 11 ? 0.825   -10.858 -8.187  1.00 0.00 ? 11 VAL A HG23 4  
ATOM 4160  N N    . GLY A 1 12 ? 0.345   -8.793  -4.135  1.00 0.00 ? 12 GLY A N    4  
ATOM 4161  C CA   . GLY A 1 12 ? 1.199   -8.021  -3.250  1.00 0.00 ? 12 GLY A CA   4  
ATOM 4162  C C    . GLY A 1 12 ? 2.522   -8.709  -2.978  1.00 0.00 ? 12 GLY A C    4  
ATOM 4163  O O    . GLY A 1 12 ? 2.729   -9.855  -3.379  1.00 0.00 ? 12 GLY A O    4  
ATOM 4164  H H    . GLY A 1 12 ? -0.016  -9.653  -3.836  1.00 0.00 ? 12 GLY A H    4  
ATOM 4165  H HA2  . GLY A 1 12 ? 1.393   -7.060  -3.703  1.00 0.00 ? 12 GLY A HA2  4  
ATOM 4166  H HA3  . GLY A 1 12 ? 0.686   -7.869  -2.313  1.00 0.00 ? 12 GLY A HA3  4  
ATOM 4167  N N    . ASP A 1 13 ? 3.422   -8.009  -2.295  1.00 0.00 ? 13 ASP A N    4  
ATOM 4168  C CA   . ASP A 1 13 ? 4.732   -8.559  -1.969  1.00 0.00 ? 13 ASP A CA   4  
ATOM 4169  C C    . ASP A 1 13 ? 4.629   -9.578  -0.838  1.00 0.00 ? 13 ASP A C    4  
ATOM 4170  O O    . ASP A 1 13 ? 3.602   -9.674  -0.168  1.00 0.00 ? 13 ASP A O    4  
ATOM 4171  C CB   . ASP A 1 13 ? 5.696   -7.438  -1.575  1.00 0.00 ? 13 ASP A CB   4  
ATOM 4172  C CG   . ASP A 1 13 ? 7.148   -7.854  -1.699  1.00 0.00 ? 13 ASP A CG   4  
ATOM 4173  O OD1  . ASP A 1 13 ? 7.563   -8.236  -2.814  1.00 0.00 ? 13 ASP A OD1  4  
ATOM 4174  O OD2  . ASP A 1 13 ? 7.872   -7.798  -0.683  1.00 0.00 ? 13 ASP A OD2  4  
ATOM 4175  H H    . ASP A 1 13 ? 3.199   -7.100  -2.001  1.00 0.00 ? 13 ASP A H    4  
ATOM 4176  H HA   . ASP A 1 13 ? 5.112   -9.054  -2.849  1.00 0.00 ? 13 ASP A HA   4  
ATOM 4177  H HB2  . ASP A 1 13 ? 5.529   -6.586  -2.217  1.00 0.00 ? 13 ASP A HB2  4  
ATOM 4178  H HB3  . ASP A 1 13 ? 5.508   -7.155  -0.549  1.00 0.00 ? 13 ASP A HB3  4  
ATOM 4179  N N    . ASP A 1 14 ? 5.701   -10.336 -0.632  1.00 0.00 ? 14 ASP A N    4  
ATOM 4180  C CA   . ASP A 1 14 ? 5.733   -11.348 0.418   1.00 0.00 ? 14 ASP A CA   4  
ATOM 4181  C C    . ASP A 1 14 ? 6.747   -10.984 1.497   1.00 0.00 ? 14 ASP A C    4  
ATOM 4182  O O    . ASP A 1 14 ? 7.455   -11.847 2.016   1.00 0.00 ? 14 ASP A O    4  
ATOM 4183  C CB   . ASP A 1 14 ? 6.070   -12.717 -0.175  1.00 0.00 ? 14 ASP A CB   4  
ATOM 4184  C CG   . ASP A 1 14 ? 4.896   -13.335 -0.908  1.00 0.00 ? 14 ASP A CG   4  
ATOM 4185  O OD1  . ASP A 1 14 ? 4.213   -12.605 -1.658  1.00 0.00 ? 14 ASP A OD1  4  
ATOM 4186  O OD2  . ASP A 1 14 ? 4.659   -14.549 -0.734  1.00 0.00 ? 14 ASP A OD2  4  
ATOM 4187  H H    . ASP A 1 14 ? 6.491   -10.211 -1.199  1.00 0.00 ? 14 ASP A H    4  
ATOM 4188  H HA   . ASP A 1 14 ? 4.751   -11.392 0.865   1.00 0.00 ? 14 ASP A HA   4  
ATOM 4189  H HB2  . ASP A 1 14 ? 6.888   -12.609 -0.872  1.00 0.00 ? 14 ASP A HB2  4  
ATOM 4190  H HB3  . ASP A 1 14 ? 6.366   -13.385 0.620   1.00 0.00 ? 14 ASP A HB3  4  
ATOM 4191  N N    . PHE A 1 15 ? 6.814   -9.698  1.829   1.00 0.00 ? 15 PHE A N    4  
ATOM 4192  C CA   . PHE A 1 15 ? 7.742   -9.219  2.846   1.00 0.00 ? 15 PHE A CA   4  
ATOM 4193  C C    . PHE A 1 15 ? 7.397   -7.795  3.269   1.00 0.00 ? 15 PHE A C    4  
ATOM 4194  O O    . PHE A 1 15 ? 7.521   -6.855  2.484   1.00 0.00 ? 15 PHE A O    4  
ATOM 4195  C CB   . PHE A 1 15 ? 9.179   -9.273  2.323   1.00 0.00 ? 15 PHE A CB   4  
ATOM 4196  C CG   . PHE A 1 15 ? 10.215  -9.181  3.406   1.00 0.00 ? 15 PHE A CG   4  
ATOM 4197  C CD1  . PHE A 1 15 ? 10.516  -10.283 4.191   1.00 0.00 ? 15 PHE A CD1  4  
ATOM 4198  C CD2  . PHE A 1 15 ? 10.889  -7.993  3.640   1.00 0.00 ? 15 PHE A CD2  4  
ATOM 4199  C CE1  . PHE A 1 15 ? 11.470  -10.202 5.188   1.00 0.00 ? 15 PHE A CE1  4  
ATOM 4200  C CE2  . PHE A 1 15 ? 11.843  -7.906  4.635   1.00 0.00 ? 15 PHE A CE2  4  
ATOM 4201  C CZ   . PHE A 1 15 ? 12.134  -9.012  5.410   1.00 0.00 ? 15 PHE A CZ   4  
ATOM 4202  H H    . PHE A 1 15 ? 6.224   -9.057  1.380   1.00 0.00 ? 15 PHE A H    4  
ATOM 4203  H HA   . PHE A 1 15 ? 7.656   -9.867  3.705   1.00 0.00 ? 15 PHE A HA   4  
ATOM 4204  H HB2  . PHE A 1 15 ? 9.328   -10.205 1.799   1.00 0.00 ? 15 PHE A HB2  4  
ATOM 4205  H HB3  . PHE A 1 15 ? 9.337   -8.452  1.639   1.00 0.00 ? 15 PHE A HB3  4  
ATOM 4206  H HD1  . PHE A 1 15 ? 9.998   -11.215 4.016   1.00 0.00 ? 15 PHE A HD1  4  
ATOM 4207  H HD2  . PHE A 1 15 ? 10.662  -7.128  3.034   1.00 0.00 ? 15 PHE A HD2  4  
ATOM 4208  H HE1  . PHE A 1 15 ? 11.695  -11.068 5.793   1.00 0.00 ? 15 PHE A HE1  4  
ATOM 4209  H HE2  . PHE A 1 15 ? 12.361  -6.974  4.808   1.00 0.00 ? 15 PHE A HE2  4  
ATOM 4210  H HZ   . PHE A 1 15 ? 12.879  -8.946  6.189   1.00 0.00 ? 15 PHE A HZ   4  
ATOM 4211  N N    . LEU A 1 16 ? 6.960   -7.642  4.516   1.00 0.00 ? 16 LEU A N    4  
ATOM 4212  C CA   . LEU A 1 16 ? 6.596   -6.333  5.044   1.00 0.00 ? 16 LEU A CA   4  
ATOM 4213  C C    . LEU A 1 16 ? 7.840   -5.505  5.352   1.00 0.00 ? 16 LEU A C    4  
ATOM 4214  O O    . LEU A 1 16 ? 8.768   -5.980  6.006   1.00 0.00 ? 16 LEU A O    4  
ATOM 4215  C CB   . LEU A 1 16 ? 5.747   -6.487  6.307   1.00 0.00 ? 16 LEU A CB   4  
ATOM 4216  C CG   . LEU A 1 16 ? 4.442   -7.262  6.117   1.00 0.00 ? 16 LEU A CG   4  
ATOM 4217  C CD1  . LEU A 1 16 ? 4.021   -7.925  7.420   1.00 0.00 ? 16 LEU A CD1  4  
ATOM 4218  C CD2  . LEU A 1 16 ? 3.345   -6.340  5.608   1.00 0.00 ? 16 LEU A CD2  4  
ATOM 4219  H H    . LEU A 1 16 ? 6.883   -8.429  5.094   1.00 0.00 ? 16 LEU A H    4  
ATOM 4220  H HA   . LEU A 1 16 ? 6.016   -5.822  4.291   1.00 0.00 ? 16 LEU A HA   4  
ATOM 4221  H HB2  . LEU A 1 16 ? 6.339   -6.995  7.054   1.00 0.00 ? 16 LEU A HB2  4  
ATOM 4222  H HB3  . LEU A 1 16 ? 5.504   -5.501  6.674   1.00 0.00 ? 16 LEU A HB3  4  
ATOM 4223  H HG   . LEU A 1 16 ? 4.595   -8.039  5.383   1.00 0.00 ? 16 LEU A HG   4  
ATOM 4224  H HD11 . LEU A 1 16 ? 4.886   -8.055  8.053   1.00 0.00 ? 16 LEU A HD11 4  
ATOM 4225  H HD12 . LEU A 1 16 ? 3.582   -8.888  7.208   1.00 0.00 ? 16 LEU A HD12 4  
ATOM 4226  H HD13 . LEU A 1 16 ? 3.298   -7.302  7.924   1.00 0.00 ? 16 LEU A HD13 4  
ATOM 4227  H HD21 . LEU A 1 16 ? 2.747   -5.998  6.439   1.00 0.00 ? 16 LEU A HD21 4  
ATOM 4228  H HD22 . LEU A 1 16 ? 2.718   -6.877  4.911   1.00 0.00 ? 16 LEU A HD22 4  
ATOM 4229  H HD23 . LEU A 1 16 ? 3.790   -5.491  5.111   1.00 0.00 ? 16 LEU A HD23 4  
ATOM 4230  N N    . GLY A 1 17 ? 7.851   -4.264  4.875   1.00 0.00 ? 17 GLY A N    4  
ATOM 4231  C CA   . GLY A 1 17 ? 8.986   -3.390  5.110   1.00 0.00 ? 17 GLY A CA   4  
ATOM 4232  C C    . GLY A 1 17 ? 9.098   -2.961  6.560   1.00 0.00 ? 17 GLY A C    4  
ATOM 4233  O O    . GLY A 1 17 ? 8.449   -3.534  7.436   1.00 0.00 ? 17 GLY A O    4  
ATOM 4234  H H    . GLY A 1 17 ? 7.083   -3.940  4.361   1.00 0.00 ? 17 GLY A H    4  
ATOM 4235  H HA2  . GLY A 1 17 ? 9.889   -3.908  4.828   1.00 0.00 ? 17 GLY A HA2  4  
ATOM 4236  H HA3  . GLY A 1 17 ? 8.881   -2.510  4.493   1.00 0.00 ? 17 GLY A HA3  4  
ATOM 4237  N N    . ASP A 1 18 ? 9.924   -1.951  6.814   1.00 0.00 ? 18 ASP A N    4  
ATOM 4238  C CA   . ASP A 1 18 ? 10.120  -1.446  8.168   1.00 0.00 ? 18 ASP A CA   4  
ATOM 4239  C C    . ASP A 1 18 ? 9.302   -0.180  8.400   1.00 0.00 ? 18 ASP A C    4  
ATOM 4240  O O    . ASP A 1 18 ? 9.739   0.732   9.102   1.00 0.00 ? 18 ASP A O    4  
ATOM 4241  C CB   . ASP A 1 18 ? 11.602  -1.164  8.420   1.00 0.00 ? 18 ASP A CB   4  
ATOM 4242  C CG   . ASP A 1 18 ? 12.342  -2.382  8.941   1.00 0.00 ? 18 ASP A CG   4  
ATOM 4243  O OD1  . ASP A 1 18 ? 12.328  -3.423  8.252   1.00 0.00 ? 18 ASP A OD1  4  
ATOM 4244  O OD2  . ASP A 1 18 ? 12.933  -2.292  10.037  1.00 0.00 ? 18 ASP A OD2  4  
ATOM 4245  H H    . ASP A 1 18 ? 10.413  -1.536  6.073   1.00 0.00 ? 18 ASP A H    4  
ATOM 4246  H HA   . ASP A 1 18 ? 9.785   -2.208  8.856   1.00 0.00 ? 18 ASP A HA   4  
ATOM 4247  H HB2  . ASP A 1 18 ? 12.065  -0.854  7.496   1.00 0.00 ? 18 ASP A HB2  4  
ATOM 4248  H HB3  . ASP A 1 18 ? 11.692  -0.371  9.148   1.00 0.00 ? 18 ASP A HB3  4  
ATOM 4249  N N    . PHE A 1 19 ? 8.113   -0.132  7.807   1.00 0.00 ? 19 PHE A N    4  
ATOM 4250  C CA   . PHE A 1 19 ? 7.234   1.023   7.949   1.00 0.00 ? 19 PHE A CA   4  
ATOM 4251  C C    . PHE A 1 19 ? 6.356   0.888   9.190   1.00 0.00 ? 19 PHE A C    4  
ATOM 4252  O O    . PHE A 1 19 ? 6.437   -0.103  9.914   1.00 0.00 ? 19 PHE A O    4  
ATOM 4253  C CB   . PHE A 1 19 ? 6.359   1.181   6.706   1.00 0.00 ? 19 PHE A CB   4  
ATOM 4254  C CG   . PHE A 1 19 ? 7.144   1.371   5.438   1.00 0.00 ? 19 PHE A CG   4  
ATOM 4255  C CD1  . PHE A 1 19 ? 7.680   2.608   5.118   1.00 0.00 ? 19 PHE A CD1  4  
ATOM 4256  C CD2  . PHE A 1 19 ? 7.346   0.312   4.568   1.00 0.00 ? 19 PHE A CD2  4  
ATOM 4257  C CE1  . PHE A 1 19 ? 8.402   2.786   3.953   1.00 0.00 ? 19 PHE A CE1  4  
ATOM 4258  C CE2  . PHE A 1 19 ? 8.067   0.483   3.402   1.00 0.00 ? 19 PHE A CE2  4  
ATOM 4259  C CZ   . PHE A 1 19 ? 8.596   1.721   3.094   1.00 0.00 ? 19 PHE A CZ   4  
ATOM 4260  H H    . PHE A 1 19 ? 7.821   -0.890  7.260   1.00 0.00 ? 19 PHE A H    4  
ATOM 4261  H HA   . PHE A 1 19 ? 7.855   1.901   8.057   1.00 0.00 ? 19 PHE A HA   4  
ATOM 4262  H HB2  . PHE A 1 19 ? 5.749   0.299   6.588   1.00 0.00 ? 19 PHE A HB2  4  
ATOM 4263  H HB3  . PHE A 1 19 ? 5.718   2.042   6.832   1.00 0.00 ? 19 PHE A HB3  4  
ATOM 4264  H HD1  . PHE A 1 19 ? 7.529   3.441   5.789   1.00 0.00 ? 19 PHE A HD1  4  
ATOM 4265  H HD2  . PHE A 1 19 ? 6.933   -0.657  4.808   1.00 0.00 ? 19 PHE A HD2  4  
ATOM 4266  H HE1  . PHE A 1 19 ? 8.814   3.754   3.715   1.00 0.00 ? 19 PHE A HE1  4  
ATOM 4267  H HE2  . PHE A 1 19 ? 8.218   -0.351  2.732   1.00 0.00 ? 19 PHE A HE2  4  
ATOM 4268  H HZ   . PHE A 1 19 ? 9.160   1.857   2.184   1.00 0.00 ? 19 PHE A HZ   4  
ATOM 4269  N N    . VAL A 1 20 ? 5.517   1.891   9.426   1.00 0.00 ? 20 VAL A N    4  
ATOM 4270  C CA   . VAL A 1 20 ? 4.624   1.884   10.578  1.00 0.00 ? 20 VAL A CA   4  
ATOM 4271  C C    . VAL A 1 20 ? 3.273   2.502   10.230  1.00 0.00 ? 20 VAL A C    4  
ATOM 4272  O O    . VAL A 1 20 ? 3.052   2.938   9.100   1.00 0.00 ? 20 VAL A O    4  
ATOM 4273  C CB   . VAL A 1 20 ? 5.233   2.649   11.767  1.00 0.00 ? 20 VAL A CB   4  
ATOM 4274  C CG1  . VAL A 1 20 ? 6.368   1.851   12.391  1.00 0.00 ? 20 VAL A CG1  4  
ATOM 4275  C CG2  . VAL A 1 20 ? 5.715   4.023   11.328  1.00 0.00 ? 20 VAL A CG2  4  
ATOM 4276  H H    . VAL A 1 20 ? 5.498   2.654   8.811   1.00 0.00 ? 20 VAL A H    4  
ATOM 4277  H HA   . VAL A 1 20 ? 4.472   0.856   10.876  1.00 0.00 ? 20 VAL A HA   4  
ATOM 4278  H HB   . VAL A 1 20 ? 4.465   2.783   12.515  1.00 0.00 ? 20 VAL A HB   4  
ATOM 4279  H HG11 . VAL A 1 20 ? 6.943   1.373   11.612  1.00 0.00 ? 20 VAL A HG11 4  
ATOM 4280  H HG12 . VAL A 1 20 ? 5.960   1.099   13.050  1.00 0.00 ? 20 VAL A HG12 4  
ATOM 4281  H HG13 . VAL A 1 20 ? 7.008   2.515   12.953  1.00 0.00 ? 20 VAL A HG13 4  
ATOM 4282  H HG21 . VAL A 1 20 ? 5.506   4.743   12.104  1.00 0.00 ? 20 VAL A HG21 4  
ATOM 4283  H HG22 . VAL A 1 20 ? 5.204   4.311   10.421  1.00 0.00 ? 20 VAL A HG22 4  
ATOM 4284  H HG23 . VAL A 1 20 ? 6.780   3.989   11.145  1.00 0.00 ? 20 VAL A HG23 4  
ATOM 4285  N N    . VAL A 1 21 ? 2.374   2.535   11.208  1.00 0.00 ? 21 VAL A N    4  
ATOM 4286  C CA   . VAL A 1 21 ? 1.046   3.100   11.004  1.00 0.00 ? 21 VAL A CA   4  
ATOM 4287  C C    . VAL A 1 21 ? 0.963   4.518   11.560  1.00 0.00 ? 21 VAL A C    4  
ATOM 4288  O O    . VAL A 1 21 ? 1.141   4.739   12.758  1.00 0.00 ? 21 VAL A O    4  
ATOM 4289  C CB   . VAL A 1 21 ? -0.042  2.236   11.670  1.00 0.00 ? 21 VAL A CB   4  
ATOM 4290  C CG1  . VAL A 1 21 ? -1.429  2.745   11.305  1.00 0.00 ? 21 VAL A CG1  4  
ATOM 4291  C CG2  . VAL A 1 21 ? 0.117   0.775   11.275  1.00 0.00 ? 21 VAL A CG2  4  
ATOM 4292  H H    . VAL A 1 21 ? 2.610   2.173   12.087  1.00 0.00 ? 21 VAL A H    4  
ATOM 4293  H HA   . VAL A 1 21 ? 0.854   3.129   9.941   1.00 0.00 ? 21 VAL A HA   4  
ATOM 4294  H HB   . VAL A 1 21 ? 0.073   2.311   12.742  1.00 0.00 ? 21 VAL A HB   4  
ATOM 4295  H HG11 . VAL A 1 21 ? -1.768  2.253   10.405  1.00 0.00 ? 21 VAL A HG11 4  
ATOM 4296  H HG12 . VAL A 1 21 ? -1.389  3.812   11.140  1.00 0.00 ? 21 VAL A HG12 4  
ATOM 4297  H HG13 . VAL A 1 21 ? -2.114  2.532   12.112  1.00 0.00 ? 21 VAL A HG13 4  
ATOM 4298  H HG21 . VAL A 1 21 ? -0.623  0.520   10.531  1.00 0.00 ? 21 VAL A HG21 4  
ATOM 4299  H HG22 . VAL A 1 21 ? -0.017  0.150   12.145  1.00 0.00 ? 21 VAL A HG22 4  
ATOM 4300  H HG23 . VAL A 1 21 ? 1.106   0.616   10.868  1.00 0.00 ? 21 VAL A HG23 4  
ATOM 4301  N N    . GLY A 1 22 ? 0.691   5.478   10.681  1.00 0.00 ? 22 GLY A N    4  
ATOM 4302  C CA   . GLY A 1 22 ? 0.590   6.863   11.101  1.00 0.00 ? 22 GLY A CA   4  
ATOM 4303  C C    . GLY A 1 22 ? 1.748   7.706   10.605  1.00 0.00 ? 22 GLY A C    4  
ATOM 4304  O O    . GLY A 1 22 ? 2.166   8.652   11.273  1.00 0.00 ? 22 GLY A O    4  
ATOM 4305  H H    . GLY A 1 22 ? 0.559   5.243   9.737   1.00 0.00 ? 22 GLY A H    4  
ATOM 4306  H HA2  . GLY A 1 22 ? -0.332  7.277   10.719  1.00 0.00 ? 22 GLY A HA2  4  
ATOM 4307  H HA3  . GLY A 1 22 ? 0.568   6.900   12.180  1.00 0.00 ? 22 GLY A HA3  4  
ATOM 4308  N N    . GLU A 1 23 ? 2.266   7.363   9.430   1.00 0.00 ? 23 GLU A N    4  
ATOM 4309  C CA   . GLU A 1 23 ? 3.384   8.094   8.845   1.00 0.00 ? 23 GLU A CA   4  
ATOM 4310  C C    . GLU A 1 23 ? 3.149   8.347   7.358   1.00 0.00 ? 23 GLU A C    4  
ATOM 4311  O O    . GLU A 1 23 ? 2.211   7.812   6.768   1.00 0.00 ? 23 GLU A O    4  
ATOM 4312  C CB   . GLU A 1 23 ? 4.688   7.319   9.043   1.00 0.00 ? 23 GLU A CB   4  
ATOM 4313  C CG   . GLU A 1 23 ? 4.712   5.978   8.329   1.00 0.00 ? 23 GLU A CG   4  
ATOM 4314  C CD   . GLU A 1 23 ? 6.118   5.437   8.153   1.00 0.00 ? 23 GLU A CD   4  
ATOM 4315  O OE1  . GLU A 1 23 ? 7.074   6.237   8.221   1.00 0.00 ? 23 GLU A OE1  4  
ATOM 4316  O OE2  . GLU A 1 23 ? 6.262   4.214   7.948   1.00 0.00 ? 23 GLU A OE2  4  
ATOM 4317  H H    . GLU A 1 23 ? 1.888   6.599   8.946   1.00 0.00 ? 23 GLU A H    4  
ATOM 4318  H HA   . GLU A 1 23 ? 3.459   9.045   9.351   1.00 0.00 ? 23 GLU A HA   4  
ATOM 4319  H HB2  . GLU A 1 23 ? 5.508   7.916   8.670   1.00 0.00 ? 23 GLU A HB2  4  
ATOM 4320  H HB3  . GLU A 1 23 ? 4.832   7.145   10.098  1.00 0.00 ? 23 GLU A HB3  4  
ATOM 4321  H HG2  . GLU A 1 23 ? 4.140   5.267   8.907   1.00 0.00 ? 23 GLU A HG2  4  
ATOM 4322  H HG3  . GLU A 1 23 ? 4.262   6.094   7.354   1.00 0.00 ? 23 GLU A HG3  4  
ATOM 4323  N N    . ARG A 1 24 ? 4.007   9.166   6.760   1.00 0.00 ? 24 ARG A N    4  
ATOM 4324  C CA   . ARG A 1 24 ? 3.894   9.489   5.343   1.00 0.00 ? 24 ARG A CA   4  
ATOM 4325  C C    . ARG A 1 24 ? 4.872   8.659   4.516   1.00 0.00 ? 24 ARG A C    4  
ATOM 4326  O O    . ARG A 1 24 ? 6.087   8.782   4.664   1.00 0.00 ? 24 ARG A O    4  
ATOM 4327  C CB   . ARG A 1 24 ? 4.149   10.981  5.117   1.00 0.00 ? 24 ARG A CB   4  
ATOM 4328  C CG   . ARG A 1 24 ? 2.967   11.714  4.504   1.00 0.00 ? 24 ARG A CG   4  
ATOM 4329  C CD   . ARG A 1 24 ? 1.923   12.067  5.551   1.00 0.00 ? 24 ARG A CD   4  
ATOM 4330  N NE   . ARG A 1 24 ? 1.501   13.463  5.454   1.00 0.00 ? 24 ARG A NE   4  
ATOM 4331  C CZ   . ARG A 1 24 ? 2.226   14.488  5.892   1.00 0.00 ? 24 ARG A CZ   4  
ATOM 4332  N NH1  . ARG A 1 24 ? 3.409   14.281  6.457   1.00 0.00 ? 24 ARG A NH1  4  
ATOM 4333  N NH2  . ARG A 1 24 ? 1.768   15.727  5.764   1.00 0.00 ? 24 ARG A NH2  4  
ATOM 4334  H H    . ARG A 1 24 ? 4.736   9.562   7.283   1.00 0.00 ? 24 ARG A H    4  
ATOM 4335  H HA   . ARG A 1 24 ? 2.887   9.254   5.030   1.00 0.00 ? 24 ARG A HA   4  
ATOM 4336  H HB2  . ARG A 1 24 ? 4.377   11.443  6.066   1.00 0.00 ? 24 ARG A HB2  4  
ATOM 4337  H HB3  . ARG A 1 24 ? 4.998   11.097  4.458   1.00 0.00 ? 24 ARG A HB3  4  
ATOM 4338  H HG2  . ARG A 1 24 ? 3.321   12.624  4.041   1.00 0.00 ? 24 ARG A HG2  4  
ATOM 4339  H HG3  . ARG A 1 24 ? 2.513   11.081  3.755   1.00 0.00 ? 24 ARG A HG3  4  
ATOM 4340  H HD2  . ARG A 1 24 ? 1.062   11.431  5.412   1.00 0.00 ? 24 ARG A HD2  4  
ATOM 4341  H HD3  . ARG A 1 24 ? 2.341   11.895  6.531   1.00 0.00 ? 24 ARG A HD3  4  
ATOM 4342  H HE   . ARG A 1 24 ? 0.630   13.644  5.041   1.00 0.00 ? 24 ARG A HE   4  
ATOM 4343  H HH11 . ARG A 1 24 ? 3.761   13.351  6.555   1.00 0.00 ? 24 ARG A HH11 4  
ATOM 4344  H HH12 . ARG A 1 24 ? 3.949   15.057  6.783   1.00 0.00 ? 24 ARG A HH12 4  
ATOM 4345  H HH21 . ARG A 1 24 ? 0.877   15.889  5.339   1.00 0.00 ? 24 ARG A HH21 4  
ATOM 4346  H HH22 . ARG A 1 24 ? 2.313   16.498  6.093   1.00 0.00 ? 24 ARG A HH22 4  
ATOM 4347  N N    . VAL A 1 25 ? 4.331   7.813   3.644   1.00 0.00 ? 25 VAL A N    4  
ATOM 4348  C CA   . VAL A 1 25 ? 5.155   6.963   2.793   1.00 0.00 ? 25 VAL A CA   4  
ATOM 4349  C C    . VAL A 1 25 ? 4.932   7.280   1.318   1.00 0.00 ? 25 VAL A C    4  
ATOM 4350  O O    . VAL A 1 25 ? 3.794   7.408   0.866   1.00 0.00 ? 25 VAL A O    4  
ATOM 4351  C CB   . VAL A 1 25 ? 4.860   5.471   3.035   1.00 0.00 ? 25 VAL A CB   4  
ATOM 4352  C CG1  . VAL A 1 25 ? 5.322   5.053   4.423   1.00 0.00 ? 25 VAL A CG1  4  
ATOM 4353  C CG2  . VAL A 1 25 ? 3.379   5.182   2.848   1.00 0.00 ? 25 VAL A CG2  4  
ATOM 4354  H H    . VAL A 1 25 ? 3.356   7.760   3.571   1.00 0.00 ? 25 VAL A H    4  
ATOM 4355  H HA   . VAL A 1 25 ? 6.191   7.148   3.037   1.00 0.00 ? 25 VAL A HA   4  
ATOM 4356  H HB   . VAL A 1 25 ? 5.412   4.893   2.308   1.00 0.00 ? 25 VAL A HB   4  
ATOM 4357  H HG11 . VAL A 1 25 ? 4.479   5.050   5.097   1.00 0.00 ? 25 VAL A HG11 4  
ATOM 4358  H HG12 . VAL A 1 25 ? 6.067   5.749   4.779   1.00 0.00 ? 25 VAL A HG12 4  
ATOM 4359  H HG13 . VAL A 1 25 ? 5.750   4.062   4.377   1.00 0.00 ? 25 VAL A HG13 4  
ATOM 4360  H HG21 . VAL A 1 25 ? 3.192   4.133   3.025   1.00 0.00 ? 25 VAL A HG21 4  
ATOM 4361  H HG22 . VAL A 1 25 ? 3.087   5.435   1.840   1.00 0.00 ? 25 VAL A HG22 4  
ATOM 4362  H HG23 . VAL A 1 25 ? 2.806   5.772   3.548   1.00 0.00 ? 25 VAL A HG23 4  
ATOM 4363  N N    . TRP A 1 26 ? 6.025   7.406   0.572   1.00 0.00 ? 26 TRP A N    4  
ATOM 4364  C CA   . TRP A 1 26 ? 5.948   7.708   -0.852  1.00 0.00 ? 26 TRP A CA   4  
ATOM 4365  C C    . TRP A 1 26 ? 5.724   6.438   -1.667  1.00 0.00 ? 26 TRP A C    4  
ATOM 4366  O O    . TRP A 1 26 ? 6.638   5.630   -1.838  1.00 0.00 ? 26 TRP A O    4  
ATOM 4367  C CB   . TRP A 1 26 ? 7.226   8.407   -1.316  1.00 0.00 ? 26 TRP A CB   4  
ATOM 4368  C CG   . TRP A 1 26 ? 7.223   9.884   -1.062  1.00 0.00 ? 26 TRP A CG   4  
ATOM 4369  C CD1  . TRP A 1 26 ? 7.098   10.875  -1.991  1.00 0.00 ? 26 TRP A CD1  4  
ATOM 4370  C CD2  . TRP A 1 26 ? 7.350   10.536  0.207   1.00 0.00 ? 26 TRP A CD2  4  
ATOM 4371  N NE1  . TRP A 1 26 ? 7.140   12.104  -1.379  1.00 0.00 ? 26 TRP A NE1  4  
ATOM 4372  C CE2  . TRP A 1 26 ? 7.294   11.922  -0.029  1.00 0.00 ? 26 TRP A CE2  4  
ATOM 4373  C CE3  . TRP A 1 26 ? 7.504   10.082  1.520   1.00 0.00 ? 26 TRP A CE3  4  
ATOM 4374  C CZ2  . TRP A 1 26 ? 7.387   12.857  0.999   1.00 0.00 ? 26 TRP A CZ2  4  
ATOM 4375  C CZ3  . TRP A 1 26 ? 7.597   11.011  2.540   1.00 0.00 ? 26 TRP A CZ3  4  
ATOM 4376  C CH2  . TRP A 1 26 ? 7.538   12.384  2.274   1.00 0.00 ? 26 TRP A CH2  4  
ATOM 4377  H H    . TRP A 1 26 ? 6.904   7.292   0.990   1.00 0.00 ? 26 TRP A H    4  
ATOM 4378  H HA   . TRP A 1 26 ? 5.109   8.371   -1.004  1.00 0.00 ? 26 TRP A HA   4  
ATOM 4379  H HB2  . TRP A 1 26 ? 8.071   7.982   -0.795  1.00 0.00 ? 26 TRP A HB2  4  
ATOM 4380  H HB3  . TRP A 1 26 ? 7.348   8.251   -2.378  1.00 0.00 ? 26 TRP A HB3  4  
ATOM 4381  H HD1  . TRP A 1 26 ? 6.985   10.705  -3.052  1.00 0.00 ? 26 TRP A HD1  4  
ATOM 4382  H HE1  . TRP A 1 26 ? 7.071   12.969  -1.833  1.00 0.00 ? 26 TRP A HE1  4  
ATOM 4383  H HE3  . TRP A 1 26 ? 7.551   9.026   1.744   1.00 0.00 ? 26 TRP A HE3  4  
ATOM 4384  H HZ2  . TRP A 1 26 ? 7.343   13.919  0.810   1.00 0.00 ? 26 TRP A HZ2  4  
ATOM 4385  H HZ3  . TRP A 1 26 ? 7.718   10.679  3.560   1.00 0.00 ? 26 TRP A HZ3  4  
ATOM 4386  H HH2  . TRP A 1 26 ? 7.616   13.075  3.101   1.00 0.00 ? 26 TRP A HH2  4  
ATOM 4387  N N    . VAL A 1 27 ? 4.504   6.268   -2.167  1.00 0.00 ? 27 VAL A N    4  
ATOM 4388  C CA   . VAL A 1 27 ? 4.162   5.096   -2.962  1.00 0.00 ? 27 VAL A CA   4  
ATOM 4389  C C    . VAL A 1 27 ? 4.887   5.111   -4.304  1.00 0.00 ? 27 VAL A C    4  
ATOM 4390  O O    . VAL A 1 27 ? 4.591   5.934   -5.170  1.00 0.00 ? 27 VAL A O    4  
ATOM 4391  C CB   . VAL A 1 27 ? 2.645   5.009   -3.213  1.00 0.00 ? 27 VAL A CB   4  
ATOM 4392  C CG1  . VAL A 1 27 ? 2.286   3.686   -3.869  1.00 0.00 ? 27 VAL A CG1  4  
ATOM 4393  C CG2  . VAL A 1 27 ? 1.878   5.194   -1.913  1.00 0.00 ? 27 VAL A CG2  4  
ATOM 4394  H H    . VAL A 1 27 ? 3.818   6.946   -1.995  1.00 0.00 ? 27 VAL A H    4  
ATOM 4395  H HA   . VAL A 1 27 ? 4.465   4.218   -2.411  1.00 0.00 ? 27 VAL A HA   4  
ATOM 4396  H HB   . VAL A 1 27 ? 2.366   5.806   -3.887  1.00 0.00 ? 27 VAL A HB   4  
ATOM 4397  H HG11 . VAL A 1 27 ? 2.692   2.872   -3.285  1.00 0.00 ? 27 VAL A HG11 4  
ATOM 4398  H HG12 . VAL A 1 27 ? 2.698   3.654   -4.867  1.00 0.00 ? 27 VAL A HG12 4  
ATOM 4399  H HG13 . VAL A 1 27 ? 1.211   3.589   -3.921  1.00 0.00 ? 27 VAL A HG13 4  
ATOM 4400  H HG21 . VAL A 1 27 ? 0.992   4.577   -1.926  1.00 0.00 ? 27 VAL A HG21 4  
ATOM 4401  H HG22 . VAL A 1 27 ? 1.592   6.231   -1.807  1.00 0.00 ? 27 VAL A HG22 4  
ATOM 4402  H HG23 . VAL A 1 27 ? 2.504   4.909   -1.081  1.00 0.00 ? 27 VAL A HG23 4  
ATOM 4403  N N    . ASN A 1 28 ? 5.837   4.197   -4.468  1.00 0.00 ? 28 ASN A N    4  
ATOM 4404  C CA   . ASN A 1 28 ? 6.605   4.106   -5.705  1.00 0.00 ? 28 ASN A CA   4  
ATOM 4405  C C    . ASN A 1 28 ? 7.359   5.403   -5.975  1.00 0.00 ? 28 ASN A C    4  
ATOM 4406  O O    . ASN A 1 28 ? 7.597   5.766   -7.127  1.00 0.00 ? 28 ASN A O    4  
ATOM 4407  C CB   . ASN A 1 28 ? 5.682   3.785   -6.881  1.00 0.00 ? 28 ASN A CB   4  
ATOM 4408  C CG   . ASN A 1 28 ? 5.515   2.293   -7.094  1.00 0.00 ? 28 ASN A CG   4  
ATOM 4409  O OD1  . ASN A 1 28 ? 6.299   1.665   -7.806  1.00 0.00 ? 28 ASN A OD1  4  
ATOM 4410  N ND2  . ASN A 1 28 ? 4.489   1.718   -6.478  1.00 0.00 ? 28 ASN A ND2  4  
ATOM 4411  H H    . ASN A 1 28 ? 6.027   3.569   -3.740  1.00 0.00 ? 28 ASN A H    4  
ATOM 4412  H HA   . ASN A 1 28 ? 7.320   3.305   -5.591  1.00 0.00 ? 28 ASN A HA   4  
ATOM 4413  H HB2  . ASN A 1 28 ? 4.708   4.213   -6.693  1.00 0.00 ? 28 ASN A HB2  4  
ATOM 4414  H HB3  . ASN A 1 28 ? 6.093   4.216   -7.781  1.00 0.00 ? 28 ASN A HB3  4  
ATOM 4415  H HD21 . ASN A 1 28 ? 3.906   2.280   -5.927  1.00 0.00 ? 28 ASN A HD21 4  
ATOM 4416  H HD22 . ASN A 1 28 ? 4.357   0.755   -6.598  1.00 0.00 ? 28 ASN A HD22 4  
ATOM 4417  N N    . GLY A 1 29 ? 7.735   6.098   -4.906  1.00 0.00 ? 29 GLY A N    4  
ATOM 4418  C CA   . GLY A 1 29 ? 8.460   7.348   -5.050  1.00 0.00 ? 29 GLY A CA   4  
ATOM 4419  C C    . GLY A 1 29 ? 7.691   8.376   -5.855  1.00 0.00 ? 29 GLY A C    4  
ATOM 4420  O O    . GLY A 1 29 ? 8.281   9.163   -6.596  1.00 0.00 ? 29 GLY A O    4  
ATOM 4421  H H    . GLY A 1 29 ? 7.520   5.760   -4.013  1.00 0.00 ? 29 GLY A H    4  
ATOM 4422  H HA2  . GLY A 1 29 ? 8.659   7.751   -4.068  1.00 0.00 ? 29 GLY A HA2  4  
ATOM 4423  H HA3  . GLY A 1 29 ? 9.400   7.151   -5.544  1.00 0.00 ? 29 GLY A HA3  4  
ATOM 4424  N N    . VAL A 1 30 ? 6.370   8.372   -5.711  1.00 0.00 ? 30 VAL A N    4  
ATOM 4425  C CA   . VAL A 1 30 ? 5.519   9.311   -6.431  1.00 0.00 ? 30 VAL A CA   4  
ATOM 4426  C C    . VAL A 1 30 ? 4.975   10.387  -5.495  1.00 0.00 ? 30 VAL A C    4  
ATOM 4427  O O    . VAL A 1 30 ? 5.323   11.561  -5.616  1.00 0.00 ? 30 VAL A O    4  
ATOM 4428  C CB   . VAL A 1 30 ? 4.339   8.593   -7.111  1.00 0.00 ? 30 VAL A CB   4  
ATOM 4429  C CG1  . VAL A 1 30 ? 3.570   9.556   -8.004  1.00 0.00 ? 30 VAL A CG1  4  
ATOM 4430  C CG2  . VAL A 1 30 ? 4.831   7.393   -7.907  1.00 0.00 ? 30 VAL A CG2  4  
ATOM 4431  H H    . VAL A 1 30 ? 5.958   7.720   -5.106  1.00 0.00 ? 30 VAL A H    4  
ATOM 4432  H HA   . VAL A 1 30 ? 6.118   9.783   -7.196  1.00 0.00 ? 30 VAL A HA   4  
ATOM 4433  H HB   . VAL A 1 30 ? 3.668   8.239   -6.343  1.00 0.00 ? 30 VAL A HB   4  
ATOM 4434  H HG11 . VAL A 1 30 ? 2.513   9.352   -7.927  1.00 0.00 ? 30 VAL A HG11 4  
ATOM 4435  H HG12 . VAL A 1 30 ? 3.887   9.427   -9.029  1.00 0.00 ? 30 VAL A HG12 4  
ATOM 4436  H HG13 . VAL A 1 30 ? 3.766   10.570  -7.693  1.00 0.00 ? 30 VAL A HG13 4  
ATOM 4437  H HG21 . VAL A 1 30 ? 4.026   7.012   -8.517  1.00 0.00 ? 30 VAL A HG21 4  
ATOM 4438  H HG22 . VAL A 1 30 ? 5.163   6.623   -7.226  1.00 0.00 ? 30 VAL A HG22 4  
ATOM 4439  H HG23 . VAL A 1 30 ? 5.652   7.694   -8.540  1.00 0.00 ? 30 VAL A HG23 4  
ATOM 4440  N N    . LYS A 1 31 ? 4.120   9.978   -4.566  1.00 0.00 ? 31 LYS A N    4  
ATOM 4441  C CA   . LYS A 1 31 ? 3.528   10.908  -3.610  1.00 0.00 ? 31 LYS A CA   4  
ATOM 4442  C C    . LYS A 1 31 ? 3.396   10.262  -2.232  1.00 0.00 ? 31 LYS A C    4  
ATOM 4443  O O    . LYS A 1 31 ? 3.155   9.060   -2.122  1.00 0.00 ? 31 LYS A O    4  
ATOM 4444  C CB   . LYS A 1 31 ? 2.156   11.373  -4.101  1.00 0.00 ? 31 LYS A CB   4  
ATOM 4445  C CG   . LYS A 1 31 ? 2.218   12.248  -5.342  1.00 0.00 ? 31 LYS A CG   4  
ATOM 4446  C CD   . LYS A 1 31 ? 0.921   12.191  -6.135  1.00 0.00 ? 31 LYS A CD   4  
ATOM 4447  C CE   . LYS A 1 31 ? 0.237   13.547  -6.188  1.00 0.00 ? 31 LYS A CE   4  
ATOM 4448  N NZ   . LYS A 1 31 ? -0.420  13.888  -4.896  1.00 0.00 ? 31 LYS A NZ   4  
ATOM 4449  H H    . LYS A 1 31 ? 3.880   9.028   -4.519  1.00 0.00 ? 31 LYS A H    4  
ATOM 4450  H HA   . LYS A 1 31 ? 4.181   11.763  -3.533  1.00 0.00 ? 31 LYS A HA   4  
ATOM 4451  H HB2  . LYS A 1 31 ? 1.555   10.504  -4.330  1.00 0.00 ? 31 LYS A HB2  4  
ATOM 4452  H HB3  . LYS A 1 31 ? 1.675   11.934  -3.315  1.00 0.00 ? 31 LYS A HB3  4  
ATOM 4453  H HG2  . LYS A 1 31 ? 2.400   13.269  -5.041  1.00 0.00 ? 31 LYS A HG2  4  
ATOM 4454  H HG3  . LYS A 1 31 ? 3.029   11.907  -5.970  1.00 0.00 ? 31 LYS A HG3  4  
ATOM 4455  H HD2  . LYS A 1 31 ? 1.141   11.871  -7.143  1.00 0.00 ? 31 LYS A HD2  4  
ATOM 4456  H HD3  . LYS A 1 31 ? 0.255   11.479  -5.668  1.00 0.00 ? 31 LYS A HD3  4  
ATOM 4457  H HE2  . LYS A 1 31 ? 0.976   14.300  -6.415  1.00 0.00 ? 31 LYS A HE2  4  
ATOM 4458  H HE3  . LYS A 1 31 ? -0.510  13.529  -6.969  1.00 0.00 ? 31 LYS A HE3  4  
ATOM 4459  H HZ1  . LYS A 1 31 ? -1.078  13.132  -4.619  1.00 0.00 ? 31 LYS A HZ1  4  
ATOM 4460  H HZ2  . LYS A 1 31 ? -0.952  14.777  -4.990  1.00 0.00 ? 31 LYS A HZ2  4  
ATOM 4461  H HZ3  . LYS A 1 31 ? 0.295   14.003  -4.150  1.00 0.00 ? 31 LYS A HZ3  4  
ATOM 4462  N N    . PRO A 1 32 ? 3.552   11.056  -1.158  1.00 0.00 ? 32 PRO A N    4  
ATOM 4463  C CA   . PRO A 1 32 ? 3.448   10.554  0.215   1.00 0.00 ? 32 PRO A CA   4  
ATOM 4464  C C    . PRO A 1 32 ? 2.009   10.246  0.613   1.00 0.00 ? 32 PRO A C    4  
ATOM 4465  O O    . PRO A 1 32 ? 1.074   10.901  0.151   1.00 0.00 ? 32 PRO A O    4  
ATOM 4466  C CB   . PRO A 1 32 ? 4.000   11.708  1.053   1.00 0.00 ? 32 PRO A CB   4  
ATOM 4467  C CG   . PRO A 1 32 ? 3.724   12.926  0.242   1.00 0.00 ? 32 PRO A CG   4  
ATOM 4468  C CD   . PRO A 1 32 ? 3.841   12.503  -1.198  1.00 0.00 ? 32 PRO A CD   4  
ATOM 4469  H HA   . PRO A 1 32 ? 4.058   9.675   0.362   1.00 0.00 ? 32 PRO A HA   4  
ATOM 4470  H HB2  . PRO A 1 32 ? 3.488   11.742  2.005   1.00 0.00 ? 32 PRO A HB2  4  
ATOM 4471  H HB3  . PRO A 1 32 ? 5.061   11.569  1.209   1.00 0.00 ? 32 PRO A HB3  4  
ATOM 4472  H HG2  . PRO A 1 32 ? 2.727   13.286  0.447   1.00 0.00 ? 32 PRO A HG2  4  
ATOM 4473  H HG3  . PRO A 1 32 ? 4.454   13.689  0.467   1.00 0.00 ? 32 PRO A HG3  4  
ATOM 4474  H HD2  . PRO A 1 32 ? 3.115   13.024  -1.804  1.00 0.00 ? 32 PRO A HD2  4  
ATOM 4475  H HD3  . PRO A 1 32 ? 4.841   12.685  -1.565  1.00 0.00 ? 32 PRO A HD3  4  
ATOM 4476  N N    . GLY A 1 33 ? 1.839   9.248   1.473   1.00 0.00 ? 33 GLY A N    4  
ATOM 4477  C CA   . GLY A 1 33 ? 0.509   8.872   1.918   1.00 0.00 ? 33 GLY A CA   4  
ATOM 4478  C C    . GLY A 1 33 ? 0.494   8.393   3.357   1.00 0.00 ? 33 GLY A C    4  
ATOM 4479  O O    . GLY A 1 33 ? 1.488   7.862   3.852   1.00 0.00 ? 33 GLY A O    4  
ATOM 4480  H H    . GLY A 1 33 ? 2.621   8.763   1.807   1.00 0.00 ? 33 GLY A H    4  
ATOM 4481  H HA2  . GLY A 1 33 ? -0.144  9.727   1.827   1.00 0.00 ? 33 GLY A HA2  4  
ATOM 4482  H HA3  . GLY A 1 33 ? 0.140   8.080   1.283   1.00 0.00 ? 33 GLY A HA3  4  
ATOM 4483  N N    . VAL A 1 34 ? -0.636  8.583   4.029   1.00 0.00 ? 34 VAL A N    4  
ATOM 4484  C CA   . VAL A 1 34 ? -0.777  8.168   5.420   1.00 0.00 ? 34 VAL A CA   4  
ATOM 4485  C C    . VAL A 1 34 ? -1.162  6.696   5.516   1.00 0.00 ? 34 VAL A C    4  
ATOM 4486  O O    . VAL A 1 34 ? -2.271  6.308   5.151   1.00 0.00 ? 34 VAL A O    4  
ATOM 4487  C CB   . VAL A 1 34 ? -1.835  9.012   6.153   1.00 0.00 ? 34 VAL A CB   4  
ATOM 4488  C CG1  . VAL A 1 34 ? -1.827  8.703   7.643   1.00 0.00 ? 34 VAL A CG1  4  
ATOM 4489  C CG2  . VAL A 1 34 ? -1.600  10.495  5.908   1.00 0.00 ? 34 VAL A CG2  4  
ATOM 4490  H H    . VAL A 1 34 ? -1.394  9.012   3.579   1.00 0.00 ? 34 VAL A H    4  
ATOM 4491  H HA   . VAL A 1 34 ? 0.175   8.315   5.910   1.00 0.00 ? 34 VAL A HA   4  
ATOM 4492  H HB   . VAL A 1 34 ? -2.808  8.754   5.761   1.00 0.00 ? 34 VAL A HB   4  
ATOM 4493  H HG11 . VAL A 1 34 ? -2.299  9.511   8.181   1.00 0.00 ? 34 VAL A HG11 4  
ATOM 4494  H HG12 . VAL A 1 34 ? -0.807  8.592   7.982   1.00 0.00 ? 34 VAL A HG12 4  
ATOM 4495  H HG13 . VAL A 1 34 ? -2.368  7.786   7.824   1.00 0.00 ? 34 VAL A HG13 4  
ATOM 4496  H HG21 . VAL A 1 34 ? -2.355  11.070  6.425   1.00 0.00 ? 34 VAL A HG21 4  
ATOM 4497  H HG22 . VAL A 1 34 ? -1.656  10.697  4.849   1.00 0.00 ? 34 VAL A HG22 4  
ATOM 4498  H HG23 . VAL A 1 34 ? -0.623  10.771  6.276   1.00 0.00 ? 34 VAL A HG23 4  
ATOM 4499  N N    . VAL A 1 35 ? -0.238  5.879   6.013   1.00 0.00 ? 35 VAL A N    4  
ATOM 4500  C CA   . VAL A 1 35 ? -0.481  4.449   6.158   1.00 0.00 ? 35 VAL A CA   4  
ATOM 4501  C C    . VAL A 1 35 ? -1.471  4.172   7.285   1.00 0.00 ? 35 VAL A C    4  
ATOM 4502  O O    . VAL A 1 35 ? -1.385  4.764   8.361   1.00 0.00 ? 35 VAL A O    4  
ATOM 4503  C CB   . VAL A 1 35 ? 0.825   3.683   6.441   1.00 0.00 ? 35 VAL A CB   4  
ATOM 4504  C CG1  . VAL A 1 35 ? 0.586   2.181   6.391   1.00 0.00 ? 35 VAL A CG1  4  
ATOM 4505  C CG2  . VAL A 1 35 ? 1.907   4.091   5.452   1.00 0.00 ? 35 VAL A CG2  4  
ATOM 4506  H H    . VAL A 1 35 ? 0.628   6.248   6.288   1.00 0.00 ? 35 VAL A H    4  
ATOM 4507  H HA   . VAL A 1 35 ? -0.895  4.084   5.230   1.00 0.00 ? 35 VAL A HA   4  
ATOM 4508  H HB   . VAL A 1 35 ? 1.161   3.938   7.435   1.00 0.00 ? 35 VAL A HB   4  
ATOM 4509  H HG11 . VAL A 1 35 ? 1.460   1.690   5.991   1.00 0.00 ? 35 VAL A HG11 4  
ATOM 4510  H HG12 . VAL A 1 35 ? -0.265  1.974   5.759   1.00 0.00 ? 35 VAL A HG12 4  
ATOM 4511  H HG13 . VAL A 1 35 ? 0.392   1.815   7.388   1.00 0.00 ? 35 VAL A HG13 4  
ATOM 4512  H HG21 . VAL A 1 35 ? 2.706   3.364   5.473   1.00 0.00 ? 35 VAL A HG21 4  
ATOM 4513  H HG22 . VAL A 1 35 ? 2.296   5.060   5.724   1.00 0.00 ? 35 VAL A HG22 4  
ATOM 4514  H HG23 . VAL A 1 35 ? 1.488   4.136   4.457   1.00 0.00 ? 35 VAL A HG23 4  
ATOM 4515  N N    . GLN A 1 36 ? -2.412  3.270   7.029   1.00 0.00 ? 36 GLN A N    4  
ATOM 4516  C CA   . GLN A 1 36 ? -3.420  2.913   8.021   1.00 0.00 ? 36 GLN A CA   4  
ATOM 4517  C C    . GLN A 1 36 ? -3.434  1.408   8.266   1.00 0.00 ? 36 GLN A C    4  
ATOM 4518  O O    . GLN A 1 36 ? -3.408  0.955   9.411   1.00 0.00 ? 36 GLN A O    4  
ATOM 4519  C CB   . GLN A 1 36 ? -4.803  3.379   7.563   1.00 0.00 ? 36 GLN A CB   4  
ATOM 4520  C CG   . GLN A 1 36 ? -5.156  4.783   8.027   1.00 0.00 ? 36 GLN A CG   4  
ATOM 4521  C CD   . GLN A 1 36 ? -5.499  4.839   9.504   1.00 0.00 ? 36 GLN A CD   4  
ATOM 4522  O OE1  . GLN A 1 36 ? -6.622  4.536   9.904   1.00 0.00 ? 36 GLN A OE1  4  
ATOM 4523  N NE2  . GLN A 1 36 ? -4.529  5.231   10.321  1.00 0.00 ? 36 GLN A NE2  4  
ATOM 4524  H H    . GLN A 1 36 ? -2.430  2.832   6.152   1.00 0.00 ? 36 GLN A H    4  
ATOM 4525  H HA   . GLN A 1 36 ? -3.169  3.414   8.944   1.00 0.00 ? 36 GLN A HA   4  
ATOM 4526  H HB2  . GLN A 1 36 ? -4.838  3.361   6.484   1.00 0.00 ? 36 GLN A HB2  4  
ATOM 4527  H HB3  . GLN A 1 36 ? -5.547  2.698   7.949   1.00 0.00 ? 36 GLN A HB3  4  
ATOM 4528  H HG2  . GLN A 1 36 ? -4.314  5.432   7.844   1.00 0.00 ? 36 GLN A HG2  4  
ATOM 4529  H HG3  . GLN A 1 36 ? -6.008  5.132   7.461   1.00 0.00 ? 36 GLN A HG3  4  
ATOM 4530  H HE21 . GLN A 1 36 ? -3.658  5.459   9.932   1.00 0.00 ? 36 GLN A HE21 4  
ATOM 4531  H HE22 . GLN A 1 36 ? -4.722  5.277   11.281  1.00 0.00 ? 36 GLN A HE22 4  
ATOM 4532  N N    . TYR A 1 37 ? -3.474  0.637   7.184   1.00 0.00 ? 37 TYR A N    4  
ATOM 4533  C CA   . TYR A 1 37 ? -3.491  -0.818  7.282   1.00 0.00 ? 37 TYR A CA   4  
ATOM 4534  C C    . TYR A 1 37 ? -2.159  -1.409  6.832   1.00 0.00 ? 37 TYR A C    4  
ATOM 4535  O O    . TYR A 1 37 ? -1.527  -0.903  5.905   1.00 0.00 ? 37 TYR A O    4  
ATOM 4536  C CB   . TYR A 1 37 ? -4.630  -1.394  6.438   1.00 0.00 ? 37 TYR A CB   4  
ATOM 4537  C CG   . TYR A 1 37 ? -5.222  -2.664  7.005   1.00 0.00 ? 37 TYR A CG   4  
ATOM 4538  C CD1  . TYR A 1 37 ? -4.506  -3.854  6.990   1.00 0.00 ? 37 TYR A CD1  4  
ATOM 4539  C CD2  . TYR A 1 37 ? -6.498  -2.672  7.557   1.00 0.00 ? 37 TYR A CD2  4  
ATOM 4540  C CE1  . TYR A 1 37 ? -5.044  -5.018  7.508   1.00 0.00 ? 37 TYR A CE1  4  
ATOM 4541  C CE2  . TYR A 1 37 ? -7.042  -3.832  8.077   1.00 0.00 ? 37 TYR A CE2  4  
ATOM 4542  C CZ   . TYR A 1 37 ? -6.312  -5.001  8.050   1.00 0.00 ? 37 TYR A CZ   4  
ATOM 4543  O OH   . TYR A 1 37 ? -6.851  -6.156  8.566   1.00 0.00 ? 37 TYR A OH   4  
ATOM 4544  H H    . TYR A 1 37 ? -3.493  1.057   6.299   1.00 0.00 ? 37 TYR A H    4  
ATOM 4545  H HA   . TYR A 1 37 ? -3.655  -1.078  8.317   1.00 0.00 ? 37 TYR A HA   4  
ATOM 4546  H HB2  . TYR A 1 37 ? -5.421  -0.663  6.368   1.00 0.00 ? 37 TYR A HB2  4  
ATOM 4547  H HB3  . TYR A 1 37 ? -4.258  -1.614  5.448   1.00 0.00 ? 37 TYR A HB3  4  
ATOM 4548  H HD1  . TYR A 1 37 ? -3.514  -3.865  6.566   1.00 0.00 ? 37 TYR A HD1  4  
ATOM 4549  H HD2  . TYR A 1 37 ? -7.067  -1.755  7.576   1.00 0.00 ? 37 TYR A HD2  4  
ATOM 4550  H HE1  . TYR A 1 37 ? -4.472  -5.933  7.486   1.00 0.00 ? 37 TYR A HE1  4  
ATOM 4551  H HE2  . TYR A 1 37 ? -8.035  -3.817  8.501   1.00 0.00 ? 37 TYR A HE2  4  
ATOM 4552  H HH   . TYR A 1 37 ? -6.383  -6.398  9.368   1.00 0.00 ? 37 TYR A HH   4  
ATOM 4553  N N    . LEU A 1 38 ? -1.739  -2.482  7.494   1.00 0.00 ? 38 LEU A N    4  
ATOM 4554  C CA   . LEU A 1 38 ? -0.482  -3.142  7.162   1.00 0.00 ? 38 LEU A CA   4  
ATOM 4555  C C    . LEU A 1 38 ? -0.598  -4.653  7.335   1.00 0.00 ? 38 LEU A C    4  
ATOM 4556  O O    . LEU A 1 38 ? -0.529  -5.166  8.452   1.00 0.00 ? 38 LEU A O    4  
ATOM 4557  C CB   . LEU A 1 38 ? 0.649   -2.601  8.038   1.00 0.00 ? 38 LEU A CB   4  
ATOM 4558  C CG   . LEU A 1 38 ? 1.190   -1.231  7.624   1.00 0.00 ? 38 LEU A CG   4  
ATOM 4559  C CD1  . LEU A 1 38 ? 2.352   -0.824  8.517   1.00 0.00 ? 38 LEU A CD1  4  
ATOM 4560  C CD2  . LEU A 1 38 ? 1.618   -1.247  6.164   1.00 0.00 ? 38 LEU A CD2  4  
ATOM 4561  H H    . LEU A 1 38 ? -2.287  -2.838  8.224   1.00 0.00 ? 38 LEU A H    4  
ATOM 4562  H HA   . LEU A 1 38 ? -0.259  -2.927  6.128   1.00 0.00 ? 38 LEU A HA   4  
ATOM 4563  H HB2  . LEU A 1 38 ? 0.287   -2.531  9.053   1.00 0.00 ? 38 LEU A HB2  4  
ATOM 4564  H HB3  . LEU A 1 38 ? 1.466   -3.307  8.012   1.00 0.00 ? 38 LEU A HB3  4  
ATOM 4565  H HG   . LEU A 1 38 ? 0.408   -0.494  7.736   1.00 0.00 ? 38 LEU A HG   4  
ATOM 4566  H HD11 . LEU A 1 38 ? 3.049   -1.645  8.599   1.00 0.00 ? 38 LEU A HD11 4  
ATOM 4567  H HD12 . LEU A 1 38 ? 1.979   -0.570  9.499   1.00 0.00 ? 38 LEU A HD12 4  
ATOM 4568  H HD13 . LEU A 1 38 ? 2.852   0.032   8.090   1.00 0.00 ? 38 LEU A HD13 4  
ATOM 4569  H HD21 . LEU A 1 38 ? 2.345   -0.467  5.993   1.00 0.00 ? 38 LEU A HD21 4  
ATOM 4570  H HD22 . LEU A 1 38 ? 0.757   -1.082  5.535   1.00 0.00 ? 38 LEU A HD22 4  
ATOM 4571  H HD23 . LEU A 1 38 ? 2.057   -2.206  5.928   1.00 0.00 ? 38 LEU A HD23 4  
ATOM 4572  N N    . GLY A 1 39 ? -0.775  -5.360  6.224   1.00 0.00 ? 39 GLY A N    4  
ATOM 4573  C CA   . GLY A 1 39 ? -0.897  -6.804  6.276   1.00 0.00 ? 39 GLY A CA   4  
ATOM 4574  C C    . GLY A 1 39 ? -1.476  -7.384  5.000   1.00 0.00 ? 39 GLY A C    4  
ATOM 4575  O O    . GLY A 1 39 ? -1.522  -6.710  3.970   1.00 0.00 ? 39 GLY A O    4  
ATOM 4576  H H    . GLY A 1 39 ? -0.823  -4.896  5.362   1.00 0.00 ? 39 GLY A H    4  
ATOM 4577  H HA2  . GLY A 1 39 ? 0.080   -7.232  6.441   1.00 0.00 ? 39 GLY A HA2  4  
ATOM 4578  H HA3  . GLY A 1 39 ? -1.540  -7.071  7.102   1.00 0.00 ? 39 GLY A HA3  4  
ATOM 4579  N N    . GLU A 1 40 ? -1.920  -8.634  5.067   1.00 0.00 ? 40 GLU A N    4  
ATOM 4580  C CA   . GLU A 1 40 ? -2.499  -9.304  3.909   1.00 0.00 ? 40 GLU A CA   4  
ATOM 4581  C C    . GLU A 1 40 ? -3.922  -8.819  3.654   1.00 0.00 ? 40 GLU A C    4  
ATOM 4582  O O    . GLU A 1 40 ? -4.787  -8.919  4.523   1.00 0.00 ? 40 GLU A O    4  
ATOM 4583  C CB   . GLU A 1 40 ? -2.493  -10.820 4.114   1.00 0.00 ? 40 GLU A CB   4  
ATOM 4584  C CG   . GLU A 1 40 ? -1.099  -11.414 4.232   1.00 0.00 ? 40 GLU A CG   4  
ATOM 4585  C CD   . GLU A 1 40 ? -1.089  -12.918 4.046   1.00 0.00 ? 40 GLU A CD   4  
ATOM 4586  O OE1  . GLU A 1 40 ? -1.000  -13.373 2.886   1.00 0.00 ? 40 GLU A OE1  4  
ATOM 4587  O OE2  . GLU A 1 40 ? -1.169  -13.642 5.062   1.00 0.00 ? 40 GLU A OE2  4  
ATOM 4588  H H    . GLU A 1 40 ? -1.856  -9.119  5.917   1.00 0.00 ? 40 GLU A H    4  
ATOM 4589  H HA   . GLU A 1 40 ? -1.890  -9.065  3.050   1.00 0.00 ? 40 GLU A HA   4  
ATOM 4590  H HB2  . GLU A 1 40 ? -3.037  -11.051 5.019   1.00 0.00 ? 40 GLU A HB2  4  
ATOM 4591  H HB3  . GLU A 1 40 ? -2.992  -11.288 3.278   1.00 0.00 ? 40 GLU A HB3  4  
ATOM 4592  H HG2  . GLU A 1 40 ? -0.468  -10.969 3.476   1.00 0.00 ? 40 GLU A HG2  4  
ATOM 4593  H HG3  . GLU A 1 40 ? -0.705  -11.183 5.210   1.00 0.00 ? 40 GLU A HG3  4  
ATOM 4594  N N    . THR A 1 41 ? -4.157  -8.292  2.456   1.00 0.00 ? 41 THR A N    4  
ATOM 4595  C CA   . THR A 1 41 ? -5.476  -7.791  2.087   1.00 0.00 ? 41 THR A CA   4  
ATOM 4596  C C    . THR A 1 41 ? -6.454  -8.941  1.878   1.00 0.00 ? 41 THR A C    4  
ATOM 4597  O O    . THR A 1 41 ? -6.105  -10.107 2.056   1.00 0.00 ? 41 THR A O    4  
ATOM 4598  C CB   . THR A 1 41 ? -5.385  -6.945  0.817   1.00 0.00 ? 41 THR A CB   4  
ATOM 4599  O OG1  . THR A 1 41 ? -4.488  -7.527  -0.112  1.00 0.00 ? 41 THR A OG1  4  
ATOM 4600  C CG2  . THR A 1 41 ? -4.923  -5.527  1.073   1.00 0.00 ? 41 THR A CG2  4  
ATOM 4601  H H    . THR A 1 41 ? -3.425  -8.240  1.806   1.00 0.00 ? 41 THR A H    4  
ATOM 4602  H HA   . THR A 1 41 ? -5.833  -7.172  2.896   1.00 0.00 ? 41 THR A HA   4  
ATOM 4603  H HB   . THR A 1 41 ? -6.363  -6.896  0.359   1.00 0.00 ? 41 THR A HB   4  
ATOM 4604  H HG1  . THR A 1 41 ? -4.659  -8.471  -0.174  1.00 0.00 ? 41 THR A HG1  4  
ATOM 4605  H HG21 . THR A 1 41 ? -4.558  -5.446  2.086   1.00 0.00 ? 41 THR A HG21 4  
ATOM 4606  H HG22 . THR A 1 41 ? -5.751  -4.848  0.932   1.00 0.00 ? 41 THR A HG22 4  
ATOM 4607  H HG23 . THR A 1 41 ? -4.131  -5.276  0.384   1.00 0.00 ? 41 THR A HG23 4  
ATOM 4608  N N    . GLN A 1 42 ? -7.683  -8.604  1.500   1.00 0.00 ? 42 GLN A N    4  
ATOM 4609  C CA   . GLN A 1 42 ? -8.714  -9.609  1.267   1.00 0.00 ? 42 GLN A CA   4  
ATOM 4610  C C    . GLN A 1 42 ? -9.016  -9.747  -0.222  1.00 0.00 ? 42 GLN A C    4  
ATOM 4611  O O    . GLN A 1 42 ? -9.387  -10.822 -0.693  1.00 0.00 ? 42 GLN A O    4  
ATOM 4612  C CB   . GLN A 1 42 ? -9.992  -9.245  2.025   1.00 0.00 ? 42 GLN A CB   4  
ATOM 4613  C CG   . GLN A 1 42 ? -9.852  -9.346  3.536   1.00 0.00 ? 42 GLN A CG   4  
ATOM 4614  C CD   . GLN A 1 42 ? -10.046 -10.761 4.045   1.00 0.00 ? 42 GLN A CD   4  
ATOM 4615  O OE1  . GLN A 1 42 ? -9.097  -11.410 4.485   1.00 0.00 ? 42 GLN A OE1  4  
ATOM 4616  N NE2  . GLN A 1 42 ? -11.281 -11.246 3.989   1.00 0.00 ? 42 GLN A NE2  4  
ATOM 4617  H H    . GLN A 1 42 ? -7.903  -7.657  1.374   1.00 0.00 ? 42 GLN A H    4  
ATOM 4618  H HA   . GLN A 1 42 ? -8.345  -10.554 1.636   1.00 0.00 ? 42 GLN A HA   4  
ATOM 4619  H HB2  . GLN A 1 42 ? -10.266 -8.230  1.778   1.00 0.00 ? 42 GLN A HB2  4  
ATOM 4620  H HB3  . GLN A 1 42 ? -10.784 -9.909  1.713   1.00 0.00 ? 42 GLN A HB3  4  
ATOM 4621  H HG2  . GLN A 1 42 ? -8.865  -9.011  3.816   1.00 0.00 ? 42 GLN A HG2  4  
ATOM 4622  H HG3  . GLN A 1 42 ? -10.592 -8.708  3.996   1.00 0.00 ? 42 GLN A HG3  4  
ATOM 4623  H HE21 . GLN A 1 42 ? -11.988 -10.671 3.627   1.00 0.00 ? 42 GLN A HE21 4  
ATOM 4624  H HE22 . GLN A 1 42 ? -11.435 -12.158 4.312   1.00 0.00 ? 42 GLN A HE22 4  
ATOM 4625  N N    . PHE A 1 43 ? -8.854  -8.653  -0.959  1.00 0.00 ? 43 PHE A N    4  
ATOM 4626  C CA   . PHE A 1 43 ? -9.111  -8.655  -2.394  1.00 0.00 ? 43 PHE A CA   4  
ATOM 4627  C C    . PHE A 1 43 ? -8.073  -9.496  -3.133  1.00 0.00 ? 43 PHE A C    4  
ATOM 4628  O O    . PHE A 1 43 ? -8.396  -10.197 -4.091  1.00 0.00 ? 43 PHE A O    4  
ATOM 4629  C CB   . PHE A 1 43 ? -9.108  -7.224  -2.938  1.00 0.00 ? 43 PHE A CB   4  
ATOM 4630  C CG   . PHE A 1 43 ? -7.764  -6.556  -2.872  1.00 0.00 ? 43 PHE A CG   4  
ATOM 4631  C CD1  . PHE A 1 43 ? -6.800  -6.815  -3.834  1.00 0.00 ? 43 PHE A CD1  4  
ATOM 4632  C CD2  . PHE A 1 43 ? -7.464  -5.668  -1.851  1.00 0.00 ? 43 PHE A CD2  4  
ATOM 4633  C CE1  . PHE A 1 43 ? -5.562  -6.202  -3.777  1.00 0.00 ? 43 PHE A CE1  4  
ATOM 4634  C CE2  . PHE A 1 43 ? -6.229  -5.052  -1.789  1.00 0.00 ? 43 PHE A CE2  4  
ATOM 4635  C CZ   . PHE A 1 43 ? -5.276  -5.319  -2.753  1.00 0.00 ? 43 PHE A CZ   4  
ATOM 4636  H H    . PHE A 1 43 ? -8.556  -7.825  -0.528  1.00 0.00 ? 43 PHE A H    4  
ATOM 4637  H HA   . PHE A 1 43 ? -10.086 -9.089  -2.555  1.00 0.00 ? 43 PHE A HA   4  
ATOM 4638  H HB2  . PHE A 1 43 ? -9.421  -7.238  -3.971  1.00 0.00 ? 43 PHE A HB2  4  
ATOM 4639  H HB3  . PHE A 1 43 ? -9.804  -6.629  -2.365  1.00 0.00 ? 43 PHE A HB3  4  
ATOM 4640  H HD1  . PHE A 1 43 ? -7.022  -7.505  -4.634  1.00 0.00 ? 43 PHE A HD1  4  
ATOM 4641  H HD2  . PHE A 1 43 ? -8.208  -5.459  -1.096  1.00 0.00 ? 43 PHE A HD2  4  
ATOM 4642  H HE1  . PHE A 1 43 ? -4.820  -6.413  -4.533  1.00 0.00 ? 43 PHE A HE1  4  
ATOM 4643  H HE2  . PHE A 1 43 ? -6.007  -4.363  -0.988  1.00 0.00 ? 43 PHE A HE2  4  
ATOM 4644  H HZ   . PHE A 1 43 ? -4.309  -4.839  -2.708  1.00 0.00 ? 43 PHE A HZ   4  
ATOM 4645  N N    . ALA A 1 44 ? -6.826  -9.420  -2.679  1.00 0.00 ? 44 ALA A N    4  
ATOM 4646  C CA   . ALA A 1 44 ? -5.742  -10.173 -3.297  1.00 0.00 ? 44 ALA A CA   4  
ATOM 4647  C C    . ALA A 1 44 ? -4.816  -10.773 -2.240  1.00 0.00 ? 44 ALA A C    4  
ATOM 4648  O O    . ALA A 1 44 ? -4.716  -10.257 -1.128  1.00 0.00 ? 44 ALA A O    4  
ATOM 4649  C CB   . ALA A 1 44 ? -4.955  -9.283  -4.246  1.00 0.00 ? 44 ALA A CB   4  
ATOM 4650  H H    . ALA A 1 44 ? -6.631  -8.843  -1.911  1.00 0.00 ? 44 ALA A H    4  
ATOM 4651  H HA   . ALA A 1 44 ? -6.179  -10.976 -3.873  1.00 0.00 ? 44 ALA A HA   4  
ATOM 4652  H HB1  . ALA A 1 44 ? -4.507  -8.472  -3.690  1.00 0.00 ? 44 ALA A HB1  4  
ATOM 4653  H HB2  . ALA A 1 44 ? -5.619  -8.882  -4.997  1.00 0.00 ? 44 ALA A HB2  4  
ATOM 4654  H HB3  . ALA A 1 44 ? -4.179  -9.863  -4.724  1.00 0.00 ? 44 ALA A HB3  4  
ATOM 4655  N N    . PRO A 1 45 ? -4.126  -11.876 -2.577  1.00 0.00 ? 45 PRO A N    4  
ATOM 4656  C CA   . PRO A 1 45 ? -3.206  -12.544 -1.652  1.00 0.00 ? 45 PRO A CA   4  
ATOM 4657  C C    . PRO A 1 45 ? -1.939  -11.731 -1.407  1.00 0.00 ? 45 PRO A C    4  
ATOM 4658  O O    . PRO A 1 45 ? -1.863  -10.557 -1.772  1.00 0.00 ? 45 PRO A O    4  
ATOM 4659  C CB   . PRO A 1 45 ? -2.870  -13.853 -2.369  1.00 0.00 ? 45 PRO A CB   4  
ATOM 4660  C CG   . PRO A 1 45 ? -3.062  -13.552 -3.815  1.00 0.00 ? 45 PRO A CG   4  
ATOM 4661  C CD   . PRO A 1 45 ? -4.188  -12.556 -3.885  1.00 0.00 ? 45 PRO A CD   4  
ATOM 4662  H HA   . PRO A 1 45 ? -3.682  -12.760 -0.707  1.00 0.00 ? 45 PRO A HA   4  
ATOM 4663  H HB2  . PRO A 1 45 ? -1.849  -14.132 -2.155  1.00 0.00 ? 45 PRO A HB2  4  
ATOM 4664  H HB3  . PRO A 1 45 ? -3.541  -14.632 -2.037  1.00 0.00 ? 45 PRO A HB3  4  
ATOM 4665  H HG2  . PRO A 1 45 ? -2.159  -13.125 -4.225  1.00 0.00 ? 45 PRO A HG2  4  
ATOM 4666  H HG3  . PRO A 1 45 ? -3.328  -14.454 -4.346  1.00 0.00 ? 45 PRO A HG3  4  
ATOM 4667  H HD2  . PRO A 1 45 ? -4.023  -11.857 -4.691  1.00 0.00 ? 45 PRO A HD2  4  
ATOM 4668  H HD3  . PRO A 1 45 ? -5.133  -13.062 -4.011  1.00 0.00 ? 45 PRO A HD3  4  
ATOM 4669  N N    . GLY A 1 46 ? -0.947  -12.362 -0.788  1.00 0.00 ? 46 GLY A N    4  
ATOM 4670  C CA   . GLY A 1 46 ? 0.303   -11.681 -0.505  1.00 0.00 ? 46 GLY A CA   4  
ATOM 4671  C C    . GLY A 1 46 ? 0.134   -10.544 0.484   1.00 0.00 ? 46 GLY A C    4  
ATOM 4672  O O    . GLY A 1 46 ? -0.987  -10.126 0.775   1.00 0.00 ? 46 GLY A O    4  
ATOM 4673  H H    . GLY A 1 46 ? -1.064  -13.297 -0.520  1.00 0.00 ? 46 GLY A H    4  
ATOM 4674  H HA2  . GLY A 1 46 ? 1.005   -12.395 -0.100  1.00 0.00 ? 46 GLY A HA2  4  
ATOM 4675  H HA3  . GLY A 1 46 ? 0.700   -11.285 -1.427  1.00 0.00 ? 46 GLY A HA3  4  
ATOM 4676  N N    . GLN A 1 47 ? 1.250   -10.042 1.002   1.00 0.00 ? 47 GLN A N    4  
ATOM 4677  C CA   . GLN A 1 47 ? 1.222   -8.947  1.964   1.00 0.00 ? 47 GLN A CA   4  
ATOM 4678  C C    . GLN A 1 47 ? 0.891   -7.627  1.277   1.00 0.00 ? 47 GLN A C    4  
ATOM 4679  O O    . GLN A 1 47 ? 1.255   -7.408  0.121   1.00 0.00 ? 47 GLN A O    4  
ATOM 4680  C CB   . GLN A 1 47 ? 2.568   -8.837  2.684   1.00 0.00 ? 47 GLN A CB   4  
ATOM 4681  C CG   . GLN A 1 47 ? 2.713   -9.800  3.850   1.00 0.00 ? 47 GLN A CG   4  
ATOM 4682  C CD   . GLN A 1 47 ? 3.506   -11.041 3.487   1.00 0.00 ? 47 GLN A CD   4  
ATOM 4683  O OE1  . GLN A 1 47 ? 4.729   -10.995 3.357   1.00 0.00 ? 47 GLN A OE1  4  
ATOM 4684  N NE2  . GLN A 1 47 ? 2.810   -12.159 3.320   1.00 0.00 ? 47 GLN A NE2  4  
ATOM 4685  H H    . GLN A 1 47 ? 2.114   -10.418 0.730   1.00 0.00 ? 47 GLN A H    4  
ATOM 4686  H HA   . GLN A 1 47 ? 0.452   -9.164  2.690   1.00 0.00 ? 47 GLN A HA   4  
ATOM 4687  H HB2  . GLN A 1 47 ? 3.358   -9.040  1.977   1.00 0.00 ? 47 GLN A HB2  4  
ATOM 4688  H HB3  . GLN A 1 47 ? 2.681   -7.831  3.059   1.00 0.00 ? 47 GLN A HB3  4  
ATOM 4689  H HG2  . GLN A 1 47 ? 3.220   -9.293  4.659   1.00 0.00 ? 47 GLN A HG2  4  
ATOM 4690  H HG3  . GLN A 1 47 ? 1.729   -10.102 4.177   1.00 0.00 ? 47 GLN A HG3  4  
ATOM 4691  H HE21 . GLN A 1 47 ? 1.837   -12.122 3.439   1.00 0.00 ? 47 GLN A HE21 4  
ATOM 4692  H HE22 . GLN A 1 47 ? 3.296   -12.977 3.085   1.00 0.00 ? 47 GLN A HE22 4  
ATOM 4693  N N    . TRP A 1 48 ? 0.197   -6.750  1.995   1.00 0.00 ? 48 TRP A N    4  
ATOM 4694  C CA   . TRP A 1 48 ? -0.185  -5.451  1.455   1.00 0.00 ? 48 TRP A CA   4  
ATOM 4695  C C    . TRP A 1 48 ? -0.047  -4.359  2.511   1.00 0.00 ? 48 TRP A C    4  
ATOM 4696  O O    . TRP A 1 48 ? 0.182   -4.643  3.686   1.00 0.00 ? 48 TRP A O    4  
ATOM 4697  C CB   . TRP A 1 48 ? -1.623  -5.495  0.935   1.00 0.00 ? 48 TRP A CB   4  
ATOM 4698  C CG   . TRP A 1 48 ? -1.739  -6.077  -0.439  1.00 0.00 ? 48 TRP A CG   4  
ATOM 4699  C CD1  . TRP A 1 48 ? -1.826  -7.399  -0.759  1.00 0.00 ? 48 TRP A CD1  4  
ATOM 4700  C CD2  . TRP A 1 48 ? -1.779  -5.358  -1.676  1.00 0.00 ? 48 TRP A CD2  4  
ATOM 4701  N NE1  . TRP A 1 48 ? -1.919  -7.548  -2.122  1.00 0.00 ? 48 TRP A NE1  4  
ATOM 4702  C CE2  . TRP A 1 48 ? -1.893  -6.309  -2.708  1.00 0.00 ? 48 TRP A CE2  4  
ATOM 4703  C CE3  . TRP A 1 48 ? -1.731  -4.002  -2.013  1.00 0.00 ? 48 TRP A CE3  4  
ATOM 4704  C CZ2  . TRP A 1 48 ? -1.958  -5.948  -4.051  1.00 0.00 ? 48 TRP A CZ2  4  
ATOM 4705  C CZ3  . TRP A 1 48 ? -1.797  -3.645  -3.347  1.00 0.00 ? 48 TRP A CZ3  4  
ATOM 4706  C CH2  . TRP A 1 48 ? -1.911  -4.614  -4.351  1.00 0.00 ? 48 TRP A CH2  4  
ATOM 4707  H H    . TRP A 1 48 ? -0.064  -6.983  2.909   1.00 0.00 ? 48 TRP A H    4  
ATOM 4708  H HA   . TRP A 1 48 ? 0.479   -5.226  0.633   1.00 0.00 ? 48 TRP A HA   4  
ATOM 4709  H HB2  . TRP A 1 48 ? -2.221  -6.098  1.603   1.00 0.00 ? 48 TRP A HB2  4  
ATOM 4710  H HB3  . TRP A 1 48 ? -2.020  -4.493  0.908   1.00 0.00 ? 48 TRP A HB3  4  
ATOM 4711  H HD1  . TRP A 1 48 ? -1.821  -8.199  -0.036  1.00 0.00 ? 48 TRP A HD1  4  
ATOM 4712  H HE1  . TRP A 1 48 ? -1.992  -8.402  -2.597  1.00 0.00 ? 48 TRP A HE1  4  
ATOM 4713  H HE3  . TRP A 1 48 ? -1.645  -3.240  -1.253  1.00 0.00 ? 48 TRP A HE3  4  
ATOM 4714  H HZ2  . TRP A 1 48 ? -2.045  -6.683  -4.837  1.00 0.00 ? 48 TRP A HZ2  4  
ATOM 4715  H HZ3  . TRP A 1 48 ? -1.762  -2.602  -3.626  1.00 0.00 ? 48 TRP A HZ3  4  
ATOM 4716  H HH2  . TRP A 1 48 ? -1.958  -4.288  -5.380  1.00 0.00 ? 48 TRP A HH2  4  
ATOM 4717  N N    . ALA A 1 49 ? -0.189  -3.108  2.083   1.00 0.00 ? 49 ALA A N    4  
ATOM 4718  C CA   . ALA A 1 49 ? -0.082  -1.973  2.991   1.00 0.00 ? 49 ALA A CA   4  
ATOM 4719  C C    . ALA A 1 49 ? -0.966  -0.819  2.532   1.00 0.00 ? 49 ALA A C    4  
ATOM 4720  O O    . ALA A 1 49 ? -0.600  -0.062  1.633   1.00 0.00 ? 49 ALA A O    4  
ATOM 4721  C CB   . ALA A 1 49 ? 1.366   -1.521  3.101   1.00 0.00 ? 49 ALA A CB   4  
ATOM 4722  H H    . ALA A 1 49 ? -0.372  -2.945  1.134   1.00 0.00 ? 49 ALA A H    4  
ATOM 4723  H HA   . ALA A 1 49 ? -0.409  -2.297  3.969   1.00 0.00 ? 49 ALA A HA   4  
ATOM 4724  H HB1  . ALA A 1 49 ? 1.418   -0.623  3.701   1.00 0.00 ? 49 ALA A HB1  4  
ATOM 4725  H HB2  . ALA A 1 49 ? 1.755   -1.317  2.115   1.00 0.00 ? 49 ALA A HB2  4  
ATOM 4726  H HB3  . ALA A 1 49 ? 1.952   -2.299  3.566   1.00 0.00 ? 49 ALA A HB3  4  
ATOM 4727  N N    . GLY A 1 50 ? -2.132  -0.689  3.156   1.00 0.00 ? 50 GLY A N    4  
ATOM 4728  C CA   . GLY A 1 50 ? -3.051  0.376   2.797   1.00 0.00 ? 50 GLY A CA   4  
ATOM 4729  C C    . GLY A 1 50 ? -2.495  1.752   3.110   1.00 0.00 ? 50 GLY A C    4  
ATOM 4730  O O    . GLY A 1 50 ? -1.932  1.972   4.182   1.00 0.00 ? 50 GLY A O    4  
ATOM 4731  H H    . GLY A 1 50 ? -2.372  -1.321  3.865   1.00 0.00 ? 50 GLY A H    4  
ATOM 4732  H HA2  . GLY A 1 50 ? -3.259  0.316   1.739   1.00 0.00 ? 50 GLY A HA2  4  
ATOM 4733  H HA3  . GLY A 1 50 ? -3.973  0.240   3.342   1.00 0.00 ? 50 GLY A HA3  4  
ATOM 4734  N N    . VAL A 1 51 ? -2.655  2.680   2.171   1.00 0.00 ? 51 VAL A N    4  
ATOM 4735  C CA   . VAL A 1 51 ? -2.165  4.040   2.351   1.00 0.00 ? 51 VAL A CA   4  
ATOM 4736  C C    . VAL A 1 51 ? -3.232  5.062   1.973   1.00 0.00 ? 51 VAL A C    4  
ATOM 4737  O O    . VAL A 1 51 ? -4.157  4.759   1.221   1.00 0.00 ? 51 VAL A O    4  
ATOM 4738  C CB   . VAL A 1 51 ? -0.902  4.300   1.510   1.00 0.00 ? 51 VAL A CB   4  
ATOM 4739  C CG1  . VAL A 1 51 ? -0.292  5.647   1.862   1.00 0.00 ? 51 VAL A CG1  4  
ATOM 4740  C CG2  . VAL A 1 51 ? 0.110   3.180   1.705   1.00 0.00 ? 51 VAL A CG2  4  
ATOM 4741  H H    . VAL A 1 51 ? -3.113  2.442   1.337   1.00 0.00 ? 51 VAL A H    4  
ATOM 4742  H HA   . VAL A 1 51 ? -1.911  4.168   3.393   1.00 0.00 ? 51 VAL A HA   4  
ATOM 4743  H HB   . VAL A 1 51 ? -1.186  4.320   0.467   1.00 0.00 ? 51 VAL A HB   4  
ATOM 4744  H HG11 . VAL A 1 51 ? -0.143  5.706   2.930   1.00 0.00 ? 51 VAL A HG11 4  
ATOM 4745  H HG12 . VAL A 1 51 ? -0.958  6.437   1.547   1.00 0.00 ? 51 VAL A HG12 4  
ATOM 4746  H HG13 . VAL A 1 51 ? 0.658   5.756   1.359   1.00 0.00 ? 51 VAL A HG13 4  
ATOM 4747  H HG21 . VAL A 1 51 ? 1.079   3.507   1.359   1.00 0.00 ? 51 VAL A HG21 4  
ATOM 4748  H HG22 . VAL A 1 51 ? -0.200  2.312   1.143   1.00 0.00 ? 51 VAL A HG22 4  
ATOM 4749  H HG23 . VAL A 1 51 ? 0.168   2.927   2.754   1.00 0.00 ? 51 VAL A HG23 4  
ATOM 4750  N N    . VAL A 1 52 ? -3.097  6.275   2.502   1.00 0.00 ? 52 VAL A N    4  
ATOM 4751  C CA   . VAL A 1 52 ? -4.051  7.341   2.221   1.00 0.00 ? 52 VAL A CA   4  
ATOM 4752  C C    . VAL A 1 52 ? -3.360  8.539   1.577   1.00 0.00 ? 52 VAL A C    4  
ATOM 4753  O O    . VAL A 1 52 ? -2.625  9.273   2.238   1.00 0.00 ? 52 VAL A O    4  
ATOM 4754  C CB   . VAL A 1 52 ? -4.769  7.805   3.501   1.00 0.00 ? 52 VAL A CB   4  
ATOM 4755  C CG1  . VAL A 1 52 ? -5.899  8.765   3.162   1.00 0.00 ? 52 VAL A CG1  4  
ATOM 4756  C CG2  . VAL A 1 52 ? -5.293  6.609   4.281   1.00 0.00 ? 52 VAL A CG2  4  
ATOM 4757  H H    . VAL A 1 52 ? -2.340  6.455   3.096   1.00 0.00 ? 52 VAL A H    4  
ATOM 4758  H HA   . VAL A 1 52 ? -4.792  6.954   1.536   1.00 0.00 ? 52 VAL A HA   4  
ATOM 4759  H HB   . VAL A 1 52 ? -4.056  8.328   4.121   1.00 0.00 ? 52 VAL A HB   4  
ATOM 4760  H HG11 . VAL A 1 52 ? -6.607  8.791   3.977   1.00 0.00 ? 52 VAL A HG11 4  
ATOM 4761  H HG12 . VAL A 1 52 ? -6.397  8.434   2.263   1.00 0.00 ? 52 VAL A HG12 4  
ATOM 4762  H HG13 . VAL A 1 52 ? -5.495  9.755   3.005   1.00 0.00 ? 52 VAL A HG13 4  
ATOM 4763  H HG21 . VAL A 1 52 ? -5.432  5.774   3.612   1.00 0.00 ? 52 VAL A HG21 4  
ATOM 4764  H HG22 . VAL A 1 52 ? -6.238  6.864   4.740   1.00 0.00 ? 52 VAL A HG22 4  
ATOM 4765  H HG23 . VAL A 1 52 ? -4.582  6.341   5.049   1.00 0.00 ? 52 VAL A HG23 4  
ATOM 4766  N N    . LEU A 1 53 ? -3.601  8.731   0.284   1.00 0.00 ? 53 LEU A N    4  
ATOM 4767  C CA   . LEU A 1 53 ? -3.002  9.840   -0.448  1.00 0.00 ? 53 LEU A CA   4  
ATOM 4768  C C    . LEU A 1 53 ? -3.639  11.166  -0.042  1.00 0.00 ? 53 LEU A C    4  
ATOM 4769  O O    . LEU A 1 53 ? -4.847  11.243  0.181   1.00 0.00 ? 53 LEU A O    4  
ATOM 4770  C CB   . LEU A 1 53 ? -3.156  9.626   -1.955  1.00 0.00 ? 53 LEU A CB   4  
ATOM 4771  C CG   . LEU A 1 53 ? -2.406  8.418   -2.518  1.00 0.00 ? 53 LEU A CG   4  
ATOM 4772  C CD1  . LEU A 1 53 ? -2.850  8.131   -3.944  1.00 0.00 ? 53 LEU A CD1  4  
ATOM 4773  C CD2  . LEU A 1 53 ? -0.904  8.652   -2.462  1.00 0.00 ? 53 LEU A CD2  4  
ATOM 4774  H H    . LEU A 1 53 ? -4.196  8.112   -0.188  1.00 0.00 ? 53 LEU A H    4  
ATOM 4775  H HA   . LEU A 1 53 ? -1.951  9.870   -0.203  1.00 0.00 ? 53 LEU A HA   4  
ATOM 4776  H HB2  . LEU A 1 53 ? -4.207  9.506   -2.174  1.00 0.00 ? 53 LEU A HB2  4  
ATOM 4777  H HB3  . LEU A 1 53 ? -2.800  10.511  -2.461  1.00 0.00 ? 53 LEU A HB3  4  
ATOM 4778  H HG   . LEU A 1 53 ? -2.633  7.550   -1.917  1.00 0.00 ? 53 LEU A HG   4  
ATOM 4779  H HD11 . LEU A 1 53 ? -2.634  8.987   -4.567  1.00 0.00 ? 53 LEU A HD11 4  
ATOM 4780  H HD12 . LEU A 1 53 ? -3.913  7.935   -3.957  1.00 0.00 ? 53 LEU A HD12 4  
ATOM 4781  H HD13 . LEU A 1 53 ? -2.320  7.269   -4.320  1.00 0.00 ? 53 LEU A HD13 4  
ATOM 4782  H HD21 . LEU A 1 53 ? -0.579  9.124   -3.378  1.00 0.00 ? 53 LEU A HD21 4  
ATOM 4783  H HD22 . LEU A 1 53 ? -0.397  7.705   -2.346  1.00 0.00 ? 53 LEU A HD22 4  
ATOM 4784  H HD23 . LEU A 1 53 ? -0.670  9.292   -1.625  1.00 0.00 ? 53 LEU A HD23 4  
ATOM 4785  N N    . ASP A 1 54 ? -2.818  12.207  0.050   1.00 0.00 ? 54 ASP A N    4  
ATOM 4786  C CA   . ASP A 1 54 ? -3.301  13.530  0.429   1.00 0.00 ? 54 ASP A CA   4  
ATOM 4787  C C    . ASP A 1 54 ? -4.302  14.058  -0.595  1.00 0.00 ? 54 ASP A C    4  
ATOM 4788  O O    . ASP A 1 54 ? -5.232  14.785  -0.250  1.00 0.00 ? 54 ASP A O    4  
ATOM 4789  C CB   . ASP A 1 54 ? -2.129  14.505  0.562   1.00 0.00 ? 54 ASP A CB   4  
ATOM 4790  C CG   . ASP A 1 54 ? -2.449  15.672  1.474   1.00 0.00 ? 54 ASP A CG   4  
ATOM 4791  O OD1  . ASP A 1 54 ? -2.682  15.439  2.678   1.00 0.00 ? 54 ASP A OD1  4  
ATOM 4792  O OD2  . ASP A 1 54 ? -2.467  16.821  0.983   1.00 0.00 ? 54 ASP A OD2  4  
ATOM 4793  H H    . ASP A 1 54 ? -1.864  12.082  -0.141  1.00 0.00 ? 54 ASP A H    4  
ATOM 4794  H HA   . ASP A 1 54 ? -3.794  13.441  1.384   1.00 0.00 ? 54 ASP A HA   4  
ATOM 4795  H HB2  . ASP A 1 54 ? -1.277  13.979  0.966   1.00 0.00 ? 54 ASP A HB2  4  
ATOM 4796  H HB3  . ASP A 1 54 ? -1.877  14.891  -0.416  1.00 0.00 ? 54 ASP A HB3  4  
ATOM 4797  N N    . ASP A 1 55 ? -4.104  13.685  -1.855  1.00 0.00 ? 55 ASP A N    4  
ATOM 4798  C CA   . ASP A 1 55 ? -4.989  14.120  -2.930  1.00 0.00 ? 55 ASP A CA   4  
ATOM 4799  C C    . ASP A 1 55 ? -5.841  12.960  -3.437  1.00 0.00 ? 55 ASP A C    4  
ATOM 4800  O O    . ASP A 1 55 ? -5.460  11.796  -3.309  1.00 0.00 ? 55 ASP A O    4  
ATOM 4801  C CB   . ASP A 1 55 ? -4.173  14.716  -4.080  1.00 0.00 ? 55 ASP A CB   4  
ATOM 4802  C CG   . ASP A 1 55 ? -4.443  16.195  -4.277  1.00 0.00 ? 55 ASP A CG   4  
ATOM 4803  O OD1  . ASP A 1 55 ? -4.835  16.862  -3.297  1.00 0.00 ? 55 ASP A OD1  4  
ATOM 4804  O OD2  . ASP A 1 55 ? -4.263  16.685  -5.411  1.00 0.00 ? 55 ASP A OD2  4  
ATOM 4805  H H    . ASP A 1 55 ? -3.344  13.104  -2.068  1.00 0.00 ? 55 ASP A H    4  
ATOM 4806  H HA   . ASP A 1 55 ? -5.642  14.883  -2.531  1.00 0.00 ? 55 ASP A HA   4  
ATOM 4807  H HB2  . ASP A 1 55 ? -3.121  14.587  -3.872  1.00 0.00 ? 55 ASP A HB2  4  
ATOM 4808  H HB3  . ASP A 1 55 ? -4.420  14.199  -4.996  1.00 0.00 ? 55 ASP A HB3  4  
ATOM 4809  N N    . PRO A 1 56 ? -7.013  13.262  -4.022  1.00 0.00 ? 56 PRO A N    4  
ATOM 4810  C CA   . PRO A 1 56 ? -7.920  12.238  -4.549  1.00 0.00 ? 56 PRO A CA   4  
ATOM 4811  C C    . PRO A 1 56 ? -7.382  11.587  -5.820  1.00 0.00 ? 56 PRO A C    4  
ATOM 4812  O O    . PRO A 1 56 ? -7.991  11.681  -6.886  1.00 0.00 ? 56 PRO A O    4  
ATOM 4813  C CB   . PRO A 1 56 ? -9.200  13.021  -4.849  1.00 0.00 ? 56 PRO A CB   4  
ATOM 4814  C CG   . PRO A 1 56 ? -8.739  14.414  -5.104  1.00 0.00 ? 56 PRO A CG   4  
ATOM 4815  C CD   . PRO A 1 56 ? -7.544  14.626  -4.215  1.00 0.00 ? 56 PRO A CD   4  
ATOM 4816  H HA   . PRO A 1 56 ? -8.124  11.474  -3.814  1.00 0.00 ? 56 PRO A HA   4  
ATOM 4817  H HB2  . PRO A 1 56 ? -9.689  12.599  -5.715  1.00 0.00 ? 56 PRO A HB2  4  
ATOM 4818  H HB3  . PRO A 1 56 ? -9.861  12.974  -3.996  1.00 0.00 ? 56 PRO A HB3  4  
ATOM 4819  H HG2  . PRO A 1 56 ? -8.459  14.523  -6.142  1.00 0.00 ? 56 PRO A HG2  4  
ATOM 4820  H HG3  . PRO A 1 56 ? -9.523  15.111  -4.851  1.00 0.00 ? 56 PRO A HG3  4  
ATOM 4821  H HD2  . PRO A 1 56 ? -6.817  15.256  -4.705  1.00 0.00 ? 56 PRO A HD2  4  
ATOM 4822  H HD3  . PRO A 1 56 ? -7.847  15.057  -3.272  1.00 0.00 ? 56 PRO A HD3  4  
ATOM 4823  N N    . VAL A 1 57 ? -6.236  10.925  -5.699  1.00 0.00 ? 57 VAL A N    4  
ATOM 4824  C CA   . VAL A 1 57 ? -5.615  10.257  -6.837  1.00 0.00 ? 57 VAL A CA   4  
ATOM 4825  C C    . VAL A 1 57 ? -5.254  8.815   -6.498  1.00 0.00 ? 57 VAL A C    4  
ATOM 4826  O O    . VAL A 1 57 ? -4.287  8.266   -7.025  1.00 0.00 ? 57 VAL A O    4  
ATOM 4827  C CB   . VAL A 1 57 ? -4.346  10.997  -7.300  1.00 0.00 ? 57 VAL A CB   4  
ATOM 4828  C CG1  . VAL A 1 57 ? -4.708  12.310  -7.977  1.00 0.00 ? 57 VAL A CG1  4  
ATOM 4829  C CG2  . VAL A 1 57 ? -3.409  11.234  -6.125  1.00 0.00 ? 57 VAL A CG2  4  
ATOM 4830  H H    . VAL A 1 57 ? -5.797  10.884  -4.824  1.00 0.00 ? 57 VAL A H    4  
ATOM 4831  H HA   . VAL A 1 57 ? -6.325  10.258  -7.652  1.00 0.00 ? 57 VAL A HA   4  
ATOM 4832  H HB   . VAL A 1 57 ? -3.834  10.375  -8.020  1.00 0.00 ? 57 VAL A HB   4  
ATOM 4833  H HG11 . VAL A 1 57 ? -4.595  13.121  -7.272  1.00 0.00 ? 57 VAL A HG11 4  
ATOM 4834  H HG12 . VAL A 1 57 ? -5.732  12.268  -8.317  1.00 0.00 ? 57 VAL A HG12 4  
ATOM 4835  H HG13 . VAL A 1 57 ? -4.055  12.472  -8.821  1.00 0.00 ? 57 VAL A HG13 4  
ATOM 4836  H HG21 . VAL A 1 57 ? -3.536  12.244  -5.761  1.00 0.00 ? 57 VAL A HG21 4  
ATOM 4837  H HG22 . VAL A 1 57 ? -2.388  11.093  -6.445  1.00 0.00 ? 57 VAL A HG22 4  
ATOM 4838  H HG23 . VAL A 1 57 ? -3.638  10.535  -5.334  1.00 0.00 ? 57 VAL A HG23 4  
ATOM 4839  N N    . GLY A 1 58 ? -6.038  8.206   -5.614  1.00 0.00 ? 58 GLY A N    4  
ATOM 4840  C CA   . GLY A 1 58 ? -5.784  6.833   -5.220  1.00 0.00 ? 58 GLY A CA   4  
ATOM 4841  C C    . GLY A 1 58 ? -6.489  5.832   -6.115  1.00 0.00 ? 58 GLY A C    4  
ATOM 4842  O O    . GLY A 1 58 ? -6.310  5.845   -7.332  1.00 0.00 ? 58 GLY A O    4  
ATOM 4843  H H    . GLY A 1 58 ? -6.795  8.693   -5.226  1.00 0.00 ? 58 GLY A H    4  
ATOM 4844  H HA2  . GLY A 1 58 ? -4.720  6.649   -5.260  1.00 0.00 ? 58 GLY A HA2  4  
ATOM 4845  H HA3  . GLY A 1 58 ? -6.124  6.694   -4.205  1.00 0.00 ? 58 GLY A HA3  4  
ATOM 4846  N N    . LYS A 1 59 ? -7.293  4.964   -5.509  1.00 0.00 ? 59 LYS A N    4  
ATOM 4847  C CA   . LYS A 1 59 ? -8.028  3.952   -6.260  1.00 0.00 ? 59 LYS A CA   4  
ATOM 4848  C C    . LYS A 1 59 ? -9.308  3.558   -5.530  1.00 0.00 ? 59 LYS A C    4  
ATOM 4849  O O    . LYS A 1 59 ? -10.403 3.652   -6.083  1.00 0.00 ? 59 LYS A O    4  
ATOM 4850  C CB   . LYS A 1 59 ? -7.153  2.718   -6.483  1.00 0.00 ? 59 LYS A CB   4  
ATOM 4851  C CG   . LYS A 1 59 ? -5.935  2.984   -7.352  1.00 0.00 ? 59 LYS A CG   4  
ATOM 4852  C CD   . LYS A 1 59 ? -5.304  1.690   -7.838  1.00 0.00 ? 59 LYS A CD   4  
ATOM 4853  C CE   . LYS A 1 59 ? -4.082  1.957   -8.704  1.00 0.00 ? 59 LYS A CE   4  
ATOM 4854  N NZ   . LYS A 1 59 ? -3.455  0.695   -9.184  1.00 0.00 ? 59 LYS A NZ   4  
ATOM 4855  H H    . LYS A 1 59 ? -7.395  5.005   -4.536  1.00 0.00 ? 59 LYS A H    4  
ATOM 4856  H HA   . LYS A 1 59 ? -8.289  4.376   -7.218  1.00 0.00 ? 59 LYS A HA   4  
ATOM 4857  H HB2  . LYS A 1 59 ? -6.812  2.354   -5.525  1.00 0.00 ? 59 LYS A HB2  4  
ATOM 4858  H HB3  . LYS A 1 59 ? -7.746  1.951   -6.958  1.00 0.00 ? 59 LYS A HB3  4  
ATOM 4859  H HG2  . LYS A 1 59 ? -6.236  3.571   -8.207  1.00 0.00 ? 59 LYS A HG2  4  
ATOM 4860  H HG3  . LYS A 1 59 ? -5.206  3.534   -6.774  1.00 0.00 ? 59 LYS A HG3  4  
ATOM 4861  H HD2  . LYS A 1 59 ? -5.005  1.102   -6.984  1.00 0.00 ? 59 LYS A HD2  4  
ATOM 4862  H HD3  . LYS A 1 59 ? -6.032  1.143   -8.419  1.00 0.00 ? 59 LYS A HD3  4  
ATOM 4863  H HE2  . LYS A 1 59 ? -4.383  2.546   -9.558  1.00 0.00 ? 59 LYS A HE2  4  
ATOM 4864  H HE3  . LYS A 1 59 ? -3.360  2.510   -8.122  1.00 0.00 ? 59 LYS A HE3  4  
ATOM 4865  H HZ1  . LYS A 1 59 ? -3.091  0.822   -10.150 1.00 0.00 ? 59 LYS A HZ1  4  
ATOM 4866  H HZ2  . LYS A 1 59 ? -4.156  -0.074  -9.188  1.00 0.00 ? 59 LYS A HZ2  4  
ATOM 4867  H HZ3  . LYS A 1 59 ? -2.668  0.426   -8.559  1.00 0.00 ? 59 LYS A HZ3  4  
ATOM 4868  N N    . ASN A 1 60 ? -9.162  3.115   -4.286  1.00 0.00 ? 60 ASN A N    4  
ATOM 4869  C CA   . ASN A 1 60 ? -10.306 2.705   -3.481  1.00 0.00 ? 60 ASN A CA   4  
ATOM 4870  C C    . ASN A 1 60 ? -10.735 3.824   -2.537  1.00 0.00 ? 60 ASN A C    4  
ATOM 4871  O O    . ASN A 1 60 ? -10.092 4.871   -2.467  1.00 0.00 ? 60 ASN A O    4  
ATOM 4872  C CB   . ASN A 1 60 ? -9.969  1.447   -2.680  1.00 0.00 ? 60 ASN A CB   4  
ATOM 4873  C CG   . ASN A 1 60 ? -9.529  0.297   -3.566  1.00 0.00 ? 60 ASN A CG   4  
ATOM 4874  O OD1  . ASN A 1 60 ? -10.349 -0.342  -4.225  1.00 0.00 ? 60 ASN A OD1  4  
ATOM 4875  N ND2  . ASN A 1 60 ? -8.229  0.029   -3.584  1.00 0.00 ? 60 ASN A ND2  4  
ATOM 4876  H H    . ASN A 1 60 ? -8.263  3.061   -3.900  1.00 0.00 ? 60 ASN A H    4  
ATOM 4877  H HA   . ASN A 1 60 ? -11.123 2.485   -4.153  1.00 0.00 ? 60 ASN A HA   4  
ATOM 4878  H HB2  . ASN A 1 60 ? -9.169  1.671   -1.989  1.00 0.00 ? 60 ASN A HB2  4  
ATOM 4879  H HB3  . ASN A 1 60 ? -10.842 1.136   -2.124  1.00 0.00 ? 60 ASN A HB3  4  
ATOM 4880  H HD21 . ASN A 1 60 ? -7.635  0.579   -3.032  1.00 0.00 ? 60 ASN A HD21 4  
ATOM 4881  H HD22 . ASN A 1 60 ? -7.917  -0.709  -4.148  1.00 0.00 ? 60 ASN A HD22 4  
ATOM 4882  N N    . ASP A 1 61 ? -11.825 3.595   -1.812  1.00 0.00 ? 61 ASP A N    4  
ATOM 4883  C CA   . ASP A 1 61 ? -12.340 4.583   -0.871  1.00 0.00 ? 61 ASP A CA   4  
ATOM 4884  C C    . ASP A 1 61 ? -12.436 3.998   0.534   1.00 0.00 ? 61 ASP A C    4  
ATOM 4885  O O    . ASP A 1 61 ? -13.346 4.329   1.294   1.00 0.00 ? 61 ASP A O    4  
ATOM 4886  C CB   . ASP A 1 61 ? -13.714 5.082   -1.323  1.00 0.00 ? 61 ASP A CB   4  
ATOM 4887  C CG   . ASP A 1 61 ? -14.692 3.947   -1.559  1.00 0.00 ? 61 ASP A CG   4  
ATOM 4888  O OD1  . ASP A 1 61 ? -14.654 3.349   -2.655  1.00 0.00 ? 61 ASP A OD1  4  
ATOM 4889  O OD2  . ASP A 1 61 ? -15.495 3.659   -0.649  1.00 0.00 ? 61 ASP A OD2  4  
ATOM 4890  H H    . ASP A 1 61 ? -12.295 2.740   -1.911  1.00 0.00 ? 61 ASP A H    4  
ATOM 4891  H HA   . ASP A 1 61 ? -11.652 5.415   -0.855  1.00 0.00 ? 61 ASP A HA   4  
ATOM 4892  H HB2  . ASP A 1 61 ? -14.122 5.732   -0.565  1.00 0.00 ? 61 ASP A HB2  4  
ATOM 4893  H HB3  . ASP A 1 61 ? -13.603 5.635   -2.244  1.00 0.00 ? 61 ASP A HB3  4  
ATOM 4894  N N    . GLY A 1 62 ? -11.492 3.126   0.873   1.00 0.00 ? 62 GLY A N    4  
ATOM 4895  C CA   . GLY A 1 62 ? -11.488 2.509   2.186   1.00 0.00 ? 62 GLY A CA   4  
ATOM 4896  C C    . GLY A 1 62 ? -12.127 1.135   2.183   1.00 0.00 ? 62 GLY A C    4  
ATOM 4897  O O    . GLY A 1 62 ? -11.750 0.266   2.970   1.00 0.00 ? 62 GLY A O    4  
ATOM 4898  H H    . GLY A 1 62 ? -10.791 2.901   0.226   1.00 0.00 ? 62 GLY A H    4  
ATOM 4899  H HA2  . GLY A 1 62 ? -10.467 2.420   2.527   1.00 0.00 ? 62 GLY A HA2  4  
ATOM 4900  H HA3  . GLY A 1 62 ? -12.032 3.144   2.871   1.00 0.00 ? 62 GLY A HA3  4  
ATOM 4901  N N    . ALA A 1 63 ? -13.095 0.936   1.295   1.00 0.00 ? 63 ALA A N    4  
ATOM 4902  C CA   . ALA A 1 63 ? -13.788 -0.343  1.192   1.00 0.00 ? 63 ALA A CA   4  
ATOM 4903  C C    . ALA A 1 63 ? -13.529 -0.999  -0.160  1.00 0.00 ? 63 ALA A C    4  
ATOM 4904  O O    . ALA A 1 63 ? -13.662 -0.364  -1.205  1.00 0.00 ? 63 ALA A O    4  
ATOM 4905  C CB   . ALA A 1 63 ? -15.281 -0.153  1.411   1.00 0.00 ? 63 ALA A CB   4  
ATOM 4906  H H    . ALA A 1 63 ? -13.351 1.667   0.695   1.00 0.00 ? 63 ALA A H    4  
ATOM 4907  H HA   . ALA A 1 63 ? -13.413 -0.989  1.973   1.00 0.00 ? 63 ALA A HA   4  
ATOM 4908  H HB1  . ALA A 1 63 ? -15.693 0.428   0.599   1.00 0.00 ? 63 ALA A HB1  4  
ATOM 4909  H HB2  . ALA A 1 63 ? -15.444 0.366   2.344   1.00 0.00 ? 63 ALA A HB2  4  
ATOM 4910  H HB3  . ALA A 1 63 ? -15.766 -1.117  1.445   1.00 0.00 ? 63 ALA A HB3  4  
ATOM 4911  N N    . VAL A 1 64 ? -13.159 -2.276  -0.131  1.00 0.00 ? 64 VAL A N    4  
ATOM 4912  C CA   . VAL A 1 64 ? -12.880 -3.019  -1.354  1.00 0.00 ? 64 VAL A CA   4  
ATOM 4913  C C    . VAL A 1 64 ? -13.674 -4.320  -1.396  1.00 0.00 ? 64 VAL A C    4  
ATOM 4914  O O    . VAL A 1 64 ? -13.333 -5.290  -0.719  1.00 0.00 ? 64 VAL A O    4  
ATOM 4915  C CB   . VAL A 1 64 ? -11.380 -3.340  -1.488  1.00 0.00 ? 64 VAL A CB   4  
ATOM 4916  C CG1  . VAL A 1 64 ? -11.086 -3.976  -2.839  1.00 0.00 ? 64 VAL A CG1  4  
ATOM 4917  C CG2  . VAL A 1 64 ? -10.543 -2.084  -1.290  1.00 0.00 ? 64 VAL A CG2  4  
ATOM 4918  H H    . VAL A 1 64 ? -13.069 -2.727  0.734   1.00 0.00 ? 64 VAL A H    4  
ATOM 4919  H HA   . VAL A 1 64 ? -13.172 -2.402  -2.192  1.00 0.00 ? 64 VAL A HA   4  
ATOM 4920  H HB   . VAL A 1 64 ? -11.114 -4.049  -0.717  1.00 0.00 ? 64 VAL A HB   4  
ATOM 4921  H HG11 . VAL A 1 64 ? -11.147 -5.051  -2.751  1.00 0.00 ? 64 VAL A HG11 4  
ATOM 4922  H HG12 . VAL A 1 64 ? -10.094 -3.696  -3.161  1.00 0.00 ? 64 VAL A HG12 4  
ATOM 4923  H HG13 . VAL A 1 64 ? -11.810 -3.631  -3.564  1.00 0.00 ? 64 VAL A HG13 4  
ATOM 4924  H HG21 . VAL A 1 64 ? -10.220 -1.712  -2.251  1.00 0.00 ? 64 VAL A HG21 4  
ATOM 4925  H HG22 . VAL A 1 64 ? -9.678  -2.320  -0.686  1.00 0.00 ? 64 VAL A HG22 4  
ATOM 4926  H HG23 . VAL A 1 64 ? -11.134 -1.331  -0.791  1.00 0.00 ? 64 VAL A HG23 4  
ATOM 4927  N N    . GLY A 1 65 ? -14.735 -4.335  -2.197  1.00 0.00 ? 65 GLY A N    4  
ATOM 4928  C CA   . GLY A 1 65 ? -15.560 -5.523  -2.312  1.00 0.00 ? 65 GLY A CA   4  
ATOM 4929  C C    . GLY A 1 65 ? -16.294 -5.846  -1.027  1.00 0.00 ? 65 GLY A C    4  
ATOM 4930  O O    . GLY A 1 65 ? -16.553 -7.012  -0.727  1.00 0.00 ? 65 GLY A O    4  
ATOM 4931  H H    . GLY A 1 65 ? -14.959 -3.533  -2.713  1.00 0.00 ? 65 GLY A H    4  
ATOM 4932  H HA2  . GLY A 1 65 ? -16.285 -5.369  -3.099  1.00 0.00 ? 65 GLY A HA2  4  
ATOM 4933  H HA3  . GLY A 1 65 ? -14.931 -6.361  -2.576  1.00 0.00 ? 65 GLY A HA3  4  
ATOM 4934  N N    . GLY A 1 66 ? -16.632 -4.811  -0.264  1.00 0.00 ? 66 GLY A N    4  
ATOM 4935  C CA   . GLY A 1 66 ? -17.338 -5.011  0.988   1.00 0.00 ? 66 GLY A CA   4  
ATOM 4936  C C    . GLY A 1 66 ? -16.398 -5.245  2.154   1.00 0.00 ? 66 GLY A C    4  
ATOM 4937  O O    . GLY A 1 66 ? -16.748 -5.929  3.115   1.00 0.00 ? 66 GLY A O    4  
ATOM 4938  H H    . GLY A 1 66 ? -16.400 -3.905  -0.554  1.00 0.00 ? 66 GLY A H    4  
ATOM 4939  H HA2  . GLY A 1 66 ? -17.938 -4.138  1.193   1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4940  H HA3  . GLY A 1 66 ? -17.989 -5.867  0.889   1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4941  N N    . VAL A 1 67 ? -15.199 -4.675  2.069   1.00 0.00 ? 67 VAL A N    4  
ATOM 4942  C CA   . VAL A 1 67 ? -14.206 -4.825  3.125   1.00 0.00 ? 67 VAL A CA   4  
ATOM 4943  C C    . VAL A 1 67 ? -13.548 -3.489  3.455   1.00 0.00 ? 67 VAL A C    4  
ATOM 4944  O O    . VAL A 1 67 ? -12.693 -3.006  2.713   1.00 0.00 ? 67 VAL A O    4  
ATOM 4945  C CB   . VAL A 1 67 ? -13.114 -5.836  2.730   1.00 0.00 ? 67 VAL A CB   4  
ATOM 4946  C CG1  . VAL A 1 67 ? -12.203 -6.130  3.911   1.00 0.00 ? 67 VAL A CG1  4  
ATOM 4947  C CG2  . VAL A 1 67 ? -13.739 -7.117  2.198   1.00 0.00 ? 67 VAL A CG2  4  
ATOM 4948  H H    . VAL A 1 67 ? -14.980 -4.141  1.277   1.00 0.00 ? 67 VAL A H    4  
ATOM 4949  H HA   . VAL A 1 67 ? -14.708 -5.196  4.006   1.00 0.00 ? 67 VAL A HA   4  
ATOM 4950  H HB   . VAL A 1 67 ? -12.515 -5.400  1.943   1.00 0.00 ? 67 VAL A HB   4  
ATOM 4951  H HG11 . VAL A 1 67 ? -11.811 -7.132  3.825   1.00 0.00 ? 67 VAL A HG11 4  
ATOM 4952  H HG12 . VAL A 1 67 ? -12.766 -6.041  4.830   1.00 0.00 ? 67 VAL A HG12 4  
ATOM 4953  H HG13 . VAL A 1 67 ? -11.386 -5.423  3.920   1.00 0.00 ? 67 VAL A HG13 4  
ATOM 4954  H HG21 . VAL A 1 67 ? -14.632 -7.342  2.762   1.00 0.00 ? 67 VAL A HG21 4  
ATOM 4955  H HG22 . VAL A 1 67 ? -13.036 -7.930  2.299   1.00 0.00 ? 67 VAL A HG22 4  
ATOM 4956  H HG23 . VAL A 1 67 ? -13.994 -6.987  1.156   1.00 0.00 ? 67 VAL A HG23 4  
ATOM 4957  N N    . ARG A 1 68 ? -13.954 -2.896  4.573   1.00 0.00 ? 68 ARG A N    4  
ATOM 4958  C CA   . ARG A 1 68 ? -13.403 -1.616  5.003   1.00 0.00 ? 68 ARG A CA   4  
ATOM 4959  C C    . ARG A 1 68 ? -12.128 -1.817  5.815   1.00 0.00 ? 68 ARG A C    4  
ATOM 4960  O O    . ARG A 1 68 ? -12.093 -2.624  6.744   1.00 0.00 ? 68 ARG A O    4  
ATOM 4961  C CB   . ARG A 1 68 ? -14.436 -0.846  5.830   1.00 0.00 ? 68 ARG A CB   4  
ATOM 4962  C CG   . ARG A 1 68 ? -15.206 0.191   5.028   1.00 0.00 ? 68 ARG A CG   4  
ATOM 4963  C CD   . ARG A 1 68 ? -15.497 1.432   5.856   1.00 0.00 ? 68 ARG A CD   4  
ATOM 4964  N NE   . ARG A 1 68 ? -16.308 2.401   5.123   1.00 0.00 ? 68 ARG A NE   4  
ATOM 4965  C CZ   . ARG A 1 68 ? -16.927 3.432   5.694   1.00 0.00 ? 68 ARG A CZ   4  
ATOM 4966  N NH1  . ARG A 1 68 ? -16.832 3.631   7.002   1.00 0.00 ? 68 ARG A NH1  4  
ATOM 4967  N NH2  . ARG A 1 68 ? -17.645 4.266   4.953   1.00 0.00 ? 68 ARG A NH2  4  
ATOM 4968  H H    . ARG A 1 68 ? -14.639 -3.331  5.123   1.00 0.00 ? 68 ARG A H    4  
ATOM 4969  H HA   . ARG A 1 68 ? -13.166 -1.045  4.118   1.00 0.00 ? 68 ARG A HA   4  
ATOM 4970  H HB2  . ARG A 1 68 ? -15.146 -1.549  6.244   1.00 0.00 ? 68 ARG A HB2  4  
ATOM 4971  H HB3  . ARG A 1 68 ? -13.926 -0.338  6.640   1.00 0.00 ? 68 ARG A HB3  4  
ATOM 4972  H HG2  . ARG A 1 68 ? -14.619 0.475   4.167   1.00 0.00 ? 68 ARG A HG2  4  
ATOM 4973  H HG3  . ARG A 1 68 ? -16.141 -0.242  4.703   1.00 0.00 ? 68 ARG A HG3  4  
ATOM 4974  H HD2  . ARG A 1 68 ? -16.027 1.138   6.750   1.00 0.00 ? 68 ARG A HD2  4  
ATOM 4975  H HD3  . ARG A 1 68 ? -14.560 1.894   6.129   1.00 0.00 ? 68 ARG A HD3  4  
ATOM 4976  H HE   . ARG A 1 68 ? -16.396 2.278   4.154   1.00 0.00 ? 68 ARG A HE   4  
ATOM 4977  H HH11 . ARG A 1 68 ? -16.293 3.006   7.565   1.00 0.00 ? 68 ARG A HH11 4  
ATOM 4978  H HH12 . ARG A 1 68 ? -17.300 4.407   7.424   1.00 0.00 ? 68 ARG A HH12 4  
ATOM 4979  H HH21 . ARG A 1 68 ? -17.720 4.121   3.967   1.00 0.00 ? 68 ARG A HH21 4  
ATOM 4980  H HH22 . ARG A 1 68 ? -18.111 5.041   5.382   1.00 0.00 ? 68 ARG A HH22 4  
ATOM 4981  N N    . TYR A 1 69 ? -11.082 -1.080  5.458   1.00 0.00 ? 69 TYR A N    4  
ATOM 4982  C CA   . TYR A 1 69 ? -9.805  -1.176  6.154   1.00 0.00 ? 69 TYR A CA   4  
ATOM 4983  C C    . TYR A 1 69 ? -9.588  0.028   7.064   1.00 0.00 ? 69 TYR A C    4  
ATOM 4984  O O    . TYR A 1 69 ? -9.266  -0.121  8.242   1.00 0.00 ? 69 TYR A O    4  
ATOM 4985  C CB   . TYR A 1 69 ? -8.659  -1.284  5.147   1.00 0.00 ? 69 TYR A CB   4  
ATOM 4986  C CG   . TYR A 1 69 ? -8.811  -2.432  4.175   1.00 0.00 ? 69 TYR A CG   4  
ATOM 4987  C CD1  . TYR A 1 69 ? -9.722  -2.363  3.128   1.00 0.00 ? 69 TYR A CD1  4  
ATOM 4988  C CD2  . TYR A 1 69 ? -8.044  -3.583  4.303   1.00 0.00 ? 69 TYR A CD2  4  
ATOM 4989  C CE1  . TYR A 1 69 ? -9.864  -3.410  2.237   1.00 0.00 ? 69 TYR A CE1  4  
ATOM 4990  C CE2  . TYR A 1 69 ? -8.181  -4.633  3.417   1.00 0.00 ? 69 TYR A CE2  4  
ATOM 4991  C CZ   . TYR A 1 69 ? -9.092  -4.542  2.385   1.00 0.00 ? 69 TYR A CZ   4  
ATOM 4992  O OH   . TYR A 1 69 ? -9.231  -5.587  1.501   1.00 0.00 ? 69 TYR A OH   4  
ATOM 4993  H H    . TYR A 1 69 ? -11.173 -0.454  4.709   1.00 0.00 ? 69 TYR A H    4  
ATOM 4994  H HA   . TYR A 1 69 ? -9.825  -2.070  6.760   1.00 0.00 ? 69 TYR A HA   4  
ATOM 4995  H HB2  . TYR A 1 69 ? -8.605  -0.369  4.575   1.00 0.00 ? 69 TYR A HB2  4  
ATOM 4996  H HB3  . TYR A 1 69 ? -7.731  -1.422  5.682   1.00 0.00 ? 69 TYR A HB3  4  
ATOM 4997  H HD1  . TYR A 1 69 ? -10.326 -1.475  3.014   1.00 0.00 ? 69 TYR A HD1  4  
ATOM 4998  H HD2  . TYR A 1 69 ? -7.331  -3.651  5.112   1.00 0.00 ? 69 TYR A HD2  4  
ATOM 4999  H HE1  . TYR A 1 69 ? -10.579 -3.338  1.430   1.00 0.00 ? 69 TYR A HE1  4  
ATOM 5000  H HE2  . TYR A 1 69 ? -7.575  -5.520  3.533   1.00 0.00 ? 69 TYR A HE2  4  
ATOM 5001  H HH   . TYR A 1 69 ? -10.017 -6.092  1.722   1.00 0.00 ? 69 TYR A HH   4  
ATOM 5002  N N    . PHE A 1 70 ? -9.766  1.222   6.508   1.00 0.00 ? 70 PHE A N    4  
ATOM 5003  C CA   . PHE A 1 70 ? -9.589  2.454   7.268   1.00 0.00 ? 70 PHE A CA   4  
ATOM 5004  C C    . PHE A 1 70 ? -10.576 3.522   6.809   1.00 0.00 ? 70 PHE A C    4  
ATOM 5005  O O    . PHE A 1 70 ? -10.780 3.719   5.611   1.00 0.00 ? 70 PHE A O    4  
ATOM 5006  C CB   . PHE A 1 70 ? -8.156  2.968   7.119   1.00 0.00 ? 70 PHE A CB   4  
ATOM 5007  C CG   . PHE A 1 70 ? -7.691  3.042   5.693   1.00 0.00 ? 70 PHE A CG   4  
ATOM 5008  C CD1  . PHE A 1 70 ? -8.031  4.123   4.895   1.00 0.00 ? 70 PHE A CD1  4  
ATOM 5009  C CD2  . PHE A 1 70 ? -6.914  2.030   5.150   1.00 0.00 ? 70 PHE A CD2  4  
ATOM 5010  C CE1  . PHE A 1 70 ? -7.604  4.192   3.582   1.00 0.00 ? 70 PHE A CE1  4  
ATOM 5011  C CE2  . PHE A 1 70 ? -6.485  2.096   3.839   1.00 0.00 ? 70 PHE A CE2  4  
ATOM 5012  C CZ   . PHE A 1 70 ? -6.830  3.178   3.054   1.00 0.00 ? 70 PHE A CZ   4  
ATOM 5013  H H    . PHE A 1 70 ? -10.023 1.276   5.563   1.00 0.00 ? 70 PHE A H    4  
ATOM 5014  H HA   . PHE A 1 70 ? -9.775  2.231   8.308   1.00 0.00 ? 70 PHE A HA   4  
ATOM 5015  H HB2  . PHE A 1 70 ? -8.092  3.960   7.541   1.00 0.00 ? 70 PHE A HB2  4  
ATOM 5016  H HB3  . PHE A 1 70 ? -7.488  2.310   7.655   1.00 0.00 ? 70 PHE A HB3  4  
ATOM 5017  H HD1  . PHE A 1 70 ? -8.636  4.916   5.306   1.00 0.00 ? 70 PHE A HD1  4  
ATOM 5018  H HD2  . PHE A 1 70 ? -6.642  1.184   5.764   1.00 0.00 ? 70 PHE A HD2  4  
ATOM 5019  H HE1  . PHE A 1 70 ? -7.876  5.040   2.969   1.00 0.00 ? 70 PHE A HE1  4  
ATOM 5020  H HE2  . PHE A 1 70 ? -5.879  1.301   3.428   1.00 0.00 ? 70 PHE A HE2  4  
ATOM 5021  H HZ   . PHE A 1 70 ? -6.495  3.231   2.027   1.00 0.00 ? 70 PHE A HZ   4  
ATOM 5022  N N    . GLU A 1 71 ? -11.185 4.210   7.769   1.00 0.00 ? 71 GLU A N    4  
ATOM 5023  C CA   . GLU A 1 71 ? -12.150 5.259   7.462   1.00 0.00 ? 71 GLU A CA   4  
ATOM 5024  C C    . GLU A 1 71 ? -11.451 6.502   6.922   1.00 0.00 ? 71 GLU A C    4  
ATOM 5025  O O    . GLU A 1 71 ? -10.781 7.221   7.664   1.00 0.00 ? 71 GLU A O    4  
ATOM 5026  C CB   . GLU A 1 71 ? -12.960 5.617   8.711   1.00 0.00 ? 71 GLU A CB   4  
ATOM 5027  C CG   . GLU A 1 71 ? -14.356 6.132   8.402   1.00 0.00 ? 71 GLU A CG   4  
ATOM 5028  C CD   . GLU A 1 71 ? -15.209 6.285   9.647   1.00 0.00 ? 71 GLU A CD   4  
ATOM 5029  O OE1  . GLU A 1 71 ? -15.712 5.260   10.151  1.00 0.00 ? 71 GLU A OE1  4  
ATOM 5030  O OE2  . GLU A 1 71 ? -15.371 7.431   10.117  1.00 0.00 ? 71 GLU A OE2  4  
ATOM 5031  H H    . GLU A 1 71 ? -10.981 4.007   8.706   1.00 0.00 ? 71 GLU A H    4  
ATOM 5032  H HA   . GLU A 1 71 ? -12.821 4.880   6.706   1.00 0.00 ? 71 GLU A HA   4  
ATOM 5033  H HB2  . GLU A 1 71 ? -13.052 4.737   9.330   1.00 0.00 ? 71 GLU A HB2  4  
ATOM 5034  H HB3  . GLU A 1 71 ? -12.431 6.381   9.261   1.00 0.00 ? 71 GLU A HB3  4  
ATOM 5035  H HG2  . GLU A 1 71 ? -14.273 7.095   7.921   1.00 0.00 ? 71 GLU A HG2  4  
ATOM 5036  H HG3  . GLU A 1 71 ? -14.843 5.438   7.734   1.00 0.00 ? 71 GLU A HG3  4  
ATOM 5037  N N    . CYS A 1 72 ? -11.613 6.749   5.626   1.00 0.00 ? 72 CYS A N    4  
ATOM 5038  C CA   . CYS A 1 72 ? -10.998 7.906   4.986   1.00 0.00 ? 72 CYS A CA   4  
ATOM 5039  C C    . CYS A 1 72 ? -11.763 8.304   3.727   1.00 0.00 ? 72 CYS A C    4  
ATOM 5040  O O    . CYS A 1 72 ? -12.561 7.525   3.205   1.00 0.00 ? 72 CYS A O    4  
ATOM 5041  C CB   . CYS A 1 72 ? -9.539  7.605   4.637   1.00 0.00 ? 72 CYS A CB   4  
ATOM 5042  S SG   . CYS A 1 72 ? -8.391  7.809   6.019   1.00 0.00 ? 72 CYS A SG   4  
ATOM 5043  H H    . CYS A 1 72 ? -12.159 6.139   5.088   1.00 0.00 ? 72 CYS A H    4  
ATOM 5044  H HA   . CYS A 1 72 ? -11.028 8.728   5.686   1.00 0.00 ? 72 CYS A HA   4  
ATOM 5045  H HB2  . CYS A 1 72 ? -9.462  6.584   4.294   1.00 0.00 ? 72 CYS A HB2  4  
ATOM 5046  H HB3  . CYS A 1 72 ? -9.222  8.269   3.845   1.00 0.00 ? 72 CYS A HB3  4  
ATOM 5047  H HG   . CYS A 1 72 ? -7.542  8.076   5.662   1.00 0.00 ? 72 CYS A HG   4  
ATOM 5048  N N    . PRO A 1 73 ? -11.529 9.526   3.221   1.00 0.00 ? 73 PRO A N    4  
ATOM 5049  C CA   . PRO A 1 73 ? -12.202 10.025  2.017   1.00 0.00 ? 73 PRO A CA   4  
ATOM 5050  C C    . PRO A 1 73 ? -12.081 9.058   0.845   1.00 0.00 ? 73 PRO A C    4  
ATOM 5051  O O    . PRO A 1 73 ? -11.241 8.158   0.852   1.00 0.00 ? 73 PRO A O    4  
ATOM 5052  C CB   . PRO A 1 73 ? -11.465 11.330  1.711   1.00 0.00 ? 73 PRO A CB   4  
ATOM 5053  C CG   . PRO A 1 73 ? -10.919 11.774  3.024   1.00 0.00 ? 73 PRO A CG   4  
ATOM 5054  C CD   . PRO A 1 73 ? -10.592 10.518  3.781   1.00 0.00 ? 73 PRO A CD   4  
ATOM 5055  H HA   . PRO A 1 73 ? -13.245 10.232  2.204   1.00 0.00 ? 73 PRO A HA   4  
ATOM 5056  H HB2  . PRO A 1 73 ? -10.675 11.142  0.998   1.00 0.00 ? 73 PRO A HB2  4  
ATOM 5057  H HB3  . PRO A 1 73 ? -12.157 12.053  1.307   1.00 0.00 ? 73 PRO A HB3  4  
ATOM 5058  H HG2  . PRO A 1 73 ? -10.028 12.364  2.871   1.00 0.00 ? 73 PRO A HG2  4  
ATOM 5059  H HG3  . PRO A 1 73 ? -11.664 12.349  3.555   1.00 0.00 ? 73 PRO A HG3  4  
ATOM 5060  H HD2  . PRO A 1 73 ? -9.568  10.225  3.602   1.00 0.00 ? 73 PRO A HD2  4  
ATOM 5061  H HD3  . PRO A 1 73 ? -10.766 10.658  4.838   1.00 0.00 ? 73 PRO A HD3  4  
ATOM 5062  N N    . ALA A 1 74 ? -12.927 9.250   -0.163  1.00 0.00 ? 74 ALA A N    4  
ATOM 5063  C CA   . ALA A 1 74 ? -12.915 8.393   -1.344  1.00 0.00 ? 74 ALA A CA   4  
ATOM 5064  C C    . ALA A 1 74 ? -11.790 8.787   -2.296  1.00 0.00 ? 74 ALA A C    4  
ATOM 5065  O O    . ALA A 1 74 ? -11.326 9.926   -2.286  1.00 0.00 ? 74 ALA A O    4  
ATOM 5066  C CB   . ALA A 1 74 ? -14.258 8.460   -2.055  1.00 0.00 ? 74 ALA A CB   4  
ATOM 5067  H H    . ALA A 1 74 ? -13.574 9.983   -0.111  1.00 0.00 ? 74 ALA A H    4  
ATOM 5068  H HA   . ALA A 1 74 ? -12.757 7.376   -1.017  1.00 0.00 ? 74 ALA A HA   4  
ATOM 5069  H HB1  . ALA A 1 74 ? -14.498 7.488   -2.462  1.00 0.00 ? 74 ALA A HB1  4  
ATOM 5070  H HB2  . ALA A 1 74 ? -14.206 9.183   -2.856  1.00 0.00 ? 74 ALA A HB2  4  
ATOM 5071  H HB3  . ALA A 1 74 ? -15.024 8.754   -1.352  1.00 0.00 ? 74 ALA A HB3  4  
ATOM 5072  N N    . LEU A 1 75 ? -11.358 7.835   -3.117  1.00 0.00 ? 75 LEU A N    4  
ATOM 5073  C CA   . LEU A 1 75 ? -10.288 8.082   -4.076  1.00 0.00 ? 75 LEU A CA   4  
ATOM 5074  C C    . LEU A 1 75 ? -9.003  8.501   -3.366  1.00 0.00 ? 75 LEU A C    4  
ATOM 5075  O O    . LEU A 1 75 ? -8.178  9.220   -3.930  1.00 0.00 ? 75 LEU A O    4  
ATOM 5076  C CB   . LEU A 1 75 ? -10.708 9.163   -5.073  1.00 0.00 ? 75 LEU A CB   4  
ATOM 5077  C CG   . LEU A 1 75 ? -11.866 8.779   -5.996  1.00 0.00 ? 75 LEU A CG   4  
ATOM 5078  C CD1  . LEU A 1 75 ? -12.703 10.002  -6.339  1.00 0.00 ? 75 LEU A CD1  4  
ATOM 5079  C CD2  . LEU A 1 75 ? -11.340 8.118   -7.261  1.00 0.00 ? 75 LEU A CD2  4  
ATOM 5080  H H    . LEU A 1 75 ? -11.768 6.946   -3.077  1.00 0.00 ? 75 LEU A H    4  
ATOM 5081  H HA   . LEU A 1 75 ? -10.105 7.163   -4.612  1.00 0.00 ? 75 LEU A HA   4  
ATOM 5082  H HB2  . LEU A 1 75 ? -10.995 10.043  -4.515  1.00 0.00 ? 75 LEU A HB2  4  
ATOM 5083  H HB3  . LEU A 1 75 ? -9.855  9.409   -5.686  1.00 0.00 ? 75 LEU A HB3  4  
ATOM 5084  H HG   . LEU A 1 75 ? -12.503 8.071   -5.487  1.00 0.00 ? 75 LEU A HG   4  
ATOM 5085  H HD11 . LEU A 1 75 ? -13.042 10.473  -5.429  1.00 0.00 ? 75 LEU A HD11 4  
ATOM 5086  H HD12 . LEU A 1 75 ? -13.556 9.699   -6.927  1.00 0.00 ? 75 LEU A HD12 4  
ATOM 5087  H HD13 . LEU A 1 75 ? -12.104 10.700  -6.904  1.00 0.00 ? 75 LEU A HD13 4  
ATOM 5088  H HD21 . LEU A 1 75 ? -10.790 8.842   -7.844  1.00 0.00 ? 75 LEU A HD21 4  
ATOM 5089  H HD22 . LEU A 1 75 ? -12.169 7.744   -7.842  1.00 0.00 ? 75 LEU A HD22 4  
ATOM 5090  H HD23 . LEU A 1 75 ? -10.687 7.300   -6.995  1.00 0.00 ? 75 LEU A HD23 4  
ATOM 5091  N N    . GLN A 1 76 ? -8.841  8.047   -2.127  1.00 0.00 ? 76 GLN A N    4  
ATOM 5092  C CA   . GLN A 1 76 ? -7.656  8.376   -1.342  1.00 0.00 ? 76 GLN A CA   4  
ATOM 5093  C C    . GLN A 1 76 ? -7.002  7.116   -0.788  1.00 0.00 ? 76 GLN A C    4  
ATOM 5094  O O    . GLN A 1 76 ? -5.779  6.979   -0.804  1.00 0.00 ? 76 GLN A O    4  
ATOM 5095  C CB   . GLN A 1 76 ? -8.023  9.321   -0.197  1.00 0.00 ? 76 GLN A CB   4  
ATOM 5096  C CG   . GLN A 1 76 ? -7.920  10.793  -0.566  1.00 0.00 ? 76 GLN A CG   4  
ATOM 5097  C CD   . GLN A 1 76 ? -8.172  11.709  0.615   1.00 0.00 ? 76 GLN A CD   4  
ATOM 5098  O OE1  . GLN A 1 76 ? -9.003  12.613  0.548   1.00 0.00 ? 76 GLN A OE1  4  
ATOM 5099  N NE2  . GLN A 1 76 ? -7.450  11.479  1.706   1.00 0.00 ? 76 GLN A NE2  4  
ATOM 5100  H H    . GLN A 1 76 ? -9.533  7.478   -1.732  1.00 0.00 ? 76 GLN A H    4  
ATOM 5101  H HA   . GLN A 1 76 ? -6.955  8.871   -1.994  1.00 0.00 ? 76 GLN A HA   4  
ATOM 5102  H HB2  . GLN A 1 76 ? -9.039  9.120   0.109   1.00 0.00 ? 76 GLN A HB2  4  
ATOM 5103  H HB3  . GLN A 1 76 ? -7.362  9.134   0.636   1.00 0.00 ? 76 GLN A HB3  4  
ATOM 5104  H HG2  . GLN A 1 76 ? -6.928  10.986  -0.947  1.00 0.00 ? 76 GLN A HG2  4  
ATOM 5105  H HG3  . GLN A 1 76 ? -8.648  11.010  -1.334  1.00 0.00 ? 76 GLN A HG3  4  
ATOM 5106  H HE21 . GLN A 1 76 ? -6.805  10.741  1.688   1.00 0.00 ? 76 GLN A HE21 4  
ATOM 5107  H HE22 . GLN A 1 76 ? -7.591  12.056  2.485   1.00 0.00 ? 76 GLN A HE22 4  
ATOM 5108  N N    . GLY A 1 77 ? -7.826  6.199   -0.297  1.00 0.00 ? 77 GLY A N    4  
ATOM 5109  C CA   . GLY A 1 77 ? -7.313  4.960   0.257   1.00 0.00 ? 77 GLY A CA   4  
ATOM 5110  C C    . GLY A 1 77 ? -6.743  4.041   -0.805  1.00 0.00 ? 77 GLY A C    4  
ATOM 5111  O O    . GLY A 1 77 ? -7.388  3.074   -1.210  1.00 0.00 ? 77 GLY A O    4  
ATOM 5112  H H    . GLY A 1 77 ? -8.790  6.365   -0.313  1.00 0.00 ? 77 GLY A H    4  
ATOM 5113  H HA2  . GLY A 1 77 ? -6.538  5.192   0.971   1.00 0.00 ? 77 GLY A HA2  4  
ATOM 5114  H HA3  . GLY A 1 77 ? -8.116  4.448   0.767   1.00 0.00 ? 77 GLY A HA3  4  
ATOM 5115  N N    . ILE A 1 78 ? -5.530  4.343   -1.256  1.00 0.00 ? 78 ILE A N    4  
ATOM 5116  C CA   . ILE A 1 78 ? -4.872  3.538   -2.278  1.00 0.00 ? 78 ILE A CA   4  
ATOM 5117  C C    . ILE A 1 78 ? -4.107  2.375   -1.652  1.00 0.00 ? 78 ILE A C    4  
ATOM 5118  O O    . ILE A 1 78 ? -3.597  2.483   -0.537  1.00 0.00 ? 78 ILE A O    4  
ATOM 5119  C CB   . ILE A 1 78 ? -3.902  4.386   -3.125  1.00 0.00 ? 78 ILE A CB   4  
ATOM 5120  C CG1  . ILE A 1 78 ? -3.303  3.547   -4.256  1.00 0.00 ? 78 ILE A CG1  4  
ATOM 5121  C CG2  . ILE A 1 78 ? -2.803  4.971   -2.250  1.00 0.00 ? 78 ILE A CG2  4  
ATOM 5122  C CD1  . ILE A 1 78 ? -2.777  4.373   -5.408  1.00 0.00 ? 78 ILE A CD1  4  
ATOM 5123  H H    . ILE A 1 78 ? -5.066  5.126   -0.893  1.00 0.00 ? 78 ILE A H    4  
ATOM 5124  H HA   . ILE A 1 78 ? -5.636  3.142   -2.932  1.00 0.00 ? 78 ILE A HA   4  
ATOM 5125  H HB   . ILE A 1 78 ? -4.460  5.206   -3.553  1.00 0.00 ? 78 ILE A HB   4  
ATOM 5126  H HG12 . ILE A 1 78 ? -2.484  2.963   -3.866  1.00 0.00 ? 78 ILE A HG12 4  
ATOM 5127  H HG13 . ILE A 1 78 ? -4.063  2.883   -4.642  1.00 0.00 ? 78 ILE A HG13 4  
ATOM 5128  H HG21 . ILE A 1 78 ? -3.232  5.677   -1.555  1.00 0.00 ? 78 ILE A HG21 4  
ATOM 5129  H HG22 . ILE A 1 78 ? -2.078  5.474   -2.873  1.00 0.00 ? 78 ILE A HG22 4  
ATOM 5130  H HG23 . ILE A 1 78 ? -2.317  4.177   -1.703  1.00 0.00 ? 78 ILE A HG23 4  
ATOM 5131  H HD11 . ILE A 1 78 ? -3.382  4.196   -6.284  1.00 0.00 ? 78 ILE A HD11 4  
ATOM 5132  H HD12 . ILE A 1 78 ? -1.754  4.094   -5.614  1.00 0.00 ? 78 ILE A HD12 4  
ATOM 5133  H HD13 . ILE A 1 78 ? -2.819  5.421   -5.148  1.00 0.00 ? 78 ILE A HD13 4  
ATOM 5134  N N    . PHE A 1 79 ? -4.032  1.264   -2.377  1.00 0.00 ? 79 PHE A N    4  
ATOM 5135  C CA   . PHE A 1 79 ? -3.329  0.080   -1.893  1.00 0.00 ? 79 PHE A CA   4  
ATOM 5136  C C    . PHE A 1 79 ? -2.099  -0.209  -2.747  1.00 0.00 ? 79 PHE A C    4  
ATOM 5137  O O    . PHE A 1 79 ? -2.144  -0.107  -3.973  1.00 0.00 ? 79 PHE A O    4  
ATOM 5138  C CB   . PHE A 1 79 ? -4.264  -1.130  -1.897  1.00 0.00 ? 79 PHE A CB   4  
ATOM 5139  C CG   . PHE A 1 79 ? -4.984  -1.338  -0.596  1.00 0.00 ? 79 PHE A CG   4  
ATOM 5140  C CD1  . PHE A 1 79 ? -6.150  -0.645  -0.315  1.00 0.00 ? 79 PHE A CD1  4  
ATOM 5141  C CD2  . PHE A 1 79 ? -4.494  -2.227  0.347   1.00 0.00 ? 79 PHE A CD2  4  
ATOM 5142  C CE1  . PHE A 1 79 ? -6.814  -0.833  0.882   1.00 0.00 ? 79 PHE A CE1  4  
ATOM 5143  C CE2  . PHE A 1 79 ? -5.153  -2.421  1.547   1.00 0.00 ? 79 PHE A CE2  4  
ATOM 5144  C CZ   . PHE A 1 79 ? -6.315  -1.723  1.813   1.00 0.00 ? 79 PHE A CZ   4  
ATOM 5145  H H    . PHE A 1 79 ? -4.459  1.238   -3.258  1.00 0.00 ? 79 PHE A H    4  
ATOM 5146  H HA   . PHE A 1 79 ? -3.011  0.275   -0.880  1.00 0.00 ? 79 PHE A HA   4  
ATOM 5147  H HB2  . PHE A 1 79 ? -5.007  -1.000  -2.671  1.00 0.00 ? 79 PHE A HB2  4  
ATOM 5148  H HB3  . PHE A 1 79 ? -3.688  -2.020  -2.106  1.00 0.00 ? 79 PHE A HB3  4  
ATOM 5149  H HD1  . PHE A 1 79 ? -6.541  0.051   -1.043  1.00 0.00 ? 79 PHE A HD1  4  
ATOM 5150  H HD2  . PHE A 1 79 ? -3.585  -2.774  0.139   1.00 0.00 ? 79 PHE A HD2  4  
ATOM 5151  H HE1  . PHE A 1 79 ? -7.722  -0.286  1.089   1.00 0.00 ? 79 PHE A HE1  4  
ATOM 5152  H HE2  . PHE A 1 79 ? -4.762  -3.117  2.274   1.00 0.00 ? 79 PHE A HE2  4  
ATOM 5153  H HZ   . PHE A 1 79 ? -6.833  -1.872  2.750   1.00 0.00 ? 79 PHE A HZ   4  
ATOM 5154  N N    . THR A 1 80 ? -1.000  -0.568  -2.090  1.00 0.00 ? 80 THR A N    4  
ATOM 5155  C CA   . THR A 1 80 ? 0.243   -0.872  -2.789  1.00 0.00 ? 80 THR A CA   4  
ATOM 5156  C C    . THR A 1 80 ? 1.139   -1.767  -1.938  1.00 0.00 ? 80 THR A C    4  
ATOM 5157  O O    . THR A 1 80 ? 0.946   -1.886  -0.728  1.00 0.00 ? 80 THR A O    4  
ATOM 5158  C CB   . THR A 1 80 ? 0.981   0.419   -3.146  1.00 0.00 ? 80 THR A CB   4  
ATOM 5159  O OG1  . THR A 1 80 ? 2.179   0.136   -3.847  1.00 0.00 ? 80 THR A OG1  4  
ATOM 5160  C CG2  . THR A 1 80 ? 1.343   1.256   -1.937  1.00 0.00 ? 80 THR A CG2  4  
ATOM 5161  H H    . THR A 1 80 ? -1.027  -0.631  -1.113  1.00 0.00 ? 80 THR A H    4  
ATOM 5162  H HA   . THR A 1 80 ? -0.008  -1.397  -3.699  1.00 0.00 ? 80 THR A HA   4  
ATOM 5163  H HB   . THR A 1 80 ? 0.347   1.018   -3.784  1.00 0.00 ? 80 THR A HB   4  
ATOM 5164  H HG1  . THR A 1 80 ? 2.816   -0.260  -3.248  1.00 0.00 ? 80 THR A HG1  4  
ATOM 5165  H HG21 . THR A 1 80 ? 0.956   0.786   -1.045  1.00 0.00 ? 80 THR A HG21 4  
ATOM 5166  H HG22 . THR A 1 80 ? 0.913   2.241   -2.040  1.00 0.00 ? 80 THR A HG22 4  
ATOM 5167  H HG23 . THR A 1 80 ? 2.417   1.336   -1.864  1.00 0.00 ? 80 THR A HG23 4  
ATOM 5168  N N    . ARG A 1 81 ? 2.121   -2.393  -2.579  1.00 0.00 ? 81 ARG A N    4  
ATOM 5169  C CA   . ARG A 1 81 ? 3.046   -3.277  -1.881  1.00 0.00 ? 81 ARG A CA   4  
ATOM 5170  C C    . ARG A 1 81 ? 3.956   -2.484  -0.943  1.00 0.00 ? 81 ARG A C    4  
ATOM 5171  O O    . ARG A 1 81 ? 4.412   -1.394  -1.287  1.00 0.00 ? 81 ARG A O    4  
ATOM 5172  C CB   . ARG A 1 81 ? 3.893   -4.061  -2.886  1.00 0.00 ? 81 ARG A CB   4  
ATOM 5173  C CG   . ARG A 1 81 ? 3.082   -4.680  -4.013  1.00 0.00 ? 81 ARG A CG   4  
ATOM 5174  C CD   . ARG A 1 81 ? 3.945   -5.560  -4.902  1.00 0.00 ? 81 ARG A CD   4  
ATOM 5175  N NE   . ARG A 1 81 ? 3.258   -5.934  -6.135  1.00 0.00 ? 81 ARG A NE   4  
ATOM 5176  C CZ   . ARG A 1 81 ? 3.113   -5.121  -7.180  1.00 0.00 ? 81 ARG A CZ   4  
ATOM 5177  N NH1  . ARG A 1 81 ? 3.607   -3.889  -7.145  1.00 0.00 ? 81 ARG A NH1  4  
ATOM 5178  N NH2  . ARG A 1 81 ? 2.475   -5.541  -8.264  1.00 0.00 ? 81 ARG A NH2  4  
ATOM 5179  H H    . ARG A 1 81 ? 2.225   -2.259  -3.544  1.00 0.00 ? 81 ARG A H    4  
ATOM 5180  H HA   . ARG A 1 81 ? 2.462   -3.972  -1.297  1.00 0.00 ? 81 ARG A HA   4  
ATOM 5181  H HB2  . ARG A 1 81 ? 4.623   -3.395  -3.320  1.00 0.00 ? 81 ARG A HB2  4  
ATOM 5182  H HB3  . ARG A 1 81 ? 4.407   -4.855  -2.364  1.00 0.00 ? 81 ARG A HB3  4  
ATOM 5183  H HG2  . ARG A 1 81 ? 2.292   -5.281  -3.588  1.00 0.00 ? 81 ARG A HG2  4  
ATOM 5184  H HG3  . ARG A 1 81 ? 2.653   -3.889  -4.611  1.00 0.00 ? 81 ARG A HG3  4  
ATOM 5185  H HD2  . ARG A 1 81 ? 4.847   -5.020  -5.153  1.00 0.00 ? 81 ARG A HD2  4  
ATOM 5186  H HD3  . ARG A 1 81 ? 4.202   -6.456  -4.358  1.00 0.00 ? 81 ARG A HD3  4  
ATOM 5187  H HE   . ARG A 1 81 ? 2.883   -6.838  -6.190  1.00 0.00 ? 81 ARG A HE   4  
ATOM 5188  H HH11 . ARG A 1 81 ? 4.089   -3.566  -6.331  1.00 0.00 ? 81 ARG A HH11 4  
ATOM 5189  H HH12 . ARG A 1 81 ? 3.495   -3.283  -7.932  1.00 0.00 ? 81 ARG A HH12 4  
ATOM 5190  H HH21 . ARG A 1 81 ? 2.102   -6.468  -8.296  1.00 0.00 ? 81 ARG A HH21 4  
ATOM 5191  H HH22 . ARG A 1 81 ? 2.366   -4.930  -9.048  1.00 0.00 ? 81 ARG A HH22 4  
ATOM 5192  N N    . PRO A 1 82 ? 4.233   -3.021  0.259   1.00 0.00 ? 82 PRO A N    4  
ATOM 5193  C CA   . PRO A 1 82 ? 5.095   -2.353  1.241   1.00 0.00 ? 82 PRO A CA   4  
ATOM 5194  C C    . PRO A 1 82 ? 6.452   -1.974  0.658   1.00 0.00 ? 82 PRO A C    4  
ATOM 5195  O O    . PRO A 1 82 ? 6.936   -0.860  0.859   1.00 0.00 ? 82 PRO A O    4  
ATOM 5196  C CB   . PRO A 1 82 ? 5.263   -3.400  2.345   1.00 0.00 ? 82 PRO A CB   4  
ATOM 5197  C CG   . PRO A 1 82 ? 4.069   -4.281  2.220   1.00 0.00 ? 82 PRO A CG   4  
ATOM 5198  C CD   . PRO A 1 82 ? 3.735   -4.317  0.755   1.00 0.00 ? 82 PRO A CD   4  
ATOM 5199  H HA   . PRO A 1 82 ? 4.620   -1.471  1.647   1.00 0.00 ? 82 PRO A HA   4  
ATOM 5200  H HB2  . PRO A 1 82 ? 6.180   -3.949  2.186   1.00 0.00 ? 82 PRO A HB2  4  
ATOM 5201  H HB3  . PRO A 1 82 ? 5.292   -2.911  3.307   1.00 0.00 ? 82 PRO A HB3  4  
ATOM 5202  H HG2  . PRO A 1 82 ? 4.306   -5.273  2.575   1.00 0.00 ? 82 PRO A HG2  4  
ATOM 5203  H HG3  . PRO A 1 82 ? 3.246   -3.867  2.781   1.00 0.00 ? 82 PRO A HG3  4  
ATOM 5204  H HD2  . PRO A 1 82 ? 4.244   -5.138  0.271   1.00 0.00 ? 82 PRO A HD2  4  
ATOM 5205  H HD3  . PRO A 1 82 ? 2.667   -4.399  0.614   1.00 0.00 ? 82 PRO A HD3  4  
ATOM 5206  N N    . SER A 1 83 ? 7.061   -2.907  -0.065  1.00 0.00 ? 83 SER A N    4  
ATOM 5207  C CA   . SER A 1 83 ? 8.364   -2.674  -0.677  1.00 0.00 ? 83 SER A CA   4  
ATOM 5208  C C    . SER A 1 83 ? 8.314   -1.487  -1.634  1.00 0.00 ? 83 SER A C    4  
ATOM 5209  O O    . SER A 1 83 ? 9.301   -0.771  -1.805  1.00 0.00 ? 83 SER A O    4  
ATOM 5210  C CB   . SER A 1 83 ? 8.832   -3.925  -1.423  1.00 0.00 ? 83 SER A CB   4  
ATOM 5211  O OG   . SER A 1 83 ? 10.228  -4.118  -1.269  1.00 0.00 ? 83 SER A OG   4  
ATOM 5212  H H    . SER A 1 83 ? 6.625   -3.776  -0.189  1.00 0.00 ? 83 SER A H    4  
ATOM 5213  H HA   . SER A 1 83 ? 9.066   -2.453  0.113   1.00 0.00 ? 83 SER A HA   4  
ATOM 5214  H HB2  . SER A 1 83 ? 8.318   -4.789  -1.030  1.00 0.00 ? 83 SER A HB2  4  
ATOM 5215  H HB3  . SER A 1 83 ? 8.609   -3.819  -2.474  1.00 0.00 ? 83 SER A HB3  4  
ATOM 5216  H HG   . SER A 1 83 ? 10.429  -5.055  -1.316  1.00 0.00 ? 83 SER A HG   4  
ATOM 5217  N N    . LYS A 1 84 ? 7.156   -1.283  -2.255  1.00 0.00 ? 84 LYS A N    4  
ATOM 5218  C CA   . LYS A 1 84 ? 6.977   -0.182  -3.196  1.00 0.00 ? 84 LYS A CA   4  
ATOM 5219  C C    . LYS A 1 84 ? 7.016   1.161   -2.475  1.00 0.00 ? 84 LYS A C    4  
ATOM 5220  O O    . LYS A 1 84 ? 7.440   2.168   -3.041  1.00 0.00 ? 84 LYS A O    4  
ATOM 5221  C CB   . LYS A 1 84 ? 5.654   -0.335  -3.945  1.00 0.00 ? 84 LYS A CB   4  
ATOM 5222  C CG   . LYS A 1 84 ? 5.572   -1.598  -4.786  1.00 0.00 ? 84 LYS A CG   4  
ATOM 5223  C CD   . LYS A 1 84 ? 6.198   -1.396  -6.158  1.00 0.00 ? 84 LYS A CD   4  
ATOM 5224  C CE   . LYS A 1 84 ? 7.676   -1.750  -6.154  1.00 0.00 ? 84 LYS A CE   4  
ATOM 5225  N NZ   . LYS A 1 84 ? 7.932   -3.073  -6.789  1.00 0.00 ? 84 LYS A NZ   4  
ATOM 5226  H H    . LYS A 1 84 ? 6.405   -1.887  -2.078  1.00 0.00 ? 84 LYS A H    4  
ATOM 5227  H HA   . LYS A 1 84 ? 7.789   -0.219  -3.907  1.00 0.00 ? 84 LYS A HA   4  
ATOM 5228  H HB2  . LYS A 1 84 ? 4.846   -0.354  -3.227  1.00 0.00 ? 84 LYS A HB2  4  
ATOM 5229  H HB3  . LYS A 1 84 ? 5.522   0.515   -4.598  1.00 0.00 ? 84 LYS A HB3  4  
ATOM 5230  H HG2  . LYS A 1 84 ? 6.097   -2.392  -4.277  1.00 0.00 ? 84 LYS A HG2  4  
ATOM 5231  H HG3  . LYS A 1 84 ? 4.535   -1.871  -4.911  1.00 0.00 ? 84 LYS A HG3  4  
ATOM 5232  H HD2  . LYS A 1 84 ? 5.689   -2.025  -6.872  1.00 0.00 ? 84 LYS A HD2  4  
ATOM 5233  H HD3  . LYS A 1 84 ? 6.086   -0.360  -6.444  1.00 0.00 ? 84 LYS A HD3  4  
ATOM 5234  H HE2  . LYS A 1 84 ? 8.217   -0.990  -6.698  1.00 0.00 ? 84 LYS A HE2  4  
ATOM 5235  H HE3  . LYS A 1 84 ? 8.025   -1.778  -5.132  1.00 0.00 ? 84 LYS A HE3  4  
ATOM 5236  H HZ1  . LYS A 1 84 ? 7.773   -3.013  -7.816  1.00 0.00 ? 84 LYS A HZ1  4  
ATOM 5237  H HZ2  . LYS A 1 84 ? 7.291   -3.790  -6.392  1.00 0.00 ? 84 LYS A HZ2  4  
ATOM 5238  H HZ3  . LYS A 1 84 ? 8.914   -3.369  -6.617  1.00 0.00 ? 84 LYS A HZ3  4  
ATOM 5239  N N    . LEU A 1 85 ? 6.570   1.169   -1.223  1.00 0.00 ? 85 LEU A N    4  
ATOM 5240  C CA   . LEU A 1 85 ? 6.553   2.390   -0.425  1.00 0.00 ? 85 LEU A CA   4  
ATOM 5241  C C    . LEU A 1 85 ? 7.972   2.861   -0.120  1.00 0.00 ? 85 LEU A C    4  
ATOM 5242  O O    . LEU A 1 85 ? 8.901   2.056   -0.045  1.00 0.00 ? 85 LEU A O    4  
ATOM 5243  C CB   . LEU A 1 85 ? 5.788   2.162   0.880   1.00 0.00 ? 85 LEU A CB   4  
ATOM 5244  C CG   . LEU A 1 85 ? 4.404   1.532   0.717   1.00 0.00 ? 85 LEU A CG   4  
ATOM 5245  C CD1  . LEU A 1 85 ? 3.933   0.932   2.032   1.00 0.00 ? 85 LEU A CD1  4  
ATOM 5246  C CD2  . LEU A 1 85 ? 3.407   2.563   0.212   1.00 0.00 ? 85 LEU A CD2  4  
ATOM 5247  H H    . LEU A 1 85 ? 6.244   0.335   -0.825  1.00 0.00 ? 85 LEU A H    4  
ATOM 5248  H HA   . LEU A 1 85 ? 6.049   3.154   -0.999  1.00 0.00 ? 85 LEU A HA   4  
ATOM 5249  H HB2  . LEU A 1 85 ? 6.382   1.518   1.512   1.00 0.00 ? 85 LEU A HB2  4  
ATOM 5250  H HB3  . LEU A 1 85 ? 5.669   3.114   1.374   1.00 0.00 ? 85 LEU A HB3  4  
ATOM 5251  H HG   . LEU A 1 85 ? 4.461   0.736   -0.012  1.00 0.00 ? 85 LEU A HG   4  
ATOM 5252  H HD11 . LEU A 1 85 ? 3.626   1.724   2.700   1.00 0.00 ? 85 LEU A HD11 4  
ATOM 5253  H HD12 . LEU A 1 85 ? 4.740   0.374   2.482   1.00 0.00 ? 85 LEU A HD12 4  
ATOM 5254  H HD13 . LEU A 1 85 ? 3.097   0.272   1.848   1.00 0.00 ? 85 LEU A HD13 4  
ATOM 5255  H HD21 . LEU A 1 85 ? 3.512   2.672   -0.858  1.00 0.00 ? 85 LEU A HD21 4  
ATOM 5256  H HD22 . LEU A 1 85 ? 3.596   3.513   0.691   1.00 0.00 ? 85 LEU A HD22 4  
ATOM 5257  H HD23 . LEU A 1 85 ? 2.403   2.237   0.443   1.00 0.00 ? 85 LEU A HD23 4  
ATOM 5258  N N    . THR A 1 86 ? 8.131   4.169   0.054   1.00 0.00 ? 86 THR A N    4  
ATOM 5259  C CA   . THR A 1 86 ? 9.436   4.746   0.351   1.00 0.00 ? 86 THR A CA   4  
ATOM 5260  C C    . THR A 1 86 ? 9.316   5.854   1.393   1.00 0.00 ? 86 THR A C    4  
ATOM 5261  O O    . THR A 1 86 ? 8.253   6.451   1.559   1.00 0.00 ? 86 THR A O    4  
ATOM 5262  C CB   . THR A 1 86 ? 10.075  5.299   -0.925  1.00 0.00 ? 86 THR A CB   4  
ATOM 5263  O OG1  . THR A 1 86 ? 9.106   5.945   -1.732  1.00 0.00 ? 86 THR A OG1  4  
ATOM 5264  C CG2  . THR A 1 86 ? 10.741  4.234   -1.770  1.00 0.00 ? 86 THR A CG2  4  
ATOM 5265  H H    . THR A 1 86 ? 7.352   4.759   -0.019  1.00 0.00 ? 86 THR A H    4  
ATOM 5266  H HA   . THR A 1 86 ? 10.064  3.963   0.746   1.00 0.00 ? 86 THR A HA   4  
ATOM 5267  H HB   . THR A 1 86 ? 10.828  6.025   -0.653  1.00 0.00 ? 86 THR A HB   4  
ATOM 5268  H HG1  . THR A 1 86 ? 8.487   5.294   -2.073  1.00 0.00 ? 86 THR A HG1  4  
ATOM 5269  H HG21 . THR A 1 86 ? 11.432  3.671   -1.161  1.00 0.00 ? 86 THR A HG21 4  
ATOM 5270  H HG22 . THR A 1 86 ? 11.276  4.703   -2.583  1.00 0.00 ? 86 THR A HG22 4  
ATOM 5271  H HG23 . THR A 1 86 ? 9.990   3.570   -2.171  1.00 0.00 ? 86 THR A HG23 4  
ATOM 5272  N N    . ARG A 1 87 ? 10.414  6.123   2.092   1.00 0.00 ? 87 ARG A N    4  
ATOM 5273  C CA   . ARG A 1 87 ? 10.431  7.160   3.118   1.00 0.00 ? 87 ARG A CA   4  
ATOM 5274  C C    . ARG A 1 87 ? 11.032  8.453   2.574   1.00 0.00 ? 87 ARG A C    4  
ATOM 5275  O O    . ARG A 1 87 ? 11.648  9.222   3.313   1.00 0.00 ? 87 ARG A O    4  
ATOM 5276  C CB   . ARG A 1 87 ? 11.222  6.684   4.339   1.00 0.00 ? 87 ARG A CB   4  
ATOM 5277  C CG   . ARG A 1 87 ? 10.420  6.712   5.631   1.00 0.00 ? 87 ARG A CG   4  
ATOM 5278  C CD   . ARG A 1 87 ? 11.289  7.095   6.818   1.00 0.00 ? 87 ARG A CD   4  
ATOM 5279  N NE   . ARG A 1 87 ? 10.513  7.204   8.051   1.00 0.00 ? 87 ARG A NE   4  
ATOM 5280  C CZ   . ARG A 1 87 ? 9.745   8.248   8.355   1.00 0.00 ? 87 ARG A CZ   4  
ATOM 5281  N NH1  . ARG A 1 87 ? 9.647   9.274   7.519   1.00 0.00 ? 87 ARG A NH1  4  
ATOM 5282  N NH2  . ARG A 1 87 ? 9.072   8.266   9.497   1.00 0.00 ? 87 ARG A NH2  4  
ATOM 5283  H H    . ARG A 1 87 ? 11.232  5.614   1.914   1.00 0.00 ? 87 ARG A H    4  
ATOM 5284  H HA   . ARG A 1 87 ? 9.410   7.348   3.413   1.00 0.00 ? 87 ARG A HA   4  
ATOM 5285  H HB2  . ARG A 1 87 ? 11.551  5.670   4.168   1.00 0.00 ? 87 ARG A HB2  4  
ATOM 5286  H HB3  . ARG A 1 87 ? 12.088  7.317   4.465   1.00 0.00 ? 87 ARG A HB3  4  
ATOM 5287  H HG2  . ARG A 1 87 ? 9.623   7.434   5.533   1.00 0.00 ? 87 ARG A HG2  4  
ATOM 5288  H HG3  . ARG A 1 87 ? 10.001  5.732   5.804   1.00 0.00 ? 87 ARG A HG3  4  
ATOM 5289  H HD2  . ARG A 1 87 ? 12.050  6.342   6.949   1.00 0.00 ? 87 ARG A HD2  4  
ATOM 5290  H HD3  . ARG A 1 87 ? 11.756  8.047   6.613   1.00 0.00 ? 87 ARG A HD3  4  
ATOM 5291  H HE   . ARG A 1 87 ? 10.567  6.461   8.687   1.00 0.00 ? 87 ARG A HE   4  
ATOM 5292  H HH11 . ARG A 1 87 ? 10.151  9.267   6.655   1.00 0.00 ? 87 ARG A HH11 4  
ATOM 5293  H HH12 . ARG A 1 87 ? 9.068   10.056  7.753   1.00 0.00 ? 87 ARG A HH12 4  
ATOM 5294  H HH21 . ARG A 1 87 ? 9.142   7.496   10.131  1.00 0.00 ? 87 ARG A HH21 4  
ATOM 5295  H HH22 . ARG A 1 87 ? 8.496   9.051   9.725   1.00 0.00 ? 87 ARG A HH22 4  
ATOM 5296  N N    . GLN A 1 88 ? 10.849  8.685   1.278   1.00 0.00 ? 88 GLN A N    4  
ATOM 5297  C CA   . GLN A 1 88 ? 11.372  9.885   0.635   1.00 0.00 ? 88 GLN A CA   4  
ATOM 5298  C C    . GLN A 1 88 ? 10.969  9.931   -0.838  1.00 0.00 ? 88 GLN A C    4  
ATOM 5299  O O    . GLN A 1 88 ? 10.781  8.892   -1.471  1.00 0.00 ? 88 GLN A O    4  
ATOM 5300  C CB   . GLN A 1 88 ? 12.897  9.934   0.763   1.00 0.00 ? 88 GLN A CB   4  
ATOM 5301  C CG   . GLN A 1 88 ? 13.389  10.980  1.751   1.00 0.00 ? 88 GLN A CG   4  
ATOM 5302  C CD   . GLN A 1 88 ? 14.518  11.826  1.192   1.00 0.00 ? 88 GLN A CD   4  
ATOM 5303  O OE1  . GLN A 1 88 ? 15.650  11.361  1.061   1.00 0.00 ? 88 GLN A OE1  4  
ATOM 5304  N NE2  . GLN A 1 88 ? 14.214  13.075  0.860   1.00 0.00 ? 88 GLN A NE2  4  
ATOM 5305  H H    . GLN A 1 88 ? 10.349  8.035   0.742   1.00 0.00 ? 88 GLN A H    4  
ATOM 5306  H HA   . GLN A 1 88 ? 10.949  10.741  1.137   1.00 0.00 ? 88 GLN A HA   4  
ATOM 5307  H HB2  . GLN A 1 88 ? 13.251  8.968   1.091   1.00 0.00 ? 88 GLN A HB2  4  
ATOM 5308  H HB3  . GLN A 1 88 ? 13.324  10.155  -0.204  1.00 0.00 ? 88 GLN A HB3  4  
ATOM 5309  H HG2  . GLN A 1 88 ? 12.566  11.631  2.006   1.00 0.00 ? 88 GLN A HG2  4  
ATOM 5310  H HG3  . GLN A 1 88 ? 13.740  10.480  2.641   1.00 0.00 ? 88 GLN A HG3  4  
ATOM 5311  H HE21 . GLN A 1 88 ? 13.290  13.377  0.993   1.00 0.00 ? 88 GLN A HE21 4  
ATOM 5312  H HE22 . GLN A 1 88 ? 14.924  13.644  0.497   1.00 0.00 ? 88 GLN A HE22 4  
ATOM 5313  N N    . PRO A 1 89 ? 10.831  11.143  -1.404  1.00 0.00 ? 89 PRO A N    4  
ATOM 5314  C CA   . PRO A 1 89 ? 10.449  11.318  -2.809  1.00 0.00 ? 89 PRO A CA   4  
ATOM 5315  C C    . PRO A 1 89 ? 11.541  10.855  -3.768  1.00 0.00 ? 89 PRO A C    4  
ATOM 5316  O O    . PRO A 1 89 ? 12.278  11.668  -4.326  1.00 0.00 ? 89 PRO A O    4  
ATOM 5317  C CB   . PRO A 1 89 ? 10.230  12.828  -2.934  1.00 0.00 ? 89 PRO A CB   4  
ATOM 5318  C CG   . PRO A 1 89 ? 11.060  13.424  -1.851  1.00 0.00 ? 89 PRO A CG   4  
ATOM 5319  C CD   . PRO A 1 89 ? 11.038  12.433  -0.720  1.00 0.00 ? 89 PRO A CD   4  
ATOM 5320  H HA   . PRO A 1 89 ? 9.530   10.798  -3.036  1.00 0.00 ? 89 PRO A HA   4  
ATOM 5321  H HB2  . PRO A 1 89 ? 10.554  13.161  -3.910  1.00 0.00 ? 89 PRO A HB2  4  
ATOM 5322  H HB3  . PRO A 1 89 ? 9.184   13.056  -2.799  1.00 0.00 ? 89 PRO A HB3  4  
ATOM 5323  H HG2  . PRO A 1 89 ? 12.071  13.571  -2.201  1.00 0.00 ? 89 PRO A HG2  4  
ATOM 5324  H HG3  . PRO A 1 89 ? 10.631  14.363  -1.533  1.00 0.00 ? 89 PRO A HG3  4  
ATOM 5325  H HD2  . PRO A 1 89 ? 11.979  12.442  -0.191  1.00 0.00 ? 89 PRO A HD2  4  
ATOM 5326  H HD3  . PRO A 1 89 ? 10.221  12.646  -0.047  1.00 0.00 ? 89 PRO A HD3  4  
ATOM 5327  N N    . SER A 1 90 ? 11.639  9.542   -3.954  1.00 0.00 ? 90 SER A N    4  
ATOM 5328  C CA   . SER A 1 90 ? 12.641  8.968   -4.845  1.00 0.00 ? 90 SER A CA   4  
ATOM 5329  C C    . SER A 1 90 ? 14.049  9.359   -4.408  1.00 0.00 ? 90 SER A C    4  
ATOM 5330  O O    . SER A 1 90 ? 14.224  10.126  -3.462  1.00 0.00 ? 90 SER A O    4  
ATOM 5331  C CB   . SER A 1 90 ? 12.395  9.424   -6.286  1.00 0.00 ? 90 SER A CB   4  
ATOM 5332  O OG   . SER A 1 90 ? 12.950  10.706  -6.518  1.00 0.00 ? 90 SER A OG   4  
ATOM 5333  H H    . SER A 1 90 ? 11.023  8.945   -3.481  1.00 0.00 ? 90 SER A H    4  
ATOM 5334  H HA   . SER A 1 90 ? 12.548  7.893   -4.798  1.00 0.00 ? 90 SER A HA   4  
ATOM 5335  H HB2  . SER A 1 90 ? 12.851  8.720   -6.967  1.00 0.00 ? 90 SER A HB2  4  
ATOM 5336  H HB3  . SER A 1 90 ? 11.332  9.465   -6.470  1.00 0.00 ? 90 SER A HB3  4  
ATOM 5337  H HG   . SER A 1 90 ? 12.344  11.381  -6.201  1.00 0.00 ? 90 SER A HG   4  
ATOM 5338  N N    . GLY A 1 91 ? 15.049  8.827   -5.103  1.00 0.00 ? 91 GLY A N    4  
ATOM 5339  C CA   . GLY A 1 91 ? 16.428  9.132   -4.770  1.00 0.00 ? 91 GLY A CA   4  
ATOM 5340  C C    . GLY A 1 91 ? 16.796  10.570  -5.086  1.00 0.00 ? 91 GLY A C    4  
ATOM 5341  O O    . GLY A 1 91 ? 15.926  11.440  -5.128  1.00 0.00 ? 91 GLY A O    4  
ATOM 5342  H H    . GLY A 1 91 ? 14.848  8.222   -5.847  1.00 0.00 ? 91 GLY A H    4  
ATOM 5343  H HA2  . GLY A 1 91 ? 16.579  8.956   -3.715  1.00 0.00 ? 91 GLY A HA2  4  
ATOM 5344  H HA3  . GLY A 1 91 ? 17.076  8.475   -5.331  1.00 0.00 ? 91 GLY A HA3  4  
ATOM 5345  N N    . PRO A 1 92 ? 18.090  10.853  -5.315  1.00 0.00 ? 92 PRO A N    4  
ATOM 5346  C CA   . PRO A 1 92 ? 18.559  12.207  -5.629  1.00 0.00 ? 92 PRO A CA   4  
ATOM 5347  C C    . PRO A 1 92 ? 18.116  12.665  -7.015  1.00 0.00 ? 92 PRO A C    4  
ATOM 5348  O O    . PRO A 1 92 ? 17.641  13.788  -7.185  1.00 0.00 ? 92 PRO A O    4  
ATOM 5349  C CB   . PRO A 1 92 ? 20.082  12.079  -5.569  1.00 0.00 ? 92 PRO A CB   4  
ATOM 5350  C CG   . PRO A 1 92 ? 20.353  10.644  -5.863  1.00 0.00 ? 92 PRO A CG   4  
ATOM 5351  C CD   . PRO A 1 92 ? 19.196  9.878   -5.286  1.00 0.00 ? 92 PRO A CD   4  
ATOM 5352  H HA   . PRO A 1 92 ? 18.225  12.922  -4.892  1.00 0.00 ? 92 PRO A HA   4  
ATOM 5353  H HB2  . PRO A 1 92 ? 20.529  12.727  -6.310  1.00 0.00 ? 92 PRO A HB2  4  
ATOM 5354  H HB3  . PRO A 1 92 ? 20.431  12.353  -4.585  1.00 0.00 ? 92 PRO A HB3  4  
ATOM 5355  H HG2  . PRO A 1 92 ? 20.409  10.492  -6.931  1.00 0.00 ? 92 PRO A HG2  4  
ATOM 5356  H HG3  . PRO A 1 92 ? 21.276  10.342  -5.391  1.00 0.00 ? 92 PRO A HG3  4  
ATOM 5357  H HD2  . PRO A 1 92 ? 18.969  9.019   -5.900  1.00 0.00 ? 92 PRO A HD2  4  
ATOM 5358  H HD3  . PRO A 1 92 ? 19.413  9.572   -4.273  1.00 0.00 ? 92 PRO A HD3  4  
ATOM 5359  N N    . SER A 1 93 ? 18.275  11.790  -8.001  1.00 0.00 ? 93 SER A N    4  
ATOM 5360  C CA   . SER A 1 93 ? 17.892  12.104  -9.373  1.00 0.00 ? 93 SER A CA   4  
ATOM 5361  C C    . SER A 1 93 ? 16.592  11.400  -9.749  1.00 0.00 ? 93 SER A C    4  
ATOM 5362  O O    . SER A 1 93 ? 16.575  10.192  -9.985  1.00 0.00 ? 93 SER A O    4  
ATOM 5363  C CB   . SER A 1 93 ? 19.005  11.700  -10.341 1.00 0.00 ? 93 SER A CB   4  
ATOM 5364  O OG   . SER A 1 93 ? 20.247  12.260  -9.952  1.00 0.00 ? 93 SER A OG   4  
ATOM 5365  H H    . SER A 1 93 ? 18.659  10.909  -7.802  1.00 0.00 ? 93 SER A H    4  
ATOM 5366  H HA   . SER A 1 93 ? 17.740  13.172  -9.437  1.00 0.00 ? 93 SER A HA   4  
ATOM 5367  H HB2  . SER A 1 93 ? 19.097  10.625  -10.351 1.00 0.00 ? 93 SER A HB2  4  
ATOM 5368  H HB3  . SER A 1 93 ? 18.760  12.050  -11.333 1.00 0.00 ? 93 SER A HB3  4  
ATOM 5369  H HG   . SER A 1 93 ? 20.882  12.157  -10.666 1.00 0.00 ? 93 SER A HG   4  
ATOM 5370  N N    . SER A 1 94 ? 15.505  12.163  -9.804  1.00 0.00 ? 94 SER A N    4  
ATOM 5371  C CA   . SER A 1 94 ? 14.201  11.612  -10.153 1.00 0.00 ? 94 SER A CA   4  
ATOM 5372  C C    . SER A 1 94 ? 13.944  11.731  -11.651 1.00 0.00 ? 94 SER A C    4  
ATOM 5373  O O    . SER A 1 94 ? 13.429  12.745  -12.124 1.00 0.00 ? 94 SER A O    4  
ATOM 5374  C CB   . SER A 1 94 ? 13.097  12.329  -9.374  1.00 0.00 ? 94 SER A CB   4  
ATOM 5375  O OG   . SER A 1 94 ? 11.825  11.777  -9.668  1.00 0.00 ? 94 SER A OG   4  
ATOM 5376  H H    . SER A 1 94 ? 15.582  13.120  -9.605  1.00 0.00 ? 94 SER A H    4  
ATOM 5377  H HA   . SER A 1 94 ? 14.201  10.567  -9.882  1.00 0.00 ? 94 SER A HA   4  
ATOM 5378  H HB2  . SER A 1 94 ? 13.282  12.229  -8.316  1.00 0.00 ? 94 SER A HB2  4  
ATOM 5379  H HB3  . SER A 1 94 ? 13.092  13.376  -9.642  1.00 0.00 ? 94 SER A HB3  4  
ATOM 5380  H HG   . SER A 1 94 ? 11.141  12.315  -9.263  1.00 0.00 ? 94 SER A HG   4  
ATOM 5381  N N    . GLY A 1 95 ? 14.303  10.689  -12.393 1.00 0.00 ? 95 GLY A N    4  
ATOM 5382  C CA   . GLY A 1 95 ? 14.102  10.697  -13.830 1.00 0.00 ? 95 GLY A CA   4  
ATOM 5383  C C    . GLY A 1 95 ? 14.876  9.597   -14.530 1.00 0.00 ? 95 GLY A C    4  
ATOM 5384  O O    . GLY A 1 95 ? 15.359  8.677   -13.837 1.00 0.00 ? 95 GLY A O    4  
ATOM 5385  O OXT  . GLY A 1 95 ? 14.999  9.654   -15.772 1.00 0.00 ? 95 GLY A OXT  4  
ATOM 5386  H H    . GLY A 1 95 ? 14.708  9.907   -11.961 1.00 0.00 ? 95 GLY A H    4  
ATOM 5387  H HA2  . GLY A 1 95 ? 13.050  10.568  -14.036 1.00 0.00 ? 95 GLY A HA2  4  
ATOM 5388  H HA3  . GLY A 1 95 ? 14.421  11.651  -14.222 1.00 0.00 ? 95 GLY A HA3  4  
ATOM 5389  N N    . GLY A 1 1  ? -16.016 -8.776  -24.821 1.00 0.00 ? 1  GLY A N    5  
ATOM 5390  C CA   . GLY A 1 1  ? -15.072 -9.908  -24.606 1.00 0.00 ? 1  GLY A CA   5  
ATOM 5391  C C    . GLY A 1 1  ? -13.628 -9.453  -24.535 1.00 0.00 ? 1  GLY A C    5  
ATOM 5392  O O    . GLY A 1 1  ? -12.727 -10.148 -25.005 1.00 0.00 ? 1  GLY A O    5  
ATOM 5393  H H1   . GLY A 1 1  ? -16.167 -8.262  -23.930 1.00 0.00 ? 1  GLY A H1   5  
ATOM 5394  H H2   . GLY A 1 1  ? -16.932 -9.133  -25.161 1.00 0.00 ? 1  GLY A H2   5  
ATOM 5395  H H3   . GLY A 1 1  ? -15.630 -8.118  -25.528 1.00 0.00 ? 1  GLY A H3   5  
ATOM 5396  H HA2  . GLY A 1 1  ? -15.328 -10.404 -23.682 1.00 0.00 ? 1  GLY A HA2  5  
ATOM 5397  H HA3  . GLY A 1 1  ? -15.178 -10.610 -25.420 1.00 0.00 ? 1  GLY A HA3  5  
ATOM 5398  N N    . SER A 1 2  ? -13.407 -8.283  -23.944 1.00 0.00 ? 2  SER A N    5  
ATOM 5399  C CA   . SER A 1 2  ? -12.062 -7.735  -23.813 1.00 0.00 ? 2  SER A CA   5  
ATOM 5400  C C    . SER A 1 2  ? -12.024 -6.631  -22.760 1.00 0.00 ? 2  SER A C    5  
ATOM 5401  O O    . SER A 1 2  ? -11.117 -6.583  -21.931 1.00 0.00 ? 2  SER A O    5  
ATOM 5402  C CB   . SER A 1 2  ? -11.577 -7.190  -25.158 1.00 0.00 ? 2  SER A CB   5  
ATOM 5403  O OG   . SER A 1 2  ? -11.078 -8.230  -25.980 1.00 0.00 ? 2  SER A OG   5  
ATOM 5404  H H    . SER A 1 2  ? -14.166 -7.776  -23.590 1.00 0.00 ? 2  SER A H    5  
ATOM 5405  H HA   . SER A 1 2  ? -11.407 -8.535  -23.502 1.00 0.00 ? 2  SER A HA   5  
ATOM 5406  H HB2  . SER A 1 2  ? -12.399 -6.709  -25.666 1.00 0.00 ? 2  SER A HB2  5  
ATOM 5407  H HB3  . SER A 1 2  ? -10.788 -6.471  -24.989 1.00 0.00 ? 2  SER A HB3  5  
ATOM 5408  H HG   . SER A 1 2  ? -10.119 -8.221  -25.962 1.00 0.00 ? 2  SER A HG   5  
ATOM 5409  N N    . SER A 1 3  ? -13.015 -5.748  -22.802 1.00 0.00 ? 3  SER A N    5  
ATOM 5410  C CA   . SER A 1 3  ? -13.095 -4.644  -21.852 1.00 0.00 ? 3  SER A CA   5  
ATOM 5411  C C    . SER A 1 3  ? -13.983 -5.010  -20.666 1.00 0.00 ? 3  SER A C    5  
ATOM 5412  O O    . SER A 1 3  ? -14.838 -4.227  -20.251 1.00 0.00 ? 3  SER A O    5  
ATOM 5413  C CB   . SER A 1 3  ? -13.634 -3.389  -22.541 1.00 0.00 ? 3  SER A CB   5  
ATOM 5414  O OG   . SER A 1 3  ? -12.911 -3.109  -23.728 1.00 0.00 ? 3  SER A OG   5  
ATOM 5415  H H    . SER A 1 3  ? -13.710 -5.839  -23.487 1.00 0.00 ? 3  SER A H    5  
ATOM 5416  H HA   . SER A 1 3  ? -12.098 -4.446  -21.490 1.00 0.00 ? 3  SER A HA   5  
ATOM 5417  H HB2  . SER A 1 3  ? -14.673 -3.538  -22.795 1.00 0.00 ? 3  SER A HB2  5  
ATOM 5418  H HB3  . SER A 1 3  ? -13.545 -2.546  -21.871 1.00 0.00 ? 3  SER A HB3  5  
ATOM 5419  H HG   . SER A 1 3  ? -11.978 -3.023  -23.522 1.00 0.00 ? 3  SER A HG   5  
ATOM 5420  N N    . GLY A 1 4  ? -13.776 -6.207  -20.125 1.00 0.00 ? 4  GLY A N    5  
ATOM 5421  C CA   . GLY A 1 4  ? -14.564 -6.655  -18.991 1.00 0.00 ? 4  GLY A CA   5  
ATOM 5422  C C    . GLY A 1 4  ? -13.713 -6.949  -17.771 1.00 0.00 ? 4  GLY A C    5  
ATOM 5423  O O    . GLY A 1 4  ? -12.943 -7.909  -17.760 1.00 0.00 ? 4  GLY A O    5  
ATOM 5424  H H    . GLY A 1 4  ? -13.081 -6.788  -20.497 1.00 0.00 ? 4  GLY A H    5  
ATOM 5425  H HA2  . GLY A 1 4  ? -15.282 -5.889  -18.740 1.00 0.00 ? 4  GLY A HA2  5  
ATOM 5426  H HA3  . GLY A 1 4  ? -15.095 -7.554  -19.270 1.00 0.00 ? 4  GLY A HA3  5  
ATOM 5427  N N    . SER A 1 5  ? -13.853 -6.119  -16.742 1.00 0.00 ? 5  SER A N    5  
ATOM 5428  C CA   . SER A 1 5  ? -13.090 -6.293  -15.511 1.00 0.00 ? 5  SER A CA   5  
ATOM 5429  C C    . SER A 1 5  ? -14.018 -6.565  -14.331 1.00 0.00 ? 5  SER A C    5  
ATOM 5430  O O    . SER A 1 5  ? -15.211 -6.270  -14.385 1.00 0.00 ? 5  SER A O    5  
ATOM 5431  C CB   . SER A 1 5  ? -12.243 -5.050  -15.232 1.00 0.00 ? 5  SER A CB   5  
ATOM 5432  O OG   . SER A 1 5  ? -10.973 -5.405  -14.711 1.00 0.00 ? 5  SER A OG   5  
ATOM 5433  H H    . SER A 1 5  ? -14.483 -5.372  -16.813 1.00 0.00 ? 5  SER A H    5  
ATOM 5434  H HA   . SER A 1 5  ? -12.437 -7.141  -15.642 1.00 0.00 ? 5  SER A HA   5  
ATOM 5435  H HB2  . SER A 1 5  ? -12.100 -4.501  -16.150 1.00 0.00 ? 5  SER A HB2  5  
ATOM 5436  H HB3  . SER A 1 5  ? -12.751 -4.424  -14.513 1.00 0.00 ? 5  SER A HB3  5  
ATOM 5437  H HG   . SER A 1 5  ? -10.422 -5.749  -15.418 1.00 0.00 ? 5  SER A HG   5  
ATOM 5438  N N    . SER A 1 6  ? -13.460 -7.128  -13.264 1.00 0.00 ? 6  SER A N    5  
ATOM 5439  C CA   . SER A 1 6  ? -14.237 -7.441  -12.071 1.00 0.00 ? 6  SER A CA   5  
ATOM 5440  C C    . SER A 1 6  ? -13.884 -6.490  -10.930 1.00 0.00 ? 6  SER A C    5  
ATOM 5441  O O    . SER A 1 6  ? -14.752 -6.085  -10.157 1.00 0.00 ? 6  SER A O    5  
ATOM 5442  C CB   . SER A 1 6  ? -13.989 -8.887  -11.638 1.00 0.00 ? 6  SER A CB   5  
ATOM 5443  O OG   . SER A 1 6  ? -12.634 -9.253  -11.834 1.00 0.00 ? 6  SER A OG   5  
ATOM 5444  H H    . SER A 1 6  ? -12.504 -7.340  -13.281 1.00 0.00 ? 6  SER A H    5  
ATOM 5445  H HA   . SER A 1 6  ? -15.281 -7.320  -12.313 1.00 0.00 ? 6  SER A HA   5  
ATOM 5446  H HB2  . SER A 1 6  ? -14.230 -8.994  -10.590 1.00 0.00 ? 6  SER A HB2  5  
ATOM 5447  H HB3  . SER A 1 6  ? -14.616 -9.546  -12.221 1.00 0.00 ? 6  SER A HB3  5  
ATOM 5448  H HG   . SER A 1 6  ? -12.066 -8.654  -11.343 1.00 0.00 ? 6  SER A HG   5  
ATOM 5449  N N    . GLY A 1 7  ? -12.606 -6.139  -10.833 1.00 0.00 ? 7  GLY A N    5  
ATOM 5450  C CA   . GLY A 1 7  ? -12.161 -5.239  -9.785  1.00 0.00 ? 7  GLY A CA   5  
ATOM 5451  C C    . GLY A 1 7  ? -10.671 -4.969  -9.846  1.00 0.00 ? 7  GLY A C    5  
ATOM 5452  O O    . GLY A 1 7  ? -10.225 -4.072  -10.561 1.00 0.00 ? 7  GLY A O    5  
ATOM 5453  H H    . GLY A 1 7  ? -11.959 -6.494  -11.479 1.00 0.00 ? 7  GLY A H    5  
ATOM 5454  H HA2  . GLY A 1 7  ? -12.690 -4.302  -9.882  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5455  H HA3  . GLY A 1 7  ? -12.399 -5.677  -8.826  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5456  N N    . ALA A 1 8  ? -9.899  -5.747  -9.093  1.00 0.00 ? 8  ALA A N    5  
ATOM 5457  C CA   . ALA A 1 8  ? -8.451  -5.587  -9.063  1.00 0.00 ? 8  ALA A CA   5  
ATOM 5458  C C    . ALA A 1 8  ? -7.750  -6.940  -9.019  1.00 0.00 ? 8  ALA A C    5  
ATOM 5459  O O    . ALA A 1 8  ? -7.982  -7.741  -8.113  1.00 0.00 ? 8  ALA A O    5  
ATOM 5460  C CB   . ALA A 1 8  ? -8.039  -4.738  -7.870  1.00 0.00 ? 8  ALA A CB   5  
ATOM 5461  H H    . ALA A 1 8  ? -10.314 -6.445  -8.544  1.00 0.00 ? 8  ALA A H    5  
ATOM 5462  H HA   . ALA A 1 8  ? -8.154  -5.069  -9.964  1.00 0.00 ? 8  ALA A HA   5  
ATOM 5463  H HB1  . ALA A 1 8  ? -8.666  -3.860  -7.819  1.00 0.00 ? 8  ALA A HB1  5  
ATOM 5464  H HB2  . ALA A 1 8  ? -7.007  -4.438  -7.982  1.00 0.00 ? 8  ALA A HB2  5  
ATOM 5465  H HB3  . ALA A 1 8  ? -8.149  -5.314  -6.963  1.00 0.00 ? 8  ALA A HB3  5  
ATOM 5466  N N    . ALA A 1 9  ? -6.892  -7.190  -10.003 1.00 0.00 ? 9  ALA A N    5  
ATOM 5467  C CA   . ALA A 1 9  ? -6.156  -8.447  -10.076 1.00 0.00 ? 9  ALA A CA   5  
ATOM 5468  C C    . ALA A 1 9  ? -4.693  -8.249  -9.698  1.00 0.00 ? 9  ALA A C    5  
ATOM 5469  O O    . ALA A 1 9  ? -3.812  -8.948  -10.200 1.00 0.00 ? 9  ALA A O    5  
ATOM 5470  C CB   . ALA A 1 9  ? -6.268  -9.041  -11.471 1.00 0.00 ? 9  ALA A CB   5  
ATOM 5471  H H    . ALA A 1 9  ? -6.750  -6.512  -10.696 1.00 0.00 ? 9  ALA A H    5  
ATOM 5472  H HA   . ALA A 1 9  ? -6.608  -9.138  -9.379  1.00 0.00 ? 9  ALA A HA   5  
ATOM 5473  H HB1  . ALA A 1 9  ? -7.106  -9.722  -11.508 1.00 0.00 ? 9  ALA A HB1  5  
ATOM 5474  H HB2  . ALA A 1 9  ? -5.360  -9.575  -11.709 1.00 0.00 ? 9  ALA A HB2  5  
ATOM 5475  H HB3  . ALA A 1 9  ? -6.417  -8.248  -12.190 1.00 0.00 ? 9  ALA A HB3  5  
ATOM 5476  N N    . GLU A 1 10 ? -4.439  -7.293  -8.811  1.00 0.00 ? 10 GLU A N    5  
ATOM 5477  C CA   . GLU A 1 10 ? -3.080  -7.004  -8.366  1.00 0.00 ? 10 GLU A CA   5  
ATOM 5478  C C    . GLU A 1 10 ? -2.658  -7.960  -7.253  1.00 0.00 ? 10 GLU A C    5  
ATOM 5479  O O    . GLU A 1 10 ? -3.425  -8.229  -6.328  1.00 0.00 ? 10 GLU A O    5  
ATOM 5480  C CB   . GLU A 1 10 ? -2.978  -5.555  -7.881  1.00 0.00 ? 10 GLU A CB   5  
ATOM 5481  C CG   . GLU A 1 10 ? -2.178  -4.660  -8.813  1.00 0.00 ? 10 GLU A CG   5  
ATOM 5482  C CD   . GLU A 1 10 ? -3.012  -4.113  -9.955  1.00 0.00 ? 10 GLU A CD   5  
ATOM 5483  O OE1  . GLU A 1 10 ? -3.378  -4.901  -10.851 1.00 0.00 ? 10 GLU A OE1  5  
ATOM 5484  O OE2  . GLU A 1 10 ? -3.297  -2.898  -9.953  1.00 0.00 ? 10 GLU A OE2  5  
ATOM 5485  H H    . GLU A 1 10 ? -5.183  -6.770  -8.447  1.00 0.00 ? 10 GLU A H    5  
ATOM 5486  H HA   . GLU A 1 10 ? -2.420  -7.140  -9.209  1.00 0.00 ? 10 GLU A HA   5  
ATOM 5487  H HB2  . GLU A 1 10 ? -3.974  -5.147  -7.792  1.00 0.00 ? 10 GLU A HB2  5  
ATOM 5488  H HB3  . GLU A 1 10 ? -2.504  -5.543  -6.911  1.00 0.00 ? 10 GLU A HB3  5  
ATOM 5489  H HG2  . GLU A 1 10 ? -1.787  -3.829  -8.244  1.00 0.00 ? 10 GLU A HG2  5  
ATOM 5490  H HG3  . GLU A 1 10 ? -1.358  -5.230  -9.224  1.00 0.00 ? 10 GLU A HG3  5  
ATOM 5491  N N    . VAL A 1 11 ? -1.435  -8.470  -7.351  1.00 0.00 ? 11 VAL A N    5  
ATOM 5492  C CA   . VAL A 1 11 ? -0.911  -9.394  -6.353  1.00 0.00 ? 11 VAL A CA   5  
ATOM 5493  C C    . VAL A 1 11 ? -0.173  -8.648  -5.246  1.00 0.00 ? 11 VAL A C    5  
ATOM 5494  O O    . VAL A 1 11 ? 0.183   -7.481  -5.401  1.00 0.00 ? 11 VAL A O    5  
ATOM 5495  C CB   . VAL A 1 11 ? 0.045   -10.423 -6.987  1.00 0.00 ? 11 VAL A CB   5  
ATOM 5496  C CG1  . VAL A 1 11 ? -0.719  -11.374 -7.894  1.00 0.00 ? 11 VAL A CG1  5  
ATOM 5497  C CG2  . VAL A 1 11 ? 1.155   -9.719  -7.752  1.00 0.00 ? 11 VAL A CG2  5  
ATOM 5498  H H    . VAL A 1 11 ? -0.871  -8.217  -8.111  1.00 0.00 ? 11 VAL A H    5  
ATOM 5499  H HA   . VAL A 1 11 ? -1.745  -9.927  -5.921  1.00 0.00 ? 11 VAL A HA   5  
ATOM 5500  H HB   . VAL A 1 11 ? 0.494   -11.002 -6.193  1.00 0.00 ? 11 VAL A HB   5  
ATOM 5501  H HG11 . VAL A 1 11 ? -0.147  -12.280 -8.030  1.00 0.00 ? 11 VAL A HG11 5  
ATOM 5502  H HG12 . VAL A 1 11 ? -0.883  -10.904 -8.853  1.00 0.00 ? 11 VAL A HG12 5  
ATOM 5503  H HG13 . VAL A 1 11 ? -1.672  -11.614 -7.445  1.00 0.00 ? 11 VAL A HG13 5  
ATOM 5504  H HG21 . VAL A 1 11 ? 0.910   -9.699  -8.803  1.00 0.00 ? 11 VAL A HG21 5  
ATOM 5505  H HG22 . VAL A 1 11 ? 2.084   -10.252 -7.609  1.00 0.00 ? 11 VAL A HG22 5  
ATOM 5506  H HG23 . VAL A 1 11 ? 1.260   -8.709  -7.386  1.00 0.00 ? 11 VAL A HG23 5  
ATOM 5507  N N    . GLY A 1 12 ? 0.052   -9.331  -4.127  1.00 0.00 ? 12 GLY A N    5  
ATOM 5508  C CA   . GLY A 1 12 ? 0.745   -8.716  -3.010  1.00 0.00 ? 12 GLY A CA   5  
ATOM 5509  C C    . GLY A 1 12 ? 2.105   -9.339  -2.759  1.00 0.00 ? 12 GLY A C    5  
ATOM 5510  O O    . GLY A 1 12 ? 2.368   -10.464 -3.183  1.00 0.00 ? 12 GLY A O    5  
ATOM 5511  H H    . GLY A 1 12 ? -0.256  -10.259 -4.060  1.00 0.00 ? 12 GLY A H    5  
ATOM 5512  H HA2  . GLY A 1 12 ? 0.877   -7.664  -3.216  1.00 0.00 ? 12 GLY A HA2  5  
ATOM 5513  H HA3  . GLY A 1 12 ? 0.142   -8.826  -2.122  1.00 0.00 ? 12 GLY A HA3  5  
ATOM 5514  N N    . ASP A 1 13 ? 2.970   -8.605  -2.066  1.00 0.00 ? 13 ASP A N    5  
ATOM 5515  C CA   . ASP A 1 13 ? 4.310   -9.091  -1.758  1.00 0.00 ? 13 ASP A CA   5  
ATOM 5516  C C    . ASP A 1 13 ? 4.273   -10.099 -0.615  1.00 0.00 ? 13 ASP A C    5  
ATOM 5517  O O    . ASP A 1 13 ? 3.567   -9.905  0.374   1.00 0.00 ? 13 ASP A O    5  
ATOM 5518  C CB   . ASP A 1 13 ? 5.228   -7.923  -1.396  1.00 0.00 ? 13 ASP A CB   5  
ATOM 5519  C CG   . ASP A 1 13 ? 6.686   -8.334  -1.320  1.00 0.00 ? 13 ASP A CG   5  
ATOM 5520  O OD1  . ASP A 1 13 ? 7.235   -8.763  -2.356  1.00 0.00 ? 13 ASP A OD1  5  
ATOM 5521  O OD2  . ASP A 1 13 ? 7.278   -8.227  -0.226  1.00 0.00 ? 13 ASP A OD2  5  
ATOM 5522  H H    . ASP A 1 13 ? 2.702   -7.715  -1.755  1.00 0.00 ? 13 ASP A H    5  
ATOM 5523  H HA   . ASP A 1 13 ? 4.696   -9.579  -2.641  1.00 0.00 ? 13 ASP A HA   5  
ATOM 5524  H HB2  . ASP A 1 13 ? 5.130   -7.150  -2.143  1.00 0.00 ? 13 ASP A HB2  5  
ATOM 5525  H HB3  . ASP A 1 13 ? 4.934   -7.528  -0.434  1.00 0.00 ? 13 ASP A HB3  5  
ATOM 5526  N N    . ASP A 1 14 ? 5.039   -11.176 -0.757  1.00 0.00 ? 14 ASP A N    5  
ATOM 5527  C CA   . ASP A 1 14 ? 5.094   -12.215 0.265   1.00 0.00 ? 14 ASP A CA   5  
ATOM 5528  C C    . ASP A 1 14 ? 5.768   -11.698 1.531   1.00 0.00 ? 14 ASP A C    5  
ATOM 5529  O O    . ASP A 1 14 ? 5.419   -12.098 2.641   1.00 0.00 ? 14 ASP A O    5  
ATOM 5530  C CB   . ASP A 1 14 ? 5.843   -13.440 -0.263  1.00 0.00 ? 14 ASP A CB   5  
ATOM 5531  C CG   . ASP A 1 14 ? 5.198   -14.743 0.168   1.00 0.00 ? 14 ASP A CG   5  
ATOM 5532  O OD1  . ASP A 1 14 ? 4.629   -14.784 1.280   1.00 0.00 ? 14 ASP A OD1  5  
ATOM 5533  O OD2  . ASP A 1 14 ? 5.262   -15.722 -0.605  1.00 0.00 ? 14 ASP A OD2  5  
ATOM 5534  H H    . ASP A 1 14 ? 5.579   -11.275 -1.568  1.00 0.00 ? 14 ASP A H    5  
ATOM 5535  H HA   . ASP A 1 14 ? 4.079   -12.500 0.503   1.00 0.00 ? 14 ASP A HA   5  
ATOM 5536  H HB2  . ASP A 1 14 ? 5.857   -13.408 -1.342  1.00 0.00 ? 14 ASP A HB2  5  
ATOM 5537  H HB3  . ASP A 1 14 ? 6.858   -13.422 0.107   1.00 0.00 ? 14 ASP A HB3  5  
ATOM 5538  N N    . PHE A 1 15 ? 6.737   -10.805 1.356   1.00 0.00 ? 15 PHE A N    5  
ATOM 5539  C CA   . PHE A 1 15 ? 7.462   -10.232 2.485   1.00 0.00 ? 15 PHE A CA   5  
ATOM 5540  C C    . PHE A 1 15 ? 6.885   -8.873  2.867   1.00 0.00 ? 15 PHE A C    5  
ATOM 5541  O O    . PHE A 1 15 ? 6.229   -8.215  2.059   1.00 0.00 ? 15 PHE A O    5  
ATOM 5542  C CB   . PHE A 1 15 ? 8.947   -10.092 2.146   1.00 0.00 ? 15 PHE A CB   5  
ATOM 5543  C CG   . PHE A 1 15 ? 9.844   -10.131 3.351   1.00 0.00 ? 15 PHE A CG   5  
ATOM 5544  C CD1  . PHE A 1 15 ? 10.188  -11.340 3.935   1.00 0.00 ? 15 PHE A CD1  5  
ATOM 5545  C CD2  . PHE A 1 15 ? 10.343  -8.960  3.898   1.00 0.00 ? 15 PHE A CD2  5  
ATOM 5546  C CE1  . PHE A 1 15 ? 11.013  -11.379 5.044   1.00 0.00 ? 15 PHE A CE1  5  
ATOM 5547  C CE2  . PHE A 1 15 ? 11.168  -8.993  5.006   1.00 0.00 ? 15 PHE A CE2  5  
ATOM 5548  C CZ   . PHE A 1 15 ? 11.503  -10.204 5.579   1.00 0.00 ? 15 PHE A CZ   5  
ATOM 5549  H H    . PHE A 1 15 ? 6.972   -10.525 0.447   1.00 0.00 ? 15 PHE A H    5  
ATOM 5550  H HA   . PHE A 1 15 ? 7.355   -10.904 3.323   1.00 0.00 ? 15 PHE A HA   5  
ATOM 5551  H HB2  . PHE A 1 15 ? 9.237   -10.899 1.490   1.00 0.00 ? 15 PHE A HB2  5  
ATOM 5552  H HB3  . PHE A 1 15 ? 9.106   -9.150  1.642   1.00 0.00 ? 15 PHE A HB3  5  
ATOM 5553  H HD1  . PHE A 1 15 ? 9.804   -12.259 3.517   1.00 0.00 ? 15 PHE A HD1  5  
ATOM 5554  H HD2  . PHE A 1 15 ? 10.082  -8.013  3.450   1.00 0.00 ? 15 PHE A HD2  5  
ATOM 5555  H HE1  . PHE A 1 15 ? 11.273  -12.327 5.491   1.00 0.00 ? 15 PHE A HE1  5  
ATOM 5556  H HE2  . PHE A 1 15 ? 11.551  -8.074  5.423   1.00 0.00 ? 15 PHE A HE2  5  
ATOM 5557  H HZ   . PHE A 1 15 ? 12.149  -10.233 6.445   1.00 0.00 ? 15 PHE A HZ   5  
ATOM 5558  N N    . LEU A 1 16 ? 7.136   -8.456  4.104   1.00 0.00 ? 16 LEU A N    5  
ATOM 5559  C CA   . LEU A 1 16 ? 6.642   -7.175  4.594   1.00 0.00 ? 16 LEU A CA   5  
ATOM 5560  C C    . LEU A 1 16 ? 7.725   -6.104  4.506   1.00 0.00 ? 16 LEU A C    5  
ATOM 5561  O O    . LEU A 1 16 ? 8.917   -6.409  4.546   1.00 0.00 ? 16 LEU A O    5  
ATOM 5562  C CB   . LEU A 1 16 ? 6.158   -7.309  6.039   1.00 0.00 ? 16 LEU A CB   5  
ATOM 5563  C CG   . LEU A 1 16 ? 4.704   -7.763  6.196   1.00 0.00 ? 16 LEU A CG   5  
ATOM 5564  C CD1  . LEU A 1 16 ? 4.518   -8.510  7.507   1.00 0.00 ? 16 LEU A CD1  5  
ATOM 5565  C CD2  . LEU A 1 16 ? 3.765   -6.568  6.121   1.00 0.00 ? 16 LEU A CD2  5  
ATOM 5566  H H    . LEU A 1 16 ? 7.665   -9.024  4.703   1.00 0.00 ? 16 LEU A H    5  
ATOM 5567  H HA   . LEU A 1 16 ? 5.810   -6.880  3.971   1.00 0.00 ? 16 LEU A HA   5  
ATOM 5568  H HB2  . LEU A 1 16 ? 6.792   -8.023  6.544   1.00 0.00 ? 16 LEU A HB2  5  
ATOM 5569  H HB3  . LEU A 1 16 ? 6.266   -6.351  6.523   1.00 0.00 ? 16 LEU A HB3  5  
ATOM 5570  H HG   . LEU A 1 16 ? 4.456   -8.436  5.389   1.00 0.00 ? 16 LEU A HG   5  
ATOM 5571  H HD11 . LEU A 1 16 ? 3.528   -8.316  7.893   1.00 0.00 ? 16 LEU A HD11 5  
ATOM 5572  H HD12 . LEU A 1 16 ? 5.255   -8.175  8.221   1.00 0.00 ? 16 LEU A HD12 5  
ATOM 5573  H HD13 . LEU A 1 16 ? 4.636   -9.570  7.336   1.00 0.00 ? 16 LEU A HD13 5  
ATOM 5574  H HD21 . LEU A 1 16 ? 2.762   -6.884  6.370   1.00 0.00 ? 16 LEU A HD21 5  
ATOM 5575  H HD22 . LEU A 1 16 ? 3.776   -6.163  5.121   1.00 0.00 ? 16 LEU A HD22 5  
ATOM 5576  H HD23 . LEU A 1 16 ? 4.087   -5.811  6.820   1.00 0.00 ? 16 LEU A HD23 5  
ATOM 5577  N N    . GLY A 1 17 ? 7.302   -4.850  4.386   1.00 0.00 ? 17 GLY A N    5  
ATOM 5578  C CA   . GLY A 1 17 ? 8.249   -3.754  4.295   1.00 0.00 ? 17 GLY A CA   5  
ATOM 5579  C C    . GLY A 1 17 ? 8.594   -3.171  5.651   1.00 0.00 ? 17 GLY A C    5  
ATOM 5580  O O    . GLY A 1 17 ? 8.127   -3.658  6.681   1.00 0.00 ? 17 GLY A O    5  
ATOM 5581  H H    . GLY A 1 17 ? 6.340   -4.667  4.360   1.00 0.00 ? 17 GLY A H    5  
ATOM 5582  H HA2  . GLY A 1 17 ? 9.155   -4.114  3.829   1.00 0.00 ? 17 GLY A HA2  5  
ATOM 5583  H HA3  . GLY A 1 17 ? 7.823   -2.976  3.678   1.00 0.00 ? 17 GLY A HA3  5  
ATOM 5584  N N    . ASP A 1 18 ? 9.413   -2.124  5.652   1.00 0.00 ? 18 ASP A N    5  
ATOM 5585  C CA   . ASP A 1 18 ? 9.821   -1.473  6.892   1.00 0.00 ? 18 ASP A CA   5  
ATOM 5586  C C    . ASP A 1 18 ? 9.078   -0.154  7.083   1.00 0.00 ? 18 ASP A C    5  
ATOM 5587  O O    . ASP A 1 18 ? 9.662   0.923   6.961   1.00 0.00 ? 18 ASP A O    5  
ATOM 5588  C CB   . ASP A 1 18 ? 11.331  -1.229  6.891   1.00 0.00 ? 18 ASP A CB   5  
ATOM 5589  C CG   . ASP A 1 18 ? 11.918  -1.240  8.289   1.00 0.00 ? 18 ASP A CG   5  
ATOM 5590  O OD1  . ASP A 1 18 ? 11.597  -0.325  9.075   1.00 0.00 ? 18 ASP A OD1  5  
ATOM 5591  O OD2  . ASP A 1 18 ? 12.701  -2.164  8.596   1.00 0.00 ? 18 ASP A OD2  5  
ATOM 5592  H H    . ASP A 1 18 ? 9.751   -1.782  4.798   1.00 0.00 ? 18 ASP A H    5  
ATOM 5593  H HA   . ASP A 1 18 ? 9.572   -2.134  7.709   1.00 0.00 ? 18 ASP A HA   5  
ATOM 5594  H HB2  . ASP A 1 18 ? 11.814  -2.001  6.312   1.00 0.00 ? 18 ASP A HB2  5  
ATOM 5595  H HB3  . ASP A 1 18 ? 11.533  -0.267  6.443   1.00 0.00 ? 18 ASP A HB3  5  
ATOM 5596  N N    . PHE A 1 19 ? 7.786   -0.247  7.382   1.00 0.00 ? 19 PHE A N    5  
ATOM 5597  C CA   . PHE A 1 19 ? 6.963   0.938   7.590   1.00 0.00 ? 19 PHE A CA   5  
ATOM 5598  C C    . PHE A 1 19 ? 5.919   0.692   8.675   1.00 0.00 ? 19 PHE A C    5  
ATOM 5599  O O    . PHE A 1 19 ? 5.644   -0.452  9.037   1.00 0.00 ? 19 PHE A O    5  
ATOM 5600  C CB   . PHE A 1 19 ? 6.273   1.339   6.285   1.00 0.00 ? 19 PHE A CB   5  
ATOM 5601  C CG   . PHE A 1 19 ? 7.228   1.565   5.146   1.00 0.00 ? 19 PHE A CG   5  
ATOM 5602  C CD1  . PHE A 1 19 ? 7.990   2.720   5.083   1.00 0.00 ? 19 PHE A CD1  5  
ATOM 5603  C CD2  . PHE A 1 19 ? 7.362   0.620   4.141   1.00 0.00 ? 19 PHE A CD2  5  
ATOM 5604  C CE1  . PHE A 1 19 ? 8.868   2.929   4.036   1.00 0.00 ? 19 PHE A CE1  5  
ATOM 5605  C CE2  . PHE A 1 19 ? 8.238   0.825   3.092   1.00 0.00 ? 19 PHE A CE2  5  
ATOM 5606  C CZ   . PHE A 1 19 ? 8.993   1.980   3.040   1.00 0.00 ? 19 PHE A CZ   5  
ATOM 5607  H H    . PHE A 1 19 ? 7.377   -1.133  7.464   1.00 0.00 ? 19 PHE A H    5  
ATOM 5608  H HA   . PHE A 1 19 ? 7.612   1.741   7.906   1.00 0.00 ? 19 PHE A HA   5  
ATOM 5609  H HB2  . PHE A 1 19 ? 5.587   0.558   5.993   1.00 0.00 ? 19 PHE A HB2  5  
ATOM 5610  H HB3  . PHE A 1 19 ? 5.723   2.255   6.444   1.00 0.00 ? 19 PHE A HB3  5  
ATOM 5611  H HD1  . PHE A 1 19 ? 7.894   3.462   5.861   1.00 0.00 ? 19 PHE A HD1  5  
ATOM 5612  H HD2  . PHE A 1 19 ? 6.772   -0.284  4.181   1.00 0.00 ? 19 PHE A HD2  5  
ATOM 5613  H HE1  . PHE A 1 19 ? 9.456   3.834   3.997   1.00 0.00 ? 19 PHE A HE1  5  
ATOM 5614  H HE2  . PHE A 1 19 ? 8.334   0.081   2.315   1.00 0.00 ? 19 PHE A HE2  5  
ATOM 5615  H HZ   . PHE A 1 19 ? 9.679   2.142   2.222   1.00 0.00 ? 19 PHE A HZ   5  
ATOM 5616  N N    . VAL A 1 20 ? 5.342   1.773   9.191   1.00 0.00 ? 20 VAL A N    5  
ATOM 5617  C CA   . VAL A 1 20 ? 4.330   1.674   10.235  1.00 0.00 ? 20 VAL A CA   5  
ATOM 5618  C C    . VAL A 1 20 ? 3.160   2.613   9.956   1.00 0.00 ? 20 VAL A C    5  
ATOM 5619  O O    . VAL A 1 20 ? 3.152   3.330   8.956   1.00 0.00 ? 20 VAL A O    5  
ATOM 5620  C CB   . VAL A 1 20 ? 4.917   2.003   11.620  1.00 0.00 ? 20 VAL A CB   5  
ATOM 5621  C CG1  . VAL A 1 20 ? 5.885   0.917   12.063  1.00 0.00 ? 20 VAL A CG1  5  
ATOM 5622  C CG2  . VAL A 1 20 ? 5.600   3.362   11.601  1.00 0.00 ? 20 VAL A CG2  5  
ATOM 5623  H H    . VAL A 1 20 ? 5.604   2.657   8.861   1.00 0.00 ? 20 VAL A H    5  
ATOM 5624  H HA   . VAL A 1 20 ? 3.967   0.657   10.253  1.00 0.00 ? 20 VAL A HA   5  
ATOM 5625  H HB   . VAL A 1 20 ? 4.106   2.042   12.332  1.00 0.00 ? 20 VAL A HB   5  
ATOM 5626  H HG11 . VAL A 1 20 ? 6.724   1.367   12.572  1.00 0.00 ? 20 VAL A HG11 5  
ATOM 5627  H HG12 . VAL A 1 20 ? 6.238   0.375   11.197  1.00 0.00 ? 20 VAL A HG12 5  
ATOM 5628  H HG13 . VAL A 1 20 ? 5.381   0.235   12.732  1.00 0.00 ? 20 VAL A HG13 5  
ATOM 5629  H HG21 . VAL A 1 20 ? 4.901   4.121   11.921  1.00 0.00 ? 20 VAL A HG21 5  
ATOM 5630  H HG22 . VAL A 1 20 ? 5.936   3.582   10.599  1.00 0.00 ? 20 VAL A HG22 5  
ATOM 5631  H HG23 . VAL A 1 20 ? 6.448   3.349   12.271  1.00 0.00 ? 20 VAL A HG23 5  
ATOM 5632  N N    . VAL A 1 21 ? 2.174   2.601   10.848  1.00 0.00 ? 21 VAL A N    5  
ATOM 5633  C CA   . VAL A 1 21 ? 1.000   3.451   10.698  1.00 0.00 ? 21 VAL A CA   5  
ATOM 5634  C C    . VAL A 1 21 ? 1.210   4.803   11.372  1.00 0.00 ? 21 VAL A C    5  
ATOM 5635  O O    . VAL A 1 21 ? 1.625   4.873   12.528  1.00 0.00 ? 21 VAL A O    5  
ATOM 5636  C CB   . VAL A 1 21 ? -0.256  2.786   11.291  1.00 0.00 ? 21 VAL A CB   5  
ATOM 5637  C CG1  . VAL A 1 21 ? -1.501  3.592   10.951  1.00 0.00 ? 21 VAL A CG1  5  
ATOM 5638  C CG2  . VAL A 1 21 ? -0.387  1.354   10.794  1.00 0.00 ? 21 VAL A CG2  5  
ATOM 5639  H H    . VAL A 1 21 ? 2.238   2.007   11.625  1.00 0.00 ? 21 VAL A H    5  
ATOM 5640  H HA   . VAL A 1 21 ? 0.833   3.609   9.642   1.00 0.00 ? 21 VAL A HA   5  
ATOM 5641  H HB   . VAL A 1 21 ? -0.154  2.763   12.366  1.00 0.00 ? 21 VAL A HB   5  
ATOM 5642  H HG11 . VAL A 1 21 ? -1.952  3.195   10.054  1.00 0.00 ? 21 VAL A HG11 5  
ATOM 5643  H HG12 . VAL A 1 21 ? -1.227  4.625   10.789  1.00 0.00 ? 21 VAL A HG12 5  
ATOM 5644  H HG13 . VAL A 1 21 ? -2.205  3.528   11.767  1.00 0.00 ? 21 VAL A HG13 5  
ATOM 5645  H HG21 . VAL A 1 21 ? 0.345   0.733   11.290  1.00 0.00 ? 21 VAL A HG21 5  
ATOM 5646  H HG22 . VAL A 1 21 ? -0.220  1.326   9.728   1.00 0.00 ? 21 VAL A HG22 5  
ATOM 5647  H HG23 . VAL A 1 21 ? -1.378  0.986   11.014  1.00 0.00 ? 21 VAL A HG23 5  
ATOM 5648  N N    . GLY A 1 22 ? 0.922   5.875   10.640  1.00 0.00 ? 22 GLY A N    5  
ATOM 5649  C CA   . GLY A 1 22 ? 1.087   7.210   11.184  1.00 0.00 ? 22 GLY A CA   5  
ATOM 5650  C C    . GLY A 1 22 ? 2.347   7.887   10.685  1.00 0.00 ? 22 GLY A C    5  
ATOM 5651  O O    . GLY A 1 22 ? 2.995   8.630   11.423  1.00 0.00 ? 22 GLY A O    5  
ATOM 5652  H H    . GLY A 1 22 ? 0.595   5.758   9.723   1.00 0.00 ? 22 GLY A H    5  
ATOM 5653  H HA2  . GLY A 1 22 ? 0.233   7.809   10.902  1.00 0.00 ? 22 GLY A HA2  5  
ATOM 5654  H HA3  . GLY A 1 22 ? 1.128   7.146   12.262  1.00 0.00 ? 22 GLY A HA3  5  
ATOM 5655  N N    . GLU A 1 23 ? 2.696   7.631   9.429   1.00 0.00 ? 23 GLU A N    5  
ATOM 5656  C CA   . GLU A 1 23 ? 3.889   8.220   8.831   1.00 0.00 ? 23 GLU A CA   5  
ATOM 5657  C C    . GLU A 1 23 ? 3.662   8.524   7.353   1.00 0.00 ? 23 GLU A C    5  
ATOM 5658  O O    . GLU A 1 23 ? 2.668   8.096   6.767   1.00 0.00 ? 23 GLU A O    5  
ATOM 5659  C CB   . GLU A 1 23 ? 5.083   7.278   8.992   1.00 0.00 ? 23 GLU A CB   5  
ATOM 5660  C CG   . GLU A 1 23 ? 4.903   5.942   8.290   1.00 0.00 ? 23 GLU A CG   5  
ATOM 5661  C CD   . GLU A 1 23 ? 6.130   5.058   8.392   1.00 0.00 ? 23 GLU A CD   5  
ATOM 5662  O OE1  . GLU A 1 23 ? 6.937   5.269   9.322   1.00 0.00 ? 23 GLU A OE1  5  
ATOM 5663  O OE2  . GLU A 1 23 ? 6.286   4.157   7.542   1.00 0.00 ? 23 GLU A OE2  5  
ATOM 5664  H H    . GLU A 1 23 ? 2.139   7.030   8.891   1.00 0.00 ? 23 GLU A H    5  
ATOM 5665  H HA   . GLU A 1 23 ? 4.098   9.143   9.349   1.00 0.00 ? 23 GLU A HA   5  
ATOM 5666  H HB2  . GLU A 1 23 ? 5.962   7.757   8.587   1.00 0.00 ? 23 GLU A HB2  5  
ATOM 5667  H HB3  . GLU A 1 23 ? 5.239   7.090   10.044  1.00 0.00 ? 23 GLU A HB3  5  
ATOM 5668  H HG2  . GLU A 1 23 ? 4.068   5.424   8.738   1.00 0.00 ? 23 GLU A HG2  5  
ATOM 5669  H HG3  . GLU A 1 23 ? 4.693   6.124   7.246   1.00 0.00 ? 23 GLU A HG3  5  
ATOM 5670  N N    . ARG A 1 24 ? 4.591   9.265   6.758   1.00 0.00 ? 24 ARG A N    5  
ATOM 5671  C CA   . ARG A 1 24 ? 4.493   9.626   5.349   1.00 0.00 ? 24 ARG A CA   5  
ATOM 5672  C C    . ARG A 1 24 ? 5.339   8.693   4.489   1.00 0.00 ? 24 ARG A C    5  
ATOM 5673  O O    . ARG A 1 24 ? 6.564   8.659   4.611   1.00 0.00 ? 24 ARG A O    5  
ATOM 5674  C CB   . ARG A 1 24 ? 4.934   11.077  5.140   1.00 0.00 ? 24 ARG A CB   5  
ATOM 5675  C CG   . ARG A 1 24 ? 3.776   12.051  5.002   1.00 0.00 ? 24 ARG A CG   5  
ATOM 5676  C CD   . ARG A 1 24 ? 2.933   12.098  6.266   1.00 0.00 ? 24 ARG A CD   5  
ATOM 5677  N NE   . ARG A 1 24 ? 3.210   13.291  7.064   1.00 0.00 ? 24 ARG A NE   5  
ATOM 5678  C CZ   . ARG A 1 24 ? 2.392   13.763  8.001   1.00 0.00 ? 24 ARG A CZ   5  
ATOM 5679  N NH1  . ARG A 1 24 ? 1.245   13.147  8.262   1.00 0.00 ? 24 ARG A NH1  5  
ATOM 5680  N NH2  . ARG A 1 24 ? 2.721   14.854  8.679   1.00 0.00 ? 24 ARG A NH2  5  
ATOM 5681  H H    . ARG A 1 24 ? 5.361   9.576   7.279   1.00 0.00 ? 24 ARG A H    5  
ATOM 5682  H HA   . ARG A 1 24 ? 3.458   9.528   5.054   1.00 0.00 ? 24 ARG A HA   5  
ATOM 5683  H HB2  . ARG A 1 24 ? 5.536   11.383  5.983   1.00 0.00 ? 24 ARG A HB2  5  
ATOM 5684  H HB3  . ARG A 1 24 ? 5.533   11.134  4.243   1.00 0.00 ? 24 ARG A HB3  5  
ATOM 5685  H HG2  . ARG A 1 24 ? 4.169   13.037  4.806   1.00 0.00 ? 24 ARG A HG2  5  
ATOM 5686  H HG3  . ARG A 1 24 ? 3.153   11.739  4.176   1.00 0.00 ? 24 ARG A HG3  5  
ATOM 5687  H HD2  . ARG A 1 24 ? 1.889   12.098  5.988   1.00 0.00 ? 24 ARG A HD2  5  
ATOM 5688  H HD3  . ARG A 1 24 ? 3.146   11.221  6.860   1.00 0.00 ? 24 ARG A HD3  5  
ATOM 5689  H HE   . ARG A 1 24 ? 4.051   13.765  6.892   1.00 0.00 ? 24 ARG A HE   5  
ATOM 5690  H HH11 . ARG A 1 24 ? 0.991   12.324  7.754   1.00 0.00 ? 24 ARG A HH11 5  
ATOM 5691  H HH12 . ARG A 1 24 ? 0.635   13.507  8.967   1.00 0.00 ? 24 ARG A HH12 5  
ATOM 5692  H HH21 . ARG A 1 24 ? 3.583   15.321  8.488   1.00 0.00 ? 24 ARG A HH21 5  
ATOM 5693  H HH22 . ARG A 1 24 ? 2.106   15.209  9.384   1.00 0.00 ? 24 ARG A HH22 5  
ATOM 5694  N N    . VAL A 1 25 ? 4.678   7.935   3.620   1.00 0.00 ? 25 VAL A N    5  
ATOM 5695  C CA   . VAL A 1 25 ? 5.369   7.000   2.740   1.00 0.00 ? 25 VAL A CA   5  
ATOM 5696  C C    . VAL A 1 25 ? 5.010   7.252   1.280   1.00 0.00 ? 25 VAL A C    5  
ATOM 5697  O O    . VAL A 1 25 ? 3.839   7.405   0.935   1.00 0.00 ? 25 VAL A O    5  
ATOM 5698  C CB   . VAL A 1 25 ? 5.033   5.540   3.094   1.00 0.00 ? 25 VAL A CB   5  
ATOM 5699  C CG1  . VAL A 1 25 ? 5.566   5.188   4.474   1.00 0.00 ? 25 VAL A CG1  5  
ATOM 5700  C CG2  . VAL A 1 25 ? 3.532   5.306   3.018   1.00 0.00 ? 25 VAL A CG2  5  
ATOM 5701  H H    . VAL A 1 25 ? 3.701   8.006   3.570   1.00 0.00 ? 25 VAL A H    5  
ATOM 5702  H HA   . VAL A 1 25 ? 6.433   7.145   2.870   1.00 0.00 ? 25 VAL A HA   5  
ATOM 5703  H HB   . VAL A 1 25 ? 5.514   4.896   2.372   1.00 0.00 ? 25 VAL A HB   5  
ATOM 5704  H HG11 . VAL A 1 25 ? 5.635   4.114   4.570   1.00 0.00 ? 25 VAL A HG11 5  
ATOM 5705  H HG12 . VAL A 1 25 ? 4.897   5.576   5.229   1.00 0.00 ? 25 VAL A HG12 5  
ATOM 5706  H HG13 . VAL A 1 25 ? 6.546   5.624   4.603   1.00 0.00 ? 25 VAL A HG13 5  
ATOM 5707  H HG21 . VAL A 1 25 ? 3.309   4.297   3.336   1.00 0.00 ? 25 VAL A HG21 5  
ATOM 5708  H HG22 . VAL A 1 25 ? 3.197   5.444   2.001   1.00 0.00 ? 25 VAL A HG22 5  
ATOM 5709  H HG23 . VAL A 1 25 ? 3.024   6.006   3.663   1.00 0.00 ? 25 VAL A HG23 5  
ATOM 5710  N N    . TRP A 1 26 ? 6.028   7.293   0.425   1.00 0.00 ? 26 TRP A N    5  
ATOM 5711  C CA   . TRP A 1 26 ? 5.821   7.525   -0.999  1.00 0.00 ? 26 TRP A CA   5  
ATOM 5712  C C    . TRP A 1 26 ? 5.410   6.238   -1.707  1.00 0.00 ? 26 TRP A C    5  
ATOM 5713  O O    . TRP A 1 26 ? 6.178   5.278   -1.766  1.00 0.00 ? 26 TRP A O    5  
ATOM 5714  C CB   . TRP A 1 26 ? 7.095   8.085   -1.635  1.00 0.00 ? 26 TRP A CB   5  
ATOM 5715  C CG   . TRP A 1 26 ? 7.216   9.574   -1.512  1.00 0.00 ? 26 TRP A CG   5  
ATOM 5716  C CD1  . TRP A 1 26 ? 7.101   10.491  -2.518  1.00 0.00 ? 26 TRP A CD1  5  
ATOM 5717  C CD2  . TRP A 1 26 ? 7.478   10.318  -0.317  1.00 0.00 ? 26 TRP A CD2  5  
ATOM 5718  N NE1  . TRP A 1 26 ? 7.275   11.759  -2.020  1.00 0.00 ? 26 TRP A NE1  5  
ATOM 5719  C CE2  . TRP A 1 26 ? 7.508   11.679  -0.672  1.00 0.00 ? 26 TRP A CE2  5  
ATOM 5720  C CE3  . TRP A 1 26 ? 7.690   9.965   1.018   1.00 0.00 ? 26 TRP A CE3  5  
ATOM 5721  C CZ2  . TRP A 1 26 ? 7.740   12.687  0.261   1.00 0.00 ? 26 TRP A CZ2  5  
ATOM 5722  C CZ3  . TRP A 1 26 ? 7.921   10.966  1.943   1.00 0.00 ? 26 TRP A CZ3  5  
ATOM 5723  C CH2  . TRP A 1 26 ? 7.944   12.313  1.561   1.00 0.00 ? 26 TRP A CH2  5  
ATOM 5724  H H    . TRP A 1 26 ? 6.939   7.164   0.760   1.00 0.00 ? 26 TRP A H    5  
ATOM 5725  H HA   . TRP A 1 26 ? 5.028   8.251   -1.106  1.00 0.00 ? 26 TRP A HA   5  
ATOM 5726  H HB2  . TRP A 1 26 ? 7.954   7.641   -1.155  1.00 0.00 ? 26 TRP A HB2  5  
ATOM 5727  H HB3  . TRP A 1 26 ? 7.105   7.834   -2.686  1.00 0.00 ? 26 TRP A HB3  5  
ATOM 5728  H HD1  . TRP A 1 26 ? 6.903   10.240  -3.549  1.00 0.00 ? 26 TRP A HD1  5  
ATOM 5729  H HE1  . TRP A 1 26 ? 7.238   12.586  -2.544  1.00 0.00 ? 26 TRP A HE1  5  
ATOM 5730  H HE3  . TRP A 1 26 ? 7.676   8.931   1.333   1.00 0.00 ? 26 TRP A HE3  5  
ATOM 5731  H HZ2  . TRP A 1 26 ? 7.761   13.731  -0.018  1.00 0.00 ? 26 TRP A HZ2  5  
ATOM 5732  H HZ3  . TRP A 1 26 ? 8.087   10.712  2.980   1.00 0.00 ? 26 TRP A HZ3  5  
ATOM 5733  H HH2  . TRP A 1 26 ? 8.129   13.061  2.317   1.00 0.00 ? 26 TRP A HH2  5  
ATOM 5734  N N    . VAL A 1 27 ? 4.195   6.225   -2.243  1.00 0.00 ? 27 VAL A N    5  
ATOM 5735  C CA   . VAL A 1 27 ? 3.682   5.057   -2.947  1.00 0.00 ? 27 VAL A CA   5  
ATOM 5736  C C    . VAL A 1 27 ? 4.313   4.928   -4.330  1.00 0.00 ? 27 VAL A C    5  
ATOM 5737  O O    . VAL A 1 27 ? 4.050   5.736   -5.221  1.00 0.00 ? 27 VAL A O    5  
ATOM 5738  C CB   . VAL A 1 27 ? 2.151   5.118   -3.099  1.00 0.00 ? 27 VAL A CB   5  
ATOM 5739  C CG1  . VAL A 1 27 ? 1.614   3.809   -3.656  1.00 0.00 ? 27 VAL A CG1  5  
ATOM 5740  C CG2  . VAL A 1 27 ? 1.496   5.446   -1.765  1.00 0.00 ? 27 VAL A CG2  5  
ATOM 5741  H H    . VAL A 1 27 ? 3.629   7.022   -2.164  1.00 0.00 ? 27 VAL A H    5  
ATOM 5742  H HA   . VAL A 1 27 ? 3.931   4.181   -2.365  1.00 0.00 ? 27 VAL A HA   5  
ATOM 5743  H HB   . VAL A 1 27 ? 1.909   5.906   -3.796  1.00 0.00 ? 27 VAL A HB   5  
ATOM 5744  H HG11 . VAL A 1 27 ? 0.539   3.866   -3.740  1.00 0.00 ? 27 VAL A HG11 5  
ATOM 5745  H HG12 . VAL A 1 27 ? 1.881   2.999   -2.992  1.00 0.00 ? 27 VAL A HG12 5  
ATOM 5746  H HG13 . VAL A 1 27 ? 2.043   3.631   -4.631  1.00 0.00 ? 27 VAL A HG13 5  
ATOM 5747  H HG21 . VAL A 1 27 ? 0.540   4.947   -1.701  1.00 0.00 ? 27 VAL A HG21 5  
ATOM 5748  H HG22 . VAL A 1 27 ? 1.352   6.513   -1.687  1.00 0.00 ? 27 VAL A HG22 5  
ATOM 5749  H HG23 . VAL A 1 27 ? 2.132   5.109   -0.959  1.00 0.00 ? 27 VAL A HG23 5  
ATOM 5750  N N    . ASN A 1 28 ? 5.148   3.908   -4.501  1.00 0.00 ? 28 ASN A N    5  
ATOM 5751  C CA   . ASN A 1 28 ? 5.817   3.674   -5.775  1.00 0.00 ? 28 ASN A CA   5  
ATOM 5752  C C    . ASN A 1 28 ? 6.703   4.859   -6.149  1.00 0.00 ? 28 ASN A C    5  
ATOM 5753  O O    . ASN A 1 28 ? 6.898   5.153   -7.328  1.00 0.00 ? 28 ASN A O    5  
ATOM 5754  C CB   . ASN A 1 28 ? 4.787   3.419   -6.877  1.00 0.00 ? 28 ASN A CB   5  
ATOM 5755  C CG   . ASN A 1 28 ? 4.904   2.026   -7.468  1.00 0.00 ? 28 ASN A CG   5  
ATOM 5756  O OD1  . ASN A 1 28 ? 6.001   1.558   -7.770  1.00 0.00 ? 28 ASN A OD1  5  
ATOM 5757  N ND2  . ASN A 1 28 ? 3.769   1.357   -7.635  1.00 0.00 ? 28 ASN A ND2  5  
ATOM 5758  H H    . ASN A 1 28 ? 5.318   3.299   -3.753  1.00 0.00 ? 28 ASN A H    5  
ATOM 5759  H HA   . ASN A 1 28 ? 6.439   2.798   -5.666  1.00 0.00 ? 28 ASN A HA   5  
ATOM 5760  H HB2  . ASN A 1 28 ? 3.794   3.532   -6.467  1.00 0.00 ? 28 ASN A HB2  5  
ATOM 5761  H HB3  . ASN A 1 28 ? 4.927   4.139   -7.671  1.00 0.00 ? 28 ASN A HB3  5  
ATOM 5762  H HD21 . ASN A 1 28 ? 2.932   1.793   -7.372  1.00 0.00 ? 28 ASN A HD21 5  
ATOM 5763  H HD22 . ASN A 1 28 ? 3.816   0.455   -8.014  1.00 0.00 ? 28 ASN A HD22 5  
ATOM 5764  N N    . GLY A 1 29 ? 7.238   5.535   -5.137  1.00 0.00 ? 29 GLY A N    5  
ATOM 5765  C CA   . GLY A 1 29 ? 8.096   6.679   -5.380  1.00 0.00 ? 29 GLY A CA   5  
ATOM 5766  C C    . GLY A 1 29 ? 7.398   7.773   -6.165  1.00 0.00 ? 29 GLY A C    5  
ATOM 5767  O O    . GLY A 1 29 ? 8.038   8.518   -6.908  1.00 0.00 ? 29 GLY A O    5  
ATOM 5768  H H    . GLY A 1 29 ? 7.048   5.254   -4.217  1.00 0.00 ? 29 GLY A H    5  
ATOM 5769  H HA2  . GLY A 1 29 ? 8.418   7.082   -4.432  1.00 0.00 ? 29 GLY A HA2  5  
ATOM 5770  H HA3  . GLY A 1 29 ? 8.965   6.353   -5.934  1.00 0.00 ? 29 GLY A HA3  5  
ATOM 5771  N N    . VAL A 1 30 ? 6.084   7.870   -6.000  1.00 0.00 ? 30 VAL A N    5  
ATOM 5772  C CA   . VAL A 1 30 ? 5.298   8.880   -6.698  1.00 0.00 ? 30 VAL A CA   5  
ATOM 5773  C C    . VAL A 1 30 ? 4.923   10.027  -5.766  1.00 0.00 ? 30 VAL A C    5  
ATOM 5774  O O    . VAL A 1 30 ? 5.381   11.156  -5.940  1.00 0.00 ? 30 VAL A O    5  
ATOM 5775  C CB   . VAL A 1 30 ? 4.011   8.278   -7.295  1.00 0.00 ? 30 VAL A CB   5  
ATOM 5776  C CG1  . VAL A 1 30 ? 3.308   9.293   -8.183  1.00 0.00 ? 30 VAL A CG1  5  
ATOM 5777  C CG2  . VAL A 1 30 ? 4.326   7.007   -8.069  1.00 0.00 ? 30 VAL A CG2  5  
ATOM 5778  H H    . VAL A 1 30 ? 5.630   7.247   -5.393  1.00 0.00 ? 30 VAL A H    5  
ATOM 5779  H HA   . VAL A 1 30 ? 5.898   9.268   -7.507  1.00 0.00 ? 30 VAL A HA   5  
ATOM 5780  H HB   . VAL A 1 30 ? 3.347   8.024   -6.483  1.00 0.00 ? 30 VAL A HB   5  
ATOM 5781  H HG11 . VAL A 1 30 ? 2.611   8.782   -8.830  1.00 0.00 ? 30 VAL A HG11 5  
ATOM 5782  H HG12 . VAL A 1 30 ? 4.040   9.815   -8.783  1.00 0.00 ? 30 VAL A HG12 5  
ATOM 5783  H HG13 . VAL A 1 30 ? 2.776   10.003  -7.568  1.00 0.00 ? 30 VAL A HG13 5  
ATOM 5784  H HG21 . VAL A 1 30 ? 3.665   6.931   -8.920  1.00 0.00 ? 30 VAL A HG21 5  
ATOM 5785  H HG22 . VAL A 1 30 ? 4.186   6.150   -7.427  1.00 0.00 ? 30 VAL A HG22 5  
ATOM 5786  H HG23 . VAL A 1 30 ? 5.350   7.038   -8.410  1.00 0.00 ? 30 VAL A HG23 5  
ATOM 5787  N N    . LYS A 1 31 ? 4.089   9.729   -4.776  1.00 0.00 ? 31 LYS A N    5  
ATOM 5788  C CA   . LYS A 1 31 ? 3.652   10.736  -3.815  1.00 0.00 ? 31 LYS A CA   5  
ATOM 5789  C C    . LYS A 1 31 ? 3.504   10.131  -2.421  1.00 0.00 ? 31 LYS A C    5  
ATOM 5790  O O    . LYS A 1 31 ? 3.213   8.943   -2.279  1.00 0.00 ? 31 LYS A O    5  
ATOM 5791  C CB   . LYS A 1 31 ? 2.325   11.353  -4.259  1.00 0.00 ? 31 LYS A CB   5  
ATOM 5792  C CG   . LYS A 1 31 ? 2.466   12.341  -5.406  1.00 0.00 ? 31 LYS A CG   5  
ATOM 5793  C CD   . LYS A 1 31 ? 1.505   13.510  -5.258  1.00 0.00 ? 31 LYS A CD   5  
ATOM 5794  C CE   . LYS A 1 31 ? 1.168   14.128  -6.605  1.00 0.00 ? 31 LYS A CE   5  
ATOM 5795  N NZ   . LYS A 1 31 ? 1.994   15.335  -6.884  1.00 0.00 ? 31 LYS A NZ   5  
ATOM 5796  H H    . LYS A 1 31 ? 3.758   8.811   -4.688  1.00 0.00 ? 31 LYS A H    5  
ATOM 5797  H HA   . LYS A 1 31 ? 4.405   11.510  -3.781  1.00 0.00 ? 31 LYS A HA   5  
ATOM 5798  H HB2  . LYS A 1 31 ? 1.660   10.563  -4.574  1.00 0.00 ? 31 LYS A HB2  5  
ATOM 5799  H HB3  . LYS A 1 31 ? 1.882   11.870  -3.420  1.00 0.00 ? 31 LYS A HB3  5  
ATOM 5800  H HG2  . LYS A 1 31 ? 3.477   12.720  -5.419  1.00 0.00 ? 31 LYS A HG2  5  
ATOM 5801  H HG3  . LYS A 1 31 ? 2.259   11.832  -6.335  1.00 0.00 ? 31 LYS A HG3  5  
ATOM 5802  H HD2  . LYS A 1 31 ? 0.593   13.157  -4.798  1.00 0.00 ? 31 LYS A HD2  5  
ATOM 5803  H HD3  . LYS A 1 31 ? 1.960   14.261  -4.630  1.00 0.00 ? 31 LYS A HD3  5  
ATOM 5804  H HE2  . LYS A 1 31 ? 1.346   13.395  -7.379  1.00 0.00 ? 31 LYS A HE2  5  
ATOM 5805  H HE3  . LYS A 1 31 ? 0.125   14.407  -6.609  1.00 0.00 ? 31 LYS A HE3  5  
ATOM 5806  H HZ1  . LYS A 1 31 ? 1.717   15.756  -7.793  1.00 0.00 ? 31 LYS A HZ1  5  
ATOM 5807  H HZ2  . LYS A 1 31 ? 3.002   15.078  -6.927  1.00 0.00 ? 31 LYS A HZ2  5  
ATOM 5808  H HZ3  . LYS A 1 31 ? 1.861   16.041  -6.132  1.00 0.00 ? 31 LYS A HZ3  5  
ATOM 5809  N N    . PRO A 1 32 ? 3.702   10.944  -1.369  1.00 0.00 ? 32 PRO A N    5  
ATOM 5810  C CA   . PRO A 1 32 ? 3.589   10.483  0.018   1.00 0.00 ? 32 PRO A CA   5  
ATOM 5811  C C    . PRO A 1 32 ? 2.142   10.223  0.424   1.00 0.00 ? 32 PRO A C    5  
ATOM 5812  O O    . PRO A 1 32 ? 1.209   10.635  -0.264  1.00 0.00 ? 32 PRO A O    5  
ATOM 5813  C CB   . PRO A 1 32 ? 4.172   11.644  0.825   1.00 0.00 ? 32 PRO A CB   5  
ATOM 5814  C CG   . PRO A 1 32 ? 3.941   12.846  -0.025  1.00 0.00 ? 32 PRO A CG   5  
ATOM 5815  C CD   . PRO A 1 32 ? 4.053   12.376  -1.450  1.00 0.00 ? 32 PRO A CD   5  
ATOM 5816  H HA   . PRO A 1 32 ? 4.176   9.592   0.188   1.00 0.00 ? 32 PRO A HA   5  
ATOM 5817  H HB2  . PRO A 1 32 ? 3.654   11.724  1.772   1.00 0.00 ? 32 PRO A HB2  5  
ATOM 5818  H HB3  . PRO A 1 32 ? 5.227   11.477  0.993   1.00 0.00 ? 32 PRO A HB3  5  
ATOM 5819  H HG2  . PRO A 1 32 ? 2.954   13.244  0.163   1.00 0.00 ? 32 PRO A HG2  5  
ATOM 5820  H HG3  . PRO A 1 32 ? 4.693   13.593  0.183   1.00 0.00 ? 32 PRO A HG3  5  
ATOM 5821  H HD2  . PRO A 1 32 ? 3.354   12.909  -2.079  1.00 0.00 ? 32 PRO A HD2  5  
ATOM 5822  H HD3  . PRO A 1 32 ? 5.061   12.505  -1.812  1.00 0.00 ? 32 PRO A HD3  5  
ATOM 5823  N N    . GLY A 1 33 ? 1.965   9.536   1.549   1.00 0.00 ? 33 GLY A N    5  
ATOM 5824  C CA   . GLY A 1 33 ? 0.628   9.233   2.028   1.00 0.00 ? 33 GLY A CA   5  
ATOM 5825  C C    . GLY A 1 33 ? 0.631   8.681   3.440   1.00 0.00 ? 33 GLY A C    5  
ATOM 5826  O O    . GLY A 1 33 ? 1.549   7.961   3.830   1.00 0.00 ? 33 GLY A O    5  
ATOM 5827  H H    . GLY A 1 33 ? 2.745   9.233   2.056   1.00 0.00 ? 33 GLY A H    5  
ATOM 5828  H HA2  . GLY A 1 33 ? 0.037   10.137  2.008   1.00 0.00 ? 33 GLY A HA2  5  
ATOM 5829  H HA3  . GLY A 1 33 ? 0.178   8.506   1.370   1.00 0.00 ? 33 GLY A HA3  5  
ATOM 5830  N N    . VAL A 1 34 ? -0.401  9.019   4.207   1.00 0.00 ? 34 VAL A N    5  
ATOM 5831  C CA   . VAL A 1 34 ? -0.515  8.552   5.584   1.00 0.00 ? 34 VAL A CA   5  
ATOM 5832  C C    . VAL A 1 34 ? -0.958  7.093   5.633   1.00 0.00 ? 34 VAL A C    5  
ATOM 5833  O O    . VAL A 1 34 ? -2.065  6.757   5.213   1.00 0.00 ? 34 VAL A O    5  
ATOM 5834  C CB   . VAL A 1 34 ? -1.512  9.408   6.388   1.00 0.00 ? 34 VAL A CB   5  
ATOM 5835  C CG1  . VAL A 1 34 ? -1.501  9.008   7.855   1.00 0.00 ? 34 VAL A CG1  5  
ATOM 5836  C CG2  . VAL A 1 34 ? -1.196  10.889  6.231   1.00 0.00 ? 34 VAL A CG2  5  
ATOM 5837  H H    . VAL A 1 34 ? -1.102  9.596   3.838   1.00 0.00 ? 34 VAL A H    5  
ATOM 5838  H HA   . VAL A 1 34 ? 0.457   8.639   6.047   1.00 0.00 ? 34 VAL A HA   5  
ATOM 5839  H HB   . VAL A 1 34 ? -2.504  9.231   5.997   1.00 0.00 ? 34 VAL A HB   5  
ATOM 5840  H HG11 . VAL A 1 34 ? -2.074  8.101   7.985   1.00 0.00 ? 34 VAL A HG11 5  
ATOM 5841  H HG12 . VAL A 1 34 ? -1.940  9.797   8.447   1.00 0.00 ? 34 VAL A HG12 5  
ATOM 5842  H HG13 . VAL A 1 34 ? -0.484  8.840   8.175   1.00 0.00 ? 34 VAL A HG13 5  
ATOM 5843  H HG21 . VAL A 1 34 ? -2.117  11.442  6.113   1.00 0.00 ? 34 VAL A HG21 5  
ATOM 5844  H HG22 . VAL A 1 34 ? -0.574  11.034  5.360   1.00 0.00 ? 34 VAL A HG22 5  
ATOM 5845  H HG23 . VAL A 1 34 ? -0.676  11.241  7.109   1.00 0.00 ? 34 VAL A HG23 5  
ATOM 5846  N N    . VAL A 1 35 ? -0.087  6.233   6.148   1.00 0.00 ? 35 VAL A N    5  
ATOM 5847  C CA   . VAL A 1 35 ? -0.389  4.810   6.252   1.00 0.00 ? 35 VAL A CA   5  
ATOM 5848  C C    . VAL A 1 35 ? -1.481  4.554   7.284   1.00 0.00 ? 35 VAL A C    5  
ATOM 5849  O O    . VAL A 1 35 ? -1.476  5.139   8.368   1.00 0.00 ? 35 VAL A O    5  
ATOM 5850  C CB   . VAL A 1 35 ? 0.862   3.996   6.635   1.00 0.00 ? 35 VAL A CB   5  
ATOM 5851  C CG1  . VAL A 1 35 ? 0.578   2.504   6.543   1.00 0.00 ? 35 VAL A CG1  5  
ATOM 5852  C CG2  . VAL A 1 35 ? 2.039   4.378   5.751   1.00 0.00 ? 35 VAL A CG2  5  
ATOM 5853  H H    . VAL A 1 35 ? 0.780   6.562   6.466   1.00 0.00 ? 35 VAL A H    5  
ATOM 5854  H HA   . VAL A 1 35 ? -0.732  4.470   5.286   1.00 0.00 ? 35 VAL A HA   5  
ATOM 5855  H HB   . VAL A 1 35 ? 1.119   4.228   7.659   1.00 0.00 ? 35 VAL A HB   5  
ATOM 5856  H HG11 . VAL A 1 35 ? -0.488  2.338   6.575   1.00 0.00 ? 35 VAL A HG11 5  
ATOM 5857  H HG12 . VAL A 1 35 ? 1.047   1.997   7.373   1.00 0.00 ? 35 VAL A HG12 5  
ATOM 5858  H HG13 . VAL A 1 35 ? 0.975   2.120   5.615   1.00 0.00 ? 35 VAL A HG13 5  
ATOM 5859  H HG21 . VAL A 1 35 ? 2.649   3.506   5.566   1.00 0.00 ? 35 VAL A HG21 5  
ATOM 5860  H HG22 . VAL A 1 35 ? 2.631   5.134   6.245   1.00 0.00 ? 35 VAL A HG22 5  
ATOM 5861  H HG23 . VAL A 1 35 ? 1.672   4.766   4.811   1.00 0.00 ? 35 VAL A HG23 5  
ATOM 5862  N N    . GLN A 1 36 ? -2.420  3.678   6.941   1.00 0.00 ? 36 GLN A N    5  
ATOM 5863  C CA   . GLN A 1 36 ? -3.519  3.343   7.838   1.00 0.00 ? 36 GLN A CA   5  
ATOM 5864  C C    . GLN A 1 36 ? -3.581  1.839   8.086   1.00 0.00 ? 36 GLN A C    5  
ATOM 5865  O O    . GLN A 1 36 ? -3.760  1.395   9.220   1.00 0.00 ? 36 GLN A O    5  
ATOM 5866  C CB   . GLN A 1 36 ? -4.846  3.832   7.254   1.00 0.00 ? 36 GLN A CB   5  
ATOM 5867  C CG   . GLN A 1 36 ? -5.270  5.198   7.769   1.00 0.00 ? 36 GLN A CG   5  
ATOM 5868  C CD   . GLN A 1 36 ? -5.745  5.156   9.209   1.00 0.00 ? 36 GLN A CD   5  
ATOM 5869  O OE1  . GLN A 1 36 ? -6.911  4.872   9.483   1.00 0.00 ? 36 GLN A OE1  5  
ATOM 5870  N NE2  . GLN A 1 36 ? -4.841  5.442   10.138  1.00 0.00 ? 36 GLN A NE2  5  
ATOM 5871  H H    . GLN A 1 36 ? -2.369  3.244   6.063   1.00 0.00 ? 36 GLN A H    5  
ATOM 5872  H HA   . GLN A 1 36 ? -3.345  3.845   8.778   1.00 0.00 ? 36 GLN A HA   5  
ATOM 5873  H HB2  . GLN A 1 36 ? -4.754  3.890   6.180   1.00 0.00 ? 36 GLN A HB2  5  
ATOM 5874  H HB3  . GLN A 1 36 ? -5.621  3.121   7.503   1.00 0.00 ? 36 GLN A HB3  5  
ATOM 5875  H HG2  . GLN A 1 36 ? -4.429  5.871   7.704   1.00 0.00 ? 36 GLN A HG2  5  
ATOM 5876  H HG3  . GLN A 1 36 ? -6.075  5.569   7.151   1.00 0.00 ? 36 GLN A HG3  5  
ATOM 5877  H HE21 . GLN A 1 36 ? -3.931  5.660   9.848   1.00 0.00 ? 36 GLN A HE21 5  
ATOM 5878  H HE22 . GLN A 1 36 ? -5.120  5.422   11.077  1.00 0.00 ? 36 GLN A HE22 5  
ATOM 5879  N N    . TYR A 1 37 ? -3.432  1.061   7.019   1.00 0.00 ? 37 TYR A N    5  
ATOM 5880  C CA   . TYR A 1 37 ? -3.471  -0.393  7.122   1.00 0.00 ? 37 TYR A CA   5  
ATOM 5881  C C    . TYR A 1 37 ? -2.124  -1.000  6.743   1.00 0.00 ? 37 TYR A C    5  
ATOM 5882  O O    . TYR A 1 37 ? -1.451  -0.525  5.828   1.00 0.00 ? 37 TYR A O    5  
ATOM 5883  C CB   . TYR A 1 37 ? -4.570  -0.960  6.221   1.00 0.00 ? 37 TYR A CB   5  
ATOM 5884  C CG   . TYR A 1 37 ? -5.119  -2.286  6.696   1.00 0.00 ? 37 TYR A CG   5  
ATOM 5885  C CD1  . TYR A 1 37 ? -4.395  -3.460  6.525   1.00 0.00 ? 37 TYR A CD1  5  
ATOM 5886  C CD2  . TYR A 1 37 ? -6.360  -2.365  7.316   1.00 0.00 ? 37 TYR A CD2  5  
ATOM 5887  C CE1  . TYR A 1 37 ? -4.894  -4.674  6.958   1.00 0.00 ? 37 TYR A CE1  5  
ATOM 5888  C CE2  . TYR A 1 37 ? -6.864  -3.575  7.752   1.00 0.00 ? 37 TYR A CE2  5  
ATOM 5889  C CZ   . TYR A 1 37 ? -6.127  -4.726  7.571   1.00 0.00 ? 37 TYR A CZ   5  
ATOM 5890  O OH   . TYR A 1 37 ? -6.627  -5.933  8.003   1.00 0.00 ? 37 TYR A OH   5  
ATOM 5891  H H    . TYR A 1 37 ? -3.293  1.475   6.141   1.00 0.00 ? 37 TYR A H    5  
ATOM 5892  H HA   . TYR A 1 37 ? -3.691  -0.647  8.147   1.00 0.00 ? 37 TYR A HA   5  
ATOM 5893  H HB2  . TYR A 1 37 ? -5.390  -0.258  6.181   1.00 0.00 ? 37 TYR A HB2  5  
ATOM 5894  H HB3  . TYR A 1 37 ? -4.173  -1.100  5.227   1.00 0.00 ? 37 TYR A HB3  5  
ATOM 5895  H HD1  . TYR A 1 37 ? -3.429  -3.416  6.046   1.00 0.00 ? 37 TYR A HD1  5  
ATOM 5896  H HD2  . TYR A 1 37 ? -6.934  -1.461  7.456   1.00 0.00 ? 37 TYR A HD2  5  
ATOM 5897  H HE1  . TYR A 1 37 ? -4.316  -5.576  6.816   1.00 0.00 ? 37 TYR A HE1  5  
ATOM 5898  H HE2  . TYR A 1 37 ? -7.831  -3.615  8.231   1.00 0.00 ? 37 TYR A HE2  5  
ATOM 5899  H HH   . TYR A 1 37 ? -5.921  -6.447  8.403   1.00 0.00 ? 37 TYR A HH   5  
ATOM 5900  N N    . LEU A 1 38 ? -1.736  -2.055  7.453   1.00 0.00 ? 38 LEU A N    5  
ATOM 5901  C CA   . LEU A 1 38 ? -0.470  -2.728  7.191   1.00 0.00 ? 38 LEU A CA   5  
ATOM 5902  C C    . LEU A 1 38 ? -0.553  -4.206  7.559   1.00 0.00 ? 38 LEU A C    5  
ATOM 5903  O O    . LEU A 1 38 ? -0.630  -4.560  8.736   1.00 0.00 ? 38 LEU A O    5  
ATOM 5904  C CB   . LEU A 1 38 ? 0.661   -2.057  7.975   1.00 0.00 ? 38 LEU A CB   5  
ATOM 5905  C CG   . LEU A 1 38 ? 1.359   -0.907  7.247   1.00 0.00 ? 38 LEU A CG   5  
ATOM 5906  C CD1  . LEU A 1 38 ? 2.168   -0.069  8.225   1.00 0.00 ? 38 LEU A CD1  5  
ATOM 5907  C CD2  . LEU A 1 38 ? 2.249   -1.445  6.137   1.00 0.00 ? 38 LEU A CD2  5  
ATOM 5908  H H    . LEU A 1 38 ? -2.316  -2.388  8.169   1.00 0.00 ? 38 LEU A H    5  
ATOM 5909  H HA   . LEU A 1 38 ? -0.261  -2.645  6.135   1.00 0.00 ? 38 LEU A HA   5  
ATOM 5910  H HB2  . LEU A 1 38 ? 0.251   -1.676  8.899   1.00 0.00 ? 38 LEU A HB2  5  
ATOM 5911  H HB3  . LEU A 1 38 ? 1.401   -2.806  8.211   1.00 0.00 ? 38 LEU A HB3  5  
ATOM 5912  H HG   . LEU A 1 38 ? 0.612   -0.268  6.799   1.00 0.00 ? 38 LEU A HG   5  
ATOM 5913  H HD11 . LEU A 1 38 ? 2.734   -0.721  8.874   1.00 0.00 ? 38 LEU A HD11 5  
ATOM 5914  H HD12 . LEU A 1 38 ? 1.500   0.537   8.817   1.00 0.00 ? 38 LEU A HD12 5  
ATOM 5915  H HD13 . LEU A 1 38 ? 2.844   0.570   7.676   1.00 0.00 ? 38 LEU A HD13 5  
ATOM 5916  H HD21 . LEU A 1 38 ? 2.367   -0.690  5.373   1.00 0.00 ? 38 LEU A HD21 5  
ATOM 5917  H HD22 . LEU A 1 38 ? 1.798   -2.325  5.707   1.00 0.00 ? 38 LEU A HD22 5  
ATOM 5918  H HD23 . LEU A 1 38 ? 3.218   -1.698  6.544   1.00 0.00 ? 38 LEU A HD23 5  
ATOM 5919  N N    . GLY A 1 39 ? -0.537  -5.065  6.545   1.00 0.00 ? 39 GLY A N    5  
ATOM 5920  C CA   . GLY A 1 39 ? -0.611  -6.494  6.783   1.00 0.00 ? 39 GLY A CA   5  
ATOM 5921  C C    . GLY A 1 39 ? -1.028  -7.267  5.547   1.00 0.00 ? 39 GLY A C    5  
ATOM 5922  O O    . GLY A 1 39 ? -0.200  -7.579  4.693   1.00 0.00 ? 39 GLY A O    5  
ATOM 5923  H H    . GLY A 1 39 ? -0.473  -4.725  5.628   1.00 0.00 ? 39 GLY A H    5  
ATOM 5924  H HA2  . GLY A 1 39 ? 0.359   -6.846  7.103   1.00 0.00 ? 39 GLY A HA2  5  
ATOM 5925  H HA3  . GLY A 1 39 ? -1.327  -6.681  7.570   1.00 0.00 ? 39 GLY A HA3  5  
ATOM 5926  N N    . GLU A 1 40 ? -2.317  -7.578  5.454   1.00 0.00 ? 40 GLU A N    5  
ATOM 5927  C CA   . GLU A 1 40 ? -2.844  -8.319  4.314   1.00 0.00 ? 40 GLU A CA   5  
ATOM 5928  C C    . GLU A 1 40 ? -4.205  -7.777  3.893   1.00 0.00 ? 40 GLU A C    5  
ATOM 5929  O O    . GLU A 1 40 ? -4.828  -7.003  4.620   1.00 0.00 ? 40 GLU A O    5  
ATOM 5930  C CB   . GLU A 1 40 ? -2.959  -9.807  4.655   1.00 0.00 ? 40 GLU A CB   5  
ATOM 5931  C CG   . GLU A 1 40 ? -1.622  -10.531 4.675   1.00 0.00 ? 40 GLU A CG   5  
ATOM 5932  C CD   . GLU A 1 40 ? -1.771  -12.019 4.926   1.00 0.00 ? 40 GLU A CD   5  
ATOM 5933  O OE1  . GLU A 1 40 ? -2.601  -12.398 5.778   1.00 0.00 ? 40 GLU A OE1  5  
ATOM 5934  O OE2  . GLU A 1 40 ? -1.057  -12.805 4.267   1.00 0.00 ? 40 GLU A OE2  5  
ATOM 5935  H H    . GLU A 1 40 ? -2.928  -7.302  6.167   1.00 0.00 ? 40 GLU A H    5  
ATOM 5936  H HA   . GLU A 1 40 ? -2.153  -8.200  3.493   1.00 0.00 ? 40 GLU A HA   5  
ATOM 5937  H HB2  . GLU A 1 40 ? -3.412  -9.907  5.630   1.00 0.00 ? 40 GLU A HB2  5  
ATOM 5938  H HB3  . GLU A 1 40 ? -3.592  -10.284 3.923   1.00 0.00 ? 40 GLU A HB3  5  
ATOM 5939  H HG2  . GLU A 1 40 ? -1.136  -10.389 3.722   1.00 0.00 ? 40 GLU A HG2  5  
ATOM 5940  H HG3  . GLU A 1 40 ? -1.010  -10.108 5.458   1.00 0.00 ? 40 GLU A HG3  5  
ATOM 5941  N N    . THR A 1 41 ? -4.662  -8.188  2.714   1.00 0.00 ? 41 THR A N    5  
ATOM 5942  C CA   . THR A 1 41 ? -5.951  -7.744  2.195   1.00 0.00 ? 41 THR A CA   5  
ATOM 5943  C C    . THR A 1 41 ? -6.870  -8.932  1.932   1.00 0.00 ? 41 THR A C    5  
ATOM 5944  O O    . THR A 1 41 ? -6.508  -10.080 2.193   1.00 0.00 ? 41 THR A O    5  
ATOM 5945  C CB   . THR A 1 41 ? -5.757  -6.939  0.910   1.00 0.00 ? 41 THR A CB   5  
ATOM 5946  O OG1  . THR A 1 41 ? -4.715  -7.492  0.126   1.00 0.00 ? 41 THR A OG1  5  
ATOM 5947  C CG2  . THR A 1 41 ? -5.422  -5.485  1.159   1.00 0.00 ? 41 THR A CG2  5  
ATOM 5948  H H    . THR A 1 41 ? -4.120  -8.806  2.181   1.00 0.00 ? 41 THR A H    5  
ATOM 5949  H HA   . THR A 1 41 ? -6.408  -7.110  2.940   1.00 0.00 ? 41 THR A HA   5  
ATOM 5950  H HB   . THR A 1 41 ? -6.670  -6.974  0.334   1.00 0.00 ? 41 THR A HB   5  
ATOM 5951  H HG1  . THR A 1 41 ? -4.922  -7.382  -0.805  1.00 0.00 ? 41 THR A HG1  5  
ATOM 5952  H HG21 . THR A 1 41 ? -4.860  -5.096  0.323   1.00 0.00 ? 41 THR A HG21 5  
ATOM 5953  H HG22 . THR A 1 41 ? -4.832  -5.400  2.060   1.00 0.00 ? 41 THR A HG22 5  
ATOM 5954  H HG23 . THR A 1 41 ? -6.335  -4.919  1.272   1.00 0.00 ? 41 THR A HG23 5  
ATOM 5955  N N    . GLN A 1 42 ? -8.061  -8.649  1.413   1.00 0.00 ? 42 GLN A N    5  
ATOM 5956  C CA   . GLN A 1 42 ? -9.033  -9.696  1.115   1.00 0.00 ? 42 GLN A CA   5  
ATOM 5957  C C    . GLN A 1 42 ? -9.218  -9.851  -0.391  1.00 0.00 ? 42 GLN A C    5  
ATOM 5958  O O    . GLN A 1 42 ? -9.359  -10.965 -0.897  1.00 0.00 ? 42 GLN A O    5  
ATOM 5959  C CB   . GLN A 1 42 ? -10.375 -9.376  1.775   1.00 0.00 ? 42 GLN A CB   5  
ATOM 5960  C CG   . GLN A 1 42 ? -10.365 -9.542  3.286   1.00 0.00 ? 42 GLN A CG   5  
ATOM 5961  C CD   . GLN A 1 42 ? -10.815 -10.922 3.724   1.00 0.00 ? 42 GLN A CD   5  
ATOM 5962  O OE1  . GLN A 1 42 ? -11.973 -11.124 4.088   1.00 0.00 ? 42 GLN A OE1  5  
ATOM 5963  N NE2  . GLN A 1 42 ? -9.896  -11.881 3.691   1.00 0.00 ? 42 GLN A NE2  5  
ATOM 5964  H H    . GLN A 1 42 ? -8.293  -7.715  1.228   1.00 0.00 ? 42 GLN A H    5  
ATOM 5965  H HA   . GLN A 1 42 ? -8.656  -10.623 1.517   1.00 0.00 ? 42 GLN A HA   5  
ATOM 5966  H HB2  . GLN A 1 42 ? -10.641 -8.355  1.548   1.00 0.00 ? 42 GLN A HB2  5  
ATOM 5967  H HB3  . GLN A 1 42 ? -11.129 -10.034 1.368   1.00 0.00 ? 42 GLN A HB3  5  
ATOM 5968  H HG2  . GLN A 1 42 ? -9.361  -9.377  3.646   1.00 0.00 ? 42 GLN A HG2  5  
ATOM 5969  H HG3  . GLN A 1 42 ? -11.028 -8.808  3.720   1.00 0.00 ? 42 GLN A HG3  5  
ATOM 5970  H HE21 . GLN A 1 42 ? -8.994  -11.648 3.390   1.00 0.00 ? 42 GLN A HE21 5  
ATOM 5971  H HE22 . GLN A 1 42 ? -10.160 -12.784 3.968   1.00 0.00 ? 42 GLN A HE22 5  
ATOM 5972  N N    . PHE A 1 43 ? -9.220  -8.728  -1.102  1.00 0.00 ? 43 PHE A N    5  
ATOM 5973  C CA   . PHE A 1 43 ? -9.389  -8.742  -2.551  1.00 0.00 ? 43 PHE A CA   5  
ATOM 5974  C C    . PHE A 1 43 ? -8.210  -9.430  -3.230  1.00 0.00 ? 43 PHE A C    5  
ATOM 5975  O O    . PHE A 1 43 ? -8.364  -10.050 -4.282  1.00 0.00 ? 43 PHE A O    5  
ATOM 5976  C CB   . PHE A 1 43 ? -9.537  -7.314  -3.082  1.00 0.00 ? 43 PHE A CB   5  
ATOM 5977  C CG   . PHE A 1 43 ? -8.311  -6.467  -2.884  1.00 0.00 ? 43 PHE A CG   5  
ATOM 5978  C CD1  . PHE A 1 43 ? -8.121  -5.764  -1.705  1.00 0.00 ? 43 PHE A CD1  5  
ATOM 5979  C CD2  . PHE A 1 43 ? -7.350  -6.376  -3.878  1.00 0.00 ? 43 PHE A CD2  5  
ATOM 5980  C CE1  . PHE A 1 43 ? -6.995  -4.984  -1.522  1.00 0.00 ? 43 PHE A CE1  5  
ATOM 5981  C CE2  . PHE A 1 43 ? -6.223  -5.597  -3.701  1.00 0.00 ? 43 PHE A CE2  5  
ATOM 5982  C CZ   . PHE A 1 43 ? -6.044  -4.901  -2.521  1.00 0.00 ? 43 PHE A CZ   5  
ATOM 5983  H H    . PHE A 1 43 ? -9.105  -7.870  -0.642  1.00 0.00 ? 43 PHE A H    5  
ATOM 5984  H HA   . PHE A 1 43 ? -10.290 -9.294  -2.773  1.00 0.00 ? 43 PHE A HA   5  
ATOM 5985  H HB2  . PHE A 1 43 ? -9.748  -7.351  -4.139  1.00 0.00 ? 43 PHE A HB2  5  
ATOM 5986  H HB3  . PHE A 1 43 ? -10.360 -6.833  -2.573  1.00 0.00 ? 43 PHE A HB3  5  
ATOM 5987  H HD1  . PHE A 1 43 ? -8.864  -5.829  -0.924  1.00 0.00 ? 43 PHE A HD1  5  
ATOM 5988  H HD2  . PHE A 1 43 ? -7.489  -6.919  -4.801  1.00 0.00 ? 43 PHE A HD2  5  
ATOM 5989  H HE1  . PHE A 1 43 ? -6.858  -4.441  -0.599  1.00 0.00 ? 43 PHE A HE1  5  
ATOM 5990  H HE2  . PHE A 1 43 ? -5.482  -5.533  -4.483  1.00 0.00 ? 43 PHE A HE2  5  
ATOM 5991  H HZ   . PHE A 1 43 ? -5.163  -4.292  -2.380  1.00 0.00 ? 43 PHE A HZ   5  
ATOM 5992  N N    . ALA A 1 44 ? -7.033  -9.316  -2.622  1.00 0.00 ? 44 ALA A N    5  
ATOM 5993  C CA   . ALA A 1 44 ? -5.829  -9.929  -3.169  1.00 0.00 ? 44 ALA A CA   5  
ATOM 5994  C C    . ALA A 1 44 ? -4.988  -10.567 -2.067  1.00 0.00 ? 44 ALA A C    5  
ATOM 5995  O O    . ALA A 1 44 ? -4.930  -10.060 -0.946  1.00 0.00 ? 44 ALA A O    5  
ATOM 5996  C CB   . ALA A 1 44 ? -5.012  -8.895  -3.929  1.00 0.00 ? 44 ALA A CB   5  
ATOM 5997  H H    . ALA A 1 44 ? -6.975  -8.810  -1.786  1.00 0.00 ? 44 ALA A H    5  
ATOM 5998  H HA   . ALA A 1 44 ? -6.134  -10.695 -3.867  1.00 0.00 ? 44 ALA A HA   5  
ATOM 5999  H HB1  . ALA A 1 44 ? -5.214  -7.912  -3.529  1.00 0.00 ? 44 ALA A HB1  5  
ATOM 6000  H HB2  . ALA A 1 44 ? -5.280  -8.920  -4.974  1.00 0.00 ? 44 ALA A HB2  5  
ATOM 6001  H HB3  . ALA A 1 44 ? -3.959  -9.117  -3.821  1.00 0.00 ? 44 ALA A HB3  5  
ATOM 6002  N N    . PRO A 1 45 ? -4.321  -11.696 -2.370  1.00 0.00 ? 45 PRO A N    5  
ATOM 6003  C CA   . PRO A 1 45 ? -3.482  -12.401 -1.398  1.00 0.00 ? 45 PRO A CA   5  
ATOM 6004  C C    . PRO A 1 45 ? -2.162  -11.682 -1.140  1.00 0.00 ? 45 PRO A C    5  
ATOM 6005  O O    . PRO A 1 45 ? -1.982  -10.532 -1.542  1.00 0.00 ? 45 PRO A O    5  
ATOM 6006  C CB   . PRO A 1 45 ? -3.232  -13.752 -2.067  1.00 0.00 ? 45 PRO A CB   5  
ATOM 6007  C CG   . PRO A 1 45 ? -3.313  -13.468 -3.526  1.00 0.00 ? 45 PRO A CG   5  
ATOM 6008  C CD   . PRO A 1 45 ? -4.333  -12.372 -3.682  1.00 0.00 ? 45 PRO A CD   5  
ATOM 6009  H HA   . PRO A 1 45 ? -3.999  -12.550 -0.461  1.00 0.00 ? 45 PRO A HA   5  
ATOM 6010  H HB2  . PRO A 1 45 ? -2.255  -14.120 -1.789  1.00 0.00 ? 45 PRO A HB2  5  
ATOM 6011  H HB3  . PRO A 1 45 ? -3.991  -14.456 -1.760  1.00 0.00 ? 45 PRO A HB3  5  
ATOM 6012  H HG2  . PRO A 1 45 ? -2.351  -13.138 -3.890  1.00 0.00 ? 45 PRO A HG2  5  
ATOM 6013  H HG3  . PRO A 1 45 ? -3.632  -14.353 -4.056  1.00 0.00 ? 45 PRO A HG3  5  
ATOM 6014  H HD2  . PRO A 1 45 ? -4.039  -11.692 -4.468  1.00 0.00 ? 45 PRO A HD2  5  
ATOM 6015  H HD3  . PRO A 1 45 ? -5.307  -12.790 -3.890  1.00 0.00 ? 45 PRO A HD3  5  
ATOM 6016  N N    . GLY A 1 46 ? -1.242  -12.365 -0.467  1.00 0.00 ? 46 GLY A N    5  
ATOM 6017  C CA   . GLY A 1 46 ? 0.049   -11.776 -0.168  1.00 0.00 ? 46 GLY A CA   5  
ATOM 6018  C C    . GLY A 1 46 ? -0.054  -10.606 0.791   1.00 0.00 ? 46 GLY A C    5  
ATOM 6019  O O    . GLY A 1 46 ? -1.153  -10.162 1.122   1.00 0.00 ? 46 GLY A O    5  
ATOM 6020  H H    . GLY A 1 46 ? -1.443  -13.278 -0.172  1.00 0.00 ? 46 GLY A H    5  
ATOM 6021  H HA2  . GLY A 1 46 ? 0.685   -12.531 0.271   1.00 0.00 ? 46 GLY A HA2  5  
ATOM 6022  H HA3  . GLY A 1 46 ? 0.498   -11.434 -1.088  1.00 0.00 ? 46 GLY A HA3  5  
ATOM 6023  N N    . GLN A 1 47 ? 1.094   -10.106 1.237   1.00 0.00 ? 47 GLN A N    5  
ATOM 6024  C CA   . GLN A 1 47 ? 1.129   -8.981  2.164   1.00 0.00 ? 47 GLN A CA   5  
ATOM 6025  C C    . GLN A 1 47 ? 0.766   -7.681  1.454   1.00 0.00 ? 47 GLN A C    5  
ATOM 6026  O O    . GLN A 1 47 ? 1.290   -7.380  0.382   1.00 0.00 ? 47 GLN A O    5  
ATOM 6027  C CB   . GLN A 1 47 ? 2.515   -8.859  2.799   1.00 0.00 ? 47 GLN A CB   5  
ATOM 6028  C CG   . GLN A 1 47 ? 3.066   -10.179 3.315   1.00 0.00 ? 47 GLN A CG   5  
ATOM 6029  C CD   . GLN A 1 47 ? 2.113   -10.878 4.264   1.00 0.00 ? 47 GLN A CD   5  
ATOM 6030  O OE1  . GLN A 1 47 ? 1.502   -11.889 3.918   1.00 0.00 ? 47 GLN A OE1  5  
ATOM 6031  N NE2  . GLN A 1 47 ? 1.981   -10.340 5.471   1.00 0.00 ? 47 GLN A NE2  5  
ATOM 6032  H H    . GLN A 1 47 ? 1.937   -10.504 0.936   1.00 0.00 ? 47 GLN A H    5  
ATOM 6033  H HA   . GLN A 1 47 ? 0.402   -9.169  2.939   1.00 0.00 ? 47 GLN A HA   5  
ATOM 6034  H HB2  . GLN A 1 47 ? 3.203   -8.469  2.063   1.00 0.00 ? 47 GLN A HB2  5  
ATOM 6035  H HB3  . GLN A 1 47 ? 2.459   -8.169  3.628   1.00 0.00 ? 47 GLN A HB3  5  
ATOM 6036  H HG2  . GLN A 1 47 ? 3.252   -10.830 2.474   1.00 0.00 ? 47 GLN A HG2  5  
ATOM 6037  H HG3  . GLN A 1 47 ? 3.994   -9.989  3.834   1.00 0.00 ? 47 GLN A HG3  5  
ATOM 6038  H HE21 . GLN A 1 47 ? 2.498   -9.533  5.679   1.00 0.00 ? 47 GLN A HE21 5  
ATOM 6039  H HE22 . GLN A 1 47 ? 1.371   -10.771 6.106   1.00 0.00 ? 47 GLN A HE22 5  
ATOM 6040  N N    . TRP A 1 48 ? -0.135  -6.914  2.060   1.00 0.00 ? 48 TRP A N    5  
ATOM 6041  C CA   . TRP A 1 48 ? -0.570  -5.646  1.486   1.00 0.00 ? 48 TRP A CA   5  
ATOM 6042  C C    . TRP A 1 48 ? -0.456  -4.519  2.508   1.00 0.00 ? 48 TRP A C    5  
ATOM 6043  O O    . TRP A 1 48 ? -0.424  -4.763  3.715   1.00 0.00 ? 48 TRP A O    5  
ATOM 6044  C CB   . TRP A 1 48 ? -2.013  -5.756  0.990   1.00 0.00 ? 48 TRP A CB   5  
ATOM 6045  C CG   . TRP A 1 48 ? -2.123  -6.289  -0.403  1.00 0.00 ? 48 TRP A CG   5  
ATOM 6046  C CD1  . TRP A 1 48 ? -2.015  -7.592  -0.786  1.00 0.00 ? 48 TRP A CD1  5  
ATOM 6047  C CD2  . TRP A 1 48 ? -2.361  -5.536  -1.598  1.00 0.00 ? 48 TRP A CD2  5  
ATOM 6048  N NE1  . TRP A 1 48 ? -2.171  -7.699  -2.148  1.00 0.00 ? 48 TRP A NE1  5  
ATOM 6049  C CE2  . TRP A 1 48 ? -2.386  -6.450  -2.669  1.00 0.00 ? 48 TRP A CE2  5  
ATOM 6050  C CE3  . TRP A 1 48 ? -2.558  -4.179  -1.867  1.00 0.00 ? 48 TRP A CE3  5  
ATOM 6051  C CZ2  . TRP A 1 48 ? -2.598  -6.049  -3.986  1.00 0.00 ? 48 TRP A CZ2  5  
ATOM 6052  C CZ3  . TRP A 1 48 ? -2.770  -3.782  -3.174  1.00 0.00 ? 48 TRP A CZ3  5  
ATOM 6053  C CH2  . TRP A 1 48 ? -2.789  -4.714  -4.218  1.00 0.00 ? 48 TRP A CH2  5  
ATOM 6054  H H    . TRP A 1 48 ? -0.518  -7.209  2.913   1.00 0.00 ? 48 TRP A H    5  
ATOM 6055  H HA   . TRP A 1 48 ? 0.073   -5.423  0.648   1.00 0.00 ? 48 TRP A HA   5  
ATOM 6056  H HB2  . TRP A 1 48 ? -2.561  -6.417  1.643   1.00 0.00 ? 48 TRP A HB2  5  
ATOM 6057  H HB3  . TRP A 1 48 ? -2.469  -4.781  1.010   1.00 0.00 ? 48 TRP A HB3  5  
ATOM 6058  H HD1  . TRP A 1 48 ? -1.832  -8.408  -0.106  1.00 0.00 ? 48 TRP A HD1  5  
ATOM 6059  H HE1  . TRP A 1 48 ? -2.135  -8.533  -2.661  1.00 0.00 ? 48 TRP A HE1  5  
ATOM 6060  H HE3  . TRP A 1 48 ? -2.548  -3.445  -1.074  1.00 0.00 ? 48 TRP A HE3  5  
ATOM 6061  H HZ2  . TRP A 1 48 ? -2.616  -6.755  -4.802  1.00 0.00 ? 48 TRP A HZ2  5  
ATOM 6062  H HZ3  . TRP A 1 48 ? -2.924  -2.737  -3.401  1.00 0.00 ? 48 TRP A HZ3  5  
ATOM 6063  H HH2  . TRP A 1 48 ? -2.956  -4.359  -5.224  1.00 0.00 ? 48 TRP A HH2  5  
ATOM 6064  N N    . ALA A 1 49 ? -0.396  -3.286  2.018   1.00 0.00 ? 49 ALA A N    5  
ATOM 6065  C CA   . ALA A 1 49 ? -0.286  -2.122  2.889   1.00 0.00 ? 49 ALA A CA   5  
ATOM 6066  C C    . ALA A 1 49 ? -1.007  -0.919  2.291   1.00 0.00 ? 49 ALA A C    5  
ATOM 6067  O O    . ALA A 1 49 ? -0.524  -0.303  1.342   1.00 0.00 ? 49 ALA A O    5  
ATOM 6068  C CB   . ALA A 1 49 ? 1.177   -1.790  3.144   1.00 0.00 ? 49 ALA A CB   5  
ATOM 6069  H H    . ALA A 1 49 ? -0.426  -3.155  1.048   1.00 0.00 ? 49 ALA A H    5  
ATOM 6070  H HA   . ALA A 1 49 ? -0.744  -2.369  3.835   1.00 0.00 ? 49 ALA A HA   5  
ATOM 6071  H HB1  . ALA A 1 49 ? 1.685   -1.653  2.200   1.00 0.00 ? 49 ALA A HB1  5  
ATOM 6072  H HB2  . ALA A 1 49 ? 1.641   -2.600  3.688   1.00 0.00 ? 49 ALA A HB2  5  
ATOM 6073  H HB3  . ALA A 1 49 ? 1.243   -0.882  3.725   1.00 0.00 ? 49 ALA A HB3  5  
ATOM 6074  N N    . GLY A 1 50 ? -2.165  -0.590  2.854   1.00 0.00 ? 50 GLY A N    5  
ATOM 6075  C CA   . GLY A 1 50 ? -2.934  0.539   2.363   1.00 0.00 ? 50 GLY A CA   5  
ATOM 6076  C C    . GLY A 1 50 ? -2.383  1.868   2.840   1.00 0.00 ? 50 GLY A C    5  
ATOM 6077  O O    . GLY A 1 50 ? -1.895  1.978   3.965   1.00 0.00 ? 50 GLY A O    5  
ATOM 6078  H H    . GLY A 1 50 ? -2.500  -1.118  3.608   1.00 0.00 ? 50 GLY A H    5  
ATOM 6079  H HA2  . GLY A 1 50 ? -2.925  0.523   1.284   1.00 0.00 ? 50 GLY A HA2  5  
ATOM 6080  H HA3  . GLY A 1 50 ? -3.953  0.441   2.705   1.00 0.00 ? 50 GLY A HA3  5  
ATOM 6081  N N    . VAL A 1 51 ? -2.460  2.880   1.982   1.00 0.00 ? 51 VAL A N    5  
ATOM 6082  C CA   . VAL A 1 51 ? -1.965  4.209   2.321   1.00 0.00 ? 51 VAL A CA   5  
ATOM 6083  C C    . VAL A 1 51 ? -2.971  5.285   1.930   1.00 0.00 ? 51 VAL A C    5  
ATOM 6084  O O    . VAL A 1 51 ? -3.598  5.207   0.874   1.00 0.00 ? 51 VAL A O    5  
ATOM 6085  C CB   . VAL A 1 51 ? -0.621  4.502   1.627   1.00 0.00 ? 51 VAL A CB   5  
ATOM 6086  C CG1  . VAL A 1 51 ? -0.013  5.789   2.163   1.00 0.00 ? 51 VAL A CG1  5  
ATOM 6087  C CG2  . VAL A 1 51 ? 0.339   3.336   1.806   1.00 0.00 ? 51 VAL A CG2  5  
ATOM 6088  H H    . VAL A 1 51 ? -2.859  2.730   1.100   1.00 0.00 ? 51 VAL A H    5  
ATOM 6089  H HA   . VAL A 1 51 ? -1.810  4.244   3.390   1.00 0.00 ? 51 VAL A HA   5  
ATOM 6090  H HB   . VAL A 1 51 ? -0.805  4.630   0.571   1.00 0.00 ? 51 VAL A HB   5  
ATOM 6091  H HG11 . VAL A 1 51 ? 0.745   5.552   2.894   1.00 0.00 ? 51 VAL A HG11 5  
ATOM 6092  H HG12 . VAL A 1 51 ? -0.784  6.388   2.623   1.00 0.00 ? 51 VAL A HG12 5  
ATOM 6093  H HG13 . VAL A 1 51 ? 0.433   6.342   1.349   1.00 0.00 ? 51 VAL A HG13 5  
ATOM 6094  H HG21 . VAL A 1 51 ? 1.356   3.693   1.737   1.00 0.00 ? 51 VAL A HG21 5  
ATOM 6095  H HG22 . VAL A 1 51 ? 0.162   2.602   1.033   1.00 0.00 ? 51 VAL A HG22 5  
ATOM 6096  H HG23 . VAL A 1 51 ? 0.181   2.884   2.774   1.00 0.00 ? 51 VAL A HG23 5  
ATOM 6097  N N    . VAL A 1 52 ? -3.120  6.289   2.788   1.00 0.00 ? 52 VAL A N    5  
ATOM 6098  C CA   . VAL A 1 52 ? -4.051  7.381   2.531   1.00 0.00 ? 52 VAL A CA   5  
ATOM 6099  C C    . VAL A 1 52 ? -3.327  8.598   1.965   1.00 0.00 ? 52 VAL A C    5  
ATOM 6100  O O    . VAL A 1 52 ? -2.508  9.217   2.644   1.00 0.00 ? 52 VAL A O    5  
ATOM 6101  C CB   . VAL A 1 52 ? -4.801  7.794   3.811   1.00 0.00 ? 52 VAL A CB   5  
ATOM 6102  C CG1  . VAL A 1 52 ? -5.903  8.791   3.487   1.00 0.00 ? 52 VAL A CG1  5  
ATOM 6103  C CG2  . VAL A 1 52 ? -5.367  6.571   4.517   1.00 0.00 ? 52 VAL A CG2  5  
ATOM 6104  H H    . VAL A 1 52 ? -2.592  6.296   3.613   1.00 0.00 ? 52 VAL A H    5  
ATOM 6105  H HA   . VAL A 1 52 ? -4.777  7.038   1.808   1.00 0.00 ? 52 VAL A HA   5  
ATOM 6106  H HB   . VAL A 1 52 ? -4.098  8.275   4.477   1.00 0.00 ? 52 VAL A HB   5  
ATOM 6107  H HG11 . VAL A 1 52 ? -6.683  8.296   2.926   1.00 0.00 ? 52 VAL A HG11 5  
ATOM 6108  H HG12 . VAL A 1 52 ? -5.496  9.601   2.899   1.00 0.00 ? 52 VAL A HG12 5  
ATOM 6109  H HG13 . VAL A 1 52 ? -6.315  9.184   4.405   1.00 0.00 ? 52 VAL A HG13 5  
ATOM 6110  H HG21 . VAL A 1 52 ? -4.636  5.778   4.504   1.00 0.00 ? 52 VAL A HG21 5  
ATOM 6111  H HG22 . VAL A 1 52 ? -6.262  6.245   4.007   1.00 0.00 ? 52 VAL A HG22 5  
ATOM 6112  H HG23 . VAL A 1 52 ? -5.608  6.824   5.539   1.00 0.00 ? 52 VAL A HG23 5  
ATOM 6113  N N    . LEU A 1 53 ? -3.634  8.936   0.717   1.00 0.00 ? 53 LEU A N    5  
ATOM 6114  C CA   . LEU A 1 53 ? -3.012  10.079  0.059   1.00 0.00 ? 53 LEU A CA   5  
ATOM 6115  C C    . LEU A 1 53 ? -3.569  11.390  0.604   1.00 0.00 ? 53 LEU A C    5  
ATOM 6116  O O    . LEU A 1 53 ? -4.736  11.469  0.984   1.00 0.00 ? 53 LEU A O    5  
ATOM 6117  C CB   . LEU A 1 53 ? -3.234  10.005  -1.453  1.00 0.00 ? 53 LEU A CB   5  
ATOM 6118  C CG   . LEU A 1 53 ? -2.583  8.807   -2.146  1.00 0.00 ? 53 LEU A CG   5  
ATOM 6119  C CD1  . LEU A 1 53 ? -3.274  8.514   -3.468  1.00 0.00 ? 53 LEU A CD1  5  
ATOM 6120  C CD2  . LEU A 1 53 ? -1.098  9.061   -2.364  1.00 0.00 ? 53 LEU A CD2  5  
ATOM 6121  H H    . LEU A 1 53 ? -4.294  8.402   0.227   1.00 0.00 ? 53 LEU A H    5  
ATOM 6122  H HA   . LEU A 1 53 ? -1.952  10.040  0.260   1.00 0.00 ? 53 LEU A HA   5  
ATOM 6123  H HB2  . LEU A 1 53 ? -4.297  9.968   -1.638  1.00 0.00 ? 53 LEU A HB2  5  
ATOM 6124  H HB3  . LEU A 1 53 ? -2.840  10.907  -1.898  1.00 0.00 ? 53 LEU A HB3  5  
ATOM 6125  H HG   . LEU A 1 53 ? -2.685  7.936   -1.516  1.00 0.00 ? 53 LEU A HG   5  
ATOM 6126  H HD11 . LEU A 1 53 ? -2.861  7.614   -3.899  1.00 0.00 ? 53 LEU A HD11 5  
ATOM 6127  H HD12 . LEU A 1 53 ? -3.121  9.341   -4.146  1.00 0.00 ? 53 LEU A HD12 5  
ATOM 6128  H HD13 . LEU A 1 53 ? -4.332  8.379   -3.298  1.00 0.00 ? 53 LEU A HD13 5  
ATOM 6129  H HD21 . LEU A 1 53 ? -0.920  10.124  -2.428  1.00 0.00 ? 53 LEU A HD21 5  
ATOM 6130  H HD22 . LEU A 1 53 ? -0.783  8.587   -3.282  1.00 0.00 ? 53 LEU A HD22 5  
ATOM 6131  H HD23 . LEU A 1 53 ? -0.538  8.651   -1.536  1.00 0.00 ? 53 LEU A HD23 5  
ATOM 6132  N N    . ASP A 1 54 ? -2.724  12.416  0.637   1.00 0.00 ? 54 ASP A N    5  
ATOM 6133  C CA   . ASP A 1 54 ? -3.132  13.724  1.136   1.00 0.00 ? 54 ASP A CA   5  
ATOM 6134  C C    . ASP A 1 54 ? -4.153  14.368  0.203   1.00 0.00 ? 54 ASP A C    5  
ATOM 6135  O O    . ASP A 1 54 ? -5.076  15.048  0.652   1.00 0.00 ? 54 ASP A O    5  
ATOM 6136  C CB   . ASP A 1 54 ? -1.913  14.637  1.286   1.00 0.00 ? 54 ASP A CB   5  
ATOM 6137  C CG   . ASP A 1 54 ? -1.955  15.452  2.564   1.00 0.00 ? 54 ASP A CG   5  
ATOM 6138  O OD1  . ASP A 1 54 ? -2.187  14.859  3.638   1.00 0.00 ? 54 ASP A OD1  5  
ATOM 6139  O OD2  . ASP A 1 54 ? -1.756  16.683  2.491   1.00 0.00 ? 54 ASP A OD2  5  
ATOM 6140  H H    . ASP A 1 54 ? -1.806  12.290  0.321   1.00 0.00 ? 54 ASP A H    5  
ATOM 6141  H HA   . ASP A 1 54 ? -3.586  13.583  2.105   1.00 0.00 ? 54 ASP A HA   5  
ATOM 6142  H HB2  . ASP A 1 54 ? -1.018  14.034  1.297   1.00 0.00 ? 54 ASP A HB2  5  
ATOM 6143  H HB3  . ASP A 1 54 ? -1.873  15.317  0.448   1.00 0.00 ? 54 ASP A HB3  5  
ATOM 6144  N N    . ASP A 1 55 ? -3.981  14.148  -1.096  1.00 0.00 ? 55 ASP A N    5  
ATOM 6145  C CA   . ASP A 1 55 ? -4.887  14.707  -2.092  1.00 0.00 ? 55 ASP A CA   5  
ATOM 6146  C C    . ASP A 1 55 ? -5.780  13.619  -2.687  1.00 0.00 ? 55 ASP A C    5  
ATOM 6147  O O    . ASP A 1 55 ? -5.391  12.454  -2.754  1.00 0.00 ? 55 ASP A O    5  
ATOM 6148  C CB   . ASP A 1 55 ? -4.095  15.397  -3.204  1.00 0.00 ? 55 ASP A CB   5  
ATOM 6149  C CG   . ASP A 1 55 ? -3.274  16.564  -2.691  1.00 0.00 ? 55 ASP A CG   5  
ATOM 6150  O OD1  . ASP A 1 55 ? -2.383  16.337  -1.846  1.00 0.00 ? 55 ASP A OD1  5  
ATOM 6151  O OD2  . ASP A 1 55 ? -3.522  17.704  -3.134  1.00 0.00 ? 55 ASP A OD2  5  
ATOM 6152  H H    . ASP A 1 55 ? -3.226  13.598  -1.392  1.00 0.00 ? 55 ASP A H    5  
ATOM 6153  H HA   . ASP A 1 55 ? -5.511  15.438  -1.600  1.00 0.00 ? 55 ASP A HA   5  
ATOM 6154  H HB2  . ASP A 1 55 ? -3.424  14.681  -3.656  1.00 0.00 ? 55 ASP A HB2  5  
ATOM 6155  H HB3  . ASP A 1 55 ? -4.782  15.763  -3.952  1.00 0.00 ? 55 ASP A HB3  5  
ATOM 6156  N N    . PRO A 1 56 ? -6.993  13.989  -3.129  1.00 0.00 ? 56 PRO A N    5  
ATOM 6157  C CA   . PRO A 1 56 ? -7.941  13.039  -3.721  1.00 0.00 ? 56 PRO A CA   5  
ATOM 6158  C C    . PRO A 1 56 ? -7.487  12.549  -5.093  1.00 0.00 ? 56 PRO A C    5  
ATOM 6159  O O    . PRO A 1 56 ? -8.050  12.933  -6.119  1.00 0.00 ? 56 PRO A O    5  
ATOM 6160  C CB   . PRO A 1 56 ? -9.232  13.853  -3.842  1.00 0.00 ? 56 PRO A CB   5  
ATOM 6161  C CG   . PRO A 1 56 ? -8.780  15.269  -3.930  1.00 0.00 ? 56 PRO A CG   5  
ATOM 6162  C CD   . PRO A 1 56 ? -7.538  15.360  -3.088  1.00 0.00 ? 56 PRO A CD   5  
ATOM 6163  H HA   . PRO A 1 56 ? -8.106  12.191  -3.073  1.00 0.00 ? 56 PRO A HA   5  
ATOM 6164  H HB2  . PRO A 1 56 ? -9.769  13.552  -4.729  1.00 0.00 ? 56 PRO A HB2  5  
ATOM 6165  H HB3  . PRO A 1 56 ? -9.847  13.689  -2.969  1.00 0.00 ? 56 PRO A HB3  5  
ATOM 6166  H HG2  . PRO A 1 56 ? -8.557  15.520  -4.956  1.00 0.00 ? 56 PRO A HG2  5  
ATOM 6167  H HG3  . PRO A 1 56 ? -9.545  15.923  -3.541  1.00 0.00 ? 56 PRO A HG3  5  
ATOM 6168  H HD2  . PRO A 1 56 ? -6.840  16.064  -3.520  1.00 0.00 ? 56 PRO A HD2  5  
ATOM 6169  H HD3  . PRO A 1 56 ? -7.787  15.646  -2.077  1.00 0.00 ? 56 PRO A HD3  5  
ATOM 6170  N N    . VAL A 1 57 ? -6.467  11.698  -5.102  1.00 0.00 ? 57 VAL A N    5  
ATOM 6171  C CA   . VAL A 1 57 ? -5.937  11.155  -6.347  1.00 0.00 ? 57 VAL A CA   5  
ATOM 6172  C C    . VAL A 1 57 ? -5.531  9.695   -6.180  1.00 0.00 ? 57 VAL A C    5  
ATOM 6173  O O    . VAL A 1 57 ? -4.608  9.218   -6.838  1.00 0.00 ? 57 VAL A O    5  
ATOM 6174  C CB   . VAL A 1 57 ? -4.721  11.960  -6.840  1.00 0.00 ? 57 VAL A CB   5  
ATOM 6175  C CG1  . VAL A 1 57 ? -5.153  13.332  -7.335  1.00 0.00 ? 57 VAL A CG1  5  
ATOM 6176  C CG2  . VAL A 1 57 ? -3.682  12.087  -5.736  1.00 0.00 ? 57 VAL A CG2  5  
ATOM 6177  H H    . VAL A 1 57 ? -6.060  11.430  -4.252  1.00 0.00 ? 57 VAL A H    5  
ATOM 6178  H HA   . VAL A 1 57 ? -6.713  11.219  -7.096  1.00 0.00 ? 57 VAL A HA   5  
ATOM 6179  H HB   . VAL A 1 57 ? -4.274  11.429  -7.666  1.00 0.00 ? 57 VAL A HB   5  
ATOM 6180  H HG11 . VAL A 1 57 ? -5.408  13.272  -8.383  1.00 0.00 ? 57 VAL A HG11 5  
ATOM 6181  H HG12 . VAL A 1 57 ? -4.343  14.035  -7.201  1.00 0.00 ? 57 VAL A HG12 5  
ATOM 6182  H HG13 . VAL A 1 57 ? -6.014  13.663  -6.774  1.00 0.00 ? 57 VAL A HG13 5  
ATOM 6183  H HG21 . VAL A 1 57 ? -4.104  12.633  -4.905  1.00 0.00 ? 57 VAL A HG21 5  
ATOM 6184  H HG22 . VAL A 1 57 ? -2.819  12.616  -6.112  1.00 0.00 ? 57 VAL A HG22 5  
ATOM 6185  H HG23 . VAL A 1 57 ? -3.386  11.102  -5.406  1.00 0.00 ? 57 VAL A HG23 5  
ATOM 6186  N N    . GLY A 1 58 ? -6.227  8.990   -5.294  1.00 0.00 ? 58 GLY A N    5  
ATOM 6187  C CA   . GLY A 1 58 ? -5.925  7.591   -5.057  1.00 0.00 ? 58 GLY A CA   5  
ATOM 6188  C C    . GLY A 1 58 ? -6.728  6.665   -5.949  1.00 0.00 ? 58 GLY A C    5  
ATOM 6189  O O    . GLY A 1 58 ? -6.886  6.923   -7.142  1.00 0.00 ? 58 GLY A O    5  
ATOM 6190  H H    . GLY A 1 58 ? -6.953  9.423   -4.798  1.00 0.00 ? 58 GLY A H    5  
ATOM 6191  H HA2  . GLY A 1 58 ? -4.874  7.426   -5.238  1.00 0.00 ? 58 GLY A HA2  5  
ATOM 6192  H HA3  . GLY A 1 58 ? -6.142  7.357   -4.025  1.00 0.00 ? 58 GLY A HA3  5  
ATOM 6193  N N    . LYS A 1 59 ? -7.236  5.581   -5.369  1.00 0.00 ? 59 LYS A N    5  
ATOM 6194  C CA   . LYS A 1 59 ? -8.027  4.613   -6.119  1.00 0.00 ? 59 LYS A CA   5  
ATOM 6195  C C    . LYS A 1 59 ? -9.302  4.252   -5.366  1.00 0.00 ? 59 LYS A C    5  
ATOM 6196  O O    . LYS A 1 59 ? -10.395 4.684   -5.731  1.00 0.00 ? 59 LYS A O    5  
ATOM 6197  C CB   . LYS A 1 59 ? -7.205  3.351   -6.389  1.00 0.00 ? 59 LYS A CB   5  
ATOM 6198  C CG   . LYS A 1 59 ? -6.389  3.420   -7.669  1.00 0.00 ? 59 LYS A CG   5  
ATOM 6199  C CD   . LYS A 1 59 ? -6.369  2.080   -8.393  1.00 0.00 ? 59 LYS A CD   5  
ATOM 6200  C CE   . LYS A 1 59 ? -7.117  2.147   -9.714  1.00 0.00 ? 59 LYS A CE   5  
ATOM 6201  N NZ   . LYS A 1 59 ? -7.315  0.796   -10.310 1.00 0.00 ? 59 LYS A NZ   5  
ATOM 6202  H H    . LYS A 1 59 ? -7.075  5.431   -4.415  1.00 0.00 ? 59 LYS A H    5  
ATOM 6203  H HA   . LYS A 1 59 ? -8.296  5.065   -7.062  1.00 0.00 ? 59 LYS A HA   5  
ATOM 6204  H HB2  . LYS A 1 59 ? -6.527  3.195   -5.563  1.00 0.00 ? 59 LYS A HB2  5  
ATOM 6205  H HB3  . LYS A 1 59 ? -7.876  2.507   -6.458  1.00 0.00 ? 59 LYS A HB3  5  
ATOM 6206  H HG2  . LYS A 1 59 ? -6.822  4.163   -8.322  1.00 0.00 ? 59 LYS A HG2  5  
ATOM 6207  H HG3  . LYS A 1 59 ? -5.375  3.701   -7.424  1.00 0.00 ? 59 LYS A HG3  5  
ATOM 6208  H HD2  . LYS A 1 59 ? -5.343  1.802   -8.586  1.00 0.00 ? 59 LYS A HD2  5  
ATOM 6209  H HD3  . LYS A 1 59 ? -6.833  1.334   -7.764  1.00 0.00 ? 59 LYS A HD3  5  
ATOM 6210  H HE2  . LYS A 1 59 ? -8.083  2.600   -9.544  1.00 0.00 ? 59 LYS A HE2  5  
ATOM 6211  H HE3  . LYS A 1 59 ? -6.551  2.756   -10.404 1.00 0.00 ? 59 LYS A HE3  5  
ATOM 6212  H HZ1  . LYS A 1 59 ? -6.575  0.146   -9.973  1.00 0.00 ? 59 LYS A HZ1  5  
ATOM 6213  H HZ2  . LYS A 1 59 ? -7.264  0.852   -11.347 1.00 0.00 ? 59 LYS A HZ2  5  
ATOM 6214  H HZ3  . LYS A 1 59 ? -8.245  0.418   -10.038 1.00 0.00 ? 59 LYS A HZ3  5  
ATOM 6215  N N    . ASN A 1 60 ? -9.154  3.457   -4.310  1.00 0.00 ? 60 ASN A N    5  
ATOM 6216  C CA   . ASN A 1 60 ? -10.294 3.037   -3.504  1.00 0.00 ? 60 ASN A CA   5  
ATOM 6217  C C    . ASN A 1 60 ? -10.613 4.073   -2.431  1.00 0.00 ? 60 ASN A C    5  
ATOM 6218  O O    . ASN A 1 60 ? -9.996  5.137   -2.378  1.00 0.00 ? 60 ASN A O    5  
ATOM 6219  C CB   . ASN A 1 60 ? -10.014 1.682   -2.854  1.00 0.00 ? 60 ASN A CB   5  
ATOM 6220  C CG   . ASN A 1 60 ? -9.725  0.598   -3.876  1.00 0.00 ? 60 ASN A CG   5  
ATOM 6221  O OD1  . ASN A 1 60 ? -10.637 -0.071  -4.362  1.00 0.00 ? 60 ASN A OD1  5  
ATOM 6222  N ND2  . ASN A 1 60 ? -8.451  0.421   -4.207  1.00 0.00 ? 60 ASN A ND2  5  
ATOM 6223  H H    . ASN A 1 60 ? -8.257  3.146   -4.068  1.00 0.00 ? 60 ASN A H    5  
ATOM 6224  H HA   . ASN A 1 60 ? -11.147 2.942   -4.160  1.00 0.00 ? 60 ASN A HA   5  
ATOM 6225  H HB2  . ASN A 1 60 ? -9.157  1.772   -2.203  1.00 0.00 ? 60 ASN A HB2  5  
ATOM 6226  H HB3  . ASN A 1 60 ? -10.873 1.383   -2.272  1.00 0.00 ? 60 ASN A HB3  5  
ATOM 6227  H HD21 . ASN A 1 60 ? -7.778  0.992   -3.779  1.00 0.00 ? 60 ASN A HD21 5  
ATOM 6228  H HD22 . ASN A 1 60 ? -8.236  -0.271  -4.866  1.00 0.00 ? 60 ASN A HD22 5  
ATOM 6229  N N    . ASP A 1 61 ? -11.580 3.754   -1.577  1.00 0.00 ? 61 ASP A N    5  
ATOM 6230  C CA   . ASP A 1 61 ? -11.981 4.658   -0.504  1.00 0.00 ? 61 ASP A CA   5  
ATOM 6231  C C    . ASP A 1 61 ? -11.943 3.950   0.846   1.00 0.00 ? 61 ASP A C    5  
ATOM 6232  O O    . ASP A 1 61 ? -12.719 4.267   1.747   1.00 0.00 ? 61 ASP A O    5  
ATOM 6233  C CB   . ASP A 1 61 ? -13.387 5.202   -0.767  1.00 0.00 ? 61 ASP A CB   5  
ATOM 6234  C CG   . ASP A 1 61 ? -14.417 4.100   -0.908  1.00 0.00 ? 61 ASP A CG   5  
ATOM 6235  O OD1  . ASP A 1 61 ? -14.484 3.483   -1.992  1.00 0.00 ? 61 ASP A OD1  5  
ATOM 6236  O OD2  . ASP A 1 61 ? -15.160 3.853   0.066   1.00 0.00 ? 61 ASP A OD2  5  
ATOM 6237  H H    . ASP A 1 61 ? -12.036 2.891   -1.670  1.00 0.00 ? 61 ASP A H    5  
ATOM 6238  H HA   . ASP A 1 61 ? -11.283 5.481   -0.486  1.00 0.00 ? 61 ASP A HA   5  
ATOM 6239  H HB2  . ASP A 1 61 ? -13.678 5.840   0.054   1.00 0.00 ? 61 ASP A HB2  5  
ATOM 6240  H HB3  . ASP A 1 61 ? -13.377 5.780   -1.680  1.00 0.00 ? 61 ASP A HB3  5  
ATOM 6241  N N    . GLY A 1 62 ? -11.033 2.990   0.980   1.00 0.00 ? 62 GLY A N    5  
ATOM 6242  C CA   . GLY A 1 62 ? -10.911 2.254   2.224   1.00 0.00 ? 62 GLY A CA   5  
ATOM 6243  C C    . GLY A 1 62 ? -11.484 0.854   2.129   1.00 0.00 ? 62 GLY A C    5  
ATOM 6244  O O    . GLY A 1 62 ? -10.993 -0.070  2.779   1.00 0.00 ? 62 GLY A O    5  
ATOM 6245  H H    . GLY A 1 62 ? -10.441 2.781   0.228   1.00 0.00 ? 62 GLY A H    5  
ATOM 6246  H HA2  . GLY A 1 62 ? -9.866  2.186   2.488   1.00 0.00 ? 62 GLY A HA2  5  
ATOM 6247  H HA3  . GLY A 1 62 ? -11.433 2.793   3.001   1.00 0.00 ? 62 GLY A HA3  5  
ATOM 6248  N N    . ALA A 1 63 ? -12.524 0.696   1.317   1.00 0.00 ? 63 ALA A N    5  
ATOM 6249  C CA   . ALA A 1 63 ? -13.164 -0.602  1.140   1.00 0.00 ? 63 ALA A CA   5  
ATOM 6250  C C    . ALA A 1 63 ? -13.052 -1.077  -0.305  1.00 0.00 ? 63 ALA A C    5  
ATOM 6251  O O    . ALA A 1 63 ? -13.259 -0.304  -1.241  1.00 0.00 ? 63 ALA A O    5  
ATOM 6252  C CB   . ALA A 1 63 ? -14.624 -0.531  1.561   1.00 0.00 ? 63 ALA A CB   5  
ATOM 6253  H H    . ALA A 1 63 ? -12.869 1.470   0.826   1.00 0.00 ? 63 ALA A H    5  
ATOM 6254  H HA   . ALA A 1 63 ? -12.662 -1.312  1.781   1.00 0.00 ? 63 ALA A HA   5  
ATOM 6255  H HB1  . ALA A 1 63 ? -14.941 -1.499  1.925   1.00 0.00 ? 63 ALA A HB1  5  
ATOM 6256  H HB2  . ALA A 1 63 ? -15.231 -0.250  0.714   1.00 0.00 ? 63 ALA A HB2  5  
ATOM 6257  H HB3  . ALA A 1 63 ? -14.738 0.202   2.345   1.00 0.00 ? 63 ALA A HB3  5  
ATOM 6258  N N    . VAL A 1 64 ? -12.724 -2.354  -0.479  1.00 0.00 ? 64 VAL A N    5  
ATOM 6259  C CA   . VAL A 1 64 ? -12.585 -2.933  -1.810  1.00 0.00 ? 64 VAL A CA   5  
ATOM 6260  C C    . VAL A 1 64 ? -13.432 -4.192  -1.952  1.00 0.00 ? 64 VAL A C    5  
ATOM 6261  O O    . VAL A 1 64 ? -13.485 -5.021  -1.044  1.00 0.00 ? 64 VAL A O    5  
ATOM 6262  C CB   . VAL A 1 64 ? -11.115 -3.278  -2.123  1.00 0.00 ? 64 VAL A CB   5  
ATOM 6263  C CG1  . VAL A 1 64 ? -10.966 -3.721  -3.570  1.00 0.00 ? 64 VAL A CG1  5  
ATOM 6264  C CG2  . VAL A 1 64 ? -10.210 -2.090  -1.825  1.00 0.00 ? 64 VAL A CG2  5  
ATOM 6265  H H    . VAL A 1 64 ? -12.573 -2.920  0.306   1.00 0.00 ? 64 VAL A H    5  
ATOM 6266  H HA   . VAL A 1 64 ? -12.921 -2.200  -2.530  1.00 0.00 ? 64 VAL A HA   5  
ATOM 6267  H HB   . VAL A 1 64 ? -10.817 -4.098  -1.487  1.00 0.00 ? 64 VAL A HB   5  
ATOM 6268  H HG11 . VAL A 1 64 ? -10.611 -2.893  -4.165  1.00 0.00 ? 64 VAL A HG11 5  
ATOM 6269  H HG12 . VAL A 1 64 ? -11.923 -4.050  -3.946  1.00 0.00 ? 64 VAL A HG12 5  
ATOM 6270  H HG13 . VAL A 1 64 ? -10.258 -4.535  -3.626  1.00 0.00 ? 64 VAL A HG13 5  
ATOM 6271  H HG21 . VAL A 1 64 ? -9.336  -2.430  -1.290  1.00 0.00 ? 64 VAL A HG21 5  
ATOM 6272  H HG22 . VAL A 1 64 ? -10.744 -1.371  -1.221  1.00 0.00 ? 64 VAL A HG22 5  
ATOM 6273  H HG23 . VAL A 1 64 ? -9.907  -1.627  -2.753  1.00 0.00 ? 64 VAL A HG23 5  
ATOM 6274  N N    . GLY A 1 65 ? -14.094 -4.329  -3.096  1.00 0.00 ? 65 GLY A N    5  
ATOM 6275  C CA   . GLY A 1 65 ? -14.930 -5.490  -3.335  1.00 0.00 ? 65 GLY A CA   5  
ATOM 6276  C C    . GLY A 1 65 ? -16.090 -5.579  -2.363  1.00 0.00 ? 65 GLY A C    5  
ATOM 6277  O O    . GLY A 1 65 ? -17.155 -5.011  -2.604  1.00 0.00 ? 65 GLY A O    5  
ATOM 6278  H H    . GLY A 1 65 ? -14.013 -3.635  -3.784  1.00 0.00 ? 65 GLY A H    5  
ATOM 6279  H HA2  . GLY A 1 65 ? -15.320 -5.438  -4.341  1.00 0.00 ? 65 GLY A HA2  5  
ATOM 6280  H HA3  . GLY A 1 65 ? -14.326 -6.380  -3.240  1.00 0.00 ? 65 GLY A HA3  5  
ATOM 6281  N N    . GLY A 1 66 ? -15.883 -6.295  -1.262  1.00 0.00 ? 66 GLY A N    5  
ATOM 6282  C CA   . GLY A 1 66 ? -16.929 -6.443  -0.268  1.00 0.00 ? 66 GLY A CA   5  
ATOM 6283  C C    . GLY A 1 66 ? -16.384 -6.477  1.146   1.00 0.00 ? 66 GLY A C    5  
ATOM 6284  O O    . GLY A 1 66 ? -16.978 -7.091  2.033   1.00 0.00 ? 66 GLY A O    5  
ATOM 6285  H H    . GLY A 1 66 ? -15.014 -6.726  -1.125  1.00 0.00 ? 66 GLY A H    5  
ATOM 6286  H HA2  . GLY A 1 66 ? -17.616 -5.615  -0.357  1.00 0.00 ? 66 GLY A HA2  5  
ATOM 6287  H HA3  . GLY A 1 66 ? -17.464 -7.363  -0.457  1.00 0.00 ? 66 GLY A HA3  5  
ATOM 6288  N N    . VAL A 1 67 ? -15.250 -5.816  1.358   1.00 0.00 ? 67 VAL A N    5  
ATOM 6289  C CA   . VAL A 1 67 ? -14.625 -5.773  2.674   1.00 0.00 ? 67 VAL A CA   5  
ATOM 6290  C C    . VAL A 1 67 ? -13.988 -4.412  2.935   1.00 0.00 ? 67 VAL A C    5  
ATOM 6291  O O    . VAL A 1 67 ? -13.358 -3.831  2.052   1.00 0.00 ? 67 VAL A O    5  
ATOM 6292  C CB   . VAL A 1 67 ? -13.550 -6.866  2.822   1.00 0.00 ? 67 VAL A CB   5  
ATOM 6293  C CG1  . VAL A 1 67 ? -13.052 -6.936  4.257   1.00 0.00 ? 67 VAL A CG1  5  
ATOM 6294  C CG2  . VAL A 1 67 ? -14.094 -8.214  2.373   1.00 0.00 ? 67 VAL A CG2  5  
ATOM 6295  H H    . VAL A 1 67 ? -14.825 -5.346  0.611   1.00 0.00 ? 67 VAL A H    5  
ATOM 6296  H HA   . VAL A 1 67 ? -15.393 -5.949  3.414   1.00 0.00 ? 67 VAL A HA   5  
ATOM 6297  H HB   . VAL A 1 67 ? -12.715 -6.610  2.187   1.00 0.00 ? 67 VAL A HB   5  
ATOM 6298  H HG11 . VAL A 1 67 ? -11.992 -7.141  4.261   1.00 0.00 ? 67 VAL A HG11 5  
ATOM 6299  H HG12 . VAL A 1 67 ? -13.573 -7.724  4.781   1.00 0.00 ? 67 VAL A HG12 5  
ATOM 6300  H HG13 . VAL A 1 67 ? -13.238 -5.992  4.748   1.00 0.00 ? 67 VAL A HG13 5  
ATOM 6301  H HG21 . VAL A 1 67 ? -13.295 -8.939  2.360   1.00 0.00 ? 67 VAL A HG21 5  
ATOM 6302  H HG22 . VAL A 1 67 ? -14.512 -8.122  1.381   1.00 0.00 ? 67 VAL A HG22 5  
ATOM 6303  H HG23 . VAL A 1 67 ? -14.863 -8.539  3.058   1.00 0.00 ? 67 VAL A HG23 5  
ATOM 6304  N N    . ARG A 1 68 ? -14.157 -3.911  4.154   1.00 0.00 ? 68 ARG A N    5  
ATOM 6305  C CA   . ARG A 1 68 ? -13.598 -2.617  4.532   1.00 0.00 ? 68 ARG A CA   5  
ATOM 6306  C C    . ARG A 1 68 ? -12.323 -2.794  5.349   1.00 0.00 ? 68 ARG A C    5  
ATOM 6307  O O    . ARG A 1 68 ? -12.197 -3.740  6.126   1.00 0.00 ? 68 ARG A O    5  
ATOM 6308  C CB   . ARG A 1 68 ? -14.623 -1.810  5.330   1.00 0.00 ? 68 ARG A CB   5  
ATOM 6309  C CG   . ARG A 1 68 ? -14.145 -0.413  5.694   1.00 0.00 ? 68 ARG A CG   5  
ATOM 6310  C CD   . ARG A 1 68 ? -14.891 0.133   6.902   1.00 0.00 ? 68 ARG A CD   5  
ATOM 6311  N NE   . ARG A 1 68 ? -16.331 0.206   6.668   1.00 0.00 ? 68 ARG A NE   5  
ATOM 6312  C CZ   . ARG A 1 68 ? -17.235 0.305   7.640   1.00 0.00 ? 68 ARG A CZ   5  
ATOM 6313  N NH1  . ARG A 1 68 ? -16.853 0.342   8.911   1.00 0.00 ? 68 ARG A NH1  5  
ATOM 6314  N NH2  . ARG A 1 68 ? -18.525 0.367   7.340   1.00 0.00 ? 68 ARG A NH2  5  
ATOM 6315  H H    . ARG A 1 68 ? -14.669 -4.421  4.815   1.00 0.00 ? 68 ARG A H    5  
ATOM 6316  H HA   . ARG A 1 68 ? -13.359 -2.082  3.625   1.00 0.00 ? 68 ARG A HA   5  
ATOM 6317  H HB2  . ARG A 1 68 ? -15.527 -1.715  4.743   1.00 0.00 ? 68 ARG A HB2  5  
ATOM 6318  H HB3  . ARG A 1 68 ? -14.848 -2.341  6.246   1.00 0.00 ? 68 ARG A HB3  5  
ATOM 6319  H HG2  . ARG A 1 68 ? -13.091 -0.452  5.923   1.00 0.00 ? 68 ARG A HG2  5  
ATOM 6320  H HG3  . ARG A 1 68 ? -14.309 0.244   4.853   1.00 0.00 ? 68 ARG A HG3  5  
ATOM 6321  H HD2  . ARG A 1 68 ? -14.705 -0.514  7.746   1.00 0.00 ? 68 ARG A HD2  5  
ATOM 6322  H HD3  . ARG A 1 68 ? -14.519 1.123   7.120   1.00 0.00 ? 68 ARG A HD3  5  
ATOM 6323  H HE   . ARG A 1 68 ? -16.641 0.181   5.739   1.00 0.00 ? 68 ARG A HE   5  
ATOM 6324  H HH11 . ARG A 1 68 ? -15.882 0.296   9.144   1.00 0.00 ? 68 ARG A HH11 5  
ATOM 6325  H HH12 . ARG A 1 68 ? -17.537 0.417   9.636   1.00 0.00 ? 68 ARG A HH12 5  
ATOM 6326  H HH21 . ARG A 1 68 ? -18.819 0.339   6.385   1.00 0.00 ? 68 ARG A HH21 5  
ATOM 6327  H HH22 . ARG A 1 68 ? -19.205 0.441   8.070   1.00 0.00 ? 68 ARG A HH22 5  
ATOM 6328  N N    . TYR A 1 69 ? -11.379 -1.875  5.170   1.00 0.00 ? 69 TYR A N    5  
ATOM 6329  C CA   . TYR A 1 69 ? -10.113 -1.929  5.892   1.00 0.00 ? 69 TYR A CA   5  
ATOM 6330  C C    . TYR A 1 69 ? -9.931  -0.691  6.763   1.00 0.00 ? 69 TYR A C    5  
ATOM 6331  O O    . TYR A 1 69 ? -9.868  -0.785  7.989   1.00 0.00 ? 69 TYR A O    5  
ATOM 6332  C CB   . TYR A 1 69 ? -8.947  -2.051  4.909   1.00 0.00 ? 69 TYR A CB   5  
ATOM 6333  C CG   . TYR A 1 69 ? -9.074  -3.222  3.960   1.00 0.00 ? 69 TYR A CG   5  
ATOM 6334  C CD1  . TYR A 1 69 ? -9.719  -3.083  2.738   1.00 0.00 ? 69 TYR A CD1  5  
ATOM 6335  C CD2  . TYR A 1 69 ? -8.547  -4.466  4.287   1.00 0.00 ? 69 TYR A CD2  5  
ATOM 6336  C CE1  . TYR A 1 69 ? -9.837  -4.151  1.869   1.00 0.00 ? 69 TYR A CE1  5  
ATOM 6337  C CE2  . TYR A 1 69 ? -8.661  -5.538  3.422   1.00 0.00 ? 69 TYR A CE2  5  
ATOM 6338  C CZ   . TYR A 1 69 ? -9.306  -5.375  2.216   1.00 0.00 ? 69 TYR A CZ   5  
ATOM 6339  O OH   . TYR A 1 69 ? -9.422  -6.441  1.352   1.00 0.00 ? 69 TYR A OH   5  
ATOM 6340  H H    . TYR A 1 69 ? -11.538 -1.144  4.537   1.00 0.00 ? 69 TYR A H    5  
ATOM 6341  H HA   . TYR A 1 69 ? -10.130 -2.802  6.527   1.00 0.00 ? 69 TYR A HA   5  
ATOM 6342  H HB2  . TYR A 1 69 ? -8.888  -1.150  4.317   1.00 0.00 ? 69 TYR A HB2  5  
ATOM 6343  H HB3  . TYR A 1 69 ? -8.028  -2.171  5.465   1.00 0.00 ? 69 TYR A HB3  5  
ATOM 6344  H HD1  . TYR A 1 69 ? -10.134 -2.122  2.470   1.00 0.00 ? 69 TYR A HD1  5  
ATOM 6345  H HD2  . TYR A 1 69 ? -8.042  -4.589  5.235   1.00 0.00 ? 69 TYR A HD2  5  
ATOM 6346  H HE1  . TYR A 1 69 ? -10.343 -4.023  0.924   1.00 0.00 ? 69 TYR A HE1  5  
ATOM 6347  H HE2  . TYR A 1 69 ? -8.245  -6.496  3.695   1.00 0.00 ? 69 TYR A HE2  5  
ATOM 6348  H HH   . TYR A 1 69 ? -10.310 -6.462  0.986   1.00 0.00 ? 69 TYR A HH   5  
ATOM 6349  N N    . PHE A 1 70 ? -9.846  0.471   6.122   1.00 0.00 ? 70 PHE A N    5  
ATOM 6350  C CA   . PHE A 1 70 ? -9.671  1.728   6.839   1.00 0.00 ? 70 PHE A CA   5  
ATOM 6351  C C    . PHE A 1 70 ? -10.698 2.761   6.386   1.00 0.00 ? 70 PHE A C    5  
ATOM 6352  O O    . PHE A 1 70 ? -10.951 2.917   5.192   1.00 0.00 ? 70 PHE A O    5  
ATOM 6353  C CB   . PHE A 1 70 ? -8.257  2.271   6.621   1.00 0.00 ? 70 PHE A CB   5  
ATOM 6354  C CG   . PHE A 1 70 ? -7.864  2.359   5.174   1.00 0.00 ? 70 PHE A CG   5  
ATOM 6355  C CD1  . PHE A 1 70 ? -8.170  3.486   4.427   1.00 0.00 ? 70 PHE A CD1  5  
ATOM 6356  C CD2  . PHE A 1 70 ? -7.190  1.315   4.560   1.00 0.00 ? 70 PHE A CD2  5  
ATOM 6357  C CE1  . PHE A 1 70 ? -7.809  3.571   3.095   1.00 0.00 ? 70 PHE A CE1  5  
ATOM 6358  C CE2  . PHE A 1 70 ? -6.827  1.395   3.228   1.00 0.00 ? 70 PHE A CE2  5  
ATOM 6359  C CZ   . PHE A 1 70 ? -7.138  2.524   2.495   1.00 0.00 ? 70 PHE A CZ   5  
ATOM 6360  H H    . PHE A 1 70 ? -9.902  0.482   5.143   1.00 0.00 ? 70 PHE A H    5  
ATOM 6361  H HA   . PHE A 1 70 ? -9.813  1.534   7.890   1.00 0.00 ? 70 PHE A HA   5  
ATOM 6362  H HB2  . PHE A 1 70 ? -8.189  3.261   7.044   1.00 0.00 ? 70 PHE A HB2  5  
ATOM 6363  H HB3  . PHE A 1 70 ? -7.550  1.623   7.118   1.00 0.00 ? 70 PHE A HB3  5  
ATOM 6364  H HD1  . PHE A 1 70 ? -8.694  4.306   4.896   1.00 0.00 ? 70 PHE A HD1  5  
ATOM 6365  H HD2  . PHE A 1 70 ? -6.947  0.432   5.132   1.00 0.00 ? 70 PHE A HD2  5  
ATOM 6366  H HE1  . PHE A 1 70 ? -8.053  4.454   2.525   1.00 0.00 ? 70 PHE A HE1  5  
ATOM 6367  H HE2  . PHE A 1 70 ? -6.303  0.574   2.762   1.00 0.00 ? 70 PHE A HE2  5  
ATOM 6368  H HZ   . PHE A 1 70 ? -6.855  2.587   1.455   1.00 0.00 ? 70 PHE A HZ   5  
ATOM 6369  N N    . GLU A 1 71 ? -11.288 3.463   7.349   1.00 0.00 ? 71 GLU A N    5  
ATOM 6370  C CA   . GLU A 1 71 ? -12.288 4.480   7.049   1.00 0.00 ? 71 GLU A CA   5  
ATOM 6371  C C    . GLU A 1 71 ? -11.625 5.805   6.686   1.00 0.00 ? 71 GLU A C    5  
ATOM 6372  O O    . GLU A 1 71 ? -11.274 6.596   7.562   1.00 0.00 ? 71 GLU A O    5  
ATOM 6373  C CB   . GLU A 1 71 ? -13.222 4.675   8.245   1.00 0.00 ? 71 GLU A CB   5  
ATOM 6374  C CG   . GLU A 1 71 ? -14.163 3.504   8.479   1.00 0.00 ? 71 GLU A CG   5  
ATOM 6375  C CD   . GLU A 1 71 ? -15.383 3.549   7.581   1.00 0.00 ? 71 GLU A CD   5  
ATOM 6376  O OE1  . GLU A 1 71 ? -15.211 3.690   6.351   1.00 0.00 ? 71 GLU A OE1  5  
ATOM 6377  O OE2  . GLU A 1 71 ? -16.511 3.442   8.105   1.00 0.00 ? 71 GLU A OE2  5  
ATOM 6378  H H    . GLU A 1 71 ? -11.043 3.293   8.282   1.00 0.00 ? 71 GLU A H    5  
ATOM 6379  H HA   . GLU A 1 71 ? -12.866 4.139   6.204   1.00 0.00 ? 71 GLU A HA   5  
ATOM 6380  H HB2  . GLU A 1 71 ? -12.626 4.812   9.134   1.00 0.00 ? 71 GLU A HB2  5  
ATOM 6381  H HB3  . GLU A 1 71 ? -13.819 5.560   8.081   1.00 0.00 ? 71 GLU A HB3  5  
ATOM 6382  H HG2  . GLU A 1 71 ? -13.628 2.585   8.287   1.00 0.00 ? 71 GLU A HG2  5  
ATOM 6383  H HG3  . GLU A 1 71 ? -14.489 3.521   9.508   1.00 0.00 ? 71 GLU A HG3  5  
ATOM 6384  N N    . CYS A 1 72 ? -11.457 6.043   5.389   1.00 0.00 ? 72 CYS A N    5  
ATOM 6385  C CA   . CYS A 1 72 ? -10.836 7.272   4.911   1.00 0.00 ? 72 CYS A CA   5  
ATOM 6386  C C    . CYS A 1 72 ? -11.611 7.850   3.730   1.00 0.00 ? 72 CYS A C    5  
ATOM 6387  O O    . CYS A 1 72 ? -12.399 7.151   3.092   1.00 0.00 ? 72 CYS A O    5  
ATOM 6388  C CB   . CYS A 1 72 ? -9.385  7.011   4.505   1.00 0.00 ? 72 CYS A CB   5  
ATOM 6389  S SG   . CYS A 1 72 ? -8.263  6.756   5.899   1.00 0.00 ? 72 CYS A SG   5  
ATOM 6390  H H    . CYS A 1 72 ? -11.757 5.374   4.739   1.00 0.00 ? 72 CYS A H    5  
ATOM 6391  H HA   . CYS A 1 72 ? -10.850 7.987   5.720   1.00 0.00 ? 72 CYS A HA   5  
ATOM 6392  H HB2  . CYS A 1 72 ? -9.346  6.126   3.886   1.00 0.00 ? 72 CYS A HB2  5  
ATOM 6393  H HB3  . CYS A 1 72 ? -9.020  7.855   3.939   1.00 0.00 ? 72 CYS A HB3  5  
ATOM 6394  H HG   . CYS A 1 72 ? -8.167  7.592   6.360   1.00 0.00 ? 72 CYS A HG   5  
ATOM 6395  N N    . PRO A 1 73 ? -11.396 9.140   3.420   1.00 0.00 ? 73 PRO A N    5  
ATOM 6396  C CA   . PRO A 1 73 ? -12.079 9.810   2.308   1.00 0.00 ? 73 PRO A CA   5  
ATOM 6397  C C    . PRO A 1 73 ? -11.916 9.057   0.992   1.00 0.00 ? 73 PRO A C    5  
ATOM 6398  O O    . PRO A 1 73 ? -10.987 8.267   0.829   1.00 0.00 ? 73 PRO A O    5  
ATOM 6399  C CB   . PRO A 1 73 ? -11.387 11.174  2.233   1.00 0.00 ? 73 PRO A CB   5  
ATOM 6400  C CG   . PRO A 1 73 ? -10.845 11.403  3.600   1.00 0.00 ? 73 PRO A CG   5  
ATOM 6401  C CD   . PRO A 1 73 ? -10.472 10.046  4.128   1.00 0.00 ? 73 PRO A CD   5  
ATOM 6402  H HA   . PRO A 1 73 ? -13.130 9.947   2.515   1.00 0.00 ? 73 PRO A HA   5  
ATOM 6403  H HB2  . PRO A 1 73 ? -10.599 11.140  1.495   1.00 0.00 ? 73 PRO A HB2  5  
ATOM 6404  H HB3  . PRO A 1 73 ? -12.107 11.931  1.963   1.00 0.00 ? 73 PRO A HB3  5  
ATOM 6405  H HG2  . PRO A 1 73 ? -9.972  12.038  3.549   1.00 0.00 ? 73 PRO A HG2  5  
ATOM 6406  H HG3  . PRO A 1 73 ? -11.601 11.853  4.225   1.00 0.00 ? 73 PRO A HG3  5  
ATOM 6407  H HD2  . PRO A 1 73 ? -9.445  9.814   3.886   1.00 0.00 ? 73 PRO A HD2  5  
ATOM 6408  H HD3  . PRO A 1 73 ? -10.629 9.998   5.195   1.00 0.00 ? 73 PRO A HD3  5  
ATOM 6409  N N    . ALA A 1 74 ? -12.827 9.307   0.057   1.00 0.00 ? 74 ALA A N    5  
ATOM 6410  C CA   . ALA A 1 74 ? -12.784 8.653   -1.245  1.00 0.00 ? 74 ALA A CA   5  
ATOM 6411  C C    . ALA A 1 74 ? -11.637 9.192   -2.093  1.00 0.00 ? 74 ALA A C    5  
ATOM 6412  O O    . ALA A 1 74 ? -11.160 10.306  -1.874  1.00 0.00 ? 74 ALA A O    5  
ATOM 6413  C CB   . ALA A 1 74 ? -14.109 8.834   -1.970  1.00 0.00 ? 74 ALA A CB   5  
ATOM 6414  H H    . ALA A 1 74 ? -13.544 9.948   0.247   1.00 0.00 ? 74 ALA A H    5  
ATOM 6415  H HA   . ALA A 1 74 ? -12.631 7.597   -1.082  1.00 0.00 ? 74 ALA A HA   5  
ATOM 6416  H HB1  . ALA A 1 74 ? -13.930 8.925   -3.031  1.00 0.00 ? 74 ALA A HB1  5  
ATOM 6417  H HB2  . ALA A 1 74 ? -14.597 9.727   -1.609  1.00 0.00 ? 74 ALA A HB2  5  
ATOM 6418  H HB3  . ALA A 1 74 ? -14.742 7.978   -1.782  1.00 0.00 ? 74 ALA A HB3  5  
ATOM 6419  N N    . LEU A 1 75 ? -11.198 8.395   -3.062  1.00 0.00 ? 75 LEU A N    5  
ATOM 6420  C CA   . LEU A 1 75 ? -10.107 8.792   -3.943  1.00 0.00 ? 75 LEU A CA   5  
ATOM 6421  C C    . LEU A 1 75 ? -8.832  9.057   -3.149  1.00 0.00 ? 75 LEU A C    5  
ATOM 6422  O O    . LEU A 1 75 ? -7.992  9.861   -3.554  1.00 0.00 ? 75 LEU A O    5  
ATOM 6423  C CB   . LEU A 1 75 ? -10.495 10.041  -4.736  1.00 0.00 ? 75 LEU A CB   5  
ATOM 6424  C CG   . LEU A 1 75 ? -11.371 9.784   -5.964  1.00 0.00 ? 75 LEU A CG   5  
ATOM 6425  C CD1  . LEU A 1 75 ? -11.849 11.096  -6.564  1.00 0.00 ? 75 LEU A CD1  5  
ATOM 6426  C CD2  . LEU A 1 75 ? -10.611 8.968   -6.998  1.00 0.00 ? 75 LEU A CD2  5  
ATOM 6427  H H    . LEU A 1 75 ? -11.619 7.519   -3.187  1.00 0.00 ? 75 LEU A H    5  
ATOM 6428  H HA   . LEU A 1 75 ? -9.926  7.981   -4.633  1.00 0.00 ? 75 LEU A HA   5  
ATOM 6429  H HB2  . LEU A 1 75 ? -11.024 10.711  -4.075  1.00 0.00 ? 75 LEU A HB2  5  
ATOM 6430  H HB3  . LEU A 1 75 ? -9.589  10.529  -5.065  1.00 0.00 ? 75 LEU A HB3  5  
ATOM 6431  H HG   . LEU A 1 75 ? -12.242 9.218   -5.663  1.00 0.00 ? 75 LEU A HG   5  
ATOM 6432  H HD11 . LEU A 1 75 ? -11.195 11.382  -7.373  1.00 0.00 ? 75 LEU A HD11 5  
ATOM 6433  H HD12 . LEU A 1 75 ? -11.838 11.865  -5.804  1.00 0.00 ? 75 LEU A HD12 5  
ATOM 6434  H HD13 . LEU A 1 75 ? -12.855 10.976  -6.939  1.00 0.00 ? 75 LEU A HD13 5  
ATOM 6435  H HD21 . LEU A 1 75 ? -11.181 8.926   -7.914  1.00 0.00 ? 75 LEU A HD21 5  
ATOM 6436  H HD22 . LEU A 1 75 ? -10.456 7.966   -6.625  1.00 0.00 ? 75 LEU A HD22 5  
ATOM 6437  H HD23 . LEU A 1 75 ? -9.654  9.431   -7.190  1.00 0.00 ? 75 LEU A HD23 5  
ATOM 6438  N N    . GLN A 1 76 ? -8.693  8.375   -2.017  1.00 0.00 ? 76 GLN A N    5  
ATOM 6439  C CA   . GLN A 1 76 ? -7.520  8.537   -1.166  1.00 0.00 ? 76 GLN A CA   5  
ATOM 6440  C C    . GLN A 1 76 ? -6.987  7.184   -0.711  1.00 0.00 ? 76 GLN A C    5  
ATOM 6441  O O    . GLN A 1 76 ? -5.779  6.943   -0.724  1.00 0.00 ? 76 GLN A O    5  
ATOM 6442  C CB   . GLN A 1 76 ? -7.861  9.399   0.051   1.00 0.00 ? 76 GLN A CB   5  
ATOM 6443  C CG   . GLN A 1 76 ? -7.724  10.891  -0.203  1.00 0.00 ? 76 GLN A CG   5  
ATOM 6444  C CD   . GLN A 1 76 ? -8.190  11.728  0.972   1.00 0.00 ? 76 GLN A CD   5  
ATOM 6445  O OE1  . GLN A 1 76 ? -8.946  12.685  0.808   1.00 0.00 ? 76 GLN A OE1  5  
ATOM 6446  N NE2  . GLN A 1 76 ? -7.736  11.370  2.168   1.00 0.00 ? 76 GLN A NE2  5  
ATOM 6447  H H    . GLN A 1 76 ? -9.397  7.749   -1.747  1.00 0.00 ? 76 GLN A H    5  
ATOM 6448  H HA   . GLN A 1 76 ? -6.759  9.032   -1.745  1.00 0.00 ? 76 GLN A HA   5  
ATOM 6449  H HB2  . GLN A 1 76 ? -8.879  9.198   0.346   1.00 0.00 ? 76 GLN A HB2  5  
ATOM 6450  H HB3  . GLN A 1 76 ? -7.199  9.133   0.863   1.00 0.00 ? 76 GLN A HB3  5  
ATOM 6451  H HG2  . GLN A 1 76 ? -6.686  11.118  -0.398  1.00 0.00 ? 76 GLN A HG2  5  
ATOM 6452  H HG3  . GLN A 1 76 ? -8.316  11.152  -1.068  1.00 0.00 ? 76 GLN A HG3  5  
ATOM 6453  H HE21 . GLN A 1 76 ? -7.135  10.599  2.223   1.00 0.00 ? 76 GLN A HE21 5  
ATOM 6454  H HE22 . GLN A 1 76 ? -8.021  11.894  2.947   1.00 0.00 ? 76 GLN A HE22 5  
ATOM 6455  N N    . GLY A 1 77 ? -7.896  6.306   -0.310  1.00 0.00 ? 77 GLY A N    5  
ATOM 6456  C CA   . GLY A 1 77 ? -7.504  4.984   0.145   1.00 0.00 ? 77 GLY A CA   5  
ATOM 6457  C C    . GLY A 1 77 ? -6.929  4.132   -0.970  1.00 0.00 ? 77 GLY A C    5  
ATOM 6458  O O    . GLY A 1 77 ? -7.650  3.365   -1.607  1.00 0.00 ? 77 GLY A O    5  
ATOM 6459  H H    . GLY A 1 77 ? -8.842  6.557   -0.322  1.00 0.00 ? 77 GLY A H    5  
ATOM 6460  H HA2  . GLY A 1 77 ? -6.760  5.089   0.922   1.00 0.00 ? 77 GLY A HA2  5  
ATOM 6461  H HA3  . GLY A 1 77 ? -8.370  4.485   0.555   1.00 0.00 ? 77 GLY A HA3  5  
ATOM 6462  N N    . ILE A 1 78 ? -5.629  4.268   -1.205  1.00 0.00 ? 78 ILE A N    5  
ATOM 6463  C CA   . ILE A 1 78 ? -4.958  3.506   -2.249  1.00 0.00 ? 78 ILE A CA   5  
ATOM 6464  C C    . ILE A 1 78 ? -4.218  2.306   -1.663  1.00 0.00 ? 78 ILE A C    5  
ATOM 6465  O O    . ILE A 1 78 ? -3.492  2.434   -0.677  1.00 0.00 ? 78 ILE A O    5  
ATOM 6466  C CB   . ILE A 1 78 ? -3.961  4.383   -3.035  1.00 0.00 ? 78 ILE A CB   5  
ATOM 6467  C CG1  . ILE A 1 78 ? -3.344  3.591   -4.190  1.00 0.00 ? 78 ILE A CG1  5  
ATOM 6468  C CG2  . ILE A 1 78 ? -2.876  4.915   -2.111  1.00 0.00 ? 78 ILE A CG2  5  
ATOM 6469  C CD1  . ILE A 1 78 ? -3.159  4.406   -5.451  1.00 0.00 ? 78 ILE A CD1  5  
ATOM 6470  H H    . ILE A 1 78 ? -5.108  4.897   -0.663  1.00 0.00 ? 78 ILE A H    5  
ATOM 6471  H HA   . ILE A 1 78 ? -5.711  3.150   -2.938  1.00 0.00 ? 78 ILE A HA   5  
ATOM 6472  H HB   . ILE A 1 78 ? -4.501  5.227   -3.436  1.00 0.00 ? 78 ILE A HB   5  
ATOM 6473  H HG12 . ILE A 1 78 ? -2.375  3.223   -3.889  1.00 0.00 ? 78 ILE A HG12 5  
ATOM 6474  H HG13 . ILE A 1 78 ? -3.984  2.753   -4.426  1.00 0.00 ? 78 ILE A HG13 5  
ATOM 6475  H HG21 . ILE A 1 78 ? -2.188  5.525   -2.678  1.00 0.00 ? 78 ILE A HG21 5  
ATOM 6476  H HG22 . ILE A 1 78 ? -2.342  4.088   -1.668  1.00 0.00 ? 78 ILE A HG22 5  
ATOM 6477  H HG23 . ILE A 1 78 ? -3.327  5.511   -1.331  1.00 0.00 ? 78 ILE A HG23 5  
ATOM 6478  H HD11 . ILE A 1 78 ? -2.123  4.371   -5.753  1.00 0.00 ? 78 ILE A HD11 5  
ATOM 6479  H HD12 . ILE A 1 78 ? -3.446  5.430   -5.263  1.00 0.00 ? 78 ILE A HD12 5  
ATOM 6480  H HD13 . ILE A 1 78 ? -3.777  3.998   -6.237  1.00 0.00 ? 78 ILE A HD13 5  
ATOM 6481  N N    . PHE A 1 79 ? -4.409  1.143   -2.275  1.00 0.00 ? 79 PHE A N    5  
ATOM 6482  C CA   . PHE A 1 79 ? -3.761  -0.079  -1.812  1.00 0.00 ? 79 PHE A CA   5  
ATOM 6483  C C    . PHE A 1 79 ? -2.529  -0.394  -2.655  1.00 0.00 ? 79 PHE A C    5  
ATOM 6484  O O    . PHE A 1 79 ? -2.541  -0.235  -3.876  1.00 0.00 ? 79 PHE A O    5  
ATOM 6485  C CB   . PHE A 1 79 ? -4.741  -1.252  -1.863  1.00 0.00 ? 79 PHE A CB   5  
ATOM 6486  C CG   . PHE A 1 79 ? -5.816  -1.181  -0.816  1.00 0.00 ? 79 PHE A CG   5  
ATOM 6487  C CD1  . PHE A 1 79 ? -6.911  -0.348  -0.984  1.00 0.00 ? 79 PHE A CD1  5  
ATOM 6488  C CD2  . PHE A 1 79 ? -5.731  -1.947  0.336   1.00 0.00 ? 79 PHE A CD2  5  
ATOM 6489  C CE1  . PHE A 1 79 ? -7.901  -0.281  -0.022  1.00 0.00 ? 79 PHE A CE1  5  
ATOM 6490  C CE2  . PHE A 1 79 ? -6.718  -1.883  1.301   1.00 0.00 ? 79 PHE A CE2  5  
ATOM 6491  C CZ   . PHE A 1 79 ? -7.805  -1.049  1.121   1.00 0.00 ? 79 PHE A CZ   5  
ATOM 6492  H H    . PHE A 1 79 ? -5.000  1.104   -3.056  1.00 0.00 ? 79 PHE A H    5  
ATOM 6493  H HA   . PHE A 1 79 ? -3.452  0.076   -0.790  1.00 0.00 ? 79 PHE A HA   5  
ATOM 6494  H HB2  . PHE A 1 79 ? -5.220  -1.271  -2.830  1.00 0.00 ? 79 PHE A HB2  5  
ATOM 6495  H HB3  . PHE A 1 79 ? -4.196  -2.174  -1.719  1.00 0.00 ? 79 PHE A HB3  5  
ATOM 6496  H HD1  . PHE A 1 79 ? -6.987  0.252   -1.878  1.00 0.00 ? 79 PHE A HD1  5  
ATOM 6497  H HD2  . PHE A 1 79 ? -4.882  -2.598  0.478   1.00 0.00 ? 79 PHE A HD2  5  
ATOM 6498  H HE1  . PHE A 1 79 ? -8.750  0.371   -0.166  1.00 0.00 ? 79 PHE A HE1  5  
ATOM 6499  H HE2  . PHE A 1 79 ? -6.641  -2.485  2.194   1.00 0.00 ? 79 PHE A HE2  5  
ATOM 6500  H HZ   . PHE A 1 79 ? -8.578  -0.998  1.874   1.00 0.00 ? 79 PHE A HZ   5  
ATOM 6501  N N    . THR A 1 80 ? -1.467  -0.844  -1.995  1.00 0.00 ? 80 THR A N    5  
ATOM 6502  C CA   . THR A 1 80 ? -0.226  -1.183  -2.681  1.00 0.00 ? 80 THR A CA   5  
ATOM 6503  C C    . THR A 1 80 ? 0.633   -2.106  -1.824  1.00 0.00 ? 80 THR A C    5  
ATOM 6504  O O    . THR A 1 80 ? 0.289   -2.408  -0.682  1.00 0.00 ? 80 THR A O    5  
ATOM 6505  C CB   . THR A 1 80 ? 0.554   0.087   -3.026  1.00 0.00 ? 80 THR A CB   5  
ATOM 6506  O OG1  . THR A 1 80 ? 1.815   -0.235  -3.585  1.00 0.00 ? 80 THR A OG1  5  
ATOM 6507  C CG2  . THR A 1 80 ? 0.797   0.983   -1.830  1.00 0.00 ? 80 THR A CG2  5  
ATOM 6508  H H    . THR A 1 80 ? -1.519  -0.949  -1.022  1.00 0.00 ? 80 THR A H    5  
ATOM 6509  H HA   . THR A 1 80 ? -0.483  -1.696  -3.595  1.00 0.00 ? 80 THR A HA   5  
ATOM 6510  H HB   . THR A 1 80 ? -0.005  0.654   -3.755  1.00 0.00 ? 80 THR A HB   5  
ATOM 6511  H HG1  . THR A 1 80 ? 2.033   0.400   -4.271  1.00 0.00 ? 80 THR A HG1  5  
ATOM 6512  H HG21 . THR A 1 80 ? 0.645   0.419   -0.922  1.00 0.00 ? 80 THR A HG21 5  
ATOM 6513  H HG22 . THR A 1 80 ? 0.108   1.814   -1.858  1.00 0.00 ? 80 THR A HG22 5  
ATOM 6514  H HG23 . THR A 1 80 ? 1.811   1.353   -1.858  1.00 0.00 ? 80 THR A HG23 5  
ATOM 6515  N N    . ARG A 1 81 ? 1.754   -2.551  -2.383  1.00 0.00 ? 81 ARG A N    5  
ATOM 6516  C CA   . ARG A 1 81 ? 2.663   -3.439  -1.668  1.00 0.00 ? 81 ARG A CA   5  
ATOM 6517  C C    . ARG A 1 81 ? 3.625   -2.643  -0.790  1.00 0.00 ? 81 ARG A C    5  
ATOM 6518  O O    . ARG A 1 81 ? 4.012   -1.527  -1.135  1.00 0.00 ? 81 ARG A O    5  
ATOM 6519  C CB   . ARG A 1 81 ? 3.451   -4.301  -2.657  1.00 0.00 ? 81 ARG A CB   5  
ATOM 6520  C CG   . ARG A 1 81 ? 2.569   -5.150  -3.559  1.00 0.00 ? 81 ARG A CG   5  
ATOM 6521  C CD   . ARG A 1 81 ? 3.382   -6.186  -4.317  1.00 0.00 ? 81 ARG A CD   5  
ATOM 6522  N NE   . ARG A 1 81 ? 3.689   -5.753  -5.678  1.00 0.00 ? 81 ARG A NE   5  
ATOM 6523  C CZ   . ARG A 1 81 ? 4.575   -6.358  -6.466  1.00 0.00 ? 81 ARG A CZ   5  
ATOM 6524  N NH1  . ARG A 1 81 ? 5.242   -7.421  -6.034  1.00 0.00 ? 81 ARG A NH1  5  
ATOM 6525  N NH2  . ARG A 1 81 ? 4.795   -5.899  -7.691  1.00 0.00 ? 81 ARG A NH2  5  
ATOM 6526  H H    . ARG A 1 81 ? 1.976   -2.275  -3.297  1.00 0.00 ? 81 ARG A H    5  
ATOM 6527  H HA   . ARG A 1 81 ? 2.068   -4.084  -1.038  1.00 0.00 ? 81 ARG A HA   5  
ATOM 6528  H HB2  . ARG A 1 81 ? 4.050   -3.655  -3.281  1.00 0.00 ? 81 ARG A HB2  5  
ATOM 6529  H HB3  . ARG A 1 81 ? 4.102   -4.960  -2.104  1.00 0.00 ? 81 ARG A HB3  5  
ATOM 6530  H HG2  . ARG A 1 81 ? 1.833   -5.657  -2.954  1.00 0.00 ? 81 ARG A HG2  5  
ATOM 6531  H HG3  . ARG A 1 81 ? 2.071   -4.505  -4.269  1.00 0.00 ? 81 ARG A HG3  5  
ATOM 6532  H HD2  . ARG A 1 81 ? 4.307   -6.358  -3.787  1.00 0.00 ? 81 ARG A HD2  5  
ATOM 6533  H HD3  . ARG A 1 81 ? 2.817   -7.106  -4.361  1.00 0.00 ? 81 ARG A HD3  5  
ATOM 6534  H HE   . ARG A 1 81 ? 3.211   -4.970  -6.023  1.00 0.00 ? 81 ARG A HE   5  
ATOM 6535  H HH11 . ARG A 1 81 ? 5.081   -7.773  -5.112  1.00 0.00 ? 81 ARG A HH11 5  
ATOM 6536  H HH12 . ARG A 1 81 ? 5.906   -7.871  -6.631  1.00 0.00 ? 81 ARG A HH12 5  
ATOM 6537  H HH21 . ARG A 1 81 ? 4.295   -5.099  -8.022  1.00 0.00 ? 81 ARG A HH21 5  
ATOM 6538  H HH22 . ARG A 1 81 ? 5.460   -6.353  -8.284  1.00 0.00 ? 81 ARG A HH22 5  
ATOM 6539  N N    . PRO A 1 82 ? 4.026   -3.209  0.362   1.00 0.00 ? 82 PRO A N    5  
ATOM 6540  C CA   . PRO A 1 82 ? 4.946   -2.543  1.289   1.00 0.00 ? 82 PRO A CA   5  
ATOM 6541  C C    . PRO A 1 82 ? 6.220   -2.069  0.598   1.00 0.00 ? 82 PRO A C    5  
ATOM 6542  O O    . PRO A 1 82 ? 6.686   -0.953  0.830   1.00 0.00 ? 82 PRO A O    5  
ATOM 6543  C CB   . PRO A 1 82 ? 5.270   -3.631  2.316   1.00 0.00 ? 82 PRO A CB   5  
ATOM 6544  C CG   . PRO A 1 82 ? 4.100   -4.552  2.273   1.00 0.00 ? 82 PRO A CG   5  
ATOM 6545  C CD   . PRO A 1 82 ? 3.613   -4.537  0.851   1.00 0.00 ? 82 PRO A CD   5  
ATOM 6546  H HA   . PRO A 1 82 ? 4.474   -1.706  1.783   1.00 0.00 ? 82 PRO A HA   5  
ATOM 6547  H HB2  . PRO A 1 82 ? 6.182   -4.136  2.034   1.00 0.00 ? 82 PRO A HB2  5  
ATOM 6548  H HB3  . PRO A 1 82 ? 5.385   -3.185  3.292   1.00 0.00 ? 82 PRO A HB3  5  
ATOM 6549  H HG2  . PRO A 1 82 ? 4.408   -5.549  2.554   1.00 0.00 ? 82 PRO A HG2  5  
ATOM 6550  H HG3  . PRO A 1 82 ? 3.327   -4.195  2.937   1.00 0.00 ? 82 PRO A HG3  5  
ATOM 6551  H HD2  . PRO A 1 82 ? 4.089   -5.322  0.282   1.00 0.00 ? 82 PRO A HD2  5  
ATOM 6552  H HD3  . PRO A 1 82 ? 2.539   -4.643  0.818   1.00 0.00 ? 82 PRO A HD3  5  
ATOM 6553  N N    . SER A 1 83 ? 6.780   -2.924  -0.251  1.00 0.00 ? 83 SER A N    5  
ATOM 6554  C CA   . SER A 1 83 ? 8.002   -2.594  -0.976  1.00 0.00 ? 83 SER A CA   5  
ATOM 6555  C C    . SER A 1 83 ? 7.800   -1.361  -1.852  1.00 0.00 ? 83 SER A C    5  
ATOM 6556  O O    . SER A 1 83 ? 8.719   -0.563  -2.039  1.00 0.00 ? 83 SER A O    5  
ATOM 6557  C CB   . SER A 1 83 ? 8.446   -3.778  -1.836  1.00 0.00 ? 83 SER A CB   5  
ATOM 6558  O OG   . SER A 1 83 ? 9.625   -3.471  -2.559  1.00 0.00 ? 83 SER A OG   5  
ATOM 6559  H H    . SER A 1 83 ? 6.363   -3.799  -0.393  1.00 0.00 ? 83 SER A H    5  
ATOM 6560  H HA   . SER A 1 83 ? 8.772   -2.380  -0.249  1.00 0.00 ? 83 SER A HA   5  
ATOM 6561  H HB2  . SER A 1 83 ? 8.640   -4.629  -1.200  1.00 0.00 ? 83 SER A HB2  5  
ATOM 6562  H HB3  . SER A 1 83 ? 7.661   -4.024  -2.537  1.00 0.00 ? 83 SER A HB3  5  
ATOM 6563  H HG   . SER A 1 83 ? 10.249  -3.029  -1.980  1.00 0.00 ? 83 SER A HG   5  
ATOM 6564  N N    . LYS A 1 84 ? 6.593   -1.214  -2.388  1.00 0.00 ? 84 LYS A N    5  
ATOM 6565  C CA   . LYS A 1 84 ? 6.273   -0.079  -3.247  1.00 0.00 ? 84 LYS A CA   5  
ATOM 6566  C C    . LYS A 1 84 ? 6.400   1.236   -2.484  1.00 0.00 ? 84 LYS A C    5  
ATOM 6567  O O    . LYS A 1 84 ? 6.723   2.272   -3.065  1.00 0.00 ? 84 LYS A O    5  
ATOM 6568  C CB   . LYS A 1 84 ? 4.857   -0.221  -3.808  1.00 0.00 ? 84 LYS A CB   5  
ATOM 6569  C CG   . LYS A 1 84 ? 4.668   -1.455  -4.676  1.00 0.00 ? 84 LYS A CG   5  
ATOM 6570  C CD   . LYS A 1 84 ? 5.227   -1.244  -6.074  1.00 0.00 ? 84 LYS A CD   5  
ATOM 6571  C CE   . LYS A 1 84 ? 4.395   -1.962  -7.122  1.00 0.00 ? 84 LYS A CE   5  
ATOM 6572  N NZ   . LYS A 1 84 ? 4.907   -1.724  -8.500  1.00 0.00 ? 84 LYS A NZ   5  
ATOM 6573  H H    . LYS A 1 84 ? 5.902   -1.883  -2.203  1.00 0.00 ? 84 LYS A H    5  
ATOM 6574  H HA   . LYS A 1 84 ? 6.975   -0.075  -4.065  1.00 0.00 ? 84 LYS A HA   5  
ATOM 6575  H HB2  . LYS A 1 84 ? 4.159   -0.277  -2.986  1.00 0.00 ? 84 LYS A HB2  5  
ATOM 6576  H HB3  . LYS A 1 84 ? 4.629   0.650   -4.404  1.00 0.00 ? 84 LYS A HB3  5  
ATOM 6577  H HG2  . LYS A 1 84 ? 5.180   -2.288  -4.217  1.00 0.00 ? 84 LYS A HG2  5  
ATOM 6578  H HG3  . LYS A 1 84 ? 3.613   -1.675  -4.749  1.00 0.00 ? 84 LYS A HG3  5  
ATOM 6579  H HD2  . LYS A 1 84 ? 5.230   -0.187  -6.294  1.00 0.00 ? 84 LYS A HD2  5  
ATOM 6580  H HD3  . LYS A 1 84 ? 6.238   -1.622  -6.108  1.00 0.00 ? 84 LYS A HD3  5  
ATOM 6581  H HE2  . LYS A 1 84 ? 4.419   -3.023  -6.918  1.00 0.00 ? 84 LYS A HE2  5  
ATOM 6582  H HE3  . LYS A 1 84 ? 3.376   -1.609  -7.060  1.00 0.00 ? 84 LYS A HE3  5  
ATOM 6583  H HZ1  . LYS A 1 84 ? 5.445   -0.834  -8.530  1.00 0.00 ? 84 LYS A HZ1  5  
ATOM 6584  H HZ2  . LYS A 1 84 ? 4.115   -1.660  -9.170  1.00 0.00 ? 84 LYS A HZ2  5  
ATOM 6585  H HZ3  . LYS A 1 84 ? 5.530   -2.504  -8.790  1.00 0.00 ? 84 LYS A HZ3  5  
ATOM 6586  N N    . LEU A 1 85 ? 6.146   1.188   -1.180  1.00 0.00 ? 85 LEU A N    5  
ATOM 6587  C CA   . LEU A 1 85 ? 6.235   2.377   -0.341  1.00 0.00 ? 85 LEU A CA   5  
ATOM 6588  C C    . LEU A 1 85 ? 7.686   2.682   0.018   1.00 0.00 ? 85 LEU A C    5  
ATOM 6589  O O    . LEU A 1 85 ? 8.455   1.782   0.354   1.00 0.00 ? 85 LEU A O    5  
ATOM 6590  C CB   . LEU A 1 85 ? 5.411   2.191   0.935   1.00 0.00 ? 85 LEU A CB   5  
ATOM 6591  C CG   . LEU A 1 85 ? 4.024   1.580   0.728   1.00 0.00 ? 85 LEU A CG   5  
ATOM 6592  C CD1  . LEU A 1 85 ? 3.438   1.124   2.055   1.00 0.00 ? 85 LEU A CD1  5  
ATOM 6593  C CD2  . LEU A 1 85 ? 3.098   2.580   0.050   1.00 0.00 ? 85 LEU A CD2  5  
ATOM 6594  H H    . LEU A 1 85 ? 5.894   0.333   -0.773  1.00 0.00 ? 85 LEU A H    5  
ATOM 6595  H HA   . LEU A 1 85 ? 5.833   3.208   -0.900  1.00 0.00 ? 85 LEU A HA   5  
ATOM 6596  H HB2  . LEU A 1 85 ? 5.966   1.552   1.607   1.00 0.00 ? 85 LEU A HB2  5  
ATOM 6597  H HB3  . LEU A 1 85 ? 5.287   3.156   1.403   1.00 0.00 ? 85 LEU A HB3  5  
ATOM 6598  H HG   . LEU A 1 85 ? 4.110   0.715   0.087   1.00 0.00 ? 85 LEU A HG   5  
ATOM 6599  H HD11 . LEU A 1 85 ? 3.863   1.710   2.856   1.00 0.00 ? 85 LEU A HD11 5  
ATOM 6600  H HD12 . LEU A 1 85 ? 3.668   0.080   2.211   1.00 0.00 ? 85 LEU A HD12 5  
ATOM 6601  H HD13 . LEU A 1 85 ? 2.367   1.258   2.041   1.00 0.00 ? 85 LEU A HD13 5  
ATOM 6602  H HD21 . LEU A 1 85 ? 2.103   2.167   -0.008  1.00 0.00 ? 85 LEU A HD21 5  
ATOM 6603  H HD22 . LEU A 1 85 ? 3.460   2.788   -0.945  1.00 0.00 ? 85 LEU A HD22 5  
ATOM 6604  H HD23 . LEU A 1 85 ? 3.075   3.495   0.623   1.00 0.00 ? 85 LEU A HD23 5  
ATOM 6605  N N    . THR A 1 86 ? 8.052   3.957   -0.055  1.00 0.00 ? 86 THR A N    5  
ATOM 6606  C CA   . THR A 1 86 ? 9.411   4.381   0.262   1.00 0.00 ? 86 THR A CA   5  
ATOM 6607  C C    . THR A 1 86 ? 9.406   5.707   1.016   1.00 0.00 ? 86 THR A C    5  
ATOM 6608  O O    . THR A 1 86 ? 8.397   6.409   1.049   1.00 0.00 ? 86 THR A O    5  
ATOM 6609  C CB   . THR A 1 86 ? 10.239  4.513   -1.018  1.00 0.00 ? 86 THR A CB   5  
ATOM 6610  O OG1  . THR A 1 86 ? 9.535   5.257   -1.996  1.00 0.00 ? 86 THR A OG1  5  
ATOM 6611  C CG2  . THR A 1 86 ? 10.607  3.179   -1.632  1.00 0.00 ? 86 THR A CG2  5  
ATOM 6612  H H    . THR A 1 86 ? 7.395   4.629   -0.330  1.00 0.00 ? 86 THR A H    5  
ATOM 6613  H HA   . THR A 1 86 ? 9.856   3.624   0.890   1.00 0.00 ? 86 THR A HA   5  
ATOM 6614  H HB   . THR A 1 86 ? 11.156  5.036   -0.789  1.00 0.00 ? 86 THR A HB   5  
ATOM 6615  H HG1  . THR A 1 86 ? 10.119  5.915   -2.380  1.00 0.00 ? 86 THR A HG1  5  
ATOM 6616  H HG21 . THR A 1 86 ? 11.672  3.022   -1.541  1.00 0.00 ? 86 THR A HG21 5  
ATOM 6617  H HG22 . THR A 1 86 ? 10.330  3.174   -2.676  1.00 0.00 ? 86 THR A HG22 5  
ATOM 6618  H HG23 . THR A 1 86 ? 10.081  2.388   -1.117  1.00 0.00 ? 86 THR A HG23 5  
ATOM 6619  N N    . ARG A 1 87 ? 10.540  6.041   1.623   1.00 0.00 ? 87 ARG A N    5  
ATOM 6620  C CA   . ARG A 1 87 ? 10.664  7.283   2.378   1.00 0.00 ? 87 ARG A CA   5  
ATOM 6621  C C    . ARG A 1 87 ? 11.327  8.369   1.536   1.00 0.00 ? 87 ARG A C    5  
ATOM 6622  O O    . ARG A 1 87 ? 12.101  9.179   2.047   1.00 0.00 ? 87 ARG A O    5  
ATOM 6623  C CB   . ARG A 1 87 ? 11.471  7.047   3.657   1.00 0.00 ? 87 ARG A CB   5  
ATOM 6624  C CG   . ARG A 1 87 ? 10.615  6.645   4.849   1.00 0.00 ? 87 ARG A CG   5  
ATOM 6625  C CD   . ARG A 1 87 ? 10.512  7.767   5.870   1.00 0.00 ? 87 ARG A CD   5  
ATOM 6626  N NE   . ARG A 1 87 ? 11.292  7.488   7.073   1.00 0.00 ? 87 ARG A NE   5  
ATOM 6627  C CZ   . ARG A 1 87 ? 11.109  8.106   8.237   1.00 0.00 ? 87 ARG A CZ   5  
ATOM 6628  N NH1  . ARG A 1 87 ? 10.173  9.041   8.360   1.00 0.00 ? 87 ARG A NH1  5  
ATOM 6629  N NH2  . ARG A 1 87 ? 11.862  7.791   9.282   1.00 0.00 ? 87 ARG A NH2  5  
ATOM 6630  H H    . ARG A 1 87 ? 11.311  5.440   1.562   1.00 0.00 ? 87 ARG A H    5  
ATOM 6631  H HA   . ARG A 1 87 ? 9.670   7.609   2.645   1.00 0.00 ? 87 ARG A HA   5  
ATOM 6632  H HB2  . ARG A 1 87 ? 12.189  6.262   3.476   1.00 0.00 ? 87 ARG A HB2  5  
ATOM 6633  H HB3  . ARG A 1 87 ? 11.998  7.956   3.909   1.00 0.00 ? 87 ARG A HB3  5  
ATOM 6634  H HG2  . ARG A 1 87 ? 9.624   6.397   4.501   1.00 0.00 ? 87 ARG A HG2  5  
ATOM 6635  H HG3  . ARG A 1 87 ? 11.060  5.781   5.322   1.00 0.00 ? 87 ARG A HG3  5  
ATOM 6636  H HD2  . ARG A 1 87 ? 10.874  8.681   5.423   1.00 0.00 ? 87 ARG A HD2  5  
ATOM 6637  H HD3  . ARG A 1 87 ? 9.474   7.890   6.147   1.00 0.00 ? 87 ARG A HD3  5  
ATOM 6638  H HE   . ARG A 1 87 ? 11.989  6.802   7.010   1.00 0.00 ? 87 ARG A HE   5  
ATOM 6639  H HH11 . ARG A 1 87 ? 9.602   9.284   7.577   1.00 0.00 ? 87 ARG A HH11 5  
ATOM 6640  H HH12 . ARG A 1 87 ? 10.041  9.502   9.238   1.00 0.00 ? 87 ARG A HH12 5  
ATOM 6641  H HH21 . ARG A 1 87 ? 12.567  7.087   9.195   1.00 0.00 ? 87 ARG A HH21 5  
ATOM 6642  H HH22 . ARG A 1 87 ? 11.724  8.255   10.156  1.00 0.00 ? 87 ARG A HH22 5  
ATOM 6643  N N    . GLN A 1 88 ? 11.019  8.380   0.243   1.00 0.00 ? 88 GLN A N    5  
ATOM 6644  C CA   . GLN A 1 88 ? 11.585  9.367   -0.669  1.00 0.00 ? 88 GLN A CA   5  
ATOM 6645  C C    . GLN A 1 88 ? 10.987  9.221   -2.067  1.00 0.00 ? 88 GLN A C    5  
ATOM 6646  O O    . GLN A 1 88 ? 10.722  8.109   -2.524  1.00 0.00 ? 88 GLN A O    5  
ATOM 6647  C CB   . GLN A 1 88 ? 13.107  9.221   -0.730  1.00 0.00 ? 88 GLN A CB   5  
ATOM 6648  C CG   . GLN A 1 88 ? 13.852  10.308  0.028   1.00 0.00 ? 88 GLN A CG   5  
ATOM 6649  C CD   . GLN A 1 88 ? 15.141  9.806   0.649   1.00 0.00 ? 88 GLN A CD   5  
ATOM 6650  O OE1  . GLN A 1 88 ? 15.950  9.155   -0.011  1.00 0.00 ? 88 GLN A OE1  5  
ATOM 6651  N NE2  . GLN A 1 88 ? 15.339  10.109  1.927   1.00 0.00 ? 88 GLN A NE2  5  
ATOM 6652  H H    . GLN A 1 88 ? 10.396  7.708   -0.105  1.00 0.00 ? 88 GLN A H    5  
ATOM 6653  H HA   . GLN A 1 88 ? 11.341  10.347  -0.286  1.00 0.00 ? 88 GLN A HA   5  
ATOM 6654  H HB2  . GLN A 1 88 ? 13.383  8.265   -0.308  1.00 0.00 ? 88 GLN A HB2  5  
ATOM 6655  H HB3  . GLN A 1 88 ? 13.422  9.253   -1.763  1.00 0.00 ? 88 GLN A HB3  5  
ATOM 6656  H HG2  . GLN A 1 88 ? 14.090  11.108  -0.657  1.00 0.00 ? 88 GLN A HG2  5  
ATOM 6657  H HG3  . GLN A 1 88 ? 13.214  10.685  0.814   1.00 0.00 ? 88 GLN A HG3  5  
ATOM 6658  H HE21 . GLN A 1 88 ? 14.652  10.632  2.391   1.00 0.00 ? 88 GLN A HE21 5  
ATOM 6659  H HE22 . GLN A 1 88 ? 16.164  9.797   2.355   1.00 0.00 ? 88 GLN A HE22 5  
ATOM 6660  N N    . PRO A 1 89 ? 10.767  10.347  -2.769  1.00 0.00 ? 89 PRO A N    5  
ATOM 6661  C CA   . PRO A 1 89 ? 10.200  10.335  -4.121  1.00 0.00 ? 89 PRO A CA   5  
ATOM 6662  C C    . PRO A 1 89 ? 11.197  9.844   -5.163  1.00 0.00 ? 89 PRO A C    5  
ATOM 6663  O O    . PRO A 1 89 ? 11.965  10.628  -5.721  1.00 0.00 ? 89 PRO A O    5  
ATOM 6664  C CB   . PRO A 1 89 ? 9.848   11.803  -4.366  1.00 0.00 ? 89 PRO A CB   5  
ATOM 6665  C CG   . PRO A 1 89 ? 10.805  12.566  -3.519  1.00 0.00 ? 89 PRO A CG   5  
ATOM 6666  C CD   . PRO A 1 89 ? 11.055  11.718  -2.303  1.00 0.00 ? 89 PRO A CD   5  
ATOM 6667  H HA   . PRO A 1 89 ? 9.304   9.734   -4.168  1.00 0.00 ? 89 PRO A HA   5  
ATOM 6668  H HB2  . PRO A 1 89 ? 9.972   12.034  -5.414  1.00 0.00 ? 89 PRO A HB2  5  
ATOM 6669  H HB3  . PRO A 1 89 ? 8.826   11.986  -4.070  1.00 0.00 ? 89 PRO A HB3  5  
ATOM 6670  H HG2  . PRO A 1 89 ? 11.726  12.727  -4.061  1.00 0.00 ? 89 PRO A HG2  5  
ATOM 6671  H HG3  . PRO A 1 89 ? 10.369  13.511  -3.234  1.00 0.00 ? 89 PRO A HG3  5  
ATOM 6672  H HD2  . PRO A 1 89 ? 12.084  11.808  -1.984  1.00 0.00 ? 89 PRO A HD2  5  
ATOM 6673  H HD3  . PRO A 1 89 ? 10.386  11.999  -1.503  1.00 0.00 ? 89 PRO A HD3  5  
ATOM 6674  N N    . SER A 1 90 ? 11.181  8.540   -5.423  1.00 0.00 ? 90 SER A N    5  
ATOM 6675  C CA   . SER A 1 90 ? 12.086  7.944   -6.400  1.00 0.00 ? 90 SER A CA   5  
ATOM 6676  C C    . SER A 1 90 ? 11.329  7.523   -7.655  1.00 0.00 ? 90 SER A C    5  
ATOM 6677  O O    . SER A 1 90 ? 10.658  6.491   -7.671  1.00 0.00 ? 90 SER A O    5  
ATOM 6678  C CB   . SER A 1 90 ? 12.801  6.737   -5.793  1.00 0.00 ? 90 SER A CB   5  
ATOM 6679  O OG   . SER A 1 90 ? 11.883  5.707   -5.471  1.00 0.00 ? 90 SER A OG   5  
ATOM 6680  H H    . SER A 1 90 ? 10.547  7.966   -4.947  1.00 0.00 ? 90 SER A H    5  
ATOM 6681  H HA   . SER A 1 90 ? 12.820  8.689   -6.669  1.00 0.00 ? 90 SER A HA   5  
ATOM 6682  H HB2  . SER A 1 90 ? 13.519  6.352   -6.503  1.00 0.00 ? 90 SER A HB2  5  
ATOM 6683  H HB3  . SER A 1 90 ? 13.314  7.040   -4.892  1.00 0.00 ? 90 SER A HB3  5  
ATOM 6684  H HG   . SER A 1 90 ? 12.276  5.118   -4.823  1.00 0.00 ? 90 SER A HG   5  
ATOM 6685  N N    . GLY A 1 91 ? 11.442  8.329   -8.707  1.00 0.00 ? 91 GLY A N    5  
ATOM 6686  C CA   . GLY A 1 91 ? 10.763  8.022   -9.952  1.00 0.00 ? 91 GLY A CA   5  
ATOM 6687  C C    . GLY A 1 91 ? 9.300   8.426   -9.932  1.00 0.00 ? 91 GLY A C    5  
ATOM 6688  O O    . GLY A 1 91 ? 8.428   7.589   -9.697  1.00 0.00 ? 91 GLY A O    5  
ATOM 6689  H H    . GLY A 1 91 ? 11.990  9.138   -8.636  1.00 0.00 ? 91 GLY A H    5  
ATOM 6690  H HA2  . GLY A 1 91 ? 11.258  8.545   -10.758 1.00 0.00 ? 91 GLY A HA2  5  
ATOM 6691  H HA3  . GLY A 1 91 ? 10.829  6.959   -10.133 1.00 0.00 ? 91 GLY A HA3  5  
ATOM 6692  N N    . PRO A 1 92 ? 8.998   9.712   -10.177 1.00 0.00 ? 92 PRO A N    5  
ATOM 6693  C CA   . PRO A 1 92 ? 7.619   10.212  -10.182 1.00 0.00 ? 92 PRO A CA   5  
ATOM 6694  C C    . PRO A 1 92 ? 6.825   9.707   -11.382 1.00 0.00 ? 92 PRO A C    5  
ATOM 6695  O O    . PRO A 1 92 ? 7.281   8.829   -12.115 1.00 0.00 ? 92 PRO A O    5  
ATOM 6696  C CB   . PRO A 1 92 ? 7.792   11.730  -10.256 1.00 0.00 ? 92 PRO A CB   5  
ATOM 6697  C CG   . PRO A 1 92 ? 9.114   11.929  -10.912 1.00 0.00 ? 92 PRO A CG   5  
ATOM 6698  C CD   . PRO A 1 92 ? 9.976   10.778  -10.467 1.00 0.00 ? 92 PRO A CD   5  
ATOM 6699  H HA   . PRO A 1 92 ? 7.100   9.950   -9.271  1.00 0.00 ? 92 PRO A HA   5  
ATOM 6700  H HB2  . PRO A 1 92 ? 6.992   12.158  -10.842 1.00 0.00 ? 92 PRO A HB2  5  
ATOM 6701  H HB3  . PRO A 1 92 ? 7.780   12.147  -9.261  1.00 0.00 ? 92 PRO A HB3  5  
ATOM 6702  H HG2  . PRO A 1 92 ? 8.997   11.915  -11.986 1.00 0.00 ? 92 PRO A HG2  5  
ATOM 6703  H HG3  . PRO A 1 92 ? 9.547   12.865  -10.592 1.00 0.00 ? 92 PRO A HG3  5  
ATOM 6704  H HD2  . PRO A 1 92 ? 10.647  10.481  -11.258 1.00 0.00 ? 92 PRO A HD2  5  
ATOM 6705  H HD3  . PRO A 1 92 ? 10.530  11.044  -9.579  1.00 0.00 ? 92 PRO A HD3  5  
ATOM 6706  N N    . SER A 1 93 ? 5.635   10.265  -11.575 1.00 0.00 ? 93 SER A N    5  
ATOM 6707  C CA   . SER A 1 93 ? 4.777   9.871   -12.686 1.00 0.00 ? 93 SER A CA   5  
ATOM 6708  C C    . SER A 1 93 ? 3.972   11.059  -13.201 1.00 0.00 ? 93 SER A C    5  
ATOM 6709  O O    . SER A 1 93 ? 3.694   12.001  -12.460 1.00 0.00 ? 93 SER A O    5  
ATOM 6710  C CB   . SER A 1 93 ? 3.832   8.748   -12.255 1.00 0.00 ? 93 SER A CB   5  
ATOM 6711  O OG   . SER A 1 93 ? 2.864   9.222   -11.335 1.00 0.00 ? 93 SER A OG   5  
ATOM 6712  H H    . SER A 1 93 ? 5.326   10.959  -10.956 1.00 0.00 ? 93 SER A H    5  
ATOM 6713  H HA   . SER A 1 93 ? 5.412   9.509   -13.482 1.00 0.00 ? 93 SER A HA   5  
ATOM 6714  H HB2  . SER A 1 93 ? 3.324   8.354   -13.122 1.00 0.00 ? 93 SER A HB2  5  
ATOM 6715  H HB3  . SER A 1 93 ? 4.403   7.961   -11.784 1.00 0.00 ? 93 SER A HB3  5  
ATOM 6716  H HG   . SER A 1 93 ? 2.206   9.742   -11.803 1.00 0.00 ? 93 SER A HG   5  
ATOM 6717  N N    . SER A 1 94 ? 3.601   11.007  -14.476 1.00 0.00 ? 94 SER A N    5  
ATOM 6718  C CA   . SER A 1 94 ? 2.827   12.079  -15.091 1.00 0.00 ? 94 SER A CA   5  
ATOM 6719  C C    . SER A 1 94 ? 2.092   11.579  -16.330 1.00 0.00 ? 94 SER A C    5  
ATOM 6720  O O    . SER A 1 94 ? 1.873   12.330  -17.280 1.00 0.00 ? 94 SER A O    5  
ATOM 6721  C CB   . SER A 1 94 ? 3.741   13.248  -15.464 1.00 0.00 ? 94 SER A CB   5  
ATOM 6722  O OG   . SER A 1 94 ? 2.986   14.385  -15.846 1.00 0.00 ? 94 SER A OG   5  
ATOM 6723  H H    . SER A 1 94 ? 3.853   10.229  -15.017 1.00 0.00 ? 94 SER A H    5  
ATOM 6724  H HA   . SER A 1 94 ? 2.100   12.419  -14.369 1.00 0.00 ? 94 SER A HA   5  
ATOM 6725  H HB2  . SER A 1 94 ? 4.353   13.508  -14.613 1.00 0.00 ? 94 SER A HB2  5  
ATOM 6726  H HB3  . SER A 1 94 ? 4.375   12.957  -16.288 1.00 0.00 ? 94 SER A HB3  5  
ATOM 6727  H HG   . SER A 1 94 ? 3.574   15.056  -16.199 1.00 0.00 ? 94 SER A HG   5  
ATOM 6728  N N    . GLY A 1 95 ? 1.713   10.304  -16.313 1.00 0.00 ? 95 GLY A N    5  
ATOM 6729  C CA   . GLY A 1 95 ? 1.008   9.725   -17.441 1.00 0.00 ? 95 GLY A CA   5  
ATOM 6730  C C    . GLY A 1 95 ? 1.650   8.441   -17.930 1.00 0.00 ? 95 GLY A C    5  
ATOM 6731  O O    . GLY A 1 95 ? 1.027   7.370   -17.778 1.00 0.00 ? 95 GLY A O    5  
ATOM 6732  O OXT  . GLY A 1 95 ? 2.776   8.509   -18.467 1.00 0.00 ? 95 GLY A OXT  5  
ATOM 6733  H H    . GLY A 1 95 ? 1.915   9.753   -15.528 1.00 0.00 ? 95 GLY A H    5  
ATOM 6734  H HA2  . GLY A 1 95 ? -0.010  9.515   -17.145 1.00 0.00 ? 95 GLY A HA2  5  
ATOM 6735  H HA3  . GLY A 1 95 ? 0.995   10.440  -18.251 1.00 0.00 ? 95 GLY A HA3  5  
ATOM 6736  N N    . GLY A 1 1  ? -17.936 -19.566 -9.238  1.00 0.00 ? 1  GLY A N    6  
ATOM 6737  C CA   . GLY A 1 1  ? -19.070 -20.263 -8.571  1.00 0.00 ? 1  GLY A CA   6  
ATOM 6738  C C    . GLY A 1 1  ? -19.637 -19.469 -7.410  1.00 0.00 ? 1  GLY A C    6  
ATOM 6739  O O    . GLY A 1 1  ? -19.760 -19.983 -6.299  1.00 0.00 ? 1  GLY A O    6  
ATOM 6740  H H1   . GLY A 1 1  ? -17.969 -18.548 -9.027  1.00 0.00 ? 1  GLY A H1   6  
ATOM 6741  H H2   . GLY A 1 1  ? -17.992 -19.697 -10.269 1.00 0.00 ? 1  GLY A H2   6  
ATOM 6742  H H3   . GLY A 1 1  ? -17.031 -19.951 -8.900  1.00 0.00 ? 1  GLY A H3   6  
ATOM 6743  H HA2  . GLY A 1 1  ? -19.853 -20.430 -9.295  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 6744  H HA3  . GLY A 1 1  ? -18.725 -21.218 -8.203  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 6745  N N    . SER A 1 2  ? -19.982 -18.212 -7.669  1.00 0.00 ? 2  SER A N    6  
ATOM 6746  C CA   . SER A 1 2  ? -20.540 -17.344 -6.638  1.00 0.00 ? 2  SER A CA   6  
ATOM 6747  C C    . SER A 1 2  ? -19.544 -17.140 -5.500  1.00 0.00 ? 2  SER A C    6  
ATOM 6748  O O    . SER A 1 2  ? -19.191 -18.085 -4.796  1.00 0.00 ? 2  SER A O    6  
ATOM 6749  C CB   . SER A 1 2  ? -21.841 -17.933 -6.093  1.00 0.00 ? 2  SER A CB   6  
ATOM 6750  O OG   . SER A 1 2  ? -22.964 -17.426 -6.792  1.00 0.00 ? 2  SER A OG   6  
ATOM 6751  H H    . SER A 1 2  ? -19.860 -17.859 -8.576  1.00 0.00 ? 2  SER A H    6  
ATOM 6752  H HA   . SER A 1 2  ? -20.751 -16.386 -7.091  1.00 0.00 ? 2  SER A HA   6  
ATOM 6753  H HB2  . SER A 1 2  ? -21.821 -19.008 -6.202  1.00 0.00 ? 2  SER A HB2  6  
ATOM 6754  H HB3  . SER A 1 2  ? -21.939 -17.680 -5.047  1.00 0.00 ? 2  SER A HB3  6  
ATOM 6755  H HG   . SER A 1 2  ? -23.633 -17.144 -6.162  1.00 0.00 ? 2  SER A HG   6  
ATOM 6756  N N    . SER A 1 3  ? -19.094 -15.901 -5.330  1.00 0.00 ? 3  SER A N    6  
ATOM 6757  C CA   . SER A 1 3  ? -18.138 -15.572 -4.278  1.00 0.00 ? 3  SER A CA   6  
ATOM 6758  C C    . SER A 1 3  ? -16.835 -16.343 -4.466  1.00 0.00 ? 3  SER A C    6  
ATOM 6759  O O    . SER A 1 3  ? -16.801 -17.566 -4.337  1.00 0.00 ? 3  SER A O    6  
ATOM 6760  C CB   . SER A 1 3  ? -18.733 -15.882 -2.903  1.00 0.00 ? 3  SER A CB   6  
ATOM 6761  O OG   . SER A 1 3  ? -19.677 -14.897 -2.521  1.00 0.00 ? 3  SER A OG   6  
ATOM 6762  H H    . SER A 1 3  ? -19.412 -15.191 -5.924  1.00 0.00 ? 3  SER A H    6  
ATOM 6763  H HA   . SER A 1 3  ? -17.929 -14.515 -4.339  1.00 0.00 ? 3  SER A HA   6  
ATOM 6764  H HB2  . SER A 1 3  ? -19.227 -16.842 -2.934  1.00 0.00 ? 3  SER A HB2  6  
ATOM 6765  H HB3  . SER A 1 3  ? -17.941 -15.909 -2.169  1.00 0.00 ? 3  SER A HB3  6  
ATOM 6766  H HG   . SER A 1 3  ? -19.272 -14.027 -2.576  1.00 0.00 ? 3  SER A HG   6  
ATOM 6767  N N    . GLY A 1 4  ? -15.765 -15.617 -4.774  1.00 0.00 ? 4  GLY A N    6  
ATOM 6768  C CA   . GLY A 1 4  ? -14.472 -16.248 -4.975  1.00 0.00 ? 4  GLY A CA   6  
ATOM 6769  C C    . GLY A 1 4  ? -13.937 -16.035 -6.377  1.00 0.00 ? 4  GLY A C    6  
ATOM 6770  O O    . GLY A 1 4  ? -13.538 -16.987 -7.047  1.00 0.00 ? 4  GLY A O    6  
ATOM 6771  H H    . GLY A 1 4  ? -15.852 -14.645 -4.864  1.00 0.00 ? 4  GLY A H    6  
ATOM 6772  H HA2  . GLY A 1 4  ? -13.769 -15.836 -4.267  1.00 0.00 ? 4  GLY A HA2  6  
ATOM 6773  H HA3  . GLY A 1 4  ? -14.569 -17.308 -4.797  1.00 0.00 ? 4  GLY A HA3  6  
ATOM 6774  N N    . SER A 1 5  ? -13.928 -14.782 -6.821  1.00 0.00 ? 5  SER A N    6  
ATOM 6775  C CA   . SER A 1 5  ? -13.437 -14.445 -8.153  1.00 0.00 ? 5  SER A CA   6  
ATOM 6776  C C    . SER A 1 5  ? -12.313 -13.418 -8.075  1.00 0.00 ? 5  SER A C    6  
ATOM 6777  O O    . SER A 1 5  ? -12.154 -12.589 -8.970  1.00 0.00 ? 5  SER A O    6  
ATOM 6778  C CB   . SER A 1 5  ? -14.578 -13.906 -9.017  1.00 0.00 ? 5  SER A CB   6  
ATOM 6779  O OG   . SER A 1 5  ? -14.467 -14.365 -10.354 1.00 0.00 ? 5  SER A OG   6  
ATOM 6780  H H    . SER A 1 5  ? -14.259 -14.066 -6.239  1.00 0.00 ? 5  SER A H    6  
ATOM 6781  H HA   . SER A 1 5  ? -13.053 -15.349 -8.602  1.00 0.00 ? 5  SER A HA   6  
ATOM 6782  H HB2  . SER A 1 5  ? -15.522 -14.239 -8.613  1.00 0.00 ? 5  SER A HB2  6  
ATOM 6783  H HB3  . SER A 1 5  ? -14.548 -12.826 -9.017  1.00 0.00 ? 5  SER A HB3  6  
ATOM 6784  H HG   . SER A 1 5  ? -13.555 -14.290 -10.644 1.00 0.00 ? 5  SER A HG   6  
ATOM 6785  N N    . SER A 1 6  ? -11.536 -13.479 -6.997  1.00 0.00 ? 6  SER A N    6  
ATOM 6786  C CA   . SER A 1 6  ? -10.423 -12.555 -6.797  1.00 0.00 ? 6  SER A CA   6  
ATOM 6787  C C    . SER A 1 6  ? -10.931 -11.137 -6.551  1.00 0.00 ? 6  SER A C    6  
ATOM 6788  O O    . SER A 1 6  ? -10.826 -10.615 -5.441  1.00 0.00 ? 6  SER A O    6  
ATOM 6789  C CB   . SER A 1 6  ? -9.486  -12.572 -8.008  1.00 0.00 ? 6  SER A CB   6  
ATOM 6790  O OG   . SER A 1 6  ? -9.665  -13.751 -8.775  1.00 0.00 ? 6  SER A OG   6  
ATOM 6791  H H    . SER A 1 6  ? -11.714 -14.164 -6.319  1.00 0.00 ? 6  SER A H    6  
ATOM 6792  H HA   . SER A 1 6  ? -9.876  -12.883 -5.927  1.00 0.00 ? 6  SER A HA   6  
ATOM 6793  H HB2  . SER A 1 6  ? -9.693  -11.717 -8.634  1.00 0.00 ? 6  SER A HB2  6  
ATOM 6794  H HB3  . SER A 1 6  ? -8.462  -12.530 -7.669  1.00 0.00 ? 6  SER A HB3  6  
ATOM 6795  H HG   . SER A 1 6  ? -9.497  -14.519 -8.224  1.00 0.00 ? 6  SER A HG   6  
ATOM 6796  N N    . GLY A 1 7  ? -11.479 -10.520 -7.591  1.00 0.00 ? 7  GLY A N    6  
ATOM 6797  C CA   . GLY A 1 7  ? -11.994 -9.169  -7.467  1.00 0.00 ? 7  GLY A CA   6  
ATOM 6798  C C    . GLY A 1 7  ? -11.128 -8.149  -8.179  1.00 0.00 ? 7  GLY A C    6  
ATOM 6799  O O    . GLY A 1 7  ? -11.375 -7.817  -9.339  1.00 0.00 ? 7  GLY A O    6  
ATOM 6800  H H    . GLY A 1 7  ? -11.535 -10.986 -8.452  1.00 0.00 ? 7  GLY A H    6  
ATOM 6801  H HA2  . GLY A 1 7  ? -12.989 -9.135  -7.885  1.00 0.00 ? 7  GLY A HA2  6  
ATOM 6802  H HA3  . GLY A 1 7  ? -12.047 -8.911  -6.420  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 6803  N N    . ALA A 1 8  ? -10.112 -7.651  -7.484  1.00 0.00 ? 8  ALA A N    6  
ATOM 6804  C CA   . ALA A 1 8  ? -9.206  -6.662  -8.057  1.00 0.00 ? 8  ALA A CA   6  
ATOM 6805  C C    . ALA A 1 8  ? -8.199  -7.319  -8.996  1.00 0.00 ? 8  ALA A C    6  
ATOM 6806  O O    . ALA A 1 8  ? -8.263  -8.522  -9.246  1.00 0.00 ? 8  ALA A O    6  
ATOM 6807  C CB   . ALA A 1 8  ? -8.484  -5.905  -6.953  1.00 0.00 ? 8  ALA A CB   6  
ATOM 6808  H H    . ALA A 1 8  ? -9.966  -7.955  -6.565  1.00 0.00 ? 8  ALA A H    6  
ATOM 6809  H HA   . ALA A 1 8  ? -9.797  -5.954  -8.619  1.00 0.00 ? 8  ALA A HA   6  
ATOM 6810  H HB1  . ALA A 1 8  ? -7.494  -5.635  -7.289  1.00 0.00 ? 8  ALA A HB1  6  
ATOM 6811  H HB2  . ALA A 1 8  ? -8.408  -6.533  -6.077  1.00 0.00 ? 8  ALA A HB2  6  
ATOM 6812  H HB3  . ALA A 1 8  ? -9.038  -5.012  -6.707  1.00 0.00 ? 8  ALA A HB3  6  
ATOM 6813  N N    . ALA A 1 9  ? -7.270  -6.520  -9.512  1.00 0.00 ? 9  ALA A N    6  
ATOM 6814  C CA   . ALA A 1 9  ? -6.251  -7.024  -10.423 1.00 0.00 ? 9  ALA A CA   6  
ATOM 6815  C C    . ALA A 1 9  ? -4.853  -6.631  -9.954  1.00 0.00 ? 9  ALA A C    6  
ATOM 6816  O O    . ALA A 1 9  ? -4.174  -5.828  -10.594 1.00 0.00 ? 9  ALA A O    6  
ATOM 6817  C CB   . ALA A 1 9  ? -6.502  -6.509  -11.833 1.00 0.00 ? 9  ALA A CB   6  
ATOM 6818  H H    . ALA A 1 9  ? -7.272  -5.570  -9.275  1.00 0.00 ? 9  ALA A H    6  
ATOM 6819  H HA   . ALA A 1 9  ? -6.322  -8.102  -10.441 1.00 0.00 ? 9  ALA A HA   6  
ATOM 6820  H HB1  . ALA A 1 9  ? -6.929  -5.519  -11.784 1.00 0.00 ? 9  ALA A HB1  6  
ATOM 6821  H HB2  . ALA A 1 9  ? -7.188  -7.172  -12.341 1.00 0.00 ? 9  ALA A HB2  6  
ATOM 6822  H HB3  . ALA A 1 9  ? -5.568  -6.473  -12.375 1.00 0.00 ? 9  ALA A HB3  6  
ATOM 6823  N N    . GLU A 1 10 ? -4.429  -7.202  -8.832  1.00 0.00 ? 10 GLU A N    6  
ATOM 6824  C CA   . GLU A 1 10 ? -3.113  -6.912  -8.276  1.00 0.00 ? 10 GLU A CA   6  
ATOM 6825  C C    . GLU A 1 10 ? -2.617  -8.070  -7.414  1.00 0.00 ? 10 GLU A C    6  
ATOM 6826  O O    . GLU A 1 10 ? -3.345  -9.034  -7.178  1.00 0.00 ? 10 GLU A O    6  
ATOM 6827  C CB   . GLU A 1 10 ? -3.159  -5.627  -7.447  1.00 0.00 ? 10 GLU A CB   6  
ATOM 6828  C CG   . GLU A 1 10 ? -2.747  -4.387  -8.224  1.00 0.00 ? 10 GLU A CG   6  
ATOM 6829  C CD   . GLU A 1 10 ? -1.267  -4.367  -8.551  1.00 0.00 ? 10 GLU A CD   6  
ATOM 6830  O OE1  . GLU A 1 10 ? -0.451  -4.481  -7.612  1.00 0.00 ? 10 GLU A OE1  6  
ATOM 6831  O OE2  . GLU A 1 10 ? -0.925  -4.238  -9.745  1.00 0.00 ? 10 GLU A OE2  6  
ATOM 6832  H H    . GLU A 1 10 ? -5.016  -7.835  -8.366  1.00 0.00 ? 10 GLU A H    6  
ATOM 6833  H HA   . GLU A 1 10 ? -2.428  -6.775  -9.099  1.00 0.00 ? 10 GLU A HA   6  
ATOM 6834  H HB2  . GLU A 1 10 ? -4.166  -5.482  -7.085  1.00 0.00 ? 10 GLU A HB2  6  
ATOM 6835  H HB3  . GLU A 1 10 ? -2.493  -5.732  -6.602  1.00 0.00 ? 10 GLU A HB3  6  
ATOM 6836  H HG2  . GLU A 1 10 ? -3.305  -4.356  -9.149  1.00 0.00 ? 10 GLU A HG2  6  
ATOM 6837  H HG3  . GLU A 1 10 ? -2.983  -3.513  -7.634  1.00 0.00 ? 10 GLU A HG3  6  
ATOM 6838  N N    . VAL A 1 11 ? -1.377  -7.968  -6.949  1.00 0.00 ? 11 VAL A N    6  
ATOM 6839  C CA   . VAL A 1 11 ? -0.786  -9.006  -6.114  1.00 0.00 ? 11 VAL A CA   6  
ATOM 6840  C C    . VAL A 1 11 ? 0.183   -8.409  -5.099  1.00 0.00 ? 11 VAL A C    6  
ATOM 6841  O O    . VAL A 1 11 ? 1.056   -7.616  -5.451  1.00 0.00 ? 11 VAL A O    6  
ATOM 6842  C CB   . VAL A 1 11 ? -0.041  -10.054 -6.962  1.00 0.00 ? 11 VAL A CB   6  
ATOM 6843  C CG1  . VAL A 1 11 ? -1.027  -10.929 -7.718  1.00 0.00 ? 11 VAL A CG1  6  
ATOM 6844  C CG2  . VAL A 1 11 ? 0.926   -9.374  -7.920  1.00 0.00 ? 11 VAL A CG2  6  
ATOM 6845  H H    . VAL A 1 11 ? -0.847  -7.175  -7.172  1.00 0.00 ? 11 VAL A H    6  
ATOM 6846  H HA   . VAL A 1 11 ? -1.585  -9.504  -5.585  1.00 0.00 ? 11 VAL A HA   6  
ATOM 6847  H HB   . VAL A 1 11 ? 0.530   -10.685 -6.297  1.00 0.00 ? 11 VAL A HB   6  
ATOM 6848  H HG11 . VAL A 1 11 ? -0.661  -11.944 -7.744  1.00 0.00 ? 11 VAL A HG11 6  
ATOM 6849  H HG12 . VAL A 1 11 ? -1.135  -10.560 -8.727  1.00 0.00 ? 11 VAL A HG12 6  
ATOM 6850  H HG13 . VAL A 1 11 ? -1.985  -10.904 -7.221  1.00 0.00 ? 11 VAL A HG13 6  
ATOM 6851  H HG21 . VAL A 1 11 ? 1.580   -8.716  -7.367  1.00 0.00 ? 11 VAL A HG21 6  
ATOM 6852  H HG22 . VAL A 1 11 ? 0.369   -8.801  -8.646  1.00 0.00 ? 11 VAL A HG22 6  
ATOM 6853  H HG23 . VAL A 1 11 ? 1.515   -10.124 -8.428  1.00 0.00 ? 11 VAL A HG23 6  
ATOM 6854  N N    . GLY A 1 12 ? 0.022   -8.794  -3.837  1.00 0.00 ? 12 GLY A N    6  
ATOM 6855  C CA   . GLY A 1 12 ? 0.891   -8.288  -2.790  1.00 0.00 ? 12 GLY A CA   6  
ATOM 6856  C C    . GLY A 1 12 ? 2.232   -8.992  -2.759  1.00 0.00 ? 12 GLY A C    6  
ATOM 6857  O O    . GLY A 1 12 ? 2.429   -9.998  -3.439  1.00 0.00 ? 12 GLY A O    6  
ATOM 6858  H H    . GLY A 1 12 ? -0.691  -9.429  -3.615  1.00 0.00 ? 12 GLY A H    6  
ATOM 6859  H HA2  . GLY A 1 12 ? 1.054   -7.232  -2.953  1.00 0.00 ? 12 GLY A HA2  6  
ATOM 6860  H HA3  . GLY A 1 12 ? 0.403   -8.424  -1.837  1.00 0.00 ? 12 GLY A HA3  6  
ATOM 6861  N N    . ASP A 1 13 ? 3.158   -8.461  -1.967  1.00 0.00 ? 13 ASP A N    6  
ATOM 6862  C CA   . ASP A 1 13 ? 4.489   -9.046  -1.850  1.00 0.00 ? 13 ASP A CA   6  
ATOM 6863  C C    . ASP A 1 13 ? 4.491   -10.199 -0.851  1.00 0.00 ? 13 ASP A C    6  
ATOM 6864  O O    . ASP A 1 13 ? 3.460   -10.525 -0.262  1.00 0.00 ? 13 ASP A O    6  
ATOM 6865  C CB   . ASP A 1 13 ? 5.501   -7.982  -1.421  1.00 0.00 ? 13 ASP A CB   6  
ATOM 6866  C CG   . ASP A 1 13 ? 6.226   -7.364  -2.601  1.00 0.00 ? 13 ASP A CG   6  
ATOM 6867  O OD1  . ASP A 1 13 ? 6.774   -8.126  -3.426  1.00 0.00 ? 13 ASP A OD1  6  
ATOM 6868  O OD2  . ASP A 1 13 ? 6.246   -6.119  -2.700  1.00 0.00 ? 13 ASP A OD2  6  
ATOM 6869  H H    . ASP A 1 13 ? 2.942   -7.658  -1.449  1.00 0.00 ? 13 ASP A H    6  
ATOM 6870  H HA   . ASP A 1 13 ? 4.771   -9.426  -2.820  1.00 0.00 ? 13 ASP A HA   6  
ATOM 6871  H HB2  . ASP A 1 13 ? 4.984   -7.196  -0.889  1.00 0.00 ? 13 ASP A HB2  6  
ATOM 6872  H HB3  . ASP A 1 13 ? 6.234   -8.431  -0.767  1.00 0.00 ? 13 ASP A HB3  6  
ATOM 6873  N N    . ASP A 1 14 ? 5.655   -10.813 -0.665  1.00 0.00 ? 14 ASP A N    6  
ATOM 6874  C CA   . ASP A 1 14 ? 5.790   -11.931 0.263   1.00 0.00 ? 14 ASP A CA   6  
ATOM 6875  C C    . ASP A 1 14 ? 6.504   -11.496 1.538   1.00 0.00 ? 14 ASP A C    6  
ATOM 6876  O O    . ASP A 1 14 ? 7.240   -12.273 2.145   1.00 0.00 ? 14 ASP A O    6  
ATOM 6877  C CB   . ASP A 1 14 ? 6.555   -13.079 -0.398  1.00 0.00 ? 14 ASP A CB   6  
ATOM 6878  C CG   . ASP A 1 14 ? 5.681   -13.892 -1.333  1.00 0.00 ? 14 ASP A CG   6  
ATOM 6879  O OD1  . ASP A 1 14 ? 4.449   -13.907 -1.133  1.00 0.00 ? 14 ASP A OD1  6  
ATOM 6880  O OD2  . ASP A 1 14 ? 6.230   -14.513 -2.267  1.00 0.00 ? 14 ASP A OD2  6  
ATOM 6881  H H    . ASP A 1 14 ? 6.442   -10.508 -1.163  1.00 0.00 ? 14 ASP A H    6  
ATOM 6882  H HA   . ASP A 1 14 ? 4.797   -12.270 0.518   1.00 0.00 ? 14 ASP A HA   6  
ATOM 6883  H HB2  . ASP A 1 14 ? 7.379   -12.675 -0.965  1.00 0.00 ? 14 ASP A HB2  6  
ATOM 6884  H HB3  . ASP A 1 14 ? 6.938   -13.736 0.369   1.00 0.00 ? 14 ASP A HB3  6  
ATOM 6885  N N    . PHE A 1 15 ? 6.279   -10.249 1.940   1.00 0.00 ? 15 PHE A N    6  
ATOM 6886  C CA   . PHE A 1 15 ? 6.901   -9.711  3.144   1.00 0.00 ? 15 PHE A CA   6  
ATOM 6887  C C    . PHE A 1 15 ? 6.393   -8.302  3.434   1.00 0.00 ? 15 PHE A C    6  
ATOM 6888  O O    . PHE A 1 15 ? 6.083   -7.542  2.517   1.00 0.00 ? 15 PHE A O    6  
ATOM 6889  C CB   . PHE A 1 15 ? 8.423   -9.696  2.997   1.00 0.00 ? 15 PHE A CB   6  
ATOM 6890  C CG   . PHE A 1 15 ? 9.150   -9.453  4.288   1.00 0.00 ? 15 PHE A CG   6  
ATOM 6891  C CD1  . PHE A 1 15 ? 9.018   -10.336 5.348   1.00 0.00 ? 15 PHE A CD1  6  
ATOM 6892  C CD2  . PHE A 1 15 ? 9.962   -8.342  4.444   1.00 0.00 ? 15 PHE A CD2  6  
ATOM 6893  C CE1  . PHE A 1 15 ? 9.684   -10.116 6.539   1.00 0.00 ? 15 PHE A CE1  6  
ATOM 6894  C CE2  . PHE A 1 15 ? 10.631  -8.116  5.632   1.00 0.00 ? 15 PHE A CE2  6  
ATOM 6895  C CZ   . PHE A 1 15 ? 10.492  -9.004  6.681   1.00 0.00 ? 15 PHE A CZ   6  
ATOM 6896  H H    . PHE A 1 15 ? 5.682   -9.678  1.414   1.00 0.00 ? 15 PHE A H    6  
ATOM 6897  H HA   . PHE A 1 15 ? 6.634   -10.353 3.970   1.00 0.00 ? 15 PHE A HA   6  
ATOM 6898  H HB2  . PHE A 1 15 ? 8.749   -10.649 2.607   1.00 0.00 ? 15 PHE A HB2  6  
ATOM 6899  H HB3  . PHE A 1 15 ? 8.703   -8.915  2.304   1.00 0.00 ? 15 PHE A HB3  6  
ATOM 6900  H HD1  . PHE A 1 15 ? 8.387   -11.206 5.238   1.00 0.00 ? 15 PHE A HD1  6  
ATOM 6901  H HD2  . PHE A 1 15 ? 10.072  -7.647  3.624   1.00 0.00 ? 15 PHE A HD2  6  
ATOM 6902  H HE1  . PHE A 1 15 ? 9.573   -10.811 7.357   1.00 0.00 ? 15 PHE A HE1  6  
ATOM 6903  H HE2  . PHE A 1 15 ? 11.262  -7.246  5.740   1.00 0.00 ? 15 PHE A HE2  6  
ATOM 6904  H HZ   . PHE A 1 15 ? 11.014  -8.830  7.610   1.00 0.00 ? 15 PHE A HZ   6  
ATOM 6905  N N    . LEU A 1 16 ? 6.311   -7.961  4.717   1.00 0.00 ? 16 LEU A N    6  
ATOM 6906  C CA   . LEU A 1 16 ? 5.840   -6.643  5.128   1.00 0.00 ? 16 LEU A CA   6  
ATOM 6907  C C    . LEU A 1 16 ? 7.013   -5.724  5.453   1.00 0.00 ? 16 LEU A C    6  
ATOM 6908  O O    . LEU A 1 16 ? 7.938   -6.111  6.167   1.00 0.00 ? 16 LEU A O    6  
ATOM 6909  C CB   . LEU A 1 16 ? 4.917   -6.765  6.344   1.00 0.00 ? 16 LEU A CB   6  
ATOM 6910  C CG   . LEU A 1 16 ? 3.428   -6.872  6.015   1.00 0.00 ? 16 LEU A CG   6  
ATOM 6911  C CD1  . LEU A 1 16 ? 2.628   -7.204  7.266   1.00 0.00 ? 16 LEU A CD1  6  
ATOM 6912  C CD2  . LEU A 1 16 ? 2.927   -5.580  5.388   1.00 0.00 ? 16 LEU A CD2  6  
ATOM 6913  H H    . LEU A 1 16 ? 6.572   -8.611  5.402   1.00 0.00 ? 16 LEU A H    6  
ATOM 6914  H HA   . LEU A 1 16 ? 5.284   -6.219  4.306   1.00 0.00 ? 16 LEU A HA   6  
ATOM 6915  H HB2  . LEU A 1 16 ? 5.206   -7.644  6.901   1.00 0.00 ? 16 LEU A HB2  6  
ATOM 6916  H HB3  . LEU A 1 16 ? 5.063   -5.897  6.969   1.00 0.00 ? 16 LEU A HB3  6  
ATOM 6917  H HG   . LEU A 1 16 ? 3.279   -7.671  5.303   1.00 0.00 ? 16 LEU A HG   6  
ATOM 6918  H HD11 . LEU A 1 16 ? 1.599   -6.909  7.125   1.00 0.00 ? 16 LEU A HD11 6  
ATOM 6919  H HD12 . LEU A 1 16 ? 3.043   -6.672  8.110   1.00 0.00 ? 16 LEU A HD12 6  
ATOM 6920  H HD13 . LEU A 1 16 ? 2.676   -8.267  7.452   1.00 0.00 ? 16 LEU A HD13 6  
ATOM 6921  H HD21 . LEU A 1 16 ? 1.870   -5.471  5.581   1.00 0.00 ? 16 LEU A HD21 6  
ATOM 6922  H HD22 . LEU A 1 16 ? 3.097   -5.608  4.322   1.00 0.00 ? 16 LEU A HD22 6  
ATOM 6923  H HD23 . LEU A 1 16 ? 3.458   -4.742  5.815   1.00 0.00 ? 16 LEU A HD23 6  
ATOM 6924  N N    . GLY A 1 17 ? 6.967   -4.506  4.926   1.00 0.00 ? 17 GLY A N    6  
ATOM 6925  C CA   . GLY A 1 17 ? 8.032   -3.550  5.171   1.00 0.00 ? 17 GLY A CA   6  
ATOM 6926  C C    . GLY A 1 17 ? 8.138   -3.162  6.632   1.00 0.00 ? 17 GLY A C    6  
ATOM 6927  O O    . GLY A 1 17 ? 7.394   -3.669  7.472   1.00 0.00 ? 17 GLY A O    6  
ATOM 6928  H H    . GLY A 1 17 ? 6.205   -4.253  4.364   1.00 0.00 ? 17 GLY A H    6  
ATOM 6929  H HA2  . GLY A 1 17 ? 8.969   -3.984  4.856   1.00 0.00 ? 17 GLY A HA2  6  
ATOM 6930  H HA3  . GLY A 1 17 ? 7.844   -2.662  4.586   1.00 0.00 ? 17 GLY A HA3  6  
ATOM 6931  N N    . ASP A 1 18 ? 9.063   -2.258  6.937   1.00 0.00 ? 18 ASP A N    6  
ATOM 6932  C CA   . ASP A 1 18 ? 9.264   -1.801  8.307   1.00 0.00 ? 18 ASP A CA   6  
ATOM 6933  C C    . ASP A 1 18 ? 8.529   -0.487  8.555   1.00 0.00 ? 18 ASP A C    6  
ATOM 6934  O O    . ASP A 1 18 ? 9.042   0.405   9.231   1.00 0.00 ? 18 ASP A O    6  
ATOM 6935  C CB   . ASP A 1 18 ? 10.757  -1.627  8.594   1.00 0.00 ? 18 ASP A CB   6  
ATOM 6936  C CG   . ASP A 1 18 ? 11.107  -1.932  10.038  1.00 0.00 ? 18 ASP A CG   6  
ATOM 6937  O OD1  . ASP A 1 18 ? 10.391  -1.444  10.938  1.00 0.00 ? 18 ASP A OD1  6  
ATOM 6938  O OD2  . ASP A 1 18 ? 12.097  -2.658  10.268  1.00 0.00 ? 18 ASP A OD2  6  
ATOM 6939  H H    . ASP A 1 18 ? 9.625   -1.890  6.223   1.00 0.00 ? 18 ASP A H    6  
ATOM 6940  H HA   . ASP A 1 18 ? 8.865   -2.554  8.969   1.00 0.00 ? 18 ASP A HA   6  
ATOM 6941  H HB2  . ASP A 1 18 ? 11.320  -2.295  7.960   1.00 0.00 ? 18 ASP A HB2  6  
ATOM 6942  H HB3  . ASP A 1 18 ? 11.042  -0.608  8.381   1.00 0.00 ? 18 ASP A HB3  6  
ATOM 6943  N N    . PHE A 1 19 ? 7.325   -0.376  8.004   1.00 0.00 ? 19 PHE A N    6  
ATOM 6944  C CA   . PHE A 1 19 ? 6.519   0.828   8.165   1.00 0.00 ? 19 PHE A CA   6  
ATOM 6945  C C    . PHE A 1 19 ? 5.518   0.665   9.305   1.00 0.00 ? 19 PHE A C    6  
ATOM 6946  O O    . PHE A 1 19 ? 5.327   -0.434  9.824   1.00 0.00 ? 19 PHE A O    6  
ATOM 6947  C CB   . PHE A 1 19 ? 5.782   1.151   6.864   1.00 0.00 ? 19 PHE A CB   6  
ATOM 6948  C CG   . PHE A 1 19 ? 6.695   1.330   5.686   1.00 0.00 ? 19 PHE A CG   6  
ATOM 6949  C CD1  . PHE A 1 19 ? 7.213   0.231   5.020   1.00 0.00 ? 19 PHE A CD1  6  
ATOM 6950  C CD2  . PHE A 1 19 ? 7.035   2.598   5.242   1.00 0.00 ? 19 PHE A CD2  6  
ATOM 6951  C CE1  . PHE A 1 19 ? 8.054   0.393   3.936   1.00 0.00 ? 19 PHE A CE1  6  
ATOM 6952  C CE2  . PHE A 1 19 ? 7.875   2.766   4.159   1.00 0.00 ? 19 PHE A CE2  6  
ATOM 6953  C CZ   . PHE A 1 19 ? 8.386   1.662   3.504   1.00 0.00 ? 19 PHE A CZ   6  
ATOM 6954  H H    . PHE A 1 19 ? 6.970   -1.121  7.476   1.00 0.00 ? 19 PHE A H    6  
ATOM 6955  H HA   . PHE A 1 19 ? 7.186   1.643   8.402   1.00 0.00 ? 19 PHE A HA   6  
ATOM 6956  H HB2  . PHE A 1 19 ? 5.099   0.346   6.636   1.00 0.00 ? 19 PHE A HB2  6  
ATOM 6957  H HB3  . PHE A 1 19 ? 5.221   2.065   6.993   1.00 0.00 ? 19 PHE A HB3  6  
ATOM 6958  H HD1  . PHE A 1 19 ? 6.955   -0.763  5.357   1.00 0.00 ? 19 PHE A HD1  6  
ATOM 6959  H HD2  . PHE A 1 19 ? 6.637   3.462   5.754   1.00 0.00 ? 19 PHE A HD2  6  
ATOM 6960  H HE1  . PHE A 1 19 ? 8.451   -0.473  3.426   1.00 0.00 ? 19 PHE A HE1  6  
ATOM 6961  H HE2  . PHE A 1 19 ? 8.133   3.761   3.823   1.00 0.00 ? 19 PHE A HE2  6  
ATOM 6962  H HZ   . PHE A 1 19 ? 9.043   1.792   2.657   1.00 0.00 ? 19 PHE A HZ   6  
ATOM 6963  N N    . VAL A 1 20 ? 4.880   1.767   9.688   1.00 0.00 ? 20 VAL A N    6  
ATOM 6964  C CA   . VAL A 1 20 ? 3.899   1.746   10.764  1.00 0.00 ? 20 VAL A CA   6  
ATOM 6965  C C    . VAL A 1 20 ? 2.648   2.531   10.385  1.00 0.00 ? 20 VAL A C    6  
ATOM 6966  O O    . VAL A 1 20 ? 2.597   3.164   9.330   1.00 0.00 ? 20 VAL A O    6  
ATOM 6967  C CB   . VAL A 1 20 ? 4.481   2.329   12.066  1.00 0.00 ? 20 VAL A CB   6  
ATOM 6968  C CG1  . VAL A 1 20 ? 5.446   1.346   12.708  1.00 0.00 ? 20 VAL A CG1  6  
ATOM 6969  C CG2  . VAL A 1 20 ? 5.164   3.660   11.797  1.00 0.00 ? 20 VAL A CG2  6  
ATOM 6970  H H    . VAL A 1 20 ? 5.076   2.614   9.235   1.00 0.00 ? 20 VAL A H    6  
ATOM 6971  H HA   . VAL A 1 20 ? 3.625   0.716   10.947  1.00 0.00 ? 20 VAL A HA   6  
ATOM 6972  H HB   . VAL A 1 20 ? 3.665   2.500   12.756  1.00 0.00 ? 20 VAL A HB   6  
ATOM 6973  H HG11 . VAL A 1 20 ? 6.248   1.888   13.186  1.00 0.00 ? 20 VAL A HG11 6  
ATOM 6974  H HG12 . VAL A 1 20 ? 5.854   0.693   11.950  1.00 0.00 ? 20 VAL A HG12 6  
ATOM 6975  H HG13 . VAL A 1 20 ? 4.921   0.755   13.446  1.00 0.00 ? 20 VAL A HG13 6  
ATOM 6976  H HG21 . VAL A 1 20 ? 5.755   3.943   12.655  1.00 0.00 ? 20 VAL A HG21 6  
ATOM 6977  H HG22 . VAL A 1 20 ? 4.418   4.418   11.609  1.00 0.00 ? 20 VAL A HG22 6  
ATOM 6978  H HG23 . VAL A 1 20 ? 5.807   3.566   10.933  1.00 0.00 ? 20 VAL A HG23 6  
ATOM 6979  N N    . VAL A 1 21 ? 1.641   2.485   11.250  1.00 0.00 ? 21 VAL A N    6  
ATOM 6980  C CA   . VAL A 1 21 ? 0.390   3.193   11.004  1.00 0.00 ? 21 VAL A CA   6  
ATOM 6981  C C    . VAL A 1 21 ? 0.450   4.617   11.544  1.00 0.00 ? 21 VAL A C    6  
ATOM 6982  O O    . VAL A 1 21 ? 0.479   4.831   12.756  1.00 0.00 ? 21 VAL A O    6  
ATOM 6983  C CB   . VAL A 1 21 ? -0.806  2.462   11.645  1.00 0.00 ? 21 VAL A CB   6  
ATOM 6984  C CG1  . VAL A 1 21 ? -2.116  3.126   11.247  1.00 0.00 ? 21 VAL A CG1  6  
ATOM 6985  C CG2  . VAL A 1 21 ? -0.806  0.991   11.256  1.00 0.00 ? 21 VAL A CG2  6  
ATOM 6986  H H    . VAL A 1 21 ? 1.741   1.964   12.074  1.00 0.00 ? 21 VAL A H    6  
ATOM 6987  H HA   . VAL A 1 21 ? 0.232   3.229   9.936   1.00 0.00 ? 21 VAL A HA   6  
ATOM 6988  H HB   . VAL A 1 21 ? -0.708  2.527   12.718  1.00 0.00 ? 21 VAL A HB   6  
ATOM 6989  H HG11 . VAL A 1 21 ? -1.922  4.136   10.920  1.00 0.00 ? 21 VAL A HG11 6  
ATOM 6990  H HG12 . VAL A 1 21 ? -2.784  3.142   12.095  1.00 0.00 ? 21 VAL A HG12 6  
ATOM 6991  H HG13 . VAL A 1 21 ? -2.571  2.567   10.442  1.00 0.00 ? 21 VAL A HG13 6  
ATOM 6992  H HG21 . VAL A 1 21 ? -1.535  0.825   10.476  1.00 0.00 ? 21 VAL A HG21 6  
ATOM 6993  H HG22 . VAL A 1 21 ? -1.059  0.390   12.118  1.00 0.00 ? 21 VAL A HG22 6  
ATOM 6994  H HG23 . VAL A 1 21 ? 0.173   0.711   10.898  1.00 0.00 ? 21 VAL A HG23 6  
ATOM 6995  N N    . GLY A 1 22 ? 0.468   5.589   10.638  1.00 0.00 ? 22 GLY A N    6  
ATOM 6996  C CA   . GLY A 1 22 ? 0.523   6.982   11.043  1.00 0.00 ? 22 GLY A CA   6  
ATOM 6997  C C    . GLY A 1 22 ? 1.623   7.748   10.334  1.00 0.00 ? 22 GLY A C    6  
ATOM 6998  O O    . GLY A 1 22 ? 1.521   8.960   10.144  1.00 0.00 ? 22 GLY A O    6  
ATOM 6999  H H    . GLY A 1 22 ? 0.442   5.358   9.685   1.00 0.00 ? 22 GLY A H    6  
ATOM 7000  H HA2  . GLY A 1 22 ? -0.426  7.447   10.822  1.00 0.00 ? 22 GLY A HA2  6  
ATOM 7001  H HA3  . GLY A 1 22 ? 0.696   7.029   12.108  1.00 0.00 ? 22 GLY A HA3  6  
ATOM 7002  N N    . GLU A 1 23 ? 2.677   7.040   9.941   1.00 0.00 ? 23 GLU A N    6  
ATOM 7003  C CA   . GLU A 1 23 ? 3.800   7.662   9.248   1.00 0.00 ? 23 GLU A CA   6  
ATOM 7004  C C    . GLU A 1 23 ? 3.464   7.913   7.782   1.00 0.00 ? 23 GLU A C    6  
ATOM 7005  O O    . GLU A 1 23 ? 2.525   7.330   7.241   1.00 0.00 ? 23 GLU A O    6  
ATOM 7006  C CB   . GLU A 1 23 ? 5.044   6.777   9.355   1.00 0.00 ? 23 GLU A CB   6  
ATOM 7007  C CG   . GLU A 1 23 ? 4.848   5.381   8.786   1.00 0.00 ? 23 GLU A CG   6  
ATOM 7008  C CD   . GLU A 1 23 ? 6.126   4.801   8.214   1.00 0.00 ? 23 GLU A CD   6  
ATOM 7009  O OE1  . GLU A 1 23 ? 6.569   5.277   7.147   1.00 0.00 ? 23 GLU A OE1  6  
ATOM 7010  O OE2  . GLU A 1 23 ? 6.685   3.871   8.832   1.00 0.00 ? 23 GLU A OE2  6  
ATOM 7011  H H    . GLU A 1 23 ? 2.700   6.077   10.119  1.00 0.00 ? 23 GLU A H    6  
ATOM 7012  H HA   . GLU A 1 23 ? 4.000   8.609   9.727   1.00 0.00 ? 23 GLU A HA   6  
ATOM 7013  H HB2  . GLU A 1 23 ? 5.854   7.250   8.821   1.00 0.00 ? 23 GLU A HB2  6  
ATOM 7014  H HB3  . GLU A 1 23 ? 5.316   6.683   10.396  1.00 0.00 ? 23 GLU A HB3  6  
ATOM 7015  H HG2  . GLU A 1 23 ? 4.497   4.731   9.573   1.00 0.00 ? 23 GLU A HG2  6  
ATOM 7016  H HG3  . GLU A 1 23 ? 4.107   5.428   8.001   1.00 0.00 ? 23 GLU A HG3  6  
ATOM 7017  N N    . ARG A 1 24 ? 4.240   8.784   7.144   1.00 0.00 ? 24 ARG A N    6  
ATOM 7018  C CA   . ARG A 1 24 ? 4.025   9.113   5.740   1.00 0.00 ? 24 ARG A CA   6  
ATOM 7019  C C    . ARG A 1 24 ? 4.930   8.276   4.841   1.00 0.00 ? 24 ARG A C    6  
ATOM 7020  O O    . ARG A 1 24 ? 6.062   7.958   5.206   1.00 0.00 ? 24 ARG A O    6  
ATOM 7021  C CB   . ARG A 1 24 ? 4.283   10.601  5.497   1.00 0.00 ? 24 ARG A CB   6  
ATOM 7022  C CG   . ARG A 1 24 ? 3.177   11.504  6.019   1.00 0.00 ? 24 ARG A CG   6  
ATOM 7023  C CD   . ARG A 1 24 ? 1.897   11.338  5.216   1.00 0.00 ? 24 ARG A CD   6  
ATOM 7024  N NE   . ARG A 1 24 ? 1.738   12.391  4.215   1.00 0.00 ? 24 ARG A NE   6  
ATOM 7025  C CZ   . ARG A 1 24 ? 1.548   13.675  4.515   1.00 0.00 ? 24 ARG A CZ   6  
ATOM 7026  N NH1  . ARG A 1 24 ? 1.491   14.067  5.781   1.00 0.00 ? 24 ARG A NH1  6  
ATOM 7027  N NH2  . ARG A 1 24 ? 1.413   14.568  3.544   1.00 0.00 ? 24 ARG A NH2  6  
ATOM 7028  H H    . ARG A 1 24 ? 4.974   9.217   7.630   1.00 0.00 ? 24 ARG A H    6  
ATOM 7029  H HA   . ARG A 1 24 ? 2.996   8.892   5.501   1.00 0.00 ? 24 ARG A HA   6  
ATOM 7030  H HB2  . ARG A 1 24 ? 5.206   10.879  5.987   1.00 0.00 ? 24 ARG A HB2  6  
ATOM 7031  H HB3  . ARG A 1 24 ? 4.385   10.769  4.436   1.00 0.00 ? 24 ARG A HB3  6  
ATOM 7032  H HG2  . ARG A 1 24 ? 2.977   11.253  7.050   1.00 0.00 ? 24 ARG A HG2  6  
ATOM 7033  H HG3  . ARG A 1 24 ? 3.503   12.532  5.953   1.00 0.00 ? 24 ARG A HG3  6  
ATOM 7034  H HD2  . ARG A 1 24 ? 1.923   10.382  4.715   1.00 0.00 ? 24 ARG A HD2  6  
ATOM 7035  H HD3  . ARG A 1 24 ? 1.056   11.367  5.893   1.00 0.00 ? 24 ARG A HD3  6  
ATOM 7036  H HE   . ARG A 1 24 ? 1.775   12.129  3.273   1.00 0.00 ? 24 ARG A HE   6  
ATOM 7037  H HH11 . ARG A 1 24 ? 1.593   13.398  6.518   1.00 0.00 ? 24 ARG A HH11 6  
ATOM 7038  H HH12 . ARG A 1 24 ? 1.348   15.032  5.999   1.00 0.00 ? 24 ARG A HH12 6  
ATOM 7039  H HH21 . ARG A 1 24 ? 1.455   14.278  2.588   1.00 0.00 ? 24 ARG A HH21 6  
ATOM 7040  H HH22 . ARG A 1 24 ? 1.270   15.532  3.769   1.00 0.00 ? 24 ARG A HH22 6  
ATOM 7041  N N    . VAL A 1 25 ? 4.424   7.922   3.665   1.00 0.00 ? 25 VAL A N    6  
ATOM 7042  C CA   . VAL A 1 25 ? 5.186   7.122   2.714   1.00 0.00 ? 25 VAL A CA   6  
ATOM 7043  C C    . VAL A 1 25 ? 4.822   7.482   1.278   1.00 0.00 ? 25 VAL A C    6  
ATOM 7044  O O    . VAL A 1 25 ? 3.661   7.746   0.967   1.00 0.00 ? 25 VAL A O    6  
ATOM 7045  C CB   . VAL A 1 25 ? 4.951   5.616   2.929   1.00 0.00 ? 25 VAL A CB   6  
ATOM 7046  C CG1  . VAL A 1 25 ? 5.495   5.178   4.279   1.00 0.00 ? 25 VAL A CG1  6  
ATOM 7047  C CG2  . VAL A 1 25 ? 3.471   5.283   2.809   1.00 0.00 ? 25 VAL A CG2  6  
ATOM 7048  H H    . VAL A 1 25 ? 3.515   8.207   3.430   1.00 0.00 ? 25 VAL A H    6  
ATOM 7049  H HA   . VAL A 1 25 ? 6.235   7.328   2.871   1.00 0.00 ? 25 VAL A HA   6  
ATOM 7050  H HB   . VAL A 1 25 ? 5.483   5.076   2.159   1.00 0.00 ? 25 VAL A HB   6  
ATOM 7051  H HG11 . VAL A 1 25 ? 5.237   4.143   4.453   1.00 0.00 ? 25 VAL A HG11 6  
ATOM 7052  H HG12 . VAL A 1 25 ? 5.065   5.790   5.057   1.00 0.00 ? 25 VAL A HG12 6  
ATOM 7053  H HG13 . VAL A 1 25 ? 6.569   5.287   4.287   1.00 0.00 ? 25 VAL A HG13 6  
ATOM 7054  H HG21 . VAL A 1 25 ? 3.047   5.165   3.795   1.00 0.00 ? 25 VAL A HG21 6  
ATOM 7055  H HG22 . VAL A 1 25 ? 3.352   4.364   2.254   1.00 0.00 ? 25 VAL A HG22 6  
ATOM 7056  H HG23 . VAL A 1 25 ? 2.962   6.082   2.292   1.00 0.00 ? 25 VAL A HG23 6  
ATOM 7057  N N    . TRP A 1 26 ? 5.823   7.491   0.403   1.00 0.00 ? 26 TRP A N    6  
ATOM 7058  C CA   . TRP A 1 26 ? 5.608   7.820   -1.001  1.00 0.00 ? 26 TRP A CA   6  
ATOM 7059  C C    . TRP A 1 26 ? 5.322   6.563   -1.816  1.00 0.00 ? 26 TRP A C    6  
ATOM 7060  O O    . TRP A 1 26 ? 6.069   5.586   -1.754  1.00 0.00 ? 26 TRP A O    6  
ATOM 7061  C CB   . TRP A 1 26 ? 6.829   8.544   -1.570  1.00 0.00 ? 26 TRP A CB   6  
ATOM 7062  C CG   . TRP A 1 26 ? 6.802   10.024  -1.337  1.00 0.00 ? 26 TRP A CG   6  
ATOM 7063  C CD1  . TRP A 1 26 ? 6.669   11.000  -2.282  1.00 0.00 ? 26 TRP A CD1  6  
ATOM 7064  C CD2  . TRP A 1 26 ? 6.912   10.697  -0.077  1.00 0.00 ? 26 TRP A CD2  6  
ATOM 7065  N NE1  . TRP A 1 26 ? 6.688   12.239  -1.688  1.00 0.00 ? 26 TRP A NE1  6  
ATOM 7066  C CE2  . TRP A 1 26 ? 6.837   12.079  -0.334  1.00 0.00 ? 26 TRP A CE2  6  
ATOM 7067  C CE3  . TRP A 1 26 ? 7.066   10.264  1.242   1.00 0.00 ? 26 TRP A CE3  6  
ATOM 7068  C CZ2  . TRP A 1 26 ? 6.911   13.030  0.680   1.00 0.00 ? 26 TRP A CZ2  6  
ATOM 7069  C CZ3  . TRP A 1 26 ? 7.140   11.210  2.248   1.00 0.00 ? 26 TRP A CZ3  6  
ATOM 7070  C CH2  . TRP A 1 26 ? 7.060   12.578  1.962   1.00 0.00 ? 26 TRP A CH2  6  
ATOM 7071  H H    . TRP A 1 26 ? 6.728   7.273   0.710   1.00 0.00 ? 26 TRP A H    6  
ATOM 7072  H HA   . TRP A 1 26 ? 4.752   8.475   -1.060  1.00 0.00 ? 26 TRP A HA   6  
ATOM 7073  H HB2  . TRP A 1 26 ? 7.721   8.151   -1.106  1.00 0.00 ? 26 TRP A HB2  6  
ATOM 7074  H HB3  . TRP A 1 26 ? 6.877   8.373   -2.635  1.00 0.00 ? 26 TRP A HB3  6  
ATOM 7075  H HD1  . TRP A 1 26 ? 6.564   10.811  -3.341  1.00 0.00 ? 26 TRP A HD1  6  
ATOM 7076  H HE1  . TRP A 1 26 ? 6.609   13.096  -2.155  1.00 0.00 ? 26 TRP A HE1  6  
ATOM 7077  H HE3  . TRP A 1 26 ? 7.129   9.213   1.483   1.00 0.00 ? 26 TRP A HE3  6  
ATOM 7078  H HZ2  . TRP A 1 26 ? 6.851   14.088  0.476   1.00 0.00 ? 26 TRP A HZ2  6  
ATOM 7079  H HZ3  . TRP A 1 26 ? 7.258   10.894  3.274   1.00 0.00 ? 26 TRP A HZ3  6  
ATOM 7080  H HH2  . TRP A 1 26 ? 7.123   13.281  2.780   1.00 0.00 ? 26 TRP A HH2  6  
ATOM 7081  N N    . VAL A 1 27 ? 4.235   6.596   -2.582  1.00 0.00 ? 27 VAL A N    6  
ATOM 7082  C CA   . VAL A 1 27 ? 3.850   5.461   -3.411  1.00 0.00 ? 27 VAL A CA   6  
ATOM 7083  C C    . VAL A 1 27 ? 4.465   5.565   -4.803  1.00 0.00 ? 27 VAL A C    6  
ATOM 7084  O O    . VAL A 1 27 ? 4.125   6.460   -5.577  1.00 0.00 ? 27 VAL A O    6  
ATOM 7085  C CB   . VAL A 1 27 ? 2.318   5.358   -3.546  1.00 0.00 ? 27 VAL A CB   6  
ATOM 7086  C CG1  . VAL A 1 27 ? 1.929   4.068   -4.252  1.00 0.00 ? 27 VAL A CG1  6  
ATOM 7087  C CG2  . VAL A 1 27 ? 1.655   5.449   -2.181  1.00 0.00 ? 27 VAL A CG2  6  
ATOM 7088  H H    . VAL A 1 27 ? 3.680   7.403   -2.589  1.00 0.00 ? 27 VAL A H    6  
ATOM 7089  H HA   . VAL A 1 27 ? 4.210   4.561   -2.935  1.00 0.00 ? 27 VAL A HA   6  
ATOM 7090  H HB   . VAL A 1 27 ? 1.974   6.187   -4.146  1.00 0.00 ? 27 VAL A HB   6  
ATOM 7091  H HG11 . VAL A 1 27 ? 2.782   3.677   -4.786  1.00 0.00 ? 27 VAL A HG11 6  
ATOM 7092  H HG12 . VAL A 1 27 ? 1.129   4.267   -4.949  1.00 0.00 ? 27 VAL A HG12 6  
ATOM 7093  H HG13 . VAL A 1 27 ? 1.598   3.344   -3.522  1.00 0.00 ? 27 VAL A HG13 6  
ATOM 7094  H HG21 . VAL A 1 27 ? 1.996   4.633   -1.559  1.00 0.00 ? 27 VAL A HG21 6  
ATOM 7095  H HG22 . VAL A 1 27 ? 0.584   5.390   -2.296  1.00 0.00 ? 27 VAL A HG22 6  
ATOM 7096  H HG23 . VAL A 1 27 ? 1.917   6.388   -1.715  1.00 0.00 ? 27 VAL A HG23 6  
ATOM 7097  N N    . ASN A 1 28 ? 5.371   4.644   -5.115  1.00 0.00 ? 28 ASN A N    6  
ATOM 7098  C CA   . ASN A 1 28 ? 6.034   4.632   -6.413  1.00 0.00 ? 28 ASN A CA   6  
ATOM 7099  C C    . ASN A 1 28 ? 6.791   5.935   -6.651  1.00 0.00 ? 28 ASN A C    6  
ATOM 7100  O O    . ASN A 1 28 ? 6.958   6.368   -7.791  1.00 0.00 ? 28 ASN A O    6  
ATOM 7101  C CB   . ASN A 1 28 ? 5.010   4.413   -7.529  1.00 0.00 ? 28 ASN A CB   6  
ATOM 7102  C CG   . ASN A 1 28 ? 4.865   2.950   -7.901  1.00 0.00 ? 28 ASN A CG   6  
ATOM 7103  O OD1  . ASN A 1 28 ? 5.853   2.227   -8.020  1.00 0.00 ? 28 ASN A OD1  6  
ATOM 7104  N ND2  . ASN A 1 28 ? 3.626   2.508   -8.089  1.00 0.00 ? 28 ASN A ND2  6  
ATOM 7105  H H    . ASN A 1 28 ? 5.599   3.956   -4.455  1.00 0.00 ? 28 ASN A H    6  
ATOM 7106  H HA   . ASN A 1 28 ? 6.737   3.814   -6.418  1.00 0.00 ? 28 ASN A HA   6  
ATOM 7107  H HB2  . ASN A 1 28 ? 4.047   4.779   -7.203  1.00 0.00 ? 28 ASN A HB2  6  
ATOM 7108  H HB3  . ASN A 1 28 ? 5.320   4.960   -8.407  1.00 0.00 ? 28 ASN A HB3  6  
ATOM 7109  H HD21 . ASN A 1 28 ? 2.887   3.141   -7.979  1.00 0.00 ? 28 ASN A HD21 6  
ATOM 7110  H HD22 . ASN A 1 28 ? 3.503   1.567   -8.331  1.00 0.00 ? 28 ASN A HD22 6  
ATOM 7111  N N    . GLY A 1 29 ? 7.248   6.556   -5.567  1.00 0.00 ? 29 GLY A N    6  
ATOM 7112  C CA   . GLY A 1 29 ? 7.982   7.802   -5.681  1.00 0.00 ? 29 GLY A CA   6  
ATOM 7113  C C    . GLY A 1 29 ? 7.180   8.889   -6.370  1.00 0.00 ? 29 GLY A C    6  
ATOM 7114  O O    . GLY A 1 29 ? 7.738   9.724   -7.082  1.00 0.00 ? 29 GLY A O    6  
ATOM 7115  H H    . GLY A 1 29 ? 7.084   6.164   -4.684  1.00 0.00 ? 29 GLY A H    6  
ATOM 7116  H HA2  . GLY A 1 29 ? 8.249   8.141   -4.690  1.00 0.00 ? 29 GLY A HA2  6  
ATOM 7117  H HA3  . GLY A 1 29 ? 8.886   7.625   -6.245  1.00 0.00 ? 29 GLY A HA3  6  
ATOM 7118  N N    . VAL A 1 30 ? 5.868   8.878   -6.159  1.00 0.00 ? 30 VAL A N    6  
ATOM 7119  C CA   . VAL A 1 30 ? 4.989   9.869   -6.767  1.00 0.00 ? 30 VAL A CA   6  
ATOM 7120  C C    . VAL A 1 30 ? 4.493   10.873  -5.733  1.00 0.00 ? 30 VAL A C    6  
ATOM 7121  O O    . VAL A 1 30 ? 4.838   12.054  -5.784  1.00 0.00 ? 30 VAL A O    6  
ATOM 7122  C CB   . VAL A 1 30 ? 3.774   9.204   -7.443  1.00 0.00 ? 30 VAL A CB   6  
ATOM 7123  C CG1  . VAL A 1 30 ? 2.979   10.228  -8.239  1.00 0.00 ? 30 VAL A CG1  6  
ATOM 7124  C CG2  . VAL A 1 30 ? 4.222   8.056   -8.334  1.00 0.00 ? 30 VAL A CG2  6  
ATOM 7125  H H    . VAL A 1 30 ? 5.482   8.186   -5.582  1.00 0.00 ? 30 VAL A H    6  
ATOM 7126  H HA   . VAL A 1 30 ? 5.552   10.395  -7.524  1.00 0.00 ? 30 VAL A HA   6  
ATOM 7127  H HB   . VAL A 1 30 ? 3.132   8.805   -6.671  1.00 0.00 ? 30 VAL A HB   6  
ATOM 7128  H HG11 . VAL A 1 30 ? 3.605   10.651  -9.011  1.00 0.00 ? 30 VAL A HG11 6  
ATOM 7129  H HG12 . VAL A 1 30 ? 2.641   11.014  -7.580  1.00 0.00 ? 30 VAL A HG12 6  
ATOM 7130  H HG13 . VAL A 1 30 ? 2.125   9.746   -8.692  1.00 0.00 ? 30 VAL A HG13 6  
ATOM 7131  H HG21 . VAL A 1 30 ? 3.364   7.463   -8.614  1.00 0.00 ? 30 VAL A HG21 6  
ATOM 7132  H HG22 . VAL A 1 30 ? 4.927   7.439   -7.797  1.00 0.00 ? 30 VAL A HG22 6  
ATOM 7133  H HG23 . VAL A 1 30 ? 4.692   8.452   -9.222  1.00 0.00 ? 30 VAL A HG23 6  
ATOM 7134  N N    . LYS A 1 31 ? 3.682   10.396  -4.793  1.00 0.00 ? 31 LYS A N    6  
ATOM 7135  C CA   . LYS A 1 31 ? 3.139   11.254  -3.746  1.00 0.00 ? 31 LYS A CA   6  
ATOM 7136  C C    . LYS A 1 31 ? 3.083   10.516  -2.411  1.00 0.00 ? 31 LYS A C    6  
ATOM 7137  O O    . LYS A 1 31 ? 2.912   9.296   -2.373  1.00 0.00 ? 31 LYS A O    6  
ATOM 7138  C CB   . LYS A 1 31 ? 1.740   11.742  -4.131  1.00 0.00 ? 31 LYS A CB   6  
ATOM 7139  C CG   . LYS A 1 31 ? 1.671   12.350  -5.522  1.00 0.00 ? 31 LYS A CG   6  
ATOM 7140  C CD   . LYS A 1 31 ? 0.742   13.553  -5.559  1.00 0.00 ? 31 LYS A CD   6  
ATOM 7141  C CE   . LYS A 1 31 ? 0.426   13.970  -6.987  1.00 0.00 ? 31 LYS A CE   6  
ATOM 7142  N NZ   . LYS A 1 31 ? -0.274  15.283  -7.040  1.00 0.00 ? 31 LYS A NZ   6  
ATOM 7143  H H    . LYS A 1 31 ? 3.443   9.446   -4.805  1.00 0.00 ? 31 LYS A H    6  
ATOM 7144  H HA   . LYS A 1 31 ? 3.793   12.107  -3.644  1.00 0.00 ? 31 LYS A HA   6  
ATOM 7145  H HB2  . LYS A 1 31 ? 1.057   10.907  -4.091  1.00 0.00 ? 31 LYS A HB2  6  
ATOM 7146  H HB3  . LYS A 1 31 ? 1.424   12.489  -3.418  1.00 0.00 ? 31 LYS A HB3  6  
ATOM 7147  H HG2  . LYS A 1 31 ? 2.661   12.664  -5.817  1.00 0.00 ? 31 LYS A HG2  6  
ATOM 7148  H HG3  . LYS A 1 31 ? 1.308   11.604  -6.212  1.00 0.00 ? 31 LYS A HG3  6  
ATOM 7149  H HD2  . LYS A 1 31 ? -0.179  13.299  -5.057  1.00 0.00 ? 31 LYS A HD2  6  
ATOM 7150  H HD3  . LYS A 1 31 ? 1.217   14.378  -5.049  1.00 0.00 ? 31 LYS A HD3  6  
ATOM 7151  H HE2  . LYS A 1 31 ? 1.351   14.042  -7.540  1.00 0.00 ? 31 LYS A HE2  6  
ATOM 7152  H HE3  . LYS A 1 31 ? -0.204  13.216  -7.437  1.00 0.00 ? 31 LYS A HE3  6  
ATOM 7153  H HZ1  . LYS A 1 31 ? -0.982  15.279  -7.802  1.00 0.00 ? 31 LYS A HZ1  6  
ATOM 7154  H HZ2  . LYS A 1 31 ? 0.409   16.046  -7.221  1.00 0.00 ? 31 LYS A HZ2  6  
ATOM 7155  H HZ3  . LYS A 1 31 ? -0.754  15.469  -6.136  1.00 0.00 ? 31 LYS A HZ3  6  
ATOM 7156  N N    . PRO A 1 32 ? 3.227   11.247  -1.292  1.00 0.00 ? 32 PRO A N    6  
ATOM 7157  C CA   . PRO A 1 32 ? 3.193   10.656  0.048   1.00 0.00 ? 32 PRO A CA   6  
ATOM 7158  C C    . PRO A 1 32 ? 1.789   10.220  0.455   1.00 0.00 ? 32 PRO A C    6  
ATOM 7159  O O    . PRO A 1 32 ? 0.799   10.645  -0.140  1.00 0.00 ? 32 PRO A O    6  
ATOM 7160  C CB   . PRO A 1 32 ? 3.681   11.792  0.948   1.00 0.00 ? 32 PRO A CB   6  
ATOM 7161  C CG   . PRO A 1 32 ? 3.314   13.036  0.215   1.00 0.00 ? 32 PRO A CG   6  
ATOM 7162  C CD   . PRO A 1 32 ? 3.435   12.708  -1.248  1.00 0.00 ? 32 PRO A CD   6  
ATOM 7163  H HA   . PRO A 1 32 ? 3.866   9.816   0.127   1.00 0.00 ? 32 PRO A HA   6  
ATOM 7164  H HB2  . PRO A 1 32 ? 3.183   11.736  1.907   1.00 0.00 ? 32 PRO A HB2  6  
ATOM 7165  H HB3  . PRO A 1 32 ? 4.751   11.715  1.083   1.00 0.00 ? 32 PRO A HB3  6  
ATOM 7166  H HG2  . PRO A 1 32 ? 2.298   13.316  0.453   1.00 0.00 ? 32 PRO A HG2  6  
ATOM 7167  H HG3  . PRO A 1 32 ? 3.995   13.832  0.478   1.00 0.00 ? 32 PRO A HG3  6  
ATOM 7168  H HD2  . PRO A 1 32 ? 2.673   13.222  -1.814  1.00 0.00 ? 32 PRO A HD2  6  
ATOM 7169  H HD3  . PRO A 1 32 ? 4.417   12.967  -1.613  1.00 0.00 ? 32 PRO A HD3  6  
ATOM 7170  N N    . GLY A 1 33 ? 1.711   9.370   1.475   1.00 0.00 ? 33 GLY A N    6  
ATOM 7171  C CA   . GLY A 1 33 ? 0.425   8.892   1.945   1.00 0.00 ? 33 GLY A CA   6  
ATOM 7172  C C    . GLY A 1 33 ? 0.472   8.429   3.389   1.00 0.00 ? 33 GLY A C    6  
ATOM 7173  O O    . GLY A 1 33 ? 1.549   8.193   3.937   1.00 0.00 ? 33 GLY A O    6  
ATOM 7174  H H    . GLY A 1 33 ? 2.535   9.067   1.911   1.00 0.00 ? 33 GLY A H    6  
ATOM 7175  H HA2  . GLY A 1 33 ? -0.298  9.690   1.857   1.00 0.00 ? 33 GLY A HA2  6  
ATOM 7176  H HA3  . GLY A 1 33 ? 0.111   8.066   1.324   1.00 0.00 ? 33 GLY A HA3  6  
ATOM 7177  N N    . VAL A 1 34 ? -0.698  8.297   4.004   1.00 0.00 ? 34 VAL A N    6  
ATOM 7178  C CA   . VAL A 1 34 ? -0.785  7.861   5.392   1.00 0.00 ? 34 VAL A CA   6  
ATOM 7179  C C    . VAL A 1 34 ? -1.112  6.374   5.481   1.00 0.00 ? 34 VAL A C    6  
ATOM 7180  O O    . VAL A 1 34 ? -2.128  5.918   4.955   1.00 0.00 ? 34 VAL A O    6  
ATOM 7181  C CB   . VAL A 1 34 ? -1.855  8.655   6.166   1.00 0.00 ? 34 VAL A CB   6  
ATOM 7182  C CG1  . VAL A 1 34 ? -1.785  8.338   7.651   1.00 0.00 ? 34 VAL A CG1  6  
ATOM 7183  C CG2  . VAL A 1 34 ? -1.693  10.147  5.923   1.00 0.00 ? 34 VAL A CG2  6  
ATOM 7184  H H    . VAL A 1 34 ? -1.523  8.500   3.513   1.00 0.00 ? 34 VAL A H    6  
ATOM 7185  H HA   . VAL A 1 34 ? 0.173   8.037   5.859   1.00 0.00 ? 34 VAL A HA   6  
ATOM 7186  H HB   . VAL A 1 34 ? -2.828  8.356   5.803   1.00 0.00 ? 34 VAL A HB   6  
ATOM 7187  H HG11 . VAL A 1 34 ? -2.490  7.555   7.887   1.00 0.00 ? 34 VAL A HG11 6  
ATOM 7188  H HG12 . VAL A 1 34 ? -2.027  9.224   8.221   1.00 0.00 ? 34 VAL A HG12 6  
ATOM 7189  H HG13 . VAL A 1 34 ? -0.787  8.011   7.903   1.00 0.00 ? 34 VAL A HG13 6  
ATOM 7190  H HG21 . VAL A 1 34 ? -1.861  10.362  4.878   1.00 0.00 ? 34 VAL A HG21 6  
ATOM 7191  H HG22 . VAL A 1 34 ? -0.692  10.450  6.195   1.00 0.00 ? 34 VAL A HG22 6  
ATOM 7192  H HG23 . VAL A 1 34 ? -2.408  10.690  6.522   1.00 0.00 ? 34 VAL A HG23 6  
ATOM 7193  N N    . VAL A 1 35 ? -0.244  5.621   6.149   1.00 0.00 ? 35 VAL A N    6  
ATOM 7194  C CA   . VAL A 1 35 ? -0.442  4.185   6.307   1.00 0.00 ? 35 VAL A CA   6  
ATOM 7195  C C    . VAL A 1 35 ? -1.506  3.890   7.357   1.00 0.00 ? 35 VAL A C    6  
ATOM 7196  O O    . VAL A 1 35 ? -1.296  4.115   8.549   1.00 0.00 ? 35 VAL A O    6  
ATOM 7197  C CB   . VAL A 1 35 ? 0.869   3.478   6.705   1.00 0.00 ? 35 VAL A CB   6  
ATOM 7198  C CG1  . VAL A 1 35 ? 0.683   1.968   6.709   1.00 0.00 ? 35 VAL A CG1  6  
ATOM 7199  C CG2  . VAL A 1 35 ? 2.001   3.881   5.773   1.00 0.00 ? 35 VAL A CG2  6  
ATOM 7200  H H    . VAL A 1 35 ? 0.547   6.041   6.545   1.00 0.00 ? 35 VAL A H    6  
ATOM 7201  H HA   . VAL A 1 35 ? -0.766  3.787   5.356   1.00 0.00 ? 35 VAL A HA   6  
ATOM 7202  H HB   . VAL A 1 35 ? 1.130   3.787   7.707   1.00 0.00 ? 35 VAL A HB   6  
ATOM 7203  H HG11 . VAL A 1 35 ? -0.286  1.725   7.118   1.00 0.00 ? 35 VAL A HG11 6  
ATOM 7204  H HG12 . VAL A 1 35 ? 1.454   1.512   7.312   1.00 0.00 ? 35 VAL A HG12 6  
ATOM 7205  H HG13 . VAL A 1 35 ? 0.750   1.596   5.697   1.00 0.00 ? 35 VAL A HG13 6  
ATOM 7206  H HG21 . VAL A 1 35 ? 1.738   4.794   5.259   1.00 0.00 ? 35 VAL A HG21 6  
ATOM 7207  H HG22 . VAL A 1 35 ? 2.167   3.096   5.048   1.00 0.00 ? 35 VAL A HG22 6  
ATOM 7208  H HG23 . VAL A 1 35 ? 2.903   4.037   6.346   1.00 0.00 ? 35 VAL A HG23 6  
ATOM 7209  N N    . GLN A 1 36 ? -2.650  3.385   6.907   1.00 0.00 ? 36 GLN A N    6  
ATOM 7210  C CA   . GLN A 1 36 ? -3.749  3.060   7.809   1.00 0.00 ? 36 GLN A CA   6  
ATOM 7211  C C    . GLN A 1 36 ? -3.820  1.557   8.060   1.00 0.00 ? 36 GLN A C    6  
ATOM 7212  O O    . GLN A 1 36 ? -3.939  1.113   9.202   1.00 0.00 ? 36 GLN A O    6  
ATOM 7213  C CB   . GLN A 1 36 ? -5.075  3.555   7.230   1.00 0.00 ? 36 GLN A CB   6  
ATOM 7214  C CG   . GLN A 1 36 ? -5.302  5.046   7.417   1.00 0.00 ? 36 GLN A CG   6  
ATOM 7215  C CD   . GLN A 1 36 ? -5.987  5.372   8.730   1.00 0.00 ? 36 GLN A CD   6  
ATOM 7216  O OE1  . GLN A 1 36 ? -7.192  5.618   8.771   1.00 0.00 ? 36 GLN A OE1  6  
ATOM 7217  N NE2  . GLN A 1 36 ? -5.219  5.375   9.814   1.00 0.00 ? 36 GLN A NE2  6  
ATOM 7218  H H    . GLN A 1 36 ? -2.759  3.228   5.946   1.00 0.00 ? 36 GLN A H    6  
ATOM 7219  H HA   . GLN A 1 36 ? -3.567  3.561   8.747   1.00 0.00 ? 36 GLN A HA   6  
ATOM 7220  H HB2  . GLN A 1 36 ? -5.096  3.340   6.172   1.00 0.00 ? 36 GLN A HB2  6  
ATOM 7221  H HB3  . GLN A 1 36 ? -5.885  3.027   7.711   1.00 0.00 ? 36 GLN A HB3  6  
ATOM 7222  H HG2  . GLN A 1 36 ? -4.345  5.548   7.394   1.00 0.00 ? 36 GLN A HG2  6  
ATOM 7223  H HG3  . GLN A 1 36 ? -5.917  5.409   6.607   1.00 0.00 ? 36 GLN A HG3  6  
ATOM 7224  H HE21 . GLN A 1 36 ? -4.266  5.170   9.706   1.00 0.00 ? 36 GLN A HE21 6  
ATOM 7225  H HE22 . GLN A 1 36 ? -5.635  5.582   10.676  1.00 0.00 ? 36 GLN A HE22 6  
ATOM 7226  N N    . TYR A 1 37 ? -3.748  0.778   6.986   1.00 0.00 ? 37 TYR A N    6  
ATOM 7227  C CA   . TYR A 1 37 ? -3.804  -0.675  7.089   1.00 0.00 ? 37 TYR A CA   6  
ATOM 7228  C C    . TYR A 1 37 ? -2.434  -1.294  6.828   1.00 0.00 ? 37 TYR A C    6  
ATOM 7229  O O    . TYR A 1 37 ? -1.633  -0.753  6.067   1.00 0.00 ? 37 TYR A O    6  
ATOM 7230  C CB   . TYR A 1 37 ? -4.827  -1.238  6.101   1.00 0.00 ? 37 TYR A CB   6  
ATOM 7231  C CG   . TYR A 1 37 ? -5.569  -2.448  6.622   1.00 0.00 ? 37 TYR A CG   6  
ATOM 7232  C CD1  . TYR A 1 37 ? -6.641  -2.309  7.495   1.00 0.00 ? 37 TYR A CD1  6  
ATOM 7233  C CD2  . TYR A 1 37 ? -5.198  -3.732  6.238   1.00 0.00 ? 37 TYR A CD2  6  
ATOM 7234  C CE1  . TYR A 1 37 ? -7.320  -3.412  7.973   1.00 0.00 ? 37 TYR A CE1  6  
ATOM 7235  C CE2  . TYR A 1 37 ? -5.874  -4.840  6.711   1.00 0.00 ? 37 TYR A CE2  6  
ATOM 7236  C CZ   . TYR A 1 37 ? -6.934  -4.675  7.577   1.00 0.00 ? 37 TYR A CZ   6  
ATOM 7237  O OH   . TYR A 1 37 ? -7.609  -5.778  8.051   1.00 0.00 ? 37 TYR A OH   6  
ATOM 7238  H H    . TYR A 1 37 ? -3.654  1.191   6.102   1.00 0.00 ? 37 TYR A H    6  
ATOM 7239  H HA   . TYR A 1 37 ? -4.112  -0.923  8.094   1.00 0.00 ? 37 TYR A HA   6  
ATOM 7240  H HB2  . TYR A 1 37 ? -5.557  -0.475  5.876   1.00 0.00 ? 37 TYR A HB2  6  
ATOM 7241  H HB3  . TYR A 1 37 ? -4.320  -1.524  5.192   1.00 0.00 ? 37 TYR A HB3  6  
ATOM 7242  H HD1  . TYR A 1 37 ? -6.942  -1.318  7.802   1.00 0.00 ? 37 TYR A HD1  6  
ATOM 7243  H HD2  . TYR A 1 37 ? -4.368  -3.857  5.559   1.00 0.00 ? 37 TYR A HD2  6  
ATOM 7244  H HE1  . TYR A 1 37 ? -8.151  -3.283  8.651   1.00 0.00 ? 37 TYR A HE1  6  
ATOM 7245  H HE2  . TYR A 1 37 ? -5.571  -5.830  6.402   1.00 0.00 ? 37 TYR A HE2  6  
ATOM 7246  H HH   . TYR A 1 37 ? -7.747  -5.687  8.996   1.00 0.00 ? 37 TYR A HH   6  
ATOM 7247  N N    . LEU A 1 38 ? -2.174  -2.431  7.465   1.00 0.00 ? 38 LEU A N    6  
ATOM 7248  C CA   . LEU A 1 38 ? -0.902  -3.124  7.301   1.00 0.00 ? 38 LEU A CA   6  
ATOM 7249  C C    . LEU A 1 38 ? -1.060  -4.619  7.560   1.00 0.00 ? 38 LEU A C    6  
ATOM 7250  O O    . LEU A 1 38 ? -1.092  -5.061  8.709   1.00 0.00 ? 38 LEU A O    6  
ATOM 7251  C CB   . LEU A 1 38 ? 0.148   -2.538  8.248   1.00 0.00 ? 38 LEU A CB   6  
ATOM 7252  C CG   . LEU A 1 38 ? 0.941   -1.358  7.685   1.00 0.00 ? 38 LEU A CG   6  
ATOM 7253  C CD1  . LEU A 1 38 ? 1.744   -0.681  8.784   1.00 0.00 ? 38 LEU A CD1  6  
ATOM 7254  C CD2  . LEU A 1 38 ? 1.857   -1.822  6.561   1.00 0.00 ? 38 LEU A CD2  6  
ATOM 7255  H H    . LEU A 1 38 ? -2.854  -2.813  8.058   1.00 0.00 ? 38 LEU A H    6  
ATOM 7256  H HA   . LEU A 1 38 ? -0.574  -2.980  6.282   1.00 0.00 ? 38 LEU A HA   6  
ATOM 7257  H HB2  . LEU A 1 38 ? -0.353  -2.212  9.149   1.00 0.00 ? 38 LEU A HB2  6  
ATOM 7258  H HB3  . LEU A 1 38 ? 0.846   -3.321  8.508   1.00 0.00 ? 38 LEU A HB3  6  
ATOM 7259  H HG   . LEU A 1 38 ? 0.253   -0.631  7.278   1.00 0.00 ? 38 LEU A HG   6  
ATOM 7260  H HD11 . LEU A 1 38 ? 1.959   -1.395  9.565   1.00 0.00 ? 38 LEU A HD11 6  
ATOM 7261  H HD12 . LEU A 1 38 ? 1.174   0.139   9.193   1.00 0.00 ? 38 LEU A HD12 6  
ATOM 7262  H HD13 . LEU A 1 38 ? 2.671   -0.307  8.374   1.00 0.00 ? 38 LEU A HD13 6  
ATOM 7263  H HD21 . LEU A 1 38 ? 2.326   -0.963  6.103   1.00 0.00 ? 38 LEU A HD21 6  
ATOM 7264  H HD22 . LEU A 1 38 ? 1.278   -2.353  5.821   1.00 0.00 ? 38 LEU A HD22 6  
ATOM 7265  H HD23 . LEU A 1 38 ? 2.617   -2.475  6.963   1.00 0.00 ? 38 LEU A HD23 6  
ATOM 7266  N N    . GLY A 1 39 ? -1.157  -5.394  6.485   1.00 0.00 ? 39 GLY A N    6  
ATOM 7267  C CA   . GLY A 1 39 ? -1.311  -6.831  6.617   1.00 0.00 ? 39 GLY A CA   6  
ATOM 7268  C C    . GLY A 1 39 ? -1.797  -7.482  5.338   1.00 0.00 ? 39 GLY A C    6  
ATOM 7269  O O    . GLY A 1 39 ? -1.692  -6.900  4.258   1.00 0.00 ? 39 GLY A O    6  
ATOM 7270  H H    . GLY A 1 39 ? -1.126  -4.986  5.593   1.00 0.00 ? 39 GLY A H    6  
ATOM 7271  H HA2  . GLY A 1 39 ? -0.358  -7.260  6.888   1.00 0.00 ? 39 GLY A HA2  6  
ATOM 7272  H HA3  . GLY A 1 39 ? -2.022  -7.034  7.404   1.00 0.00 ? 39 GLY A HA3  6  
ATOM 7273  N N    . GLU A 1 40 ? -2.328  -8.694  5.457   1.00 0.00 ? 40 GLU A N    6  
ATOM 7274  C CA   . GLU A 1 40 ? -2.832  -9.426  4.301   1.00 0.00 ? 40 GLU A CA   6  
ATOM 7275  C C    . GLU A 1 40 ? -4.284  -9.057  4.014   1.00 0.00 ? 40 GLU A C    6  
ATOM 7276  O O    . GLU A 1 40 ? -5.174  -9.320  4.823   1.00 0.00 ? 40 GLU A O    6  
ATOM 7277  C CB   . GLU A 1 40 ? -2.713  -10.934 4.534   1.00 0.00 ? 40 GLU A CB   6  
ATOM 7278  C CG   . GLU A 1 40 ? -1.343  -11.366 5.029   1.00 0.00 ? 40 GLU A CG   6  
ATOM 7279  C CD   . GLU A 1 40 ? -1.352  -11.773 6.491   1.00 0.00 ? 40 GLU A CD   6  
ATOM 7280  O OE1  . GLU A 1 40 ? -2.108  -11.159 7.272   1.00 0.00 ? 40 GLU A OE1  6  
ATOM 7281  O OE2  . GLU A 1 40 ? -0.601  -12.703 6.852   1.00 0.00 ? 40 GLU A OE2  6  
ATOM 7282  H H    . GLU A 1 40 ? -2.384  -9.106  6.345   1.00 0.00 ? 40 GLU A H    6  
ATOM 7283  H HA   . GLU A 1 40 ? -2.229  -9.155  3.448   1.00 0.00 ? 40 GLU A HA   6  
ATOM 7284  H HB2  . GLU A 1 40 ? -3.449  -11.232 5.268   1.00 0.00 ? 40 GLU A HB2  6  
ATOM 7285  H HB3  . GLU A 1 40 ? -2.916  -11.447 3.606   1.00 0.00 ? 40 GLU A HB3  6  
ATOM 7286  H HG2  . GLU A 1 40 ? -1.011  -12.208 4.440   1.00 0.00 ? 40 GLU A HG2  6  
ATOM 7287  H HG3  . GLU A 1 40 ? -0.653  -10.545 4.903   1.00 0.00 ? 40 GLU A HG3  6  
ATOM 7288  N N    . THR A 1 41 ? -4.517  -8.447  2.857   1.00 0.00 ? 41 THR A N    6  
ATOM 7289  C CA   . THR A 1 41 ? -5.860  -8.041  2.462   1.00 0.00 ? 41 THR A CA   6  
ATOM 7290  C C    . THR A 1 41 ? -6.754  -9.257  2.242   1.00 0.00 ? 41 THR A C    6  
ATOM 7291  O O    . THR A 1 41 ? -6.325  -10.397 2.426   1.00 0.00 ? 41 THR A O    6  
ATOM 7292  C CB   . THR A 1 41 ? -5.808  -7.196  1.189   1.00 0.00 ? 41 THR A CB   6  
ATOM 7293  O OG1  . THR A 1 41 ? -5.057  -7.852  0.182   1.00 0.00 ? 41 THR A OG1  6  
ATOM 7294  C CG2  . THR A 1 41 ? -5.193  -5.829  1.402   1.00 0.00 ? 41 THR A CG2  6  
ATOM 7295  H H    . THR A 1 41 ? -3.766  -8.264  2.254   1.00 0.00 ? 41 THR A H    6  
ATOM 7296  H HA   . THR A 1 41 ? -6.274  -7.445  3.261   1.00 0.00 ? 41 THR A HA   6  
ATOM 7297  H HB   . THR A 1 41 ? -6.814  -7.053  0.822   1.00 0.00 ? 41 THR A HB   6  
ATOM 7298  H HG1  . THR A 1 41 ? -5.310  -7.511  -0.679  1.00 0.00 ? 41 THR A HG1  6  
ATOM 7299  H HG21 . THR A 1 41 ? -4.561  -5.851  2.278   1.00 0.00 ? 41 THR A HG21 6  
ATOM 7300  H HG22 . THR A 1 41 ? -5.978  -5.100  1.541   1.00 0.00 ? 41 THR A HG22 6  
ATOM 7301  H HG23 . THR A 1 41 ? -4.602  -5.562  0.538   1.00 0.00 ? 41 THR A HG23 6  
ATOM 7302  N N    . GLN A 1 42 ? -7.999  -9.007  1.851   1.00 0.00 ? 42 GLN A N    6  
ATOM 7303  C CA   . GLN A 1 42 ? -8.954  -10.082 1.606   1.00 0.00 ? 42 GLN A CA   6  
ATOM 7304  C C    . GLN A 1 42 ? -9.271  -10.203 0.119   1.00 0.00 ? 42 GLN A C    6  
ATOM 7305  O O    . GLN A 1 42 ? -9.552  -11.293 -0.379  1.00 0.00 ? 42 GLN A O    6  
ATOM 7306  C CB   . GLN A 1 42 ? -10.241 -9.838  2.396   1.00 0.00 ? 42 GLN A CB   6  
ATOM 7307  C CG   . GLN A 1 42 ? -10.047 -9.876  3.903   1.00 0.00 ? 42 GLN A CG   6  
ATOM 7308  C CD   . GLN A 1 42 ? -9.789  -11.276 4.422   1.00 0.00 ? 42 GLN A CD   6  
ATOM 7309  O OE1  . GLN A 1 42 ? -8.922  -11.990 3.916   1.00 0.00 ? 42 GLN A OE1  6  
ATOM 7310  N NE2  . GLN A 1 42 ? -10.543 -11.680 5.438   1.00 0.00 ? 42 GLN A NE2  6  
ATOM 7311  H H    . GLN A 1 42 ? -8.283  -8.078  1.722   1.00 0.00 ? 42 GLN A H    6  
ATOM 7312  H HA   . GLN A 1 42 ? -8.507  -11.006 1.942   1.00 0.00 ? 42 GLN A HA   6  
ATOM 7313  H HB2  . GLN A 1 42 ? -10.634 -8.868  2.129   1.00 0.00 ? 42 GLN A HB2  6  
ATOM 7314  H HB3  . GLN A 1 42 ? -10.963 -10.595 2.128   1.00 0.00 ? 42 GLN A HB3  6  
ATOM 7315  H HG2  . GLN A 1 42 ? -9.205  -9.252  4.161   1.00 0.00 ? 42 GLN A HG2  6  
ATOM 7316  H HG3  . GLN A 1 42 ? -10.938 -9.490  4.377   1.00 0.00 ? 42 GLN A HG3  6  
ATOM 7317  H HE21 . GLN A 1 42 ? -11.214 -11.059 5.792   1.00 0.00 ? 42 GLN A HE21 6  
ATOM 7318  H HE22 . GLN A 1 42 ? -10.396 -12.580 5.794   1.00 0.00 ? 42 GLN A HE22 6  
ATOM 7319  N N    . PHE A 1 43 ? -9.225  -9.077  -0.584  1.00 0.00 ? 43 PHE A N    6  
ATOM 7320  C CA   . PHE A 1 43 ? -9.508  -9.057  -2.015  1.00 0.00 ? 43 PHE A CA   6  
ATOM 7321  C C    . PHE A 1 43 ? -8.479  -9.879  -2.786  1.00 0.00 ? 43 PHE A C    6  
ATOM 7322  O O    . PHE A 1 43 ? -8.789  -10.466 -3.822  1.00 0.00 ? 43 PHE A O    6  
ATOM 7323  C CB   . PHE A 1 43 ? -9.525  -7.618  -2.534  1.00 0.00 ? 43 PHE A CB   6  
ATOM 7324  C CG   . PHE A 1 43 ? -8.190  -6.933  -2.456  1.00 0.00 ? 43 PHE A CG   6  
ATOM 7325  C CD1  . PHE A 1 43 ? -7.216  -7.174  -3.412  1.00 0.00 ? 43 PHE A CD1  6  
ATOM 7326  C CD2  . PHE A 1 43 ? -7.910  -6.048  -1.426  1.00 0.00 ? 43 PHE A CD2  6  
ATOM 7327  C CE1  . PHE A 1 43 ? -5.988  -6.544  -3.342  1.00 0.00 ? 43 PHE A CE1  6  
ATOM 7328  C CE2  . PHE A 1 43 ? -6.682  -5.417  -1.352  1.00 0.00 ? 43 PHE A CE2  6  
ATOM 7329  C CZ   . PHE A 1 43 ? -5.720  -5.666  -2.312  1.00 0.00 ? 43 PHE A CZ   6  
ATOM 7330  H H    . PHE A 1 43 ? -8.994  -8.238  -0.132  1.00 0.00 ? 43 PHE A H    6  
ATOM 7331  H HA   . PHE A 1 43 ? -10.483 -9.495  -2.165  1.00 0.00 ? 43 PHE A HA   6  
ATOM 7332  H HB2  . PHE A 1 43 ? -9.836  -7.619  -3.568  1.00 0.00 ? 43 PHE A HB2  6  
ATOM 7333  H HB3  . PHE A 1 43 ? -10.230 -7.042  -1.952  1.00 0.00 ? 43 PHE A HB3  6  
ATOM 7334  H HD1  . PHE A 1 43 ? -7.424  -7.861  -4.218  1.00 0.00 ? 43 PHE A HD1  6  
ATOM 7335  H HD2  . PHE A 1 43 ? -8.661  -5.854  -0.676  1.00 0.00 ? 43 PHE A HD2  6  
ATOM 7336  H HE1  . PHE A 1 43 ? -5.237  -6.741  -4.095  1.00 0.00 ? 43 PHE A HE1  6  
ATOM 7337  H HE2  . PHE A 1 43 ? -6.477  -4.729  -0.545  1.00 0.00 ? 43 PHE A HE2  6  
ATOM 7338  H HZ   . PHE A 1 43 ? -4.760  -5.172  -2.257  1.00 0.00 ? 43 PHE A HZ   6  
ATOM 7339  N N    . ALA A 1 44 ? -7.253  -9.913  -2.274  1.00 0.00 ? 44 ALA A N    6  
ATOM 7340  C CA   . ALA A 1 44 ? -6.179  -10.663 -2.914  1.00 0.00 ? 44 ALA A CA   6  
ATOM 7341  C C    . ALA A 1 44 ? -5.122  -11.087 -1.897  1.00 0.00 ? 44 ALA A C    6  
ATOM 7342  O O    . ALA A 1 44 ? -4.959  -10.449 -0.857  1.00 0.00 ? 44 ALA A O    6  
ATOM 7343  C CB   . ALA A 1 44 ? -5.546  -9.833  -4.021  1.00 0.00 ? 44 ALA A CB   6  
ATOM 7344  H H    . ALA A 1 44 ? -7.067  -9.424  -1.445  1.00 0.00 ? 44 ALA A H    6  
ATOM 7345  H HA   . ALA A 1 44 ? -6.610  -11.546 -3.361  1.00 0.00 ? 44 ALA A HA   6  
ATOM 7346  H HB1  . ALA A 1 44 ? -6.281  -9.631  -4.786  1.00 0.00 ? 44 ALA A HB1  6  
ATOM 7347  H HB2  . ALA A 1 44 ? -4.719  -10.378 -4.452  1.00 0.00 ? 44 ALA A HB2  6  
ATOM 7348  H HB3  . ALA A 1 44 ? -5.186  -8.900  -3.612  1.00 0.00 ? 44 ALA A HB3  6  
ATOM 7349  N N    . PRO A 1 45 ? -4.388  -12.175 -2.186  1.00 0.00 ? 45 PRO A N    6  
ATOM 7350  C CA   . PRO A 1 45 ? -3.343  -12.682 -1.291  1.00 0.00 ? 45 PRO A CA   6  
ATOM 7351  C C    . PRO A 1 45 ? -2.125  -11.768 -1.247  1.00 0.00 ? 45 PRO A C    6  
ATOM 7352  O O    . PRO A 1 45 ? -2.151  -10.656 -1.773  1.00 0.00 ? 45 PRO A O    6  
ATOM 7353  C CB   . PRO A 1 45 ? -2.976  -14.034 -1.905  1.00 0.00 ? 45 PRO A CB   6  
ATOM 7354  C CG   . PRO A 1 45 ? -3.320  -13.901 -3.348  1.00 0.00 ? 45 PRO A CG   6  
ATOM 7355  C CD   . PRO A 1 45 ? -4.519  -12.995 -3.406  1.00 0.00 ? 45 PRO A CD   6  
ATOM 7356  H HA   . PRO A 1 45 ? -3.719  -12.829 -0.288  1.00 0.00 ? 45 PRO A HA   6  
ATOM 7357  H HB2  . PRO A 1 45 ? -1.921  -14.222 -1.764  1.00 0.00 ? 45 PRO A HB2  6  
ATOM 7358  H HB3  . PRO A 1 45 ? -3.552  -14.817 -1.433  1.00 0.00 ? 45 PRO A HB3  6  
ATOM 7359  H HG2  . PRO A 1 45 ? -2.491  -13.461 -3.882  1.00 0.00 ? 45 PRO A HG2  6  
ATOM 7360  H HG3  . PRO A 1 45 ? -3.562  -14.870 -3.759  1.00 0.00 ? 45 PRO A HG3  6  
ATOM 7361  H HD2  . PRO A 1 45 ? -4.482  -12.377 -4.290  1.00 0.00 ? 45 PRO A HD2  6  
ATOM 7362  H HD3  . PRO A 1 45 ? -5.430  -13.573 -3.385  1.00 0.00 ? 45 PRO A HD3  6  
ATOM 7363  N N    . GLY A 1 46 ? -1.056  -12.245 -0.616  1.00 0.00 ? 46 GLY A N    6  
ATOM 7364  C CA   . GLY A 1 46 ? 0.159   -11.457 -0.516  1.00 0.00 ? 46 GLY A CA   6  
ATOM 7365  C C    . GLY A 1 46 ? 0.033   -10.322 0.481   1.00 0.00 ? 46 GLY A C    6  
ATOM 7366  O O    . GLY A 1 46 ? -1.074  -9.909  0.826   1.00 0.00 ? 46 GLY A O    6  
ATOM 7367  H H    . GLY A 1 46 ? -1.092  -13.138 -0.216  1.00 0.00 ? 46 GLY A H    6  
ATOM 7368  H HA2  . GLY A 1 46 ? 0.969   -12.102 -0.208  1.00 0.00 ? 46 GLY A HA2  6  
ATOM 7369  H HA3  . GLY A 1 46 ? 0.389   -11.045 -1.487  1.00 0.00 ? 46 GLY A HA3  6  
ATOM 7370  N N    . GLN A 1 47 ? 1.172   -9.815  0.943   1.00 0.00 ? 47 GLN A N    6  
ATOM 7371  C CA   . GLN A 1 47 ? 1.185   -8.719  1.905   1.00 0.00 ? 47 GLN A CA   6  
ATOM 7372  C C    . GLN A 1 47 ? 0.712   -7.421  1.259   1.00 0.00 ? 47 GLN A C    6  
ATOM 7373  O O    . GLN A 1 47 ? 0.981   -7.167  0.084   1.00 0.00 ? 47 GLN A O    6  
ATOM 7374  C CB   . GLN A 1 47 ? 2.591   -8.534  2.480   1.00 0.00 ? 47 GLN A CB   6  
ATOM 7375  C CG   . GLN A 1 47 ? 3.103   -9.748  3.239   1.00 0.00 ? 47 GLN A CG   6  
ATOM 7376  C CD   . GLN A 1 47 ? 2.359   -9.977  4.539   1.00 0.00 ? 47 GLN A CD   6  
ATOM 7377  O OE1  . GLN A 1 47 ? 1.294   -9.404  4.769   1.00 0.00 ? 47 GLN A OE1  6  
ATOM 7378  N NE2  . GLN A 1 47 ? 2.918   -10.820 5.401   1.00 0.00 ? 47 GLN A NE2  6  
ATOM 7379  H H    . GLN A 1 47 ? 2.023   -10.186 0.629   1.00 0.00 ? 47 GLN A H    6  
ATOM 7380  H HA   . GLN A 1 47 ? 0.509   -8.975  2.707   1.00 0.00 ? 47 GLN A HA   6  
ATOM 7381  H HB2  . GLN A 1 47 ? 3.274   -8.330  1.668   1.00 0.00 ? 47 GLN A HB2  6  
ATOM 7382  H HB3  . GLN A 1 47 ? 2.583   -7.691  3.154   1.00 0.00 ? 47 GLN A HB3  6  
ATOM 7383  H HG2  . GLN A 1 47 ? 2.986   -10.621 2.616   1.00 0.00 ? 47 GLN A HG2  6  
ATOM 7384  H HG3  . GLN A 1 47 ? 4.150   -9.602  3.460   1.00 0.00 ? 47 GLN A HG3  6  
ATOM 7385  H HE21 . GLN A 1 47 ? 3.767   -11.240 5.151   1.00 0.00 ? 47 GLN A HE21 6  
ATOM 7386  H HE22 . GLN A 1 47 ? 2.458   -10.986 6.249   1.00 0.00 ? 47 GLN A HE22 6  
ATOM 7387  N N    . TRP A 1 48 ? 0.008   -6.603  2.033   1.00 0.00 ? 48 TRP A N    6  
ATOM 7388  C CA   . TRP A 1 48 ? -0.503  -5.330  1.536   1.00 0.00 ? 48 TRP A CA   6  
ATOM 7389  C C    . TRP A 1 48 ? -0.300  -4.222  2.563   1.00 0.00 ? 48 TRP A C    6  
ATOM 7390  O O    . TRP A 1 48 ? -0.135  -4.489  3.754   1.00 0.00 ? 48 TRP A O    6  
ATOM 7391  C CB   . TRP A 1 48 ? -1.988  -5.454  1.189   1.00 0.00 ? 48 TRP A CB   6  
ATOM 7392  C CG   . TRP A 1 48 ? -2.236  -6.069  -0.153  1.00 0.00 ? 48 TRP A CG   6  
ATOM 7393  C CD1  . TRP A 1 48 ? -2.419  -7.394  -0.427  1.00 0.00 ? 48 TRP A CD1  6  
ATOM 7394  C CD2  . TRP A 1 48 ? -2.326  -5.384  -1.408  1.00 0.00 ? 48 TRP A CD2  6  
ATOM 7395  N NE1  . TRP A 1 48 ? -2.618  -7.574  -1.774  1.00 0.00 ? 48 TRP A NE1  6  
ATOM 7396  C CE2  . TRP A 1 48 ? -2.566  -6.356  -2.397  1.00 0.00 ? 48 TRP A CE2  6  
ATOM 7397  C CE3  . TRP A 1 48 ? -2.228  -4.043  -1.790  1.00 0.00 ? 48 TRP A CE3  6  
ATOM 7398  C CZ2  . TRP A 1 48 ? -2.709  -6.028  -3.744  1.00 0.00 ? 48 TRP A CZ2  6  
ATOM 7399  C CZ3  . TRP A 1 48 ? -2.371  -3.719  -3.126  1.00 0.00 ? 48 TRP A CZ3  6  
ATOM 7400  C CH2  . TRP A 1 48 ? -2.608  -4.708  -4.089  1.00 0.00 ? 48 TRP A CH2  6  
ATOM 7401  H H    . TRP A 1 48 ? -0.174  -6.861  2.961   1.00 0.00 ? 48 TRP A H    6  
ATOM 7402  H HA   . TRP A 1 48 ? 0.046   -5.080  0.641   1.00 0.00 ? 48 TRP A HA   6  
ATOM 7403  H HB2  . TRP A 1 48 ? -2.475  -6.069  1.932   1.00 0.00 ? 48 TRP A HB2  6  
ATOM 7404  H HB3  . TRP A 1 48 ? -2.435  -4.471  1.194   1.00 0.00 ? 48 TRP A HB3  6  
ATOM 7405  H HD1  . TRP A 1 48 ? -2.406  -8.175  0.319   1.00 0.00 ? 48 TRP A HD1  6  
ATOM 7406  H HE1  . TRP A 1 48 ? -2.773  -8.436  -2.215  1.00 0.00 ? 48 TRP A HE1  6  
ATOM 7407  H HE3  . TRP A 1 48 ? -2.045  -3.267  -1.062  1.00 0.00 ? 48 TRP A HE3  6  
ATOM 7408  H HZ2  . TRP A 1 48 ? -2.893  -6.778  -4.498  1.00 0.00 ? 48 TRP A HZ2  6  
ATOM 7409  H HZ3  . TRP A 1 48 ? -2.298  -2.688  -3.440  1.00 0.00 ? 48 TRP A HZ3  6  
ATOM 7410  H HH2  . TRP A 1 48 ? -2.713  -4.408  -5.121  1.00 0.00 ? 48 TRP A HH2  6  
ATOM 7411  N N    . ALA A 1 49 ? -0.315  -2.978  2.096   1.00 0.00 ? 49 ALA A N    6  
ATOM 7412  C CA   . ALA A 1 49 ? -0.132  -1.829  2.974   1.00 0.00 ? 49 ALA A CA   6  
ATOM 7413  C C    . ALA A 1 49 ? -1.056  -0.683  2.574   1.00 0.00 ? 49 ALA A C    6  
ATOM 7414  O O    . ALA A 1 49 ? -0.769  0.059   1.635   1.00 0.00 ? 49 ALA A O    6  
ATOM 7415  C CB   . ALA A 1 49 ? 1.318   -1.374  2.953   1.00 0.00 ? 49 ALA A CB   6  
ATOM 7416  H H    . ALA A 1 49 ? -0.451  -2.830  1.137   1.00 0.00 ? 49 ALA A H    6  
ATOM 7417  H HA   . ALA A 1 49 ? -0.374  -2.138  3.981   1.00 0.00 ? 49 ALA A HA   6  
ATOM 7418  H HB1  . ALA A 1 49 ? 1.731   -1.532  1.967   1.00 0.00 ? 49 ALA A HB1  6  
ATOM 7419  H HB2  . ALA A 1 49 ? 1.885   -1.942  3.676   1.00 0.00 ? 49 ALA A HB2  6  
ATOM 7420  H HB3  . ALA A 1 49 ? 1.370   -0.324  3.200   1.00 0.00 ? 49 ALA A HB3  6  
ATOM 7421  N N    . GLY A 1 50 ? -2.164  -0.545  3.293   1.00 0.00 ? 50 GLY A N    6  
ATOM 7422  C CA   . GLY A 1 50 ? -3.113  0.513   2.998   1.00 0.00 ? 50 GLY A CA   6  
ATOM 7423  C C    . GLY A 1 50 ? -2.553  1.892   3.287   1.00 0.00 ? 50 GLY A C    6  
ATOM 7424  O O    . GLY A 1 50 ? -2.251  2.218   4.436   1.00 0.00 ? 50 GLY A O    6  
ATOM 7425  H H    . GLY A 1 50 ? -2.340  -1.166  4.030   1.00 0.00 ? 50 GLY A H    6  
ATOM 7426  H HA2  . GLY A 1 50 ? -3.382  0.458   1.954   1.00 0.00 ? 50 GLY A HA2  6  
ATOM 7427  H HA3  . GLY A 1 50 ? -4.000  0.363   3.596   1.00 0.00 ? 50 GLY A HA3  6  
ATOM 7428  N N    . VAL A 1 51 ? -2.417  2.704   2.244   1.00 0.00 ? 51 VAL A N    6  
ATOM 7429  C CA   . VAL A 1 51 ? -1.891  4.056   2.392   1.00 0.00 ? 51 VAL A CA   6  
ATOM 7430  C C    . VAL A 1 51 ? -2.869  5.088   1.840   1.00 0.00 ? 51 VAL A C    6  
ATOM 7431  O O    . VAL A 1 51 ? -3.511  4.863   0.813   1.00 0.00 ? 51 VAL A O    6  
ATOM 7432  C CB   . VAL A 1 51 ? -0.537  4.216   1.676   1.00 0.00 ? 51 VAL A CB   6  
ATOM 7433  C CG1  . VAL A 1 51 ? 0.096   5.555   2.021   1.00 0.00 ? 51 VAL A CG1  6  
ATOM 7434  C CG2  . VAL A 1 51 ? 0.396   3.069   2.034   1.00 0.00 ? 51 VAL A CG2  6  
ATOM 7435  H H    . VAL A 1 51 ? -2.677  2.387   1.355   1.00 0.00 ? 51 VAL A H    6  
ATOM 7436  H HA   . VAL A 1 51 ? -1.742  4.244   3.445   1.00 0.00 ? 51 VAL A HA   6  
ATOM 7437  H HB   . VAL A 1 51 ? -0.711  4.190   0.610   1.00 0.00 ? 51 VAL A HB   6  
ATOM 7438  H HG11 . VAL A 1 51 ? 0.573   5.489   2.987   1.00 0.00 ? 51 VAL A HG11 6  
ATOM 7439  H HG12 . VAL A 1 51 ? -0.668  6.318   2.047   1.00 0.00 ? 51 VAL A HG12 6  
ATOM 7440  H HG13 . VAL A 1 51 ? 0.831   5.809   1.271   1.00 0.00 ? 51 VAL A HG13 6  
ATOM 7441  H HG21 . VAL A 1 51 ? 1.411   3.433   2.086   1.00 0.00 ? 51 VAL A HG21 6  
ATOM 7442  H HG22 . VAL A 1 51 ? 0.327   2.299   1.279   1.00 0.00 ? 51 VAL A HG22 6  
ATOM 7443  H HG23 . VAL A 1 51 ? 0.111   2.660   2.993   1.00 0.00 ? 51 VAL A HG23 6  
ATOM 7444  N N    . VAL A 1 52 ? -2.979  6.220   2.528   1.00 0.00 ? 52 VAL A N    6  
ATOM 7445  C CA   . VAL A 1 52 ? -3.879  7.287   2.107   1.00 0.00 ? 52 VAL A CA   6  
ATOM 7446  C C    . VAL A 1 52 ? -3.105  8.448   1.493   1.00 0.00 ? 52 VAL A C    6  
ATOM 7447  O O    . VAL A 1 52 ? -2.466  9.225   2.202   1.00 0.00 ? 52 VAL A O    6  
ATOM 7448  C CB   . VAL A 1 52 ? -4.719  7.811   3.286   1.00 0.00 ? 52 VAL A CB   6  
ATOM 7449  C CG1  . VAL A 1 52 ? -5.787  8.775   2.794   1.00 0.00 ? 52 VAL A CG1  6  
ATOM 7450  C CG2  . VAL A 1 52 ? -5.346  6.654   4.051   1.00 0.00 ? 52 VAL A CG2  6  
ATOM 7451  H H    . VAL A 1 52 ? -2.441  6.340   3.339   1.00 0.00 ? 52 VAL A H    6  
ATOM 7452  H HA   . VAL A 1 52 ? -4.551  6.881   1.364   1.00 0.00 ? 52 VAL A HA   6  
ATOM 7453  H HB   . VAL A 1 52 ? -4.065  8.346   3.958   1.00 0.00 ? 52 VAL A HB   6  
ATOM 7454  H HG11 . VAL A 1 52 ? -6.729  8.254   2.705   1.00 0.00 ? 52 VAL A HG11 6  
ATOM 7455  H HG12 . VAL A 1 52 ? -5.500  9.168   1.831   1.00 0.00 ? 52 VAL A HG12 6  
ATOM 7456  H HG13 . VAL A 1 52 ? -5.890  9.587   3.499   1.00 0.00 ? 52 VAL A HG13 6  
ATOM 7457  H HG21 . VAL A 1 52 ? -5.444  5.801   3.396   1.00 0.00 ? 52 VAL A HG21 6  
ATOM 7458  H HG22 . VAL A 1 52 ? -6.322  6.946   4.410   1.00 0.00 ? 52 VAL A HG22 6  
ATOM 7459  H HG23 . VAL A 1 52 ? -4.717  6.395   4.890   1.00 0.00 ? 52 VAL A HG23 6  
ATOM 7460  N N    . LEU A 1 53 ? -3.166  8.559   0.170   1.00 0.00 ? 53 LEU A N    6  
ATOM 7461  C CA   . LEU A 1 53 ? -2.472  9.627   -0.540  1.00 0.00 ? 53 LEU A CA   6  
ATOM 7462  C C    . LEU A 1 53 ? -2.961  10.996  -0.079  1.00 0.00 ? 53 LEU A C    6  
ATOM 7463  O O    . LEU A 1 53 ? -4.076  11.131  0.425   1.00 0.00 ? 53 LEU A O    6  
ATOM 7464  C CB   . LEU A 1 53 ? -2.676  9.481   -2.050  1.00 0.00 ? 53 LEU A CB   6  
ATOM 7465  C CG   . LEU A 1 53 ? -1.915  8.322   -2.696  1.00 0.00 ? 53 LEU A CG   6  
ATOM 7466  C CD1  . LEU A 1 53 ? -2.391  8.103   -4.124  1.00 0.00 ? 53 LEU A CD1  6  
ATOM 7467  C CD2  . LEU A 1 53 ? -0.418  8.586   -2.665  1.00 0.00 ? 53 LEU A CD2  6  
ATOM 7468  H H    . LEU A 1 53 ? -3.693  7.909   -0.341  1.00 0.00 ? 53 LEU A H    6  
ATOM 7469  H HA   . LEU A 1 53 ? -1.419  9.541   -0.318  1.00 0.00 ? 53 LEU A HA   6  
ATOM 7470  H HB2  . LEU A 1 53 ? -3.731  9.341   -2.237  1.00 0.00 ? 53 LEU A HB2  6  
ATOM 7471  H HB3  . LEU A 1 53 ? -2.362  10.398  -2.525  1.00 0.00 ? 53 LEU A HB3  6  
ATOM 7472  H HG   . LEU A 1 53 ? -2.109  7.417   -2.138  1.00 0.00 ? 53 LEU A HG   6  
ATOM 7473  H HD11 . LEU A 1 53 ? -2.373  7.048   -4.352  1.00 0.00 ? 53 LEU A HD11 6  
ATOM 7474  H HD12 . LEU A 1 53 ? -1.740  8.630   -4.805  1.00 0.00 ? 53 LEU A HD12 6  
ATOM 7475  H HD13 . LEU A 1 53 ? -3.399  8.476   -4.229  1.00 0.00 ? 53 LEU A HD13 6  
ATOM 7476  H HD21 . LEU A 1 53 ? 0.107   7.660   -2.482  1.00 0.00 ? 53 LEU A HD21 6  
ATOM 7477  H HD22 . LEU A 1 53 ? -0.192  9.290   -1.878  1.00 0.00 ? 53 LEU A HD22 6  
ATOM 7478  H HD23 . LEU A 1 53 ? -0.105  8.996   -3.615  1.00 0.00 ? 53 LEU A HD23 6  
ATOM 7479  N N    . ASP A 1 54 ? -2.119  12.009  -0.255  1.00 0.00 ? 54 ASP A N    6  
ATOM 7480  C CA   . ASP A 1 54 ? -2.465  13.368  0.144   1.00 0.00 ? 54 ASP A CA   6  
ATOM 7481  C C    . ASP A 1 54 ? -3.555  13.938  -0.758  1.00 0.00 ? 54 ASP A C    6  
ATOM 7482  O O    . ASP A 1 54 ? -4.552  14.477  -0.278  1.00 0.00 ? 54 ASP A O    6  
ATOM 7483  C CB   . ASP A 1 54 ? -1.227  14.267  0.096   1.00 0.00 ? 54 ASP A CB   6  
ATOM 7484  C CG   . ASP A 1 54 ? -0.480  14.153  -1.217  1.00 0.00 ? 54 ASP A CG   6  
ATOM 7485  O OD1  . ASP A 1 54 ? 0.218   13.136  -1.418  1.00 0.00 ? 54 ASP A OD1  6  
ATOM 7486  O OD2  . ASP A 1 54 ? -0.592  15.080  -2.047  1.00 0.00 ? 54 ASP A OD2  6  
ATOM 7487  H H    . ASP A 1 54 ? -1.244  11.839  -0.662  1.00 0.00 ? 54 ASP A H    6  
ATOM 7488  H HA   . ASP A 1 54 ? -2.835  13.333  1.158   1.00 0.00 ? 54 ASP A HA   6  
ATOM 7489  H HB2  . ASP A 1 54 ? -1.531  15.295  0.229   1.00 0.00 ? 54 ASP A HB2  6  
ATOM 7490  H HB3  . ASP A 1 54 ? -0.558  13.988  0.897   1.00 0.00 ? 54 ASP A HB3  6  
ATOM 7491  N N    . ASP A 1 55 ? -3.359  13.815  -2.067  1.00 0.00 ? 55 ASP A N    6  
ATOM 7492  C CA   . ASP A 1 55 ? -4.326  14.318  -3.036  1.00 0.00 ? 55 ASP A CA   6  
ATOM 7493  C C    . ASP A 1 55 ? -5.257  13.203  -3.505  1.00 0.00 ? 55 ASP A C    6  
ATOM 7494  O O    . ASP A 1 55 ? -4.891  12.028  -3.487  1.00 0.00 ? 55 ASP A O    6  
ATOM 7495  C CB   . ASP A 1 55 ? -3.603  14.934  -4.236  1.00 0.00 ? 55 ASP A CB   6  
ATOM 7496  C CG   . ASP A 1 55 ? -3.037  16.305  -3.927  1.00 0.00 ? 55 ASP A CG   6  
ATOM 7497  O OD1  . ASP A 1 55 ? -3.793  17.160  -3.420  1.00 0.00 ? 55 ASP A OD1  6  
ATOM 7498  O OD2  . ASP A 1 55 ? -1.836  16.525  -4.194  1.00 0.00 ? 55 ASP A OD2  6  
ATOM 7499  H H    . ASP A 1 55 ? -2.544  13.376  -2.388  1.00 0.00 ? 55 ASP A H    6  
ATOM 7500  H HA   . ASP A 1 55 ? -4.914  15.082  -2.551  1.00 0.00 ? 55 ASP A HA   6  
ATOM 7501  H HB2  . ASP A 1 55 ? -2.790  14.287  -4.529  1.00 0.00 ? 55 ASP A HB2  6  
ATOM 7502  H HB3  . ASP A 1 55 ? -4.298  15.027  -5.057  1.00 0.00 ? 55 ASP A HB3  6  
ATOM 7503  N N    . PRO A 1 56 ? -6.480  13.560  -3.934  1.00 0.00 ? 56 PRO A N    6  
ATOM 7504  C CA   . PRO A 1 56 ? -7.465  12.584  -4.409  1.00 0.00 ? 56 PRO A CA   6  
ATOM 7505  C C    . PRO A 1 56 ? -7.087  11.991  -5.763  1.00 0.00 ? 56 PRO A C    6  
ATOM 7506  O O    . PRO A 1 56 ? -7.802  12.163  -6.750  1.00 0.00 ? 56 PRO A O    6  
ATOM 7507  C CB   . PRO A 1 56 ? -8.751  13.405  -4.523  1.00 0.00 ? 56 PRO A CB   6  
ATOM 7508  C CG   . PRO A 1 56 ? -8.287  14.802  -4.751  1.00 0.00 ? 56 PRO A CG   6  
ATOM 7509  C CD   . PRO A 1 56 ? -6.997  14.940  -3.988  1.00 0.00 ? 56 PRO A CD   6  
ATOM 7510  H HA   . PRO A 1 56 ? -7.606  11.785  -3.696  1.00 0.00 ? 56 PRO A HA   6  
ATOM 7511  H HB2  . PRO A 1 56 ? -9.341  13.043  -5.353  1.00 0.00 ? 56 PRO A HB2  6  
ATOM 7512  H HB3  . PRO A 1 56 ? -9.317  13.323  -3.607  1.00 0.00 ? 56 PRO A HB3  6  
ATOM 7513  H HG2  . PRO A 1 56 ? -8.119  14.964  -5.805  1.00 0.00 ? 56 PRO A HG2  6  
ATOM 7514  H HG3  . PRO A 1 56 ? -9.022  15.499  -4.376  1.00 0.00 ? 56 PRO A HG3  6  
ATOM 7515  H HD2  . PRO A 1 56 ? -6.315  15.588  -4.518  1.00 0.00 ? 56 PRO A HD2  6  
ATOM 7516  H HD3  . PRO A 1 56 ? -7.187  15.321  -2.995  1.00 0.00 ? 56 PRO A HD3  6  
ATOM 7517  N N    . VAL A 1 57 ? -5.956  11.295  -5.803  1.00 0.00 ? 57 VAL A N    6  
ATOM 7518  C CA   . VAL A 1 57 ? -5.482  10.677  -7.034  1.00 0.00 ? 57 VAL A CA   6  
ATOM 7519  C C    . VAL A 1 57 ? -5.073  9.227   -6.802  1.00 0.00 ? 57 VAL A C    6  
ATOM 7520  O O    . VAL A 1 57 ? -4.177  8.708   -7.469  1.00 0.00 ? 57 VAL A O    6  
ATOM 7521  C CB   . VAL A 1 57 ? -4.285  11.447  -7.625  1.00 0.00 ? 57 VAL A CB   6  
ATOM 7522  C CG1  . VAL A 1 57 ? -4.745  12.759  -8.242  1.00 0.00 ? 57 VAL A CG1  6  
ATOM 7523  C CG2  . VAL A 1 57 ? -3.230  11.692  -6.557  1.00 0.00 ? 57 VAL A CG2  6  
ATOM 7524  H H    . VAL A 1 57 ? -5.428  11.192  -4.983  1.00 0.00 ? 57 VAL A H    6  
ATOM 7525  H HA   . VAL A 1 57 ? -6.289  10.703  -7.753  1.00 0.00 ? 57 VAL A HA   6  
ATOM 7526  H HB   . VAL A 1 57 ? -3.844  10.843  -8.405  1.00 0.00 ? 57 VAL A HB   6  
ATOM 7527  H HG11 . VAL A 1 57 ? -5.794  12.691  -8.490  1.00 0.00 ? 57 VAL A HG11 6  
ATOM 7528  H HG12 . VAL A 1 57 ? -4.175  12.954  -9.139  1.00 0.00 ? 57 VAL A HG12 6  
ATOM 7529  H HG13 . VAL A 1 57 ? -4.592  13.561  -7.536  1.00 0.00 ? 57 VAL A HG13 6  
ATOM 7530  H HG21 . VAL A 1 57 ? -2.270  11.848  -7.028  1.00 0.00 ? 57 VAL A HG21 6  
ATOM 7531  H HG22 . VAL A 1 57 ? -3.174  10.835  -5.903  1.00 0.00 ? 57 VAL A HG22 6  
ATOM 7532  H HG23 . VAL A 1 57 ? -3.496  12.567  -5.982  1.00 0.00 ? 57 VAL A HG23 6  
ATOM 7533  N N    . GLY A 1 58 ? -5.735  8.575   -5.852  1.00 0.00 ? 58 GLY A N    6  
ATOM 7534  C CA   . GLY A 1 58 ? -5.427  7.190   -5.549  1.00 0.00 ? 58 GLY A CA   6  
ATOM 7535  C C    . GLY A 1 58 ? -6.221  6.220   -6.400  1.00 0.00 ? 58 GLY A C    6  
ATOM 7536  O O    . GLY A 1 58 ? -6.073  6.189   -7.621  1.00 0.00 ? 58 GLY A O    6  
ATOM 7537  H H    . GLY A 1 58 ? -6.439  9.040   -5.353  1.00 0.00 ? 58 GLY A H    6  
ATOM 7538  H HA2  . GLY A 1 58 ? -4.373  7.022   -5.718  1.00 0.00 ? 58 GLY A HA2  6  
ATOM 7539  H HA3  . GLY A 1 58 ? -5.647  7.004   -4.508  1.00 0.00 ? 58 GLY A HA3  6  
ATOM 7540  N N    . LYS A 1 59 ? -7.067  5.424   -5.753  1.00 0.00 ? 59 LYS A N    6  
ATOM 7541  C CA   . LYS A 1 59 ? -7.889  4.448   -6.459  1.00 0.00 ? 59 LYS A CA   6  
ATOM 7542  C C    . LYS A 1 59 ? -9.186  4.179   -5.703  1.00 0.00 ? 59 LYS A C    6  
ATOM 7543  O O    . LYS A 1 59 ? -10.276 4.474   -6.195  1.00 0.00 ? 59 LYS A O    6  
ATOM 7544  C CB   . LYS A 1 59 ? -7.115  3.141   -6.650  1.00 0.00 ? 59 LYS A CB   6  
ATOM 7545  C CG   . LYS A 1 59 ? -6.402  3.048   -7.990  1.00 0.00 ? 59 LYS A CG   6  
ATOM 7546  C CD   . LYS A 1 59 ? -6.623  1.696   -8.650  1.00 0.00 ? 59 LYS A CD   6  
ATOM 7547  C CE   . LYS A 1 59 ? -5.890  0.588   -7.909  1.00 0.00 ? 59 LYS A CE   6  
ATOM 7548  N NZ   . LYS A 1 59 ? -6.596  0.194   -6.659  1.00 0.00 ? 59 LYS A NZ   6  
ATOM 7549  H H    . LYS A 1 59 ? -7.142  5.496   -4.779  1.00 0.00 ? 59 LYS A H    6  
ATOM 7550  H HA   . LYS A 1 59 ? -8.130  4.858   -7.428  1.00 0.00 ? 59 LYS A HA   6  
ATOM 7551  H HB2  . LYS A 1 59 ? -6.377  3.056   -5.867  1.00 0.00 ? 59 LYS A HB2  6  
ATOM 7552  H HB3  . LYS A 1 59 ? -7.804  2.313   -6.574  1.00 0.00 ? 59 LYS A HB3  6  
ATOM 7553  H HG2  . LYS A 1 59 ? -6.780  3.820   -8.643  1.00 0.00 ? 59 LYS A HG2  6  
ATOM 7554  H HG3  . LYS A 1 59 ? -5.343  3.193   -7.833  1.00 0.00 ? 59 LYS A HG3  6  
ATOM 7555  H HD2  . LYS A 1 59 ? -7.681  1.475   -8.650  1.00 0.00 ? 59 LYS A HD2  6  
ATOM 7556  H HD3  . LYS A 1 59 ? -6.261  1.738   -9.667  1.00 0.00 ? 59 LYS A HD3  6  
ATOM 7557  H HE2  . LYS A 1 59 ? -5.816  -0.272  -8.558  1.00 0.00 ? 59 LYS A HE2  6  
ATOM 7558  H HE3  . LYS A 1 59 ? -4.898  0.936   -7.659  1.00 0.00 ? 59 LYS A HE3  6  
ATOM 7559  H HZ1  . LYS A 1 59 ? -7.622  0.330   -6.769  1.00 0.00 ? 59 LYS A HZ1  6  
ATOM 7560  H HZ2  . LYS A 1 59 ? -6.264  0.774   -5.863  1.00 0.00 ? 59 LYS A HZ2  6  
ATOM 7561  H HZ3  . LYS A 1 59 ? -6.411  -0.807  -6.445  1.00 0.00 ? 59 LYS A HZ3  6  
ATOM 7562  N N    . ASN A 1 60 ? -9.061  3.619   -4.504  1.00 0.00 ? 60 ASN A N    6  
ATOM 7563  C CA   . ASN A 1 60 ? -10.225 3.310   -3.681  1.00 0.00 ? 60 ASN A CA   6  
ATOM 7564  C C    . ASN A 1 60 ? -10.407 4.354   -2.584  1.00 0.00 ? 60 ASN A C    6  
ATOM 7565  O O    . ASN A 1 60 ? -9.603  5.278   -2.452  1.00 0.00 ? 60 ASN A O    6  
ATOM 7566  C CB   . ASN A 1 60 ? -10.082 1.920   -3.059  1.00 0.00 ? 60 ASN A CB   6  
ATOM 7567  C CG   . ASN A 1 60 ? -9.677  0.871   -4.076  1.00 0.00 ? 60 ASN A CG   6  
ATOM 7568  O OD1  . ASN A 1 60 ? -10.504 0.388   -4.848  1.00 0.00 ? 60 ASN A OD1  6  
ATOM 7569  N ND2  . ASN A 1 60 ? -8.398  0.513   -4.079  1.00 0.00 ? 60 ASN A ND2  6  
ATOM 7570  H H    . ASN A 1 60 ? -8.167  3.407   -4.166  1.00 0.00 ? 60 ASN A H    6  
ATOM 7571  H HA   . ASN A 1 60 ? -11.095 3.321   -4.319  1.00 0.00 ? 60 ASN A HA   6  
ATOM 7572  H HB2  . ASN A 1 60 ? -9.328  1.954   -2.285  1.00 0.00 ? 60 ASN A HB2  6  
ATOM 7573  H HB3  . ASN A 1 60 ? -11.026 1.628   -2.623  1.00 0.00 ? 60 ASN A HB3  6  
ATOM 7574  H HD21 . ASN A 1 60 ? -7.795  0.940   -3.435  1.00 0.00 ? 60 ASN A HD21 6  
ATOM 7575  H HD22 . ASN A 1 60 ? -8.109  -0.163  -4.727  1.00 0.00 ? 60 ASN A HD22 6  
ATOM 7576  N N    . ASP A 1 61 ? -11.469 4.204   -1.800  1.00 0.00 ? 61 ASP A N    6  
ATOM 7577  C CA   . ASP A 1 61 ? -11.758 5.134   -0.714  1.00 0.00 ? 61 ASP A CA   6  
ATOM 7578  C C    . ASP A 1 61 ? -11.370 4.534   0.634   1.00 0.00 ? 61 ASP A C    6  
ATOM 7579  O O    . ASP A 1 61 ? -10.989 5.254   1.557   1.00 0.00 ? 61 ASP A O    6  
ATOM 7580  C CB   . ASP A 1 61 ? -13.242 5.503   -0.713  1.00 0.00 ? 61 ASP A CB   6  
ATOM 7581  C CG   . ASP A 1 61 ? -14.141 4.283   -0.734  1.00 0.00 ? 61 ASP A CG   6  
ATOM 7582  O OD1  . ASP A 1 61 ? -14.366 3.730   -1.831  1.00 0.00 ? 61 ASP A OD1  6  
ATOM 7583  O OD2  . ASP A 1 61 ? -14.621 3.880   0.346   1.00 0.00 ? 61 ASP A OD2  6  
ATOM 7584  H H    . ASP A 1 61 ? -12.074 3.447   -1.955  1.00 0.00 ? 61 ASP A H    6  
ATOM 7585  H HA   . ASP A 1 61 ? -11.174 6.027   -0.879  1.00 0.00 ? 61 ASP A HA   6  
ATOM 7586  H HB2  . ASP A 1 61 ? -13.463 6.074   0.176   1.00 0.00 ? 61 ASP A HB2  6  
ATOM 7587  H HB3  . ASP A 1 61 ? -13.458 6.103   -1.585  1.00 0.00 ? 61 ASP A HB3  6  
ATOM 7588  N N    . GLY A 1 62 ? -11.470 3.214   0.739   1.00 0.00 ? 62 GLY A N    6  
ATOM 7589  C CA   . GLY A 1 62 ? -11.125 2.541   1.978   1.00 0.00 ? 62 GLY A CA   6  
ATOM 7590  C C    . GLY A 1 62 ? -11.592 1.098   2.004   1.00 0.00 ? 62 GLY A C    6  
ATOM 7591  O O    . GLY A 1 62 ? -10.940 0.238   2.595   1.00 0.00 ? 62 GLY A O    6  
ATOM 7592  H H    . GLY A 1 62 ? -11.778 2.691   -0.030  1.00 0.00 ? 62 GLY A H    6  
ATOM 7593  H HA2  . GLY A 1 62 ? -10.053 2.562   2.101   1.00 0.00 ? 62 GLY A HA2  6  
ATOM 7594  H HA3  . GLY A 1 62 ? -11.581 3.071   2.801   1.00 0.00 ? 62 GLY A HA3  6  
ATOM 7595  N N    . ALA A 1 63 ? -12.725 0.834   1.362   1.00 0.00 ? 63 ALA A N    6  
ATOM 7596  C CA   . ALA A 1 63 ? -13.280 -0.513  1.314   1.00 0.00 ? 63 ALA A CA   6  
ATOM 7597  C C    . ALA A 1 63 ? -13.142 -1.113  -0.082  1.00 0.00 ? 63 ALA A C    6  
ATOM 7598  O O    . ALA A 1 63 ? -13.539 -0.501  -1.073  1.00 0.00 ? 63 ALA A O    6  
ATOM 7599  C CB   . ALA A 1 63 ? -14.740 -0.498  1.744   1.00 0.00 ? 63 ALA A CB   6  
ATOM 7600  H H    . ALA A 1 63 ? -13.201 1.563   0.910   1.00 0.00 ? 63 ALA A H    6  
ATOM 7601  H HA   . ALA A 1 63 ? -12.730 -1.125  2.014   1.00 0.00 ? 63 ALA A HA   6  
ATOM 7602  H HB1  . ALA A 1 63 ? -15.131 0.504   1.651   1.00 0.00 ? 63 ALA A HB1  6  
ATOM 7603  H HB2  . ALA A 1 63 ? -14.815 -0.821  2.771   1.00 0.00 ? 63 ALA A HB2  6  
ATOM 7604  H HB3  . ALA A 1 63 ? -15.309 -1.166  1.114   1.00 0.00 ? 63 ALA A HB3  6  
ATOM 7605  N N    . VAL A 1 64 ? -12.576 -2.313  -0.151  1.00 0.00 ? 64 VAL A N    6  
ATOM 7606  C CA   . VAL A 1 64 ? -12.385 -2.996  -1.425  1.00 0.00 ? 64 VAL A CA   6  
ATOM 7607  C C    . VAL A 1 64 ? -12.824 -4.453  -1.340  1.00 0.00 ? 64 VAL A C    6  
ATOM 7608  O O    . VAL A 1 64 ? -12.153 -5.279  -0.722  1.00 0.00 ? 64 VAL A O    6  
ATOM 7609  C CB   . VAL A 1 64 ? -10.914 -2.941  -1.878  1.00 0.00 ? 64 VAL A CB   6  
ATOM 7610  C CG1  . VAL A 1 64 ? -10.769 -3.478  -3.293  1.00 0.00 ? 64 VAL A CG1  6  
ATOM 7611  C CG2  . VAL A 1 64 ? -10.378 -1.521  -1.779  1.00 0.00 ? 64 VAL A CG2  6  
ATOM 7612  H H    . VAL A 1 64 ? -12.279 -2.751  0.674   1.00 0.00 ? 64 VAL A H    6  
ATOM 7613  H HA   . VAL A 1 64 ? -12.988 -2.491  -2.168  1.00 0.00 ? 64 VAL A HA   6  
ATOM 7614  H HB   . VAL A 1 64 ? -10.332 -3.568  -1.218  1.00 0.00 ? 64 VAL A HB   6  
ATOM 7615  H HG11 . VAL A 1 64 ? -10.730 -2.652  -3.989  1.00 0.00 ? 64 VAL A HG11 6  
ATOM 7616  H HG12 . VAL A 1 64 ? -11.615 -4.106  -3.528  1.00 0.00 ? 64 VAL A HG12 6  
ATOM 7617  H HG13 . VAL A 1 64 ? -9.859  -4.054  -3.368  1.00 0.00 ? 64 VAL A HG13 6  
ATOM 7618  H HG21 . VAL A 1 64 ? -9.299  -1.540  -1.808  1.00 0.00 ? 64 VAL A HG21 6  
ATOM 7619  H HG22 . VAL A 1 64 ? -10.706 -1.076  -0.852  1.00 0.00 ? 64 VAL A HG22 6  
ATOM 7620  H HG23 . VAL A 1 64 ? -10.750 -0.938  -2.610  1.00 0.00 ? 64 VAL A HG23 6  
ATOM 7621  N N    . GLY A 1 65 ? -13.957 -4.762  -1.963  1.00 0.00 ? 65 GLY A N    6  
ATOM 7622  C CA   . GLY A 1 65 ? -14.466 -6.121  -1.945  1.00 0.00 ? 65 GLY A CA   6  
ATOM 7623  C C    . GLY A 1 65 ? -15.281 -6.418  -0.700  1.00 0.00 ? 65 GLY A C    6  
ATOM 7624  O O    . GLY A 1 65 ? -15.109 -7.463  -0.074  1.00 0.00 ? 65 GLY A O    6  
ATOM 7625  H H    . GLY A 1 65 ? -14.450 -4.062  -2.439  1.00 0.00 ? 65 GLY A H    6  
ATOM 7626  H HA2  . GLY A 1 65 ? -15.090 -6.272  -2.814  1.00 0.00 ? 65 GLY A HA2  6  
ATOM 7627  H HA3  . GLY A 1 65 ? -13.633 -6.807  -1.988  1.00 0.00 ? 65 GLY A HA3  6  
ATOM 7628  N N    . GLY A 1 66 ? -16.169 -5.496  -0.344  1.00 0.00 ? 66 GLY A N    6  
ATOM 7629  C CA   . GLY A 1 66 ? -17.000 -5.684  0.832   1.00 0.00 ? 66 GLY A CA   6  
ATOM 7630  C C    . GLY A 1 66 ? -16.183 -5.828  2.100   1.00 0.00 ? 66 GLY A C    6  
ATOM 7631  O O    . GLY A 1 66 ? -16.612 -6.484  3.050   1.00 0.00 ? 66 GLY A O    6  
ATOM 7632  H H    . GLY A 1 66 ? -16.262 -4.683  -0.883  1.00 0.00 ? 66 GLY A H    6  
ATOM 7633  H HA2  . GLY A 1 66 ? -17.656 -4.833  0.933   1.00 0.00 ? 66 GLY A HA2  6  
ATOM 7634  H HA3  . GLY A 1 66 ? -17.598 -6.573  0.698   1.00 0.00 ? 66 GLY A HA3  6  
ATOM 7635  N N    . VAL A 1 67 ? -15.005 -5.215  2.116   1.00 0.00 ? 67 VAL A N    6  
ATOM 7636  C CA   . VAL A 1 67 ? -14.125 -5.278  3.278   1.00 0.00 ? 67 VAL A CA   6  
ATOM 7637  C C    . VAL A 1 67 ? -13.527 -3.910  3.588   1.00 0.00 ? 67 VAL A C    6  
ATOM 7638  O O    . VAL A 1 67 ? -12.631 -3.440  2.886   1.00 0.00 ? 67 VAL A O    6  
ATOM 7639  C CB   . VAL A 1 67 ? -12.984 -6.289  3.064   1.00 0.00 ? 67 VAL A CB   6  
ATOM 7640  C CG1  . VAL A 1 67 ? -12.199 -6.489  4.351   1.00 0.00 ? 67 VAL A CG1  6  
ATOM 7641  C CG2  . VAL A 1 67 ? -13.532 -7.613  2.553   1.00 0.00 ? 67 VAL A CG2  6  
ATOM 7642  H H    . VAL A 1 67 ? -14.719 -4.707  1.328   1.00 0.00 ? 67 VAL A H    6  
ATOM 7643  H HA   . VAL A 1 67 ? -14.714 -5.603  4.124   1.00 0.00 ? 67 VAL A HA   6  
ATOM 7644  H HB   . VAL A 1 67 ? -12.312 -5.891  2.318   1.00 0.00 ? 67 VAL A HB   6  
ATOM 7645  H HG11 . VAL A 1 67 ? -12.539 -7.388  4.845   1.00 0.00 ? 67 VAL A HG11 6  
ATOM 7646  H HG12 . VAL A 1 67 ? -12.353 -5.642  5.003   1.00 0.00 ? 67 VAL A HG12 6  
ATOM 7647  H HG13 . VAL A 1 67 ? -11.148 -6.581  4.121   1.00 0.00 ? 67 VAL A HG13 6  
ATOM 7648  H HG21 . VAL A 1 67 ? -12.946 -8.425  2.958   1.00 0.00 ? 67 VAL A HG21 6  
ATOM 7649  H HG22 . VAL A 1 67 ? -13.479 -7.633  1.475   1.00 0.00 ? 67 VAL A HG22 6  
ATOM 7650  H HG23 . VAL A 1 67 ? -14.561 -7.721  2.865   1.00 0.00 ? 67 VAL A HG23 6  
ATOM 7651  N N    . ARG A 1 68 ? -14.026 -3.277  4.644   1.00 0.00 ? 68 ARG A N    6  
ATOM 7652  C CA   . ARG A 1 68 ? -13.539 -1.963  5.048   1.00 0.00 ? 68 ARG A CA   6  
ATOM 7653  C C    . ARG A 1 68 ? -12.232 -2.083  5.825   1.00 0.00 ? 68 ARG A C    6  
ATOM 7654  O O    . ARG A 1 68 ? -12.201 -2.627  6.929   1.00 0.00 ? 68 ARG A O    6  
ATOM 7655  C CB   . ARG A 1 68 ? -14.591 -1.246  5.897   1.00 0.00 ? 68 ARG A CB   6  
ATOM 7656  C CG   . ARG A 1 68 ? -14.904 0.162   5.413   1.00 0.00 ? 68 ARG A CG   6  
ATOM 7657  C CD   . ARG A 1 68 ? -14.273 1.215   6.311   1.00 0.00 ? 68 ARG A CD   6  
ATOM 7658  N NE   . ARG A 1 68 ? -14.636 1.028   7.713   1.00 0.00 ? 68 ARG A NE   6  
ATOM 7659  C CZ   . ARG A 1 68 ? -15.848 1.276   8.205   1.00 0.00 ? 68 ARG A CZ   6  
ATOM 7660  N NH1  . ARG A 1 68 ? -16.815 1.722   7.413   1.00 0.00 ? 68 ARG A NH1  6  
ATOM 7661  N NH2  . ARG A 1 68 ? -16.094 1.077   9.493   1.00 0.00 ? 68 ARG A NH2  6  
ATOM 7662  H H    . ARG A 1 68 ? -14.738 -3.703  5.165   1.00 0.00 ? 68 ARG A H    6  
ATOM 7663  H HA   . ARG A 1 68 ? -13.359 -1.388  4.152   1.00 0.00 ? 68 ARG A HA   6  
ATOM 7664  H HB2  . ARG A 1 68 ? -15.507 -1.821  5.876   1.00 0.00 ? 68 ARG A HB2  6  
ATOM 7665  H HB3  . ARG A 1 68 ? -14.236 -1.183  6.918   1.00 0.00 ? 68 ARG A HB3  6  
ATOM 7666  H HG2  . ARG A 1 68 ? -14.521 0.282   4.411   1.00 0.00 ? 68 ARG A HG2  6  
ATOM 7667  H HG3  . ARG A 1 68 ? -15.976 0.301   5.409   1.00 0.00 ? 68 ARG A HG3  6  
ATOM 7668  H HD2  . ARG A 1 68 ? -13.199 1.154   6.215   1.00 0.00 ? 68 ARG A HD2  6  
ATOM 7669  H HD3  . ARG A 1 68 ? -14.608 2.191   5.989   1.00 0.00 ? 68 ARG A HD3  6  
ATOM 7670  H HE   . ARG A 1 68 ? -13.941 0.699   8.321   1.00 0.00 ? 68 ARG A HE   6  
ATOM 7671  H HH11 . ARG A 1 68 ? -16.636 1.874   6.441   1.00 0.00 ? 68 ARG A HH11 6  
ATOM 7672  H HH12 . ARG A 1 68 ? -17.723 1.906   7.788   1.00 0.00 ? 68 ARG A HH12 6  
ATOM 7673  H HH21 . ARG A 1 68 ? -15.369 0.741   10.094  1.00 0.00 ? 68 ARG A HH21 6  
ATOM 7674  H HH22 . ARG A 1 68 ? -17.004 1.264   9.863   1.00 0.00 ? 68 ARG A HH22 6  
ATOM 7675  N N    . TYR A 1 69 ? -11.153 -1.571  5.241   1.00 0.00 ? 69 TYR A N    6  
ATOM 7676  C CA   . TYR A 1 69 ? -9.843  -1.621  5.879   1.00 0.00 ? 69 TYR A CA   6  
ATOM 7677  C C    . TYR A 1 69 ? -9.600  -0.376  6.725   1.00 0.00 ? 69 TYR A C    6  
ATOM 7678  O O    . TYR A 1 69 ? -9.060  -0.458  7.828   1.00 0.00 ? 69 TYR A O    6  
ATOM 7679  C CB   . TYR A 1 69 ? -8.744  -1.755  4.823   1.00 0.00 ? 69 TYR A CB   6  
ATOM 7680  C CG   . TYR A 1 69 ? -8.920  -2.950  3.913   1.00 0.00 ? 69 TYR A CG   6  
ATOM 7681  C CD1  . TYR A 1 69 ? -9.731  -2.876  2.787   1.00 0.00 ? 69 TYR A CD1  6  
ATOM 7682  C CD2  . TYR A 1 69 ? -8.275  -4.152  4.180   1.00 0.00 ? 69 TYR A CD2  6  
ATOM 7683  C CE1  . TYR A 1 69 ? -9.894  -3.966  1.953   1.00 0.00 ? 69 TYR A CE1  6  
ATOM 7684  C CE2  . TYR A 1 69 ? -8.433  -5.245  3.350   1.00 0.00 ? 69 TYR A CE2  6  
ATOM 7685  C CZ   . TYR A 1 69 ? -9.243  -5.148  2.239   1.00 0.00 ? 69 TYR A CZ   6  
ATOM 7686  O OH   . TYR A 1 69 ? -9.403  -6.235  1.411   1.00 0.00 ? 69 TYR A OH   6  
ATOM 7687  H H    . TYR A 1 69 ? -11.240 -1.149  4.361   1.00 0.00 ? 69 TYR A H    6  
ATOM 7688  H HA   . TYR A 1 69 ? -9.819  -2.488  6.521   1.00 0.00 ? 69 TYR A HA   6  
ATOM 7689  H HB2  . TYR A 1 69 ? -8.736  -0.868  4.207   1.00 0.00 ? 69 TYR A HB2  6  
ATOM 7690  H HB3  . TYR A 1 69 ? -7.789  -1.852  5.319   1.00 0.00 ? 69 TYR A HB3  6  
ATOM 7691  H HD1  . TYR A 1 69 ? -10.239 -1.950  2.565   1.00 0.00 ? 69 TYR A HD1  6  
ATOM 7692  H HD2  . TYR A 1 69 ? -7.642  -4.224  5.051   1.00 0.00 ? 69 TYR A HD2  6  
ATOM 7693  H HE1  . TYR A 1 69 ? -10.528 -3.889  1.082   1.00 0.00 ? 69 TYR A HE1  6  
ATOM 7694  H HE2  . TYR A 1 69 ? -7.923  -6.171  3.574   1.00 0.00 ? 69 TYR A HE2  6  
ATOM 7695  H HH   . TYR A 1 69 ? -10.330 -6.333  1.185   1.00 0.00 ? 69 TYR A HH   6  
ATOM 7696  N N    . PHE A 1 70 ? -10.003 0.777   6.202   1.00 0.00 ? 70 PHE A N    6  
ATOM 7697  C CA   . PHE A 1 70 ? -9.829  2.040   6.910   1.00 0.00 ? 70 PHE A CA   6  
ATOM 7698  C C    . PHE A 1 70 ? -10.852 3.071   6.443   1.00 0.00 ? 70 PHE A C    6  
ATOM 7699  O O    . PHE A 1 70 ? -11.376 2.982   5.332   1.00 0.00 ? 70 PHE A O    6  
ATOM 7700  C CB   . PHE A 1 70 ? -8.413  2.577   6.696   1.00 0.00 ? 70 PHE A CB   6  
ATOM 7701  C CG   . PHE A 1 70 ? -8.037  2.715   5.249   1.00 0.00 ? 70 PHE A CG   6  
ATOM 7702  C CD1  . PHE A 1 70 ? -8.502  3.783   4.497   1.00 0.00 ? 70 PHE A CD1  6  
ATOM 7703  C CD2  . PHE A 1 70 ? -7.216  1.779   4.640   1.00 0.00 ? 70 PHE A CD2  6  
ATOM 7704  C CE1  . PHE A 1 70 ? -8.157  3.912   3.165   1.00 0.00 ? 70 PHE A CE1  6  
ATOM 7705  C CE2  . PHE A 1 70 ? -6.868  1.903   3.308   1.00 0.00 ? 70 PHE A CE2  6  
ATOM 7706  C CZ   . PHE A 1 70 ? -7.339  2.971   2.571   1.00 0.00 ? 70 PHE A CZ   6  
ATOM 7707  H H    . PHE A 1 70 ? -10.427 0.779   5.318   1.00 0.00 ? 70 PHE A H    6  
ATOM 7708  H HA   . PHE A 1 70 ? -9.978  1.852   7.962   1.00 0.00 ? 70 PHE A HA   6  
ATOM 7709  H HB2  . PHE A 1 70 ? -8.333  3.552   7.154   1.00 0.00 ? 70 PHE A HB2  6  
ATOM 7710  H HB3  . PHE A 1 70 ? -7.707  1.906   7.162   1.00 0.00 ? 70 PHE A HB3  6  
ATOM 7711  H HD1  . PHE A 1 70 ? -9.141  4.518   4.961   1.00 0.00 ? 70 PHE A HD1  6  
ATOM 7712  H HD2  . PHE A 1 70 ? -6.848  0.943   5.217   1.00 0.00 ? 70 PHE A HD2  6  
ATOM 7713  H HE1  . PHE A 1 70 ? -8.526  4.748   2.589   1.00 0.00 ? 70 PHE A HE1  6  
ATOM 7714  H HE2  . PHE A 1 70 ? -6.228  1.165   2.846   1.00 0.00 ? 70 PHE A HE2  6  
ATOM 7715  H HZ   . PHE A 1 70 ? -7.068  3.070   1.530   1.00 0.00 ? 70 PHE A HZ   6  
ATOM 7716  N N    . GLU A 1 71 ? -11.134 4.047   7.300   1.00 0.00 ? 71 GLU A N    6  
ATOM 7717  C CA   . GLU A 1 71 ? -12.094 5.095   6.976   1.00 0.00 ? 71 GLU A CA   6  
ATOM 7718  C C    . GLU A 1 71 ? -11.381 6.383   6.577   1.00 0.00 ? 71 GLU A C    6  
ATOM 7719  O O    . GLU A 1 71 ? -10.746 7.034   7.407   1.00 0.00 ? 71 GLU A O    6  
ATOM 7720  C CB   . GLU A 1 71 ? -13.018 5.356   8.167   1.00 0.00 ? 71 GLU A CB   6  
ATOM 7721  C CG   . GLU A 1 71 ? -14.271 4.497   8.164   1.00 0.00 ? 71 GLU A CG   6  
ATOM 7722  C CD   . GLU A 1 71 ? -15.318 4.990   9.144   1.00 0.00 ? 71 GLU A CD   6  
ATOM 7723  O OE1  . GLU A 1 71 ? -15.201 4.675   10.348  1.00 0.00 ? 71 GLU A OE1  6  
ATOM 7724  O OE2  . GLU A 1 71 ? -16.255 5.691   8.709   1.00 0.00 ? 71 GLU A OE2  6  
ATOM 7725  H H    . GLU A 1 71 ? -10.684 4.064   8.171   1.00 0.00 ? 71 GLU A H    6  
ATOM 7726  H HA   . GLU A 1 71 ? -12.688 4.753   6.140   1.00 0.00 ? 71 GLU A HA   6  
ATOM 7727  H HB2  . GLU A 1 71 ? -12.474 5.159   9.079   1.00 0.00 ? 71 GLU A HB2  6  
ATOM 7728  H HB3  . GLU A 1 71 ? -13.318 6.394   8.155   1.00 0.00 ? 71 GLU A HB3  6  
ATOM 7729  H HG2  . GLU A 1 71 ? -14.697 4.507   7.173   1.00 0.00 ? 71 GLU A HG2  6  
ATOM 7730  H HG3  . GLU A 1 71 ? -14.000 3.486   8.429   1.00 0.00 ? 71 GLU A HG3  6  
ATOM 7731  N N    . CYS A 1 72 ? -11.491 6.745   5.304   1.00 0.00 ? 72 CYS A N    6  
ATOM 7732  C CA   . CYS A 1 72 ? -10.857 7.955   4.795   1.00 0.00 ? 72 CYS A CA   6  
ATOM 7733  C C    . CYS A 1 72 ? -11.569 8.457   3.541   1.00 0.00 ? 72 CYS A C    6  
ATOM 7734  O O    . CYS A 1 72 ? -12.392 7.750   2.960   1.00 0.00 ? 72 CYS A O    6  
ATOM 7735  C CB   . CYS A 1 72 ? -9.381  7.692   4.489   1.00 0.00 ? 72 CYS A CB   6  
ATOM 7736  S SG   . CYS A 1 72 ? -8.261  8.115   5.843   1.00 0.00 ? 72 CYS A SG   6  
ATOM 7737  H H    . CYS A 1 72 ? -12.011 6.184   4.690   1.00 0.00 ? 72 CYS A H    6  
ATOM 7738  H HA   . CYS A 1 72 ? -10.928 8.713   5.561   1.00 0.00 ? 72 CYS A HA   6  
ATOM 7739  H HB2  . CYS A 1 72 ? -9.248  6.643   4.270   1.00 0.00 ? 72 CYS A HB2  6  
ATOM 7740  H HB3  . CYS A 1 72 ? -9.090  8.275   3.627   1.00 0.00 ? 72 CYS A HB3  6  
ATOM 7741  H HG   . CYS A 1 72 ? -7.624  8.752   5.512   1.00 0.00 ? 72 CYS A HG   6  
ATOM 7742  N N    . PRO A 1 73 ? -11.259 9.690   3.105   1.00 0.00 ? 73 PRO A N    6  
ATOM 7743  C CA   . PRO A 1 73 ? -11.874 10.284  1.913   1.00 0.00 ? 73 PRO A CA   6  
ATOM 7744  C C    . PRO A 1 73 ? -11.782 9.368   0.697   1.00 0.00 ? 73 PRO A C    6  
ATOM 7745  O O    . PRO A 1 73 ? -11.002 8.416   0.681   1.00 0.00 ? 73 PRO A O    6  
ATOM 7746  C CB   . PRO A 1 73 ? -11.054 11.556  1.687   1.00 0.00 ? 73 PRO A CB   6  
ATOM 7747  C CG   . PRO A 1 73 ? -10.522 11.907  3.032   1.00 0.00 ? 73 PRO A CG   6  
ATOM 7748  C CD   . PRO A 1 73 ? -10.287 10.601  3.739   1.00 0.00 ? 73 PRO A CD   6  
ATOM 7749  H HA   . PRO A 1 73 ? -12.907 10.544  2.090   1.00 0.00 ? 73 PRO A HA   6  
ATOM 7750  H HB2  . PRO A 1 73 ? -10.258 11.354  0.986   1.00 0.00 ? 73 PRO A HB2  6  
ATOM 7751  H HB3  . PRO A 1 73 ? -11.692 12.335  1.300   1.00 0.00 ? 73 PRO A HB3  6  
ATOM 7752  H HG2  . PRO A 1 73 ? -9.594  12.451  2.929   1.00 0.00 ? 73 PRO A HG2  6  
ATOM 7753  H HG3  . PRO A 1 73 ? -11.246 12.500  3.571   1.00 0.00 ? 73 PRO A HG3  6  
ATOM 7754  H HD2  . PRO A 1 73 ? -9.275  10.259  3.575   1.00 0.00 ? 73 PRO A HD2  6  
ATOM 7755  H HD3  . PRO A 1 73 ? -10.487 10.702  4.796   1.00 0.00 ? 73 PRO A HD3  6  
ATOM 7756  N N    . ALA A 1 74 ? -12.585 9.663   -0.320  1.00 0.00 ? 74 ALA A N    6  
ATOM 7757  C CA   . ALA A 1 74 ? -12.596 8.866   -1.541  1.00 0.00 ? 74 ALA A CA   6  
ATOM 7758  C C    . ALA A 1 74 ? -11.430 9.239   -2.450  1.00 0.00 ? 74 ALA A C    6  
ATOM 7759  O O    . ALA A 1 74 ? -10.913 10.354  -2.387  1.00 0.00 ? 74 ALA A O    6  
ATOM 7760  C CB   . ALA A 1 74 ? -13.916 9.042   -2.274  1.00 0.00 ? 74 ALA A CB   6  
ATOM 7761  H H    . ALA A 1 74 ? -13.185 10.434  -0.248  1.00 0.00 ? 74 ALA A H    6  
ATOM 7762  H HA   . ALA A 1 74 ? -12.502 7.826   -1.261  1.00 0.00 ? 74 ALA A HA   6  
ATOM 7763  H HB1  . ALA A 1 74 ? -13.759 8.916   -3.335  1.00 0.00 ? 74 ALA A HB1  6  
ATOM 7764  H HB2  . ALA A 1 74 ? -14.305 10.031  -2.082  1.00 0.00 ? 74 ALA A HB2  6  
ATOM 7765  H HB3  . ALA A 1 74 ? -14.624 8.304   -1.924  1.00 0.00 ? 74 ALA A HB3  6  
ATOM 7766  N N    . LEU A 1 75 ? -11.021 8.299   -3.296  1.00 0.00 ? 75 LEU A N    6  
ATOM 7767  C CA   . LEU A 1 75 ? -9.916  8.529   -4.219  1.00 0.00 ? 75 LEU A CA   6  
ATOM 7768  C C    . LEU A 1 75 ? -8.634  8.863   -3.464  1.00 0.00 ? 75 LEU A C    6  
ATOM 7769  O O    . LEU A 1 75 ? -7.765  9.568   -3.977  1.00 0.00 ? 75 LEU A O    6  
ATOM 7770  C CB   . LEU A 1 75 ? -10.262 9.662   -5.187  1.00 0.00 ? 75 LEU A CB   6  
ATOM 7771  C CG   . LEU A 1 75 ? -11.544 9.457   -5.993  1.00 0.00 ? 75 LEU A CG   6  
ATOM 7772  C CD1  . LEU A 1 75 ? -12.283 10.775  -6.168  1.00 0.00 ? 75 LEU A CD1  6  
ATOM 7773  C CD2  . LEU A 1 75 ? -11.228 8.838   -7.347  1.00 0.00 ? 75 LEU A CD2  6  
ATOM 7774  H H    . LEU A 1 75 ? -11.474 7.429   -3.299  1.00 0.00 ? 75 LEU A H    6  
ATOM 7775  H HA   . LEU A 1 75 ? -9.762  7.621   -4.784  1.00 0.00 ? 75 LEU A HA   6  
ATOM 7776  H HB2  . LEU A 1 75 ? -10.359 10.575  -4.616  1.00 0.00 ? 75 LEU A HB2  6  
ATOM 7777  H HB3  . LEU A 1 75 ? -9.442  9.778   -5.879  1.00 0.00 ? 75 LEU A HB3  6  
ATOM 7778  H HG   . LEU A 1 75 ? -12.194 8.780   -5.458  1.00 0.00 ? 75 LEU A HG   6  
ATOM 7779  H HD11 . LEU A 1 75 ? -11.578 11.593  -6.118  1.00 0.00 ? 75 LEU A HD11 6  
ATOM 7780  H HD12 . LEU A 1 75 ? -13.017 10.884  -5.383  1.00 0.00 ? 75 LEU A HD12 6  
ATOM 7781  H HD13 . LEU A 1 75 ? -12.778 10.787  -7.128  1.00 0.00 ? 75 LEU A HD13 6  
ATOM 7782  H HD21 . LEU A 1 75 ? -12.005 8.137   -7.612  1.00 0.00 ? 75 LEU A HD21 6  
ATOM 7783  H HD22 . LEU A 1 75 ? -10.281 8.323   -7.295  1.00 0.00 ? 75 LEU A HD22 6  
ATOM 7784  H HD23 . LEU A 1 75 ? -11.175 9.616   -8.095  1.00 0.00 ? 75 LEU A HD23 6  
ATOM 7785  N N    . GLN A 1 76 ? -8.521  8.352   -2.241  1.00 0.00 ? 76 GLN A N    6  
ATOM 7786  C CA   . GLN A 1 76 ? -7.343  8.598   -1.416  1.00 0.00 ? 76 GLN A CA   6  
ATOM 7787  C C    . GLN A 1 76 ? -6.778  7.293   -0.867  1.00 0.00 ? 76 GLN A C    6  
ATOM 7788  O O    . GLN A 1 76 ? -5.565  7.079   -0.870  1.00 0.00 ? 76 GLN A O    6  
ATOM 7789  C CB   . GLN A 1 76 ? -7.690  9.542   -0.264  1.00 0.00 ? 76 GLN A CB   6  
ATOM 7790  C CG   . GLN A 1 76 ? -7.536  11.012  -0.616  1.00 0.00 ? 76 GLN A CG   6  
ATOM 7791  C CD   . GLN A 1 76 ? -7.648  11.917  0.596   1.00 0.00 ? 76 GLN A CD   6  
ATOM 7792  O OE1  . GLN A 1 76 ? -8.537  12.765  0.673   1.00 0.00 ? 76 GLN A OE1  6  
ATOM 7793  N NE2  . GLN A 1 76 ? -6.744  11.741  1.552   1.00 0.00 ? 76 GLN A NE2  6  
ATOM 7794  H H    . GLN A 1 76 ? -9.246  7.797   -1.886  1.00 0.00 ? 76 GLN A H    6  
ATOM 7795  H HA   . GLN A 1 76 ? -6.597  9.064   -2.038  1.00 0.00 ? 76 GLN A HA   6  
ATOM 7796  H HB2  . GLN A 1 76 ? -8.715  9.370   0.031   1.00 0.00 ? 76 GLN A HB2  6  
ATOM 7797  H HB3  . GLN A 1 76 ? -7.042  9.324   0.573   1.00 0.00 ? 76 GLN A HB3  6  
ATOM 7798  H HG2  . GLN A 1 76 ? -6.567  11.163  -1.068  1.00 0.00 ? 76 GLN A HG2  6  
ATOM 7799  H HG3  . GLN A 1 76 ? -8.307  11.284  -1.321  1.00 0.00 ? 76 GLN A HG3  6  
ATOM 7800  H HE21 . GLN A 1 76 ? -6.064  11.047  1.423   1.00 0.00 ? 76 GLN A HE21 6  
ATOM 7801  H HE22 . GLN A 1 76 ? -6.792  12.312  2.347   1.00 0.00 ? 76 GLN A HE22 6  
ATOM 7802  N N    . GLY A 1 77 ? -7.664  6.426   -0.396  1.00 0.00 ? 77 GLY A N    6  
ATOM 7803  C CA   . GLY A 1 77 ? -7.240  5.151   0.151   1.00 0.00 ? 77 GLY A CA   6  
ATOM 7804  C C    . GLY A 1 77 ? -6.705  4.212   -0.913  1.00 0.00 ? 77 GLY A C    6  
ATOM 7805  O O    . GLY A 1 77 ? -7.429  3.349   -1.409  1.00 0.00 ? 77 GLY A O    6  
ATOM 7806  H H    . GLY A 1 77 ? -8.616  6.654   -0.421  1.00 0.00 ? 77 GLY A H    6  
ATOM 7807  H HA2  . GLY A 1 77 ? -6.466  5.327   0.883   1.00 0.00 ? 77 GLY A HA2  6  
ATOM 7808  H HA3  . GLY A 1 77 ? -8.082  4.682   0.639   1.00 0.00 ? 77 GLY A HA3  6  
ATOM 7809  N N    . ILE A 1 78 ? -5.434  4.381   -1.264  1.00 0.00 ? 78 ILE A N    6  
ATOM 7810  C CA   . ILE A 1 78 ? -4.803  3.544   -2.276  1.00 0.00 ? 78 ILE A CA   6  
ATOM 7811  C C    . ILE A 1 78 ? -4.038  2.388   -1.633  1.00 0.00 ? 78 ILE A C    6  
ATOM 7812  O O    . ILE A 1 78 ? -3.395  2.558   -0.598  1.00 0.00 ? 78 ILE A O    6  
ATOM 7813  C CB   . ILE A 1 78 ? -3.840  4.360   -3.161  1.00 0.00 ? 78 ILE A CB   6  
ATOM 7814  C CG1  . ILE A 1 78 ? -3.270  3.488   -4.281  1.00 0.00 ? 78 ILE A CG1  6  
ATOM 7815  C CG2  . ILE A 1 78 ? -2.718  4.955   -2.322  1.00 0.00 ? 78 ILE A CG2  6  
ATOM 7816  C CD1  . ILE A 1 78 ? -3.170  4.201   -5.613  1.00 0.00 ? 78 ILE A CD1  6  
ATOM 7817  H H    . ILE A 1 78 ? -4.909  5.087   -0.832  1.00 0.00 ? 78 ILE A H    6  
ATOM 7818  H HA   . ILE A 1 78 ? -5.582  3.139   -2.907  1.00 0.00 ? 78 ILE A HA   6  
ATOM 7819  H HB   . ILE A 1 78 ? -4.396  5.176   -3.599  1.00 0.00 ? 78 ILE A HB   6  
ATOM 7820  H HG12 . ILE A 1 78 ? -2.279  3.161   -4.006  1.00 0.00 ? 78 ILE A HG12 6  
ATOM 7821  H HG13 . ILE A 1 78 ? -3.905  2.624   -4.414  1.00 0.00 ? 78 ILE A HG13 6  
ATOM 7822  H HG21 . ILE A 1 78 ? -2.281  4.182   -1.706  1.00 0.00 ? 78 ILE A HG21 6  
ATOM 7823  H HG22 . ILE A 1 78 ? -3.117  5.735   -1.689  1.00 0.00 ? 78 ILE A HG22 6  
ATOM 7824  H HG23 . ILE A 1 78 ? -1.963  5.368   -2.971  1.00 0.00 ? 78 ILE A HG23 6  
ATOM 7825  H HD11 . ILE A 1 78 ? -2.234  4.736   -5.664  1.00 0.00 ? 78 ILE A HD11 6  
ATOM 7826  H HD12 . ILE A 1 78 ? -3.989  4.898   -5.710  1.00 0.00 ? 78 ILE A HD12 6  
ATOM 7827  H HD13 . ILE A 1 78 ? -3.216  3.477   -6.413  1.00 0.00 ? 78 ILE A HD13 6  
ATOM 7828  N N    . PHE A 1 79 ? -4.115  1.216   -2.255  1.00 0.00 ? 79 PHE A N    6  
ATOM 7829  C CA   . PHE A 1 79 ? -3.430  0.035   -1.743  1.00 0.00 ? 79 PHE A CA   6  
ATOM 7830  C C    . PHE A 1 79 ? -2.239  -0.330  -2.625  1.00 0.00 ? 79 PHE A C    6  
ATOM 7831  O O    . PHE A 1 79 ? -2.335  -0.318  -3.851  1.00 0.00 ? 79 PHE A O    6  
ATOM 7832  C CB   . PHE A 1 79 ? -4.399  -1.147  -1.664  1.00 0.00 ? 79 PHE A CB   6  
ATOM 7833  C CG   . PHE A 1 79 ? -5.429  -1.007  -0.579  1.00 0.00 ? 79 PHE A CG   6  
ATOM 7834  C CD1  . PHE A 1 79 ? -6.400  -0.020  -0.650  1.00 0.00 ? 79 PHE A CD1  6  
ATOM 7835  C CD2  . PHE A 1 79 ? -5.426  -1.862  0.511   1.00 0.00 ? 79 PHE A CD2  6  
ATOM 7836  C CE1  . PHE A 1 79 ? -7.348  0.111   0.347   1.00 0.00 ? 79 PHE A CE1  6  
ATOM 7837  C CE2  . PHE A 1 79 ? -6.372  -1.735  1.511   1.00 0.00 ? 79 PHE A CE2  6  
ATOM 7838  C CZ   . PHE A 1 79 ? -7.334  -0.748  1.429   1.00 0.00 ? 79 PHE A CZ   6  
ATOM 7839  H H    . PHE A 1 79 ? -4.643  1.144   -3.077  1.00 0.00 ? 79 PHE A H    6  
ATOM 7840  H HA   . PHE A 1 79 ? -3.072  0.262   -0.751  1.00 0.00 ? 79 PHE A HA   6  
ATOM 7841  H HB2  . PHE A 1 79 ? -4.920  -1.240  -2.604  1.00 0.00 ? 79 PHE A HB2  6  
ATOM 7842  H HB3  . PHE A 1 79 ? -3.838  -2.051  -1.477  1.00 0.00 ? 79 PHE A HB3  6  
ATOM 7843  H HD1  . PHE A 1 79 ? -6.412  0.652   -1.495  1.00 0.00 ? 79 PHE A HD1  6  
ATOM 7844  H HD2  . PHE A 1 79 ? -4.673  -2.633  0.577   1.00 0.00 ? 79 PHE A HD2  6  
ATOM 7845  H HE1  . PHE A 1 79 ? -8.099  0.884   0.280   1.00 0.00 ? 79 PHE A HE1  6  
ATOM 7846  H HE2  . PHE A 1 79 ? -6.359  -2.409  2.355   1.00 0.00 ? 79 PHE A HE2  6  
ATOM 7847  H HZ   . PHE A 1 79 ? -8.074  -0.648  2.208   1.00 0.00 ? 79 PHE A HZ   6  
ATOM 7848  N N    . THR A 1 80 ? -1.117  -0.654  -1.990  1.00 0.00 ? 80 THR A N    6  
ATOM 7849  C CA   . THR A 1 80 ? 0.092   -1.023  -2.716  1.00 0.00 ? 80 THR A CA   6  
ATOM 7850  C C    . THR A 1 80 ? 1.049   -1.801  -1.818  1.00 0.00 ? 80 THR A C    6  
ATOM 7851  O O    . THR A 1 80 ? 0.904   -1.804  -0.595  1.00 0.00 ? 80 THR A O    6  
ATOM 7852  C CB   . THR A 1 80 ? 0.785   0.227   -3.260  1.00 0.00 ? 80 THR A CB   6  
ATOM 7853  O OG1  . THR A 1 80 ? 1.927   -0.124  -4.024  1.00 0.00 ? 80 THR A OG1  6  
ATOM 7854  C CG2  . THR A 1 80 ? 1.234   1.184   -2.176  1.00 0.00 ? 80 THR A CG2  6  
ATOM 7855  H H    . THR A 1 80 ? -1.103  -0.646  -1.010  1.00 0.00 ? 80 THR A H    6  
ATOM 7856  H HA   . THR A 1 80 ? -0.197  -1.653  -3.544  1.00 0.00 ? 80 THR A HA   6  
ATOM 7857  H HB   . THR A 1 80 ? 0.097   0.756   -3.904  1.00 0.00 ? 80 THR A HB   6  
ATOM 7858  H HG1  . THR A 1 80 ? 2.619   -0.439  -3.440  1.00 0.00 ? 80 THR A HG1  6  
ATOM 7859  H HG21 . THR A 1 80 ? 0.449   1.898   -1.980  1.00 0.00 ? 80 THR A HG21 6  
ATOM 7860  H HG22 . THR A 1 80 ? 2.122   1.704   -2.501  1.00 0.00 ? 80 THR A HG22 6  
ATOM 7861  H HG23 . THR A 1 80 ? 1.450   0.629   -1.275  1.00 0.00 ? 80 THR A HG23 6  
ATOM 7862  N N    . ARG A 1 81 ? 2.025   -2.462  -2.432  1.00 0.00 ? 81 ARG A N    6  
ATOM 7863  C CA   . ARG A 1 81 ? 3.005   -3.245  -1.688  1.00 0.00 ? 81 ARG A CA   6  
ATOM 7864  C C    . ARG A 1 81 ? 3.906   -2.337  -0.850  1.00 0.00 ? 81 ARG A C    6  
ATOM 7865  O O    . ARG A 1 81 ? 4.331   -1.279  -1.312  1.00 0.00 ? 81 ARG A O    6  
ATOM 7866  C CB   . ARG A 1 81 ? 3.855   -4.082  -2.646  1.00 0.00 ? 81 ARG A CB   6  
ATOM 7867  C CG   . ARG A 1 81 ? 3.035   -4.922  -3.613  1.00 0.00 ? 81 ARG A CG   6  
ATOM 7868  C CD   . ARG A 1 81 ? 3.891   -5.464  -4.747  1.00 0.00 ? 81 ARG A CD   6  
ATOM 7869  N NE   . ARG A 1 81 ? 3.434   -4.993  -6.052  1.00 0.00 ? 81 ARG A NE   6  
ATOM 7870  C CZ   . ARG A 1 81 ? 4.155   -5.080  -7.167  1.00 0.00 ? 81 ARG A CZ   6  
ATOM 7871  N NH1  . ARG A 1 81 ? 5.367   -5.621  -7.141  1.00 0.00 ? 81 ARG A NH1  6  
ATOM 7872  N NH2  . ARG A 1 81 ? 3.664   -4.627  -8.312  1.00 0.00 ? 81 ARG A NH2  6  
ATOM 7873  H H    . ARG A 1 81 ? 2.088   -2.422  -3.409  1.00 0.00 ? 81 ARG A H    6  
ATOM 7874  H HA   . ARG A 1 81 ? 2.464   -3.907  -1.029  1.00 0.00 ? 81 ARG A HA   6  
ATOM 7875  H HB2  . ARG A 1 81 ? 4.483   -3.418  -3.223  1.00 0.00 ? 81 ARG A HB2  6  
ATOM 7876  H HB3  . ARG A 1 81 ? 4.481   -4.744  -2.068  1.00 0.00 ? 81 ARG A HB3  6  
ATOM 7877  H HG2  . ARG A 1 81 ? 2.603   -5.751  -3.074  1.00 0.00 ? 81 ARG A HG2  6  
ATOM 7878  H HG3  . ARG A 1 81 ? 2.249   -4.309  -4.028  1.00 0.00 ? 81 ARG A HG3  6  
ATOM 7879  H HD2  . ARG A 1 81 ? 4.912   -5.145  -4.598  1.00 0.00 ? 81 ARG A HD2  6  
ATOM 7880  H HD3  . ARG A 1 81 ? 3.846   -6.544  -4.730  1.00 0.00 ? 81 ARG A HD3  6  
ATOM 7881  H HE   . ARG A 1 81 ? 2.542   -4.588  -6.100  1.00 0.00 ? 81 ARG A HE   6  
ATOM 7882  H HH11 . ARG A 1 81 ? 5.744   -5.965  -6.281  1.00 0.00 ? 81 ARG A HH11 6  
ATOM 7883  H HH12 . ARG A 1 81 ? 5.904   -5.684  -7.982  1.00 0.00 ? 81 ARG A HH12 6  
ATOM 7884  H HH21 . ARG A 1 81 ? 2.751   -4.219  -8.338  1.00 0.00 ? 81 ARG A HH21 6  
ATOM 7885  H HH22 . ARG A 1 81 ? 4.206   -4.693  -9.149  1.00 0.00 ? 81 ARG A HH22 6  
ATOM 7886  N N    . PRO A 1 82 ? 4.211   -2.740  0.398   1.00 0.00 ? 82 PRO A N    6  
ATOM 7887  C CA   . PRO A 1 82 ? 5.067   -1.952  1.292   1.00 0.00 ? 82 PRO A CA   6  
ATOM 7888  C C    . PRO A 1 82 ? 6.419   -1.629  0.664   1.00 0.00 ? 82 PRO A C    6  
ATOM 7889  O O    . PRO A 1 82 ? 6.914   -0.508  0.775   1.00 0.00 ? 82 PRO A O    6  
ATOM 7890  C CB   . PRO A 1 82 ? 5.250   -2.861  2.510   1.00 0.00 ? 82 PRO A CB   6  
ATOM 7891  C CG   . PRO A 1 82 ? 4.078   -3.777  2.485   1.00 0.00 ? 82 PRO A CG   6  
ATOM 7892  C CD   . PRO A 1 82 ? 3.750   -3.987  1.034   1.00 0.00 ? 82 PRO A CD   6  
ATOM 7893  H HA   . PRO A 1 82 ? 4.583   -1.034  1.592   1.00 0.00 ? 82 PRO A HA   6  
ATOM 7894  H HB2  . PRO A 1 82 ? 6.180   -3.405  2.420   1.00 0.00 ? 82 PRO A HB2  6  
ATOM 7895  H HB3  . PRO A 1 82 ? 5.263   -2.262  3.409   1.00 0.00 ? 82 PRO A HB3  6  
ATOM 7896  H HG2  . PRO A 1 82 ? 4.335   -4.717  2.951   1.00 0.00 ? 82 PRO A HG2  6  
ATOM 7897  H HG3  . PRO A 1 82 ? 3.242   -3.320  2.995   1.00 0.00 ? 82 PRO A HG3  6  
ATOM 7898  H HD2  . PRO A 1 82 ? 4.286   -4.841  0.645   1.00 0.00 ? 82 PRO A HD2  6  
ATOM 7899  H HD3  . PRO A 1 82 ? 2.686   -4.117  0.903   1.00 0.00 ? 82 PRO A HD3  6  
ATOM 7900  N N    . SER A 1 83 ? 7.012   -2.620  0.005   1.00 0.00 ? 83 SER A N    6  
ATOM 7901  C CA   . SER A 1 83 ? 8.308   -2.444  -0.639  1.00 0.00 ? 83 SER A CA   6  
ATOM 7902  C C    . SER A 1 83 ? 8.267   -1.304  -1.654  1.00 0.00 ? 83 SER A C    6  
ATOM 7903  O O    . SER A 1 83 ? 9.262   -0.610  -1.863  1.00 0.00 ? 83 SER A O    6  
ATOM 7904  C CB   . SER A 1 83 ? 8.737   -3.740  -1.330  1.00 0.00 ? 83 SER A CB   6  
ATOM 7905  O OG   . SER A 1 83 ? 10.051  -3.631  -1.849  1.00 0.00 ? 83 SER A OG   6  
ATOM 7906  H H    . SER A 1 83 ? 6.567   -3.491  -0.048  1.00 0.00 ? 83 SER A H    6  
ATOM 7907  H HA   . SER A 1 83 ? 9.029   -2.201  0.127   1.00 0.00 ? 83 SER A HA   6  
ATOM 7908  H HB2  . SER A 1 83 ? 8.712   -4.550  -0.617  1.00 0.00 ? 83 SER A HB2  6  
ATOM 7909  H HB3  . SER A 1 83 ? 8.058   -3.954  -2.142  1.00 0.00 ? 83 SER A HB3  6  
ATOM 7910  H HG   . SER A 1 83 ? 10.518  -4.459  -1.716  1.00 0.00 ? 83 SER A HG   6  
ATOM 7911  N N    . LYS A 1 84 ? 7.111   -1.118  -2.280  1.00 0.00 ? 84 LYS A N    6  
ATOM 7912  C CA   . LYS A 1 84 ? 6.940   -0.062  -3.272  1.00 0.00 ? 84 LYS A CA   6  
ATOM 7913  C C    . LYS A 1 84 ? 6.940   1.312   -2.611  1.00 0.00 ? 84 LYS A C    6  
ATOM 7914  O O    . LYS A 1 84 ? 7.351   2.303   -3.215  1.00 0.00 ? 84 LYS A O    6  
ATOM 7915  C CB   . LYS A 1 84 ? 5.639   -0.267  -4.049  1.00 0.00 ? 84 LYS A CB   6  
ATOM 7916  C CG   . LYS A 1 84 ? 5.534   -1.632  -4.710  1.00 0.00 ? 84 LYS A CG   6  
ATOM 7917  C CD   . LYS A 1 84 ? 6.256   -1.659  -6.048  1.00 0.00 ? 84 LYS A CD   6  
ATOM 7918  C CE   . LYS A 1 84 ? 5.374   -1.132  -7.167  1.00 0.00 ? 84 LYS A CE   6  
ATOM 7919  N NZ   . LYS A 1 84 ? 5.846   -1.582  -8.506  1.00 0.00 ? 84 LYS A NZ   6  
ATOM 7920  H H    . LYS A 1 84 ? 6.353   -1.703  -2.071  1.00 0.00 ? 84 LYS A H    6  
ATOM 7921  H HA   . LYS A 1 84 ? 7.772   -0.117  -3.959  1.00 0.00 ? 84 LYS A HA   6  
ATOM 7922  H HB2  . LYS A 1 84 ? 4.807   -0.155  -3.370  1.00 0.00 ? 84 LYS A HB2  6  
ATOM 7923  H HB3  . LYS A 1 84 ? 5.569   0.488   -4.817  1.00 0.00 ? 84 LYS A HB3  6  
ATOM 7924  H HG2  . LYS A 1 84 ? 5.976   -2.372  -4.059  1.00 0.00 ? 84 LYS A HG2  6  
ATOM 7925  H HG3  . LYS A 1 84 ? 4.491   -1.865  -4.869  1.00 0.00 ? 84 LYS A HG3  6  
ATOM 7926  H HD2  . LYS A 1 84 ? 7.142   -1.046  -5.981  1.00 0.00 ? 84 LYS A HD2  6  
ATOM 7927  H HD3  . LYS A 1 84 ? 6.538   -2.678  -6.272  1.00 0.00 ? 84 LYS A HD3  6  
ATOM 7928  H HE2  . LYS A 1 84 ? 4.367   -1.488  -7.013  1.00 0.00 ? 84 LYS A HE2  6  
ATOM 7929  H HE3  . LYS A 1 84 ? 5.382   -0.052  -7.136  1.00 0.00 ? 84 LYS A HE3  6  
ATOM 7930  H HZ1  . LYS A 1 84 ? 6.398   -2.460  -8.414  1.00 0.00 ? 84 LYS A HZ1  6  
ATOM 7931  H HZ2  . LYS A 1 84 ? 6.449   -0.852  -8.936  1.00 0.00 ? 84 LYS A HZ2  6  
ATOM 7932  H HZ3  . LYS A 1 84 ? 5.034   -1.759  -9.131  1.00 0.00 ? 84 LYS A HZ3  6  
ATOM 7933  N N    . LEU A 1 85 ? 6.477   1.366   -1.365  1.00 0.00 ? 85 LEU A N    6  
ATOM 7934  C CA   . LEU A 1 85 ? 6.424   2.620   -0.624  1.00 0.00 ? 85 LEU A CA   6  
ATOM 7935  C C    . LEU A 1 85 ? 7.820   3.059   -0.194  1.00 0.00 ? 85 LEU A C    6  
ATOM 7936  O O    . LEU A 1 85 ? 8.679   2.229   0.101   1.00 0.00 ? 85 LEU A O    6  
ATOM 7937  C CB   . LEU A 1 85 ? 5.523   2.472   0.605   1.00 0.00 ? 85 LEU A CB   6  
ATOM 7938  C CG   . LEU A 1 85 ? 4.167   1.817   0.338   1.00 0.00 ? 85 LEU A CG   6  
ATOM 7939  C CD1  . LEU A 1 85 ? 3.580   1.262   1.626   1.00 0.00 ? 85 LEU A CD1  6  
ATOM 7940  C CD2  . LEU A 1 85 ? 3.212   2.816   -0.299  1.00 0.00 ? 85 LEU A CD2  6  
ATOM 7941  H H    . LEU A 1 85 ? 6.164   0.543   -0.936  1.00 0.00 ? 85 LEU A H    6  
ATOM 7942  H HA   . LEU A 1 85 ? 6.007   3.373   -1.276  1.00 0.00 ? 85 LEU A HA   6  
ATOM 7943  H HB2  . LEU A 1 85 ? 6.048   1.880   1.340   1.00 0.00 ? 85 LEU A HB2  6  
ATOM 7944  H HB3  . LEU A 1 85 ? 5.348   3.455   1.017   1.00 0.00 ? 85 LEU A HB3  6  
ATOM 7945  H HG   . LEU A 1 85 ? 4.300   0.996   -0.350  1.00 0.00 ? 85 LEU A HG   6  
ATOM 7946  H HD11 . LEU A 1 85 ? 4.376   1.050   2.323   1.00 0.00 ? 85 LEU A HD11 6  
ATOM 7947  H HD12 . LEU A 1 85 ? 3.037   0.352   1.412   1.00 0.00 ? 85 LEU A HD12 6  
ATOM 7948  H HD13 . LEU A 1 85 ? 2.907   1.989   2.058   1.00 0.00 ? 85 LEU A HD13 6  
ATOM 7949  H HD21 . LEU A 1 85 ? 3.415   2.884   -1.358  1.00 0.00 ? 85 LEU A HD21 6  
ATOM 7950  H HD22 . LEU A 1 85 ? 3.347   3.784   0.157   1.00 0.00 ? 85 LEU A HD22 6  
ATOM 7951  H HD23 . LEU A 1 85 ? 2.194   2.486   -0.149  1.00 0.00 ? 85 LEU A HD23 6  
ATOM 7952  N N    . THR A 1 86 ? 8.039   4.370   -0.161  1.00 0.00 ? 86 THR A N    6  
ATOM 7953  C CA   . THR A 1 86 ? 9.330   4.920   0.232   1.00 0.00 ? 86 THR A CA   6  
ATOM 7954  C C    . THR A 1 86 ? 9.161   5.981   1.316   1.00 0.00 ? 86 THR A C    6  
ATOM 7955  O O    . THR A 1 86 ? 8.065   6.498   1.528   1.00 0.00 ? 86 THR A O    6  
ATOM 7956  C CB   . THR A 1 86 ? 10.044  5.522   -0.979  1.00 0.00 ? 86 THR A CB   6  
ATOM 7957  O OG1  . THR A 1 86 ? 9.351   6.662   -1.454  1.00 0.00 ? 86 THR A OG1  6  
ATOM 7958  C CG2  . THR A 1 86 ? 10.181  4.555   -2.134  1.00 0.00 ? 86 THR A CG2  6  
ATOM 7959  H H    . THR A 1 86 ? 7.313   4.982   -0.408  1.00 0.00 ? 86 THR A H    6  
ATOM 7960  H HA   . THR A 1 86 ? 9.929   4.112   0.627   1.00 0.00 ? 86 THR A HA   6  
ATOM 7961  H HB   . THR A 1 86 ? 11.037  5.828   -0.684  1.00 0.00 ? 86 THR A HB   6  
ATOM 7962  H HG1  . THR A 1 86 ? 8.513   6.393   -1.837  1.00 0.00 ? 86 THR A HG1  6  
ATOM 7963  H HG21 . THR A 1 86 ? 10.979  3.858   -1.928  1.00 0.00 ? 86 THR A HG21 6  
ATOM 7964  H HG22 . THR A 1 86 ? 10.406  5.102   -3.038  1.00 0.00 ? 86 THR A HG22 6  
ATOM 7965  H HG23 . THR A 1 86 ? 9.255   4.014   -2.263  1.00 0.00 ? 86 THR A HG23 6  
ATOM 7966  N N    . ARG A 1 87 ? 10.256  6.300   2.000   1.00 0.00 ? 87 ARG A N    6  
ATOM 7967  C CA   . ARG A 1 87 ? 10.229  7.300   3.062   1.00 0.00 ? 87 ARG A CA   6  
ATOM 7968  C C    . ARG A 1 87 ? 10.719  8.652   2.550   1.00 0.00 ? 87 ARG A C    6  
ATOM 7969  O O    . ARG A 1 87 ? 11.284  9.444   3.305   1.00 0.00 ? 87 ARG A O    6  
ATOM 7970  C CB   . ARG A 1 87 ? 11.088  6.841   4.243   1.00 0.00 ? 87 ARG A CB   6  
ATOM 7971  C CG   . ARG A 1 87 ? 10.284  6.552   5.503   1.00 0.00 ? 87 ARG A CG   6  
ATOM 7972  C CD   . ARG A 1 87 ? 10.635  7.516   6.625   1.00 0.00 ? 87 ARG A CD   6  
ATOM 7973  N NE   . ARG A 1 87 ? 10.137  7.057   7.918   1.00 0.00 ? 87 ARG A NE   6  
ATOM 7974  C CZ   . ARG A 1 87 ? 10.590  7.500   9.088   1.00 0.00 ? 87 ARG A CZ   6  
ATOM 7975  N NH1  . ARG A 1 87 ? 11.551  8.415   9.132   1.00 0.00 ? 87 ARG A NH1  6  
ATOM 7976  N NH2  . ARG A 1 87 ? 10.081  7.028   10.218  1.00 0.00 ? 87 ARG A NH2  6  
ATOM 7977  H H    . ARG A 1 87 ? 11.101  5.854   1.786   1.00 0.00 ? 87 ARG A H    6  
ATOM 7978  H HA   . ARG A 1 87 ? 9.206   7.404   3.392   1.00 0.00 ? 87 ARG A HA   6  
ATOM 7979  H HB2  . ARG A 1 87 ? 11.611  5.939   3.963   1.00 0.00 ? 87 ARG A HB2  6  
ATOM 7980  H HB3  . ARG A 1 87 ? 11.811  7.610   4.471   1.00 0.00 ? 87 ARG A HB3  6  
ATOM 7981  H HG2  . ARG A 1 87 ? 9.233   6.647   5.277   1.00 0.00 ? 87 ARG A HG2  6  
ATOM 7982  H HG3  . ARG A 1 87 ? 10.495  5.543   5.827   1.00 0.00 ? 87 ARG A HG3  6  
ATOM 7983  H HD2  . ARG A 1 87 ? 11.710  7.611   6.677   1.00 0.00 ? 87 ARG A HD2  6  
ATOM 7984  H HD3  . ARG A 1 87 ? 10.200  8.480   6.403   1.00 0.00 ? 87 ARG A HD3  6  
ATOM 7985  H HE   . ARG A 1 87 ? 9.426   6.381   7.915   1.00 0.00 ? 87 ARG A HE   6  
ATOM 7986  H HH11 . ARG A 1 87 ? 11.939  8.775   8.284   1.00 0.00 ? 87 ARG A HH11 6  
ATOM 7987  H HH12 . ARG A 1 87 ? 11.887  8.745   10.014  1.00 0.00 ? 87 ARG A HH12 6  
ATOM 7988  H HH21 . ARG A 1 87 ? 9.356   6.340   10.192  1.00 0.00 ? 87 ARG A HH21 6  
ATOM 7989  H HH22 . ARG A 1 87 ? 10.421  7.362   11.097  1.00 0.00 ? 87 ARG A HH22 6  
ATOM 7990  N N    . GLN A 1 88 ? 10.501  8.909   1.265   1.00 0.00 ? 88 GLN A N    6  
ATOM 7991  C CA   . GLN A 1 88 ? 10.920  10.164  0.653   1.00 0.00 ? 88 GLN A CA   6  
ATOM 7992  C C    . GLN A 1 88 ? 10.449  10.245  -0.797  1.00 0.00 ? 88 GLN A C    6  
ATOM 7993  O O    . GLN A 1 88 ? 10.056  9.239   -1.388  1.00 0.00 ? 88 GLN A O    6  
ATOM 7994  C CB   . GLN A 1 88 ? 12.443  10.304  0.719   1.00 0.00 ? 88 GLN A CB   6  
ATOM 7995  C CG   . GLN A 1 88 ? 12.922  11.226  1.827   1.00 0.00 ? 88 GLN A CG   6  
ATOM 7996  C CD   . GLN A 1 88 ? 14.211  11.941  1.474   1.00 0.00 ? 88 GLN A CD   6  
ATOM 7997  O OE1  . GLN A 1 88 ? 14.227  12.835  0.628   1.00 0.00 ? 88 GLN A OE1  6  
ATOM 7998  N NE2  . GLN A 1 88 ? 15.302  11.550  2.123   1.00 0.00 ? 88 GLN A NE2  6  
ATOM 7999  H H    . GLN A 1 88 ? 10.045  8.238   0.714   1.00 0.00 ? 88 GLN A H    6  
ATOM 8000  H HA   . GLN A 1 88 ? 10.469  10.972  1.211   1.00 0.00 ? 88 GLN A HA   6  
ATOM 8001  H HB2  . GLN A 1 88 ? 12.876  9.327   0.881   1.00 0.00 ? 88 GLN A HB2  6  
ATOM 8002  H HB3  . GLN A 1 88 ? 12.800  10.694  -0.223  1.00 0.00 ? 88 GLN A HB3  6  
ATOM 8003  H HG2  . GLN A 1 88 ? 12.158  11.966  2.018   1.00 0.00 ? 88 GLN A HG2  6  
ATOM 8004  H HG3  . GLN A 1 88 ? 13.084  10.640  2.720   1.00 0.00 ? 88 GLN A HG3  6  
ATOM 8005  H HE21 . GLN A 1 88 ? 15.214  10.831  2.784   1.00 0.00 ? 88 GLN A HE21 6  
ATOM 8006  H HE22 . GLN A 1 88 ? 16.149  11.995  1.914   1.00 0.00 ? 88 GLN A HE22 6  
ATOM 8007  N N    . PRO A 1 89 ? 10.484  11.450  -1.393  1.00 0.00 ? 89 PRO A N    6  
ATOM 8008  C CA   . PRO A 1 89 ? 10.060  11.656  -2.782  1.00 0.00 ? 89 PRO A CA   6  
ATOM 8009  C C    . PRO A 1 89 ? 11.015  11.008  -3.779  1.00 0.00 ? 89 PRO A C    6  
ATOM 8010  O O    . PRO A 1 89 ? 11.803  11.691  -4.434  1.00 0.00 ? 89 PRO A O    6  
ATOM 8011  C CB   . PRO A 1 89 ? 10.074  13.179  -2.936  1.00 0.00 ? 89 PRO A CB   6  
ATOM 8012  C CG   . PRO A 1 89 ? 11.051  13.656  -1.918  1.00 0.00 ? 89 PRO A CG   6  
ATOM 8013  C CD   . PRO A 1 89 ? 10.941  12.703  -0.760  1.00 0.00 ? 89 PRO A CD   6  
ATOM 8014  H HA   . PRO A 1 89 ? 9.060   11.283  -2.948  1.00 0.00 ? 89 PRO A HA   6  
ATOM 8015  H HB2  . PRO A 1 89 ? 10.387  13.439  -3.938  1.00 0.00 ? 89 PRO A HB2  6  
ATOM 8016  H HB3  . PRO A 1 89 ? 9.086   13.572  -2.748  1.00 0.00 ? 89 PRO A HB3  6  
ATOM 8017  H HG2  . PRO A 1 89 ? 12.049  13.634  -2.329  1.00 0.00 ? 89 PRO A HG2  6  
ATOM 8018  H HG3  . PRO A 1 89 ? 10.795  14.657  -1.604  1.00 0.00 ? 89 PRO A HG3  6  
ATOM 8019  H HD2  . PRO A 1 89 ? 11.903  12.568  -0.289  1.00 0.00 ? 89 PRO A HD2  6  
ATOM 8020  H HD3  . PRO A 1 89 ? 10.214  13.059  -0.045  1.00 0.00 ? 89 PRO A HD3  6  
ATOM 8021  N N    . SER A 1 90 ? 10.938  9.686   -3.888  1.00 0.00 ? 90 SER A N    6  
ATOM 8022  C CA   . SER A 1 90 ? 11.796  8.944   -4.806  1.00 0.00 ? 90 SER A CA   6  
ATOM 8023  C C    . SER A 1 90 ? 13.267  9.147   -4.457  1.00 0.00 ? 90 SER A C    6  
ATOM 8024  O O    . SER A 1 90 ? 13.962  9.941   -5.091  1.00 0.00 ? 90 SER A O    6  
ATOM 8025  C CB   . SER A 1 90 ? 11.532  9.382   -6.248  1.00 0.00 ? 90 SER A CB   6  
ATOM 8026  O OG   . SER A 1 90 ? 10.873  8.361   -6.979  1.00 0.00 ? 90 SER A OG   6  
ATOM 8027  H H    . SER A 1 90 ? 10.291  9.198   -3.339  1.00 0.00 ? 90 SER A H    6  
ATOM 8028  H HA   . SER A 1 90 ? 11.556  7.896   -4.707  1.00 0.00 ? 90 SER A HA   6  
ATOM 8029  H HB2  . SER A 1 90 ? 10.909  10.263  -6.247  1.00 0.00 ? 90 SER A HB2  6  
ATOM 8030  H HB3  . SER A 1 90 ? 12.471  9.606   -6.733  1.00 0.00 ? 90 SER A HB3  6  
ATOM 8031  H HG   . SER A 1 90 ? 11.461  7.608   -7.079  1.00 0.00 ? 90 SER A HG   6  
ATOM 8032  N N    . GLY A 1 91 ? 13.736  8.423   -3.446  1.00 0.00 ? 91 GLY A N    6  
ATOM 8033  C CA   . GLY A 1 91 ? 15.121  8.537   -3.031  1.00 0.00 ? 91 GLY A CA   6  
ATOM 8034  C C    . GLY A 1 91 ? 15.786  7.185   -2.845  1.00 0.00 ? 91 GLY A C    6  
ATOM 8035  O O    . GLY A 1 91 ? 15.103  6.164   -2.761  1.00 0.00 ? 91 GLY A O    6  
ATOM 8036  H H    . GLY A 1 91 ? 13.136  7.806   -2.978  1.00 0.00 ? 91 GLY A H    6  
ATOM 8037  H HA2  . GLY A 1 91 ? 15.666  9.093   -3.781  1.00 0.00 ? 91 GLY A HA2  6  
ATOM 8038  H HA3  . GLY A 1 91 ? 15.163  9.077   -2.097  1.00 0.00 ? 91 GLY A HA3  6  
ATOM 8039  N N    . PRO A 1 92 ? 17.127  7.146   -2.777  1.00 0.00 ? 92 PRO A N    6  
ATOM 8040  C CA   . PRO A 1 92 ? 17.874  5.896   -2.598  1.00 0.00 ? 92 PRO A CA   6  
ATOM 8041  C C    . PRO A 1 92 ? 17.374  5.088   -1.405  1.00 0.00 ? 92 PRO A C    6  
ATOM 8042  O O    . PRO A 1 92 ? 16.942  5.652   -0.399  1.00 0.00 ? 92 PRO A O    6  
ATOM 8043  C CB   . PRO A 1 92 ? 19.310  6.368   -2.360  1.00 0.00 ? 92 PRO A CB   6  
ATOM 8044  C CG   . PRO A 1 92 ? 19.384  7.701   -3.021  1.00 0.00 ? 92 PRO A CG   6  
ATOM 8045  C CD   . PRO A 1 92 ? 18.021  8.316   -2.868  1.00 0.00 ? 92 PRO A CD   6  
ATOM 8046  H HA   . PRO A 1 92 ? 17.835  5.283   -3.487  1.00 0.00 ? 92 PRO A HA   6  
ATOM 8047  H HB2  . PRO A 1 92 ? 19.495  6.441   -1.299  1.00 0.00 ? 92 PRO A HB2  6  
ATOM 8048  H HB3  . PRO A 1 92 ? 20.000  5.669   -2.807  1.00 0.00 ? 92 PRO A HB3  6  
ATOM 8049  H HG2  . PRO A 1 92 ? 20.129  8.312   -2.531  1.00 0.00 ? 92 PRO A HG2  6  
ATOM 8050  H HG3  . PRO A 1 92 ? 19.626  7.580   -4.066  1.00 0.00 ? 92 PRO A HG3  6  
ATOM 8051  H HD2  . PRO A 1 92 ? 17.973  8.909   -1.968  1.00 0.00 ? 92 PRO A HD2  6  
ATOM 8052  H HD3  . PRO A 1 92 ? 17.780  8.918   -3.732  1.00 0.00 ? 92 PRO A HD3  6  
ATOM 8053  N N    . SER A 1 93 ? 17.435  3.767   -1.524  1.00 0.00 ? 93 SER A N    6  
ATOM 8054  C CA   . SER A 1 93 ? 16.989  2.881   -0.454  1.00 0.00 ? 93 SER A CA   6  
ATOM 8055  C C    . SER A 1 93 ? 18.164  2.111   0.139   1.00 0.00 ? 93 SER A C    6  
ATOM 8056  O O    . SER A 1 93 ? 18.425  0.968   -0.237  1.00 0.00 ? 93 SER A O    6  
ATOM 8057  C CB   . SER A 1 93 ? 15.935  1.904   -0.980  1.00 0.00 ? 93 SER A CB   6  
ATOM 8058  O OG   . SER A 1 93 ? 14.628  2.326   -0.629  1.00 0.00 ? 93 SER A OG   6  
ATOM 8059  H H    . SER A 1 93 ? 17.789  3.378   -2.350  1.00 0.00 ? 93 SER A H    6  
ATOM 8060  H HA   . SER A 1 93 ? 16.546  3.492   0.318   1.00 0.00 ? 93 SER A HA   6  
ATOM 8061  H HB2  . SER A 1 93 ? 16.003  1.849   -2.057  1.00 0.00 ? 93 SER A HB2  6  
ATOM 8062  H HB3  . SER A 1 93 ? 16.110  0.926   -0.558  1.00 0.00 ? 93 SER A HB3  6  
ATOM 8063  H HG   . SER A 1 93 ? 14.516  2.264   0.322   1.00 0.00 ? 93 SER A HG   6  
ATOM 8064  N N    . SER A 1 94 ? 18.871  2.745   1.069   1.00 0.00 ? 94 SER A N    6  
ATOM 8065  C CA   . SER A 1 94 ? 20.018  2.120   1.716   1.00 0.00 ? 94 SER A CA   6  
ATOM 8066  C C    . SER A 1 94 ? 20.106  2.529   3.183   1.00 0.00 ? 94 SER A C    6  
ATOM 8067  O O    . SER A 1 94 ? 20.288  1.688   4.063   1.00 0.00 ? 94 SER A O    6  
ATOM 8068  C CB   . SER A 1 94 ? 21.309  2.500   0.989   1.00 0.00 ? 94 SER A CB   6  
ATOM 8069  O OG   . SER A 1 94 ? 22.371  1.632   1.346   1.00 0.00 ? 94 SER A OG   6  
ATOM 8070  H H    . SER A 1 94 ? 18.613  3.655   1.328   1.00 0.00 ? 94 SER A H    6  
ATOM 8071  H HA   . SER A 1 94 ? 19.887  1.049   1.660   1.00 0.00 ? 94 SER A HA   6  
ATOM 8072  H HB2  . SER A 1 94 ? 21.152  2.437   -0.077  1.00 0.00 ? 94 SER A HB2  6  
ATOM 8073  H HB3  . SER A 1 94 ? 21.583  3.511   1.253   1.00 0.00 ? 94 SER A HB3  6  
ATOM 8074  H HG   . SER A 1 94 ? 22.668  1.838   2.235   1.00 0.00 ? 94 SER A HG   6  
ATOM 8075  N N    . GLY A 1 95 ? 19.978  3.827   3.438   1.00 0.00 ? 95 GLY A N    6  
ATOM 8076  C CA   . GLY A 1 95 ? 20.046  4.325   4.799   1.00 0.00 ? 95 GLY A CA   6  
ATOM 8077  C C    . GLY A 1 95 ? 21.465  4.375   5.328   1.00 0.00 ? 95 GLY A C    6  
ATOM 8078  O O    . GLY A 1 95 ? 22.370  4.773   4.565   1.00 0.00 ? 95 GLY A O    6  
ATOM 8079  O OXT  . GLY A 1 95 ? 21.672  4.017   6.507   1.00 0.00 ? 95 GLY A OXT  6  
ATOM 8080  H H    . GLY A 1 95 ? 19.834  4.451   2.696   1.00 0.00 ? 95 GLY A H    6  
ATOM 8081  H HA2  . GLY A 1 95 ? 19.627  5.320   4.827   1.00 0.00 ? 95 GLY A HA2  6  
ATOM 8082  H HA3  . GLY A 1 95 ? 19.458  3.681   5.436   1.00 0.00 ? 95 GLY A HA3  6  
ATOM 8083  N N    . GLY A 1 1  ? -18.719 10.901  -20.797 1.00 0.00 ? 1  GLY A N    7  
ATOM 8084  C CA   . GLY A 1 1  ? -19.058 10.445  -19.420 1.00 0.00 ? 1  GLY A CA   7  
ATOM 8085  C C    . GLY A 1 1  ? -17.854 9.905   -18.673 1.00 0.00 ? 1  GLY A C    7  
ATOM 8086  O O    . GLY A 1 1  ? -16.714 10.258  -18.981 1.00 0.00 ? 1  GLY A O    7  
ATOM 8087  H H1   . GLY A 1 1  ? -19.071 10.217  -21.496 1.00 0.00 ? 1  GLY A H1   7  
ATOM 8088  H H2   . GLY A 1 1  ? -17.688 10.987  -20.902 1.00 0.00 ? 1  GLY A H2   7  
ATOM 8089  H H3   . GLY A 1 1  ? -19.154 11.827  -20.983 1.00 0.00 ? 1  GLY A H3   7  
ATOM 8090  H HA2  . GLY A 1 1  ? -19.466 11.277  -18.867 1.00 0.00 ? 1  GLY A HA2  7  
ATOM 8091  H HA3  . GLY A 1 1  ? -19.805 9.667   -19.484 1.00 0.00 ? 1  GLY A HA3  7  
ATOM 8092  N N    . SER A 1 2  ? -18.104 9.048   -17.689 1.00 0.00 ? 2  SER A N    7  
ATOM 8093  C CA   . SER A 1 2  ? -17.032 8.459   -16.896 1.00 0.00 ? 2  SER A CA   7  
ATOM 8094  C C    . SER A 1 2  ? -16.360 7.317   -17.651 1.00 0.00 ? 2  SER A C    7  
ATOM 8095  O O    . SER A 1 2  ? -16.864 6.854   -18.675 1.00 0.00 ? 2  SER A O    7  
ATOM 8096  C CB   . SER A 1 2  ? -17.577 7.950   -15.561 1.00 0.00 ? 2  SER A CB   7  
ATOM 8097  O OG   . SER A 1 2  ? -17.899 9.028   -14.697 1.00 0.00 ? 2  SER A OG   7  
ATOM 8098  H H    . SER A 1 2  ? -19.034 8.806   -17.491 1.00 0.00 ? 2  SER A H    7  
ATOM 8099  H HA   . SER A 1 2  ? -16.299 9.229   -16.706 1.00 0.00 ? 2  SER A HA   7  
ATOM 8100  H HB2  . SER A 1 2  ? -18.469 7.368   -15.735 1.00 0.00 ? 2  SER A HB2  7  
ATOM 8101  H HB3  . SER A 1 2  ? -16.832 7.332   -15.082 1.00 0.00 ? 2  SER A HB3  7  
ATOM 8102  H HG   . SER A 1 2  ? -18.379 9.699   -15.188 1.00 0.00 ? 2  SER A HG   7  
ATOM 8103  N N    . SER A 1 3  ? -15.219 6.867   -17.140 1.00 0.00 ? 3  SER A N    7  
ATOM 8104  C CA   . SER A 1 3  ? -14.477 5.779   -17.767 1.00 0.00 ? 3  SER A CA   7  
ATOM 8105  C C    . SER A 1 3  ? -13.841 4.877   -16.714 1.00 0.00 ? 3  SER A C    7  
ATOM 8106  O O    . SER A 1 3  ? -13.192 5.355   -15.784 1.00 0.00 ? 3  SER A O    7  
ATOM 8107  C CB   . SER A 1 3  ? -13.398 6.338   -18.695 1.00 0.00 ? 3  SER A CB   7  
ATOM 8108  O OG   . SER A 1 3  ? -12.541 7.230   -18.004 1.00 0.00 ? 3  SER A OG   7  
ATOM 8109  H H    . SER A 1 3  ? -14.867 7.277   -16.323 1.00 0.00 ? 3  SER A H    7  
ATOM 8110  H HA   . SER A 1 3  ? -15.174 5.196   -18.350 1.00 0.00 ? 3  SER A HA   7  
ATOM 8111  H HB2  . SER A 1 3  ? -12.807 5.524   -19.088 1.00 0.00 ? 3  SER A HB2  7  
ATOM 8112  H HB3  . SER A 1 3  ? -13.867 6.868   -19.511 1.00 0.00 ? 3  SER A HB3  7  
ATOM 8113  H HG   . SER A 1 3  ? -12.883 8.123   -18.075 1.00 0.00 ? 3  SER A HG   7  
ATOM 8114  N N    . GLY A 1 4  ? -14.032 3.571   -16.867 1.00 0.00 ? 4  GLY A N    7  
ATOM 8115  C CA   . GLY A 1 4  ? -13.472 2.624   -15.922 1.00 0.00 ? 4  GLY A CA   7  
ATOM 8116  C C    . GLY A 1 4  ? -14.448 2.251   -14.825 1.00 0.00 ? 4  GLY A C    7  
ATOM 8117  O O    . GLY A 1 4  ? -15.302 3.053   -14.447 1.00 0.00 ? 4  GLY A O    7  
ATOM 8118  H H    . GLY A 1 4  ? -14.559 3.248   -17.628 1.00 0.00 ? 4  GLY A H    7  
ATOM 8119  H HA2  . GLY A 1 4  ? -13.186 1.728   -16.454 1.00 0.00 ? 4  GLY A HA2  7  
ATOM 8120  H HA3  . GLY A 1 4  ? -12.592 3.059   -15.472 1.00 0.00 ? 4  GLY A HA3  7  
ATOM 8121  N N    . SER A 1 5  ? -14.324 1.031   -14.312 1.00 0.00 ? 5  SER A N    7  
ATOM 8122  C CA   . SER A 1 5  ? -15.203 0.554   -13.252 1.00 0.00 ? 5  SER A CA   7  
ATOM 8123  C C    . SER A 1 5  ? -14.440 -0.326  -12.267 1.00 0.00 ? 5  SER A C    7  
ATOM 8124  O O    . SER A 1 5  ? -14.543 -0.151  -11.054 1.00 0.00 ? 5  SER A O    7  
ATOM 8125  C CB   . SER A 1 5  ? -16.377 -0.225  -13.848 1.00 0.00 ? 5  SER A CB   7  
ATOM 8126  O OG   . SER A 1 5  ? -17.502 0.614   -14.038 1.00 0.00 ? 5  SER A OG   7  
ATOM 8127  H H    . SER A 1 5  ? -13.622 0.438   -14.656 1.00 0.00 ? 5  SER A H    7  
ATOM 8128  H HA   . SER A 1 5  ? -15.584 1.416   -12.725 1.00 0.00 ? 5  SER A HA   7  
ATOM 8129  H HB2  . SER A 1 5  ? -16.086 -0.637  -14.802 1.00 0.00 ? 5  SER A HB2  7  
ATOM 8130  H HB3  . SER A 1 5  ? -16.652 -1.027  -13.178 1.00 0.00 ? 5  SER A HB3  7  
ATOM 8131  H HG   . SER A 1 5  ? -18.226 0.312   -13.485 1.00 0.00 ? 5  SER A HG   7  
ATOM 8132  N N    . SER A 1 6  ? -13.674 -1.274  -12.799 1.00 0.00 ? 6  SER A N    7  
ATOM 8133  C CA   . SER A 1 6  ? -12.893 -2.182  -11.967 1.00 0.00 ? 6  SER A CA   7  
ATOM 8134  C C    . SER A 1 6  ? -11.892 -1.411  -11.113 1.00 0.00 ? 6  SER A C    7  
ATOM 8135  O O    . SER A 1 6  ? -11.940 -0.182  -11.038 1.00 0.00 ? 6  SER A O    7  
ATOM 8136  C CB   . SER A 1 6  ? -12.161 -3.204  -12.841 1.00 0.00 ? 6  SER A CB   7  
ATOM 8137  O OG   . SER A 1 6  ? -12.567 -4.525  -12.528 1.00 0.00 ? 6  SER A OG   7  
ATOM 8138  H H    . SER A 1 6  ? -13.633 -1.365  -13.774 1.00 0.00 ? 6  SER A H    7  
ATOM 8139  H HA   . SER A 1 6  ? -13.577 -2.704  -11.315 1.00 0.00 ? 6  SER A HA   7  
ATOM 8140  H HB2  . SER A 1 6  ? -12.383 -3.011  -13.880 1.00 0.00 ? 6  SER A HB2  7  
ATOM 8141  H HB3  . SER A 1 6  ? -11.097 -3.120  -12.678 1.00 0.00 ? 6  SER A HB3  7  
ATOM 8142  H HG   . SER A 1 6  ? -13.201 -4.829  -13.182 1.00 0.00 ? 6  SER A HG   7  
ATOM 8143  N N    . GLY A 1 7  ? -10.985 -2.138  -10.470 1.00 0.00 ? 7  GLY A N    7  
ATOM 8144  C CA   . GLY A 1 7  ? -9.985  -1.506  -9.630  1.00 0.00 ? 7  GLY A CA   7  
ATOM 8145  C C    . GLY A 1 7  ? -8.626  -2.165  -9.747  1.00 0.00 ? 7  GLY A C    7  
ATOM 8146  O O    . GLY A 1 7  ? -7.886  -1.914  -10.698 1.00 0.00 ? 7  GLY A O    7  
ATOM 8147  H H    . GLY A 1 7  ? -10.994 -3.114  -10.567 1.00 0.00 ? 7  GLY A H    7  
ATOM 8148  H HA2  . GLY A 1 7  ? -9.896  -0.468  -9.916  1.00 0.00 ? 7  GLY A HA2  7  
ATOM 8149  H HA3  . GLY A 1 7  ? -10.310 -1.558  -8.601  1.00 0.00 ? 7  GLY A HA3  7  
ATOM 8150  N N    . ALA A 1 8  ? -8.295  -3.012  -8.777  1.00 0.00 ? 8  ALA A N    7  
ATOM 8151  C CA   . ALA A 1 8  ? -7.014  -3.709  -8.775  1.00 0.00 ? 8  ALA A CA   7  
ATOM 8152  C C    . ALA A 1 8  ? -7.184  -5.169  -9.181  1.00 0.00 ? 8  ALA A C    7  
ATOM 8153  O O    . ALA A 1 8  ? -8.255  -5.579  -9.629  1.00 0.00 ? 8  ALA A O    7  
ATOM 8154  C CB   . ALA A 1 8  ? -6.365  -3.614  -7.403  1.00 0.00 ? 8  ALA A CB   7  
ATOM 8155  H H    . ALA A 1 8  ? -8.926  -3.171  -8.045  1.00 0.00 ? 8  ALA A H    7  
ATOM 8156  H HA   . ALA A 1 8  ? -6.368  -3.220  -9.489  1.00 0.00 ? 8  ALA A HA   7  
ATOM 8157  H HB1  . ALA A 1 8  ? -6.912  -4.226  -6.702  1.00 0.00 ? 8  ALA A HB1  7  
ATOM 8158  H HB2  . ALA A 1 8  ? -6.376  -2.586  -7.070  1.00 0.00 ? 8  ALA A HB2  7  
ATOM 8159  H HB3  . ALA A 1 8  ? -5.343  -3.961  -7.463  1.00 0.00 ? 8  ALA A HB3  7  
ATOM 8160  N N    . ALA A 1 9  ? -6.120  -5.950  -9.023  1.00 0.00 ? 9  ALA A N    7  
ATOM 8161  C CA   . ALA A 1 9  ? -6.150  -7.365  -9.374  1.00 0.00 ? 9  ALA A CA   7  
ATOM 8162  C C    . ALA A 1 9  ? -4.824  -8.043  -9.042  1.00 0.00 ? 9  ALA A C    7  
ATOM 8163  O O    . ALA A 1 9  ? -4.798  -9.184  -8.582  1.00 0.00 ? 9  ALA A O    7  
ATOM 8164  C CB   . ALA A 1 9  ? -6.477  -7.537  -10.850 1.00 0.00 ? 9  ALA A CB   7  
ATOM 8165  H H    . ALA A 1 9  ? -5.294  -5.565  -8.662  1.00 0.00 ? 9  ALA A H    7  
ATOM 8166  H HA   . ALA A 1 9  ? -6.936  -7.834  -8.799  1.00 0.00 ? 9  ALA A HA   7  
ATOM 8167  H HB1  . ALA A 1 9  ? -7.128  -8.389  -10.978 1.00 0.00 ? 9  ALA A HB1  7  
ATOM 8168  H HB2  . ALA A 1 9  ? -5.563  -7.696  -11.404 1.00 0.00 ? 9  ALA A HB2  7  
ATOM 8169  H HB3  . ALA A 1 9  ? -6.969  -6.648  -11.215 1.00 0.00 ? 9  ALA A HB3  7  
ATOM 8170  N N    . GLU A 1 10 ? -3.726  -7.333  -9.281  1.00 0.00 ? 10 GLU A N    7  
ATOM 8171  C CA   . GLU A 1 10 ? -2.395  -7.866  -9.010  1.00 0.00 ? 10 GLU A CA   7  
ATOM 8172  C C    . GLU A 1 10 ? -2.272  -8.322  -7.559  1.00 0.00 ? 10 GLU A C    7  
ATOM 8173  O O    . GLU A 1 10 ? -2.962  -7.812  -6.676  1.00 0.00 ? 10 GLU A O    7  
ATOM 8174  C CB   . GLU A 1 10 ? -1.329  -6.810  -9.315  1.00 0.00 ? 10 GLU A CB   7  
ATOM 8175  C CG   . GLU A 1 10 ? 0.068   -7.387  -9.483  1.00 0.00 ? 10 GLU A CG   7  
ATOM 8176  C CD   . GLU A 1 10 ? 0.728   -6.952  -10.777 1.00 0.00 ? 10 GLU A CD   7  
ATOM 8177  O OE1  . GLU A 1 10 ? 0.135   -7.183  -11.852 1.00 0.00 ? 10 GLU A OE1  7  
ATOM 8178  O OE2  . GLU A 1 10 ? 1.837   -6.382  -10.714 1.00 0.00 ? 10 GLU A OE2  7  
ATOM 8179  H H    . GLU A 1 10 ? -3.813  -6.429  -9.650  1.00 0.00 ? 10 GLU A H    7  
ATOM 8180  H HA   . GLU A 1 10 ? -2.240  -8.717  -9.656  1.00 0.00 ? 10 GLU A HA   7  
ATOM 8181  H HB2  . GLU A 1 10 ? -1.598  -6.300  -10.228 1.00 0.00 ? 10 GLU A HB2  7  
ATOM 8182  H HB3  . GLU A 1 10 ? -1.305  -6.095  -8.506  1.00 0.00 ? 10 GLU A HB3  7  
ATOM 8183  H HG2  . GLU A 1 10 ? 0.681   -7.059  -8.656  1.00 0.00 ? 10 GLU A HG2  7  
ATOM 8184  H HG3  . GLU A 1 10 ? 0.001   -8.465  -9.474  1.00 0.00 ? 10 GLU A HG3  7  
ATOM 8185  N N    . VAL A 1 11 ? -1.387  -9.286  -7.321  1.00 0.00 ? 11 VAL A N    7  
ATOM 8186  C CA   . VAL A 1 11 ? -1.173  -9.811  -5.978  1.00 0.00 ? 11 VAL A CA   7  
ATOM 8187  C C    . VAL A 1 11 ? -0.184  -8.949  -5.202  1.00 0.00 ? 11 VAL A C    7  
ATOM 8188  O O    . VAL A 1 11 ? 0.313   -7.945  -5.712  1.00 0.00 ? 11 VAL A O    7  
ATOM 8189  C CB   . VAL A 1 11 ? -0.652  -11.260 -6.019  1.00 0.00 ? 11 VAL A CB   7  
ATOM 8190  C CG1  . VAL A 1 11 ? -1.700  -12.190 -6.611  1.00 0.00 ? 11 VAL A CG1  7  
ATOM 8191  C CG2  . VAL A 1 11 ? 0.647   -11.338 -6.807  1.00 0.00 ? 11 VAL A CG2  7  
ATOM 8192  H H    . VAL A 1 11 ? -0.868  -9.652  -8.066  1.00 0.00 ? 11 VAL A H    7  
ATOM 8193  H HA   . VAL A 1 11 ? -2.123  -9.807  -5.462  1.00 0.00 ? 11 VAL A HA   7  
ATOM 8194  H HB   . VAL A 1 11 ? -0.452  -11.578 -5.006  1.00 0.00 ? 11 VAL A HB   7  
ATOM 8195  H HG11 . VAL A 1 11 ? -2.292  -11.650 -7.335  1.00 0.00 ? 11 VAL A HG11 7  
ATOM 8196  H HG12 . VAL A 1 11 ? -2.341  -12.557 -5.824  1.00 0.00 ? 11 VAL A HG12 7  
ATOM 8197  H HG13 . VAL A 1 11 ? -1.211  -13.022 -7.095  1.00 0.00 ? 11 VAL A HG13 7  
ATOM 8198  H HG21 . VAL A 1 11 ? 1.159   -10.389 -6.753  1.00 0.00 ? 11 VAL A HG21 7  
ATOM 8199  H HG22 . VAL A 1 11 ? 0.429   -11.570 -7.840  1.00 0.00 ? 11 VAL A HG22 7  
ATOM 8200  H HG23 . VAL A 1 11 ? 1.276   -12.111 -6.390  1.00 0.00 ? 11 VAL A HG23 7  
ATOM 8201  N N    . GLY A 1 12 ? 0.097   -9.348  -3.965  1.00 0.00 ? 12 GLY A N    7  
ATOM 8202  C CA   . GLY A 1 12 ? 1.026   -8.599  -3.139  1.00 0.00 ? 12 GLY A CA   7  
ATOM 8203  C C    . GLY A 1 12 ? 2.371   -9.287  -3.009  1.00 0.00 ? 12 GLY A C    7  
ATOM 8204  O O    . GLY A 1 12 ? 2.628   -10.292 -3.671  1.00 0.00 ? 12 GLY A O    7  
ATOM 8205  H H    . GLY A 1 12 ? -0.329  -10.156 -3.611  1.00 0.00 ? 12 GLY A H    7  
ATOM 8206  H HA2  . GLY A 1 12 ? 1.174   -7.623  -3.576  1.00 0.00 ? 12 GLY A HA2  7  
ATOM 8207  H HA3  . GLY A 1 12 ? 0.599   -8.480  -2.154  1.00 0.00 ? 12 GLY A HA3  7  
ATOM 8208  N N    . ASP A 1 13 ? 3.231   -8.743  -2.155  1.00 0.00 ? 13 ASP A N    7  
ATOM 8209  C CA   . ASP A 1 13 ? 4.558   -9.310  -1.942  1.00 0.00 ? 13 ASP A CA   7  
ATOM 8210  C C    . ASP A 1 13 ? 4.563   -10.245 -0.736  1.00 0.00 ? 13 ASP A C    7  
ATOM 8211  O O    . ASP A 1 13 ? 3.651   -10.213 0.090   1.00 0.00 ? 13 ASP A O    7  
ATOM 8212  C CB   . ASP A 1 13 ? 5.586   -8.194  -1.741  1.00 0.00 ? 13 ASP A CB   7  
ATOM 8213  C CG   . ASP A 1 13 ? 6.991   -8.629  -2.110  1.00 0.00 ? 13 ASP A CG   7  
ATOM 8214  O OD1  . ASP A 1 13 ? 7.205   -9.016  -3.278  1.00 0.00 ? 13 ASP A OD1  7  
ATOM 8215  O OD2  . ASP A 1 13 ? 7.877   -8.584  -1.230  1.00 0.00 ? 13 ASP A OD2  7  
ATOM 8216  H H    . ASP A 1 13 ? 2.969   -7.941  -1.657  1.00 0.00 ? 13 ASP A H    7  
ATOM 8217  H HA   . ASP A 1 13 ? 4.823   -9.875  -2.822  1.00 0.00 ? 13 ASP A HA   7  
ATOM 8218  H HB2  . ASP A 1 13 ? 5.317   -7.350  -2.357  1.00 0.00 ? 13 ASP A HB2  7  
ATOM 8219  H HB3  . ASP A 1 13 ? 5.583   -7.893  -0.703  1.00 0.00 ? 13 ASP A HB3  7  
ATOM 8220  N N    . ASP A 1 14 ? 5.596   -11.076 -0.643  1.00 0.00 ? 14 ASP A N    7  
ATOM 8221  C CA   . ASP A 1 14 ? 5.720   -12.020 0.462   1.00 0.00 ? 14 ASP A CA   7  
ATOM 8222  C C    . ASP A 1 14 ? 6.661   -11.482 1.534   1.00 0.00 ? 14 ASP A C    7  
ATOM 8223  O O    . ASP A 1 14 ? 7.354   -12.246 2.206   1.00 0.00 ? 14 ASP A O    7  
ATOM 8224  C CB   . ASP A 1 14 ? 6.226   -13.370 -0.047  1.00 0.00 ? 14 ASP A CB   7  
ATOM 8225  C CG   . ASP A 1 14 ? 7.474   -13.235 -0.897  1.00 0.00 ? 14 ASP A CG   7  
ATOM 8226  O OD1  . ASP A 1 14 ? 8.223   -12.256 -0.701  1.00 0.00 ? 14 ASP A OD1  7  
ATOM 8227  O OD2  . ASP A 1 14 ? 7.703   -14.109 -1.760  1.00 0.00 ? 14 ASP A OD2  7  
ATOM 8228  H H    . ASP A 1 14 ? 6.291   -11.053 -1.333  1.00 0.00 ? 14 ASP A H    7  
ATOM 8229  H HA   . ASP A 1 14 ? 4.739   -12.153 0.895   1.00 0.00 ? 14 ASP A HA   7  
ATOM 8230  H HB2  . ASP A 1 14 ? 6.455   -14.004 0.796   1.00 0.00 ? 14 ASP A HB2  7  
ATOM 8231  H HB3  . ASP A 1 14 ? 5.455   -13.836 -0.644  1.00 0.00 ? 14 ASP A HB3  7  
ATOM 8232  N N    . PHE A 1 15 ? 6.683   -10.162 1.688   1.00 0.00 ? 15 PHE A N    7  
ATOM 8233  C CA   . PHE A 1 15 ? 7.541   -9.522  2.678   1.00 0.00 ? 15 PHE A CA   7  
ATOM 8234  C C    . PHE A 1 15 ? 6.951   -8.189  3.129   1.00 0.00 ? 15 PHE A C    7  
ATOM 8235  O O    . PHE A 1 15 ? 6.718   -7.295  2.315   1.00 0.00 ? 15 PHE A O    7  
ATOM 8236  C CB   . PHE A 1 15 ? 8.942   -9.305  2.106   1.00 0.00 ? 15 PHE A CB   7  
ATOM 8237  C CG   . PHE A 1 15 ? 10.018  -9.253  3.153   1.00 0.00 ? 15 PHE A CG   7  
ATOM 8238  C CD1  . PHE A 1 15 ? 10.143  -8.150  3.982   1.00 0.00 ? 15 PHE A CD1  7  
ATOM 8239  C CD2  . PHE A 1 15 ? 10.903  -10.308 3.307   1.00 0.00 ? 15 PHE A CD2  7  
ATOM 8240  C CE1  . PHE A 1 15 ? 11.131  -8.100  4.946   1.00 0.00 ? 15 PHE A CE1  7  
ATOM 8241  C CE2  . PHE A 1 15 ? 11.894  -10.263 4.270   1.00 0.00 ? 15 PHE A CE2  7  
ATOM 8242  C CZ   . PHE A 1 15 ? 12.008  -9.158  5.090   1.00 0.00 ? 15 PHE A CZ   7  
ATOM 8243  H H    . PHE A 1 15 ? 6.108   -9.605  1.122   1.00 0.00 ? 15 PHE A H    7  
ATOM 8244  H HA   . PHE A 1 15 ? 7.608   -10.179 3.532   1.00 0.00 ? 15 PHE A HA   7  
ATOM 8245  H HB2  . PHE A 1 15 ? 9.176   -10.114 1.429   1.00 0.00 ? 15 PHE A HB2  7  
ATOM 8246  H HB3  . PHE A 1 15 ? 8.961   -8.373  1.562   1.00 0.00 ? 15 PHE A HB3  7  
ATOM 8247  H HD1  . PHE A 1 15 ? 9.458   -7.323  3.870   1.00 0.00 ? 15 PHE A HD1  7  
ATOM 8248  H HD2  . PHE A 1 15 ? 10.815  -11.173 2.667   1.00 0.00 ? 15 PHE A HD2  7  
ATOM 8249  H HE1  . PHE A 1 15 ? 11.218  -7.234  5.586   1.00 0.00 ? 15 PHE A HE1  7  
ATOM 8250  H HE2  . PHE A 1 15 ? 12.578  -11.091 4.380   1.00 0.00 ? 15 PHE A HE2  7  
ATOM 8251  H HZ   . PHE A 1 15 ? 12.781  -9.120  5.843   1.00 0.00 ? 15 PHE A HZ   7  
ATOM 8252  N N    . LEU A 1 16 ? 6.715   -8.063  4.431   1.00 0.00 ? 16 LEU A N    7  
ATOM 8253  C CA   . LEU A 1 16 ? 6.154   -6.838  4.990   1.00 0.00 ? 16 LEU A CA   7  
ATOM 8254  C C    . LEU A 1 16 ? 7.227   -5.762  5.128   1.00 0.00 ? 16 LEU A C    7  
ATOM 8255  O O    . LEU A 1 16 ? 8.376   -6.056  5.457   1.00 0.00 ? 16 LEU A O    7  
ATOM 8256  C CB   . LEU A 1 16 ? 5.514   -7.121  6.352   1.00 0.00 ? 16 LEU A CB   7  
ATOM 8257  C CG   . LEU A 1 16 ? 3.998   -6.926  6.408   1.00 0.00 ? 16 LEU A CG   7  
ATOM 8258  C CD1  . LEU A 1 16 ? 3.400   -7.725  7.555   1.00 0.00 ? 16 LEU A CD1  7  
ATOM 8259  C CD2  . LEU A 1 16 ? 3.657   -5.450  6.548   1.00 0.00 ? 16 LEU A CD2  7  
ATOM 8260  H H    . LEU A 1 16 ? 6.923   -8.810  5.029   1.00 0.00 ? 16 LEU A H    7  
ATOM 8261  H HA   . LEU A 1 16 ? 5.392   -6.484  4.313   1.00 0.00 ? 16 LEU A HA   7  
ATOM 8262  H HB2  . LEU A 1 16 ? 5.735   -8.144  6.623   1.00 0.00 ? 16 LEU A HB2  7  
ATOM 8263  H HB3  . LEU A 1 16 ? 5.965   -6.468  7.085   1.00 0.00 ? 16 LEU A HB3  7  
ATOM 8264  H HG   . LEU A 1 16 ? 3.561   -7.286  5.488   1.00 0.00 ? 16 LEU A HG   7  
ATOM 8265  H HD11 . LEU A 1 16 ? 2.439   -8.120  7.256   1.00 0.00 ? 16 LEU A HD11 7  
ATOM 8266  H HD12 . LEU A 1 16 ? 3.272   -7.082  8.414   1.00 0.00 ? 16 LEU A HD12 7  
ATOM 8267  H HD13 . LEU A 1 16 ? 4.060   -8.540  7.810   1.00 0.00 ? 16 LEU A HD13 7  
ATOM 8268  H HD21 . LEU A 1 16 ? 2.756   -5.344  7.134   1.00 0.00 ? 16 LEU A HD21 7  
ATOM 8269  H HD22 . LEU A 1 16 ? 3.502   -5.022  5.569   1.00 0.00 ? 16 LEU A HD22 7  
ATOM 8270  H HD23 . LEU A 1 16 ? 4.470   -4.939  7.042   1.00 0.00 ? 16 LEU A HD23 7  
ATOM 8271  N N    . GLY A 1 17 ? 6.845   -4.515  4.873   1.00 0.00 ? 17 GLY A N    7  
ATOM 8272  C CA   . GLY A 1 17 ? 7.786   -3.416  4.974   1.00 0.00 ? 17 GLY A CA   7  
ATOM 8273  C C    . GLY A 1 17 ? 7.899   -2.876  6.386   1.00 0.00 ? 17 GLY A C    7  
ATOM 8274  O O    . GLY A 1 17 ? 6.968   -2.999  7.181   1.00 0.00 ? 17 GLY A O    7  
ATOM 8275  H H    . GLY A 1 17 ? 5.916   -4.340  4.615   1.00 0.00 ? 17 GLY A H    7  
ATOM 8276  H HA2  . GLY A 1 17 ? 8.759   -3.758  4.652   1.00 0.00 ? 17 GLY A HA2  7  
ATOM 8277  H HA3  . GLY A 1 17 ? 7.463   -2.618  4.321   1.00 0.00 ? 17 GLY A HA3  7  
ATOM 8278  N N    . ASP A 1 18 ? 9.043   -2.276  6.698   1.00 0.00 ? 18 ASP A N    7  
ATOM 8279  C CA   . ASP A 1 18 ? 9.275   -1.715  8.024   1.00 0.00 ? 18 ASP A CA   7  
ATOM 8280  C C    . ASP A 1 18 ? 8.605   -0.351  8.163   1.00 0.00 ? 18 ASP A C    7  
ATOM 8281  O O    . ASP A 1 18 ? 9.270   0.662   8.383   1.00 0.00 ? 18 ASP A O    7  
ATOM 8282  C CB   . ASP A 1 18 ? 10.777  -1.591  8.292   1.00 0.00 ? 18 ASP A CB   7  
ATOM 8283  C CG   . ASP A 1 18 ? 11.131  -1.867  9.739   1.00 0.00 ? 18 ASP A CG   7  
ATOM 8284  O OD1  . ASP A 1 18 ? 10.646  -1.127  10.620  1.00 0.00 ? 18 ASP A OD1  7  
ATOM 8285  O OD2  . ASP A 1 18 ? 11.894  -2.823  9.992   1.00 0.00 ? 18 ASP A OD2  7  
ATOM 8286  H H    . ASP A 1 18 ? 9.748   -2.208  6.020   1.00 0.00 ? 18 ASP A H    7  
ATOM 8287  H HA   . ASP A 1 18 ? 8.846   -2.389  8.748   1.00 0.00 ? 18 ASP A HA   7  
ATOM 8288  H HB2  . ASP A 1 18 ? 11.307  -2.298  7.670   1.00 0.00 ? 18 ASP A HB2  7  
ATOM 8289  H HB3  . ASP A 1 18 ? 11.099  -0.589  8.045   1.00 0.00 ? 18 ASP A HB3  7  
ATOM 8290  N N    . PHE A 1 19 ? 7.282   -0.333  8.033   1.00 0.00 ? 19 PHE A N    7  
ATOM 8291  C CA   . PHE A 1 19 ? 6.519   0.905   8.145   1.00 0.00 ? 19 PHE A CA   7  
ATOM 8292  C C    . PHE A 1 19 ? 5.483   0.806   9.259   1.00 0.00 ? 19 PHE A C    7  
ATOM 8293  O O    . PHE A 1 19 ? 5.284   -0.259  9.842   1.00 0.00 ? 19 PHE A O    7  
ATOM 8294  C CB   . PHE A 1 19 ? 5.830   1.226   6.818   1.00 0.00 ? 19 PHE A CB   7  
ATOM 8295  C CG   . PHE A 1 19 ? 6.752   1.168   5.633   1.00 0.00 ? 19 PHE A CG   7  
ATOM 8296  C CD1  . PHE A 1 19 ? 7.494   2.277   5.261   1.00 0.00 ? 19 PHE A CD1  7  
ATOM 8297  C CD2  . PHE A 1 19 ? 6.876   0.004   4.891   1.00 0.00 ? 19 PHE A CD2  7  
ATOM 8298  C CE1  . PHE A 1 19 ? 8.344   2.226   4.172   1.00 0.00 ? 19 PHE A CE1  7  
ATOM 8299  C CE2  . PHE A 1 19 ? 7.723   -0.053  3.801   1.00 0.00 ? 19 PHE A CE2  7  
ATOM 8300  C CZ   . PHE A 1 19 ? 8.458   1.060   3.441   1.00 0.00 ? 19 PHE A CZ   7  
ATOM 8301  H H    . PHE A 1 19 ? 6.808   -1.172  7.859   1.00 0.00 ? 19 PHE A H    7  
ATOM 8302  H HA   . PHE A 1 19 ? 7.211   1.700   8.382   1.00 0.00 ? 19 PHE A HA   7  
ATOM 8303  H HB2  . PHE A 1 19 ? 5.034   0.515   6.653   1.00 0.00 ? 19 PHE A HB2  7  
ATOM 8304  H HB3  . PHE A 1 19 ? 5.413   2.220   6.868   1.00 0.00 ? 19 PHE A HB3  7  
ATOM 8305  H HD1  . PHE A 1 19 ? 7.406   3.189   5.833   1.00 0.00 ? 19 PHE A HD1  7  
ATOM 8306  H HD2  . PHE A 1 19 ? 6.301   -0.867  5.172   1.00 0.00 ? 19 PHE A HD2  7  
ATOM 8307  H HE1  . PHE A 1 19 ? 8.916   3.098   3.893   1.00 0.00 ? 19 PHE A HE1  7  
ATOM 8308  H HE2  . PHE A 1 19 ? 7.810   -0.966  3.231   1.00 0.00 ? 19 PHE A HE2  7  
ATOM 8309  H HZ   . PHE A 1 19 ? 9.120   1.018   2.589   1.00 0.00 ? 19 PHE A HZ   7  
ATOM 8310  N N    . VAL A 1 20 ? 4.824   1.923   9.549   1.00 0.00 ? 20 VAL A N    7  
ATOM 8311  C CA   . VAL A 1 20 ? 3.808   1.962   10.593  1.00 0.00 ? 20 VAL A CA   7  
ATOM 8312  C C    . VAL A 1 20 ? 2.539   2.649   10.099  1.00 0.00 ? 20 VAL A C    7  
ATOM 8313  O O    . VAL A 1 20 ? 2.482   3.129   8.967   1.00 0.00 ? 20 VAL A O    7  
ATOM 8314  C CB   . VAL A 1 20 ? 4.318   2.694   11.848  1.00 0.00 ? 20 VAL A CB   7  
ATOM 8315  C CG1  . VAL A 1 20 ? 5.459   1.920   12.491  1.00 0.00 ? 20 VAL A CG1  7  
ATOM 8316  C CG2  . VAL A 1 20 ? 4.753   4.110   11.501  1.00 0.00 ? 20 VAL A CG2  7  
ATOM 8317  H H    . VAL A 1 20 ? 5.028   2.741   9.049   1.00 0.00 ? 20 VAL A H    7  
ATOM 8318  H HA   . VAL A 1 20 ? 3.572   0.945   10.866  1.00 0.00 ? 20 VAL A HA   7  
ATOM 8319  H HB   . VAL A 1 20 ? 3.508   2.754   12.560  1.00 0.00 ? 20 VAL A HB   7  
ATOM 8320  H HG11 . VAL A 1 20 ? 6.176   2.613   12.906  1.00 0.00 ? 20 VAL A HG11 7  
ATOM 8321  H HG12 . VAL A 1 20 ? 5.942   1.305   11.746  1.00 0.00 ? 20 VAL A HG12 7  
ATOM 8322  H HG13 . VAL A 1 20 ? 5.069   1.293   13.279  1.00 0.00 ? 20 VAL A HG13 7  
ATOM 8323  H HG21 . VAL A 1 20 ? 5.059   4.149   10.466  1.00 0.00 ? 20 VAL A HG21 7  
ATOM 8324  H HG22 . VAL A 1 20 ? 5.582   4.397   12.132  1.00 0.00 ? 20 VAL A HG22 7  
ATOM 8325  H HG23 . VAL A 1 20 ? 3.928   4.788   11.659  1.00 0.00 ? 20 VAL A HG23 7  
ATOM 8326  N N    . VAL A 1 21 ? 1.525   2.693   10.956  1.00 0.00 ? 21 VAL A N    7  
ATOM 8327  C CA   . VAL A 1 21 ? 0.257   3.322   10.608  1.00 0.00 ? 21 VAL A CA   7  
ATOM 8328  C C    . VAL A 1 21 ? 0.198   4.759   11.115  1.00 0.00 ? 21 VAL A C    7  
ATOM 8329  O O    . VAL A 1 21 ? 0.164   5.001   12.321  1.00 0.00 ? 21 VAL A O    7  
ATOM 8330  C CB   . VAL A 1 21 ? -0.936  2.538   11.183  1.00 0.00 ? 21 VAL A CB   7  
ATOM 8331  C CG1  . VAL A 1 21 ? -2.248  3.090   10.647  1.00 0.00 ? 21 VAL A CG1  7  
ATOM 8332  C CG2  . VAL A 1 21 ? -0.804  1.056   10.868  1.00 0.00 ? 21 VAL A CG2  7  
ATOM 8333  H H    . VAL A 1 21 ? 1.632   2.293   11.845  1.00 0.00 ? 21 VAL A H    7  
ATOM 8334  H HA   . VAL A 1 21 ? 0.172   3.328   9.531   1.00 0.00 ? 21 VAL A HA   7  
ATOM 8335  H HB   . VAL A 1 21 ? -0.934  2.656   12.258  1.00 0.00 ? 21 VAL A HB   7  
ATOM 8336  H HG11 . VAL A 1 21 ? -3.041  2.883   11.351  1.00 0.00 ? 21 VAL A HG11 7  
ATOM 8337  H HG12 . VAL A 1 21 ? -2.477  2.621   9.702   1.00 0.00 ? 21 VAL A HG12 7  
ATOM 8338  H HG13 . VAL A 1 21 ? -2.160  4.157   10.508  1.00 0.00 ? 21 VAL A HG13 7  
ATOM 8339  H HG21 . VAL A 1 21 ? -1.561  0.504   11.404  1.00 0.00 ? 21 VAL A HG21 7  
ATOM 8340  H HG22 . VAL A 1 21 ? 0.174   0.711   11.167  1.00 0.00 ? 21 VAL A HG22 7  
ATOM 8341  H HG23 . VAL A 1 21 ? -0.931  0.902   9.806   1.00 0.00 ? 21 VAL A HG23 7  
ATOM 8342  N N    . GLY A 1 22 ? 0.189   5.710   10.186  1.00 0.00 ? 22 GLY A N    7  
ATOM 8343  C CA   . GLY A 1 22 ? 0.136   7.111   10.559  1.00 0.00 ? 22 GLY A CA   7  
ATOM 8344  C C    . GLY A 1 22 ? 1.256   7.920   9.934   1.00 0.00 ? 22 GLY A C    7  
ATOM 8345  O O    . GLY A 1 22 ? 1.110   9.122   9.708   1.00 0.00 ? 22 GLY A O    7  
ATOM 8346  H H    . GLY A 1 22 ? 0.219   5.457   9.239   1.00 0.00 ? 22 GLY A H    7  
ATOM 8347  H HA2  . GLY A 1 22 ? -0.811  7.521   10.240  1.00 0.00 ? 22 GLY A HA2  7  
ATOM 8348  H HA3  . GLY A 1 22 ? 0.207   7.190   11.633  1.00 0.00 ? 22 GLY A HA3  7  
ATOM 8349  N N    . GLU A 1 23 ? 2.375   7.261   9.653   1.00 0.00 ? 23 GLU A N    7  
ATOM 8350  C CA   . GLU A 1 23 ? 3.523   7.928   9.050   1.00 0.00 ? 23 GLU A CA   7  
ATOM 8351  C C    . GLU A 1 23 ? 3.269   8.222   7.574   1.00 0.00 ? 23 GLU A C    7  
ATOM 8352  O O    . GLU A 1 23 ? 2.221   7.873   7.034   1.00 0.00 ? 23 GLU A O    7  
ATOM 8353  C CB   . GLU A 1 23 ? 4.777   7.066   9.202   1.00 0.00 ? 23 GLU A CB   7  
ATOM 8354  C CG   . GLU A 1 23 ? 4.689   5.732   8.479   1.00 0.00 ? 23 GLU A CG   7  
ATOM 8355  C CD   . GLU A 1 23 ? 6.037   5.049   8.351   1.00 0.00 ? 23 GLU A CD   7  
ATOM 8356  O OE1  . GLU A 1 23 ? 6.919   5.311   9.197   1.00 0.00 ? 23 GLU A OE1  7  
ATOM 8357  O OE2  . GLU A 1 23 ? 6.212   4.253   7.404   1.00 0.00 ? 23 GLU A OE2  7  
ATOM 8358  H H    . GLU A 1 23 ? 2.430   6.304   9.855   1.00 0.00 ? 23 GLU A H    7  
ATOM 8359  H HA   . GLU A 1 23 ? 3.674   8.862   9.570   1.00 0.00 ? 23 GLU A HA   7  
ATOM 8360  H HB2  . GLU A 1 23 ? 5.623   7.609   8.808   1.00 0.00 ? 23 GLU A HB2  7  
ATOM 8361  H HB3  . GLU A 1 23 ? 4.943   6.872   10.252  1.00 0.00 ? 23 GLU A HB3  7  
ATOM 8362  H HG2  . GLU A 1 23 ? 4.026   5.082   9.029   1.00 0.00 ? 23 GLU A HG2  7  
ATOM 8363  H HG3  . GLU A 1 23 ? 4.291   5.899   7.489   1.00 0.00 ? 23 GLU A HG3  7  
ATOM 8364  N N    . ARG A 1 24 ? 4.237   8.865   6.930   1.00 0.00 ? 24 ARG A N    7  
ATOM 8365  C CA   . ARG A 1 24 ? 4.117   9.206   5.517   1.00 0.00 ? 24 ARG A CA   7  
ATOM 8366  C C    . ARG A 1 24 ? 5.059   8.354   4.671   1.00 0.00 ? 24 ARG A C    7  
ATOM 8367  O O    . ARG A 1 24 ? 6.244   8.233   4.975   1.00 0.00 ? 24 ARG A O    7  
ATOM 8368  C CB   . ARG A 1 24 ? 4.421   10.690  5.301   1.00 0.00 ? 24 ARG A CB   7  
ATOM 8369  C CG   . ARG A 1 24 ? 3.448   11.619  6.008   1.00 0.00 ? 24 ARG A CG   7  
ATOM 8370  C CD   . ARG A 1 24 ? 2.188   11.837  5.186   1.00 0.00 ? 24 ARG A CD   7  
ATOM 8371  N NE   . ARG A 1 24 ? 2.274   13.039  4.360   1.00 0.00 ? 24 ARG A NE   7  
ATOM 8372  C CZ   . ARG A 1 24 ? 1.220   13.640  3.815   1.00 0.00 ? 24 ARG A CZ   7  
ATOM 8373  N NH1  . ARG A 1 24 ? -0.001  13.158  4.006   1.00 0.00 ? 24 ARG A NH1  7  
ATOM 8374  N NH2  . ARG A 1 24 ? 1.386   14.729  3.077   1.00 0.00 ? 24 ARG A NH2  7  
ATOM 8375  H H    . ARG A 1 24 ? 5.049   9.118   7.415   1.00 0.00 ? 24 ARG A H    7  
ATOM 8376  H HA   . ARG A 1 24 ? 3.101   9.008   5.212   1.00 0.00 ? 24 ARG A HA   7  
ATOM 8377  H HB2  . ARG A 1 24 ? 5.416   10.899  5.667   1.00 0.00 ? 24 ARG A HB2  7  
ATOM 8378  H HB3  . ARG A 1 24 ? 4.385   10.903  4.243   1.00 0.00 ? 24 ARG A HB3  7  
ATOM 8379  H HG2  . ARG A 1 24 ? 3.175   11.183  6.957   1.00 0.00 ? 24 ARG A HG2  7  
ATOM 8380  H HG3  . ARG A 1 24 ? 3.930   12.572  6.172   1.00 0.00 ? 24 ARG A HG3  7  
ATOM 8381  H HD2  . ARG A 1 24 ? 2.040   10.981  4.545   1.00 0.00 ? 24 ARG A HD2  7  
ATOM 8382  H HD3  . ARG A 1 24 ? 1.348   11.932  5.858   1.00 0.00 ? 24 ARG A HD3  7  
ATOM 8383  H HE   . ARG A 1 24 ? 3.165   13.417  4.203   1.00 0.00 ? 24 ARG A HE   7  
ATOM 8384  H HH11 . ARG A 1 24 ? -0.134  12.337  4.561   1.00 0.00 ? 24 ARG A HH11 7  
ATOM 8385  H HH12 . ARG A 1 24 ? -0.789  13.615  3.594   1.00 0.00 ? 24 ARG A HH12 7  
ATOM 8386  H HH21 . ARG A 1 24 ? 2.305   15.098  2.930   1.00 0.00 ? 24 ARG A HH21 7  
ATOM 8387  H HH22 . ARG A 1 24 ? 0.595   15.182  2.667   1.00 0.00 ? 24 ARG A HH22 7  
ATOM 8388  N N    . VAL A 1 25 ? 4.521   7.766   3.607   1.00 0.00 ? 25 VAL A N    7  
ATOM 8389  C CA   . VAL A 1 25 ? 5.312   6.926   2.717   1.00 0.00 ? 25 VAL A CA   7  
ATOM 8390  C C    . VAL A 1 25 ? 5.033   7.256   1.255   1.00 0.00 ? 25 VAL A C    7  
ATOM 8391  O O    . VAL A 1 25 ? 3.888   7.497   0.870   1.00 0.00 ? 25 VAL A O    7  
ATOM 8392  C CB   . VAL A 1 25 ? 5.030   5.431   2.956   1.00 0.00 ? 25 VAL A CB   7  
ATOM 8393  C CG1  . VAL A 1 25 ? 5.488   5.016   4.345   1.00 0.00 ? 25 VAL A CG1  7  
ATOM 8394  C CG2  . VAL A 1 25 ? 3.551   5.130   2.763   1.00 0.00 ? 25 VAL A CG2  7  
ATOM 8395  H H    . VAL A 1 25 ? 3.570   7.901   3.416   1.00 0.00 ? 25 VAL A H    7  
ATOM 8396  H HA   . VAL A 1 25 ? 6.357   7.111   2.924   1.00 0.00 ? 25 VAL A HA   7  
ATOM 8397  H HB   . VAL A 1 25 ? 5.590   4.859   2.231   1.00 0.00 ? 25 VAL A HB   7  
ATOM 8398  H HG11 . VAL A 1 25 ? 6.273   5.679   4.679   1.00 0.00 ? 25 VAL A HG11 7  
ATOM 8399  H HG12 . VAL A 1 25 ? 5.862   4.003   4.313   1.00 0.00 ? 25 VAL A HG12 7  
ATOM 8400  H HG13 . VAL A 1 25 ? 4.655   5.070   5.031   1.00 0.00 ? 25 VAL A HG13 7  
ATOM 8401  H HG21 . VAL A 1 25 ? 3.392   4.063   2.812   1.00 0.00 ? 25 VAL A HG21 7  
ATOM 8402  H HG22 . VAL A 1 25 ? 3.233   5.497   1.798   1.00 0.00 ? 25 VAL A HG22 7  
ATOM 8403  H HG23 . VAL A 1 25 ? 2.980   5.616   3.539   1.00 0.00 ? 25 VAL A HG23 7  
ATOM 8404  N N    . TRP A 1 26 ? 6.086   7.267   0.444   1.00 0.00 ? 26 TRP A N    7  
ATOM 8405  C CA   . TRP A 1 26 ? 5.954   7.568   -0.977  1.00 0.00 ? 26 TRP A CA   7  
ATOM 8406  C C    . TRP A 1 26 ? 5.535   6.329   -1.760  1.00 0.00 ? 26 TRP A C    7  
ATOM 8407  O O    . TRP A 1 26 ? 6.315   5.390   -1.923  1.00 0.00 ? 26 TRP A O    7  
ATOM 8408  C CB   . TRP A 1 26 ? 7.275   8.110   -1.528  1.00 0.00 ? 26 TRP A CB   7  
ATOM 8409  C CG   . TRP A 1 26 ? 7.434   9.588   -1.343  1.00 0.00 ? 26 TRP A CG   7  
ATOM 8410  C CD1  . TRP A 1 26 ? 7.462   10.539  -2.323  1.00 0.00 ? 26 TRP A CD1  7  
ATOM 8411  C CD2  . TRP A 1 26 ? 7.590   10.286  -0.103  1.00 0.00 ? 26 TRP A CD2  7  
ATOM 8412  N NE1  . TRP A 1 26 ? 7.626   11.784  -1.768  1.00 0.00 ? 26 TRP A NE1  7  
ATOM 8413  C CE2  . TRP A 1 26 ? 7.706   11.656  -0.405  1.00 0.00 ? 26 TRP A CE2  7  
ATOM 8414  C CE3  . TRP A 1 26 ? 7.641   9.886   1.237   1.00 0.00 ? 26 TRP A CE3  7  
ATOM 8415  C CZ2  . TRP A 1 26 ? 7.871   12.627  0.581   1.00 0.00 ? 26 TRP A CZ2  7  
ATOM 8416  C CZ3  . TRP A 1 26 ? 7.805   10.849  2.214   1.00 0.00 ? 26 TRP A CZ3  7  
ATOM 8417  C CH2  . TRP A 1 26 ? 7.918   12.205  1.882   1.00 0.00 ? 26 TRP A CH2  7  
ATOM 8418  H H    . TRP A 1 26 ? 6.973   7.067   0.810   1.00 0.00 ? 26 TRP A H    7  
ATOM 8419  H HA   . TRP A 1 26 ? 5.191   8.324   -1.086  1.00 0.00 ? 26 TRP A HA   7  
ATOM 8420  H HB2  . TRP A 1 26 ? 8.095   7.621   -1.025  1.00 0.00 ? 26 TRP A HB2  7  
ATOM 8421  H HB3  . TRP A 1 26 ? 7.329   7.898   -2.586  1.00 0.00 ? 26 TRP A HB3  7  
ATOM 8422  H HD1  . TRP A 1 26 ? 7.369   10.327  -3.379  1.00 0.00 ? 26 TRP A HD1  7  
ATOM 8423  H HE1  . TRP A 1 26 ? 7.676   12.628  -2.265  1.00 0.00 ? 26 TRP A HE1  7  
ATOM 8424  H HE3  . TRP A 1 26 ? 7.556   8.845   1.512   1.00 0.00 ? 26 TRP A HE3  7  
ATOM 8425  H HZ2  . TRP A 1 26 ? 7.959   13.675  0.341   1.00 0.00 ? 26 TRP A HZ2  7  
ATOM 8426  H HZ3  . TRP A 1 26 ? 7.847   10.559  3.253   1.00 0.00 ? 26 TRP A HZ3  7  
ATOM 8427  H HH2  . TRP A 1 26 ? 8.046   12.923  2.678   1.00 0.00 ? 26 TRP A HH2  7  
ATOM 8428  N N    . VAL A 1 27 ? 4.297   6.331   -2.245  1.00 0.00 ? 27 VAL A N    7  
ATOM 8429  C CA   . VAL A 1 27 ? 3.774   5.208   -3.012  1.00 0.00 ? 27 VAL A CA   7  
ATOM 8430  C C    . VAL A 1 27 ? 4.339   5.200   -4.428  1.00 0.00 ? 27 VAL A C    7  
ATOM 8431  O O    . VAL A 1 27 ? 4.050   6.091   -5.227  1.00 0.00 ? 27 VAL A O    7  
ATOM 8432  C CB   . VAL A 1 27 ? 2.236   5.243   -3.086  1.00 0.00 ? 27 VAL A CB   7  
ATOM 8433  C CG1  . VAL A 1 27 ? 1.701   3.965   -3.713  1.00 0.00 ? 27 VAL A CG1  7  
ATOM 8434  C CG2  . VAL A 1 27 ? 1.640   5.457   -1.702  1.00 0.00 ? 27 VAL A CG2  7  
ATOM 8435  H H    . VAL A 1 27 ? 3.722   7.108   -2.082  1.00 0.00 ? 27 VAL A H    7  
ATOM 8436  H HA   . VAL A 1 27 ? 4.069   4.296   -2.512  1.00 0.00 ? 27 VAL A HA   7  
ATOM 8437  H HB   . VAL A 1 27 ? 1.945   6.075   -3.712  1.00 0.00 ? 27 VAL A HB   7  
ATOM 8438  H HG11 . VAL A 1 27 ? 0.629   3.922   -3.583  1.00 0.00 ? 27 VAL A HG11 7  
ATOM 8439  H HG12 . VAL A 1 27 ? 2.156   3.112   -3.235  1.00 0.00 ? 27 VAL A HG12 7  
ATOM 8440  H HG13 . VAL A 1 27 ? 1.936   3.957   -4.767  1.00 0.00 ? 27 VAL A HG13 7  
ATOM 8441  H HG21 . VAL A 1 27 ? 2.168   4.846   -0.984  1.00 0.00 ? 27 VAL A HG21 7  
ATOM 8442  H HG22 . VAL A 1 27 ? 0.596   5.179   -1.714  1.00 0.00 ? 27 VAL A HG22 7  
ATOM 8443  H HG23 . VAL A 1 27 ? 1.732   6.497   -1.427  1.00 0.00 ? 27 VAL A HG23 7  
ATOM 8444  N N    . ASN A 1 28 ? 5.145   4.189   -4.733  1.00 0.00 ? 28 ASN A N    7  
ATOM 8445  C CA   . ASN A 1 28 ? 5.751   4.066   -6.054  1.00 0.00 ? 28 ASN A CA   7  
ATOM 8446  C C    . ASN A 1 28 ? 6.624   5.277   -6.369  1.00 0.00 ? 28 ASN A C    7  
ATOM 8447  O O    . ASN A 1 28 ? 6.787   5.651   -7.531  1.00 0.00 ? 28 ASN A O    7  
ATOM 8448  C CB   . ASN A 1 28 ? 4.666   3.908   -7.123  1.00 0.00 ? 28 ASN A CB   7  
ATOM 8449  C CG   . ASN A 1 28 ? 4.469   2.463   -7.536  1.00 0.00 ? 28 ASN A CG   7  
ATOM 8450  O OD1  . ASN A 1 28 ? 4.015   1.635   -6.746  1.00 0.00 ? 28 ASN A OD1  7  
ATOM 8451  N ND2  . ASN A 1 28 ? 4.808   2.153   -8.783  1.00 0.00 ? 28 ASN A ND2  7  
ATOM 8452  H H    . ASN A 1 28 ? 5.338   3.509   -4.054  1.00 0.00 ? 28 ASN A H    7  
ATOM 8453  H HA   . ASN A 1 28 ? 6.372   3.182   -6.052  1.00 0.00 ? 28 ASN A HA   7  
ATOM 8454  H HB2  . ASN A 1 28 ? 3.731   4.282   -6.735  1.00 0.00 ? 28 ASN A HB2  7  
ATOM 8455  H HB3  . ASN A 1 28 ? 4.942   4.480   -7.997  1.00 0.00 ? 28 ASN A HB3  7  
ATOM 8456  H HD21 . ASN A 1 28 ? 5.163   2.864   -9.356  1.00 0.00 ? 28 ASN A HD21 7  
ATOM 8457  H HD22 . ASN A 1 28 ? 4.690   1.226   -9.077  1.00 0.00 ? 28 ASN A HD22 7  
ATOM 8458  N N    . GLY A 1 29 ? 7.182   5.886   -5.328  1.00 0.00 ? 29 GLY A N    7  
ATOM 8459  C CA   . GLY A 1 29 ? 8.030   7.049   -5.516  1.00 0.00 ? 29 GLY A CA   7  
ATOM 8460  C C    . GLY A 1 29 ? 7.318   8.180   -6.233  1.00 0.00 ? 29 GLY A C    7  
ATOM 8461  O O    . GLY A 1 29 ? 7.949   8.985   -6.917  1.00 0.00 ? 29 GLY A O    7  
ATOM 8462  H H    . GLY A 1 29 ? 7.017   5.544   -4.425  1.00 0.00 ? 29 GLY A H    7  
ATOM 8463  H HA2  . GLY A 1 29 ? 8.359   7.401   -4.550  1.00 0.00 ? 29 GLY A HA2  7  
ATOM 8464  H HA3  . GLY A 1 29 ? 8.895   6.760   -6.094  1.00 0.00 ? 29 GLY A HA3  7  
ATOM 8465  N N    . VAL A 1 30 ? 5.999   8.240   -6.075  1.00 0.00 ? 30 VAL A N    7  
ATOM 8466  C CA   . VAL A 1 30 ? 5.201   9.279   -6.712  1.00 0.00 ? 30 VAL A CA   7  
ATOM 8467  C C    . VAL A 1 30 ? 4.851   10.387  -5.725  1.00 0.00 ? 30 VAL A C    7  
ATOM 8468  O O    . VAL A 1 30 ? 5.283   11.530  -5.880  1.00 0.00 ? 30 VAL A O    7  
ATOM 8469  C CB   . VAL A 1 30 ? 3.899   8.706   -7.303  1.00 0.00 ? 30 VAL A CB   7  
ATOM 8470  C CG1  . VAL A 1 30 ? 3.179   9.757   -8.133  1.00 0.00 ? 30 VAL A CG1  7  
ATOM 8471  C CG2  . VAL A 1 30 ? 4.191   7.467   -8.136  1.00 0.00 ? 30 VAL A CG2  7  
ATOM 8472  H H    . VAL A 1 30 ? 5.554   7.569   -5.517  1.00 0.00 ? 30 VAL A H    7  
ATOM 8473  H HA   . VAL A 1 30 ? 5.783   9.700   -7.519  1.00 0.00 ? 30 VAL A HA   7  
ATOM 8474  H HB   . VAL A 1 30 ? 3.253   8.420   -6.486  1.00 0.00 ? 30 VAL A HB   7  
ATOM 8475  H HG11 . VAL A 1 30 ? 3.399   9.604   -9.179  1.00 0.00 ? 30 VAL A HG11 7  
ATOM 8476  H HG12 . VAL A 1 30 ? 3.512   10.741  -7.836  1.00 0.00 ? 30 VAL A HG12 7  
ATOM 8477  H HG13 . VAL A 1 30 ? 2.114   9.674   -7.973  1.00 0.00 ? 30 VAL A HG13 7  
ATOM 8478  H HG21 . VAL A 1 30 ? 3.389   7.308   -8.841  1.00 0.00 ? 30 VAL A HG21 7  
ATOM 8479  H HG22 . VAL A 1 30 ? 4.275   6.608   -7.486  1.00 0.00 ? 30 VAL A HG22 7  
ATOM 8480  H HG23 . VAL A 1 30 ? 5.119   7.604   -8.672  1.00 0.00 ? 30 VAL A HG23 7  
ATOM 8481  N N    . LYS A 1 31 ? 4.067   10.042  -4.710  1.00 0.00 ? 31 LYS A N    7  
ATOM 8482  C CA   . LYS A 1 31 ? 3.660   11.007  -3.695  1.00 0.00 ? 31 LYS A CA   7  
ATOM 8483  C C    . LYS A 1 31 ? 3.491   10.331  -2.336  1.00 0.00 ? 31 LYS A C    7  
ATOM 8484  O O    . LYS A 1 31 ? 3.166   9.147   -2.259  1.00 0.00 ? 31 LYS A O    7  
ATOM 8485  C CB   . LYS A 1 31 ? 2.351   11.687  -4.105  1.00 0.00 ? 31 LYS A CB   7  
ATOM 8486  C CG   . LYS A 1 31 ? 2.504   12.644  -5.275  1.00 0.00 ? 31 LYS A CG   7  
ATOM 8487  C CD   . LYS A 1 31 ? 1.159   12.975  -5.903  1.00 0.00 ? 31 LYS A CD   7  
ATOM 8488  C CE   . LYS A 1 31 ? 0.256   13.716  -4.931  1.00 0.00 ? 31 LYS A CE   7  
ATOM 8489  N NZ   . LYS A 1 31 ? 0.156   15.165  -5.260  1.00 0.00 ? 31 LYS A NZ   7  
ATOM 8490  H H    . LYS A 1 31 ? 3.755   9.115   -4.640  1.00 0.00 ? 31 LYS A H    7  
ATOM 8491  H HA   . LYS A 1 31 ? 4.435   11.755  -3.619  1.00 0.00 ? 31 LYS A HA   7  
ATOM 8492  H HB2  . LYS A 1 31 ? 1.635   10.927  -4.380  1.00 0.00 ? 31 LYS A HB2  7  
ATOM 8493  H HB3  . LYS A 1 31 ? 1.967   12.242  -3.262  1.00 0.00 ? 31 LYS A HB3  7  
ATOM 8494  H HG2  . LYS A 1 31 ? 2.959   13.558  -4.924  1.00 0.00 ? 31 LYS A HG2  7  
ATOM 8495  H HG3  . LYS A 1 31 ? 3.137   12.187  -6.021  1.00 0.00 ? 31 LYS A HG3  7  
ATOM 8496  H HD2  . LYS A 1 31 ? 1.321   13.594  -6.772  1.00 0.00 ? 31 LYS A HD2  7  
ATOM 8497  H HD3  . LYS A 1 31 ? 0.676   12.055  -6.200  1.00 0.00 ? 31 LYS A HD3  7  
ATOM 8498  H HE2  . LYS A 1 31 ? -0.732  13.279  -4.972  1.00 0.00 ? 31 LYS A HE2  7  
ATOM 8499  H HE3  . LYS A 1 31 ? 0.655   13.609  -3.933  1.00 0.00 ? 31 LYS A HE3  7  
ATOM 8500  H HZ1  . LYS A 1 31 ? 0.112   15.727  -4.386  1.00 0.00 ? 31 LYS A HZ1  7  
ATOM 8501  H HZ2  . LYS A 1 31 ? -0.700  15.348  -5.819  1.00 0.00 ? 31 LYS A HZ2  7  
ATOM 8502  H HZ3  . LYS A 1 31 ? 0.987   15.464  -5.811  1.00 0.00 ? 31 LYS A HZ3  7  
ATOM 8503  N N    . PRO A 1 32 ? 3.712   11.080  -1.242  1.00 0.00 ? 32 PRO A N    7  
ATOM 8504  C CA   . PRO A 1 32 ? 3.583   10.546  0.118   1.00 0.00 ? 32 PRO A CA   7  
ATOM 8505  C C    . PRO A 1 32 ? 2.132   10.267  0.494   1.00 0.00 ? 32 PRO A C    7  
ATOM 8506  O O    . PRO A 1 32 ? 1.208   10.823  -0.099  1.00 0.00 ? 32 PRO A O    7  
ATOM 8507  C CB   . PRO A 1 32 ? 4.157   11.662  0.994   1.00 0.00 ? 32 PRO A CB   7  
ATOM 8508  C CG   . PRO A 1 32 ? 3.960   12.906  0.198   1.00 0.00 ? 32 PRO A CG   7  
ATOM 8509  C CD   . PRO A 1 32 ? 4.104   12.502  -1.244  1.00 0.00 ? 32 PRO A CD   7  
ATOM 8510  H HA   . PRO A 1 32 ? 4.167   9.647   0.247   1.00 0.00 ? 32 PRO A HA   7  
ATOM 8511  H HB2  . PRO A 1 32 ? 3.617   11.703  1.930   1.00 0.00 ? 32 PRO A HB2  7  
ATOM 8512  H HB3  . PRO A 1 32 ? 5.205   11.475  1.180   1.00 0.00 ? 32 PRO A HB3  7  
ATOM 8513  H HG2  . PRO A 1 32 ? 2.974   13.305  0.379   1.00 0.00 ? 32 PRO A HG2  7  
ATOM 8514  H HG3  . PRO A 1 32 ? 4.714   13.633  0.460   1.00 0.00 ? 32 PRO A HG3  7  
ATOM 8515  H HD2  . PRO A 1 32 ? 3.441   13.084  -1.867  1.00 0.00 ? 32 PRO A HD2  7  
ATOM 8516  H HD3  . PRO A 1 32 ? 5.128   12.619  -1.568  1.00 0.00 ? 32 PRO A HD3  7  
ATOM 8517  N N    . GLY A 1 33 ? 1.939   9.400   1.484   1.00 0.00 ? 33 GLY A N    7  
ATOM 8518  C CA   . GLY A 1 33 ? 0.598   9.062   1.921   1.00 0.00 ? 33 GLY A CA   7  
ATOM 8519  C C    . GLY A 1 33 ? 0.563   8.564   3.352   1.00 0.00 ? 33 GLY A C    7  
ATOM 8520  O O    . GLY A 1 33 ? 1.565   8.069   3.869   1.00 0.00 ? 33 GLY A O    7  
ATOM 8521  H H    . GLY A 1 33 ? 2.713   8.988   1.920   1.00 0.00 ? 33 GLY A H    7  
ATOM 8522  H HA2  . GLY A 1 33 ? -0.026  9.940   1.842   1.00 0.00 ? 33 GLY A HA2  7  
ATOM 8523  H HA3  . GLY A 1 33 ? 0.203   8.293   1.274   1.00 0.00 ? 33 GLY A HA3  7  
ATOM 8524  N N    . VAL A 1 34 ? -0.594  8.695   3.994   1.00 0.00 ? 34 VAL A N    7  
ATOM 8525  C CA   . VAL A 1 34 ? -0.755  8.254   5.374   1.00 0.00 ? 34 VAL A CA   7  
ATOM 8526  C C    . VAL A 1 34 ? -1.199  6.797   5.437   1.00 0.00 ? 34 VAL A C    7  
ATOM 8527  O O    . VAL A 1 34 ? -2.320  6.462   5.054   1.00 0.00 ? 34 VAL A O    7  
ATOM 8528  C CB   . VAL A 1 34 ? -1.781  9.123   6.125   1.00 0.00 ? 34 VAL A CB   7  
ATOM 8529  C CG1  . VAL A 1 34 ? -1.789  8.780   7.607   1.00 0.00 ? 34 VAL A CG1  7  
ATOM 8530  C CG2  . VAL A 1 34 ? -1.486  10.600  5.914   1.00 0.00 ? 34 VAL A CG2  7  
ATOM 8531  H H    . VAL A 1 34 ? -1.356  9.097   3.529   1.00 0.00 ? 34 VAL A H    7  
ATOM 8532  H HA   . VAL A 1 34 ? 0.200   8.351   5.870   1.00 0.00 ? 34 VAL A HA   7  
ATOM 8533  H HB   . VAL A 1 34 ? -2.762  8.913   5.726   1.00 0.00 ? 34 VAL A HB   7  
ATOM 8534  H HG11 . VAL A 1 34 ? -0.775  8.755   7.977   1.00 0.00 ? 34 VAL A HG11 7  
ATOM 8535  H HG12 . VAL A 1 34 ? -2.248  7.813   7.750   1.00 0.00 ? 34 VAL A HG12 7  
ATOM 8536  H HG13 . VAL A 1 34 ? -2.351  9.528   8.147   1.00 0.00 ? 34 VAL A HG13 7  
ATOM 8537  H HG21 . VAL A 1 34 ? -1.832  11.163  6.769   1.00 0.00 ? 34 VAL A HG21 7  
ATOM 8538  H HG22 . VAL A 1 34 ? -1.994  10.946  5.027   1.00 0.00 ? 34 VAL A HG22 7  
ATOM 8539  H HG23 . VAL A 1 34 ? -0.421  10.741  5.798   1.00 0.00 ? 34 VAL A HG23 7  
ATOM 8540  N N    . VAL A 1 35 ? -0.313  5.933   5.923   1.00 0.00 ? 35 VAL A N    7  
ATOM 8541  C CA   . VAL A 1 35 ? -0.613  4.512   6.036   1.00 0.00 ? 35 VAL A CA   7  
ATOM 8542  C C    . VAL A 1 35 ? -1.713  4.261   7.063   1.00 0.00 ? 35 VAL A C    7  
ATOM 8543  O O    . VAL A 1 35 ? -1.664  4.782   8.178   1.00 0.00 ? 35 VAL A O    7  
ATOM 8544  C CB   . VAL A 1 35 ? 0.637   3.703   6.432   1.00 0.00 ? 35 VAL A CB   7  
ATOM 8545  C CG1  . VAL A 1 35 ? 0.356   2.211   6.355   1.00 0.00 ? 35 VAL A CG1  7  
ATOM 8546  C CG2  . VAL A 1 35 ? 1.817   4.079   5.549   1.00 0.00 ? 35 VAL A CG2  7  
ATOM 8547  H H    . VAL A 1 35 ? 0.565   6.261   6.214   1.00 0.00 ? 35 VAL A H    7  
ATOM 8548  H HA   . VAL A 1 35 ? -0.950  4.164   5.071   1.00 0.00 ? 35 VAL A HA   7  
ATOM 8549  H HB   . VAL A 1 35 ? 0.888   3.946   7.454   1.00 0.00 ? 35 VAL A HB   7  
ATOM 8550  H HG11 . VAL A 1 35 ? 1.264   1.663   6.561   1.00 0.00 ? 35 VAL A HG11 7  
ATOM 8551  H HG12 . VAL A 1 35 ? 0.002   1.961   5.365   1.00 0.00 ? 35 VAL A HG12 7  
ATOM 8552  H HG13 . VAL A 1 35 ? -0.397  1.948   7.083   1.00 0.00 ? 35 VAL A HG13 7  
ATOM 8553  H HG21 . VAL A 1 35 ? 2.220   5.029   5.869   1.00 0.00 ? 35 VAL A HG21 7  
ATOM 8554  H HG22 . VAL A 1 35 ? 1.488   4.154   4.522   1.00 0.00 ? 35 VAL A HG22 7  
ATOM 8555  H HG23 . VAL A 1 35 ? 2.581   3.319   5.627   1.00 0.00 ? 35 VAL A HG23 7  
ATOM 8556  N N    . GLN A 1 36 ? -2.703  3.462   6.680   1.00 0.00 ? 36 GLN A N    7  
ATOM 8557  C CA   . GLN A 1 36 ? -3.815  3.143   7.568   1.00 0.00 ? 36 GLN A CA   7  
ATOM 8558  C C    . GLN A 1 36 ? -3.861  1.648   7.866   1.00 0.00 ? 36 GLN A C    7  
ATOM 8559  O O    . GLN A 1 36 ? -4.105  1.238   9.001   1.00 0.00 ? 36 GLN A O    7  
ATOM 8560  C CB   . GLN A 1 36 ? -5.139  3.591   6.944   1.00 0.00 ? 36 GLN A CB   7  
ATOM 8561  C CG   . GLN A 1 36 ? -5.583  4.976   7.386   1.00 0.00 ? 36 GLN A CG   7  
ATOM 8562  C CD   . GLN A 1 36 ? -6.066  5.001   8.824   1.00 0.00 ? 36 GLN A CD   7  
ATOM 8563  O OE1  . GLN A 1 36 ? -7.253  4.820   9.094   1.00 0.00 ? 36 GLN A OE1  7  
ATOM 8564  N NE2  . GLN A 1 36 ? -5.146  5.225   9.755   1.00 0.00 ? 36 GLN A NE2  7  
ATOM 8565  H H    . GLN A 1 36 ? -2.686  3.078   5.778   1.00 0.00 ? 36 GLN A H    7  
ATOM 8566  H HA   . GLN A 1 36 ? -3.666  3.678   8.494   1.00 0.00 ? 36 GLN A HA   7  
ATOM 8567  H HB2  . GLN A 1 36 ? -5.032  3.598   5.869   1.00 0.00 ? 36 GLN A HB2  7  
ATOM 8568  H HB3  . GLN A 1 36 ? -5.910  2.886   7.216   1.00 0.00 ? 36 GLN A HB3  7  
ATOM 8569  H HG2  . GLN A 1 36 ? -4.748  5.654   7.293   1.00 0.00 ? 36 GLN A HG2  7  
ATOM 8570  H HG3  . GLN A 1 36 ? -6.387  5.304   6.745   1.00 0.00 ? 36 GLN A HG3  7  
ATOM 8571  H HE21 . GLN A 1 36 ? -4.219  5.361   9.466   1.00 0.00 ? 36 GLN A HE21 7  
ATOM 8572  H HE22 . GLN A 1 36 ? -5.431  5.247   10.692  1.00 0.00 ? 36 GLN A HE22 7  
ATOM 8573  N N    . TYR A 1 37 ? -3.624  0.837   6.840   1.00 0.00 ? 37 TYR A N    7  
ATOM 8574  C CA   . TYR A 1 37 ? -3.637  -0.613  6.991   1.00 0.00 ? 37 TYR A CA   7  
ATOM 8575  C C    . TYR A 1 37 ? -2.315  -1.221  6.536   1.00 0.00 ? 37 TYR A C    7  
ATOM 8576  O O    . TYR A 1 37 ? -1.696  -0.741  5.586   1.00 0.00 ? 37 TYR A O    7  
ATOM 8577  C CB   . TYR A 1 37 ? -4.792  -1.220  6.193   1.00 0.00 ? 37 TYR A CB   7  
ATOM 8578  C CG   . TYR A 1 37 ? -5.242  -2.569  6.708   1.00 0.00 ? 37 TYR A CG   7  
ATOM 8579  C CD1  . TYR A 1 37 ? -6.109  -2.666  7.789   1.00 0.00 ? 37 TYR A CD1  7  
ATOM 8580  C CD2  . TYR A 1 37 ? -4.801  -3.743  6.112   1.00 0.00 ? 37 TYR A CD2  7  
ATOM 8581  C CE1  . TYR A 1 37 ? -6.521  -3.897  8.264   1.00 0.00 ? 37 TYR A CE1  7  
ATOM 8582  C CE2  . TYR A 1 37 ? -5.210  -4.978  6.580   1.00 0.00 ? 37 TYR A CE2  7  
ATOM 8583  C CZ   . TYR A 1 37 ? -6.070  -5.049  7.655   1.00 0.00 ? 37 TYR A CZ   7  
ATOM 8584  O OH   . TYR A 1 37 ? -6.478  -6.277  8.124   1.00 0.00 ? 37 TYR A OH   7  
ATOM 8585  H H    . TYR A 1 37 ? -3.437  1.224   5.959   1.00 0.00 ? 37 TYR A H    7  
ATOM 8586  H HA   . TYR A 1 37 ? -3.780  -0.836  8.039   1.00 0.00 ? 37 TYR A HA   7  
ATOM 8587  H HB2  . TYR A 1 37 ? -5.639  -0.551  6.233   1.00 0.00 ? 37 TYR A HB2  7  
ATOM 8588  H HB3  . TYR A 1 37 ? -4.484  -1.342  5.165   1.00 0.00 ? 37 TYR A HB3  7  
ATOM 8589  H HD1  . TYR A 1 37 ? -6.461  -1.762  8.264   1.00 0.00 ? 37 TYR A HD1  7  
ATOM 8590  H HD2  . TYR A 1 37 ? -4.127  -3.684  5.271   1.00 0.00 ? 37 TYR A HD2  7  
ATOM 8591  H HE1  . TYR A 1 37 ? -7.196  -3.954  9.105   1.00 0.00 ? 37 TYR A HE1  7  
ATOM 8592  H HE2  . TYR A 1 37 ? -4.855  -5.880  6.104   1.00 0.00 ? 37 TYR A HE2  7  
ATOM 8593  H HH   . TYR A 1 37 ? -5.725  -6.870  8.169   1.00 0.00 ? 37 TYR A HH   7  
ATOM 8594  N N    . LEU A 1 38 ? -1.888  -2.277  7.218   1.00 0.00 ? 38 LEU A N    7  
ATOM 8595  C CA   . LEU A 1 38 ? -0.639  -2.949  6.884   1.00 0.00 ? 38 LEU A CA   7  
ATOM 8596  C C    . LEU A 1 38 ? -0.743  -4.450  7.137   1.00 0.00 ? 38 LEU A C    7  
ATOM 8597  O O    . LEU A 1 38 ? -0.624  -4.907  8.273   1.00 0.00 ? 38 LEU A O    7  
ATOM 8598  C CB   . LEU A 1 38 ? 0.515   -2.362  7.699   1.00 0.00 ? 38 LEU A CB   7  
ATOM 8599  C CG   . LEU A 1 38 ? 1.066   -1.034  7.175   1.00 0.00 ? 38 LEU A CG   7  
ATOM 8600  C CD1  . LEU A 1 38 ? 1.458   -0.125  8.330   1.00 0.00 ? 38 LEU A CD1  7  
ATOM 8601  C CD2  . LEU A 1 38 ? 2.256   -1.277  6.258   1.00 0.00 ? 38 LEU A CD2  7  
ATOM 8602  H H    . LEU A 1 38 ? -2.426  -2.613  7.966   1.00 0.00 ? 38 LEU A H    7  
ATOM 8603  H HA   . LEU A 1 38 ? -0.445  -2.787  5.834   1.00 0.00 ? 38 LEU A HA   7  
ATOM 8604  H HB2  . LEU A 1 38 ? 0.172   -2.212  8.712   1.00 0.00 ? 38 LEU A HB2  7  
ATOM 8605  H HB3  . LEU A 1 38 ? 1.322   -3.080  7.712   1.00 0.00 ? 38 LEU A HB3  7  
ATOM 8606  H HG   . LEU A 1 38 ? 0.298   -0.534  6.603   1.00 0.00 ? 38 LEU A HG   7  
ATOM 8607  H HD11 . LEU A 1 38 ? 1.706   -0.725  9.192   1.00 0.00 ? 38 LEU A HD11 7  
ATOM 8608  H HD12 . LEU A 1 38 ? 0.632   0.527   8.570   1.00 0.00 ? 38 LEU A HD12 7  
ATOM 8609  H HD13 . LEU A 1 38 ? 2.315   0.469   8.045   1.00 0.00 ? 38 LEU A HD13 7  
ATOM 8610  H HD21 . LEU A 1 38 ? 2.705   -0.331  5.993   1.00 0.00 ? 38 LEU A HD21 7  
ATOM 8611  H HD22 . LEU A 1 38 ? 1.923   -1.781  5.363   1.00 0.00 ? 38 LEU A HD22 7  
ATOM 8612  H HD23 . LEU A 1 38 ? 2.984   -1.891  6.767   1.00 0.00 ? 38 LEU A HD23 7  
ATOM 8613  N N    . GLY A 1 39 ? -0.967  -5.211  6.071   1.00 0.00 ? 39 GLY A N    7  
ATOM 8614  C CA   . GLY A 1 39 ? -1.084  -6.652  6.199   1.00 0.00 ? 39 GLY A CA   7  
ATOM 8615  C C    . GLY A 1 39 ? -1.741  -7.290  4.991   1.00 0.00 ? 39 GLY A C    7  
ATOM 8616  O O    . GLY A 1 39 ? -1.887  -6.654  3.947   1.00 0.00 ? 39 GLY A O    7  
ATOM 8617  H H    . GLY A 1 39 ? -1.054  -4.791  5.190   1.00 0.00 ? 39 GLY A H    7  
ATOM 8618  H HA2  . GLY A 1 39 ? -0.097  -7.072  6.323   1.00 0.00 ? 39 GLY A HA2  7  
ATOM 8619  H HA3  . GLY A 1 39 ? -1.673  -6.877  7.076   1.00 0.00 ? 39 GLY A HA3  7  
ATOM 8620  N N    . GLU A 1 40 ? -2.137  -8.551  5.132   1.00 0.00 ? 40 GLU A N    7  
ATOM 8621  C CA   . GLU A 1 40 ? -2.782  -9.276  4.043   1.00 0.00 ? 40 GLU A CA   7  
ATOM 8622  C C    . GLU A 1 40 ? -4.116  -8.635  3.677   1.00 0.00 ? 40 GLU A C    7  
ATOM 8623  O O    . GLU A 1 40 ? -4.694  -7.886  4.464   1.00 0.00 ? 40 GLU A O    7  
ATOM 8624  C CB   . GLU A 1 40 ? -2.997  -10.740 4.435   1.00 0.00 ? 40 GLU A CB   7  
ATOM 8625  C CG   . GLU A 1 40 ? -1.712  -11.472 4.784   1.00 0.00 ? 40 GLU A CG   7  
ATOM 8626  C CD   . GLU A 1 40 ? -1.953  -12.691 5.652   1.00 0.00 ? 40 GLU A CD   7  
ATOM 8627  O OE1  . GLU A 1 40 ? -3.095  -13.199 5.659   1.00 0.00 ? 40 GLU A OE1  7  
ATOM 8628  O OE2  . GLU A 1 40 ? -1.001  -13.139 6.324   1.00 0.00 ? 40 GLU A OE2  7  
ATOM 8629  H H    . GLU A 1 40 ? -1.993  -9.004  5.989   1.00 0.00 ? 40 GLU A H    7  
ATOM 8630  H HA   . GLU A 1 40 ? -2.128  -9.235  3.185   1.00 0.00 ? 40 GLU A HA   7  
ATOM 8631  H HB2  . GLU A 1 40 ? -3.652  -10.778 5.292   1.00 0.00 ? 40 GLU A HB2  7  
ATOM 8632  H HB3  . GLU A 1 40 ? -3.467  -11.255 3.611   1.00 0.00 ? 40 GLU A HB3  7  
ATOM 8633  H HG2  . GLU A 1 40 ? -1.233  -11.788 3.870   1.00 0.00 ? 40 GLU A HG2  7  
ATOM 8634  H HG3  . GLU A 1 40 ? -1.059  -10.793 5.315   1.00 0.00 ? 40 GLU A HG3  7  
ATOM 8635  N N    . THR A 1 41 ? -4.600  -8.934  2.475   1.00 0.00 ? 41 THR A N    7  
ATOM 8636  C CA   . THR A 1 41 ? -5.867  -8.388  2.004   1.00 0.00 ? 41 THR A CA   7  
ATOM 8637  C C    . THR A 1 41 ? -6.830  -9.505  1.614   1.00 0.00 ? 41 THR A C    7  
ATOM 8638  O O    . THR A 1 41 ? -6.498  -10.685 1.712   1.00 0.00 ? 41 THR A O    7  
ATOM 8639  C CB   . THR A 1 41 ? -5.634  -7.460  0.810   1.00 0.00 ? 41 THR A CB   7  
ATOM 8640  O OG1  . THR A 1 41 ? -4.761  -8.061  -0.130  1.00 0.00 ? 41 THR A OG1  7  
ATOM 8641  C CG2  . THR A 1 41 ? -5.042  -6.123  1.198   1.00 0.00 ? 41 THR A CG2  7  
ATOM 8642  H H    . THR A 1 41 ? -4.094  -9.538  1.892   1.00 0.00 ? 41 THR A H    7  
ATOM 8643  H HA   . THR A 1 41 ? -6.303  -7.818  2.810   1.00 0.00 ? 41 THR A HA   7  
ATOM 8644  H HB   . THR A 1 41 ? -6.580  -7.273  0.322   1.00 0.00 ? 41 THR A HB   7  
ATOM 8645  H HG1  . THR A 1 41 ? -4.989  -7.764  -1.014  1.00 0.00 ? 41 THR A HG1  7  
ATOM 8646  H HG21 . THR A 1 41 ? -5.823  -5.477  1.572   1.00 0.00 ? 41 THR A HG21 7  
ATOM 8647  H HG22 . THR A 1 41 ? -4.581  -5.668  0.334   1.00 0.00 ? 41 THR A HG22 7  
ATOM 8648  H HG23 . THR A 1 41 ? -4.297  -6.269  1.967   1.00 0.00 ? 41 THR A HG23 7  
ATOM 8649  N N    . GLN A 1 42 ? -8.024  -9.123  1.172   1.00 0.00 ? 42 GLN A N    7  
ATOM 8650  C CA   . GLN A 1 42 ? -9.035  -10.093 0.769   1.00 0.00 ? 42 GLN A CA   7  
ATOM 8651  C C    . GLN A 1 42 ? -9.173  -10.136 -0.749  1.00 0.00 ? 42 GLN A C    7  
ATOM 8652  O O    . GLN A 1 42 ? -9.474  -11.182 -1.326  1.00 0.00 ? 42 GLN A O    7  
ATOM 8653  C CB   . GLN A 1 42 ? -10.383 -9.750  1.405   1.00 0.00 ? 42 GLN A CB   7  
ATOM 8654  C CG   . GLN A 1 42 ? -10.373 -9.815  2.924   1.00 0.00 ? 42 GLN A CG   7  
ATOM 8655  C CD   . GLN A 1 42 ? -10.085 -11.209 3.446   1.00 0.00 ? 42 GLN A CD   7  
ATOM 8656  O OE1  . GLN A 1 42 ? -10.673 -12.189 2.988   1.00 0.00 ? 42 GLN A OE1  7  
ATOM 8657  N NE2  . GLN A 1 42 ? -9.176  -11.305 4.408   1.00 0.00 ? 42 GLN A NE2  7  
ATOM 8658  H H    . GLN A 1 42 ? -8.229  -8.166  1.117   1.00 0.00 ? 42 GLN A H    7  
ATOM 8659  H HA   . GLN A 1 42 ? -8.719  -11.065 1.118   1.00 0.00 ? 42 GLN A HA   7  
ATOM 8660  H HB2  . GLN A 1 42 ? -10.662 -8.749  1.111   1.00 0.00 ? 42 GLN A HB2  7  
ATOM 8661  H HB3  . GLN A 1 42 ? -11.126 -10.444 1.042   1.00 0.00 ? 42 GLN A HB3  7  
ATOM 8662  H HG2  . GLN A 1 42 ? -9.610  -9.145  3.295   1.00 0.00 ? 42 GLN A HG2  7  
ATOM 8663  H HG3  . GLN A 1 42 ? -11.337 -9.500  3.292   1.00 0.00 ? 42 GLN A HG3  7  
ATOM 8664  H HE21 . GLN A 1 42 ? -8.747  -10.483 4.725   1.00 0.00 ? 42 GLN A HE21 7  
ATOM 8665  H HE22 . GLN A 1 42 ? -8.971  -12.195 4.764   1.00 0.00 ? 42 GLN A HE22 7  
ATOM 8666  N N    . PHE A 1 43 ? -8.951  -8.994  -1.392  1.00 0.00 ? 43 PHE A N    7  
ATOM 8667  C CA   . PHE A 1 43 ? -9.052  -8.904  -2.844  1.00 0.00 ? 43 PHE A CA   7  
ATOM 8668  C C    . PHE A 1 43 ? -7.919  -9.673  -3.517  1.00 0.00 ? 43 PHE A C    7  
ATOM 8669  O O    . PHE A 1 43 ? -8.087  -10.216 -4.609  1.00 0.00 ? 43 PHE A O    7  
ATOM 8670  C CB   . PHE A 1 43 ? -9.028  -7.438  -3.289  1.00 0.00 ? 43 PHE A CB   7  
ATOM 8671  C CG   . PHE A 1 43 ? -7.715  -6.752  -3.035  1.00 0.00 ? 43 PHE A CG   7  
ATOM 8672  C CD1  . PHE A 1 43 ? -6.704  -6.792  -3.982  1.00 0.00 ? 43 PHE A CD1  7  
ATOM 8673  C CD2  . PHE A 1 43 ? -7.493  -6.066  -1.851  1.00 0.00 ? 43 PHE A CD2  7  
ATOM 8674  C CE1  . PHE A 1 43 ? -5.495  -6.161  -3.752  1.00 0.00 ? 43 PHE A CE1  7  
ATOM 8675  C CE2  . PHE A 1 43 ? -6.287  -5.432  -1.617  1.00 0.00 ? 43 PHE A CE2  7  
ATOM 8676  C CZ   . PHE A 1 43 ? -5.287  -5.480  -2.569  1.00 0.00 ? 43 PHE A CZ   7  
ATOM 8677  H H    . PHE A 1 43 ? -8.714  -8.194  -0.879  1.00 0.00 ? 43 PHE A H    7  
ATOM 8678  H HA   . PHE A 1 43 ? -9.993  -9.343  -3.138  1.00 0.00 ? 43 PHE A HA   7  
ATOM 8679  H HB2  . PHE A 1 43 ? -9.228  -7.388  -4.348  1.00 0.00 ? 43 PHE A HB2  7  
ATOM 8680  H HB3  . PHE A 1 43 ? -9.795  -6.897  -2.756  1.00 0.00 ? 43 PHE A HB3  7  
ATOM 8681  H HD1  . PHE A 1 43 ? -6.866  -7.323  -4.908  1.00 0.00 ? 43 PHE A HD1  7  
ATOM 8682  H HD2  . PHE A 1 43 ? -8.274  -6.029  -1.107  1.00 0.00 ? 43 PHE A HD2  7  
ATOM 8683  H HE1  . PHE A 1 43 ? -4.715  -6.200  -4.498  1.00 0.00 ? 43 PHE A HE1  7  
ATOM 8684  H HE2  . PHE A 1 43 ? -6.127  -4.902  -0.690  1.00 0.00 ? 43 PHE A HE2  7  
ATOM 8685  H HZ   . PHE A 1 43 ? -4.344  -4.986  -2.388  1.00 0.00 ? 43 PHE A HZ   7  
ATOM 8686  N N    . ALA A 1 44 ? -6.766  -9.717  -2.858  1.00 0.00 ? 44 ALA A N    7  
ATOM 8687  C CA   . ALA A 1 44 ? -5.607  -10.419 -3.391  1.00 0.00 ? 44 ALA A CA   7  
ATOM 8688  C C    . ALA A 1 44 ? -4.704  -10.924 -2.267  1.00 0.00 ? 44 ALA A C    7  
ATOM 8689  O O    . ALA A 1 44 ? -4.620  -10.308 -1.204  1.00 0.00 ? 44 ALA A O    7  
ATOM 8690  C CB   . ALA A 1 44 ? -4.826  -9.511  -4.329  1.00 0.00 ? 44 ALA A CB   7  
ATOM 8691  H H    . ALA A 1 44 ? -6.694  -9.264  -1.991  1.00 0.00 ? 44 ALA A H    7  
ATOM 8692  H HA   . ALA A 1 44 ? -5.962  -11.265 -3.961  1.00 0.00 ? 44 ALA A HA   7  
ATOM 8693  H HB1  . ALA A 1 44 ? -4.058  -10.084 -4.828  1.00 0.00 ? 44 ALA A HB1  7  
ATOM 8694  H HB2  . ALA A 1 44 ? -4.370  -8.714  -3.762  1.00 0.00 ? 44 ALA A HB2  7  
ATOM 8695  H HB3  . ALA A 1 44 ? -5.497  -9.091  -5.064  1.00 0.00 ? 44 ALA A HB3  7  
ATOM 8696  N N    . PRO A 1 45 ? -4.014  -12.056 -2.488  1.00 0.00 ? 45 PRO A N    7  
ATOM 8697  C CA   . PRO A 1 45 ? -3.116  -12.641 -1.488  1.00 0.00 ? 45 PRO A CA   7  
ATOM 8698  C C    . PRO A 1 45 ? -1.850  -11.813 -1.291  1.00 0.00 ? 45 PRO A C    7  
ATOM 8699  O O    . PRO A 1 45 ? -1.744  -10.695 -1.795  1.00 0.00 ? 45 PRO A O    7  
ATOM 8700  C CB   . PRO A 1 45 ? -2.772  -14.011 -2.078  1.00 0.00 ? 45 PRO A CB   7  
ATOM 8701  C CG   . PRO A 1 45 ? -2.936  -13.841 -3.548  1.00 0.00 ? 45 PRO A CG   7  
ATOM 8702  C CD   . PRO A 1 45 ? -4.057  -12.854 -3.728  1.00 0.00 ? 45 PRO A CD   7  
ATOM 8703  H HA   . PRO A 1 45 ? -3.612  -12.769 -0.537  1.00 0.00 ? 45 PRO A HA   7  
ATOM 8704  H HB2  . PRO A 1 45 ? -1.755  -14.272 -1.821  1.00 0.00 ? 45 PRO A HB2  7  
ATOM 8705  H HB3  . PRO A 1 45 ? -3.451  -14.754 -1.689  1.00 0.00 ? 45 PRO A HB3  7  
ATOM 8706  H HG2  . PRO A 1 45 ? -2.024  -13.453 -3.977  1.00 0.00 ? 45 PRO A HG2  7  
ATOM 8707  H HG3  . PRO A 1 45 ? -3.193  -14.786 -4.001  1.00 0.00 ? 45 PRO A HG3  7  
ATOM 8708  H HD2  . PRO A 1 45 ? -3.878  -12.232 -4.593  1.00 0.00 ? 45 PRO A HD2  7  
ATOM 8709  H HD3  . PRO A 1 45 ? -5.002  -13.369 -3.822  1.00 0.00 ? 45 PRO A HD3  7  
ATOM 8710  N N    . GLY A 1 46 ? -0.894  -12.370 -0.555  1.00 0.00 ? 46 GLY A N    7  
ATOM 8711  C CA   . GLY A 1 46 ? 0.351   -11.668 -0.304  1.00 0.00 ? 46 GLY A CA   7  
ATOM 8712  C C    . GLY A 1 46 ? 0.179   -10.499 0.645   1.00 0.00 ? 46 GLY A C    7  
ATOM 8713  O O    . GLY A 1 46 ? -0.943  -10.074 0.918   1.00 0.00 ? 46 GLY A O    7  
ATOM 8714  H H    . GLY A 1 46 ? -1.034  -13.263 -0.179  1.00 0.00 ? 46 GLY A H    7  
ATOM 8715  H HA2  . GLY A 1 46 ? 1.063   -12.361 0.121   1.00 0.00 ? 46 GLY A HA2  7  
ATOM 8716  H HA3  . GLY A 1 46 ? 0.740   -11.302 -1.243  1.00 0.00 ? 46 GLY A HA3  7  
ATOM 8717  N N    . GLN A 1 47 ? 1.293   -9.978  1.147   1.00 0.00 ? 47 GLN A N    7  
ATOM 8718  C CA   . GLN A 1 47 ? 1.261   -8.851  2.073   1.00 0.00 ? 47 GLN A CA   7  
ATOM 8719  C C    . GLN A 1 47 ? 0.890   -7.562  1.347   1.00 0.00 ? 47 GLN A C    7  
ATOM 8720  O O    . GLN A 1 47 ? 1.283   -7.347  0.200   1.00 0.00 ? 47 GLN A O    7  
ATOM 8721  C CB   . GLN A 1 47 ? 2.617   -8.690  2.761   1.00 0.00 ? 47 GLN A CB   7  
ATOM 8722  C CG   . GLN A 1 47 ? 2.986   -9.859  3.659   1.00 0.00 ? 47 GLN A CG   7  
ATOM 8723  C CD   . GLN A 1 47 ? 2.050   -10.002 4.843   1.00 0.00 ? 47 GLN A CD   7  
ATOM 8724  O OE1  . GLN A 1 47 ? 1.242   -9.116  5.122   1.00 0.00 ? 47 GLN A OE1  7  
ATOM 8725  N NE2  . GLN A 1 47 ? 2.154   -11.122 5.548   1.00 0.00 ? 47 GLN A NE2  7  
ATOM 8726  H H    . GLN A 1 47 ? 2.158   -10.360 0.891   1.00 0.00 ? 47 GLN A H    7  
ATOM 8727  H HA   . GLN A 1 47 ? 0.510   -9.057  2.820   1.00 0.00 ? 47 GLN A HA   7  
ATOM 8728  H HB2  . GLN A 1 47 ? 3.382   -8.589  2.005   1.00 0.00 ? 47 GLN A HB2  7  
ATOM 8729  H HB3  . GLN A 1 47 ? 2.598   -7.793  3.363   1.00 0.00 ? 47 GLN A HB3  7  
ATOM 8730  H HG2  . GLN A 1 47 ? 2.948   -10.768 3.078   1.00 0.00 ? 47 GLN A HG2  7  
ATOM 8731  H HG3  . GLN A 1 47 ? 3.990   -9.710  4.029   1.00 0.00 ? 47 GLN A HG3  7  
ATOM 8732  H HE21 . GLN A 1 47 ? 2.819   -11.786 5.268   1.00 0.00 ? 47 GLN A HE21 7  
ATOM 8733  H HE22 . GLN A 1 47 ? 1.561   -11.241 6.319   1.00 0.00 ? 47 GLN A HE22 7  
ATOM 8734  N N    . TRP A 1 48 ? 0.129   -6.706  2.022   1.00 0.00 ? 48 TRP A N    7  
ATOM 8735  C CA   . TRP A 1 48 ? -0.297  -5.438  1.443   1.00 0.00 ? 48 TRP A CA   7  
ATOM 8736  C C    . TRP A 1 48 ? -0.139  -4.300  2.447   1.00 0.00 ? 48 TRP A C    7  
ATOM 8737  O O    . TRP A 1 48 ? 0.237   -4.523  3.597   1.00 0.00 ? 48 TRP A O    7  
ATOM 8738  C CB   . TRP A 1 48 ? -1.753  -5.528  0.981   1.00 0.00 ? 48 TRP A CB   7  
ATOM 8739  C CG   . TRP A 1 48 ? -1.909  -6.134  -0.379  1.00 0.00 ? 48 TRP A CG   7  
ATOM 8740  C CD1  . TRP A 1 48 ? -1.982  -7.463  -0.676  1.00 0.00 ? 48 TRP A CD1  7  
ATOM 8741  C CD2  . TRP A 1 48 ? -2.010  -5.436  -1.625  1.00 0.00 ? 48 TRP A CD2  7  
ATOM 8742  N NE1  . TRP A 1 48 ? -2.122  -7.637  -2.031  1.00 0.00 ? 48 TRP A NE1  7  
ATOM 8743  C CE2  . TRP A 1 48 ? -2.142  -6.406  -2.635  1.00 0.00 ? 48 TRP A CE2  7  
ATOM 8744  C CE3  . TRP A 1 48 ? -2.003  -4.086  -1.984  1.00 0.00 ? 48 TRP A CE3  7  
ATOM 8745  C CZ2  . TRP A 1 48 ? -2.266  -6.069  -3.981  1.00 0.00 ? 48 TRP A CZ2  7  
ATOM 8746  C CZ3  . TRP A 1 48 ? -2.126  -3.751  -3.320  1.00 0.00 ? 48 TRP A CZ3  7  
ATOM 8747  C CH2  . TRP A 1 48 ? -2.256  -4.739  -4.304  1.00 0.00 ? 48 TRP A CH2  7  
ATOM 8748  H H    . TRP A 1 48 ? -0.154  -6.934  2.933   1.00 0.00 ? 48 TRP A H    7  
ATOM 8749  H HA   . TRP A 1 48 ? 0.331   -5.237  0.587   1.00 0.00 ? 48 TRP A HA   7  
ATOM 8750  H HB2  . TRP A 1 48 ? -2.307  -6.134  1.681   1.00 0.00 ? 48 TRP A HB2  7  
ATOM 8751  H HB3  . TRP A 1 48 ? -2.178  -4.537  0.956   1.00 0.00 ? 48 TRP A HB3  7  
ATOM 8752  H HD1  . TRP A 1 48 ? -1.934  -8.252  0.059   1.00 0.00 ? 48 TRP A HD1  7  
ATOM 8753  H HE1  . TRP A 1 48 ? -2.196  -8.499  -2.490  1.00 0.00 ? 48 TRP A HE1  7  
ATOM 8754  H HE3  . TRP A 1 48 ? -1.902  -3.310  -1.239  1.00 0.00 ? 48 TRP A HE3  7  
ATOM 8755  H HZ2  . TRP A 1 48 ? -2.368  -6.818  -4.752  1.00 0.00 ? 48 TRP A HZ2  7  
ATOM 8756  H HZ3  . TRP A 1 48 ? -2.121  -2.713  -3.617  1.00 0.00 ? 48 TRP A HZ3  7  
ATOM 8757  H HH2  . TRP A 1 48 ? -2.349  -4.432  -5.335  1.00 0.00 ? 48 TRP A HH2  7  
ATOM 8758  N N    . ALA A 1 49 ? -0.428  -3.081  2.002   1.00 0.00 ? 49 ALA A N    7  
ATOM 8759  C CA   . ALA A 1 49 ? -0.318  -1.909  2.863   1.00 0.00 ? 49 ALA A CA   7  
ATOM 8760  C C    . ALA A 1 49 ? -1.150  -0.751  2.323   1.00 0.00 ? 49 ALA A C    7  
ATOM 8761  O O    . ALA A 1 49 ? -0.820  -0.164  1.292   1.00 0.00 ? 49 ALA A O    7  
ATOM 8762  C CB   . ALA A 1 49 ? 1.140   -1.494  3.005   1.00 0.00 ? 49 ALA A CB   7  
ATOM 8763  H H    . ALA A 1 49 ? -0.722  -2.967  1.076   1.00 0.00 ? 49 ALA A H    7  
ATOM 8764  H HA   . ALA A 1 49 ? -0.687  -2.179  3.842   1.00 0.00 ? 49 ALA A HA   7  
ATOM 8765  H HB1  . ALA A 1 49 ? 1.206   -0.627  3.646   1.00 0.00 ? 49 ALA A HB1  7  
ATOM 8766  H HB2  . ALA A 1 49 ? 1.541   -1.253  2.032   1.00 0.00 ? 49 ALA A HB2  7  
ATOM 8767  H HB3  . ALA A 1 49 ? 1.705   -2.306  3.436   1.00 0.00 ? 49 ALA A HB3  7  
ATOM 8768  N N    . GLY A 1 50 ? -2.232  -0.429  3.025   1.00 0.00 ? 50 GLY A N    7  
ATOM 8769  C CA   . GLY A 1 50 ? -3.094  0.657   2.600   1.00 0.00 ? 50 GLY A CA   7  
ATOM 8770  C C    . GLY A 1 50 ? -2.529  2.020   2.949   1.00 0.00 ? 50 GLY A C    7  
ATOM 8771  O O    . GLY A 1 50 ? -2.057  2.236   4.065   1.00 0.00 ? 50 GLY A O    7  
ATOM 8772  H H    . GLY A 1 50 ? -2.445  -0.933  3.837   1.00 0.00 ? 50 GLY A H    7  
ATOM 8773  H HA2  . GLY A 1 50 ? -3.227  0.599   1.529   1.00 0.00 ? 50 GLY A HA2  7  
ATOM 8774  H HA3  . GLY A 1 50 ? -4.057  0.546   3.078   1.00 0.00 ? 50 GLY A HA3  7  
ATOM 8775  N N    . VAL A 1 51 ? -2.575  2.941   1.992   1.00 0.00 ? 51 VAL A N    7  
ATOM 8776  C CA   . VAL A 1 51 ? -2.063  4.290   2.203   1.00 0.00 ? 51 VAL A CA   7  
ATOM 8777  C C    . VAL A 1 51 ? -3.089  5.337   1.783   1.00 0.00 ? 51 VAL A C    7  
ATOM 8778  O O    . VAL A 1 51 ? -3.741  5.202   0.748   1.00 0.00 ? 51 VAL A O    7  
ATOM 8779  C CB   . VAL A 1 51 ? -0.757  4.524   1.422   1.00 0.00 ? 51 VAL A CB   7  
ATOM 8780  C CG1  . VAL A 1 51 ? -0.148  5.869   1.786   1.00 0.00 ? 51 VAL A CG1  7  
ATOM 8781  C CG2  . VAL A 1 51 ? 0.231   3.396   1.682   1.00 0.00 ? 51 VAL A CG2  7  
ATOM 8782  H H    . VAL A 1 51 ? -2.964  2.708   1.123   1.00 0.00 ? 51 VAL A H    7  
ATOM 8783  H HA   . VAL A 1 51 ? -1.855  4.406   3.257   1.00 0.00 ? 51 VAL A HA   7  
ATOM 8784  H HB   . VAL A 1 51 ? -0.989  4.533   0.367   1.00 0.00 ? 51 VAL A HB   7  
ATOM 8785  H HG11 . VAL A 1 51 ? 0.264   6.330   0.901   1.00 0.00 ? 51 VAL A HG11 7  
ATOM 8786  H HG12 . VAL A 1 51 ? 0.637   5.723   2.514   1.00 0.00 ? 51 VAL A HG12 7  
ATOM 8787  H HG13 . VAL A 1 51 ? -0.911  6.508   2.205   1.00 0.00 ? 51 VAL A HG13 7  
ATOM 8788  H HG21 . VAL A 1 51 ? -0.299  2.456   1.729   1.00 0.00 ? 51 VAL A HG21 7  
ATOM 8789  H HG22 . VAL A 1 51 ? 0.737   3.571   2.620   1.00 0.00 ? 51 VAL A HG22 7  
ATOM 8790  H HG23 . VAL A 1 51 ? 0.955   3.360   0.882   1.00 0.00 ? 51 VAL A HG23 7  
ATOM 8791  N N    . VAL A 1 52 ? -3.225  6.383   2.592   1.00 0.00 ? 52 VAL A N    7  
ATOM 8792  C CA   . VAL A 1 52 ? -4.171  7.454   2.306   1.00 0.00 ? 52 VAL A CA   7  
ATOM 8793  C C    . VAL A 1 52 ? -3.461  8.669   1.717   1.00 0.00 ? 52 VAL A C    7  
ATOM 8794  O O    . VAL A 1 52 ? -2.835  9.445   2.440   1.00 0.00 ? 52 VAL A O    7  
ATOM 8795  C CB   . VAL A 1 52 ? -4.936  7.883   3.571   1.00 0.00 ? 52 VAL A CB   7  
ATOM 8796  C CG1  . VAL A 1 52 ? -6.050  8.857   3.217   1.00 0.00 ? 52 VAL A CG1  7  
ATOM 8797  C CG2  . VAL A 1 52 ? -5.492  6.668   4.298   1.00 0.00 ? 52 VAL A CG2  7  
ATOM 8798  H H    . VAL A 1 52 ? -2.676  6.434   3.403   1.00 0.00 ? 52 VAL A H    7  
ATOM 8799  H HA   . VAL A 1 52 ? -4.886  7.083   1.585   1.00 0.00 ? 52 VAL A HA   7  
ATOM 8800  H HB   . VAL A 1 52 ? -4.246  8.387   4.232   1.00 0.00 ? 52 VAL A HB   7  
ATOM 8801  H HG11 . VAL A 1 52 ? -6.115  9.621   3.978   1.00 0.00 ? 52 VAL A HG11 7  
ATOM 8802  H HG12 . VAL A 1 52 ? -6.989  8.325   3.162   1.00 0.00 ? 52 VAL A HG12 7  
ATOM 8803  H HG13 . VAL A 1 52 ? -5.839  9.316   2.264   1.00 0.00 ? 52 VAL A HG13 7  
ATOM 8804  H HG21 . VAL A 1 52 ? -6.385  6.326   3.798   1.00 0.00 ? 52 VAL A HG21 7  
ATOM 8805  H HG22 . VAL A 1 52 ? -5.729  6.934   5.316   1.00 0.00 ? 52 VAL A HG22 7  
ATOM 8806  H HG23 . VAL A 1 52 ? -4.754  5.878   4.294   1.00 0.00 ? 52 VAL A HG23 7  
ATOM 8807  N N    . LEU A 1 53 ? -3.562  8.828   0.401   1.00 0.00 ? 53 LEU A N    7  
ATOM 8808  C CA   . LEU A 1 53 ? -2.931  9.949   -0.284  1.00 0.00 ? 53 LEU A CA   7  
ATOM 8809  C C    . LEU A 1 53 ? -3.464  11.278  0.239   1.00 0.00 ? 53 LEU A C    7  
ATOM 8810  O O    . LEU A 1 53 ? -4.569  11.347  0.777   1.00 0.00 ? 53 LEU A O    7  
ATOM 8811  C CB   . LEU A 1 53 ? -3.165  9.848   -1.793  1.00 0.00 ? 53 LEU A CB   7  
ATOM 8812  C CG   . LEU A 1 53 ? -2.598  8.591   -2.454  1.00 0.00 ? 53 LEU A CG   7  
ATOM 8813  C CD1  . LEU A 1 53 ? -3.347  8.282   -3.741  1.00 0.00 ? 53 LEU A CD1  7  
ATOM 8814  C CD2  . LEU A 1 53 ? -1.111  8.756   -2.726  1.00 0.00 ? 53 LEU A CD2  7  
ATOM 8815  H H    . LEU A 1 53 ? -4.075  8.176   -0.120  1.00 0.00 ? 53 LEU A H    7  
ATOM 8816  H HA   . LEU A 1 53 ? -1.869  9.899   -0.089  1.00 0.00 ? 53 LEU A HA   7  
ATOM 8817  H HB2  . LEU A 1 53 ? -4.230  9.877   -1.973  1.00 0.00 ? 53 LEU A HB2  7  
ATOM 8818  H HB3  . LEU A 1 53 ? -2.714  10.709  -2.264  1.00 0.00 ? 53 LEU A HB3  7  
ATOM 8819  H HG   . LEU A 1 53 ? -2.726  7.752   -1.785  1.00 0.00 ? 53 LEU A HG   7  
ATOM 8820  H HD11 . LEU A 1 53 ? -4.262  7.757   -3.509  1.00 0.00 ? 53 LEU A HD11 7  
ATOM 8821  H HD12 . LEU A 1 53 ? -2.730  7.665   -4.377  1.00 0.00 ? 53 LEU A HD12 7  
ATOM 8822  H HD13 . LEU A 1 53 ? -3.581  9.204   -4.251  1.00 0.00 ? 53 LEU A HD13 7  
ATOM 8823  H HD21 . LEU A 1 53 ? -0.850  8.230   -3.633  1.00 0.00 ? 53 LEU A HD21 7  
ATOM 8824  H HD22 . LEU A 1 53 ? -0.547  8.351   -1.899  1.00 0.00 ? 53 LEU A HD22 7  
ATOM 8825  H HD23 . LEU A 1 53 ? -0.880  9.805   -2.840  1.00 0.00 ? 53 LEU A HD23 7  
ATOM 8826  N N    . ASP A 1 54 ? -2.672  12.332  0.076   1.00 0.00 ? 54 ASP A N    7  
ATOM 8827  C CA   . ASP A 1 54 ? -3.065  13.661  0.532   1.00 0.00 ? 54 ASP A CA   7  
ATOM 8828  C C    . ASP A 1 54 ? -4.056  14.297  -0.438  1.00 0.00 ? 54 ASP A C    7  
ATOM 8829  O O    . ASP A 1 54 ? -4.975  15.006  -0.026  1.00 0.00 ? 54 ASP A O    7  
ATOM 8830  C CB   . ASP A 1 54 ? -1.833  14.557  0.682   1.00 0.00 ? 54 ASP A CB   7  
ATOM 8831  C CG   . ASP A 1 54 ? -1.917  15.454  1.901   1.00 0.00 ? 54 ASP A CG   7  
ATOM 8832  O OD1  . ASP A 1 54 ? -2.025  14.920  3.025   1.00 0.00 ? 54 ASP A OD1  7  
ATOM 8833  O OD2  . ASP A 1 54 ? -1.871  16.691  1.732   1.00 0.00 ? 54 ASP A OD2  7  
ATOM 8834  H H    . ASP A 1 54 ? -1.803  12.215  -0.360  1.00 0.00 ? 54 ASP A H    7  
ATOM 8835  H HA   . ASP A 1 54 ? -3.540  13.554  1.495   1.00 0.00 ? 54 ASP A HA   7  
ATOM 8836  H HB2  . ASP A 1 54 ? -0.954  13.936  0.775   1.00 0.00 ? 54 ASP A HB2  7  
ATOM 8837  H HB3  . ASP A 1 54 ? -1.739  15.178  -0.196  1.00 0.00 ? 54 ASP A HB3  7  
ATOM 8838  N N    . ASP A 1 55 ? -3.863  14.041  -1.727  1.00 0.00 ? 55 ASP A N    7  
ATOM 8839  C CA   . ASP A 1 55 ? -4.740  14.588  -2.756  1.00 0.00 ? 55 ASP A CA   7  
ATOM 8840  C C    . ASP A 1 55 ? -5.658  13.506  -3.322  1.00 0.00 ? 55 ASP A C    7  
ATOM 8841  O O    . ASP A 1 55 ? -5.357  12.316  -3.231  1.00 0.00 ? 55 ASP A O    7  
ATOM 8842  C CB   . ASP A 1 55 ? -3.914  15.212  -3.881  1.00 0.00 ? 55 ASP A CB   7  
ATOM 8843  C CG   . ASP A 1 55 ? -3.693  16.699  -3.681  1.00 0.00 ? 55 ASP A CG   7  
ATOM 8844  O OD1  . ASP A 1 55 ? -4.675  17.463  -3.783  1.00 0.00 ? 55 ASP A OD1  7  
ATOM 8845  O OD2  . ASP A 1 55 ? -2.538  17.099  -3.422  1.00 0.00 ? 55 ASP A OD2  7  
ATOM 8846  H H    . ASP A 1 55 ? -3.114  13.469  -1.993  1.00 0.00 ? 55 ASP A H    7  
ATOM 8847  H HA   . ASP A 1 55 ? -5.347  15.355  -2.299  1.00 0.00 ? 55 ASP A HA   7  
ATOM 8848  H HB2  . ASP A 1 55 ? -2.949  14.727  -3.922  1.00 0.00 ? 55 ASP A HB2  7  
ATOM 8849  H HB3  . ASP A 1 55 ? -4.426  15.065  -4.821  1.00 0.00 ? 55 ASP A HB3  7  
ATOM 8850  N N    . PRO A 1 56 ? -6.795  13.909  -3.915  1.00 0.00 ? 56 PRO A N    7  
ATOM 8851  C CA   . PRO A 1 56 ? -7.758  12.968  -4.497  1.00 0.00 ? 56 PRO A CA   7  
ATOM 8852  C C    . PRO A 1 56 ? -7.234  12.321  -5.776  1.00 0.00 ? 56 PRO A C    7  
ATOM 8853  O O    . PRO A 1 56 ? -7.802  12.502  -6.854  1.00 0.00 ? 56 PRO A O    7  
ATOM 8854  C CB   . PRO A 1 56 ? -8.973  13.847  -4.798  1.00 0.00 ? 56 PRO A CB   7  
ATOM 8855  C CG   . PRO A 1 56 ? -8.413  15.214  -4.990  1.00 0.00 ? 56 PRO A CG   7  
ATOM 8856  C CD   . PRO A 1 56 ? -7.231  15.311  -4.066  1.00 0.00 ? 56 PRO A CD   7  
ATOM 8857  H HA   . PRO A 1 56 ? -8.032  12.198  -3.792  1.00 0.00 ? 56 PRO A HA   7  
ATOM 8858  H HB2  . PRO A 1 56 ? -9.465  13.491  -5.691  1.00 0.00 ? 56 PRO A HB2  7  
ATOM 8859  H HB3  . PRO A 1 56 ? -9.659  13.817  -3.965  1.00 0.00 ? 56 PRO A HB3  7  
ATOM 8860  H HG2  . PRO A 1 56 ? -8.098  15.340  -6.016  1.00 0.00 ? 56 PRO A HG2  7  
ATOM 8861  H HG3  . PRO A 1 56 ? -9.153  15.955  -4.730  1.00 0.00 ? 56 PRO A HG3  7  
ATOM 8862  H HD2  . PRO A 1 56 ? -6.451  15.910  -4.513  1.00 0.00 ? 56 PRO A HD2  7  
ATOM 8863  H HD3  . PRO A 1 56 ? -7.528  15.726  -3.114  1.00 0.00 ? 56 PRO A HD3  7  
ATOM 8864  N N    . VAL A 1 57 ? -6.146  11.568  -5.648  1.00 0.00 ? 57 VAL A N    7  
ATOM 8865  C CA   . VAL A 1 57 ? -5.545  10.895  -6.793  1.00 0.00 ? 57 VAL A CA   7  
ATOM 8866  C C    . VAL A 1 57 ? -5.292  9.421   -6.494  1.00 0.00 ? 57 VAL A C    7  
ATOM 8867  O O    . VAL A 1 57 ? -4.353  8.823   -7.019  1.00 0.00 ? 57 VAL A O    7  
ATOM 8868  C CB   . VAL A 1 57 ? -4.217  11.558  -7.201  1.00 0.00 ? 57 VAL A CB   7  
ATOM 8869  C CG1  . VAL A 1 57 ? -4.474  12.884  -7.900  1.00 0.00 ? 57 VAL A CG1  7  
ATOM 8870  C CG2  . VAL A 1 57 ? -3.322  11.753  -5.987  1.00 0.00 ? 57 VAL A CG2  7  
ATOM 8871  H H    . VAL A 1 57 ? -5.739  11.463  -4.764  1.00 0.00 ? 57 VAL A H    7  
ATOM 8872  H HA   . VAL A 1 57 ? -6.232  10.970  -7.623  1.00 0.00 ? 57 VAL A HA   7  
ATOM 8873  H HB   . VAL A 1 57 ? -3.709  10.904  -7.894  1.00 0.00 ? 57 VAL A HB   7  
ATOM 8874  H HG11 . VAL A 1 57 ? -4.495  12.729  -8.970  1.00 0.00 ? 57 VAL A HG11 7  
ATOM 8875  H HG12 . VAL A 1 57 ? -3.687  13.581  -7.654  1.00 0.00 ? 57 VAL A HG12 7  
ATOM 8876  H HG13 . VAL A 1 57 ? -5.424  13.284  -7.577  1.00 0.00 ? 57 VAL A HG13 7  
ATOM 8877  H HG21 . VAL A 1 57 ? -3.217  10.814  -5.463  1.00 0.00 ? 57 VAL A HG21 7  
ATOM 8878  H HG22 . VAL A 1 57 ? -3.764  12.484  -5.327  1.00 0.00 ? 57 VAL A HG22 7  
ATOM 8879  H HG23 . VAL A 1 57 ? -2.350  12.097  -6.307  1.00 0.00 ? 57 VAL A HG23 7  
ATOM 8880  N N    . GLY A 1 58 ? -6.136  8.841   -5.645  1.00 0.00 ? 58 GLY A N    7  
ATOM 8881  C CA   . GLY A 1 58 ? -5.986  7.443   -5.291  1.00 0.00 ? 58 GLY A CA   7  
ATOM 8882  C C    . GLY A 1 58 ? -6.860  6.533   -6.132  1.00 0.00 ? 58 GLY A C    7  
ATOM 8883  O O    . GLY A 1 58 ? -6.943  6.693   -7.350  1.00 0.00 ? 58 GLY A O    7  
ATOM 8884  H H    . GLY A 1 58 ? -6.866  9.368   -5.258  1.00 0.00 ? 58 GLY A H    7  
ATOM 8885  H HA2  . GLY A 1 58 ? -4.953  7.156   -5.427  1.00 0.00 ? 58 GLY A HA2  7  
ATOM 8886  H HA3  . GLY A 1 58 ? -6.249  7.315   -4.251  1.00 0.00 ? 58 GLY A HA3  7  
ATOM 8887  N N    . LYS A 1 59 ? -7.513  5.576   -5.482  1.00 0.00 ? 59 LYS A N    7  
ATOM 8888  C CA   . LYS A 1 59 ? -8.386  4.637   -6.176  1.00 0.00 ? 59 LYS A CA   7  
ATOM 8889  C C    . LYS A 1 59 ? -9.598  4.284   -5.319  1.00 0.00 ? 59 LYS A C    7  
ATOM 8890  O O    . LYS A 1 59 ? -10.713 4.730   -5.588  1.00 0.00 ? 59 LYS A O    7  
ATOM 8891  C CB   . LYS A 1 59 ? -7.615  3.367   -6.542  1.00 0.00 ? 59 LYS A CB   7  
ATOM 8892  C CG   . LYS A 1 59 ? -7.078  3.369   -7.965  1.00 0.00 ? 59 LYS A CG   7  
ATOM 8893  C CD   . LYS A 1 59 ? -7.434  2.084   -8.701  1.00 0.00 ? 59 LYS A CD   7  
ATOM 8894  C CE   . LYS A 1 59 ? -6.216  1.472   -9.377  1.00 0.00 ? 59 LYS A CE   7  
ATOM 8895  N NZ   . LYS A 1 59 ? -5.378  0.702   -8.419  1.00 0.00 ? 59 LYS A NZ   7  
ATOM 8896  H H    . LYS A 1 59 ? -7.407  5.500   -4.510  1.00 0.00 ? 59 LYS A H    7  
ATOM 8897  H HA   . LYS A 1 59 ? -8.729  5.112   -7.084  1.00 0.00 ? 59 LYS A HA   7  
ATOM 8898  H HB2  . LYS A 1 59 ? -6.780  3.261   -5.866  1.00 0.00 ? 59 LYS A HB2  7  
ATOM 8899  H HB3  . LYS A 1 59 ? -8.270  2.516   -6.427  1.00 0.00 ? 59 LYS A HB3  7  
ATOM 8900  H HG2  . LYS A 1 59 ? -7.505  4.205   -8.499  1.00 0.00 ? 59 LYS A HG2  7  
ATOM 8901  H HG3  . LYS A 1 59 ? -6.004  3.470   -7.933  1.00 0.00 ? 59 LYS A HG3  7  
ATOM 8902  H HD2  . LYS A 1 59 ? -7.834  1.372   -7.994  1.00 0.00 ? 59 LYS A HD2  7  
ATOM 8903  H HD3  . LYS A 1 59 ? -8.177  2.306   -9.452  1.00 0.00 ? 59 LYS A HD3  7  
ATOM 8904  H HE2  . LYS A 1 59 ? -6.551  0.810   -10.162 1.00 0.00 ? 59 LYS A HE2  7  
ATOM 8905  H HE3  . LYS A 1 59 ? -5.622  2.266   -9.805  1.00 0.00 ? 59 LYS A HE3  7  
ATOM 8906  H HZ1  . LYS A 1 59 ? -4.668  1.326   -7.982  1.00 0.00 ? 59 LYS A HZ1  7  
ATOM 8907  H HZ2  . LYS A 1 59 ? -4.886  -0.069  -8.913  1.00 0.00 ? 59 LYS A HZ2  7  
ATOM 8908  H HZ3  . LYS A 1 59 ? -5.973  0.294   -7.669  1.00 0.00 ? 59 LYS A HZ3  7  
ATOM 8909  N N    . ASN A 1 60 ? -9.370  3.478   -4.288  1.00 0.00 ? 60 ASN A N    7  
ATOM 8910  C CA   . ASN A 1 60 ? -10.443 3.063   -3.391  1.00 0.00 ? 60 ASN A CA   7  
ATOM 8911  C C    . ASN A 1 60 ? -10.776 4.167   -2.393  1.00 0.00 ? 60 ASN A C    7  
ATOM 8912  O O    . ASN A 1 60 ? -10.170 5.238   -2.411  1.00 0.00 ? 60 ASN A O    7  
ATOM 8913  C CB   . ASN A 1 60 ? -10.048 1.787   -2.645  1.00 0.00 ? 60 ASN A CB   7  
ATOM 8914  C CG   . ASN A 1 60 ? -10.141 0.553   -3.522  1.00 0.00 ? 60 ASN A CG   7  
ATOM 8915  O OD1  . ASN A 1 60 ? -11.221 0.184   -3.982  1.00 0.00 ? 60 ASN A OD1  7  
ATOM 8916  N ND2  . ASN A 1 60 ? -9.004  -0.093  -3.756  1.00 0.00 ? 60 ASN A ND2  7  
ATOM 8917  H H    . ASN A 1 60 ? -8.460  3.154   -4.126  1.00 0.00 ? 60 ASN A H    7  
ATOM 8918  H HA   . ASN A 1 60 ? -11.317 2.861   -3.992  1.00 0.00 ? 60 ASN A HA   7  
ATOM 8919  H HB2  . ASN A 1 60 ? -9.031  1.882   -2.296  1.00 0.00 ? 60 ASN A HB2  7  
ATOM 8920  H HB3  . ASN A 1 60 ? -10.705 1.655   -1.798  1.00 0.00 ? 60 ASN A HB3  7  
ATOM 8921  H HD21 . ASN A 1 60 ? -8.181  0.258   -3.357  1.00 0.00 ? 60 ASN A HD21 7  
ATOM 8922  H HD22 . ASN A 1 60 ? -9.035  -0.894  -4.320  1.00 0.00 ? 60 ASN A HD22 7  
ATOM 8923  N N    . ASP A 1 61 ? -11.744 3.898   -1.523  1.00 0.00 ? 61 ASP A N    7  
ATOM 8924  C CA   . ASP A 1 61 ? -12.159 4.869   -0.516  1.00 0.00 ? 61 ASP A CA   7  
ATOM 8925  C C    . ASP A 1 61 ? -12.140 4.248   0.877   1.00 0.00 ? 61 ASP A C    7  
ATOM 8926  O O    . ASP A 1 61 ? -12.995 4.545   1.712   1.00 0.00 ? 61 ASP A O    7  
ATOM 8927  C CB   . ASP A 1 61 ? -13.559 5.397   -0.834  1.00 0.00 ? 61 ASP A CB   7  
ATOM 8928  C CG   . ASP A 1 61 ? -14.541 4.284   -1.140  1.00 0.00 ? 61 ASP A CG   7  
ATOM 8929  O OD1  . ASP A 1 61 ? -14.261 3.480   -2.054  1.00 0.00 ? 61 ASP A OD1  7  
ATOM 8930  O OD2  . ASP A 1 61 ? -15.590 4.215   -0.467  1.00 0.00 ? 61 ASP A OD2  7  
ATOM 8931  H H    . ASP A 1 61 ? -12.191 3.026   -1.558  1.00 0.00 ? 61 ASP A H    7  
ATOM 8932  H HA   . ASP A 1 61 ? -11.460 5.691   -0.540  1.00 0.00 ? 61 ASP A HA   7  
ATOM 8933  H HB2  . ASP A 1 61 ? -13.928 5.953   0.015   1.00 0.00 ? 61 ASP A HB2  7  
ATOM 8934  H HB3  . ASP A 1 61 ? -13.505 6.051   -1.692  1.00 0.00 ? 61 ASP A HB3  7  
ATOM 8935  N N    . GLY A 1 62 ? -11.162 3.383   1.121   1.00 0.00 ? 62 GLY A N    7  
ATOM 8936  C CA   . GLY A 1 62 ? -11.050 2.734   2.414   1.00 0.00 ? 62 GLY A CA   7  
ATOM 8937  C C    . GLY A 1 62 ? -11.426 1.266   2.360   1.00 0.00 ? 62 GLY A C    7  
ATOM 8938  O O    . GLY A 1 62 ? -10.927 0.461   3.146   1.00 0.00 ? 62 GLY A O    7  
ATOM 8939  H H    . GLY A 1 62 ? -10.509 3.185   0.417   1.00 0.00 ? 62 GLY A H    7  
ATOM 8940  H HA2  . GLY A 1 62 ? -10.031 2.821   2.762   1.00 0.00 ? 62 GLY A HA2  7  
ATOM 8941  H HA3  . GLY A 1 62 ? -11.702 3.235   3.114   1.00 0.00 ? 62 GLY A HA3  7  
ATOM 8942  N N    . ALA A 1 63 ? -12.308 0.917   1.429   1.00 0.00 ? 63 ALA A N    7  
ATOM 8943  C CA   . ALA A 1 63 ? -12.750 -0.463  1.273   1.00 0.00 ? 63 ALA A CA   7  
ATOM 8944  C C    . ALA A 1 63 ? -12.356 -1.015  -0.092  1.00 0.00 ? 63 ALA A C    7  
ATOM 8945  O O    . ALA A 1 63 ? -12.157 -0.261  -1.044  1.00 0.00 ? 63 ALA A O    7  
ATOM 8946  C CB   . ALA A 1 63 ? -14.256 -0.558  1.468   1.00 0.00 ? 63 ALA A CB   7  
ATOM 8947  H H    . ALA A 1 63 ? -12.669 1.605   0.831   1.00 0.00 ? 63 ALA A H    7  
ATOM 8948  H HA   . ALA A 1 63 ? -12.274 -1.055  2.041   1.00 0.00 ? 63 ALA A HA   7  
ATOM 8949  H HB1  . ALA A 1 63 ? -14.494 -1.463  2.008   1.00 0.00 ? 63 ALA A HB1  7  
ATOM 8950  H HB2  . ALA A 1 63 ? -14.743 -0.576  0.504   1.00 0.00 ? 63 ALA A HB2  7  
ATOM 8951  H HB3  . ALA A 1 63 ? -14.602 0.297   2.030   1.00 0.00 ? 63 ALA A HB3  7  
ATOM 8952  N N    . VAL A 1 64 ? -12.245 -2.337  -0.180  1.00 0.00 ? 64 VAL A N    7  
ATOM 8953  C CA   . VAL A 1 64 ? -11.874 -2.991  -1.429  1.00 0.00 ? 64 VAL A CA   7  
ATOM 8954  C C    . VAL A 1 64 ? -12.619 -4.311  -1.600  1.00 0.00 ? 64 VAL A C    7  
ATOM 8955  O O    . VAL A 1 64 ? -12.353 -5.281  -0.892  1.00 0.00 ? 64 VAL A O    7  
ATOM 8956  C CB   . VAL A 1 64 ? -10.359 -3.259  -1.496  1.00 0.00 ? 64 VAL A CB   7  
ATOM 8957  C CG1  . VAL A 1 64 ? -9.963  -3.746  -2.882  1.00 0.00 ? 64 VAL A CG1  7  
ATOM 8958  C CG2  . VAL A 1 64 ? -9.579  -2.008  -1.120  1.00 0.00 ? 64 VAL A CG2  7  
ATOM 8959  H H    . VAL A 1 64 ? -12.416 -2.886  0.614   1.00 0.00 ? 64 VAL A H    7  
ATOM 8960  H HA   . VAL A 1 64 ? -12.139 -2.331  -2.243  1.00 0.00 ? 64 VAL A HA   7  
ATOM 8961  H HB   . VAL A 1 64 ? -10.119 -4.034  -0.785  1.00 0.00 ? 64 VAL A HB   7  
ATOM 8962  H HG11 . VAL A 1 64 ? -10.824 -4.175  -3.372  1.00 0.00 ? 64 VAL A HG11 7  
ATOM 8963  H HG12 . VAL A 1 64 ? -9.189  -4.493  -2.794  1.00 0.00 ? 64 VAL A HG12 7  
ATOM 8964  H HG13 . VAL A 1 64 ? -9.595  -2.914  -3.465  1.00 0.00 ? 64 VAL A HG13 7  
ATOM 8965  H HG21 . VAL A 1 64 ? -8.524  -2.183  -1.272  1.00 0.00 ? 64 VAL A HG21 7  
ATOM 8966  H HG22 . VAL A 1 64 ? -9.758  -1.770  -0.082  1.00 0.00 ? 64 VAL A HG22 7  
ATOM 8967  H HG23 . VAL A 1 64 ? -9.899  -1.183  -1.740  1.00 0.00 ? 64 VAL A HG23 7  
ATOM 8968  N N    . GLY A 1 65 ? -13.553 -4.339  -2.545  1.00 0.00 ? 65 GLY A N    7  
ATOM 8969  C CA   . GLY A 1 65 ? -14.322 -5.544  -2.792  1.00 0.00 ? 65 GLY A CA   7  
ATOM 8970  C C    . GLY A 1 65 ? -15.547 -5.643  -1.904  1.00 0.00 ? 65 GLY A C    7  
ATOM 8971  O O    . GLY A 1 65 ? -16.652 -5.293  -2.319  1.00 0.00 ? 65 GLY A O    7  
ATOM 8972  H H    . GLY A 1 65 ? -13.723 -3.535  -3.079  1.00 0.00 ? 65 GLY A H    7  
ATOM 8973  H HA2  . GLY A 1 65 ? -14.638 -5.552  -3.824  1.00 0.00 ? 65 GLY A HA2  7  
ATOM 8974  H HA3  . GLY A 1 65 ? -13.692 -6.403  -2.613  1.00 0.00 ? 65 GLY A HA3  7  
ATOM 8975  N N    . GLY A 1 66 ? -15.352 -6.122  -0.680  1.00 0.00 ? 66 GLY A N    7  
ATOM 8976  C CA   . GLY A 1 66 ? -16.458 -6.258  0.249   1.00 0.00 ? 66 GLY A CA   7  
ATOM 8977  C C    . GLY A 1 66 ? -16.012 -6.184  1.696   1.00 0.00 ? 66 GLY A C    7  
ATOM 8978  O O    . GLY A 1 66 ? -16.641 -6.770  2.577   1.00 0.00 ? 66 GLY A O    7  
ATOM 8979  H H    . GLY A 1 66 ? -14.448 -6.385  -0.405  1.00 0.00 ? 66 GLY A H    7  
ATOM 8980  H HA2  . GLY A 1 66 ? -17.170 -5.467  0.062   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 8981  H HA3  . GLY A 1 66 ? -16.941 -7.210  0.081   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 8982  N N    . VAL A 1 67 ? -14.924 -5.462  1.942   1.00 0.00 ? 67 VAL A N    7  
ATOM 8983  C CA   . VAL A 1 67 ? -14.394 -5.313  3.292   1.00 0.00 ? 67 VAL A CA   7  
ATOM 8984  C C    . VAL A 1 67 ? -13.796 -3.925  3.498   1.00 0.00 ? 67 VAL A C    7  
ATOM 8985  O O    . VAL A 1 67 ? -13.317 -3.299  2.553   1.00 0.00 ? 67 VAL A O    7  
ATOM 8986  C CB   . VAL A 1 67 ? -13.317 -6.373  3.593   1.00 0.00 ? 67 VAL A CB   7  
ATOM 8987  C CG1  . VAL A 1 67 ? -12.922 -6.331  5.060   1.00 0.00 ? 67 VAL A CG1  7  
ATOM 8988  C CG2  . VAL A 1 67 ? -13.809 -7.759  3.205   1.00 0.00 ? 67 VAL A CG2  7  
ATOM 8989  H H    . VAL A 1 67 ? -14.466 -5.019  1.197   1.00 0.00 ? 67 VAL A H    7  
ATOM 8990  H HA   . VAL A 1 67 ? -15.209 -5.450  3.987   1.00 0.00 ? 67 VAL A HA   7  
ATOM 8991  H HB   . VAL A 1 67 ? -12.443 -6.145  3.001   1.00 0.00 ? 67 VAL A HB   7  
ATOM 8992  H HG11 . VAL A 1 67 ? -12.354 -7.216  5.306   1.00 0.00 ? 67 VAL A HG11 7  
ATOM 8993  H HG12 . VAL A 1 67 ? -13.811 -6.294  5.672   1.00 0.00 ? 67 VAL A HG12 7  
ATOM 8994  H HG13 . VAL A 1 67 ? -12.321 -5.453  5.247   1.00 0.00 ? 67 VAL A HG13 7  
ATOM 8995  H HG21 . VAL A 1 67 ? -14.757 -7.952  3.684   1.00 0.00 ? 67 VAL A HG21 7  
ATOM 8996  H HG22 . VAL A 1 67 ? -13.089 -8.498  3.521   1.00 0.00 ? 67 VAL A HG22 7  
ATOM 8997  H HG23 . VAL A 1 67 ? -13.930 -7.810  2.132   1.00 0.00 ? 67 VAL A HG23 7  
ATOM 8998  N N    . ARG A 1 68 ? -13.827 -3.452  4.739   1.00 0.00 ? 68 ARG A N    7  
ATOM 8999  C CA   . ARG A 1 68 ? -13.287 -2.138  5.070   1.00 0.00 ? 68 ARG A CA   7  
ATOM 9000  C C    . ARG A 1 68 ? -12.049 -2.266  5.952   1.00 0.00 ? 68 ARG A C    7  
ATOM 9001  O O    . ARG A 1 68 ? -12.080 -2.929  6.988   1.00 0.00 ? 68 ARG A O    7  
ATOM 9002  C CB   . ARG A 1 68 ? -14.348 -1.291  5.777   1.00 0.00 ? 68 ARG A CB   7  
ATOM 9003  C CG   . ARG A 1 68 ? -15.119 -0.376  4.838   1.00 0.00 ? 68 ARG A CG   7  
ATOM 9004  C CD   . ARG A 1 68 ? -15.502 0.927   5.521   1.00 0.00 ? 68 ARG A CD   7  
ATOM 9005  N NE   . ARG A 1 68 ? -16.799 1.423   5.066   1.00 0.00 ? 68 ARG A NE   7  
ATOM 9006  C CZ   . ARG A 1 68 ? -17.239 2.659   5.289   1.00 0.00 ? 68 ARG A CZ   7  
ATOM 9007  N NH1  . ARG A 1 68 ? -16.490 3.527   5.959   1.00 0.00 ? 68 ARG A NH1  7  
ATOM 9008  N NH2  . ARG A 1 68 ? -18.430 3.030   4.840   1.00 0.00 ? 68 ARG A NH2  7  
ATOM 9009  H H    . ARG A 1 68 ? -14.222 -3.999  5.450   1.00 0.00 ? 68 ARG A H    7  
ATOM 9010  H HA   . ARG A 1 68 ? -13.007 -1.653  4.147   1.00 0.00 ? 68 ARG A HA   7  
ATOM 9011  H HB2  . ARG A 1 68 ? -15.054 -1.950  6.262   1.00 0.00 ? 68 ARG A HB2  7  
ATOM 9012  H HB3  . ARG A 1 68 ? -13.863 -0.677  6.525   1.00 0.00 ? 68 ARG A HB3  7  
ATOM 9013  H HG2  . ARG A 1 68 ? -14.502 -0.153  3.981   1.00 0.00 ? 68 ARG A HG2  7  
ATOM 9014  H HG3  . ARG A 1 68 ? -16.018 -0.882  4.516   1.00 0.00 ? 68 ARG A HG3  7  
ATOM 9015  H HD2  . ARG A 1 68 ? -15.546 0.760   6.587   1.00 0.00 ? 68 ARG A HD2  7  
ATOM 9016  H HD3  . ARG A 1 68 ? -14.747 1.668   5.304   1.00 0.00 ? 68 ARG A HD3  7  
ATOM 9017  H HE   . ARG A 1 68 ? -17.371 0.803   4.568   1.00 0.00 ? 68 ARG A HE   7  
ATOM 9018  H HH11 . ARG A 1 68 ? -15.591 3.255   6.300   1.00 0.00 ? 68 ARG A HH11 7  
ATOM 9019  H HH12 . ARG A 1 68 ? -16.827 4.454   6.124   1.00 0.00 ? 68 ARG A HH12 7  
ATOM 9020  H HH21 . ARG A 1 68 ? -18.998 2.380   4.334   1.00 0.00 ? 68 ARG A HH21 7  
ATOM 9021  H HH22 . ARG A 1 68 ? -18.761 3.958   5.008   1.00 0.00 ? 68 ARG A HH22 7  
ATOM 9022  N N    . TYR A 1 69 ? -10.962 -1.626  5.534   1.00 0.00 ? 69 TYR A N    7  
ATOM 9023  C CA   . TYR A 1 69 ? -9.714  -1.668  6.287   1.00 0.00 ? 69 TYR A CA   7  
ATOM 9024  C C    . TYR A 1 69 ? -9.556  -0.420  7.151   1.00 0.00 ? 69 TYR A C    7  
ATOM 9025  O O    . TYR A 1 69 ? -9.135  -0.501  8.305   1.00 0.00 ? 69 TYR A O    7  
ATOM 9026  C CB   . TYR A 1 69 ? -8.524  -1.795  5.335   1.00 0.00 ? 69 TYR A CB   7  
ATOM 9027  C CG   . TYR A 1 69 ? -8.643  -2.950  4.365   1.00 0.00 ? 69 TYR A CG   7  
ATOM 9028  C CD1  . TYR A 1 69 ? -9.460  -2.861  3.246   1.00 0.00 ? 69 TYR A CD1  7  
ATOM 9029  C CD2  . TYR A 1 69 ? -7.938  -4.130  4.570   1.00 0.00 ? 69 TYR A CD2  7  
ATOM 9030  C CE1  . TYR A 1 69 ? -9.571  -3.914  2.357   1.00 0.00 ? 69 TYR A CE1  7  
ATOM 9031  C CE2  . TYR A 1 69 ? -8.043  -5.187  3.687   1.00 0.00 ? 69 TYR A CE2  7  
ATOM 9032  C CZ   . TYR A 1 69 ? -8.861  -5.073  2.582   1.00 0.00 ? 69 TYR A CZ   7  
ATOM 9033  O OH   . TYR A 1 69 ? -8.968  -6.124  1.700   1.00 0.00 ? 69 TYR A OH   7  
ATOM 9034  H H    . TYR A 1 69 ? -11.001 -1.113  4.700   1.00 0.00 ? 69 TYR A H    7  
ATOM 9035  H HA   . TYR A 1 69 ? -9.744  -2.534  6.930   1.00 0.00 ? 69 TYR A HA   7  
ATOM 9036  H HB2  . TYR A 1 69 ? -8.434  -0.888  4.758   1.00 0.00 ? 69 TYR A HB2  7  
ATOM 9037  H HB3  . TYR A 1 69 ? -7.622  -1.939  5.914   1.00 0.00 ? 69 TYR A HB3  7  
ATOM 9038  H HD1  . TYR A 1 69 ? -10.014 -1.950  3.072   1.00 0.00 ? 69 TYR A HD1  7  
ATOM 9039  H HD2  . TYR A 1 69 ? -7.298  -4.215  5.437   1.00 0.00 ? 69 TYR A HD2  7  
ATOM 9040  H HE1  . TYR A 1 69 ? -10.211 -3.824  1.493   1.00 0.00 ? 69 TYR A HE1  7  
ATOM 9041  H HE2  . TYR A 1 69 ? -7.487  -6.095  3.864   1.00 0.00 ? 69 TYR A HE2  7  
ATOM 9042  H HH   . TYR A 1 69 ? -8.184  -6.161  1.147   1.00 0.00 ? 69 TYR A HH   7  
ATOM 9043  N N    . PHE A 1 70 ? -9.897  0.732   6.584   1.00 0.00 ? 70 PHE A N    7  
ATOM 9044  C CA   . PHE A 1 70 ? -9.793  1.997   7.301   1.00 0.00 ? 70 PHE A CA   7  
ATOM 9045  C C    . PHE A 1 70 ? -10.838 2.991   6.805   1.00 0.00 ? 70 PHE A C    7  
ATOM 9046  O O    . PHE A 1 70 ? -11.356 2.861   5.696   1.00 0.00 ? 70 PHE A O    7  
ATOM 9047  C CB   . PHE A 1 70 ? -8.392  2.587   7.134   1.00 0.00 ? 70 PHE A CB   7  
ATOM 9048  C CG   . PHE A 1 70 ? -7.973  2.744   5.700   1.00 0.00 ? 70 PHE A CG   7  
ATOM 9049  C CD1  . PHE A 1 70 ? -8.373  3.849   4.965   1.00 0.00 ? 70 PHE A CD1  7  
ATOM 9050  C CD2  . PHE A 1 70 ? -7.182  1.787   5.087   1.00 0.00 ? 70 PHE A CD2  7  
ATOM 9051  C CE1  . PHE A 1 70 ? -7.991  3.997   3.645   1.00 0.00 ? 70 PHE A CE1  7  
ATOM 9052  C CE2  . PHE A 1 70 ? -6.796  1.929   3.766   1.00 0.00 ? 70 PHE A CE2  7  
ATOM 9053  C CZ   . PHE A 1 70 ? -7.201  3.035   3.045   1.00 0.00 ? 70 PHE A CZ   7  
ATOM 9054  H H    . PHE A 1 70 ? -10.226 0.732   5.660   1.00 0.00 ? 70 PHE A H    7  
ATOM 9055  H HA   . PHE A 1 70 ? -9.969  1.800   8.348   1.00 0.00 ? 70 PHE A HA   7  
ATOM 9056  H HB2  . PHE A 1 70 ? -8.361  3.562   7.597   1.00 0.00 ? 70 PHE A HB2  7  
ATOM 9057  H HB3  . PHE A 1 70 ? -7.676  1.941   7.621   1.00 0.00 ? 70 PHE A HB3  7  
ATOM 9058  H HD1  . PHE A 1 70 ? -8.990  4.602   5.434   1.00 0.00 ? 70 PHE A HD1  7  
ATOM 9059  H HD2  . PHE A 1 70 ? -6.865  0.921   5.650   1.00 0.00 ? 70 PHE A HD2  7  
ATOM 9060  H HE1  . PHE A 1 70 ? -8.309  4.862   3.084   1.00 0.00 ? 70 PHE A HE1  7  
ATOM 9061  H HE2  . PHE A 1 70 ? -6.180  1.175   3.300   1.00 0.00 ? 70 PHE A HE2  7  
ATOM 9062  H HZ   . PHE A 1 70 ? -6.902  3.148   2.014   1.00 0.00 ? 70 PHE A HZ   7  
ATOM 9063  N N    . GLU A 1 71 ? -11.142 3.984   7.634   1.00 0.00 ? 71 GLU A N    7  
ATOM 9064  C CA   . GLU A 1 71 ? -12.126 5.001   7.278   1.00 0.00 ? 71 GLU A CA   7  
ATOM 9065  C C    . GLU A 1 71 ? -11.441 6.312   6.905   1.00 0.00 ? 71 GLU A C    7  
ATOM 9066  O O    . GLU A 1 71 ? -11.023 7.076   7.775   1.00 0.00 ? 71 GLU A O    7  
ATOM 9067  C CB   . GLU A 1 71 ? -13.098 5.228   8.438   1.00 0.00 ? 71 GLU A CB   7  
ATOM 9068  C CG   . GLU A 1 71 ? -14.509 4.739   8.152   1.00 0.00 ? 71 GLU A CG   7  
ATOM 9069  C CD   . GLU A 1 71 ? -15.536 5.337   9.093   1.00 0.00 ? 71 GLU A CD   7  
ATOM 9070  O OE1  . GLU A 1 71 ? -15.275 6.430   9.640   1.00 0.00 ? 71 GLU A OE1  7  
ATOM 9071  O OE2  . GLU A 1 71 ? -16.601 4.714   9.284   1.00 0.00 ? 71 GLU A OE2  7  
ATOM 9072  H H    . GLU A 1 71 ? -10.695 4.036   8.504   1.00 0.00 ? 71 GLU A H    7  
ATOM 9073  H HA   . GLU A 1 71 ? -12.678 4.642   6.423   1.00 0.00 ? 71 GLU A HA   7  
ATOM 9074  H HB2  . GLU A 1 71 ? -12.731 4.705   9.309   1.00 0.00 ? 71 GLU A HB2  7  
ATOM 9075  H HB3  . GLU A 1 71 ? -13.145 6.284   8.657   1.00 0.00 ? 71 GLU A HB3  7  
ATOM 9076  H HG2  . GLU A 1 71 ? -14.772 5.010   7.139   1.00 0.00 ? 71 GLU A HG2  7  
ATOM 9077  H HG3  . GLU A 1 71 ? -14.532 3.665   8.254   1.00 0.00 ? 71 GLU A HG3  7  
ATOM 9078  N N    . CYS A 1 72 ? -11.329 6.565   5.605   1.00 0.00 ? 72 CYS A N    7  
ATOM 9079  C CA   . CYS A 1 72 ? -10.695 7.784   5.115   1.00 0.00 ? 72 CYS A CA   7  
ATOM 9080  C C    . CYS A 1 72 ? -11.440 8.333   3.901   1.00 0.00 ? 72 CYS A C    7  
ATOM 9081  O O    . CYS A 1 72 ? -12.333 7.680   3.362   1.00 0.00 ? 72 CYS A O    7  
ATOM 9082  C CB   . CYS A 1 72 ? -9.233  7.512   4.755   1.00 0.00 ? 72 CYS A CB   7  
ATOM 9083  S SG   . CYS A 1 72 ? -8.048  8.092   5.993   1.00 0.00 ? 72 CYS A SG   7  
ATOM 9084  H H    . CYS A 1 72 ? -11.682 5.918   4.960   1.00 0.00 ? 72 CYS A H    7  
ATOM 9085  H HA   . CYS A 1 72 ? -10.730 8.516   5.907   1.00 0.00 ? 72 CYS A HA   7  
ATOM 9086  H HB2  . CYS A 1 72 ? -9.089  6.448   4.640   1.00 0.00 ? 72 CYS A HB2  7  
ATOM 9087  H HB3  . CYS A 1 72 ? -9.000  8.004   3.822   1.00 0.00 ? 72 CYS A HB3  7  
ATOM 9088  H HG   . CYS A 1 72 ? -8.539  8.337   6.781   1.00 0.00 ? 72 CYS A HG   7  
ATOM 9089  N N    . PRO A 1 73 ? -11.080 9.549   3.453   1.00 0.00 ? 73 PRO A N    7  
ATOM 9090  C CA   . PRO A 1 73 ? -11.719 10.185  2.296   1.00 0.00 ? 73 PRO A CA   7  
ATOM 9091  C C    . PRO A 1 73 ? -11.745 9.272   1.075   1.00 0.00 ? 73 PRO A C    7  
ATOM 9092  O O    . PRO A 1 73 ? -10.969 8.321   0.981   1.00 0.00 ? 73 PRO A O    7  
ATOM 9093  C CB   . PRO A 1 73 ? -10.839 11.409  2.031   1.00 0.00 ? 73 PRO A CB   7  
ATOM 9094  C CG   . PRO A 1 73 ? -10.217 11.720  3.347   1.00 0.00 ? 73 PRO A CG   7  
ATOM 9095  C CD   . PRO A 1 73 ? -10.024 10.398  4.038   1.00 0.00 ? 73 PRO A CD   7  
ATOM 9096  H HA   . PRO A 1 73 ? -12.725 10.505  2.527   1.00 0.00 ? 73 PRO A HA   7  
ATOM 9097  H HB2  . PRO A 1 73 ? -10.093 11.164  1.288   1.00 0.00 ? 73 PRO A HB2  7  
ATOM 9098  H HB3  . PRO A 1 73 ? -11.450 12.226  1.681   1.00 0.00 ? 73 PRO A HB3  7  
ATOM 9099  H HG2  . PRO A 1 73 ? -9.265  12.207  3.198   1.00 0.00 ? 73 PRO A HG2  7  
ATOM 9100  H HG3  . PRO A 1 73 ? -10.876 12.351  3.926   1.00 0.00 ? 73 PRO A HG3  7  
ATOM 9101  H HD2  . PRO A 1 73 ? -9.044  9.998   3.821   1.00 0.00 ? 73 PRO A HD2  7  
ATOM 9102  H HD3  . PRO A 1 73 ? -10.163 10.504  5.103   1.00 0.00 ? 73 PRO A HD3  7  
ATOM 9103  N N    . ALA A 1 74 ? -12.643 9.568   0.140   1.00 0.00 ? 74 ALA A N    7  
ATOM 9104  C CA   . ALA A 1 74 ? -12.770 8.774   -1.075  1.00 0.00 ? 74 ALA A CA   7  
ATOM 9105  C C    . ALA A 1 74 ? -11.680 9.127   -2.080  1.00 0.00 ? 74 ALA A C    7  
ATOM 9106  O O    . ALA A 1 74 ? -11.165 10.246  -2.084  1.00 0.00 ? 74 ALA A O    7  
ATOM 9107  C CB   . ALA A 1 74 ? -14.145 8.975   -1.694  1.00 0.00 ? 74 ALA A CB   7  
ATOM 9108  H H    . ALA A 1 74 ? -13.234 10.339  0.271   1.00 0.00 ? 74 ALA A H    7  
ATOM 9109  H HA   . ALA A 1 74 ? -12.672 7.732   -0.804  1.00 0.00 ? 74 ALA A HA   7  
ATOM 9110  H HB1  . ALA A 1 74 ? -14.390 8.124   -2.312  1.00 0.00 ? 74 ALA A HB1  7  
ATOM 9111  H HB2  . ALA A 1 74 ? -14.141 9.869   -2.299  1.00 0.00 ? 74 ALA A HB2  7  
ATOM 9112  H HB3  . ALA A 1 74 ? -14.881 9.074   -0.910  1.00 0.00 ? 74 ALA A HB3  7  
ATOM 9113  N N    . LEU A 1 75 ? -11.331 8.167   -2.930  1.00 0.00 ? 75 LEU A N    7  
ATOM 9114  C CA   . LEU A 1 75 ? -10.301 8.377   -3.941  1.00 0.00 ? 75 LEU A CA   7  
ATOM 9115  C C    . LEU A 1 75 ? -8.964  8.726   -3.291  1.00 0.00 ? 75 LEU A C    7  
ATOM 9116  O O    . LEU A 1 75 ? -8.154  9.451   -3.869  1.00 0.00 ? 75 LEU A O    7  
ATOM 9117  C CB   . LEU A 1 75 ? -10.721 9.490   -4.903  1.00 0.00 ? 75 LEU A CB   7  
ATOM 9118  C CG   . LEU A 1 75 ? -12.106 9.318   -5.528  1.00 0.00 ? 75 LEU A CG   7  
ATOM 9119  C CD1  . LEU A 1 75 ? -12.589 10.630  -6.123  1.00 0.00 ? 75 LEU A CD1  7  
ATOM 9120  C CD2  . LEU A 1 75 ? -12.078 8.227   -6.588  1.00 0.00 ? 75 LEU A CD2  7  
ATOM 9121  H H    . LEU A 1 75 ? -11.778 7.296   -2.877  1.00 0.00 ? 75 LEU A H    7  
ATOM 9122  H HA   . LEU A 1 75 ? -10.188 7.457   -4.495  1.00 0.00 ? 75 LEU A HA   7  
ATOM 9123  H HB2  . LEU A 1 75 ? -10.706 10.426  -4.364  1.00 0.00 ? 75 LEU A HB2  7  
ATOM 9124  H HB3  . LEU A 1 75 ? -9.994  9.542   -5.699  1.00 0.00 ? 75 LEU A HB3  7  
ATOM 9125  H HG   . LEU A 1 75 ? -12.805 9.021   -4.760  1.00 0.00 ? 75 LEU A HG   7  
ATOM 9126  H HD11 . LEU A 1 75 ? -13.661 10.705  -6.005  1.00 0.00 ? 75 LEU A HD11 7  
ATOM 9127  H HD12 . LEU A 1 75 ? -12.340 10.662  -7.173  1.00 0.00 ? 75 LEU A HD12 7  
ATOM 9128  H HD13 . LEU A 1 75 ? -12.112 11.454  -5.614  1.00 0.00 ? 75 LEU A HD13 7  
ATOM 9129  H HD21 . LEU A 1 75 ? -11.748 7.300   -6.143  1.00 0.00 ? 75 LEU A HD21 7  
ATOM 9130  H HD22 . LEU A 1 75 ? -11.396 8.509   -7.378  1.00 0.00 ? 75 LEU A HD22 7  
ATOM 9131  H HD23 . LEU A 1 75 ? -13.069 8.097   -6.998  1.00 0.00 ? 75 LEU A HD23 7  
ATOM 9132  N N    . GLN A 1 76 ? -8.742  8.205   -2.089  1.00 0.00 ? 76 GLN A N    7  
ATOM 9133  C CA   . GLN A 1 76 ? -7.504  8.462   -1.363  1.00 0.00 ? 76 GLN A CA   7  
ATOM 9134  C C    . GLN A 1 76 ? -6.942  7.174   -0.773  1.00 0.00 ? 76 GLN A C    7  
ATOM 9135  O O    . GLN A 1 76 ? -5.744  6.906   -0.865  1.00 0.00 ? 76 GLN A O    7  
ATOM 9136  C CB   . GLN A 1 76 ? -7.742  9.486   -0.251  1.00 0.00 ? 76 GLN A CB   7  
ATOM 9137  C CG   . GLN A 1 76 ? -7.724  10.926  -0.737  1.00 0.00 ? 76 GLN A CG   7  
ATOM 9138  C CD   . GLN A 1 76 ? -7.881  11.924  0.394   1.00 0.00 ? 76 GLN A CD   7  
ATOM 9139  O OE1  . GLN A 1 76 ? -8.743  12.802  0.346   1.00 0.00 ? 76 GLN A OE1  7  
ATOM 9140  N NE2  . GLN A 1 76 ? -7.046  11.795  1.418   1.00 0.00 ? 76 GLN A NE2  7  
ATOM 9141  H H    . GLN A 1 76 ? -9.427  7.636   -1.681  1.00 0.00 ? 76 GLN A H    7  
ATOM 9142  H HA   . GLN A 1 76 ? -6.789  8.863   -2.061  1.00 0.00 ? 76 GLN A HA   7  
ATOM 9143  H HB2  . GLN A 1 76 ? -8.704  9.292   0.201   1.00 0.00 ? 76 GLN A HB2  7  
ATOM 9144  H HB3  . GLN A 1 76 ? -6.973  9.371   0.499   1.00 0.00 ? 76 GLN A HB3  7  
ATOM 9145  H HG2  . GLN A 1 76 ? -6.782  11.113  -1.232  1.00 0.00 ? 76 GLN A HG2  7  
ATOM 9146  H HG3  . GLN A 1 76 ? -8.533  11.066  -1.437  1.00 0.00 ? 76 GLN A HG3  7  
ATOM 9147  H HE21 . GLN A 1 76 ? -6.384  11.073  1.388   1.00 0.00 ? 76 GLN A HE21 7  
ATOM 9148  H HE22 . GLN A 1 76 ? -7.125  12.427  2.162   1.00 0.00 ? 76 GLN A HE22 7  
ATOM 9149  N N    . GLY A 1 77 ? -7.816  6.382   -0.166  1.00 0.00 ? 77 GLY A N    7  
ATOM 9150  C CA   . GLY A 1 77 ? -7.393  5.129   0.433   1.00 0.00 ? 77 GLY A CA   7  
ATOM 9151  C C    . GLY A 1 77 ? -6.932  4.120   -0.599  1.00 0.00 ? 77 GLY A C    7  
ATOM 9152  O O    . GLY A 1 77 ? -7.669  3.198   -0.948  1.00 0.00 ? 77 GLY A O    7  
ATOM 9153  H H    . GLY A 1 77 ? -8.756  6.651   -0.125  1.00 0.00 ? 77 GLY A H    7  
ATOM 9154  H HA2  . GLY A 1 77 ? -6.580  5.326   1.117   1.00 0.00 ? 77 GLY A HA2  7  
ATOM 9155  H HA3  . GLY A 1 77 ? -8.221  4.710   0.985   1.00 0.00 ? 77 GLY A HA3  7  
ATOM 9156  N N    . ILE A 1 78 ? -5.708  4.294   -1.089  1.00 0.00 ? 78 ILE A N    7  
ATOM 9157  C CA   . ILE A 1 78 ? -5.150  3.391   -2.088  1.00 0.00 ? 78 ILE A CA   7  
ATOM 9158  C C    . ILE A 1 78 ? -4.307  2.302   -1.430  1.00 0.00 ? 78 ILE A C    7  
ATOM 9159  O O    . ILE A 1 78 ? -3.661  2.535   -0.409  1.00 0.00 ? 78 ILE A O    7  
ATOM 9160  C CB   . ILE A 1 78 ? -4.287  4.153   -3.114  1.00 0.00 ? 78 ILE A CB   7  
ATOM 9161  C CG1  . ILE A 1 78 ? -3.780  3.201   -4.201  1.00 0.00 ? 78 ILE A CG1  7  
ATOM 9162  C CG2  . ILE A 1 78 ? -3.122  4.847   -2.422  1.00 0.00 ? 78 ILE A CG2  7  
ATOM 9163  C CD1  . ILE A 1 78 ? -3.741  3.823   -5.579  1.00 0.00 ? 78 ILE A CD1  7  
ATOM 9164  H H    . ILE A 1 78 ? -5.170  5.049   -0.772  1.00 0.00 ? 78 ILE A H    7  
ATOM 9165  H HA   . ILE A 1 78 ? -5.972  2.927   -2.614  1.00 0.00 ? 78 ILE A HA   7  
ATOM 9166  H HB   . ILE A 1 78 ? -4.902  4.913   -3.572  1.00 0.00 ? 78 ILE A HB   7  
ATOM 9167  H HG12 . ILE A 1 78 ? -2.780  2.882   -3.953  1.00 0.00 ? 78 ILE A HG12 7  
ATOM 9168  H HG13 . ILE A 1 78 ? -4.428  2.338   -4.243  1.00 0.00 ? 78 ILE A HG13 7  
ATOM 9169  H HG21 . ILE A 1 78 ? -3.359  5.891   -2.278  1.00 0.00 ? 78 ILE A HG21 7  
ATOM 9170  H HG22 . ILE A 1 78 ? -2.236  4.760   -3.034  1.00 0.00 ? 78 ILE A HG22 7  
ATOM 9171  H HG23 . ILE A 1 78 ? -2.944  4.383   -1.464  1.00 0.00 ? 78 ILE A HG23 7  
ATOM 9172  H HD11 . ILE A 1 78 ? -3.508  3.063   -6.311  1.00 0.00 ? 78 ILE A HD11 7  
ATOM 9173  H HD12 . ILE A 1 78 ? -2.983  4.592   -5.605  1.00 0.00 ? 78 ILE A HD12 7  
ATOM 9174  H HD13 . ILE A 1 78 ? -4.703  4.258   -5.806  1.00 0.00 ? 78 ILE A HD13 7  
ATOM 9175  N N    . PHE A 1 79 ? -4.320  1.112   -2.023  1.00 0.00 ? 79 PHE A N    7  
ATOM 9176  C CA   . PHE A 1 79 ? -3.558  -0.013  -1.494  1.00 0.00 ? 79 PHE A CA   7  
ATOM 9177  C C    . PHE A 1 79 ? -2.402  -0.373  -2.422  1.00 0.00 ? 79 PHE A C    7  
ATOM 9178  O O    . PHE A 1 79 ? -2.538  -0.331  -3.644  1.00 0.00 ? 79 PHE A O    7  
ATOM 9179  C CB   . PHE A 1 79 ? -4.469  -1.226  -1.299  1.00 0.00 ? 79 PHE A CB   7  
ATOM 9180  C CG   . PHE A 1 79 ? -5.104  -1.288  0.061   1.00 0.00 ? 79 PHE A CG   7  
ATOM 9181  C CD1  . PHE A 1 79 ? -4.391  -1.755  1.153   1.00 0.00 ? 79 PHE A CD1  7  
ATOM 9182  C CD2  . PHE A 1 79 ? -6.415  -0.879  0.246   1.00 0.00 ? 79 PHE A CD2  7  
ATOM 9183  C CE1  . PHE A 1 79 ? -4.974  -1.814  2.404   1.00 0.00 ? 79 PHE A CE1  7  
ATOM 9184  C CE2  . PHE A 1 79 ? -7.003  -0.933  1.495   1.00 0.00 ? 79 PHE A CE2  7  
ATOM 9185  C CZ   . PHE A 1 79 ? -6.281  -1.402  2.576   1.00 0.00 ? 79 PHE A CZ   7  
ATOM 9186  H H    . PHE A 1 79 ? -4.855  0.988   -2.834  1.00 0.00 ? 79 PHE A H    7  
ATOM 9187  H HA   . PHE A 1 79 ? -3.155  0.281   -0.536  1.00 0.00 ? 79 PHE A HA   7  
ATOM 9188  H HB2  . PHE A 1 79 ? -5.259  -1.196  -2.034  1.00 0.00 ? 79 PHE A HB2  7  
ATOM 9189  H HB3  . PHE A 1 79 ? -3.890  -2.128  -1.437  1.00 0.00 ? 79 PHE A HB3  7  
ATOM 9190  H HD1  . PHE A 1 79 ? -3.369  -2.077  1.020   1.00 0.00 ? 79 PHE A HD1  7  
ATOM 9191  H HD2  . PHE A 1 79 ? -6.980  -0.513  -0.598  1.00 0.00 ? 79 PHE A HD2  7  
ATOM 9192  H HE1  . PHE A 1 79 ? -4.407  -2.179  3.247   1.00 0.00 ? 79 PHE A HE1  7  
ATOM 9193  H HE2  . PHE A 1 79 ? -8.025  -0.611  1.626   1.00 0.00 ? 79 PHE A HE2  7  
ATOM 9194  H HZ   . PHE A 1 79 ? -6.738  -1.445  3.553   1.00 0.00 ? 79 PHE A HZ   7  
ATOM 9195  N N    . THR A 1 80 ? -1.265  -0.729  -1.832  1.00 0.00 ? 80 THR A N    7  
ATOM 9196  C CA   . THR A 1 80 ? -0.085  -1.098  -2.603  1.00 0.00 ? 80 THR A CA   7  
ATOM 9197  C C    . THR A 1 80 ? 0.883   -1.918  -1.756  1.00 0.00 ? 80 THR A C    7  
ATOM 9198  O O    . THR A 1 80 ? 0.808   -1.909  -0.528  1.00 0.00 ? 80 THR A O    7  
ATOM 9199  C CB   . THR A 1 80 ? 0.617   0.154   -3.133  1.00 0.00 ? 80 THR A CB   7  
ATOM 9200  O OG1  . THR A 1 80 ? 1.822   -0.188  -3.794  1.00 0.00 ? 80 THR A OG1  7  
ATOM 9201  C CG2  . THR A 1 80 ? 0.954   1.154   -2.049  1.00 0.00 ? 80 THR A CG2  7  
ATOM 9202  H H    . THR A 1 80 ? -1.219  -0.743  -0.853  1.00 0.00 ? 80 THR A H    7  
ATOM 9203  H HA   . THR A 1 80 ? -0.410  -1.698  -3.440  1.00 0.00 ? 80 THR A HA   7  
ATOM 9204  H HB   . THR A 1 80 ? -0.033  0.644   -3.844  1.00 0.00 ? 80 THR A HB   7  
ATOM 9205  H HG1  . THR A 1 80 ? 2.463   -0.500  -3.151  1.00 0.00 ? 80 THR A HG1  7  
ATOM 9206  H HG21 . THR A 1 80 ? 0.327   2.027   -2.156  1.00 0.00 ? 80 THR A HG21 7  
ATOM 9207  H HG22 . THR A 1 80 ? 1.992   1.443   -2.137  1.00 0.00 ? 80 THR A HG22 7  
ATOM 9208  H HG23 . THR A 1 80 ? 0.786   0.707   -1.081  1.00 0.00 ? 80 THR A HG23 7  
ATOM 9209  N N    . ARG A 1 81 ? 1.790   -2.627  -2.420  1.00 0.00 ? 81 ARG A N    7  
ATOM 9210  C CA   . ARG A 1 81 ? 2.771   -3.453  -1.726  1.00 0.00 ? 81 ARG A CA   7  
ATOM 9211  C C    . ARG A 1 81 ? 3.711   -2.591  -0.883  1.00 0.00 ? 81 ARG A C    7  
ATOM 9212  O O    . ARG A 1 81 ? 4.137   -1.522  -1.317  1.00 0.00 ? 81 ARG A O    7  
ATOM 9213  C CB   . ARG A 1 81 ? 3.578   -4.275  -2.732  1.00 0.00 ? 81 ARG A CB   7  
ATOM 9214  C CG   . ARG A 1 81 ? 2.716   -4.999  -3.756  1.00 0.00 ? 81 ARG A CG   7  
ATOM 9215  C CD   . ARG A 1 81 ? 3.230   -4.787  -5.173  1.00 0.00 ? 81 ARG A CD   7  
ATOM 9216  N NE   . ARG A 1 81 ? 2.142   -4.537  -6.116  1.00 0.00 ? 81 ARG A NE   7  
ATOM 9217  C CZ   . ARG A 1 81 ? 2.316   -4.407  -7.429  1.00 0.00 ? 81 ARG A CZ   7  
ATOM 9218  N NH1  . ARG A 1 81 ? 3.530   -4.505  -7.958  1.00 0.00 ? 81 ARG A NH1  7  
ATOM 9219  N NH2  . ARG A 1 81 ? 1.273   -4.179  -8.216  1.00 0.00 ? 81 ARG A NH2  7  
ATOM 9220  H H    . ARG A 1 81 ? 1.799   -2.594  -3.399  1.00 0.00 ? 81 ARG A H    7  
ATOM 9221  H HA   . ARG A 1 81 ? 2.233   -4.125  -1.076  1.00 0.00 ? 81 ARG A HA   7  
ATOM 9222  H HB2  . ARG A 1 81 ? 4.252   -3.616  -3.259  1.00 0.00 ? 81 ARG A HB2  7  
ATOM 9223  H HB3  . ARG A 1 81 ? 4.156   -5.013  -2.195  1.00 0.00 ? 81 ARG A HB3  7  
ATOM 9224  H HG2  . ARG A 1 81 ? 2.725   -6.056  -3.536  1.00 0.00 ? 81 ARG A HG2  7  
ATOM 9225  H HG3  . ARG A 1 81 ? 1.706   -4.624  -3.689  1.00 0.00 ? 81 ARG A HG3  7  
ATOM 9226  H HD2  . ARG A 1 81 ? 3.899   -3.940  -5.177  1.00 0.00 ? 81 ARG A HD2  7  
ATOM 9227  H HD3  . ARG A 1 81 ? 3.767   -5.672  -5.482  1.00 0.00 ? 81 ARG A HD3  7  
ATOM 9228  H HE   . ARG A 1 81 ? 1.236   -4.461  -5.752  1.00 0.00 ? 81 ARG A HE   7  
ATOM 9229  H HH11 . ARG A 1 81 ? 4.320   -4.676  -7.370  1.00 0.00 ? 81 ARG A HH11 7  
ATOM 9230  H HH12 . ARG A 1 81 ? 3.653   -4.406  -8.946  1.00 0.00 ? 81 ARG A HH12 7  
ATOM 9231  H HH21 . ARG A 1 81 ? 0.356   -4.106  -7.823  1.00 0.00 ? 81 ARG A HH21 7  
ATOM 9232  H HH22 . ARG A 1 81 ? 1.403   -4.082  -9.203  1.00 0.00 ? 81 ARG A HH22 7  
ATOM 9233  N N    . PRO A 1 82 ? 4.049   -3.048  0.337   1.00 0.00 ? 82 PRO A N    7  
ATOM 9234  C CA   . PRO A 1 82 ? 4.943   -2.308  1.234   1.00 0.00 ? 82 PRO A CA   7  
ATOM 9235  C C    . PRO A 1 82 ? 6.273   -1.963  0.572   1.00 0.00 ? 82 PRO A C    7  
ATOM 9236  O O    . PRO A 1 82 ? 6.815   -0.876  0.774   1.00 0.00 ? 82 PRO A O    7  
ATOM 9237  C CB   . PRO A 1 82 ? 5.166   -3.275  2.400   1.00 0.00 ? 82 PRO A CB   7  
ATOM 9238  C CG   . PRO A 1 82 ? 3.979   -4.174  2.382   1.00 0.00 ? 82 PRO A CG   7  
ATOM 9239  C CD   . PRO A 1 82 ? 3.589   -4.315  0.937   1.00 0.00 ? 82 PRO A CD   7  
ATOM 9240  H HA   . PRO A 1 82 ? 4.479   -1.403  1.597   1.00 0.00 ? 82 PRO A HA   7  
ATOM 9241  H HB2  . PRO A 1 82 ? 6.082   -3.827  2.243   1.00 0.00 ? 82 PRO A HB2  7  
ATOM 9242  H HB3  . PRO A 1 82 ? 5.226   -2.721  3.325   1.00 0.00 ? 82 PRO A HB3  7  
ATOM 9243  H HG2  . PRO A 1 82 ? 4.240   -5.136  2.795   1.00 0.00 ? 82 PRO A HG2  7  
ATOM 9244  H HG3  . PRO A 1 82 ? 3.172   -3.729  2.946   1.00 0.00 ? 82 PRO A HG3  7  
ATOM 9245  H HD2  . PRO A 1 82 ? 4.093   -5.158  0.491   1.00 0.00 ? 82 PRO A HD2  7  
ATOM 9246  H HD3  . PRO A 1 82 ? 2.519   -4.418  0.844   1.00 0.00 ? 82 PRO A HD3  7  
ATOM 9247  N N    . SER A 1 83 ? 6.793   -2.894  -0.221  1.00 0.00 ? 83 SER A N    7  
ATOM 9248  C CA   . SER A 1 83 ? 8.061   -2.691  -0.913  1.00 0.00 ? 83 SER A CA   7  
ATOM 9249  C C    . SER A 1 83 ? 8.004   -1.453  -1.803  1.00 0.00 ? 83 SER A C    7  
ATOM 9250  O O    . SER A 1 83 ? 8.990   -0.728  -1.937  1.00 0.00 ? 83 SER A O    7  
ATOM 9251  C CB   . SER A 1 83 ? 8.411   -3.920  -1.751  1.00 0.00 ? 83 SER A CB   7  
ATOM 9252  O OG   . SER A 1 83 ? 7.663   -3.949  -2.955  1.00 0.00 ? 83 SER A OG   7  
ATOM 9253  H H    . SER A 1 83 ? 6.313   -3.741  -0.342  1.00 0.00 ? 83 SER A H    7  
ATOM 9254  H HA   . SER A 1 83 ? 8.826   -2.546  -0.166  1.00 0.00 ? 83 SER A HA   7  
ATOM 9255  H HB2  . SER A 1 83 ? 9.462   -3.899  -1.997  1.00 0.00 ? 83 SER A HB2  7  
ATOM 9256  H HB3  . SER A 1 83 ? 8.192   -4.814  -1.185  1.00 0.00 ? 83 SER A HB3  7  
ATOM 9257  H HG   . SER A 1 83 ? 6.748   -4.160  -2.758  1.00 0.00 ? 83 SER A HG   7  
ATOM 9258  N N    . LYS A 1 84 ? 6.846   -1.220  -2.410  1.00 0.00 ? 84 LYS A N    7  
ATOM 9259  C CA   . LYS A 1 84 ? 6.661   -0.069  -3.289  1.00 0.00 ? 84 LYS A CA   7  
ATOM 9260  C C    . LYS A 1 84 ? 6.728   1.234   -2.500  1.00 0.00 ? 84 LYS A C    7  
ATOM 9261  O O    . LYS A 1 84 ? 7.144   2.268   -3.025  1.00 0.00 ? 84 LYS A O    7  
ATOM 9262  C CB   . LYS A 1 84 ? 5.322   -0.170  -4.020  1.00 0.00 ? 84 LYS A CB   7  
ATOM 9263  C CG   . LYS A 1 84 ? 5.199   -1.404  -4.898  1.00 0.00 ? 84 LYS A CG   7  
ATOM 9264  C CD   . LYS A 1 84 ? 6.254   -1.417  -5.992  1.00 0.00 ? 84 LYS A CD   7  
ATOM 9265  C CE   . LYS A 1 84 ? 5.753   -2.128  -7.240  1.00 0.00 ? 84 LYS A CE   7  
ATOM 9266  N NZ   . LYS A 1 84 ? 6.814   -2.963  -7.867  1.00 0.00 ? 84 LYS A NZ   7  
ATOM 9267  H H    . LYS A 1 84 ? 6.097   -1.834  -2.265  1.00 0.00 ? 84 LYS A H    7  
ATOM 9268  H HA   . LYS A 1 84 ? 7.460   -0.078  -4.016  1.00 0.00 ? 84 LYS A HA   7  
ATOM 9269  H HB2  . LYS A 1 84 ? 4.527   -0.194  -3.288  1.00 0.00 ? 84 LYS A HB2  7  
ATOM 9270  H HB3  . LYS A 1 84 ? 5.200   0.703   -4.644  1.00 0.00 ? 84 LYS A HB3  7  
ATOM 9271  H HG2  . LYS A 1 84 ? 5.322   -2.284  -4.285  1.00 0.00 ? 84 LYS A HG2  7  
ATOM 9272  H HG3  . LYS A 1 84 ? 4.219   -1.415  -5.352  1.00 0.00 ? 84 LYS A HG3  7  
ATOM 9273  H HD2  . LYS A 1 84 ? 6.505   -0.398  -6.248  1.00 0.00 ? 84 LYS A HD2  7  
ATOM 9274  H HD3  . LYS A 1 84 ? 7.133   -1.926  -5.627  1.00 0.00 ? 84 LYS A HD3  7  
ATOM 9275  H HE2  . LYS A 1 84 ? 4.922   -2.762  -6.969  1.00 0.00 ? 84 LYS A HE2  7  
ATOM 9276  H HE3  . LYS A 1 84 ? 5.422   -1.387  -7.953  1.00 0.00 ? 84 LYS A HE3  7  
ATOM 9277  H HZ1  . LYS A 1 84 ? 7.754   -2.609  -7.596  1.00 0.00 ? 84 LYS A HZ1  7  
ATOM 9278  H HZ2  . LYS A 1 84 ? 6.730   -2.933  -8.902  1.00 0.00 ? 84 LYS A HZ2  7  
ATOM 9279  H HZ3  . LYS A 1 84 ? 6.724   -3.951  -7.552  1.00 0.00 ? 84 LYS A HZ3  7  
ATOM 9280  N N    . LEU A 1 85 ? 6.316   1.180   -1.238  1.00 0.00 ? 85 LEU A N    7  
ATOM 9281  C CA   . LEU A 1 85 ? 6.330   2.358   -0.378  1.00 0.00 ? 85 LEU A CA   7  
ATOM 9282  C C    . LEU A 1 85 ? 7.754   2.706   0.047   1.00 0.00 ? 85 LEU A C    7  
ATOM 9283  O O    . LEU A 1 85 ? 8.552   1.823   0.360   1.00 0.00 ? 85 LEU A O    7  
ATOM 9284  C CB   . LEU A 1 85 ? 5.459   2.125   0.858   1.00 0.00 ? 85 LEU A CB   7  
ATOM 9285  C CG   . LEU A 1 85 ? 4.039   1.636   0.567   1.00 0.00 ? 85 LEU A CG   7  
ATOM 9286  C CD1  . LEU A 1 85 ? 3.302   1.335   1.863   1.00 0.00 ? 85 LEU A CD1  7  
ATOM 9287  C CD2  . LEU A 1 85 ? 3.279   2.668   -0.252  1.00 0.00 ? 85 LEU A CD2  7  
ATOM 9288  H H    . LEU A 1 85 ? 5.996   0.329   -0.875  1.00 0.00 ? 85 LEU A H    7  
ATOM 9289  H HA   . LEU A 1 85 ? 5.924   3.185   -0.942  1.00 0.00 ? 85 LEU A HA   7  
ATOM 9290  H HB2  . LEU A 1 85 ? 5.948   1.393   1.484   1.00 0.00 ? 85 LEU A HB2  7  
ATOM 9291  H HB3  . LEU A 1 85 ? 5.391   3.054   1.405   1.00 0.00 ? 85 LEU A HB3  7  
ATOM 9292  H HG   . LEU A 1 85 ? 4.091   0.722   -0.008  1.00 0.00 ? 85 LEU A HG   7  
ATOM 9293  H HD11 . LEU A 1 85 ? 3.507   0.319   2.165   1.00 0.00 ? 85 LEU A HD11 7  
ATOM 9294  H HD12 . LEU A 1 85 ? 2.240   1.458   1.710   1.00 0.00 ? 85 LEU A HD12 7  
ATOM 9295  H HD13 . LEU A 1 85 ? 3.637   2.013   2.633   1.00 0.00 ? 85 LEU A HD13 7  
ATOM 9296  H HD21 . LEU A 1 85 ? 3.374   3.639   0.213   1.00 0.00 ? 85 LEU A HD21 7  
ATOM 9297  H HD22 . LEU A 1 85 ? 2.236   2.393   -0.300  1.00 0.00 ? 85 LEU A HD22 7  
ATOM 9298  H HD23 . LEU A 1 85 ? 3.688   2.707   -1.251  1.00 0.00 ? 85 LEU A HD23 7  
ATOM 9299  N N    . THR A 1 86 ? 8.064   3.999   0.057   1.00 0.00 ? 86 THR A N    7  
ATOM 9300  C CA   . THR A 1 86 ? 9.391   4.464   0.444   1.00 0.00 ? 86 THR A CA   7  
ATOM 9301  C C    . THR A 1 86 ? 9.293   5.606   1.450   1.00 0.00 ? 86 THR A C    7  
ATOM 9302  O O    . THR A 1 86 ? 8.248   6.243   1.582   1.00 0.00 ? 86 THR A O    7  
ATOM 9303  C CB   . THR A 1 86 ? 10.174  4.919   -0.788  1.00 0.00 ? 86 THR A CB   7  
ATOM 9304  O OG1  . THR A 1 86 ? 9.366   5.725   -1.627  1.00 0.00 ? 86 THR A OG1  7  
ATOM 9305  C CG2  . THR A 1 86 ? 10.699  3.770   -1.622  1.00 0.00 ? 86 THR A CG2  7  
ATOM 9306  H H    . THR A 1 86 ? 7.384   4.655   -0.203  1.00 0.00 ? 86 THR A H    7  
ATOM 9307  H HA   . THR A 1 86 ? 9.910   3.638   0.905   1.00 0.00 ? 86 THR A HA   7  
ATOM 9308  H HB   . THR A 1 86 ? 11.021  5.508   -0.466  1.00 0.00 ? 86 THR A HB   7  
ATOM 9309  H HG1  . THR A 1 86 ? 9.915   6.144   -2.293  1.00 0.00 ? 86 THR A HG1  7  
ATOM 9310  H HG21 . THR A 1 86 ? 9.884   3.321   -2.169  1.00 0.00 ? 86 THR A HG21 7  
ATOM 9311  H HG22 . THR A 1 86 ? 11.148  3.032   -0.975  1.00 0.00 ? 86 THR A HG22 7  
ATOM 9312  H HG23 . THR A 1 86 ? 11.439  4.138   -2.317  1.00 0.00 ? 86 THR A HG23 7  
ATOM 9313  N N    . ARG A 1 87 ? 10.390  5.861   2.157   1.00 0.00 ? 87 ARG A N    7  
ATOM 9314  C CA   . ARG A 1 87 ? 10.427  6.928   3.151   1.00 0.00 ? 87 ARG A CA   7  
ATOM 9315  C C    . ARG A 1 87 ? 11.096  8.177   2.588   1.00 0.00 ? 87 ARG A C    7  
ATOM 9316  O O    . ARG A 1 87 ? 11.703  8.954   3.325   1.00 0.00 ? 87 ARG A O    7  
ATOM 9317  C CB   . ARG A 1 87 ? 11.168  6.459   4.405   1.00 0.00 ? 87 ARG A CB   7  
ATOM 9318  C CG   . ARG A 1 87 ? 10.315  5.607   5.333   1.00 0.00 ? 87 ARG A CG   7  
ATOM 9319  C CD   . ARG A 1 87 ? 10.406  6.086   6.773   1.00 0.00 ? 87 ARG A CD   7  
ATOM 9320  N NE   . ARG A 1 87 ? 11.483  5.424   7.505   1.00 0.00 ? 87 ARG A NE   7  
ATOM 9321  C CZ   . ARG A 1 87 ? 11.875  5.777   8.726   1.00 0.00 ? 87 ARG A CZ   7  
ATOM 9322  N NH1  . ARG A 1 87 ? 11.283  6.784   9.357   1.00 0.00 ? 87 ARG A NH1  7  
ATOM 9323  N NH2  . ARG A 1 87 ? 12.863  5.121   9.320   1.00 0.00 ? 87 ARG A NH2  7  
ATOM 9324  H H    . ARG A 1 87 ? 11.192  5.319   2.007   1.00 0.00 ? 87 ARG A H    7  
ATOM 9325  H HA   . ARG A 1 87 ? 9.408   7.168   3.416   1.00 0.00 ? 87 ARG A HA   7  
ATOM 9326  H HB2  . ARG A 1 87 ? 12.027  5.877   4.104   1.00 0.00 ? 87 ARG A HB2  7  
ATOM 9327  H HB3  . ARG A 1 87 ? 11.506  7.326   4.953   1.00 0.00 ? 87 ARG A HB3  7  
ATOM 9328  H HG2  . ARG A 1 87 ? 9.287   5.661   5.011   1.00 0.00 ? 87 ARG A HG2  7  
ATOM 9329  H HG3  . ARG A 1 87 ? 10.658  4.584   5.281   1.00 0.00 ? 87 ARG A HG3  7  
ATOM 9330  H HD2  . ARG A 1 87 ? 10.585  7.152   6.774   1.00 0.00 ? 87 ARG A HD2  7  
ATOM 9331  H HD3  . ARG A 1 87 ? 9.468   5.880   7.266   1.00 0.00 ? 87 ARG A HD3  7  
ATOM 9332  H HE   . ARG A 1 87 ? 11.937  4.677   7.062   1.00 0.00 ? 87 ARG A HE   7  
ATOM 9333  H HH11 . ARG A 1 87 ? 10.538  7.282   8.915   1.00 0.00 ? 87 ARG A HH11 7  
ATOM 9334  H HH12 . ARG A 1 87 ? 11.583  7.043   10.275  1.00 0.00 ? 87 ARG A HH12 7  
ATOM 9335  H HH21 . ARG A 1 87 ? 13.313  4.361   8.850   1.00 0.00 ? 87 ARG A HH21 7  
ATOM 9336  H HH22 . ARG A 1 87 ? 13.158  5.386   10.238  1.00 0.00 ? 87 ARG A HH22 7  
ATOM 9337  N N    . GLN A 1 88 ? 10.982  8.365   1.276   1.00 0.00 ? 88 GLN A N    7  
ATOM 9338  C CA   . GLN A 1 88 ? 11.576  9.523   0.615   1.00 0.00 ? 88 GLN A CA   7  
ATOM 9339  C C    . GLN A 1 88 ? 11.280  9.506   -0.883  1.00 0.00 ? 88 GLN A C    7  
ATOM 9340  O O    . GLN A 1 88 ? 11.139  8.441   -1.483  1.00 0.00 ? 88 GLN A O    7  
ATOM 9341  C CB   . GLN A 1 88 ? 13.088  9.551   0.846   1.00 0.00 ? 88 GLN A CB   7  
ATOM 9342  C CG   . GLN A 1 88 ? 13.762  8.205   0.638   1.00 0.00 ? 88 GLN A CG   7  
ATOM 9343  C CD   . GLN A 1 88 ? 15.116  8.329   -0.033  1.00 0.00 ? 88 GLN A CD   7  
ATOM 9344  O OE1  . GLN A 1 88 ? 15.341  9.230   -0.841  1.00 0.00 ? 88 GLN A OE1  7  
ATOM 9345  N NE2  . GLN A 1 88 ? 16.026  7.421   0.300   1.00 0.00 ? 88 GLN A NE2  7  
ATOM 9346  H H    . GLN A 1 88 ? 10.487  7.712   0.741   1.00 0.00 ? 88 GLN A H    7  
ATOM 9347  H HA   . GLN A 1 88 ? 11.138  10.410  1.046   1.00 0.00 ? 88 GLN A HA   7  
ATOM 9348  H HB2  . GLN A 1 88 ? 13.532  10.261  0.163   1.00 0.00 ? 88 GLN A HB2  7  
ATOM 9349  H HB3  . GLN A 1 88 ? 13.280  9.873   1.860   1.00 0.00 ? 88 GLN A HB3  7  
ATOM 9350  H HG2  . GLN A 1 88 ? 13.896  7.731   1.599   1.00 0.00 ? 88 GLN A HG2  7  
ATOM 9351  H HG3  . GLN A 1 88 ? 13.124  7.590   0.020   1.00 0.00 ? 88 GLN A HG3  7  
ATOM 9352  H HE21 . GLN A 1 88 ? 15.777  6.731   0.950   1.00 0.00 ? 88 GLN A HE21 7  
ATOM 9353  H HE22 . GLN A 1 88 ? 16.911  7.477   -0.119  1.00 0.00 ? 88 GLN A HE22 7  
ATOM 9354  N N    . PRO A 1 89 ? 11.180  10.692  -1.507  1.00 0.00 ? 89 PRO A N    7  
ATOM 9355  C CA   . PRO A 1 89 ? 10.899  10.808  -2.942  1.00 0.00 ? 89 PRO A CA   7  
ATOM 9356  C C    . PRO A 1 89 ? 12.070  10.345  -3.800  1.00 0.00 ? 89 PRO A C    7  
ATOM 9357  O O    . PRO A 1 89 ? 13.220  10.366  -3.363  1.00 0.00 ? 89 PRO A O    7  
ATOM 9358  C CB   . PRO A 1 89 ? 10.652  12.306  -3.136  1.00 0.00 ? 89 PRO A CB   7  
ATOM 9359  C CG   . PRO A 1 89 ? 11.404  12.960  -2.029  1.00 0.00 ? 89 PRO A CG   7  
ATOM 9360  C CD   . PRO A 1 89 ? 11.335  12.011  -0.865  1.00 0.00 ? 89 PRO A CD   7  
ATOM 9361  H HA   . PRO A 1 89 ? 10.012  10.255  -3.215  1.00 0.00 ? 89 PRO A HA   7  
ATOM 9362  H HB2  . PRO A 1 89 ? 11.025  12.611  -4.103  1.00 0.00 ? 89 PRO A HB2  7  
ATOM 9363  H HB3  . PRO A 1 89 ? 9.595   12.511  -3.070  1.00 0.00 ? 89 PRO A HB3  7  
ATOM 9364  H HG2  . PRO A 1 89 ? 12.431  13.117  -2.325  1.00 0.00 ? 89 PRO A HG2  7  
ATOM 9365  H HG3  . PRO A 1 89 ? 10.937  13.900  -1.774  1.00 0.00 ? 89 PRO A HG3  7  
ATOM 9366  H HD2  . PRO A 1 89 ? 12.247  12.054  -0.288  1.00 0.00 ? 89 PRO A HD2  7  
ATOM 9367  H HD3  . PRO A 1 89 ? 10.482  12.238  -0.243  1.00 0.00 ? 89 PRO A HD3  7  
ATOM 9368  N N    . SER A 1 90 ? 11.769  9.925   -5.025  1.00 0.00 ? 90 SER A N    7  
ATOM 9369  C CA   . SER A 1 90 ? 12.798  9.455   -5.946  1.00 0.00 ? 90 SER A CA   7  
ATOM 9370  C C    . SER A 1 90 ? 13.510  10.630  -6.610  1.00 0.00 ? 90 SER A C    7  
ATOM 9371  O O    . SER A 1 90 ? 13.057  11.146  -7.632  1.00 0.00 ? 90 SER A O    7  
ATOM 9372  C CB   . SER A 1 90 ? 12.182  8.549   -7.012  1.00 0.00 ? 90 SER A CB   7  
ATOM 9373  O OG   . SER A 1 90 ? 13.145  8.175   -7.983  1.00 0.00 ? 90 SER A OG   7  
ATOM 9374  H H    . SER A 1 90 ? 10.833  9.930   -5.316  1.00 0.00 ? 90 SER A H    7  
ATOM 9375  H HA   . SER A 1 90 ? 13.519  8.889   -5.376  1.00 0.00 ? 90 SER A HA   7  
ATOM 9376  H HB2  . SER A 1 90 ? 11.797  7.656   -6.544  1.00 0.00 ? 90 SER A HB2  7  
ATOM 9377  H HB3  . SER A 1 90 ? 11.376  9.072   -7.507  1.00 0.00 ? 90 SER A HB3  7  
ATOM 9378  H HG   . SER A 1 90 ? 13.934  7.851   -7.542  1.00 0.00 ? 90 SER A HG   7  
ATOM 9379  N N    . GLY A 1 91 ? 14.627  11.048  -6.022  1.00 0.00 ? 91 GLY A N    7  
ATOM 9380  C CA   . GLY A 1 91 ? 15.384  12.158  -6.570  1.00 0.00 ? 91 GLY A CA   7  
ATOM 9381  C C    . GLY A 1 91 ? 15.325  13.393  -5.689  1.00 0.00 ? 91 GLY A C    7  
ATOM 9382  O O    . GLY A 1 91 ? 16.119  13.531  -4.760  1.00 0.00 ? 91 GLY A O    7  
ATOM 9383  H H    . GLY A 1 91 ? 14.938  10.598  -5.210  1.00 0.00 ? 91 GLY A H    7  
ATOM 9384  H HA2  . GLY A 1 91 ? 16.415  11.856  -6.678  1.00 0.00 ? 91 GLY A HA2  7  
ATOM 9385  H HA3  . GLY A 1 91 ? 14.988  12.404  -7.544  1.00 0.00 ? 91 GLY A HA3  7  
ATOM 9386  N N    . PRO A 1 92 ? 14.385  14.316  -5.958  1.00 0.00 ? 92 PRO A N    7  
ATOM 9387  C CA   . PRO A 1 92 ? 14.239  15.545  -5.171  1.00 0.00 ? 92 PRO A CA   7  
ATOM 9388  C C    . PRO A 1 92 ? 13.671  15.279  -3.781  1.00 0.00 ? 92 PRO A C    7  
ATOM 9389  O O    . PRO A 1 92 ? 12.481  15.005  -3.627  1.00 0.00 ? 92 PRO A O    7  
ATOM 9390  C CB   . PRO A 1 92 ? 13.260  16.380  -5.997  1.00 0.00 ? 92 PRO A CB   7  
ATOM 9391  C CG   . PRO A 1 92 ? 12.461  15.380  -6.758  1.00 0.00 ? 92 PRO A CG   7  
ATOM 9392  C CD   . PRO A 1 92 ? 13.394  14.236  -7.047  1.00 0.00 ? 92 PRO A CD   7  
ATOM 9393  H HA   . PRO A 1 92 ? 15.178  16.070  -5.081  1.00 0.00 ? 92 PRO A HA   7  
ATOM 9394  H HB2  . PRO A 1 92 ? 12.637  16.967  -5.337  1.00 0.00 ? 92 PRO A HB2  7  
ATOM 9395  H HB3  . PRO A 1 92 ? 13.808  17.033  -6.660  1.00 0.00 ? 92 PRO A HB3  7  
ATOM 9396  H HG2  . PRO A 1 92 ? 11.627  15.043  -6.159  1.00 0.00 ? 92 PRO A HG2  7  
ATOM 9397  H HG3  . PRO A 1 92 ? 12.108  15.818  -7.680  1.00 0.00 ? 92 PRO A HG3  7  
ATOM 9398  H HD2  . PRO A 1 92 ? 12.860  13.297  -7.014  1.00 0.00 ? 92 PRO A HD2  7  
ATOM 9399  H HD3  . PRO A 1 92 ? 13.867  14.368  -8.009  1.00 0.00 ? 92 PRO A HD3  7  
ATOM 9400  N N    . SER A 1 93 ? 14.531  15.362  -2.770  1.00 0.00 ? 93 SER A N    7  
ATOM 9401  C CA   . SER A 1 93 ? 14.115  15.131  -1.392  1.00 0.00 ? 93 SER A CA   7  
ATOM 9402  C C    . SER A 1 93 ? 14.154  16.427  -0.588  1.00 0.00 ? 93 SER A C    7  
ATOM 9403  O O    . SER A 1 93 ? 14.824  17.385  -0.970  1.00 0.00 ? 93 SER A O    7  
ATOM 9404  C CB   . SER A 1 93 ? 15.015  14.083  -0.734  1.00 0.00 ? 93 SER A CB   7  
ATOM 9405  O OG   . SER A 1 93 ? 16.385  14.383  -0.941  1.00 0.00 ? 93 SER A OG   7  
ATOM 9406  H H    . SER A 1 93 ? 15.468  15.584  -2.955  1.00 0.00 ? 93 SER A H    7  
ATOM 9407  H HA   . SER A 1 93 ? 13.101  14.762  -1.408  1.00 0.00 ? 93 SER A HA   7  
ATOM 9408  H HB2  . SER A 1 93 ? 14.822  14.059  0.328   1.00 0.00 ? 93 SER A HB2  7  
ATOM 9409  H HB3  . SER A 1 93 ? 14.803  13.112  -1.159  1.00 0.00 ? 93 SER A HB3  7  
ATOM 9410  H HG   . SER A 1 93 ? 16.560  15.286  -0.667  1.00 0.00 ? 93 SER A HG   7  
ATOM 9411  N N    . SER A 1 94 ? 13.431  16.448  0.527   1.00 0.00 ? 94 SER A N    7  
ATOM 9412  C CA   . SER A 1 94 ? 13.382  17.627  1.385   1.00 0.00 ? 94 SER A CA   7  
ATOM 9413  C C    . SER A 1 94 ? 14.515  17.605  2.404   1.00 0.00 ? 94 SER A C    7  
ATOM 9414  O O    . SER A 1 94 ? 15.260  16.629  2.500   1.00 0.00 ? 94 SER A O    7  
ATOM 9415  C CB   . SER A 1 94 ? 12.034  17.704  2.104   1.00 0.00 ? 94 SER A CB   7  
ATOM 9416  O OG   . SER A 1 94 ? 10.963  17.474  1.207   1.00 0.00 ? 94 SER A OG   7  
ATOM 9417  H H    . SER A 1 94 ? 12.918  15.652  0.779   1.00 0.00 ? 94 SER A H    7  
ATOM 9418  H HA   . SER A 1 94 ? 13.495  18.498  0.756   1.00 0.00 ? 94 SER A HA   7  
ATOM 9419  H HB2  . SER A 1 94 ? 12.001  16.957  2.883   1.00 0.00 ? 94 SER A HB2  7  
ATOM 9420  H HB3  . SER A 1 94 ? 11.918  18.685  2.541   1.00 0.00 ? 94 SER A HB3  7  
ATOM 9421  H HG   . SER A 1 94 ? 10.978  16.558  0.917   1.00 0.00 ? 94 SER A HG   7  
ATOM 9422  N N    . GLY A 1 95 ? 14.642  18.688  3.164   1.00 0.00 ? 95 GLY A N    7  
ATOM 9423  C CA   . GLY A 1 95 ? 15.688  18.773  4.167   1.00 0.00 ? 95 GLY A CA   7  
ATOM 9424  C C    . GLY A 1 95 ? 15.624  20.060  4.965   1.00 0.00 ? 95 GLY A C    7  
ATOM 9425  O O    . GLY A 1 95 ? 16.332  20.160  5.989   1.00 0.00 ? 95 GLY A O    7  
ATOM 9426  O OXT  . GLY A 1 95 ? 14.868  20.970  4.564   1.00 0.00 ? 95 GLY A OXT  7  
ATOM 9427  H H    . GLY A 1 95 ? 14.020  19.436  3.043   1.00 0.00 ? 95 GLY A H    7  
ATOM 9428  H HA2  . GLY A 1 95 ? 15.589  17.937  4.845   1.00 0.00 ? 95 GLY A HA2  7  
ATOM 9429  H HA3  . GLY A 1 95 ? 16.648  18.713  3.676   1.00 0.00 ? 95 GLY A HA3  7  
ATOM 9430  N N    . GLY A 1 1  ? -4.097  -17.327 -7.260  1.00 0.00 ? 1  GLY A N    8  
ATOM 9431  C CA   . GLY A 1 1  ? -2.917  -17.687 -8.094  1.00 0.00 ? 1  GLY A CA   8  
ATOM 9432  C C    . GLY A 1 1  ? -3.278  -17.898 -9.551  1.00 0.00 ? 1  GLY A C    8  
ATOM 9433  O O    . GLY A 1 1  ? -3.459  -16.936 -10.298 1.00 0.00 ? 1  GLY A O    8  
ATOM 9434  H H1   . GLY A 1 1  ? -4.889  -17.966 -7.469  1.00 0.00 ? 1  GLY A H1   8  
ATOM 9435  H H2   . GLY A 1 1  ? -4.391  -16.351 -7.461  1.00 0.00 ? 1  GLY A H2   8  
ATOM 9436  H H3   . GLY A 1 1  ? -3.859  -17.405 -6.251  1.00 0.00 ? 1  GLY A H3   8  
ATOM 9437  H HA2  . GLY A 1 1  ? -2.187  -16.894 -8.027  1.00 0.00 ? 1  GLY A HA2  8  
ATOM 9438  H HA3  . GLY A 1 1  ? -2.480  -18.597 -7.708  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 9439  N N    . SER A 1 2  ? -3.383  -19.159 -9.956  1.00 0.00 ? 2  SER A N    8  
ATOM 9440  C CA   . SER A 1 2  ? -3.725  -19.495 -11.333 1.00 0.00 ? 2  SER A CA   8  
ATOM 9441  C C    . SER A 1 2  ? -5.027  -20.287 -11.393 1.00 0.00 ? 2  SER A C    8  
ATOM 9442  O O    . SER A 1 2  ? -5.195  -21.161 -12.245 1.00 0.00 ? 2  SER A O    8  
ATOM 9443  C CB   . SER A 1 2  ? -2.595  -20.298 -11.980 1.00 0.00 ? 2  SER A CB   8  
ATOM 9444  O OG   . SER A 1 2  ? -2.623  -20.175 -13.391 1.00 0.00 ? 2  SER A OG   8  
ATOM 9445  H H    . SER A 1 2  ? -3.226  -19.883 -9.313  1.00 0.00 ? 2  SER A H    8  
ATOM 9446  H HA   . SER A 1 2  ? -3.854  -18.571 -11.878 1.00 0.00 ? 2  SER A HA   8  
ATOM 9447  H HB2  . SER A 1 2  ? -1.645  -19.935 -11.619 1.00 0.00 ? 2  SER A HB2  8  
ATOM 9448  H HB3  . SER A 1 2  ? -2.704  -21.341 -11.720 1.00 0.00 ? 2  SER A HB3  8  
ATOM 9449  H HG   . SER A 1 2  ? -2.406  -19.273 -13.639 1.00 0.00 ? 2  SER A HG   8  
ATOM 9450  N N    . SER A 1 3  ? -5.945  -19.977 -10.484 1.00 0.00 ? 3  SER A N    8  
ATOM 9451  C CA   . SER A 1 3  ? -7.232  -20.660 -10.433 1.00 0.00 ? 3  SER A CA   8  
ATOM 9452  C C    . SER A 1 3  ? -8.284  -19.898 -11.234 1.00 0.00 ? 3  SER A C    8  
ATOM 9453  O O    . SER A 1 3  ? -9.199  -20.494 -11.801 1.00 0.00 ? 3  SER A O    8  
ATOM 9454  C CB   . SER A 1 3  ? -7.693  -20.817 -8.984  1.00 0.00 ? 3  SER A CB   8  
ATOM 9455  O OG   . SER A 1 3  ? -6.939  -21.814 -8.314  1.00 0.00 ? 3  SER A OG   8  
ATOM 9456  H H    . SER A 1 3  ? -5.752  -19.272 -9.831  1.00 0.00 ? 3  SER A H    8  
ATOM 9457  H HA   . SER A 1 3  ? -7.105  -21.640 -10.870 1.00 0.00 ? 3  SER A HA   8  
ATOM 9458  H HB2  . SER A 1 3  ? -7.568  -19.880 -8.464  1.00 0.00 ? 3  SER A HB2  8  
ATOM 9459  H HB3  . SER A 1 3  ? -8.735  -21.102 -8.969  1.00 0.00 ? 3  SER A HB3  8  
ATOM 9460  H HG   . SER A 1 3  ? -6.033  -21.515 -8.212  1.00 0.00 ? 3  SER A HG   8  
ATOM 9461  N N    . GLY A 1 4  ? -8.146  -18.577 -11.274 1.00 0.00 ? 4  GLY A N    8  
ATOM 9462  C CA   . GLY A 1 4  ? -9.090  -17.755 -12.008 1.00 0.00 ? 4  GLY A CA   8  
ATOM 9463  C C    . GLY A 1 4  ? -10.364 -17.496 -11.226 1.00 0.00 ? 4  GLY A C    8  
ATOM 9464  O O    . GLY A 1 4  ? -11.453 -17.870 -11.659 1.00 0.00 ? 4  GLY A O    8  
ATOM 9465  H H    . GLY A 1 4  ? -7.396  -18.156 -10.803 1.00 0.00 ? 4  GLY A H    8  
ATOM 9466  H HA2  . GLY A 1 4  ? -8.624  -16.809 -12.239 1.00 0.00 ? 4  GLY A HA2  8  
ATOM 9467  H HA3  . GLY A 1 4  ? -9.344  -18.255 -12.931 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 9468  N N    . SER A 1 5  ? -10.226 -16.854 -10.070 1.00 0.00 ? 5  SER A N    8  
ATOM 9469  C CA   . SER A 1 5  ? -11.374 -16.545 -9.226  1.00 0.00 ? 5  SER A CA   8  
ATOM 9470  C C    . SER A 1 5  ? -11.896 -15.141 -9.510  1.00 0.00 ? 5  SER A C    8  
ATOM 9471  O O    . SER A 1 5  ? -11.172 -14.292 -10.029 1.00 0.00 ? 5  SER A O    8  
ATOM 9472  C CB   . SER A 1 5  ? -10.996 -16.672 -7.749  1.00 0.00 ? 5  SER A CB   8  
ATOM 9473  O OG   . SER A 1 5  ? -12.135 -16.954 -6.953  1.00 0.00 ? 5  SER A OG   8  
ATOM 9474  H H    . SER A 1 5  ? -9.331  -16.581 -9.779  1.00 0.00 ? 5  SER A H    8  
ATOM 9475  H HA   . SER A 1 5  ? -12.152 -17.259 -9.452  1.00 0.00 ? 5  SER A HA   8  
ATOM 9476  H HB2  . SER A 1 5  ? -10.282 -17.473 -7.629  1.00 0.00 ? 5  SER A HB2  8  
ATOM 9477  H HB3  . SER A 1 5  ? -10.556 -15.744 -7.411  1.00 0.00 ? 5  SER A HB3  8  
ATOM 9478  H HG   . SER A 1 5  ? -12.677 -16.165 -6.878  1.00 0.00 ? 5  SER A HG   8  
ATOM 9479  N N    . SER A 1 6  ? -13.159 -14.903 -9.168  1.00 0.00 ? 6  SER A N    8  
ATOM 9480  C CA   . SER A 1 6  ? -13.777 -13.602 -9.386  1.00 0.00 ? 6  SER A CA   8  
ATOM 9481  C C    . SER A 1 6  ? -13.264 -12.579 -8.378  1.00 0.00 ? 6  SER A C    8  
ATOM 9482  O O    . SER A 1 6  ? -13.283 -12.819 -7.171  1.00 0.00 ? 6  SER A O    8  
ATOM 9483  C CB   . SER A 1 6  ? -15.299 -13.714 -9.286  1.00 0.00 ? 6  SER A CB   8  
ATOM 9484  O OG   . SER A 1 6  ? -15.937 -12.874 -10.232 1.00 0.00 ? 6  SER A OG   8  
ATOM 9485  H H    . SER A 1 6  ? -13.685 -15.621 -8.758  1.00 0.00 ? 6  SER A H    8  
ATOM 9486  H HA   . SER A 1 6  ? -13.515 -13.273 -10.380 1.00 0.00 ? 6  SER A HA   8  
ATOM 9487  H HB2  . SER A 1 6  ? -15.596 -14.735 -9.474  1.00 0.00 ? 6  SER A HB2  8  
ATOM 9488  H HB3  . SER A 1 6  ? -15.615 -13.425 -8.294  1.00 0.00 ? 6  SER A HB3  8  
ATOM 9489  H HG   . SER A 1 6  ? -16.828 -12.674 -9.935  1.00 0.00 ? 6  SER A HG   8  
ATOM 9490  N N    . GLY A 1 7  ? -12.806 -11.437 -8.882  1.00 0.00 ? 7  GLY A N    8  
ATOM 9491  C CA   . GLY A 1 7  ? -12.294 -10.395 -8.012  1.00 0.00 ? 7  GLY A CA   8  
ATOM 9492  C C    . GLY A 1 7  ? -10.803 -10.523 -7.769  1.00 0.00 ? 7  GLY A C    8  
ATOM 9493  O O    . GLY A 1 7  ? -10.377 -11.136 -6.792  1.00 0.00 ? 7  GLY A O    8  
ATOM 9494  H H    . GLY A 1 7  ? -12.816 -11.302 -9.853  1.00 0.00 ? 7  GLY A H    8  
ATOM 9495  H HA2  . GLY A 1 7  ? -12.494 -9.435  -8.464  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 9496  H HA3  . GLY A 1 7  ? -12.808 -10.449 -7.064  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 9497  N N    . ALA A 1 8  ? -10.009 -9.940  -8.662  1.00 0.00 ? 8  ALA A N    8  
ATOM 9498  C CA   . ALA A 1 8  ? -8.557  -9.991  -8.540  1.00 0.00 ? 8  ALA A CA   8  
ATOM 9499  C C    . ALA A 1 8  ? -7.917  -8.715  -9.074  1.00 0.00 ? 8  ALA A C    8  
ATOM 9500  O O    . ALA A 1 8  ? -8.104  -8.354  -10.237 1.00 0.00 ? 8  ALA A O    8  
ATOM 9501  C CB   . ALA A 1 8  ? -8.008  -11.206 -9.272  1.00 0.00 ? 8  ALA A CB   8  
ATOM 9502  H H    . ALA A 1 8  ? -10.409 -9.465  -9.420  1.00 0.00 ? 8  ALA A H    8  
ATOM 9503  H HA   . ALA A 1 8  ? -8.314  -10.091 -7.492  1.00 0.00 ? 8  ALA A HA   8  
ATOM 9504  H HB1  . ALA A 1 8  ? -7.931  -12.035 -8.585  1.00 0.00 ? 8  ALA A HB1  8  
ATOM 9505  H HB2  . ALA A 1 8  ? -7.032  -10.976 -9.670  1.00 0.00 ? 8  ALA A HB2  8  
ATOM 9506  H HB3  . ALA A 1 8  ? -8.674  -11.469 -10.081 1.00 0.00 ? 8  ALA A HB3  8  
ATOM 9507  N N    . ALA A 1 9  ? -7.162  -8.034  -8.218  1.00 0.00 ? 9  ALA A N    8  
ATOM 9508  C CA   . ALA A 1 9  ? -6.493  -6.798  -8.605  1.00 0.00 ? 9  ALA A CA   8  
ATOM 9509  C C    . ALA A 1 9  ? -5.054  -6.771  -8.101  1.00 0.00 ? 9  ALA A C    8  
ATOM 9510  O O    . ALA A 1 9  ? -4.792  -6.380  -6.964  1.00 0.00 ? 9  ALA A O    8  
ATOM 9511  C CB   . ALA A 1 9  ? -7.262  -5.596  -8.076  1.00 0.00 ? 9  ALA A CB   8  
ATOM 9512  H H    . ALA A 1 9  ? -7.050  -8.372  -7.305  1.00 0.00 ? 9  ALA A H    8  
ATOM 9513  H HA   . ALA A 1 9  ? -6.487  -6.745  -9.684  1.00 0.00 ? 9  ALA A HA   8  
ATOM 9514  H HB1  . ALA A 1 9  ? -8.054  -5.344  -8.766  1.00 0.00 ? 9  ALA A HB1  8  
ATOM 9515  H HB2  . ALA A 1 9  ? -6.592  -4.756  -7.976  1.00 0.00 ? 9  ALA A HB2  8  
ATOM 9516  H HB3  . ALA A 1 9  ? -7.686  -5.836  -7.112  1.00 0.00 ? 9  ALA A HB3  8  
ATOM 9517  N N    . GLU A 1 10 ? -4.126  -7.190  -8.954  1.00 0.00 ? 10 GLU A N    8  
ATOM 9518  C CA   . GLU A 1 10 ? -2.712  -7.213  -8.595  1.00 0.00 ? 10 GLU A CA   8  
ATOM 9519  C C    . GLU A 1 10 ? -2.471  -8.130  -7.400  1.00 0.00 ? 10 GLU A C    8  
ATOM 9520  O O    . GLU A 1 10 ? -3.411  -8.537  -6.718  1.00 0.00 ? 10 GLU A O    8  
ATOM 9521  C CB   . GLU A 1 10 ? -2.222  -5.799  -8.276  1.00 0.00 ? 10 GLU A CB   8  
ATOM 9522  C CG   . GLU A 1 10 ? -0.817  -5.514  -8.783  1.00 0.00 ? 10 GLU A CG   8  
ATOM 9523  C CD   . GLU A 1 10 ? -0.705  -5.635  -10.290 1.00 0.00 ? 10 GLU A CD   8  
ATOM 9524  O OE1  . GLU A 1 10 ? -1.283  -4.784  -10.997 1.00 0.00 ? 10 GLU A OE1  8  
ATOM 9525  O OE2  . GLU A 1 10 ? -0.041  -6.581  -10.763 1.00 0.00 ? 10 GLU A OE2  8  
ATOM 9526  H H    . GLU A 1 10 ? -4.397  -7.489  -9.847  1.00 0.00 ? 10 GLU A H    8  
ATOM 9527  H HA   . GLU A 1 10 ? -2.162  -7.593  -9.443  1.00 0.00 ? 10 GLU A HA   8  
ATOM 9528  H HB2  . GLU A 1 10 ? -2.896  -5.086  -8.729  1.00 0.00 ? 10 GLU A HB2  8  
ATOM 9529  H HB3  . GLU A 1 10 ? -2.230  -5.660  -7.206  1.00 0.00 ? 10 GLU A HB3  8  
ATOM 9530  H HG2  . GLU A 1 10 ? -0.541  -4.511  -8.496  1.00 0.00 ? 10 GLU A HG2  8  
ATOM 9531  H HG3  . GLU A 1 10 ? -0.135  -6.218  -8.328  1.00 0.00 ? 10 GLU A HG3  8  
ATOM 9532  N N    . VAL A 1 11 ? -1.205  -8.451  -7.154  1.00 0.00 ? 11 VAL A N    8  
ATOM 9533  C CA   . VAL A 1 11 ? -0.838  -9.318  -6.042  1.00 0.00 ? 11 VAL A CA   8  
ATOM 9534  C C    . VAL A 1 11 ? -0.063  -8.550  -4.977  1.00 0.00 ? 11 VAL A C    8  
ATOM 9535  O O    . VAL A 1 11 ? 0.232   -7.367  -5.143  1.00 0.00 ? 11 VAL A O    8  
ATOM 9536  C CB   . VAL A 1 11 ? 0.010   -10.513 -6.517  1.00 0.00 ? 11 VAL A CB   8  
ATOM 9537  C CG1  . VAL A 1 11 ? -0.820  -11.447 -7.383  1.00 0.00 ? 11 VAL A CG1  8  
ATOM 9538  C CG2  . VAL A 1 11 ? 1.240   -10.027 -7.269  1.00 0.00 ? 11 VAL A CG2  8  
ATOM 9539  H H    . VAL A 1 11 ? -0.500  -8.094  -7.734  1.00 0.00 ? 11 VAL A H    8  
ATOM 9540  H HA   . VAL A 1 11 ? -1.748  -9.702  -5.604  1.00 0.00 ? 11 VAL A HA   8  
ATOM 9541  H HB   . VAL A 1 11 ? 0.341   -11.063 -5.648  1.00 0.00 ? 11 VAL A HB   8  
ATOM 9542  H HG11 . VAL A 1 11 ? -0.176  -12.189 -7.833  1.00 0.00 ? 11 VAL A HG11 8  
ATOM 9543  H HG12 . VAL A 1 11 ? -1.311  -10.879 -8.159  1.00 0.00 ? 11 VAL A HG12 8  
ATOM 9544  H HG13 . VAL A 1 11 ? -1.563  -11.939 -6.772  1.00 0.00 ? 11 VAL A HG13 8  
ATOM 9545  H HG21 . VAL A 1 11 ? 2.057   -10.715 -7.107  1.00 0.00 ? 11 VAL A HG21 8  
ATOM 9546  H HG22 . VAL A 1 11 ? 1.517   -9.047  -6.912  1.00 0.00 ? 11 VAL A HG22 8  
ATOM 9547  H HG23 . VAL A 1 11 ? 1.019   -9.977  -8.326  1.00 0.00 ? 11 VAL A HG23 8  
ATOM 9548  N N    . GLY A 1 12 ? 0.264   -9.231  -3.883  1.00 0.00 ? 12 GLY A N    8  
ATOM 9549  C CA   . GLY A 1 12 ? 1.000   -8.594  -2.808  1.00 0.00 ? 12 GLY A CA   8  
ATOM 9550  C C    . GLY A 1 12 ? 2.476   -8.943  -2.829  1.00 0.00 ? 12 GLY A C    8  
ATOM 9551  O O    . GLY A 1 12 ? 2.979   -9.481  -3.815  1.00 0.00 ? 12 GLY A O    8  
ATOM 9552  H H    . GLY A 1 12 ? 0.001   -10.172 -3.806  1.00 0.00 ? 12 GLY A H    8  
ATOM 9553  H HA2  . GLY A 1 12 ? 0.895   -7.524  -2.897  1.00 0.00 ? 12 GLY A HA2  8  
ATOM 9554  H HA3  . GLY A 1 12 ? 0.582   -8.909  -1.863  1.00 0.00 ? 12 GLY A HA3  8  
ATOM 9555  N N    . ASP A 1 13 ? 3.171   -8.637  -1.738  1.00 0.00 ? 13 ASP A N    8  
ATOM 9556  C CA   . ASP A 1 13 ? 4.598   -8.922  -1.636  1.00 0.00 ? 13 ASP A CA   8  
ATOM 9557  C C    . ASP A 1 13 ? 4.842   -10.199 -0.838  1.00 0.00 ? 13 ASP A C    8  
ATOM 9558  O O    . ASP A 1 13 ? 3.952   -10.690 -0.144  1.00 0.00 ? 13 ASP A O    8  
ATOM 9559  C CB   . ASP A 1 13 ? 5.328   -7.749  -0.978  1.00 0.00 ? 13 ASP A CB   8  
ATOM 9560  C CG   . ASP A 1 13 ? 6.704   -7.520  -1.569  1.00 0.00 ? 13 ASP A CG   8  
ATOM 9561  O OD1  . ASP A 1 13 ? 6.785   -7.165  -2.765  1.00 0.00 ? 13 ASP A OD1  8  
ATOM 9562  O OD2  . ASP A 1 13 ? 7.701   -7.697  -0.838  1.00 0.00 ? 13 ASP A OD2  8  
ATOM 9563  H H    . ASP A 1 13 ? 2.714   -8.210  -0.984  1.00 0.00 ? 13 ASP A H    8  
ATOM 9564  H HA   . ASP A 1 13 ? 4.981   -9.057  -2.636  1.00 0.00 ? 13 ASP A HA   8  
ATOM 9565  H HB2  . ASP A 1 13 ? 4.744   -6.849  -1.112  1.00 0.00 ? 13 ASP A HB2  8  
ATOM 9566  H HB3  . ASP A 1 13 ? 5.437   -7.947  0.077   1.00 0.00 ? 13 ASP A HB3  8  
ATOM 9567  N N    . ASP A 1 14 ? 6.055   -10.732 -0.943  1.00 0.00 ? 14 ASP A N    8  
ATOM 9568  C CA   . ASP A 1 14 ? 6.418   -11.952 -0.232  1.00 0.00 ? 14 ASP A CA   8  
ATOM 9569  C C    . ASP A 1 14 ? 6.708   -11.660 1.237   1.00 0.00 ? 14 ASP A C    8  
ATOM 9570  O O    . ASP A 1 14 ? 6.365   -12.450 2.117   1.00 0.00 ? 14 ASP A O    8  
ATOM 9571  C CB   . ASP A 1 14 ? 7.639   -12.604 -0.884  1.00 0.00 ? 14 ASP A CB   8  
ATOM 9572  C CG   . ASP A 1 14 ? 7.309   -13.237 -2.222  1.00 0.00 ? 14 ASP A CG   8  
ATOM 9573  O OD1  . ASP A 1 14 ? 6.146   -13.651 -2.413  1.00 0.00 ? 14 ASP A OD1  8  
ATOM 9574  O OD2  . ASP A 1 14 ? 8.215   -13.321 -3.078  1.00 0.00 ? 14 ASP A OD2  8  
ATOM 9575  H H    . ASP A 1 14 ? 6.722   -10.294 -1.512  1.00 0.00 ? 14 ASP A H    8  
ATOM 9576  H HA   . ASP A 1 14 ? 5.582   -12.633 -0.292  1.00 0.00 ? 14 ASP A HA   8  
ATOM 9577  H HB2  . ASP A 1 14 ? 8.399   -11.853 -1.041  1.00 0.00 ? 14 ASP A HB2  8  
ATOM 9578  H HB3  . ASP A 1 14 ? 8.024   -13.370 -0.229  1.00 0.00 ? 14 ASP A HB3  8  
ATOM 9579  N N    . PHE A 1 15 ? 7.343   -10.521 1.495   1.00 0.00 ? 15 PHE A N    8  
ATOM 9580  C CA   . PHE A 1 15 ? 7.679   -10.125 2.857   1.00 0.00 ? 15 PHE A CA   8  
ATOM 9581  C C    . PHE A 1 15 ? 7.104   -8.750  3.182   1.00 0.00 ? 15 PHE A C    8  
ATOM 9582  O O    . PHE A 1 15 ? 6.715   -8.001  2.287   1.00 0.00 ? 15 PHE A O    8  
ATOM 9583  C CB   . PHE A 1 15 ? 9.197   -10.113 3.047   1.00 0.00 ? 15 PHE A CB   8  
ATOM 9584  C CG   . PHE A 1 15 ? 9.622   -9.982  4.482   1.00 0.00 ? 15 PHE A CG   8  
ATOM 9585  C CD1  . PHE A 1 15 ? 9.169   -10.880 5.436   1.00 0.00 ? 15 PHE A CD1  8  
ATOM 9586  C CD2  . PHE A 1 15 ? 10.472  -8.962  4.877   1.00 0.00 ? 15 PHE A CD2  8  
ATOM 9587  C CE1  . PHE A 1 15 ? 9.559   -10.763 6.757   1.00 0.00 ? 15 PHE A CE1  8  
ATOM 9588  C CE2  . PHE A 1 15 ? 10.865  -8.840  6.196   1.00 0.00 ? 15 PHE A CE2  8  
ATOM 9589  C CZ   . PHE A 1 15 ? 10.407  -9.742  7.137   1.00 0.00 ? 15 PHE A CZ   8  
ATOM 9590  H H    . PHE A 1 15 ? 7.590   -9.932  0.751   1.00 0.00 ? 15 PHE A H    8  
ATOM 9591  H HA   . PHE A 1 15 ? 7.247   -10.850 3.530   1.00 0.00 ? 15 PHE A HA   8  
ATOM 9592  H HB2  . PHE A 1 15 ? 9.608   -11.034 2.662   1.00 0.00 ? 15 PHE A HB2  8  
ATOM 9593  H HB3  . PHE A 1 15 ? 9.615   -9.281  2.499   1.00 0.00 ? 15 PHE A HB3  8  
ATOM 9594  H HD1  . PHE A 1 15 ? 8.507   -11.680 5.139   1.00 0.00 ? 15 PHE A HD1  8  
ATOM 9595  H HD2  . PHE A 1 15 ? 10.831  -8.257  4.141   1.00 0.00 ? 15 PHE A HD2  8  
ATOM 9596  H HE1  . PHE A 1 15 ? 9.200   -11.469 7.491   1.00 0.00 ? 15 PHE A HE1  8  
ATOM 9597  H HE2  . PHE A 1 15 ? 11.528  -8.041  6.491   1.00 0.00 ? 15 PHE A HE2  8  
ATOM 9598  H HZ   . PHE A 1 15 ? 10.712  -9.648  8.170   1.00 0.00 ? 15 PHE A HZ   8  
ATOM 9599  N N    . LEU A 1 16 ? 7.056   -8.424  4.470   1.00 0.00 ? 16 LEU A N    8  
ATOM 9600  C CA   . LEU A 1 16 ? 6.529   -7.139  4.914   1.00 0.00 ? 16 LEU A CA   8  
ATOM 9601  C C    . LEU A 1 16 ? 7.641   -6.099  5.010   1.00 0.00 ? 16 LEU A C    8  
ATOM 9602  O O    . LEU A 1 16 ? 8.800   -6.385  4.705   1.00 0.00 ? 16 LEU A O    8  
ATOM 9603  C CB   . LEU A 1 16 ? 5.834   -7.290  6.270   1.00 0.00 ? 16 LEU A CB   8  
ATOM 9604  C CG   . LEU A 1 16 ? 4.315   -7.452  6.203   1.00 0.00 ? 16 LEU A CG   8  
ATOM 9605  C CD1  . LEU A 1 16 ? 3.827   -8.379  7.307   1.00 0.00 ? 16 LEU A CD1  8  
ATOM 9606  C CD2  . LEU A 1 16 ? 3.631   -6.097  6.302   1.00 0.00 ? 16 LEU A CD2  8  
ATOM 9607  H H    . LEU A 1 16 ? 7.382   -9.063  5.138   1.00 0.00 ? 16 LEU A H    8  
ATOM 9608  H HA   . LEU A 1 16 ? 5.806   -6.808  4.184   1.00 0.00 ? 16 LEU A HA   8  
ATOM 9609  H HB2  . LEU A 1 16 ? 6.247   -8.156  6.767   1.00 0.00 ? 16 LEU A HB2  8  
ATOM 9610  H HB3  . LEU A 1 16 ? 6.053   -6.416  6.865   1.00 0.00 ? 16 LEU A HB3  8  
ATOM 9611  H HG   . LEU A 1 16 ? 4.048   -7.895  5.254   1.00 0.00 ? 16 LEU A HG   8  
ATOM 9612  H HD11 . LEU A 1 16 ? 4.088   -9.398  7.063   1.00 0.00 ? 16 LEU A HD11 8  
ATOM 9613  H HD12 . LEU A 1 16 ? 2.755   -8.294  7.400   1.00 0.00 ? 16 LEU A HD12 8  
ATOM 9614  H HD13 . LEU A 1 16 ? 4.292   -8.102  8.241   1.00 0.00 ? 16 LEU A HD13 8  
ATOM 9615  H HD21 . LEU A 1 16 ? 3.332   -5.918  7.324   1.00 0.00 ? 16 LEU A HD21 8  
ATOM 9616  H HD22 . LEU A 1 16 ? 2.758   -6.087  5.665   1.00 0.00 ? 16 LEU A HD22 8  
ATOM 9617  H HD23 . LEU A 1 16 ? 4.315   -5.324  5.986   1.00 0.00 ? 16 LEU A HD23 8  
ATOM 9618  N N    . GLY A 1 17 ? 7.282   -4.893  5.435   1.00 0.00 ? 17 GLY A N    8  
ATOM 9619  C CA   . GLY A 1 17 ? 8.261   -3.829  5.563   1.00 0.00 ? 17 GLY A CA   8  
ATOM 9620  C C    . GLY A 1 17 ? 8.374   -3.311  6.984   1.00 0.00 ? 17 GLY A C    8  
ATOM 9621  O O    . GLY A 1 17 ? 7.841   -3.915  7.916   1.00 0.00 ? 17 GLY A O    8  
ATOM 9622  H H    . GLY A 1 17 ? 6.345   -4.723  5.663   1.00 0.00 ? 17 GLY A H    8  
ATOM 9623  H HA2  . GLY A 1 17 ? 9.226   -4.201  5.250   1.00 0.00 ? 17 GLY A HA2  8  
ATOM 9624  H HA3  . GLY A 1 17 ? 7.976   -3.012  4.916   1.00 0.00 ? 17 GLY A HA3  8  
ATOM 9625  N N    . ASP A 1 18 ? 9.070   -2.192  7.150   1.00 0.00 ? 18 ASP A N    8  
ATOM 9626  C CA   . ASP A 1 18 ? 9.251   -1.592  8.467   1.00 0.00 ? 18 ASP A CA   8  
ATOM 9627  C C    . ASP A 1 18 ? 8.422   -0.320  8.604   1.00 0.00 ? 18 ASP A C    8  
ATOM 9628  O O    . ASP A 1 18 ? 8.808   0.613   9.309   1.00 0.00 ? 18 ASP A O    8  
ATOM 9629  C CB   . ASP A 1 18 ? 10.730  -1.282  8.709   1.00 0.00 ? 18 ASP A CB   8  
ATOM 9630  C CG   . ASP A 1 18 ? 11.444  -2.399  9.443   1.00 0.00 ? 18 ASP A CG   8  
ATOM 9631  O OD1  . ASP A 1 18 ? 11.511  -3.521  8.896   1.00 0.00 ? 18 ASP A OD1  8  
ATOM 9632  O OD2  . ASP A 1 18 ? 11.934  -2.154  10.565  1.00 0.00 ? 18 ASP A OD2  8  
ATOM 9633  H H    . ASP A 1 18 ? 9.471   -1.757  6.368   1.00 0.00 ? 18 ASP A H    8  
ATOM 9634  H HA   . ASP A 1 18 ? 8.918   -2.307  9.204   1.00 0.00 ? 18 ASP A HA   8  
ATOM 9635  H HB2  . ASP A 1 18 ? 11.220  -1.131  7.758   1.00 0.00 ? 18 ASP A HB2  8  
ATOM 9636  H HB3  . ASP A 1 18 ? 10.811  -0.379  9.298   1.00 0.00 ? 18 ASP A HB3  8  
ATOM 9637  N N    . PHE A 1 19 ? 7.279   -0.288  7.927   1.00 0.00 ? 19 PHE A N    8  
ATOM 9638  C CA   . PHE A 1 19 ? 6.394   0.870   7.973   1.00 0.00 ? 19 PHE A CA   8  
ATOM 9639  C C    . PHE A 1 19 ? 5.312   0.685   9.032   1.00 0.00 ? 19 PHE A C    8  
ATOM 9640  O O    . PHE A 1 19 ? 4.840   -0.427  9.264   1.00 0.00 ? 19 PHE A O    8  
ATOM 9641  C CB   . PHE A 1 19 ? 5.752   1.101   6.604   1.00 0.00 ? 19 PHE A CB   8  
ATOM 9642  C CG   . PHE A 1 19 ? 6.745   1.179   5.480   1.00 0.00 ? 19 PHE A CG   8  
ATOM 9643  C CD1  . PHE A 1 19 ? 7.366   2.379   5.170   1.00 0.00 ? 19 PHE A CD1  8  
ATOM 9644  C CD2  . PHE A 1 19 ? 7.058   0.054   4.735   1.00 0.00 ? 19 PHE A CD2  8  
ATOM 9645  C CE1  . PHE A 1 19 ? 8.281   2.453   4.137   1.00 0.00 ? 19 PHE A CE1  8  
ATOM 9646  C CE2  . PHE A 1 19 ? 7.972   0.124   3.702   1.00 0.00 ? 19 PHE A CE2  8  
ATOM 9647  C CZ   . PHE A 1 19 ? 8.585   1.324   3.403   1.00 0.00 ? 19 PHE A CZ   8  
ATOM 9648  H H    . PHE A 1 19 ? 7.025   -1.063  7.382   1.00 0.00 ? 19 PHE A H    8  
ATOM 9649  H HA   . PHE A 1 19 ? 6.990   1.732   8.231   1.00 0.00 ? 19 PHE A HA   8  
ATOM 9650  H HB2  . PHE A 1 19 ? 5.073   0.289   6.391   1.00 0.00 ? 19 PHE A HB2  8  
ATOM 9651  H HB3  . PHE A 1 19 ? 5.199   2.029   6.626   1.00 0.00 ? 19 PHE A HB3  8  
ATOM 9652  H HD1  . PHE A 1 19 ? 7.130   3.261   5.745   1.00 0.00 ? 19 PHE A HD1  8  
ATOM 9653  H HD2  . PHE A 1 19 ? 6.580   -0.886  4.968   1.00 0.00 ? 19 PHE A HD2  8  
ATOM 9654  H HE1  . PHE A 1 19 ? 8.758   3.395   3.906   1.00 0.00 ? 19 PHE A HE1  8  
ATOM 9655  H HE2  . PHE A 1 19 ? 8.208   -0.761  3.127   1.00 0.00 ? 19 PHE A HE2  8  
ATOM 9656  H HZ   . PHE A 1 19 ? 9.299   1.381   2.594   1.00 0.00 ? 19 PHE A HZ   8  
ATOM 9657  N N    . VAL A 1 20 ? 4.923   1.784   9.670   1.00 0.00 ? 20 VAL A N    8  
ATOM 9658  C CA   . VAL A 1 20 ? 3.896   1.745   10.704  1.00 0.00 ? 20 VAL A CA   8  
ATOM 9659  C C    . VAL A 1 20 ? 2.692   2.595   10.315  1.00 0.00 ? 20 VAL A C    8  
ATOM 9660  O O    . VAL A 1 20 ? 2.715   3.296   9.302   1.00 0.00 ? 20 VAL A O    8  
ATOM 9661  C CB   . VAL A 1 20 ? 4.442   2.241   12.056  1.00 0.00 ? 20 VAL A CB   8  
ATOM 9662  C CG1  . VAL A 1 20 ? 5.403   1.222   12.650  1.00 0.00 ? 20 VAL A CG1  8  
ATOM 9663  C CG2  . VAL A 1 20 ? 5.119   3.593   11.896  1.00 0.00 ? 20 VAL A CG2  8  
ATOM 9664  H H    . VAL A 1 20 ? 5.337   2.643   9.439   1.00 0.00 ? 20 VAL A H    8  
ATOM 9665  H HA   . VAL A 1 20 ? 3.579   0.720   10.821  1.00 0.00 ? 20 VAL A HA   8  
ATOM 9666  H HB   . VAL A 1 20 ? 3.611   2.356   12.736  1.00 0.00 ? 20 VAL A HB   8  
ATOM 9667  H HG11 . VAL A 1 20 ? 6.189   1.737   13.183  1.00 0.00 ? 20 VAL A HG11 8  
ATOM 9668  H HG12 . VAL A 1 20 ? 5.836   0.630   11.857  1.00 0.00 ? 20 VAL A HG12 8  
ATOM 9669  H HG13 . VAL A 1 20 ? 4.869   0.577   13.332  1.00 0.00 ? 20 VAL A HG13 8  
ATOM 9670  H HG21 . VAL A 1 20 ? 5.350   3.998   12.870  1.00 0.00 ? 20 VAL A HG21 8  
ATOM 9671  H HG22 . VAL A 1 20 ? 4.455   4.268   11.374  1.00 0.00 ? 20 VAL A HG22 8  
ATOM 9672  H HG23 . VAL A 1 20 ? 6.030   3.475   11.329  1.00 0.00 ? 20 VAL A HG23 8  
ATOM 9673  N N    . VAL A 1 21 ? 1.639   2.528   11.124  1.00 0.00 ? 21 VAL A N    8  
ATOM 9674  C CA   . VAL A 1 21 ? 0.425   3.291   10.864  1.00 0.00 ? 21 VAL A CA   8  
ATOM 9675  C C    . VAL A 1 21 ? 0.508   4.683   11.481  1.00 0.00 ? 21 VAL A C    8  
ATOM 9676  O O    . VAL A 1 21 ? 0.644   4.827   12.696  1.00 0.00 ? 21 VAL A O    8  
ATOM 9677  C CB   . VAL A 1 21 ? -0.820  2.571   11.415  1.00 0.00 ? 21 VAL A CB   8  
ATOM 9678  C CG1  . VAL A 1 21 ? -2.089  3.277   10.964  1.00 0.00 ? 21 VAL A CG1  8  
ATOM 9679  C CG2  . VAL A 1 21 ? -0.829  1.112   10.984  1.00 0.00 ? 21 VAL A CG2  8  
ATOM 9680  H H    . VAL A 1 21 ? 1.682   1.951   11.916  1.00 0.00 ? 21 VAL A H    8  
ATOM 9681  H HA   . VAL A 1 21 ? 0.315   3.387   9.794   1.00 0.00 ? 21 VAL A HA   8  
ATOM 9682  H HB   . VAL A 1 21 ? -0.782  2.604   12.494  1.00 0.00 ? 21 VAL A HB   8  
ATOM 9683  H HG11 . VAL A 1 21 ? -2.381  2.905   9.992   1.00 0.00 ? 21 VAL A HG11 8  
ATOM 9684  H HG12 . VAL A 1 21 ? -1.909  4.339   10.903  1.00 0.00 ? 21 VAL A HG12 8  
ATOM 9685  H HG13 . VAL A 1 21 ? -2.880  3.085   11.674  1.00 0.00 ? 21 VAL A HG13 8  
ATOM 9686  H HG21 . VAL A 1 21 ? 0.164   0.699   11.092  1.00 0.00 ? 21 VAL A HG21 8  
ATOM 9687  H HG22 . VAL A 1 21 ? -1.136  1.045   9.951   1.00 0.00 ? 21 VAL A HG22 8  
ATOM 9688  H HG23 . VAL A 1 21 ? -1.519  0.558   11.602  1.00 0.00 ? 21 VAL A HG23 8  
ATOM 9689  N N    . GLY A 1 22 ? 0.426   5.705   10.636  1.00 0.00 ? 22 GLY A N    8  
ATOM 9690  C CA   . GLY A 1 22 ? 0.495   7.073   11.116  1.00 0.00 ? 22 GLY A CA   8  
ATOM 9691  C C    . GLY A 1 22 ? 1.750   7.787   10.657  1.00 0.00 ? 22 GLY A C    8  
ATOM 9692  O O    . GLY A 1 22 ? 2.237   8.696   11.331  1.00 0.00 ? 22 GLY A O    8  
ATOM 9693  H H    . GLY A 1 22 ? 0.320   5.529   9.677   1.00 0.00 ? 22 GLY A H    8  
ATOM 9694  H HA2  . GLY A 1 22 ? -0.367  7.614   10.752  1.00 0.00 ? 22 GLY A HA2  8  
ATOM 9695  H HA3  . GLY A 1 22 ? 0.472   7.065   12.196  1.00 0.00 ? 22 GLY A HA3  8  
ATOM 9696  N N    . GLU A 1 23 ? 2.277   7.376   9.508   1.00 0.00 ? 23 GLU A N    8  
ATOM 9697  C CA   . GLU A 1 23 ? 3.485   7.983   8.960   1.00 0.00 ? 23 GLU A CA   8  
ATOM 9698  C C    . GLU A 1 23 ? 3.284   8.366   7.497   1.00 0.00 ? 23 GLU A C    8  
ATOM 9699  O O    . GLU A 1 23 ? 2.211   8.155   6.931   1.00 0.00 ? 23 GLU A O    8  
ATOM 9700  C CB   . GLU A 1 23 ? 4.668   7.023   9.091   1.00 0.00 ? 23 GLU A CB   8  
ATOM 9701  C CG   . GLU A 1 23 ? 4.373   5.620   8.583   1.00 0.00 ? 23 GLU A CG   8  
ATOM 9702  C CD   . GLU A 1 23 ? 5.507   5.051   7.754   1.00 0.00 ? 23 GLU A CD   8  
ATOM 9703  O OE1  . GLU A 1 23 ? 6.139   5.822   7.003   1.00 0.00 ? 23 GLU A OE1  8  
ATOM 9704  O OE2  . GLU A 1 23 ? 5.764   3.832   7.857   1.00 0.00 ? 23 GLU A OE2  8  
ATOM 9705  H H    . GLU A 1 23 ? 1.843   6.647   9.017   1.00 0.00 ? 23 GLU A H    8  
ATOM 9706  H HA   . GLU A 1 23 ? 3.693   8.877   9.528   1.00 0.00 ? 23 GLU A HA   8  
ATOM 9707  H HB2  . GLU A 1 23 ? 5.501   7.418   8.529   1.00 0.00 ? 23 GLU A HB2  8  
ATOM 9708  H HB3  . GLU A 1 23 ? 4.947   6.954   10.132  1.00 0.00 ? 23 GLU A HB3  8  
ATOM 9709  H HG2  . GLU A 1 23 ? 4.206   4.972   9.430   1.00 0.00 ? 23 GLU A HG2  8  
ATOM 9710  H HG3  . GLU A 1 23 ? 3.482   5.653   7.974   1.00 0.00 ? 23 GLU A HG3  8  
ATOM 9711  N N    . ARG A 1 24 ? 4.324   8.930   6.891   1.00 0.00 ? 24 ARG A N    8  
ATOM 9712  C CA   . ARG A 1 24 ? 4.262   9.343   5.493   1.00 0.00 ? 24 ARG A CA   8  
ATOM 9713  C C    . ARG A 1 24 ? 5.191   8.492   4.634   1.00 0.00 ? 24 ARG A C    8  
ATOM 9714  O O    . ARG A 1 24 ? 6.399   8.446   4.864   1.00 0.00 ? 24 ARG A O    8  
ATOM 9715  C CB   . ARG A 1 24 ? 4.633   10.822  5.362   1.00 0.00 ? 24 ARG A CB   8  
ATOM 9716  C CG   . ARG A 1 24 ? 3.430   11.746  5.270   1.00 0.00 ? 24 ARG A CG   8  
ATOM 9717  C CD   . ARG A 1 24 ? 2.487   11.553  6.447   1.00 0.00 ? 24 ARG A CD   8  
ATOM 9718  N NE   . ARG A 1 24 ? 1.376   12.501  6.420   1.00 0.00 ? 24 ARG A NE   8  
ATOM 9719  C CZ   . ARG A 1 24 ? 1.469   13.764  6.827   1.00 0.00 ? 24 ARG A CZ   8  
ATOM 9720  N NH1  . ARG A 1 24 ? 2.619   14.237  7.291   1.00 0.00 ? 24 ARG A NH1  8  
ATOM 9721  N NH2  . ARG A 1 24 ? 0.410   14.559  6.768   1.00 0.00 ? 24 ARG A NH2  8  
ATOM 9722  H H    . ARG A 1 24 ? 5.153   9.072   7.395   1.00 0.00 ? 24 ARG A H    8  
ATOM 9723  H HA   . ARG A 1 24 ? 3.248   9.204   5.151   1.00 0.00 ? 24 ARG A HA   8  
ATOM 9724  H HB2  . ARG A 1 24 ? 5.219   11.113  6.221   1.00 0.00 ? 24 ARG A HB2  8  
ATOM 9725  H HB3  . ARG A 1 24 ? 5.230   10.955  4.471   1.00 0.00 ? 24 ARG A HB3  8  
ATOM 9726  H HG2  . ARG A 1 24 ? 3.773   12.769  5.262   1.00 0.00 ? 24 ARG A HG2  8  
ATOM 9727  H HG3  . ARG A 1 24 ? 2.896   11.536  4.354   1.00 0.00 ? 24 ARG A HG3  8  
ATOM 9728  H HD2  . ARG A 1 24 ? 2.092   10.549  6.413   1.00 0.00 ? 24 ARG A HD2  8  
ATOM 9729  H HD3  . ARG A 1 24 ? 3.043   11.689  7.363   1.00 0.00 ? 24 ARG A HD3  8  
ATOM 9730  H HE   . ARG A 1 24 ? 0.514   12.179  6.082   1.00 0.00 ? 24 ARG A HE   8  
ATOM 9731  H HH11 . ARG A 1 24 ? 3.423   13.643  7.338   1.00 0.00 ? 24 ARG A HH11 8  
ATOM 9732  H HH12 . ARG A 1 24 ? 2.683   15.187  7.596   1.00 0.00 ? 24 ARG A HH12 8  
ATOM 9733  H HH21 . ARG A 1 24 ? -0.459  14.209  6.418   1.00 0.00 ? 24 ARG A HH21 8  
ATOM 9734  H HH22 . ARG A 1 24 ? 0.479   15.509  7.073   1.00 0.00 ? 24 ARG A HH22 8  
ATOM 9735  N N    . VAL A 1 25 ? 4.618   7.820   3.640   1.00 0.00 ? 25 VAL A N    8  
ATOM 9736  C CA   . VAL A 1 25 ? 5.393   6.970   2.744   1.00 0.00 ? 25 VAL A CA   8  
ATOM 9737  C C    . VAL A 1 25 ? 5.108   7.306   1.285   1.00 0.00 ? 25 VAL A C    8  
ATOM 9738  O O    . VAL A 1 25 ? 3.956   7.484   0.892   1.00 0.00 ? 25 VAL A O    8  
ATOM 9739  C CB   . VAL A 1 25 ? 5.090   5.478   2.983   1.00 0.00 ? 25 VAL A CB   8  
ATOM 9740  C CG1  . VAL A 1 25 ? 5.601   5.041   4.347   1.00 0.00 ? 25 VAL A CG1  8  
ATOM 9741  C CG2  . VAL A 1 25 ? 3.600   5.207   2.851   1.00 0.00 ? 25 VAL A CG2  8  
ATOM 9742  H H    . VAL A 1 25 ? 3.649   7.897   3.507   1.00 0.00 ? 25 VAL A H    8  
ATOM 9743  H HA   . VAL A 1 25 ? 6.440   7.140   2.946   1.00 0.00 ? 25 VAL A HA   8  
ATOM 9744  H HB   . VAL A 1 25 ? 5.608   4.902   2.229   1.00 0.00 ? 25 VAL A HB   8  
ATOM 9745  H HG11 . VAL A 1 25 ? 6.611   5.397   4.484   1.00 0.00 ? 25 VAL A HG11 8  
ATOM 9746  H HG12 . VAL A 1 25 ? 5.588   3.962   4.408   1.00 0.00 ? 25 VAL A HG12 8  
ATOM 9747  H HG13 . VAL A 1 25 ? 4.966   5.452   5.118   1.00 0.00 ? 25 VAL A HG13 8  
ATOM 9748  H HG21 . VAL A 1 25 ? 3.327   5.197   1.806   1.00 0.00 ? 25 VAL A HG21 8  
ATOM 9749  H HG22 . VAL A 1 25 ? 3.047   5.984   3.360   1.00 0.00 ? 25 VAL A HG22 8  
ATOM 9750  H HG23 . VAL A 1 25 ? 3.367   4.250   3.293   1.00 0.00 ? 25 VAL A HG23 8  
ATOM 9751  N N    . TRP A 1 26 ? 6.166   7.392   0.485   1.00 0.00 ? 26 TRP A N    8  
ATOM 9752  C CA   . TRP A 1 26 ? 6.029   7.707   -0.932  1.00 0.00 ? 26 TRP A CA   8  
ATOM 9753  C C    . TRP A 1 26 ? 5.688   6.457   -1.737  1.00 0.00 ? 26 TRP A C    8  
ATOM 9754  O O    . TRP A 1 26 ? 6.555   5.623   -2.003  1.00 0.00 ? 26 TRP A O    8  
ATOM 9755  C CB   . TRP A 1 26 ? 7.319   8.335   -1.463  1.00 0.00 ? 26 TRP A CB   8  
ATOM 9756  C CG   . TRP A 1 26 ? 7.409   9.809   -1.214  1.00 0.00 ? 26 TRP A CG   8  
ATOM 9757  C CD1  . TRP A 1 26 ? 7.300   10.806  -2.141  1.00 0.00 ? 26 TRP A CD1  8  
ATOM 9758  C CD2  . TRP A 1 26 ? 7.630   10.454  0.046   1.00 0.00 ? 26 TRP A CD2  8  
ATOM 9759  N NE1  . TRP A 1 26 ? 7.437   12.031  -1.535  1.00 0.00 ? 26 TRP A NE1  8  
ATOM 9760  C CE2  . TRP A 1 26 ? 7.641   11.842  -0.192  1.00 0.00 ? 26 TRP A CE2  8  
ATOM 9761  C CE3  . TRP A 1 26 ? 7.818   9.994   1.352   1.00 0.00 ? 26 TRP A CE3  8  
ATOM 9762  C CZ2  . TRP A 1 26 ? 7.833   12.771  0.827   1.00 0.00 ? 26 TRP A CZ2  8  
ATOM 9763  C CZ3  . TRP A 1 26 ? 8.008   10.917  2.363   1.00 0.00 ? 26 TRP A CZ3  8  
ATOM 9764  C CH2  . TRP A 1 26 ? 8.014   12.292  2.096   1.00 0.00 ? 26 TRP A CH2  8  
ATOM 9765  H H    . TRP A 1 26 ? 7.060   7.239   0.857   1.00 0.00 ? 26 TRP A H    8  
ATOM 9766  H HA   . TRP A 1 26 ? 5.224   8.418   -1.037  1.00 0.00 ? 26 TRP A HA   8  
ATOM 9767  H HB2  . TRP A 1 26 ? 8.165   7.864   -0.985  1.00 0.00 ? 26 TRP A HB2  8  
ATOM 9768  H HB3  . TRP A 1 26 ? 7.378   8.172   -2.530  1.00 0.00 ? 26 TRP A HB3  8  
ATOM 9769  H HD1  . TRP A 1 26 ? 7.129   10.640  -3.194  1.00 0.00 ? 26 TRP A HD1  8  
ATOM 9770  H HE1  . TRP A 1 26 ? 7.396   12.898  -1.989  1.00 0.00 ? 26 TRP A HE1  8  
ATOM 9771  H HE3  . TRP A 1 26 ? 7.816   8.937   1.577   1.00 0.00 ? 26 TRP A HE3  8  
ATOM 9772  H HZ2  . TRP A 1 26 ? 7.839   13.834  0.638   1.00 0.00 ? 26 TRP A HZ2  8  
ATOM 9773  H HZ3  . TRP A 1 26 ? 8.155   10.579  3.378   1.00 0.00 ? 26 TRP A HZ3  8  
ATOM 9774  H HH2  . TRP A 1 26 ? 8.167   12.977  2.916   1.00 0.00 ? 26 TRP A HH2  8  
ATOM 9775  N N    . VAL A 1 27 ? 4.422   6.333   -2.120  1.00 0.00 ? 27 VAL A N    8  
ATOM 9776  C CA   . VAL A 1 27 ? 3.967   5.184   -2.895  1.00 0.00 ? 27 VAL A CA   8  
ATOM 9777  C C    . VAL A 1 27 ? 4.516   5.228   -4.317  1.00 0.00 ? 27 VAL A C    8  
ATOM 9778  O O    . VAL A 1 27 ? 4.204   6.139   -5.085  1.00 0.00 ? 27 VAL A O    8  
ATOM 9779  C CB   . VAL A 1 27 ? 2.428   5.118   -2.952  1.00 0.00 ? 27 VAL A CB   8  
ATOM 9780  C CG1  . VAL A 1 27 ? 1.972   3.835   -3.629  1.00 0.00 ? 27 VAL A CG1  8  
ATOM 9781  C CG2  . VAL A 1 27 ? 1.835   5.231   -1.554  1.00 0.00 ? 27 VAL A CG2  8  
ATOM 9782  H H    . VAL A 1 27 ? 3.779   7.031   -1.878  1.00 0.00 ? 27 VAL A H    8  
ATOM 9783  H HA   . VAL A 1 27 ? 4.327   4.290   -2.407  1.00 0.00 ? 27 VAL A HA   8  
ATOM 9784  H HB   . VAL A 1 27 ? 2.073   5.953   -3.538  1.00 0.00 ? 27 VAL A HB   8  
ATOM 9785  H HG11 . VAL A 1 27 ? 2.034   3.952   -4.701  1.00 0.00 ? 27 VAL A HG11 8  
ATOM 9786  H HG12 . VAL A 1 27 ? 0.951   3.623   -3.348  1.00 0.00 ? 27 VAL A HG12 8  
ATOM 9787  H HG13 . VAL A 1 27 ? 2.607   3.018   -3.320  1.00 0.00 ? 27 VAL A HG13 8  
ATOM 9788  H HG21 . VAL A 1 27 ? 1.773   4.247   -1.111  1.00 0.00 ? 27 VAL A HG21 8  
ATOM 9789  H HG22 . VAL A 1 27 ? 0.847   5.661   -1.617  1.00 0.00 ? 27 VAL A HG22 8  
ATOM 9790  H HG23 . VAL A 1 27 ? 2.465   5.861   -0.945  1.00 0.00 ? 27 VAL A HG23 8  
ATOM 9791  N N    . ASN A 1 28 ? 5.334   4.239   -4.661  1.00 0.00 ? 28 ASN A N    8  
ATOM 9792  C CA   . ASN A 1 28 ? 5.927   4.164   -5.991  1.00 0.00 ? 28 ASN A CA   8  
ATOM 9793  C C    . ASN A 1 28 ? 6.747   5.414   -6.295  1.00 0.00 ? 28 ASN A C    8  
ATOM 9794  O O    . ASN A 1 28 ? 6.880   5.815   -7.452  1.00 0.00 ? 28 ASN A O    8  
ATOM 9795  C CB   . ASN A 1 28 ? 4.837   3.984   -7.049  1.00 0.00 ? 28 ASN A CB   8  
ATOM 9796  C CG   . ASN A 1 28 ? 4.598   2.526   -7.390  1.00 0.00 ? 28 ASN A CG   8  
ATOM 9797  O OD1  . ASN A 1 28 ? 4.468   2.164   -8.559  1.00 0.00 ? 28 ASN A OD1  8  
ATOM 9798  N ND2  . ASN A 1 28 ? 4.539   1.680   -6.367  1.00 0.00 ? 28 ASN A ND2  8  
ATOM 9799  H H    . ASN A 1 28 ? 5.545   3.543   -4.004  1.00 0.00 ? 28 ASN A H    8  
ATOM 9800  H HA   . ASN A 1 28 ? 6.582   3.305   -6.013  1.00 0.00 ? 28 ASN A HA   8  
ATOM 9801  H HB2  . ASN A 1 28 ? 3.913   4.404   -6.680  1.00 0.00 ? 28 ASN A HB2  8  
ATOM 9802  H HB3  . ASN A 1 28 ? 5.129   4.502   -7.951  1.00 0.00 ? 28 ASN A HB3  8  
ATOM 9803  H HD21 . ASN A 1 28 ? 4.651   2.041   -5.463  1.00 0.00 ? 28 ASN A HD21 8  
ATOM 9804  H HD22 . ASN A 1 28 ? 4.385   0.732   -6.559  1.00 0.00 ? 28 ASN A HD22 8  
ATOM 9805  N N    . GLY A 1 29 ? 7.296   6.026   -5.250  1.00 0.00 ? 29 GLY A N    8  
ATOM 9806  C CA   . GLY A 1 29 ? 8.096   7.225   -5.427  1.00 0.00 ? 29 GLY A CA   8  
ATOM 9807  C C    . GLY A 1 29 ? 7.337   8.334   -6.128  1.00 0.00 ? 29 GLY A C    8  
ATOM 9808  O O    . GLY A 1 29 ? 7.935   9.184   -6.787  1.00 0.00 ? 29 GLY A O    8  
ATOM 9809  H H    . GLY A 1 29 ? 7.156   5.661   -4.352  1.00 0.00 ? 29 GLY A H    8  
ATOM 9810  H HA2  . GLY A 1 29 ? 8.414   7.578   -4.458  1.00 0.00 ? 29 GLY A HA2  8  
ATOM 9811  H HA3  . GLY A 1 29 ? 8.970   6.977   -6.012  1.00 0.00 ? 29 GLY A HA3  8  
ATOM 9812  N N    . VAL A 1 30 ? 6.015   8.328   -5.985  1.00 0.00 ? 30 VAL A N    8  
ATOM 9813  C CA   . VAL A 1 30 ? 5.175   9.343   -6.610  1.00 0.00 ? 30 VAL A CA   8  
ATOM 9814  C C    . VAL A 1 30 ? 4.814   10.444  -5.619  1.00 0.00 ? 30 VAL A C    8  
ATOM 9815  O O    . VAL A 1 30 ? 5.232   11.592  -5.772  1.00 0.00 ? 30 VAL A O    8  
ATOM 9816  C CB   . VAL A 1 30 ? 3.879   8.730   -7.173  1.00 0.00 ? 30 VAL A CB   8  
ATOM 9817  C CG1  . VAL A 1 30 ? 3.115   9.758   -7.994  1.00 0.00 ? 30 VAL A CG1  8  
ATOM 9818  C CG2  . VAL A 1 30 ? 4.189   7.496   -8.006  1.00 0.00 ? 30 VAL A CG2  8  
ATOM 9819  H H    . VAL A 1 30 ? 5.595   7.625   -5.447  1.00 0.00 ? 30 VAL A H    8  
ATOM 9820  H HA   . VAL A 1 30 ? 5.729   9.776   -7.429  1.00 0.00 ? 30 VAL A HA   8  
ATOM 9821  H HB   . VAL A 1 30 ? 3.256   8.430   -6.343  1.00 0.00 ? 30 VAL A HB   8  
ATOM 9822  H HG11 . VAL A 1 30 ? 3.777   10.203  -8.721  1.00 0.00 ? 30 VAL A HG11 8  
ATOM 9823  H HG12 . VAL A 1 30 ? 2.730   10.526  -7.340  1.00 0.00 ? 30 VAL A HG12 8  
ATOM 9824  H HG13 . VAL A 1 30 ? 2.295   9.275   -8.503  1.00 0.00 ? 30 VAL A HG13 8  
ATOM 9825  H HG21 . VAL A 1 30 ? 4.366   6.655   -7.352  1.00 0.00 ? 30 VAL A HG21 8  
ATOM 9826  H HG22 . VAL A 1 30 ? 5.070   7.678   -8.604  1.00 0.00 ? 30 VAL A HG22 8  
ATOM 9827  H HG23 . VAL A 1 30 ? 3.353   7.279   -8.654  1.00 0.00 ? 30 VAL A HG23 8  
ATOM 9828  N N    . LYS A 1 31 ? 4.036   10.087  -4.602  1.00 0.00 ? 31 LYS A N    8  
ATOM 9829  C CA   . LYS A 1 31 ? 3.619   11.046  -3.586  1.00 0.00 ? 31 LYS A CA   8  
ATOM 9830  C C    . LYS A 1 31 ? 3.474   10.369  -2.225  1.00 0.00 ? 31 LYS A C    8  
ATOM 9831  O O    . LYS A 1 31 ? 3.131   9.190   -2.142  1.00 0.00 ? 31 LYS A O    8  
ATOM 9832  C CB   . LYS A 1 31 ? 2.298   11.704  -3.986  1.00 0.00 ? 31 LYS A CB   8  
ATOM 9833  C CG   . LYS A 1 31 ? 2.439   12.725  -5.103  1.00 0.00 ? 31 LYS A CG   8  
ATOM 9834  C CD   . LYS A 1 31 ? 1.592   13.961  -4.841  1.00 0.00 ? 31 LYS A CD   8  
ATOM 9835  C CE   . LYS A 1 31 ? 1.608   14.909  -6.028  1.00 0.00 ? 31 LYS A CE   8  
ATOM 9836  N NZ   . LYS A 1 31 ? 2.962   15.475  -6.270  1.00 0.00 ? 31 LYS A NZ   8  
ATOM 9837  H H    . LYS A 1 31 ? 3.736   9.157   -4.534  1.00 0.00 ? 31 LYS A H    8  
ATOM 9838  H HA   . LYS A 1 31 ? 4.383   11.807  -3.517  1.00 0.00 ? 31 LYS A HA   8  
ATOM 9839  H HB2  . LYS A 1 31 ? 1.612   10.936  -4.316  1.00 0.00 ? 31 LYS A HB2  8  
ATOM 9840  H HB3  . LYS A 1 31 ? 1.880   12.200  -3.122  1.00 0.00 ? 31 LYS A HB3  8  
ATOM 9841  H HG2  . LYS A 1 31 ? 3.475   13.022  -5.177  1.00 0.00 ? 31 LYS A HG2  8  
ATOM 9842  H HG3  . LYS A 1 31 ? 2.124   12.275  -6.032  1.00 0.00 ? 31 LYS A HG3  8  
ATOM 9843  H HD2  . LYS A 1 31 ? 0.575   13.654  -4.650  1.00 0.00 ? 31 LYS A HD2  8  
ATOM 9844  H HD3  . LYS A 1 31 ? 1.983   14.475  -3.975  1.00 0.00 ? 31 LYS A HD3  8  
ATOM 9845  H HE2  . LYS A 1 31 ? 1.290   14.369  -6.908  1.00 0.00 ? 31 LYS A HE2  8  
ATOM 9846  H HE3  . LYS A 1 31 ? 0.918   15.718  -5.836  1.00 0.00 ? 31 LYS A HE3  8  
ATOM 9847  H HZ1  . LYS A 1 31 ? 3.454   14.926  -7.005  1.00 0.00 ? 31 LYS A HZ1  8  
ATOM 9848  H HZ2  . LYS A 1 31 ? 3.525   15.443  -5.397  1.00 0.00 ? 31 LYS A HZ2  8  
ATOM 9849  H HZ3  . LYS A 1 31 ? 2.886   16.464  -6.584  1.00 0.00 ? 31 LYS A HZ3  8  
ATOM 9850  N N    . PRO A 1 32 ? 3.733   11.112  -1.135  1.00 0.00 ? 32 PRO A N    8  
ATOM 9851  C CA   . PRO A 1 32 ? 3.629   10.577  0.227   1.00 0.00 ? 32 PRO A CA   8  
ATOM 9852  C C    . PRO A 1 32 ? 2.183   10.330  0.643   1.00 0.00 ? 32 PRO A C    8  
ATOM 9853  O O    . PRO A 1 32 ? 1.283   11.088  0.279   1.00 0.00 ? 32 PRO A O    8  
ATOM 9854  C CB   . PRO A 1 32 ? 4.253   11.676  1.088   1.00 0.00 ? 32 PRO A CB   8  
ATOM 9855  C CG   . PRO A 1 32 ? 4.057   12.927  0.305   1.00 0.00 ? 32 PRO A CG   8  
ATOM 9856  C CD   . PRO A 1 32 ? 4.147   12.527  -1.143  1.00 0.00 ? 32 PRO A CD   8  
ATOM 9857  H HA   . PRO A 1 32 ? 4.194   9.664   0.337   1.00 0.00 ? 32 PRO A HA   8  
ATOM 9858  H HB2  . PRO A 1 32 ? 3.744   11.722  2.043   1.00 0.00 ? 32 PRO A HB2  8  
ATOM 9859  H HB3  . PRO A 1 32 ? 5.303   11.467  1.240   1.00 0.00 ? 32 PRO A HB3  8  
ATOM 9860  H HG2  . PRO A 1 32 ? 3.084   13.346  0.517   1.00 0.00 ? 32 PRO A HG2  8  
ATOM 9861  H HG3  . PRO A 1 32 ? 4.833   13.638  0.546   1.00 0.00 ? 32 PRO A HG3  8  
ATOM 9862  H HD2  . PRO A 1 32 ? 3.474   13.122  -1.741  1.00 0.00 ? 32 PRO A HD2  8  
ATOM 9863  H HD3  . PRO A 1 32 ? 5.162   12.629  -1.499  1.00 0.00 ? 32 PRO A HD3  8  
ATOM 9864  N N    . GLY A 1 33 ? 1.966   9.265   1.409   1.00 0.00 ? 33 GLY A N    8  
ATOM 9865  C CA   . GLY A 1 33 ? 0.627   8.937   1.861   1.00 0.00 ? 33 GLY A CA   8  
ATOM 9866  C C    . GLY A 1 33 ? 0.600   8.476   3.305   1.00 0.00 ? 33 GLY A C    8  
ATOM 9867  O O    . GLY A 1 33 ? 1.594   7.961   3.818   1.00 0.00 ? 33 GLY A O    8  
ATOM 9868  H H    . GLY A 1 33 ? 2.721   8.698   1.668   1.00 0.00 ? 33 GLY A H    8  
ATOM 9869  H HA2  . GLY A 1 33 ? 0.001   9.812   1.763   1.00 0.00 ? 33 GLY A HA2  8  
ATOM 9870  H HA3  . GLY A 1 33 ? 0.230   8.151   1.236   1.00 0.00 ? 33 GLY A HA3  8  
ATOM 9871  N N    . VAL A 1 34 ? -0.540  8.662   3.963   1.00 0.00 ? 34 VAL A N    8  
ATOM 9872  C CA   . VAL A 1 34 ? -0.692  8.261   5.356   1.00 0.00 ? 34 VAL A CA   8  
ATOM 9873  C C    . VAL A 1 34 ? -1.101  6.796   5.464   1.00 0.00 ? 34 VAL A C    8  
ATOM 9874  O O    . VAL A 1 34 ? -2.157  6.398   4.971   1.00 0.00 ? 34 VAL A O    8  
ATOM 9875  C CB   . VAL A 1 34 ? -1.738  9.130   6.081   1.00 0.00 ? 34 VAL A CB   8  
ATOM 9876  C CG1  . VAL A 1 34 ? -1.771  8.803   7.566   1.00 0.00 ? 34 VAL A CG1  8  
ATOM 9877  C CG2  . VAL A 1 34 ? -1.452  10.609  5.861   1.00 0.00 ? 34 VAL A CG2  8  
ATOM 9878  H H    . VAL A 1 34 ? -1.296  9.077   3.500   1.00 0.00 ? 34 VAL A H    8  
ATOM 9879  H HA   . VAL A 1 34 ? 0.261   8.395   5.848   1.00 0.00 ? 34 VAL A HA   8  
ATOM 9880  H HB   . VAL A 1 34 ? -2.711  8.908   5.665   1.00 0.00 ? 34 VAL A HB   8  
ATOM 9881  H HG11 . VAL A 1 34 ? -2.107  7.785   7.703   1.00 0.00 ? 34 VAL A HG11 8  
ATOM 9882  H HG12 . VAL A 1 34 ? -2.449  9.477   8.068   1.00 0.00 ? 34 VAL A HG12 8  
ATOM 9883  H HG13 . VAL A 1 34 ? -0.780  8.913   7.981   1.00 0.00 ? 34 VAL A HG13 8  
ATOM 9884  H HG21 . VAL A 1 34 ? -0.972  11.017  6.737   1.00 0.00 ? 34 VAL A HG21 8  
ATOM 9885  H HG22 . VAL A 1 34 ? -2.380  11.132  5.682   1.00 0.00 ? 34 VAL A HG22 8  
ATOM 9886  H HG23 . VAL A 1 34 ? -0.802  10.727  5.007   1.00 0.00 ? 34 VAL A HG23 8  
ATOM 9887  N N    . VAL A 1 35 ? -0.260  5.998   6.114   1.00 0.00 ? 35 VAL A N    8  
ATOM 9888  C CA   . VAL A 1 35 ? -0.534  4.576   6.286   1.00 0.00 ? 35 VAL A CA   8  
ATOM 9889  C C    . VAL A 1 35 ? -1.678  4.355   7.271   1.00 0.00 ? 35 VAL A C    8  
ATOM 9890  O O    . VAL A 1 35 ? -1.676  4.902   8.374   1.00 0.00 ? 35 VAL A O    8  
ATOM 9891  C CB   . VAL A 1 35 ? 0.710   3.820   6.784   1.00 0.00 ? 35 VAL A CB   8  
ATOM 9892  C CG1  . VAL A 1 35 ? 0.467   2.319   6.768   1.00 0.00 ? 35 VAL A CG1  8  
ATOM 9893  C CG2  . VAL A 1 35 ? 1.926   4.180   5.943   1.00 0.00 ? 35 VAL A CG2  8  
ATOM 9894  H H    . VAL A 1 35 ? 0.565   6.374   6.485   1.00 0.00 ? 35 VAL A H    8  
ATOM 9895  H HA   . VAL A 1 35 ? -0.816  4.172   5.325   1.00 0.00 ? 35 VAL A HA   8  
ATOM 9896  H HB   . VAL A 1 35 ? 0.904   4.118   7.804   1.00 0.00 ? 35 VAL A HB   8  
ATOM 9897  H HG11 . VAL A 1 35 ? -0.287  2.086   6.031   1.00 0.00 ? 35 VAL A HG11 8  
ATOM 9898  H HG12 . VAL A 1 35 ? 0.130   1.999   7.742   1.00 0.00 ? 35 VAL A HG12 8  
ATOM 9899  H HG13 . VAL A 1 35 ? 1.385   1.808   6.518   1.00 0.00 ? 35 VAL A HG13 8  
ATOM 9900  H HG21 . VAL A 1 35 ? 2.771   3.586   6.259   1.00 0.00 ? 35 VAL A HG21 8  
ATOM 9901  H HG22 . VAL A 1 35 ? 2.155   5.228   6.070   1.00 0.00 ? 35 VAL A HG22 8  
ATOM 9902  H HG23 . VAL A 1 35 ? 1.716   3.981   4.903   1.00 0.00 ? 35 VAL A HG23 8  
ATOM 9903  N N    . GLN A 1 36 ? -2.653  3.548   6.866   1.00 0.00 ? 36 GLN A N    8  
ATOM 9904  C CA   . GLN A 1 36 ? -3.803  3.253   7.712   1.00 0.00 ? 36 GLN A CA   8  
ATOM 9905  C C    . GLN A 1 36 ? -3.880  1.762   8.027   1.00 0.00 ? 36 GLN A C    8  
ATOM 9906  O O    . GLN A 1 36 ? -4.149  1.370   9.162   1.00 0.00 ? 36 GLN A O    8  
ATOM 9907  C CB   . GLN A 1 36 ? -5.095  3.708   7.031   1.00 0.00 ? 36 GLN A CB   8  
ATOM 9908  C CG   . GLN A 1 36 ? -5.494  5.134   7.376   1.00 0.00 ? 36 GLN A CG   8  
ATOM 9909  C CD   . GLN A 1 36 ? -5.927  5.285   8.821   1.00 0.00 ? 36 GLN A CD   8  
ATOM 9910  O OE1  . GLN A 1 36 ? -7.058  4.957   9.180   1.00 0.00 ? 36 GLN A OE1  8  
ATOM 9911  N NE2  . GLN A 1 36 ? -5.026  5.783   9.660   1.00 0.00 ? 36 GLN A NE2  8  
ATOM 9912  H H    . GLN A 1 36 ? -2.598  3.140   5.975   1.00 0.00 ? 36 GLN A H    8  
ATOM 9913  H HA   . GLN A 1 36 ? -3.683  3.798   8.636   1.00 0.00 ? 36 GLN A HA   8  
ATOM 9914  H HB2  . GLN A 1 36 ? -4.966  3.643   5.961   1.00 0.00 ? 36 GLN A HB2  8  
ATOM 9915  H HB3  . GLN A 1 36 ? -5.897  3.051   7.329   1.00 0.00 ? 36 GLN A HB3  8  
ATOM 9916  H HG2  . GLN A 1 36 ? -4.649  5.783   7.200   1.00 0.00 ? 36 GLN A HG2  8  
ATOM 9917  H HG3  . GLN A 1 36 ? -6.313  5.429   6.737   1.00 0.00 ? 36 GLN A HG3  8  
ATOM 9918  H HE21 . GLN A 1 36 ? -4.145  6.023   9.303   1.00 0.00 ? 36 GLN A HE21 8  
ATOM 9919  H HE22 . GLN A 1 36 ? -5.279  5.891   10.601  1.00 0.00 ? 36 GLN A HE22 8  
ATOM 9920  N N    . TYR A 1 37 ? -3.641  0.935   7.013   1.00 0.00 ? 37 TYR A N    8  
ATOM 9921  C CA   . TYR A 1 37 ? -3.684  -0.513  7.181   1.00 0.00 ? 37 TYR A CA   8  
ATOM 9922  C C    . TYR A 1 37 ? -2.333  -1.138  6.851   1.00 0.00 ? 37 TYR A C    8  
ATOM 9923  O O    . TYR A 1 37 ? -1.561  -0.593  6.062   1.00 0.00 ? 37 TYR A O    8  
ATOM 9924  C CB   . TYR A 1 37 ? -4.771  -1.118  6.291   1.00 0.00 ? 37 TYR A CB   8  
ATOM 9925  C CG   . TYR A 1 37 ? -5.458  -2.317  6.906   1.00 0.00 ? 37 TYR A CG   8  
ATOM 9926  C CD1  . TYR A 1 37 ? -6.461  -2.156  7.854   1.00 0.00 ? 37 TYR A CD1  8  
ATOM 9927  C CD2  . TYR A 1 37 ? -5.105  -3.609  6.537   1.00 0.00 ? 37 TYR A CD2  8  
ATOM 9928  C CE1  . TYR A 1 37 ? -7.092  -3.249  8.417   1.00 0.00 ? 37 TYR A CE1  8  
ATOM 9929  C CE2  . TYR A 1 37 ? -5.731  -4.707  7.097   1.00 0.00 ? 37 TYR A CE2  8  
ATOM 9930  C CZ   . TYR A 1 37 ? -6.723  -4.521  8.036   1.00 0.00 ? 37 TYR A CZ   8  
ATOM 9931  O OH   . TYR A 1 37 ? -7.348  -5.613  8.594   1.00 0.00 ? 37 TYR A OH   8  
ATOM 9932  H H    . TYR A 1 37 ? -3.432  1.308   6.132   1.00 0.00 ? 37 TYR A H    8  
ATOM 9933  H HA   . TYR A 1 37 ? -3.920  -0.720  8.214   1.00 0.00 ? 37 TYR A HA   8  
ATOM 9934  H HB2  . TYR A 1 37 ? -5.524  -0.370  6.095   1.00 0.00 ? 37 TYR A HB2  8  
ATOM 9935  H HB3  . TYR A 1 37 ? -4.328  -1.432  5.357   1.00 0.00 ? 37 TYR A HB3  8  
ATOM 9936  H HD1  . TYR A 1 37 ? -6.748  -1.158  8.150   1.00 0.00 ? 37 TYR A HD1  8  
ATOM 9937  H HD2  . TYR A 1 37 ? -4.326  -3.751  5.802   1.00 0.00 ? 37 TYR A HD2  8  
ATOM 9938  H HE1  . TYR A 1 37 ? -7.869  -3.104  9.153   1.00 0.00 ? 37 TYR A HE1  8  
ATOM 9939  H HE2  . TYR A 1 37 ? -5.441  -5.703  6.797   1.00 0.00 ? 37 TYR A HE2  8  
ATOM 9940  H HH   . TYR A 1 37 ? -6.817  -5.951  9.319   1.00 0.00 ? 37 TYR A HH   8  
ATOM 9941  N N    . LEU A 1 38 ? -2.054  -2.287  7.458   1.00 0.00 ? 38 LEU A N    8  
ATOM 9942  C CA   . LEU A 1 38 ? -0.796  -2.987  7.229   1.00 0.00 ? 38 LEU A CA   8  
ATOM 9943  C C    . LEU A 1 38 ? -0.966  -4.490  7.426   1.00 0.00 ? 38 LEU A C    8  
ATOM 9944  O O    . LEU A 1 38 ? -1.193  -4.959  8.541   1.00 0.00 ? 38 LEU A O    8  
ATOM 9945  C CB   . LEU A 1 38 ? 0.288   -2.456  8.169   1.00 0.00 ? 38 LEU A CB   8  
ATOM 9946  C CG   . LEU A 1 38 ? 1.106   -1.287  7.619   1.00 0.00 ? 38 LEU A CG   8  
ATOM 9947  C CD1  . LEU A 1 38 ? 1.686   -0.458  8.755   1.00 0.00 ? 38 LEU A CD1  8  
ATOM 9948  C CD2  . LEU A 1 38 ? 2.213   -1.795  6.709   1.00 0.00 ? 38 LEU A CD2  8  
ATOM 9949  H H    . LEU A 1 38 ? -2.709  -2.673  8.077   1.00 0.00 ? 38 LEU A H    8  
ATOM 9950  H HA   . LEU A 1 38 ? -0.496  -2.803  6.207   1.00 0.00 ? 38 LEU A HA   8  
ATOM 9951  H HB2  . LEU A 1 38 ? -0.187  -2.137  9.086   1.00 0.00 ? 38 LEU A HB2  8  
ATOM 9952  H HB3  . LEU A 1 38 ? 0.967   -3.265  8.397   1.00 0.00 ? 38 LEU A HB3  8  
ATOM 9953  H HG   . LEU A 1 38 ? 0.460   -0.647  7.035   1.00 0.00 ? 38 LEU A HG   8  
ATOM 9954  H HD11 . LEU A 1 38 ? 1.017   0.360   8.980   1.00 0.00 ? 38 LEU A HD11 8  
ATOM 9955  H HD12 . LEU A 1 38 ? 2.648   -0.068  8.461   1.00 0.00 ? 38 LEU A HD12 8  
ATOM 9956  H HD13 . LEU A 1 38 ? 1.801   -1.080  9.631   1.00 0.00 ? 38 LEU A HD13 8  
ATOM 9957  H HD21 . LEU A 1 38 ? 2.483   -2.801  6.995   1.00 0.00 ? 38 LEU A HD21 8  
ATOM 9958  H HD22 . LEU A 1 38 ? 3.076   -1.152  6.798   1.00 0.00 ? 38 LEU A HD22 8  
ATOM 9959  H HD23 . LEU A 1 38 ? 1.868   -1.793  5.685   1.00 0.00 ? 38 LEU A HD23 8  
ATOM 9960  N N    . GLY A 1 39 ? -0.855  -5.241  6.335   1.00 0.00 ? 39 GLY A N    8  
ATOM 9961  C CA   . GLY A 1 39 ? -0.999  -6.683  6.409   1.00 0.00 ? 39 GLY A CA   8  
ATOM 9962  C C    . GLY A 1 39 ? -1.524  -7.280  5.118   1.00 0.00 ? 39 GLY A C    8  
ATOM 9963  O O    . GLY A 1 39 ? -1.401  -6.677  4.051   1.00 0.00 ? 39 GLY A O    8  
ATOM 9964  H H    . GLY A 1 39 ? -0.673  -4.812  5.472   1.00 0.00 ? 39 GLY A H    8  
ATOM 9965  H HA2  . GLY A 1 39 ? -0.037  -7.120  6.629   1.00 0.00 ? 39 GLY A HA2  8  
ATOM 9966  H HA3  . GLY A 1 39 ? -1.684  -6.925  7.208   1.00 0.00 ? 39 GLY A HA3  8  
ATOM 9967  N N    . GLU A 1 40 ? -2.111  -8.469  5.213   1.00 0.00 ? 40 GLU A N    8  
ATOM 9968  C CA   . GLU A 1 40 ? -2.656  -9.149  4.043   1.00 0.00 ? 40 GLU A CA   8  
ATOM 9969  C C    . GLU A 1 40 ? -4.046  -8.619  3.705   1.00 0.00 ? 40 GLU A C    8  
ATOM 9970  O O    . GLU A 1 40 ? -4.756  -8.112  4.573   1.00 0.00 ? 40 GLU A O    8  
ATOM 9971  C CB   . GLU A 1 40 ? -2.718  -10.658 4.287   1.00 0.00 ? 40 GLU A CB   8  
ATOM 9972  C CG   . GLU A 1 40 ? -1.351  -11.313 4.396   1.00 0.00 ? 40 GLU A CG   8  
ATOM 9973  C CD   . GLU A 1 40 ? -0.905  -11.496 5.833   1.00 0.00 ? 40 GLU A CD   8  
ATOM 9974  O OE1  . GLU A 1 40 ? -1.781  -11.633 6.714   1.00 0.00 ? 40 GLU A OE1  8  
ATOM 9975  O OE2  . GLU A 1 40 ? 0.320   -11.501 6.078   1.00 0.00 ? 40 GLU A OE2  8  
ATOM 9976  H H    . GLU A 1 40 ? -2.179  -8.899  6.090   1.00 0.00 ? 40 GLU A H    8  
ATOM 9977  H HA   . GLU A 1 40 ? -1.997  -8.954  3.210   1.00 0.00 ? 40 GLU A HA   8  
ATOM 9978  H HB2  . GLU A 1 40 ? -3.256  -10.840 5.206   1.00 0.00 ? 40 GLU A HB2  8  
ATOM 9979  H HB3  . GLU A 1 40 ? -3.253  -11.121 3.470   1.00 0.00 ? 40 GLU A HB3  8  
ATOM 9980  H HG2  . GLU A 1 40 ? -1.393  -12.282 3.922   1.00 0.00 ? 40 GLU A HG2  8  
ATOM 9981  H HG3  . GLU A 1 40 ? -0.628  -10.694 3.886   1.00 0.00 ? 40 GLU A HG3  8  
ATOM 9982  N N    . THR A 1 41 ? -4.428  -8.740  2.437   1.00 0.00 ? 41 THR A N    8  
ATOM 9983  C CA   . THR A 1 41 ? -5.733  -8.274  1.985   1.00 0.00 ? 41 THR A CA   8  
ATOM 9984  C C    . THR A 1 41 ? -6.665  -9.449  1.707   1.00 0.00 ? 41 THR A C    8  
ATOM 9985  O O    . THR A 1 41 ? -6.293  -10.607 1.896   1.00 0.00 ? 41 THR A O    8  
ATOM 9986  C CB   . THR A 1 41 ? -5.583  -7.420  0.725   1.00 0.00 ? 41 THR A CB   8  
ATOM 9987  O OG1  . THR A 1 41 ? -4.737  -8.057  -0.216  1.00 0.00 ? 41 THR A OG1  8  
ATOM 9988  C CG2  . THR A 1 41 ? -5.013  -6.045  0.998   1.00 0.00 ? 41 THR A CG2  8  
ATOM 9989  H H    . THR A 1 41 ? -3.817  -9.154  1.792   1.00 0.00 ? 41 THR A H    8  
ATOM 9990  H HA   . THR A 1 41 ? -6.160  -7.669  2.770   1.00 0.00 ? 41 THR A HA   8  
ATOM 9991  H HB   . THR A 1 41 ? -6.557  -7.289  0.273   1.00 0.00 ? 41 THR A HB   8  
ATOM 9992  H HG1  . THR A 1 41 ? -5.237  -8.721  -0.697  1.00 0.00 ? 41 THR A HG1  8  
ATOM 9993  H HG21 . THR A 1 41 ? -5.818  -5.352  1.193   1.00 0.00 ? 41 THR A HG21 8  
ATOM 9994  H HG22 . THR A 1 41 ? -4.451  -5.711  0.139   1.00 0.00 ? 41 THR A HG22 8  
ATOM 9995  H HG23 . THR A 1 41 ? -4.360  -6.090  1.858   1.00 0.00 ? 41 THR A HG23 8  
ATOM 9996  N N    . GLN A 1 42 ? -7.877  -9.144  1.257   1.00 0.00 ? 42 GLN A N    8  
ATOM 9997  C CA   . GLN A 1 42 ? -8.863  -10.175 0.954   1.00 0.00 ? 42 GLN A CA   8  
ATOM 9998  C C    . GLN A 1 42 ? -9.031  -10.341 -0.553  1.00 0.00 ? 42 GLN A C    8  
ATOM 9999  O O    . GLN A 1 42 ? -9.180  -11.456 -1.051  1.00 0.00 ? 42 GLN A O    8  
ATOM 10000 C CB   . GLN A 1 42 ? -10.208 -9.829  1.597   1.00 0.00 ? 42 GLN A CB   8  
ATOM 10001 C CG   . GLN A 1 42 ? -10.458 -10.551 2.911   1.00 0.00 ? 42 GLN A CG   8  
ATOM 10002 C CD   . GLN A 1 42 ? -11.350 -11.766 2.749   1.00 0.00 ? 42 GLN A CD   8  
ATOM 10003 O OE1  . GLN A 1 42 ? -11.012 -12.863 3.192   1.00 0.00 ? 42 GLN A OE1  8  
ATOM 10004 N NE2  . GLN A 1 42 ? -12.498 -11.576 2.108   1.00 0.00 ? 42 GLN A NE2  8  
ATOM 10005 H H    . GLN A 1 42 ? -8.116  -8.202  1.127   1.00 0.00 ? 42 GLN A H    8  
ATOM 10006 H HA   . GLN A 1 42 ? -8.506  -11.106 1.368   1.00 0.00 ? 42 GLN A HA   8  
ATOM 10007 H HB2  . GLN A 1 42 ? -10.242 -8.766  1.784   1.00 0.00 ? 42 GLN A HB2  8  
ATOM 10008 H HB3  . GLN A 1 42 ? -11.001 -10.091 0.912   1.00 0.00 ? 42 GLN A HB3  8  
ATOM 10009 H HG2  . GLN A 1 42 ? -9.510  -10.872 3.317   1.00 0.00 ? 42 GLN A HG2  8  
ATOM 10010 H HG3  . GLN A 1 42 ? -10.928 -9.866  3.600   1.00 0.00 ? 42 GLN A HG3  8  
ATOM 10011 H HE21 . GLN A 1 42 ? -12.701 -10.675 1.781   1.00 0.00 ? 42 GLN A HE21 8  
ATOM 10012 H HE22 . GLN A 1 42 ? -13.094 -12.344 1.988   1.00 0.00 ? 42 GLN A HE22 8  
ATOM 10013 N N    . PHE A 1 43 ? -9.008  -9.225  -1.272  1.00 0.00 ? 43 PHE A N    8  
ATOM 10014 C CA   . PHE A 1 43 ? -9.159  -9.247  -2.723  1.00 0.00 ? 43 PHE A CA   8  
ATOM 10015 C C    . PHE A 1 43 ? -8.014  -10.015 -3.377  1.00 0.00 ? 43 PHE A C    8  
ATOM 10016 O O    . PHE A 1 43 ? -8.192  -10.643 -4.421  1.00 0.00 ? 43 PHE A O    8  
ATOM 10017 C CB   . PHE A 1 43 ? -9.215  -7.821  -3.275  1.00 0.00 ? 43 PHE A CB   8  
ATOM 10018 C CG   . PHE A 1 43 ? -7.947  -7.044  -3.063  1.00 0.00 ? 43 PHE A CG   8  
ATOM 10019 C CD1  . PHE A 1 43 ? -6.872  -7.202  -3.922  1.00 0.00 ? 43 PHE A CD1  8  
ATOM 10020 C CD2  . PHE A 1 43 ? -7.832  -6.155  -2.006  1.00 0.00 ? 43 PHE A CD2  8  
ATOM 10021 C CE1  . PHE A 1 43 ? -5.703  -6.489  -3.730  1.00 0.00 ? 43 PHE A CE1  8  
ATOM 10022 C CE2  . PHE A 1 43 ? -6.666  -5.439  -1.810  1.00 0.00 ? 43 PHE A CE2  8  
ATOM 10023 C CZ   . PHE A 1 43 ? -5.601  -5.606  -2.673  1.00 0.00 ? 43 PHE A CZ   8  
ATOM 10024 H H    . PHE A 1 43 ? -8.886  -8.365  -0.818  1.00 0.00 ? 43 PHE A H    8  
ATOM 10025 H HA   . PHE A 1 43 ? -10.088 -9.748  -2.951  1.00 0.00 ? 43 PHE A HA   8  
ATOM 10026 H HB2  . PHE A 1 43 ? -9.407  -7.860  -4.336  1.00 0.00 ? 43 PHE A HB2  8  
ATOM 10027 H HB3  . PHE A 1 43 ? -10.019 -7.287  -2.789  1.00 0.00 ? 43 PHE A HB3  8  
ATOM 10028 H HD1  . PHE A 1 43 ? -6.950  -7.892  -4.749  1.00 0.00 ? 43 PHE A HD1  8  
ATOM 10029 H HD2  . PHE A 1 43 ? -8.664  -6.025  -1.331  1.00 0.00 ? 43 PHE A HD2  8  
ATOM 10030 H HE1  . PHE A 1 43 ? -4.872  -6.621  -4.407  1.00 0.00 ? 43 PHE A HE1  8  
ATOM 10031 H HE2  . PHE A 1 43 ? -6.589  -4.749  -0.983  1.00 0.00 ? 43 PHE A HE2  8  
ATOM 10032 H HZ   . PHE A 1 43 ? -4.689  -5.048  -2.522  1.00 0.00 ? 43 PHE A HZ   8  
ATOM 10033 N N    . ALA A 1 44 ? -6.840  -9.957  -2.758  1.00 0.00 ? 44 ALA A N    8  
ATOM 10034 C CA   . ALA A 1 44 ? -5.667  -10.647 -3.280  1.00 0.00 ? 44 ALA A CA   8  
ATOM 10035 C C    . ALA A 1 44 ? -4.748  -11.102 -2.149  1.00 0.00 ? 44 ALA A C    8  
ATOM 10036 O O    . ALA A 1 44 ? -4.661  -10.449 -1.109  1.00 0.00 ? 44 ALA A O    8  
ATOM 10037 C CB   . ALA A 1 44 ? -4.912  -9.746  -4.246  1.00 0.00 ? 44 ALA A CB   8  
ATOM 10038 H H    . ALA A 1 44 ? -6.760  -9.439  -1.930  1.00 0.00 ? 44 ALA A H    8  
ATOM 10039 H HA   . ALA A 1 44 ? -6.006  -11.515 -3.825  1.00 0.00 ? 44 ALA A HA   8  
ATOM 10040 H HB1  . ALA A 1 44 ? -5.597  -9.356  -4.984  1.00 0.00 ? 44 ALA A HB1  8  
ATOM 10041 H HB2  . ALA A 1 44 ? -4.137  -10.315 -4.739  1.00 0.00 ? 44 ALA A HB2  8  
ATOM 10042 H HB3  . ALA A 1 44 ? -4.466  -8.927  -3.702  1.00 0.00 ? 44 ALA A HB3  8  
ATOM 10043 N N    . PRO A 1 45 ? -4.045  -12.232 -2.338  1.00 0.00 ? 45 PRO A N    8  
ATOM 10044 C CA   . PRO A 1 45 ? -3.130  -12.770 -1.328  1.00 0.00 ? 45 PRO A CA   8  
ATOM 10045 C C    . PRO A 1 45 ? -1.858  -11.940 -1.198  1.00 0.00 ? 45 PRO A C    8  
ATOM 10046 O O    . PRO A 1 45 ? -1.772  -10.830 -1.724  1.00 0.00 ? 45 PRO A O    8  
ATOM 10047 C CB   . PRO A 1 45 ? -2.802  -14.167 -1.858  1.00 0.00 ? 45 PRO A CB   8  
ATOM 10048 C CG   . PRO A 1 45 ? -2.976  -14.062 -3.333  1.00 0.00 ? 45 PRO A CG   8  
ATOM 10049 C CD   . PRO A 1 45 ? -4.087  -13.072 -3.552  1.00 0.00 ? 45 PRO A CD   8  
ATOM 10050 H HA   . PRO A 1 45 ? -3.608  -12.850 -0.364  1.00 0.00 ? 45 PRO A HA   8  
ATOM 10051 H HB2  . PRO A 1 45 ? -1.787  -14.427 -1.595  1.00 0.00 ? 45 PRO A HB2  8  
ATOM 10052 H HB3  . PRO A 1 45 ? -3.486  -14.887 -1.431  1.00 0.00 ? 45 PRO A HB3  8  
ATOM 10053 H HG2  . PRO A 1 45 ? -2.061  -13.704 -3.785  1.00 0.00 ? 45 PRO A HG2  8  
ATOM 10054 H HG3  . PRO A 1 45 ? -3.244  -15.024 -3.742  1.00 0.00 ? 45 PRO A HG3  8  
ATOM 10055 H HD2  . PRO A 1 45 ? -3.899  -12.482 -4.436  1.00 0.00 ? 45 PRO A HD2  8  
ATOM 10056 H HD3  . PRO A 1 45 ? -5.036  -13.583 -3.632  1.00 0.00 ? 45 PRO A HD3  8  
ATOM 10057 N N    . GLY A 1 46 ? -0.872  -12.483 -0.491  1.00 0.00 ? 46 GLY A N    8  
ATOM 10058 C CA   . GLY A 1 46 ? 0.383   -11.778 -0.303  1.00 0.00 ? 46 GLY A CA   8  
ATOM 10059 C C    . GLY A 1 46 ? 0.279   -10.675 0.733   1.00 0.00 ? 46 GLY A C    8  
ATOM 10060 O O    . GLY A 1 46 ? -0.715  -10.583 1.453   1.00 0.00 ? 46 GLY A O    8  
ATOM 10061 H H    . GLY A 1 46 ? -0.997  -13.370 -0.093  1.00 0.00 ? 46 GLY A H    8  
ATOM 10062 H HA2  . GLY A 1 46 ? 1.136   -12.484 0.013   1.00 0.00 ? 46 GLY A HA2  8  
ATOM 10063 H HA3  . GLY A 1 46 ? 0.683   -11.344 -1.245  1.00 0.00 ? 46 GLY A HA3  8  
ATOM 10064 N N    . GLN A 1 47 ? 1.309   -9.839  0.808   1.00 0.00 ? 47 GLN A N    8  
ATOM 10065 C CA   . GLN A 1 47 ? 1.331   -8.738  1.764   1.00 0.00 ? 47 GLN A CA   8  
ATOM 10066 C C    . GLN A 1 47 ? 0.867   -7.440  1.110   1.00 0.00 ? 47 GLN A C    8  
ATOM 10067 O O    . GLN A 1 47 ? 1.193   -7.163  -0.045  1.00 0.00 ? 47 GLN A O    8  
ATOM 10068 C CB   . GLN A 1 47 ? 2.740   -8.558  2.334   1.00 0.00 ? 47 GLN A CB   8  
ATOM 10069 C CG   . GLN A 1 47 ? 3.269   -9.792  3.048   1.00 0.00 ? 47 GLN A CG   8  
ATOM 10070 C CD   . GLN A 1 47 ? 2.569   -10.046 4.370   1.00 0.00 ? 47 GLN A CD   8  
ATOM 10071 O OE1  . GLN A 1 47 ? 1.435   -9.614  4.578   1.00 0.00 ? 47 GLN A OE1  8  
ATOM 10072 N NE2  . GLN A 1 47 ? 3.245   -10.748 5.271   1.00 0.00 ? 47 GLN A NE2  8  
ATOM 10073 H H    . GLN A 1 47 ? 2.073   -9.966  0.207   1.00 0.00 ? 47 GLN A H    8  
ATOM 10074 H HA   . GLN A 1 47 ? 0.655   -8.984  2.568   1.00 0.00 ? 47 GLN A HA   8  
ATOM 10075 H HB2  . GLN A 1 47 ? 3.415   -8.318  1.527   1.00 0.00 ? 47 GLN A HB2  8  
ATOM 10076 H HB3  . GLN A 1 47 ? 2.729   -7.739  3.038   1.00 0.00 ? 47 GLN A HB3  8  
ATOM 10077 H HG2  . GLN A 1 47 ? 3.122   -10.652 2.410   1.00 0.00 ? 47 GLN A HG2  8  
ATOM 10078 H HG3  . GLN A 1 47 ? 4.324   -9.659  3.235   1.00 0.00 ? 47 GLN A HG3  8  
ATOM 10079 H HE21 . GLN A 1 47 ? 4.144   -11.060 5.036   1.00 0.00 ? 47 GLN A HE21 8  
ATOM 10080 H HE22 . GLN A 1 47 ? 2.817   -10.928 6.134   1.00 0.00 ? 47 GLN A HE22 8  
ATOM 10081 N N    . TRP A 1 48 ? 0.101   -6.650  1.855   1.00 0.00 ? 48 TRP A N    8  
ATOM 10082 C CA   . TRP A 1 48 ? -0.409  -5.381  1.349   1.00 0.00 ? 48 TRP A CA   8  
ATOM 10083 C C    . TRP A 1 48 ? -0.272  -4.282  2.397   1.00 0.00 ? 48 TRP A C    8  
ATOM 10084 O O    . TRP A 1 48 ? -0.037  -4.558  3.573   1.00 0.00 ? 48 TRP A O    8  
ATOM 10085 C CB   . TRP A 1 48 ? -1.875  -5.528  0.935   1.00 0.00 ? 48 TRP A CB   8  
ATOM 10086 C CG   . TRP A 1 48 ? -2.051  -6.104  -0.435  1.00 0.00 ? 48 TRP A CG   8  
ATOM 10087 C CD1  . TRP A 1 48 ? -2.122  -7.426  -0.762  1.00 0.00 ? 48 TRP A CD1  8  
ATOM 10088 C CD2  . TRP A 1 48 ? -2.177  -5.378  -1.663  1.00 0.00 ? 48 TRP A CD2  8  
ATOM 10089 N NE1  . TRP A 1 48 ? -2.285  -7.569  -2.119  1.00 0.00 ? 48 TRP A NE1  8  
ATOM 10090 C CE2  . TRP A 1 48 ? -2.322  -6.326  -2.694  1.00 0.00 ? 48 TRP A CE2  8  
ATOM 10091 C CE3  . TRP A 1 48 ? -2.182  -4.019  -1.991  1.00 0.00 ? 48 TRP A CE3  8  
ATOM 10092 C CZ2  . TRP A 1 48 ? -2.470  -5.957  -4.029  1.00 0.00 ? 48 TRP A CZ2  8  
ATOM 10093 C CZ3  . TRP A 1 48 ? -2.330  -3.655  -3.317  1.00 0.00 ? 48 TRP A CZ3  8  
ATOM 10094 C CH2  . TRP A 1 48 ? -2.472  -4.620  -4.321  1.00 0.00 ? 48 TRP A CH2  8  
ATOM 10095 H H    . TRP A 1 48 ? -0.125  -6.925  2.768   1.00 0.00 ? 48 TRP A H    8  
ATOM 10096 H HA   . TRP A 1 48 ? 0.175   -5.111  0.482   1.00 0.00 ? 48 TRP A HA   8  
ATOM 10097 H HB2  . TRP A 1 48 ? -2.377  -6.177  1.637   1.00 0.00 ? 48 TRP A HB2  8  
ATOM 10098 H HB3  . TRP A 1 48 ? -2.345  -4.557  0.953   1.00 0.00 ? 48 TRP A HB3  8  
ATOM 10099 H HD1  . TRP A 1 48 ? -2.058  -8.232  -0.046  1.00 0.00 ? 48 TRP A HD1  8  
ATOM 10100 H HE1  . TRP A 1 48 ? -2.363  -8.421  -2.596  1.00 0.00 ? 48 TRP A HE1  8  
ATOM 10101 H HE3  . TRP A 1 48 ? -2.074  -3.261  -1.231  1.00 0.00 ? 48 TRP A HE3  8  
ATOM 10102 H HZ2  . TRP A 1 48 ? -2.582  -6.689  -4.815  1.00 0.00 ? 48 TRP A HZ2  8  
ATOM 10103 H HZ3  . TRP A 1 48 ? -2.336  -2.610  -3.589  1.00 0.00 ? 48 TRP A HZ3  8  
ATOM 10104 H HH2  . TRP A 1 48 ? -2.584  -4.290  -5.343  1.00 0.00 ? 48 TRP A HH2  8  
ATOM 10105 N N    . ALA A 1 49 ? -0.421  -3.035  1.963   1.00 0.00 ? 49 ALA A N    8  
ATOM 10106 C CA   . ALA A 1 49 ? -0.314  -1.893  2.863   1.00 0.00 ? 49 ALA A CA   8  
ATOM 10107 C C    . ALA A 1 49 ? -1.246  -0.767  2.433   1.00 0.00 ? 49 ALA A C    8  
ATOM 10108 O O    . ALA A 1 49 ? -1.053  -0.153  1.383   1.00 0.00 ? 49 ALA A O    8  
ATOM 10109 C CB   . ALA A 1 49 ? 1.124   -1.401  2.921   1.00 0.00 ? 49 ALA A CB   8  
ATOM 10110 H H    . ALA A 1 49 ? -0.607  -2.878  1.013   1.00 0.00 ? 49 ALA A H    8  
ATOM 10111 H HA   . ALA A 1 49 ? -0.597  -2.223  3.853   1.00 0.00 ? 49 ALA A HA   8  
ATOM 10112 H HB1  . ALA A 1 49 ? 1.147   -0.411  3.355   1.00 0.00 ? 49 ALA A HB1  8  
ATOM 10113 H HB2  . ALA A 1 49 ? 1.532   -1.364  1.921   1.00 0.00 ? 49 ALA A HB2  8  
ATOM 10114 H HB3  . ALA A 1 49 ? 1.712   -2.074  3.527   1.00 0.00 ? 49 ALA A HB3  8  
ATOM 10115 N N    . GLY A 1 50 ? -2.258  -0.498  3.253   1.00 0.00 ? 50 GLY A N    8  
ATOM 10116 C CA   . GLY A 1 50 ? -3.205  0.557   2.939   1.00 0.00 ? 50 GLY A CA   8  
ATOM 10117 C C    . GLY A 1 50 ? -2.650  1.938   3.219   1.00 0.00 ? 50 GLY A C    8  
ATOM 10118 O O    . GLY A 1 50 ? -2.341  2.271   4.364   1.00 0.00 ? 50 GLY A O    8  
ATOM 10119 H H    . GLY A 1 50 ? -2.363  -1.019  4.075   1.00 0.00 ? 50 GLY A H    8  
ATOM 10120 H HA2  . GLY A 1 50 ? -3.467  0.490   1.893   1.00 0.00 ? 50 GLY A HA2  8  
ATOM 10121 H HA3  . GLY A 1 50 ? -4.096  0.412   3.532   1.00 0.00 ? 50 GLY A HA3  8  
ATOM 10122 N N    . VAL A 1 51 ? -2.522  2.746   2.171   1.00 0.00 ? 51 VAL A N    8  
ATOM 10123 C CA   . VAL A 1 51 ? -2.000  4.101   2.310   1.00 0.00 ? 51 VAL A CA   8  
ATOM 10124 C C    . VAL A 1 51 ? -3.035  5.134   1.878   1.00 0.00 ? 51 VAL A C    8  
ATOM 10125 O O    . VAL A 1 51 ? -3.846  4.881   0.986   1.00 0.00 ? 51 VAL A O    8  
ATOM 10126 C CB   . VAL A 1 51 ? -0.719  4.297   1.477   1.00 0.00 ? 51 VAL A CB   8  
ATOM 10127 C CG1  . VAL A 1 51 ? -0.081  5.643   1.787   1.00 0.00 ? 51 VAL A CG1  8  
ATOM 10128 C CG2  . VAL A 1 51 ? 0.262   3.163   1.733   1.00 0.00 ? 51 VAL A CG2  8  
ATOM 10129 H H    . VAL A 1 51 ? -2.786  2.424   1.284   1.00 0.00 ? 51 VAL A H    8  
ATOM 10130 H HA   . VAL A 1 51 ? -1.758  4.261   3.350   1.00 0.00 ? 51 VAL A HA   8  
ATOM 10131 H HB   . VAL A 1 51 ? -0.987  4.284   0.431   1.00 0.00 ? 51 VAL A HB   8  
ATOM 10132 H HG11 . VAL A 1 51 ? -0.801  6.430   1.619   1.00 0.00 ? 51 VAL A HG11 8  
ATOM 10133 H HG12 . VAL A 1 51 ? 0.773   5.793   1.144   1.00 0.00 ? 51 VAL A HG12 8  
ATOM 10134 H HG13 . VAL A 1 51 ? 0.237   5.661   2.819   1.00 0.00 ? 51 VAL A HG13 8  
ATOM 10135 H HG21 . VAL A 1 51 ? 0.318   2.967   2.793   1.00 0.00 ? 51 VAL A HG21 8  
ATOM 10136 H HG22 . VAL A 1 51 ? 1.239   3.443   1.366   1.00 0.00 ? 51 VAL A HG22 8  
ATOM 10137 H HG23 . VAL A 1 51 ? -0.074  2.275   1.219   1.00 0.00 ? 51 VAL A HG23 8  
ATOM 10138 N N    . VAL A 1 52 ? -3.003  6.300   2.516   1.00 0.00 ? 52 VAL A N    8  
ATOM 10139 C CA   . VAL A 1 52 ? -3.938  7.372   2.197   1.00 0.00 ? 52 VAL A CA   8  
ATOM 10140 C C    . VAL A 1 52 ? -3.213  8.571   1.598   1.00 0.00 ? 52 VAL A C    8  
ATOM 10141 O O    . VAL A 1 52 ? -2.454  9.256   2.282   1.00 0.00 ? 52 VAL A O    8  
ATOM 10142 C CB   . VAL A 1 52 ? -4.718  7.828   3.446   1.00 0.00 ? 52 VAL A CB   8  
ATOM 10143 C CG1  . VAL A 1 52 ? -5.795  8.834   3.068   1.00 0.00 ? 52 VAL A CG1  8  
ATOM 10144 C CG2  . VAL A 1 52 ? -5.326  6.632   4.165   1.00 0.00 ? 52 VAL A CG2  8  
ATOM 10145 H H    . VAL A 1 52 ? -2.334  6.442   3.217   1.00 0.00 ? 52 VAL A H    8  
ATOM 10146 H HA   . VAL A 1 52 ? -4.647  6.993   1.475   1.00 0.00 ? 52 VAL A HA   8  
ATOM 10147 H HB   . VAL A 1 52 ? -4.027  8.312   4.120   1.00 0.00 ? 52 VAL A HB   8  
ATOM 10148 H HG11 . VAL A 1 52 ? -6.339  9.128   3.953   1.00 0.00 ? 52 VAL A HG11 8  
ATOM 10149 H HG12 . VAL A 1 52 ? -6.475  8.384   2.360   1.00 0.00 ? 52 VAL A HG12 8  
ATOM 10150 H HG13 . VAL A 1 52 ? -5.335  9.703   2.623   1.00 0.00 ? 52 VAL A HG13 8  
ATOM 10151 H HG21 . VAL A 1 52 ? -5.206  6.754   5.231   1.00 0.00 ? 52 VAL A HG21 8  
ATOM 10152 H HG22 . VAL A 1 52 ? -4.827  5.729   3.848   1.00 0.00 ? 52 VAL A HG22 8  
ATOM 10153 H HG23 . VAL A 1 52 ? -6.377  6.565   3.927   1.00 0.00 ? 52 VAL A HG23 8  
ATOM 10154 N N    . LEU A 1 53 ? -3.454  8.820   0.314   1.00 0.00 ? 53 LEU A N    8  
ATOM 10155 C CA   . LEU A 1 53 ? -2.823  9.937   -0.379  1.00 0.00 ? 53 LEU A CA   8  
ATOM 10156 C C    . LEU A 1 53 ? -3.275  11.269  0.211   1.00 0.00 ? 53 LEU A C    8  
ATOM 10157 O O    . LEU A 1 53 ? -4.244  11.327  0.967   1.00 0.00 ? 53 LEU A O    8  
ATOM 10158 C CB   . LEU A 1 53 ? -3.154  9.889   -1.872  1.00 0.00 ? 53 LEU A CB   8  
ATOM 10159 C CG   . LEU A 1 53 ? -2.456  8.774   -2.654  1.00 0.00 ? 53 LEU A CG   8  
ATOM 10160 C CD1  . LEU A 1 53 ? -3.130  8.566   -4.002  1.00 0.00 ? 53 LEU A CD1  8  
ATOM 10161 C CD2  . LEU A 1 53 ? -0.981  9.095   -2.837  1.00 0.00 ? 53 LEU A CD2  8  
ATOM 10162 H H    . LEU A 1 53 ? -4.070  8.238   -0.179  1.00 0.00 ? 53 LEU A H    8  
ATOM 10163 H HA   . LEU A 1 53 ? -1.755  9.845   -0.254  1.00 0.00 ? 53 LEU A HA   8  
ATOM 10164 H HB2  . LEU A 1 53 ? -4.222  9.762   -1.980  1.00 0.00 ? 53 LEU A HB2  8  
ATOM 10165 H HB3  . LEU A 1 53 ? -2.875  10.835  -2.312  1.00 0.00 ? 53 LEU A HB3  8  
ATOM 10166 H HG   . LEU A 1 53 ? -2.533  7.851   -2.098  1.00 0.00 ? 53 LEU A HG   8  
ATOM 10167 H HD11 . LEU A 1 53 ? -2.606  9.132   -4.758  1.00 0.00 ? 53 LEU A HD11 8  
ATOM 10168 H HD12 . LEU A 1 53 ? -4.155  8.900   -3.949  1.00 0.00 ? 53 LEU A HD12 8  
ATOM 10169 H HD13 . LEU A 1 53 ? -3.106  7.516   -4.258  1.00 0.00 ? 53 LEU A HD13 8  
ATOM 10170 H HD21 . LEU A 1 53 ? -0.517  8.325   -3.437  1.00 0.00 ? 53 LEU A HD21 8  
ATOM 10171 H HD22 . LEU A 1 53 ? -0.500  9.137   -1.871  1.00 0.00 ? 53 LEU A HD22 8  
ATOM 10172 H HD23 . LEU A 1 53 ? -0.878  10.049  -3.333  1.00 0.00 ? 53 LEU A HD23 8  
ATOM 10173 N N    . ASP A 1 54 ? -2.567  12.337  -0.141  1.00 0.00 ? 54 ASP A N    8  
ATOM 10174 C CA   . ASP A 1 54 ? -2.895  13.669  0.354   1.00 0.00 ? 54 ASP A CA   8  
ATOM 10175 C C    . ASP A 1 54 ? -3.708  14.449  -0.675  1.00 0.00 ? 54 ASP A C    8  
ATOM 10176 O O    . ASP A 1 54 ? -3.642  15.677  -0.730  1.00 0.00 ? 54 ASP A O    8  
ATOM 10177 C CB   . ASP A 1 54 ? -1.618  14.436  0.699   1.00 0.00 ? 54 ASP A CB   8  
ATOM 10178 C CG   . ASP A 1 54 ? -1.787  15.325  1.917   1.00 0.00 ? 54 ASP A CG   8  
ATOM 10179 O OD1  . ASP A 1 54 ? -2.928  15.765  2.176   1.00 0.00 ? 54 ASP A OD1  8  
ATOM 10180 O OD2  . ASP A 1 54 ? -0.781  15.580  2.611   1.00 0.00 ? 54 ASP A OD2  8  
ATOM 10181 H H    . ASP A 1 54 ? -1.805  12.227  -0.747  1.00 0.00 ? 54 ASP A H    8  
ATOM 10182 H HA   . ASP A 1 54 ? -3.488  13.553  1.250   1.00 0.00 ? 54 ASP A HA   8  
ATOM 10183 H HB2  . ASP A 1 54 ? -0.825  13.732  0.900   1.00 0.00 ? 54 ASP A HB2  8  
ATOM 10184 H HB3  . ASP A 1 54 ? -1.340  15.057  -0.140  1.00 0.00 ? 54 ASP A HB3  8  
ATOM 10185 N N    . ASP A 1 55 ? -4.473  13.729  -1.488  1.00 0.00 ? 55 ASP A N    8  
ATOM 10186 C CA   . ASP A 1 55 ? -5.299  14.353  -2.516  1.00 0.00 ? 55 ASP A CA   8  
ATOM 10187 C C    . ASP A 1 55 ? -6.097  13.303  -3.286  1.00 0.00 ? 55 ASP A C    8  
ATOM 10188 O O    . ASP A 1 55 ? -5.823  12.107  -3.184  1.00 0.00 ? 55 ASP A O    8  
ATOM 10189 C CB   . ASP A 1 55 ? -4.426  15.159  -3.482  1.00 0.00 ? 55 ASP A CB   8  
ATOM 10190 C CG   . ASP A 1 55 ? -4.498  16.650  -3.217  1.00 0.00 ? 55 ASP A CG   8  
ATOM 10191 O OD1  . ASP A 1 55 ? -5.600  17.145  -2.901  1.00 0.00 ? 55 ASP A OD1  8  
ATOM 10192 O OD2  . ASP A 1 55 ? -3.451  17.324  -3.327  1.00 0.00 ? 55 ASP A OD2  8  
ATOM 10193 H H    . ASP A 1 55 ? -4.483  12.753  -1.396  1.00 0.00 ? 55 ASP A H    8  
ATOM 10194 H HA   . ASP A 1 55 ? -5.989  15.022  -2.025  1.00 0.00 ? 55 ASP A HA   8  
ATOM 10195 H HB2  . ASP A 1 55 ? -3.399  14.844  -3.378  1.00 0.00 ? 55 ASP A HB2  8  
ATOM 10196 H HB3  . ASP A 1 55 ? -4.755  14.976  -4.495  1.00 0.00 ? 55 ASP A HB3  8  
ATOM 10197 N N    . PRO A 1 56 ? -7.098  13.738  -4.070  1.00 0.00 ? 56 PRO A N    8  
ATOM 10198 C CA   . PRO A 1 56 ? -7.935  12.828  -4.858  1.00 0.00 ? 56 PRO A CA   8  
ATOM 10199 C C    . PRO A 1 56 ? -7.176  12.217  -6.033  1.00 0.00 ? 56 PRO A C    8  
ATOM 10200 O O    . PRO A 1 56 ? -7.523  12.439  -7.192  1.00 0.00 ? 56 PRO A O    8  
ATOM 10201 C CB   . PRO A 1 56 ? -9.064  13.731  -5.359  1.00 0.00 ? 56 PRO A CB   8  
ATOM 10202 C CG   . PRO A 1 56 ? -8.471  15.097  -5.389  1.00 0.00 ? 56 PRO A CG   8  
ATOM 10203 C CD   . PRO A 1 56 ? -7.490  15.149  -4.249  1.00 0.00 ? 56 PRO A CD   8  
ATOM 10204 H HA   . PRO A 1 56 ? -8.345  12.038  -4.246  1.00 0.00 ? 56 PRO A HA   8  
ATOM 10205 H HB2  . PRO A 1 56 ? -9.374  13.412  -6.343  1.00 0.00 ? 56 PRO A HB2  8  
ATOM 10206 H HB3  . PRO A 1 56 ? -9.899  13.678  -4.678  1.00 0.00 ? 56 PRO A HB3  8  
ATOM 10207 H HG2  . PRO A 1 56 ? -7.963  15.255  -6.328  1.00 0.00 ? 56 PRO A HG2  8  
ATOM 10208 H HG3  . PRO A 1 56 ? -9.245  15.836  -5.250  1.00 0.00 ? 56 PRO A HG3  8  
ATOM 10209 H HD2  . PRO A 1 56 ? -6.637  15.755  -4.513  1.00 0.00 ? 56 PRO A HD2  8  
ATOM 10210 H HD3  . PRO A 1 56 ? -7.968  15.532  -3.359  1.00 0.00 ? 56 PRO A HD3  8  
ATOM 10211 N N    . VAL A 1 57 ? -6.137  11.448  -5.723  1.00 0.00 ? 57 VAL A N    8  
ATOM 10212 C CA   . VAL A 1 57 ? -5.329  10.805  -6.752  1.00 0.00 ? 57 VAL A CA   8  
ATOM 10213 C C    . VAL A 1 57 ? -5.079  9.338   -6.420  1.00 0.00 ? 57 VAL A C    8  
ATOM 10214 O O    . VAL A 1 57 ? -4.056  8.770   -6.802  1.00 0.00 ? 57 VAL A O    8  
ATOM 10215 C CB   . VAL A 1 57 ? -3.975  11.517  -6.926  1.00 0.00 ? 57 VAL A CB   8  
ATOM 10216 C CG1  . VAL A 1 57 ? -4.165  12.876  -7.580  1.00 0.00 ? 57 VAL A CG1  8  
ATOM 10217 C CG2  . VAL A 1 57 ? -3.268  11.656  -5.586  1.00 0.00 ? 57 VAL A CG2  8  
ATOM 10218 H H    . VAL A 1 57 ? -5.909  11.309  -4.780  1.00 0.00 ? 57 VAL A H    8  
ATOM 10219 H HA   . VAL A 1 57 ? -5.868  10.867  -7.686  1.00 0.00 ? 57 VAL A HA   8  
ATOM 10220 H HB   . VAL A 1 57 ? -3.355  10.914  -7.574  1.00 0.00 ? 57 VAL A HB   8  
ATOM 10221 H HG11 . VAL A 1 57 ? -3.264  13.461  -7.466  1.00 0.00 ? 57 VAL A HG11 8  
ATOM 10222 H HG12 . VAL A 1 57 ? -4.990  13.390  -7.110  1.00 0.00 ? 57 VAL A HG12 8  
ATOM 10223 H HG13 . VAL A 1 57 ? -4.376  12.744  -8.631  1.00 0.00 ? 57 VAL A HG13 8  
ATOM 10224 H HG21 . VAL A 1 57 ? -3.433  12.649  -5.194  1.00 0.00 ? 57 VAL A HG21 8  
ATOM 10225 H HG22 . VAL A 1 57 ? -2.210  11.493  -5.717  1.00 0.00 ? 57 VAL A HG22 8  
ATOM 10226 H HG23 . VAL A 1 57 ? -3.662  10.926  -4.894  1.00 0.00 ? 57 VAL A HG23 8  
ATOM 10227 N N    . GLY A 1 58 ? -6.021  8.728   -5.707  1.00 0.00 ? 58 GLY A N    8  
ATOM 10228 C CA   . GLY A 1 58 ? -5.883  7.333   -5.336  1.00 0.00 ? 58 GLY A CA   8  
ATOM 10229 C C    . GLY A 1 58 ? -6.708  6.414   -6.217  1.00 0.00 ? 58 GLY A C    8  
ATOM 10230 O O    . GLY A 1 58 ? -6.811  6.629   -7.425  1.00 0.00 ? 58 GLY A O    8  
ATOM 10231 H H    . GLY A 1 58 ? -6.816  9.231   -5.429  1.00 0.00 ? 58 GLY A H    8  
ATOM 10232 H HA2  . GLY A 1 58 ? -4.844  7.051   -5.416  1.00 0.00 ? 58 GLY A HA2  8  
ATOM 10233 H HA3  . GLY A 1 58 ? -6.200  7.210   -4.311  1.00 0.00 ? 58 GLY A HA3  8  
ATOM 10234 N N    . LYS A 1 59 ? -7.298  5.389   -5.611  1.00 0.00 ? 59 LYS A N    8  
ATOM 10235 C CA   . LYS A 1 59 ? -8.118  4.435   -6.348  1.00 0.00 ? 59 LYS A CA   8  
ATOM 10236 C C    . LYS A 1 59 ? -9.358  4.051   -5.547  1.00 0.00 ? 59 LYS A C    8  
ATOM 10237 O O    . LYS A 1 59 ? -10.484 4.333   -5.955  1.00 0.00 ? 59 LYS A O    8  
ATOM 10238 C CB   . LYS A 1 59 ? -7.304  3.182   -6.682  1.00 0.00 ? 59 LYS A CB   8  
ATOM 10239 C CG   . LYS A 1 59 ? -6.069  3.465   -7.521  1.00 0.00 ? 59 LYS A CG   8  
ATOM 10240 C CD   . LYS A 1 59 ? -5.555  2.204   -8.197  1.00 0.00 ? 59 LYS A CD   8  
ATOM 10241 C CE   . LYS A 1 59 ? -4.085  2.329   -8.565  1.00 0.00 ? 59 LYS A CE   8  
ATOM 10242 N NZ   . LYS A 1 59 ? -3.690  1.350   -9.615  1.00 0.00 ? 59 LYS A NZ   8  
ATOM 10243 H H    . LYS A 1 59 ? -7.178  5.271   -4.645  1.00 0.00 ? 59 LYS A H    8  
ATOM 10244 H HA   . LYS A 1 59 ? -8.429  4.906   -7.268  1.00 0.00 ? 59 LYS A HA   8  
ATOM 10245 H HB2  . LYS A 1 59 ? -6.989  2.716   -5.760  1.00 0.00 ? 59 LYS A HB2  8  
ATOM 10246 H HB3  . LYS A 1 59 ? -7.933  2.494   -7.226  1.00 0.00 ? 59 LYS A HB3  8  
ATOM 10247 H HG2  . LYS A 1 59 ? -6.319  4.192   -8.279  1.00 0.00 ? 59 LYS A HG2  8  
ATOM 10248 H HG3  . LYS A 1 59 ? -5.294  3.861   -6.880  1.00 0.00 ? 59 LYS A HG3  8  
ATOM 10249 H HD2  . LYS A 1 59 ? -5.677  1.369   -7.522  1.00 0.00 ? 59 LYS A HD2  8  
ATOM 10250 H HD3  . LYS A 1 59 ? -6.128  2.030   -9.096  1.00 0.00 ? 59 LYS A HD3  8  
ATOM 10251 H HE2  . LYS A 1 59 ? -3.902  3.328   -8.930  1.00 0.00 ? 59 LYS A HE2  8  
ATOM 10252 H HE3  . LYS A 1 59 ? -3.490  2.156   -7.680  1.00 0.00 ? 59 LYS A HE3  8  
ATOM 10253 H HZ1  . LYS A 1 59 ? -3.521  0.417   -9.188  1.00 0.00 ? 59 LYS A HZ1  8  
ATOM 10254 H HZ2  . LYS A 1 59 ? -2.820  1.665   -10.088 1.00 0.00 ? 59 LYS A HZ2  8  
ATOM 10255 H HZ3  . LYS A 1 59 ? -4.445  1.263   -10.325 1.00 0.00 ? 59 LYS A HZ3  8  
ATOM 10256 N N    . ASN A 1 60 ? -9.142  3.406   -4.405  1.00 0.00 ? 60 ASN A N    8  
ATOM 10257 C CA   . ASN A 1 60 ? -10.243 2.985   -3.547  1.00 0.00 ? 60 ASN A CA   8  
ATOM 10258 C C    . ASN A 1 60 ? -10.556 4.049   -2.501  1.00 0.00 ? 60 ASN A C    8  
ATOM 10259 O O    . ASN A 1 60 ? -9.966  5.130   -2.504  1.00 0.00 ? 60 ASN A O    8  
ATOM 10260 C CB   . ASN A 1 60 ? -9.901  1.661   -2.858  1.00 0.00 ? 60 ASN A CB   8  
ATOM 10261 C CG   . ASN A 1 60 ? -9.607  0.553   -3.849  1.00 0.00 ? 60 ASN A CG   8  
ATOM 10262 O OD1  . ASN A 1 60 ? -10.516 -0.120  -4.333  1.00 0.00 ? 60 ASN A OD1  8  
ATOM 10263 N ND2  . ASN A 1 60 ? -8.329  0.358   -4.156  1.00 0.00 ? 60 ASN A ND2  8  
ATOM 10264 H H    . ASN A 1 60 ? -8.222  3.210   -4.133  1.00 0.00 ? 60 ASN A H    8  
ATOM 10265 H HA   . ASN A 1 60 ? -11.112 2.841   -4.169  1.00 0.00 ? 60 ASN A HA   8  
ATOM 10266 H HB2  . ASN A 1 60 ? -9.030  1.802   -2.234  1.00 0.00 ? 60 ASN A HB2  8  
ATOM 10267 H HB3  . ASN A 1 60 ? -10.734 1.358   -2.241  1.00 0.00 ? 60 ASN A HB3  8  
ATOM 10268 H HD21 . ASN A 1 60 ? -7.658  0.931   -3.731  1.00 0.00 ? 60 ASN A HD21 8  
ATOM 10269 H HD22 . ASN A 1 60 ? -8.111  -0.354  -4.794  1.00 0.00 ? 60 ASN A HD22 8  
ATOM 10270 N N    . ASP A 1 61 ? -11.489 3.737   -1.607  1.00 0.00 ? 61 ASP A N    8  
ATOM 10271 C CA   . ASP A 1 61 ? -11.882 4.668   -0.555  1.00 0.00 ? 61 ASP A CA   8  
ATOM 10272 C C    . ASP A 1 61 ? -11.783 4.010   0.817   1.00 0.00 ? 61 ASP A C    8  
ATOM 10273 O O    . ASP A 1 61 ? -12.568 4.308   1.718   1.00 0.00 ? 61 ASP A O    8  
ATOM 10274 C CB   . ASP A 1 61 ? -13.308 5.166   -0.793  1.00 0.00 ? 61 ASP A CB   8  
ATOM 10275 C CG   . ASP A 1 61 ? -14.294 4.031   -0.985  1.00 0.00 ? 61 ASP A CG   8  
ATOM 10276 O OD1  . ASP A 1 61 ? -14.315 3.443   -2.087  1.00 0.00 ? 61 ASP A OD1  8  
ATOM 10277 O OD2  . ASP A 1 61 ? -15.044 3.728   -0.034  1.00 0.00 ? 61 ASP A OD2  8  
ATOM 10278 H H    . ASP A 1 61 ? -11.925 2.861   -1.657  1.00 0.00 ? 61 ASP A H    8  
ATOM 10279 H HA   . ASP A 1 61 ? -11.206 5.508   -0.587  1.00 0.00 ? 61 ASP A HA   8  
ATOM 10280 H HB2  . ASP A 1 61 ? -13.625 5.752   0.058   1.00 0.00 ? 61 ASP A HB2  8  
ATOM 10281 H HB3  . ASP A 1 61 ? -13.323 5.786   -1.677  1.00 0.00 ? 61 ASP A HB3  8  
ATOM 10282 N N    . GLY A 1 62 ? -10.814 3.113   0.970   1.00 0.00 ? 62 GLY A N    8  
ATOM 10283 C CA   . GLY A 1 62 ? -10.630 2.427   2.235   1.00 0.00 ? 62 GLY A CA   8  
ATOM 10284 C C    . GLY A 1 62 ? -11.074 0.978   2.180   1.00 0.00 ? 62 GLY A C    8  
ATOM 10285 O O    . GLY A 1 62 ? -10.389 0.093   2.691   1.00 0.00 ? 62 GLY A O    8  
ATOM 10286 H H    . GLY A 1 62 ? -10.218 2.915   0.216   1.00 0.00 ? 62 GLY A H    8  
ATOM 10287 H HA2  . GLY A 1 62 ? -9.584  2.462   2.502   1.00 0.00 ? 62 GLY A HA2  8  
ATOM 10288 H HA3  . GLY A 1 62 ? -11.202 2.938   2.995   1.00 0.00 ? 62 GLY A HA3  8  
ATOM 10289 N N    . ALA A 1 63 ? -12.225 0.738   1.559   1.00 0.00 ? 63 ALA A N    8  
ATOM 10290 C CA   . ALA A 1 63 ? -12.759 -0.613  1.440   1.00 0.00 ? 63 ALA A CA   8  
ATOM 10291 C C    . ALA A 1 63 ? -12.527 -1.174  0.041   1.00 0.00 ? 63 ALA A C    8  
ATOM 10292 O O    . ALA A 1 63 ? -12.595 -0.446  -0.950  1.00 0.00 ? 63 ALA A O    8  
ATOM 10293 C CB   . ALA A 1 63 ? -14.243 -0.626  1.775   1.00 0.00 ? 63 ALA A CB   8  
ATOM 10294 H H    . ALA A 1 63 ? -12.725 1.485   1.172   1.00 0.00 ? 63 ALA A H    8  
ATOM 10295 H HA   . ALA A 1 63 ? -12.247 -1.239  2.156   1.00 0.00 ? 63 ALA A HA   8  
ATOM 10296 H HB1  . ALA A 1 63 ? -14.591 -1.645  1.833   1.00 0.00 ? 63 ALA A HB1  8  
ATOM 10297 H HB2  . ALA A 1 63 ? -14.790 -0.101  1.005   1.00 0.00 ? 63 ALA A HB2  8  
ATOM 10298 H HB3  . ALA A 1 63 ? -14.400 -0.136  2.726   1.00 0.00 ? 63 ALA A HB3  8  
ATOM 10299 N N    . VAL A 1 64 ? -12.251 -2.472  -0.033  1.00 0.00 ? 64 VAL A N    8  
ATOM 10300 C CA   . VAL A 1 64 ? -12.008 -3.130  -1.311  1.00 0.00 ? 64 VAL A CA   8  
ATOM 10301 C C    . VAL A 1 64 ? -12.451 -4.588  -1.272  1.00 0.00 ? 64 VAL A C    8  
ATOM 10302 O O    . VAL A 1 64 ? -12.083 -5.335  -0.364  1.00 0.00 ? 64 VAL A O    8  
ATOM 10303 C CB   . VAL A 1 64 ? -10.520 -3.068  -1.702  1.00 0.00 ? 64 VAL A CB   8  
ATOM 10304 C CG1  . VAL A 1 64 ? -10.318 -3.577  -3.120  1.00 0.00 ? 64 VAL A CG1  8  
ATOM 10305 C CG2  . VAL A 1 64 ? -9.988  -1.651  -1.555  1.00 0.00 ? 64 VAL A CG2  8  
ATOM 10306 H H    . VAL A 1 64 ? -12.210 -3.000  0.791   1.00 0.00 ? 64 VAL A H    8  
ATOM 10307 H HA   . VAL A 1 64 ? -12.579 -2.611  -2.067  1.00 0.00 ? 64 VAL A HA   8  
ATOM 10308 H HB   . VAL A 1 64 ? -9.966  -3.709  -1.031  1.00 0.00 ? 64 VAL A HB   8  
ATOM 10309 H HG11 . VAL A 1 64 ? -11.128 -3.233  -3.745  1.00 0.00 ? 64 VAL A HG11 8  
ATOM 10310 H HG12 . VAL A 1 64 ? -10.300 -4.658  -3.116  1.00 0.00 ? 64 VAL A HG12 8  
ATOM 10311 H HG13 . VAL A 1 64 ? -9.381  -3.204  -3.507  1.00 0.00 ? 64 VAL A HG13 8  
ATOM 10312 H HG21 . VAL A 1 64 ? -10.681 -0.957  -2.007  1.00 0.00 ? 64 VAL A HG21 8  
ATOM 10313 H HG22 . VAL A 1 64 ? -9.029  -1.573  -2.047  1.00 0.00 ? 64 VAL A HG22 8  
ATOM 10314 H HG23 . VAL A 1 64 ? -9.875  -1.416  -0.507  1.00 0.00 ? 64 VAL A HG23 8  
ATOM 10315 N N    . GLY A 1 65 ? -13.242 -4.989  -2.261  1.00 0.00 ? 65 GLY A N    8  
ATOM 10316 C CA   . GLY A 1 65 ? -13.721 -6.357  -2.321  1.00 0.00 ? 65 GLY A CA   8  
ATOM 10317 C C    . GLY A 1 65 ? -14.607 -6.713  -1.143  1.00 0.00 ? 65 GLY A C    8  
ATOM 10318 O O    . GLY A 1 65 ? -14.398 -7.734  -0.487  1.00 0.00 ? 65 GLY A O    8  
ATOM 10319 H H    . GLY A 1 65 ? -13.502 -4.350  -2.957  1.00 0.00 ? 65 GLY A H    8  
ATOM 10320 H HA2  . GLY A 1 65 ? -14.283 -6.491  -3.233  1.00 0.00 ? 65 GLY A HA2  8  
ATOM 10321 H HA3  . GLY A 1 65 ? -12.872 -7.024  -2.333  1.00 0.00 ? 65 GLY A HA3  8  
ATOM 10322 N N    . GLY A 1 66 ? -15.601 -5.871  -0.876  1.00 0.00 ? 66 GLY A N    8  
ATOM 10323 C CA   . GLY A 1 66 ? -16.507 -6.120  0.230   1.00 0.00 ? 66 GLY A CA   8  
ATOM 10324 C C    . GLY A 1 66 ? -15.788 -6.205  1.562   1.00 0.00 ? 66 GLY A C    8  
ATOM 10325 O O    . GLY A 1 66 ? -16.251 -6.880  2.482   1.00 0.00 ? 66 GLY A O    8  
ATOM 10326 H H    . GLY A 1 66 ? -15.719 -5.074  -1.433  1.00 0.00 ? 66 GLY A H    8  
ATOM 10327 H HA2  . GLY A 1 66 ? -17.230 -5.320  0.274   1.00 0.00 ? 66 GLY A HA2  8  
ATOM 10328 H HA3  . GLY A 1 66 ? -17.025 -7.050  0.053   1.00 0.00 ? 66 GLY A HA3  8  
ATOM 10329 N N    . VAL A 1 67 ? -14.653 -5.521  1.665   1.00 0.00 ? 67 VAL A N    8  
ATOM 10330 C CA   . VAL A 1 67 ? -13.870 -5.522  2.894   1.00 0.00 ? 67 VAL A CA   8  
ATOM 10331 C C    . VAL A 1 67 ? -13.462 -4.106  3.287   1.00 0.00 ? 67 VAL A C    8  
ATOM 10332 O O    . VAL A 1 67 ? -12.999 -3.330  2.452   1.00 0.00 ? 67 VAL A O    8  
ATOM 10333 C CB   . VAL A 1 67 ? -12.604 -6.388  2.752   1.00 0.00 ? 67 VAL A CB   8  
ATOM 10334 C CG1  . VAL A 1 67 ? -11.906 -6.540  4.096   1.00 0.00 ? 67 VAL A CG1  8  
ATOM 10335 C CG2  . VAL A 1 67 ? -12.950 -7.748  2.166   1.00 0.00 ? 67 VAL A CG2  8  
ATOM 10336 H H    . VAL A 1 67 ? -14.336 -5.002  0.898   1.00 0.00 ? 67 VAL A H    8  
ATOM 10337 H HA   . VAL A 1 67 ? -14.481 -5.941  3.680   1.00 0.00 ? 67 VAL A HA   8  
ATOM 10338 H HB   . VAL A 1 67 ? -11.926 -5.890  2.075   1.00 0.00 ? 67 VAL A HB   8  
ATOM 10339 H HG11 . VAL A 1 67 ? -11.260 -7.404  4.070   1.00 0.00 ? 67 VAL A HG11 8  
ATOM 10340 H HG12 . VAL A 1 67 ? -12.645 -6.667  4.872   1.00 0.00 ? 67 VAL A HG12 8  
ATOM 10341 H HG13 . VAL A 1 67 ? -11.318 -5.657  4.298   1.00 0.00 ? 67 VAL A HG13 8  
ATOM 10342 H HG21 . VAL A 1 67 ? -12.805 -7.727  1.096   1.00 0.00 ? 67 VAL A HG21 8  
ATOM 10343 H HG22 . VAL A 1 67 ? -13.982 -7.982  2.384   1.00 0.00 ? 67 VAL A HG22 8  
ATOM 10344 H HG23 . VAL A 1 67 ? -12.310 -8.501  2.601   1.00 0.00 ? 67 VAL A HG23 8  
ATOM 10345 N N    . ARG A 1 68 ? -13.636 -3.778  4.563   1.00 0.00 ? 68 ARG A N    8  
ATOM 10346 C CA   . ARG A 1 68 ? -13.287 -2.454  5.065   1.00 0.00 ? 68 ARG A CA   8  
ATOM 10347 C C    . ARG A 1 68 ? -11.992 -2.503  5.871   1.00 0.00 ? 68 ARG A C    8  
ATOM 10348 O O    . ARG A 1 68 ? -11.894 -3.222  6.866   1.00 0.00 ? 68 ARG A O    8  
ATOM 10349 C CB   . ARG A 1 68 ? -14.422 -1.899  5.928   1.00 0.00 ? 68 ARG A CB   8  
ATOM 10350 C CG   . ARG A 1 68 ? -14.955 -0.560  5.442   1.00 0.00 ? 68 ARG A CG   8  
ATOM 10351 C CD   . ARG A 1 68 ? -15.280 0.367   6.603   1.00 0.00 ? 68 ARG A CD   8  
ATOM 10352 N NE   . ARG A 1 68 ? -16.658 0.207   7.061   1.00 0.00 ? 68 ARG A NE   8  
ATOM 10353 C CZ   . ARG A 1 68 ? -17.304 1.108   7.798   1.00 0.00 ? 68 ARG A CZ   8  
ATOM 10354 N NH1  . ARG A 1 68 ? -16.701 2.233   8.163   1.00 0.00 ? 68 ARG A NH1  8  
ATOM 10355 N NH2  . ARG A 1 68 ? -18.556 0.882   8.173   1.00 0.00 ? 68 ARG A NH2  8  
ATOM 10356 H H    . ARG A 1 68 ? -14.009 -4.441  5.181   1.00 0.00 ? 68 ARG A H    8  
ATOM 10357 H HA   . ARG A 1 68 ? -13.143 -1.806  4.215   1.00 0.00 ? 68 ARG A HA   8  
ATOM 10358 H HB2  . ARG A 1 68 ? -15.240 -2.608  5.927   1.00 0.00 ? 68 ARG A HB2  8  
ATOM 10359 H HB3  . ARG A 1 68 ? -14.065 -1.774  6.942   1.00 0.00 ? 68 ARG A HB3  8  
ATOM 10360 H HG2  . ARG A 1 68 ? -14.207 -0.091  4.820   1.00 0.00 ? 68 ARG A HG2  8  
ATOM 10361 H HG3  . ARG A 1 68 ? -15.852 -0.728  4.865   1.00 0.00 ? 68 ARG A HG3  8  
ATOM 10362 H HD2  . ARG A 1 68 ? -14.611 0.146   7.421   1.00 0.00 ? 68 ARG A HD2  8  
ATOM 10363 H HD3  . ARG A 1 68 ? -15.133 1.388   6.284   1.00 0.00 ? 68 ARG A HD3  8  
ATOM 10364 H HE   . ARG A 1 68 ? -17.126 -0.616  6.807   1.00 0.00 ? 68 ARG A HE   8  
ATOM 10365 H HH11 . ARG A 1 68 ? -15.757 2.409   7.883   1.00 0.00 ? 68 ARG A HH11 8  
ATOM 10366 H HH12 . ARG A 1 68 ? -17.192 2.906   8.716   1.00 0.00 ? 68 ARG A HH12 8  
ATOM 10367 H HH21 . ARG A 1 68 ? -19.014 0.036   7.901   1.00 0.00 ? 68 ARG A HH21 8  
ATOM 10368 H HH22 . ARG A 1 68 ? -19.041 1.559   8.726   1.00 0.00 ? 68 ARG A HH22 8  
ATOM 10369 N N    . TYR A 1 69 ? -11.000 -1.733  5.435   1.00 0.00 ? 69 TYR A N    8  
ATOM 10370 C CA   . TYR A 1 69 ? -9.711  -1.689  6.116   1.00 0.00 ? 69 TYR A CA   8  
ATOM 10371 C C    . TYR A 1 69 ? -9.572  -0.409  6.933   1.00 0.00 ? 69 TYR A C    8  
ATOM 10372 O O    . TYR A 1 69 ? -9.261  -0.450  8.122   1.00 0.00 ? 69 TYR A O    8  
ATOM 10373 C CB   . TYR A 1 69 ? -8.571  -1.786  5.100   1.00 0.00 ? 69 TYR A CB   8  
ATOM 10374 C CG   . TYR A 1 69 ? -8.695  -2.964  4.160   1.00 0.00 ? 69 TYR A CG   8  
ATOM 10375 C CD1  . TYR A 1 69 ? -9.662  -2.982  3.163   1.00 0.00 ? 69 TYR A CD1  8  
ATOM 10376 C CD2  . TYR A 1 69 ? -7.846  -4.058  4.271   1.00 0.00 ? 69 TYR A CD2  8  
ATOM 10377 C CE1  . TYR A 1 69 ? -9.780  -4.056  2.302   1.00 0.00 ? 69 TYR A CE1  8  
ATOM 10378 C CE2  . TYR A 1 69 ? -7.956  -5.136  3.414   1.00 0.00 ? 69 TYR A CE2  8  
ATOM 10379 C CZ   . TYR A 1 69 ? -8.925  -5.131  2.432   1.00 0.00 ? 69 TYR A CZ   8  
ATOM 10380 O OH   . TYR A 1 69 ? -9.038  -6.203  1.577   1.00 0.00 ? 69 TYR A OH   8  
ATOM 10381 H H    . TYR A 1 69 ? -11.138 -1.183  4.636   1.00 0.00 ? 69 TYR A H    8  
ATOM 10382 H HA   . TYR A 1 69 ? -9.659  -2.535  6.783   1.00 0.00 ? 69 TYR A HA   8  
ATOM 10383 H HB2  . TYR A 1 69 ? -8.551  -0.887  4.503   1.00 0.00 ? 69 TYR A HB2  8  
ATOM 10384 H HB3  . TYR A 1 69 ? -7.634  -1.880  5.630   1.00 0.00 ? 69 TYR A HB3  8  
ATOM 10385 H HD1  . TYR A 1 69 ? -10.330 -2.139  3.064   1.00 0.00 ? 69 TYR A HD1  8  
ATOM 10386 H HD2  . TYR A 1 69 ? -7.089  -4.060  5.042   1.00 0.00 ? 69 TYR A HD2  8  
ATOM 10387 H HE1  . TYR A 1 69 ? -10.537 -4.052  1.533   1.00 0.00 ? 69 TYR A HE1  8  
ATOM 10388 H HE2  . TYR A 1 69 ? -7.287  -5.978  3.515   1.00 0.00 ? 69 TYR A HE2  8  
ATOM 10389 H HH   . TYR A 1 69 ? -9.384  -6.960  2.055   1.00 0.00 ? 69 TYR A HH   8  
ATOM 10390 N N    . PHE A 1 70 ? -9.805  0.729   6.285   1.00 0.00 ? 70 PHE A N    8  
ATOM 10391 C CA   . PHE A 1 70 ? -9.705  2.022   6.951   1.00 0.00 ? 70 PHE A CA   8  
ATOM 10392 C C    . PHE A 1 70 ? -10.734 3.001   6.395   1.00 0.00 ? 70 PHE A C    8  
ATOM 10393 O O    . PHE A 1 70 ? -11.164 2.880   5.248   1.00 0.00 ? 70 PHE A O    8  
ATOM 10394 C CB   . PHE A 1 70 ? -8.297  2.596   6.788   1.00 0.00 ? 70 PHE A CB   8  
ATOM 10395 C CG   . PHE A 1 70 ? -7.874  2.747   5.355   1.00 0.00 ? 70 PHE A CG   8  
ATOM 10396 C CD1  . PHE A 1 70 ? -8.195  3.891   4.641   1.00 0.00 ? 70 PHE A CD1  8  
ATOM 10397 C CD2  . PHE A 1 70 ? -7.154  1.746   4.723   1.00 0.00 ? 70 PHE A CD2  8  
ATOM 10398 C CE1  . PHE A 1 70 ? -7.807  4.032   3.322   1.00 0.00 ? 70 PHE A CE1  8  
ATOM 10399 C CE2  . PHE A 1 70 ? -6.763  1.882   3.404   1.00 0.00 ? 70 PHE A CE2  8  
ATOM 10400 C CZ   . PHE A 1 70 ? -7.090  3.027   2.703   1.00 0.00 ? 70 PHE A CZ   8  
ATOM 10401 H H    . PHE A 1 70 ? -10.048 0.697   5.337   1.00 0.00 ? 70 PHE A H    8  
ATOM 10402 H HA   . PHE A 1 70 ? -9.903  1.869   8.002   1.00 0.00 ? 70 PHE A HA   8  
ATOM 10403 H HB2  . PHE A 1 70 ? -8.258  3.572   7.250   1.00 0.00 ? 70 PHE A HB2  8  
ATOM 10404 H HB3  . PHE A 1 70 ? -7.590  1.942   7.278   1.00 0.00 ? 70 PHE A HB3  8  
ATOM 10405 H HD1  . PHE A 1 70 ? -8.755  4.677   5.124   1.00 0.00 ? 70 PHE A HD1  8  
ATOM 10406 H HD2  . PHE A 1 70 ? -6.897  0.851   5.270   1.00 0.00 ? 70 PHE A HD2  8  
ATOM 10407 H HE1  . PHE A 1 70 ? -8.064  4.928   2.775   1.00 0.00 ? 70 PHE A HE1  8  
ATOM 10408 H HE2  . PHE A 1 70 ? -6.202  1.095   2.922   1.00 0.00 ? 70 PHE A HE2  8  
ATOM 10409 H HZ   . PHE A 1 70 ? -6.786  3.135   1.672   1.00 0.00 ? 70 PHE A HZ   8  
ATOM 10410 N N    . GLU A 1 71 ? -11.125 3.971   7.215   1.00 0.00 ? 71 GLU A N    8  
ATOM 10411 C CA   . GLU A 1 71 ? -12.103 4.971   6.806   1.00 0.00 ? 71 GLU A CA   8  
ATOM 10412 C C    . GLU A 1 71 ? -11.416 6.273   6.407   1.00 0.00 ? 71 GLU A C    8  
ATOM 10413 O O    . GLU A 1 71 ? -10.713 6.887   7.209   1.00 0.00 ? 71 GLU A O    8  
ATOM 10414 C CB   . GLU A 1 71 ? -13.100 5.232   7.937   1.00 0.00 ? 71 GLU A CB   8  
ATOM 10415 C CG   . GLU A 1 71 ? -14.339 5.994   7.493   1.00 0.00 ? 71 GLU A CG   8  
ATOM 10416 C CD   . GLU A 1 71 ? -15.227 6.389   8.655   1.00 0.00 ? 71 GLU A CD   8  
ATOM 10417 O OE1  . GLU A 1 71 ? -14.727 6.425   9.800   1.00 0.00 ? 71 GLU A OE1  8  
ATOM 10418 O OE2  . GLU A 1 71 ? -16.424 6.663   8.422   1.00 0.00 ? 71 GLU A OE2  8  
ATOM 10419 H H    . GLU A 1 71 ? -10.746 4.014   8.118   1.00 0.00 ? 71 GLU A H    8  
ATOM 10420 H HA   . GLU A 1 71 ? -12.637 4.582   5.951   1.00 0.00 ? 71 GLU A HA   8  
ATOM 10421 H HB2  . GLU A 1 71 ? -13.415 4.286   8.350   1.00 0.00 ? 71 GLU A HB2  8  
ATOM 10422 H HB3  . GLU A 1 71 ? -12.609 5.807   8.709   1.00 0.00 ? 71 GLU A HB3  8  
ATOM 10423 H HG2  . GLU A 1 71 ? -14.029 6.889   6.975   1.00 0.00 ? 71 GLU A HG2  8  
ATOM 10424 H HG3  . GLU A 1 71 ? -14.907 5.367   6.821   1.00 0.00 ? 71 GLU A HG3  8  
ATOM 10425 N N    . CYS A 1 72 ? -11.624 6.689   5.161   1.00 0.00 ? 72 CYS A N    8  
ATOM 10426 C CA   . CYS A 1 72 ? -11.025 7.918   4.656   1.00 0.00 ? 72 CYS A CA   8  
ATOM 10427 C C    . CYS A 1 72 ? -11.761 8.412   3.413   1.00 0.00 ? 72 CYS A C    8  
ATOM 10428 O O    . CYS A 1 72 ? -12.548 7.678   2.815   1.00 0.00 ? 72 CYS A O    8  
ATOM 10429 C CB   . CYS A 1 72 ? -9.547  7.693   4.331   1.00 0.00 ? 72 CYS A CB   8  
ATOM 10430 S SG   . CYS A 1 72 ? -8.424  8.080   5.695   1.00 0.00 ? 72 CYS A SG   8  
ATOM 10431 H H    . CYS A 1 72 ? -12.194 6.155   4.569   1.00 0.00 ? 72 CYS A H    8  
ATOM 10432 H HA   . CYS A 1 72 ? -11.104 8.667   5.428   1.00 0.00 ? 72 CYS A HA   8  
ATOM 10433 H HB2  . CYS A 1 72 ? -9.398  6.656   4.068   1.00 0.00 ? 72 CYS A HB2  8  
ATOM 10434 H HB3  . CYS A 1 72 ? -9.271  8.315   3.492   1.00 0.00 ? 72 CYS A HB3  8  
ATOM 10435 H HG   . CYS A 1 72 ? -7.528  8.070   5.353   1.00 0.00 ? 72 CYS A HG   8  
ATOM 10436 N N    . PRO A 1 73 ? -11.514 9.669   3.007   1.00 0.00 ? 73 PRO A N    8  
ATOM 10437 C CA   . PRO A 1 73 ? -12.158 10.259  1.829   1.00 0.00 ? 73 PRO A CA   8  
ATOM 10438 C C    . PRO A 1 73 ? -12.012 9.383   0.590   1.00 0.00 ? 73 PRO A C    8  
ATOM 10439 O O    . PRO A 1 73 ? -11.100 8.560   0.502   1.00 0.00 ? 73 PRO A O    8  
ATOM 10440 C CB   . PRO A 1 73 ? -11.412 11.582  1.639   1.00 0.00 ? 73 PRO A CB   8  
ATOM 10441 C CG   . PRO A 1 73 ? -10.897 11.924  2.994   1.00 0.00 ? 73 PRO A CG   8  
ATOM 10442 C CD   . PRO A 1 73 ? -10.589 10.613  3.662   1.00 0.00 ? 73 PRO A CD   8  
ATOM 10443 H HA   . PRO A 1 73 ? -13.204 10.455  2.007   1.00 0.00 ? 73 PRO A HA   8  
ATOM 10444 H HB2  . PRO A 1 73 ? -10.606 11.445  0.932   1.00 0.00 ? 73 PRO A HB2  8  
ATOM 10445 H HB3  . PRO A 1 73 ? -12.095 12.335  1.275   1.00 0.00 ? 73 PRO A HB3  8  
ATOM 10446 H HG2  . PRO A 1 73 ? -10.001 12.520  2.907   1.00 0.00 ? 73 PRO A HG2  8  
ATOM 10447 H HG3  . PRO A 1 73 ? -11.653 12.458  3.550   1.00 0.00 ? 73 PRO A HG3  8  
ATOM 10448 H HD2  . PRO A 1 73 ? -9.561  10.330  3.485   1.00 0.00 ? 73 PRO A HD2  8  
ATOM 10449 H HD3  . PRO A 1 73 ? -10.788 10.672  4.722   1.00 0.00 ? 73 PRO A HD3  8  
ATOM 10450 N N    . ALA A 1 74 ? -12.916 9.565   -0.368  1.00 0.00 ? 74 ALA A N    8  
ATOM 10451 C CA   . ALA A 1 74 ? -12.888 8.790   -1.602  1.00 0.00 ? 74 ALA A CA   8  
ATOM 10452 C C    . ALA A 1 74 ? -11.718 9.208   -2.486  1.00 0.00 ? 74 ALA A C    8  
ATOM 10453 O O    . ALA A 1 74 ? -11.241 10.340  -2.407  1.00 0.00 ? 74 ALA A O    8  
ATOM 10454 C CB   . ALA A 1 74 ? -14.202 8.948   -2.353  1.00 0.00 ? 74 ALA A CB   8  
ATOM 10455 H H    . ALA A 1 74 ? -13.619 10.235  -0.239  1.00 0.00 ? 74 ALA A H    8  
ATOM 10456 H HA   . ALA A 1 74 ? -12.773 7.749   -1.340  1.00 0.00 ? 74 ALA A HA   8  
ATOM 10457 H HB1  . ALA A 1 74 ? -14.995 9.156   -1.650  1.00 0.00 ? 74 ALA A HB1  8  
ATOM 10458 H HB2  . ALA A 1 74 ? -14.423 8.035   -2.887  1.00 0.00 ? 74 ALA A HB2  8  
ATOM 10459 H HB3  . ALA A 1 74 ? -14.119 9.764   -3.055  1.00 0.00 ? 74 ALA A HB3  8  
ATOM 10460 N N    . LEU A 1 75 ? -11.262 8.287   -3.329  1.00 0.00 ? 75 LEU A N    8  
ATOM 10461 C CA   . LEU A 1 75 ? -10.147 8.560   -4.230  1.00 0.00 ? 75 LEU A CA   8  
ATOM 10462 C C    . LEU A 1 75 ? -8.887  8.916   -3.447  1.00 0.00 ? 75 LEU A C    8  
ATOM 10463 O O    . LEU A 1 75 ? -8.042  9.673   -3.923  1.00 0.00 ? 75 LEU A O    8  
ATOM 10464 C CB   . LEU A 1 75 ? -10.505 9.699   -5.186  1.00 0.00 ? 75 LEU A CB   8  
ATOM 10465 C CG   . LEU A 1 75 ? -11.776 9.479   -6.008  1.00 0.00 ? 75 LEU A CG   8  
ATOM 10466 C CD1  . LEU A 1 75 ? -12.381 10.811  -6.423  1.00 0.00 ? 75 LEU A CD1  8  
ATOM 10467 C CD2  . LEU A 1 75 ? -11.476 8.624   -7.230  1.00 0.00 ? 75 LEU A CD2  8  
ATOM 10468 H H    . LEU A 1 75 ? -11.684 7.404   -3.346  1.00 0.00 ? 75 LEU A H    8  
ATOM 10469 H HA   . LEU A 1 75 ? -9.959  7.666   -4.805  1.00 0.00 ? 75 LEU A HA   8  
ATOM 10470 H HB2  . LEU A 1 75 ? -10.628 10.602  -4.605  1.00 0.00 ? 75 LEU A HB2  8  
ATOM 10471 H HB3  . LEU A 1 75 ? -9.681  9.840   -5.869  1.00 0.00 ? 75 LEU A HB3  8  
ATOM 10472 H HG   . LEU A 1 75 ? -12.502 8.956   -5.403  1.00 0.00 ? 75 LEU A HG   8  
ATOM 10473 H HD11 . LEU A 1 75 ? -12.059 11.056  -7.424  1.00 0.00 ? 75 LEU A HD11 8  
ATOM 10474 H HD12 . LEU A 1 75 ? -12.055 11.582  -5.741  1.00 0.00 ? 75 LEU A HD12 8  
ATOM 10475 H HD13 . LEU A 1 75 ? -13.459 10.740  -6.398  1.00 0.00 ? 75 LEU A HD13 8  
ATOM 10476 H HD21 . LEU A 1 75 ? -10.575 8.980   -7.707  1.00 0.00 ? 75 LEU A HD21 8  
ATOM 10477 H HD22 . LEU A 1 75 ? -12.300 8.688   -7.926  1.00 0.00 ? 75 LEU A HD22 8  
ATOM 10478 H HD23 . LEU A 1 75 ? -11.340 7.596   -6.926  1.00 0.00 ? 75 LEU A HD23 8  
ATOM 10479 N N    . GLN A 1 76 ? -8.768  8.365   -2.244  1.00 0.00 ? 76 GLN A N    8  
ATOM 10480 C CA   . GLN A 1 76 ? -7.611  8.624   -1.395  1.00 0.00 ? 76 GLN A CA   8  
ATOM 10481 C C    . GLN A 1 76 ? -7.057  7.327   -0.817  1.00 0.00 ? 76 GLN A C    8  
ATOM 10482 O O    . GLN A 1 76 ? -5.847  7.105   -0.808  1.00 0.00 ? 76 GLN A O    8  
ATOM 10483 C CB   . GLN A 1 76 ? -7.985  9.582   -0.263  1.00 0.00 ? 76 GLN A CB   8  
ATOM 10484 C CG   . GLN A 1 76 ? -7.973  11.045  -0.673  1.00 0.00 ? 76 GLN A CG   8  
ATOM 10485 C CD   . GLN A 1 76 ? -8.022  11.983  0.516   1.00 0.00 ? 76 GLN A CD   8  
ATOM 10486 O OE1  . GLN A 1 76 ? -8.888  12.856  0.597   1.00 0.00 ? 76 GLN A OE1  8  
ATOM 10487 N NE2  . GLN A 1 76 ? -7.092  11.809  1.447   1.00 0.00 ? 76 GLN A NE2  8  
ATOM 10488 H H    . GLN A 1 76 ? -9.475  7.769   -1.918  1.00 0.00 ? 76 GLN A H    8  
ATOM 10489 H HA   . GLN A 1 76 ? -6.850  9.083   -2.005  1.00 0.00 ? 76 GLN A HA   8  
ATOM 10490 H HB2  . GLN A 1 76 ? -8.977  9.336   0.086   1.00 0.00 ? 76 GLN A HB2  8  
ATOM 10491 H HB3  . GLN A 1 76 ? -7.285  9.451   0.549   1.00 0.00 ? 76 GLN A HB3  8  
ATOM 10492 H HG2  . GLN A 1 76 ? -7.068  11.241  -1.230  1.00 0.00 ? 76 GLN A HG2  8  
ATOM 10493 H HG3  . GLN A 1 76 ? -8.830  11.237  -1.302  1.00 0.00 ? 76 GLN A HG3  8  
ATOM 10494 H HE21 . GLN A 1 76 ? -6.434  11.094  1.317   1.00 0.00 ? 76 GLN A HE21 8  
ATOM 10495 H HE22 . GLN A 1 76 ? -7.101  12.402  2.228   1.00 0.00 ? 76 GLN A HE22 8  
ATOM 10496 N N    . GLY A 1 77 ? -7.952  6.476   -0.335  1.00 0.00 ? 77 GLY A N    8  
ATOM 10497 C CA   . GLY A 1 77 ? -7.541  5.209   0.241   1.00 0.00 ? 77 GLY A CA   8  
ATOM 10498 C C    . GLY A 1 77 ? -7.034  4.235   -0.804  1.00 0.00 ? 77 GLY A C    8  
ATOM 10499 O O    . GLY A 1 77 ? -7.726  3.282   -1.162  1.00 0.00 ? 77 GLY A O    8  
ATOM 10500 H H    . GLY A 1 77 ? -8.902  6.710   -0.370  1.00 0.00 ? 77 GLY A H    8  
ATOM 10501 H HA2  . GLY A 1 77 ? -6.754  5.392   0.959   1.00 0.00 ? 77 GLY A HA2  8  
ATOM 10502 H HA3  . GLY A 1 77 ? -8.383  4.767   0.751   1.00 0.00 ? 77 GLY A HA3  8  
ATOM 10503 N N    . ILE A 1 78 ? -5.821  4.473   -1.295  1.00 0.00 ? 78 ILE A N    8  
ATOM 10504 C CA   . ILE A 1 78 ? -5.223  3.610   -2.304  1.00 0.00 ? 78 ILE A CA   8  
ATOM 10505 C C    . ILE A 1 78 ? -4.504  2.428   -1.659  1.00 0.00 ? 78 ILE A C    8  
ATOM 10506 O O    . ILE A 1 78 ? -3.938  2.551   -0.573  1.00 0.00 ? 78 ILE A O    8  
ATOM 10507 C CB   . ILE A 1 78 ? -4.228  4.387   -3.190  1.00 0.00 ? 78 ILE A CB   8  
ATOM 10508 C CG1  . ILE A 1 78 ? -3.697  3.491   -4.311  1.00 0.00 ? 78 ILE A CG1  8  
ATOM 10509 C CG2  . ILE A 1 78 ? -3.080  4.934   -2.352  1.00 0.00 ? 78 ILE A CG2  8  
ATOM 10510 C CD1  . ILE A 1 78 ? -2.963  4.250   -5.395  1.00 0.00 ? 78 ILE A CD1  8  
ATOM 10511 H H    . ILE A 1 78 ? -5.318  5.249   -0.969  1.00 0.00 ? 78 ILE A H    8  
ATOM 10512 H HA   . ILE A 1 78 ? -6.016  3.235   -2.934  1.00 0.00 ? 78 ILE A HA   8  
ATOM 10513 H HB   . ILE A 1 78 ? -4.750  5.225   -3.627  1.00 0.00 ? 78 ILE A HB   8  
ATOM 10514 H HG12 . ILE A 1 78 ? -3.011  2.769   -3.892  1.00 0.00 ? 78 ILE A HG12 8  
ATOM 10515 H HG13 . ILE A 1 78 ? -4.524  2.970   -4.771  1.00 0.00 ? 78 ILE A HG13 8  
ATOM 10516 H HG21 . ILE A 1 78 ? -2.837  5.933   -2.683  1.00 0.00 ? 78 ILE A HG21 8  
ATOM 10517 H HG22 . ILE A 1 78 ? -2.216  4.297   -2.465  1.00 0.00 ? 78 ILE A HG22 8  
ATOM 10518 H HG23 . ILE A 1 78 ? -3.374  4.960   -1.313  1.00 0.00 ? 78 ILE A HG23 8  
ATOM 10519 H HD11 . ILE A 1 78 ? -3.389  5.238   -5.494  1.00 0.00 ? 78 ILE A HD11 8  
ATOM 10520 H HD12 . ILE A 1 78 ? -3.059  3.722   -6.332  1.00 0.00 ? 78 ILE A HD12 8  
ATOM 10521 H HD13 . ILE A 1 78 ? -1.919  4.333   -5.134  1.00 0.00 ? 78 ILE A HD13 8  
ATOM 10522 N N    . PHE A 1 79 ? -4.533  1.284   -2.335  1.00 0.00 ? 79 PHE A N    8  
ATOM 10523 C CA   . PHE A 1 79 ? -3.885  0.079   -1.828  1.00 0.00 ? 79 PHE A CA   8  
ATOM 10524 C C    . PHE A 1 79 ? -2.673  -0.286  -2.679  1.00 0.00 ? 79 PHE A C    8  
ATOM 10525 O O    . PHE A 1 79 ? -2.735  -0.260  -3.908  1.00 0.00 ? 79 PHE A O    8  
ATOM 10526 C CB   . PHE A 1 79 ? -4.876  -1.086  -1.803  1.00 0.00 ? 79 PHE A CB   8  
ATOM 10527 C CG   . PHE A 1 79 ? -5.757  -1.098  -0.586  1.00 0.00 ? 79 PHE A CG   8  
ATOM 10528 C CD1  . PHE A 1 79 ? -6.578  -0.021  -0.298  1.00 0.00 ? 79 PHE A CD1  8  
ATOM 10529 C CD2  . PHE A 1 79 ? -5.762  -2.189  0.269   1.00 0.00 ? 79 PHE A CD2  8  
ATOM 10530 C CE1  . PHE A 1 79 ? -7.389  -0.030  0.821   1.00 0.00 ? 79 PHE A CE1  8  
ATOM 10531 C CE2  . PHE A 1 79 ? -6.570  -2.203  1.390   1.00 0.00 ? 79 PHE A CE2  8  
ATOM 10532 C CZ   . PHE A 1 79 ? -7.386  -1.122  1.666   1.00 0.00 ? 79 PHE A CZ   8  
ATOM 10533 H H    . PHE A 1 79 ? -5.001  1.249   -3.195  1.00 0.00 ? 79 PHE A H    8  
ATOM 10534 H HA   . PHE A 1 79 ? -3.554  0.280   -0.821  1.00 0.00 ? 79 PHE A HA   8  
ATOM 10535 H HB2  . PHE A 1 79 ? -5.513  -1.027  -2.673  1.00 0.00 ? 79 PHE A HB2  8  
ATOM 10536 H HB3  . PHE A 1 79 ? -4.327  -2.015  -1.828  1.00 0.00 ? 79 PHE A HB3  8  
ATOM 10537 H HD1  . PHE A 1 79 ? -6.581  0.834   -0.958  1.00 0.00 ? 79 PHE A HD1  8  
ATOM 10538 H HD2  . PHE A 1 79 ? -5.125  -3.033  0.055   1.00 0.00 ? 79 PHE A HD2  8  
ATOM 10539 H HE1  . PHE A 1 79 ? -8.025  0.817   1.035   1.00 0.00 ? 79 PHE A HE1  8  
ATOM 10540 H HE2  . PHE A 1 79 ? -6.566  -3.059  2.049   1.00 0.00 ? 79 PHE A HE2  8  
ATOM 10541 H HZ   . PHE A 1 79 ? -8.019  -1.131  2.540   1.00 0.00 ? 79 PHE A HZ   8  
ATOM 10542 N N    . THR A 1 80 ? -1.573  -0.627  -2.016  1.00 0.00 ? 80 THR A N    8  
ATOM 10543 C CA   . THR A 1 80 ? -0.345  -0.998  -2.712  1.00 0.00 ? 80 THR A CA   8  
ATOM 10544 C C    . THR A 1 80 ? 0.557   -1.835  -1.812  1.00 0.00 ? 80 THR A C    8  
ATOM 10545 O O    . THR A 1 80 ? 0.436   -1.797  -0.588  1.00 0.00 ? 80 THR A O    8  
ATOM 10546 C CB   . THR A 1 80 ? 0.398   0.253   -3.181  1.00 0.00 ? 80 THR A CB   8  
ATOM 10547 O OG1  . THR A 1 80 ? 1.684   -0.083  -3.672  1.00 0.00 ? 80 THR A OG1  8  
ATOM 10548 C CG2  . THR A 1 80 ? 0.580   1.286   -2.090  1.00 0.00 ? 80 THR A CG2  8  
ATOM 10549 H H    . THR A 1 80 ? -1.586  -0.629  -1.037  1.00 0.00 ? 80 THR A H    8  
ATOM 10550 H HA   . THR A 1 80 ? -0.619  -1.588  -3.574  1.00 0.00 ? 80 THR A HA   8  
ATOM 10551 H HB   . THR A 1 80 ? -0.162  0.713   -3.982  1.00 0.00 ? 80 THR A HB   8  
ATOM 10552 H HG1  . THR A 1 80 ? 2.239   -0.374  -2.945  1.00 0.00 ? 80 THR A HG1  8  
ATOM 10553 H HG21 . THR A 1 80 ? 1.613   1.594   -2.054  1.00 0.00 ? 80 THR A HG21 8  
ATOM 10554 H HG22 . THR A 1 80 ? 0.299   0.857   -1.138  1.00 0.00 ? 80 THR A HG22 8  
ATOM 10555 H HG23 . THR A 1 80 ? -0.045  2.142   -2.297  1.00 0.00 ? 80 THR A HG23 8  
ATOM 10556 N N    . ARG A 1 81 ? 1.464   -2.587  -2.427  1.00 0.00 ? 81 ARG A N    8  
ATOM 10557 C CA   . ARG A 1 81 ? 2.388   -3.432  -1.679  1.00 0.00 ? 81 ARG A CA   8  
ATOM 10558 C C    . ARG A 1 81 ? 3.313   -2.587  -0.805  1.00 0.00 ? 81 ARG A C    8  
ATOM 10559 O O    . ARG A 1 81 ? 3.779   -1.527  -1.225  1.00 0.00 ? 81 ARG A O    8  
ATOM 10560 C CB   . ARG A 1 81 ? 3.217   -4.290  -2.638  1.00 0.00 ? 81 ARG A CB   8  
ATOM 10561 C CG   . ARG A 1 81 ? 2.416   -5.384  -3.323  1.00 0.00 ? 81 ARG A CG   8  
ATOM 10562 C CD   . ARG A 1 81 ? 2.992   -5.725  -4.688  1.00 0.00 ? 81 ARG A CD   8  
ATOM 10563 N NE   . ARG A 1 81 ? 3.946   -6.830  -4.618  1.00 0.00 ? 81 ARG A NE   8  
ATOM 10564 C CZ   . ARG A 1 81 ? 4.634   -7.282  -5.664  1.00 0.00 ? 81 ARG A CZ   8  
ATOM 10565 N NH1  . ARG A 1 81 ? 4.478   -6.728  -6.860  1.00 0.00 ? 81 ARG A NH1  8  
ATOM 10566 N NH2  . ARG A 1 81 ? 5.482   -8.291  -5.514  1.00 0.00 ? 81 ARG A NH2  8  
ATOM 10567 H H    . ARG A 1 81 ? 1.513   -2.575  -3.405  1.00 0.00 ? 81 ARG A H    8  
ATOM 10568 H HA   . ARG A 1 81 ? 1.803   -4.081  -1.045  1.00 0.00 ? 81 ARG A HA   8  
ATOM 10569 H HB2  . ARG A 1 81 ? 3.639   -3.652  -3.400  1.00 0.00 ? 81 ARG A HB2  8  
ATOM 10570 H HB3  . ARG A 1 81 ? 4.020   -4.754  -2.085  1.00 0.00 ? 81 ARG A HB3  8  
ATOM 10571 H HG2  . ARG A 1 81 ? 2.432   -6.269  -2.705  1.00 0.00 ? 81 ARG A HG2  8  
ATOM 10572 H HG3  . ARG A 1 81 ? 1.396   -5.047  -3.446  1.00 0.00 ? 81 ARG A HG3  8  
ATOM 10573 H HD2  . ARG A 1 81 ? 2.183   -6.002  -5.347  1.00 0.00 ? 81 ARG A HD2  8  
ATOM 10574 H HD3  . ARG A 1 81 ? 3.494   -4.853  -5.081  1.00 0.00 ? 81 ARG A HD3  8  
ATOM 10575 H HE   . ARG A 1 81 ? 4.080   -7.258  -3.747  1.00 0.00 ? 81 ARG A HE   8  
ATOM 10576 H HH11 . ARG A 1 81 ? 3.842   -5.967  -6.980  1.00 0.00 ? 81 ARG A HH11 8  
ATOM 10577 H HH12 . ARG A 1 81 ? 4.999   -7.072  -7.641  1.00 0.00 ? 81 ARG A HH12 8  
ATOM 10578 H HH21 . ARG A 1 81 ? 5.603   -8.713  -4.614  1.00 0.00 ? 81 ARG A HH21 8  
ATOM 10579 H HH22 . ARG A 1 81 ? 5.998   -8.631  -6.299  1.00 0.00 ? 81 ARG A HH22 8  
ATOM 10580 N N    . PRO A 1 82 ? 3.597   -3.046  0.428   1.00 0.00 ? 82 PRO A N    8  
ATOM 10581 C CA   . PRO A 1 82 ? 4.474   -2.324  1.356   1.00 0.00 ? 82 PRO A CA   8  
ATOM 10582 C C    . PRO A 1 82 ? 5.881   -2.145  0.795   1.00 0.00 ? 82 PRO A C    8  
ATOM 10583 O O    . PRO A 1 82 ? 6.504   -1.100  0.978   1.00 0.00 ? 82 PRO A O    8  
ATOM 10584 C CB   . PRO A 1 82 ? 4.502   -3.214  2.604   1.00 0.00 ? 82 PRO A CB   8  
ATOM 10585 C CG   . PRO A 1 82 ? 4.054   -4.557  2.136   1.00 0.00 ? 82 PRO A CG   8  
ATOM 10586 C CD   . PRO A 1 82 ? 3.095   -4.301  1.011   1.00 0.00 ? 82 PRO A CD   8  
ATOM 10587 H HA   . PRO A 1 82 ? 4.066   -1.356  1.610   1.00 0.00 ? 82 PRO A HA   8  
ATOM 10588 H HB2  . PRO A 1 82 ? 5.506   -3.250  3.000   1.00 0.00 ? 82 PRO A HB2  8  
ATOM 10589 H HB3  . PRO A 1 82 ? 3.832   -2.814  3.349   1.00 0.00 ? 82 PRO A HB3  8  
ATOM 10590 H HG2  . PRO A 1 82 ? 4.902   -5.126  1.785   1.00 0.00 ? 82 PRO A HG2  8  
ATOM 10591 H HG3  . PRO A 1 82 ? 3.559   -5.080  2.940   1.00 0.00 ? 82 PRO A HG3  8  
ATOM 10592 H HD2  . PRO A 1 82 ? 3.131   -5.105  0.291   1.00 0.00 ? 82 PRO A HD2  8  
ATOM 10593 H HD3  . PRO A 1 82 ? 2.091   -4.175  1.390   1.00 0.00 ? 82 PRO A HD3  8  
ATOM 10594 N N    . SER A 1 83 ? 6.373   -3.172  0.110   1.00 0.00 ? 83 SER A N    8  
ATOM 10595 C CA   . SER A 1 83 ? 7.705   -3.127  -0.480  1.00 0.00 ? 83 SER A CA   8  
ATOM 10596 C C    . SER A 1 83 ? 7.816   -1.988  -1.490  1.00 0.00 ? 83 SER A C    8  
ATOM 10597 O O    . SER A 1 83 ? 8.907   -1.477  -1.744  1.00 0.00 ? 83 SER A O    8  
ATOM 10598 C CB   . SER A 1 83 ? 8.029   -4.458  -1.158  1.00 0.00 ? 83 SER A CB   8  
ATOM 10599 O OG   . SER A 1 83 ? 9.156   -4.337  -2.010  1.00 0.00 ? 83 SER A OG   8  
ATOM 10600 H H    . SER A 1 83 ? 5.826   -3.977  -0.003  1.00 0.00 ? 83 SER A H    8  
ATOM 10601 H HA   . SER A 1 83 ? 8.414   -2.956  0.316   1.00 0.00 ? 83 SER A HA   8  
ATOM 10602 H HB2  . SER A 1 83 ? 8.243   -5.202  -0.405  1.00 0.00 ? 83 SER A HB2  8  
ATOM 10603 H HB3  . SER A 1 83 ? 7.181   -4.777  -1.747  1.00 0.00 ? 83 SER A HB3  8  
ATOM 10604 H HG   . SER A 1 83 ? 9.853   -3.861  -1.553  1.00 0.00 ? 83 SER A HG   8  
ATOM 10605 N N    . LYS A 1 84 ? 6.682   -1.595  -2.064  1.00 0.00 ? 84 LYS A N    8  
ATOM 10606 C CA   . LYS A 1 84 ? 6.657   -0.517  -3.046  1.00 0.00 ? 84 LYS A CA   8  
ATOM 10607 C C    . LYS A 1 84 ? 6.751   0.845   -2.363  1.00 0.00 ? 84 LYS A C    8  
ATOM 10608 O O    . LYS A 1 84 ? 7.266   1.803   -2.938  1.00 0.00 ? 84 LYS A O    8  
ATOM 10609 C CB   . LYS A 1 84 ? 5.379   -0.593  -3.884  1.00 0.00 ? 84 LYS A CB   8  
ATOM 10610 C CG   . LYS A 1 84 ? 5.245   -1.886  -4.671  1.00 0.00 ? 84 LYS A CG   8  
ATOM 10611 C CD   . LYS A 1 84 ? 5.964   -1.801  -6.008  1.00 0.00 ? 84 LYS A CD   8  
ATOM 10612 C CE   . LYS A 1 84 ? 5.903   -3.122  -6.758  1.00 0.00 ? 84 LYS A CE   8  
ATOM 10613 N NZ   . LYS A 1 84 ? 7.141   -3.370  -7.550  1.00 0.00 ? 84 LYS A NZ   8  
ATOM 10614 H H    . LYS A 1 84 ? 5.843   -2.040  -1.821  1.00 0.00 ? 84 LYS A H    8  
ATOM 10615 H HA   . LYS A 1 84 ? 7.510   -0.641  -3.695  1.00 0.00 ? 84 LYS A HA   8  
ATOM 10616 H HB2  . LYS A 1 84 ? 4.526   -0.507  -3.228  1.00 0.00 ? 84 LYS A HB2  8  
ATOM 10617 H HB3  . LYS A 1 84 ? 5.371   0.231   -4.582  1.00 0.00 ? 84 LYS A HB3  8  
ATOM 10618 H HG2  . LYS A 1 84 ? 5.671   -2.694  -4.096  1.00 0.00 ? 84 LYS A HG2  8  
ATOM 10619 H HG3  . LYS A 1 84 ? 4.198   -2.081  -4.848  1.00 0.00 ? 84 LYS A HG3  8  
ATOM 10620 H HD2  . LYS A 1 84 ? 5.498   -1.035  -6.609  1.00 0.00 ? 84 LYS A HD2  8  
ATOM 10621 H HD3  . LYS A 1 84 ? 6.999   -1.544  -5.833  1.00 0.00 ? 84 LYS A HD3  8  
ATOM 10622 H HE2  . LYS A 1 84 ? 5.778   -3.922  -6.044  1.00 0.00 ? 84 LYS A HE2  8  
ATOM 10623 H HE3  . LYS A 1 84 ? 5.055   -3.102  -7.428  1.00 0.00 ? 84 LYS A HE3  8  
ATOM 10624 H HZ1  . LYS A 1 84 ? 7.934   -2.827  -7.152  1.00 0.00 ? 84 LYS A HZ1  8  
ATOM 10625 H HZ2  . LYS A 1 84 ? 6.997   -3.080  -8.538  1.00 0.00 ? 84 LYS A HZ2  8  
ATOM 10626 H HZ3  . LYS A 1 84 ? 7.381   -4.382  -7.529  1.00 0.00 ? 84 LYS A HZ3  8  
ATOM 10627 N N    . LEU A 1 85 ? 6.248   0.923   -1.136  1.00 0.00 ? 85 LEU A N    8  
ATOM 10628 C CA   . LEU A 1 85 ? 6.275   2.168   -0.377  1.00 0.00 ? 85 LEU A CA   8  
ATOM 10629 C C    . LEU A 1 85 ? 7.707   2.563   -0.030  1.00 0.00 ? 85 LEU A C    8  
ATOM 10630 O O    . LEU A 1 85 ? 8.564   1.704   0.186   1.00 0.00 ? 85 LEU A O    8  
ATOM 10631 C CB   . LEU A 1 85 ? 5.448   2.030   0.903   1.00 0.00 ? 85 LEU A CB   8  
ATOM 10632 C CG   . LEU A 1 85 ? 4.039   1.470   0.706   1.00 0.00 ? 85 LEU A CG   8  
ATOM 10633 C CD1  . LEU A 1 85 ? 3.450   1.026   2.036   1.00 0.00 ? 85 LEU A CD1  8  
ATOM 10634 C CD2  . LEU A 1 85 ? 3.143   2.507   0.044   1.00 0.00 ? 85 LEU A CD2  8  
ATOM 10635 H H    . LEU A 1 85 ? 5.849   0.125   -0.730  1.00 0.00 ? 85 LEU A H    8  
ATOM 10636 H HA   . LEU A 1 85 ? 5.841   2.941   -0.993  1.00 0.00 ? 85 LEU A HA   8  
ATOM 10637 H HB2  . LEU A 1 85 ? 5.980   1.379   1.581   1.00 0.00 ? 85 LEU A HB2  8  
ATOM 10638 H HB3  . LEU A 1 85 ? 5.363   3.005   1.358   1.00 0.00 ? 85 LEU A HB3  8  
ATOM 10639 H HG   . LEU A 1 85 ? 4.087   0.607   0.058   1.00 0.00 ? 85 LEU A HG   8  
ATOM 10640 H HD11 . LEU A 1 85 ? 4.245   0.693   2.688   1.00 0.00 ? 85 LEU A HD11 8  
ATOM 10641 H HD12 . LEU A 1 85 ? 2.757   0.215   1.870   1.00 0.00 ? 85 LEU A HD12 8  
ATOM 10642 H HD13 . LEU A 1 85 ? 2.930   1.855   2.494   1.00 0.00 ? 85 LEU A HD13 8  
ATOM 10643 H HD21 . LEU A 1 85 ? 2.125   2.144   0.025   1.00 0.00 ? 85 LEU A HD21 8  
ATOM 10644 H HD22 . LEU A 1 85 ? 3.481   2.682   -0.966  1.00 0.00 ? 85 LEU A HD22 8  
ATOM 10645 H HD23 . LEU A 1 85 ? 3.184   3.429   0.604   1.00 0.00 ? 85 LEU A HD23 8  
ATOM 10646 N N    . THR A 1 86 ? 7.961   3.866   0.023   1.00 0.00 ? 86 THR A N    8  
ATOM 10647 C CA   . THR A 1 86 ? 9.289   4.375   0.345   1.00 0.00 ? 86 THR A CA   8  
ATOM 10648 C C    . THR A 1 86 ? 9.209   5.475   1.398   1.00 0.00 ? 86 THR A C    8  
ATOM 10649 O O    . THR A 1 86 ? 8.127   5.973   1.709   1.00 0.00 ? 86 THR A O    8  
ATOM 10650 C CB   . THR A 1 86 ? 9.973   4.907   -0.916  1.00 0.00 ? 86 THR A CB   8  
ATOM 10651 O OG1  . THR A 1 86 ? 9.206   5.942   -1.503  1.00 0.00 ? 86 THR A OG1  8  
ATOM 10652 C CG2  . THR A 1 86 ? 10.194  3.844   -1.970  1.00 0.00 ? 86 THR A CG2  8  
ATOM 10653 H H    . THR A 1 86 ? 7.236   4.501   -0.158  1.00 0.00 ? 86 THR A H    8  
ATOM 10654 H HA   . THR A 1 86 ? 9.870   3.555   0.740   1.00 0.00 ? 86 THR A HA   8  
ATOM 10655 H HB   . THR A 1 86 ? 10.938  5.310   -0.645  1.00 0.00 ? 86 THR A HB   8  
ATOM 10656 H HG1  . THR A 1 86 ? 9.719   6.368   -2.194  1.00 0.00 ? 86 THR A HG1  8  
ATOM 10657 H HG21 . THR A 1 86 ? 10.112  4.287   -2.951  1.00 0.00 ? 86 THR A HG21 8  
ATOM 10658 H HG22 . THR A 1 86 ? 9.449   3.069   -1.862  1.00 0.00 ? 86 THR A HG22 8  
ATOM 10659 H HG23 . THR A 1 86 ? 11.178  3.417   -1.850  1.00 0.00 ? 86 THR A HG23 8  
ATOM 10660 N N    . ARG A 1 87 ? 10.362  5.851   1.943   1.00 0.00 ? 87 ARG A N    8  
ATOM 10661 C CA   . ARG A 1 87 ? 10.421  6.892   2.962   1.00 0.00 ? 87 ARG A CA   8  
ATOM 10662 C C    . ARG A 1 87 ? 11.178  8.114   2.449   1.00 0.00 ? 87 ARG A C    8  
ATOM 10663 O O    . ARG A 1 87 ? 11.809  8.835   3.222   1.00 0.00 ? 87 ARG A O    8  
ATOM 10664 C CB   . ARG A 1 87 ? 11.090  6.355   4.231   1.00 0.00 ? 87 ARG A CB   8  
ATOM 10665 C CG   . ARG A 1 87 ? 10.251  6.541   5.485   1.00 0.00 ? 87 ARG A CG   8  
ATOM 10666 C CD   . ARG A 1 87 ? 10.427  7.932   6.073   1.00 0.00 ? 87 ARG A CD   8  
ATOM 10667 N NE   . ARG A 1 87 ? 9.304   8.808   5.752   1.00 0.00 ? 87 ARG A NE   8  
ATOM 10668 C CZ   . ARG A 1 87 ? 9.025   9.930   6.413   1.00 0.00 ? 87 ARG A CZ   8  
ATOM 10669 N NH1  . ARG A 1 87 ? 9.785   10.314  7.431   1.00 0.00 ? 87 ARG A NH1  8  
ATOM 10670 N NH2  . ARG A 1 87 ? 7.985   10.669  6.055   1.00 0.00 ? 87 ARG A NH2  8  
ATOM 10671 H H    . ARG A 1 87 ? 11.191  5.416   1.654   1.00 0.00 ? 87 ARG A H    8  
ATOM 10672 H HA   . ARG A 1 87 ? 9.409   7.185   3.196   1.00 0.00 ? 87 ARG A HA   8  
ATOM 10673 H HB2  . ARG A 1 87 ? 11.279  5.299   4.104   1.00 0.00 ? 87 ARG A HB2  8  
ATOM 10674 H HB3  . ARG A 1 87 ? 12.031  6.865   4.374   1.00 0.00 ? 87 ARG A HB3  8  
ATOM 10675 H HG2  . ARG A 1 87 ? 9.211   6.396   5.235   1.00 0.00 ? 87 ARG A HG2  8  
ATOM 10676 H HG3  . ARG A 1 87 ? 10.552  5.808   6.219   1.00 0.00 ? 87 ARG A HG3  8  
ATOM 10677 H HD2  . ARG A 1 87 ? 10.508  7.846   7.146   1.00 0.00 ? 87 ARG A HD2  8  
ATOM 10678 H HD3  . ARG A 1 87 ? 11.335  8.364   5.678   1.00 0.00 ? 87 ARG A HD3  8  
ATOM 10679 H HE   . ARG A 1 87 ? 8.727   8.548   5.003   1.00 0.00 ? 87 ARG A HE   8  
ATOM 10680 H HH11 . ARG A 1 87 ? 10.572  9.761   7.706   1.00 0.00 ? 87 ARG A HH11 8  
ATOM 10681 H HH12 . ARG A 1 87 ? 9.571   11.157  7.923   1.00 0.00 ? 87 ARG A HH12 8  
ATOM 10682 H HH21 . ARG A 1 87 ? 7.409   10.385  5.288   1.00 0.00 ? 87 ARG A HH21 8  
ATOM 10683 H HH22 . ARG A 1 87 ? 7.775   11.512  6.551   1.00 0.00 ? 87 ARG A HH22 8  
ATOM 10684 N N    . GLN A 1 88 ? 11.111  8.341   1.140   1.00 0.00 ? 88 GLN A N    8  
ATOM 10685 C CA   . GLN A 1 88 ? 11.789  9.476   0.525   1.00 0.00 ? 88 GLN A CA   8  
ATOM 10686 C C    . GLN A 1 88 ? 11.494  9.539   -0.973  1.00 0.00 ? 88 GLN A C    8  
ATOM 10687 O O    . GLN A 1 88 ? 11.459  8.510   -1.648  1.00 0.00 ? 88 GLN A O    8  
ATOM 10688 C CB   . GLN A 1 88 ? 13.300  9.381   0.758   1.00 0.00 ? 88 GLN A CB   8  
ATOM 10689 C CG   . GLN A 1 88 ? 13.829  10.410  1.743   1.00 0.00 ? 88 GLN A CG   8  
ATOM 10690 C CD   . GLN A 1 88 ? 15.158  10.005  2.351   1.00 0.00 ? 88 GLN A CD   8  
ATOM 10691 O OE1  . GLN A 1 88 ? 16.146  9.813   1.641   1.00 0.00 ? 88 GLN A OE1  8  
ATOM 10692 N NE2  . GLN A 1 88 ? 15.190  9.873   3.671   1.00 0.00 ? 88 GLN A NE2  8  
ATOM 10693 H H    . GLN A 1 88 ? 10.593  7.731   0.575   1.00 0.00 ? 88 GLN A H    8  
ATOM 10694 H HA   . GLN A 1 88 ? 11.419  10.374  0.994   1.00 0.00 ? 88 GLN A HA   8  
ATOM 10695 H HB2  . GLN A 1 88 ? 13.532  8.398   1.139   1.00 0.00 ? 88 GLN A HB2  8  
ATOM 10696 H HB3  . GLN A 1 88 ? 13.810  9.522   -0.184  1.00 0.00 ? 88 GLN A HB3  8  
ATOM 10697 H HG2  . GLN A 1 88 ? 13.959  11.350  1.229   1.00 0.00 ? 88 GLN A HG2  8  
ATOM 10698 H HG3  . GLN A 1 88 ? 13.109  10.531  2.540   1.00 0.00 ? 88 GLN A HG3  8  
ATOM 10699 H HE21 . GLN A 1 88 ? 14.365  10.041  4.173   1.00 0.00 ? 88 GLN A HE21 8  
ATOM 10700 H HE22 . GLN A 1 88 ? 16.036  9.612   4.091   1.00 0.00 ? 88 GLN A HE22 8  
ATOM 10701 N N    . PRO A 1 89 ? 11.277  10.751  -1.516  1.00 0.00 ? 89 PRO A N    8  
ATOM 10702 C CA   . PRO A 1 89 ? 10.984  10.933  -2.942  1.00 0.00 ? 89 PRO A CA   8  
ATOM 10703 C C    . PRO A 1 89 ? 12.046  10.299  -3.834  1.00 0.00 ? 89 PRO A C    8  
ATOM 10704 O O    . PRO A 1 89 ? 13.244  10.459  -3.601  1.00 0.00 ? 89 PRO A O    8  
ATOM 10705 C CB   . PRO A 1 89 ? 10.979  12.454  -3.118  1.00 0.00 ? 89 PRO A CB   8  
ATOM 10706 C CG   . PRO A 1 89 ? 10.680  12.995  -1.764  1.00 0.00 ? 89 PRO A CG   8  
ATOM 10707 C CD   . PRO A 1 89 ? 11.300  12.033  -0.789  1.00 0.00 ? 89 PRO A CD   8  
ATOM 10708 H HA   . PRO A 1 89 ? 10.015  10.534  -3.200  1.00 0.00 ? 89 PRO A HA   8  
ATOM 10709 H HB2  . PRO A 1 89 ? 11.947  12.781  -3.470  1.00 0.00 ? 89 PRO A HB2  8  
ATOM 10710 H HB3  . PRO A 1 89 ? 10.218  12.733  -3.831  1.00 0.00 ? 89 PRO A HB3  8  
ATOM 10711 H HG2  . PRO A 1 89 ? 11.120  13.976  -1.655  1.00 0.00 ? 89 PRO A HG2  8  
ATOM 10712 H HG3  . PRO A 1 89 ? 9.612   13.042  -1.616  1.00 0.00 ? 89 PRO A HG3  8  
ATOM 10713 H HD2  . PRO A 1 89 ? 12.313  12.330  -0.559  1.00 0.00 ? 89 PRO A HD2  8  
ATOM 10714 H HD3  . PRO A 1 89 ? 10.707  11.976  0.112   1.00 0.00 ? 89 PRO A HD3  8  
ATOM 10715 N N    . SER A 1 90 ? 11.600  9.580   -4.858  1.00 0.00 ? 90 SER A N    8  
ATOM 10716 C CA   . SER A 1 90 ? 12.512  8.921   -5.786  1.00 0.00 ? 90 SER A CA   8  
ATOM 10717 C C    . SER A 1 90 ? 13.232  9.944   -6.658  1.00 0.00 ? 90 SER A C    8  
ATOM 10718 O O    . SER A 1 90 ? 14.374  9.733   -7.067  1.00 0.00 ? 90 SER A O    8  
ATOM 10719 C CB   . SER A 1 90 ? 11.749  7.929   -6.667  1.00 0.00 ? 90 SER A CB   8  
ATOM 10720 O OG   . SER A 1 90 ? 12.537  6.786   -6.948  1.00 0.00 ? 90 SER A OG   8  
ATOM 10721 H H    . SER A 1 90 ? 10.633  9.488   -4.993  1.00 0.00 ? 90 SER A H    8  
ATOM 10722 H HA   . SER A 1 90 ? 13.245  8.383   -5.204  1.00 0.00 ? 90 SER A HA   8  
ATOM 10723 H HB2  . SER A 1 90 ? 10.851  7.616   -6.157  1.00 0.00 ? 90 SER A HB2  8  
ATOM 10724 H HB3  . SER A 1 90 ? 11.486  8.408   -7.599  1.00 0.00 ? 90 SER A HB3  8  
ATOM 10725 H HG   . SER A 1 90 ? 13.133  6.977   -7.675  1.00 0.00 ? 90 SER A HG   8  
ATOM 10726 N N    . GLY A 1 91 ? 12.558  11.055  -6.939  1.00 0.00 ? 91 GLY A N    8  
ATOM 10727 C CA   . GLY A 1 91 ? 13.148  12.095  -7.761  1.00 0.00 ? 91 GLY A CA   8  
ATOM 10728 C C    . GLY A 1 91 ? 13.316  13.403  -7.011  1.00 0.00 ? 91 GLY A C    8  
ATOM 10729 O O    . GLY A 1 91 ? 12.432  14.259  -7.049  1.00 0.00 ? 91 GLY A O    8  
ATOM 10730 H H    . GLY A 1 91 ? 11.650  11.169  -6.585  1.00 0.00 ? 91 GLY A H    8  
ATOM 10731 H HA2  . GLY A 1 91 ? 14.117  11.762  -8.103  1.00 0.00 ? 91 GLY A HA2  8  
ATOM 10732 H HA3  . GLY A 1 91 ? 12.514  12.263  -8.619  1.00 0.00 ? 91 GLY A HA3  8  
ATOM 10733 N N    . PRO A 1 92 ? 14.449  13.589  -6.313  1.00 0.00 ? 92 PRO A N    8  
ATOM 10734 C CA   . PRO A 1 92 ? 14.716  14.813  -5.552  1.00 0.00 ? 92 PRO A CA   8  
ATOM 10735 C C    . PRO A 1 92 ? 14.546  16.070  -6.400  1.00 0.00 ? 92 PRO A C    8  
ATOM 10736 O O    . PRO A 1 92 ? 15.117  16.179  -7.485  1.00 0.00 ? 92 PRO A O    8  
ATOM 10737 C CB   . PRO A 1 92 ? 16.174  14.654  -5.118  1.00 0.00 ? 92 PRO A CB   8  
ATOM 10738 C CG   . PRO A 1 92 ? 16.408  13.183  -5.107  1.00 0.00 ? 92 PRO A CG   8  
ATOM 10739 C CD   . PRO A 1 92 ? 15.557  12.621  -6.211  1.00 0.00 ? 92 PRO A CD   8  
ATOM 10740 H HA   . PRO A 1 92 ? 14.083  14.882  -4.679  1.00 0.00 ? 92 PRO A HA   8  
ATOM 10741 H HB2  . PRO A 1 92 ? 16.820  15.153  -5.825  1.00 0.00 ? 92 PRO A HB2  8  
ATOM 10742 H HB3  . PRO A 1 92 ? 16.310  15.081  -4.136  1.00 0.00 ? 92 PRO A HB3  8  
ATOM 10743 H HG2  . PRO A 1 92 ? 17.451  12.976  -5.295  1.00 0.00 ? 92 PRO A HG2  8  
ATOM 10744 H HG3  . PRO A 1 92 ? 16.109  12.770  -4.155  1.00 0.00 ? 92 PRO A HG3  8  
ATOM 10745 H HD2  . PRO A 1 92 ? 16.116  12.576  -7.133  1.00 0.00 ? 92 PRO A HD2  8  
ATOM 10746 H HD3  . PRO A 1 92 ? 15.189  11.641  -5.943  1.00 0.00 ? 92 PRO A HD3  8  
ATOM 10747 N N    . SER A 1 93 ? 13.760  17.015  -5.897  1.00 0.00 ? 93 SER A N    8  
ATOM 10748 C CA   . SER A 1 93 ? 13.517  18.265  -6.609  1.00 0.00 ? 93 SER A CA   8  
ATOM 10749 C C    . SER A 1 93 ? 13.129  19.377  -5.640  1.00 0.00 ? 93 SER A C    8  
ATOM 10750 O O    . SER A 1 93 ? 12.221  19.214  -4.824  1.00 0.00 ? 93 SER A O    8  
ATOM 10751 C CB   . SER A 1 93 ? 12.414  18.074  -7.652  1.00 0.00 ? 93 SER A CB   8  
ATOM 10752 O OG   . SER A 1 93 ? 12.738  17.028  -8.552  1.00 0.00 ? 93 SER A OG   8  
ATOM 10753 H H    . SER A 1 93 ? 13.334  16.870  -5.027  1.00 0.00 ? 93 SER A H    8  
ATOM 10754 H HA   . SER A 1 93 ? 14.431  18.543  -7.111  1.00 0.00 ? 93 SER A HA   8  
ATOM 10755 H HB2  . SER A 1 93 ? 11.488  17.829  -7.154  1.00 0.00 ? 93 SER A HB2  8  
ATOM 10756 H HB3  . SER A 1 93 ? 12.289  18.989  -8.212  1.00 0.00 ? 93 SER A HB3  8  
ATOM 10757 H HG   . SER A 1 93 ? 13.570  17.227  -8.988  1.00 0.00 ? 93 SER A HG   8  
ATOM 10758 N N    . SER A 1 94 ? 13.822  20.507  -5.736  1.00 0.00 ? 94 SER A N    8  
ATOM 10759 C CA   . SER A 1 94 ? 13.550  21.646  -4.868  1.00 0.00 ? 94 SER A CA   8  
ATOM 10760 C C    . SER A 1 94 ? 13.570  22.950  -5.659  1.00 0.00 ? 94 SER A C    8  
ATOM 10761 O O    . SER A 1 94 ? 14.377  23.121  -6.573  1.00 0.00 ? 94 SER A O    8  
ATOM 10762 C CB   . SER A 1 94 ? 14.577  21.707  -3.735  1.00 0.00 ? 94 SER A CB   8  
ATOM 10763 O OG   . SER A 1 94 ? 15.050  20.413  -3.404  1.00 0.00 ? 94 SER A OG   8  
ATOM 10764 H H    . SER A 1 94 ? 14.533  20.576  -6.406  1.00 0.00 ? 94 SER A H    8  
ATOM 10765 H HA   . SER A 1 94 ? 12.567  21.511  -4.443  1.00 0.00 ? 94 SER A HA   8  
ATOM 10766 H HB2  . SER A 1 94 ? 15.415  22.314  -4.045  1.00 0.00 ? 94 SER A HB2  8  
ATOM 10767 H HB3  . SER A 1 94 ? 14.119  22.146  -2.861  1.00 0.00 ? 94 SER A HB3  8  
ATOM 10768 H HG   . SER A 1 94 ? 15.618  20.090  -4.107  1.00 0.00 ? 94 SER A HG   8  
ATOM 10769 N N    . GLY A 1 95 ? 12.677  23.866  -5.301  1.00 0.00 ? 95 GLY A N    8  
ATOM 10770 C CA   . GLY A 1 95 ? 12.609  25.143  -5.988  1.00 0.00 ? 95 GLY A CA   8  
ATOM 10771 C C    . GLY A 1 95 ? 11.899  26.204  -5.170  1.00 0.00 ? 95 GLY A C    8  
ATOM 10772 O O    . GLY A 1 95 ? 10.737  26.526  -5.494  1.00 0.00 ? 95 GLY A O    8  
ATOM 10773 O OXT  . GLY A 1 95 ? 12.506  26.714  -4.204  1.00 0.00 ? 95 GLY A OXT  8  
ATOM 10774 H H    . GLY A 1 95 ? 12.059  23.675  -4.565  1.00 0.00 ? 95 GLY A H    8  
ATOM 10775 H HA2  . GLY A 1 95 ? 13.613  25.479  -6.200  1.00 0.00 ? 95 GLY A HA2  8  
ATOM 10776 H HA3  . GLY A 1 95 ? 12.079  25.010  -6.920  1.00 0.00 ? 95 GLY A HA3  8  
ATOM 10777 N N    . GLY A 1 1  ? -15.559 -13.820 -19.549 1.00 0.00 ? 1  GLY A N    9  
ATOM 10778 C CA   . GLY A 1 1  ? -14.805 -15.019 -19.092 1.00 0.00 ? 1  GLY A CA   9  
ATOM 10779 C C    . GLY A 1 1  ? -14.688 -15.089 -17.581 1.00 0.00 ? 1  GLY A C    9  
ATOM 10780 O O    . GLY A 1 1  ? -14.872 -14.087 -16.890 1.00 0.00 ? 1  GLY A O    9  
ATOM 10781 H H1   . GLY A 1 1  ? -15.226 -12.974 -19.043 1.00 0.00 ? 1  GLY A H1   9  
ATOM 10782 H H2   . GLY A 1 1  ? -16.575 -13.943 -19.365 1.00 0.00 ? 1  GLY A H2   9  
ATOM 10783 H H3   . GLY A 1 1  ? -15.418 -13.677 -20.570 1.00 0.00 ? 1  GLY A H3   9  
ATOM 10784 H HA2  . GLY A 1 1  ? -15.312 -15.906 -19.443 1.00 0.00 ? 1  GLY A HA2  9  
ATOM 10785 H HA3  . GLY A 1 1  ? -13.813 -14.991 -19.517 1.00 0.00 ? 1  GLY A HA3  9  
ATOM 10786 N N    . SER A 1 2  ? -14.380 -16.276 -17.068 1.00 0.00 ? 2  SER A N    9  
ATOM 10787 C CA   . SER A 1 2  ? -14.238 -16.474 -15.631 1.00 0.00 ? 2  SER A CA   9  
ATOM 10788 C C    . SER A 1 2  ? -13.268 -17.612 -15.332 1.00 0.00 ? 2  SER A C    9  
ATOM 10789 O O    . SER A 1 2  ? -12.673 -18.188 -16.242 1.00 0.00 ? 2  SER A O    9  
ATOM 10790 C CB   . SER A 1 2  ? -15.600 -16.769 -14.998 1.00 0.00 ? 2  SER A CB   9  
ATOM 10791 O OG   . SER A 1 2  ? -16.051 -18.067 -15.342 1.00 0.00 ? 2  SER A OG   9  
ATOM 10792 H H    . SER A 1 2  ? -14.245 -17.037 -17.671 1.00 0.00 ? 2  SER A H    9  
ATOM 10793 H HA   . SER A 1 2  ? -13.845 -15.561 -15.208 1.00 0.00 ? 2  SER A HA   9  
ATOM 10794 H HB2  . SER A 1 2  ? -15.517 -16.703 -13.923 1.00 0.00 ? 2  SER A HB2  9  
ATOM 10795 H HB3  . SER A 1 2  ? -16.321 -16.045 -15.349 1.00 0.00 ? 2  SER A HB3  9  
ATOM 10796 H HG   . SER A 1 2  ? -16.995 -18.042 -15.515 1.00 0.00 ? 2  SER A HG   9  
ATOM 10797 N N    . SER A 1 3  ? -13.114 -17.930 -14.051 1.00 0.00 ? 3  SER A N    9  
ATOM 10798 C CA   . SER A 1 3  ? -12.216 -19.001 -13.633 1.00 0.00 ? 3  SER A CA   9  
ATOM 10799 C C    . SER A 1 3  ? -12.369 -19.290 -12.144 1.00 0.00 ? 3  SER A C    9  
ATOM 10800 O O    . SER A 1 3  ? -12.414 -20.448 -11.728 1.00 0.00 ? 3  SER A O    9  
ATOM 10801 C CB   . SER A 1 3  ? -10.766 -18.627 -13.946 1.00 0.00 ? 3  SER A CB   9  
ATOM 10802 O OG   . SER A 1 3  ? -10.591 -17.221 -13.955 1.00 0.00 ? 3  SER A OG   9  
ATOM 10803 H H    . SER A 1 3  ? -13.616 -17.435 -13.371 1.00 0.00 ? 3  SER A H    9  
ATOM 10804 H HA   . SER A 1 3  ? -12.477 -19.888 -14.189 1.00 0.00 ? 3  SER A HA   9  
ATOM 10805 H HB2  . SER A 1 3  ? -10.116 -19.053 -13.194 1.00 0.00 ? 3  SER A HB2  9  
ATOM 10806 H HB3  . SER A 1 3  ? -10.496 -19.018 -14.915 1.00 0.00 ? 3  SER A HB3  9  
ATOM 10807 H HG   . SER A 1 3  ? -10.675 -16.882 -13.062 1.00 0.00 ? 3  SER A HG   9  
ATOM 10808 N N    . GLY A 1 4  ? -12.449 -18.231 -11.346 1.00 0.00 ? 4  GLY A N    9  
ATOM 10809 C CA   . GLY A 1 4  ? -12.596 -18.392 -9.911  1.00 0.00 ? 4  GLY A CA   9  
ATOM 10810 C C    . GLY A 1 4  ? -11.702 -17.451 -9.127  1.00 0.00 ? 4  GLY A C    9  
ATOM 10811 O O    . GLY A 1 4  ? -12.035 -17.053 -8.012  1.00 0.00 ? 4  GLY A O    9  
ATOM 10812 H H    . GLY A 1 4  ? -12.407 -17.332 -11.734 1.00 0.00 ? 4  GLY A H    9  
ATOM 10813 H HA2  . GLY A 1 4  ? -13.625 -18.202 -9.642  1.00 0.00 ? 4  GLY A HA2  9  
ATOM 10814 H HA3  . GLY A 1 4  ? -12.349 -19.410 -9.647  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 10815 N N    . SER A 1 5  ? -10.562 -17.098 -9.712  1.00 0.00 ? 5  SER A N    9  
ATOM 10816 C CA   . SER A 1 5  ? -9.616  -16.198 -9.062  1.00 0.00 ? 5  SER A CA   9  
ATOM 10817 C C    . SER A 1 5  ? -10.138 -14.765 -9.068  1.00 0.00 ? 5  SER A C    9  
ATOM 10818 O O    . SER A 1 5  ? -11.115 -14.453 -9.748  1.00 0.00 ? 5  SER A O    9  
ATOM 10819 C CB   . SER A 1 5  ? -8.257  -16.262 -9.762  1.00 0.00 ? 5  SER A CB   9  
ATOM 10820 O OG   . SER A 1 5  ? -7.790  -17.597 -9.850  1.00 0.00 ? 5  SER A OG   9  
ATOM 10821 H H    . SER A 1 5  ? -10.353 -17.449 -10.603 1.00 0.00 ? 5  SER A H    9  
ATOM 10822 H HA   . SER A 1 5  ? -9.500  -16.522 -8.038  1.00 0.00 ? 5  SER A HA   9  
ATOM 10823 H HB2  . SER A 1 5  ? -8.350  -15.860 -10.759 1.00 0.00 ? 5  SER A HB2  9  
ATOM 10824 H HB3  . SER A 1 5  ? -7.540  -15.679 -9.203  1.00 0.00 ? 5  SER A HB3  9  
ATOM 10825 H HG   . SER A 1 5  ? -8.453  -18.139 -10.284 1.00 0.00 ? 5  SER A HG   9  
ATOM 10826 N N    . SER A 1 6  ? -9.480  -13.898 -8.306  1.00 0.00 ? 6  SER A N    9  
ATOM 10827 C CA   . SER A 1 6  ? -9.877  -12.497 -8.223  1.00 0.00 ? 6  SER A CA   9  
ATOM 10828 C C    . SER A 1 6  ? -8.706  -11.579 -8.561  1.00 0.00 ? 6  SER A C    9  
ATOM 10829 O O    . SER A 1 6  ? -7.546  -11.973 -8.459  1.00 0.00 ? 6  SER A O    9  
ATOM 10830 C CB   . SER A 1 6  ? -10.405 -12.176 -6.824  1.00 0.00 ? 6  SER A CB   9  
ATOM 10831 O OG   . SER A 1 6  ? -11.497 -11.274 -6.884  1.00 0.00 ? 6  SER A OG   9  
ATOM 10832 H H    . SER A 1 6  ? -8.708  -14.207 -7.787  1.00 0.00 ? 6  SER A H    9  
ATOM 10833 H HA   . SER A 1 6  ? -10.666 -12.333 -8.942  1.00 0.00 ? 6  SER A HA   9  
ATOM 10834 H HB2  . SER A 1 6  ? -10.734 -13.088 -6.348  1.00 0.00 ? 6  SER A HB2  9  
ATOM 10835 H HB3  . SER A 1 6  ? -9.616  -11.728 -6.238  1.00 0.00 ? 6  SER A HB3  9  
ATOM 10836 H HG   . SER A 1 6  ? -12.200 -11.657 -7.415  1.00 0.00 ? 6  SER A HG   9  
ATOM 10837 N N    . GLY A 1 7  ? -9.021  -10.351 -8.964  1.00 0.00 ? 7  GLY A N    9  
ATOM 10838 C CA   . GLY A 1 7  ? -7.986  -9.396  -9.311  1.00 0.00 ? 7  GLY A CA   9  
ATOM 10839 C C    . GLY A 1 7  ? -7.184  -9.824  -10.524 1.00 0.00 ? 7  GLY A C    9  
ATOM 10840 O O    . GLY A 1 7  ? -7.235  -10.985 -10.932 1.00 0.00 ? 7  GLY A O    9  
ATOM 10841 H H    . GLY A 1 7  ? -9.964  -10.093 -9.027  1.00 0.00 ? 7  GLY A H    9  
ATOM 10842 H HA2  . GLY A 1 7  ? -8.446  -8.441  -9.515  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 10843 H HA3  . GLY A 1 7  ? -7.316  -9.289  -8.470  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 10844 N N    . ALA A 1 8  ? -6.443  -8.885  -11.103 1.00 0.00 ? 8  ALA A N    9  
ATOM 10845 C CA   . ALA A 1 8  ? -5.628  -9.171  -12.277 1.00 0.00 ? 8  ALA A CA   9  
ATOM 10846 C C    . ALA A 1 8  ? -4.344  -8.347  -12.270 1.00 0.00 ? 8  ALA A C    9  
ATOM 10847 O O    . ALA A 1 8  ? -3.247  -8.889  -12.397 1.00 0.00 ? 8  ALA A O    9  
ATOM 10848 C CB   . ALA A 1 8  ? -6.421  -8.904  -13.548 1.00 0.00 ? 8  ALA A CB   9  
ATOM 10849 H H    . ALA A 1 8  ? -6.444  -7.979  -10.731 1.00 0.00 ? 8  ALA A H    9  
ATOM 10850 H HA   . ALA A 1 8  ? -5.371  -10.220 -12.257 1.00 0.00 ? 8  ALA A HA   9  
ATOM 10851 H HB1  . ALA A 1 8  ? -5.826  -9.172  -14.407 1.00 0.00 ? 8  ALA A HB1  9  
ATOM 10852 H HB2  . ALA A 1 8  ? -6.676  -7.855  -13.599 1.00 0.00 ? 8  ALA A HB2  9  
ATOM 10853 H HB3  . ALA A 1 8  ? -7.326  -9.493  -13.537 1.00 0.00 ? 8  ALA A HB3  9  
ATOM 10854 N N    . ALA A 1 9  ? -4.491  -7.035  -12.119 1.00 0.00 ? 9  ALA A N    9  
ATOM 10855 C CA   . ALA A 1 9  ? -3.343  -6.137  -12.095 1.00 0.00 ? 9  ALA A CA   9  
ATOM 10856 C C    . ALA A 1 9  ? -2.826  -5.945  -10.673 1.00 0.00 ? 9  ALA A C    9  
ATOM 10857 O O    . ALA A 1 9  ? -1.630  -5.748  -10.458 1.00 0.00 ? 9  ALA A O    9  
ATOM 10858 C CB   . ALA A 1 9  ? -3.710  -4.795  -12.710 1.00 0.00 ? 9  ALA A CB   9  
ATOM 10859 H H    . ALA A 1 9  ? -5.392  -6.662  -12.021 1.00 0.00 ? 9  ALA A H    9  
ATOM 10860 H HA   . ALA A 1 9  ? -2.561  -6.579  -12.694 1.00 0.00 ? 9  ALA A HA   9  
ATOM 10861 H HB1  . ALA A 1 9  ? -2.879  -4.426  -13.291 1.00 0.00 ? 9  ALA A HB1  9  
ATOM 10862 H HB2  . ALA A 1 9  ? -3.942  -4.090  -11.925 1.00 0.00 ? 9  ALA A HB2  9  
ATOM 10863 H HB3  . ALA A 1 9  ? -4.571  -4.916  -13.351 1.00 0.00 ? 9  ALA A HB3  9  
ATOM 10864 N N    . GLU A 1 10 ? -3.735  -6.002  -9.706  1.00 0.00 ? 10 GLU A N    9  
ATOM 10865 C CA   . GLU A 1 10 ? -3.371  -5.834  -8.303  1.00 0.00 ? 10 GLU A CA   9  
ATOM 10866 C C    . GLU A 1 10 ? -2.713  -7.098  -7.758  1.00 0.00 ? 10 GLU A C    9  
ATOM 10867 O O    . GLU A 1 10 ? -3.237  -8.200  -7.917  1.00 0.00 ? 10 GLU A O    9  
ATOM 10868 C CB   . GLU A 1 10 ? -4.607  -5.488  -7.472  1.00 0.00 ? 10 GLU A CB   9  
ATOM 10869 C CG   . GLU A 1 10 ? -4.850  -3.993  -7.338  1.00 0.00 ? 10 GLU A CG   9  
ATOM 10870 C CD   . GLU A 1 10 ? -6.306  -3.619  -7.533  1.00 0.00 ? 10 GLU A CD   9  
ATOM 10871 O OE1  . GLU A 1 10 ? -6.738  -3.501  -8.699  1.00 0.00 ? 10 GLU A OE1  9  
ATOM 10872 O OE2  . GLU A 1 10 ? -7.015  -3.443  -6.520  1.00 0.00 ? 10 GLU A OE2  9  
ATOM 10873 H H    . GLU A 1 10 ? -4.674  -6.161  -9.939  1.00 0.00 ? 10 GLU A H    9  
ATOM 10874 H HA   . GLU A 1 10 ? -2.665  -5.020  -8.240  1.00 0.00 ? 10 GLU A HA   9  
ATOM 10875 H HB2  . GLU A 1 10 ? -5.476  -5.932  -7.936  1.00 0.00 ? 10 GLU A HB2  9  
ATOM 10876 H HB3  . GLU A 1 10 ? -4.488  -5.901  -6.481  1.00 0.00 ? 10 GLU A HB3  9  
ATOM 10877 H HG2  . GLU A 1 10 ? -4.544  -3.678  -6.352  1.00 0.00 ? 10 GLU A HG2  9  
ATOM 10878 H HG3  . GLU A 1 10 ? -4.259  -3.477  -8.080  1.00 0.00 ? 10 GLU A HG3  9  
ATOM 10879 N N    . VAL A 1 11 ? -1.564  -6.929  -7.113  1.00 0.00 ? 11 VAL A N    9  
ATOM 10880 C CA   . VAL A 1 11 ? -0.834  -8.056  -6.543  1.00 0.00 ? 11 VAL A CA   9  
ATOM 10881 C C    . VAL A 1 11 ? -0.039  -7.630  -5.314  1.00 0.00 ? 11 VAL A C    9  
ATOM 10882 O O    . VAL A 1 11 ? 0.377   -6.477  -5.200  1.00 0.00 ? 11 VAL A O    9  
ATOM 10883 C CB   . VAL A 1 11 ? 0.127   -8.681  -7.570  1.00 0.00 ? 11 VAL A CB   9  
ATOM 10884 C CG1  . VAL A 1 11 ? -0.649  -9.424  -8.646  1.00 0.00 ? 11 VAL A CG1  9  
ATOM 10885 C CG2  . VAL A 1 11 ? 1.017   -7.613  -8.186  1.00 0.00 ? 11 VAL A CG2  9  
ATOM 10886 H H    . VAL A 1 11 ? -1.197  -6.025  -7.018  1.00 0.00 ? 11 VAL A H    9  
ATOM 10887 H HA   . VAL A 1 11 ? -1.555  -8.806  -6.251  1.00 0.00 ? 11 VAL A HA   9  
ATOM 10888 H HB   . VAL A 1 11 ? 0.757   -9.392  -7.058  1.00 0.00 ? 11 VAL A HB   9  
ATOM 10889 H HG11 . VAL A 1 11 ? 0.029   -9.746  -9.422  1.00 0.00 ? 11 VAL A HG11 9  
ATOM 10890 H HG12 . VAL A 1 11 ? -1.396  -8.768  -9.070  1.00 0.00 ? 11 VAL A HG12 9  
ATOM 10891 H HG13 . VAL A 1 11 ? -1.134  -10.286 -8.211  1.00 0.00 ? 11 VAL A HG13 9  
ATOM 10892 H HG21 . VAL A 1 11 ? 0.464   -6.690  -8.275  1.00 0.00 ? 11 VAL A HG21 9  
ATOM 10893 H HG22 . VAL A 1 11 ? 1.340   -7.935  -9.166  1.00 0.00 ? 11 VAL A HG22 9  
ATOM 10894 H HG23 . VAL A 1 11 ? 1.880   -7.457  -7.556  1.00 0.00 ? 11 VAL A HG23 9  
ATOM 10895 N N    . GLY A 1 12 ? 0.170   -8.568  -4.396  1.00 0.00 ? 12 GLY A N    9  
ATOM 10896 C CA   . GLY A 1 12 ? 0.915   -8.270  -3.187  1.00 0.00 ? 12 GLY A CA   9  
ATOM 10897 C C    . GLY A 1 12 ? 2.360   -8.725  -3.270  1.00 0.00 ? 12 GLY A C    9  
ATOM 10898 O O    . GLY A 1 12 ? 2.771   -9.331  -4.259  1.00 0.00 ? 12 GLY A O    9  
ATOM 10899 H H    . GLY A 1 12 ? -0.185  -9.470  -4.541  1.00 0.00 ? 12 GLY A H    9  
ATOM 10900 H HA2  . GLY A 1 12 ? 0.894   -7.203  -3.019  1.00 0.00 ? 12 GLY A HA2  9  
ATOM 10901 H HA3  . GLY A 1 12 ? 0.441   -8.766  -2.353  1.00 0.00 ? 12 GLY A HA3  9  
ATOM 10902 N N    . ASP A 1 13 ? 3.131   -8.431  -2.229  1.00 0.00 ? 13 ASP A N    9  
ATOM 10903 C CA   . ASP A 1 13 ? 4.538   -8.813  -2.187  1.00 0.00 ? 13 ASP A CA   9  
ATOM 10904 C C    . ASP A 1 13 ? 4.802   -9.793  -1.049  1.00 0.00 ? 13 ASP A C    9  
ATOM 10905 O O    . ASP A 1 13 ? 3.921   -10.068 -0.235  1.00 0.00 ? 13 ASP A O    9  
ATOM 10906 C CB   . ASP A 1 13 ? 5.419   -7.573  -2.024  1.00 0.00 ? 13 ASP A CB   9  
ATOM 10907 C CG   . ASP A 1 13 ? 6.694   -7.659  -2.841  1.00 0.00 ? 13 ASP A CG   9  
ATOM 10908 O OD1  . ASP A 1 13 ? 6.655   -7.307  -4.039  1.00 0.00 ? 13 ASP A OD1  9  
ATOM 10909 O OD2  . ASP A 1 13 ? 7.730   -8.077  -2.284  1.00 0.00 ? 13 ASP A OD2  9  
ATOM 10910 H H    . ASP A 1 13 ? 2.745   -7.945  -1.469  1.00 0.00 ? 13 ASP A H    9  
ATOM 10911 H HA   . ASP A 1 13 ? 4.778   -9.294  -3.123  1.00 0.00 ? 13 ASP A HA   9  
ATOM 10912 H HB2  . ASP A 1 13 ? 4.868   -6.702  -2.343  1.00 0.00 ? 13 ASP A HB2  9  
ATOM 10913 H HB3  . ASP A 1 13 ? 5.687   -7.463  -0.983  1.00 0.00 ? 13 ASP A HB3  9  
ATOM 10914 N N    . ASP A 1 14 ? 6.023   -10.318 -0.999  1.00 0.00 ? 14 ASP A N    9  
ATOM 10915 C CA   . ASP A 1 14 ? 6.404   -11.268 0.040   1.00 0.00 ? 14 ASP A CA   9  
ATOM 10916 C C    . ASP A 1 14 ? 7.194   -10.576 1.145   1.00 0.00 ? 14 ASP A C    9  
ATOM 10917 O O    . ASP A 1 14 ? 8.090   -11.169 1.746   1.00 0.00 ? 14 ASP A O    9  
ATOM 10918 C CB   . ASP A 1 14 ? 7.232   -12.405 -0.560  1.00 0.00 ? 14 ASP A CB   9  
ATOM 10919 C CG   . ASP A 1 14 ? 6.372   -13.565 -1.024  1.00 0.00 ? 14 ASP A CG   9  
ATOM 10920 O OD1  . ASP A 1 14 ? 5.350   -13.848 -0.364  1.00 0.00 ? 14 ASP A OD1  9  
ATOM 10921 O OD2  . ASP A 1 14 ? 6.720   -14.189 -2.048  1.00 0.00 ? 14 ASP A OD2  9  
ATOM 10922 H H    . ASP A 1 14 ? 6.682   -10.059 -1.675  1.00 0.00 ? 14 ASP A H    9  
ATOM 10923 H HA   . ASP A 1 14 ? 5.499   -11.678 0.463   1.00 0.00 ? 14 ASP A HA   9  
ATOM 10924 H HB2  . ASP A 1 14 ? 7.786   -12.031 -1.408  1.00 0.00 ? 14 ASP A HB2  9  
ATOM 10925 H HB3  . ASP A 1 14 ? 7.925   -12.770 0.184   1.00 0.00 ? 14 ASP A HB3  9  
ATOM 10926 N N    . PHE A 1 15 ? 6.856   -9.318  1.409   1.00 0.00 ? 15 PHE A N    9  
ATOM 10927 C CA   . PHE A 1 15 ? 7.535   -8.545  2.443   1.00 0.00 ? 15 PHE A CA   9  
ATOM 10928 C C    . PHE A 1 15 ? 6.723   -7.310  2.821   1.00 0.00 ? 15 PHE A C    9  
ATOM 10929 O O    . PHE A 1 15 ? 5.990   -6.761  1.999   1.00 0.00 ? 15 PHE A O    9  
ATOM 10930 C CB   . PHE A 1 15 ? 8.927   -8.129  1.966   1.00 0.00 ? 15 PHE A CB   9  
ATOM 10931 C CG   . PHE A 1 15 ? 9.974   -8.190  3.041   1.00 0.00 ? 15 PHE A CG   9  
ATOM 10932 C CD1  . PHE A 1 15 ? 10.448  -9.411  3.495   1.00 0.00 ? 15 PHE A CD1  9  
ATOM 10933 C CD2  . PHE A 1 15 ? 10.485  -7.029  3.596   1.00 0.00 ? 15 PHE A CD2  9  
ATOM 10934 C CE1  . PHE A 1 15 ? 11.412  -9.471  4.484   1.00 0.00 ? 15 PHE A CE1  9  
ATOM 10935 C CE2  . PHE A 1 15 ? 11.448  -7.082  4.585   1.00 0.00 ? 15 PHE A CE2  9  
ATOM 10936 C CZ   . PHE A 1 15 ? 11.913  -8.305  5.030   1.00 0.00 ? 15 PHE A CZ   9  
ATOM 10937 H H    . PHE A 1 15 ? 6.133   -8.900  0.897   1.00 0.00 ? 15 PHE A H    9  
ATOM 10938 H HA   . PHE A 1 15 ? 7.636   -9.174  3.314   1.00 0.00 ? 15 PHE A HA   9  
ATOM 10939 H HB2  . PHE A 1 15 ? 9.236   -8.783  1.164   1.00 0.00 ? 15 PHE A HB2  9  
ATOM 10940 H HB3  . PHE A 1 15 ? 8.885   -7.114  1.598   1.00 0.00 ? 15 PHE A HB3  9  
ATOM 10941 H HD1  . PHE A 1 15 ? 10.057  -10.323 3.069   1.00 0.00 ? 15 PHE A HD1  9  
ATOM 10942 H HD2  . PHE A 1 15 ? 10.123  -6.072  3.250   1.00 0.00 ? 15 PHE A HD2  9  
ATOM 10943 H HE1  . PHE A 1 15 ? 11.772  -10.428 4.830   1.00 0.00 ? 15 PHE A HE1  9  
ATOM 10944 H HE2  . PHE A 1 15 ? 11.839  -6.169  5.011   1.00 0.00 ? 15 PHE A HE2  9  
ATOM 10945 H HZ   . PHE A 1 15 ? 12.666  -8.349  5.802   1.00 0.00 ? 15 PHE A HZ   9  
ATOM 10946 N N    . LEU A 1 16 ? 6.860   -6.877  4.070   1.00 0.00 ? 16 LEU A N    9  
ATOM 10947 C CA   . LEU A 1 16 ? 6.141   -5.707  4.557   1.00 0.00 ? 16 LEU A CA   9  
ATOM 10948 C C    . LEU A 1 16 ? 7.081   -4.516  4.713   1.00 0.00 ? 16 LEU A C    9  
ATOM 10949 O O    . LEU A 1 16 ? 6.674   -3.366  4.551   1.00 0.00 ? 16 LEU A O    9  
ATOM 10950 C CB   . LEU A 1 16 ? 5.465   -6.017  5.895   1.00 0.00 ? 16 LEU A CB   9  
ATOM 10951 C CG   . LEU A 1 16 ? 4.054   -6.597  5.789   1.00 0.00 ? 16 LEU A CG   9  
ATOM 10952 C CD1  . LEU A 1 16 ? 3.759   -7.505  6.973   1.00 0.00 ? 16 LEU A CD1  9  
ATOM 10953 C CD2  . LEU A 1 16 ? 3.025   -5.479  5.703   1.00 0.00 ? 16 LEU A CD2  9  
ATOM 10954 H H    . LEU A 1 16 ? 7.460   -7.357  4.679   1.00 0.00 ? 16 LEU A H    9  
ATOM 10955 H HA   . LEU A 1 16 ? 5.381   -5.459  3.831   1.00 0.00 ? 16 LEU A HA   9  
ATOM 10956 H HB2  . LEU A 1 16 ? 6.084   -6.723  6.430   1.00 0.00 ? 16 LEU A HB2  9  
ATOM 10957 H HB3  . LEU A 1 16 ? 5.413   -5.103  6.468   1.00 0.00 ? 16 LEU A HB3  9  
ATOM 10958 H HG   . LEU A 1 16 ? 3.982   -7.189  4.889   1.00 0.00 ? 16 LEU A HG   9  
ATOM 10959 H HD11 . LEU A 1 16 ? 4.606   -8.150  7.151   1.00 0.00 ? 16 LEU A HD11 9  
ATOM 10960 H HD12 . LEU A 1 16 ? 2.888   -8.105  6.757   1.00 0.00 ? 16 LEU A HD12 9  
ATOM 10961 H HD13 . LEU A 1 16 ? 3.574   -6.904  7.851   1.00 0.00 ? 16 LEU A HD13 9  
ATOM 10962 H HD21 . LEU A 1 16 ? 2.617   -5.289  6.684   1.00 0.00 ? 16 LEU A HD21 9  
ATOM 10963 H HD22 . LEU A 1 16 ? 2.231   -5.773  5.033   1.00 0.00 ? 16 LEU A HD22 9  
ATOM 10964 H HD23 . LEU A 1 16 ? 3.497   -4.583  5.330   1.00 0.00 ? 16 LEU A HD23 9  
ATOM 10965 N N    . GLY A 1 17 ? 8.340   -4.800  5.027   1.00 0.00 ? 17 GLY A N    9  
ATOM 10966 C CA   . GLY A 1 17 ? 9.318   -3.742  5.198   1.00 0.00 ? 17 GLY A CA   9  
ATOM 10967 C C    . GLY A 1 17 ? 9.485   -3.335  6.650   1.00 0.00 ? 17 GLY A C    9  
ATOM 10968 O O    . GLY A 1 17 ? 9.700   -4.182  7.518   1.00 0.00 ? 17 GLY A O    9  
ATOM 10969 H H    . GLY A 1 17 ? 8.608   -5.736  5.143   1.00 0.00 ? 17 GLY A H    9  
ATOM 10970 H HA2  . GLY A 1 17 ? 10.270  -4.082  4.820   1.00 0.00 ? 17 GLY A HA2  9  
ATOM 10971 H HA3  . GLY A 1 17 ? 9.004   -2.881  4.629   1.00 0.00 ? 17 GLY A HA3  9  
ATOM 10972 N N    . ASP A 1 18 ? 9.387   -2.036  6.914   1.00 0.00 ? 18 ASP A N    9  
ATOM 10973 C CA   . ASP A 1 18 ? 9.528   -1.520  8.269   1.00 0.00 ? 18 ASP A CA   9  
ATOM 10974 C C    . ASP A 1 18 ? 8.617   -0.316  8.491   1.00 0.00 ? 18 ASP A C    9  
ATOM 10975 O O    . ASP A 1 18 ? 8.976   0.625   9.200   1.00 0.00 ? 18 ASP A O    9  
ATOM 10976 C CB   . ASP A 1 18 ? 10.983  -1.129  8.538   1.00 0.00 ? 18 ASP A CB   9  
ATOM 10977 C CG   . ASP A 1 18 ? 11.563  -0.266  7.435   1.00 0.00 ? 18 ASP A CG   9  
ATOM 10978 O OD1  . ASP A 1 18 ? 10.933  0.753   7.083   1.00 0.00 ? 18 ASP A OD1  9  
ATOM 10979 O OD2  . ASP A 1 18 ? 12.649  -0.609  6.924   1.00 0.00 ? 18 ASP A OD2  9  
ATOM 10980 H H    . ASP A 1 18 ? 9.215   -1.412  6.178   1.00 0.00 ? 18 ASP A H    9  
ATOM 10981 H HA   . ASP A 1 18 ? 9.243   -2.303  8.954   1.00 0.00 ? 18 ASP A HA   9  
ATOM 10982 H HB2  . ASP A 1 18 ? 11.035  -0.577  9.466   1.00 0.00 ? 18 ASP A HB2  9  
ATOM 10983 H HB3  . ASP A 1 18 ? 11.580  -2.024  8.623   1.00 0.00 ? 18 ASP A HB3  9  
ATOM 10984 N N    . PHE A 1 19 ? 7.437   -0.353  7.883   1.00 0.00 ? 19 PHE A N    9  
ATOM 10985 C CA   . PHE A 1 19 ? 6.473   0.734   8.014   1.00 0.00 ? 19 PHE A CA   9  
ATOM 10986 C C    . PHE A 1 19 ? 5.482   0.447   9.137   1.00 0.00 ? 19 PHE A C    9  
ATOM 10987 O O    . PHE A 1 19 ? 5.360   -0.688  9.597   1.00 0.00 ? 19 PHE A O    9  
ATOM 10988 C CB   . PHE A 1 19 ? 5.724   0.943   6.697   1.00 0.00 ? 19 PHE A CB   9  
ATOM 10989 C CG   . PHE A 1 19 ? 6.628   1.212   5.527   1.00 0.00 ? 19 PHE A CG   9  
ATOM 10990 C CD1  . PHE A 1 19 ? 7.207   2.459   5.354   1.00 0.00 ? 19 PHE A CD1  9  
ATOM 10991 C CD2  . PHE A 1 19 ? 6.899   0.217   4.602   1.00 0.00 ? 19 PHE A CD2  9  
ATOM 10992 C CE1  . PHE A 1 19 ? 8.039   2.709   4.279   1.00 0.00 ? 19 PHE A CE1  9  
ATOM 10993 C CE2  . PHE A 1 19 ? 7.730   0.460   3.525   1.00 0.00 ? 19 PHE A CE2  9  
ATOM 10994 C CZ   . PHE A 1 19 ? 8.301   1.708   3.363   1.00 0.00 ? 19 PHE A CZ   9  
ATOM 10995 H H    . PHE A 1 19 ? 7.207   -1.130  7.331   1.00 0.00 ? 19 PHE A H    9  
ATOM 10996 H HA   . PHE A 1 19 ? 7.020   1.633   8.255   1.00 0.00 ? 19 PHE A HA   9  
ATOM 10997 H HB2  . PHE A 1 19 ? 5.148   0.059   6.474   1.00 0.00 ? 19 PHE A HB2  9  
ATOM 10998 H HB3  . PHE A 1 19 ? 5.055   1.785   6.801   1.00 0.00 ? 19 PHE A HB3  9  
ATOM 10999 H HD1  . PHE A 1 19 ? 7.003   3.242   6.069   1.00 0.00 ? 19 PHE A HD1  9  
ATOM 11000 H HD2  . PHE A 1 19 ? 6.453   -0.759  4.727   1.00 0.00 ? 19 PHE A HD2  9  
ATOM 11001 H HE1  . PHE A 1 19 ? 8.483   3.685   4.155   1.00 0.00 ? 19 PHE A HE1  9  
ATOM 11002 H HE2  . PHE A 1 19 ? 7.933   -0.323  2.810   1.00 0.00 ? 19 PHE A HE2  9  
ATOM 11003 H HZ   . PHE A 1 19 ? 8.951   1.901   2.523   1.00 0.00 ? 19 PHE A HZ   9  
ATOM 11004 N N    . VAL A 1 20 ? 4.773   1.483   9.573   1.00 0.00 ? 20 VAL A N    9  
ATOM 11005 C CA   . VAL A 1 20 ? 3.791   1.342   10.641  1.00 0.00 ? 20 VAL A CA   9  
ATOM 11006 C C    . VAL A 1 20 ? 2.468   1.998   10.262  1.00 0.00 ? 20 VAL A C    9  
ATOM 11007 O O    . VAL A 1 20 ? 2.339   2.584   9.186   1.00 0.00 ? 20 VAL A O    9  
ATOM 11008 C CB   . VAL A 1 20 ? 4.298   1.962   11.957  1.00 0.00 ? 20 VAL A CB   9  
ATOM 11009 C CG1  . VAL A 1 20 ? 5.457   1.151   12.518  1.00 0.00 ? 20 VAL A CG1  9  
ATOM 11010 C CG2  . VAL A 1 20 ? 4.707   3.412   11.741  1.00 0.00 ? 20 VAL A CG2  9  
ATOM 11011 H H    . VAL A 1 20 ? 4.913   2.364   9.166   1.00 0.00 ? 20 VAL A H    9  
ATOM 11012 H HA   . VAL A 1 20 ? 3.625   0.288   10.805  1.00 0.00 ? 20 VAL A HA   9  
ATOM 11013 H HB   . VAL A 1 20 ? 3.492   1.941   12.676  1.00 0.00 ? 20 VAL A HB   9  
ATOM 11014 H HG11 . VAL A 1 20 ? 5.082   0.437   13.236  1.00 0.00 ? 20 VAL A HG11 9  
ATOM 11015 H HG12 . VAL A 1 20 ? 6.159   1.814   13.001  1.00 0.00 ? 20 VAL A HG12 9  
ATOM 11016 H HG13 . VAL A 1 20 ? 5.952   0.627   11.713  1.00 0.00 ? 20 VAL A HG13 9  
ATOM 11017 H HG21 . VAL A 1 20 ? 5.388   3.473   10.905  1.00 0.00 ? 20 VAL A HG21 9  
ATOM 11018 H HG22 . VAL A 1 20 ? 5.194   3.784   12.630  1.00 0.00 ? 20 VAL A HG22 9  
ATOM 11019 H HG23 . VAL A 1 20 ? 3.829   4.006   11.536  1.00 0.00 ? 20 VAL A HG23 9  
ATOM 11020 N N    . VAL A 1 21 ? 1.486   1.896   11.152  1.00 0.00 ? 21 VAL A N    9  
ATOM 11021 C CA   . VAL A 1 21 ? 0.172   2.479   10.911  1.00 0.00 ? 21 VAL A CA   9  
ATOM 11022 C C    . VAL A 1 21 ? 0.113   3.921   11.400  1.00 0.00 ? 21 VAL A C    9  
ATOM 11023 O O    . VAL A 1 21 ? 0.253   4.189   12.594  1.00 0.00 ? 21 VAL A O    9  
ATOM 11024 C CB   . VAL A 1 21 ? -0.939  1.668   11.604  1.00 0.00 ? 21 VAL A CB   9  
ATOM 11025 C CG1  . VAL A 1 21 ? -2.310  2.169   11.181  1.00 0.00 ? 21 VAL A CG1  9  
ATOM 11026 C CG2  . VAL A 1 21 ? -0.787  0.185   11.298  1.00 0.00 ? 21 VAL A CG2  9  
ATOM 11027 H H    . VAL A 1 21 ? 1.650   1.417   11.991  1.00 0.00 ? 21 VAL A H    9  
ATOM 11028 H HA   . VAL A 1 21 ? -0.010  2.462   9.846   1.00 0.00 ? 21 VAL A HA   9  
ATOM 11029 H HB   . VAL A 1 21 ? -0.843  1.804   12.671  1.00 0.00 ? 21 VAL A HB   9  
ATOM 11030 H HG11 . VAL A 1 21 ? -2.249  2.596   10.191  1.00 0.00 ? 21 VAL A HG11 9  
ATOM 11031 H HG12 . VAL A 1 21 ? -2.648  2.922   11.878  1.00 0.00 ? 21 VAL A HG12 9  
ATOM 11032 H HG13 . VAL A 1 21 ? -3.009  1.345   11.176  1.00 0.00 ? 21 VAL A HG13 9  
ATOM 11033 H HG21 . VAL A 1 21 ? 0.254   -0.094  11.374  1.00 0.00 ? 21 VAL A HG21 9  
ATOM 11034 H HG22 . VAL A 1 21 ? -1.142  -0.015  10.298  1.00 0.00 ? 21 VAL A HG22 9  
ATOM 11035 H HG23 . VAL A 1 21 ? -1.365  -0.390  12.008  1.00 0.00 ? 21 VAL A HG23 9  
ATOM 11036 N N    . GLY A 1 22 ? -0.096  4.848   10.472  1.00 0.00 ? 22 GLY A N    9  
ATOM 11037 C CA   . GLY A 1 22 ? -0.172  6.253   10.829  1.00 0.00 ? 22 GLY A CA   9  
ATOM 11038 C C    . GLY A 1 22 ? 1.109   7.001   10.511  1.00 0.00 ? 22 GLY A C    9  
ATOM 11039 O O    . GLY A 1 22 ? 1.526   7.880   11.267  1.00 0.00 ? 22 GLY A O    9  
ATOM 11040 H H    . GLY A 1 22 ? -0.201  4.577   9.536   1.00 0.00 ? 22 GLY A H    9  
ATOM 11041 H HA2  . GLY A 1 22 ? -0.985  6.709   10.285  1.00 0.00 ? 22 GLY A HA2  9  
ATOM 11042 H HA3  . GLY A 1 22 ? -0.369  6.334   11.887  1.00 0.00 ? 22 GLY A HA3  9  
ATOM 11043 N N    . GLU A 1 23 ? 1.733   6.653   9.391   1.00 0.00 ? 23 GLU A N    9  
ATOM 11044 C CA   . GLU A 1 23 ? 2.974   7.298   8.976   1.00 0.00 ? 23 GLU A CA   9  
ATOM 11045 C C    . GLU A 1 23 ? 2.913   7.697   7.505   1.00 0.00 ? 23 GLU A C    9  
ATOM 11046 O O    . GLU A 1 23 ? 2.060   7.220   6.757   1.00 0.00 ? 23 GLU A O    9  
ATOM 11047 C CB   . GLU A 1 23 ? 4.163   6.365   9.216   1.00 0.00 ? 23 GLU A CB   9  
ATOM 11048 C CG   . GLU A 1 23 ? 3.975   4.976   8.627   1.00 0.00 ? 23 GLU A CG   9  
ATOM 11049 C CD   . GLU A 1 23 ? 4.881   4.716   7.440   1.00 0.00 ? 23 GLU A CD   9  
ATOM 11050 O OE1  . GLU A 1 23 ? 5.991   5.289   7.403   1.00 0.00 ? 23 GLU A OE1  9  
ATOM 11051 O OE2  . GLU A 1 23 ? 4.480   3.941   6.546   1.00 0.00 ? 23 GLU A OE2  9  
ATOM 11052 H H    . GLU A 1 23 ? 1.351   5.946   8.832   1.00 0.00 ? 23 GLU A H    9  
ATOM 11053 H HA   . GLU A 1 23 ? 3.100   8.189   9.573   1.00 0.00 ? 23 GLU A HA   9  
ATOM 11054 H HB2  . GLU A 1 23 ? 5.044   6.805   8.772   1.00 0.00 ? 23 GLU A HB2  9  
ATOM 11055 H HB3  . GLU A 1 23 ? 4.318   6.265   10.280  1.00 0.00 ? 23 GLU A HB3  9  
ATOM 11056 H HG2  . GLU A 1 23 ? 4.192   4.244   9.391   1.00 0.00 ? 23 GLU A HG2  9  
ATOM 11057 H HG3  . GLU A 1 23 ? 2.948   4.869   8.310   1.00 0.00 ? 23 GLU A HG3  9  
ATOM 11058 N N    . ARG A 1 24 ? 3.825   8.574   7.098   1.00 0.00 ? 24 ARG A N    9  
ATOM 11059 C CA   . ARG A 1 24 ? 3.876   9.037   5.716   1.00 0.00 ? 24 ARG A CA   9  
ATOM 11060 C C    . ARG A 1 24 ? 4.858   8.204   4.899   1.00 0.00 ? 24 ARG A C    9  
ATOM 11061 O O    . ARG A 1 24 ? 5.932   7.843   5.380   1.00 0.00 ? 24 ARG A O    9  
ATOM 11062 C CB   . ARG A 1 24 ? 4.275   10.513  5.665   1.00 0.00 ? 24 ARG A CB   9  
ATOM 11063 C CG   . ARG A 1 24 ? 3.174   11.457  6.118   1.00 0.00 ? 24 ARG A CG   9  
ATOM 11064 C CD   . ARG A 1 24 ? 3.172   11.630  7.628   1.00 0.00 ? 24 ARG A CD   9  
ATOM 11065 N NE   . ARG A 1 24 ? 2.920   13.014  8.019   1.00 0.00 ? 24 ARG A NE   9  
ATOM 11066 C CZ   . ARG A 1 24 ? 1.772   13.651  7.794   1.00 0.00 ? 24 ARG A CZ   9  
ATOM 11067 N NH1  . ARG A 1 24 ? 0.772   13.032  7.179   1.00 0.00 ? 24 ARG A NH1  9  
ATOM 11068 N NH2  . ARG A 1 24 ? 1.625   14.910  8.183   1.00 0.00 ? 24 ARG A NH2  9  
ATOM 11069 H H    . ARG A 1 24 ? 4.479   8.917   7.741   1.00 0.00 ? 24 ARG A H    9  
ATOM 11070 H HA   . ARG A 1 24 ? 2.889   8.925   5.293   1.00 0.00 ? 24 ARG A HA   9  
ATOM 11071 H HB2  . ARG A 1 24 ? 5.134   10.664  6.303   1.00 0.00 ? 24 ARG A HB2  9  
ATOM 11072 H HB3  . ARG A 1 24 ? 4.543   10.767  4.650   1.00 0.00 ? 24 ARG A HB3  9  
ATOM 11073 H HG2  . ARG A 1 24 ? 3.326   12.421  5.655   1.00 0.00 ? 24 ARG A HG2  9  
ATOM 11074 H HG3  . ARG A 1 24 ? 2.219   11.055  5.810   1.00 0.00 ? 24 ARG A HG3  9  
ATOM 11075 H HD2  . ARG A 1 24 ? 2.403   11.001  8.050   1.00 0.00 ? 24 ARG A HD2  9  
ATOM 11076 H HD3  . ARG A 1 24 ? 4.135   11.327  8.013   1.00 0.00 ? 24 ARG A HD3  9  
ATOM 11077 H HE   . ARG A 1 24 ? 3.642   13.496  8.476   1.00 0.00 ? 24 ARG A HE   9  
ATOM 11078 H HH11 . ARG A 1 24 ? 0.876   12.083  6.883   1.00 0.00 ? 24 ARG A HH11 9  
ATOM 11079 H HH12 . ARG A 1 24 ? -0.087  13.516  7.013   1.00 0.00 ? 24 ARG A HH12 9  
ATOM 11080 H HH21 . ARG A 1 24 ? 2.376   15.382  8.646   1.00 0.00 ? 24 ARG A HH21 9  
ATOM 11081 H HH22 . ARG A 1 24 ? 0.764   15.389  8.012   1.00 0.00 ? 24 ARG A HH22 9  
ATOM 11082 N N    . VAL A 1 25 ? 4.482   7.903   3.660   1.00 0.00 ? 25 VAL A N    9  
ATOM 11083 C CA   . VAL A 1 25 ? 5.330   7.114   2.775   1.00 0.00 ? 25 VAL A CA   9  
ATOM 11084 C C    . VAL A 1 25 ? 5.029   7.416   1.312   1.00 0.00 ? 25 VAL A C    9  
ATOM 11085 O O    . VAL A 1 25 ? 3.867   7.516   0.915   1.00 0.00 ? 25 VAL A O    9  
ATOM 11086 C CB   . VAL A 1 25 ? 5.150   5.605   3.023   1.00 0.00 ? 25 VAL A CB   9  
ATOM 11087 C CG1  . VAL A 1 25 ? 5.637   5.229   4.413   1.00 0.00 ? 25 VAL A CG1  9  
ATOM 11088 C CG2  . VAL A 1 25 ? 3.694   5.203   2.832   1.00 0.00 ? 25 VAL A CG2  9  
ATOM 11089 H H    . VAL A 1 25 ? 3.615   8.220   3.333   1.00 0.00 ? 25 VAL A H    9  
ATOM 11090 H HA   . VAL A 1 25 ? 6.359   7.371   2.981   1.00 0.00 ? 25 VAL A HA   9  
ATOM 11091 H HB   . VAL A 1 25 ? 5.746   5.068   2.299   1.00 0.00 ? 25 VAL A HB   9  
ATOM 11092 H HG11 . VAL A 1 25 ? 6.665   5.537   4.531   1.00 0.00 ? 25 VAL A HG11 9  
ATOM 11093 H HG12 . VAL A 1 25 ? 5.564   4.159   4.543   1.00 0.00 ? 25 VAL A HG12 9  
ATOM 11094 H HG13 . VAL A 1 25 ? 5.026   5.723   5.155   1.00 0.00 ? 25 VAL A HG13 9  
ATOM 11095 H HG21 . VAL A 1 25 ? 3.440   4.427   3.539   1.00 0.00 ? 25 VAL A HG21 9  
ATOM 11096 H HG22 . VAL A 1 25 ? 3.551   4.835   1.827   1.00 0.00 ? 25 VAL A HG22 9  
ATOM 11097 H HG23 . VAL A 1 25 ? 3.060   6.061   2.995   1.00 0.00 ? 25 VAL A HG23 9  
ATOM 11098 N N    . TRP A 1 26 ? 6.081   7.561   0.513   1.00 0.00 ? 26 TRP A N    9  
ATOM 11099 C CA   . TRP A 1 26 ? 5.929   7.852   -0.907  1.00 0.00 ? 26 TRP A CA   9  
ATOM 11100 C C    . TRP A 1 26 ? 5.614   6.583   -1.691  1.00 0.00 ? 26 TRP A C    9  
ATOM 11101 O O    . TRP A 1 26 ? 6.449   5.685   -1.800  1.00 0.00 ? 26 TRP A O    9  
ATOM 11102 C CB   . TRP A 1 26 ? 7.201   8.502   -1.455  1.00 0.00 ? 26 TRP A CB   9  
ATOM 11103 C CG   . TRP A 1 26 ? 7.227   9.991   -1.289  1.00 0.00 ? 26 TRP A CG   9  
ATOM 11104 C CD1  . TRP A 1 26 ? 7.044   10.928  -2.264  1.00 0.00 ? 26 TRP A CD1  9  
ATOM 11105 C CD2  . TRP A 1 26 ? 7.448   10.715  -0.073  1.00 0.00 ? 26 TRP A CD2  9  
ATOM 11106 N NE1  . TRP A 1 26 ? 7.139   12.191  -1.730  1.00 0.00 ? 26 TRP A NE1  9  
ATOM 11107 C CE2  . TRP A 1 26 ? 7.386   12.086  -0.387  1.00 0.00 ? 26 TRP A CE2  9  
ATOM 11108 C CE3  . TRP A 1 26 ? 7.692   10.337  1.251   1.00 0.00 ? 26 TRP A CE3  9  
ATOM 11109 C CZ2  . TRP A 1 26 ? 7.559   13.078  0.576   1.00 0.00 ? 26 TRP A CZ2  9  
ATOM 11110 C CZ3  . TRP A 1 26 ? 7.864   11.322  2.204   1.00 0.00 ? 26 TRP A CZ3  9  
ATOM 11111 C CH2  . TRP A 1 26 ? 7.796   12.679  1.863   1.00 0.00 ? 26 TRP A CH2  9  
ATOM 11112 H H    . TRP A 1 26 ? 6.982   7.470   0.889   1.00 0.00 ? 26 TRP A H    9  
ATOM 11113 H HA   . TRP A 1 26 ? 5.107   8.543   -1.017  1.00 0.00 ? 26 TRP A HA   9  
ATOM 11114 H HB2  . TRP A 1 26 ? 8.057   8.095   -0.938  1.00 0.00 ? 26 TRP A HB2  9  
ATOM 11115 H HB3  . TRP A 1 26 ? 7.284   8.282   -2.509  1.00 0.00 ? 26 TRP A HB3  9  
ATOM 11116 H HD1  . TRP A 1 26 ? 6.855   10.697  -3.302  1.00 0.00 ? 26 TRP A HD1  9  
ATOM 11117 H HE1  . TRP A 1 26 ? 7.044   13.029  -2.229  1.00 0.00 ? 26 TRP A HE1  9  
ATOM 11118 H HE3  . TRP A 1 26 ? 7.746   9.295   1.533   1.00 0.00 ? 26 TRP A HE3  9  
ATOM 11119 H HZ2  . TRP A 1 26 ? 7.509   14.129  0.329   1.00 0.00 ? 26 TRP A HZ2  9  
ATOM 11120 H HZ3  . TRP A 1 26 ? 8.053   11.049  3.232   1.00 0.00 ? 26 TRP A HZ3  9  
ATOM 11121 H HH2  . TRP A 1 26 ? 7.937   13.415  2.640   1.00 0.00 ? 26 TRP A HH2  9  
ATOM 11122 N N    . VAL A 1 27 ? 4.403   6.515   -2.236  1.00 0.00 ? 27 VAL A N    9  
ATOM 11123 C CA   . VAL A 1 27 ? 3.978   5.356   -3.011  1.00 0.00 ? 27 VAL A CA   9  
ATOM 11124 C C    . VAL A 1 27 ? 4.671   5.317   -4.368  1.00 0.00 ? 27 VAL A C    9  
ATOM 11125 O O    . VAL A 1 27 ? 4.397   6.141   -5.240  1.00 0.00 ? 27 VAL A O    9  
ATOM 11126 C CB   . VAL A 1 27 ? 2.452   5.354   -3.226  1.00 0.00 ? 27 VAL A CB   9  
ATOM 11127 C CG1  . VAL A 1 27 ? 2.004   4.046   -3.860  1.00 0.00 ? 27 VAL A CG1  9  
ATOM 11128 C CG2  . VAL A 1 27 ? 1.727   5.593   -1.910  1.00 0.00 ? 27 VAL A CG2  9  
ATOM 11129 H H    . VAL A 1 27 ? 3.782   7.264   -2.114  1.00 0.00 ? 27 VAL A H    9  
ATOM 11130 H HA   . VAL A 1 27 ? 4.243   4.468   -2.456  1.00 0.00 ? 27 VAL A HA   9  
ATOM 11131 H HB   . VAL A 1 27 ? 2.203   6.158   -3.902  1.00 0.00 ? 27 VAL A HB   9  
ATOM 11132 H HG11 . VAL A 1 27 ? 2.612   3.840   -4.729  1.00 0.00 ? 27 VAL A HG11 9  
ATOM 11133 H HG12 . VAL A 1 27 ? 0.969   4.126   -4.155  1.00 0.00 ? 27 VAL A HG12 9  
ATOM 11134 H HG13 . VAL A 1 27 ? 2.115   3.244   -3.146  1.00 0.00 ? 27 VAL A HG13 9  
ATOM 11135 H HG21 . VAL A 1 27 ? 1.503   6.645   -1.810  1.00 0.00 ? 27 VAL A HG21 9  
ATOM 11136 H HG22 . VAL A 1 27 ? 2.355   5.279   -1.090  1.00 0.00 ? 27 VAL A HG22 9  
ATOM 11137 H HG23 . VAL A 1 27 ? 0.808   5.026   -1.898  1.00 0.00 ? 27 VAL A HG23 9  
ATOM 11138 N N    . ASN A 1 28 ? 5.571   4.354   -4.539  1.00 0.00 ? 28 ASN A N    9  
ATOM 11139 C CA   . ASN A 1 28 ? 6.304   4.206   -5.792  1.00 0.00 ? 28 ASN A CA   9  
ATOM 11140 C C    . ASN A 1 28 ? 7.103   5.467   -6.106  1.00 0.00 ? 28 ASN A C    9  
ATOM 11141 O O    . ASN A 1 28 ? 7.320   5.803   -7.270  1.00 0.00 ? 28 ASN A O    9  
ATOM 11142 C CB   . ASN A 1 28 ? 5.338   3.901   -6.939  1.00 0.00 ? 28 ASN A CB   9  
ATOM 11143 C CG   . ASN A 1 28 ? 5.162   2.412   -7.164  1.00 0.00 ? 28 ASN A CG   9  
ATOM 11144 O OD1  . ASN A 1 28 ? 5.588   1.871   -8.184  1.00 0.00 ? 28 ASN A OD1  9  
ATOM 11145 N ND2  . ASN A 1 28 ? 4.529   1.740   -6.209  1.00 0.00 ? 28 ASN A ND2  9  
ATOM 11146 H H    . ASN A 1 28 ? 5.745   3.727   -3.806  1.00 0.00 ? 28 ASN A H    9  
ATOM 11147 H HA   . ASN A 1 28 ? 6.988   3.379   -5.679  1.00 0.00 ? 28 ASN A HA   9  
ATOM 11148 H HB2  . ASN A 1 28 ? 4.374   4.328   -6.713  1.00 0.00 ? 28 ASN A HB2  9  
ATOM 11149 H HB3  . ASN A 1 28 ? 5.720   4.342   -7.849  1.00 0.00 ? 28 ASN A HB3  9  
ATOM 11150 H HD21 . ASN A 1 28 ? 4.216   2.237   -5.424  1.00 0.00 ? 28 ASN A HD21 9  
ATOM 11151 H HD22 . ASN A 1 28 ? 4.401   0.776   -6.328  1.00 0.00 ? 28 ASN A HD22 9  
ATOM 11152 N N    . GLY A 1 29 ? 7.540   6.162   -5.060  1.00 0.00 ? 29 GLY A N    9  
ATOM 11153 C CA   . GLY A 1 29 ? 8.311   7.376   -5.246  1.00 0.00 ? 29 GLY A CA   9  
ATOM 11154 C C    . GLY A 1 29 ? 7.554   8.430   -6.030  1.00 0.00 ? 29 GLY A C    9  
ATOM 11155 O O    . GLY A 1 29 ? 8.159   9.263   -6.705  1.00 0.00 ? 29 GLY A O    9  
ATOM 11156 H H    . GLY A 1 29 ? 7.338   5.845   -4.154  1.00 0.00 ? 29 GLY A H    9  
ATOM 11157 H HA2  . GLY A 1 29 ? 8.566   7.779   -4.276  1.00 0.00 ? 29 GLY A HA2  9  
ATOM 11158 H HA3  . GLY A 1 29 ? 9.222   7.134   -5.774  1.00 0.00 ? 29 GLY A HA3  9  
ATOM 11159 N N    . VAL A 1 30 ? 6.228   8.394   -5.941  1.00 0.00 ? 30 VAL A N    9  
ATOM 11160 C CA   . VAL A 1 30 ? 5.389   9.353   -6.648  1.00 0.00 ? 30 VAL A CA   9  
ATOM 11161 C C    . VAL A 1 30 ? 4.873   10.434  -5.705  1.00 0.00 ? 30 VAL A C    9  
ATOM 11162 O O    . VAL A 1 30 ? 5.237   11.603  -5.826  1.00 0.00 ? 30 VAL A O    9  
ATOM 11163 C CB   . VAL A 1 30 ? 4.190   8.661   -7.323  1.00 0.00 ? 30 VAL A CB   9  
ATOM 11164 C CG1  . VAL A 1 30 ? 3.442   9.638   -8.217  1.00 0.00 ? 30 VAL A CG1  9  
ATOM 11165 C CG2  . VAL A 1 30 ? 4.649   7.447   -8.114  1.00 0.00 ? 30 VAL A CG2  9  
ATOM 11166 H H    . VAL A 1 30 ? 5.805   7.705   -5.386  1.00 0.00 ? 30 VAL A H    9  
ATOM 11167 H HA   . VAL A 1 30 ? 5.989   9.818   -7.418  1.00 0.00 ? 30 VAL A HA   9  
ATOM 11168 H HB   . VAL A 1 30 ? 3.512   8.326   -6.550  1.00 0.00 ? 30 VAL A HB   9  
ATOM 11169 H HG11 . VAL A 1 30 ? 4.114   10.421  -8.535  1.00 0.00 ? 30 VAL A HG11 9  
ATOM 11170 H HG12 . VAL A 1 30 ? 2.619   10.072  -7.668  1.00 0.00 ? 30 VAL A HG12 9  
ATOM 11171 H HG13 . VAL A 1 30 ? 3.062   9.115   -9.082  1.00 0.00 ? 30 VAL A HG13 9  
ATOM 11172 H HG21 . VAL A 1 30 ? 3.801   6.814   -8.329  1.00 0.00 ? 30 VAL A HG21 9  
ATOM 11173 H HG22 . VAL A 1 30 ? 5.374   6.893   -7.535  1.00 0.00 ? 30 VAL A HG22 9  
ATOM 11174 H HG23 . VAL A 1 30 ? 5.101   7.770   -9.040  1.00 0.00 ? 30 VAL A HG23 9  
ATOM 11175 N N    . LYS A 1 31 ? 4.022   10.035  -4.764  1.00 0.00 ? 31 LYS A N    9  
ATOM 11176 C CA   . LYS A 1 31 ? 3.456   10.971  -3.799  1.00 0.00 ? 31 LYS A CA   9  
ATOM 11177 C C    . LYS A 1 31 ? 3.345   10.329  -2.417  1.00 0.00 ? 31 LYS A C    9  
ATOM 11178 O O    . LYS A 1 31 ? 3.119   9.125   -2.301  1.00 0.00 ? 31 LYS A O    9  
ATOM 11179 C CB   . LYS A 1 31 ? 2.078   11.444  -4.266  1.00 0.00 ? 31 LYS A CB   9  
ATOM 11180 C CG   . LYS A 1 31 ? 2.134   12.505  -5.353  1.00 0.00 ? 31 LYS A CG   9  
ATOM 11181 C CD   . LYS A 1 31 ? 0.955   13.460  -5.259  1.00 0.00 ? 31 LYS A CD   9  
ATOM 11182 C CE   . LYS A 1 31 ? 0.714   14.184  -6.575  1.00 0.00 ? 31 LYS A CE   9  
ATOM 11183 N NZ   . LYS A 1 31 ? -0.640  13.898  -7.126  1.00 0.00 ? 31 LYS A NZ   9  
ATOM 11184 H H    . LYS A 1 31 ? 3.769   9.090   -4.718  1.00 0.00 ? 31 LYS A H    9  
ATOM 11185 H HA   . LYS A 1 31 ? 4.117   11.822  -3.736  1.00 0.00 ? 31 LYS A HA   9  
ATOM 11186 H HB2  . LYS A 1 31 ? 1.529   10.596  -4.648  1.00 0.00 ? 31 LYS A HB2  9  
ATOM 11187 H HB3  . LYS A 1 31 ? 1.546   11.853  -3.420  1.00 0.00 ? 31 LYS A HB3  9  
ATOM 11188 H HG2  . LYS A 1 31 ? 3.049   13.067  -5.247  1.00 0.00 ? 31 LYS A HG2  9  
ATOM 11189 H HG3  . LYS A 1 31 ? 2.117   12.018  -6.317  1.00 0.00 ? 31 LYS A HG3  9  
ATOM 11190 H HD2  . LYS A 1 31 ? 0.069   12.899  -5.002  1.00 0.00 ? 31 LYS A HD2  9  
ATOM 11191 H HD3  . LYS A 1 31 ? 1.157   14.190  -4.489  1.00 0.00 ? 31 LYS A HD3  9  
ATOM 11192 H HE2  . LYS A 1 31 ? 0.807   15.247  -6.409  1.00 0.00 ? 31 LYS A HE2  9  
ATOM 11193 H HE3  . LYS A 1 31 ? 1.458   13.865  -7.290  1.00 0.00 ? 31 LYS A HE3  9  
ATOM 11194 H HZ1  . LYS A 1 31 ? -1.284  13.612  -6.360  1.00 0.00 ? 31 LYS A HZ1  9  
ATOM 11195 H HZ2  . LYS A 1 31 ? -0.587  13.129  -7.825  1.00 0.00 ? 31 LYS A HZ2  9  
ATOM 11196 H HZ3  . LYS A 1 31 ? -1.024  14.747  -7.590  1.00 0.00 ? 31 LYS A HZ3  9  
ATOM 11197 N N    . PRO A 1 32 ? 3.502   11.129  -1.348  1.00 0.00 ? 32 PRO A N    9  
ATOM 11198 C CA   . PRO A 1 32 ? 3.418   10.632  0.028   1.00 0.00 ? 32 PRO A CA   9  
ATOM 11199 C C    . PRO A 1 32 ? 1.990   10.286  0.433   1.00 0.00 ? 32 PRO A C    9  
ATOM 11200 O O    . PRO A 1 32 ? 1.031   10.868  -0.076  1.00 0.00 ? 32 PRO A O    9  
ATOM 11201 C CB   . PRO A 1 32 ? 3.939   11.805  0.859   1.00 0.00 ? 32 PRO A CB   9  
ATOM 11202 C CG   . PRO A 1 32 ? 3.640   13.010  0.037   1.00 0.00 ? 32 PRO A CG   9  
ATOM 11203 C CD   . PRO A 1 32 ? 3.775   12.579  -1.397  1.00 0.00 ? 32 PRO A CD   9  
ATOM 11204 H HA   . PRO A 1 32 ? 4.053   9.771   0.178   1.00 0.00 ? 32 PRO A HA   9  
ATOM 11205 H HB2  . PRO A 1 32 ? 3.422   11.834  1.810   1.00 0.00 ? 32 PRO A HB2  9  
ATOM 11206 H HB3  . PRO A 1 32 ? 5.003   11.692  1.021   1.00 0.00 ? 32 PRO A HB3  9  
ATOM 11207 H HG2  . PRO A 1 32 ? 2.633   13.348  0.234   1.00 0.00 ? 32 PRO A HG2  9  
ATOM 11208 H HG3  . PRO A 1 32 ? 4.349   13.793  0.261   1.00 0.00 ? 32 PRO A HG3  9  
ATOM 11209 H HD2  . PRO A 1 32 ? 3.047   13.087  -2.014  1.00 0.00 ? 32 PRO A HD2  9  
ATOM 11210 H HD3  . PRO A 1 32 ? 4.775   12.771  -1.757  1.00 0.00 ? 32 PRO A HD3  9  
ATOM 11211 N N    . GLY A 1 33 ? 1.853   9.335   1.352   1.00 0.00 ? 33 GLY A N    9  
ATOM 11212 C CA   . GLY A 1 33 ? 0.538   8.928   1.810   1.00 0.00 ? 33 GLY A CA   9  
ATOM 11213 C C    . GLY A 1 33 ? 0.550   8.433   3.243   1.00 0.00 ? 33 GLY A C    9  
ATOM 11214 O O    . GLY A 1 33 ? 1.541   7.863   3.701   1.00 0.00 ? 33 GLY A O    9  
ATOM 11215 H H    . GLY A 1 33 ? 2.654   8.907   1.722   1.00 0.00 ? 33 GLY A H    9  
ATOM 11216 H HA2  . GLY A 1 33 ? -0.133  9.771   1.737   1.00 0.00 ? 33 GLY A HA2  9  
ATOM 11217 H HA3  . GLY A 1 33 ? 0.176   8.136   1.170   1.00 0.00 ? 33 GLY A HA3  9  
ATOM 11218 N N    . VAL A 1 34 ? -0.553  8.650   3.951   1.00 0.00 ? 34 VAL A N    9  
ATOM 11219 C CA   . VAL A 1 34 ? -0.665  8.222   5.340   1.00 0.00 ? 34 VAL A CA   9  
ATOM 11220 C C    . VAL A 1 34 ? -1.135  6.774   5.432   1.00 0.00 ? 34 VAL A C    9  
ATOM 11221 O O    . VAL A 1 34 ? -2.268  6.456   5.072   1.00 0.00 ? 34 VAL A O    9  
ATOM 11222 C CB   . VAL A 1 34 ? -1.641  9.119   6.128   1.00 0.00 ? 34 VAL A CB   9  
ATOM 11223 C CG1  . VAL A 1 34 ? -1.627  8.756   7.606   1.00 0.00 ? 34 VAL A CG1  9  
ATOM 11224 C CG2  . VAL A 1 34 ? -1.299  10.588  5.929   1.00 0.00 ? 34 VAL A CG2  9  
ATOM 11225 H H    . VAL A 1 34 ? -1.308  9.109   3.530   1.00 0.00 ? 34 VAL A H    9  
ATOM 11226 H HA   . VAL A 1 34 ? 0.311   8.303   5.795   1.00 0.00 ? 34 VAL A HA   9  
ATOM 11227 H HB   . VAL A 1 34 ? -2.638  8.949   5.750   1.00 0.00 ? 34 VAL A HB   9  
ATOM 11228 H HG11 . VAL A 1 34 ? -1.822  9.641   8.194   1.00 0.00 ? 34 VAL A HG11 9  
ATOM 11229 H HG12 . VAL A 1 34 ? -0.659  8.356   7.868   1.00 0.00 ? 34 VAL A HG12 9  
ATOM 11230 H HG13 . VAL A 1 34 ? -2.389  8.018   7.803   1.00 0.00 ? 34 VAL A HG13 9  
ATOM 11231 H HG21 . VAL A 1 34 ? -0.771  10.955  6.796   1.00 0.00 ? 34 VAL A HG21 9  
ATOM 11232 H HG22 . VAL A 1 34 ? -2.209  11.153  5.794   1.00 0.00 ? 34 VAL A HG22 9  
ATOM 11233 H HG23 . VAL A 1 34 ? -0.675  10.698  5.055   1.00 0.00 ? 34 VAL A HG23 9  
ATOM 11234 N N    . VAL A 1 35 ? -0.258  5.901   5.914   1.00 0.00 ? 35 VAL A N    9  
ATOM 11235 C CA   . VAL A 1 35 ? -0.584  4.487   6.053   1.00 0.00 ? 35 VAL A CA   9  
ATOM 11236 C C    . VAL A 1 35 ? -1.641  4.269   7.130   1.00 0.00 ? 35 VAL A C    9  
ATOM 11237 O O    . VAL A 1 35 ? -1.511  4.762   8.251   1.00 0.00 ? 35 VAL A O    9  
ATOM 11238 C CB   . VAL A 1 35 ? 0.664   3.653   6.400   1.00 0.00 ? 35 VAL A CB   9  
ATOM 11239 C CG1  . VAL A 1 35 ? 0.347   2.167   6.344   1.00 0.00 ? 35 VAL A CG1  9  
ATOM 11240 C CG2  . VAL A 1 35 ? 1.813   3.996   5.464   1.00 0.00 ? 35 VAL A CG2  9  
ATOM 11241 H H    . VAL A 1 35 ? 0.631   6.215   6.185   1.00 0.00 ? 35 VAL A H    9  
ATOM 11242 H HA   . VAL A 1 35 ? -0.971  4.140   5.106   1.00 0.00 ? 35 VAL A HA   9  
ATOM 11243 H HB   . VAL A 1 35 ? 0.965   3.895   7.408   1.00 0.00 ? 35 VAL A HB   9  
ATOM 11244 H HG11 . VAL A 1 35 ? 0.151   1.879   5.321   1.00 0.00 ? 35 VAL A HG11 9  
ATOM 11245 H HG12 . VAL A 1 35 ? -0.523  1.961   6.949   1.00 0.00 ? 35 VAL A HG12 9  
ATOM 11246 H HG13 . VAL A 1 35 ? 1.189   1.605   6.720   1.00 0.00 ? 35 VAL A HG13 9  
ATOM 11247 H HG21 . VAL A 1 35 ? 2.213   4.965   5.725   1.00 0.00 ? 35 VAL A HG21 9  
ATOM 11248 H HG22 . VAL A 1 35 ? 1.452   4.019   4.446   1.00 0.00 ? 35 VAL A HG22 9  
ATOM 11249 H HG23 . VAL A 1 35 ? 2.588   3.250   5.555   1.00 0.00 ? 35 VAL A HG23 9  
ATOM 11250 N N    . GLN A 1 36 ? -2.687  3.526   6.782   1.00 0.00 ? 36 GLN A N    9  
ATOM 11251 C CA   . GLN A 1 36 ? -3.769  3.241   7.718   1.00 0.00 ? 36 GLN A CA   9  
ATOM 11252 C C    . GLN A 1 36 ? -3.852  1.747   8.014   1.00 0.00 ? 36 GLN A C    9  
ATOM 11253 O O    . GLN A 1 36 ? -4.008  1.340   9.165   1.00 0.00 ? 36 GLN A O    9  
ATOM 11254 C CB   . GLN A 1 36 ? -5.102  3.738   7.157   1.00 0.00 ? 36 GLN A CB   9  
ATOM 11255 C CG   . GLN A 1 36 ? -5.455  5.152   7.588   1.00 0.00 ? 36 GLN A CG   9  
ATOM 11256 C CD   . GLN A 1 36 ? -6.191  5.190   8.913   1.00 0.00 ? 36 GLN A CD   9  
ATOM 11257 O OE1  . GLN A 1 36 ? -7.417  5.299   8.953   1.00 0.00 ? 36 GLN A OE1  9  
ATOM 11258 N NE2  . GLN A 1 36 ? -5.445  5.100   10.008  1.00 0.00 ? 36 GLN A NE2  9  
ATOM 11259 H H    . GLN A 1 36 ? -2.733  3.160   5.874   1.00 0.00 ? 36 GLN A H    9  
ATOM 11260 H HA   . GLN A 1 36 ? -3.558  3.767   8.638   1.00 0.00 ? 36 GLN A HA   9  
ATOM 11261 H HB2  . GLN A 1 36 ? -5.055  3.715   6.078   1.00 0.00 ? 36 GLN A HB2  9  
ATOM 11262 H HB3  . GLN A 1 36 ? -5.889  3.076   7.488   1.00 0.00 ? 36 GLN A HB3  9  
ATOM 11263 H HG2  . GLN A 1 36 ? -4.544  5.723   7.684   1.00 0.00 ? 36 GLN A HG2  9  
ATOM 11264 H HG3  . GLN A 1 36 ? -6.083  5.599   6.831   1.00 0.00 ? 36 GLN A HG3  9  
ATOM 11265 H HE21 . GLN A 1 36 ? -4.474  5.016   9.900   1.00 0.00 ? 36 GLN A HE21 9  
ATOM 11266 H HE22 . GLN A 1 36 ? -5.895  5.122   10.878  1.00 0.00 ? 36 GLN A HE22 9  
ATOM 11267 N N    . TYR A 1 37 ? -3.745  0.935   6.967   1.00 0.00 ? 37 TYR A N    9  
ATOM 11268 C CA   . TYR A 1 37 ? -3.809  -0.514  7.114   1.00 0.00 ? 37 TYR A CA   9  
ATOM 11269 C C    . TYR A 1 37 ? -2.489  -1.161  6.708   1.00 0.00 ? 37 TYR A C    9  
ATOM 11270 O O    . TYR A 1 37 ? -1.808  -0.686  5.798   1.00 0.00 ? 37 TYR A O    9  
ATOM 11271 C CB   . TYR A 1 37 ? -4.950  -1.083  6.269   1.00 0.00 ? 37 TYR A CB   9  
ATOM 11272 C CG   . TYR A 1 37 ? -5.517  -2.378  6.808   1.00 0.00 ? 37 TYR A CG   9  
ATOM 11273 C CD1  . TYR A 1 37 ? -4.906  -3.594  6.530   1.00 0.00 ? 37 TYR A CD1  9  
ATOM 11274 C CD2  . TYR A 1 37 ? -6.661  -2.383  7.595   1.00 0.00 ? 37 TYR A CD2  9  
ATOM 11275 C CE1  . TYR A 1 37 ? -5.421  -4.780  7.020   1.00 0.00 ? 37 TYR A CE1  9  
ATOM 11276 C CE2  . TYR A 1 37 ? -7.181  -3.564  8.089   1.00 0.00 ? 37 TYR A CE2  9  
ATOM 11277 C CZ   . TYR A 1 37 ? -6.558  -4.759  7.799   1.00 0.00 ? 37 TYR A CZ   9  
ATOM 11278 O OH   . TYR A 1 37 ? -7.073  -5.937  8.290   1.00 0.00 ? 37 TYR A OH   9  
ATOM 11279 H H    . TYR A 1 37 ? -3.622  1.320   6.075   1.00 0.00 ? 37 TYR A H    9  
ATOM 11280 H HA   . TYR A 1 37 ? -3.999  -0.735  8.154   1.00 0.00 ? 37 TYR A HA   9  
ATOM 11281 H HB2  . TYR A 1 37 ? -5.752  -0.363  6.228   1.00 0.00 ? 37 TYR A HB2  9  
ATOM 11282 H HB3  . TYR A 1 37 ? -4.589  -1.270  5.268   1.00 0.00 ? 37 TYR A HB3  9  
ATOM 11283 H HD1  . TYR A 1 37 ? -4.015  -3.607  5.920   1.00 0.00 ? 37 TYR A HD1  9  
ATOM 11284 H HD2  . TYR A 1 37 ? -7.148  -1.446  7.820   1.00 0.00 ? 37 TYR A HD2  9  
ATOM 11285 H HE1  . TYR A 1 37 ? -4.932  -5.715  6.792   1.00 0.00 ? 37 TYR A HE1  9  
ATOM 11286 H HE2  . TYR A 1 37 ? -8.073  -3.548  8.700   1.00 0.00 ? 37 TYR A HE2  9  
ATOM 11287 H HH   . TYR A 1 37 ? -7.775  -6.244  7.712   1.00 0.00 ? 37 TYR A HH   9  
ATOM 11288 N N    . LEU A 1 38 ? -2.132  -2.245  7.388   1.00 0.00 ? 38 LEU A N    9  
ATOM 11289 C CA   . LEU A 1 38 ? -0.893  -2.957  7.098   1.00 0.00 ? 38 LEU A CA   9  
ATOM 11290 C C    . LEU A 1 38 ? -1.057  -4.455  7.329   1.00 0.00 ? 38 LEU A C    9  
ATOM 11291 O O    . LEU A 1 38 ? -1.065  -4.921  8.469   1.00 0.00 ? 38 LEU A O    9  
ATOM 11292 C CB   . LEU A 1 38 ? 0.245   -2.416  7.967   1.00 0.00 ? 38 LEU A CB   9  
ATOM 11293 C CG   . LEU A 1 38 ? 0.914   -1.145  7.440   1.00 0.00 ? 38 LEU A CG   9  
ATOM 11294 C CD1  . LEU A 1 38 ? 1.300   -0.227  8.590   1.00 0.00 ? 38 LEU A CD1  9  
ATOM 11295 C CD2  . LEU A 1 38 ? 2.135   -1.494  6.602   1.00 0.00 ? 38 LEU A CD2  9  
ATOM 11296 H H    . LEU A 1 38 ? -2.716  -2.575  8.103   1.00 0.00 ? 38 LEU A H    9  
ATOM 11297 H HA   . LEU A 1 38 ? -0.650  -2.789  6.059   1.00 0.00 ? 38 LEU A HA   9  
ATOM 11298 H HB2  . LEU A 1 38 ? -0.150  -2.211  8.951   1.00 0.00 ? 38 LEU A HB2  9  
ATOM 11299 H HB3  . LEU A 1 38 ? 0.999   -3.183  8.053   1.00 0.00 ? 38 LEU A HB3  9  
ATOM 11300 H HG   . LEU A 1 38 ? 0.215   -0.613  6.809   1.00 0.00 ? 38 LEU A HG   9  
ATOM 11301 H HD11 . LEU A 1 38 ? 1.458   -0.815  9.482   1.00 0.00 ? 38 LEU A HD11 9  
ATOM 11302 H HD12 . LEU A 1 38 ? 0.507   0.485   8.764   1.00 0.00 ? 38 LEU A HD12 9  
ATOM 11303 H HD13 . LEU A 1 38 ? 2.209   0.299   8.341   1.00 0.00 ? 38 LEU A HD13 9  
ATOM 11304 H HD21 . LEU A 1 38 ? 2.565   -0.590  6.198   1.00 0.00 ? 38 LEU A HD21 9  
ATOM 11305 H HD22 . LEU A 1 38 ? 1.841   -2.146  5.793   1.00 0.00 ? 38 LEU A HD22 9  
ATOM 11306 H HD23 . LEU A 1 38 ? 2.865   -1.994  7.221   1.00 0.00 ? 38 LEU A HD23 9  
ATOM 11307 N N    . GLY A 1 39 ? -1.189  -5.205  6.241   1.00 0.00 ? 39 GLY A N    9  
ATOM 11308 C CA   . GLY A 1 39 ? -1.352  -6.644  6.345   1.00 0.00 ? 39 GLY A CA   9  
ATOM 11309 C C    . GLY A 1 39 ? -1.949  -7.253  5.092   1.00 0.00 ? 39 GLY A C    9  
ATOM 11310 O O    . GLY A 1 39 ? -1.830  -6.690  4.004   1.00 0.00 ? 39 GLY A O    9  
ATOM 11311 H H    . GLY A 1 39 ? -1.176  -4.779  5.358   1.00 0.00 ? 39 GLY A H    9  
ATOM 11312 H HA2  . GLY A 1 39 ? -0.386  -7.093  6.526   1.00 0.00 ? 39 GLY A HA2  9  
ATOM 11313 H HA3  . GLY A 1 39 ? -2.000  -6.862  7.182   1.00 0.00 ? 39 GLY A HA3  9  
ATOM 11314 N N    . GLU A 1 40 ? -2.592  -8.406  5.244   1.00 0.00 ? 40 GLU A N    9  
ATOM 11315 C CA   . GLU A 1 40 ? -3.210  -9.091  4.116   1.00 0.00 ? 40 GLU A CA   9  
ATOM 11316 C C    . GLU A 1 40 ? -4.486  -8.379  3.679   1.00 0.00 ? 40 GLU A C    9  
ATOM 11317 O O    . GLU A 1 40 ? -4.993  -7.506  4.381   1.00 0.00 ? 40 GLU A O    9  
ATOM 11318 C CB   . GLU A 1 40 ? -3.522  -10.544 4.483   1.00 0.00 ? 40 GLU A CB   9  
ATOM 11319 C CG   . GLU A 1 40 ? -2.289  -11.429 4.569   1.00 0.00 ? 40 GLU A CG   9  
ATOM 11320 C CD   . GLU A 1 40 ? -2.094  -12.027 5.948   1.00 0.00 ? 40 GLU A CD   9  
ATOM 11321 O OE1  . GLU A 1 40 ? -2.915  -12.881 6.346   1.00 0.00 ? 40 GLU A OE1  9  
ATOM 11322 O OE2  . GLU A 1 40 ? -1.122  -11.643 6.630   1.00 0.00 ? 40 GLU A OE2  9  
ATOM 11323 H H    . GLU A 1 40 ? -2.653  -8.805  6.138   1.00 0.00 ? 40 GLU A H    9  
ATOM 11324 H HA   . GLU A 1 40 ? -2.506  -9.081  3.297   1.00 0.00 ? 40 GLU A HA   9  
ATOM 11325 H HB2  . GLU A 1 40 ? -4.020  -10.561 5.441   1.00 0.00 ? 40 GLU A HB2  9  
ATOM 11326 H HB3  . GLU A 1 40 ? -4.184  -10.956 3.736   1.00 0.00 ? 40 GLU A HB3  9  
ATOM 11327 H HG2  . GLU A 1 40 ? -2.389  -12.233 3.855   1.00 0.00 ? 40 GLU A HG2  9  
ATOM 11328 H HG3  . GLU A 1 40 ? -1.420  -10.836 4.323   1.00 0.00 ? 40 GLU A HG3  9  
ATOM 11329 N N    . THR A 1 41 ? -4.999  -8.758  2.512   1.00 0.00 ? 41 THR A N    9  
ATOM 11330 C CA   . THR A 1 41 ? -6.215  -8.156  1.980   1.00 0.00 ? 41 THR A CA   9  
ATOM 11331 C C    . THR A 1 41 ? -7.258  -9.224  1.664   1.00 0.00 ? 41 THR A C    9  
ATOM 11332 O O    . THR A 1 41 ? -7.009  -10.418 1.834   1.00 0.00 ? 41 THR A O    9  
ATOM 11333 C CB   . THR A 1 41 ? -5.901  -7.347  0.722   1.00 0.00 ? 41 THR A CB   9  
ATOM 11334 O OG1  . THR A 1 41 ? -5.079  -8.090  -0.161  1.00 0.00 ? 41 THR A OG1  9  
ATOM 11335 C CG2  . THR A 1 41 ? -5.197  -6.039  1.012   1.00 0.00 ? 41 THR A CG2  9  
ATOM 11336 H H    . THR A 1 41 ? -4.548  -9.460  1.997   1.00 0.00 ? 41 THR A H    9  
ATOM 11337 H HA   . THR A 1 41 ? -6.614  -7.493  2.733   1.00 0.00 ? 41 THR A HA   9  
ATOM 11338 H HB   . THR A 1 41 ? -6.826  -7.119  0.212   1.00 0.00 ? 41 THR A HB   9  
ATOM 11339 H HG1  . THR A 1 41 ? -5.070  -7.667  -1.023  1.00 0.00 ? 41 THR A HG1  9  
ATOM 11340 H HG21 . THR A 1 41 ? -4.542  -6.163  1.860   1.00 0.00 ? 41 THR A HG21 9  
ATOM 11341 H HG22 . THR A 1 41 ? -5.931  -5.277  1.233   1.00 0.00 ? 41 THR A HG22 9  
ATOM 11342 H HG23 . THR A 1 41 ? -4.618  -5.742  0.150   1.00 0.00 ? 41 THR A HG23 9  
ATOM 11343 N N    . GLN A 1 42 ? -8.425  -8.786  1.206   1.00 0.00 ? 42 GLN A N    9  
ATOM 11344 C CA   . GLN A 1 42 ? -9.506  -9.705  0.865   1.00 0.00 ? 42 GLN A CA   9  
ATOM 11345 C C    . GLN A 1 42 ? -9.823  -9.652  -0.627  1.00 0.00 ? 42 GLN A C    9  
ATOM 11346 O O    . GLN A 1 42 ? -10.950 -9.919  -1.042  1.00 0.00 ? 42 GLN A O    9  
ATOM 11347 C CB   . GLN A 1 42 ? -10.760 -9.372  1.677   1.00 0.00 ? 42 GLN A CB   9  
ATOM 11348 C CG   . GLN A 1 42 ? -10.852 -10.126 2.993   1.00 0.00 ? 42 GLN A CG   9  
ATOM 11349 C CD   . GLN A 1 42 ? -11.892 -11.229 2.964   1.00 0.00 ? 42 GLN A CD   9  
ATOM 11350 O OE1  . GLN A 1 42 ? -13.061 -10.987 2.663   1.00 0.00 ? 42 GLN A OE1  9  
ATOM 11351 N NE2  . GLN A 1 42 ? -11.470 -12.449 3.276   1.00 0.00 ? 42 GLN A NE2  9  
ATOM 11352 H H    . GLN A 1 42 ? -8.565  -7.823  1.092   1.00 0.00 ? 42 GLN A H    9  
ATOM 11353 H HA   . GLN A 1 42 ? -9.182  -10.705 1.116   1.00 0.00 ? 42 GLN A HA   9  
ATOM 11354 H HB2  . GLN A 1 42 ? -10.765 -8.314  1.891   1.00 0.00 ? 42 GLN A HB2  9  
ATOM 11355 H HB3  . GLN A 1 42 ? -11.632 -9.614  1.086   1.00 0.00 ? 42 GLN A HB3  9  
ATOM 11356 H HG2  . GLN A 1 42 ? -9.889  -10.567 3.208   1.00 0.00 ? 42 GLN A HG2  9  
ATOM 11357 H HG3  . GLN A 1 42 ? -11.109 -9.428  3.776   1.00 0.00 ? 42 GLN A HG3  9  
ATOM 11358 H HE21 . GLN A 1 42 ? -10.525 -12.568 3.506   1.00 0.00 ? 42 GLN A HE21 9  
ATOM 11359 H HE22 . GLN A 1 42 ? -12.122 -13.180 3.266   1.00 0.00 ? 42 GLN A HE22 9  
ATOM 11360 N N    . PHE A 1 43 ? -8.820  -9.306  -1.429  1.00 0.00 ? 43 PHE A N    9  
ATOM 11361 C CA   . PHE A 1 43 ? -8.995  -9.221  -2.875  1.00 0.00 ? 43 PHE A CA   9  
ATOM 11362 C C    . PHE A 1 43 ? -7.840  -9.900  -3.605  1.00 0.00 ? 43 PHE A C    9  
ATOM 11363 O O    . PHE A 1 43 ? -8.050  -10.638 -4.568  1.00 0.00 ? 43 PHE A O    9  
ATOM 11364 C CB   . PHE A 1 43 ? -9.107  -7.758  -3.314  1.00 0.00 ? 43 PHE A CB   9  
ATOM 11365 C CG   . PHE A 1 43 ? -7.855  -6.959  -3.086  1.00 0.00 ? 43 PHE A CG   9  
ATOM 11366 C CD1  . PHE A 1 43 ? -6.835  -6.961  -4.024  1.00 0.00 ? 43 PHE A CD1  9  
ATOM 11367 C CD2  . PHE A 1 43 ? -7.700  -6.205  -1.934  1.00 0.00 ? 43 PHE A CD2  9  
ATOM 11368 C CE1  . PHE A 1 43 ? -5.683  -6.227  -3.816  1.00 0.00 ? 43 PHE A CE1  9  
ATOM 11369 C CE2  . PHE A 1 43 ? -6.550  -5.469  -1.721  1.00 0.00 ? 43 PHE A CE2  9  
ATOM 11370 C CZ   . PHE A 1 43 ? -5.540  -5.480  -2.664  1.00 0.00 ? 43 PHE A CZ   9  
ATOM 11371 H H    . PHE A 1 43 ? -7.944  -9.105  -1.040  1.00 0.00 ? 43 PHE A H    9  
ATOM 11372 H HA   . PHE A 1 43 ? -9.911  -9.733  -3.126  1.00 0.00 ? 43 PHE A HA   9  
ATOM 11373 H HB2  . PHE A 1 43 ? -9.334  -7.723  -4.369  1.00 0.00 ? 43 PHE A HB2  9  
ATOM 11374 H HB3  . PHE A 1 43 ? -9.908  -7.286  -2.764  1.00 0.00 ? 43 PHE A HB3  9  
ATOM 11375 H HD1  . PHE A 1 43 ? -6.946  -7.546  -4.925  1.00 0.00 ? 43 PHE A HD1  9  
ATOM 11376 H HD2  . PHE A 1 43 ? -8.487  -6.197  -1.195  1.00 0.00 ? 43 PHE A HD2  9  
ATOM 11377 H HE1  . PHE A 1 43 ? -4.896  -6.237  -4.556  1.00 0.00 ? 43 PHE A HE1  9  
ATOM 11378 H HE2  . PHE A 1 43 ? -6.441  -4.885  -0.820  1.00 0.00 ? 43 PHE A HE2  9  
ATOM 11379 H HZ   . PHE A 1 43 ? -4.641  -4.904  -2.500  1.00 0.00 ? 43 PHE A HZ   9  
ATOM 11380 N N    . ALA A 1 44 ? -6.620  -9.646  -3.142  1.00 0.00 ? 44 ALA A N    9  
ATOM 11381 C CA   . ALA A 1 44 ? -5.434  -10.234 -3.751  1.00 0.00 ? 44 ALA A CA   9  
ATOM 11382 C C    . ALA A 1 44 ? -4.496  -10.805 -2.689  1.00 0.00 ? 44 ALA A C    9  
ATOM 11383 O O    . ALA A 1 44 ? -4.435  -10.300 -1.568  1.00 0.00 ? 44 ALA A O    9  
ATOM 11384 C CB   . ALA A 1 44 ? -4.707  -9.199  -4.597  1.00 0.00 ? 44 ALA A CB   9  
ATOM 11385 H H    . ALA A 1 44 ? -6.515  -9.050  -2.371  1.00 0.00 ? 44 ALA A H    9  
ATOM 11386 H HA   . ALA A 1 44 ? -5.755  -11.035 -4.401  1.00 0.00 ? 44 ALA A HA   9  
ATOM 11387 H HB1  . ALA A 1 44 ? -3.848  -9.656  -5.066  1.00 0.00 ? 44 ALA A HB1  9  
ATOM 11388 H HB2  . ALA A 1 44 ? -4.382  -8.384  -3.968  1.00 0.00 ? 44 ALA A HB2  9  
ATOM 11389 H HB3  . ALA A 1 44 ? -5.375  -8.823  -5.358  1.00 0.00 ? 44 ALA A HB3  9  
ATOM 11390 N N    . PRO A 1 45 ? -3.753  -11.871 -3.030  1.00 0.00 ? 45 PRO A N    9  
ATOM 11391 C CA   . PRO A 1 45 ? -2.816  -12.509 -2.099  1.00 0.00 ? 45 PRO A CA   9  
ATOM 11392 C C    . PRO A 1 45 ? -1.601  -11.635 -1.808  1.00 0.00 ? 45 PRO A C    9  
ATOM 11393 O O    . PRO A 1 45 ? -1.531  -10.487 -2.247  1.00 0.00 ? 45 PRO A O    9  
ATOM 11394 C CB   . PRO A 1 45 ? -2.394  -13.782 -2.836  1.00 0.00 ? 45 PRO A CB   9  
ATOM 11395 C CG   . PRO A 1 45 ? -2.583  -13.465 -4.279  1.00 0.00 ? 45 PRO A CG   9  
ATOM 11396 C CD   . PRO A 1 45 ? -3.765  -12.537 -4.346  1.00 0.00 ? 45 PRO A CD   9  
ATOM 11397 H HA   . PRO A 1 45 ? -3.299  -12.772 -1.169  1.00 0.00 ? 45 PRO A HA   9  
ATOM 11398 H HB2  . PRO A 1 45 ? -1.360  -14.005 -2.612  1.00 0.00 ? 45 PRO A HB2  9  
ATOM 11399 H HB3  . PRO A 1 45 ? -3.020  -14.605 -2.527  1.00 0.00 ? 45 PRO A HB3  9  
ATOM 11400 H HG2  . PRO A 1 45 ? -1.701  -12.979 -4.666  1.00 0.00 ? 45 PRO A HG2  9  
ATOM 11401 H HG3  . PRO A 1 45 ? -2.787  -14.371 -4.830  1.00 0.00 ? 45 PRO A HG3  9  
ATOM 11402 H HD2  . PRO A 1 45 ? -3.635  -11.818 -5.142  1.00 0.00 ? 45 PRO A HD2  9  
ATOM 11403 H HD3  . PRO A 1 45 ? -4.677  -13.097 -4.485  1.00 0.00 ? 45 PRO A HD3  9  
ATOM 11404 N N    . GLY A 1 46 ? -0.646  -12.185 -1.065  1.00 0.00 ? 46 GLY A N    9  
ATOM 11405 C CA   . GLY A 1 46 ? 0.553   -11.440 -0.729  1.00 0.00 ? 46 GLY A CA   9  
ATOM 11406 C C    . GLY A 1 46 ? 0.286   -10.327 0.265   1.00 0.00 ? 46 GLY A C    9  
ATOM 11407 O O    . GLY A 1 46 ? -0.867  -9.975  0.516   1.00 0.00 ? 46 GLY A O    9  
ATOM 11408 H H    . GLY A 1 46 ? -0.756  -13.103 -0.743  1.00 0.00 ? 46 GLY A H    9  
ATOM 11409 H HA2  . GLY A 1 46 ? 1.278   -12.120 -0.306  1.00 0.00 ? 46 GLY A HA2  9  
ATOM 11410 H HA3  . GLY A 1 46 ? 0.961   -11.010 -1.632  1.00 0.00 ? 46 GLY A HA3  9  
ATOM 11411 N N    . GLN A 1 47 ? 1.353   -9.773  0.832   1.00 0.00 ? 47 GLN A N    9  
ATOM 11412 C CA   . GLN A 1 47 ? 1.228   -8.694  1.804   1.00 0.00 ? 47 GLN A CA   9  
ATOM 11413 C C    . GLN A 1 47 ? 0.722   -7.418  1.139   1.00 0.00 ? 47 GLN A C    9  
ATOM 11414 O O    . GLN A 1 47 ? 0.931   -7.203  -0.055  1.00 0.00 ? 47 GLN A O    9  
ATOM 11415 C CB   . GLN A 1 47 ? 2.575   -8.431  2.480   1.00 0.00 ? 47 GLN A CB   9  
ATOM 11416 C CG   . GLN A 1 47 ? 3.074   -9.597  3.316   1.00 0.00 ? 47 GLN A CG   9  
ATOM 11417 C CD   . GLN A 1 47 ? 2.292   -9.768  4.604   1.00 0.00 ? 47 GLN A CD   9  
ATOM 11418 O OE1  . GLN A 1 47 ? 1.111   -9.427  4.676   1.00 0.00 ? 47 GLN A OE1  9  
ATOM 11419 N NE2  . GLN A 1 47 ? 2.948   -10.299 5.629   1.00 0.00 ? 47 GLN A NE2  9  
ATOM 11420 H H    . GLN A 1 47 ? 2.245   -10.098 0.590   1.00 0.00 ? 47 GLN A H    9  
ATOM 11421 H HA   . GLN A 1 47 ? 0.514   -9.003  2.553   1.00 0.00 ? 47 GLN A HA   9  
ATOM 11422 H HB2  . GLN A 1 47 ? 3.311   -8.220  1.719   1.00 0.00 ? 47 GLN A HB2  9  
ATOM 11423 H HB3  . GLN A 1 47 ? 2.479   -7.569  3.124   1.00 0.00 ? 47 GLN A HB3  9  
ATOM 11424 H HG2  . GLN A 1 47 ? 2.986   -10.503 2.737   1.00 0.00 ? 47 GLN A HG2  9  
ATOM 11425 H HG3  . GLN A 1 47 ? 4.112   -9.429  3.563   1.00 0.00 ? 47 GLN A HG3  9  
ATOM 11426 H HE21 . GLN A 1 47 ? 3.887   -10.547 5.499   1.00 0.00 ? 47 GLN A HE21 9  
ATOM 11427 H HE22 . GLN A 1 47 ? 2.466   -10.421 6.474   1.00 0.00 ? 47 GLN A HE22 9  
ATOM 11428 N N    . TRP A 1 48 ? 0.054   -6.574  1.919   1.00 0.00 ? 48 TRP A N    9  
ATOM 11429 C CA   . TRP A 1 48 ? -0.482  -5.320  1.406   1.00 0.00 ? 48 TRP A CA   9  
ATOM 11430 C C    . TRP A 1 48 ? -0.344  -4.206  2.439   1.00 0.00 ? 48 TRP A C    9  
ATOM 11431 O O    . TRP A 1 48 ? -0.002  -4.455  3.594   1.00 0.00 ? 48 TRP A O    9  
ATOM 11432 C CB   . TRP A 1 48 ? -1.952  -5.491  1.017   1.00 0.00 ? 48 TRP A CB   9  
ATOM 11433 C CG   . TRP A 1 48 ? -2.140  -6.166  -0.308  1.00 0.00 ? 48 TRP A CG   9  
ATOM 11434 C CD1  . TRP A 1 48 ? -2.293  -7.503  -0.532  1.00 0.00 ? 48 TRP A CD1  9  
ATOM 11435 C CD2  . TRP A 1 48 ? -2.194  -5.535  -1.593  1.00 0.00 ? 48 TRP A CD2  9  
ATOM 11436 N NE1  . TRP A 1 48 ? -2.438  -7.743  -1.877  1.00 0.00 ? 48 TRP A NE1  9  
ATOM 11437 C CE2  . TRP A 1 48 ? -2.381  -6.550  -2.549  1.00 0.00 ? 48 TRP A CE2  9  
ATOM 11438 C CE3  . TRP A 1 48 ? -2.102  -4.209  -2.028  1.00 0.00 ? 48 TRP A CE3  9  
ATOM 11439 C CZ2  . TRP A 1 48 ? -2.478  -6.281  -3.912  1.00 0.00 ? 48 TRP A CZ2  9  
ATOM 11440 C CZ3  . TRP A 1 48 ? -2.199  -3.944  -3.380  1.00 0.00 ? 48 TRP A CZ3  9  
ATOM 11441 C CH2  . TRP A 1 48 ? -2.386  -4.975  -4.309  1.00 0.00 ? 48 TRP A CH2  9  
ATOM 11442 H H    . TRP A 1 48 ? -0.081  -6.802  2.863   1.00 0.00 ? 48 TRP A H    9  
ATOM 11443 H HA   . TRP A 1 48 ? 0.085   -5.052  0.527   1.00 0.00 ? 48 TRP A HA   9  
ATOM 11444 H HB2  . TRP A 1 48 ? -2.449  -6.087  1.767   1.00 0.00 ? 48 TRP A HB2  9  
ATOM 11445 H HB3  . TRP A 1 48 ? -2.419  -4.519  0.965   1.00 0.00 ? 48 TRP A HB3  9  
ATOM 11446 H HD1  . TRP A 1 48 ? -2.295  -8.252  0.246   1.00 0.00 ? 48 TRP A HD1  9  
ATOM 11447 H HE1  . TRP A 1 48 ? -2.563  -8.624  -2.287  1.00 0.00 ? 48 TRP A HE1  9  
ATOM 11448 H HE3  . TRP A 1 48 ? -1.958  -3.400  -1.326  1.00 0.00 ? 48 TRP A HE3  9  
ATOM 11449 H HZ2  . TRP A 1 48 ? -2.623  -7.065  -4.640  1.00 0.00 ? 48 TRP A HZ2  9  
ATOM 11450 H HZ3  . TRP A 1 48 ? -2.131  -2.925  -3.735  1.00 0.00 ? 48 TRP A HZ3  9  
ATOM 11451 H HH2  . TRP A 1 48 ? -2.456  -4.721  -5.356  1.00 0.00 ? 48 TRP A HH2  9  
ATOM 11452 N N    . ALA A 1 49 ? -0.614  -2.975  2.013   1.00 0.00 ? 49 ALA A N    9  
ATOM 11453 C CA   . ALA A 1 49 ? -0.520  -1.823  2.901   1.00 0.00 ? 49 ALA A CA   9  
ATOM 11454 C C    . ALA A 1 49 ? -1.402  -0.680  2.411   1.00 0.00 ? 49 ALA A C    9  
ATOM 11455 O O    . ALA A 1 49 ? -1.155  -0.102  1.353   1.00 0.00 ? 49 ALA A O    9  
ATOM 11456 C CB   . ALA A 1 49 ? 0.926   -1.364  3.018   1.00 0.00 ? 49 ALA A CB   9  
ATOM 11457 H H    . ALA A 1 49 ? -0.882  -2.839  1.080   1.00 0.00 ? 49 ALA A H    9  
ATOM 11458 H HA   . ALA A 1 49 ? -0.856  -2.128  3.881   1.00 0.00 ? 49 ALA A HA   9  
ATOM 11459 H HB1  . ALA A 1 49 ? 1.459   -1.623  2.115   1.00 0.00 ? 49 ALA A HB1  9  
ATOM 11460 H HB2  . ALA A 1 49 ? 1.390   -1.849  3.864   1.00 0.00 ? 49 ALA A HB2  9  
ATOM 11461 H HB3  . ALA A 1 49 ? 0.953   -0.293  3.157   1.00 0.00 ? 49 ALA A HB3  9  
ATOM 11462 N N    . GLY A 1 50 ? -2.433  -0.359  3.187   1.00 0.00 ? 50 GLY A N    9  
ATOM 11463 C CA   . GLY A 1 50 ? -3.336  0.714   2.815   1.00 0.00 ? 50 GLY A CA   9  
ATOM 11464 C C    . GLY A 1 50 ? -2.749  2.086   3.084   1.00 0.00 ? 50 GLY A C    9  
ATOM 11465 O O    . GLY A 1 50 ? -2.541  2.464   4.237   1.00 0.00 ? 50 GLY A O    9  
ATOM 11466 H H    . GLY A 1 50 ? -2.580  -0.855  4.019   1.00 0.00 ? 50 GLY A H    9  
ATOM 11467 H HA2  . GLY A 1 50 ? -3.561  0.630   1.762   1.00 0.00 ? 50 GLY A HA2  9  
ATOM 11468 H HA3  . GLY A 1 50 ? -4.251  0.610   3.377   1.00 0.00 ? 50 GLY A HA3  9  
ATOM 11469 N N    . VAL A 1 51 ? -2.480  2.832   2.017   1.00 0.00 ? 51 VAL A N    9  
ATOM 11470 C CA   . VAL A 1 51 ? -1.914  4.169   2.143   1.00 0.00 ? 51 VAL A CA   9  
ATOM 11471 C C    . VAL A 1 51 ? -2.919  5.234   1.717   1.00 0.00 ? 51 VAL A C    9  
ATOM 11472 O O    . VAL A 1 51 ? -3.522  5.141   0.648   1.00 0.00 ? 51 VAL A O    9  
ATOM 11473 C CB   . VAL A 1 51 ? -0.636  4.321   1.297   1.00 0.00 ? 51 VAL A CB   9  
ATOM 11474 C CG1  . VAL A 1 51 ? 0.049   5.645   1.595   1.00 0.00 ? 51 VAL A CG1  9  
ATOM 11475 C CG2  . VAL A 1 51 ? 0.310   3.156   1.545   1.00 0.00 ? 51 VAL A CG2  9  
ATOM 11476 H H    . VAL A 1 51 ? -2.668  2.474   1.124   1.00 0.00 ? 51 VAL A H    9  
ATOM 11477 H HA   . VAL A 1 51 ? -1.655  4.326   3.180   1.00 0.00 ? 51 VAL A HA   9  
ATOM 11478 H HB   . VAL A 1 51 ? -0.916  4.313   0.254   1.00 0.00 ? 51 VAL A HB   9  
ATOM 11479 H HG11 . VAL A 1 51 ? 0.710   5.900   0.780   1.00 0.00 ? 51 VAL A HG11 9  
ATOM 11480 H HG12 . VAL A 1 51 ? 0.619   5.559   2.508   1.00 0.00 ? 51 VAL A HG12 9  
ATOM 11481 H HG13 . VAL A 1 51 ? -0.697  6.419   1.708   1.00 0.00 ? 51 VAL A HG13 9  
ATOM 11482 H HG21 . VAL A 1 51 ? -0.242  2.228   1.501   1.00 0.00 ? 51 VAL A HG21 9  
ATOM 11483 H HG22 . VAL A 1 51 ? 0.761   3.260   2.521   1.00 0.00 ? 51 VAL A HG22 9  
ATOM 11484 H HG23 . VAL A 1 51 ? 1.082   3.151   0.790   1.00 0.00 ? 51 VAL A HG23 9  
ATOM 11485 N N    . VAL A 1 52 ? -3.094  6.247   2.561   1.00 0.00 ? 52 VAL A N    9  
ATOM 11486 C CA   . VAL A 1 52 ? -4.026  7.330   2.272   1.00 0.00 ? 52 VAL A CA   9  
ATOM 11487 C C    . VAL A 1 52 ? -3.302  8.532   1.675   1.00 0.00 ? 52 VAL A C    9  
ATOM 11488 O O    . VAL A 1 52 ? -2.526  9.202   2.356   1.00 0.00 ? 52 VAL A O    9  
ATOM 11489 C CB   . VAL A 1 52 ? -4.781  7.775   3.539   1.00 0.00 ? 52 VAL A CB   9  
ATOM 11490 C CG1  . VAL A 1 52 ? -5.866  8.782   3.190   1.00 0.00 ? 52 VAL A CG1  9  
ATOM 11491 C CG2  . VAL A 1 52 ? -5.372  6.574   4.260   1.00 0.00 ? 52 VAL A CG2  9  
ATOM 11492 H H    . VAL A 1 52 ? -2.584  6.266   3.397   1.00 0.00 ? 52 VAL A H    9  
ATOM 11493 H HA   . VAL A 1 52 ? -4.750  6.966   1.557   1.00 0.00 ? 52 VAL A HA   9  
ATOM 11494 H HB   . VAL A 1 52 ? -4.077  8.256   4.202   1.00 0.00 ? 52 VAL A HB   9  
ATOM 11495 H HG11 . VAL A 1 52 ? -6.334  9.137   4.097   1.00 0.00 ? 52 VAL A HG11 9  
ATOM 11496 H HG12 . VAL A 1 52 ? -6.608  8.310   2.564   1.00 0.00 ? 52 VAL A HG12 9  
ATOM 11497 H HG13 . VAL A 1 52 ? -5.427  9.616   2.661   1.00 0.00 ? 52 VAL A HG13 9  
ATOM 11498 H HG21 . VAL A 1 52 ? -5.556  6.829   5.293   1.00 0.00 ? 52 VAL A HG21 9  
ATOM 11499 H HG22 . VAL A 1 52 ? -4.678  5.747   4.211   1.00 0.00 ? 52 VAL A HG22 9  
ATOM 11500 H HG23 . VAL A 1 52 ? -6.300  6.291   3.788   1.00 0.00 ? 52 VAL A HG23 9  
ATOM 11501 N N    . LEU A 1 53 ? -3.562  8.800   0.400   1.00 0.00 ? 53 LEU A N    9  
ATOM 11502 C CA   . LEU A 1 53 ? -2.935  9.923   -0.288  1.00 0.00 ? 53 LEU A CA   9  
ATOM 11503 C C    . LEU A 1 53 ? -3.459  11.251  0.249   1.00 0.00 ? 53 LEU A C    9  
ATOM 11504 O O    . LEU A 1 53 ? -4.624  11.362  0.629   1.00 0.00 ? 53 LEU A O    9  
ATOM 11505 C CB   . LEU A 1 53 ? -3.189  9.832   -1.794  1.00 0.00 ? 53 LEU A CB   9  
ATOM 11506 C CG   . LEU A 1 53 ? -2.316  8.821   -2.538  1.00 0.00 ? 53 LEU A CG   9  
ATOM 11507 C CD1  . LEU A 1 53 ? -2.862  8.571   -3.936  1.00 0.00 ? 53 LEU A CD1  9  
ATOM 11508 C CD2  . LEU A 1 53 ? -0.877  9.308   -2.606  1.00 0.00 ? 53 LEU A CD2  9  
ATOM 11509 H H    . LEU A 1 53 ? -4.191  8.229   -0.090  1.00 0.00 ? 53 LEU A H    9  
ATOM 11510 H HA   . LEU A 1 53 ? -1.871  9.869   -0.108  1.00 0.00 ? 53 LEU A HA   9  
ATOM 11511 H HB2  . LEU A 1 53 ? -4.225  9.564   -1.948  1.00 0.00 ? 53 LEU A HB2  9  
ATOM 11512 H HB3  . LEU A 1 53 ? -3.019  10.806  -2.226  1.00 0.00 ? 53 LEU A HB3  9  
ATOM 11513 H HG   . LEU A 1 53 ? -2.328  7.882   -2.003  1.00 0.00 ? 53 LEU A HG   9  
ATOM 11514 H HD11 . LEU A 1 53 ? -2.043  8.387   -4.615  1.00 0.00 ? 53 LEU A HD11 9  
ATOM 11515 H HD12 . LEU A 1 53 ? -3.416  9.438   -4.266  1.00 0.00 ? 53 LEU A HD12 9  
ATOM 11516 H HD13 . LEU A 1 53 ? -3.515  7.711   -3.919  1.00 0.00 ? 53 LEU A HD13 9  
ATOM 11517 H HD21 . LEU A 1 53 ? -0.238  8.502   -2.935  1.00 0.00 ? 53 LEU A HD21 9  
ATOM 11518 H HD22 . LEU A 1 53 ? -0.563  9.640   -1.626  1.00 0.00 ? 53 LEU A HD22 9  
ATOM 11519 H HD23 . LEU A 1 53 ? -0.808  10.130  -3.303  1.00 0.00 ? 53 LEU A HD23 9  
ATOM 11520 N N    . ASP A 1 54 ? -2.589  12.256  0.276   1.00 0.00 ? 54 ASP A N    9  
ATOM 11521 C CA   . ASP A 1 54 ? -2.964  13.577  0.766   1.00 0.00 ? 54 ASP A CA   9  
ATOM 11522 C C    . ASP A 1 54 ? -4.034  14.204  -0.123  1.00 0.00 ? 54 ASP A C    9  
ATOM 11523 O O    . ASP A 1 54 ? -4.885  14.958  0.350   1.00 0.00 ? 54 ASP A O    9  
ATOM 11524 C CB   . ASP A 1 54 ? -1.737  14.488  0.826   1.00 0.00 ? 54 ASP A CB   9  
ATOM 11525 C CG   . ASP A 1 54 ? -1.003  14.382  2.148   1.00 0.00 ? 54 ASP A CG   9  
ATOM 11526 O OD1  . ASP A 1 54 ? -1.657  14.079  3.168   1.00 0.00 ? 54 ASP A OD1  9  
ATOM 11527 O OD2  . ASP A 1 54 ? 0.226   14.603  2.164   1.00 0.00 ? 54 ASP A OD2  9  
ATOM 11528 H H    . ASP A 1 54 ? -1.675  12.106  -0.042  1.00 0.00 ? 54 ASP A H    9  
ATOM 11529 H HA   . ASP A 1 54 ? -3.364  13.461  1.762   1.00 0.00 ? 54 ASP A HA   9  
ATOM 11530 H HB2  . ASP A 1 54 ? -1.055  14.217  0.035   1.00 0.00 ? 54 ASP A HB2  9  
ATOM 11531 H HB3  . ASP A 1 54 ? -2.050  15.514  0.691   1.00 0.00 ? 54 ASP A HB3  9  
ATOM 11532 N N    . ASP A 1 55 ? -3.984  13.887  -1.412  1.00 0.00 ? 55 ASP A N    9  
ATOM 11533 C CA   . ASP A 1 55 ? -4.949  14.419  -2.368  1.00 0.00 ? 55 ASP A CA   9  
ATOM 11534 C C    . ASP A 1 55 ? -5.743  13.292  -3.025  1.00 0.00 ? 55 ASP A C    9  
ATOM 11535 O O    . ASP A 1 55 ? -5.281  12.153  -3.090  1.00 0.00 ? 55 ASP A O    9  
ATOM 11536 C CB   . ASP A 1 55 ? -4.234  15.244  -3.440  1.00 0.00 ? 55 ASP A CB   9  
ATOM 11537 C CG   . ASP A 1 55 ? -3.632  16.519  -2.883  1.00 0.00 ? 55 ASP A CG   9  
ATOM 11538 O OD1  . ASP A 1 55 ? -2.526  16.451  -2.306  1.00 0.00 ? 55 ASP A OD1  9  
ATOM 11539 O OD2  . ASP A 1 55 ? -4.267  17.586  -3.023  1.00 0.00 ? 55 ASP A OD2  9  
ATOM 11540 H H    . ASP A 1 55 ? -3.282  13.281  -1.729  1.00 0.00 ? 55 ASP A H    9  
ATOM 11541 H HA   . ASP A 1 55 ? -5.632  15.059  -1.830  1.00 0.00 ? 55 ASP A HA   9  
ATOM 11542 H HB2  . ASP A 1 55 ? -3.441  14.654  -3.872  1.00 0.00 ? 55 ASP A HB2  9  
ATOM 11543 H HB3  . ASP A 1 55 ? -4.941  15.509  -4.212  1.00 0.00 ? 55 ASP A HB3  9  
ATOM 11544 N N    . PRO A 1 56 ? -6.954  13.597  -3.523  1.00 0.00 ? 56 PRO A N    9  
ATOM 11545 C CA   . PRO A 1 56 ? -7.810  12.603  -4.177  1.00 0.00 ? 56 PRO A CA   9  
ATOM 11546 C C    . PRO A 1 56 ? -7.253  12.163  -5.526  1.00 0.00 ? 56 PRO A C    9  
ATOM 11547 O O    . PRO A 1 56 ? -7.698  12.628  -6.576  1.00 0.00 ? 56 PRO A O    9  
ATOM 11548 C CB   . PRO A 1 56 ? -9.137  13.343  -4.361  1.00 0.00 ? 56 PRO A CB   9  
ATOM 11549 C CG   . PRO A 1 56 ? -8.765  14.785  -4.403  1.00 0.00 ? 56 PRO A CG   9  
ATOM 11550 C CD   . PRO A 1 56 ? -7.580  14.933  -3.490  1.00 0.00 ? 56 PRO A CD   9  
ATOM 11551 H HA   . PRO A 1 56 ? -7.960  11.737  -3.551  1.00 0.00 ? 56 PRO A HA   9  
ATOM 11552 H HB2  . PRO A 1 56 ? -9.603  13.027  -5.284  1.00 0.00 ? 56 PRO A HB2  9  
ATOM 11553 H HB3  . PRO A 1 56 ? -9.790  13.128  -3.529  1.00 0.00 ? 56 PRO A HB3  9  
ATOM 11554 H HG2  . PRO A 1 56 ? -8.500  15.066  -5.411  1.00 0.00 ? 56 PRO A HG2  9  
ATOM 11555 H HG3  . PRO A 1 56 ? -9.588  15.387  -4.048  1.00 0.00 ? 56 PRO A HG3  9  
ATOM 11556 H HD2  . PRO A 1 56 ? -6.904  15.685  -3.869  1.00 0.00 ? 56 PRO A HD2  9  
ATOM 11557 H HD3  . PRO A 1 56 ? -7.903  15.182  -2.489  1.00 0.00 ? 56 PRO A HD3  9  
ATOM 11558 N N    . VAL A 1 57 ? -6.274  11.265  -5.490  1.00 0.00 ? 57 VAL A N    9  
ATOM 11559 C CA   . VAL A 1 57 ? -5.653  10.763  -6.710  1.00 0.00 ? 57 VAL A CA   9  
ATOM 11560 C C    . VAL A 1 57 ? -5.140  9.339   -6.520  1.00 0.00 ? 57 VAL A C    9  
ATOM 11561 O O    . VAL A 1 57 ? -4.138  8.945   -7.116  1.00 0.00 ? 57 VAL A O    9  
ATOM 11562 C CB   . VAL A 1 57 ? -4.485  11.662  -7.155  1.00 0.00 ? 57 VAL A CB   9  
ATOM 11563 C CG1  . VAL A 1 57 ? -5.008  12.958  -7.755  1.00 0.00 ? 57 VAL A CG1  9  
ATOM 11564 C CG2  . VAL A 1 57 ? -3.554  11.946  -5.986  1.00 0.00 ? 57 VAL A CG2  9  
ATOM 11565 H H    . VAL A 1 57 ? -5.961  10.933  -4.623  1.00 0.00 ? 57 VAL A H    9  
ATOM 11566 H HA   . VAL A 1 57 ? -6.400  10.765  -7.490  1.00 0.00 ? 57 VAL A HA   9  
ATOM 11567 H HB   . VAL A 1 57 ? -3.924  11.140  -7.916  1.00 0.00 ? 57 VAL A HB   9  
ATOM 11568 H HG11 . VAL A 1 57 ? -6.029  12.820  -8.076  1.00 0.00 ? 57 VAL A HG11 9  
ATOM 11569 H HG12 . VAL A 1 57 ? -4.398  13.234  -8.603  1.00 0.00 ? 57 VAL A HG12 9  
ATOM 11570 H HG13 . VAL A 1 57 ? -4.966  13.742  -7.013  1.00 0.00 ? 57 VAL A HG13 9  
ATOM 11571 H HG21 . VAL A 1 57 ? -2.530  11.934  -6.330  1.00 0.00 ? 57 VAL A HG21 9  
ATOM 11572 H HG22 . VAL A 1 57 ? -3.687  11.187  -5.228  1.00 0.00 ? 57 VAL A HG22 9  
ATOM 11573 H HG23 . VAL A 1 57 ? -3.783  12.915  -5.570  1.00 0.00 ? 57 VAL A HG23 9  
ATOM 11574 N N    . GLY A 1 58 ? -5.834  8.573   -5.686  1.00 0.00 ? 58 GLY A N    9  
ATOM 11575 C CA   . GLY A 1 58 ? -5.435  7.201   -5.432  1.00 0.00 ? 58 GLY A CA   9  
ATOM 11576 C C    . GLY A 1 58 ? -6.227  6.204   -6.254  1.00 0.00 ? 58 GLY A C    9  
ATOM 11577 O O    . GLY A 1 58 ? -6.288  6.308   -7.479  1.00 0.00 ? 58 GLY A O    9  
ATOM 11578 H H    . GLY A 1 58 ? -6.625  8.940   -5.239  1.00 0.00 ? 58 GLY A H    9  
ATOM 11579 H HA2  . GLY A 1 58 ? -4.386  7.093   -5.669  1.00 0.00 ? 58 GLY A HA2  9  
ATOM 11580 H HA3  . GLY A 1 58 ? -5.580  6.982   -4.385  1.00 0.00 ? 58 GLY A HA3  9  
ATOM 11581 N N    . LYS A 1 59 ? -6.836  5.235   -5.579  1.00 0.00 ? 59 LYS A N    9  
ATOM 11582 C CA   . LYS A 1 59 ? -7.629  4.214   -6.254  1.00 0.00 ? 59 LYS A CA   9  
ATOM 11583 C C    . LYS A 1 59 ? -8.879  3.874   -5.451  1.00 0.00 ? 59 LYS A C    9  
ATOM 11584 O O    . LYS A 1 59 ? -9.999  4.168   -5.872  1.00 0.00 ? 59 LYS A O    9  
ATOM 11585 C CB   . LYS A 1 59 ? -6.792  2.953   -6.476  1.00 0.00 ? 59 LYS A CB   9  
ATOM 11586 C CG   . LYS A 1 59 ? -5.548  3.187   -7.317  1.00 0.00 ? 59 LYS A CG   9  
ATOM 11587 C CD   . LYS A 1 59 ? -5.281  2.021   -8.256  1.00 0.00 ? 59 LYS A CD   9  
ATOM 11588 C CE   . LYS A 1 59 ? -4.114  2.309   -9.187  1.00 0.00 ? 59 LYS A CE   9  
ATOM 11589 N NZ   . LYS A 1 59 ? -4.422  1.940   -10.596 1.00 0.00 ? 59 LYS A NZ   9  
ATOM 11590 H H    . LYS A 1 59 ? -6.750  5.205   -4.604  1.00 0.00 ? 59 LYS A H    9  
ATOM 11591 H HA   . LYS A 1 59 ? -7.928  4.609   -7.214  1.00 0.00 ? 59 LYS A HA   9  
ATOM 11592 H HB2  . LYS A 1 59 ? -6.485  2.565   -5.516  1.00 0.00 ? 59 LYS A HB2  9  
ATOM 11593 H HB3  . LYS A 1 59 ? -7.403  2.212   -6.973  1.00 0.00 ? 59 LYS A HB3  9  
ATOM 11594 H HG2  . LYS A 1 59 ? -5.685  4.084   -7.902  1.00 0.00 ? 59 LYS A HG2  9  
ATOM 11595 H HG3  . LYS A 1 59 ? -4.700  3.308   -6.659  1.00 0.00 ? 59 LYS A HG3  9  
ATOM 11596 H HD2  . LYS A 1 59 ? -5.053  1.144   -7.670  1.00 0.00 ? 59 LYS A HD2  9  
ATOM 11597 H HD3  . LYS A 1 59 ? -6.166  1.841   -8.849  1.00 0.00 ? 59 LYS A HD3  9  
ATOM 11598 H HE2  . LYS A 1 59 ? -3.885  3.365   -9.143  1.00 0.00 ? 59 LYS A HE2  9  
ATOM 11599 H HE3  . LYS A 1 59 ? -3.257  1.742   -8.854  1.00 0.00 ? 59 LYS A HE3  9  
ATOM 11600 H HZ1  . LYS A 1 59 ? -4.939  2.712   -11.063 1.00 0.00 ? 59 LYS A HZ1  9  
ATOM 11601 H HZ2  . LYS A 1 59 ? -5.008  1.081   -10.620 1.00 0.00 ? 59 LYS A HZ2  9  
ATOM 11602 H HZ3  . LYS A 1 59 ? -3.541  1.759   -11.119 1.00 0.00 ? 59 LYS A HZ3  9  
ATOM 11603 N N    . ASN A 1 60 ? -8.682  3.254   -4.293  1.00 0.00 ? 60 ASN A N    9  
ATOM 11604 C CA   . ASN A 1 60 ? -9.794  2.872   -3.430  1.00 0.00 ? 60 ASN A CA   9  
ATOM 11605 C C    . ASN A 1 60 ? -10.042 3.930   -2.360  1.00 0.00 ? 60 ASN A C    9  
ATOM 11606 O O    . ASN A 1 60 ? -9.351  4.948   -2.306  1.00 0.00 ? 60 ASN A O    9  
ATOM 11607 C CB   . ASN A 1 60 ? -9.516  1.520   -2.771  1.00 0.00 ? 60 ASN A CB   9  
ATOM 11608 C CG   . ASN A 1 60 ? -9.038  0.480   -3.764  1.00 0.00 ? 60 ASN A CG   9  
ATOM 11609 O OD1  . ASN A 1 60 ? -9.528  0.410   -4.892  1.00 0.00 ? 60 ASN A OD1  9  
ATOM 11610 N ND2  . ASN A 1 60 ? -8.077  -0.337  -3.348  1.00 0.00 ? 60 ASN A ND2  9  
ATOM 11611 H H    . ASN A 1 60 ? -7.766  3.045   -4.012  1.00 0.00 ? 60 ASN A H    9  
ATOM 11612 H HA   . ASN A 1 60 ? -10.677 2.787   -4.046  1.00 0.00 ? 60 ASN A HA   9  
ATOM 11613 H HB2  . ASN A 1 60 ? -8.755  1.646   -2.015  1.00 0.00 ? 60 ASN A HB2  9  
ATOM 11614 H HB3  . ASN A 1 60 ? -10.423 1.160   -2.308  1.00 0.00 ? 60 ASN A HB3  9  
ATOM 11615 H HD21 . ASN A 1 60 ? -7.734  -0.223  -2.438  1.00 0.00 ? 60 ASN A HD21 9  
ATOM 11616 H HD22 . ASN A 1 60 ? -7.748  -1.019  -3.971  1.00 0.00 ? 60 ASN A HD22 9  
ATOM 11617 N N    . ASP A 1 61 ? -11.031 3.681   -1.508  1.00 0.00 ? 61 ASP A N    9  
ATOM 11618 C CA   . ASP A 1 61 ? -11.371 4.610   -0.436  1.00 0.00 ? 61 ASP A CA   9  
ATOM 11619 C C    . ASP A 1 61 ? -11.274 3.927   0.924   1.00 0.00 ? 61 ASP A C    9  
ATOM 11620 O O    . ASP A 1 61 ? -12.069 4.198   1.825   1.00 0.00 ? 61 ASP A O    9  
ATOM 11621 C CB   . ASP A 1 61 ? -12.782 5.164   -0.643  1.00 0.00 ? 61 ASP A CB   9  
ATOM 11622 C CG   . ASP A 1 61 ? -13.840 4.079   -0.613  1.00 0.00 ? 61 ASP A CG   9  
ATOM 11623 O OD1  . ASP A 1 61 ? -13.716 3.107   -1.387  1.00 0.00 ? 61 ASP A OD1  9  
ATOM 11624 O OD2  . ASP A 1 61 ? -14.794 4.201   0.185   1.00 0.00 ? 61 ASP A OD2  9  
ATOM 11625 H H    . ASP A 1 61 ? -11.545 2.852   -1.601  1.00 0.00 ? 61 ASP A H    9  
ATOM 11626 H HA   . ASP A 1 61 ? -10.665 5.426   -0.467  1.00 0.00 ? 61 ASP A HA   9  
ATOM 11627 H HB2  . ASP A 1 61 ? -13.001 5.876   0.140   1.00 0.00 ? 61 ASP A HB2  9  
ATOM 11628 H HB3  . ASP A 1 61 ? -12.830 5.662   -1.600  1.00 0.00 ? 61 ASP A HB3  9  
ATOM 11629 N N    . GLY A 1 62 ? -10.295 3.039   1.066   1.00 0.00 ? 62 GLY A N    9  
ATOM 11630 C CA   . GLY A 1 62 ? -10.112 2.329   2.317   1.00 0.00 ? 62 GLY A CA   9  
ATOM 11631 C C    . GLY A 1 62 ? -11.062 1.156   2.466   1.00 0.00 ? 62 GLY A C    9  
ATOM 11632 O O    . GLY A 1 62 ? -11.325 0.701   3.580   1.00 0.00 ? 62 GLY A O    9  
ATOM 11633 H H    . GLY A 1 62 ? -9.694  2.864   0.312   1.00 0.00 ? 62 GLY A H    9  
ATOM 11634 H HA2  . GLY A 1 62 ? -9.097  1.964   2.366   1.00 0.00 ? 62 GLY A HA2  9  
ATOM 11635 H HA3  . GLY A 1 62 ? -10.276 3.016   3.135   1.00 0.00 ? 62 GLY A HA3  9  
ATOM 11636 N N    . ALA A 1 63 ? -11.578 0.665   1.344   1.00 0.00 ? 63 ALA A N    9  
ATOM 11637 C CA   . ALA A 1 63 ? -12.502 -0.463  1.358   1.00 0.00 ? 63 ALA A CA   9  
ATOM 11638 C C    . ALA A 1 63 ? -12.565 -1.139  -0.008  1.00 0.00 ? 63 ALA A C    9  
ATOM 11639 O O    . ALA A 1 63 ? -12.969 -0.527  -0.996  1.00 0.00 ? 63 ALA A O    9  
ATOM 11640 C CB   . ALA A 1 63 ? -13.889 -0.003  1.784   1.00 0.00 ? 63 ALA A CB   9  
ATOM 11641 H H    . ALA A 1 63 ? -11.330 1.068   0.486   1.00 0.00 ? 63 ALA A H    9  
ATOM 11642 H HA   . ALA A 1 63 ? -12.147 -1.177  2.087   1.00 0.00 ? 63 ALA A HA   9  
ATOM 11643 H HB1  . ALA A 1 63 ? -13.818 0.534   2.719   1.00 0.00 ? 63 ALA A HB1  9  
ATOM 11644 H HB2  . ALA A 1 63 ? -14.531 -0.861  1.909   1.00 0.00 ? 63 ALA A HB2  9  
ATOM 11645 H HB3  . ALA A 1 63 ? -14.300 0.648   1.026   1.00 0.00 ? 63 ALA A HB3  9  
ATOM 11646 N N    . VAL A 1 64 ? -12.162 -2.404  -0.054  1.00 0.00 ? 64 VAL A N    9  
ATOM 11647 C CA   . VAL A 1 64 ? -12.173 -3.164  -1.300  1.00 0.00 ? 64 VAL A CA   9  
ATOM 11648 C C    . VAL A 1 64 ? -13.122 -4.353  -1.209  1.00 0.00 ? 64 VAL A C    9  
ATOM 11649 O O    . VAL A 1 64 ? -12.856 -5.321  -0.498  1.00 0.00 ? 64 VAL A O    9  
ATOM 11650 C CB   . VAL A 1 64 ? -10.765 -3.673  -1.659  1.00 0.00 ? 64 VAL A CB   9  
ATOM 11651 C CG1  . VAL A 1 64 ? -10.756 -4.284  -3.052  1.00 0.00 ? 64 VAL A CG1  9  
ATOM 11652 C CG2  . VAL A 1 64 ? -9.747  -2.546  -1.557  1.00 0.00 ? 64 VAL A CG2  9  
ATOM 11653 H H    . VAL A 1 64 ? -11.851 -2.839  0.767   1.00 0.00 ? 64 VAL A H    9  
ATOM 11654 H HA   . VAL A 1 64 ? -12.508 -2.506  -2.089  1.00 0.00 ? 64 VAL A HA   9  
ATOM 11655 H HB   . VAL A 1 64 ? -10.491 -4.443  -0.952  1.00 0.00 ? 64 VAL A HB   9  
ATOM 11656 H HG11 . VAL A 1 64 ? -9.808  -4.082  -3.529  1.00 0.00 ? 64 VAL A HG11 9  
ATOM 11657 H HG12 . VAL A 1 64 ? -11.554 -3.851  -3.639  1.00 0.00 ? 64 VAL A HG12 9  
ATOM 11658 H HG13 . VAL A 1 64 ? -10.902 -5.351  -2.978  1.00 0.00 ? 64 VAL A HG13 9  
ATOM 11659 H HG21 . VAL A 1 64 ? -9.283  -2.568  -0.582  1.00 0.00 ? 64 VAL A HG21 9  
ATOM 11660 H HG22 . VAL A 1 64 ? -10.245 -1.599  -1.699  1.00 0.00 ? 64 VAL A HG22 9  
ATOM 11661 H HG23 . VAL A 1 64 ? -8.991  -2.674  -2.318  1.00 0.00 ? 64 VAL A HG23 9  
ATOM 11662 N N    . GLY A 1 65 ? -14.233 -4.273  -1.937  1.00 0.00 ? 65 GLY A N    9  
ATOM 11663 C CA   . GLY A 1 65 ? -15.205 -5.350  -1.924  1.00 0.00 ? 65 GLY A CA   9  
ATOM 11664 C C    . GLY A 1 65 ? -16.138 -5.277  -0.731  1.00 0.00 ? 65 GLY A C    9  
ATOM 11665 O O    . GLY A 1 65 ? -16.905 -4.324  -0.591  1.00 0.00 ? 65 GLY A O    9  
ATOM 11666 H H    . GLY A 1 65 ? -14.393 -3.477  -2.484  1.00 0.00 ? 65 GLY A H    9  
ATOM 11667 H HA2  . GLY A 1 65 ? -15.793 -5.299  -2.830  1.00 0.00 ? 65 GLY A HA2  9  
ATOM 11668 H HA3  . GLY A 1 65 ? -14.681 -6.294  -1.900  1.00 0.00 ? 65 GLY A HA3  9  
ATOM 11669 N N    . GLY A 1 66 ? -16.072 -6.286  0.132   1.00 0.00 ? 66 GLY A N    9  
ATOM 11670 C CA   . GLY A 1 66 ? -16.923 -6.314  1.308   1.00 0.00 ? 66 GLY A CA   9  
ATOM 11671 C C    . GLY A 1 66 ? -16.129 -6.268  2.598   1.00 0.00 ? 66 GLY A C    9  
ATOM 11672 O O    . GLY A 1 66 ? -16.486 -6.924  3.577   1.00 0.00 ? 66 GLY A O    9  
ATOM 11673 H H    . GLY A 1 66 ? -15.442 -7.018  -0.032  1.00 0.00 ? 66 GLY A H    9  
ATOM 11674 H HA2  . GLY A 1 66 ? -17.589 -5.464  1.278   1.00 0.00 ? 66 GLY A HA2  9  
ATOM 11675 H HA3  . GLY A 1 66 ? -17.511 -7.219  1.291   1.00 0.00 ? 66 GLY A HA3  9  
ATOM 11676 N N    . VAL A 1 67 ? -15.050 -5.492  2.602   1.00 0.00 ? 67 VAL A N    9  
ATOM 11677 C CA   . VAL A 1 67 ? -14.205 -5.363  3.782   1.00 0.00 ? 67 VAL A CA   9  
ATOM 11678 C C    . VAL A 1 67 ? -13.585 -3.973  3.866   1.00 0.00 ? 67 VAL A C    9  
ATOM 11679 O O    . VAL A 1 67 ? -12.889 -3.537  2.949   1.00 0.00 ? 67 VAL A O    9  
ATOM 11680 C CB   . VAL A 1 67 ? -13.080 -6.415  3.785   1.00 0.00 ? 67 VAL A CB   9  
ATOM 11681 C CG1  . VAL A 1 67 ? -12.334 -6.398  5.110   1.00 0.00 ? 67 VAL A CG1  9  
ATOM 11682 C CG2  . VAL A 1 67 ? -13.642 -7.799  3.499   1.00 0.00 ? 67 VAL A CG2  9  
ATOM 11683 H H    . VAL A 1 67 ? -14.818 -4.993  1.791   1.00 0.00 ? 67 VAL A H    9  
ATOM 11684 H HA   . VAL A 1 67 ? -14.823 -5.524  4.654   1.00 0.00 ? 67 VAL A HA   9  
ATOM 11685 H HB   . VAL A 1 67 ? -12.380 -6.165  3.001   1.00 0.00 ? 67 VAL A HB   9  
ATOM 11686 H HG11 . VAL A 1 67 ? -11.536 -7.123  5.083   1.00 0.00 ? 67 VAL A HG11 9  
ATOM 11687 H HG12 . VAL A 1 67 ? -13.018 -6.644  5.910   1.00 0.00 ? 67 VAL A HG12 9  
ATOM 11688 H HG13 . VAL A 1 67 ? -11.923 -5.414  5.279   1.00 0.00 ? 67 VAL A HG13 9  
ATOM 11689 H HG21 . VAL A 1 67 ? -12.902 -8.546  3.745   1.00 0.00 ? 67 VAL A HG21 9  
ATOM 11690 H HG22 . VAL A 1 67 ? -13.897 -7.875  2.452   1.00 0.00 ? 67 VAL A HG22 9  
ATOM 11691 H HG23 . VAL A 1 67 ? -14.527 -7.959  4.097   1.00 0.00 ? 67 VAL A HG23 9  
ATOM 11692 N N    . ARG A 1 68 ? -13.841 -3.282  4.971   1.00 0.00 ? 68 ARG A N    9  
ATOM 11693 C CA   . ARG A 1 68 ? -13.308 -1.940  5.174   1.00 0.00 ? 68 ARG A CA   9  
ATOM 11694 C C    . ARG A 1 68 ? -11.993 -1.989  5.946   1.00 0.00 ? 68 ARG A C    9  
ATOM 11695 O O    . ARG A 1 68 ? -11.893 -2.649  6.981   1.00 0.00 ? 68 ARG A O    9  
ATOM 11696 C CB   . ARG A 1 68 ? -14.321 -1.074  5.926   1.00 0.00 ? 68 ARG A CB   9  
ATOM 11697 C CG   . ARG A 1 68 ? -13.952 0.400   5.963   1.00 0.00 ? 68 ARG A CG   9  
ATOM 11698 C CD   . ARG A 1 68 ? -14.308 1.031   7.298   1.00 0.00 ? 68 ARG A CD   9  
ATOM 11699 N NE   . ARG A 1 68 ? -15.750 1.035   7.535   1.00 0.00 ? 68 ARG A NE   9  
ATOM 11700 C CZ   . ARG A 1 68 ? -16.313 1.422   8.678   1.00 0.00 ? 68 ARG A CZ   9  
ATOM 11701 N NH1  . ARG A 1 68 ? -15.560 1.838   9.689   1.00 0.00 ? 68 ARG A NH1  9  
ATOM 11702 N NH2  . ARG A 1 68 ? -17.631 1.394   8.809   1.00 0.00 ? 68 ARG A NH2  9  
ATOM 11703 H H    . ARG A 1 68 ? -14.403 -3.683  5.667   1.00 0.00 ? 68 ARG A H    9  
ATOM 11704 H HA   . ARG A 1 68 ? -13.126 -1.505  4.204   1.00 0.00 ? 68 ARG A HA   9  
ATOM 11705 H HB2  . ARG A 1 68 ? -15.286 -1.170  5.445   1.00 0.00 ? 68 ARG A HB2  9  
ATOM 11706 H HB3  . ARG A 1 68 ? -14.396 -1.431  6.945   1.00 0.00 ? 68 ARG A HB3  9  
ATOM 11707 H HG2  . ARG A 1 68 ? -12.889 0.499   5.802   1.00 0.00 ? 68 ARG A HG2  9  
ATOM 11708 H HG3  . ARG A 1 68 ? -14.486 0.914   5.177   1.00 0.00 ? 68 ARG A HG3  9  
ATOM 11709 H HD2  . ARG A 1 68 ? -13.825 0.473   8.087   1.00 0.00 ? 68 ARG A HD2  9  
ATOM 11710 H HD3  . ARG A 1 68 ? -13.949 2.050   7.308   1.00 0.00 ? 68 ARG A HD3  9  
ATOM 11711 H HE   . ARG A 1 68 ? -16.329 0.731   6.805   1.00 0.00 ? 68 ARG A HE   9  
ATOM 11712 H HH11 . ARG A 1 68 ? -14.565 1.862   9.596   1.00 0.00 ? 68 ARG A HH11 9  
ATOM 11713 H HH12 . ARG A 1 68 ? -15.989 2.129   10.544  1.00 0.00 ? 68 ARG A HH12 9  
ATOM 11714 H HH21 . ARG A 1 68 ? -18.203 1.082   8.051   1.00 0.00 ? 68 ARG A HH21 9  
ATOM 11715 H HH22 . ARG A 1 68 ? -18.055 1.685   9.667   1.00 0.00 ? 68 ARG A HH22 9  
ATOM 11716 N N    . TYR A 1 69 ? -10.987 -1.287  5.437   1.00 0.00 ? 69 TYR A N    9  
ATOM 11717 C CA   . TYR A 1 69 ? -9.677  -1.251  6.078   1.00 0.00 ? 69 TYR A CA   9  
ATOM 11718 C C    . TYR A 1 69 ? -9.522  0.006   6.927   1.00 0.00 ? 69 TYR A C    9  
ATOM 11719 O O    . TYR A 1 69 ? -9.034  -0.051  8.056   1.00 0.00 ? 69 TYR A O    9  
ATOM 11720 C CB   . TYR A 1 69 ? -8.569  -1.311  5.026   1.00 0.00 ? 69 TYR A CB   9  
ATOM 11721 C CG   . TYR A 1 69 ? -8.619  -2.550  4.161   1.00 0.00 ? 69 TYR A CG   9  
ATOM 11722 C CD1  . TYR A 1 69 ? -9.556  -2.671  3.143   1.00 0.00 ? 69 TYR A CD1  9  
ATOM 11723 C CD2  . TYR A 1 69 ? -7.730  -3.597  4.364   1.00 0.00 ? 69 TYR A CD2  9  
ATOM 11724 C CE1  . TYR A 1 69 ? -9.605  -3.803  2.350   1.00 0.00 ? 69 TYR A CE1  9  
ATOM 11725 C CE2  . TYR A 1 69 ? -7.772  -4.732  3.576   1.00 0.00 ? 69 TYR A CE2  9  
ATOM 11726 C CZ   . TYR A 1 69 ? -8.711  -4.830  2.571   1.00 0.00 ? 69 TYR A CZ   9  
ATOM 11727 O OH   . TYR A 1 69 ? -8.756  -5.958  1.784   1.00 0.00 ? 69 TYR A OH   9  
ATOM 11728 H H    . TYR A 1 69 ? -11.128 -0.781  4.609   1.00 0.00 ? 69 TYR A H    9  
ATOM 11729 H HA   . TYR A 1 69 ? -9.600  -2.116  6.719   1.00 0.00 ? 69 TYR A HA   9  
ATOM 11730 H HB2  . TYR A 1 69 ? -8.651  -0.451  4.377   1.00 0.00 ? 69 TYR A HB2  9  
ATOM 11731 H HB3  . TYR A 1 69 ? -7.610  -1.290  5.523   1.00 0.00 ? 69 TYR A HB3  9  
ATOM 11732 H HD1  . TYR A 1 69 ? -10.253 -1.865  2.971   1.00 0.00 ? 69 TYR A HD1  9  
ATOM 11733 H HD2  . TYR A 1 69 ? -6.996  -3.518  5.153   1.00 0.00 ? 69 TYR A HD2  9  
ATOM 11734 H HE1  . TYR A 1 69 ? -10.340 -3.879  1.563   1.00 0.00 ? 69 TYR A HE1  9  
ATOM 11735 H HE2  . TYR A 1 69 ? -7.073  -5.536  3.750   1.00 0.00 ? 69 TYR A HE2  9  
ATOM 11736 H HH   . TYR A 1 69 ? -8.132  -5.869  1.061   1.00 0.00 ? 69 TYR A HH   9  
ATOM 11737 N N    . PHE A 1 70 ? -9.938  1.142   6.376   1.00 0.00 ? 70 PHE A N    9  
ATOM 11738 C CA   . PHE A 1 70 ? -9.845  2.414   7.082   1.00 0.00 ? 70 PHE A CA   9  
ATOM 11739 C C    . PHE A 1 70 ? -10.846 3.420   6.526   1.00 0.00 ? 70 PHE A C    9  
ATOM 11740 O O    . PHE A 1 70 ? -11.163 3.404   5.336   1.00 0.00 ? 70 PHE A O    9  
ATOM 11741 C CB   . PHE A 1 70 ? -8.426  2.977   6.976   1.00 0.00 ? 70 PHE A CB   9  
ATOM 11742 C CG   . PHE A 1 70 ? -7.932  3.094   5.562   1.00 0.00 ? 70 PHE A CG   9  
ATOM 11743 C CD1  . PHE A 1 70 ? -8.249  4.203   4.794   1.00 0.00 ? 70 PHE A CD1  9  
ATOM 11744 C CD2  . PHE A 1 70 ? -7.150  2.096   5.003   1.00 0.00 ? 70 PHE A CD2  9  
ATOM 11745 C CE1  . PHE A 1 70 ? -7.796  4.314   3.492   1.00 0.00 ? 70 PHE A CE1  9  
ATOM 11746 C CE2  . PHE A 1 70 ? -6.694  2.202   3.703   1.00 0.00 ? 70 PHE A CE2  9  
ATOM 11747 C CZ   . PHE A 1 70 ? -7.018  3.312   2.946   1.00 0.00 ? 70 PHE A CZ   9  
ATOM 11748 H H    . PHE A 1 70 ? -10.317 1.124   5.473   1.00 0.00 ? 70 PHE A H    9  
ATOM 11749 H HA   . PHE A 1 70 ? -10.074 2.233   8.122   1.00 0.00 ? 70 PHE A HA   9  
ATOM 11750 H HB2  . PHE A 1 70 ? -8.403  3.961   7.418   1.00 0.00 ? 70 PHE A HB2  9  
ATOM 11751 H HB3  . PHE A 1 70 ? -7.748  2.330   7.514   1.00 0.00 ? 70 PHE A HB3  9  
ATOM 11752 H HD1  . PHE A 1 70 ? -8.857  4.986   5.220   1.00 0.00 ? 70 PHE A HD1  9  
ATOM 11753 H HD2  . PHE A 1 70 ? -6.898  1.227   5.592   1.00 0.00 ? 70 PHE A HD2  9  
ATOM 11754 H HE1  . PHE A 1 70 ? -8.050  5.182   2.904   1.00 0.00 ? 70 PHE A HE1  9  
ATOM 11755 H HE2  . PHE A 1 70 ? -6.086  1.417   3.278   1.00 0.00 ? 70 PHE A HE2  9  
ATOM 11756 H HZ   . PHE A 1 70 ? -6.662  3.396   1.930   1.00 0.00 ? 70 PHE A HZ   9  
ATOM 11757 N N    . GLU A 1 71 ? -11.343 4.295   7.394   1.00 0.00 ? 71 GLU A N    9  
ATOM 11758 C CA   . GLU A 1 71 ? -12.309 5.310   6.988   1.00 0.00 ? 71 GLU A CA   9  
ATOM 11759 C C    . GLU A 1 71 ? -11.604 6.545   6.439   1.00 0.00 ? 71 GLU A C    9  
ATOM 11760 O O    . GLU A 1 71 ? -11.078 7.361   7.195   1.00 0.00 ? 71 GLU A O    9  
ATOM 11761 C CB   . GLU A 1 71 ? -13.199 5.700   8.170   1.00 0.00 ? 71 GLU A CB   9  
ATOM 11762 C CG   . GLU A 1 71 ? -14.640 5.983   7.780   1.00 0.00 ? 71 GLU A CG   9  
ATOM 11763 C CD   . GLU A 1 71 ? -15.316 6.964   8.717   1.00 0.00 ? 71 GLU A CD   9  
ATOM 11764 O OE1  . GLU A 1 71 ? -15.639 6.569   9.858   1.00 0.00 ? 71 GLU A OE1  9  
ATOM 11765 O OE2  . GLU A 1 71 ? -15.524 8.126   8.311   1.00 0.00 ? 71 GLU A OE2  9  
ATOM 11766 H H    . GLU A 1 71 ? -11.053 4.259   8.330   1.00 0.00 ? 71 GLU A H    9  
ATOM 11767 H HA   . GLU A 1 71 ? -12.926 4.886   6.210   1.00 0.00 ? 71 GLU A HA   9  
ATOM 11768 H HB2  . GLU A 1 71 ? -13.196 4.894   8.889   1.00 0.00 ? 71 GLU A HB2  9  
ATOM 11769 H HB3  . GLU A 1 71 ? -12.793 6.587   8.634   1.00 0.00 ? 71 GLU A HB3  9  
ATOM 11770 H HG2  . GLU A 1 71 ? -14.655 6.395   6.781   1.00 0.00 ? 71 GLU A HG2  9  
ATOM 11771 H HG3  . GLU A 1 71 ? -15.192 5.055   7.793   1.00 0.00 ? 71 GLU A HG3  9  
ATOM 11772 N N    . CYS A 1 72 ? -11.596 6.677   5.116   1.00 0.00 ? 72 CYS A N    9  
ATOM 11773 C CA   . CYS A 1 72 ? -10.956 7.812   4.464   1.00 0.00 ? 72 CYS A CA   9  
ATOM 11774 C C    . CYS A 1 72 ? -11.736 8.238   3.223   1.00 0.00 ? 72 CYS A C    9  
ATOM 11775 O O    . CYS A 1 72 ? -12.519 7.462   2.675   1.00 0.00 ? 72 CYS A O    9  
ATOM 11776 C CB   . CYS A 1 72 ? -9.517  7.461   4.081   1.00 0.00 ? 72 CYS A CB   9  
ATOM 11777 S SG   . CYS A 1 72 ? -8.309  7.764   5.391   1.00 0.00 ? 72 CYS A SG   9  
ATOM 11778 H H    . CYS A 1 72 ? -12.033 5.992   4.566   1.00 0.00 ? 72 CYS A H    9  
ATOM 11779 H HA   . CYS A 1 72 ? -10.942 8.632   5.166   1.00 0.00 ? 72 CYS A HA   9  
ATOM 11780 H HB2  . CYS A 1 72 ? -9.466  6.414   3.824   1.00 0.00 ? 72 CYS A HB2  9  
ATOM 11781 H HB3  . CYS A 1 72 ? -9.227  8.051   3.223   1.00 0.00 ? 72 CYS A HB3  9  
ATOM 11782 H HG   . CYS A 1 72 ? -8.615  7.318   6.185   1.00 0.00 ? 72 CYS A HG   9  
ATOM 11783 N N    . PRO A 1 73 ? -11.532 9.484   2.761   1.00 0.00 ? 73 PRO A N    9  
ATOM 11784 C CA   . PRO A 1 73 ? -12.221 10.010  1.579   1.00 0.00 ? 73 PRO A CA   9  
ATOM 11785 C C    . PRO A 1 73 ? -12.094 9.084   0.374   1.00 0.00 ? 73 PRO A C    9  
ATOM 11786 O O    . PRO A 1 73 ? -11.451 8.036   0.449   1.00 0.00 ? 73 PRO A O    9  
ATOM 11787 C CB   . PRO A 1 73 ? -11.507 11.337  1.311   1.00 0.00 ? 73 PRO A CB   9  
ATOM 11788 C CG   . PRO A 1 73 ? -10.967 11.749  2.637   1.00 0.00 ? 73 PRO A CG   9  
ATOM 11789 C CD   . PRO A 1 73 ? -10.616 10.475  3.355   1.00 0.00 ? 73 PRO A CD   9  
ATOM 11790 H HA   . PRO A 1 73 ? -13.266 10.195  1.779   1.00 0.00 ? 73 PRO A HA   9  
ATOM 11791 H HB2  . PRO A 1 73 ? -10.716 11.183  0.592   1.00 0.00 ? 73 PRO A HB2  9  
ATOM 11792 H HB3  . PRO A 1 73 ? -12.213 12.059  0.931   1.00 0.00 ? 73 PRO A HB3  9  
ATOM 11793 H HG2  . PRO A 1 73 ? -10.086 12.359  2.501   1.00 0.00 ? 73 PRO A HG2  9  
ATOM 11794 H HG3  . PRO A 1 73 ? -11.721 12.293  3.186   1.00 0.00 ? 73 PRO A HG3  9  
ATOM 11795 H HD2  . PRO A 1 73 ? -9.586  10.209  3.167   1.00 0.00 ? 73 PRO A HD2  9  
ATOM 11796 H HD3  . PRO A 1 73 ? -10.794 10.578  4.415   1.00 0.00 ? 73 PRO A HD3  9  
ATOM 11797 N N    . ALA A 1 74 ? -12.709 9.476   -0.736  1.00 0.00 ? 74 ALA A N    9  
ATOM 11798 C CA   . ALA A 1 74 ? -12.664 8.681   -1.956  1.00 0.00 ? 74 ALA A CA   9  
ATOM 11799 C C    . ALA A 1 74 ? -11.434 9.023   -2.790  1.00 0.00 ? 74 ALA A C    9  
ATOM 11800 O O    . ALA A 1 74 ? -10.955 10.156  -2.773  1.00 0.00 ? 74 ALA A O    9  
ATOM 11801 C CB   . ALA A 1 74 ? -13.931 8.894   -2.772  1.00 0.00 ? 74 ALA A CB   9  
ATOM 11802 H H    . ALA A 1 74 ? -13.206 10.322  -0.734  1.00 0.00 ? 74 ALA A H    9  
ATOM 11803 H HA   . ALA A 1 74 ? -12.617 7.640   -1.674  1.00 0.00 ? 74 ALA A HA   9  
ATOM 11804 H HB1  . ALA A 1 74 ? -13.701 8.813   -3.823  1.00 0.00 ? 74 ALA A HB1  9  
ATOM 11805 H HB2  . ALA A 1 74 ? -14.332 9.875   -2.564  1.00 0.00 ? 74 ALA A HB2  9  
ATOM 11806 H HB3  . ALA A 1 74 ? -14.661 8.143   -2.505  1.00 0.00 ? 74 ALA A HB3  9  
ATOM 11807 N N    . LEU A 1 75 ? -10.926 8.034   -3.519  1.00 0.00 ? 75 LEU A N    9  
ATOM 11808 C CA   . LEU A 1 75 ? -9.750  8.230   -4.359  1.00 0.00 ? 75 LEU A CA   9  
ATOM 11809 C C    . LEU A 1 75 ? -8.545  8.647   -3.523  1.00 0.00 ? 75 LEU A C    9  
ATOM 11810 O O    . LEU A 1 75 ? -7.666  9.365   -3.998  1.00 0.00 ? 75 LEU A O    9  
ATOM 11811 C CB   . LEU A 1 75 ? -10.033 9.286   -5.428  1.00 0.00 ? 75 LEU A CB   9  
ATOM 11812 C CG   . LEU A 1 75 ? -11.233 8.990   -6.330  1.00 0.00 ? 75 LEU A CG   9  
ATOM 11813 C CD1  . LEU A 1 75 ? -11.787 10.278  -6.919  1.00 0.00 ? 75 LEU A CD1  9  
ATOM 11814 C CD2  . LEU A 1 75 ? -10.842 8.021   -7.436  1.00 0.00 ? 75 LEU A CD2  9  
ATOM 11815 H H    . LEU A 1 75 ? -11.352 7.152   -3.491  1.00 0.00 ? 75 LEU A H    9  
ATOM 11816 H HA   . LEU A 1 75 ? -9.529  7.290   -4.843  1.00 0.00 ? 75 LEU A HA   9  
ATOM 11817 H HB2  . LEU A 1 75 ? -10.204 10.231  -4.934  1.00 0.00 ? 75 LEU A HB2  9  
ATOM 11818 H HB3  . LEU A 1 75 ? -9.157