data_2CP3
# 
_entry.id   2CP3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CP3         
RCSB  RCSB024469   
WWPDB D_1000024469 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002100283.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CP3 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Saito, K.'                                              1 
'Koshiba, S.'                                            2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the 2nd CAP-Gly domain in human CLIP-115/CYLN2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Saito, K.'    1 
primary 'Koshiba, S.'  2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Yokoyama, S.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           CLIP-115 
_entity.formula_weight             8679.797 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CAP-Gly domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'KIAA0291; similar rodent cytoplasmic linker protein CLIP-115 and restin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSG
PSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSG
PSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002100283.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  LEU n 
1 9  ARG n 
1 10 LEU n 
1 11 GLY n 
1 12 ASP n 
1 13 ARG n 
1 14 VAL n 
1 15 LEU n 
1 16 VAL n 
1 17 GLY n 
1 18 GLY n 
1 19 THR n 
1 20 LYS n 
1 21 THR n 
1 22 GLY n 
1 23 VAL n 
1 24 VAL n 
1 25 ARG n 
1 26 TYR n 
1 27 VAL n 
1 28 GLY n 
1 29 GLU n 
1 30 THR n 
1 31 ASP n 
1 32 PHE n 
1 33 ALA n 
1 34 LYS n 
1 35 GLY n 
1 36 GLU n 
1 37 TRP n 
1 38 CYS n 
1 39 GLY n 
1 40 VAL n 
1 41 GLU n 
1 42 LEU n 
1 43 ASP n 
1 44 GLU n 
1 45 PRO n 
1 46 LEU n 
1 47 GLY n 
1 48 LYS n 
1 49 ASN n 
1 50 ASP n 
1 51 GLY n 
1 52 ALA n 
1 53 VAL n 
1 54 ALA n 
1 55 GLY n 
1 56 THR n 
1 57 ARG n 
1 58 TYR n 
1 59 PHE n 
1 60 GLN n 
1 61 CYS n 
1 62 PRO n 
1 63 PRO n 
1 64 LYS n 
1 65 PHE n 
1 66 GLY n 
1 67 LEU n 
1 68 PHE n 
1 69 ALA n 
1 70 PRO n 
1 71 ILE n 
1 72 HIS n 
1 73 LYS n 
1 74 VAL n 
1 75 ILE n 
1 76 ARG n 
1 77 ILE n 
1 78 GLY n 
1 79 SER n 
1 80 GLY n 
1 81 PRO n 
1 82 SER n 
1 83 SER n 
1 84 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA fh25236' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040301-94 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CYLN2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UDT6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIG 
_struct_ref.pdbx_align_begin           219 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CP3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 78 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UDT6 
_struct_ref_seq.db_align_beg                  219 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  289 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       78 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CP3 GLY A 1  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 1  1  
1 2CP3 SER A 2  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 2  2  
1 2CP3 SER A 3  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 3  3  
1 2CP3 GLY A 4  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 4  4  
1 2CP3 SER A 5  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 5  5  
1 2CP3 SER A 6  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 6  6  
1 2CP3 GLY A 7  ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 7  7  
1 2CP3 SER A 79 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 79 8  
1 2CP3 GLY A 80 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 80 9  
1 2CP3 PRO A 81 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 81 10 
1 2CP3 SER A 82 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 82 11 
1 2CP3 SER A 83 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 83 12 
1 2CP3 GLY A 84 ? UNP Q9UDT6 ? ? 'CLONING ARTIFACT' 84 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM protein, 20mM d-Tris-HCl, pH7.0, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2CP3 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2CP3 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CP3 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5        'Johnson, B.A.' 3 
'structure solution' CNS     1.1      'Brunger, A.T.' 4 
refinement           CNS     1.1      'Brunger, A.T.' 5 
# 
_exptl.entry_id          2CP3 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CP3 
_struct.title                     'Solution structure of the 2nd CAP-Gly domain in human CLIP-115/CYLN2' 
_struct.pdbx_descriptor           CLIP-115 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CP3 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;microtubule binding, cytoskeleton associated protein, CYLN2, KIAA0291, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 66 ? PRO A 70 ? GLY A 66 PRO A 70 
A 2 GLU A 36 ? LEU A 42 ? GLU A 36 LEU A 42 
A 3 LYS A 20 ? GLU A 29 ? LYS A 20 GLU A 29 
A 4 ARG A 13 ? VAL A 16 ? ARG A 13 VAL A 16 
A 5 VAL A 74 ? ARG A 76 ? VAL A 74 ARG A 76 
B 1 ALA A 52 ? VAL A 53 ? ALA A 52 VAL A 53 
B 2 THR A 56 ? ARG A 57 ? THR A 56 ARG A 57 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 69 ? O ALA A 69 N CYS A 38 ? N CYS A 38 
A 2 3 O GLY A 39 ? O GLY A 39 N ARG A 25 ? N ARG A 25 
A 3 4 O GLY A 22 ? O GLY A 22 N VAL A 14 ? N VAL A 14 
A 4 5 N LEU A 15 ? N LEU A 15 O ILE A 75 ? O ILE A 75 
B 1 2 N VAL A 53 ? N VAL A 53 O THR A 56 ? O THR A 56 
# 
_database_PDB_matrix.entry_id          2CP3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CP3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 12.781  -13.718 -7.893  1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 14.212  -13.362 -7.688  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 14.477  -12.795 -6.307  1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 14.347  -11.591 -6.087  1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 12.572  -13.789 -8.910  1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? 12.168  -12.990 -7.475  1.00 0.00 ? 1  GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? 12.572  -14.633 -7.442  1.00 0.00 ? 1  GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? 14.815  -14.247 -7.823  1.00 0.00 ? 1  GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? 14.498  -12.628 -8.427  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 10    N N    . SER A 1 2  ? 14.848  -13.665 -5.373  1.00 0.00 ? 2  SER A N    1  
ATOM 11    C CA   . SER A 1 2  ? 15.131  -13.245 -4.006  1.00 0.00 ? 2  SER A CA   1  
ATOM 12    C C    . SER A 1 2  ? 16.574  -12.768 -3.871  1.00 0.00 ? 2  SER A C    1  
ATOM 13    O O    . SER A 1 2  ? 17.485  -13.568 -3.651  1.00 0.00 ? 2  SER A O    1  
ATOM 14    C CB   . SER A 1 2  ? 14.869  -14.394 -3.032  1.00 0.00 ? 2  SER A CB   1  
ATOM 15    O OG   . SER A 1 2  ? 15.849  -15.409 -3.164  1.00 0.00 ? 2  SER A OG   1  
ATOM 16    H H    . SER A 1 2  ? 14.934  -14.613 -5.610  1.00 0.00 ? 2  SER A H    1  
ATOM 17    H HA   . SER A 1 2  ? 14.471  -12.425 -3.768  1.00 0.00 ? 2  SER A HA   1  
ATOM 18    H HB2  . SER A 1 2  ? 14.893  -14.019 -2.020  1.00 0.00 ? 2  SER A HB2  1  
ATOM 19    H HB3  . SER A 1 2  ? 13.897  -14.821 -3.234  1.00 0.00 ? 2  SER A HB3  1  
ATOM 20    H HG   . SER A 1 2  ? 15.917  -15.672 -4.086  1.00 0.00 ? 2  SER A HG   1  
ATOM 21    N N    . SER A 1 3  ? 16.775  -11.462 -4.004  1.00 0.00 ? 3  SER A N    1  
ATOM 22    C CA   . SER A 1 3  ? 18.108  -10.878 -3.896  1.00 0.00 ? 3  SER A CA   1  
ATOM 23    C C    . SER A 1 3  ? 18.182  -9.902  -2.727  1.00 0.00 ? 3  SER A C    1  
ATOM 24    O O    . SER A 1 3  ? 18.942  -10.109 -1.780  1.00 0.00 ? 3  SER A O    1  
ATOM 25    C CB   . SER A 1 3  ? 18.481  -10.163 -5.197  1.00 0.00 ? 3  SER A CB   1  
ATOM 26    O OG   . SER A 1 3  ? 18.072  -10.913 -6.327  1.00 0.00 ? 3  SER A OG   1  
ATOM 27    H H    . SER A 1 3  ? 16.009  -10.876 -4.178  1.00 0.00 ? 3  SER A H    1  
ATOM 28    H HA   . SER A 1 3  ? 18.809  -11.681 -3.725  1.00 0.00 ? 3  SER A HA   1  
ATOM 29    H HB2  . SER A 1 3  ? 17.996  -9.198  -5.226  1.00 0.00 ? 3  SER A HB2  1  
ATOM 30    H HB3  . SER A 1 3  ? 19.552  -10.029 -5.237  1.00 0.00 ? 3  SER A HB3  1  
ATOM 31    H HG   . SER A 1 3  ? 18.560  -10.621 -7.100  1.00 0.00 ? 3  SER A HG   1  
ATOM 32    N N    . GLY A 1 4  ? 17.388  -8.839  -2.798  1.00 0.00 ? 4  GLY A N    1  
ATOM 33    C CA   . GLY A 1 4  ? 17.379  -7.847  -1.739  1.00 0.00 ? 4  GLY A CA   1  
ATOM 34    C C    . GLY A 1 4  ? 16.250  -6.848  -1.889  1.00 0.00 ? 4  GLY A C    1  
ATOM 35    O O    . GLY A 1 4  ? 15.546  -6.545  -0.925  1.00 0.00 ? 4  GLY A O    1  
ATOM 36    H H    . GLY A 1 4  ? 16.803  -8.727  -3.577  1.00 0.00 ? 4  GLY A H    1  
ATOM 37    H HA2  . GLY A 1 4  ? 17.275  -8.352  -0.790  1.00 0.00 ? 4  GLY A HA2  1  
ATOM 38    H HA3  . GLY A 1 4  ? 18.319  -7.316  -1.751  1.00 0.00 ? 4  GLY A HA3  1  
ATOM 39    N N    . SER A 1 5  ? 16.076  -6.332  -3.101  1.00 0.00 ? 5  SER A N    1  
ATOM 40    C CA   . SER A 1 5  ? 15.023  -5.361  -3.375  1.00 0.00 ? 5  SER A CA   1  
ATOM 41    C C    . SER A 1 5  ? 13.678  -6.055  -3.570  1.00 0.00 ? 5  SER A C    1  
ATOM 42    O O    . SER A 1 5  ? 13.156  -6.119  -4.683  1.00 0.00 ? 5  SER A O    1  
ATOM 43    C CB   . SER A 1 5  ? 15.371  -4.535  -4.616  1.00 0.00 ? 5  SER A CB   1  
ATOM 44    O OG   . SER A 1 5  ? 16.206  -5.267  -5.497  1.00 0.00 ? 5  SER A OG   1  
ATOM 45    H H    . SER A 1 5  ? 16.668  -6.612  -3.831  1.00 0.00 ? 5  SER A H    1  
ATOM 46    H HA   . SER A 1 5  ? 14.953  -4.701  -2.523  1.00 0.00 ? 5  SER A HA   1  
ATOM 47    H HB2  . SER A 1 5  ? 14.463  -4.272  -5.136  1.00 0.00 ? 5  SER A HB2  1  
ATOM 48    H HB3  . SER A 1 5  ? 15.887  -3.636  -4.314  1.00 0.00 ? 5  SER A HB3  1  
ATOM 49    H HG   . SER A 1 5  ? 16.257  -4.812  -6.341  1.00 0.00 ? 5  SER A HG   1  
ATOM 50    N N    . SER A 1 6  ? 13.125  -6.575  -2.479  1.00 0.00 ? 6  SER A N    1  
ATOM 51    C CA   . SER A 1 6  ? 11.840  -7.265  -2.530  1.00 0.00 ? 6  SER A CA   1  
ATOM 52    C C    . SER A 1 6  ? 11.243  -7.406  -1.133  1.00 0.00 ? 6  SER A C    1  
ATOM 53    O O    . SER A 1 6  ? 11.968  -7.478  -0.141  1.00 0.00 ? 6  SER A O    1  
ATOM 54    C CB   . SER A 1 6  ? 12.005  -8.646  -3.168  1.00 0.00 ? 6  SER A CB   1  
ATOM 55    O OG   . SER A 1 6  ? 10.746  -9.224  -3.465  1.00 0.00 ? 6  SER A OG   1  
ATOM 56    H H    . SER A 1 6  ? 13.589  -6.492  -1.620  1.00 0.00 ? 6  SER A H    1  
ATOM 57    H HA   . SER A 1 6  ? 11.171  -6.676  -3.137  1.00 0.00 ? 6  SER A HA   1  
ATOM 58    H HB2  . SER A 1 6  ? 12.569  -8.551  -4.084  1.00 0.00 ? 6  SER A HB2  1  
ATOM 59    H HB3  . SER A 1 6  ? 12.535  -9.295  -2.485  1.00 0.00 ? 6  SER A HB3  1  
ATOM 60    H HG   . SER A 1 6  ? 10.874  -10.017 -3.991  1.00 0.00 ? 6  SER A HG   1  
ATOM 61    N N    . GLY A 1 7  ? 9.916   -7.443  -1.064  1.00 0.00 ? 7  GLY A N    1  
ATOM 62    C CA   . GLY A 1 7  ? 9.244   -7.575  0.215   1.00 0.00 ? 7  GLY A CA   1  
ATOM 63    C C    . GLY A 1 7  ? 8.888   -6.232  0.824   1.00 0.00 ? 7  GLY A C    1  
ATOM 64    O O    . GLY A 1 7  ? 7.766   -6.035  1.293   1.00 0.00 ? 7  GLY A O    1  
ATOM 65    H H    . GLY A 1 7  ? 9.390   -7.380  -1.888  1.00 0.00 ? 7  GLY A H    1  
ATOM 66    H HA2  . GLY A 1 7  ? 8.339   -8.146  0.076   1.00 0.00 ? 7  GLY A HA2  1  
ATOM 67    H HA3  . GLY A 1 7  ? 9.892   -8.106  0.897   1.00 0.00 ? 7  GLY A HA3  1  
ATOM 68    N N    . LEU A 1 8  ? 9.843   -5.309  0.816   1.00 0.00 ? 8  LEU A N    1  
ATOM 69    C CA   . LEU A 1 8  ? 9.626   -3.977  1.371   1.00 0.00 ? 8  LEU A CA   1  
ATOM 70    C C    . LEU A 1 8  ? 9.356   -4.050  2.871   1.00 0.00 ? 8  LEU A C    1  
ATOM 71    O O    . LEU A 1 8  ? 8.475   -4.784  3.319   1.00 0.00 ? 8  LEU A O    1  
ATOM 72    C CB   . LEU A 1 8  ? 8.457   -3.288  0.664   1.00 0.00 ? 8  LEU A CB   1  
ATOM 73    C CG   . LEU A 1 8  ? 8.512   -3.327  -0.864  1.00 0.00 ? 8  LEU A CG   1  
ATOM 74    C CD1  . LEU A 1 8  ? 7.110   -3.417  -1.447  1.00 0.00 ? 8  LEU A CD1  1  
ATOM 75    C CD2  . LEU A 1 8  ? 9.235   -2.101  -1.402  1.00 0.00 ? 8  LEU A CD2  1  
ATOM 76    H H    . LEU A 1 8  ? 10.716  -5.527  0.427   1.00 0.00 ? 8  LEU A H    1  
ATOM 77    H HA   . LEU A 1 8  ? 10.524  -3.400  1.208   1.00 0.00 ? 8  LEU A HA   1  
ATOM 78    H HB2  . LEU A 1 8  ? 7.541   -3.763  0.984   1.00 0.00 ? 8  LEU A HB2  1  
ATOM 79    H HB3  . LEU A 1 8  ? 8.435   -2.254  0.974   1.00 0.00 ? 8  LEU A HB3  1  
ATOM 80    H HG   . LEU A 1 8  ? 9.060   -4.204  -1.176  1.00 0.00 ? 8  LEU A HG   1  
ATOM 81    H HD11 . LEU A 1 8  ? 6.439   -3.830  -0.707  1.00 0.00 ? 8  LEU A HD11 1  
ATOM 82    H HD12 . LEU A 1 8  ? 7.123   -4.056  -2.318  1.00 0.00 ? 8  LEU A HD12 1  
ATOM 83    H HD13 . LEU A 1 8  ? 6.772   -2.431  -1.728  1.00 0.00 ? 8  LEU A HD13 1  
ATOM 84    H HD21 . LEU A 1 8  ? 9.676   -2.335  -2.360  1.00 0.00 ? 8  LEU A HD21 1  
ATOM 85    H HD22 . LEU A 1 8  ? 10.012  -1.809  -0.710  1.00 0.00 ? 8  LEU A HD22 1  
ATOM 86    H HD23 . LEU A 1 8  ? 8.533   -1.289  -1.517  1.00 0.00 ? 8  LEU A HD23 1  
ATOM 87    N N    . ARG A 1 9  ? 10.122  -3.285  3.643   1.00 0.00 ? 9  ARG A N    1  
ATOM 88    C CA   . ARG A 1 9  ? 9.965   -3.263  5.092   1.00 0.00 ? 9  ARG A CA   1  
ATOM 89    C C    . ARG A 1 9  ? 8.598   -2.709  5.484   1.00 0.00 ? 9  ARG A C    1  
ATOM 90    O O    . ARG A 1 9  ? 7.986   -1.951  4.732   1.00 0.00 ? 9  ARG A O    1  
ATOM 91    C CB   . ARG A 1 9  ? 11.071  -2.422  5.733   1.00 0.00 ? 9  ARG A CB   1  
ATOM 92    C CG   . ARG A 1 9  ? 12.418  -3.125  5.783   1.00 0.00 ? 9  ARG A CG   1  
ATOM 93    C CD   . ARG A 1 9  ? 13.346  -2.479  6.799   1.00 0.00 ? 9  ARG A CD   1  
ATOM 94    N NE   . ARG A 1 9  ? 12.734  -2.394  8.123   1.00 0.00 ? 9  ARG A NE   1  
ATOM 95    C CZ   . ARG A 1 9  ? 13.251  -1.703  9.135   1.00 0.00 ? 9  ARG A CZ   1  
ATOM 96    N NH1  . ARG A 1 9  ? 14.388  -1.034  8.979   1.00 0.00 ? 9  ARG A NH1  1  
ATOM 97    N NH2  . ARG A 1 9  ? 12.630  -1.677  10.306  1.00 0.00 ? 9  ARG A NH2  1  
ATOM 98    H H    . ARG A 1 9  ? 10.808  -2.722  3.228   1.00 0.00 ? 9  ARG A H    1  
ATOM 99    H HA   . ARG A 1 9  ? 10.044  -4.279  5.450   1.00 0.00 ? 9  ARG A HA   1  
ATOM 100   H HB2  . ARG A 1 9  ? 11.186  -1.509  5.168   1.00 0.00 ? 9  ARG A HB2  1  
ATOM 101   H HB3  . ARG A 1 9  ? 10.780  -2.176  6.744   1.00 0.00 ? 9  ARG A HB3  1  
ATOM 102   H HG2  . ARG A 1 9  ? 12.264  -4.159  6.056   1.00 0.00 ? 9  ARG A HG2  1  
ATOM 103   H HG3  . ARG A 1 9  ? 12.875  -3.074  4.806   1.00 0.00 ? 9  ARG A HG3  1  
ATOM 104   H HD2  . ARG A 1 9  ? 14.248  -3.068  6.868   1.00 0.00 ? 9  ARG A HD2  1  
ATOM 105   H HD3  . ARG A 1 9  ? 13.591  -1.483  6.460   1.00 0.00 ? 9  ARG A HD3  1  
ATOM 106   H HE   . ARG A 1 9  ? 11.893  -2.878  8.264   1.00 0.00 ? 9  ARG A HE   1  
ATOM 107   H HH11 . ARG A 1 9  ? 14.861  -1.049  8.099   1.00 0.00 ? 9  ARG A HH11 1  
ATOM 108   H HH12 . ARG A 1 9  ? 14.771  -0.516  9.744   1.00 0.00 ? 9  ARG A HH12 1  
ATOM 109   H HH21 . ARG A 1 9  ? 11.774  -2.178  10.429  1.00 0.00 ? 9  ARG A HH21 1  
ATOM 110   H HH22 . ARG A 1 9  ? 13.018  -1.158  11.068  1.00 0.00 ? 9  ARG A HH22 1  
ATOM 111   N N    . LEU A 1 10 ? 8.126   -3.095  6.665   1.00 0.00 ? 10 LEU A N    1  
ATOM 112   C CA   . LEU A 1 10 ? 6.831   -2.638  7.157   1.00 0.00 ? 10 LEU A CA   1  
ATOM 113   C C    . LEU A 1 10 ? 6.944   -1.250  7.779   1.00 0.00 ? 10 LEU A C    1  
ATOM 114   O O    . LEU A 1 10 ? 7.010   -1.109  9.000   1.00 0.00 ? 10 LEU A O    1  
ATOM 115   C CB   . LEU A 1 10 ? 6.274   -3.626  8.183   1.00 0.00 ? 10 LEU A CB   1  
ATOM 116   C CG   . LEU A 1 10 ? 5.629   -4.880  7.589   1.00 0.00 ? 10 LEU A CG   1  
ATOM 117   C CD1  . LEU A 1 10 ? 6.000   -6.110  8.404   1.00 0.00 ? 10 LEU A CD1  1  
ATOM 118   C CD2  . LEU A 1 10 ? 4.118   -4.721  7.521   1.00 0.00 ? 10 LEU A CD2  1  
ATOM 119   H H    . LEU A 1 10 ? 8.660   -3.701  7.219   1.00 0.00 ? 10 LEU A H    1  
ATOM 120   H HA   . LEU A 1 10 ? 6.156   -2.588  6.315   1.00 0.00 ? 10 LEU A HA   1  
ATOM 121   H HB2  . LEU A 1 10 ? 7.083   -3.932  8.830   1.00 0.00 ? 10 LEU A HB2  1  
ATOM 122   H HB3  . LEU A 1 10 ? 5.533   -3.115  8.778   1.00 0.00 ? 10 LEU A HB3  1  
ATOM 123   H HG   . LEU A 1 10 ? 5.997   -5.024  6.583   1.00 0.00 ? 10 LEU A HG   1  
ATOM 124   H HD11 . LEU A 1 10 ? 6.925   -6.524  8.030   1.00 0.00 ? 10 LEU A HD11 1  
ATOM 125   H HD12 . LEU A 1 10 ? 5.216   -6.849  8.320   1.00 0.00 ? 10 LEU A HD12 1  
ATOM 126   H HD13 . LEU A 1 10 ? 6.123   -5.832  9.440   1.00 0.00 ? 10 LEU A HD13 1  
ATOM 127   H HD21 . LEU A 1 10 ? 3.844   -4.284  6.572   1.00 0.00 ? 10 LEU A HD21 1  
ATOM 128   H HD22 . LEU A 1 10 ? 3.787   -4.078  8.323   1.00 0.00 ? 10 LEU A HD22 1  
ATOM 129   H HD23 . LEU A 1 10 ? 3.649   -5.689  7.619   1.00 0.00 ? 10 LEU A HD23 1  
ATOM 130   N N    . GLY A 1 11 ? 6.965   -0.226  6.931   1.00 0.00 ? 11 GLY A N    1  
ATOM 131   C CA   . GLY A 1 11 ? 7.071   1.138   7.416   1.00 0.00 ? 11 GLY A CA   1  
ATOM 132   C C    . GLY A 1 11 ? 8.122   1.937   6.675   1.00 0.00 ? 11 GLY A C    1  
ATOM 133   O O    . GLY A 1 11 ? 8.919   2.648   7.289   1.00 0.00 ? 11 GLY A O    1  
ATOM 134   H H    . GLY A 1 11 ? 6.910   -0.399  5.968   1.00 0.00 ? 11 GLY A H    1  
ATOM 135   H HA2  . GLY A 1 11 ? 6.114   1.624   7.297   1.00 0.00 ? 11 GLY A HA2  1  
ATOM 136   H HA3  . GLY A 1 11 ? 7.324   1.115   8.466   1.00 0.00 ? 11 GLY A HA3  1  
ATOM 137   N N    . ASP A 1 12 ? 8.128   1.821   5.351   1.00 0.00 ? 12 ASP A N    1  
ATOM 138   C CA   . ASP A 1 12 ? 9.090   2.540   4.524   1.00 0.00 ? 12 ASP A CA   1  
ATOM 139   C C    . ASP A 1 12 ? 8.387   3.291   3.398   1.00 0.00 ? 12 ASP A C    1  
ATOM 140   O O    . ASP A 1 12 ? 7.376   2.830   2.867   1.00 0.00 ? 12 ASP A O    1  
ATOM 141   C CB   . ASP A 1 12 ? 10.121  1.568   3.944   1.00 0.00 ? 12 ASP A CB   1  
ATOM 142   C CG   . ASP A 1 12 ? 11.511  1.796   4.504   1.00 0.00 ? 12 ASP A CG   1  
ATOM 143   O OD1  . ASP A 1 12 ? 11.618  2.314   5.636   1.00 0.00 ? 12 ASP A OD1  1  
ATOM 144   O OD2  . ASP A 1 12 ? 12.494  1.457   3.811   1.00 0.00 ? 12 ASP A OD2  1  
ATOM 145   H H    . ASP A 1 12 ? 7.469   1.239   4.920   1.00 0.00 ? 12 ASP A H    1  
ATOM 146   H HA   . ASP A 1 12 ? 9.599   3.254   5.154   1.00 0.00 ? 12 ASP A HA   1  
ATOM 147   H HB2  . ASP A 1 12 ? 9.822   0.556   4.176   1.00 0.00 ? 12 ASP A HB2  1  
ATOM 148   H HB3  . ASP A 1 12 ? 10.161  1.689   2.870   1.00 0.00 ? 12 ASP A HB3  1  
ATOM 149   N N    . ARG A 1 13 ? 8.928   4.451   3.039   1.00 0.00 ? 13 ARG A N    1  
ATOM 150   C CA   . ARG A 1 13 ? 8.352   5.265   1.975   1.00 0.00 ? 13 ARG A CA   1  
ATOM 151   C C    . ARG A 1 13 ? 8.611   4.639   0.609   1.00 0.00 ? 13 ARG A C    1  
ATOM 152   O O    . ARG A 1 13 ? 9.753   4.568   0.154   1.00 0.00 ? 13 ARG A O    1  
ATOM 153   C CB   . ARG A 1 13 ? 8.931   6.680   2.019   1.00 0.00 ? 13 ARG A CB   1  
ATOM 154   C CG   . ARG A 1 13 ? 8.005   7.735   1.437   1.00 0.00 ? 13 ARG A CG   1  
ATOM 155   C CD   . ARG A 1 13 ? 8.376   9.129   1.920   1.00 0.00 ? 13 ARG A CD   1  
ATOM 156   N NE   . ARG A 1 13 ? 9.750   9.481   1.571   1.00 0.00 ? 13 ARG A NE   1  
ATOM 157   C CZ   . ARG A 1 13 ? 10.214  10.728  1.555   1.00 0.00 ? 13 ARG A CZ   1  
ATOM 158   N NH1  . ARG A 1 13 ? 9.419   11.744  1.866   1.00 0.00 ? 13 ARG A NH1  1  
ATOM 159   N NH2  . ARG A 1 13 ? 11.478  10.961  1.228   1.00 0.00 ? 13 ARG A NH2  1  
ATOM 160   H H    . ARG A 1 13 ? 9.733   4.764   3.499   1.00 0.00 ? 13 ARG A H    1  
ATOM 161   H HA   . ARG A 1 13 ? 7.286   5.317   2.138   1.00 0.00 ? 13 ARG A HA   1  
ATOM 162   H HB2  . ARG A 1 13 ? 9.138   6.941   3.046   1.00 0.00 ? 13 ARG A HB2  1  
ATOM 163   H HB3  . ARG A 1 13 ? 9.856   6.696   1.460   1.00 0.00 ? 13 ARG A HB3  1  
ATOM 164   H HG2  . ARG A 1 13 ? 8.074   7.708   0.361   1.00 0.00 ? 13 ARG A HG2  1  
ATOM 165   H HG3  . ARG A 1 13 ? 6.992   7.517   1.740   1.00 0.00 ? 13 ARG A HG3  1  
ATOM 166   H HD2  . ARG A 1 13 ? 7.706   9.843   1.464   1.00 0.00 ? 13 ARG A HD2  1  
ATOM 167   H HD3  . ARG A 1 13 ? 8.265   9.166   2.993   1.00 0.00 ? 13 ARG A HD3  1  
ATOM 168   H HE   . ARG A 1 13 ? 10.360  8.750   1.337   1.00 0.00 ? 13 ARG A HE   1  
ATOM 169   H HH11 . ARG A 1 13 ? 8.465   11.576  2.115   1.00 0.00 ? 13 ARG A HH11 1  
ATOM 170   H HH12 . ARG A 1 13 ? 9.774   12.679  1.853   1.00 0.00 ? 13 ARG A HH12 1  
ATOM 171   H HH21 . ARG A 1 13 ? 12.082  10.199  0.992   1.00 0.00 ? 13 ARG A HH21 1  
ATOM 172   H HH22 . ARG A 1 13 ? 11.827  11.898  1.215   1.00 0.00 ? 13 ARG A HH22 1  
ATOM 173   N N    . VAL A 1 14 ? 7.544   4.186   -0.041  1.00 0.00 ? 14 VAL A N    1  
ATOM 174   C CA   . VAL A 1 14 ? 7.656   3.567   -1.356  1.00 0.00 ? 14 VAL A CA   1  
ATOM 175   C C    . VAL A 1 14 ? 6.816   4.311   -2.388  1.00 0.00 ? 14 VAL A C    1  
ATOM 176   O O    . VAL A 1 14 ? 5.835   4.970   -2.046  1.00 0.00 ? 14 VAL A O    1  
ATOM 177   C CB   . VAL A 1 14 ? 7.216   2.091   -1.321  1.00 0.00 ? 14 VAL A CB   1  
ATOM 178   C CG1  . VAL A 1 14 ? 8.163   1.271   -0.459  1.00 0.00 ? 14 VAL A CG1  1  
ATOM 179   C CG2  . VAL A 1 14 ? 5.786   1.972   -0.817  1.00 0.00 ? 14 VAL A CG2  1  
ATOM 180   H H    . VAL A 1 14 ? 6.660   4.272   0.373   1.00 0.00 ? 14 VAL A H    1  
ATOM 181   H HA   . VAL A 1 14 ? 8.694   3.603   -1.656  1.00 0.00 ? 14 VAL A HA   1  
ATOM 182   H HB   . VAL A 1 14 ? 7.254   1.701   -2.327  1.00 0.00 ? 14 VAL A HB   1  
ATOM 183   H HG11 . VAL A 1 14 ? 8.302   1.762   0.492   1.00 0.00 ? 14 VAL A HG11 1  
ATOM 184   H HG12 . VAL A 1 14 ? 9.117   1.179   -0.959  1.00 0.00 ? 14 VAL A HG12 1  
ATOM 185   H HG13 . VAL A 1 14 ? 7.745   0.288   -0.299  1.00 0.00 ? 14 VAL A HG13 1  
ATOM 186   H HG21 . VAL A 1 14 ? 5.739   2.296   0.213   1.00 0.00 ? 14 VAL A HG21 1  
ATOM 187   H HG22 . VAL A 1 14 ? 5.465   0.944   -0.885  1.00 0.00 ? 14 VAL A HG22 1  
ATOM 188   H HG23 . VAL A 1 14 ? 5.139   2.592   -1.419  1.00 0.00 ? 14 VAL A HG23 1  
ATOM 189   N N    . LEU A 1 15 ? 7.209   4.201   -3.652  1.00 0.00 ? 15 LEU A N    1  
ATOM 190   C CA   . LEU A 1 15 ? 6.493   4.865   -4.736  1.00 0.00 ? 15 LEU A CA   1  
ATOM 191   C C    . LEU A 1 15 ? 5.393   3.966   -5.293  1.00 0.00 ? 15 LEU A C    1  
ATOM 192   O O    . LEU A 1 15 ? 5.637   2.809   -5.634  1.00 0.00 ? 15 LEU A O    1  
ATOM 193   C CB   . LEU A 1 15 ? 7.463   5.255   -5.853  1.00 0.00 ? 15 LEU A CB   1  
ATOM 194   C CG   . LEU A 1 15 ? 7.049   6.479   -6.672  1.00 0.00 ? 15 LEU A CG   1  
ATOM 195   C CD1  . LEU A 1 15 ? 6.796   7.670   -5.761  1.00 0.00 ? 15 LEU A CD1  1  
ATOM 196   C CD2  . LEU A 1 15 ? 8.115   6.812   -7.705  1.00 0.00 ? 15 LEU A CD2  1  
ATOM 197   H H    . LEU A 1 15 ? 8.000   3.662   -3.864  1.00 0.00 ? 15 LEU A H    1  
ATOM 198   H HA   . LEU A 1 15 ? 6.040   5.760   -4.335  1.00 0.00 ? 15 LEU A HA   1  
ATOM 199   H HB2  . LEU A 1 15 ? 8.428   5.453   -5.409  1.00 0.00 ? 15 LEU A HB2  1  
ATOM 200   H HB3  . LEU A 1 15 ? 7.560   4.416   -6.527  1.00 0.00 ? 15 LEU A HB3  1  
ATOM 201   H HG   . LEU A 1 15 ? 6.130   6.259   -7.197  1.00 0.00 ? 15 LEU A HG   1  
ATOM 202   H HD11 . LEU A 1 15 ? 7.380   7.563   -4.858  1.00 0.00 ? 15 LEU A HD11 1  
ATOM 203   H HD12 . LEU A 1 15 ? 5.747   7.713   -5.508  1.00 0.00 ? 15 LEU A HD12 1  
ATOM 204   H HD13 . LEU A 1 15 ? 7.082   8.578   -6.269  1.00 0.00 ? 15 LEU A HD13 1  
ATOM 205   H HD21 . LEU A 1 15 ? 7.652   7.274   -8.564  1.00 0.00 ? 15 LEU A HD21 1  
ATOM 206   H HD22 . LEU A 1 15 ? 8.617   5.906   -8.010  1.00 0.00 ? 15 LEU A HD22 1  
ATOM 207   H HD23 . LEU A 1 15 ? 8.833   7.494   -7.274  1.00 0.00 ? 15 LEU A HD23 1  
ATOM 208   N N    . VAL A 1 16 ? 4.182   4.508   -5.381  1.00 0.00 ? 16 VAL A N    1  
ATOM 209   C CA   . VAL A 1 16 ? 3.044   3.755   -5.898  1.00 0.00 ? 16 VAL A CA   1  
ATOM 210   C C    . VAL A 1 16 ? 2.493   4.395   -7.167  1.00 0.00 ? 16 VAL A C    1  
ATOM 211   O O    . VAL A 1 16 ? 1.870   5.455   -7.118  1.00 0.00 ? 16 VAL A O    1  
ATOM 212   C CB   . VAL A 1 16 ? 1.916   3.656   -4.855  1.00 0.00 ? 16 VAL A CB   1  
ATOM 213   C CG1  . VAL A 1 16 ? 0.829   2.704   -5.330  1.00 0.00 ? 16 VAL A CG1  1  
ATOM 214   C CG2  . VAL A 1 16 ? 2.470   3.215   -3.508  1.00 0.00 ? 16 VAL A CG2  1  
ATOM 215   H H    . VAL A 1 16 ? 4.051   5.435   -5.093  1.00 0.00 ? 16 VAL A H    1  
ATOM 216   H HA   . VAL A 1 16 ? 3.382   2.755   -6.128  1.00 0.00 ? 16 VAL A HA   1  
ATOM 217   H HB   . VAL A 1 16 ? 1.476   4.636   -4.735  1.00 0.00 ? 16 VAL A HB   1  
ATOM 218   H HG11 . VAL A 1 16 ? -0.136  3.077   -5.022  1.00 0.00 ? 16 VAL A HG11 1  
ATOM 219   H HG12 . VAL A 1 16 ? 0.993   1.727   -4.899  1.00 0.00 ? 16 VAL A HG12 1  
ATOM 220   H HG13 . VAL A 1 16 ? 0.861   2.631   -6.408  1.00 0.00 ? 16 VAL A HG13 1  
ATOM 221   H HG21 . VAL A 1 16 ? 2.710   4.084   -2.915  1.00 0.00 ? 16 VAL A HG21 1  
ATOM 222   H HG22 . VAL A 1 16 ? 3.362   2.627   -3.661  1.00 0.00 ? 16 VAL A HG22 1  
ATOM 223   H HG23 . VAL A 1 16 ? 1.731   2.620   -2.992  1.00 0.00 ? 16 VAL A HG23 1  
ATOM 224   N N    . GLY A 1 17 ? 2.726   3.743   -8.301  1.00 0.00 ? 17 GLY A N    1  
ATOM 225   C CA   . GLY A 1 17 ? 2.244   4.264   -9.567  1.00 0.00 ? 17 GLY A CA   1  
ATOM 226   C C    . GLY A 1 17 ? 3.312   5.031   -10.322 1.00 0.00 ? 17 GLY A C    1  
ATOM 227   O O    . GLY A 1 17 ? 3.338   5.024   -11.553 1.00 0.00 ? 17 GLY A O    1  
ATOM 228   H H    . GLY A 1 17 ? 3.228   2.902   -8.278  1.00 0.00 ? 17 GLY A H    1  
ATOM 229   H HA2  . GLY A 1 17 ? 1.909   3.440   -10.179 1.00 0.00 ? 17 GLY A HA2  1  
ATOM 230   H HA3  . GLY A 1 17 ? 1.409   4.923   -9.379  1.00 0.00 ? 17 GLY A HA3  1  
ATOM 231   N N    . GLY A 1 18 ? 4.194   5.697   -9.583  1.00 0.00 ? 18 GLY A N    1  
ATOM 232   C CA   . GLY A 1 18 ? 5.257   6.463   -10.208 1.00 0.00 ? 18 GLY A CA   1  
ATOM 233   C C    . GLY A 1 18 ? 5.102   7.955   -9.988  1.00 0.00 ? 18 GLY A C    1  
ATOM 234   O O    . GLY A 1 18 ? 5.490   8.757   -10.838 1.00 0.00 ? 18 GLY A O    1  
ATOM 235   H H    . GLY A 1 18 ? 4.124   5.666   -8.606  1.00 0.00 ? 18 GLY A H    1  
ATOM 236   H HA2  . GLY A 1 18 ? 6.204   6.146   -9.795  1.00 0.00 ? 18 GLY A HA2  1  
ATOM 237   H HA3  . GLY A 1 18 ? 5.256   6.264   -11.269 1.00 0.00 ? 18 GLY A HA3  1  
ATOM 238   N N    . THR A 1 19 ? 4.532   8.327   -8.847  1.00 0.00 ? 19 THR A N    1  
ATOM 239   C CA   . THR A 1 19 ? 4.325   9.732   -8.518  1.00 0.00 ? 19 THR A CA   1  
ATOM 240   C C    . THR A 1 19 ? 3.805   9.887   -7.093  1.00 0.00 ? 19 THR A C    1  
ATOM 241   O O    . THR A 1 19 ? 4.256   10.755  -6.347  1.00 0.00 ? 19 THR A O    1  
ATOM 242   C CB   . THR A 1 19 ? 3.345   10.369  -9.505  1.00 0.00 ? 19 THR A CB   1  
ATOM 243   O OG1  . THR A 1 19 ? 2.492   9.389   -10.068 1.00 0.00 ? 19 THR A OG1  1  
ATOM 244   C CG2  . THR A 1 19 ? 4.028   11.092  -10.646 1.00 0.00 ? 19 THR A CG2  1  
ATOM 245   H H    . THR A 1 19 ? 4.245   7.640   -8.210  1.00 0.00 ? 19 THR A H    1  
ATOM 246   H HA   . THR A 1 19 ? 5.278   10.235  -8.597  1.00 0.00 ? 19 THR A HA   1  
ATOM 247   H HB   . THR A 1 19 ? 2.733   11.088  -8.978  1.00 0.00 ? 19 THR A HB   1  
ATOM 248   H HG1  . THR A 1 19 ? 1.585   9.703   -10.049 1.00 0.00 ? 19 THR A HG1  1  
ATOM 249   H HG21 . THR A 1 19 ? 3.801   12.147  -10.592 1.00 0.00 ? 19 THR A HG21 1  
ATOM 250   H HG22 . THR A 1 19 ? 3.676   10.696  -11.586 1.00 0.00 ? 19 THR A HG22 1  
ATOM 251   H HG23 . THR A 1 19 ? 5.096   10.950  -10.573 1.00 0.00 ? 19 THR A HG23 1  
ATOM 252   N N    . LYS A 1 20 ? 2.852   9.037   -6.722  1.00 0.00 ? 20 LYS A N    1  
ATOM 253   C CA   . LYS A 1 20 ? 2.269   9.078   -5.386  1.00 0.00 ? 20 LYS A CA   1  
ATOM 254   C C    . LYS A 1 20 ? 3.166   8.364   -4.379  1.00 0.00 ? 20 LYS A C    1  
ATOM 255   O O    . LYS A 1 20 ? 3.344   7.148   -4.445  1.00 0.00 ? 20 LYS A O    1  
ATOM 256   C CB   . LYS A 1 20 ? 0.880   8.437   -5.394  1.00 0.00 ? 20 LYS A CB   1  
ATOM 257   C CG   . LYS A 1 20 ? -0.068  9.055   -6.409  1.00 0.00 ? 20 LYS A CG   1  
ATOM 258   C CD   . LYS A 1 20 ? -0.701  7.997   -7.301  1.00 0.00 ? 20 LYS A CD   1  
ATOM 259   C CE   . LYS A 1 20 ? -1.786  8.590   -8.184  1.00 0.00 ? 20 LYS A CE   1  
ATOM 260   N NZ   . LYS A 1 20 ? -1.291  8.871   -9.561  1.00 0.00 ? 20 LYS A NZ   1  
ATOM 261   H H    . LYS A 1 20 ? 2.533   8.367   -7.362  1.00 0.00 ? 20 LYS A H    1  
ATOM 262   H HA   . LYS A 1 20 ? 2.176   10.114  -5.096  1.00 0.00 ? 20 LYS A HA   1  
ATOM 263   H HB2  . LYS A 1 20 ? 0.983   7.386   -5.620  1.00 0.00 ? 20 LYS A HB2  1  
ATOM 264   H HB3  . LYS A 1 20 ? 0.442   8.544   -4.412  1.00 0.00 ? 20 LYS A HB3  1  
ATOM 265   H HG2  . LYS A 1 20 ? -0.851  9.580   -5.883  1.00 0.00 ? 20 LYS A HG2  1  
ATOM 266   H HG3  . LYS A 1 20 ? 0.483   9.750   -7.025  1.00 0.00 ? 20 LYS A HG3  1  
ATOM 267   H HD2  . LYS A 1 20 ? 0.064   7.565   -7.929  1.00 0.00 ? 20 LYS A HD2  1  
ATOM 268   H HD3  . LYS A 1 20 ? -1.134  7.228   -6.679  1.00 0.00 ? 20 LYS A HD3  1  
ATOM 269   H HE2  . LYS A 1 20 ? -2.607  7.890   -8.244  1.00 0.00 ? 20 LYS A HE2  1  
ATOM 270   H HE3  . LYS A 1 20 ? -2.132  9.512   -7.739  1.00 0.00 ? 20 LYS A HE3  1  
ATOM 271   H HZ1  . LYS A 1 20 ? -1.727  9.742   -9.926  1.00 0.00 ? 20 LYS A HZ1  1  
ATOM 272   H HZ2  . LYS A 1 20 ? -1.532  8.084   -10.195 1.00 0.00 ? 20 LYS A HZ2  1  
ATOM 273   H HZ3  . LYS A 1 20 ? -0.258  8.990   -9.552  1.00 0.00 ? 20 LYS A HZ3  1  
ATOM 274   N N    . THR A 1 21 ? 3.727   9.129   -3.449  1.00 0.00 ? 21 THR A N    1  
ATOM 275   C CA   . THR A 1 21 ? 4.605   8.569   -2.427  1.00 0.00 ? 21 THR A CA   1  
ATOM 276   C C    . THR A 1 21 ? 3.809   8.145   -1.198  1.00 0.00 ? 21 THR A C    1  
ATOM 277   O O    . THR A 1 21 ? 2.986   8.904   -0.687  1.00 0.00 ? 21 THR A O    1  
ATOM 278   C CB   . THR A 1 21 ? 5.675   9.587   -2.031  1.00 0.00 ? 21 THR A CB   1  
ATOM 279   O OG1  . THR A 1 21 ? 5.080   10.756  -1.496  1.00 0.00 ? 21 THR A OG1  1  
ATOM 280   C CG2  . THR A 1 21 ? 6.557   10.008  -3.185  1.00 0.00 ? 21 THR A CG2  1  
ATOM 281   H H    . THR A 1 21 ? 3.546   10.092  -3.447  1.00 0.00 ? 21 THR A H    1  
ATOM 282   H HA   . THR A 1 21 ? 5.088   7.698   -2.847  1.00 0.00 ? 21 THR A HA   1  
ATOM 283   H HB   . THR A 1 21 ? 6.308   9.152   -1.271  1.00 0.00 ? 21 THR A HB   1  
ATOM 284   H HG1  . THR A 1 21 ? 4.612   11.225  -2.191  1.00 0.00 ? 21 THR A HG1  1  
ATOM 285   H HG21 . THR A 1 21 ? 7.378   10.604  -2.813  1.00 0.00 ? 21 THR A HG21 1  
ATOM 286   H HG22 . THR A 1 21 ? 5.979   10.592  -3.887  1.00 0.00 ? 21 THR A HG22 1  
ATOM 287   H HG23 . THR A 1 21 ? 6.945   9.131   -3.681  1.00 0.00 ? 21 THR A HG23 1  
ATOM 288   N N    . GLY A 1 22 ? 4.058   6.926   -0.729  1.00 0.00 ? 22 GLY A N    1  
ATOM 289   C CA   . GLY A 1 22 ? 3.356   6.422   0.437   1.00 0.00 ? 22 GLY A CA   1  
ATOM 290   C C    . GLY A 1 22 ? 4.178   5.419   1.221   1.00 0.00 ? 22 GLY A C    1  
ATOM 291   O O    . GLY A 1 22 ? 4.994   4.694   0.651   1.00 0.00 ? 22 GLY A O    1  
ATOM 292   H H    . GLY A 1 22 ? 4.724   6.365   -1.177  1.00 0.00 ? 22 GLY A H    1  
ATOM 293   H HA2  . GLY A 1 22 ? 3.111   7.253   1.083   1.00 0.00 ? 22 GLY A HA2  1  
ATOM 294   H HA3  . GLY A 1 22 ? 2.441   5.948   0.115   1.00 0.00 ? 22 GLY A HA3  1  
ATOM 295   N N    . VAL A 1 23 ? 3.964   5.376   2.531   1.00 0.00 ? 23 VAL A N    1  
ATOM 296   C CA   . VAL A 1 23 ? 4.691   4.453   3.395   1.00 0.00 ? 23 VAL A CA   1  
ATOM 297   C C    . VAL A 1 23 ? 3.960   3.120   3.513   1.00 0.00 ? 23 VAL A C    1  
ATOM 298   O O    . VAL A 1 23 ? 2.735   3.081   3.631   1.00 0.00 ? 23 VAL A O    1  
ATOM 299   C CB   . VAL A 1 23 ? 4.893   5.042   4.805   1.00 0.00 ? 23 VAL A CB   1  
ATOM 300   C CG1  . VAL A 1 23 ? 5.786   4.138   5.641   1.00 0.00 ? 23 VAL A CG1  1  
ATOM 301   C CG2  . VAL A 1 23 ? 5.476   6.446   4.720   1.00 0.00 ? 23 VAL A CG2  1  
ATOM 302   H H    . VAL A 1 23 ? 3.300   5.978   2.928   1.00 0.00 ? 23 VAL A H    1  
ATOM 303   H HA   . VAL A 1 23 ? 5.663   4.282   2.957   1.00 0.00 ? 23 VAL A HA   1  
ATOM 304   H HB   . VAL A 1 23 ? 3.929   5.105   5.288   1.00 0.00 ? 23 VAL A HB   1  
ATOM 305   H HG11 . VAL A 1 23 ? 5.336   3.158   5.717   1.00 0.00 ? 23 VAL A HG11 1  
ATOM 306   H HG12 . VAL A 1 23 ? 5.900   4.558   6.630   1.00 0.00 ? 23 VAL A HG12 1  
ATOM 307   H HG13 . VAL A 1 23 ? 6.754   4.054   5.171   1.00 0.00 ? 23 VAL A HG13 1  
ATOM 308   H HG21 . VAL A 1 23 ? 6.534   6.410   4.930   1.00 0.00 ? 23 VAL A HG21 1  
ATOM 309   H HG22 . VAL A 1 23 ? 4.987   7.082   5.443   1.00 0.00 ? 23 VAL A HG22 1  
ATOM 310   H HG23 . VAL A 1 23 ? 5.318   6.843   3.729   1.00 0.00 ? 23 VAL A HG23 1  
ATOM 311   N N    . VAL A 1 24 ? 4.719   2.030   3.483   1.00 0.00 ? 24 VAL A N    1  
ATOM 312   C CA   . VAL A 1 24 ? 4.143   0.694   3.587   1.00 0.00 ? 24 VAL A CA   1  
ATOM 313   C C    . VAL A 1 24 ? 3.520   0.471   4.961   1.00 0.00 ? 24 VAL A C    1  
ATOM 314   O O    . VAL A 1 24 ? 4.163   0.692   5.987   1.00 0.00 ? 24 VAL A O    1  
ATOM 315   C CB   . VAL A 1 24 ? 5.201   -0.397  3.331   1.00 0.00 ? 24 VAL A CB   1  
ATOM 316   C CG1  . VAL A 1 24 ? 4.552   -1.772  3.289   1.00 0.00 ? 24 VAL A CG1  1  
ATOM 317   C CG2  . VAL A 1 24 ? 5.957   -0.117  2.040   1.00 0.00 ? 24 VAL A CG2  1  
ATOM 318   H H    . VAL A 1 24 ? 5.690   2.125   3.388   1.00 0.00 ? 24 VAL A H    1  
ATOM 319   H HA   . VAL A 1 24 ? 3.373   0.604   2.834   1.00 0.00 ? 24 VAL A HA   1  
ATOM 320   H HB   . VAL A 1 24 ? 5.907   -0.383  4.148   1.00 0.00 ? 24 VAL A HB   1  
ATOM 321   H HG11 . VAL A 1 24 ? 3.908   -1.841  2.424   1.00 0.00 ? 24 VAL A HG11 1  
ATOM 322   H HG12 . VAL A 1 24 ? 3.967   -1.922  4.184   1.00 0.00 ? 24 VAL A HG12 1  
ATOM 323   H HG13 . VAL A 1 24 ? 5.319   -2.530  3.228   1.00 0.00 ? 24 VAL A HG13 1  
ATOM 324   H HG21 . VAL A 1 24 ? 5.576   -0.753  1.255   1.00 0.00 ? 24 VAL A HG21 1  
ATOM 325   H HG22 . VAL A 1 24 ? 7.007   -0.320  2.188   1.00 0.00 ? 24 VAL A HG22 1  
ATOM 326   H HG23 . VAL A 1 24 ? 5.826   0.918   1.762   1.00 0.00 ? 24 VAL A HG23 1  
ATOM 327   N N    . ARG A 1 25 ? 2.266   0.033   4.972   1.00 0.00 ? 25 ARG A N    1  
ATOM 328   C CA   . ARG A 1 25 ? 1.555   -0.221  6.221   1.00 0.00 ? 25 ARG A CA   1  
ATOM 329   C C    . ARG A 1 25 ? 1.327   -1.716  6.422   1.00 0.00 ? 25 ARG A C    1  
ATOM 330   O O    . ARG A 1 25 ? 1.314   -2.205  7.553   1.00 0.00 ? 25 ARG A O    1  
ATOM 331   C CB   . ARG A 1 25 ? 0.216   0.519   6.229   1.00 0.00 ? 25 ARG A CB   1  
ATOM 332   C CG   . ARG A 1 25 ? 0.246   1.818   7.019   1.00 0.00 ? 25 ARG A CG   1  
ATOM 333   C CD   . ARG A 1 25 ? -0.045  1.580   8.492   1.00 0.00 ? 25 ARG A CD   1  
ATOM 334   N NE   . ARG A 1 25 ? -0.386  2.817   9.189   1.00 0.00 ? 25 ARG A NE   1  
ATOM 335   C CZ   . ARG A 1 25 ? 0.511   3.710   9.599   1.00 0.00 ? 25 ARG A CZ   1  
ATOM 336   N NH1  . ARG A 1 25 ? 1.805   3.507   9.383   1.00 0.00 ? 25 ARG A NH1  1  
ATOM 337   N NH2  . ARG A 1 25 ? 0.116   4.808   10.227  1.00 0.00 ? 25 ARG A NH2  1  
ATOM 338   H H    . ARG A 1 25 ? 1.806   -0.126  4.121   1.00 0.00 ? 25 ARG A H    1  
ATOM 339   H HA   . ARG A 1 25 ? 2.167   0.150   7.030   1.00 0.00 ? 25 ARG A HA   1  
ATOM 340   H HB2  . ARG A 1 25 ? -0.062  0.749   5.211   1.00 0.00 ? 25 ARG A HB2  1  
ATOM 341   H HB3  . ARG A 1 25 ? -0.536  -0.122  6.663   1.00 0.00 ? 25 ARG A HB3  1  
ATOM 342   H HG2  . ARG A 1 25 ? 1.224   2.265   6.924   1.00 0.00 ? 25 ARG A HG2  1  
ATOM 343   H HG3  . ARG A 1 25 ? -0.500  2.489   6.618   1.00 0.00 ? 25 ARG A HG3  1  
ATOM 344   H HD2  . ARG A 1 25 ? -0.872  0.892   8.576   1.00 0.00 ? 25 ARG A HD2  1  
ATOM 345   H HD3  . ARG A 1 25 ? 0.830   1.148   8.953   1.00 0.00 ? 25 ARG A HD3  1  
ATOM 346   H HE   . ARG A 1 25 ? -1.335  2.993   9.362   1.00 0.00 ? 25 ARG A HE   1  
ATOM 347   H HH11 . ARG A 1 25 ? 2.111   2.681   8.910   1.00 0.00 ? 25 ARG A HH11 1  
ATOM 348   H HH12 . ARG A 1 25 ? 2.475   4.181   9.693   1.00 0.00 ? 25 ARG A HH12 1  
ATOM 349   H HH21 . ARG A 1 25 ? -0.858  4.967   10.393  1.00 0.00 ? 25 ARG A HH21 1  
ATOM 350   H HH22 . ARG A 1 25 ? 0.791   5.479   10.536  1.00 0.00 ? 25 ARG A HH22 1  
ATOM 351   N N    . TYR A 1 26 ? 1.147   -2.436  5.321   1.00 0.00 ? 26 TYR A N    1  
ATOM 352   C CA   . TYR A 1 26 ? 0.918   -3.875  5.378   1.00 0.00 ? 26 TYR A CA   1  
ATOM 353   C C    . TYR A 1 26 ? 1.662   -4.589  4.253   1.00 0.00 ? 26 TYR A C    1  
ATOM 354   O O    . TYR A 1 26 ? 1.824   -4.047  3.160   1.00 0.00 ? 26 TYR A O    1  
ATOM 355   C CB   . TYR A 1 26 ? -0.579  -4.178  5.288   1.00 0.00 ? 26 TYR A CB   1  
ATOM 356   C CG   . TYR A 1 26 ? -0.908  -5.648  5.418   1.00 0.00 ? 26 TYR A CG   1  
ATOM 357   C CD1  . TYR A 1 26 ? -0.723  -6.317  6.622   1.00 0.00 ? 26 TYR A CD1  1  
ATOM 358   C CD2  . TYR A 1 26 ? -1.405  -6.366  4.338   1.00 0.00 ? 26 TYR A CD2  1  
ATOM 359   C CE1  . TYR A 1 26 ? -1.023  -7.660  6.745   1.00 0.00 ? 26 TYR A CE1  1  
ATOM 360   C CE2  . TYR A 1 26 ? -1.707  -7.711  4.454   1.00 0.00 ? 26 TYR A CE2  1  
ATOM 361   C CZ   . TYR A 1 26 ? -1.515  -8.352  5.658   1.00 0.00 ? 26 TYR A CZ   1  
ATOM 362   O OH   . TYR A 1 26 ? -1.814  -9.690  5.776   1.00 0.00 ? 26 TYR A OH   1  
ATOM 363   H H    . TYR A 1 26 ? 1.167   -1.990  4.448   1.00 0.00 ? 26 TYR A H    1  
ATOM 364   H HA   . TYR A 1 26 ? 1.292   -4.232  6.325   1.00 0.00 ? 26 TYR A HA   1  
ATOM 365   H HB2  . TYR A 1 26 ? -1.093  -3.652  6.078   1.00 0.00 ? 26 TYR A HB2  1  
ATOM 366   H HB3  . TYR A 1 26 ? -0.951  -3.837  4.333   1.00 0.00 ? 26 TYR A HB3  1  
ATOM 367   H HD1  . TYR A 1 26 ? -0.338  -5.773  7.470   1.00 0.00 ? 26 TYR A HD1  1  
ATOM 368   H HD2  . TYR A 1 26 ? -1.554  -5.861  3.395   1.00 0.00 ? 26 TYR A HD2  1  
ATOM 369   H HE1  . TYR A 1 26 ? -0.872  -8.163  7.688   1.00 0.00 ? 26 TYR A HE1  1  
ATOM 370   H HE2  . TYR A 1 26 ? -2.093  -8.252  3.601   1.00 0.00 ? 26 TYR A HE2  1  
ATOM 371   H HH   . TYR A 1 26 ? -2.231  -9.851  6.626   1.00 0.00 ? 26 TYR A HH   1  
ATOM 372   N N    . VAL A 1 27 ? 2.110   -5.809  4.530   1.00 0.00 ? 27 VAL A N    1  
ATOM 373   C CA   . VAL A 1 27 ? 2.837   -6.598  3.543   1.00 0.00 ? 27 VAL A CA   1  
ATOM 374   C C    . VAL A 1 27 ? 2.522   -8.083  3.687   1.00 0.00 ? 27 VAL A C    1  
ATOM 375   O O    . VAL A 1 27 ? 2.772   -8.682  4.734   1.00 0.00 ? 27 VAL A O    1  
ATOM 376   C CB   . VAL A 1 27 ? 4.358   -6.393  3.668   1.00 0.00 ? 27 VAL A CB   1  
ATOM 377   C CG1  . VAL A 1 27 ? 5.087   -7.074  2.519   1.00 0.00 ? 27 VAL A CG1  1  
ATOM 378   C CG2  . VAL A 1 27 ? 4.695   -4.910  3.717   1.00 0.00 ? 27 VAL A CG2  1  
ATOM 379   H H    . VAL A 1 27 ? 1.950   -6.187  5.420   1.00 0.00 ? 27 VAL A H    1  
ATOM 380   H HA   . VAL A 1 27 ? 2.529   -6.270  2.560   1.00 0.00 ? 27 VAL A HA   1  
ATOM 381   H HB   . VAL A 1 27 ? 4.687   -6.846  4.591   1.00 0.00 ? 27 VAL A HB   1  
ATOM 382   H HG11 . VAL A 1 27 ? 5.983   -7.548  2.891   1.00 0.00 ? 27 VAL A HG11 1  
ATOM 383   H HG12 . VAL A 1 27 ? 5.352   -6.339  1.774   1.00 0.00 ? 27 VAL A HG12 1  
ATOM 384   H HG13 . VAL A 1 27 ? 4.444   -7.820  2.075   1.00 0.00 ? 27 VAL A HG13 1  
ATOM 385   H HG21 . VAL A 1 27 ? 5.723   -4.765  3.423   1.00 0.00 ? 27 VAL A HG21 1  
ATOM 386   H HG22 . VAL A 1 27 ? 4.552   -4.542  4.722   1.00 0.00 ? 27 VAL A HG22 1  
ATOM 387   H HG23 . VAL A 1 27 ? 4.047   -4.372  3.042   1.00 0.00 ? 27 VAL A HG23 1  
ATOM 388   N N    . GLY A 1 28 ? 1.973   -8.673  2.632   1.00 0.00 ? 28 GLY A N    1  
ATOM 389   C CA   . GLY A 1 28 ? 1.633   -10.084 2.662   1.00 0.00 ? 28 GLY A CA   1  
ATOM 390   C C    . GLY A 1 28 ? 0.470   -10.421 1.750   1.00 0.00 ? 28 GLY A C    1  
ATOM 391   O O    . GLY A 1 28 ? -0.044  -9.555  1.042   1.00 0.00 ? 28 GLY A O    1  
ATOM 392   H H    . GLY A 1 28 ? 1.796   -8.146  1.824   1.00 0.00 ? 28 GLY A H    1  
ATOM 393   H HA2  . GLY A 1 28 ? 2.495   -10.657 2.354   1.00 0.00 ? 28 GLY A HA2  1  
ATOM 394   H HA3  . GLY A 1 28 ? 1.374   -10.358 3.675   1.00 0.00 ? 28 GLY A HA3  1  
ATOM 395   N N    . GLU A 1 29 ? 0.053   -11.683 1.769   1.00 0.00 ? 29 GLU A N    1  
ATOM 396   C CA   . GLU A 1 29 ? -1.058  -12.133 0.938   1.00 0.00 ? 29 GLU A CA   1  
ATOM 397   C C    . GLU A 1 29 ? -2.368  -11.498 1.391   1.00 0.00 ? 29 GLU A C    1  
ATOM 398   O O    . GLU A 1 29 ? -2.470  -10.991 2.508   1.00 0.00 ? 29 GLU A O    1  
ATOM 399   C CB   . GLU A 1 29 ? -1.174  -13.658 0.986   1.00 0.00 ? 29 GLU A CB   1  
ATOM 400   C CG   . GLU A 1 29 ? 0.084   -14.378 0.530   1.00 0.00 ? 29 GLU A CG   1  
ATOM 401   C CD   . GLU A 1 29 ? -0.205  -15.755 -0.036  1.00 0.00 ? 29 GLU A CD   1  
ATOM 402   O OE1  . GLU A 1 29 ? -1.154  -15.880 -0.837  1.00 0.00 ? 29 GLU A OE1  1  
ATOM 403   O OE2  . GLU A 1 29 ? 0.518   -16.708 0.323   1.00 0.00 ? 29 GLU A OE2  1  
ATOM 404   H H    . GLU A 1 29 ? 0.503   -12.327 2.355   1.00 0.00 ? 29 GLU A H    1  
ATOM 405   H HA   . GLU A 1 29 ? -0.855  -11.828 -0.078  1.00 0.00 ? 29 GLU A HA   1  
ATOM 406   H HB2  . GLU A 1 29 ? -1.387  -13.959 2.001   1.00 0.00 ? 29 GLU A HB2  1  
ATOM 407   H HB3  . GLU A 1 29 ? -1.989  -13.965 0.349   1.00 0.00 ? 29 GLU A HB3  1  
ATOM 408   H HG2  . GLU A 1 29 ? 0.567   -13.786 -0.233  1.00 0.00 ? 29 GLU A HG2  1  
ATOM 409   H HG3  . GLU A 1 29 ? 0.750   -14.485 1.376   1.00 0.00 ? 29 GLU A HG3  1  
ATOM 410   N N    . THR A 1 30 ? -3.368  -11.527 0.516   1.00 0.00 ? 30 THR A N    1  
ATOM 411   C CA   . THR A 1 30 ? -4.672  -10.955 0.826   1.00 0.00 ? 30 THR A CA   1  
ATOM 412   C C    . THR A 1 30 ? -5.754  -12.030 0.814   1.00 0.00 ? 30 THR A C    1  
ATOM 413   O O    . THR A 1 30 ? -5.458  -13.221 0.730   1.00 0.00 ? 30 THR A O    1  
ATOM 414   C CB   . THR A 1 30 ? -5.021  -9.854  -0.176  1.00 0.00 ? 30 THR A CB   1  
ATOM 415   O OG1  . THR A 1 30 ? -5.313  -10.407 -1.447  1.00 0.00 ? 30 THR A OG1  1  
ATOM 416   C CG2  . THR A 1 30 ? -3.913  -8.839  -0.361  1.00 0.00 ? 30 THR A CG2  1  
ATOM 417   H H    . THR A 1 30 ? -3.225  -11.945 -0.360  1.00 0.00 ? 30 THR A H    1  
ATOM 418   H HA   . THR A 1 30 ? -4.619  -10.525 1.815   1.00 0.00 ? 30 THR A HA   1  
ATOM 419   H HB   . THR A 1 30 ? -5.897  -9.327  0.173   1.00 0.00 ? 30 THR A HB   1  
ATOM 420   H HG1  . THR A 1 30 ? -4.511  -10.771 -1.830  1.00 0.00 ? 30 THR A HG1  1  
ATOM 421   H HG21 . THR A 1 30 ? -4.294  -7.984  -0.899  1.00 0.00 ? 30 THR A HG21 1  
ATOM 422   H HG22 . THR A 1 30 ? -3.105  -9.285  -0.921  1.00 0.00 ? 30 THR A HG22 1  
ATOM 423   H HG23 . THR A 1 30 ? -3.550  -8.523  0.606   1.00 0.00 ? 30 THR A HG23 1  
ATOM 424   N N    . ASP A 1 31 ? -7.010  -11.600 0.901   1.00 0.00 ? 31 ASP A N    1  
ATOM 425   C CA   . ASP A 1 31 ? -8.135  -12.527 0.901   1.00 0.00 ? 31 ASP A CA   1  
ATOM 426   C C    . ASP A 1 31 ? -9.118  -12.189 -0.216  1.00 0.00 ? 31 ASP A C    1  
ATOM 427   O O    . ASP A 1 31 ? -10.322 -12.409 -0.085  1.00 0.00 ? 31 ASP A O    1  
ATOM 428   C CB   . ASP A 1 31 ? -8.851  -12.492 2.252   1.00 0.00 ? 31 ASP A CB   1  
ATOM 429   C CG   . ASP A 1 31 ? -8.062  -13.191 3.343   1.00 0.00 ? 31 ASP A CG   1  
ATOM 430   O OD1  . ASP A 1 31 ? -7.579  -14.316 3.097   1.00 0.00 ? 31 ASP A OD1  1  
ATOM 431   O OD2  . ASP A 1 31 ? -7.926  -12.612 4.441   1.00 0.00 ? 31 ASP A OD2  1  
ATOM 432   H H    . ASP A 1 31 ? -7.182  -10.638 0.967   1.00 0.00 ? 31 ASP A H    1  
ATOM 433   H HA   . ASP A 1 31 ? -7.748  -13.520 0.735   1.00 0.00 ? 31 ASP A HA   1  
ATOM 434   H HB2  . ASP A 1 31 ? -9.003  -11.465 2.547   1.00 0.00 ? 31 ASP A HB2  1  
ATOM 435   H HB3  . ASP A 1 31 ? -9.810  -12.981 2.158   1.00 0.00 ? 31 ASP A HB3  1  
ATOM 436   N N    . PHE A 1 32 ? -8.597  -11.656 -1.316  1.00 0.00 ? 32 PHE A N    1  
ATOM 437   C CA   . PHE A 1 32 ? -9.428  -11.289 -2.456  1.00 0.00 ? 32 PHE A CA   1  
ATOM 438   C C    . PHE A 1 32 ? -8.742  -11.650 -3.769  1.00 0.00 ? 32 PHE A C    1  
ATOM 439   O O    . PHE A 1 32 ? -9.356  -12.237 -4.661  1.00 0.00 ? 32 PHE A O    1  
ATOM 440   C CB   . PHE A 1 32 ? -9.742  -9.793  -2.426  1.00 0.00 ? 32 PHE A CB   1  
ATOM 441   C CG   . PHE A 1 32 ? -8.526  -8.920  -2.552  1.00 0.00 ? 32 PHE A CG   1  
ATOM 442   C CD1  . PHE A 1 32 ? -8.073  -8.516  -3.797  1.00 0.00 ? 32 PHE A CD1  1  
ATOM 443   C CD2  . PHE A 1 32 ? -7.835  -8.504  -1.425  1.00 0.00 ? 32 PHE A CD2  1  
ATOM 444   C CE1  . PHE A 1 32 ? -6.955  -7.712  -3.918  1.00 0.00 ? 32 PHE A CE1  1  
ATOM 445   C CE2  . PHE A 1 32 ? -6.716  -7.701  -1.538  1.00 0.00 ? 32 PHE A CE2  1  
ATOM 446   C CZ   . PHE A 1 32 ? -6.275  -7.306  -2.786  1.00 0.00 ? 32 PHE A CZ   1  
ATOM 447   H H    . PHE A 1 32 ? -7.629  -11.504 -1.362  1.00 0.00 ? 32 PHE A H    1  
ATOM 448   H HA   . PHE A 1 32 ? -10.352 -11.843 -2.383  1.00 0.00 ? 32 PHE A HA   1  
ATOM 449   H HB2  . PHE A 1 32 ? -10.407 -9.554  -3.243  1.00 0.00 ? 32 PHE A HB2  1  
ATOM 450   H HB3  . PHE A 1 32 ? -10.229 -9.553  -1.491  1.00 0.00 ? 32 PHE A HB3  1  
ATOM 451   H HD1  . PHE A 1 32 ? -8.604  -8.832  -4.683  1.00 0.00 ? 32 PHE A HD1  1  
ATOM 452   H HD2  . PHE A 1 32 ? -8.178  -8.814  -0.449  1.00 0.00 ? 32 PHE A HD2  1  
ATOM 453   H HE1  . PHE A 1 32 ? -6.612  -7.405  -4.894  1.00 0.00 ? 32 PHE A HE1  1  
ATOM 454   H HE2  . PHE A 1 32 ? -6.186  -7.384  -0.651  1.00 0.00 ? 32 PHE A HE2  1  
ATOM 455   H HZ   . PHE A 1 32 ? -5.401  -6.678  -2.877  1.00 0.00 ? 32 PHE A HZ   1  
ATOM 456   N N    . ALA A 1 33 ? -7.465  -11.298 -3.882  1.00 0.00 ? 33 ALA A N    1  
ATOM 457   C CA   . ALA A 1 33 ? -6.696  -11.585 -5.086  1.00 0.00 ? 33 ALA A CA   1  
ATOM 458   C C    . ALA A 1 33 ? -5.513  -12.496 -4.778  1.00 0.00 ? 33 ALA A C    1  
ATOM 459   O O    . ALA A 1 33 ? -4.901  -12.396 -3.714  1.00 0.00 ? 33 ALA A O    1  
ATOM 460   C CB   . ALA A 1 33 ? -6.216  -10.292 -5.728  1.00 0.00 ? 33 ALA A CB   1  
ATOM 461   H H    . ALA A 1 33 ? -7.030  -10.832 -3.138  1.00 0.00 ? 33 ALA A H    1  
ATOM 462   H HA   . ALA A 1 33 ? -7.349  -12.086 -5.788  1.00 0.00 ? 33 ALA A HA   1  
ATOM 463   H HB1  . ALA A 1 33 ? -5.789  -10.507 -6.696  1.00 0.00 ? 33 ALA A HB1  1  
ATOM 464   H HB2  . ALA A 1 33 ? -5.467  -9.835  -5.098  1.00 0.00 ? 33 ALA A HB2  1  
ATOM 465   H HB3  . ALA A 1 33 ? -7.050  -9.616  -5.844  1.00 0.00 ? 33 ALA A HB3  1  
ATOM 466   N N    . LYS A 1 34 ? -5.195  -13.383 -5.714  1.00 0.00 ? 34 LYS A N    1  
ATOM 467   C CA   . LYS A 1 34 ? -4.084  -14.312 -5.543  1.00 0.00 ? 34 LYS A CA   1  
ATOM 468   C C    . LYS A 1 34 ? -2.748  -13.578 -5.600  1.00 0.00 ? 34 LYS A C    1  
ATOM 469   O O    . LYS A 1 34 ? -2.584  -12.622 -6.358  1.00 0.00 ? 34 LYS A O    1  
ATOM 470   C CB   . LYS A 1 34 ? -4.131  -15.400 -6.619  1.00 0.00 ? 34 LYS A CB   1  
ATOM 471   C CG   . LYS A 1 34 ? -3.812  -16.790 -6.092  1.00 0.00 ? 34 LYS A CG   1  
ATOM 472   C CD   . LYS A 1 34 ? -4.443  -17.871 -6.956  1.00 0.00 ? 34 LYS A CD   1  
ATOM 473   C CE   . LYS A 1 34 ? -3.568  -19.112 -7.022  1.00 0.00 ? 34 LYS A CE   1  
ATOM 474   N NZ   . LYS A 1 34 ? -4.074  -20.195 -6.134  1.00 0.00 ? 34 LYS A NZ   1  
ATOM 475   H H    . LYS A 1 34 ? -5.720  -13.414 -6.541  1.00 0.00 ? 34 LYS A H    1  
ATOM 476   H HA   . LYS A 1 34 ? -4.186  -14.774 -4.572  1.00 0.00 ? 34 LYS A HA   1  
ATOM 477   H HB2  . LYS A 1 34 ? -5.119  -15.420 -7.051  1.00 0.00 ? 34 LYS A HB2  1  
ATOM 478   H HB3  . LYS A 1 34 ? -3.414  -15.158 -7.391  1.00 0.00 ? 34 LYS A HB3  1  
ATOM 479   H HG2  . LYS A 1 34 ? -2.741  -16.926 -6.088  1.00 0.00 ? 34 LYS A HG2  1  
ATOM 480   H HG3  . LYS A 1 34 ? -4.193  -16.878 -5.085  1.00 0.00 ? 34 LYS A HG3  1  
ATOM 481   H HD2  . LYS A 1 34 ? -5.401  -18.138 -6.537  1.00 0.00 ? 34 LYS A HD2  1  
ATOM 482   H HD3  . LYS A 1 34 ? -4.580  -17.484 -7.955  1.00 0.00 ? 34 LYS A HD3  1  
ATOM 483   H HE2  . LYS A 1 34 ? -3.554  -19.473 -8.041  1.00 0.00 ? 34 LYS A HE2  1  
ATOM 484   H HE3  . LYS A 1 34 ? -2.566  -18.849 -6.720  1.00 0.00 ? 34 LYS A HE3  1  
ATOM 485   H HZ1  . LYS A 1 34 ? -3.921  -21.123 -6.580  1.00 0.00 ? 34 LYS A HZ1  1  
ATOM 486   H HZ2  . LYS A 1 34 ? -5.091  -20.070 -5.961  1.00 0.00 ? 34 LYS A HZ2  1  
ATOM 487   H HZ3  . LYS A 1 34 ? -3.573  -20.173 -5.223  1.00 0.00 ? 34 LYS A HZ3  1  
ATOM 488   N N    . GLY A 1 35 ? -1.794  -14.033 -4.793  1.00 0.00 ? 35 GLY A N    1  
ATOM 489   C CA   . GLY A 1 35 ? -0.485  -13.408 -4.768  1.00 0.00 ? 35 GLY A CA   1  
ATOM 490   C C    . GLY A 1 35 ? -0.274  -12.553 -3.534  1.00 0.00 ? 35 GLY A C    1  
ATOM 491   O O    . GLY A 1 35 ? -1.120  -12.521 -2.641  1.00 0.00 ? 35 GLY A O    1  
ATOM 492   H H    . GLY A 1 35 ? -1.982  -14.798 -4.211  1.00 0.00 ? 35 GLY A H    1  
ATOM 493   H HA2  . GLY A 1 35 ? 0.271   -14.179 -4.792  1.00 0.00 ? 35 GLY A HA2  1  
ATOM 494   H HA3  . GLY A 1 35 ? -0.377  -12.787 -5.645  1.00 0.00 ? 35 GLY A HA3  1  
ATOM 495   N N    . GLU A 1 36 ? 0.859   -11.859 -3.484  1.00 0.00 ? 36 GLU A N    1  
ATOM 496   C CA   . GLU A 1 36 ? 1.178   -10.999 -2.351  1.00 0.00 ? 36 GLU A CA   1  
ATOM 497   C C    . GLU A 1 36 ? 0.963   -9.530  -2.702  1.00 0.00 ? 36 GLU A C    1  
ATOM 498   O O    . GLU A 1 36 ? 1.404   -9.063  -3.753  1.00 0.00 ? 36 GLU A O    1  
ATOM 499   C CB   . GLU A 1 36 ? 2.627   -11.225 -1.906  1.00 0.00 ? 36 GLU A CB   1  
ATOM 500   C CG   . GLU A 1 36 ? 2.752   -12.092 -0.663  1.00 0.00 ? 36 GLU A CG   1  
ATOM 501   C CD   . GLU A 1 36 ? 4.100   -11.945 0.014   1.00 0.00 ? 36 GLU A CD   1  
ATOM 502   O OE1  . GLU A 1 36 ? 4.257   -11.013 0.831   1.00 0.00 ? 36 GLU A OE1  1  
ATOM 503   O OE2  . GLU A 1 36 ? 5.001   -12.763 -0.271  1.00 0.00 ? 36 GLU A OE2  1  
ATOM 504   H H    . GLU A 1 36 ? 1.494   -11.926 -4.227  1.00 0.00 ? 36 GLU A H    1  
ATOM 505   H HA   . GLU A 1 36 ? 0.518   -11.263 -1.538  1.00 0.00 ? 36 GLU A HA   1  
ATOM 506   H HB2  . GLU A 1 36 ? 3.167   -11.704 -2.708  1.00 0.00 ? 36 GLU A HB2  1  
ATOM 507   H HB3  . GLU A 1 36 ? 3.082   -10.268 -1.698  1.00 0.00 ? 36 GLU A HB3  1  
ATOM 508   H HG2  . GLU A 1 36 ? 1.982   -11.808 0.037   1.00 0.00 ? 36 GLU A HG2  1  
ATOM 509   H HG3  . GLU A 1 36 ? 2.618   -13.125 -0.946  1.00 0.00 ? 36 GLU A HG3  1  
ATOM 510   N N    . TRP A 1 37 ? 0.282   -8.809  -1.817  1.00 0.00 ? 37 TRP A N    1  
ATOM 511   C CA   . TRP A 1 37 ? 0.008   -7.393  -2.033  1.00 0.00 ? 37 TRP A CA   1  
ATOM 512   C C    . TRP A 1 37 ? 0.632   -6.544  -0.930  1.00 0.00 ? 37 TRP A C    1  
ATOM 513   O O    . TRP A 1 37 ? 0.929   -7.042  0.156   1.00 0.00 ? 37 TRP A O    1  
ATOM 514   C CB   . TRP A 1 37 ? -1.500  -7.147  -2.092  1.00 0.00 ? 37 TRP A CB   1  
ATOM 515   C CG   . TRP A 1 37 ? -2.167  -7.813  -3.256  1.00 0.00 ? 37 TRP A CG   1  
ATOM 516   C CD1  . TRP A 1 37 ? -2.295  -9.155  -3.471  1.00 0.00 ? 37 TRP A CD1  1  
ATOM 517   C CD2  . TRP A 1 37 ? -2.796  -7.165  -4.369  1.00 0.00 ? 37 TRP A CD2  1  
ATOM 518   N NE1  . TRP A 1 37 ? -2.966  -9.382  -4.649  1.00 0.00 ? 37 TRP A NE1  1  
ATOM 519   C CE2  . TRP A 1 37 ? -3.284  -8.177  -5.218  1.00 0.00 ? 37 TRP A CE2  1  
ATOM 520   C CE3  . TRP A 1 37 ? -2.995  -5.830  -4.729  1.00 0.00 ? 37 TRP A CE3  1  
ATOM 521   C CZ2  . TRP A 1 37 ? -3.959  -7.893  -6.403  1.00 0.00 ? 37 TRP A CZ2  1  
ATOM 522   C CZ3  . TRP A 1 37 ? -3.665  -5.549  -5.905  1.00 0.00 ? 37 TRP A CZ3  1  
ATOM 523   C CH2  . TRP A 1 37 ? -4.139  -6.577  -6.730  1.00 0.00 ? 37 TRP A CH2  1  
ATOM 524   H H    . TRP A 1 37 ? -0.042  -9.239  -0.998  1.00 0.00 ? 37 TRP A H    1  
ATOM 525   H HA   . TRP A 1 37 ? 0.447   -7.110  -2.979  1.00 0.00 ? 37 TRP A HA   1  
ATOM 526   H HB2  . TRP A 1 37 ? -1.955  -7.525  -1.187  1.00 0.00 ? 37 TRP A HB2  1  
ATOM 527   H HB3  . TRP A 1 37 ? -1.682  -6.085  -2.164  1.00 0.00 ? 37 TRP A HB3  1  
ATOM 528   H HD1  . TRP A 1 37 ? -1.918  -9.915  -2.804  1.00 0.00 ? 37 TRP A HD1  1  
ATOM 529   H HE1  . TRP A 1 37 ? -3.182  -10.263 -5.020  1.00 0.00 ? 37 TRP A HE1  1  
ATOM 530   H HE3  . TRP A 1 37 ? -2.637  -5.024  -4.105  1.00 0.00 ? 37 TRP A HE3  1  
ATOM 531   H HZ2  . TRP A 1 37 ? -4.330  -8.674  -7.050  1.00 0.00 ? 37 TRP A HZ2  1  
ATOM 532   H HZ3  . TRP A 1 37 ? -3.828  -4.524  -6.200  1.00 0.00 ? 37 TRP A HZ3  1  
ATOM 533   H HH2  . TRP A 1 37 ? -4.657  -6.312  -7.641  1.00 0.00 ? 37 TRP A HH2  1  
ATOM 534   N N    . CYS A 1 38 ? 0.827   -5.261  -1.216  1.00 0.00 ? 38 CYS A N    1  
ATOM 535   C CA   . CYS A 1 38 ? 1.415   -4.343  -0.246  1.00 0.00 ? 38 CYS A CA   1  
ATOM 536   C C    . CYS A 1 38 ? 0.536   -3.111  -0.060  1.00 0.00 ? 38 CYS A C    1  
ATOM 537   O O    . CYS A 1 38 ? 0.265   -2.379  -1.012  1.00 0.00 ? 38 CYS A O    1  
ATOM 538   C CB   . CYS A 1 38 ? 2.814   -3.921  -0.698  1.00 0.00 ? 38 CYS A CB   1  
ATOM 539   S SG   . CYS A 1 38 ? 4.118   -5.093  -0.253  1.00 0.00 ? 38 CYS A SG   1  
ATOM 540   H H    . CYS A 1 38 ? 0.570   -4.923  -2.099  1.00 0.00 ? 38 CYS A H    1  
ATOM 541   H HA   . CYS A 1 38 ? 1.492   -4.862  0.697   1.00 0.00 ? 38 CYS A HA   1  
ATOM 542   H HB2  . CYS A 1 38 ? 2.822   -3.815  -1.771  1.00 0.00 ? 38 CYS A HB2  1  
ATOM 543   H HB3  . CYS A 1 38 ? 3.058   -2.970  -0.246  1.00 0.00 ? 38 CYS A HB3  1  
ATOM 544   H HG   . CYS A 1 38 ? 4.783   -4.619  0.250   1.00 0.00 ? 38 CYS A HG   1  
ATOM 545   N N    . GLY A 1 39 ? 0.091   -2.889  1.173   1.00 0.00 ? 39 GLY A N    1  
ATOM 546   C CA   . GLY A 1 39 ? -0.752  -1.744  1.462   1.00 0.00 ? 39 GLY A CA   1  
ATOM 547   C C    . GLY A 1 39 ? 0.048   -0.476  1.685   1.00 0.00 ? 39 GLY A C    1  
ATOM 548   O O    . GLY A 1 39 ? 0.645   -0.289  2.745   1.00 0.00 ? 39 GLY A O    1  
ATOM 549   H H    . GLY A 1 39 ? 0.339   -3.506  1.892   1.00 0.00 ? 39 GLY A H    1  
ATOM 550   H HA2  . GLY A 1 39 ? -1.427  -1.590  0.632   1.00 0.00 ? 39 GLY A HA2  1  
ATOM 551   H HA3  . GLY A 1 39 ? -1.331  -1.952  2.349   1.00 0.00 ? 39 GLY A HA3  1  
ATOM 552   N N    . VAL A 1 40 ? 0.061   0.396   0.683   1.00 0.00 ? 40 VAL A N    1  
ATOM 553   C CA   . VAL A 1 40 ? 0.794   1.653   0.774   1.00 0.00 ? 40 VAL A CA   1  
ATOM 554   C C    . VAL A 1 40 ? -0.127  2.799   1.177   1.00 0.00 ? 40 VAL A C    1  
ATOM 555   O O    . VAL A 1 40 ? -1.166  3.023   0.555   1.00 0.00 ? 40 VAL A O    1  
ATOM 556   C CB   . VAL A 1 40 ? 1.475   2.004   -0.563  1.00 0.00 ? 40 VAL A CB   1  
ATOM 557   C CG1  . VAL A 1 40 ? 2.393   3.205   -0.396  1.00 0.00 ? 40 VAL A CG1  1  
ATOM 558   C CG2  . VAL A 1 40 ? 2.243   0.806   -1.101  1.00 0.00 ? 40 VAL A CG2  1  
ATOM 559   H H    . VAL A 1 40 ? -0.434  0.191   -0.137  1.00 0.00 ? 40 VAL A H    1  
ATOM 560   H HA   . VAL A 1 40 ? 1.561   1.539   1.525   1.00 0.00 ? 40 VAL A HA   1  
ATOM 561   H HB   . VAL A 1 40 ? 0.708   2.263   -1.278  1.00 0.00 ? 40 VAL A HB   1  
ATOM 562   H HG11 . VAL A 1 40 ? 2.746   3.250   0.623   1.00 0.00 ? 40 VAL A HG11 1  
ATOM 563   H HG12 . VAL A 1 40 ? 1.849   4.109   -0.630  1.00 0.00 ? 40 VAL A HG12 1  
ATOM 564   H HG13 . VAL A 1 40 ? 3.236   3.109   -1.065  1.00 0.00 ? 40 VAL A HG13 1  
ATOM 565   H HG21 . VAL A 1 40 ? 3.169   0.697   -0.555  1.00 0.00 ? 40 VAL A HG21 1  
ATOM 566   H HG22 . VAL A 1 40 ? 2.459   0.958   -2.149  1.00 0.00 ? 40 VAL A HG22 1  
ATOM 567   H HG23 . VAL A 1 40 ? 1.648   -0.086  -0.981  1.00 0.00 ? 40 VAL A HG23 1  
ATOM 568   N N    . GLU A 1 41 ? 0.260   3.524   2.221   1.00 0.00 ? 41 GLU A N    1  
ATOM 569   C CA   . GLU A 1 41 ? -0.531  4.649   2.707   1.00 0.00 ? 41 GLU A CA   1  
ATOM 570   C C    . GLU A 1 41 ? 0.020   5.969   2.179   1.00 0.00 ? 41 GLU A C    1  
ATOM 571   O O    . GLU A 1 41 ? 1.202   6.272   2.345   1.00 0.00 ? 41 GLU A O    1  
ATOM 572   C CB   . GLU A 1 41 ? -0.546  4.664   4.238   1.00 0.00 ? 41 GLU A CB   1  
ATOM 573   C CG   . GLU A 1 41 ? -1.661  5.514   4.825   1.00 0.00 ? 41 GLU A CG   1  
ATOM 574   C CD   . GLU A 1 41 ? -1.177  6.422   5.940   1.00 0.00 ? 41 GLU A CD   1  
ATOM 575   O OE1  . GLU A 1 41 ? -0.117  7.060   5.768   1.00 0.00 ? 41 GLU A OE1  1  
ATOM 576   O OE2  . GLU A 1 41 ? -1.859  6.494   6.984   1.00 0.00 ? 41 GLU A OE2  1  
ATOM 577   H H    . GLU A 1 41 ? 1.099   3.298   2.676   1.00 0.00 ? 41 GLU A H    1  
ATOM 578   H HA   . GLU A 1 41 ? -1.541  4.523   2.348   1.00 0.00 ? 41 GLU A HA   1  
ATOM 579   H HB2  . GLU A 1 41 ? -0.667  3.653   4.595   1.00 0.00 ? 41 GLU A HB2  1  
ATOM 580   H HB3  . GLU A 1 41 ? 0.399   5.052   4.592   1.00 0.00 ? 41 GLU A HB3  1  
ATOM 581   H HG2  . GLU A 1 41 ? -2.082  6.127   4.042   1.00 0.00 ? 41 GLU A HG2  1  
ATOM 582   H HG3  . GLU A 1 41 ? -2.425  4.860   5.220   1.00 0.00 ? 41 GLU A HG3  1  
ATOM 583   N N    . LEU A 1 42 ? -0.844  6.752   1.542   1.00 0.00 ? 42 LEU A N    1  
ATOM 584   C CA   . LEU A 1 42 ? -0.444  8.040   0.988   1.00 0.00 ? 42 LEU A CA   1  
ATOM 585   C C    . LEU A 1 42 ? -0.659  9.161   2.000   1.00 0.00 ? 42 LEU A C    1  
ATOM 586   O O    . LEU A 1 42 ? -1.277  8.955   3.046   1.00 0.00 ? 42 LEU A O    1  
ATOM 587   C CB   . LEU A 1 42 ? -1.232  8.335   -0.291  1.00 0.00 ? 42 LEU A CB   1  
ATOM 588   C CG   . LEU A 1 42 ? -0.926  7.406   -1.468  1.00 0.00 ? 42 LEU A CG   1  
ATOM 589   C CD1  . LEU A 1 42 ? -1.868  7.689   -2.628  1.00 0.00 ? 42 LEU A CD1  1  
ATOM 590   C CD2  . LEU A 1 42 ? 0.523   7.561   -1.904  1.00 0.00 ? 42 LEU A CD2  1  
ATOM 591   H H    . LEU A 1 42 ? -1.773  6.455   1.440   1.00 0.00 ? 42 LEU A H    1  
ATOM 592   H HA   . LEU A 1 42 ? 0.607   7.985   0.747   1.00 0.00 ? 42 LEU A HA   1  
ATOM 593   H HB2  . LEU A 1 42 ? -2.285  8.262   -0.064  1.00 0.00 ? 42 LEU A HB2  1  
ATOM 594   H HB3  . LEU A 1 42 ? -1.016  9.348   -0.596  1.00 0.00 ? 42 LEU A HB3  1  
ATOM 595   H HG   . LEU A 1 42 ? -1.076  6.383   -1.158  1.00 0.00 ? 42 LEU A HG   1  
ATOM 596   H HD11 . LEU A 1 42 ? -2.840  7.273   -2.411  1.00 0.00 ? 42 LEU A HD11 1  
ATOM 597   H HD12 . LEU A 1 42 ? -1.476  7.238   -3.527  1.00 0.00 ? 42 LEU A HD12 1  
ATOM 598   H HD13 . LEU A 1 42 ? -1.956  8.756   -2.769  1.00 0.00 ? 42 LEU A HD13 1  
ATOM 599   H HD21 . LEU A 1 42 ? 0.809   8.601   -1.843  1.00 0.00 ? 42 LEU A HD21 1  
ATOM 600   H HD22 . LEU A 1 42 ? 0.630   7.219   -2.923  1.00 0.00 ? 42 LEU A HD22 1  
ATOM 601   H HD23 . LEU A 1 42 ? 1.158   6.975   -1.258  1.00 0.00 ? 42 LEU A HD23 1  
ATOM 602   N N    . ASP A 1 43 ? -0.146  10.344  1.683   1.00 0.00 ? 43 ASP A N    1  
ATOM 603   C CA   . ASP A 1 43 ? -0.281  11.498  2.565   1.00 0.00 ? 43 ASP A CA   1  
ATOM 604   C C    . ASP A 1 43 ? -1.547  12.285  2.241   1.00 0.00 ? 43 ASP A C    1  
ATOM 605   O O    . ASP A 1 43 ? -2.141  12.912  3.118   1.00 0.00 ? 43 ASP A O    1  
ATOM 606   C CB   . ASP A 1 43 ? 0.944   12.406  2.443   1.00 0.00 ? 43 ASP A CB   1  
ATOM 607   C CG   . ASP A 1 43 ? 1.253   12.770  1.004   1.00 0.00 ? 43 ASP A CG   1  
ATOM 608   O OD1  . ASP A 1 43 ? 0.397   13.407  0.356   1.00 0.00 ? 43 ASP A OD1  1  
ATOM 609   O OD2  . ASP A 1 43 ? 2.352   12.418  0.525   1.00 0.00 ? 43 ASP A OD2  1  
ATOM 610   H H    . ASP A 1 43 ? 0.336   10.445  0.835   1.00 0.00 ? 43 ASP A H    1  
ATOM 611   H HA   . ASP A 1 43 ? -0.348  11.133  3.579   1.00 0.00 ? 43 ASP A HA   1  
ATOM 612   H HB2  . ASP A 1 43 ? 0.766   13.317  2.995   1.00 0.00 ? 43 ASP A HB2  1  
ATOM 613   H HB3  . ASP A 1 43 ? 1.803   11.899  2.860   1.00 0.00 ? 43 ASP A HB3  1  
ATOM 614   N N    . GLU A 1 44 ? -1.952  12.251  0.975   1.00 0.00 ? 44 GLU A N    1  
ATOM 615   C CA   . GLU A 1 44 ? -3.148  12.962  0.537   1.00 0.00 ? 44 GLU A CA   1  
ATOM 616   C C    . GLU A 1 44 ? -4.286  11.987  0.247   1.00 0.00 ? 44 GLU A C    1  
ATOM 617   O O    . GLU A 1 44 ? -4.058  10.792  0.058   1.00 0.00 ? 44 GLU A O    1  
ATOM 618   C CB   . GLU A 1 44 ? -2.843  13.794  -0.711  1.00 0.00 ? 44 GLU A CB   1  
ATOM 619   C CG   . GLU A 1 44 ? -2.316  15.185  -0.400  1.00 0.00 ? 44 GLU A CG   1  
ATOM 620   C CD   . GLU A 1 44 ? -3.425  16.208  -0.247  1.00 0.00 ? 44 GLU A CD   1  
ATOM 621   O OE1  . GLU A 1 44 ? -4.083  16.525  -1.260  1.00 0.00 ? 44 GLU A OE1  1  
ATOM 622   O OE2  . GLU A 1 44 ? -3.635  16.691  0.886   1.00 0.00 ? 44 GLU A OE2  1  
ATOM 623   H H    . GLU A 1 44 ? -1.437  11.735  0.322   1.00 0.00 ? 44 GLU A H    1  
ATOM 624   H HA   . GLU A 1 44 ? -3.451  13.623  1.334   1.00 0.00 ? 44 GLU A HA   1  
ATOM 625   H HB2  . GLU A 1 44 ? -2.103  13.275  -1.302  1.00 0.00 ? 44 GLU A HB2  1  
ATOM 626   H HB3  . GLU A 1 44 ? -3.748  13.896  -1.291  1.00 0.00 ? 44 GLU A HB3  1  
ATOM 627   H HG2  . GLU A 1 44 ? -1.754  15.146  0.522   1.00 0.00 ? 44 GLU A HG2  1  
ATOM 628   H HG3  . GLU A 1 44 ? -1.666  15.497  -1.204  1.00 0.00 ? 44 GLU A HG3  1  
ATOM 629   N N    . PRO A 1 45 ? -5.533  12.486  0.204   1.00 0.00 ? 45 PRO A N    1  
ATOM 630   C CA   . PRO A 1 45 ? -6.709  11.651  -0.065  1.00 0.00 ? 45 PRO A CA   1  
ATOM 631   C C    . PRO A 1 45 ? -6.750  11.159  -1.508  1.00 0.00 ? 45 PRO A C    1  
ATOM 632   O O    . PRO A 1 45 ? -7.662  11.494  -2.265  1.00 0.00 ? 45 PRO A O    1  
ATOM 633   C CB   . PRO A 1 45 ? -7.885  12.591  0.215   1.00 0.00 ? 45 PRO A CB   1  
ATOM 634   C CG   . PRO A 1 45 ? -7.337  13.959  -0.004  1.00 0.00 ? 45 PRO A CG   1  
ATOM 635   C CD   . PRO A 1 45 ? -5.894  13.900  0.417   1.00 0.00 ? 45 PRO A CD   1  
ATOM 636   H HA   . PRO A 1 45 ? -6.754  10.805  0.604   1.00 0.00 ? 45 PRO A HA   1  
ATOM 637   H HB2  . PRO A 1 45 ? -8.693  12.375  -0.468  1.00 0.00 ? 45 PRO A HB2  1  
ATOM 638   H HB3  . PRO A 1 45 ? -8.220  12.460  1.233   1.00 0.00 ? 45 PRO A HB3  1  
ATOM 639   H HG2  . PRO A 1 45 ? -7.412  14.221  -1.050  1.00 0.00 ? 45 PRO A HG2  1  
ATOM 640   H HG3  . PRO A 1 45 ? -7.875  14.671  0.602   1.00 0.00 ? 45 PRO A HG3  1  
ATOM 641   H HD2  . PRO A 1 45 ? -5.294  14.549  -0.204  1.00 0.00 ? 45 PRO A HD2  1  
ATOM 642   H HD3  . PRO A 1 45 ? -5.794  14.171  1.457   1.00 0.00 ? 45 PRO A HD3  1  
ATOM 643   N N    . LEU A 1 46 ? -5.756  10.360  -1.883  1.00 0.00 ? 46 LEU A N    1  
ATOM 644   C CA   . LEU A 1 46 ? -5.677  9.820   -3.236  1.00 0.00 ? 46 LEU A CA   1  
ATOM 645   C C    . LEU A 1 46 ? -5.701  8.295   -3.216  1.00 0.00 ? 46 LEU A C    1  
ATOM 646   O O    . LEU A 1 46 ? -5.106  7.643   -4.075  1.00 0.00 ? 46 LEU A O    1  
ATOM 647   C CB   . LEU A 1 46 ? -4.407  10.313  -3.931  1.00 0.00 ? 46 LEU A CB   1  
ATOM 648   C CG   . LEU A 1 46 ? -4.463  11.756  -4.434  1.00 0.00 ? 46 LEU A CG   1  
ATOM 649   C CD1  . LEU A 1 46 ? -3.081  12.226  -4.859  1.00 0.00 ? 46 LEU A CD1  1  
ATOM 650   C CD2  . LEU A 1 46 ? -5.449  11.880  -5.585  1.00 0.00 ? 46 LEU A CD2  1  
ATOM 651   H H    . LEU A 1 46 ? -5.059  10.127  -1.235  1.00 0.00 ? 46 LEU A H    1  
ATOM 652   H HA   . LEU A 1 46 ? -6.537  10.173  -3.785  1.00 0.00 ? 46 LEU A HA   1  
ATOM 653   H HB2  . LEU A 1 46 ? -3.585  10.227  -3.236  1.00 0.00 ? 46 LEU A HB2  1  
ATOM 654   H HB3  . LEU A 1 46 ? -4.211  9.669   -4.776  1.00 0.00 ? 46 LEU A HB3  1  
ATOM 655   H HG   . LEU A 1 46 ? -4.801  12.397  -3.632  1.00 0.00 ? 46 LEU A HG   1  
ATOM 656   H HD11 . LEU A 1 46 ? -2.490  11.376  -5.169  1.00 0.00 ? 46 LEU A HD11 1  
ATOM 657   H HD12 . LEU A 1 46 ? -2.597  12.718  -4.029  1.00 0.00 ? 46 LEU A HD12 1  
ATOM 658   H HD13 . LEU A 1 46 ? -3.174  12.918  -5.684  1.00 0.00 ? 46 LEU A HD13 1  
ATOM 659   H HD21 . LEU A 1 46 ? -5.274  12.808  -6.111  1.00 0.00 ? 46 LEU A HD21 1  
ATOM 660   H HD22 . LEU A 1 46 ? -6.457  11.871  -5.200  1.00 0.00 ? 46 LEU A HD22 1  
ATOM 661   H HD23 . LEU A 1 46 ? -5.316  11.051  -6.264  1.00 0.00 ? 46 LEU A HD23 1  
ATOM 662   N N    . GLY A 1 47 ? -6.390  7.731   -2.229  1.00 0.00 ? 47 GLY A N    1  
ATOM 663   C CA   . GLY A 1 47 ? -6.476  6.287   -2.116  1.00 0.00 ? 47 GLY A CA   1  
ATOM 664   C C    . GLY A 1 47 ? -7.839  5.755   -2.513  1.00 0.00 ? 47 GLY A C    1  
ATOM 665   O O    . GLY A 1 47 ? -8.726  6.519   -2.893  1.00 0.00 ? 47 GLY A O    1  
ATOM 666   H H    . GLY A 1 47 ? -6.843  8.300   -1.573  1.00 0.00 ? 47 GLY A H    1  
ATOM 667   H HA2  . GLY A 1 47 ? -5.728  5.841   -2.754  1.00 0.00 ? 47 GLY A HA2  1  
ATOM 668   H HA3  . GLY A 1 47 ? -6.276  6.004   -1.093  1.00 0.00 ? 47 GLY A HA3  1  
ATOM 669   N N    . LYS A 1 48 ? -8.008  4.439   -2.424  1.00 0.00 ? 48 LYS A N    1  
ATOM 670   C CA   . LYS A 1 48 ? -9.272  3.805   -2.776  1.00 0.00 ? 48 LYS A CA   1  
ATOM 671   C C    . LYS A 1 48 ? -9.962  3.242   -1.538  1.00 0.00 ? 48 LYS A C    1  
ATOM 672   O O    . LYS A 1 48 ? -11.190 3.241   -1.446  1.00 0.00 ? 48 LYS A O    1  
ATOM 673   C CB   . LYS A 1 48 ? -9.039  2.688   -3.795  1.00 0.00 ? 48 LYS A CB   1  
ATOM 674   C CG   . LYS A 1 48 ? -7.950  1.708   -3.387  1.00 0.00 ? 48 LYS A CG   1  
ATOM 675   C CD   . LYS A 1 48 ? -8.019  0.427   -4.201  1.00 0.00 ? 48 LYS A CD   1  
ATOM 676   C CE   . LYS A 1 48 ? -6.633  -0.095  -4.539  1.00 0.00 ? 48 LYS A CE   1  
ATOM 677   N NZ   . LYS A 1 48 ? -6.689  -1.384  -5.281  1.00 0.00 ? 48 LYS A NZ   1  
ATOM 678   H H    . LYS A 1 48 ? -7.263  3.882   -2.113  1.00 0.00 ? 48 LYS A H    1  
ATOM 679   H HA   . LYS A 1 48 ? -9.909  4.556   -3.219  1.00 0.00 ? 48 LYS A HA   1  
ATOM 680   H HB2  . LYS A 1 48 ? -9.959  2.136   -3.925  1.00 0.00 ? 48 LYS A HB2  1  
ATOM 681   H HB3  . LYS A 1 48 ? -8.760  3.130   -4.741  1.00 0.00 ? 48 LYS A HB3  1  
ATOM 682   H HG2  . LYS A 1 48 ? -6.987  2.171   -3.545  1.00 0.00 ? 48 LYS A HG2  1  
ATOM 683   H HG3  . LYS A 1 48 ? -8.069  1.468   -2.342  1.00 0.00 ? 48 LYS A HG3  1  
ATOM 684   H HD2  . LYS A 1 48 ? -8.546  -0.323  -3.629  1.00 0.00 ? 48 LYS A HD2  1  
ATOM 685   H HD3  . LYS A 1 48 ? -8.554  0.624   -5.119  1.00 0.00 ? 48 LYS A HD3  1  
ATOM 686   H HE2  . LYS A 1 48 ? -6.124  0.637   -5.146  1.00 0.00 ? 48 LYS A HE2  1  
ATOM 687   H HE3  . LYS A 1 48 ? -6.084  -0.242  -3.619  1.00 0.00 ? 48 LYS A HE3  1  
ATOM 688   H HZ1  . LYS A 1 48 ? -7.376  -2.025  -4.834  1.00 0.00 ? 48 LYS A HZ1  1  
ATOM 689   H HZ2  . LYS A 1 48 ? -5.754  -1.840  -5.278  1.00 0.00 ? 48 LYS A HZ2  1  
ATOM 690   H HZ3  . LYS A 1 48 ? -6.978  -1.217  -6.266  1.00 0.00 ? 48 LYS A HZ3  1  
ATOM 691   N N    . ASN A 1 49 ? -9.165  2.764   -0.588  1.00 0.00 ? 49 ASN A N    1  
ATOM 692   C CA   . ASN A 1 49 ? -9.700  2.198   0.645   1.00 0.00 ? 49 ASN A CA   1  
ATOM 693   C C    . ASN A 1 49 ? -8.875  2.643   1.849   1.00 0.00 ? 49 ASN A C    1  
ATOM 694   O O    . ASN A 1 49 ? -7.971  3.469   1.725   1.00 0.00 ? 49 ASN A O    1  
ATOM 695   C CB   . ASN A 1 49 ? -9.721  0.671   0.564   1.00 0.00 ? 49 ASN A CB   1  
ATOM 696   C CG   . ASN A 1 49 ? -10.469 0.169   -0.656  1.00 0.00 ? 49 ASN A CG   1  
ATOM 697   O OD1  . ASN A 1 49 ? -11.691 0.294   -0.744  1.00 0.00 ? 49 ASN A OD1  1  
ATOM 698   N ND2  . ASN A 1 49 ? -9.737  -0.405  -1.605  1.00 0.00 ? 49 ASN A ND2  1  
ATOM 699   H H    . ASN A 1 49 ? -8.194  2.792   -0.719  1.00 0.00 ? 49 ASN A H    1  
ATOM 700   H HA   . ASN A 1 49 ? -10.711 2.558   0.763   1.00 0.00 ? 49 ASN A HA   1  
ATOM 701   H HB2  . ASN A 1 49 ? -8.708  0.305   0.516   1.00 0.00 ? 49 ASN A HB2  1  
ATOM 702   H HB3  . ASN A 1 49 ? -10.202 0.276   1.447   1.00 0.00 ? 49 ASN A HB3  1  
ATOM 703   H HD21 . ASN A 1 49 ? -8.769  -0.470  -1.466  1.00 0.00 ? 49 ASN A HD21 1  
ATOM 704   H HD22 . ASN A 1 49 ? -10.195 -0.738  -2.404  1.00 0.00 ? 49 ASN A HD22 1  
ATOM 705   N N    . ASP A 1 50 ? -9.194  2.089   3.015   1.00 0.00 ? 50 ASP A N    1  
ATOM 706   C CA   . ASP A 1 50 ? -8.484  2.429   4.242   1.00 0.00 ? 50 ASP A CA   1  
ATOM 707   C C    . ASP A 1 50 ? -7.847  1.189   4.863   1.00 0.00 ? 50 ASP A C    1  
ATOM 708   O O    . ASP A 1 50 ? -7.820  1.036   6.084   1.00 0.00 ? 50 ASP A O    1  
ATOM 709   C CB   . ASP A 1 50 ? -9.437  3.081   5.245   1.00 0.00 ? 50 ASP A CB   1  
ATOM 710   C CG   . ASP A 1 50 ? -10.731 2.305   5.402   1.00 0.00 ? 50 ASP A CG   1  
ATOM 711   O OD1  . ASP A 1 50 ? -11.645 2.500   4.574   1.00 0.00 ? 50 ASP A OD1  1  
ATOM 712   O OD2  . ASP A 1 50 ? -10.830 1.503   6.354   1.00 0.00 ? 50 ASP A OD2  1  
ATOM 713   H H    . ASP A 1 50 ? -9.925  1.437   3.051   1.00 0.00 ? 50 ASP A H    1  
ATOM 714   H HA   . ASP A 1 50 ? -7.704  3.131   3.991   1.00 0.00 ? 50 ASP A HA   1  
ATOM 715   H HB2  . ASP A 1 50 ? -8.954  3.138   6.208   1.00 0.00 ? 50 ASP A HB2  1  
ATOM 716   H HB3  . ASP A 1 50 ? -9.676  4.080   4.907   1.00 0.00 ? 50 ASP A HB3  1  
ATOM 717   N N    . GLY A 1 51 ? -7.334  0.306   4.012   1.00 0.00 ? 51 GLY A N    1  
ATOM 718   C CA   . GLY A 1 51 ? -6.704  -0.909  4.496   1.00 0.00 ? 51 GLY A CA   1  
ATOM 719   C C    . GLY A 1 51 ? -7.712  -1.932  4.978   1.00 0.00 ? 51 GLY A C    1  
ATOM 720   O O    . GLY A 1 51 ? -7.412  -2.744  5.853   1.00 0.00 ? 51 GLY A O    1  
ATOM 721   H H    . GLY A 1 51 ? -7.384  0.480   3.049   1.00 0.00 ? 51 GLY A H    1  
ATOM 722   H HA2  . GLY A 1 51 ? -6.122  -1.342  3.696   1.00 0.00 ? 51 GLY A HA2  1  
ATOM 723   H HA3  . GLY A 1 51 ? -6.043  -0.658  5.312   1.00 0.00 ? 51 GLY A HA3  1  
ATOM 724   N N    . ALA A 1 52 ? -8.912  -1.894  4.408   1.00 0.00 ? 52 ALA A N    1  
ATOM 725   C CA   . ALA A 1 52 ? -9.968  -2.825  4.784   1.00 0.00 ? 52 ALA A CA   1  
ATOM 726   C C    . ALA A 1 52 ? -10.592 -3.476  3.554   1.00 0.00 ? 52 ALA A C    1  
ATOM 727   O O    . ALA A 1 52 ? -11.206 -2.801  2.728   1.00 0.00 ? 52 ALA A O    1  
ATOM 728   C CB   . ALA A 1 52 ? -11.032 -2.111  5.603   1.00 0.00 ? 52 ALA A CB   1  
ATOM 729   H H    . ALA A 1 52 ? -9.091  -1.223  3.716   1.00 0.00 ? 52 ALA A H    1  
ATOM 730   H HA   . ALA A 1 52 ? -9.528  -3.595  5.403   1.00 0.00 ? 52 ALA A HA   1  
ATOM 731   H HB1  . ALA A 1 52 ? -10.557 -1.449  6.313   1.00 0.00 ? 52 ALA A HB1  1  
ATOM 732   H HB2  . ALA A 1 52 ? -11.628 -2.840  6.133   1.00 0.00 ? 52 ALA A HB2  1  
ATOM 733   H HB3  . ALA A 1 52 ? -11.668 -1.537  4.945   1.00 0.00 ? 52 ALA A HB3  1  
ATOM 734   N N    . VAL A 1 53 ? -10.430 -4.789  3.440   1.00 0.00 ? 53 VAL A N    1  
ATOM 735   C CA   . VAL A 1 53 ? -10.977 -5.532  2.310   1.00 0.00 ? 53 VAL A CA   1  
ATOM 736   C C    . VAL A 1 53 ? -12.121 -6.438  2.750   1.00 0.00 ? 53 VAL A C    1  
ATOM 737   O O    . VAL A 1 53 ? -11.898 -7.490  3.351   1.00 0.00 ? 53 VAL A O    1  
ATOM 738   C CB   . VAL A 1 53 ? -9.896  -6.387  1.623   1.00 0.00 ? 53 VAL A CB   1  
ATOM 739   C CG1  . VAL A 1 53 ? -10.432 -6.993  0.335   1.00 0.00 ? 53 VAL A CG1  1  
ATOM 740   C CG2  . VAL A 1 53 ? -8.651  -5.557  1.352   1.00 0.00 ? 53 VAL A CG2  1  
ATOM 741   H H    . VAL A 1 53 ? -9.930  -5.272  4.131   1.00 0.00 ? 53 VAL A H    1  
ATOM 742   H HA   . VAL A 1 53 ? -11.352 -4.817  1.592   1.00 0.00 ? 53 VAL A HA   1  
ATOM 743   H HB   . VAL A 1 53 ? -9.627  -7.194  2.289   1.00 0.00 ? 53 VAL A HB   1  
ATOM 744   H HG11 . VAL A 1 53 ? -11.512 -7.014  0.370   1.00 0.00 ? 53 VAL A HG11 1  
ATOM 745   H HG12 . VAL A 1 53 ? -10.056 -8.000  0.227   1.00 0.00 ? 53 VAL A HG12 1  
ATOM 746   H HG13 . VAL A 1 53 ? -10.110 -6.396  -0.505  1.00 0.00 ? 53 VAL A HG13 1  
ATOM 747   H HG21 . VAL A 1 53 ? -8.932  -4.526  1.194   1.00 0.00 ? 53 VAL A HG21 1  
ATOM 748   H HG22 . VAL A 1 53 ? -8.152  -5.932  0.470   1.00 0.00 ? 53 VAL A HG22 1  
ATOM 749   H HG23 . VAL A 1 53 ? -7.983  -5.621  2.198   1.00 0.00 ? 53 VAL A HG23 1  
ATOM 750   N N    . ALA A 1 54 ? -13.347 -6.024  2.449   1.00 0.00 ? 54 ALA A N    1  
ATOM 751   C CA   . ALA A 1 54 ? -14.526 -6.798  2.813   1.00 0.00 ? 54 ALA A CA   1  
ATOM 752   C C    . ALA A 1 54 ? -14.618 -6.981  4.324   1.00 0.00 ? 54 ALA A C    1  
ATOM 753   O O    . ALA A 1 54 ? -15.026 -8.036  4.808   1.00 0.00 ? 54 ALA A O    1  
ATOM 754   C CB   . ALA A 1 54 ? -14.506 -8.150  2.116   1.00 0.00 ? 54 ALA A CB   1  
ATOM 755   H H    . ALA A 1 54 ? -13.461 -5.177  1.969   1.00 0.00 ? 54 ALA A H    1  
ATOM 756   H HA   . ALA A 1 54 ? -15.398 -6.258  2.473   1.00 0.00 ? 54 ALA A HA   1  
ATOM 757   H HB1  . ALA A 1 54 ? -14.665 -8.012  1.057   1.00 0.00 ? 54 ALA A HB1  1  
ATOM 758   H HB2  . ALA A 1 54 ? -15.288 -8.776  2.520   1.00 0.00 ? 54 ALA A HB2  1  
ATOM 759   H HB3  . ALA A 1 54 ? -13.548 -8.624  2.277   1.00 0.00 ? 54 ALA A HB3  1  
ATOM 760   N N    . GLY A 1 55 ? -14.234 -5.946  5.064   1.00 0.00 ? 55 GLY A N    1  
ATOM 761   C CA   . GLY A 1 55 ? -14.281 -6.012  6.513   1.00 0.00 ? 55 GLY A CA   1  
ATOM 762   C C    . GLY A 1 55 ? -12.942 -6.383  7.120   1.00 0.00 ? 55 GLY A C    1  
ATOM 763   O O    . GLY A 1 55 ? -12.635 -5.995  8.247   1.00 0.00 ? 55 GLY A O    1  
ATOM 764   H H    . GLY A 1 55 ? -13.918 -5.130  4.623   1.00 0.00 ? 55 GLY A H    1  
ATOM 765   H HA2  . GLY A 1 55 ? -14.584 -5.049  6.897   1.00 0.00 ? 55 GLY A HA2  1  
ATOM 766   H HA3  . GLY A 1 55 ? -15.013 -6.751  6.805   1.00 0.00 ? 55 GLY A HA3  1  
ATOM 767   N N    . THR A 1 56 ? -12.142 -7.136  6.370   1.00 0.00 ? 56 THR A N    1  
ATOM 768   C CA   . THR A 1 56 ? -10.830 -7.558  6.841   1.00 0.00 ? 56 THR A CA   1  
ATOM 769   C C    . THR A 1 56 ? -9.854  -6.386  6.858   1.00 0.00 ? 56 THR A C    1  
ATOM 770   O O    . THR A 1 56 ? -9.392  -5.936  5.809   1.00 0.00 ? 56 THR A O    1  
ATOM 771   C CB   . THR A 1 56 ? -10.283 -8.679  5.956   1.00 0.00 ? 56 THR A CB   1  
ATOM 772   O OG1  . THR A 1 56 ? -11.199 -9.758  5.888   1.00 0.00 ? 56 THR A OG1  1  
ATOM 773   C CG2  . THR A 1 56 ? -8.958  -9.231  6.437   1.00 0.00 ? 56 THR A CG2  1  
ATOM 774   H H    . THR A 1 56 ? -12.444 -7.413  5.480   1.00 0.00 ? 56 THR A H    1  
ATOM 775   H HA   . THR A 1 56 ? -10.943 -7.931  7.848   1.00 0.00 ? 56 THR A HA   1  
ATOM 776   H HB   . THR A 1 56 ? -10.137 -8.295  4.957   1.00 0.00 ? 56 THR A HB   1  
ATOM 777   H HG1  . THR A 1 56 ? -11.133 -10.180 5.029   1.00 0.00 ? 56 THR A HG1  1  
ATOM 778   H HG21 . THR A 1 56 ? -8.151  -8.718  5.936   1.00 0.00 ? 56 THR A HG21 1  
ATOM 779   H HG22 . THR A 1 56 ? -8.907  -10.286 6.216   1.00 0.00 ? 56 THR A HG22 1  
ATOM 780   H HG23 . THR A 1 56 ? -8.873  -9.082  7.503   1.00 0.00 ? 56 THR A HG23 1  
ATOM 781   N N    . ARG A 1 57 ? -9.544  -5.896  8.054   1.00 0.00 ? 57 ARG A N    1  
ATOM 782   C CA   . ARG A 1 57 ? -8.623  -4.777  8.207   1.00 0.00 ? 57 ARG A CA   1  
ATOM 783   C C    . ARG A 1 57 ? -7.278  -5.249  8.749   1.00 0.00 ? 57 ARG A C    1  
ATOM 784   O O    . ARG A 1 57 ? -7.177  -5.674  9.900   1.00 0.00 ? 57 ARG A O    1  
ATOM 785   C CB   . ARG A 1 57 ? -9.220  -3.722  9.139   1.00 0.00 ? 57 ARG A CB   1  
ATOM 786   C CG   . ARG A 1 57 ? -8.360  -2.475  9.277   1.00 0.00 ? 57 ARG A CG   1  
ATOM 787   C CD   . ARG A 1 57 ? -9.183  -1.206  9.116   1.00 0.00 ? 57 ARG A CD   1  
ATOM 788   N NE   . ARG A 1 57 ? -10.345 -1.190  10.002  1.00 0.00 ? 57 ARG A NE   1  
ATOM 789   C CZ   . ARG A 1 57 ? -11.230 -0.197  10.045  1.00 0.00 ? 57 ARG A CZ   1  
ATOM 790   N NH1  . ARG A 1 57 ? -11.091 0.860   9.255   1.00 0.00 ? 57 ARG A NH1  1  
ATOM 791   N NH2  . ARG A 1 57 ? -12.257 -0.262  10.881  1.00 0.00 ? 57 ARG A NH2  1  
ATOM 792   H H    . ARG A 1 57 ? -9.944  -6.299  8.853   1.00 0.00 ? 57 ARG A H    1  
ATOM 793   H HA   . ARG A 1 57 ? -8.470  -4.338  7.232   1.00 0.00 ? 57 ARG A HA   1  
ATOM 794   H HB2  . ARG A 1 57 ? -10.187 -3.427  8.758   1.00 0.00 ? 57 ARG A HB2  1  
ATOM 795   H HB3  . ARG A 1 57 ? -9.347  -4.155  10.121  1.00 0.00 ? 57 ARG A HB3  1  
ATOM 796   H HG2  . ARG A 1 57 ? -7.902  -2.472  10.254  1.00 0.00 ? 57 ARG A HG2  1  
ATOM 797   H HG3  . ARG A 1 57 ? -7.592  -2.495  8.518   1.00 0.00 ? 57 ARG A HG3  1  
ATOM 798   H HD2  . ARG A 1 57 ? -8.558  -0.356  9.341   1.00 0.00 ? 57 ARG A HD2  1  
ATOM 799   H HD3  . ARG A 1 57 ? -9.522  -1.140  8.091   1.00 0.00 ? 57 ARG A HD3  1  
ATOM 800   H HE   . ARG A 1 57 ? -10.470 -1.959  10.597  1.00 0.00 ? 57 ARG A HE   1  
ATOM 801   H HH11 . ARG A 1 57 ? -10.319 0.915   8.622   1.00 0.00 ? 57 ARG A HH11 1  
ATOM 802   H HH12 . ARG A 1 57 ? -11.760 1.602   9.293   1.00 0.00 ? 57 ARG A HH12 1  
ATOM 803   H HH21 . ARG A 1 57 ? -12.367 -1.057  11.478  1.00 0.00 ? 57 ARG A HH21 1  
ATOM 804   H HH22 . ARG A 1 57 ? -12.923 0.483   10.914  1.00 0.00 ? 57 ARG A HH22 1  
ATOM 805   N N    . TYR A 1 58 ? -6.248  -5.172  7.912   1.00 0.00 ? 58 TYR A N    1  
ATOM 806   C CA   . TYR A 1 58 ? -4.909  -5.592  8.308   1.00 0.00 ? 58 TYR A CA   1  
ATOM 807   C C    . TYR A 1 58 ? -4.200  -4.488  9.085   1.00 0.00 ? 58 TYR A C    1  
ATOM 808   O O    . TYR A 1 58 ? -3.384  -4.760  9.966   1.00 0.00 ? 58 TYR A O    1  
ATOM 809   C CB   . TYR A 1 58 ? -4.087  -5.973  7.076   1.00 0.00 ? 58 TYR A CB   1  
ATOM 810   C CG   . TYR A 1 58 ? -4.826  -6.871  6.108   1.00 0.00 ? 58 TYR A CG   1  
ATOM 811   C CD1  . TYR A 1 58 ? -4.856  -8.247  6.293   1.00 0.00 ? 58 TYR A CD1  1  
ATOM 812   C CD2  . TYR A 1 58 ? -5.494  -6.342  5.011   1.00 0.00 ? 58 TYR A CD2  1  
ATOM 813   C CE1  . TYR A 1 58 ? -5.531  -9.071  5.412   1.00 0.00 ? 58 TYR A CE1  1  
ATOM 814   C CE2  . TYR A 1 58 ? -6.171  -7.159  4.126   1.00 0.00 ? 58 TYR A CE2  1  
ATOM 815   C CZ   . TYR A 1 58 ? -6.185  -8.522  4.331   1.00 0.00 ? 58 TYR A CZ   1  
ATOM 816   O OH   . TYR A 1 58 ? -6.858  -9.339  3.451   1.00 0.00 ? 58 TYR A OH   1  
ATOM 817   H H    . TYR A 1 58 ? -6.393  -4.825  7.007   1.00 0.00 ? 58 TYR A H    1  
ATOM 818   H HA   . TYR A 1 58 ? -5.008  -6.458  8.946   1.00 0.00 ? 58 TYR A HA   1  
ATOM 819   H HB2  . TYR A 1 58 ? -3.809  -5.075  6.546   1.00 0.00 ? 58 TYR A HB2  1  
ATOM 820   H HB3  . TYR A 1 58 ? -3.194  -6.491  7.393   1.00 0.00 ? 58 TYR A HB3  1  
ATOM 821   H HD1  . TYR A 1 58 ? -4.342  -8.675  7.142   1.00 0.00 ? 58 TYR A HD1  1  
ATOM 822   H HD2  . TYR A 1 58 ? -5.480  -5.273  4.853   1.00 0.00 ? 58 TYR A HD2  1  
ATOM 823   H HE1  . TYR A 1 58 ? -5.542  -10.139 5.573   1.00 0.00 ? 58 TYR A HE1  1  
ATOM 824   H HE2  . TYR A 1 58 ? -6.683  -6.728  3.278   1.00 0.00 ? 58 TYR A HE2  1  
ATOM 825   H HH   . TYR A 1 58 ? -6.727  -9.022  2.555   1.00 0.00 ? 58 TYR A HH   1  
ATOM 826   N N    . PHE A 1 59 ? -4.516  -3.241  8.752   1.00 0.00 ? 59 PHE A N    1  
ATOM 827   C CA   . PHE A 1 59 ? -3.909  -2.094  9.419   1.00 0.00 ? 59 PHE A CA   1  
ATOM 828   C C    . PHE A 1 59 ? -4.902  -0.942  9.532   1.00 0.00 ? 59 PHE A C    1  
ATOM 829   O O    . PHE A 1 59 ? -5.584  -0.600  8.565   1.00 0.00 ? 59 PHE A O    1  
ATOM 830   C CB   . PHE A 1 59 ? -2.663  -1.637  8.658   1.00 0.00 ? 59 PHE A CB   1  
ATOM 831   C CG   . PHE A 1 59 ? -2.944  -1.215  7.244   1.00 0.00 ? 59 PHE A CG   1  
ATOM 832   C CD1  . PHE A 1 59 ? -3.094  -2.161  6.242   1.00 0.00 ? 59 PHE A CD1  1  
ATOM 833   C CD2  . PHE A 1 59 ? -3.060  0.125   6.916   1.00 0.00 ? 59 PHE A CD2  1  
ATOM 834   C CE1  . PHE A 1 59 ? -3.353  -1.777  4.941   1.00 0.00 ? 59 PHE A CE1  1  
ATOM 835   C CE2  . PHE A 1 59 ? -3.320  0.516   5.616   1.00 0.00 ? 59 PHE A CE2  1  
ATOM 836   C CZ   . PHE A 1 59 ? -3.467  -0.437  4.627   1.00 0.00 ? 59 PHE A CZ   1  
ATOM 837   H H    . PHE A 1 59 ? -5.173  -3.087  8.041   1.00 0.00 ? 59 PHE A H    1  
ATOM 838   H HA   . PHE A 1 59 ? -3.620  -2.403  10.411  1.00 0.00 ? 59 PHE A HA   1  
ATOM 839   H HB2  . PHE A 1 59 ? -2.224  -0.795  9.173   1.00 0.00 ? 59 PHE A HB2  1  
ATOM 840   H HB3  . PHE A 1 59 ? -1.950  -2.447  8.629   1.00 0.00 ? 59 PHE A HB3  1  
ATOM 841   H HD1  . PHE A 1 59 ? -3.006  -3.210  6.486   1.00 0.00 ? 59 PHE A HD1  1  
ATOM 842   H HD2  . PHE A 1 59 ? -2.946  0.872   7.688   1.00 0.00 ? 59 PHE A HD2  1  
ATOM 843   H HE1  . PHE A 1 59 ? -3.467  -2.525  4.168   1.00 0.00 ? 59 PHE A HE1  1  
ATOM 844   H HE2  . PHE A 1 59 ? -3.408  1.565   5.373   1.00 0.00 ? 59 PHE A HE2  1  
ATOM 845   H HZ   . PHE A 1 59 ? -3.669  -0.134  3.609   1.00 0.00 ? 59 PHE A HZ   1  
ATOM 846   N N    . GLN A 1 60 ? -4.977  -0.346  10.717  1.00 0.00 ? 60 GLN A N    1  
ATOM 847   C CA   . GLN A 1 60 ? -5.887  0.768   10.955  1.00 0.00 ? 60 GLN A CA   1  
ATOM 848   C C    . GLN A 1 60 ? -5.420  2.019   10.218  1.00 0.00 ? 60 GLN A C    1  
ATOM 849   O O    . GLN A 1 60 ? -4.319  2.515   10.452  1.00 0.00 ? 60 GLN A O    1  
ATOM 850   C CB   . GLN A 1 60 ? -5.992  1.056   12.455  1.00 0.00 ? 60 GLN A CB   1  
ATOM 851   C CG   . GLN A 1 60 ? -7.079  2.058   12.806  1.00 0.00 ? 60 GLN A CG   1  
ATOM 852   C CD   . GLN A 1 60 ? -8.462  1.584   12.403  1.00 0.00 ? 60 GLN A CD   1  
ATOM 853   O OE1  . GLN A 1 60 ? -9.066  0.749   13.077  1.00 0.00 ? 60 GLN A OE1  1  
ATOM 854   N NE2  . GLN A 1 60 ? -8.971  2.117   11.298  1.00 0.00 ? 60 GLN A NE2  1  
ATOM 855   H H    . GLN A 1 60 ? -4.408  -0.664  11.449  1.00 0.00 ? 60 GLN A H    1  
ATOM 856   H HA   . GLN A 1 60 ? -6.861  0.487   10.583  1.00 0.00 ? 60 GLN A HA   1  
ATOM 857   H HB2  . GLN A 1 60 ? -6.203  0.132   12.972  1.00 0.00 ? 60 GLN A HB2  1  
ATOM 858   H HB3  . GLN A 1 60 ? -5.047  1.446   12.802  1.00 0.00 ? 60 GLN A HB3  1  
ATOM 859   H HG2  . GLN A 1 60 ? -7.070  2.221   13.874  1.00 0.00 ? 60 GLN A HG2  1  
ATOM 860   H HG3  . GLN A 1 60 ? -6.872  2.989   12.300  1.00 0.00 ? 60 GLN A HG3  1  
ATOM 861   H HE21 . GLN A 1 60 ? -8.433  2.776   10.811  1.00 0.00 ? 60 GLN A HE21 1  
ATOM 862   H HE22 . GLN A 1 60 ? -9.863  1.828   11.013  1.00 0.00 ? 60 GLN A HE22 1  
ATOM 863   N N    . CYS A 1 61 ? -6.266  2.523   9.325   1.00 0.00 ? 61 CYS A N    1  
ATOM 864   C CA   . CYS A 1 61 ? -5.940  3.717   8.553   1.00 0.00 ? 61 CYS A CA   1  
ATOM 865   C C    . CYS A 1 61 ? -7.192  4.545   8.273   1.00 0.00 ? 61 CYS A C    1  
ATOM 866   O O    . CYS A 1 61 ? -8.293  4.005   8.170   1.00 0.00 ? 61 CYS A O    1  
ATOM 867   C CB   . CYS A 1 61 ? -5.264  3.328   7.236   1.00 0.00 ? 61 CYS A CB   1  
ATOM 868   S SG   . CYS A 1 61 ? -3.461  3.467   7.262   1.00 0.00 ? 61 CYS A SG   1  
ATOM 869   H H    . CYS A 1 61 ? -7.130  2.083   9.182   1.00 0.00 ? 61 CYS A H    1  
ATOM 870   H HA   . CYS A 1 61 ? -5.253  4.312   9.137   1.00 0.00 ? 61 CYS A HA   1  
ATOM 871   H HB2  . CYS A 1 61 ? -5.510  2.303   7.003   1.00 0.00 ? 61 CYS A HB2  1  
ATOM 872   H HB3  . CYS A 1 61 ? -5.631  3.969   6.447   1.00 0.00 ? 61 CYS A HB3  1  
ATOM 873   H HG   . CYS A 1 61 ? -3.237  4.398   7.316   1.00 0.00 ? 61 CYS A HG   1  
ATOM 874   N N    . PRO A 1 62 ? -7.038  5.873   8.147   1.00 0.00 ? 62 PRO A N    1  
ATOM 875   C CA   . PRO A 1 62 ? -8.162  6.778   7.879   1.00 0.00 ? 62 PRO A CA   1  
ATOM 876   C C    . PRO A 1 62 ? -8.736  6.587   6.477   1.00 0.00 ? 62 PRO A C    1  
ATOM 877   O O    . PRO A 1 62 ? -8.030  6.171   5.559   1.00 0.00 ? 62 PRO A O    1  
ATOM 878   C CB   . PRO A 1 62 ? -7.543  8.170   8.019   1.00 0.00 ? 62 PRO A CB   1  
ATOM 879   C CG   . PRO A 1 62 ? -6.092  7.974   7.750   1.00 0.00 ? 62 PRO A CG   1  
ATOM 880   C CD   . PRO A 1 62 ? -5.758  6.598   8.256   1.00 0.00 ? 62 PRO A CD   1  
ATOM 881   H HA   . PRO A 1 62 ? -8.948  6.654   8.608   1.00 0.00 ? 62 PRO A HA   1  
ATOM 882   H HB2  . PRO A 1 62 ? -7.992  8.840   7.299   1.00 0.00 ? 62 PRO A HB2  1  
ATOM 883   H HB3  . PRO A 1 62 ? -7.711  8.543   9.018   1.00 0.00 ? 62 PRO A HB3  1  
ATOM 884   H HG2  . PRO A 1 62 ? -5.902  8.037   6.689   1.00 0.00 ? 62 PRO A HG2  1  
ATOM 885   H HG3  . PRO A 1 62 ? -5.516  8.718   8.280   1.00 0.00 ? 62 PRO A HG3  1  
ATOM 886   H HD2  . PRO A 1 62 ? -5.002  6.141   7.636   1.00 0.00 ? 62 PRO A HD2  1  
ATOM 887   H HD3  . PRO A 1 62 ? -5.429  6.643   9.284   1.00 0.00 ? 62 PRO A HD3  1  
ATOM 888   N N    . PRO A 1 63 ? -10.035 6.889   6.292   1.00 0.00 ? 63 PRO A N    1  
ATOM 889   C CA   . PRO A 1 63 ? -10.702 6.748   4.993   1.00 0.00 ? 63 PRO A CA   1  
ATOM 890   C C    . PRO A 1 63 ? -9.987  7.512   3.886   1.00 0.00 ? 63 PRO A C    1  
ATOM 891   O O    . PRO A 1 63 ? -9.584  8.662   4.071   1.00 0.00 ? 63 PRO A O    1  
ATOM 892   C CB   . PRO A 1 63 ? -12.094 7.339   5.236   1.00 0.00 ? 63 PRO A CB   1  
ATOM 893   C CG   . PRO A 1 63 ? -12.307 7.226   6.705   1.00 0.00 ? 63 PRO A CG   1  
ATOM 894   C CD   . PRO A 1 63 ? -10.951 7.390   7.333   1.00 0.00 ? 63 PRO A CD   1  
ATOM 895   H HA   . PRO A 1 63 ? -10.795 5.709   4.709   1.00 0.00 ? 63 PRO A HA   1  
ATOM 896   H HB2  . PRO A 1 63 ? -12.110 8.370   4.912   1.00 0.00 ? 63 PRO A HB2  1  
ATOM 897   H HB3  . PRO A 1 63 ? -12.830 6.772   4.686   1.00 0.00 ? 63 PRO A HB3  1  
ATOM 898   H HG2  . PRO A 1 63 ? -12.973 8.007   7.042   1.00 0.00 ? 63 PRO A HG2  1  
ATOM 899   H HG3  . PRO A 1 63 ? -12.715 6.255   6.944   1.00 0.00 ? 63 PRO A HG3  1  
ATOM 900   H HD2  . PRO A 1 63 ? -10.759 8.430   7.549   1.00 0.00 ? 63 PRO A HD2  1  
ATOM 901   H HD3  . PRO A 1 63 ? -10.877 6.795   8.231   1.00 0.00 ? 63 PRO A HD3  1  
ATOM 902   N N    . LYS A 1 64 ? -9.833  6.868   2.733   1.00 0.00 ? 64 LYS A N    1  
ATOM 903   C CA   . LYS A 1 64 ? -9.167  7.488   1.592   1.00 0.00 ? 64 LYS A CA   1  
ATOM 904   C C    . LYS A 1 64 ? -7.721  7.839   1.928   1.00 0.00 ? 64 LYS A C    1  
ATOM 905   O O    . LYS A 1 64 ? -7.370  9.012   2.060   1.00 0.00 ? 64 LYS A O    1  
ATOM 906   C CB   . LYS A 1 64 ? -9.924  8.745   1.156   1.00 0.00 ? 64 LYS A CB   1  
ATOM 907   C CG   . LYS A 1 64 ? -11.409 8.515   0.934   1.00 0.00 ? 64 LYS A CG   1  
ATOM 908   C CD   . LYS A 1 64 ? -11.706 8.145   -0.509  1.00 0.00 ? 64 LYS A CD   1  
ATOM 909   C CE   . LYS A 1 64 ? -11.430 6.674   -0.776  1.00 0.00 ? 64 LYS A CE   1  
ATOM 910   N NZ   . LYS A 1 64 ? -12.065 6.209   -2.040  1.00 0.00 ? 64 LYS A NZ   1  
ATOM 911   H H    . LYS A 1 64 ? -10.176 5.955   2.647   1.00 0.00 ? 64 LYS A H    1  
ATOM 912   H HA   . LYS A 1 64 ? -9.173  6.777   0.780   1.00 0.00 ? 64 LYS A HA   1  
ATOM 913   H HB2  . LYS A 1 64 ? -9.808  9.503   1.917   1.00 0.00 ? 64 LYS A HB2  1  
ATOM 914   H HB3  . LYS A 1 64 ? -9.495  9.106   0.232   1.00 0.00 ? 64 LYS A HB3  1  
ATOM 915   H HG2  . LYS A 1 64 ? -11.739 7.711   1.576   1.00 0.00 ? 64 LYS A HG2  1  
ATOM 916   H HG3  . LYS A 1 64 ? -11.944 9.420   1.183   1.00 0.00 ? 64 LYS A HG3  1  
ATOM 917   H HD2  . LYS A 1 64 ? -12.747 8.348   -0.716  1.00 0.00 ? 64 LYS A HD2  1  
ATOM 918   H HD3  . LYS A 1 64 ? -11.084 8.743   -1.159  1.00 0.00 ? 64 LYS A HD3  1  
ATOM 919   H HE2  . LYS A 1 64 ? -10.362 6.529   -0.846  1.00 0.00 ? 64 LYS A HE2  1  
ATOM 920   H HE3  . LYS A 1 64 ? -11.818 6.093   0.048   1.00 0.00 ? 64 LYS A HE3  1  
ATOM 921   H HZ1  . LYS A 1 64 ? -11.377 6.239   -2.818  1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 922   H HZ2  . LYS A 1 64 ? -12.870 6.821   -2.281  1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 923   H HZ3  . LYS A 1 64 ? -12.407 5.233   -1.930  1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 924   N N    . PHE A 1 65 ? -6.886  6.815   2.064   1.00 0.00 ? 65 PHE A N    1  
ATOM 925   C CA   . PHE A 1 65 ? -5.477  7.015   2.383   1.00 0.00 ? 65 PHE A CA   1  
ATOM 926   C C    . PHE A 1 65 ? -4.654  5.787   2.003   1.00 0.00 ? 65 PHE A C    1  
ATOM 927   O O    . PHE A 1 65 ? -3.583  5.906   1.407   1.00 0.00 ? 65 PHE A O    1  
ATOM 928   C CB   . PHE A 1 65 ? -5.307  7.317   3.872   1.00 0.00 ? 65 PHE A CB   1  
ATOM 929   C CG   . PHE A 1 65 ? -5.429  8.777   4.206   1.00 0.00 ? 65 PHE A CG   1  
ATOM 930   C CD1  . PHE A 1 65 ? -4.350  9.631   4.045   1.00 0.00 ? 65 PHE A CD1  1  
ATOM 931   C CD2  . PHE A 1 65 ? -6.625  9.296   4.678   1.00 0.00 ? 65 PHE A CD2  1  
ATOM 932   C CE1  . PHE A 1 65 ? -4.459  10.974  4.351   1.00 0.00 ? 65 PHE A CE1  1  
ATOM 933   C CE2  . PHE A 1 65 ? -6.740  10.638  4.986   1.00 0.00 ? 65 PHE A CE2  1  
ATOM 934   C CZ   . PHE A 1 65 ? -5.656  11.479  4.822   1.00 0.00 ? 65 PHE A CZ   1  
ATOM 935   H H    . PHE A 1 65 ? -7.225  5.903   1.946   1.00 0.00 ? 65 PHE A H    1  
ATOM 936   H HA   . PHE A 1 65 ? -5.125  7.860   1.810   1.00 0.00 ? 65 PHE A HA   1  
ATOM 937   H HB2  . PHE A 1 65 ? -6.063  6.786   4.429   1.00 0.00 ? 65 PHE A HB2  1  
ATOM 938   H HB3  . PHE A 1 65 ? -4.330  6.983   4.191   1.00 0.00 ? 65 PHE A HB3  1  
ATOM 939   H HD1  . PHE A 1 65 ? -3.414  9.238   3.678   1.00 0.00 ? 65 PHE A HD1  1  
ATOM 940   H HD2  . PHE A 1 65 ? -7.472  8.640   4.807   1.00 0.00 ? 65 PHE A HD2  1  
ATOM 941   H HE1  . PHE A 1 65 ? -3.610  11.629  4.222   1.00 0.00 ? 65 PHE A HE1  1  
ATOM 942   H HE2  . PHE A 1 65 ? -7.677  11.030  5.353   1.00 0.00 ? 65 PHE A HE2  1  
ATOM 943   H HZ   . PHE A 1 65 ? -5.744  12.528  5.061   1.00 0.00 ? 65 PHE A HZ   1  
ATOM 944   N N    . GLY A 1 66 ? -5.162  4.609   2.352   1.00 0.00 ? 66 GLY A N    1  
ATOM 945   C CA   . GLY A 1 66 ? -4.461  3.378   2.039   1.00 0.00 ? 66 GLY A CA   1  
ATOM 946   C C    . GLY A 1 66 ? -4.838  2.828   0.677   1.00 0.00 ? 66 GLY A C    1  
ATOM 947   O O    . GLY A 1 66 ? -6.011  2.829   0.303   1.00 0.00 ? 66 GLY A O    1  
ATOM 948   H H    . GLY A 1 66 ? -6.020  4.576   2.825   1.00 0.00 ? 66 GLY A H    1  
ATOM 949   H HA2  . GLY A 1 66 ? -3.398  3.568   2.056   1.00 0.00 ? 66 GLY A HA2  1  
ATOM 950   H HA3  . GLY A 1 66 ? -4.698  2.641   2.792   1.00 0.00 ? 66 GLY A HA3  1  
ATOM 951   N N    . LEU A 1 67 ? -3.842  2.355   -0.065  1.00 0.00 ? 67 LEU A N    1  
ATOM 952   C CA   . LEU A 1 67 ? -4.076  1.799   -1.393  1.00 0.00 ? 67 LEU A CA   1  
ATOM 953   C C    . LEU A 1 67 ? -3.373  0.456   -1.553  1.00 0.00 ? 67 LEU A C    1  
ATOM 954   O O    . LEU A 1 67 ? -2.146  0.376   -1.506  1.00 0.00 ? 67 LEU A O    1  
ATOM 955   C CB   . LEU A 1 67 ? -3.592  2.774   -2.468  1.00 0.00 ? 67 LEU A CB   1  
ATOM 956   C CG   . LEU A 1 67 ? -3.802  2.303   -3.911  1.00 0.00 ? 67 LEU A CG   1  
ATOM 957   C CD1  . LEU A 1 67 ? -4.474  3.390   -4.737  1.00 0.00 ? 67 LEU A CD1  1  
ATOM 958   C CD2  . LEU A 1 67 ? -2.477  1.898   -4.539  1.00 0.00 ? 67 LEU A CD2  1  
ATOM 959   H H    . LEU A 1 67 ? -2.929  2.382   0.289   1.00 0.00 ? 67 LEU A H    1  
ATOM 960   H HA   . LEU A 1 67 ? -5.140  1.652   -1.507  1.00 0.00 ? 67 LEU A HA   1  
ATOM 961   H HB2  . LEU A 1 67 ? -4.114  3.711   -2.334  1.00 0.00 ? 67 LEU A HB2  1  
ATOM 962   H HB3  . LEU A 1 67 ? -2.536  2.946   -2.319  1.00 0.00 ? 67 LEU A HB3  1  
ATOM 963   H HG   . LEU A 1 67 ? -4.450  1.439   -3.909  1.00 0.00 ? 67 LEU A HG   1  
ATOM 964   H HD11 . LEU A 1 67 ? -4.759  2.987   -5.697  1.00 0.00 ? 67 LEU A HD11 1  
ATOM 965   H HD12 . LEU A 1 67 ? -3.786  4.210   -4.881  1.00 0.00 ? 67 LEU A HD12 1  
ATOM 966   H HD13 . LEU A 1 67 ? -5.353  3.745   -4.219  1.00 0.00 ? 67 LEU A HD13 1  
ATOM 967   H HD21 . LEU A 1 67 ? -2.098  2.713   -5.138  1.00 0.00 ? 67 LEU A HD21 1  
ATOM 968   H HD22 . LEU A 1 67 ? -2.626  1.031   -5.165  1.00 0.00 ? 67 LEU A HD22 1  
ATOM 969   H HD23 . LEU A 1 67 ? -1.766  1.662   -3.761  1.00 0.00 ? 67 LEU A HD23 1  
ATOM 970   N N    . PHE A 1 68 ? -4.160  -0.599  -1.742  1.00 0.00 ? 68 PHE A N    1  
ATOM 971   C CA   . PHE A 1 68 ? -3.613  -1.941  -1.909  1.00 0.00 ? 68 PHE A CA   1  
ATOM 972   C C    . PHE A 1 68 ? -3.092  -2.143  -3.329  1.00 0.00 ? 68 PHE A C    1  
ATOM 973   O O    . PHE A 1 68 ? -3.844  -2.038  -4.297  1.00 0.00 ? 68 PHE A O    1  
ATOM 974   C CB   . PHE A 1 68 ? -4.678  -2.991  -1.591  1.00 0.00 ? 68 PHE A CB   1  
ATOM 975   C CG   . PHE A 1 68 ? -4.928  -3.166  -0.119  1.00 0.00 ? 68 PHE A CG   1  
ATOM 976   C CD1  . PHE A 1 68 ? -3.905  -3.561  0.727   1.00 0.00 ? 68 PHE A CD1  1  
ATOM 977   C CD2  . PHE A 1 68 ? -6.184  -2.935  0.416   1.00 0.00 ? 68 PHE A CD2  1  
ATOM 978   C CE1  . PHE A 1 68 ? -4.131  -3.723  2.081   1.00 0.00 ? 68 PHE A CE1  1  
ATOM 979   C CE2  . PHE A 1 68 ? -6.417  -3.095  1.768   1.00 0.00 ? 68 PHE A CE2  1  
ATOM 980   C CZ   . PHE A 1 68 ? -5.389  -3.490  2.602   1.00 0.00 ? 68 PHE A CZ   1  
ATOM 981   H H    . PHE A 1 68 ? -5.132  -0.472  -1.771  1.00 0.00 ? 68 PHE A H    1  
ATOM 982   H HA   . PHE A 1 68 ? -2.791  -2.052  -1.218  1.00 0.00 ? 68 PHE A HA   1  
ATOM 983   H HB2  . PHE A 1 68 ? -5.609  -2.702  -2.052  1.00 0.00 ? 68 PHE A HB2  1  
ATOM 984   H HB3  . PHE A 1 68 ? -4.364  -3.945  -1.991  1.00 0.00 ? 68 PHE A HB3  1  
ATOM 985   H HD1  . PHE A 1 68 ? -2.920  -3.744  0.321   1.00 0.00 ? 68 PHE A HD1  1  
ATOM 986   H HD2  . PHE A 1 68 ? -6.989  -2.626  -0.235  1.00 0.00 ? 68 PHE A HD2  1  
ATOM 987   H HE1  . PHE A 1 68 ? -3.326  -4.032  2.731   1.00 0.00 ? 68 PHE A HE1  1  
ATOM 988   H HE2  . PHE A 1 68 ? -7.401  -2.912  2.173   1.00 0.00 ? 68 PHE A HE2  1  
ATOM 989   H HZ   . PHE A 1 68 ? -5.568  -3.615  3.660   1.00 0.00 ? 68 PHE A HZ   1  
ATOM 990   N N    . ALA A 1 69 ? -1.800  -2.435  -3.444  1.00 0.00 ? 69 ALA A N    1  
ATOM 991   C CA   . ALA A 1 69 ? -1.180  -2.653  -4.745  1.00 0.00 ? 69 ALA A CA   1  
ATOM 992   C C    . ALA A 1 69 ? -0.198  -3.821  -4.695  1.00 0.00 ? 69 ALA A C    1  
ATOM 993   O O    . ALA A 1 69 ? 0.427   -4.072  -3.666  1.00 0.00 ? 69 ALA A O    1  
ATOM 994   C CB   . ALA A 1 69 ? -0.476  -1.388  -5.211  1.00 0.00 ? 69 ALA A CB   1  
ATOM 995   H H    . ALA A 1 69 ? -1.253  -2.506  -2.635  1.00 0.00 ? 69 ALA A H    1  
ATOM 996   H HA   . ALA A 1 69 ? -1.963  -2.883  -5.453  1.00 0.00 ? 69 ALA A HA   1  
ATOM 997   H HB1  . ALA A 1 69 ? -0.359  -1.415  -6.284  1.00 0.00 ? 69 ALA A HB1  1  
ATOM 998   H HB2  . ALA A 1 69 ? 0.497   -1.324  -4.744  1.00 0.00 ? 69 ALA A HB2  1  
ATOM 999   H HB3  . ALA A 1 69 ? -1.065  -0.526  -4.935  1.00 0.00 ? 69 ALA A HB3  1  
ATOM 1000  N N    . PRO A 1 70 ? -0.049  -4.552  -5.814  1.00 0.00 ? 70 PRO A N    1  
ATOM 1001  C CA   . PRO A 1 70 ? 0.865   -5.697  -5.891  1.00 0.00 ? 70 PRO A CA   1  
ATOM 1002  C C    . PRO A 1 70 ? 2.283   -5.334  -5.465  1.00 0.00 ? 70 PRO A C    1  
ATOM 1003  O O    . PRO A 1 70 ? 2.750   -4.222  -5.715  1.00 0.00 ? 70 PRO A O    1  
ATOM 1004  C CB   . PRO A 1 70 ? 0.833   -6.083  -7.372  1.00 0.00 ? 70 PRO A CB   1  
ATOM 1005  C CG   . PRO A 1 70 ? -0.473  -5.571  -7.872  1.00 0.00 ? 70 PRO A CG   1  
ATOM 1006  C CD   . PRO A 1 70 ? -0.755  -4.321  -7.088  1.00 0.00 ? 70 PRO A CD   1  
ATOM 1007  H HA   . PRO A 1 70 ? 0.512   -6.524  -5.292  1.00 0.00 ? 70 PRO A HA   1  
ATOM 1008  H HB2  . PRO A 1 70 ? 1.663   -5.621  -7.885  1.00 0.00 ? 70 PRO A HB2  1  
ATOM 1009  H HB3  . PRO A 1 70 ? 0.897   -7.157  -7.467  1.00 0.00 ? 70 PRO A HB3  1  
ATOM 1010  H HG2  . PRO A 1 70 ? -0.399  -5.345  -8.926  1.00 0.00 ? 70 PRO A HG2  1  
ATOM 1011  H HG3  . PRO A 1 70 ? -1.247  -6.305  -7.699  1.00 0.00 ? 70 PRO A HG3  1  
ATOM 1012  H HD2  . PRO A 1 70 ? -0.357  -3.457  -7.598  1.00 0.00 ? 70 PRO A HD2  1  
ATOM 1013  H HD3  . PRO A 1 70 ? -1.816  -4.209  -6.924  1.00 0.00 ? 70 PRO A HD3  1  
ATOM 1014  N N    . ILE A 1 71 ? 2.964   -6.277  -4.822  1.00 0.00 ? 71 ILE A N    1  
ATOM 1015  C CA   . ILE A 1 71 ? 4.328   -6.053  -4.361  1.00 0.00 ? 71 ILE A CA   1  
ATOM 1016  C C    . ILE A 1 71 ? 5.256   -5.714  -5.526  1.00 0.00 ? 71 ILE A C    1  
ATOM 1017  O O    . ILE A 1 71 ? 6.044   -4.772  -5.448  1.00 0.00 ? 71 ILE A O    1  
ATOM 1018  C CB   . ILE A 1 71 ? 4.878   -7.286  -3.612  1.00 0.00 ? 71 ILE A CB   1  
ATOM 1019  C CG1  . ILE A 1 71 ? 6.271   -6.994  -3.050  1.00 0.00 ? 71 ILE A CG1  1  
ATOM 1020  C CG2  . ILE A 1 71 ? 4.913   -8.498  -4.531  1.00 0.00 ? 71 ILE A CG2  1  
ATOM 1021  C CD1  . ILE A 1 71 ? 6.500   -7.573  -1.671  1.00 0.00 ? 71 ILE A CD1  1  
ATOM 1022  H H    . ILE A 1 71 ? 2.537   -7.142  -4.652  1.00 0.00 ? 71 ILE A H    1  
ATOM 1023  H HA   . ILE A 1 71 ? 4.313   -5.219  -3.674  1.00 0.00 ? 71 ILE A HA   1  
ATOM 1024  H HB   . ILE A 1 71 ? 4.209   -7.507  -2.794  1.00 0.00 ? 71 ILE A HB   1  
ATOM 1025  H HG12 . ILE A 1 71 ? 7.014   -7.414  -3.712  1.00 0.00 ? 71 ILE A HG12 1  
ATOM 1026  H HG13 . ILE A 1 71 ? 6.412   -5.925  -2.990  1.00 0.00 ? 71 ILE A HG13 1  
ATOM 1027  H HG21 . ILE A 1 71 ? 4.003   -8.537  -5.111  1.00 0.00 ? 71 ILE A HG21 1  
ATOM 1028  H HG22 . ILE A 1 71 ? 5.002   -9.397  -3.938  1.00 0.00 ? 71 ILE A HG22 1  
ATOM 1029  H HG23 . ILE A 1 71 ? 5.761   -8.421  -5.196  1.00 0.00 ? 71 ILE A HG23 1  
ATOM 1030  H HD11 . ILE A 1 71 ? 5.561   -7.612  -1.138  1.00 0.00 ? 71 ILE A HD11 1  
ATOM 1031  H HD12 . ILE A 1 71 ? 7.195   -6.948  -1.129  1.00 0.00 ? 71 ILE A HD12 1  
ATOM 1032  H HD13 . ILE A 1 71 ? 6.904   -8.569  -1.761  1.00 0.00 ? 71 ILE A HD13 1  
ATOM 1033  N N    . HIS A 1 72 ? 5.156   -6.487  -6.603  1.00 0.00 ? 72 HIS A N    1  
ATOM 1034  C CA   . HIS A 1 72 ? 5.988   -6.262  -7.779  1.00 0.00 ? 72 HIS A CA   1  
ATOM 1035  C C    . HIS A 1 72 ? 5.685   -4.908  -8.416  1.00 0.00 ? 72 HIS A C    1  
ATOM 1036  O O    . HIS A 1 72 ? 6.493   -4.378  -9.181  1.00 0.00 ? 72 HIS A O    1  
ATOM 1037  C CB   . HIS A 1 72 ? 5.779   -7.379  -8.803  1.00 0.00 ? 72 HIS A CB   1  
ATOM 1038  C CG   . HIS A 1 72 ? 4.338   -7.687  -9.072  1.00 0.00 ? 72 HIS A CG   1  
ATOM 1039  N ND1  . HIS A 1 72 ? 3.592   -8.577  -8.332  1.00 0.00 ? 72 HIS A ND1  1  
ATOM 1040  C CD2  . HIS A 1 72 ? 3.505   -7.205  -10.029 1.00 0.00 ? 72 HIS A CD2  1  
ATOM 1041  C CE1  . HIS A 1 72 ? 2.357   -8.608  -8.851  1.00 0.00 ? 72 HIS A CE1  1  
ATOM 1042  N NE2  . HIS A 1 72 ? 2.252   -7.793  -9.882  1.00 0.00 ? 72 HIS A NE2  1  
ATOM 1043  H H    . HIS A 1 72 ? 4.509   -7.222  -6.608  1.00 0.00 ? 72 HIS A H    1  
ATOM 1044  H HA   . HIS A 1 72 ? 7.019   -6.271  -7.460  1.00 0.00 ? 72 HIS A HA   1  
ATOM 1045  H HB2  . HIS A 1 72 ? 6.236   -7.092  -9.739  1.00 0.00 ? 72 HIS A HB2  1  
ATOM 1046  H HB3  . HIS A 1 72 ? 6.250   -8.282  -8.441  1.00 0.00 ? 72 HIS A HB3  1  
ATOM 1047  H HD1  . HIS A 1 72 ? 3.908   -9.096  -7.563  1.00 0.00 ? 72 HIS A HD1  1  
ATOM 1048  H HD2  . HIS A 1 72 ? 3.763   -6.482  -10.788 1.00 0.00 ? 72 HIS A HD2  1  
ATOM 1049  H HE1  . HIS A 1 72 ? 1.551   -9.220  -8.473  1.00 0.00 ? 72 HIS A HE1  1  
ATOM 1050  N N    . LYS A 1 73 ? 4.521   -4.349  -8.098  1.00 0.00 ? 73 LYS A N    1  
ATOM 1051  C CA   . LYS A 1 73 ? 4.121   -3.056  -8.641  1.00 0.00 ? 73 LYS A CA   1  
ATOM 1052  C C    . LYS A 1 73 ? 4.448   -1.927  -7.668  1.00 0.00 ? 73 LYS A C    1  
ATOM 1053  O O    . LYS A 1 73 ? 3.835   -0.859  -7.713  1.00 0.00 ? 73 LYS A O    1  
ATOM 1054  C CB   . LYS A 1 73 ? 2.624   -3.053  -8.955  1.00 0.00 ? 73 LYS A CB   1  
ATOM 1055  C CG   . LYS A 1 73 ? 2.240   -3.974  -10.102 1.00 0.00 ? 73 LYS A CG   1  
ATOM 1056  C CD   . LYS A 1 73 ? 2.125   -3.214  -11.414 1.00 0.00 ? 73 LYS A CD   1  
ATOM 1057  C CE   . LYS A 1 73 ? 0.958   -3.715  -12.248 1.00 0.00 ? 73 LYS A CE   1  
ATOM 1058  N NZ   . LYS A 1 73 ? 0.821   -2.958  -13.523 1.00 0.00 ? 73 LYS A NZ   1  
ATOM 1059  H H    . LYS A 1 73 ? 3.917   -4.816  -7.484  1.00 0.00 ? 73 LYS A H    1  
ATOM 1060  H HA   . LYS A 1 73 ? 4.671   -2.897  -9.556  1.00 0.00 ? 73 LYS A HA   1  
ATOM 1061  H HB2  . LYS A 1 73 ? 2.082   -3.366  -8.076  1.00 0.00 ? 73 LYS A HB2  1  
ATOM 1062  H HB3  . LYS A 1 73 ? 2.323   -2.048  -9.214  1.00 0.00 ? 73 LYS A HB3  1  
ATOM 1063  H HG2  . LYS A 1 73 ? 2.997   -4.737  -10.206 1.00 0.00 ? 73 LYS A HG2  1  
ATOM 1064  H HG3  . LYS A 1 73 ? 1.290   -4.435  -9.879  1.00 0.00 ? 73 LYS A HG3  1  
ATOM 1065  H HD2  . LYS A 1 73 ? 1.977   -2.165  -11.199 1.00 0.00 ? 73 LYS A HD2  1  
ATOM 1066  H HD3  . LYS A 1 73 ? 3.039   -3.342  -11.974 1.00 0.00 ? 73 LYS A HD3  1  
ATOM 1067  H HE2  . LYS A 1 73 ? 1.117   -4.758  -12.475 1.00 0.00 ? 73 LYS A HE2  1  
ATOM 1068  H HE3  . LYS A 1 73 ? 0.049   -3.606  -11.674 1.00 0.00 ? 73 LYS A HE3  1  
ATOM 1069  H HZ1  . LYS A 1 73 ? 1.746   -2.587  -13.820 1.00 0.00 ? 73 LYS A HZ1  1  
ATOM 1070  H HZ2  . LYS A 1 73 ? 0.164   -2.162  -13.396 1.00 0.00 ? 73 LYS A HZ2  1  
ATOM 1071  H HZ3  . LYS A 1 73 ? 0.452   -3.580  -14.271 1.00 0.00 ? 73 LYS A HZ3  1  
ATOM 1072  N N    . VAL A 1 74 ? 5.417   -2.166  -6.788  1.00 0.00 ? 74 VAL A N    1  
ATOM 1073  C CA   . VAL A 1 74 ? 5.821   -1.164  -5.807  1.00 0.00 ? 74 VAL A CA   1  
ATOM 1074  C C    . VAL A 1 74 ? 7.309   -0.853  -5.922  1.00 0.00 ? 74 VAL A C    1  
ATOM 1075  O O    . VAL A 1 74 ? 8.138   -1.759  -6.011  1.00 0.00 ? 74 VAL A O    1  
ATOM 1076  C CB   . VAL A 1 74 ? 5.515   -1.628  -4.371  1.00 0.00 ? 74 VAL A CB   1  
ATOM 1077  C CG1  . VAL A 1 74 ? 5.749   -0.495  -3.383  1.00 0.00 ? 74 VAL A CG1  1  
ATOM 1078  C CG2  . VAL A 1 74 ? 4.088   -2.151  -4.269  1.00 0.00 ? 74 VAL A CG2  1  
ATOM 1079  H H    . VAL A 1 74 ? 5.871   -3.033  -6.798  1.00 0.00 ? 74 VAL A H    1  
ATOM 1080  H HA   . VAL A 1 74 ? 5.259   -0.263  -6.000  1.00 0.00 ? 74 VAL A HA   1  
ATOM 1081  H HB   . VAL A 1 74 ? 6.189   -2.435  -4.123  1.00 0.00 ? 74 VAL A HB   1  
ATOM 1082  H HG11 . VAL A 1 74 ? 6.799   -0.441  -3.139  1.00 0.00 ? 74 VAL A HG11 1  
ATOM 1083  H HG12 . VAL A 1 74 ? 5.179   -0.679  -2.483  1.00 0.00 ? 74 VAL A HG12 1  
ATOM 1084  H HG13 . VAL A 1 74 ? 5.432   0.438   -3.824  1.00 0.00 ? 74 VAL A HG13 1  
ATOM 1085  H HG21 . VAL A 1 74 ? 3.626   -1.765  -3.374  1.00 0.00 ? 74 VAL A HG21 1  
ATOM 1086  H HG22 . VAL A 1 74 ? 4.103   -3.229  -4.231  1.00 0.00 ? 74 VAL A HG22 1  
ATOM 1087  H HG23 . VAL A 1 74 ? 3.525   -1.829  -5.133  1.00 0.00 ? 74 VAL A HG23 1  
ATOM 1088  N N    . ILE A 1 75 ? 7.642   0.434   -5.920  1.00 0.00 ? 75 ILE A N    1  
ATOM 1089  C CA   . ILE A 1 75 ? 9.032   0.864   -6.023  1.00 0.00 ? 75 ILE A CA   1  
ATOM 1090  C C    . ILE A 1 75 ? 9.527   1.443   -4.703  1.00 0.00 ? 75 ILE A C    1  
ATOM 1091  O O    . ILE A 1 75 ? 8.787   2.131   -3.999  1.00 0.00 ? 75 ILE A O    1  
ATOM 1092  C CB   . ILE A 1 75 ? 9.212   1.917   -7.132  1.00 0.00 ? 75 ILE A CB   1  
ATOM 1093  C CG1  . ILE A 1 75 ? 8.541   1.449   -8.424  1.00 0.00 ? 75 ILE A CG1  1  
ATOM 1094  C CG2  . ILE A 1 75 ? 10.690  2.193   -7.365  1.00 0.00 ? 75 ILE A CG2  1  
ATOM 1095  C CD1  . ILE A 1 75 ? 8.581   2.477   -9.533  1.00 0.00 ? 75 ILE A CD1  1  
ATOM 1096  H H    . ILE A 1 75 ? 6.937   1.109   -5.846  1.00 0.00 ? 75 ILE A H    1  
ATOM 1097  H HA   . ILE A 1 75 ? 9.630   0.001   -6.273  1.00 0.00 ? 75 ILE A HA   1  
ATOM 1098  H HB   . ILE A 1 75 ? 8.748   2.835   -6.806  1.00 0.00 ? 75 ILE A HB   1  
ATOM 1099  H HG12 . ILE A 1 75 ? 9.039   0.559   -8.780  1.00 0.00 ? 75 ILE A HG12 1  
ATOM 1100  H HG13 . ILE A 1 75 ? 7.505   1.220   -8.222  1.00 0.00 ? 75 ILE A HG13 1  
ATOM 1101  H HG21 . ILE A 1 75 ? 11.253  1.282   -7.219  1.00 0.00 ? 75 ILE A HG21 1  
ATOM 1102  H HG22 . ILE A 1 75 ? 11.031  2.943   -6.668  1.00 0.00 ? 75 ILE A HG22 1  
ATOM 1103  H HG23 . ILE A 1 75 ? 10.835  2.546   -8.375  1.00 0.00 ? 75 ILE A HG23 1  
ATOM 1104  H HD11 . ILE A 1 75 ? 7.679   2.409   -10.122 1.00 0.00 ? 75 ILE A HD11 1  
ATOM 1105  H HD12 . ILE A 1 75 ? 9.438   2.292   -10.165 1.00 0.00 ? 75 ILE A HD12 1  
ATOM 1106  H HD13 . ILE A 1 75 ? 8.658   3.466   -9.105  1.00 0.00 ? 75 ILE A HD13 1  
ATOM 1107  N N    . ARG A 1 76 ? 10.784  1.161   -4.373  1.00 0.00 ? 76 ARG A N    1  
ATOM 1108  C CA   . ARG A 1 76 ? 11.378  1.656   -3.137  1.00 0.00 ? 76 ARG A CA   1  
ATOM 1109  C C    . ARG A 1 76 ? 12.166  2.938   -3.387  1.00 0.00 ? 76 ARG A C    1  
ATOM 1110  O O    . ARG A 1 76 ? 12.761  3.116   -4.449  1.00 0.00 ? 76 ARG A O    1  
ATOM 1111  C CB   . ARG A 1 76 ? 12.291  0.591   -2.525  1.00 0.00 ? 76 ARG A CB   1  
ATOM 1112  C CG   . ARG A 1 76 ? 12.160  0.472   -1.015  1.00 0.00 ? 76 ARG A CG   1  
ATOM 1113  C CD   . ARG A 1 76 ? 13.232  -0.434  -0.433  1.00 0.00 ? 76 ARG A CD   1  
ATOM 1114  N NE   . ARG A 1 76 ? 12.824  -1.838  -0.437  1.00 0.00 ? 76 ARG A NE   1  
ATOM 1115  C CZ   . ARG A 1 76 ? 13.485  -2.804  0.196   1.00 0.00 ? 76 ARG A CZ   1  
ATOM 1116  N NH1  . ARG A 1 76 ? 14.586  -2.524  0.885   1.00 0.00 ? 76 ARG A NH1  1  
ATOM 1117  N NH2  . ARG A 1 76 ? 13.045  -4.054  0.141   1.00 0.00 ? 76 ARG A NH2  1  
ATOM 1118  H H    . ARG A 1 76 ? 11.323  0.608   -4.976  1.00 0.00 ? 76 ARG A H    1  
ATOM 1119  H HA   . ARG A 1 76 ? 10.576  1.869   -2.446  1.00 0.00 ? 76 ARG A HA   1  
ATOM 1120  H HB2  . ARG A 1 76 ? 12.051  -0.367  -2.961  1.00 0.00 ? 76 ARG A HB2  1  
ATOM 1121  H HB3  . ARG A 1 76 ? 13.317  0.835   -2.758  1.00 0.00 ? 76 ARG A HB3  1  
ATOM 1122  H HG2  . ARG A 1 76 ? 12.257  1.454   -0.576  1.00 0.00 ? 76 ARG A HG2  1  
ATOM 1123  H HG3  . ARG A 1 76 ? 11.188  0.064   -0.778  1.00 0.00 ? 76 ARG A HG3  1  
ATOM 1124  H HD2  . ARG A 1 76 ? 14.132  -0.330  -1.021  1.00 0.00 ? 76 ARG A HD2  1  
ATOM 1125  H HD3  . ARG A 1 76 ? 13.430  -0.130  0.585   1.00 0.00 ? 76 ARG A HD3  1  
ATOM 1126  H HE   . ARG A 1 76 ? 12.014  -2.072  -0.937  1.00 0.00 ? 76 ARG A HE   1  
ATOM 1127  H HH11 . ARG A 1 76 ? 14.922  -1.584  0.930   1.00 0.00 ? 76 ARG A HH11 1  
ATOM 1128  H HH12 . ARG A 1 76 ? 15.077  -3.255  1.357   1.00 0.00 ? 76 ARG A HH12 1  
ATOM 1129  H HH21 . ARG A 1 76 ? 12.216  -4.270  -0.374  1.00 0.00 ? 76 ARG A HH21 1  
ATOM 1130  H HH22 . ARG A 1 76 ? 13.541  -4.780  0.617   1.00 0.00 ? 76 ARG A HH22 1  
ATOM 1131  N N    . ILE A 1 77 ? 12.165  3.829   -2.400  1.00 0.00 ? 77 ILE A N    1  
ATOM 1132  C CA   . ILE A 1 77 ? 12.879  5.094   -2.512  1.00 0.00 ? 77 ILE A CA   1  
ATOM 1133  C C    . ILE A 1 77 ? 14.177  5.065   -1.713  1.00 0.00 ? 77 ILE A C    1  
ATOM 1134  O O    . ILE A 1 77 ? 15.157  5.713   -2.077  1.00 0.00 ? 77 ILE A O    1  
ATOM 1135  C CB   . ILE A 1 77 ? 12.015  6.272   -2.024  1.00 0.00 ? 77 ILE A CB   1  
ATOM 1136  C CG1  . ILE A 1 77 ? 10.626  6.213   -2.662  1.00 0.00 ? 77 ILE A CG1  1  
ATOM 1137  C CG2  . ILE A 1 77 ? 12.695  7.595   -2.343  1.00 0.00 ? 77 ILE A CG2  1  
ATOM 1138  C CD1  . ILE A 1 77 ? 9.700   7.316   -2.197  1.00 0.00 ? 77 ILE A CD1  1  
ATOM 1139  H H    . ILE A 1 77 ? 11.671  3.629   -1.576  1.00 0.00 ? 77 ILE A H    1  
ATOM 1140  H HA   . ILE A 1 77 ? 13.113  5.253   -3.555  1.00 0.00 ? 77 ILE A HA   1  
ATOM 1141  H HB   . ILE A 1 77 ? 11.915  6.196   -0.952  1.00 0.00 ? 77 ILE A HB   1  
ATOM 1142  H HG12 . ILE A 1 77 ? 10.725  6.296   -3.734  1.00 0.00 ? 77 ILE A HG12 1  
ATOM 1143  H HG13 . ILE A 1 77 ? 10.166  5.267   -2.419  1.00 0.00 ? 77 ILE A HG13 1  
ATOM 1144  H HG21 . ILE A 1 77 ? 11.948  8.330   -2.605  1.00 0.00 ? 77 ILE A HG21 1  
ATOM 1145  H HG22 . ILE A 1 77 ? 13.374  7.461   -3.172  1.00 0.00 ? 77 ILE A HG22 1  
ATOM 1146  H HG23 . ILE A 1 77 ? 13.246  7.934   -1.479  1.00 0.00 ? 77 ILE A HG23 1  
ATOM 1147  H HD11 . ILE A 1 77 ? 8.981   7.534   -2.973  1.00 0.00 ? 77 ILE A HD11 1  
ATOM 1148  H HD12 . ILE A 1 77 ? 10.277  8.203   -1.979  1.00 0.00 ? 77 ILE A HD12 1  
ATOM 1149  H HD13 . ILE A 1 77 ? 9.181   6.997   -1.305  1.00 0.00 ? 77 ILE A HD13 1  
ATOM 1150  N N    . GLY A 1 78 ? 14.176  4.308   -0.620  1.00 0.00 ? 78 GLY A N    1  
ATOM 1151  C CA   . GLY A 1 78 ? 15.358  4.208   0.215   1.00 0.00 ? 78 GLY A CA   1  
ATOM 1152  C C    . GLY A 1 78 ? 16.353  3.191   -0.309  1.00 0.00 ? 78 GLY A C    1  
ATOM 1153  O O    . GLY A 1 78 ? 15.968  2.188   -0.910  1.00 0.00 ? 78 GLY A O    1  
ATOM 1154  H H    . GLY A 1 78 ? 13.365  3.813   -0.379  1.00 0.00 ? 78 GLY A H    1  
ATOM 1155  H HA2  . GLY A 1 78 ? 15.838  5.175   0.257   1.00 0.00 ? 78 GLY A HA2  1  
ATOM 1156  H HA3  . GLY A 1 78 ? 15.059  3.923   1.212   1.00 0.00 ? 78 GLY A HA3  1  
ATOM 1157  N N    . SER A 1 79 ? 17.637  3.449   -0.081  1.00 0.00 ? 79 SER A N    1  
ATOM 1158  C CA   . SER A 1 79 ? 18.691  2.548   -0.535  1.00 0.00 ? 79 SER A CA   1  
ATOM 1159  C C    . SER A 1 79 ? 19.568  2.106   0.633   1.00 0.00 ? 79 SER A C    1  
ATOM 1160  O O    . SER A 1 79 ? 20.081  2.934   1.384   1.00 0.00 ? 79 SER A O    1  
ATOM 1161  C CB   . SER A 1 79 ? 19.548  3.230   -1.603  1.00 0.00 ? 79 SER A CB   1  
ATOM 1162  O OG   . SER A 1 79 ? 19.084  2.915   -2.905  1.00 0.00 ? 79 SER A OG   1  
ATOM 1163  H H    . SER A 1 79 ? 17.882  4.265   0.403   1.00 0.00 ? 79 SER A H    1  
ATOM 1164  H HA   . SER A 1 79 ? 18.219  1.677   -0.965  1.00 0.00 ? 79 SER A HA   1  
ATOM 1165  H HB2  . SER A 1 79 ? 19.504  4.300   -1.468  1.00 0.00 ? 79 SER A HB2  1  
ATOM 1166  H HB3  . SER A 1 79 ? 20.570  2.896   -1.508  1.00 0.00 ? 79 SER A HB3  1  
ATOM 1167  H HG   . SER A 1 79 ? 18.126  2.978   -2.929  1.00 0.00 ? 79 SER A HG   1  
ATOM 1168  N N    . GLY A 1 80 ? 19.734  0.796   0.777   1.00 0.00 ? 80 GLY A N    1  
ATOM 1169  C CA   . GLY A 1 80 ? 20.550  0.268   1.855   1.00 0.00 ? 80 GLY A CA   1  
ATOM 1170  C C    . GLY A 1 80 ? 22.031  0.293   1.527   1.00 0.00 ? 80 GLY A C    1  
ATOM 1171  O O    . GLY A 1 80 ? 22.789  1.049   2.134   1.00 0.00 ? 80 GLY A O    1  
ATOM 1172  H H    . GLY A 1 80 ? 19.299  0.183   0.149   1.00 0.00 ? 80 GLY A H    1  
ATOM 1173  H HA2  . GLY A 1 80 ? 20.378  0.857   2.743   1.00 0.00 ? 80 GLY A HA2  1  
ATOM 1174  H HA3  . GLY A 1 80 ? 20.253  -0.752  2.050   1.00 0.00 ? 80 GLY A HA3  1  
ATOM 1175  N N    . PRO A 1 81 ? 22.477  -0.530  0.563   1.00 0.00 ? 81 PRO A N    1  
ATOM 1176  C CA   . PRO A 1 81 ? 23.886  -0.589  0.165   1.00 0.00 ? 81 PRO A CA   1  
ATOM 1177  C C    . PRO A 1 81 ? 24.320  0.650   -0.612  1.00 0.00 ? 81 PRO A C    1  
ATOM 1178  O O    . PRO A 1 81 ? 24.702  0.563   -1.779  1.00 0.00 ? 81 PRO A O    1  
ATOM 1179  C CB   . PRO A 1 81 ? 23.950  -1.831  -0.726  1.00 0.00 ? 81 PRO A CB   1  
ATOM 1180  C CG   . PRO A 1 81 ? 22.575  -1.964  -1.284  1.00 0.00 ? 81 PRO A CG   1  
ATOM 1181  C CD   . PRO A 1 81 ? 21.642  -1.468  -0.213  1.00 0.00 ? 81 PRO A CD   1  
ATOM 1182  H HA   . PRO A 1 81 ? 24.533  -0.722  1.019   1.00 0.00 ? 81 PRO A HA   1  
ATOM 1183  H HB2  . PRO A 1 81 ? 24.681  -1.680  -1.507  1.00 0.00 ? 81 PRO A HB2  1  
ATOM 1184  H HB3  . PRO A 1 81 ? 24.219  -2.691  -0.132  1.00 0.00 ? 81 PRO A HB3  1  
ATOM 1185  H HG2  . PRO A 1 81 ? 22.479  -1.361  -2.174  1.00 0.00 ? 81 PRO A HG2  1  
ATOM 1186  H HG3  . PRO A 1 81 ? 22.369  -3.000  -1.508  1.00 0.00 ? 81 PRO A HG3  1  
ATOM 1187  H HD2  . PRO A 1 81 ? 20.799  -0.958  -0.654  1.00 0.00 ? 81 PRO A HD2  1  
ATOM 1188  H HD3  . PRO A 1 81 ? 21.307  -2.287  0.405   1.00 0.00 ? 81 PRO A HD3  1  
ATOM 1189  N N    . SER A 1 82 ? 24.255  1.805   0.042   1.00 0.00 ? 82 SER A N    1  
ATOM 1190  C CA   . SER A 1 82 ? 24.640  3.063   -0.587  1.00 0.00 ? 82 SER A CA   1  
ATOM 1191  C C    . SER A 1 82 ? 25.559  3.870   0.325   1.00 0.00 ? 82 SER A C    1  
ATOM 1192  O O    . SER A 1 82 ? 25.642  3.612   1.525   1.00 0.00 ? 82 SER A O    1  
ATOM 1193  C CB   . SER A 1 82 ? 23.398  3.884   -0.934  1.00 0.00 ? 82 SER A CB   1  
ATOM 1194  O OG   . SER A 1 82 ? 22.631  4.166   0.224   1.00 0.00 ? 82 SER A OG   1  
ATOM 1195  H H    . SER A 1 82 ? 23.941  1.812   0.971   1.00 0.00 ? 82 SER A H    1  
ATOM 1196  H HA   . SER A 1 82 ? 25.172  2.828   -1.497  1.00 0.00 ? 82 SER A HA   1  
ATOM 1197  H HB2  . SER A 1 82 ? 23.700  4.818   -1.385  1.00 0.00 ? 82 SER A HB2  1  
ATOM 1198  H HB3  . SER A 1 82 ? 22.785  3.330   -1.630  1.00 0.00 ? 82 SER A HB3  1  
ATOM 1199  H HG   . SER A 1 82 ? 21.718  4.320   -0.026  1.00 0.00 ? 82 SER A HG   1  
ATOM 1200  N N    . SER A 1 83 ? 26.248  4.847   -0.254  1.00 0.00 ? 83 SER A N    1  
ATOM 1201  C CA   . SER A 1 83 ? 27.161  5.693   0.506   1.00 0.00 ? 83 SER A CA   1  
ATOM 1202  C C    . SER A 1 83 ? 27.036  7.151   0.077   1.00 0.00 ? 83 SER A C    1  
ATOM 1203  O O    . SER A 1 83 ? 26.854  8.041   0.909   1.00 0.00 ? 83 SER A O    1  
ATOM 1204  C CB   . SER A 1 83 ? 28.603  5.216   0.322   1.00 0.00 ? 83 SER A CB   1  
ATOM 1205  O OG   . SER A 1 83 ? 29.333  5.322   1.533   1.00 0.00 ? 83 SER A OG   1  
ATOM 1206  H H    . SER A 1 83 ? 26.139  5.005   -1.215  1.00 0.00 ? 83 SER A H    1  
ATOM 1207  H HA   . SER A 1 83 ? 26.895  5.614   1.550   1.00 0.00 ? 83 SER A HA   1  
ATOM 1208  H HB2  . SER A 1 83 ? 28.601  4.183   0.008   1.00 0.00 ? 83 SER A HB2  1  
ATOM 1209  H HB3  . SER A 1 83 ? 29.087  5.822   -0.430  1.00 0.00 ? 83 SER A HB3  1  
ATOM 1210  H HG   . SER A 1 83 ? 28.921  4.773   2.204   1.00 0.00 ? 83 SER A HG   1  
ATOM 1211  N N    . GLY A 1 84 ? 27.135  7.390   -1.227  1.00 0.00 ? 84 GLY A N    1  
ATOM 1212  C CA   . GLY A 1 84 ? 27.031  8.741   -1.744  1.00 0.00 ? 84 GLY A CA   1  
ATOM 1213  C C    . GLY A 1 84 ? 28.386  9.389   -1.952  1.00 0.00 ? 84 GLY A C    1  
ATOM 1214  O O    . GLY A 1 84 ? 28.441  10.634  -2.039  1.00 0.00 ? 84 GLY A O    1  
ATOM 1215  O OXT  . GLY A 1 84 ? 29.391  8.652   -2.029  1.00 0.00 ? 84 GLY A OXT  1  
ATOM 1216  H H    . GLY A 1 84 ? 27.279  6.641   -1.843  1.00 0.00 ? 84 GLY A H    1  
ATOM 1217  H HA2  . GLY A 1 84 ? 26.508  8.715   -2.689  1.00 0.00 ? 84 GLY A HA2  1  
ATOM 1218  H HA3  . GLY A 1 84 ? 26.462  9.339   -1.047  1.00 0.00 ? 84 GLY A HA3  1  
ATOM 1219  N N    . GLY A 1 1  ? 18.681  -12.957 0.970   1.00 0.00 ? 1  GLY A N    2  
ATOM 1220  C CA   . GLY A 1 1  ? 20.062  -13.470 0.750   1.00 0.00 ? 1  GLY A CA   2  
ATOM 1221  C C    . GLY A 1 1  ? 20.349  -13.763 -0.709  1.00 0.00 ? 1  GLY A C    2  
ATOM 1222  O O    . GLY A 1 1  ? 19.997  -14.830 -1.215  1.00 0.00 ? 1  GLY A O    2  
ATOM 1223  H H1   . GLY A 1 1  ? 18.104  -13.678 1.448   1.00 0.00 ? 1  GLY A H1   2  
ATOM 1224  H H2   . GLY A 1 1  ? 18.236  -12.724 0.059   1.00 0.00 ? 1  GLY A H2   2  
ATOM 1225  H H3   . GLY A 1 1  ? 18.707  -12.102 1.560   1.00 0.00 ? 1  GLY A H3   2  
ATOM 1226  H HA2  . GLY A 1 1  ? 20.768  -12.731 1.102   1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1227  H HA3  . GLY A 1 1  ? 20.193  -14.377 1.321   1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1228  N N    . SER A 1 2  ? 20.989  -12.817 -1.387  1.00 0.00 ? 2  SER A N    2  
ATOM 1229  C CA   . SER A 1 2  ? 21.324  -12.979 -2.797  1.00 0.00 ? 2  SER A CA   2  
ATOM 1230  C C    . SER A 1 2  ? 20.064  -13.165 -3.637  1.00 0.00 ? 2  SER A C    2  
ATOM 1231  O O    . SER A 1 2  ? 18.947  -13.107 -3.120  1.00 0.00 ? 2  SER A O    2  
ATOM 1232  C CB   . SER A 1 2  ? 22.257  -14.176 -2.987  1.00 0.00 ? 2  SER A CB   2  
ATOM 1233  O OG   . SER A 1 2  ? 23.479  -13.985 -2.296  1.00 0.00 ? 2  SER A OG   2  
ATOM 1234  H H    . SER A 1 2  ? 21.244  -11.989 -0.928  1.00 0.00 ? 2  SER A H    2  
ATOM 1235  H HA   . SER A 1 2  ? 21.830  -12.083 -3.122  1.00 0.00 ? 2  SER A HA   2  
ATOM 1236  H HB2  . SER A 1 2  ? 21.779  -15.066 -2.606  1.00 0.00 ? 2  SER A HB2  2  
ATOM 1237  H HB3  . SER A 1 2  ? 22.468  -14.302 -4.039  1.00 0.00 ? 2  SER A HB3  2  
ATOM 1238  H HG   . SER A 1 2  ? 23.300  -13.641 -1.418  1.00 0.00 ? 2  SER A HG   2  
ATOM 1239  N N    . SER A 1 3  ? 20.250  -13.386 -4.934  1.00 0.00 ? 3  SER A N    2  
ATOM 1240  C CA   . SER A 1 3  ? 19.129  -13.580 -5.846  1.00 0.00 ? 3  SER A CA   2  
ATOM 1241  C C    . SER A 1 3  ? 18.227  -12.349 -5.869  1.00 0.00 ? 3  SER A C    2  
ATOM 1242  O O    . SER A 1 3  ? 18.532  -11.333 -5.244  1.00 0.00 ? 3  SER A O    2  
ATOM 1243  C CB   . SER A 1 3  ? 18.319  -14.812 -5.437  1.00 0.00 ? 3  SER A CB   2  
ATOM 1244  O OG   . SER A 1 3  ? 17.425  -15.198 -6.466  1.00 0.00 ? 3  SER A OG   2  
ATOM 1245  H H    . SER A 1 3  ? 21.165  -13.421 -5.286  1.00 0.00 ? 3  SER A H    2  
ATOM 1246  H HA   . SER A 1 3  ? 19.530  -13.736 -6.836  1.00 0.00 ? 3  SER A HA   2  
ATOM 1247  H HB2  . SER A 1 3  ? 18.992  -15.632 -5.236  1.00 0.00 ? 3  SER A HB2  2  
ATOM 1248  H HB3  . SER A 1 3  ? 17.750  -14.587 -4.547  1.00 0.00 ? 3  SER A HB3  2  
ATOM 1249  H HG   . SER A 1 3  ? 17.496  -16.144 -6.614  1.00 0.00 ? 3  SER A HG   2  
ATOM 1250  N N    . GLY A 1 4  ? 17.117  -12.449 -6.592  1.00 0.00 ? 4  GLY A N    2  
ATOM 1251  C CA   . GLY A 1 4  ? 16.188  -11.339 -6.682  1.00 0.00 ? 4  GLY A CA   2  
ATOM 1252  C C    . GLY A 1 4  ? 14.859  -11.638 -6.017  1.00 0.00 ? 4  GLY A C    2  
ATOM 1253  O O    . GLY A 1 4  ? 13.799  -11.393 -6.593  1.00 0.00 ? 4  GLY A O    2  
ATOM 1254  H H    . GLY A 1 4  ? 16.926  -13.285 -7.067  1.00 0.00 ? 4  GLY A H    2  
ATOM 1255  H HA2  . GLY A 1 4  ? 16.629  -10.474 -6.208  1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1256  H HA3  . GLY A 1 4  ? 16.013  -11.114 -7.725  1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1257  N N    . SER A 1 5  ? 14.915  -12.169 -4.800  1.00 0.00 ? 5  SER A N    2  
ATOM 1258  C CA   . SER A 1 5  ? 13.708  -12.503 -4.055  1.00 0.00 ? 5  SER A CA   2  
ATOM 1259  C C    . SER A 1 5  ? 12.977  -11.242 -3.609  1.00 0.00 ? 5  SER A C    2  
ATOM 1260  O O    . SER A 1 5  ? 11.751  -11.229 -3.498  1.00 0.00 ? 5  SER A O    2  
ATOM 1261  C CB   . SER A 1 5  ? 14.055  -13.363 -2.838  1.00 0.00 ? 5  SER A CB   2  
ATOM 1262  O OG   . SER A 1 5  ? 15.164  -12.829 -2.137  1.00 0.00 ? 5  SER A OG   2  
ATOM 1263  H H    . SER A 1 5  ? 15.791  -12.341 -4.394  1.00 0.00 ? 5  SER A H    2  
ATOM 1264  H HA   . SER A 1 5  ? 13.060  -13.068 -4.710  1.00 0.00 ? 5  SER A HA   2  
ATOM 1265  H HB2  . SER A 1 5  ? 13.207  -13.398 -2.171  1.00 0.00 ? 5  SER A HB2  2  
ATOM 1266  H HB3  . SER A 1 5  ? 14.298  -14.363 -3.164  1.00 0.00 ? 5  SER A HB3  2  
ATOM 1267  H HG   . SER A 1 5  ? 15.572  -13.519 -1.608  1.00 0.00 ? 5  SER A HG   2  
ATOM 1268  N N    . SER A 1 6  ? 13.737  -10.182 -3.352  1.00 0.00 ? 6  SER A N    2  
ATOM 1269  C CA   . SER A 1 6  ? 13.161  -8.915  -2.918  1.00 0.00 ? 6  SER A CA   2  
ATOM 1270  C C    . SER A 1 6  ? 12.411  -9.083  -1.601  1.00 0.00 ? 6  SER A C    2  
ATOM 1271  O O    . SER A 1 6  ? 12.106  -10.200 -1.186  1.00 0.00 ? 6  SER A O    2  
ATOM 1272  C CB   . SER A 1 6  ? 12.218  -8.365  -3.990  1.00 0.00 ? 6  SER A CB   2  
ATOM 1273  O OG   . SER A 1 6  ? 12.132  -6.953  -3.919  1.00 0.00 ? 6  SER A OG   2  
ATOM 1274  H H    . SER A 1 6  ? 14.709  -10.254 -3.458  1.00 0.00 ? 6  SER A H    2  
ATOM 1275  H HA   . SER A 1 6  ? 13.971  -8.216  -2.771  1.00 0.00 ? 6  SER A HA   2  
ATOM 1276  H HB2  . SER A 1 6  ? 12.584  -8.643  -4.967  1.00 0.00 ? 6  SER A HB2  2  
ATOM 1277  H HB3  . SER A 1 6  ? 11.231  -8.781  -3.845  1.00 0.00 ? 6  SER A HB3  2  
ATOM 1278  H HG   . SER A 1 6  ? 13.013  -6.582  -3.835  1.00 0.00 ? 6  SER A HG   2  
ATOM 1279  N N    . GLY A 1 7  ? 12.117  -7.963  -0.947  1.00 0.00 ? 7  GLY A N    2  
ATOM 1280  C CA   . GLY A 1 7  ? 11.406  -8.008  0.317   1.00 0.00 ? 7  GLY A CA   2  
ATOM 1281  C C    . GLY A 1 7  ? 11.165  -6.628  0.896   1.00 0.00 ? 7  GLY A C    2  
ATOM 1282  O O    . GLY A 1 7  ? 12.078  -5.805  0.960   1.00 0.00 ? 7  GLY A O    2  
ATOM 1283  H H    . GLY A 1 7  ? 12.387  -7.100  -1.325  1.00 0.00 ? 7  GLY A H    2  
ATOM 1284  H HA2  . GLY A 1 7  ? 10.454  -8.494  0.164   1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1285  H HA3  . GLY A 1 7  ? 11.984  -8.586  1.023   1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1286  N N    . LEU A 1 8  ? 9.930   -6.373  1.318   1.00 0.00 ? 8  LEU A N    2  
ATOM 1287  C CA   . LEU A 1 8  ? 9.571   -5.082  1.894   1.00 0.00 ? 8  LEU A CA   2  
ATOM 1288  C C    . LEU A 1 8  ? 9.151   -5.235  3.352   1.00 0.00 ? 8  LEU A C    2  
ATOM 1289  O O    . LEU A 1 8  ? 8.475   -6.198  3.717   1.00 0.00 ? 8  LEU A O    2  
ATOM 1290  C CB   . LEU A 1 8  ? 8.439   -4.440  1.090   1.00 0.00 ? 8  LEU A CB   2  
ATOM 1291  C CG   . LEU A 1 8  ? 8.586   -4.541  -0.429  1.00 0.00 ? 8  LEU A CG   2  
ATOM 1292  C CD1  . LEU A 1 8  ? 7.220   -4.554  -1.098  1.00 0.00 ? 8  LEU A CD1  2  
ATOM 1293  C CD2  . LEU A 1 8  ? 9.431   -3.393  -0.960  1.00 0.00 ? 8  LEU A CD2  2  
ATOM 1294  H H    . LEU A 1 8  ? 9.246   -7.069  1.240   1.00 0.00 ? 8  LEU A H    2  
ATOM 1295  H HA   . LEU A 1 8  ? 10.441  -4.445  1.847   1.00 0.00 ? 8  LEU A HA   2  
ATOM 1296  H HB2  . LEU A 1 8  ? 7.510   -4.913  1.374   1.00 0.00 ? 8  LEU A HB2  2  
ATOM 1297  H HB3  . LEU A 1 8  ? 8.387   -3.394  1.354   1.00 0.00 ? 8  LEU A HB3  2  
ATOM 1298  H HG   . LEU A 1 8  ? 9.086   -5.467  -0.675  1.00 0.00 ? 8  LEU A HG   2  
ATOM 1299  H HD11 . LEU A 1 8  ? 7.298   -5.021  -2.068  1.00 0.00 ? 8  LEU A HD11 2  
ATOM 1300  H HD12 . LEU A 1 8  ? 6.867   -3.540  -1.214  1.00 0.00 ? 8  LEU A HD12 2  
ATOM 1301  H HD13 . LEU A 1 8  ? 6.525   -5.110  -0.486  1.00 0.00 ? 8  LEU A HD13 2  
ATOM 1302  H HD21 . LEU A 1 8  ? 10.463  -3.706  -1.026  1.00 0.00 ? 8  LEU A HD21 2  
ATOM 1303  H HD22 . LEU A 1 8  ? 9.352   -2.548  -0.292  1.00 0.00 ? 8  LEU A HD22 2  
ATOM 1304  H HD23 . LEU A 1 8  ? 9.077   -3.109  -1.941  1.00 0.00 ? 8  LEU A HD23 2  
ATOM 1305  N N    . ARG A 1 9  ? 9.557   -4.279  4.183   1.00 0.00 ? 9  ARG A N    2  
ATOM 1306  C CA   . ARG A 1 9  ? 9.223   -4.309  5.602   1.00 0.00 ? 9  ARG A CA   2  
ATOM 1307  C C    . ARG A 1 9  ? 7.932   -3.542  5.874   1.00 0.00 ? 9  ARG A C    2  
ATOM 1308  O O    . ARG A 1 9  ? 7.368   -2.919  4.975   1.00 0.00 ? 9  ARG A O    2  
ATOM 1309  C CB   . ARG A 1 9  ? 10.365  -3.716  6.429   1.00 0.00 ? 9  ARG A CB   2  
ATOM 1310  C CG   . ARG A 1 9  ? 11.666  -4.496  6.319   1.00 0.00 ? 9  ARG A CG   2  
ATOM 1311  C CD   . ARG A 1 9  ? 12.235  -4.833  7.688   1.00 0.00 ? 9  ARG A CD   2  
ATOM 1312  N NE   . ARG A 1 9  ? 13.669  -5.105  7.634   1.00 0.00 ? 9  ARG A NE   2  
ATOM 1313  C CZ   . ARG A 1 9  ? 14.359  -5.648  8.633   1.00 0.00 ? 9  ARG A CZ   2  
ATOM 1314  N NH1  . ARG A 1 9  ? 13.751  -5.980  9.765   1.00 0.00 ? 9  ARG A NH1  2  
ATOM 1315  N NH2  . ARG A 1 9  ? 15.661  -5.862  8.502   1.00 0.00 ? 9  ARG A NH2  2  
ATOM 1316  H H    . ARG A 1 9  ? 10.093  -3.538  3.833   1.00 0.00 ? 9  ARG A H    2  
ATOM 1317  H HA   . ARG A 1 9  ? 9.081   -5.340  5.889   1.00 0.00 ? 9  ARG A HA   2  
ATOM 1318  H HB2  . ARG A 1 9  ? 10.548  -2.704  6.095   1.00 0.00 ? 9  ARG A HB2  2  
ATOM 1319  H HB3  . ARG A 1 9  ? 10.069  -3.694  7.468   1.00 0.00 ? 9  ARG A HB3  2  
ATOM 1320  H HG2  . ARG A 1 9  ? 11.478  -5.414  5.783   1.00 0.00 ? 9  ARG A HG2  2  
ATOM 1321  H HG3  . ARG A 1 9  ? 12.385  -3.901  5.775   1.00 0.00 ? 9  ARG A HG3  2  
ATOM 1322  H HD2  . ARG A 1 9  ? 12.061  -3.997  8.350   1.00 0.00 ? 9  ARG A HD2  2  
ATOM 1323  H HD3  . ARG A 1 9  ? 11.727  -5.705  8.070   1.00 0.00 ? 9  ARG A HD3  2  
ATOM 1324  H HE   . ARG A 1 9  ? 14.143  -4.869  6.809   1.00 0.00 ? 9  ARG A HE   2  
ATOM 1325  H HH11 . ARG A 1 9  ? 12.769  -5.822  9.872   1.00 0.00 ? 9  ARG A HH11 2  
ATOM 1326  H HH12 . ARG A 1 9  ? 14.275  -6.389  10.513  1.00 0.00 ? 9  ARG A HH12 2  
ATOM 1327  H HH21 . ARG A 1 9  ? 16.125  -5.614  7.651   1.00 0.00 ? 9  ARG A HH21 2  
ATOM 1328  H HH22 . ARG A 1 9  ? 16.180  -6.270  9.253   1.00 0.00 ? 9  ARG A HH22 2  
ATOM 1329  N N    . LEU A 1 10 ? 7.471   -3.593  7.119   1.00 0.00 ? 10 LEU A N    2  
ATOM 1330  C CA   . LEU A 1 10 ? 6.248   -2.903  7.510   1.00 0.00 ? 10 LEU A CA   2  
ATOM 1331  C C    . LEU A 1 10 ? 6.561   -1.530  8.096   1.00 0.00 ? 10 LEU A C    2  
ATOM 1332  O O    . LEU A 1 10 ? 6.593   -1.357  9.315   1.00 0.00 ? 10 LEU A O    2  
ATOM 1333  C CB   . LEU A 1 10 ? 5.468   -3.739  8.527   1.00 0.00 ? 10 LEU A CB   2  
ATOM 1334  C CG   . LEU A 1 10 ? 4.528   -4.783  7.922   1.00 0.00 ? 10 LEU A CG   2  
ATOM 1335  C CD1  . LEU A 1 10 ? 4.124   -5.809  8.969   1.00 0.00 ? 10 LEU A CD1  2  
ATOM 1336  C CD2  . LEU A 1 10 ? 3.299   -4.112  7.329   1.00 0.00 ? 10 LEU A CD2  2  
ATOM 1337  H H    . LEU A 1 10 ? 7.966   -4.107  7.792   1.00 0.00 ? 10 LEU A H    2  
ATOM 1338  H HA   . LEU A 1 10 ? 5.644   -2.774  6.625   1.00 0.00 ? 10 LEU A HA   2  
ATOM 1339  H HB2  . LEU A 1 10 ? 6.178   -4.249  9.162   1.00 0.00 ? 10 LEU A HB2  2  
ATOM 1340  H HB3  . LEU A 1 10 ? 4.880   -3.070  9.137   1.00 0.00 ? 10 LEU A HB3  2  
ATOM 1341  H HG   . LEU A 1 10 ? 5.043   -5.303  7.127   1.00 0.00 ? 10 LEU A HG   2  
ATOM 1342  H HD11 . LEU A 1 10 ? 3.165   -5.539  9.386   1.00 0.00 ? 10 LEU A HD11 2  
ATOM 1343  H HD12 . LEU A 1 10 ? 4.865   -5.833  9.755   1.00 0.00 ? 10 LEU A HD12 2  
ATOM 1344  H HD13 . LEU A 1 10 ? 4.056   -6.784  8.509   1.00 0.00 ? 10 LEU A HD13 2  
ATOM 1345  H HD21 . LEU A 1 10 ? 3.602   -3.434  6.544   1.00 0.00 ? 10 LEU A HD21 2  
ATOM 1346  H HD22 . LEU A 1 10 ? 2.783   -3.560  8.100   1.00 0.00 ? 10 LEU A HD22 2  
ATOM 1347  H HD23 . LEU A 1 10 ? 2.640   -4.863  6.920   1.00 0.00 ? 10 LEU A HD23 2  
ATOM 1348  N N    . GLY A 1 11 ? 6.794   -0.558  7.220   1.00 0.00 ? 11 GLY A N    2  
ATOM 1349  C CA   . GLY A 1 11 ? 7.103   0.786   7.669   1.00 0.00 ? 11 GLY A CA   2  
ATOM 1350  C C    . GLY A 1 11 ? 8.226   1.419   6.870   1.00 0.00 ? 11 GLY A C    2  
ATOM 1351  O O    . GLY A 1 11 ? 9.196   1.919   7.439   1.00 0.00 ? 11 GLY A O    2  
ATOM 1352  H H    . GLY A 1 11 ? 6.755   -0.756  6.261   1.00 0.00 ? 11 GLY A H    2  
ATOM 1353  H HA2  . GLY A 1 11 ? 6.219   1.398   7.572   1.00 0.00 ? 11 GLY A HA2  2  
ATOM 1354  H HA3  . GLY A 1 11 ? 7.392   0.750   8.709   1.00 0.00 ? 11 GLY A HA3  2  
ATOM 1355  N N    . ASP A 1 12 ? 8.094   1.395   5.548   1.00 0.00 ? 12 ASP A N    2  
ATOM 1356  C CA   . ASP A 1 12 ? 9.105   1.968   4.668   1.00 0.00 ? 12 ASP A CA   2  
ATOM 1357  C C    . ASP A 1 12 ? 8.475   2.945   3.680   1.00 0.00 ? 12 ASP A C    2  
ATOM 1358  O O    . ASP A 1 12 ? 7.286   2.856   3.377   1.00 0.00 ? 12 ASP A O    2  
ATOM 1359  C CB   . ASP A 1 12 ? 9.840   0.861   3.910   1.00 0.00 ? 12 ASP A CB   2  
ATOM 1360  C CG   . ASP A 1 12 ? 10.291  -0.263  4.822   1.00 0.00 ? 12 ASP A CG   2  
ATOM 1361  O OD1  . ASP A 1 12 ? 9.438   -0.823  5.542   1.00 0.00 ? 12 ASP A OD1  2  
ATOM 1362  O OD2  . ASP A 1 12 ? 11.498  -0.583  4.816   1.00 0.00 ? 12 ASP A OD2  2  
ATOM 1363  H H    . ASP A 1 12 ? 7.297   0.981   5.154   1.00 0.00 ? 12 ASP A H    2  
ATOM 1364  H HA   . ASP A 1 12 ? 9.814   2.503   5.282   1.00 0.00 ? 12 ASP A HA   2  
ATOM 1365  H HB2  . ASP A 1 12 ? 9.181   0.448   3.161   1.00 0.00 ? 12 ASP A HB2  2  
ATOM 1366  H HB3  . ASP A 1 12 ? 10.710  1.280   3.428   1.00 0.00 ? 12 ASP A HB3  2  
ATOM 1367  N N    . ARG A 1 13 ? 9.281   3.877   3.181   1.00 0.00 ? 13 ARG A N    2  
ATOM 1368  C CA   . ARG A 1 13 ? 8.802   4.870   2.227   1.00 0.00 ? 13 ARG A CA   2  
ATOM 1369  C C    . ARG A 1 13 ? 8.889   4.340   0.800   1.00 0.00 ? 13 ARG A C    2  
ATOM 1370  O O    . ARG A 1 13 ? 9.981   4.157   0.261   1.00 0.00 ? 13 ARG A O    2  
ATOM 1371  C CB   . ARG A 1 13 ? 9.612   6.162   2.355   1.00 0.00 ? 13 ARG A CB   2  
ATOM 1372  C CG   . ARG A 1 13 ? 9.056   7.129   3.387   1.00 0.00 ? 13 ARG A CG   2  
ATOM 1373  C CD   . ARG A 1 13 ? 9.895   7.136   4.655   1.00 0.00 ? 13 ARG A CD   2  
ATOM 1374  N NE   . ARG A 1 13 ? 9.834   8.422   5.345   1.00 0.00 ? 13 ARG A NE   2  
ATOM 1375  C CZ   . ARG A 1 13 ? 10.311  9.558   4.839   1.00 0.00 ? 13 ARG A CZ   2  
ATOM 1376  N NH1  . ARG A 1 13 ? 10.884  9.570   3.641   1.00 0.00 ? 13 ARG A NH1  2  
ATOM 1377  N NH2  . ARG A 1 13 ? 10.216  10.684  5.533   1.00 0.00 ? 13 ARG A NH2  2  
ATOM 1378  H H    . ARG A 1 13 ? 10.220  3.897   3.462   1.00 0.00 ? 13 ARG A H    2  
ATOM 1379  H HA   . ARG A 1 13 ? 7.768   5.080   2.459   1.00 0.00 ? 13 ARG A HA   2  
ATOM 1380  H HB2  . ARG A 1 13 ? 10.625  5.912   2.633   1.00 0.00 ? 13 ARG A HB2  2  
ATOM 1381  H HB3  . ARG A 1 13 ? 9.625   6.660   1.397   1.00 0.00 ? 13 ARG A HB3  2  
ATOM 1382  H HG2  . ARG A 1 13 ? 9.050   8.124   2.967   1.00 0.00 ? 13 ARG A HG2  2  
ATOM 1383  H HG3  . ARG A 1 13 ? 8.046   6.835   3.635   1.00 0.00 ? 13 ARG A HG3  2  
ATOM 1384  H HD2  . ARG A 1 13 ? 9.528   6.366   5.318   1.00 0.00 ? 13 ARG A HD2  2  
ATOM 1385  H HD3  . ARG A 1 13 ? 10.921  6.926   4.394   1.00 0.00 ? 13 ARG A HD3  2  
ATOM 1386  H HE   . ARG A 1 13 ? 9.417   8.442   6.231   1.00 0.00 ? 13 ARG A HE   2  
ATOM 1387  H HH11 . ARG A 1 13 ? 10.959  8.725   3.113   1.00 0.00 ? 13 ARG A HH11 2  
ATOM 1388  H HH12 . ARG A 1 13 ? 11.241  10.426  3.267   1.00 0.00 ? 13 ARG A HH12 2  
ATOM 1389  H HH21 . ARG A 1 13 ? 9.786   10.680  6.435   1.00 0.00 ? 13 ARG A HH21 2  
ATOM 1390  H HH22 . ARG A 1 13 ? 10.574  11.536  5.154   1.00 0.00 ? 13 ARG A HH22 2  
ATOM 1391  N N    . VAL A 1 14 ? 7.732   4.097   0.193   1.00 0.00 ? 14 VAL A N    2  
ATOM 1392  C CA   . VAL A 1 14 ? 7.679   3.590   -1.173  1.00 0.00 ? 14 VAL A CA   2  
ATOM 1393  C C    . VAL A 1 14 ? 6.974   4.577   -2.098  1.00 0.00 ? 14 VAL A C    2  
ATOM 1394  O O    . VAL A 1 14 ? 6.446   5.594   -1.649  1.00 0.00 ? 14 VAL A O    2  
ATOM 1395  C CB   . VAL A 1 14 ? 6.954   2.232   -1.240  1.00 0.00 ? 14 VAL A CB   2  
ATOM 1396  C CG1  . VAL A 1 14 ? 7.726   1.174   -0.468  1.00 0.00 ? 14 VAL A CG1  2  
ATOM 1397  C CG2  . VAL A 1 14 ? 5.532   2.357   -0.711  1.00 0.00 ? 14 VAL A CG2  2  
ATOM 1398  H H    . VAL A 1 14 ? 6.896   4.264   0.674   1.00 0.00 ? 14 VAL A H    2  
ATOM 1399  H HA   . VAL A 1 14 ? 8.693   3.450   -1.517  1.00 0.00 ? 14 VAL A HA   2  
ATOM 1400  H HB   . VAL A 1 14 ? 6.903   1.925   -2.274  1.00 0.00 ? 14 VAL A HB   2  
ATOM 1401  H HG11 . VAL A 1 14 ? 8.048   1.583   0.479   1.00 0.00 ? 14 VAL A HG11 2  
ATOM 1402  H HG12 . VAL A 1 14 ? 8.589   0.869   -1.040  1.00 0.00 ? 14 VAL A HG12 2  
ATOM 1403  H HG13 . VAL A 1 14 ? 7.090   0.320   -0.293  1.00 0.00 ? 14 VAL A HG13 2  
ATOM 1404  H HG21 . VAL A 1 14 ? 5.105   1.373   -0.590  1.00 0.00 ? 14 VAL A HG21 2  
ATOM 1405  H HG22 . VAL A 1 14 ? 4.936   2.924   -1.410  1.00 0.00 ? 14 VAL A HG22 2  
ATOM 1406  H HG23 . VAL A 1 14 ? 5.547   2.862   0.243   1.00 0.00 ? 14 VAL A HG23 2  
ATOM 1407  N N    . LEU A 1 15 ? 6.971   4.271   -3.390  1.00 0.00 ? 15 LEU A N    2  
ATOM 1408  C CA   . LEU A 1 15 ? 6.332   5.131   -4.378  1.00 0.00 ? 15 LEU A CA   2  
ATOM 1409  C C    . LEU A 1 15 ? 5.352   4.340   -5.238  1.00 0.00 ? 15 LEU A C    2  
ATOM 1410  O O    . LEU A 1 15 ? 5.722   3.346   -5.863  1.00 0.00 ? 15 LEU A O    2  
ATOM 1411  C CB   . LEU A 1 15 ? 7.386   5.796   -5.265  1.00 0.00 ? 15 LEU A CB   2  
ATOM 1412  C CG   . LEU A 1 15 ? 6.843   6.832   -6.252  1.00 0.00 ? 15 LEU A CG   2  
ATOM 1413  C CD1  . LEU A 1 15 ? 6.017   7.880   -5.523  1.00 0.00 ? 15 LEU A CD1  2  
ATOM 1414  C CD2  . LEU A 1 15 ? 7.984   7.486   -7.017  1.00 0.00 ? 15 LEU A CD2  2  
ATOM 1415  H H    . LEU A 1 15 ? 7.409   3.445   -3.687  1.00 0.00 ? 15 LEU A H    2  
ATOM 1416  H HA   . LEU A 1 15 ? 5.787   5.898   -3.846  1.00 0.00 ? 15 LEU A HA   2  
ATOM 1417  H HB2  . LEU A 1 15 ? 8.109   6.281   -4.626  1.00 0.00 ? 15 LEU A HB2  2  
ATOM 1418  H HB3  . LEU A 1 15 ? 7.890   5.025   -5.830  1.00 0.00 ? 15 LEU A HB3  2  
ATOM 1419  H HG   . LEU A 1 15 ? 6.200   6.338   -6.965  1.00 0.00 ? 15 LEU A HG   2  
ATOM 1420  H HD11 . LEU A 1 15 ? 4.971   7.615   -5.576  1.00 0.00 ? 15 LEU A HD11 2  
ATOM 1421  H HD12 . LEU A 1 15 ? 6.169   8.845   -5.986  1.00 0.00 ? 15 LEU A HD12 2  
ATOM 1422  H HD13 . LEU A 1 15 ? 6.325   7.926   -4.488  1.00 0.00 ? 15 LEU A HD13 2  
ATOM 1423  H HD21 . LEU A 1 15 ? 8.565   6.724   -7.517  1.00 0.00 ? 15 LEU A HD21 2  
ATOM 1424  H HD22 . LEU A 1 15 ? 8.615   8.028   -6.329  1.00 0.00 ? 15 LEU A HD22 2  
ATOM 1425  H HD23 . LEU A 1 15 ? 7.580   8.168   -7.750  1.00 0.00 ? 15 LEU A HD23 2  
ATOM 1426  N N    . VAL A 1 16 ? 4.101   4.787   -5.265  1.00 0.00 ? 16 VAL A N    2  
ATOM 1427  C CA   . VAL A 1 16 ? 3.067   4.121   -6.049  1.00 0.00 ? 16 VAL A CA   2  
ATOM 1428  C C    . VAL A 1 16 ? 2.908   4.775   -7.417  1.00 0.00 ? 16 VAL A C    2  
ATOM 1429  O O    . VAL A 1 16 ? 2.633   5.970   -7.516  1.00 0.00 ? 16 VAL A O    2  
ATOM 1430  C CB   . VAL A 1 16 ? 1.710   4.142   -5.321  1.00 0.00 ? 16 VAL A CB   2  
ATOM 1431  C CG1  . VAL A 1 16 ? 0.697   3.275   -6.054  1.00 0.00 ? 16 VAL A CG1  2  
ATOM 1432  C CG2  . VAL A 1 16 ? 1.869   3.685   -3.879  1.00 0.00 ? 16 VAL A CG2  2  
ATOM 1433  H H    . VAL A 1 16 ? 3.867   5.585   -4.745  1.00 0.00 ? 16 VAL A H    2  
ATOM 1434  H HA   . VAL A 1 16 ? 3.364   3.091   -6.184  1.00 0.00 ? 16 VAL A HA   2  
ATOM 1435  H HB   . VAL A 1 16 ? 1.343   5.158   -5.316  1.00 0.00 ? 16 VAL A HB   2  
ATOM 1436  H HG11 . VAL A 1 16 ? 0.933   3.259   -7.108  1.00 0.00 ? 16 VAL A HG11 2  
ATOM 1437  H HG12 . VAL A 1 16 ? -0.293  3.682   -5.913  1.00 0.00 ? 16 VAL A HG12 2  
ATOM 1438  H HG13 . VAL A 1 16 ? 0.733   2.270   -5.661  1.00 0.00 ? 16 VAL A HG13 2  
ATOM 1439  H HG21 . VAL A 1 16 ? 0.989   3.139   -3.575  1.00 0.00 ? 16 VAL A HG21 2  
ATOM 1440  H HG22 . VAL A 1 16 ? 1.997   4.547   -3.240  1.00 0.00 ? 16 VAL A HG22 2  
ATOM 1441  H HG23 . VAL A 1 16 ? 2.735   3.045   -3.798  1.00 0.00 ? 16 VAL A HG23 2  
ATOM 1442  N N    . GLY A 1 17 ? 3.083   3.982   -8.469  1.00 0.00 ? 17 GLY A N    2  
ATOM 1443  C CA   . GLY A 1 17 ? 2.955   4.501   -9.818  1.00 0.00 ? 17 GLY A CA   2  
ATOM 1444  C C    . GLY A 1 17 ? 4.007   5.544   -10.144 1.00 0.00 ? 17 GLY A C    2  
ATOM 1445  O O    . GLY A 1 17 ? 3.812   6.375   -11.030 1.00 0.00 ? 17 GLY A O    2  
ATOM 1446  H H    . GLY A 1 17 ? 3.301   3.037   -8.328  1.00 0.00 ? 17 GLY A H    2  
ATOM 1447  H HA2  . GLY A 1 17 ? 3.046   3.683   -10.517 1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1448  H HA3  . GLY A 1 17 ? 1.977   4.947   -9.929  1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1449  N N    . GLY A 1 18 ? 5.127   5.499   -9.427  1.00 0.00 ? 18 GLY A N    2  
ATOM 1450  C CA   . GLY A 1 18 ? 6.196   6.451   -9.662  1.00 0.00 ? 18 GLY A CA   2  
ATOM 1451  C C    . GLY A 1 18 ? 5.741   7.889   -9.503  1.00 0.00 ? 18 GLY A C    2  
ATOM 1452  O O    . GLY A 1 18 ? 6.190   8.772   -10.234 1.00 0.00 ? 18 GLY A O    2  
ATOM 1453  H H    . GLY A 1 18 ? 5.228   4.813   -8.735  1.00 0.00 ? 18 GLY A H    2  
ATOM 1454  H HA2  . GLY A 1 18 ? 6.994   6.258   -8.960  1.00 0.00 ? 18 GLY A HA2  2  
ATOM 1455  H HA3  . GLY A 1 18 ? 6.573   6.312   -10.665 1.00 0.00 ? 18 GLY A HA3  2  
ATOM 1456  N N    . THR A 1 19 ? 4.849   8.124   -8.548  1.00 0.00 ? 19 THR A N    2  
ATOM 1457  C CA   . THR A 1 19 ? 4.333   9.465   -8.297  1.00 0.00 ? 19 THR A CA   2  
ATOM 1458  C C    . THR A 1 19 ? 3.810   9.590   -6.870  1.00 0.00 ? 19 THR A C    2  
ATOM 1459  O O    . THR A 1 19 ? 4.419   10.252  -6.030  1.00 0.00 ? 19 THR A O    2  
ATOM 1460  C CB   . THR A 1 19 ? 3.220   9.800   -9.291  1.00 0.00 ? 19 THR A CB   2  
ATOM 1461  O OG1  . THR A 1 19 ? 2.127   8.911   -9.139  1.00 0.00 ? 19 THR A OG1  2  
ATOM 1462  C CG2  . THR A 1 19 ? 3.667   9.736   -10.735 1.00 0.00 ? 19 THR A CG2  2  
ATOM 1463  H H    . THR A 1 19 ? 4.529   7.378   -7.998  1.00 0.00 ? 19 THR A H    2  
ATOM 1464  H HA   . THR A 1 19 ? 5.146   10.163  -8.432  1.00 0.00 ? 19 THR A HA   2  
ATOM 1465  H HB   . THR A 1 19 ? 2.870   10.804  -9.098  1.00 0.00 ? 19 THR A HB   2  
ATOM 1466  H HG1  . THR A 1 19 ? 1.306   9.409   -9.145  1.00 0.00 ? 19 THR A HG1  2  
ATOM 1467  H HG21 . THR A 1 19 ? 4.580   10.299  -10.854 1.00 0.00 ? 19 THR A HG21 2  
ATOM 1468  H HG22 . THR A 1 19 ? 2.900   10.157  -11.368 1.00 0.00 ? 19 THR A HG22 2  
ATOM 1469  H HG23 . THR A 1 19 ? 3.839   8.707   -11.012 1.00 0.00 ? 19 THR A HG23 2  
ATOM 1470  N N    . LYS A 1 20 ? 2.678   8.948   -6.602  1.00 0.00 ? 20 LYS A N    2  
ATOM 1471  C CA   . LYS A 1 20 ? 2.072   8.987   -5.276  1.00 0.00 ? 20 LYS A CA   2  
ATOM 1472  C C    . LYS A 1 20 ? 3.001   8.373   -4.234  1.00 0.00 ? 20 LYS A C    2  
ATOM 1473  O O    . LYS A 1 20 ? 3.233   7.164   -4.230  1.00 0.00 ? 20 LYS A O    2  
ATOM 1474  C CB   . LYS A 1 20 ? 0.733   8.247   -5.283  1.00 0.00 ? 20 LYS A CB   2  
ATOM 1475  C CG   . LYS A 1 20 ? -0.144  8.586   -6.478  1.00 0.00 ? 20 LYS A CG   2  
ATOM 1476  C CD   . LYS A 1 20 ? -0.222  7.430   -7.465  1.00 0.00 ? 20 LYS A CD   2  
ATOM 1477  C CE   . LYS A 1 20 ? -1.630  6.865   -7.556  1.00 0.00 ? 20 LYS A CE   2  
ATOM 1478  N NZ   . LYS A 1 20 ? -1.995  6.085   -6.341  1.00 0.00 ? 20 LYS A NZ   2  
ATOM 1479  H H    . LYS A 1 20 ? 2.238   8.437   -7.314  1.00 0.00 ? 20 LYS A H    2  
ATOM 1480  H HA   . LYS A 1 20 ? 1.899   10.023  -5.021  1.00 0.00 ? 20 LYS A HA   2  
ATOM 1481  H HB2  . LYS A 1 20 ? 0.923   7.184   -5.290  1.00 0.00 ? 20 LYS A HB2  2  
ATOM 1482  H HB3  . LYS A 1 20 ? 0.192   8.500   -4.382  1.00 0.00 ? 20 LYS A HB3  2  
ATOM 1483  H HG2  . LYS A 1 20 ? -1.139  8.816   -6.128  1.00 0.00 ? 20 LYS A HG2  2  
ATOM 1484  H HG3  . LYS A 1 20 ? 0.270   9.449   -6.980  1.00 0.00 ? 20 LYS A HG3  2  
ATOM 1485  H HD2  . LYS A 1 20 ? 0.075   7.782   -8.441  1.00 0.00 ? 20 LYS A HD2  2  
ATOM 1486  H HD3  . LYS A 1 20 ? 0.451   6.648   -7.143  1.00 0.00 ? 20 LYS A HD3  2  
ATOM 1487  H HE2  . LYS A 1 20 ? -2.326  7.683   -7.668  1.00 0.00 ? 20 LYS A HE2  2  
ATOM 1488  H HE3  . LYS A 1 20 ? -1.691  6.219   -8.419  1.00 0.00 ? 20 LYS A HE3  2  
ATOM 1489  H HZ1  . LYS A 1 20 ? -2.475  6.698   -5.652  1.00 0.00 ? 20 LYS A HZ1  2  
ATOM 1490  H HZ2  . LYS A 1 20 ? -1.140  5.690   -5.899  1.00 0.00 ? 20 LYS A HZ2  2  
ATOM 1491  H HZ3  . LYS A 1 20 ? -2.631  5.303   -6.596  1.00 0.00 ? 20 LYS A HZ3  2  
ATOM 1492  N N    . THR A 1 21 ? 3.530   9.215   -3.352  1.00 0.00 ? 21 THR A N    2  
ATOM 1493  C CA   . THR A 1 21 ? 4.434   8.755   -2.304  1.00 0.00 ? 21 THR A CA   2  
ATOM 1494  C C    . THR A 1 21 ? 3.658   8.347   -1.056  1.00 0.00 ? 21 THR A C    2  
ATOM 1495  O O    . THR A 1 21 ? 2.779   9.076   -0.594  1.00 0.00 ? 21 THR A O    2  
ATOM 1496  C CB   . THR A 1 21 ? 5.444   9.849   -1.955  1.00 0.00 ? 21 THR A CB   2  
ATOM 1497  O OG1  . THR A 1 21 ? 4.853   11.132  -2.071  1.00 0.00 ? 21 THR A OG1  2  
ATOM 1498  C CG2  . THR A 1 21 ? 6.674   9.830   -2.836  1.00 0.00 ? 21 THR A CG2  2  
ATOM 1499  H H    . THR A 1 21 ? 3.307   10.167  -3.407  1.00 0.00 ? 21 THR A H    2  
ATOM 1500  H HA   . THR A 1 21 ? 4.966   7.893   -2.680  1.00 0.00 ? 21 THR A HA   2  
ATOM 1501  H HB   . THR A 1 21 ? 5.766   9.715   -0.933  1.00 0.00 ? 21 THR A HB   2  
ATOM 1502  H HG1  . THR A 1 21 ? 5.371   11.769  -1.574  1.00 0.00 ? 21 THR A HG1  2  
ATOM 1503  H HG21 . THR A 1 21 ? 7.331   10.639  -2.553  1.00 0.00 ? 21 THR A HG21 2  
ATOM 1504  H HG22 . THR A 1 21 ? 6.380   9.949   -3.868  1.00 0.00 ? 21 THR A HG22 2  
ATOM 1505  H HG23 . THR A 1 21 ? 7.189   8.889   -2.714  1.00 0.00 ? 21 THR A HG23 2  
ATOM 1506  N N    . GLY A 1 22 ? 3.990   7.180   -0.514  1.00 0.00 ? 22 GLY A N    2  
ATOM 1507  C CA   . GLY A 1 22 ? 3.315   6.696   0.675   1.00 0.00 ? 22 GLY A CA   2  
ATOM 1508  C C    . GLY A 1 22 ? 4.137   5.671   1.432   1.00 0.00 ? 22 GLY A C    2  
ATOM 1509  O O    . GLY A 1 22 ? 5.011   5.021   0.859   1.00 0.00 ? 22 GLY A O    2  
ATOM 1510  H H    . GLY A 1 22 ? 4.698   6.642   -0.927  1.00 0.00 ? 22 GLY A H    2  
ATOM 1511  H HA2  . GLY A 1 22 ? 3.114   7.533   1.328   1.00 0.00 ? 22 GLY A HA2  2  
ATOM 1512  H HA3  . GLY A 1 22 ? 2.377   6.246   0.386   1.00 0.00 ? 22 GLY A HA3  2  
ATOM 1513  N N    . VAL A 1 23 ? 3.854   5.525   2.722   1.00 0.00 ? 23 VAL A N    2  
ATOM 1514  C CA   . VAL A 1 23 ? 4.573   4.571   3.559   1.00 0.00 ? 23 VAL A CA   2  
ATOM 1515  C C    . VAL A 1 23 ? 3.894   3.206   3.545   1.00 0.00 ? 23 VAL A C    2  
ATOM 1516  O O    . VAL A 1 23 ? 2.679   3.108   3.375   1.00 0.00 ? 23 VAL A O    2  
ATOM 1517  C CB   . VAL A 1 23 ? 4.675   5.066   5.014   1.00 0.00 ? 23 VAL A CB   2  
ATOM 1518  C CG1  . VAL A 1 23 ? 5.594   4.163   5.823   1.00 0.00 ? 23 VAL A CG1  2  
ATOM 1519  C CG2  . VAL A 1 23 ? 5.159   6.507   5.056   1.00 0.00 ? 23 VAL A CG2  2  
ATOM 1520  H H    . VAL A 1 23 ? 3.146   6.072   3.122   1.00 0.00 ? 23 VAL A H    2  
ATOM 1521  H HA   . VAL A 1 23 ? 5.574   4.469   3.164   1.00 0.00 ? 23 VAL A HA   2  
ATOM 1522  H HB   . VAL A 1 23 ? 3.690   5.027   5.456   1.00 0.00 ? 23 VAL A HB   2  
ATOM 1523  H HG11 . VAL A 1 23 ? 5.620   4.502   6.849   1.00 0.00 ? 23 VAL A HG11 2  
ATOM 1524  H HG12 . VAL A 1 23 ? 6.590   4.199   5.408   1.00 0.00 ? 23 VAL A HG12 2  
ATOM 1525  H HG13 . VAL A 1 23 ? 5.226   3.150   5.788   1.00 0.00 ? 23 VAL A HG13 2  
ATOM 1526  H HG21 . VAL A 1 23 ? 4.587   7.100   4.356   1.00 0.00 ? 23 VAL A HG21 2  
ATOM 1527  H HG22 . VAL A 1 23 ? 6.205   6.544   4.788   1.00 0.00 ? 23 VAL A HG22 2  
ATOM 1528  H HG23 . VAL A 1 23 ? 5.029   6.903   6.052   1.00 0.00 ? 23 VAL A HG23 2  
ATOM 1529  N N    . VAL A 1 24 ? 4.687   2.154   3.724   1.00 0.00 ? 24 VAL A N    2  
ATOM 1530  C CA   . VAL A 1 24 ? 4.162   0.794   3.731   1.00 0.00 ? 24 VAL A CA   2  
ATOM 1531  C C    . VAL A 1 24 ? 3.413   0.500   5.026   1.00 0.00 ? 24 VAL A C    2  
ATOM 1532  O O    . VAL A 1 24 ? 3.930   0.730   6.121   1.00 0.00 ? 24 VAL A O    2  
ATOM 1533  C CB   . VAL A 1 24 ? 5.286   -0.244  3.555   1.00 0.00 ? 24 VAL A CB   2  
ATOM 1534  C CG1  . VAL A 1 24 ? 4.704   -1.633  3.350   1.00 0.00 ? 24 VAL A CG1  2  
ATOM 1535  C CG2  . VAL A 1 24 ? 6.191   0.140   2.394   1.00 0.00 ? 24 VAL A CG2  2  
ATOM 1536  H H    . VAL A 1 24 ? 5.648   2.296   3.854   1.00 0.00 ? 24 VAL A H    2  
ATOM 1537  H HA   . VAL A 1 24 ? 3.477   0.697   2.901   1.00 0.00 ? 24 VAL A HA   2  
ATOM 1538  H HB   . VAL A 1 24 ? 5.881   -0.257  4.458   1.00 0.00 ? 24 VAL A HB   2  
ATOM 1539  H HG11 . VAL A 1 24 ? 4.075   -1.889  4.191   1.00 0.00 ? 24 VAL A HG11 2  
ATOM 1540  H HG12 . VAL A 1 24 ? 5.506   -2.352  3.269   1.00 0.00 ? 24 VAL A HG12 2  
ATOM 1541  H HG13 . VAL A 1 24 ? 4.116   -1.647  2.444   1.00 0.00 ? 24 VAL A HG13 2  
ATOM 1542  H HG21 . VAL A 1 24 ? 6.539   -0.753  1.898   1.00 0.00 ? 24 VAL A HG21 2  
ATOM 1543  H HG22 . VAL A 1 24 ? 7.038   0.698   2.767   1.00 0.00 ? 24 VAL A HG22 2  
ATOM 1544  H HG23 . VAL A 1 24 ? 5.639   0.749   1.694   1.00 0.00 ? 24 VAL A HG23 2  
ATOM 1545  N N    . ARG A 1 25 ? 2.193   -0.009  4.896   1.00 0.00 ? 25 ARG A N    2  
ATOM 1546  C CA   . ARG A 1 25 ? 1.371   -0.335  6.057   1.00 0.00 ? 25 ARG A CA   2  
ATOM 1547  C C    . ARG A 1 25 ? 1.069   -1.829  6.109   1.00 0.00 ? 25 ARG A C    2  
ATOM 1548  O O    . ARG A 1 25 ? 1.073   -2.437  7.179   1.00 0.00 ? 25 ARG A O    2  
ATOM 1549  C CB   . ARG A 1 25 ? 0.064   0.459   6.021   1.00 0.00 ? 25 ARG A CB   2  
ATOM 1550  C CG   . ARG A 1 25 ? 0.219   1.908   6.454   1.00 0.00 ? 25 ARG A CG   2  
ATOM 1551  C CD   . ARG A 1 25 ? -0.119  2.089   7.926   1.00 0.00 ? 25 ARG A CD   2  
ATOM 1552  N NE   . ARG A 1 25 ? 0.317   3.388   8.431   1.00 0.00 ? 25 ARG A NE   2  
ATOM 1553  C CZ   . ARG A 1 25 ? 1.576   3.671   8.759   1.00 0.00 ? 25 ARG A CZ   2  
ATOM 1554  N NH1  . ARG A 1 25 ? 2.524   2.751   8.635   1.00 0.00 ? 25 ARG A NH1  2  
ATOM 1555  N NH2  . ARG A 1 25 ? 1.888   4.878   9.210   1.00 0.00 ? 25 ARG A NH2  2  
ATOM 1556  H H    . ARG A 1 25 ? 1.835   -0.170  3.998   1.00 0.00 ? 25 ARG A H    2  
ATOM 1557  H HA   . ARG A 1 25 ? 1.924   -0.061  6.943   1.00 0.00 ? 25 ARG A HA   2  
ATOM 1558  H HB2  . ARG A 1 25 ? -0.324  0.446   5.014   1.00 0.00 ? 25 ARG A HB2  2  
ATOM 1559  H HB3  . ARG A 1 25 ? -0.650  -0.016  6.679   1.00 0.00 ? 25 ARG A HB3  2  
ATOM 1560  H HG2  . ARG A 1 25 ? 1.242   2.215   6.291   1.00 0.00 ? 25 ARG A HG2  2  
ATOM 1561  H HG3  . ARG A 1 25 ? -0.443  2.523   5.864   1.00 0.00 ? 25 ARG A HG3  2  
ATOM 1562  H HD2  . ARG A 1 25 ? -1.189  2.007   8.048   1.00 0.00 ? 25 ARG A HD2  2  
ATOM 1563  H HD3  . ARG A 1 25 ? 0.368   1.309   8.493   1.00 0.00 ? 25 ARG A HD3  2  
ATOM 1564  H HE   . ARG A 1 25 ? -0.364  4.086   8.532   1.00 0.00 ? 25 ARG A HE   2  
ATOM 1565  H HH11 . ARG A 1 25 ? 2.296   1.839   8.295   1.00 0.00 ? 25 ARG A HH11 2  
ATOM 1566  H HH12 . ARG A 1 25 ? 3.467   2.969   8.883   1.00 0.00 ? 25 ARG A HH12 2  
ATOM 1567  H HH21 . ARG A 1 25 ? 1.177   5.576   9.305   1.00 0.00 ? 25 ARG A HH21 2  
ATOM 1568  H HH22 . ARG A 1 25 ? 2.833   5.091   9.457   1.00 0.00 ? 25 ARG A HH22 2  
ATOM 1569  N N    . TYR A 1 26 ? 0.805   -2.414  4.945   1.00 0.00 ? 26 TYR A N    2  
ATOM 1570  C CA   . TYR A 1 26 ? 0.498   -3.837  4.857   1.00 0.00 ? 26 TYR A CA   2  
ATOM 1571  C C    . TYR A 1 26 ? 1.513   -4.559  3.976   1.00 0.00 ? 26 TYR A C    2  
ATOM 1572  O O    . TYR A 1 26 ? 1.809   -4.116  2.865   1.00 0.00 ? 26 TYR A O    2  
ATOM 1573  C CB   . TYR A 1 26 ? -0.913  -4.041  4.302   1.00 0.00 ? 26 TYR A CB   2  
ATOM 1574  C CG   . TYR A 1 26 ? -1.379  -5.479  4.337   1.00 0.00 ? 26 TYR A CG   2  
ATOM 1575  C CD1  . TYR A 1 26 ? -1.296  -6.229  5.504   1.00 0.00 ? 26 TYR A CD1  2  
ATOM 1576  C CD2  . TYR A 1 26 ? -1.900  -6.087  3.202   1.00 0.00 ? 26 TYR A CD2  2  
ATOM 1577  C CE1  . TYR A 1 26 ? -1.720  -7.543  5.539   1.00 0.00 ? 26 TYR A CE1  2  
ATOM 1578  C CE2  . TYR A 1 26 ? -2.326  -7.401  3.229   1.00 0.00 ? 26 TYR A CE2  2  
ATOM 1579  C CZ   . TYR A 1 26 ? -2.234  -8.125  4.399   1.00 0.00 ? 26 TYR A CZ   2  
ATOM 1580  O OH   . TYR A 1 26 ? -2.657  -9.433  4.430   1.00 0.00 ? 26 TYR A OH   2  
ATOM 1581  H H    . TYR A 1 26 ? 0.815   -1.876  4.127   1.00 0.00 ? 26 TYR A H    2  
ATOM 1582  H HA   . TYR A 1 26 ? 0.546   -4.250  5.854   1.00 0.00 ? 26 TYR A HA   2  
ATOM 1583  H HB2  . TYR A 1 26 ? -1.609  -3.454  4.884   1.00 0.00 ? 26 TYR A HB2  2  
ATOM 1584  H HB3  . TYR A 1 26 ? -0.941  -3.707  3.275   1.00 0.00 ? 26 TYR A HB3  2  
ATOM 1585  H HD1  . TYR A 1 26 ? -0.893  -5.769  6.394   1.00 0.00 ? 26 TYR A HD1  2  
ATOM 1586  H HD2  . TYR A 1 26 ? -1.970  -5.519  2.286   1.00 0.00 ? 26 TYR A HD2  2  
ATOM 1587  H HE1  . TYR A 1 26 ? -1.649  -8.109  6.455   1.00 0.00 ? 26 TYR A HE1  2  
ATOM 1588  H HE2  . TYR A 1 26 ? -2.728  -7.856  2.336   1.00 0.00 ? 26 TYR A HE2  2  
ATOM 1589  H HH   . TYR A 1 26 ? -3.582  -9.477  4.172   1.00 0.00 ? 26 TYR A HH   2  
ATOM 1590  N N    . VAL A 1 27 ? 2.040   -5.670  4.477   1.00 0.00 ? 27 VAL A N    2  
ATOM 1591  C CA   . VAL A 1 27 ? 3.022   -6.451  3.735   1.00 0.00 ? 27 VAL A CA   2  
ATOM 1592  C C    . VAL A 1 27 ? 2.828   -7.945  3.975   1.00 0.00 ? 27 VAL A C    2  
ATOM 1593  O O    . VAL A 1 27 ? 3.257   -8.480  4.997   1.00 0.00 ? 27 VAL A O    2  
ATOM 1594  C CB   . VAL A 1 27 ? 4.460   -6.062  4.124   1.00 0.00 ? 27 VAL A CB   2  
ATOM 1595  C CG1  . VAL A 1 27 ? 5.466   -6.751  3.215   1.00 0.00 ? 27 VAL A CG1  2  
ATOM 1596  C CG2  . VAL A 1 27 ? 4.635   -4.551  4.077   1.00 0.00 ? 27 VAL A CG2  2  
ATOM 1597  H H    . VAL A 1 27 ? 1.764   -5.971  5.367   1.00 0.00 ? 27 VAL A H    2  
ATOM 1598  H HA   . VAL A 1 27 ? 2.886   -6.245  2.683   1.00 0.00 ? 27 VAL A HA   2  
ATOM 1599  H HB   . VAL A 1 27 ? 4.639   -6.392  5.137   1.00 0.00 ? 27 VAL A HB   2  
ATOM 1600  H HG11 . VAL A 1 27 ? 6.366   -6.966  3.771   1.00 0.00 ? 27 VAL A HG11 2  
ATOM 1601  H HG12 . VAL A 1 27 ? 5.703   -6.103  2.384   1.00 0.00 ? 27 VAL A HG12 2  
ATOM 1602  H HG13 . VAL A 1 27 ? 5.044   -7.673  2.843   1.00 0.00 ? 27 VAL A HG13 2  
ATOM 1603  H HG21 . VAL A 1 27 ? 5.605   -4.288  4.472   1.00 0.00 ? 27 VAL A HG21 2  
ATOM 1604  H HG22 . VAL A 1 27 ? 3.865   -4.081  4.670   1.00 0.00 ? 27 VAL A HG22 2  
ATOM 1605  H HG23 . VAL A 1 27 ? 4.559   -4.212  3.054   1.00 0.00 ? 27 VAL A HG23 2  
ATOM 1606  N N    . GLY A 1 28 ? 2.180   -8.612  3.026   1.00 0.00 ? 28 GLY A N    2  
ATOM 1607  C CA   . GLY A 1 28 ? 1.942   -10.038 3.153   1.00 0.00 ? 28 GLY A CA   2  
ATOM 1608  C C    . GLY A 1 28 ? 0.990   -10.562 2.095   1.00 0.00 ? 28 GLY A C    2  
ATOM 1609  O O    . GLY A 1 28 ? 0.539   -9.812  1.229   1.00 0.00 ? 28 GLY A O    2  
ATOM 1610  H H    . GLY A 1 28 ? 1.862   -8.132  2.233   1.00 0.00 ? 28 GLY A H    2  
ATOM 1611  H HA2  . GLY A 1 28 ? 2.884   -10.559 3.064   1.00 0.00 ? 28 GLY A HA2  2  
ATOM 1612  H HA3  . GLY A 1 28 ? 1.523   -10.236 4.129   1.00 0.00 ? 28 GLY A HA3  2  
ATOM 1613  N N    . GLU A 1 29 ? 0.683   -11.853 2.166   1.00 0.00 ? 29 GLU A N    2  
ATOM 1614  C CA   . GLU A 1 29 ? -0.222  -12.478 1.209   1.00 0.00 ? 29 GLU A CA   2  
ATOM 1615  C C    . GLU A 1 29 ? -1.668  -12.087 1.493   1.00 0.00 ? 29 GLU A C    2  
ATOM 1616  O O    . GLU A 1 29 ? -1.989  -11.604 2.578   1.00 0.00 ? 29 GLU A O    2  
ATOM 1617  C CB   . GLU A 1 29 ? -0.074  -14.000 1.252   1.00 0.00 ? 29 GLU A CB   2  
ATOM 1618  C CG   . GLU A 1 29 ? 0.947   -14.541 0.265   1.00 0.00 ? 29 GLU A CG   2  
ATOM 1619  C CD   . GLU A 1 29 ? 0.882   -16.050 0.128   1.00 0.00 ? 29 GLU A CD   2  
ATOM 1620  O OE1  . GLU A 1 29 ? -0.168  -16.632 0.472   1.00 0.00 ? 29 GLU A OE1  2  
ATOM 1621  O OE2  . GLU A 1 29 ? 1.880   -16.648 -0.324  1.00 0.00 ? 29 GLU A OE2  2  
ATOM 1622  H H    . GLU A 1 29 ? 1.074   -12.399 2.880   1.00 0.00 ? 29 GLU A H    2  
ATOM 1623  H HA   . GLU A 1 29 ? 0.046   -12.128 0.223   1.00 0.00 ? 29 GLU A HA   2  
ATOM 1624  H HB2  . GLU A 1 29 ? 0.230   -14.292 2.247   1.00 0.00 ? 29 GLU A HB2  2  
ATOM 1625  H HB3  . GLU A 1 29 ? -1.030  -14.450 1.032   1.00 0.00 ? 29 GLU A HB3  2  
ATOM 1626  H HG2  . GLU A 1 29 ? 0.762   -14.099 -0.702  1.00 0.00 ? 29 GLU A HG2  2  
ATOM 1627  H HG3  . GLU A 1 29 ? 1.935   -14.267 0.602   1.00 0.00 ? 29 GLU A HG3  2  
ATOM 1628  N N    . THR A 1 30 ? -2.537  -12.300 0.510   1.00 0.00 ? 30 THR A N    2  
ATOM 1629  C CA   . THR A 1 30 ? -3.951  -11.972 0.655   1.00 0.00 ? 30 THR A CA   2  
ATOM 1630  C C    . THR A 1 30 ? -4.823  -13.194 0.384   1.00 0.00 ? 30 THR A C    2  
ATOM 1631  O O    . THR A 1 30 ? -4.319  -14.271 0.064   1.00 0.00 ? 30 THR A O    2  
ATOM 1632  C CB   . THR A 1 30 ? -4.332  -10.837 -0.298  1.00 0.00 ? 30 THR A CB   2  
ATOM 1633  O OG1  . THR A 1 30 ? -3.675  -10.986 -1.544  1.00 0.00 ? 30 THR A OG1  2  
ATOM 1634  C CG2  . THR A 1 30 ? -3.991  -9.464  0.239   1.00 0.00 ? 30 THR A CG2  2  
ATOM 1635  H H    . THR A 1 30 ? -2.221  -12.689 -0.332  1.00 0.00 ? 30 THR A H    2  
ATOM 1636  H HA   . THR A 1 30 ? -4.114  -11.647 1.671   1.00 0.00 ? 30 THR A HA   2  
ATOM 1637  H HB   . THR A 1 30 ? -5.398  -10.869 -0.471  1.00 0.00 ? 30 THR A HB   2  
ATOM 1638  H HG1  . THR A 1 30 ? -3.744  -11.898 -1.835  1.00 0.00 ? 30 THR A HG1  2  
ATOM 1639  H HG21 . THR A 1 30 ? -3.991  -8.750  -0.570  1.00 0.00 ? 30 THR A HG21 2  
ATOM 1640  H HG22 . THR A 1 30 ? -3.012  -9.490  0.697   1.00 0.00 ? 30 THR A HG22 2  
ATOM 1641  H HG23 . THR A 1 30 ? -4.725  -9.174  0.976   1.00 0.00 ? 30 THR A HG23 2  
ATOM 1642  N N    . ASP A 1 31 ? -6.135  -13.018 0.514   1.00 0.00 ? 31 ASP A N    2  
ATOM 1643  C CA   . ASP A 1 31 ? -7.078  -14.107 0.284   1.00 0.00 ? 31 ASP A CA   2  
ATOM 1644  C C    . ASP A 1 31 ? -7.995  -13.792 -0.893  1.00 0.00 ? 31 ASP A C    2  
ATOM 1645  O O    . ASP A 1 31 ? -8.304  -14.666 -1.704  1.00 0.00 ? 31 ASP A O    2  
ATOM 1646  C CB   . ASP A 1 31 ? -7.912  -14.362 1.541   1.00 0.00 ? 31 ASP A CB   2  
ATOM 1647  C CG   . ASP A 1 31 ? -7.296  -15.416 2.439   1.00 0.00 ? 31 ASP A CG   2  
ATOM 1648  O OD1  . ASP A 1 31 ? -6.632  -16.333 1.911   1.00 0.00 ? 31 ASP A OD1  2  
ATOM 1649  O OD2  . ASP A 1 31 ? -7.478  -15.326 3.672   1.00 0.00 ? 31 ASP A OD2  2  
ATOM 1650  H H    . ASP A 1 31 ? -6.477  -12.138 0.772   1.00 0.00 ? 31 ASP A H    2  
ATOM 1651  H HA   . ASP A 1 31 ? -6.509  -14.995 0.054   1.00 0.00 ? 31 ASP A HA   2  
ATOM 1652  H HB2  . ASP A 1 31 ? -7.997  -13.443 2.102   1.00 0.00 ? 31 ASP A HB2  2  
ATOM 1653  H HB3  . ASP A 1 31 ? -8.898  -14.694 1.251   1.00 0.00 ? 31 ASP A HB3  2  
ATOM 1654  N N    . PHE A 1 32 ? -8.427  -12.539 -0.980  1.00 0.00 ? 32 PHE A N    2  
ATOM 1655  C CA   . PHE A 1 32 ? -9.309  -12.108 -2.058  1.00 0.00 ? 32 PHE A CA   2  
ATOM 1656  C C    . PHE A 1 32 ? -8.642  -12.300 -3.417  1.00 0.00 ? 32 PHE A C    2  
ATOM 1657  O O    . PHE A 1 32 ? -9.311  -12.565 -4.417  1.00 0.00 ? 32 PHE A O    2  
ATOM 1658  C CB   . PHE A 1 32 ? -9.698  -10.640 -1.872  1.00 0.00 ? 32 PHE A CB   2  
ATOM 1659  C CG   . PHE A 1 32 ? -8.535  -9.747  -1.547  1.00 0.00 ? 32 PHE A CG   2  
ATOM 1660  C CD1  . PHE A 1 32 ? -7.589  -9.440  -2.513  1.00 0.00 ? 32 PHE A CD1  2  
ATOM 1661  C CD2  . PHE A 1 32 ? -8.386  -9.215  -0.277  1.00 0.00 ? 32 PHE A CD2  2  
ATOM 1662  C CE1  . PHE A 1 32 ? -6.518  -8.619  -2.218  1.00 0.00 ? 32 PHE A CE1  2  
ATOM 1663  C CE2  . PHE A 1 32 ? -7.317  -8.393  0.025   1.00 0.00 ? 32 PHE A CE2  2  
ATOM 1664  C CZ   . PHE A 1 32 ? -6.382  -8.095  -0.946  1.00 0.00 ? 32 PHE A CZ   2  
ATOM 1665  H H    . PHE A 1 32 ? -8.145  -11.887 -0.304  1.00 0.00 ? 32 PHE A H    2  
ATOM 1666  H HA   . PHE A 1 32 ? -10.201 -12.715 -2.020  1.00 0.00 ? 32 PHE A HA   2  
ATOM 1667  H HB2  . PHE A 1 32 ? -10.152 -10.276 -2.782  1.00 0.00 ? 32 PHE A HB2  2  
ATOM 1668  H HB3  . PHE A 1 32 ? -10.412 -10.565 -1.064  1.00 0.00 ? 32 PHE A HB3  2  
ATOM 1669  H HD1  . PHE A 1 32 ? -7.695  -9.849  -3.507  1.00 0.00 ? 32 PHE A HD1  2  
ATOM 1670  H HD2  . PHE A 1 32 ? -9.116  -9.448  0.484   1.00 0.00 ? 32 PHE A HD2  2  
ATOM 1671  H HE1  . PHE A 1 32 ? -5.787  -8.388  -2.979  1.00 0.00 ? 32 PHE A HE1  2  
ATOM 1672  H HE2  . PHE A 1 32 ? -7.213  -7.984  1.019   1.00 0.00 ? 32 PHE A HE2  2  
ATOM 1673  H HZ   . PHE A 1 32 ? -5.545  -7.452  -0.713  1.00 0.00 ? 32 PHE A HZ   2  
ATOM 1674  N N    . ALA A 1 33 ? -7.320  -12.167 -3.446  1.00 0.00 ? 33 ALA A N    2  
ATOM 1675  C CA   . ALA A 1 33 ? -6.562  -12.327 -4.681  1.00 0.00 ? 33 ALA A CA   2  
ATOM 1676  C C    . ALA A 1 33 ? -5.349  -13.226 -4.468  1.00 0.00 ? 33 ALA A C    2  
ATOM 1677  O O    . ALA A 1 33 ? -4.963  -13.505 -3.333  1.00 0.00 ? 33 ALA A O    2  
ATOM 1678  C CB   . ALA A 1 33 ? -6.130  -10.969 -5.213  1.00 0.00 ? 33 ALA A CB   2  
ATOM 1679  H H    . ALA A 1 33 ? -6.842  -11.956 -2.616  1.00 0.00 ? 33 ALA A H    2  
ATOM 1680  H HA   . ALA A 1 33 ? -7.212  -12.783 -5.413  1.00 0.00 ? 33 ALA A HA   2  
ATOM 1681  H HB1  . ALA A 1 33 ? -6.994  -10.331 -5.319  1.00 0.00 ? 33 ALA A HB1  2  
ATOM 1682  H HB2  . ALA A 1 33 ? -5.655  -11.094 -6.175  1.00 0.00 ? 33 ALA A HB2  2  
ATOM 1683  H HB3  . ALA A 1 33 ? -5.431  -10.518 -4.523  1.00 0.00 ? 33 ALA A HB3  2  
ATOM 1684  N N    . LYS A 1 34 ? -4.752  -13.676 -5.566  1.00 0.00 ? 34 LYS A N    2  
ATOM 1685  C CA   . LYS A 1 34 ? -3.582  -14.544 -5.499  1.00 0.00 ? 34 LYS A CA   2  
ATOM 1686  C C    . LYS A 1 34 ? -2.295  -13.729 -5.559  1.00 0.00 ? 34 LYS A C    2  
ATOM 1687  O O    . LYS A 1 34 ? -2.245  -12.673 -6.191  1.00 0.00 ? 34 LYS A O    2  
ATOM 1688  C CB   . LYS A 1 34 ? -3.607  -15.560 -6.642  1.00 0.00 ? 34 LYS A CB   2  
ATOM 1689  C CG   . LYS A 1 34 ? -4.846  -16.440 -6.648  1.00 0.00 ? 34 LYS A CG   2  
ATOM 1690  C CD   . LYS A 1 34 ? -4.738  -17.546 -7.686  1.00 0.00 ? 34 LYS A CD   2  
ATOM 1691  C CE   . LYS A 1 34 ? -4.837  -16.993 -9.098  1.00 0.00 ? 34 LYS A CE   2  
ATOM 1692  N NZ   . LYS A 1 34 ? -6.110  -16.253 -9.319  1.00 0.00 ? 34 LYS A NZ   2  
ATOM 1693  H H    . LYS A 1 34 ? -5.105  -13.418 -6.443  1.00 0.00 ? 34 LYS A H    2  
ATOM 1694  H HA   . LYS A 1 34 ? -3.615  -15.073 -4.558  1.00 0.00 ? 34 LYS A HA   2  
ATOM 1695  H HB2  . LYS A 1 34 ? -3.565  -15.028 -7.581  1.00 0.00 ? 34 LYS A HB2  2  
ATOM 1696  H HB3  . LYS A 1 34 ? -2.739  -16.197 -6.560  1.00 0.00 ? 34 LYS A HB3  2  
ATOM 1697  H HG2  . LYS A 1 34 ? -4.962  -16.888 -5.672  1.00 0.00 ? 34 LYS A HG2  2  
ATOM 1698  H HG3  . LYS A 1 34 ? -5.708  -15.830 -6.872  1.00 0.00 ? 34 LYS A HG3  2  
ATOM 1699  H HD2  . LYS A 1 34 ? -3.786  -18.043 -7.571  1.00 0.00 ? 34 LYS A HD2  2  
ATOM 1700  H HD3  . LYS A 1 34 ? -5.538  -18.254 -7.529  1.00 0.00 ? 34 LYS A HD3  2  
ATOM 1701  H HE2  . LYS A 1 34 ? -4.007  -16.321 -9.268  1.00 0.00 ? 34 LYS A HE2  2  
ATOM 1702  H HE3  . LYS A 1 34 ? -4.782  -17.814 -9.798  1.00 0.00 ? 34 LYS A HE3  2  
ATOM 1703  H HZ1  . LYS A 1 34 ? -5.943  -15.228 -9.257  1.00 0.00 ? 34 LYS A HZ1  2  
ATOM 1704  H HZ2  . LYS A 1 34 ? -6.811  -16.524 -8.601  1.00 0.00 ? 34 LYS A HZ2  2  
ATOM 1705  H HZ3  . LYS A 1 34 ? -6.493  -16.474 -10.261 1.00 0.00 ? 34 LYS A HZ3  2  
ATOM 1706  N N    . GLY A 1 35 ? -1.253  -14.226 -4.899  1.00 0.00 ? 35 GLY A N    2  
ATOM 1707  C CA   . GLY A 1 35 ? 0.021   -13.532 -4.892  1.00 0.00 ? 35 GLY A CA   2  
ATOM 1708  C C    . GLY A 1 35 ? 0.208   -12.674 -3.656  1.00 0.00 ? 35 GLY A C    2  
ATOM 1709  O O    . GLY A 1 35 ? -0.631  -12.676 -2.756  1.00 0.00 ? 35 GLY A O    2  
ATOM 1710  H H    . GLY A 1 35 ? -1.351  -15.072 -4.414  1.00 0.00 ? 35 GLY A H    2  
ATOM 1711  H HA2  . GLY A 1 35 ? 0.816   -14.262 -4.933  1.00 0.00 ? 35 GLY A HA2  2  
ATOM 1712  H HA3  . GLY A 1 35 ? 0.079   -12.901 -5.767  1.00 0.00 ? 35 GLY A HA3  2  
ATOM 1713  N N    . GLU A 1 36 ? 1.315   -11.938 -3.614  1.00 0.00 ? 36 GLU A N    2  
ATOM 1714  C CA   . GLU A 1 36 ? 1.613   -11.071 -2.480  1.00 0.00 ? 36 GLU A CA   2  
ATOM 1715  C C    . GLU A 1 36 ? 1.288   -9.616  -2.807  1.00 0.00 ? 36 GLU A C    2  
ATOM 1716  O O    . GLU A 1 36 ? 1.736   -9.082  -3.821  1.00 0.00 ? 36 GLU A O    2  
ATOM 1717  C CB   . GLU A 1 36 ? 3.086   -11.199 -2.087  1.00 0.00 ? 36 GLU A CB   2  
ATOM 1718  C CG   . GLU A 1 36 ? 3.419   -12.513 -1.398  1.00 0.00 ? 36 GLU A CG   2  
ATOM 1719  C CD   . GLU A 1 36 ? 3.953   -13.556 -2.361  1.00 0.00 ? 36 GLU A CD   2  
ATOM 1720  O OE1  . GLU A 1 36 ? 3.309   -13.783 -3.407  1.00 0.00 ? 36 GLU A OE1  2  
ATOM 1721  O OE2  . GLU A 1 36 ? 5.014   -14.146 -2.068  1.00 0.00 ? 36 GLU A OE2  2  
ATOM 1722  H H    . GLU A 1 36 ? 1.946   -11.980 -4.362  1.00 0.00 ? 36 GLU A H    2  
ATOM 1723  H HA   . GLU A 1 36 ? 0.999   -11.386 -1.650  1.00 0.00 ? 36 GLU A HA   2  
ATOM 1724  H HB2  . GLU A 1 36 ? 3.692   -11.120 -2.976  1.00 0.00 ? 36 GLU A HB2  2  
ATOM 1725  H HB3  . GLU A 1 36 ? 3.339   -10.391 -1.415  1.00 0.00 ? 36 GLU A HB3  2  
ATOM 1726  H HG2  . GLU A 1 36 ? 4.166   -12.329 -0.641  1.00 0.00 ? 36 GLU A HG2  2  
ATOM 1727  H HG3  . GLU A 1 36 ? 2.524   -12.897 -0.933  1.00 0.00 ? 36 GLU A HG3  2  
ATOM 1728  N N    . TRP A 1 37 ? 0.505   -8.982  -1.941  1.00 0.00 ? 37 TRP A N    2  
ATOM 1729  C CA   . TRP A 1 37 ? 0.119   -7.589  -2.136  1.00 0.00 ? 37 TRP A CA   2  
ATOM 1730  C C    . TRP A 1 37 ? 0.728   -6.700  -1.058  1.00 0.00 ? 37 TRP A C    2  
ATOM 1731  O O    . TRP A 1 37 ? 1.268   -7.191  -0.066  1.00 0.00 ? 37 TRP A O    2  
ATOM 1732  C CB   . TRP A 1 37 ? -1.405  -7.454  -2.126  1.00 0.00 ? 37 TRP A CB   2  
ATOM 1733  C CG   . TRP A 1 37 ? -2.071  -8.148  -3.274  1.00 0.00 ? 37 TRP A CG   2  
ATOM 1734  C CD1  . TRP A 1 37 ? -2.234  -9.494  -3.434  1.00 0.00 ? 37 TRP A CD1  2  
ATOM 1735  C CD2  . TRP A 1 37 ? -2.663  -7.532  -4.423  1.00 0.00 ? 37 TRP A CD2  2  
ATOM 1736  N NE1  . TRP A 1 37 ? -2.892  -9.753  -4.613  1.00 0.00 ? 37 TRP A NE1  2  
ATOM 1737  C CE2  . TRP A 1 37 ? -3.166  -8.565  -5.238  1.00 0.00 ? 37 TRP A CE2  2  
ATOM 1738  C CE3  . TRP A 1 37 ? -2.818  -6.207  -4.843  1.00 0.00 ? 37 TRP A CE3  2  
ATOM 1739  C CZ2  . TRP A 1 37 ? -3.812  -8.313  -6.446  1.00 0.00 ? 37 TRP A CZ2  2  
ATOM 1740  C CZ3  . TRP A 1 37 ? -3.459  -5.959  -6.042  1.00 0.00 ? 37 TRP A CZ3  2  
ATOM 1741  C CH2  . TRP A 1 37 ? -3.950  -7.007  -6.831  1.00 0.00 ? 37 TRP A CH2  2  
ATOM 1742  H H    . TRP A 1 37 ? 0.179   -9.461  -1.151  1.00 0.00 ? 37 TRP A H    2  
ATOM 1743  H HA   . TRP A 1 37 ? 0.492   -7.274  -3.100  1.00 0.00 ? 37 TRP A HA   2  
ATOM 1744  H HB2  . TRP A 1 37 ? -1.791  -7.876  -1.211  1.00 0.00 ? 37 TRP A HB2  2  
ATOM 1745  H HB3  . TRP A 1 37 ? -1.667  -6.406  -2.172  1.00 0.00 ? 37 TRP A HB3  2  
ATOM 1746  H HD1  . TRP A 1 37 ? -1.891  -10.237 -2.729  1.00 0.00 ? 37 TRP A HD1  2  
ATOM 1747  H HE1  . TRP A 1 37 ? -3.127  -10.642 -4.950  1.00 0.00 ? 37 TRP A HE1  2  
ATOM 1748  H HE3  . TRP A 1 37 ? -2.447  -5.387  -4.248  1.00 0.00 ? 37 TRP A HE3  2  
ATOM 1749  H HZ2  . TRP A 1 37 ? -4.196  -9.110  -7.066  1.00 0.00 ? 37 TRP A HZ2  2  
ATOM 1750  H HZ3  . TRP A 1 37 ? -3.588  -4.942  -6.382  1.00 0.00 ? 37 TRP A HZ3  2  
ATOM 1751  H HH2  . TRP A 1 37 ? -4.443  -6.766  -7.761  1.00 0.00 ? 37 TRP A HH2  2  
ATOM 1752  N N    . CYS A 1 38 ? 0.637   -5.389  -1.258  1.00 0.00 ? 38 CYS A N    2  
ATOM 1753  C CA   . CYS A 1 38 ? 1.180   -4.431  -0.301  1.00 0.00 ? 38 CYS A CA   2  
ATOM 1754  C C    . CYS A 1 38 ? 0.258   -3.224  -0.157  1.00 0.00 ? 38 CYS A C    2  
ATOM 1755  O O    . CYS A 1 38 ? -0.322  -2.753  -1.135  1.00 0.00 ? 38 CYS A O    2  
ATOM 1756  C CB   . CYS A 1 38 ? 2.574   -3.976  -0.738  1.00 0.00 ? 38 CYS A CB   2  
ATOM 1757  S SG   . CYS A 1 38 ? 3.926   -4.831  0.104   1.00 0.00 ? 38 CYS A SG   2  
ATOM 1758  H H    . CYS A 1 38 ? 0.196   -5.058  -2.067  1.00 0.00 ? 38 CYS A H    2  
ATOM 1759  H HA   . CYS A 1 38 ? 1.256   -4.925  0.656   1.00 0.00 ? 38 CYS A HA   2  
ATOM 1760  H HB2  . CYS A 1 38 ? 2.686   -4.152  -1.798  1.00 0.00 ? 38 CYS A HB2  2  
ATOM 1761  H HB3  . CYS A 1 38 ? 2.680   -2.919  -0.541  1.00 0.00 ? 38 CYS A HB3  2  
ATOM 1762  H HG   . CYS A 1 38 ? 3.554   -5.578  0.579   1.00 0.00 ? 38 CYS A HG   2  
ATOM 1763  N N    . GLY A 1 39 ? 0.128   -2.728  1.069   1.00 0.00 ? 39 GLY A N    2  
ATOM 1764  C CA   . GLY A 1 39 ? -0.724  -1.580  1.320   1.00 0.00 ? 39 GLY A CA   2  
ATOM 1765  C C    . GLY A 1 39 ? 0.069   -0.315  1.584   1.00 0.00 ? 39 GLY A C    2  
ATOM 1766  O O    . GLY A 1 39 ? 0.645   -0.149  2.659   1.00 0.00 ? 39 GLY A O    2  
ATOM 1767  H H    . GLY A 1 39 ? 0.615   -3.145  1.810   1.00 0.00 ? 39 GLY A H    2  
ATOM 1768  H HA2  . GLY A 1 39 ? -1.357  -1.422  0.459   1.00 0.00 ? 39 GLY A HA2  2  
ATOM 1769  H HA3  . GLY A 1 39 ? -1.346  -1.788  2.177   1.00 0.00 ? 39 GLY A HA3  2  
ATOM 1770  N N    . VAL A 1 40 ? 0.099   0.579   0.600   1.00 0.00 ? 40 VAL A N    2  
ATOM 1771  C CA   . VAL A 1 40 ? 0.828   1.835   0.731   1.00 0.00 ? 40 VAL A CA   2  
ATOM 1772  C C    . VAL A 1 40 ? -0.121  2.991   1.028   1.00 0.00 ? 40 VAL A C    2  
ATOM 1773  O O    . VAL A 1 40 ? -0.976  3.331   0.210   1.00 0.00 ? 40 VAL A O    2  
ATOM 1774  C CB   . VAL A 1 40 ? 1.627   2.156   -0.545  1.00 0.00 ? 40 VAL A CB   2  
ATOM 1775  C CG1  . VAL A 1 40 ? 2.531   3.360   -0.320  1.00 0.00 ? 40 VAL A CG1  2  
ATOM 1776  C CG2  . VAL A 1 40 ? 2.438   0.948   -0.986  1.00 0.00 ? 40 VAL A CG2  2  
ATOM 1777  H H    . VAL A 1 40 ? -0.379  0.389   -0.234  1.00 0.00 ? 40 VAL A H    2  
ATOM 1778  H HA   . VAL A 1 40 ? 1.524   1.733   1.552   1.00 0.00 ? 40 VAL A HA   2  
ATOM 1779  H HB   . VAL A 1 40 ? 0.929   2.402   -1.331  1.00 0.00 ? 40 VAL A HB   2  
ATOM 1780  H HG11 . VAL A 1 40 ? 3.059   3.588   -1.233  1.00 0.00 ? 40 VAL A HG11 2  
ATOM 1781  H HG12 . VAL A 1 40 ? 3.241   3.135   0.462   1.00 0.00 ? 40 VAL A HG12 2  
ATOM 1782  H HG13 . VAL A 1 40 ? 1.931   4.209   -0.029  1.00 0.00 ? 40 VAL A HG13 2  
ATOM 1783  H HG21 . VAL A 1 40 ? 1.793   0.083   -1.040  1.00 0.00 ? 40 VAL A HG21 2  
ATOM 1784  H HG22 . VAL A 1 40 ? 3.228   0.764   -0.273  1.00 0.00 ? 40 VAL A HG22 2  
ATOM 1785  H HG23 . VAL A 1 40 ? 2.867   1.138   -1.958  1.00 0.00 ? 40 VAL A HG23 2  
ATOM 1786  N N    . GLU A 1 41 ? 0.036   3.592   2.203   1.00 0.00 ? 41 GLU A N    2  
ATOM 1787  C CA   . GLU A 1 41 ? -0.808  4.711   2.607   1.00 0.00 ? 41 GLU A CA   2  
ATOM 1788  C C    . GLU A 1 41 ? -0.217  6.035   2.136   1.00 0.00 ? 41 GLU A C    2  
ATOM 1789  O O    . GLU A 1 41 ? 0.781   6.509   2.679   1.00 0.00 ? 41 GLU A O    2  
ATOM 1790  C CB   . GLU A 1 41 ? -0.977  4.725   4.128   1.00 0.00 ? 41 GLU A CB   2  
ATOM 1791  C CG   . GLU A 1 41 ? -2.085  5.648   4.608   1.00 0.00 ? 41 GLU A CG   2  
ATOM 1792  C CD   . GLU A 1 41 ? -1.651  6.531   5.761   1.00 0.00 ? 41 GLU A CD   2  
ATOM 1793  O OE1  . GLU A 1 41 ? -0.686  6.161   6.461   1.00 0.00 ? 41 GLU A OE1  2  
ATOM 1794  O OE2  . GLU A 1 41 ? -2.277  7.593   5.965   1.00 0.00 ? 41 GLU A OE2  2  
ATOM 1795  H H    . GLU A 1 41 ? 0.735   3.275   2.812   1.00 0.00 ? 41 GLU A H    2  
ATOM 1796  H HA   . GLU A 1 41 ? -1.776  4.578   2.148   1.00 0.00 ? 41 GLU A HA   2  
ATOM 1797  H HB2  . GLU A 1 41 ? -1.202  3.724   4.463   1.00 0.00 ? 41 GLU A HB2  2  
ATOM 1798  H HB3  . GLU A 1 41 ? -0.049  5.047   4.579   1.00 0.00 ? 41 GLU A HB3  2  
ATOM 1799  H HG2  . GLU A 1 41 ? -2.390  6.281   3.787   1.00 0.00 ? 41 GLU A HG2  2  
ATOM 1800  H HG3  . GLU A 1 41 ? -2.924  5.047   4.928   1.00 0.00 ? 41 GLU A HG3  2  
ATOM 1801  N N    . LEU A 1 42 ? -0.841  6.628   1.123   1.00 0.00 ? 42 LEU A N    2  
ATOM 1802  C CA   . LEU A 1 42 ? -0.379  7.898   0.578   1.00 0.00 ? 42 LEU A CA   2  
ATOM 1803  C C    . LEU A 1 42 ? -0.605  9.033   1.572   1.00 0.00 ? 42 LEU A C    2  
ATOM 1804  O O    . LEU A 1 42 ? -1.443  8.929   2.467   1.00 0.00 ? 42 LEU A O    2  
ATOM 1805  C CB   . LEU A 1 42 ? -1.100  8.205   -0.736  1.00 0.00 ? 42 LEU A CB   2  
ATOM 1806  C CG   . LEU A 1 42 ? -0.819  7.222   -1.873  1.00 0.00 ? 42 LEU A CG   2  
ATOM 1807  C CD1  . LEU A 1 42 ? -1.699  7.530   -3.075  1.00 0.00 ? 42 LEU A CD1  2  
ATOM 1808  C CD2  . LEU A 1 42 ? 0.652   7.266   -2.262  1.00 0.00 ? 42 LEU A CD2  2  
ATOM 1809  H H    . LEU A 1 42 ? -1.631  6.200   0.733   1.00 0.00 ? 42 LEU A H    2  
ATOM 1810  H HA   . LEU A 1 42 ? 0.680   7.810   0.384   1.00 0.00 ? 42 LEU A HA   2  
ATOM 1811  H HB2  . LEU A 1 42 ? -2.164  8.208   -0.546  1.00 0.00 ? 42 LEU A HB2  2  
ATOM 1812  H HB3  . LEU A 1 42 ? -0.807  9.191   -1.062  1.00 0.00 ? 42 LEU A HB3  2  
ATOM 1813  H HG   . LEU A 1 42 ? -1.047  6.220   -1.540  1.00 0.00 ? 42 LEU A HG   2  
ATOM 1814  H HD11 . LEU A 1 42 ? -1.794  8.600   -3.187  1.00 0.00 ? 42 LEU A HD11 2  
ATOM 1815  H HD12 . LEU A 1 42 ? -2.676  7.095   -2.925  1.00 0.00 ? 42 LEU A HD12 2  
ATOM 1816  H HD13 . LEU A 1 42 ? -1.251  7.113   -3.965  1.00 0.00 ? 42 LEU A HD13 2  
ATOM 1817  H HD21 . LEU A 1 42 ? 0.982   8.293   -2.304  1.00 0.00 ? 42 LEU A HD21 2  
ATOM 1818  H HD22 . LEU A 1 42 ? 0.782   6.806   -3.230  1.00 0.00 ? 42 LEU A HD22 2  
ATOM 1819  H HD23 . LEU A 1 42 ? 1.234   6.729   -1.528  1.00 0.00 ? 42 LEU A HD23 2  
ATOM 1820  N N    . ASP A 1 43 ? 0.148   10.116  1.407   1.00 0.00 ? 43 ASP A N    2  
ATOM 1821  C CA   . ASP A 1 43 ? 0.027   11.271  2.290   1.00 0.00 ? 43 ASP A CA   2  
ATOM 1822  C C    . ASP A 1 43 ? -1.178  12.123  1.906   1.00 0.00 ? 43 ASP A C    2  
ATOM 1823  O O    . ASP A 1 43 ? -1.875  12.655  2.771   1.00 0.00 ? 43 ASP A O    2  
ATOM 1824  C CB   . ASP A 1 43 ? 1.302   12.115  2.235   1.00 0.00 ? 43 ASP A CB   2  
ATOM 1825  C CG   . ASP A 1 43 ? 2.285   11.749  3.330   1.00 0.00 ? 43 ASP A CG   2  
ATOM 1826  O OD1  . ASP A 1 43 ? 2.895   10.662  3.241   1.00 0.00 ? 43 ASP A OD1  2  
ATOM 1827  O OD2  . ASP A 1 43 ? 2.445   12.548  4.277   1.00 0.00 ? 43 ASP A OD2  2  
ATOM 1828  H H    . ASP A 1 43 ? 0.797   10.140  0.674   1.00 0.00 ? 43 ASP A H    2  
ATOM 1829  H HA   . ASP A 1 43 ? -0.109  10.906  3.297   1.00 0.00 ? 43 ASP A HA   2  
ATOM 1830  H HB2  . ASP A 1 43 ? 1.785   11.967  1.281   1.00 0.00 ? 43 ASP A HB2  2  
ATOM 1831  H HB3  . ASP A 1 43 ? 1.042   13.158  2.345   1.00 0.00 ? 43 ASP A HB3  2  
ATOM 1832  N N    . GLU A 1 44 ? -1.419  12.247  0.605   1.00 0.00 ? 44 GLU A N    2  
ATOM 1833  C CA   . GLU A 1 44 ? -2.541  13.032  0.106   1.00 0.00 ? 44 GLU A CA   2  
ATOM 1834  C C    . GLU A 1 44 ? -3.775  12.154  -0.088  1.00 0.00 ? 44 GLU A C    2  
ATOM 1835  O O    . GLU A 1 44 ? -3.661  10.940  -0.260  1.00 0.00 ? 44 GLU A O    2  
ATOM 1836  C CB   . GLU A 1 44 ? -2.166  13.714  -1.213  1.00 0.00 ? 44 GLU A CB   2  
ATOM 1837  C CG   . GLU A 1 44 ? -2.188  15.232  -1.140  1.00 0.00 ? 44 GLU A CG   2  
ATOM 1838  C CD   . GLU A 1 44 ? -2.850  15.863  -2.350  1.00 0.00 ? 44 GLU A CD   2  
ATOM 1839  O OE1  . GLU A 1 44 ? -4.072  15.675  -2.523  1.00 0.00 ? 44 GLU A OE1  2  
ATOM 1840  O OE2  . GLU A 1 44 ? -2.146  16.548  -3.123  1.00 0.00 ? 44 GLU A OE2  2  
ATOM 1841  H H    . GLU A 1 44 ? -0.828  11.798  -0.034  1.00 0.00 ? 44 GLU A H    2  
ATOM 1842  H HA   . GLU A 1 44 ? -2.767  13.791  0.841   1.00 0.00 ? 44 GLU A HA   2  
ATOM 1843  H HB2  . GLU A 1 44 ? -1.171  13.403  -1.495  1.00 0.00 ? 44 GLU A HB2  2  
ATOM 1844  H HB3  . GLU A 1 44 ? -2.862  13.402  -1.978  1.00 0.00 ? 44 GLU A HB3  2  
ATOM 1845  H HG2  . GLU A 1 44 ? -2.730  15.530  -0.256  1.00 0.00 ? 44 GLU A HG2  2  
ATOM 1846  H HG3  . GLU A 1 44 ? -1.170  15.590  -1.077  1.00 0.00 ? 44 GLU A HG3  2  
ATOM 1847  N N    . PRO A 1 45 ? -4.975  12.759  -0.063  1.00 0.00 ? 45 PRO A N    2  
ATOM 1848  C CA   . PRO A 1 45 ? -6.232  12.024  -0.239  1.00 0.00 ? 45 PRO A CA   2  
ATOM 1849  C C    . PRO A 1 45 ? -6.394  11.484  -1.657  1.00 0.00 ? 45 PRO A C    2  
ATOM 1850  O O    . PRO A 1 45 ? -7.298  11.888  -2.389  1.00 0.00 ? 45 PRO A O    2  
ATOM 1851  C CB   . PRO A 1 45 ? -7.305  13.075  0.060   1.00 0.00 ? 45 PRO A CB   2  
ATOM 1852  C CG   . PRO A 1 45 ? -6.648  14.381  -0.227  1.00 0.00 ? 45 PRO A CG   2  
ATOM 1853  C CD   . PRO A 1 45 ? -5.200  14.202  0.135   1.00 0.00 ? 45 PRO A CD   2  
ATOM 1854  H HA   . PRO A 1 45 ? -6.315  11.211  0.466   1.00 0.00 ? 45 PRO A HA   2  
ATOM 1855  H HB2  . PRO A 1 45 ? -8.160  12.913  -0.580  1.00 0.00 ? 45 PRO A HB2  2  
ATOM 1856  H HB3  . PRO A 1 45 ? -7.604  13.004  1.095   1.00 0.00 ? 45 PRO A HB3  2  
ATOM 1857  H HG2  . PRO A 1 45 ? -6.746  14.619  -1.276  1.00 0.00 ? 45 PRO A HG2  2  
ATOM 1858  H HG3  . PRO A 1 45 ? -7.093  15.157  0.378   1.00 0.00 ? 45 PRO A HG3  2  
ATOM 1859  H HD2  . PRO A 1 45 ? -4.571  14.785  -0.523  1.00 0.00 ? 45 PRO A HD2  2  
ATOM 1860  H HD3  . PRO A 1 45 ? -5.031  14.480  1.165   1.00 0.00 ? 45 PRO A HD3  2  
ATOM 1861  N N    . LEU A 1 46 ? -5.510  10.566  -2.038  1.00 0.00 ? 46 LEU A N    2  
ATOM 1862  C CA   . LEU A 1 46 ? -5.552  9.970   -3.368  1.00 0.00 ? 46 LEU A CA   2  
ATOM 1863  C C    . LEU A 1 46 ? -5.803  8.467   -3.285  1.00 0.00 ? 46 LEU A C    2  
ATOM 1864  O O    . LEU A 1 46 ? -5.400  7.711   -4.168  1.00 0.00 ? 46 LEU A O    2  
ATOM 1865  C CB   . LEU A 1 46 ? -4.244  10.240  -4.112  1.00 0.00 ? 46 LEU A CB   2  
ATOM 1866  C CG   . LEU A 1 46 ? -3.713  11.670  -3.993  1.00 0.00 ? 46 LEU A CG   2  
ATOM 1867  C CD1  . LEU A 1 46 ? -2.193  11.673  -3.947  1.00 0.00 ? 46 LEU A CD1  2  
ATOM 1868  C CD2  . LEU A 1 46 ? -4.215  12.522  -5.147  1.00 0.00 ? 46 LEU A CD2  2  
ATOM 1869  H H    . LEU A 1 46 ? -4.812  10.285  -1.410  1.00 0.00 ? 46 LEU A H    2  
ATOM 1870  H HA   . LEU A 1 46 ? -6.366  10.427  -3.911  1.00 0.00 ? 46 LEU A HA   2  
ATOM 1871  H HB2  . LEU A 1 46 ? -3.492  9.564   -3.731  1.00 0.00 ? 46 LEU A HB2  2  
ATOM 1872  H HB3  . LEU A 1 46 ? -4.398  10.025  -5.159  1.00 0.00 ? 46 LEU A HB3  2  
ATOM 1873  H HG   . LEU A 1 46 ? -4.075  12.105  -3.073  1.00 0.00 ? 46 LEU A HG   2  
ATOM 1874  H HD11 . LEU A 1 46 ? -1.861  11.352  -2.972  1.00 0.00 ? 46 LEU A HD11 2  
ATOM 1875  H HD12 . LEU A 1 46 ? -1.830  12.672  -4.140  1.00 0.00 ? 46 LEU A HD12 2  
ATOM 1876  H HD13 . LEU A 1 46 ? -1.809  11.000  -4.699  1.00 0.00 ? 46 LEU A HD13 2  
ATOM 1877  H HD21 . LEU A 1 46 ? -3.464  12.558  -5.922  1.00 0.00 ? 46 LEU A HD21 2  
ATOM 1878  H HD22 . LEU A 1 46 ? -4.418  13.522  -4.796  1.00 0.00 ? 46 LEU A HD22 2  
ATOM 1879  H HD23 . LEU A 1 46 ? -5.123  12.090  -5.546  1.00 0.00 ? 46 LEU A HD23 2  
ATOM 1880  N N    . GLY A 1 47 ? -6.471  8.039   -2.218  1.00 0.00 ? 47 GLY A N    2  
ATOM 1881  C CA   . GLY A 1 47 ? -6.763  6.628   -2.041  1.00 0.00 ? 47 GLY A CA   2  
ATOM 1882  C C    . GLY A 1 47 ? -8.248  6.332   -2.108  1.00 0.00 ? 47 GLY A C    2  
ATOM 1883  O O    . GLY A 1 47 ? -9.075  7.236   -1.988  1.00 0.00 ? 47 GLY A O    2  
ATOM 1884  H H    . GLY A 1 47 ? -6.769  8.687   -1.545  1.00 0.00 ? 47 GLY A H    2  
ATOM 1885  H HA2  . GLY A 1 47 ? -6.260  6.068   -2.814  1.00 0.00 ? 47 GLY A HA2  2  
ATOM 1886  H HA3  . GLY A 1 47 ? -6.387  6.313   -1.079  1.00 0.00 ? 47 GLY A HA3  2  
ATOM 1887  N N    . LYS A 1 48 ? -8.588  5.061   -2.299  1.00 0.00 ? 48 LYS A N    2  
ATOM 1888  C CA   . LYS A 1 48 ? -9.983  4.647   -2.381  1.00 0.00 ? 48 LYS A CA   2  
ATOM 1889  C C    . LYS A 1 48 ? -10.357 3.752   -1.204  1.00 0.00 ? 48 LYS A C    2  
ATOM 1890  O O    . LYS A 1 48 ? -11.468 3.832   -0.679  1.00 0.00 ? 48 LYS A O    2  
ATOM 1891  C CB   . LYS A 1 48 ? -10.242 3.911   -3.697  1.00 0.00 ? 48 LYS A CB   2  
ATOM 1892  C CG   . LYS A 1 48 ? -10.054 4.783   -4.929  1.00 0.00 ? 48 LYS A CG   2  
ATOM 1893  C CD   . LYS A 1 48 ? -11.389 5.225   -5.507  1.00 0.00 ? 48 LYS A CD   2  
ATOM 1894  C CE   . LYS A 1 48 ? -11.312 6.636   -6.068  1.00 0.00 ? 48 LYS A CE   2  
ATOM 1895  N NZ   . LYS A 1 48 ? -11.110 6.637   -7.543  1.00 0.00 ? 48 LYS A NZ   2  
ATOM 1896  H H    . LYS A 1 48 ? -7.883  4.386   -2.387  1.00 0.00 ? 48 LYS A H    2  
ATOM 1897  H HA   . LYS A 1 48 ? -10.596 5.536   -2.351  1.00 0.00 ? 48 LYS A HA   2  
ATOM 1898  H HB2  . LYS A 1 48 ? -9.561  3.075   -3.768  1.00 0.00 ? 48 LYS A HB2  2  
ATOM 1899  H HB3  . LYS A 1 48 ? -11.255 3.539   -3.696  1.00 0.00 ? 48 LYS A HB3  2  
ATOM 1900  H HG2  . LYS A 1 48 ? -9.484  5.657   -4.656  1.00 0.00 ? 48 LYS A HG2  2  
ATOM 1901  H HG3  . LYS A 1 48 ? -9.516  4.220   -5.678  1.00 0.00 ? 48 LYS A HG3  2  
ATOM 1902  H HD2  . LYS A 1 48 ? -11.669 4.549   -6.301  1.00 0.00 ? 48 LYS A HD2  2  
ATOM 1903  H HD3  . LYS A 1 48 ? -12.135 5.198   -4.727  1.00 0.00 ? 48 LYS A HD3  2  
ATOM 1904  H HE2  . LYS A 1 48 ? -12.233 7.151   -5.840  1.00 0.00 ? 48 LYS A HE2  2  
ATOM 1905  H HE3  . LYS A 1 48 ? -10.486 7.152   -5.600  1.00 0.00 ? 48 LYS A HE3  2  
ATOM 1906  H HZ1  . LYS A 1 48 ? -10.145 6.321   -7.773  1.00 0.00 ? 48 LYS A HZ1  2  
ATOM 1907  H HZ2  . LYS A 1 48 ? -11.247 7.596   -7.923  1.00 0.00 ? 48 LYS A HZ2  2  
ATOM 1908  H HZ3  . LYS A 1 48 ? -11.791 5.996   -7.998  1.00 0.00 ? 48 LYS A HZ3  2  
ATOM 1909  N N    . ASN A 1 49 ? -9.423  2.900   -0.795  1.00 0.00 ? 49 ASN A N    2  
ATOM 1910  C CA   . ASN A 1 49 ? -9.654  1.990   0.321   1.00 0.00 ? 49 ASN A CA   2  
ATOM 1911  C C    . ASN A 1 49 ? -9.088  2.561   1.616   1.00 0.00 ? 49 ASN A C    2  
ATOM 1912  O O    . ASN A 1 49 ? -8.486  3.634   1.623   1.00 0.00 ? 49 ASN A O    2  
ATOM 1913  C CB   . ASN A 1 49 ? -9.023  0.626   0.032   1.00 0.00 ? 49 ASN A CB   2  
ATOM 1914  C CG   . ASN A 1 49 ? -9.919  -0.258  -0.813  1.00 0.00 ? 49 ASN A CG   2  
ATOM 1915  O OD1  . ASN A 1 49 ? -11.012 -0.637  -0.393  1.00 0.00 ? 49 ASN A OD1  2  
ATOM 1916  N ND2  . ASN A 1 49 ? -9.458  -0.592  -2.012  1.00 0.00 ? 49 ASN A ND2  2  
ATOM 1917  H H    . ASN A 1 49 ? -8.557  2.884   -1.254  1.00 0.00 ? 49 ASN A H    2  
ATOM 1918  H HA   . ASN A 1 49 ? -10.721 1.867   0.431   1.00 0.00 ? 49 ASN A HA   2  
ATOM 1919  H HB2  . ASN A 1 49 ? -8.091  0.771   -0.494  1.00 0.00 ? 49 ASN A HB2  2  
ATOM 1920  H HB3  . ASN A 1 49 ? -8.829  0.122   0.968   1.00 0.00 ? 49 ASN A HB3  2  
ATOM 1921  H HD21 . ASN A 1 49 ? -8.578  -0.254  -2.281  1.00 0.00 ? 49 ASN A HD21 2  
ATOM 1922  H HD22 . ASN A 1 49 ? -10.015 -1.164  -2.580  1.00 0.00 ? 49 ASN A HD22 2  
ATOM 1923  N N    . ASP A 1 50 ? -9.285  1.836   2.712   1.00 0.00 ? 50 ASP A N    2  
ATOM 1924  C CA   . ASP A 1 50 ? -8.794  2.270   4.015   1.00 0.00 ? 50 ASP A CA   2  
ATOM 1925  C C    . ASP A 1 50 ? -8.076  1.131   4.732   1.00 0.00 ? 50 ASP A C    2  
ATOM 1926  O O    . ASP A 1 50 ? -8.147  1.010   5.955   1.00 0.00 ? 50 ASP A O    2  
ATOM 1927  C CB   . ASP A 1 50 ? -9.952  2.778   4.876   1.00 0.00 ? 50 ASP A CB   2  
ATOM 1928  C CG   . ASP A 1 50 ? -11.028 1.729   5.076   1.00 0.00 ? 50 ASP A CG   2  
ATOM 1929  O OD1  . ASP A 1 50 ? -11.556 1.219   4.066   1.00 0.00 ? 50 ASP A OD1  2  
ATOM 1930  O OD2  . ASP A 1 50 ? -11.342 1.417   6.244   1.00 0.00 ? 50 ASP A OD2  2  
ATOM 1931  H H    . ASP A 1 50 ? -9.773  0.988   2.644   1.00 0.00 ? 50 ASP A H    2  
ATOM 1932  H HA   . ASP A 1 50 ? -8.095  3.077   3.854   1.00 0.00 ? 50 ASP A HA   2  
ATOM 1933  H HB2  . ASP A 1 50 ? -9.573  3.068   5.844   1.00 0.00 ? 50 ASP A HB2  2  
ATOM 1934  H HB3  . ASP A 1 50 ? -10.398 3.637   4.397   1.00 0.00 ? 50 ASP A HB3  2  
ATOM 1935  N N    . GLY A 1 51 ? -7.384  0.297   3.962   1.00 0.00 ? 51 GLY A N    2  
ATOM 1936  C CA   . GLY A 1 51 ? -6.663  -0.821  4.540   1.00 0.00 ? 51 GLY A CA   2  
ATOM 1937  C C    . GLY A 1 51 ? -7.592  -1.886  5.091   1.00 0.00 ? 51 GLY A C    2  
ATOM 1938  O O    . GLY A 1 51 ? -7.241  -2.597  6.033   1.00 0.00 ? 51 GLY A O    2  
ATOM 1939  H H    . GLY A 1 51 ? -7.364  0.442   2.992   1.00 0.00 ? 51 GLY A H    2  
ATOM 1940  H HA2  . GLY A 1 51 ? -6.037  -1.263  3.781   1.00 0.00 ? 51 GLY A HA2  2  
ATOM 1941  H HA3  . GLY A 1 51 ? -6.037  -0.455  5.340   1.00 0.00 ? 51 GLY A HA3  2  
ATOM 1942  N N    . ALA A 1 52 ? -8.778  -1.995  4.504   1.00 0.00 ? 52 ALA A N    2  
ATOM 1943  C CA   . ALA A 1 52 ? -9.760  -2.979  4.940   1.00 0.00 ? 52 ALA A CA   2  
ATOM 1944  C C    . ALA A 1 52 ? -10.505 -3.575  3.750   1.00 0.00 ? 52 ALA A C    2  
ATOM 1945  O O    . ALA A 1 52 ? -11.354 -2.921  3.146   1.00 0.00 ? 52 ALA A O    2  
ATOM 1946  C CB   . ALA A 1 52 ? -10.741 -2.350  5.917   1.00 0.00 ? 52 ALA A CB   2  
ATOM 1947  H H    . ALA A 1 52 ? -8.999  -1.398  3.758   1.00 0.00 ? 52 ALA A H    2  
ATOM 1948  H HA   . ALA A 1 52 ? -9.233  -3.770  5.454   1.00 0.00 ? 52 ALA A HA   2  
ATOM 1949  H HB1  . ALA A 1 52 ? -10.209 -1.690  6.586   1.00 0.00 ? 52 ALA A HB1  2  
ATOM 1950  H HB2  . ALA A 1 52 ? -11.227 -3.126  6.489   1.00 0.00 ? 52 ALA A HB2  2  
ATOM 1951  H HB3  . ALA A 1 52 ? -11.483 -1.788  5.371   1.00 0.00 ? 52 ALA A HB3  2  
ATOM 1952  N N    . VAL A 1 53 ? -10.180 -4.821  3.419   1.00 0.00 ? 53 VAL A N    2  
ATOM 1953  C CA   . VAL A 1 53 ? -10.818 -5.505  2.301   1.00 0.00 ? 53 VAL A CA   2  
ATOM 1954  C C    . VAL A 1 53 ? -11.575 -6.741  2.773   1.00 0.00 ? 53 VAL A C    2  
ATOM 1955  O O    . VAL A 1 53 ? -11.065 -7.525  3.573   1.00 0.00 ? 53 VAL A O    2  
ATOM 1956  C CB   . VAL A 1 53 ? -9.787  -5.924  1.237   1.00 0.00 ? 53 VAL A CB   2  
ATOM 1957  C CG1  . VAL A 1 53 ? -10.485 -6.453  -0.006  1.00 0.00 ? 53 VAL A CG1  2  
ATOM 1958  C CG2  . VAL A 1 53 ? -8.874  -4.759  0.890   1.00 0.00 ? 53 VAL A CG2  2  
ATOM 1959  H H    . VAL A 1 53 ? -9.495  -5.290  3.939   1.00 0.00 ? 53 VAL A H    2  
ATOM 1960  H HA   . VAL A 1 53 ? -11.517 -4.819  1.844   1.00 0.00 ? 53 VAL A HA   2  
ATOM 1961  H HB   . VAL A 1 53 ? -9.180  -6.719  1.646   1.00 0.00 ? 53 VAL A HB   2  
ATOM 1962  H HG11 . VAL A 1 53 ? -10.783 -5.624  -0.632  1.00 0.00 ? 53 VAL A HG11 2  
ATOM 1963  H HG12 . VAL A 1 53 ? -11.359 -7.017  0.283   1.00 0.00 ? 53 VAL A HG12 2  
ATOM 1964  H HG13 . VAL A 1 53 ? -9.810  -7.093  -0.555  1.00 0.00 ? 53 VAL A HG13 2  
ATOM 1965  H HG21 . VAL A 1 53 ? -7.976  -4.812  1.489   1.00 0.00 ? 53 VAL A HG21 2  
ATOM 1966  H HG22 . VAL A 1 53 ? -9.385  -3.828  1.090   1.00 0.00 ? 53 VAL A HG22 2  
ATOM 1967  H HG23 . VAL A 1 53 ? -8.611  -4.805  -0.157  1.00 0.00 ? 53 VAL A HG23 2  
ATOM 1968  N N    . ALA A 1 54 ? -12.795 -6.908  2.272   1.00 0.00 ? 54 ALA A N    2  
ATOM 1969  C CA   . ALA A 1 54 ? -13.622 -8.049  2.643   1.00 0.00 ? 54 ALA A CA   2  
ATOM 1970  C C    . ALA A 1 54 ? -13.883 -8.075  4.146   1.00 0.00 ? 54 ALA A C    2  
ATOM 1971  O O    . ALA A 1 54 ? -13.999 -9.142  4.747   1.00 0.00 ? 54 ALA A O    2  
ATOM 1972  C CB   . ALA A 1 54 ? -12.964 -9.346  2.197   1.00 0.00 ? 54 ALA A CB   2  
ATOM 1973  H H    . ALA A 1 54 ? -13.145 -6.248  1.638   1.00 0.00 ? 54 ALA A H    2  
ATOM 1974  H HA   . ALA A 1 54 ? -14.567 -7.957  2.126   1.00 0.00 ? 54 ALA A HA   2  
ATOM 1975  H HB1  . ALA A 1 54 ? -12.454 -9.797  3.036   1.00 0.00 ? 54 ALA A HB1  2  
ATOM 1976  H HB2  . ALA A 1 54 ? -12.252 -9.138  1.412   1.00 0.00 ? 54 ALA A HB2  2  
ATOM 1977  H HB3  . ALA A 1 54 ? -13.719 -10.025 1.828   1.00 0.00 ? 54 ALA A HB3  2  
ATOM 1978  N N    . GLY A 1 55 ? -13.975 -6.892  4.745   1.00 0.00 ? 55 GLY A N    2  
ATOM 1979  C CA   . GLY A 1 55 ? -14.222 -6.802  6.172   1.00 0.00 ? 55 GLY A CA   2  
ATOM 1980  C C    . GLY A 1 55 ? -13.017 -7.214  6.997   1.00 0.00 ? 55 GLY A C    2  
ATOM 1981  O O    . GLY A 1 55 ? -13.162 -7.690  8.123   1.00 0.00 ? 55 GLY A O    2  
ATOM 1982  H H    . GLY A 1 55 ? -13.875 -6.075  4.215   1.00 0.00 ? 55 GLY A H    2  
ATOM 1983  H HA2  . GLY A 1 55 ? -14.482 -5.783  6.418   1.00 0.00 ? 55 GLY A HA2  2  
ATOM 1984  H HA3  . GLY A 1 55 ? -15.053 -7.445  6.424   1.00 0.00 ? 55 GLY A HA3  2  
ATOM 1985  N N    . THR A 1 56 ? -11.828 -7.029  6.435   1.00 0.00 ? 56 THR A N    2  
ATOM 1986  C CA   . THR A 1 56 ? -10.593 -7.385  7.126   1.00 0.00 ? 56 THR A CA   2  
ATOM 1987  C C    . THR A 1 56 ? -9.617  -6.212  7.130   1.00 0.00 ? 56 THR A C    2  
ATOM 1988  O O    . THR A 1 56 ? -8.997  -5.904  6.112   1.00 0.00 ? 56 THR A O    2  
ATOM 1989  C CB   . THR A 1 56 ? -9.945  -8.601  6.463   1.00 0.00 ? 56 THR A CB   2  
ATOM 1990  O OG1  . THR A 1 56 ? -10.931 -9.517  6.022   1.00 0.00 ? 56 THR A OG1  2  
ATOM 1991  C CG2  . THR A 1 56 ? -9.000  -9.349  7.379   1.00 0.00 ? 56 THR A CG2  2  
ATOM 1992  H H    . THR A 1 56 ? -11.778 -6.645  5.535   1.00 0.00 ? 56 THR A H    2  
ATOM 1993  H HA   . THR A 1 56 ? -10.844 -7.632  8.147   1.00 0.00 ? 56 THR A HA   2  
ATOM 1994  H HB   . THR A 1 56 ? -9.379  -8.271  5.604   1.00 0.00 ? 56 THR A HB   2  
ATOM 1995  H HG1  . THR A 1 56 ? -11.296 -9.218  5.186   1.00 0.00 ? 56 THR A HG1  2  
ATOM 1996  H HG21 . THR A 1 56 ? -8.054  -8.830  7.422   1.00 0.00 ? 56 THR A HG21 2  
ATOM 1997  H HG22 . THR A 1 56 ? -8.846  -10.348 6.999   1.00 0.00 ? 56 THR A HG22 2  
ATOM 1998  H HG23 . THR A 1 56 ? -9.426  -9.403  8.370   1.00 0.00 ? 56 THR A HG23 2  
ATOM 1999  N N    . ARG A 1 57 ? -9.486  -5.563  8.281   1.00 0.00 ? 57 ARG A N    2  
ATOM 2000  C CA   . ARG A 1 57 ? -8.586  -4.423  8.418   1.00 0.00 ? 57 ARG A CA   2  
ATOM 2001  C C    . ARG A 1 57 ? -7.212  -4.871  8.904   1.00 0.00 ? 57 ARG A C    2  
ATOM 2002  O O    . ARG A 1 57 ? -7.023  -5.155  10.087  1.00 0.00 ? 57 ARG A O    2  
ATOM 2003  C CB   . ARG A 1 57 ? -9.174  -3.396  9.387   1.00 0.00 ? 57 ARG A CB   2  
ATOM 2004  C CG   . ARG A 1 57 ? -8.364  -2.111  9.474   1.00 0.00 ? 57 ARG A CG   2  
ATOM 2005  C CD   . ARG A 1 57 ? -9.254  -0.881  9.379   1.00 0.00 ? 57 ARG A CD   2  
ATOM 2006  N NE   . ARG A 1 57 ? -10.431 -0.989  10.237  1.00 0.00 ? 57 ARG A NE   2  
ATOM 2007  C CZ   . ARG A 1 57 ? -11.502 -0.204  10.127  1.00 0.00 ? 57 ARG A CZ   2  
ATOM 2008  N NH1  . ARG A 1 57 ? -11.546 0.744   9.199   1.00 0.00 ? 57 ARG A NH1  2  
ATOM 2009  N NH2  . ARG A 1 57 ? -12.532 -0.370  10.946  1.00 0.00 ? 57 ARG A NH2  2  
ATOM 2010  H H    . ARG A 1 57 ? -10.008 -5.854  9.058   1.00 0.00 ? 57 ARG A H    2  
ATOM 2011  H HA   . ARG A 1 57 ? -8.480  -3.967  7.445   1.00 0.00 ? 57 ARG A HA   2  
ATOM 2012  H HB2  . ARG A 1 57 ? -10.174 -3.146  9.066   1.00 0.00 ? 57 ARG A HB2  2  
ATOM 2013  H HB3  . ARG A 1 57 ? -9.221  -3.834  10.372  1.00 0.00 ? 57 ARG A HB3  2  
ATOM 2014  H HG2  . ARG A 1 57 ? -7.842  -2.091  10.419  1.00 0.00 ? 57 ARG A HG2  2  
ATOM 2015  H HG3  . ARG A 1 57 ? -7.650  -2.092  8.665   1.00 0.00 ? 57 ARG A HG3  2  
ATOM 2016  H HD2  . ARG A 1 57 ? -8.681  -0.015  9.677   1.00 0.00 ? 57 ARG A HD2  2  
ATOM 2017  H HD3  . ARG A 1 57 ? -9.575  -0.765  8.355   1.00 0.00 ? 57 ARG A HD3  2  
ATOM 2018  H HE   . ARG A 1 57 ? -10.425 -1.680  10.931  1.00 0.00 ? 57 ARG A HE   2  
ATOM 2019  H HH11 . ARG A 1 57 ? -10.774 0.874   8.578   1.00 0.00 ? 57 ARG A HH11 2  
ATOM 2020  H HH12 . ARG A 1 57 ? -12.354 1.329   9.122   1.00 0.00 ? 57 ARG A HH12 2  
ATOM 2021  H HH21 . ARG A 1 57 ? -12.503 -1.084  11.647  1.00 0.00 ? 57 ARG A HH21 2  
ATOM 2022  H HH22 . ARG A 1 57 ? -13.336 0.218   10.864  1.00 0.00 ? 57 ARG A HH22 2  
ATOM 2023  N N    . TYR A 1 58 ? -6.255  -4.930  7.984   1.00 0.00 ? 58 TYR A N    2  
ATOM 2024  C CA   . TYR A 1 58 ? -4.897  -5.343  8.320   1.00 0.00 ? 58 TYR A CA   2  
ATOM 2025  C C    . TYR A 1 58 ? -4.160  -4.234  9.064   1.00 0.00 ? 58 TYR A C    2  
ATOM 2026  O O    . TYR A 1 58 ? -3.324  -4.502  9.928   1.00 0.00 ? 58 TYR A O    2  
ATOM 2027  C CB   . TYR A 1 58 ? -4.128  -5.720  7.052   1.00 0.00 ? 58 TYR A CB   2  
ATOM 2028  C CG   . TYR A 1 58 ? -4.870  -6.690  6.161   1.00 0.00 ? 58 TYR A CG   2  
ATOM 2029  C CD1  . TYR A 1 58 ? -5.185  -7.968  6.606   1.00 0.00 ? 58 TYR A CD1  2  
ATOM 2030  C CD2  . TYR A 1 58 ? -5.253  -6.329  4.876   1.00 0.00 ? 58 TYR A CD2  2  
ATOM 2031  C CE1  . TYR A 1 58 ? -5.863  -8.858  5.794   1.00 0.00 ? 58 TYR A CE1  2  
ATOM 2032  C CE2  . TYR A 1 58 ? -5.932  -7.214  4.058   1.00 0.00 ? 58 TYR A CE2  2  
ATOM 2033  C CZ   . TYR A 1 58 ? -6.234  -8.476  4.523   1.00 0.00 ? 58 TYR A CZ   2  
ATOM 2034  O OH   . TYR A 1 58 ? -6.908  -9.361  3.713   1.00 0.00 ? 58 TYR A OH   2  
ATOM 2035  H H    . TYR A 1 58 ? -6.466  -4.690  7.058   1.00 0.00 ? 58 TYR A H    2  
ATOM 2036  H HA   . TYR A 1 58 ? -4.963  -6.208  8.961   1.00 0.00 ? 58 TYR A HA   2  
ATOM 2037  H HB2  . TYR A 1 58 ? -3.934  -4.826  6.478   1.00 0.00 ? 58 TYR A HB2  2  
ATOM 2038  H HB3  . TYR A 1 58 ? -3.189  -6.174  7.331   1.00 0.00 ? 58 TYR A HB3  2  
ATOM 2039  H HD1  . TYR A 1 58 ? -4.894  -8.264  7.603   1.00 0.00 ? 58 TYR A HD1  2  
ATOM 2040  H HD2  . TYR A 1 58 ? -5.015  -5.340  4.515   1.00 0.00 ? 58 TYR A HD2  2  
ATOM 2041  H HE1  . TYR A 1 58 ? -6.100  -9.848  6.159   1.00 0.00 ? 58 TYR A HE1  2  
ATOM 2042  H HE2  . TYR A 1 58 ? -6.222  -6.915  3.063   1.00 0.00 ? 58 TYR A HE2  2  
ATOM 2043  H HH   . TYR A 1 58 ? -6.438  -10.197 3.690   1.00 0.00 ? 58 TYR A HH   2  
ATOM 2044  N N    . PHE A 1 59 ? -4.475  -2.988  8.723   1.00 0.00 ? 59 PHE A N    2  
ATOM 2045  C CA   . PHE A 1 59 ? -3.842  -1.839  9.360   1.00 0.00 ? 59 PHE A CA   2  
ATOM 2046  C C    . PHE A 1 59 ? -4.835  -0.694  9.528   1.00 0.00 ? 59 PHE A C    2  
ATOM 2047  O O    . PHE A 1 59 ? -5.559  -0.344  8.595   1.00 0.00 ? 59 PHE A O    2  
ATOM 2048  C CB   . PHE A 1 59 ? -2.641  -1.371  8.536   1.00 0.00 ? 59 PHE A CB   2  
ATOM 2049  C CG   . PHE A 1 59 ? -2.995  -0.967  7.133   1.00 0.00 ? 59 PHE A CG   2  
ATOM 2050  C CD1  . PHE A 1 59 ? -3.203  -1.924  6.154   1.00 0.00 ? 59 PHE A CD1  2  
ATOM 2051  C CD2  . PHE A 1 59 ? -3.118  0.371   6.794   1.00 0.00 ? 59 PHE A CD2  2  
ATOM 2052  C CE1  . PHE A 1 59 ? -3.527  -1.554  4.862   1.00 0.00 ? 59 PHE A CE1  2  
ATOM 2053  C CE2  . PHE A 1 59 ? -3.442  0.747   5.504   1.00 0.00 ? 59 PHE A CE2  2  
ATOM 2054  C CZ   . PHE A 1 59 ? -3.647  -0.217  4.537   1.00 0.00 ? 59 PHE A CZ   2  
ATOM 2055  H H    . PHE A 1 59 ? -5.149  -2.839  8.028   1.00 0.00 ? 59 PHE A H    2  
ATOM 2056  H HA   . PHE A 1 59 ? -3.499  -2.148  10.336  1.00 0.00 ? 59 PHE A HA   2  
ATOM 2057  H HB2  . PHE A 1 59 ? -2.190  -0.520  9.023   1.00 0.00 ? 59 PHE A HB2  2  
ATOM 2058  H HB3  . PHE A 1 59 ? -1.919  -2.172  8.480   1.00 0.00 ? 59 PHE A HB3  2  
ATOM 2059  H HD1  . PHE A 1 59 ? -3.109  -2.970  6.407   1.00 0.00 ? 59 PHE A HD1  2  
ATOM 2060  H HD2  . PHE A 1 59 ? -2.958  1.127   7.550   1.00 0.00 ? 59 PHE A HD2  2  
ATOM 2061  H HE1  . PHE A 1 59 ? -3.687  -2.311  4.107   1.00 0.00 ? 59 PHE A HE1  2  
ATOM 2062  H HE2  . PHE A 1 59 ? -3.537  1.793   5.253   1.00 0.00 ? 59 PHE A HE2  2  
ATOM 2063  H HZ   . PHE A 1 59 ? -3.901  0.074   3.528   1.00 0.00 ? 59 PHE A HZ   2  
ATOM 2064  N N    . GLN A 1 60 ? -4.865  -0.114  10.723  1.00 0.00 ? 60 GLN A N    2  
ATOM 2065  C CA   . GLN A 1 60 ? -5.769  0.993   11.015  1.00 0.00 ? 60 GLN A CA   2  
ATOM 2066  C C    . GLN A 1 60 ? -5.389  2.234   10.215  1.00 0.00 ? 60 GLN A C    2  
ATOM 2067  O O    . GLN A 1 60 ? -4.335  2.831   10.440  1.00 0.00 ? 60 GLN A O    2  
ATOM 2068  C CB   . GLN A 1 60 ? -5.754  1.313   12.511  1.00 0.00 ? 60 GLN A CB   2  
ATOM 2069  C CG   . GLN A 1 60 ? -6.834  2.293   12.936  1.00 0.00 ? 60 GLN A CG   2  
ATOM 2070  C CD   . GLN A 1 60 ? -8.233  1.758   12.698  1.00 0.00 ? 60 GLN A CD   2  
ATOM 2071  O OE1  . GLN A 1 60 ? -8.861  1.207   13.601  1.00 0.00 ? 60 GLN A OE1  2  
ATOM 2072  N NE2  . GLN A 1 60 ? -8.729  1.921   11.477  1.00 0.00 ? 60 GLN A NE2  2  
ATOM 2073  H H    . GLN A 1 60 ? -4.265  -0.437  11.427  1.00 0.00 ? 60 GLN A H    2  
ATOM 2074  H HA   . GLN A 1 60 ? -6.766  0.689   10.732  1.00 0.00 ? 60 GLN A HA   2  
ATOM 2075  H HB2  . GLN A 1 60 ? -5.892  0.395   13.064  1.00 0.00 ? 60 GLN A HB2  2  
ATOM 2076  H HB3  . GLN A 1 60 ? -4.793  1.735   12.767  1.00 0.00 ? 60 GLN A HB3  2  
ATOM 2077  H HG2  . GLN A 1 60 ? -6.720  2.501   13.988  1.00 0.00 ? 60 GLN A HG2  2  
ATOM 2078  H HG3  . GLN A 1 60 ? -6.714  3.208   12.374  1.00 0.00 ? 60 GLN A HG3  2  
ATOM 2079  H HE21 . GLN A 1 60 ? -8.172  2.370   10.807  1.00 0.00 ? 60 GLN A HE21 2  
ATOM 2080  H HE22 . GLN A 1 60 ? -9.631  1.585   11.296  1.00 0.00 ? 60 GLN A HE22 2  
ATOM 2081  N N    . CYS A 1 61 ? -6.252  2.618   9.281   1.00 0.00 ? 61 CYS A N    2  
ATOM 2082  C CA   . CYS A 1 61 ? -6.007  3.789   8.447   1.00 0.00 ? 61 CYS A CA   2  
ATOM 2083  C C    . CYS A 1 61 ? -7.315  4.497   8.104   1.00 0.00 ? 61 CYS A C    2  
ATOM 2084  O O    . CYS A 1 61 ? -8.368  3.865   8.017   1.00 0.00 ? 61 CYS A O    2  
ATOM 2085  C CB   . CYS A 1 61 ? -5.277  3.384   7.164   1.00 0.00 ? 61 CYS A CB   2  
ATOM 2086  S SG   . CYS A 1 61 ? -3.501  3.724   7.187   1.00 0.00 ? 61 CYS A SG   2  
ATOM 2087  H H    . CYS A 1 61 ? -7.075  2.102   9.149   1.00 0.00 ? 61 CYS A H    2  
ATOM 2088  H HA   . CYS A 1 61 ? -5.381  4.468   9.007   1.00 0.00 ? 61 CYS A HA   2  
ATOM 2089  H HB2  . CYS A 1 61 ? -5.406  2.324   7.005   1.00 0.00 ? 61 CYS A HB2  2  
ATOM 2090  H HB3  . CYS A 1 61 ? -5.704  3.921   6.330   1.00 0.00 ? 61 CYS A HB3  2  
ATOM 2091  H HG   . CYS A 1 61 ? -3.051  2.975   6.788   1.00 0.00 ? 61 CYS A HG   2  
ATOM 2092  N N    . PRO A 1 62 ? -7.266  5.825   7.902   1.00 0.00 ? 62 PRO A N    2  
ATOM 2093  C CA   . PRO A 1 62 ? -8.453  6.617   7.566   1.00 0.00 ? 62 PRO A CA   2  
ATOM 2094  C C    . PRO A 1 62 ? -8.954  6.337   6.151   1.00 0.00 ? 62 PRO A C    2  
ATOM 2095  O O    . PRO A 1 62 ? -8.277  5.676   5.364   1.00 0.00 ? 62 PRO A O    2  
ATOM 2096  C CB   . PRO A 1 62 ? -7.961  8.061   7.684   1.00 0.00 ? 62 PRO A CB   2  
ATOM 2097  C CG   . PRO A 1 62 ? -6.495  7.983   7.435   1.00 0.00 ? 62 PRO A CG   2  
ATOM 2098  C CD   . PRO A 1 62 ? -6.050  6.656   7.985   1.00 0.00 ? 62 PRO A CD   2  
ATOM 2099  H HA   . PRO A 1 62 ? -9.253  6.447   8.270   1.00 0.00 ? 62 PRO A HA   2  
ATOM 2100  H HB2  . PRO A 1 62 ? -8.456  8.674   6.944   1.00 0.00 ? 62 PRO A HB2  2  
ATOM 2101  H HB3  . PRO A 1 62 ? -8.173  8.437   8.673   1.00 0.00 ? 62 PRO A HB3  2  
ATOM 2102  H HG2  . PRO A 1 62 ? -6.300  8.033   6.374   1.00 0.00 ? 62 PRO A HG2  2  
ATOM 2103  H HG3  . PRO A 1 62 ? -5.992  8.789   7.948   1.00 0.00 ? 62 PRO A HG3  2  
ATOM 2104  H HD2  . PRO A 1 62 ? -5.257  6.243   7.378   1.00 0.00 ? 62 PRO A HD2  2  
ATOM 2105  H HD3  . PRO A 1 62 ? -5.725  6.762   9.010   1.00 0.00 ? 62 PRO A HD3  2  
ATOM 2106  N N    . PRO A 1 63 ? -10.153 6.839   5.810   1.00 0.00 ? 63 PRO A N    2  
ATOM 2107  C CA   . PRO A 1 63 ? -10.742 6.640   4.482   1.00 0.00 ? 63 PRO A CA   2  
ATOM 2108  C C    . PRO A 1 63 ? -10.010 7.425   3.399   1.00 0.00 ? 63 PRO A C    2  
ATOM 2109  O O    . PRO A 1 63 ? -9.565  8.550   3.628   1.00 0.00 ? 63 PRO A O    2  
ATOM 2110  C CB   . PRO A 1 63 ? -12.172 7.160   4.646   1.00 0.00 ? 63 PRO A CB   2  
ATOM 2111  C CG   . PRO A 1 63 ? -12.089 8.151   5.755   1.00 0.00 ? 63 PRO A CG   2  
ATOM 2112  C CD   . PRO A 1 63 ? -11.026 7.639   6.689   1.00 0.00 ? 63 PRO A CD   2  
ATOM 2113  H HA   . PRO A 1 63 ? -10.766 5.594   4.213   1.00 0.00 ? 63 PRO A HA   2  
ATOM 2114  H HB2  . PRO A 1 63 ? -12.498 7.623   3.726   1.00 0.00 ? 63 PRO A HB2  2  
ATOM 2115  H HB3  . PRO A 1 63 ? -12.830 6.342   4.898   1.00 0.00 ? 63 PRO A HB3  2  
ATOM 2116  H HG2  . PRO A 1 63 ? -11.810 9.118   5.364   1.00 0.00 ? 63 PRO A HG2  2  
ATOM 2117  H HG3  . PRO A 1 63 ? -13.038 8.212   6.266   1.00 0.00 ? 63 PRO A HG3  2  
ATOM 2118  H HD2  . PRO A 1 63 ? -10.481 8.463   7.127   1.00 0.00 ? 63 PRO A HD2  2  
ATOM 2119  H HD3  . PRO A 1 63 ? -11.466 7.024   7.460   1.00 0.00 ? 63 PRO A HD3  2  
ATOM 2120  N N    . LYS A 1 64 ? -9.889  6.824   2.221   1.00 0.00 ? 64 LYS A N    2  
ATOM 2121  C CA   . LYS A 1 64 ? -9.210  7.466   1.100   1.00 0.00 ? 64 LYS A CA   2  
ATOM 2122  C C    . LYS A 1 64 ? -7.752  7.758   1.443   1.00 0.00 ? 64 LYS A C    2  
ATOM 2123  O O    . LYS A 1 64 ? -7.333  8.915   1.489   1.00 0.00 ? 64 LYS A O    2  
ATOM 2124  C CB   . LYS A 1 64 ? -9.929  8.761   0.715   1.00 0.00 ? 64 LYS A CB   2  
ATOM 2125  C CG   . LYS A 1 64 ? -11.191 8.536   -0.102  1.00 0.00 ? 64 LYS A CG   2  
ATOM 2126  C CD   . LYS A 1 64 ? -12.281 7.868   0.722   1.00 0.00 ? 64 LYS A CD   2  
ATOM 2127  C CE   . LYS A 1 64 ? -12.541 6.444   0.256   1.00 0.00 ? 64 LYS A CE   2  
ATOM 2128  N NZ   . LYS A 1 64 ? -13.454 6.403   -0.920  1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2129  H H    . LYS A 1 64 ? -10.265 5.927   2.100   1.00 0.00 ? 64 LYS A H    2  
ATOM 2130  H HA   . LYS A 1 64 ? -9.240  6.786   0.263   1.00 0.00 ? 64 LYS A HA   2  
ATOM 2131  H HB2  . LYS A 1 64 ? -10.200 9.291   1.616   1.00 0.00 ? 64 LYS A HB2  2  
ATOM 2132  H HB3  . LYS A 1 64 ? -9.255  9.374   0.136   1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2133  H HG2  . LYS A 1 64 ? -11.554 9.491   -0.454  1.00 0.00 ? 64 LYS A HG2  2  
ATOM 2134  H HG3  . LYS A 1 64 ? -10.953 7.907   -0.948  1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2135  H HD2  . LYS A 1 64 ? -11.974 7.846   1.757   1.00 0.00 ? 64 LYS A HD2  2  
ATOM 2136  H HD3  . LYS A 1 64 ? -13.192 8.441   0.627   1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2137  H HE2  . LYS A 1 64 ? -11.600 5.989   -0.015  1.00 0.00 ? 64 LYS A HE2  2  
ATOM 2138  H HE3  . LYS A 1 64 ? -12.988 5.889   1.068   1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2139  H HZ1  . LYS A 1 64 ? -14.039 7.262   -0.950  1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2140  H HZ2  . LYS A 1 64 ? -14.079 5.574   -0.858  1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2141  H HZ3  . LYS A 1 64 ? -12.901 6.341   -1.800  1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2142  N N    . PHE A 1 65 ? -6.983  6.702   1.685   1.00 0.00 ? 65 PHE A N    2  
ATOM 2143  C CA   . PHE A 1 65 ? -5.571  6.845   2.024   1.00 0.00 ? 65 PHE A CA   2  
ATOM 2144  C C    . PHE A 1 65 ? -4.814  5.545   1.771   1.00 0.00 ? 65 PHE A C    2  
ATOM 2145  O O    . PHE A 1 65 ? -3.724  5.553   1.200   1.00 0.00 ? 65 PHE A O    2  
ATOM 2146  C CB   . PHE A 1 65 ? -5.417  7.263   3.487   1.00 0.00 ? 65 PHE A CB   2  
ATOM 2147  C CG   . PHE A 1 65 ? -5.551  8.743   3.705   1.00 0.00 ? 65 PHE A CG   2  
ATOM 2148  C CD1  . PHE A 1 65 ? -4.521  9.603   3.363   1.00 0.00 ? 65 PHE A CD1  2  
ATOM 2149  C CD2  . PHE A 1 65 ? -6.708  9.273   4.252   1.00 0.00 ? 65 PHE A CD2  2  
ATOM 2150  C CE1  . PHE A 1 65 ? -4.642  10.966  3.561   1.00 0.00 ? 65 PHE A CE1  2  
ATOM 2151  C CE2  . PHE A 1 65 ? -6.835  10.635  4.454   1.00 0.00 ? 65 PHE A CE2  2  
ATOM 2152  C CZ   . PHE A 1 65 ? -5.801  11.482  4.108   1.00 0.00 ? 65 PHE A CZ   2  
ATOM 2153  H H    . PHE A 1 65 ? -7.373  5.805   1.634   1.00 0.00 ? 65 PHE A H    2  
ATOM 2154  H HA   . PHE A 1 65 ? -5.157  7.618   1.393   1.00 0.00 ? 65 PHE A HA   2  
ATOM 2155  H HB2  . PHE A 1 65 ? -6.175  6.770   4.077   1.00 0.00 ? 65 PHE A HB2  2  
ATOM 2156  H HB3  . PHE A 1 65 ? -4.442  6.961   3.840   1.00 0.00 ? 65 PHE A HB3  2  
ATOM 2157  H HD1  . PHE A 1 65 ? -3.615  9.200   2.934   1.00 0.00 ? 65 PHE A HD1  2  
ATOM 2158  H HD2  . PHE A 1 65 ? -7.517  8.611   4.522   1.00 0.00 ? 65 PHE A HD2  2  
ATOM 2159  H HE1  . PHE A 1 65 ? -3.831  11.626  3.291   1.00 0.00 ? 65 PHE A HE1  2  
ATOM 2160  H HE2  . PHE A 1 65 ? -7.743  11.035  4.881   1.00 0.00 ? 65 PHE A HE2  2  
ATOM 2161  H HZ   . PHE A 1 65 ? -5.898  12.546  4.264   1.00 0.00 ? 65 PHE A HZ   2  
ATOM 2162  N N    . GLY A 1 66 ? -5.399  4.431   2.201   1.00 0.00 ? 66 GLY A N    2  
ATOM 2163  C CA   . GLY A 1 66 ? -4.763  3.141   2.012   1.00 0.00 ? 66 GLY A CA   2  
ATOM 2164  C C    . GLY A 1 66 ? -5.028  2.560   0.636   1.00 0.00 ? 66 GLY A C    2  
ATOM 2165  O O    . GLY A 1 66 ? -6.178  2.326   0.265   1.00 0.00 ? 66 GLY A O    2  
ATOM 2166  H H    . GLY A 1 66 ? -6.268  4.487   2.650   1.00 0.00 ? 66 GLY A H    2  
ATOM 2167  H HA2  . GLY A 1 66 ? -3.697  3.254   2.144   1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2168  H HA3  . GLY A 1 66 ? -5.137  2.456   2.757   1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2169  N N    . LEU A 1 67 ? -3.960  2.327   -0.120  1.00 0.00 ? 67 LEU A N    2  
ATOM 2170  C CA   . LEU A 1 67 ? -4.081  1.769   -1.463  1.00 0.00 ? 67 LEU A CA   2  
ATOM 2171  C C    . LEU A 1 67 ? -3.384  0.416   -1.555  1.00 0.00 ? 67 LEU A C    2  
ATOM 2172  O O    . LEU A 1 67 ? -2.180  0.310   -1.326  1.00 0.00 ? 67 LEU A O    2  
ATOM 2173  C CB   . LEU A 1 67 ? -3.489  2.732   -2.493  1.00 0.00 ? 67 LEU A CB   2  
ATOM 2174  C CG   . LEU A 1 67 ? -3.654  2.302   -3.951  1.00 0.00 ? 67 LEU A CG   2  
ATOM 2175  C CD1  . LEU A 1 67 ? -5.125  2.101   -4.286  1.00 0.00 ? 67 LEU A CD1  2  
ATOM 2176  C CD2  . LEU A 1 67 ? -3.030  3.331   -4.883  1.00 0.00 ? 67 LEU A CD2  2  
ATOM 2177  H H    . LEU A 1 67 ? -3.070  2.533   0.232   1.00 0.00 ? 67 LEU A H    2  
ATOM 2178  H HA   . LEU A 1 67 ? -5.133  1.634   -1.672  1.00 0.00 ? 67 LEU A HA   2  
ATOM 2179  H HB2  . LEU A 1 67 ? -3.962  3.696   -2.367  1.00 0.00 ? 67 LEU A HB2  2  
ATOM 2180  H HB3  . LEU A 1 67 ? -2.434  2.839   -2.291  1.00 0.00 ? 67 LEU A HB3  2  
ATOM 2181  H HG   . LEU A 1 67 ? -3.147  1.361   -4.103  1.00 0.00 ? 67 LEU A HG   2  
ATOM 2182  H HD11 . LEU A 1 67 ? -5.423  1.099   -4.011  1.00 0.00 ? 67 LEU A HD11 2  
ATOM 2183  H HD12 . LEU A 1 67 ? -5.276  2.244   -5.345  1.00 0.00 ? 67 LEU A HD12 2  
ATOM 2184  H HD13 . LEU A 1 67 ? -5.719  2.816   -3.737  1.00 0.00 ? 67 LEU A HD13 2  
ATOM 2185  H HD21 . LEU A 1 67 ? -3.031  4.298   -4.404  1.00 0.00 ? 67 LEU A HD21 2  
ATOM 2186  H HD22 . LEU A 1 67 ? -3.602  3.381   -5.798  1.00 0.00 ? 67 LEU A HD22 2  
ATOM 2187  H HD23 . LEU A 1 67 ? -2.015  3.041   -5.109  1.00 0.00 ? 67 LEU A HD23 2  
ATOM 2188  N N    . PHE A 1 68 ? -4.149  -0.616  -1.893  1.00 0.00 ? 68 PHE A N    2  
ATOM 2189  C CA   . PHE A 1 68 ? -3.606  -1.964  -2.017  1.00 0.00 ? 68 PHE A CA   2  
ATOM 2190  C C    . PHE A 1 68 ? -3.087  -2.213  -3.429  1.00 0.00 ? 68 PHE A C    2  
ATOM 2191  O O    . PHE A 1 68 ? -3.856  -2.234  -4.389  1.00 0.00 ? 68 PHE A O    2  
ATOM 2192  C CB   . PHE A 1 68 ? -4.672  -3.002  -1.663  1.00 0.00 ? 68 PHE A CB   2  
ATOM 2193  C CG   . PHE A 1 68 ? -4.930  -3.120  -0.188  1.00 0.00 ? 68 PHE A CG   2  
ATOM 2194  C CD1  . PHE A 1 68 ? -3.940  -3.576  0.668   1.00 0.00 ? 68 PHE A CD1  2  
ATOM 2195  C CD2  . PHE A 1 68 ? -6.162  -2.773  0.343   1.00 0.00 ? 68 PHE A CD2  2  
ATOM 2196  C CE1  . PHE A 1 68 ? -4.175  -3.685  2.025   1.00 0.00 ? 68 PHE A CE1  2  
ATOM 2197  C CE2  . PHE A 1 68 ? -6.403  -2.880  1.699   1.00 0.00 ? 68 PHE A CE2  2  
ATOM 2198  C CZ   . PHE A 1 68 ? -5.408  -3.336  2.541   1.00 0.00 ? 68 PHE A CZ   2  
ATOM 2199  H H    . PHE A 1 68 ? -5.104  -0.470  -2.064  1.00 0.00 ? 68 PHE A H    2  
ATOM 2200  H HA   . PHE A 1 68 ? -2.783  -2.054  -1.323  1.00 0.00 ? 68 PHE A HA   2  
ATOM 2201  H HB2  . PHE A 1 68 ? -5.600  -2.731  -2.142  1.00 0.00 ? 68 PHE A HB2  2  
ATOM 2202  H HB3  . PHE A 1 68 ? -4.355  -3.970  -2.024  1.00 0.00 ? 68 PHE A HB3  2  
ATOM 2203  H HD1  . PHE A 1 68 ? -2.976  -3.849  0.266   1.00 0.00 ? 68 PHE A HD1  2  
ATOM 2204  H HD2  . PHE A 1 68 ? -6.940  -2.416  -0.315  1.00 0.00 ? 68 PHE A HD2  2  
ATOM 2205  H HE1  . PHE A 1 68 ? -3.395  -4.042  2.682   1.00 0.00 ? 68 PHE A HE1  2  
ATOM 2206  H HE2  . PHE A 1 68 ? -7.367  -2.606  2.101   1.00 0.00 ? 68 PHE A HE2  2  
ATOM 2207  H HZ   . PHE A 1 68 ? -5.593  -3.421  3.603   1.00 0.00 ? 68 PHE A HZ   2  
ATOM 2208  N N    . ALA A 1 69 ? -1.776  -2.402  -3.548  1.00 0.00 ? 69 ALA A N    2  
ATOM 2209  C CA   . ALA A 1 69 ? -1.155  -2.649  -4.843  1.00 0.00 ? 69 ALA A CA   2  
ATOM 2210  C C    . ALA A 1 69 ? -0.217  -3.853  -4.781  1.00 0.00 ? 69 ALA A C    2  
ATOM 2211  O O    . ALA A 1 69 ? 0.396   -4.119  -3.748  1.00 0.00 ? 69 ALA A O    2  
ATOM 2212  C CB   . ALA A 1 69 ? -0.401  -1.413  -5.311  1.00 0.00 ? 69 ALA A CB   2  
ATOM 2213  H H    . ALA A 1 69 ? -1.214  -2.373  -2.746  1.00 0.00 ? 69 ALA A H    2  
ATOM 2214  H HA   . ALA A 1 69 ? -1.941  -2.853  -5.555  1.00 0.00 ? 69 ALA A HA   2  
ATOM 2215  H HB1  . ALA A 1 69 ? -1.103  -0.618  -5.510  1.00 0.00 ? 69 ALA A HB1  2  
ATOM 2216  H HB2  . ALA A 1 69 ? 0.145   -1.646  -6.215  1.00 0.00 ? 69 ALA A HB2  2  
ATOM 2217  H HB3  . ALA A 1 69 ? 0.290   -1.101  -4.542  1.00 0.00 ? 69 ALA A HB3  2  
ATOM 2218  N N    . PRO A 1 70 ? -0.094  -4.601  -5.892  1.00 0.00 ? 70 PRO A N    2  
ATOM 2219  C CA   . PRO A 1 70 ? 0.776   -5.780  -5.956  1.00 0.00 ? 70 PRO A CA   2  
ATOM 2220  C C    . PRO A 1 70 ? 2.210   -5.464  -5.544  1.00 0.00 ? 70 PRO A C    2  
ATOM 2221  O O    . PRO A 1 70 ? 2.651   -4.319  -5.630  1.00 0.00 ? 70 PRO A O    2  
ATOM 2222  C CB   . PRO A 1 70 ? 0.722   -6.188  -7.431  1.00 0.00 ? 70 PRO A CB   2  
ATOM 2223  C CG   . PRO A 1 70 ? -0.561  -5.628  -7.937  1.00 0.00 ? 70 PRO A CG   2  
ATOM 2224  C CD   . PRO A 1 70 ? -0.788  -4.355  -7.170  1.00 0.00 ? 70 PRO A CD   2  
ATOM 2225  H HA   . PRO A 1 70 ? 0.396   -6.584  -5.343  1.00 0.00 ? 70 PRO A HA   2  
ATOM 2226  H HB2  . PRO A 1 70 ? 1.570   -5.770  -7.953  1.00 0.00 ? 70 PRO A HB2  2  
ATOM 2227  H HB3  . PRO A 1 70 ? 0.740   -7.266  -7.509  1.00 0.00 ? 70 PRO A HB3  2  
ATOM 2228  H HG2  . PRO A 1 70 ? -0.480  -5.419  -8.993  1.00 0.00 ? 70 PRO A HG2  2  
ATOM 2229  H HG3  . PRO A 1 70 ? -1.365  -6.325  -7.753  1.00 0.00 ? 70 PRO A HG3  2  
ATOM 2230  H HD2  . PRO A 1 70 ? -0.352  -3.517  -7.692  1.00 0.00 ? 70 PRO A HD2  2  
ATOM 2231  H HD3  . PRO A 1 70 ? -1.844  -4.195  -7.009  1.00 0.00 ? 70 PRO A HD3  2  
ATOM 2232  N N    . ILE A 1 71 ? 2.931   -6.487  -5.099  1.00 0.00 ? 71 ILE A N    2  
ATOM 2233  C CA   . ILE A 1 71 ? 4.316   -6.315  -4.675  1.00 0.00 ? 71 ILE A CA   2  
ATOM 2234  C C    . ILE A 1 71 ? 5.177   -5.791  -5.821  1.00 0.00 ? 71 ILE A C    2  
ATOM 2235  O O    . ILE A 1 71 ? 5.973   -4.868  -5.640  1.00 0.00 ? 71 ILE A O    2  
ATOM 2236  C CB   . ILE A 1 71 ? 4.913   -7.639  -4.154  1.00 0.00 ? 71 ILE A CB   2  
ATOM 2237  C CG1  . ILE A 1 71 ? 6.330   -7.413  -3.621  1.00 0.00 ? 71 ILE A CG1  2  
ATOM 2238  C CG2  . ILE A 1 71 ? 4.914   -8.693  -5.250  1.00 0.00 ? 71 ILE A CG2  2  
ATOM 2239  C CD1  . ILE A 1 71 ? 6.676   -8.287  -2.435  1.00 0.00 ? 71 ILE A CD1  2  
ATOM 2240  H H    . ILE A 1 71 ? 2.524   -7.377  -5.054  1.00 0.00 ? 71 ILE A H    2  
ATOM 2241  H HA   . ILE A 1 71 ? 4.331   -5.595  -3.870  1.00 0.00 ? 71 ILE A HA   2  
ATOM 2242  H HB   . ILE A 1 71 ? 4.288   -7.995  -3.349  1.00 0.00 ? 71 ILE A HB   2  
ATOM 2243  H HG12 . ILE A 1 71 ? 7.040   -7.625  -4.406  1.00 0.00 ? 71 ILE A HG12 2  
ATOM 2244  H HG13 . ILE A 1 71 ? 6.433   -6.382  -3.316  1.00 0.00 ? 71 ILE A HG13 2  
ATOM 2245  H HG21 . ILE A 1 71 ? 5.048   -9.670  -4.810  1.00 0.00 ? 71 ILE A HG21 2  
ATOM 2246  H HG22 . ILE A 1 71 ? 5.721   -8.495  -5.939  1.00 0.00 ? 71 ILE A HG22 2  
ATOM 2247  H HG23 . ILE A 1 71 ? 3.973   -8.663  -5.780  1.00 0.00 ? 71 ILE A HG23 2  
ATOM 2248  H HD11 . ILE A 1 71 ? 5.829   -8.906  -2.186  1.00 0.00 ? 71 ILE A HD11 2  
ATOM 2249  H HD12 . ILE A 1 71 ? 6.928   -7.663  -1.591  1.00 0.00 ? 71 ILE A HD12 2  
ATOM 2250  H HD13 . ILE A 1 71 ? 7.520   -8.914  -2.684  1.00 0.00 ? 71 ILE A HD13 2  
ATOM 2251  N N    . HIS A 1 72 ? 5.010   -6.381  -7.000  1.00 0.00 ? 72 HIS A N    2  
ATOM 2252  C CA   . HIS A 1 72 ? 5.771   -5.971  -8.174  1.00 0.00 ? 72 HIS A CA   2  
ATOM 2253  C C    . HIS A 1 72 ? 5.437   -4.534  -8.570  1.00 0.00 ? 72 HIS A C    2  
ATOM 2254  O O    . HIS A 1 72 ? 6.198   -3.888  -9.292  1.00 0.00 ? 72 HIS A O    2  
ATOM 2255  C CB   . HIS A 1 72 ? 5.489   -6.914  -9.345  1.00 0.00 ? 72 HIS A CB   2  
ATOM 2256  C CG   . HIS A 1 72 ? 4.033   -7.183  -9.562  1.00 0.00 ? 72 HIS A CG   2  
ATOM 2257  N ND1  . HIS A 1 72 ? 3.356   -8.242  -8.999  1.00 0.00 ? 72 HIS A ND1  2  
ATOM 2258  C CD2  . HIS A 1 72 ? 3.118   -6.505  -10.301 1.00 0.00 ? 72 HIS A CD2  2  
ATOM 2259  C CE1  . HIS A 1 72 ? 2.081   -8.177  -9.405  1.00 0.00 ? 72 HIS A CE1  2  
ATOM 2260  N NE2  . HIS A 1 72 ? 1.884   -7.141  -10.196 1.00 0.00 ? 72 HIS A NE2  2  
ATOM 2261  H H    . HIS A 1 72 ? 4.359   -7.109  -7.082  1.00 0.00 ? 72 HIS A H    2  
ATOM 2262  H HA   . HIS A 1 72 ? 6.819   -6.026  -7.924  1.00 0.00 ? 72 HIS A HA   2  
ATOM 2263  H HB2  . HIS A 1 72 ? 5.884   -6.479  -10.251 1.00 0.00 ? 72 HIS A HB2  2  
ATOM 2264  H HB3  . HIS A 1 72 ? 5.980   -7.859  -9.162  1.00 0.00 ? 72 HIS A HB3  2  
ATOM 2265  H HD1  . HIS A 1 72 ? 3.739   -8.923  -8.408  1.00 0.00 ? 72 HIS A HD1  2  
ATOM 2266  H HD2  . HIS A 1 72 ? 3.306   -5.613  -10.880 1.00 0.00 ? 72 HIS A HD2  2  
ATOM 2267  H HE1  . HIS A 1 72 ? 1.314   -8.883  -9.120  1.00 0.00 ? 72 HIS A HE1  2  
ATOM 2268  N N    . LYS A 1 73 ? 4.297   -4.038  -8.095  1.00 0.00 ? 73 LYS A N    2  
ATOM 2269  C CA   . LYS A 1 73 ? 3.870   -2.677  -8.403  1.00 0.00 ? 73 LYS A CA   2  
ATOM 2270  C C    . LYS A 1 73 ? 4.292   -1.705  -7.304  1.00 0.00 ? 73 LYS A C    2  
ATOM 2271  O O    . LYS A 1 73 ? 3.706   -0.633  -7.155  1.00 0.00 ? 73 LYS A O    2  
ATOM 2272  C CB   . LYS A 1 73 ? 2.351   -2.629  -8.584  1.00 0.00 ? 73 LYS A CB   2  
ATOM 2273  C CG   . LYS A 1 73 ? 1.875   -3.225  -9.900  1.00 0.00 ? 73 LYS A CG   2  
ATOM 2274  C CD   . LYS A 1 73 ? 1.270   -2.167  -10.808 1.00 0.00 ? 73 LYS A CD   2  
ATOM 2275  C CE   . LYS A 1 73 ? 0.807   -2.764  -12.127 1.00 0.00 ? 73 LYS A CE   2  
ATOM 2276  N NZ   . LYS A 1 73 ? -0.332  -2.004  -12.713 1.00 0.00 ? 73 LYS A NZ   2  
ATOM 2277  H H    . LYS A 1 73 ? 3.730   -4.598  -7.525  1.00 0.00 ? 73 LYS A H    2  
ATOM 2278  H HA   . LYS A 1 73 ? 4.342   -2.384  -9.328  1.00 0.00 ? 73 LYS A HA   2  
ATOM 2279  H HB2  . LYS A 1 73 ? 1.887   -3.176  -7.777  1.00 0.00 ? 73 LYS A HB2  2  
ATOM 2280  H HB3  . LYS A 1 73 ? 2.028   -1.599  -8.542  1.00 0.00 ? 73 LYS A HB3  2  
ATOM 2281  H HG2  . LYS A 1 73 ? 2.715   -3.679  -10.404 1.00 0.00 ? 73 LYS A HG2  2  
ATOM 2282  H HG3  . LYS A 1 73 ? 1.128   -3.978  -9.692  1.00 0.00 ? 73 LYS A HG3  2  
ATOM 2283  H HD2  . LYS A 1 73 ? 0.423   -1.720  -10.310 1.00 0.00 ? 73 LYS A HD2  2  
ATOM 2284  H HD3  . LYS A 1 73 ? 2.014   -1.409  -11.007 1.00 0.00 ? 73 LYS A HD3  2  
ATOM 2285  H HE2  . LYS A 1 73 ? 1.633   -2.749  -12.824 1.00 0.00 ? 73 LYS A HE2  2  
ATOM 2286  H HE3  . LYS A 1 73 ? 0.498   -3.784  -11.957 1.00 0.00 ? 73 LYS A HE3  2  
ATOM 2287  H HZ1  . LYS A 1 73 ? -1.190  -2.154  -12.145 1.00 0.00 ? 73 LYS A HZ1  2  
ATOM 2288  H HZ2  . LYS A 1 73 ? -0.512  -2.322  -13.685 1.00 0.00 ? 73 LYS A HZ2  2  
ATOM 2289  H HZ3  . LYS A 1 73 ? -0.112  -0.986  -12.727 1.00 0.00 ? 73 LYS A HZ3  2  
ATOM 2290  N N    . VAL A 1 74 ? 5.311   -2.084  -6.535  1.00 0.00 ? 74 VAL A N    2  
ATOM 2291  C CA   . VAL A 1 74 ? 5.805   -1.240  -5.455  1.00 0.00 ? 74 VAL A CA   2  
ATOM 2292  C C    . VAL A 1 74 ? 7.283   -0.917  -5.644  1.00 0.00 ? 74 VAL A C    2  
ATOM 2293  O O    . VAL A 1 74 ? 8.152   -1.732  -5.330  1.00 0.00 ? 74 VAL A O    2  
ATOM 2294  C CB   . VAL A 1 74 ? 5.610   -1.912  -4.083  1.00 0.00 ? 74 VAL A CB   2  
ATOM 2295  C CG1  . VAL A 1 74 ? 5.944   -0.942  -2.959  1.00 0.00 ? 74 VAL A CG1  2  
ATOM 2296  C CG2  . VAL A 1 74 ? 4.189   -2.435  -3.941  1.00 0.00 ? 74 VAL A CG2  2  
ATOM 2297  H H    . VAL A 1 74 ? 5.740   -2.949  -6.700  1.00 0.00 ? 74 VAL A H    2  
ATOM 2298  H HA   . VAL A 1 74 ? 5.241   -0.319  -5.465  1.00 0.00 ? 74 VAL A HA   2  
ATOM 2299  H HB   . VAL A 1 74 ? 6.287   -2.751  -4.015  1.00 0.00 ? 74 VAL A HB   2  
ATOM 2300  H HG11 . VAL A 1 74 ? 5.808   0.072   -3.308  1.00 0.00 ? 74 VAL A HG11 2  
ATOM 2301  H HG12 . VAL A 1 74 ? 6.969   -1.083  -2.655  1.00 0.00 ? 74 VAL A HG12 2  
ATOM 2302  H HG13 . VAL A 1 74 ? 5.289   -1.124  -2.120  1.00 0.00 ? 74 VAL A HG13 2  
ATOM 2303  H HG21 . VAL A 1 74 ? 4.163   -3.483  -4.199  1.00 0.00 ? 74 VAL A HG21 2  
ATOM 2304  H HG22 . VAL A 1 74 ? 3.535   -1.886  -4.604  1.00 0.00 ? 74 VAL A HG22 2  
ATOM 2305  H HG23 . VAL A 1 74 ? 3.856   -2.305  -2.922  1.00 0.00 ? 74 VAL A HG23 2  
ATOM 2306  N N    . ILE A 1 75 ? 7.562   0.276   -6.157  1.00 0.00 ? 75 ILE A N    2  
ATOM 2307  C CA   . ILE A 1 75 ? 8.934   0.707   -6.388  1.00 0.00 ? 75 ILE A CA   2  
ATOM 2308  C C    . ILE A 1 75 ? 9.478   1.478   -5.191  1.00 0.00 ? 75 ILE A C    2  
ATOM 2309  O O    . ILE A 1 75 ? 9.112   2.631   -4.964  1.00 0.00 ? 75 ILE A O    2  
ATOM 2310  C CB   . ILE A 1 75 ? 9.042   1.593   -7.644  1.00 0.00 ? 75 ILE A CB   2  
ATOM 2311  C CG1  . ILE A 1 75 ? 8.325   0.934   -8.823  1.00 0.00 ? 75 ILE A CG1  2  
ATOM 2312  C CG2  . ILE A 1 75 ? 10.501  1.854   -7.984  1.00 0.00 ? 75 ILE A CG2  2  
ATOM 2313  C CD1  . ILE A 1 75 ? 8.193   1.835   -10.030 1.00 0.00 ? 75 ILE A CD1  2  
ATOM 2314  H H    . ILE A 1 75 ? 6.826   0.881   -6.387  1.00 0.00 ? 75 ILE A H    2  
ATOM 2315  H HA   . ILE A 1 75 ? 9.540   -0.174  -6.541  1.00 0.00 ? 75 ILE A HA   2  
ATOM 2316  H HB   . ILE A 1 75 ? 8.573   2.541   -7.430  1.00 0.00 ? 75 ILE A HB   2  
ATOM 2317  H HG12 . ILE A 1 75 ? 8.873   0.055   -9.125  1.00 0.00 ? 75 ILE A HG12 2  
ATOM 2318  H HG13 . ILE A 1 75 ? 7.330   0.644   -8.514  1.00 0.00 ? 75 ILE A HG13 2  
ATOM 2319  H HG21 . ILE A 1 75 ? 11.113  1.062   -7.580  1.00 0.00 ? 75 ILE A HG21 2  
ATOM 2320  H HG22 . ILE A 1 75 ? 10.807  2.799   -7.557  1.00 0.00 ? 75 ILE A HG22 2  
ATOM 2321  H HG23 . ILE A 1 75 ? 10.621  1.890   -9.057  1.00 0.00 ? 75 ILE A HG23 2  
ATOM 2322  H HD11 . ILE A 1 75 ? 7.318   1.551   -10.598 1.00 0.00 ? 75 ILE A HD11 2  
ATOM 2323  H HD12 . ILE A 1 75 ? 9.071   1.738   -10.651 1.00 0.00 ? 75 ILE A HD12 2  
ATOM 2324  H HD13 . ILE A 1 75 ? 8.093   2.861   -9.705  1.00 0.00 ? 75 ILE A HD13 2  
ATOM 2325  N N    . ARG A 1 76 ? 10.353  0.833   -4.425  1.00 0.00 ? 76 ARG A N    2  
ATOM 2326  C CA   . ARG A 1 76 ? 10.948  1.458   -3.250  1.00 0.00 ? 76 ARG A CA   2  
ATOM 2327  C C    . ARG A 1 76 ? 11.775  2.677   -3.643  1.00 0.00 ? 76 ARG A C    2  
ATOM 2328  O O    . ARG A 1 76 ? 12.633  2.600   -4.524  1.00 0.00 ? 76 ARG A O    2  
ATOM 2329  C CB   . ARG A 1 76 ? 11.819  0.450   -2.497  1.00 0.00 ? 76 ARG A CB   2  
ATOM 2330  C CG   . ARG A 1 76 ? 11.242  0.031   -1.154  1.00 0.00 ? 76 ARG A CG   2  
ATOM 2331  C CD   . ARG A 1 76 ? 12.080  -1.056  -0.501  1.00 0.00 ? 76 ARG A CD   2  
ATOM 2332  N NE   . ARG A 1 76 ? 12.264  -0.819  0.929   1.00 0.00 ? 76 ARG A NE   2  
ATOM 2333  C CZ   . ARG A 1 76 ? 12.978  0.187   1.428   1.00 0.00 ? 76 ARG A CZ   2  
ATOM 2334  N NH1  . ARG A 1 76 ? 13.576  1.052   0.617   1.00 0.00 ? 76 ARG A NH1  2  
ATOM 2335  N NH2  . ARG A 1 76 ? 13.094  0.330   2.740   1.00 0.00 ? 76 ARG A NH2  2  
ATOM 2336  H H    . ARG A 1 76 ? 10.605  -0.086  -4.658  1.00 0.00 ? 76 ARG A H    2  
ATOM 2337  H HA   . ARG A 1 76 ? 10.144  1.778   -2.604  1.00 0.00 ? 76 ARG A HA   2  
ATOM 2338  H HB2  . ARG A 1 76 ? 11.936  -0.434  -3.106  1.00 0.00 ? 76 ARG A HB2  2  
ATOM 2339  H HB3  . ARG A 1 76 ? 12.792  0.888   -2.324  1.00 0.00 ? 76 ARG A HB3  2  
ATOM 2340  H HG2  . ARG A 1 76 ? 11.213  0.890   -0.502  1.00 0.00 ? 76 ARG A HG2  2  
ATOM 2341  H HG3  . ARG A 1 76 ? 10.239  -0.341  -1.306  1.00 0.00 ? 76 ARG A HG3  2  
ATOM 2342  H HD2  . ARG A 1 76 ? 11.585  -2.006  -0.637  1.00 0.00 ? 76 ARG A HD2  2  
ATOM 2343  H HD3  . ARG A 1 76 ? 13.048  -1.084  -0.979  1.00 0.00 ? 76 ARG A HD3  2  
ATOM 2344  H HE   . ARG A 1 76 ? 11.832  -1.442  1.550   1.00 0.00 ? 76 ARG A HE   2  
ATOM 2345  H HH11 . ARG A 1 76 ? 13.492  0.950   -0.374  1.00 0.00 ? 76 ARG A HH11 2  
ATOM 2346  H HH12 . ARG A 1 76 ? 14.111  1.806   0.998   1.00 0.00 ? 76 ARG A HH12 2  
ATOM 2347  H HH21 . ARG A 1 76 ? 12.645  -0.318  3.356   1.00 0.00 ? 76 ARG A HH21 2  
ATOM 2348  H HH22 . ARG A 1 76 ? 13.631  1.086   3.116   1.00 0.00 ? 76 ARG A HH22 2  
ATOM 2349  N N    . ILE A 1 77 ? 11.514  3.802   -2.985  1.00 0.00 ? 77 ILE A N    2  
ATOM 2350  C CA   . ILE A 1 77 ? 12.235  5.037   -3.265  1.00 0.00 ? 77 ILE A CA   2  
ATOM 2351  C C    . ILE A 1 77 ? 13.083  5.462   -2.072  1.00 0.00 ? 77 ILE A C    2  
ATOM 2352  O O    . ILE A 1 77 ? 14.191  5.973   -2.235  1.00 0.00 ? 77 ILE A O    2  
ATOM 2353  C CB   . ILE A 1 77 ? 11.270  6.183   -3.627  1.00 0.00 ? 77 ILE A CB   2  
ATOM 2354  C CG1  . ILE A 1 77 ? 10.169  6.303   -2.570  1.00 0.00 ? 77 ILE A CG1  2  
ATOM 2355  C CG2  . ILE A 1 77 ? 10.667  5.953   -5.005  1.00 0.00 ? 77 ILE A CG2  2  
ATOM 2356  C CD1  . ILE A 1 77 ? 9.266   7.500   -2.774  1.00 0.00 ? 77 ILE A CD1  2  
ATOM 2357  H H    . ILE A 1 77 ? 10.819  3.800   -2.294  1.00 0.00 ? 77 ILE A H    2  
ATOM 2358  H HA   . ILE A 1 77 ? 12.883  4.861   -4.112  1.00 0.00 ? 77 ILE A HA   2  
ATOM 2359  H HB   . ILE A 1 77 ? 11.833  7.103   -3.656  1.00 0.00 ? 77 ILE A HB   2  
ATOM 2360  H HG12 . ILE A 1 77 ? 9.554   5.417   -2.598  1.00 0.00 ? 77 ILE A HG12 2  
ATOM 2361  H HG13 . ILE A 1 77 ? 10.624  6.390   -1.595  1.00 0.00 ? 77 ILE A HG13 2  
ATOM 2362  H HG21 . ILE A 1 77 ? 11.459  5.840   -5.730  1.00 0.00 ? 77 ILE A HG21 2  
ATOM 2363  H HG22 . ILE A 1 77 ? 10.050  6.798   -5.273  1.00 0.00 ? 77 ILE A HG22 2  
ATOM 2364  H HG23 . ILE A 1 77 ? 10.064  5.058   -4.989  1.00 0.00 ? 77 ILE A HG23 2  
ATOM 2365  H HD11 . ILE A 1 77 ? 9.457   7.935   -3.743  1.00 0.00 ? 77 ILE A HD11 2  
ATOM 2366  H HD12 . ILE A 1 77 ? 9.462   8.233   -2.006  1.00 0.00 ? 77 ILE A HD12 2  
ATOM 2367  H HD13 . ILE A 1 77 ? 8.234   7.186   -2.717  1.00 0.00 ? 77 ILE A HD13 2  
ATOM 2368  N N    . GLY A 1 78 ? 12.555  5.249   -0.871  1.00 0.00 ? 78 GLY A N    2  
ATOM 2369  C CA   . GLY A 1 78 ? 13.277  5.615   0.333   1.00 0.00 ? 78 GLY A CA   2  
ATOM 2370  C C    . GLY A 1 78 ? 14.554  4.817   0.508   1.00 0.00 ? 78 GLY A C    2  
ATOM 2371  O O    . GLY A 1 78 ? 14.516  3.597   0.662   1.00 0.00 ? 78 GLY A O    2  
ATOM 2372  H H    . GLY A 1 78 ? 11.668  4.839   -0.802  1.00 0.00 ? 78 GLY A H    2  
ATOM 2373  H HA2  . GLY A 1 78 ? 13.526  6.665   0.285   1.00 0.00 ? 78 GLY A HA2  2  
ATOM 2374  H HA3  . GLY A 1 78 ? 12.640  5.445   1.189   1.00 0.00 ? 78 GLY A HA3  2  
ATOM 2375  N N    . SER A 1 79 ? 15.690  5.509   0.486   1.00 0.00 ? 79 SER A N    2  
ATOM 2376  C CA   . SER A 1 79 ? 16.985  4.857   0.644   1.00 0.00 ? 79 SER A CA   2  
ATOM 2377  C C    . SER A 1 79 ? 18.026  5.838   1.171   1.00 0.00 ? 79 SER A C    2  
ATOM 2378  O O    . SER A 1 79 ? 18.776  6.437   0.401   1.00 0.00 ? 79 SER A O    2  
ATOM 2379  C CB   . SER A 1 79 ? 17.450  4.271   -0.690  1.00 0.00 ? 79 SER A CB   2  
ATOM 2380  O OG   . SER A 1 79 ? 16.487  3.376   -1.219  1.00 0.00 ? 79 SER A OG   2  
ATOM 2381  H H    . SER A 1 79 ? 15.655  6.480   0.360   1.00 0.00 ? 79 SER A H    2  
ATOM 2382  H HA   . SER A 1 79 ? 16.868  4.056   1.358   1.00 0.00 ? 79 SER A HA   2  
ATOM 2383  H HB2  . SER A 1 79 ? 17.605  5.071   -1.399  1.00 0.00 ? 79 SER A HB2  2  
ATOM 2384  H HB3  . SER A 1 79 ? 18.378  3.737   -0.542  1.00 0.00 ? 79 SER A HB3  2  
ATOM 2385  H HG   . SER A 1 79 ? 16.930  2.685   -1.717  1.00 0.00 ? 79 SER A HG   2  
ATOM 2386  N N    . GLY A 1 80 ? 18.066  5.999   2.490   1.00 0.00 ? 80 GLY A N    2  
ATOM 2387  C CA   . GLY A 1 80 ? 19.019  6.908   3.099   1.00 0.00 ? 80 GLY A CA   2  
ATOM 2388  C C    . GLY A 1 80 ? 18.852  7.005   4.605   1.00 0.00 ? 80 GLY A C    2  
ATOM 2389  O O    . GLY A 1 80 ? 18.528  8.071   5.127   1.00 0.00 ? 80 GLY A O    2  
ATOM 2390  H H    . GLY A 1 80 ? 17.444  5.495   3.055   1.00 0.00 ? 80 GLY A H    2  
ATOM 2391  H HA2  . GLY A 1 80 ? 20.019  6.563   2.880   1.00 0.00 ? 80 GLY A HA2  2  
ATOM 2392  H HA3  . GLY A 1 80 ? 18.887  7.890   2.670   1.00 0.00 ? 80 GLY A HA3  2  
ATOM 2393  N N    . PRO A 1 81 ? 19.067  5.897   5.334   1.00 0.00 ? 81 PRO A N    2  
ATOM 2394  C CA   . PRO A 1 81 ? 18.934  5.875   6.795   1.00 0.00 ? 81 PRO A CA   2  
ATOM 2395  C C    . PRO A 1 81 ? 20.038  6.666   7.488   1.00 0.00 ? 81 PRO A C    2  
ATOM 2396  O O    . PRO A 1 81 ? 19.776  7.446   8.404   1.00 0.00 ? 81 PRO A O    2  
ATOM 2397  C CB   . PRO A 1 81 ? 19.044  4.389   7.140   1.00 0.00 ? 81 PRO A CB   2  
ATOM 2398  C CG   . PRO A 1 81 ? 19.828  3.796   6.022   1.00 0.00 ? 81 PRO A CG   2  
ATOM 2399  C CD   . PRO A 1 81 ? 19.456  4.580   4.794   1.00 0.00 ? 81 PRO A CD   2  
ATOM 2400  H HA   . PRO A 1 81 ? 17.972  6.251   7.109   1.00 0.00 ? 81 PRO A HA   2  
ATOM 2401  H HB2  . PRO A 1 81 ? 19.553  4.274   8.086   1.00 0.00 ? 81 PRO A HB2  2  
ATOM 2402  H HB3  . PRO A 1 81 ? 18.057  3.956   7.201   1.00 0.00 ? 81 PRO A HB3  2  
ATOM 2403  H HG2  . PRO A 1 81 ? 20.886  3.894   6.223   1.00 0.00 ? 81 PRO A HG2  2  
ATOM 2404  H HG3  . PRO A 1 81 ? 19.564  2.757   5.897   1.00 0.00 ? 81 PRO A HG3  2  
ATOM 2405  H HD2  . PRO A 1 81 ? 20.305  4.671   4.133   1.00 0.00 ? 81 PRO A HD2  2  
ATOM 2406  H HD3  . PRO A 1 81 ? 18.626  4.113   4.285   1.00 0.00 ? 81 PRO A HD3  2  
ATOM 2407  N N    . SER A 1 82 ? 21.274  6.461   7.045   1.00 0.00 ? 82 SER A N    2  
ATOM 2408  C CA   . SER A 1 82 ? 22.418  7.156   7.622   1.00 0.00 ? 82 SER A CA   2  
ATOM 2409  C C    . SER A 1 82 ? 22.589  8.537   6.998   1.00 0.00 ? 82 SER A C    2  
ATOM 2410  O O    . SER A 1 82 ? 22.010  8.832   5.953   1.00 0.00 ? 82 SER A O    2  
ATOM 2411  C CB   . SER A 1 82 ? 23.694  6.334   7.426   1.00 0.00 ? 82 SER A CB   2  
ATOM 2412  O OG   . SER A 1 82 ? 23.924  6.070   6.053   1.00 0.00 ? 82 SER A OG   2  
ATOM 2413  H H    . SER A 1 82 ? 21.420  5.827   6.311   1.00 0.00 ? 82 SER A H    2  
ATOM 2414  H HA   . SER A 1 82 ? 22.235  7.272   8.680   1.00 0.00 ? 82 SER A HA   2  
ATOM 2415  H HB2  . SER A 1 82 ? 24.536  6.880   7.821   1.00 0.00 ? 82 SER A HB2  2  
ATOM 2416  H HB3  . SER A 1 82 ? 23.597  5.394   7.949   1.00 0.00 ? 82 SER A HB3  2  
ATOM 2417  H HG   . SER A 1 82 ? 23.752  5.143   5.871   1.00 0.00 ? 82 SER A HG   2  
ATOM 2418  N N    . SER A 1 83 ? 23.387  9.378   7.645   1.00 0.00 ? 83 SER A N    2  
ATOM 2419  C CA   . SER A 1 83 ? 23.633  10.729  7.153   1.00 0.00 ? 83 SER A CA   2  
ATOM 2420  C C    . SER A 1 83 ? 22.335  11.526  7.078   1.00 0.00 ? 83 SER A C    2  
ATOM 2421  O O    . SER A 1 83 ? 21.707  11.609  6.024   1.00 0.00 ? 83 SER A O    2  
ATOM 2422  C CB   . SER A 1 83 ? 24.296  10.679  5.775   1.00 0.00 ? 83 SER A CB   2  
ATOM 2423  O OG   . SER A 1 83 ? 25.216  9.605   5.690   1.00 0.00 ? 83 SER A OG   2  
ATOM 2424  H H    . SER A 1 83 ? 23.821  9.086   8.475   1.00 0.00 ? 83 SER A H    2  
ATOM 2425  H HA   . SER A 1 83 ? 24.302  11.217  7.846   1.00 0.00 ? 83 SER A HA   2  
ATOM 2426  H HB2  . SER A 1 83 ? 23.537  10.546  5.018   1.00 0.00 ? 83 SER A HB2  2  
ATOM 2427  H HB3  . SER A 1 83 ? 24.823  11.604  5.597   1.00 0.00 ? 83 SER A HB3  2  
ATOM 2428  H HG   . SER A 1 83 ? 26.020  9.833   6.162   1.00 0.00 ? 83 SER A HG   2  
ATOM 2429  N N    . GLY A 1 84 ? 21.940  12.110  8.205   1.00 0.00 ? 84 GLY A N    2  
ATOM 2430  C CA   . GLY A 1 84 ? 20.719  12.892  8.246   1.00 0.00 ? 84 GLY A CA   2  
ATOM 2431  C C    . GLY A 1 84 ? 20.884  14.183  9.023   1.00 0.00 ? 84 GLY A C    2  
ATOM 2432  O O    . GLY A 1 84 ? 19.915  14.970  9.080   1.00 0.00 ? 84 GLY A O    2  
ATOM 2433  O OXT  . GLY A 1 84 ? 21.981  14.409  9.575   1.00 0.00 ? 84 GLY A OXT  2  
ATOM 2434  H H    . GLY A 1 84 ? 22.482  12.008  9.015   1.00 0.00 ? 84 GLY A H    2  
ATOM 2435  H HA2  . GLY A 1 84 ? 20.422  13.129  7.236   1.00 0.00 ? 84 GLY A HA2  2  
ATOM 2436  H HA3  . GLY A 1 84 ? 19.942  12.303  8.710   1.00 0.00 ? 84 GLY A HA3  2  
ATOM 2437  N N    . GLY A 1 1  ? 21.647  -18.520 -6.052  1.00 0.00 ? 1  GLY A N    3  
ATOM 2438  C CA   . GLY A 1 1  ? 21.315  -18.963 -7.434  1.00 0.00 ? 1  GLY A CA   3  
ATOM 2439  C C    . GLY A 1 1  ? 19.980  -18.426 -7.909  1.00 0.00 ? 1  GLY A C    3  
ATOM 2440  O O    . GLY A 1 1  ? 19.924  -17.420 -8.616  1.00 0.00 ? 1  GLY A O    3  
ATOM 2441  H H1   . GLY A 1 1  ? 22.675  -18.388 -5.956  1.00 0.00 ? 1  GLY A H1   3  
ATOM 2442  H H2   . GLY A 1 1  ? 21.336  -19.233 -5.362  1.00 0.00 ? 1  GLY A H2   3  
ATOM 2443  H H3   . GLY A 1 1  ? 21.173  -17.619 -5.842  1.00 0.00 ? 1  GLY A H3   3  
ATOM 2444  H HA2  . GLY A 1 1  ? 22.088  -18.621 -8.106  1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2445  H HA3  . GLY A 1 1  ? 21.286  -20.042 -7.456  1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2446  N N    . SER A 1 2  ? 18.901  -19.100 -7.520  1.00 0.00 ? 2  SER A N    3  
ATOM 2447  C CA   . SER A 1 2  ? 17.559  -18.685 -7.912  1.00 0.00 ? 2  SER A CA   3  
ATOM 2448  C C    . SER A 1 2  ? 16.534  -19.094 -6.859  1.00 0.00 ? 2  SER A C    3  
ATOM 2449  O O    . SER A 1 2  ? 15.982  -20.193 -6.911  1.00 0.00 ? 2  SER A O    3  
ATOM 2450  C CB   . SER A 1 2  ? 17.188  -19.294 -9.265  1.00 0.00 ? 2  SER A CB   3  
ATOM 2451  O OG   . SER A 1 2  ? 17.625  -18.471 -10.333 1.00 0.00 ? 2  SER A OG   3  
ATOM 2452  H H    . SER A 1 2  ? 19.011  -19.894 -6.957  1.00 0.00 ? 2  SER A H    3  
ATOM 2453  H HA   . SER A 1 2  ? 17.557  -17.609 -7.999  1.00 0.00 ? 2  SER A HA   3  
ATOM 2454  H HB2  . SER A 1 2  ? 17.654  -20.264 -9.361  1.00 0.00 ? 2  SER A HB2  3  
ATOM 2455  H HB3  . SER A 1 2  ? 16.115  -19.403 -9.327  1.00 0.00 ? 2  SER A HB3  3  
ATOM 2456  H HG   . SER A 1 2  ? 18.359  -18.896 -10.785 1.00 0.00 ? 2  SER A HG   3  
ATOM 2457  N N    . SER A 1 3  ? 16.286  -18.204 -5.904  1.00 0.00 ? 3  SER A N    3  
ATOM 2458  C CA   . SER A 1 3  ? 15.329  -18.472 -4.838  1.00 0.00 ? 3  SER A CA   3  
ATOM 2459  C C    . SER A 1 3  ? 15.081  -17.222 -4.001  1.00 0.00 ? 3  SER A C    3  
ATOM 2460  O O    . SER A 1 3  ? 14.946  -17.297 -2.779  1.00 0.00 ? 3  SER A O    3  
ATOM 2461  C CB   . SER A 1 3  ? 15.833  -19.609 -3.946  1.00 0.00 ? 3  SER A CB   3  
ATOM 2462  O OG   . SER A 1 3  ? 17.192  -19.417 -3.595  1.00 0.00 ? 3  SER A OG   3  
ATOM 2463  H H    . SER A 1 3  ? 16.759  -17.346 -5.916  1.00 0.00 ? 3  SER A H    3  
ATOM 2464  H HA   . SER A 1 3  ? 14.399  -18.774 -5.297  1.00 0.00 ? 3  SER A HA   3  
ATOM 2465  H HB2  . SER A 1 3  ? 15.242  -19.641 -3.042  1.00 0.00 ? 3  SER A HB2  3  
ATOM 2466  H HB3  . SER A 1 3  ? 15.737  -20.547 -4.473  1.00 0.00 ? 3  SER A HB3  3  
ATOM 2467  H HG   . SER A 1 3  ? 17.260  -18.713 -2.947  1.00 0.00 ? 3  SER A HG   3  
ATOM 2468  N N    . GLY A 1 4  ? 15.022  -16.073 -4.665  1.00 0.00 ? 4  GLY A N    3  
ATOM 2469  C CA   . GLY A 1 4  ? 14.791  -14.822 -3.966  1.00 0.00 ? 4  GLY A CA   3  
ATOM 2470  C C    . GLY A 1 4  ? 13.335  -14.401 -3.996  1.00 0.00 ? 4  GLY A C    3  
ATOM 2471  O O    . GLY A 1 4  ? 12.715  -14.362 -5.059  1.00 0.00 ? 4  GLY A O    3  
ATOM 2472  H H    . GLY A 1 4  ? 15.136  -16.074 -5.639  1.00 0.00 ? 4  GLY A H    3  
ATOM 2473  H HA2  . GLY A 1 4  ? 15.100  -14.936 -2.938  1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2474  H HA3  . GLY A 1 4  ? 15.387  -14.049 -4.428  1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2475  N N    . SER A 1 5  ? 12.789  -14.085 -2.827  1.00 0.00 ? 5  SER A N    3  
ATOM 2476  C CA   . SER A 1 5  ? 11.397  -13.665 -2.721  1.00 0.00 ? 5  SER A CA   3  
ATOM 2477  C C    . SER A 1 5  ? 11.299  -12.181 -2.383  1.00 0.00 ? 5  SER A C    3  
ATOM 2478  O O    . SER A 1 5  ? 10.348  -11.505 -2.774  1.00 0.00 ? 5  SER A O    3  
ATOM 2479  C CB   . SER A 1 5  ? 10.671  -14.491 -1.657  1.00 0.00 ? 5  SER A CB   3  
ATOM 2480  O OG   . SER A 1 5  ? 9.320   -14.718 -2.020  1.00 0.00 ? 5  SER A OG   3  
ATOM 2481  H H    . SER A 1 5  ? 13.335  -14.136 -2.014  1.00 0.00 ? 5  SER A H    3  
ATOM 2482  H HA   . SER A 1 5  ? 10.926  -13.835 -3.678  1.00 0.00 ? 5  SER A HA   3  
ATOM 2483  H HB2  . SER A 1 5  ? 11.166  -15.444 -1.546  1.00 0.00 ? 5  SER A HB2  3  
ATOM 2484  H HB3  . SER A 1 5  ? 10.694  -13.961 -0.716  1.00 0.00 ? 5  SER A HB3  3  
ATOM 2485  H HG   . SER A 1 5  ? 8.828   -13.896 -1.958  1.00 0.00 ? 5  SER A HG   3  
ATOM 2486  N N    . SER A 1 6  ? 12.291  -11.679 -1.653  1.00 0.00 ? 6  SER A N    3  
ATOM 2487  C CA   . SER A 1 6  ? 12.318  -10.274 -1.262  1.00 0.00 ? 6  SER A CA   3  
ATOM 2488  C C    . SER A 1 6  ? 11.113  -9.928  -0.393  1.00 0.00 ? 6  SER A C    3  
ATOM 2489  O O    . SER A 1 6  ? 10.205  -10.743 -0.220  1.00 0.00 ? 6  SER A O    3  
ATOM 2490  C CB   . SER A 1 6  ? 12.343  -9.377  -2.500  1.00 0.00 ? 6  SER A CB   3  
ATOM 2491  O OG   . SER A 1 6  ? 12.497  -8.015  -2.141  1.00 0.00 ? 6  SER A OG   3  
ATOM 2492  H H    . SER A 1 6  ? 13.022  -12.267 -1.370  1.00 0.00 ? 6  SER A H    3  
ATOM 2493  H HA   . SER A 1 6  ? 13.218  -10.107 -0.690  1.00 0.00 ? 6  SER A HA   3  
ATOM 2494  H HB2  . SER A 1 6  ? 13.168  -9.665  -3.135  1.00 0.00 ? 6  SER A HB2  3  
ATOM 2495  H HB3  . SER A 1 6  ? 11.416  -9.492  -3.044  1.00 0.00 ? 6  SER A HB3  3  
ATOM 2496  H HG   . SER A 1 6  ? 11.699  -7.532  -2.366  1.00 0.00 ? 6  SER A HG   3  
ATOM 2497  N N    . GLY A 1 7  ? 11.110  -8.715  0.150   1.00 0.00 ? 7  GLY A N    3  
ATOM 2498  C CA   . GLY A 1 7  ? 10.011  -8.284  0.994   1.00 0.00 ? 7  GLY A CA   3  
ATOM 2499  C C    . GLY A 1 7  ? 10.233  -6.900  1.573   1.00 0.00 ? 7  GLY A C    3  
ATOM 2500  O O    . GLY A 1 7  ? 11.240  -6.652  2.237   1.00 0.00 ? 7  GLY A O    3  
ATOM 2501  H H    . GLY A 1 7  ? 11.860  -8.109  -0.023  1.00 0.00 ? 7  GLY A H    3  
ATOM 2502  H HA2  . GLY A 1 7  ? 9.103   -8.274  0.409   1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2503  H HA3  . GLY A 1 7  ? 9.896   -8.987  1.805   1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2504  N N    . LEU A 1 8  ? 9.291   -5.997  1.321   1.00 0.00 ? 8  LEU A N    3  
ATOM 2505  C CA   . LEU A 1 8  ? 9.388   -4.631  1.821   1.00 0.00 ? 8  LEU A CA   3  
ATOM 2506  C C    . LEU A 1 8  ? 9.153   -4.585  3.328   1.00 0.00 ? 8  LEU A C    3  
ATOM 2507  O O    . LEU A 1 8  ? 8.254   -5.247  3.847   1.00 0.00 ? 8  LEU A O    3  
ATOM 2508  C CB   . LEU A 1 8  ? 8.377   -3.731  1.108   1.00 0.00 ? 8  LEU A CB   3  
ATOM 2509  C CG   . LEU A 1 8  ? 8.540   -3.652  -0.411  1.00 0.00 ? 8  LEU A CG   3  
ATOM 2510  C CD1  . LEU A 1 8  ? 7.182   -3.582  -1.091  1.00 0.00 ? 8  LEU A CD1  3  
ATOM 2511  C CD2  . LEU A 1 8  ? 9.392   -2.451  -0.792  1.00 0.00 ? 8  LEU A CD2  3  
ATOM 2512  H H    . LEU A 1 8  ? 8.513   -6.256  0.786   1.00 0.00 ? 8  LEU A H    3  
ATOM 2513  H HA   . LEU A 1 8  ? 10.385  -4.272  1.614   1.00 0.00 ? 8  LEU A HA   3  
ATOM 2514  H HB2  . LEU A 1 8  ? 7.384   -4.099  1.326   1.00 0.00 ? 8  LEU A HB2  3  
ATOM 2515  H HB3  . LEU A 1 8  ? 8.469   -2.733  1.510   1.00 0.00 ? 8  LEU A HB3  3  
ATOM 2516  H HG   . LEU A 1 8  ? 9.041   -4.543  -0.759  1.00 0.00 ? 8  LEU A HG   3  
ATOM 2517  H HD11 . LEU A 1 8  ? 7.268   -3.944  -2.105  1.00 0.00 ? 8  LEU A HD11 3  
ATOM 2518  H HD12 . LEU A 1 8  ? 6.839   -2.557  -1.104  1.00 0.00 ? 8  LEU A HD12 3  
ATOM 2519  H HD13 . LEU A 1 8  ? 6.475   -4.192  -0.550  1.00 0.00 ? 8  LEU A HD13 3  
ATOM 2520  H HD21 . LEU A 1 8  ? 8.751   -1.618  -1.037  1.00 0.00 ? 8  LEU A HD21 3  
ATOM 2521  H HD22 . LEU A 1 8  ? 10.002  -2.700  -1.648  1.00 0.00 ? 8  LEU A HD22 3  
ATOM 2522  H HD23 . LEU A 1 8  ? 10.030  -2.183  0.037   1.00 0.00 ? 8  LEU A HD23 3  
ATOM 2523  N N    . ARG A 1 9  ? 9.967   -3.799  4.025   1.00 0.00 ? 9  ARG A N    3  
ATOM 2524  C CA   . ARG A 1 9  ? 9.848   -3.667  5.473   1.00 0.00 ? 9  ARG A CA   3  
ATOM 2525  C C    . ARG A 1 9  ? 8.783   -2.638  5.838   1.00 0.00 ? 9  ARG A C    3  
ATOM 2526  O O    . ARG A 1 9  ? 8.504   -1.718  5.069   1.00 0.00 ? 9  ARG A O    3  
ATOM 2527  C CB   . ARG A 1 9  ? 11.192  -3.265  6.082   1.00 0.00 ? 9  ARG A CB   3  
ATOM 2528  C CG   . ARG A 1 9  ? 12.211  -4.392  6.105   1.00 0.00 ? 9  ARG A CG   3  
ATOM 2529  C CD   . ARG A 1 9  ? 11.789  -5.508  7.046   1.00 0.00 ? 9  ARG A CD   3  
ATOM 2530  N NE   . ARG A 1 9  ? 12.893  -5.960  7.890   1.00 0.00 ? 9  ARG A NE   3  
ATOM 2531  C CZ   . ARG A 1 9  ? 13.306  -5.313  8.978   1.00 0.00 ? 9  ARG A CZ   3  
ATOM 2532  N NH1  . ARG A 1 9  ? 12.712  -4.189  9.357   1.00 0.00 ? 9  ARG A NH1  3  
ATOM 2533  N NH2  . ARG A 1 9  ? 14.318  -5.792  9.689   1.00 0.00 ? 9  ARG A NH2  3  
ATOM 2534  H H    . ARG A 1 9  ? 10.665  -3.296  3.556   1.00 0.00 ? 9  ARG A H    3  
ATOM 2535  H HA   . ARG A 1 9  ? 9.555   -4.627  5.870   1.00 0.00 ? 9  ARG A HA   3  
ATOM 2536  H HB2  . ARG A 1 9  ? 11.604  -2.447  5.509   1.00 0.00 ? 9  ARG A HB2  3  
ATOM 2537  H HB3  . ARG A 1 9  ? 11.029  -2.935  7.098   1.00 0.00 ? 9  ARG A HB3  3  
ATOM 2538  H HG2  . ARG A 1 9  ? 12.311  -4.794  5.108   1.00 0.00 ? 9  ARG A HG2  3  
ATOM 2539  H HG3  . ARG A 1 9  ? 13.162  -3.998  6.432   1.00 0.00 ? 9  ARG A HG3  3  
ATOM 2540  H HD2  . ARG A 1 9  ? 10.991  -5.148  7.678   1.00 0.00 ? 9  ARG A HD2  3  
ATOM 2541  H HD3  . ARG A 1 9  ? 11.434  -6.342  6.459   1.00 0.00 ? 9  ARG A HD3  3  
ATOM 2542  H HE   . ARG A 1 9  ? 13.351  -6.788  7.633   1.00 0.00 ? 9  ARG A HE   3  
ATOM 2543  H HH11 . ARG A 1 9  ? 11.948  -3.822  8.825   1.00 0.00 ? 9  ARG A HH11 3  
ATOM 2544  H HH12 . ARG A 1 9  ? 13.027  -3.708  10.175  1.00 0.00 ? 9  ARG A HH12 3  
ATOM 2545  H HH21 . ARG A 1 9  ? 14.770  -6.639  9.409   1.00 0.00 ? 9  ARG A HH21 3  
ATOM 2546  H HH22 . ARG A 1 9  ? 14.629  -5.307  10.506  1.00 0.00 ? 9  ARG A HH22 3  
ATOM 2547  N N    . LEU A 1 10 ? 8.191   -2.801  7.017   1.00 0.00 ? 10 LEU A N    3  
ATOM 2548  C CA   . LEU A 1 10 ? 7.155   -1.886  7.485   1.00 0.00 ? 10 LEU A CA   3  
ATOM 2549  C C    . LEU A 1 10 ? 7.730   -0.495  7.731   1.00 0.00 ? 10 LEU A C    3  
ATOM 2550  O O    . LEU A 1 10 ? 8.819   -0.352  8.287   1.00 0.00 ? 10 LEU A O    3  
ATOM 2551  C CB   . LEU A 1 10 ? 6.515   -2.420  8.767   1.00 0.00 ? 10 LEU A CB   3  
ATOM 2552  C CG   . LEU A 1 10 ? 5.494   -3.541  8.563   1.00 0.00 ? 10 LEU A CG   3  
ATOM 2553  C CD1  . LEU A 1 10 ? 4.998   -4.062  9.903   1.00 0.00 ? 10 LEU A CD1  3  
ATOM 2554  C CD2  . LEU A 1 10 ? 4.330   -3.052  7.715   1.00 0.00 ? 10 LEU A CD2  3  
ATOM 2555  H H    . LEU A 1 10 ? 8.455   -3.553  7.585   1.00 0.00 ? 10 LEU A H    3  
ATOM 2556  H HA   . LEU A 1 10 ? 6.399   -1.819  6.716   1.00 0.00 ? 10 LEU A HA   3  
ATOM 2557  H HB2  . LEU A 1 10 ? 7.300   -2.788  9.410   1.00 0.00 ? 10 LEU A HB2  3  
ATOM 2558  H HB3  . LEU A 1 10 ? 6.020   -1.601  9.266   1.00 0.00 ? 10 LEU A HB3  3  
ATOM 2559  H HG   . LEU A 1 10 ? 5.968   -4.360  8.041   1.00 0.00 ? 10 LEU A HG   3  
ATOM 2560  H HD11 . LEU A 1 10 ? 4.376   -4.931  9.744   1.00 0.00 ? 10 LEU A HD11 3  
ATOM 2561  H HD12 . LEU A 1 10 ? 4.423   -3.294  10.398  1.00 0.00 ? 10 LEU A HD12 3  
ATOM 2562  H HD13 . LEU A 1 10 ? 5.844   -4.332  10.519  1.00 0.00 ? 10 LEU A HD13 3  
ATOM 2563  H HD21 . LEU A 1 10 ? 3.421   -3.542  8.035   1.00 0.00 ? 10 LEU A HD21 3  
ATOM 2564  H HD22 . LEU A 1 10 ? 4.518   -3.284  6.677   1.00 0.00 ? 10 LEU A HD22 3  
ATOM 2565  H HD23 . LEU A 1 10 ? 4.223   -1.984  7.832   1.00 0.00 ? 10 LEU A HD23 3  
ATOM 2566  N N    . GLY A 1 11 ? 6.992   0.528   7.313   1.00 0.00 ? 11 GLY A N    3  
ATOM 2567  C CA   . GLY A 1 11 ? 7.444   1.894   7.497   1.00 0.00 ? 11 GLY A CA   3  
ATOM 2568  C C    . GLY A 1 11 ? 8.476   2.307   6.466   1.00 0.00 ? 11 GLY A C    3  
ATOM 2569  O O    . GLY A 1 11 ? 9.439   3.003   6.788   1.00 0.00 ? 11 GLY A O    3  
ATOM 2570  H H    . GLY A 1 11 ? 6.132   0.353   6.875   1.00 0.00 ? 11 GLY A H    3  
ATOM 2571  H HA2  . GLY A 1 11 ? 6.593   2.556   7.425   1.00 0.00 ? 11 GLY A HA2  3  
ATOM 2572  H HA3  . GLY A 1 11 ? 7.877   1.989   8.482   1.00 0.00 ? 11 GLY A HA3  3  
ATOM 2573  N N    . ASP A 1 12 ? 8.273   1.879   5.224   1.00 0.00 ? 12 ASP A N    3  
ATOM 2574  C CA   . ASP A 1 12 ? 9.194   2.209   4.142   1.00 0.00 ? 12 ASP A CA   3  
ATOM 2575  C C    . ASP A 1 12 ? 8.506   3.068   3.085   1.00 0.00 ? 12 ASP A C    3  
ATOM 2576  O O    . ASP A 1 12 ? 7.426   2.728   2.602   1.00 0.00 ? 12 ASP A O    3  
ATOM 2577  C CB   . ASP A 1 12 ? 9.739   0.931   3.501   1.00 0.00 ? 12 ASP A CB   3  
ATOM 2578  C CG   . ASP A 1 12 ? 10.968  1.190   2.651   1.00 0.00 ? 12 ASP A CG   3  
ATOM 2579  O OD1  . ASP A 1 12 ? 10.937  2.136   1.836   1.00 0.00 ? 12 ASP A OD1  3  
ATOM 2580  O OD2  . ASP A 1 12 ? 11.960  0.446   2.800   1.00 0.00 ? 12 ASP A OD2  3  
ATOM 2581  H H    . ASP A 1 12 ? 7.487   1.328   5.031   1.00 0.00 ? 12 ASP A H    3  
ATOM 2582  H HA   . ASP A 1 12 ? 10.016  2.768   4.564   1.00 0.00 ? 12 ASP A HA   3  
ATOM 2583  H HB2  . ASP A 1 12 ? 10.004  0.231   4.279   1.00 0.00 ? 12 ASP A HB2  3  
ATOM 2584  H HB3  . ASP A 1 12 ? 8.974   0.496   2.874   1.00 0.00 ? 12 ASP A HB3  3  
ATOM 2585  N N    . ARG A 1 13 ? 9.139   4.181   2.732   1.00 0.00 ? 13 ARG A N    3  
ATOM 2586  C CA   . ARG A 1 13 ? 8.588   5.089   1.733   1.00 0.00 ? 13 ARG A CA   3  
ATOM 2587  C C    . ARG A 1 13 ? 8.673   4.478   0.337   1.00 0.00 ? 13 ARG A C    3  
ATOM 2588  O O    . ARG A 1 13 ? 9.760   4.332   -0.222  1.00 0.00 ? 13 ARG A O    3  
ATOM 2589  C CB   . ARG A 1 13 ? 9.329   6.428   1.767   1.00 0.00 ? 13 ARG A CB   3  
ATOM 2590  C CG   . ARG A 1 13 ? 8.414   7.624   1.981   1.00 0.00 ? 13 ARG A CG   3  
ATOM 2591  C CD   . ARG A 1 13 ? 8.977   8.579   3.020   1.00 0.00 ? 13 ARG A CD   3  
ATOM 2592  N NE   . ARG A 1 13 ? 8.648   8.164   4.382   1.00 0.00 ? 13 ARG A NE   3  
ATOM 2593  C CZ   . ARG A 1 13 ? 9.293   8.593   5.465   1.00 0.00 ? 13 ARG A CZ   3  
ATOM 2594  N NH1  . ARG A 1 13 ? 10.300  9.449   5.350   1.00 0.00 ? 13 ARG A NH1  3  
ATOM 2595  N NH2  . ARG A 1 13 ? 8.928   8.165   6.666   1.00 0.00 ? 13 ARG A NH2  3  
ATOM 2596  H H    . ARG A 1 13 ? 9.997   4.397   3.153   1.00 0.00 ? 13 ARG A H    3  
ATOM 2597  H HA   . ARG A 1 13 ? 7.550   5.256   1.975   1.00 0.00 ? 13 ARG A HA   3  
ATOM 2598  H HB2  . ARG A 1 13 ? 10.050  6.405   2.570   1.00 0.00 ? 13 ARG A HB2  3  
ATOM 2599  H HB3  . ARG A 1 13 ? 9.851   6.565   0.831   1.00 0.00 ? 13 ARG A HB3  3  
ATOM 2600  H HG2  . ARG A 1 13 ? 8.302   8.151   1.046   1.00 0.00 ? 13 ARG A HG2  3  
ATOM 2601  H HG3  . ARG A 1 13 ? 7.449   7.271   2.315   1.00 0.00 ? 13 ARG A HG3  3  
ATOM 2602  H HD2  . ARG A 1 13 ? 10.051  8.614   2.915   1.00 0.00 ? 13 ARG A HD2  3  
ATOM 2603  H HD3  . ARG A 1 13 ? 8.568   9.563   2.845   1.00 0.00 ? 13 ARG A HD3  3  
ATOM 2604  H HE   . ARG A 1 13 ? 7.907   7.533   4.496   1.00 0.00 ? 13 ARG A HE   3  
ATOM 2605  H HH11 . ARG A 1 13 ? 10.580  9.776   4.448   1.00 0.00 ? 13 ARG A HH11 3  
ATOM 2606  H HH12 . ARG A 1 13 ? 10.781  9.767   6.167   1.00 0.00 ? 13 ARG A HH12 3  
ATOM 2607  H HH21 . ARG A 1 13 ? 8.169   7.519   6.757   1.00 0.00 ? 13 ARG A HH21 3  
ATOM 2608  H HH22 . ARG A 1 13 ? 9.412   8.485   7.479   1.00 0.00 ? 13 ARG A HH22 3  
ATOM 2609  N N    . VAL A 1 14 ? 7.520   4.123   -0.219  1.00 0.00 ? 14 VAL A N    3  
ATOM 2610  C CA   . VAL A 1 14 ? 7.464   3.527   -1.548  1.00 0.00 ? 14 VAL A CA   3  
ATOM 2611  C C    . VAL A 1 14 ? 6.667   4.402   -2.510  1.00 0.00 ? 14 VAL A C    3  
ATOM 2612  O O    . VAL A 1 14 ? 6.007   5.355   -2.097  1.00 0.00 ? 14 VAL A O    3  
ATOM 2613  C CB   . VAL A 1 14 ? 6.834   2.122   -1.510  1.00 0.00 ? 14 VAL A CB   3  
ATOM 2614  C CG1  . VAL A 1 14 ? 7.752   1.143   -0.795  1.00 0.00 ? 14 VAL A CG1  3  
ATOM 2615  C CG2  . VAL A 1 14 ? 5.468   2.169   -0.840  1.00 0.00 ? 14 VAL A CG2  3  
ATOM 2616  H H    . VAL A 1 14 ? 6.686   4.264   0.276   1.00 0.00 ? 14 VAL A H    3  
ATOM 2617  H HA   . VAL A 1 14 ? 8.476   3.434   -1.916  1.00 0.00 ? 14 VAL A HA   3  
ATOM 2618  H HB   . VAL A 1 14 ? 6.701   1.781   -2.526  1.00 0.00 ? 14 VAL A HB   3  
ATOM 2619  H HG11 . VAL A 1 14 ? 7.400   0.136   -0.956  1.00 0.00 ? 14 VAL A HG11 3  
ATOM 2620  H HG12 . VAL A 1 14 ? 7.756   1.359   0.263   1.00 0.00 ? 14 VAL A HG12 3  
ATOM 2621  H HG13 . VAL A 1 14 ? 8.755   1.240   -1.186  1.00 0.00 ? 14 VAL A HG13 3  
ATOM 2622  H HG21 . VAL A 1 14 ? 4.790   1.508   -1.360  1.00 0.00 ? 14 VAL A HG21 3  
ATOM 2623  H HG22 . VAL A 1 14 ? 5.085   3.179   -0.874  1.00 0.00 ? 14 VAL A HG22 3  
ATOM 2624  H HG23 . VAL A 1 14 ? 5.561   1.853   0.189   1.00 0.00 ? 14 VAL A HG23 3  
ATOM 2625  N N    . LEU A 1 15 ? 6.732   4.070   -3.796  1.00 0.00 ? 15 LEU A N    3  
ATOM 2626  C CA   . LEU A 1 15 ? 6.016   4.825   -4.817  1.00 0.00 ? 15 LEU A CA   3  
ATOM 2627  C C    . LEU A 1 15 ? 4.946   3.962   -5.481  1.00 0.00 ? 15 LEU A C    3  
ATOM 2628  O O    . LEU A 1 15 ? 5.256   2.972   -6.143  1.00 0.00 ? 15 LEU A O    3  
ATOM 2629  C CB   . LEU A 1 15 ? 6.991   5.348   -5.873  1.00 0.00 ? 15 LEU A CB   3  
ATOM 2630  C CG   . LEU A 1 15 ? 6.457   6.486   -6.743  1.00 0.00 ? 15 LEU A CG   3  
ATOM 2631  C CD1  . LEU A 1 15 ? 5.951   7.628   -5.875  1.00 0.00 ? 15 LEU A CD1  3  
ATOM 2632  C CD2  . LEU A 1 15 ? 7.534   6.979   -7.697  1.00 0.00 ? 15 LEU A CD2  3  
ATOM 2633  H H    . LEU A 1 15 ? 7.274   3.299   -4.064  1.00 0.00 ? 15 LEU A H    3  
ATOM 2634  H HA   . LEU A 1 15 ? 5.536   5.664   -4.336  1.00 0.00 ? 15 LEU A HA   3  
ATOM 2635  H HB2  . LEU A 1 15 ? 7.882   5.695   -5.368  1.00 0.00 ? 15 LEU A HB2  3  
ATOM 2636  H HB3  . LEU A 1 15 ? 7.262   4.528   -6.521  1.00 0.00 ? 15 LEU A HB3  3  
ATOM 2637  H HG   . LEU A 1 15 ? 5.627   6.123   -7.331  1.00 0.00 ? 15 LEU A HG   3  
ATOM 2638  H HD11 . LEU A 1 15 ? 5.921   8.538   -6.456  1.00 0.00 ? 15 LEU A HD11 3  
ATOM 2639  H HD12 . LEU A 1 15 ? 6.613   7.760   -5.032  1.00 0.00 ? 15 LEU A HD12 3  
ATOM 2640  H HD13 . LEU A 1 15 ? 4.957   7.397   -5.519  1.00 0.00 ? 15 LEU A HD13 3  
ATOM 2641  H HD21 . LEU A 1 15 ? 7.208   7.893   -8.169  1.00 0.00 ? 15 LEU A HD21 3  
ATOM 2642  H HD22 . LEU A 1 15 ? 7.714   6.228   -8.453  1.00 0.00 ? 15 LEU A HD22 3  
ATOM 2643  H HD23 . LEU A 1 15 ? 8.446   7.162   -7.148  1.00 0.00 ? 15 LEU A HD23 3  
ATOM 2644  N N    . VAL A 1 16 ? 3.687   4.344   -5.296  1.00 0.00 ? 16 VAL A N    3  
ATOM 2645  C CA   . VAL A 1 16 ? 2.571   3.606   -5.876  1.00 0.00 ? 16 VAL A CA   3  
ATOM 2646  C C    . VAL A 1 16 ? 2.127   4.225   -7.196  1.00 0.00 ? 16 VAL A C    3  
ATOM 2647  O O    . VAL A 1 16 ? 1.510   5.290   -7.218  1.00 0.00 ? 16 VAL A O    3  
ATOM 2648  C CB   . VAL A 1 16 ? 1.369   3.560   -4.915  1.00 0.00 ? 16 VAL A CB   3  
ATOM 2649  C CG1  . VAL A 1 16 ? 0.294   2.624   -5.446  1.00 0.00 ? 16 VAL A CG1  3  
ATOM 2650  C CG2  . VAL A 1 16 ? 1.814   3.137   -3.522  1.00 0.00 ? 16 VAL A CG2  3  
ATOM 2651  H H    . VAL A 1 16 ? 3.503   5.142   -4.758  1.00 0.00 ? 16 VAL A H    3  
ATOM 2652  H HA   . VAL A 1 16 ? 2.900   2.593   -6.055  1.00 0.00 ? 16 VAL A HA   3  
ATOM 2653  H HB   . VAL A 1 16 ? 0.949   4.553   -4.848  1.00 0.00 ? 16 VAL A HB   3  
ATOM 2654  H HG11 . VAL A 1 16 ? 0.759   1.749   -5.876  1.00 0.00 ? 16 VAL A HG11 3  
ATOM 2655  H HG12 . VAL A 1 16 ? -0.284  3.133   -6.202  1.00 0.00 ? 16 VAL A HG12 3  
ATOM 2656  H HG13 . VAL A 1 16 ? -0.355  2.325   -4.636  1.00 0.00 ? 16 VAL A HG13 3  
ATOM 2657  H HG21 . VAL A 1 16 ? 1.029   3.354   -2.812  1.00 0.00 ? 16 VAL A HG21 3  
ATOM 2658  H HG22 . VAL A 1 16 ? 2.706   3.680   -3.250  1.00 0.00 ? 16 VAL A HG22 3  
ATOM 2659  H HG23 . VAL A 1 16 ? 2.021   2.078   -3.517  1.00 0.00 ? 16 VAL A HG23 3  
ATOM 2660  N N    . GLY A 1 17 ? 2.447   3.551   -8.296  1.00 0.00 ? 17 GLY A N    3  
ATOM 2661  C CA   . GLY A 1 17 ? 2.072   4.050   -9.607  1.00 0.00 ? 17 GLY A CA   3  
ATOM 2662  C C    . GLY A 1 17 ? 3.192   4.824   -10.275 1.00 0.00 ? 17 GLY A C    3  
ATOM 2663  O O    . GLY A 1 17 ? 3.270   4.879   -11.502 1.00 0.00 ? 17 GLY A O    3  
ATOM 2664  H H    . GLY A 1 17 ? 2.938   2.707   -8.218  1.00 0.00 ? 17 GLY A H    3  
ATOM 2665  H HA2  . GLY A 1 17 ? 1.803   3.213   -10.234 1.00 0.00 ? 17 GLY A HA2  3  
ATOM 2666  H HA3  . GLY A 1 17 ? 1.214   4.698   -9.502  1.00 0.00 ? 17 GLY A HA3  3  
ATOM 2667  N N    . GLY A 1 18 ? 4.059   5.424   -9.466  1.00 0.00 ? 18 GLY A N    3  
ATOM 2668  C CA   . GLY A 1 18 ? 5.167   6.191   -10.003 1.00 0.00 ? 18 GLY A CA   3  
ATOM 2669  C C    . GLY A 1 18 ? 5.021   7.678   -9.748  1.00 0.00 ? 18 GLY A C    3  
ATOM 2670  O O    . GLY A 1 18 ? 5.561   8.498   -10.492 1.00 0.00 ? 18 GLY A O    3  
ATOM 2671  H H    . GLY A 1 18 ? 3.945   5.345   -8.495  1.00 0.00 ? 18 GLY A H    3  
ATOM 2672  H HA2  . GLY A 1 18 ? 6.083   5.847   -9.546  1.00 0.00 ? 18 GLY A HA2  3  
ATOM 2673  H HA3  . GLY A 1 18 ? 5.224   6.024   -11.068 1.00 0.00 ? 18 GLY A HA3  3  
ATOM 2674  N N    . THR A 1 19 ? 4.289   8.029   -8.695  1.00 0.00 ? 19 THR A N    3  
ATOM 2675  C CA   . THR A 1 19 ? 4.073   9.427   -8.344  1.00 0.00 ? 19 THR A CA   3  
ATOM 2676  C C    . THR A 1 19 ? 3.583   9.556   -6.906  1.00 0.00 ? 19 THR A C    3  
ATOM 2677  O O    . THR A 1 19 ? 4.116   10.343  -6.124  1.00 0.00 ? 19 THR A O    3  
ATOM 2678  C CB   . THR A 1 19 ? 3.064   10.066  -9.298  1.00 0.00 ? 19 THR A CB   3  
ATOM 2679  O OG1  . THR A 1 19 ? 3.011   9.358   -10.523 1.00 0.00 ? 19 THR A OG1  3  
ATOM 2680  C CG2  . THR A 1 19 ? 3.374   11.513  -9.618  1.00 0.00 ? 19 THR A CG2  3  
ATOM 2681  H H    . THR A 1 19 ? 3.885   7.330   -8.140  1.00 0.00 ? 19 THR A H    3  
ATOM 2682  H HA   . THR A 1 19 ? 5.019   9.942   -8.436  1.00 0.00 ? 19 THR A HA   3  
ATOM 2683  H HB   . THR A 1 19 ? 2.083   10.031  -8.845  1.00 0.00 ? 19 THR A HB   3  
ATOM 2684  H HG1  . THR A 1 19 ? 2.373   8.644   -10.454 1.00 0.00 ? 19 THR A HG1  3  
ATOM 2685  H HG21 . THR A 1 19 ? 2.579   11.927  -10.219 1.00 0.00 ? 19 THR A HG21 3  
ATOM 2686  H HG22 . THR A 1 19 ? 4.304   11.570  -10.162 1.00 0.00 ? 19 THR A HG22 3  
ATOM 2687  H HG23 . THR A 1 19 ? 3.459   12.074  -8.698  1.00 0.00 ? 19 THR A HG23 3  
ATOM 2688  N N    . LYS A 1 20 ? 2.561   8.778   -6.564  1.00 0.00 ? 20 LYS A N    3  
ATOM 2689  C CA   . LYS A 1 20 ? 1.996   8.803   -5.219  1.00 0.00 ? 20 LYS A CA   3  
ATOM 2690  C C    . LYS A 1 20 ? 2.961   8.183   -4.213  1.00 0.00 ? 20 LYS A C    3  
ATOM 2691  O O    . LYS A 1 20 ? 3.180   6.972   -4.212  1.00 0.00 ? 20 LYS A O    3  
ATOM 2692  C CB   . LYS A 1 20 ? 0.661   8.057   -5.191  1.00 0.00 ? 20 LYS A CB   3  
ATOM 2693  C CG   . LYS A 1 20 ? -0.322  8.529   -6.251  1.00 0.00 ? 20 LYS A CG   3  
ATOM 2694  C CD   . LYS A 1 20 ? -0.725  7.397   -7.184  1.00 0.00 ? 20 LYS A CD   3  
ATOM 2695  C CE   . LYS A 1 20 ? -1.954  7.759   -8.003  1.00 0.00 ? 20 LYS A CE   3  
ATOM 2696  N NZ   . LYS A 1 20 ? -3.182  7.093   -7.487  1.00 0.00 ? 20 LYS A NZ   3  
ATOM 2697  H H    . LYS A 1 20 ? 2.178   8.171   -7.231  1.00 0.00 ? 20 LYS A H    3  
ATOM 2698  H HA   . LYS A 1 20 ? 1.828   9.835   -4.950  1.00 0.00 ? 20 LYS A HA   3  
ATOM 2699  H HB2  . LYS A 1 20 ? 0.847   7.004   -5.342  1.00 0.00 ? 20 LYS A HB2  3  
ATOM 2700  H HB3  . LYS A 1 20 ? 0.205   8.196   -4.221  1.00 0.00 ? 20 LYS A HB3  3  
ATOM 2701  H HG2  . LYS A 1 20 ? -1.206  8.912   -5.764  1.00 0.00 ? 20 LYS A HG2  3  
ATOM 2702  H HG3  . LYS A 1 20 ? 0.140   9.314   -6.832  1.00 0.00 ? 20 LYS A HG3  3  
ATOM 2703  H HD2  . LYS A 1 20 ? 0.093   7.188   -7.857  1.00 0.00 ? 20 LYS A HD2  3  
ATOM 2704  H HD3  . LYS A 1 20 ? -0.942  6.518   -6.594  1.00 0.00 ? 20 LYS A HD3  3  
ATOM 2705  H HE2  . LYS A 1 20 ? -2.094  8.830   -7.965  1.00 0.00 ? 20 LYS A HE2  3  
ATOM 2706  H HE3  . LYS A 1 20 ? -1.792  7.454   -9.026  1.00 0.00 ? 20 LYS A HE3  3  
ATOM 2707  H HZ1  . LYS A 1 20 ? -3.485  7.541   -6.598  1.00 0.00 ? 20 LYS A HZ1  3  
ATOM 2708  H HZ2  . LYS A 1 20 ? -2.994  6.086   -7.308  1.00 0.00 ? 20 LYS A HZ2  3  
ATOM 2709  H HZ3  . LYS A 1 20 ? -3.951  7.172   -8.182  1.00 0.00 ? 20 LYS A HZ3  3  
ATOM 2710  N N    . THR A 1 21 ? 3.532   9.022   -3.355  1.00 0.00 ? 21 THR A N    3  
ATOM 2711  C CA   . THR A 1 21 ? 4.472   8.557   -2.342  1.00 0.00 ? 21 THR A CA   3  
ATOM 2712  C C    . THR A 1 21 ? 3.743   8.177   -1.058  1.00 0.00 ? 21 THR A C    3  
ATOM 2713  O O    . THR A 1 21 ? 3.071   9.006   -0.444  1.00 0.00 ? 21 THR A O    3  
ATOM 2714  C CB   . THR A 1 21 ? 5.515   9.637   -2.050  1.00 0.00 ? 21 THR A CB   3  
ATOM 2715  O OG1  . THR A 1 21 ? 4.921   10.744  -1.395  1.00 0.00 ? 21 THR A OG1  3  
ATOM 2716  C CG2  . THR A 1 21 ? 6.203   10.156  -3.294  1.00 0.00 ? 21 THR A CG2  3  
ATOM 2717  H H    . THR A 1 21 ? 3.317   9.977   -3.405  1.00 0.00 ? 21 THR A H    3  
ATOM 2718  H HA   . THR A 1 21 ? 4.971   7.683   -2.731  1.00 0.00 ? 21 THR A HA   3  
ATOM 2719  H HB   . THR A 1 21 ? 6.273   9.224   -1.400  1.00 0.00 ? 21 THR A HB   3  
ATOM 2720  H HG1  . THR A 1 21 ? 4.120   10.999  -1.859  1.00 0.00 ? 21 THR A HG1  3  
ATOM 2721  H HG21 . THR A 1 21 ? 6.877   10.956  -3.026  1.00 0.00 ? 21 THR A HG21 3  
ATOM 2722  H HG22 . THR A 1 21 ? 5.463   10.528  -3.987  1.00 0.00 ? 21 THR A HG22 3  
ATOM 2723  H HG23 . THR A 1 21 ? 6.761   9.356   -3.758  1.00 0.00 ? 21 THR A HG23 3  
ATOM 2724  N N    . GLY A 1 22 ? 3.881   6.918   -0.655  1.00 0.00 ? 22 GLY A N    3  
ATOM 2725  C CA   . GLY A 1 22 ? 3.230   6.451   0.554   1.00 0.00 ? 22 GLY A CA   3  
ATOM 2726  C C    . GLY A 1 22 ? 4.087   5.473   1.333   1.00 0.00 ? 22 GLY A C    3  
ATOM 2727  O O    . GLY A 1 22 ? 4.957   4.811   0.766   1.00 0.00 ? 22 GLY A O    3  
ATOM 2728  H H    . GLY A 1 22 ? 4.429   6.301   -1.185  1.00 0.00 ? 22 GLY A H    3  
ATOM 2729  H HA2  . GLY A 1 22 ? 3.010   7.301   1.183   1.00 0.00 ? 22 GLY A HA2  3  
ATOM 2730  H HA3  . GLY A 1 22 ? 2.303   5.966   0.286   1.00 0.00 ? 22 GLY A HA3  3  
ATOM 2731  N N    . VAL A 1 23 ? 3.843   5.383   2.637   1.00 0.00 ? 23 VAL A N    3  
ATOM 2732  C CA   . VAL A 1 23 ? 4.599   4.479   3.495   1.00 0.00 ? 23 VAL A CA   3  
ATOM 2733  C C    . VAL A 1 23 ? 3.938   3.107   3.564   1.00 0.00 ? 23 VAL A C    3  
ATOM 2734  O O    . VAL A 1 23 ? 2.712   2.998   3.602   1.00 0.00 ? 23 VAL A O    3  
ATOM 2735  C CB   . VAL A 1 23 ? 4.737   5.043   4.922   1.00 0.00 ? 23 VAL A CB   3  
ATOM 2736  C CG1  . VAL A 1 23 ? 5.659   4.166   5.757   1.00 0.00 ? 23 VAL A CG1  3  
ATOM 2737  C CG2  . VAL A 1 23 ? 5.244   6.477   4.885   1.00 0.00 ? 23 VAL A CG2  3  
ATOM 2738  H H    . VAL A 1 23 ? 3.137   5.937   3.030   1.00 0.00 ? 23 VAL A H    3  
ATOM 2739  H HA   . VAL A 1 23 ? 5.588   4.371   3.075   1.00 0.00 ? 23 VAL A HA   3  
ATOM 2740  H HB   . VAL A 1 23 ? 3.761   5.041   5.384   1.00 0.00 ? 23 VAL A HB   3  
ATOM 2741  H HG11 . VAL A 1 23 ? 5.558   4.429   6.800   1.00 0.00 ? 23 VAL A HG11 3  
ATOM 2742  H HG12 . VAL A 1 23 ? 6.681   4.318   5.445   1.00 0.00 ? 23 VAL A HG12 3  
ATOM 2743  H HG13 . VAL A 1 23 ? 5.390   3.129   5.620   1.00 0.00 ? 23 VAL A HG13 3  
ATOM 2744  H HG21 . VAL A 1 23 ? 6.298   6.492   5.121   1.00 0.00 ? 23 VAL A HG21 3  
ATOM 2745  H HG22 . VAL A 1 23 ? 4.705   7.068   5.611   1.00 0.00 ? 23 VAL A HG22 3  
ATOM 2746  H HG23 . VAL A 1 23 ? 5.090   6.890   3.900   1.00 0.00 ? 23 VAL A HG23 3  
ATOM 2747  N N    . VAL A 1 24 ? 4.757   2.061   3.579   1.00 0.00 ? 24 VAL A N    3  
ATOM 2748  C CA   . VAL A 1 24 ? 4.252   0.695   3.644   1.00 0.00 ? 24 VAL A CA   3  
ATOM 2749  C C    . VAL A 1 24 ? 3.586   0.419   4.988   1.00 0.00 ? 24 VAL A C    3  
ATOM 2750  O O    . VAL A 1 24 ? 4.206   0.564   6.041   1.00 0.00 ? 24 VAL A O    3  
ATOM 2751  C CB   . VAL A 1 24 ? 5.379   -0.333  3.421   1.00 0.00 ? 24 VAL A CB   3  
ATOM 2752  C CG1  . VAL A 1 24 ? 4.811   -1.742  3.344   1.00 0.00 ? 24 VAL A CG1  3  
ATOM 2753  C CG2  . VAL A 1 24 ? 6.166   0.001   2.161   1.00 0.00 ? 24 VAL A CG2  3  
ATOM 2754  H H    . VAL A 1 24 ? 5.725   2.211   3.548   1.00 0.00 ? 24 VAL A H    3  
ATOM 2755  H HA   . VAL A 1 24 ? 3.520   0.573   2.858   1.00 0.00 ? 24 VAL A HA   3  
ATOM 2756  H HB   . VAL A 1 24 ? 6.053   -0.287  4.263   1.00 0.00 ? 24 VAL A HB   3  
ATOM 2757  H HG11 . VAL A 1 24 ? 4.857   -2.202  4.320   1.00 0.00 ? 24 VAL A HG11 3  
ATOM 2758  H HG12 . VAL A 1 24 ? 5.389   -2.325  2.643   1.00 0.00 ? 24 VAL A HG12 3  
ATOM 2759  H HG13 . VAL A 1 24 ? 3.783   -1.699  3.015   1.00 0.00 ? 24 VAL A HG13 3  
ATOM 2760  H HG21 . VAL A 1 24 ? 6.074   1.055   1.948   1.00 0.00 ? 24 VAL A HG21 3  
ATOM 2761  H HG22 . VAL A 1 24 ? 5.775   -0.571  1.332   1.00 0.00 ? 24 VAL A HG22 3  
ATOM 2762  H HG23 . VAL A 1 24 ? 7.206   -0.248  2.312   1.00 0.00 ? 24 VAL A HG23 3  
ATOM 2763  N N    . ARG A 1 25 ? 2.319   0.020   4.943   1.00 0.00 ? 25 ARG A N    3  
ATOM 2764  C CA   . ARG A 1 25 ? 1.567   -0.275  6.157   1.00 0.00 ? 25 ARG A CA   3  
ATOM 2765  C C    . ARG A 1 25 ? 1.358   -1.779  6.315   1.00 0.00 ? 25 ARG A C    3  
ATOM 2766  O O    . ARG A 1 25 ? 1.271   -2.290  7.431   1.00 0.00 ? 25 ARG A O    3  
ATOM 2767  C CB   . ARG A 1 25 ? 0.216   0.440   6.133   1.00 0.00 ? 25 ARG A CB   3  
ATOM 2768  C CG   . ARG A 1 25 ? 0.235   1.799   6.815   1.00 0.00 ? 25 ARG A CG   3  
ATOM 2769  C CD   . ARG A 1 25 ? -0.126  1.689   8.287   1.00 0.00 ? 25 ARG A CD   3  
ATOM 2770  N NE   . ARG A 1 25 ? -0.214  2.998   8.929   1.00 0.00 ? 25 ARG A NE   3  
ATOM 2771  C CZ   . ARG A 1 25 ? -0.829  3.214   10.090  1.00 0.00 ? 25 ARG A CZ   3  
ATOM 2772  N NH1  . ARG A 1 25 ? -1.410  2.212   10.738  1.00 0.00 ? 25 ARG A NH1  3  
ATOM 2773  N NH2  . ARG A 1 25 ? -0.862  4.435   10.604  1.00 0.00 ? 25 ARG A NH2  3  
ATOM 2774  H H    . ARG A 1 25 ? 1.879   -0.076  4.073   1.00 0.00 ? 25 ARG A H    3  
ATOM 2775  H HA   . ARG A 1 25 ? 2.141   0.086   6.999   1.00 0.00 ? 25 ARG A HA   3  
ATOM 2776  H HB2  . ARG A 1 25 ? -0.086  0.582   5.106   1.00 0.00 ? 25 ARG A HB2  3  
ATOM 2777  H HB3  . ARG A 1 25 ? -0.516  -0.177  6.631   1.00 0.00 ? 25 ARG A HB3  3  
ATOM 2778  H HG2  . ARG A 1 25 ? 1.225   2.220   6.727   1.00 0.00 ? 25 ARG A HG2  3  
ATOM 2779  H HG3  . ARG A 1 25 ? -0.479  2.446   6.326   1.00 0.00 ? 25 ARG A HG3  3  
ATOM 2780  H HD2  . ARG A 1 25 ? -1.080  1.191   8.374   1.00 0.00 ? 25 ARG A HD2  3  
ATOM 2781  H HD3  . ARG A 1 25 ? 0.632   1.102   8.787   1.00 0.00 ? 25 ARG A HD3  3  
ATOM 2782  H HE   . ARG A 1 25 ? 0.208   3.756   8.472   1.00 0.00 ? 25 ARG A HE   3  
ATOM 2783  H HH11 . ARG A 1 25 ? -1.389  1.289   10.354  1.00 0.00 ? 25 ARG A HH11 3  
ATOM 2784  H HH12 . ARG A 1 25 ? -1.870  2.381   11.609  1.00 0.00 ? 25 ARG A HH12 3  
ATOM 2785  H HH21 . ARG A 1 25 ? -0.424  5.194   10.121  1.00 0.00 ? 25 ARG A HH21 3  
ATOM 2786  H HH22 . ARG A 1 25 ? -1.324  4.599   11.477  1.00 0.00 ? 25 ARG A HH22 3  
ATOM 2787  N N    . TYR A 1 26 ? 1.279   -2.482  5.190   1.00 0.00 ? 26 TYR A N    3  
ATOM 2788  C CA   . TYR A 1 26 ? 1.079   -3.926  5.203   1.00 0.00 ? 26 TYR A CA   3  
ATOM 2789  C C    . TYR A 1 26 ? 2.005   -4.611  4.203   1.00 0.00 ? 26 TYR A C    3  
ATOM 2790  O O    . TYR A 1 26 ? 2.351   -4.039  3.169   1.00 0.00 ? 26 TYR A O    3  
ATOM 2791  C CB   . TYR A 1 26 ? -0.377  -4.264  4.882   1.00 0.00 ? 26 TYR A CB   3  
ATOM 2792  C CG   . TYR A 1 26 ? -0.679  -5.746  4.927   1.00 0.00 ? 26 TYR A CG   3  
ATOM 2793  C CD1  . TYR A 1 26 ? -0.807  -6.412  6.139   1.00 0.00 ? 26 TYR A CD1  3  
ATOM 2794  C CD2  . TYR A 1 26 ? -0.836  -6.478  3.756   1.00 0.00 ? 26 TYR A CD2  3  
ATOM 2795  C CE1  . TYR A 1 26 ? -1.082  -7.765  6.183   1.00 0.00 ? 26 TYR A CE1  3  
ATOM 2796  C CE2  . TYR A 1 26 ? -1.113  -7.831  3.792   1.00 0.00 ? 26 TYR A CE2  3  
ATOM 2797  C CZ   . TYR A 1 26 ? -1.234  -8.470  5.008   1.00 0.00 ? 26 TYR A CZ   3  
ATOM 2798  O OH   . TYR A 1 26 ? -1.509  -9.818  5.048   1.00 0.00 ? 26 TYR A OH   3  
ATOM 2799  H H    . TYR A 1 26 ? 1.355   -2.019  4.330   1.00 0.00 ? 26 TYR A H    3  
ATOM 2800  H HA   . TYR A 1 26 ? 1.313   -4.284  6.195   1.00 0.00 ? 26 TYR A HA   3  
ATOM 2801  H HB2  . TYR A 1 26 ? -1.020  -3.774  5.598   1.00 0.00 ? 26 TYR A HB2  3  
ATOM 2802  H HB3  . TYR A 1 26 ? -0.613  -3.906  3.890   1.00 0.00 ? 26 TYR A HB3  3  
ATOM 2803  H HD1  . TYR A 1 26 ? -0.687  -5.857  7.057   1.00 0.00 ? 26 TYR A HD1  3  
ATOM 2804  H HD2  . TYR A 1 26 ? -0.740  -5.973  2.805   1.00 0.00 ? 26 TYR A HD2  3  
ATOM 2805  H HE1  . TYR A 1 26 ? -1.178  -8.265  7.136   1.00 0.00 ? 26 TYR A HE1  3  
ATOM 2806  H HE2  . TYR A 1 26 ? -1.231  -8.383  2.871   1.00 0.00 ? 26 TYR A HE2  3  
ATOM 2807  H HH   . TYR A 1 26 ? -2.447  -9.949  5.208   1.00 0.00 ? 26 TYR A HH   3  
ATOM 2808  N N    . VAL A 1 27 ? 2.403   -5.839  4.518   1.00 0.00 ? 27 VAL A N    3  
ATOM 2809  C CA   . VAL A 1 27 ? 3.290   -6.601  3.647   1.00 0.00 ? 27 VAL A CA   3  
ATOM 2810  C C    . VAL A 1 27 ? 3.022   -8.097  3.766   1.00 0.00 ? 27 VAL A C    3  
ATOM 2811  O O    . VAL A 1 27 ? 3.383   -8.725  4.762   1.00 0.00 ? 27 VAL A O    3  
ATOM 2812  C CB   . VAL A 1 27 ? 4.769   -6.327  3.974   1.00 0.00 ? 27 VAL A CB   3  
ATOM 2813  C CG1  . VAL A 1 27 ? 5.676   -6.985  2.946   1.00 0.00 ? 27 VAL A CG1  3  
ATOM 2814  C CG2  . VAL A 1 27 ? 5.032   -4.830  4.048   1.00 0.00 ? 27 VAL A CG2  3  
ATOM 2815  H H    . VAL A 1 27 ? 2.095   -6.241  5.357   1.00 0.00 ? 27 VAL A H    3  
ATOM 2816  H HA   . VAL A 1 27 ? 3.104   -6.292  2.629   1.00 0.00 ? 27 VAL A HA   3  
ATOM 2817  H HB   . VAL A 1 27 ? 4.989   -6.757  4.941   1.00 0.00 ? 27 VAL A HB   3  
ATOM 2818  H HG11 . VAL A 1 27 ? 6.607   -7.268  3.413   1.00 0.00 ? 27 VAL A HG11 3  
ATOM 2819  H HG12 . VAL A 1 27 ? 5.874   -6.290  2.143   1.00 0.00 ? 27 VAL A HG12 3  
ATOM 2820  H HG13 . VAL A 1 27 ? 5.191   -7.865  2.548   1.00 0.00 ? 27 VAL A HG13 3  
ATOM 2821  H HG21 . VAL A 1 27 ? 4.576   -4.343  3.199   1.00 0.00 ? 27 VAL A HG21 3  
ATOM 2822  H HG22 . VAL A 1 27 ? 6.098   -4.651  4.037   1.00 0.00 ? 27 VAL A HG22 3  
ATOM 2823  H HG23 . VAL A 1 27 ? 4.610   -4.435  4.960   1.00 0.00 ? 27 VAL A HG23 3  
ATOM 2824  N N    . GLY A 1 28 ? 2.388   -8.663  2.745   1.00 0.00 ? 28 GLY A N    3  
ATOM 2825  C CA   . GLY A 1 28 ? 2.084   -10.082 2.754   1.00 0.00 ? 28 GLY A CA   3  
ATOM 2826  C C    . GLY A 1 28 ? 1.089   -10.468 1.677   1.00 0.00 ? 28 GLY A C    3  
ATOM 2827  O O    . GLY A 1 28 ? 0.790   -9.675  0.784   1.00 0.00 ? 28 GLY A O    3  
ATOM 2828  H H    . GLY A 1 28 ? 2.125   -8.113  1.978   1.00 0.00 ? 28 GLY A H    3  
ATOM 2829  H HA2  . GLY A 1 28 ? 2.997   -10.636 2.600   1.00 0.00 ? 28 GLY A HA2  3  
ATOM 2830  H HA3  . GLY A 1 28 ? 1.674   -10.344 3.717   1.00 0.00 ? 28 GLY A HA3  3  
ATOM 2831  N N    . GLU A 1 29 ? 0.575   -11.691 1.761   1.00 0.00 ? 29 GLU A N    3  
ATOM 2832  C CA   . GLU A 1 29 ? -0.391  -12.181 0.785   1.00 0.00 ? 29 GLU A CA   3  
ATOM 2833  C C    . GLU A 1 29 ? -1.819  -11.924 1.256   1.00 0.00 ? 29 GLU A C    3  
ATOM 2834  O O    . GLU A 1 29 ? -2.082  -11.844 2.456   1.00 0.00 ? 29 GLU A O    3  
ATOM 2835  C CB   . GLU A 1 29 ? -0.186  -13.677 0.540   1.00 0.00 ? 29 GLU A CB   3  
ATOM 2836  C CG   . GLU A 1 29 ? 0.943   -13.986 -0.430  1.00 0.00 ? 29 GLU A CG   3  
ATOM 2837  C CD   . GLU A 1 29 ? 0.785   -15.338 -1.098  1.00 0.00 ? 29 GLU A CD   3  
ATOM 2838  O OE1  . GLU A 1 29 ? 0.385   -16.299 -0.406  1.00 0.00 ? 29 GLU A OE1  3  
ATOM 2839  O OE2  . GLU A 1 29 ? 1.061   -15.437 -2.312  1.00 0.00 ? 29 GLU A OE2  3  
ATOM 2840  H H    . GLU A 1 29 ? 0.853   -12.277 2.495   1.00 0.00 ? 29 GLU A H    3  
ATOM 2841  H HA   . GLU A 1 29 ? -0.228  -11.649 -0.140  1.00 0.00 ? 29 GLU A HA   3  
ATOM 2842  H HB2  . GLU A 1 29 ? 0.036   -14.158 1.482   1.00 0.00 ? 29 GLU A HB2  3  
ATOM 2843  H HB3  . GLU A 1 29 ? -1.099  -14.095 0.141   1.00 0.00 ? 29 GLU A HB3  3  
ATOM 2844  H HG2  . GLU A 1 29 ? 0.961   -13.224 -1.195  1.00 0.00 ? 29 GLU A HG2  3  
ATOM 2845  H HG3  . GLU A 1 29 ? 1.878   -13.975 0.110   1.00 0.00 ? 29 GLU A HG3  3  
ATOM 2846  N N    . THR A 1 30 ? -2.737  -11.792 0.304   1.00 0.00 ? 30 THR A N    3  
ATOM 2847  C CA   . THR A 1 30 ? -4.138  -11.543 0.621   1.00 0.00 ? 30 THR A CA   3  
ATOM 2848  C C    . THR A 1 30 ? -4.997  -12.757 0.280   1.00 0.00 ? 30 THR A C    3  
ATOM 2849  O O    . THR A 1 30 ? -4.487  -13.788 -0.157  1.00 0.00 ? 30 THR A O    3  
ATOM 2850  C CB   . THR A 1 30 ? -4.644  -10.317 -0.140  1.00 0.00 ? 30 THR A CB   3  
ATOM 2851  O OG1  . THR A 1 30 ? -4.458  -10.480 -1.535  1.00 0.00 ? 30 THR A OG1  3  
ATOM 2852  C CG2  . THR A 1 30 ? -3.955  -9.032  0.267   1.00 0.00 ? 30 THR A CG2  3  
ATOM 2853  H H    . THR A 1 30 ? -2.465  -11.865 -0.636  1.00 0.00 ? 30 THR A H    3  
ATOM 2854  H HA   . THR A 1 30 ? -4.209  -11.352 1.681   1.00 0.00 ? 30 THR A HA   3  
ATOM 2855  H HB   . THR A 1 30 ? -5.701  -10.199 0.050   1.00 0.00 ? 30 THR A HB   3  
ATOM 2856  H HG1  . THR A 1 30 ? -4.983  -9.828  -2.008  1.00 0.00 ? 30 THR A HG1  3  
ATOM 2857  H HG21 . THR A 1 30 ? -4.531  -8.188  -0.079  1.00 0.00 ? 30 THR A HG21 3  
ATOM 2858  H HG22 . THR A 1 30 ? -2.968  -8.998  -0.172  1.00 0.00 ? 30 THR A HG22 3  
ATOM 2859  H HG23 . THR A 1 30 ? -3.871  -8.994  1.343   1.00 0.00 ? 30 THR A HG23 3  
ATOM 2860  N N    . ASP A 1 31 ? -6.304  -12.625 0.484   1.00 0.00 ? 31 ASP A N    3  
ATOM 2861  C CA   . ASP A 1 31 ? -7.234  -13.712 0.199   1.00 0.00 ? 31 ASP A CA   3  
ATOM 2862  C C    . ASP A 1 31 ? -8.082  -13.394 -1.029  1.00 0.00 ? 31 ASP A C    3  
ATOM 2863  O O    . ASP A 1 31 ? -8.361  -14.270 -1.848  1.00 0.00 ? 31 ASP A O    3  
ATOM 2864  C CB   . ASP A 1 31 ? -8.138  -13.967 1.405   1.00 0.00 ? 31 ASP A CB   3  
ATOM 2865  C CG   . ASP A 1 31 ? -7.563  -15.006 2.349   1.00 0.00 ? 31 ASP A CG   3  
ATOM 2866  O OD1  . ASP A 1 31 ? -7.842  -16.207 2.151   1.00 0.00 ? 31 ASP A OD1  3  
ATOM 2867  O OD2  . ASP A 1 31 ? -6.832  -14.618 3.285   1.00 0.00 ? 31 ASP A OD2  3  
ATOM 2868  H H    . ASP A 1 31 ? -6.651  -11.779 0.834   1.00 0.00 ? 31 ASP A H    3  
ATOM 2869  H HA   . ASP A 1 31 ? -6.655  -14.601 0.000   1.00 0.00 ? 31 ASP A HA   3  
ATOM 2870  H HB2  . ASP A 1 31 ? -8.269  -13.046 1.952   1.00 0.00 ? 31 ASP A HB2  3  
ATOM 2871  H HB3  . ASP A 1 31 ? -9.100  -14.316 1.059   1.00 0.00 ? 31 ASP A HB3  3  
ATOM 2872  N N    . PHE A 1 32 ? -8.490  -12.134 -1.149  1.00 0.00 ? 32 PHE A N    3  
ATOM 2873  C CA   . PHE A 1 32 ? -9.307  -11.701 -2.277  1.00 0.00 ? 32 PHE A CA   3  
ATOM 2874  C C    . PHE A 1 32 ? -8.522  -11.785 -3.581  1.00 0.00 ? 32 PHE A C    3  
ATOM 2875  O O    . PHE A 1 32 ? -9.044  -12.231 -4.603  1.00 0.00 ? 32 PHE A O    3  
ATOM 2876  C CB   . PHE A 1 32 ? -9.799  -10.269 -2.056  1.00 0.00 ? 32 PHE A CB   3  
ATOM 2877  C CG   . PHE A 1 32 ? -8.695  -9.295  -1.757  1.00 0.00 ? 32 PHE A CG   3  
ATOM 2878  C CD1  . PHE A 1 32 ? -7.981  -8.702  -2.786  1.00 0.00 ? 32 PHE A CD1  3  
ATOM 2879  C CD2  . PHE A 1 32 ? -8.373  -8.972  -0.449  1.00 0.00 ? 32 PHE A CD2  3  
ATOM 2880  C CE1  . PHE A 1 32 ? -6.965  -7.804  -2.513  1.00 0.00 ? 32 PHE A CE1  3  
ATOM 2881  C CE2  . PHE A 1 32 ? -7.357  -8.077  -0.171  1.00 0.00 ? 32 PHE A CE2  3  
ATOM 2882  C CZ   . PHE A 1 32 ? -6.653  -7.492  -1.205  1.00 0.00 ? 32 PHE A CZ   3  
ATOM 2883  H H    . PHE A 1 32 ? -8.236  -11.482 -0.463  1.00 0.00 ? 32 PHE A H    3  
ATOM 2884  H HA   . PHE A 1 32 ? -10.161 -12.359 -2.340  1.00 0.00 ? 32 PHE A HA   3  
ATOM 2885  H HB2  . PHE A 1 32 ? -10.310 -9.930  -2.945  1.00 0.00 ? 32 PHE A HB2  3  
ATOM 2886  H HB3  . PHE A 1 32 ? -10.488 -10.257 -1.223  1.00 0.00 ? 32 PHE A HB3  3  
ATOM 2887  H HD1  . PHE A 1 32 ? -8.224  -8.945  -3.808  1.00 0.00 ? 32 PHE A HD1  3  
ATOM 2888  H HD2  . PHE A 1 32 ? -8.923  -9.430  0.361   1.00 0.00 ? 32 PHE A HD2  3  
ATOM 2889  H HE1  . PHE A 1 32 ? -6.415  -7.349  -3.324  1.00 0.00 ? 32 PHE A HE1  3  
ATOM 2890  H HE2  . PHE A 1 32 ? -7.116  -7.834  0.853   1.00 0.00 ? 32 PHE A HE2  3  
ATOM 2891  H HZ   . PHE A 1 32 ? -5.859  -6.792  -0.991  1.00 0.00 ? 32 PHE A HZ   3  
ATOM 2892  N N    . ALA A 1 33 ? -7.266  -11.354 -3.540  1.00 0.00 ? 33 ALA A N    3  
ATOM 2893  C CA   . ALA A 1 33 ? -6.409  -11.381 -4.719  1.00 0.00 ? 33 ALA A CA   3  
ATOM 2894  C C    . ALA A 1 33 ? -5.328  -12.450 -4.587  1.00 0.00 ? 33 ALA A C    3  
ATOM 2895  O O    . ALA A 1 33 ? -4.837  -12.719 -3.491  1.00 0.00 ? 33 ALA A O    3  
ATOM 2896  C CB   . ALA A 1 33 ? -5.778  -10.015 -4.943  1.00 0.00 ? 33 ALA A CB   3  
ATOM 2897  H H    . ALA A 1 33 ? -6.906  -11.010 -2.695  1.00 0.00 ? 33 ALA A H    3  
ATOM 2898  H HA   . ALA A 1 33 ? -7.026  -11.612 -5.574  1.00 0.00 ? 33 ALA A HA   3  
ATOM 2899  H HB1  . ALA A 1 33 ? -4.967  -10.106 -5.651  1.00 0.00 ? 33 ALA A HB1  3  
ATOM 2900  H HB2  . ALA A 1 33 ? -5.398  -9.636  -4.006  1.00 0.00 ? 33 ALA A HB2  3  
ATOM 2901  H HB3  . ALA A 1 33 ? -6.520  -9.335  -5.332  1.00 0.00 ? 33 ALA A HB3  3  
ATOM 2902  N N    . LYS A 1 34 ? -4.965  -13.057 -5.713  1.00 0.00 ? 34 LYS A N    3  
ATOM 2903  C CA   . LYS A 1 34 ? -3.942  -14.097 -5.723  1.00 0.00 ? 34 LYS A CA   3  
ATOM 2904  C C    . LYS A 1 34 ? -2.552  -13.492 -5.887  1.00 0.00 ? 34 LYS A C    3  
ATOM 2905  O O    . LYS A 1 34 ? -2.242  -12.892 -6.916  1.00 0.00 ? 34 LYS A O    3  
ATOM 2906  C CB   . LYS A 1 34 ? -4.212  -15.095 -6.850  1.00 0.00 ? 34 LYS A CB   3  
ATOM 2907  C CG   . LYS A 1 34 ? -5.180  -16.203 -6.464  1.00 0.00 ? 34 LYS A CG   3  
ATOM 2908  C CD   . LYS A 1 34 ? -5.689  -16.948 -7.686  1.00 0.00 ? 34 LYS A CD   3  
ATOM 2909  C CE   . LYS A 1 34 ? -6.686  -18.031 -7.303  1.00 0.00 ? 34 LYS A CE   3  
ATOM 2910  N NZ   . LYS A 1 34 ? -8.093  -17.579 -7.479  1.00 0.00 ? 34 LYS A NZ   3  
ATOM 2911  H H    . LYS A 1 34 ? -5.394  -12.800 -6.555  1.00 0.00 ? 34 LYS A H    3  
ATOM 2912  H HA   . LYS A 1 34 ? -3.987  -14.616 -4.777  1.00 0.00 ? 34 LYS A HA   3  
ATOM 2913  H HB2  . LYS A 1 34 ? -4.627  -14.564 -7.695  1.00 0.00 ? 34 LYS A HB2  3  
ATOM 2914  H HB3  . LYS A 1 34 ? -3.278  -15.549 -7.145  1.00 0.00 ? 34 LYS A HB3  3  
ATOM 2915  H HG2  . LYS A 1 34 ? -4.672  -16.901 -5.815  1.00 0.00 ? 34 LYS A HG2  3  
ATOM 2916  H HG3  . LYS A 1 34 ? -6.019  -15.768 -5.942  1.00 0.00 ? 34 LYS A HG3  3  
ATOM 2917  H HD2  . LYS A 1 34 ? -6.174  -16.246 -8.349  1.00 0.00 ? 34 LYS A HD2  3  
ATOM 2918  H HD3  . LYS A 1 34 ? -4.852  -17.405 -8.193  1.00 0.00 ? 34 LYS A HD3  3  
ATOM 2919  H HE2  . LYS A 1 34 ? -6.515  -18.897 -7.926  1.00 0.00 ? 34 LYS A HE2  3  
ATOM 2920  H HE3  . LYS A 1 34 ? -6.529  -18.297 -6.268  1.00 0.00 ? 34 LYS A HE3  3  
ATOM 2921  H HZ1  . LYS A 1 34 ? -8.413  -17.776 -8.450  1.00 0.00 ? 34 LYS A HZ1  3  
ATOM 2922  H HZ2  . LYS A 1 34 ? -8.165  -16.556 -7.304  1.00 0.00 ? 34 LYS A HZ2  3  
ATOM 2923  H HZ3  . LYS A 1 34 ? -8.715  -18.078 -6.812  1.00 0.00 ? 34 LYS A HZ3  3  
ATOM 2924  N N    . GLY A 1 35 ? -1.718  -13.654 -4.865  1.00 0.00 ? 35 GLY A N    3  
ATOM 2925  C CA   . GLY A 1 35 ? -0.370  -13.118 -4.916  1.00 0.00 ? 35 GLY A CA   3  
ATOM 2926  C C    . GLY A 1 35 ? -0.020  -12.310 -3.680  1.00 0.00 ? 35 GLY A C    3  
ATOM 2927  O O    . GLY A 1 35 ? -0.771  -12.300 -2.705  1.00 0.00 ? 35 GLY A O    3  
ATOM 2928  H H    . GLY A 1 35 ? -2.020  -14.141 -4.070  1.00 0.00 ? 35 GLY A H    3  
ATOM 2929  H HA2  . GLY A 1 35 ? 0.328   -13.937 -5.006  1.00 0.00 ? 35 GLY A HA2  3  
ATOM 2930  H HA3  . GLY A 1 35 ? -0.279  -12.483 -5.784  1.00 0.00 ? 35 GLY A HA3  3  
ATOM 2931  N N    . GLU A 1 36 ? 1.123   -11.634 -3.723  1.00 0.00 ? 36 GLU A N    3  
ATOM 2932  C CA   . GLU A 1 36 ? 1.571   -10.820 -2.598  1.00 0.00 ? 36 GLU A CA   3  
ATOM 2933  C C    . GLU A 1 36 ? 1.245   -9.348  -2.828  1.00 0.00 ? 36 GLU A C    3  
ATOM 2934  O O    . GLU A 1 36 ? 1.628   -8.769  -3.843  1.00 0.00 ? 36 GLU A O    3  
ATOM 2935  C CB   . GLU A 1 36 ? 3.076   -10.995 -2.383  1.00 0.00 ? 36 GLU A CB   3  
ATOM 2936  C CG   . GLU A 1 36 ? 3.478   -11.057 -0.919  1.00 0.00 ? 36 GLU A CG   3  
ATOM 2937  C CD   . GLU A 1 36 ? 4.931   -11.442 -0.729  1.00 0.00 ? 36 GLU A CD   3  
ATOM 2938  O OE1  . GLU A 1 36 ? 5.812   -10.643 -1.113  1.00 0.00 ? 36 GLU A OE1  3  
ATOM 2939  O OE2  . GLU A 1 36 ? 5.190   -12.542 -0.197  1.00 0.00 ? 36 GLU A OE2  3  
ATOM 2940  H H    . GLU A 1 36 ? 1.678   -11.683 -4.528  1.00 0.00 ? 36 GLU A H    3  
ATOM 2941  H HA   . GLU A 1 36 ? 1.049   -11.159 -1.715  1.00 0.00 ? 36 GLU A HA   3  
ATOM 2942  H HB2  . GLU A 1 36 ? 3.392   -11.911 -2.860  1.00 0.00 ? 36 GLU A HB2  3  
ATOM 2943  H HB3  . GLU A 1 36 ? 3.592   -10.164 -2.841  1.00 0.00 ? 36 GLU A HB3  3  
ATOM 2944  H HG2  . GLU A 1 36 ? 3.318   -10.086 -0.473  1.00 0.00 ? 36 GLU A HG2  3  
ATOM 2945  H HG3  . GLU A 1 36 ? 2.858   -11.787 -0.419  1.00 0.00 ? 36 GLU A HG3  3  
ATOM 2946  N N    . TRP A 1 37 ? 0.532   -8.750  -1.878  1.00 0.00 ? 37 TRP A N    3  
ATOM 2947  C CA   . TRP A 1 37 ? 0.154   -7.345  -1.977  1.00 0.00 ? 37 TRP A CA   3  
ATOM 2948  C C    . TRP A 1 37 ? 0.739   -6.541  -0.821  1.00 0.00 ? 37 TRP A C    3  
ATOM 2949  O O    . TRP A 1 37 ? 1.036   -7.087  0.241   1.00 0.00 ? 37 TRP A O    3  
ATOM 2950  C CB   . TRP A 1 37 ? -1.369  -7.206  -1.989  1.00 0.00 ? 37 TRP A CB   3  
ATOM 2951  C CG   . TRP A 1 37 ? -2.011  -7.802  -3.205  1.00 0.00 ? 37 TRP A CG   3  
ATOM 2952  C CD1  . TRP A 1 37 ? -2.144  -9.130  -3.494  1.00 0.00 ? 37 TRP A CD1  3  
ATOM 2953  C CD2  . TRP A 1 37 ? -2.606  -7.092  -4.296  1.00 0.00 ? 37 TRP A CD2  3  
ATOM 2954  N NE1  . TRP A 1 37 ? -2.785  -9.289  -4.699  1.00 0.00 ? 37 TRP A NE1  3  
ATOM 2955  C CE2  . TRP A 1 37 ? -3.079  -8.052  -5.211  1.00 0.00 ? 37 TRP A CE2  3  
ATOM 2956  C CE3  . TRP A 1 37 ? -2.785  -5.736  -4.589  1.00 0.00 ? 37 TRP A CE3  3  
ATOM 2957  C CZ2  . TRP A 1 37 ? -3.720  -7.699  -6.396  1.00 0.00 ? 37 TRP A CZ2  3  
ATOM 2958  C CZ3  . TRP A 1 37 ? -3.421  -5.388  -5.767  1.00 0.00 ? 37 TRP A CZ3  3  
ATOM 2959  C CH2  . TRP A 1 37 ? -3.882  -6.366  -6.657  1.00 0.00 ? 37 TRP A CH2  3  
ATOM 2960  H H    . TRP A 1 37 ? 0.255   -9.266  -1.092  1.00 0.00 ? 37 TRP A H    3  
ATOM 2961  H HA   . TRP A 1 37 ? 0.549   -6.960  -2.905  1.00 0.00 ? 37 TRP A HA   3  
ATOM 2962  H HB2  . TRP A 1 37 ? -1.776  -7.702  -1.121  1.00 0.00 ? 37 TRP A HB2  3  
ATOM 2963  H HB3  . TRP A 1 37 ? -1.629  -6.158  -1.954  1.00 0.00 ? 37 TRP A HB3  3  
ATOM 2964  H HD1  . TRP A 1 37 ? -1.790  -9.929  -2.859  1.00 0.00 ? 37 TRP A HD1  3  
ATOM 2965  H HE1  . TRP A 1 37 ? -2.998  -10.146 -5.122  1.00 0.00 ? 37 TRP A HE1  3  
ATOM 2966  H HE3  . TRP A 1 37 ? -2.437  -4.969  -3.915  1.00 0.00 ? 37 TRP A HE3  3  
ATOM 2967  H HZ2  . TRP A 1 37 ? -4.081  -8.440  -7.093  1.00 0.00 ? 37 TRP A HZ2  3  
ATOM 2968  H HZ3  . TRP A 1 37 ? -3.568  -4.346  -6.010  1.00 0.00 ? 37 TRP A HZ3  3  
ATOM 2969  H HH2  . TRP A 1 37 ? -4.372  -6.048  -7.565  1.00 0.00 ? 37 TRP A HH2  3  
ATOM 2970  N N    . CYS A 1 38 ? 0.903   -5.239  -1.037  1.00 0.00 ? 38 CYS A N    3  
ATOM 2971  C CA   . CYS A 1 38 ? 1.454   -4.359  -0.012  1.00 0.00 ? 38 CYS A CA   3  
ATOM 2972  C C    . CYS A 1 38 ? 0.616   -3.092  0.123   1.00 0.00 ? 38 CYS A C    3  
ATOM 2973  O O    . CYS A 1 38 ? 0.432   -2.351  -0.844  1.00 0.00 ? 38 CYS A O    3  
ATOM 2974  C CB   . CYS A 1 38 ? 2.901   -3.994  -0.347  1.00 0.00 ? 38 CYS A CB   3  
ATOM 2975  S SG   . CYS A 1 38 ? 4.128   -5.124  0.351   1.00 0.00 ? 38 CYS A SG   3  
ATOM 2976  H H    . CYS A 1 38 ? 0.648   -4.862  -1.905  1.00 0.00 ? 38 CYS A H    3  
ATOM 2977  H HA   . CYS A 1 38 ? 1.435   -4.890  0.927   1.00 0.00 ? 38 CYS A HA   3  
ATOM 2978  H HB2  . CYS A 1 38 ? 3.027   -3.997  -1.420  1.00 0.00 ? 38 CYS A HB2  3  
ATOM 2979  H HB3  . CYS A 1 38 ? 3.112   -3.004  0.031   1.00 0.00 ? 38 CYS A HB3  3  
ATOM 2980  H HG   . CYS A 1 38 ? 3.659   -5.867  0.738   1.00 0.00 ? 38 CYS A HG   3  
ATOM 2981  N N    . GLY A 1 39 ? 0.111   -2.849  1.327   1.00 0.00 ? 39 GLY A N    3  
ATOM 2982  C CA   . GLY A 1 39 ? -0.702  -1.670  1.565   1.00 0.00 ? 39 GLY A CA   3  
ATOM 2983  C C    . GLY A 1 39 ? 0.131   -0.415  1.736   1.00 0.00 ? 39 GLY A C    3  
ATOM 2984  O O    . GLY A 1 39 ? 0.968   -0.335  2.635   1.00 0.00 ? 39 GLY A O    3  
ATOM 2985  H H    . GLY A 1 39 ? 0.290   -3.474  2.059   1.00 0.00 ? 39 GLY A H    3  
ATOM 2986  H HA2  . GLY A 1 39 ? -1.372  -1.533  0.730   1.00 0.00 ? 39 GLY A HA2  3  
ATOM 2987  H HA3  . GLY A 1 39 ? -1.286  -1.825  2.461   1.00 0.00 ? 39 GLY A HA3  3  
ATOM 2988  N N    . VAL A 1 40 ? -0.100  0.567   0.871   1.00 0.00 ? 40 VAL A N    3  
ATOM 2989  C CA   . VAL A 1 40 ? 0.637   1.824   0.929   1.00 0.00 ? 40 VAL A CA   3  
ATOM 2990  C C    . VAL A 1 40 ? -0.271  2.972   1.359   1.00 0.00 ? 40 VAL A C    3  
ATOM 2991  O O    . VAL A 1 40 ? -1.327  3.197   0.768   1.00 0.00 ? 40 VAL A O    3  
ATOM 2992  C CB   . VAL A 1 40 ? 1.269   2.169   -0.433  1.00 0.00 ? 40 VAL A CB   3  
ATOM 2993  C CG1  . VAL A 1 40 ? 2.191   3.372   -0.305  1.00 0.00 ? 40 VAL A CG1  3  
ATOM 2994  C CG2  . VAL A 1 40 ? 2.019   0.969   -0.992  1.00 0.00 ? 40 VAL A CG2  3  
ATOM 2995  H H    . VAL A 1 40 ? -0.780  0.443   0.177   1.00 0.00 ? 40 VAL A H    3  
ATOM 2996  H HA   . VAL A 1 40 ? 1.430   1.715   1.653   1.00 0.00 ? 40 VAL A HA   3  
ATOM 2997  H HB   . VAL A 1 40 ? 0.476   2.424   -1.121  1.00 0.00 ? 40 VAL A HB   3  
ATOM 2998  H HG11 . VAL A 1 40 ? 1.911   3.950   0.563   1.00 0.00 ? 40 VAL A HG11 3  
ATOM 2999  H HG12 . VAL A 1 40 ? 2.108   3.985   -1.190  1.00 0.00 ? 40 VAL A HG12 3  
ATOM 3000  H HG13 . VAL A 1 40 ? 3.211   3.033   -0.197  1.00 0.00 ? 40 VAL A HG13 3  
ATOM 3001  H HG21 . VAL A 1 40 ? 1.315   0.281   -1.435  1.00 0.00 ? 40 VAL A HG21 3  
ATOM 3002  H HG22 . VAL A 1 40 ? 2.552   0.476   -0.194  1.00 0.00 ? 40 VAL A HG22 3  
ATOM 3003  H HG23 . VAL A 1 40 ? 2.720   1.302   -1.743  1.00 0.00 ? 40 VAL A HG23 3  
ATOM 3004  N N    . GLU A 1 41 ? 0.148   3.695   2.393   1.00 0.00 ? 41 GLU A N    3  
ATOM 3005  C CA   . GLU A 1 41 ? -0.627  4.820   2.903   1.00 0.00 ? 41 GLU A CA   3  
ATOM 3006  C C    . GLU A 1 41 ? -0.115  6.138   2.332   1.00 0.00 ? 41 GLU A C    3  
ATOM 3007  O O    . GLU A 1 41 ? 0.965   6.605   2.694   1.00 0.00 ? 41 GLU A O    3  
ATOM 3008  C CB   . GLU A 1 41 ? -0.568  4.856   4.431   1.00 0.00 ? 41 GLU A CB   3  
ATOM 3009  C CG   . GLU A 1 41 ? -1.411  5.961   5.046   1.00 0.00 ? 41 GLU A CG   3  
ATOM 3010  C CD   . GLU A 1 41 ? -0.585  7.166   5.454   1.00 0.00 ? 41 GLU A CD   3  
ATOM 3011  O OE1  . GLU A 1 41 ? 0.380   6.990   6.228   1.00 0.00 ? 41 GLU A OE1  3  
ATOM 3012  O OE2  . GLU A 1 41 ? -0.902  8.285   4.999   1.00 0.00 ? 41 GLU A OE2  3  
ATOM 3013  H H    . GLU A 1 41 ? 0.998   3.467   2.822   1.00 0.00 ? 41 GLU A H    3  
ATOM 3014  H HA   . GLU A 1 41 ? -1.653  4.683   2.595   1.00 0.00 ? 41 GLU A HA   3  
ATOM 3015  H HB2  . GLU A 1 41 ? -0.918  3.909   4.816   1.00 0.00 ? 41 GLU A HB2  3  
ATOM 3016  H HB3  . GLU A 1 41 ? 0.458   5.001   4.737   1.00 0.00 ? 41 GLU A HB3  3  
ATOM 3017  H HG2  . GLU A 1 41 ? -2.148  6.278   4.324   1.00 0.00 ? 41 GLU A HG2  3  
ATOM 3018  H HG3  . GLU A 1 41 ? -1.909  5.571   5.921   1.00 0.00 ? 41 GLU A HG3  3  
ATOM 3019  N N    . LEU A 1 42 ? -0.896  6.732   1.436   1.00 0.00 ? 42 LEU A N    3  
ATOM 3020  C CA   . LEU A 1 42 ? -0.521  7.997   0.814   1.00 0.00 ? 42 LEU A CA   3  
ATOM 3021  C C    . LEU A 1 42 ? -0.673  9.153   1.797   1.00 0.00 ? 42 LEU A C    3  
ATOM 3022  O O    . LEU A 1 42 ? -1.571  9.151   2.640   1.00 0.00 ? 42 LEU A O    3  
ATOM 3023  C CB   . LEU A 1 42 ? -1.378  8.253   -0.428  1.00 0.00 ? 42 LEU A CB   3  
ATOM 3024  C CG   . LEU A 1 42 ? -1.181  7.252   -1.567  1.00 0.00 ? 42 LEU A CG   3  
ATOM 3025  C CD1  . LEU A 1 42 ? -2.023  7.642   -2.772  1.00 0.00 ? 42 LEU A CD1  3  
ATOM 3026  C CD2  . LEU A 1 42 ? 0.289   7.161   -1.949  1.00 0.00 ? 42 LEU A CD2  3  
ATOM 3027  H H    . LEU A 1 42 ? -1.745  6.311   1.188   1.00 0.00 ? 42 LEU A H    3  
ATOM 3028  H HA   . LEU A 1 42 ? 0.515   7.927   0.518   1.00 0.00 ? 42 LEU A HA   3  
ATOM 3029  H HB2  . LEU A 1 42 ? -2.417  8.231   -0.133  1.00 0.00 ? 42 LEU A HB2  3  
ATOM 3030  H HB3  . LEU A 1 42 ? -1.147  9.239   -0.802  1.00 0.00 ? 42 LEU A HB3  3  
ATOM 3031  H HG   . LEU A 1 42 ? -1.502  6.274   -1.238  1.00 0.00 ? 42 LEU A HG   3  
ATOM 3032  H HD11 . LEU A 1 42 ? -1.711  8.612   -3.130  1.00 0.00 ? 42 LEU A HD11 3  
ATOM 3033  H HD12 . LEU A 1 42 ? -3.063  7.680   -2.487  1.00 0.00 ? 42 LEU A HD12 3  
ATOM 3034  H HD13 . LEU A 1 42 ? -1.891  6.910   -3.555  1.00 0.00 ? 42 LEU A HD13 3  
ATOM 3035  H HD21 . LEU A 1 42 ? 0.706   8.156   -2.013  1.00 0.00 ? 42 LEU A HD21 3  
ATOM 3036  H HD22 . LEU A 1 42 ? 0.384   6.668   -2.905  1.00 0.00 ? 42 LEU A HD22 3  
ATOM 3037  H HD23 . LEU A 1 42 ? 0.822   6.596   -1.198  1.00 0.00 ? 42 LEU A HD23 3  
ATOM 3038  N N    . ASP A 1 43 ? 0.210   10.140  1.684   1.00 0.00 ? 43 ASP A N    3  
ATOM 3039  C CA   . ASP A 1 43 ? 0.174   11.303  2.564   1.00 0.00 ? 43 ASP A CA   3  
ATOM 3040  C C    . ASP A 1 43 ? -1.081  12.133  2.316   1.00 0.00 ? 43 ASP A C    3  
ATOM 3041  O O    . ASP A 1 43 ? -1.659  12.695  3.247   1.00 0.00 ? 43 ASP A O    3  
ATOM 3042  C CB   . ASP A 1 43 ? 1.420   12.165  2.355   1.00 0.00 ? 43 ASP A CB   3  
ATOM 3043  C CG   . ASP A 1 43 ? 2.686   11.475  2.823   1.00 0.00 ? 43 ASP A CG   3  
ATOM 3044  O OD1  . ASP A 1 43 ? 2.701   10.973  3.965   1.00 0.00 ? 43 ASP A OD1  3  
ATOM 3045  O OD2  . ASP A 1 43 ? 3.663   11.437  2.045   1.00 0.00 ? 43 ASP A OD2  3  
ATOM 3046  H H    . ASP A 1 43 ? 0.903   10.084  0.993   1.00 0.00 ? 43 ASP A H    3  
ATOM 3047  H HA   . ASP A 1 43 ? 0.161   10.947  3.583   1.00 0.00 ? 43 ASP A HA   3  
ATOM 3048  H HB2  . ASP A 1 43 ? 1.522   12.390  1.304   1.00 0.00 ? 43 ASP A HB2  3  
ATOM 3049  H HB3  . ASP A 1 43 ? 1.309   13.087  2.907   1.00 0.00 ? 43 ASP A HB3  3  
ATOM 3050  N N    . GLU A 1 44 ? -1.498  12.206  1.057   1.00 0.00 ? 44 GLU A N    3  
ATOM 3051  C CA   . GLU A 1 44 ? -2.685  12.968  0.687   1.00 0.00 ? 44 GLU A CA   3  
ATOM 3052  C C    . GLU A 1 44 ? -3.868  12.039  0.422   1.00 0.00 ? 44 GLU A C    3  
ATOM 3053  O O    . GLU A 1 44 ? -3.691  10.912  -0.040  1.00 0.00 ? 44 GLU A O    3  
ATOM 3054  C CB   . GLU A 1 44 ? -2.405  13.821  -0.551  1.00 0.00 ? 44 GLU A CB   3  
ATOM 3055  C CG   . GLU A 1 44 ? -1.186  14.720  -0.408  1.00 0.00 ? 44 GLU A CG   3  
ATOM 3056  C CD   . GLU A 1 44 ? -0.112  14.417  -1.434  1.00 0.00 ? 44 GLU A CD   3  
ATOM 3057  O OE1  . GLU A 1 44 ? 0.250   13.232  -1.584  1.00 0.00 ? 44 GLU A OE1  3  
ATOM 3058  O OE2  . GLU A 1 44 ? 0.367   15.367  -2.089  1.00 0.00 ? 44 GLU A OE2  3  
ATOM 3059  H H    . GLU A 1 44 ? -0.995  11.736  0.358   1.00 0.00 ? 44 GLU A H    3  
ATOM 3060  H HA   . GLU A 1 44 ? -2.930  13.618  1.513   1.00 0.00 ? 44 GLU A HA   3  
ATOM 3061  H HB2  . GLU A 1 44 ? -2.245  13.166  -1.396  1.00 0.00 ? 44 GLU A HB2  3  
ATOM 3062  H HB3  . GLU A 1 44 ? -3.264  14.444  -0.747  1.00 0.00 ? 44 GLU A HB3  3  
ATOM 3063  H HG2  . GLU A 1 44 ? -1.497  15.747  -0.527  1.00 0.00 ? 44 GLU A HG2  3  
ATOM 3064  H HG3  . GLU A 1 44 ? -0.769  14.584  0.580   1.00 0.00 ? 44 GLU A HG3  3  
ATOM 3065  N N    . PRO A 1 45 ? -5.096  12.503  0.714   1.00 0.00 ? 45 PRO A N    3  
ATOM 3066  C CA   . PRO A 1 45 ? -6.310  11.707  0.504   1.00 0.00 ? 45 PRO A CA   3  
ATOM 3067  C C    . PRO A 1 45 ? -6.650  11.548  -0.975  1.00 0.00 ? 45 PRO A C    3  
ATOM 3068  O O    . PRO A 1 45 ? -7.549  12.211  -1.491  1.00 0.00 ? 45 PRO A O    3  
ATOM 3069  C CB   . PRO A 1 45 ? -7.392  12.519  1.218   1.00 0.00 ? 45 PRO A CB   3  
ATOM 3070  C CG   . PRO A 1 45 ? -6.896  13.922  1.181   1.00 0.00 ? 45 PRO A CG   3  
ATOM 3071  C CD   . PRO A 1 45 ? -5.397  13.836  1.268   1.00 0.00 ? 45 PRO A CD   3  
ATOM 3072  H HA   . PRO A 1 45 ? -6.227  10.732  0.960   1.00 0.00 ? 45 PRO A HA   3  
ATOM 3073  H HB2  . PRO A 1 45 ? -8.330  12.415  0.692   1.00 0.00 ? 45 PRO A HB2  3  
ATOM 3074  H HB3  . PRO A 1 45 ? -7.500  12.165  2.233   1.00 0.00 ? 45 PRO A HB3  3  
ATOM 3075  H HG2  . PRO A 1 45 ? -7.192  14.392  0.254   1.00 0.00 ? 45 PRO A HG2  3  
ATOM 3076  H HG3  . PRO A 1 45 ? -7.290  14.473  2.023   1.00 0.00 ? 45 PRO A HG3  3  
ATOM 3077  H HD2  . PRO A 1 45 ? -4.940  14.613  0.673   1.00 0.00 ? 45 PRO A HD2  3  
ATOM 3078  H HD3  . PRO A 1 45 ? -5.075  13.907  2.296   1.00 0.00 ? 45 PRO A HD3  3  
ATOM 3079  N N    . LEU A 1 46 ? -5.924  10.663  -1.651  1.00 0.00 ? 46 LEU A N    3  
ATOM 3080  C CA   . LEU A 1 46 ? -6.149  10.416  -3.070  1.00 0.00 ? 46 LEU A CA   3  
ATOM 3081  C C    . LEU A 1 46 ? -6.289  8.922   -3.347  1.00 0.00 ? 46 LEU A C    3  
ATOM 3082  O O    . LEU A 1 46 ? -5.935  8.444   -4.425  1.00 0.00 ? 46 LEU A O    3  
ATOM 3083  C CB   . LEU A 1 46 ? -5.001  10.994  -3.899  1.00 0.00 ? 46 LEU A CB   3  
ATOM 3084  C CG   . LEU A 1 46 ? -4.900  12.520  -3.889  1.00 0.00 ? 46 LEU A CG   3  
ATOM 3085  C CD1  . LEU A 1 46 ? -3.563  12.971  -4.455  1.00 0.00 ? 46 LEU A CD1  3  
ATOM 3086  C CD2  . LEU A 1 46 ? -6.047  13.134  -4.678  1.00 0.00 ? 46 LEU A CD2  3  
ATOM 3087  H H    . LEU A 1 46 ? -5.222  10.164  -1.184  1.00 0.00 ? 46 LEU A H    3  
ATOM 3088  H HA   . LEU A 1 46 ? -7.067  10.908  -3.352  1.00 0.00 ? 46 LEU A HA   3  
ATOM 3089  H HB2  . LEU A 1 46 ? -4.073  10.590  -3.521  1.00 0.00 ? 46 LEU A HB2  3  
ATOM 3090  H HB3  . LEU A 1 46 ? -5.123  10.671  -4.921  1.00 0.00 ? 46 LEU A HB3  3  
ATOM 3091  H HG   . LEU A 1 46 ? -4.967  12.873  -2.870  1.00 0.00 ? 46 LEU A HG   3  
ATOM 3092  H HD11 . LEU A 1 46 ? -3.213  13.835  -3.909  1.00 0.00 ? 46 LEU A HD11 3  
ATOM 3093  H HD12 . LEU A 1 46 ? -3.680  13.227  -5.497  1.00 0.00 ? 46 LEU A HD12 3  
ATOM 3094  H HD13 . LEU A 1 46 ? -2.844  12.170  -4.360  1.00 0.00 ? 46 LEU A HD13 3  
ATOM 3095  H HD21 . LEU A 1 46 ? -6.869  13.349  -4.010  1.00 0.00 ? 46 LEU A HD21 3  
ATOM 3096  H HD22 . LEU A 1 46 ? -6.375  12.439  -5.438  1.00 0.00 ? 46 LEU A HD22 3  
ATOM 3097  H HD23 . LEU A 1 46 ? -5.715  14.049  -5.145  1.00 0.00 ? 46 LEU A HD23 3  
ATOM 3098  N N    . GLY A 1 47 ? -6.806  8.189   -2.366  1.00 0.00 ? 47 GLY A N    3  
ATOM 3099  C CA   . GLY A 1 47 ? -6.983  6.757   -2.523  1.00 0.00 ? 47 GLY A CA   3  
ATOM 3100  C C    . GLY A 1 47 ? -8.441  6.365   -2.667  1.00 0.00 ? 47 GLY A C    3  
ATOM 3101  O O    . GLY A 1 47 ? -9.290  7.206   -2.964  1.00 0.00 ? 47 GLY A O    3  
ATOM 3102  H H    . GLY A 1 47 ? -7.070  8.625   -1.529  1.00 0.00 ? 47 GLY A H    3  
ATOM 3103  H HA2  . GLY A 1 47 ? -6.446  6.433   -3.402  1.00 0.00 ? 47 GLY A HA2  3  
ATOM 3104  H HA3  . GLY A 1 47 ? -6.572  6.259   -1.659  1.00 0.00 ? 47 GLY A HA3  3  
ATOM 3105  N N    . LYS A 1 48 ? -8.732  5.086   -2.456  1.00 0.00 ? 48 LYS A N    3  
ATOM 3106  C CA   . LYS A 1 48 ? -10.097 4.585   -2.565  1.00 0.00 ? 48 LYS A CA   3  
ATOM 3107  C C    . LYS A 1 48 ? -10.337 3.443   -1.583  1.00 0.00 ? 48 LYS A C    3  
ATOM 3108  O O    . LYS A 1 48 ? -11.132 2.541   -1.847  1.00 0.00 ? 48 LYS A O    3  
ATOM 3109  C CB   . LYS A 1 48 ? -10.376 4.112   -3.993  1.00 0.00 ? 48 LYS A CB   3  
ATOM 3110  C CG   . LYS A 1 48 ? -9.307  3.181   -4.545  1.00 0.00 ? 48 LYS A CG   3  
ATOM 3111  C CD   . LYS A 1 48 ? -9.801  1.744   -4.627  1.00 0.00 ? 48 LYS A CD   3  
ATOM 3112  C CE   . LYS A 1 48 ? -9.924  1.276   -6.068  1.00 0.00 ? 48 LYS A CE   3  
ATOM 3113  N NZ   . LYS A 1 48 ? -8.658  0.668   -6.564  1.00 0.00 ? 48 LYS A NZ   3  
ATOM 3114  H H    . LYS A 1 48 ? -8.010  4.464   -2.222  1.00 0.00 ? 48 LYS A H    3  
ATOM 3115  H HA   . LYS A 1 48 ? -10.767 5.396   -2.327  1.00 0.00 ? 48 LYS A HA   3  
ATOM 3116  H HB2  . LYS A 1 48 ? -11.322 3.591   -4.009  1.00 0.00 ? 48 LYS A HB2  3  
ATOM 3117  H HB3  . LYS A 1 48 ? -10.440 4.975   -4.639  1.00 0.00 ? 48 LYS A HB3  3  
ATOM 3118  H HG2  . LYS A 1 48 ? -9.032  3.514   -5.536  1.00 0.00 ? 48 LYS A HG2  3  
ATOM 3119  H HG3  . LYS A 1 48 ? -8.443  3.219   -3.898  1.00 0.00 ? 48 LYS A HG3  3  
ATOM 3120  H HD2  . LYS A 1 48 ? -9.103  1.104   -4.110  1.00 0.00 ? 48 LYS A HD2  3  
ATOM 3121  H HD3  . LYS A 1 48 ? -10.770 1.678   -4.153  1.00 0.00 ? 48 LYS A HD3  3  
ATOM 3122  H HE2  . LYS A 1 48 ? -10.713 0.542   -6.129  1.00 0.00 ? 48 LYS A HE2  3  
ATOM 3123  H HE3  . LYS A 1 48 ? -10.174 2.124   -6.689  1.00 0.00 ? 48 LYS A HE3  3  
ATOM 3124  H HZ1  . LYS A 1 48 ? -8.585  -0.318  -6.243  1.00 0.00 ? 48 LYS A HZ1  3  
ATOM 3125  H HZ2  . LYS A 1 48 ? -7.840  1.200   -6.203  1.00 0.00 ? 48 LYS A HZ2  3  
ATOM 3126  H HZ3  . LYS A 1 48 ? -8.637  0.686   -7.604  1.00 0.00 ? 48 LYS A HZ3  3  
ATOM 3127  N N    . ASN A 1 49 ? -9.645  3.488   -0.448  1.00 0.00 ? 49 ASN A N    3  
ATOM 3128  C CA   . ASN A 1 49 ? -9.786  2.457   0.573   1.00 0.00 ? 49 ASN A CA   3  
ATOM 3129  C C    . ASN A 1 49 ? -9.206  2.927   1.904   1.00 0.00 ? 49 ASN A C    3  
ATOM 3130  O O    . ASN A 1 49 ? -8.619  4.005   1.990   1.00 0.00 ? 49 ASN A O    3  
ATOM 3131  C CB   . ASN A 1 49 ? -9.089  1.170   0.127   1.00 0.00 ? 49 ASN A CB   3  
ATOM 3132  C CG   . ASN A 1 49 ? -9.973  0.308   -0.751  1.00 0.00 ? 49 ASN A CG   3  
ATOM 3133  O OD1  . ASN A 1 49 ? -11.042 -0.136  -0.331  1.00 0.00 ? 49 ASN A OD1  3  
ATOM 3134  N ND2  . ASN A 1 49 ? -9.531  0.066   -1.980  1.00 0.00 ? 49 ASN A ND2  3  
ATOM 3135  H H    . ASN A 1 49 ? -9.027  4.233   -0.295  1.00 0.00 ? 49 ASN A H    3  
ATOM 3136  H HA   . ASN A 1 49 ? -10.839 2.259   0.702   1.00 0.00 ? 49 ASN A HA   3  
ATOM 3137  H HB2  . ASN A 1 49 ? -8.199  1.424   -0.429  1.00 0.00 ? 49 ASN A HB2  3  
ATOM 3138  H HB3  . ASN A 1 49 ? -8.812  0.598   1.000   1.00 0.00 ? 49 ASN A HB3  3  
ATOM 3139  H HD21 . ASN A 1 49 ? -8.671  0.452   -2.246  1.00 0.00 ? 49 ASN A HD21 3  
ATOM 3140  H HD22 . ASN A 1 49 ? -10.083 -0.489  -2.570  1.00 0.00 ? 49 ASN A HD22 3  
ATOM 3141  N N    . ASP A 1 50 ? -9.377  2.112   2.939   1.00 0.00 ? 50 ASP A N    3  
ATOM 3142  C CA   . ASP A 1 50 ? -8.871  2.444   4.266   1.00 0.00 ? 50 ASP A CA   3  
ATOM 3143  C C    . ASP A 1 50 ? -8.063  1.287   4.845   1.00 0.00 ? 50 ASP A C    3  
ATOM 3144  O O    . ASP A 1 50 ? -8.046  1.075   6.058   1.00 0.00 ? 50 ASP A O    3  
ATOM 3145  C CB   . ASP A 1 50 ? -10.029 2.792   5.204   1.00 0.00 ? 50 ASP A CB   3  
ATOM 3146  C CG   . ASP A 1 50 ? -11.046 1.672   5.308   1.00 0.00 ? 50 ASP A CG   3  
ATOM 3147  O OD1  . ASP A 1 50 ? -10.696 0.519   4.979   1.00 0.00 ? 50 ASP A OD1  3  
ATOM 3148  O OD2  . ASP A 1 50 ? -12.193 1.948   5.719   1.00 0.00 ? 50 ASP A OD2  3  
ATOM 3149  H H    . ASP A 1 50 ? -9.855  1.266   2.808   1.00 0.00 ? 50 ASP A H    3  
ATOM 3150  H HA   . ASP A 1 50 ? -8.227  3.304   4.170   1.00 0.00 ? 50 ASP A HA   3  
ATOM 3151  H HB2  . ASP A 1 50 ? -9.637  2.990   6.190   1.00 0.00 ? 50 ASP A HB2  3  
ATOM 3152  H HB3  . ASP A 1 50 ? -10.529 3.676   4.835   1.00 0.00 ? 50 ASP A HB3  3  
ATOM 3153  N N    . GLY A 1 51 ? -7.395  0.542   3.971   1.00 0.00 ? 51 GLY A N    3  
ATOM 3154  C CA   . GLY A 1 51 ? -6.595  -0.583  4.415   1.00 0.00 ? 51 GLY A CA   3  
ATOM 3155  C C    . GLY A 1 51 ? -7.441  -1.773  4.825   1.00 0.00 ? 51 GLY A C    3  
ATOM 3156  O O    . GLY A 1 51 ? -7.038  -2.569  5.672   1.00 0.00 ? 51 GLY A O    3  
ATOM 3157  H H    . GLY A 1 51 ? -7.447  0.758   3.017   1.00 0.00 ? 51 GLY A H    3  
ATOM 3158  H HA2  . GLY A 1 51 ? -5.938  -0.883  3.612   1.00 0.00 ? 51 GLY A HA2  3  
ATOM 3159  H HA3  . GLY A 1 51 ? -5.996  -0.275  5.259   1.00 0.00 ? 51 GLY A HA3  3  
ATOM 3160  N N    . ALA A 1 52 ? -8.620  -1.893  4.222   1.00 0.00 ? 52 ALA A N    3  
ATOM 3161  C CA   . ALA A 1 52 ? -9.526  -2.993  4.528   1.00 0.00 ? 52 ALA A CA   3  
ATOM 3162  C C    . ALA A 1 52 ? -10.269 -3.456  3.280   1.00 0.00 ? 52 ALA A C    3  
ATOM 3163  O O    . ALA A 1 52 ? -10.578 -2.657  2.397   1.00 0.00 ? 52 ALA A O    3  
ATOM 3164  C CB   . ALA A 1 52 ? -10.513 -2.578  5.609   1.00 0.00 ? 52 ALA A CB   3  
ATOM 3165  H H    . ALA A 1 52 ? -8.885  -1.227  3.554   1.00 0.00 ? 52 ALA A H    3  
ATOM 3166  H HA   . ALA A 1 52 ? -8.936  -3.815  4.909   1.00 0.00 ? 52 ALA A HA   3  
ATOM 3167  H HB1  . ALA A 1 52 ? -9.972  -2.276  6.494   1.00 0.00 ? 52 ALA A HB1  3  
ATOM 3168  H HB2  . ALA A 1 52 ? -11.158 -3.411  5.847   1.00 0.00 ? 52 ALA A HB2  3  
ATOM 3169  H HB3  . ALA A 1 52 ? -11.109 -1.751  5.252   1.00 0.00 ? 52 ALA A HB3  3  
ATOM 3170  N N    . VAL A 1 53 ? -10.552 -4.753  3.213   1.00 0.00 ? 53 VAL A N    3  
ATOM 3171  C CA   . VAL A 1 53 ? -11.259 -5.323  2.073   1.00 0.00 ? 53 VAL A CA   3  
ATOM 3172  C C    . VAL A 1 53 ? -12.407 -6.216  2.529   1.00 0.00 ? 53 VAL A C    3  
ATOM 3173  O O    . VAL A 1 53 ? -12.194 -7.214  3.218   1.00 0.00 ? 53 VAL A O    3  
ATOM 3174  C CB   . VAL A 1 53 ? -10.312 -6.142  1.177   1.00 0.00 ? 53 VAL A CB   3  
ATOM 3175  C CG1  . VAL A 1 53 ? -11.016 -6.560  -0.105  1.00 0.00 ? 53 VAL A CG1  3  
ATOM 3176  C CG2  . VAL A 1 53 ? -9.051  -5.350  0.867   1.00 0.00 ? 53 VAL A CG2  3  
ATOM 3177  H H    . VAL A 1 53 ? -10.279 -5.341  3.949   1.00 0.00 ? 53 VAL A H    3  
ATOM 3178  H HA   . VAL A 1 53 ? -11.660 -4.508  1.488   1.00 0.00 ? 53 VAL A HA   3  
ATOM 3179  H HB   . VAL A 1 53 ? -10.027 -7.037  1.711   1.00 0.00 ? 53 VAL A HB   3  
ATOM 3180  H HG11 . VAL A 1 53 ? -10.293 -6.964  -0.798  1.00 0.00 ? 53 VAL A HG11 3  
ATOM 3181  H HG12 . VAL A 1 53 ? -11.498 -5.701  -0.548  1.00 0.00 ? 53 VAL A HG12 3  
ATOM 3182  H HG13 . VAL A 1 53 ? -11.758 -7.312  0.120   1.00 0.00 ? 53 VAL A HG13 3  
ATOM 3183  H HG21 . VAL A 1 53 ? -9.320  -4.346  0.570   1.00 0.00 ? 53 VAL A HG21 3  
ATOM 3184  H HG22 . VAL A 1 53 ? -8.512  -5.830  0.064   1.00 0.00 ? 53 VAL A HG22 3  
ATOM 3185  H HG23 . VAL A 1 53 ? -8.426  -5.309  1.746   1.00 0.00 ? 53 VAL A HG23 3  
ATOM 3186  N N    . ALA A 1 54 ? -13.625 -5.851  2.141   1.00 0.00 ? 54 ALA A N    3  
ATOM 3187  C CA   . ALA A 1 54 ? -14.807 -6.619  2.511   1.00 0.00 ? 54 ALA A CA   3  
ATOM 3188  C C    . ALA A 1 54 ? -14.973 -6.678  4.024   1.00 0.00 ? 54 ALA A C    3  
ATOM 3189  O O    . ALA A 1 54 ? -15.493 -7.655  4.565   1.00 0.00 ? 54 ALA A O    3  
ATOM 3190  C CB   . ALA A 1 54 ? -14.725 -8.024  1.932   1.00 0.00 ? 54 ALA A CB   3  
ATOM 3191  H H    . ALA A 1 54 ? -13.730 -5.045  1.593   1.00 0.00 ? 54 ALA A H    3  
ATOM 3192  H HA   . ALA A 1 54 ? -15.670 -6.129  2.083   1.00 0.00 ? 54 ALA A HA   3  
ATOM 3193  H HB1  . ALA A 1 54 ? -15.658 -8.539  2.105   1.00 0.00 ? 54 ALA A HB1  3  
ATOM 3194  H HB2  . ALA A 1 54 ? -13.922 -8.564  2.410   1.00 0.00 ? 54 ALA A HB2  3  
ATOM 3195  H HB3  . ALA A 1 54 ? -14.537 -7.965  0.870   1.00 0.00 ? 54 ALA A HB3  3  
ATOM 3196  N N    . GLY A 1 55 ? -14.528 -5.626  4.705   1.00 0.00 ? 55 GLY A N    3  
ATOM 3197  C CA   . GLY A 1 55 ? -14.636 -5.579  6.152   1.00 0.00 ? 55 GLY A CA   3  
ATOM 3198  C C    . GLY A 1 55 ? -13.339 -5.950  6.843   1.00 0.00 ? 55 GLY A C    3  
ATOM 3199  O O    . GLY A 1 55 ? -13.053 -5.470  7.941   1.00 0.00 ? 55 GLY A O    3  
ATOM 3200  H H    . GLY A 1 55 ? -14.122 -4.877  4.221   1.00 0.00 ? 55 GLY A H    3  
ATOM 3201  H HA2  . GLY A 1 55 ? -14.916 -4.579  6.447   1.00 0.00 ? 55 GLY A HA2  3  
ATOM 3202  H HA3  . GLY A 1 55 ? -15.408 -6.266  6.467   1.00 0.00 ? 55 GLY A HA3  3  
ATOM 3203  N N    . THR A 1 56 ? -12.551 -6.806  6.200   1.00 0.00 ? 56 THR A N    3  
ATOM 3204  C CA   . THR A 1 56 ? -11.277 -7.241  6.759   1.00 0.00 ? 56 THR A CA   3  
ATOM 3205  C C    . THR A 1 56 ? -10.236 -6.129  6.673   1.00 0.00 ? 56 THR A C    3  
ATOM 3206  O O    . THR A 1 56 ? -9.770  -5.786  5.587   1.00 0.00 ? 56 THR A O    3  
ATOM 3207  C CB   . THR A 1 56 ? -10.773 -8.485  6.027   1.00 0.00 ? 56 THR A CB   3  
ATOM 3208  O OG1  . THR A 1 56 ? -11.858 -9.283  5.587   1.00 0.00 ? 56 THR A OG1  3  
ATOM 3209  C CG2  . THR A 1 56 ? -9.877  -9.360  6.878   1.00 0.00 ? 56 THR A CG2  3  
ATOM 3210  H H    . THR A 1 56 ? -12.834 -7.153  5.329   1.00 0.00 ? 56 THR A H    3  
ATOM 3211  H HA   . THR A 1 56 ? -11.439 -7.487  7.799   1.00 0.00 ? 56 THR A HA   3  
ATOM 3212  H HB   . THR A 1 56 ? -10.206 -8.175  5.161   1.00 0.00 ? 56 THR A HB   3  
ATOM 3213  H HG1  . THR A 1 56 ? -11.527 -10.007 5.052   1.00 0.00 ? 56 THR A HG1  3  
ATOM 3214  H HG21 . THR A 1 56 ? -9.565  -8.810  7.754   1.00 0.00 ? 56 THR A HG21 3  
ATOM 3215  H HG22 . THR A 1 56 ? -9.007  -9.648  6.306   1.00 0.00 ? 56 THR A HG22 3  
ATOM 3216  H HG23 . THR A 1 56 ? -10.418 -10.243 7.181   1.00 0.00 ? 56 THR A HG23 3  
ATOM 3217  N N    . ARG A 1 57 ? -9.878  -5.569  7.824   1.00 0.00 ? 57 ARG A N    3  
ATOM 3218  C CA   . ARG A 1 57 ? -8.892  -4.497  7.878   1.00 0.00 ? 57 ARG A CA   3  
ATOM 3219  C C    . ARG A 1 57 ? -7.569  -5.000  8.443   1.00 0.00 ? 57 ARG A C    3  
ATOM 3220  O O    . ARG A 1 57 ? -7.530  -5.605  9.515   1.00 0.00 ? 57 ARG A O    3  
ATOM 3221  C CB   . ARG A 1 57 ? -9.415  -3.338  8.730   1.00 0.00 ? 57 ARG A CB   3  
ATOM 3222  C CG   . ARG A 1 57 ? -8.609  -2.059  8.579   1.00 0.00 ? 57 ARG A CG   3  
ATOM 3223  C CD   . ARG A 1 57 ? -9.471  -0.826  8.794   1.00 0.00 ? 57 ARG A CD   3  
ATOM 3224  N NE   . ARG A 1 57 ? -9.951  -0.728  10.171  1.00 0.00 ? 57 ARG A NE   3  
ATOM 3225  C CZ   . ARG A 1 57 ? -10.954 0.060   10.552  1.00 0.00 ? 57 ARG A CZ   3  
ATOM 3226  N NH1  . ARG A 1 57 ? -11.585 0.819   9.664   1.00 0.00 ? 57 ARG A NH1  3  
ATOM 3227  N NH2  . ARG A 1 57 ? -11.327 0.089   11.824  1.00 0.00 ? 57 ARG A NH2  3  
ATOM 3228  H H    . ARG A 1 57 ? -10.285 -5.887  8.657   1.00 0.00 ? 57 ARG A H    3  
ATOM 3229  H HA   . ARG A 1 57 ? -8.729  -4.145  6.870   1.00 0.00 ? 57 ARG A HA   3  
ATOM 3230  H HB2  . ARG A 1 57 ? -10.437 -3.130  8.445   1.00 0.00 ? 57 ARG A HB2  3  
ATOM 3231  H HB3  . ARG A 1 57 ? -9.394  -3.632  9.769   1.00 0.00 ? 57 ARG A HB3  3  
ATOM 3232  H HG2  . ARG A 1 57 ? -7.812  -2.060  9.307   1.00 0.00 ? 57 ARG A HG2  3  
ATOM 3233  H HG3  . ARG A 1 57 ? -8.190  -2.025  7.583   1.00 0.00 ? 57 ARG A HG3  3  
ATOM 3234  H HD2  . ARG A 1 57 ? -8.887  0.051   8.564   1.00 0.00 ? 57 ARG A HD2  3  
ATOM 3235  H HD3  . ARG A 1 57 ? -10.321 -0.878  8.129   1.00 0.00 ? 57 ARG A HD3  3  
ATOM 3236  H HE   . ARG A 1 57 ? -9.503  -1.278  10.846  1.00 0.00 ? 57 ARG A HE   3  
ATOM 3237  H HH11 . ARG A 1 57 ? -11.308 0.802   8.703   1.00 0.00 ? 57 ARG A HH11 3  
ATOM 3238  H HH12 . ARG A 1 57 ? -12.337 1.409   9.956   1.00 0.00 ? 57 ARG A HH12 3  
ATOM 3239  H HH21 . ARG A 1 57 ? -10.856 -0.480  12.496  1.00 0.00 ? 57 ARG A HH21 3  
ATOM 3240  H HH22 . ARG A 1 57 ? -12.081 0.681   12.110  1.00 0.00 ? 57 ARG A HH22 3  
ATOM 3241  N N    . TYR A 1 58 ? -6.486  -4.748  7.716   1.00 0.00 ? 58 TYR A N    3  
ATOM 3242  C CA   . TYR A 1 58 ? -5.159  -5.176  8.145   1.00 0.00 ? 58 TYR A CA   3  
ATOM 3243  C C    . TYR A 1 58 ? -4.513  -4.125  9.042   1.00 0.00 ? 58 TYR A C    3  
ATOM 3244  O O    . TYR A 1 58 ? -4.014  -4.440  10.122  1.00 0.00 ? 58 TYR A O    3  
ATOM 3245  C CB   . TYR A 1 58 ? -4.269  -5.444  6.930   1.00 0.00 ? 58 TYR A CB   3  
ATOM 3246  C CG   . TYR A 1 58 ? -4.848  -6.454  5.966   1.00 0.00 ? 58 TYR A CG   3  
ATOM 3247  C CD1  . TYR A 1 58 ? -5.765  -6.071  4.995   1.00 0.00 ? 58 TYR A CD1  3  
ATOM 3248  C CD2  . TYR A 1 58 ? -4.479  -7.793  6.027   1.00 0.00 ? 58 TYR A CD2  3  
ATOM 3249  C CE1  . TYR A 1 58 ? -6.297  -6.992  4.112   1.00 0.00 ? 58 TYR A CE1  3  
ATOM 3250  C CE2  . TYR A 1 58 ? -5.005  -8.720  5.147   1.00 0.00 ? 58 TYR A CE2  3  
ATOM 3251  C CZ   . TYR A 1 58 ? -5.914  -8.315  4.193   1.00 0.00 ? 58 TYR A CZ   3  
ATOM 3252  O OH   . TYR A 1 58 ? -6.441  -9.235  3.316   1.00 0.00 ? 58 TYR A OH   3  
ATOM 3253  H H    . TYR A 1 58 ? -6.581  -4.261  6.870   1.00 0.00 ? 58 TYR A H    3  
ATOM 3254  H HA   . TYR A 1 58 ? -5.272  -6.092  8.706   1.00 0.00 ? 58 TYR A HA   3  
ATOM 3255  H HB2  . TYR A 1 58 ? -4.120  -4.520  6.391   1.00 0.00 ? 58 TYR A HB2  3  
ATOM 3256  H HB3  . TYR A 1 58 ? -3.313  -5.816  7.268   1.00 0.00 ? 58 TYR A HB3  3  
ATOM 3257  H HD1  . TYR A 1 58 ? -6.063  -5.035  4.934   1.00 0.00 ? 58 TYR A HD1  3  
ATOM 3258  H HD2  . TYR A 1 58 ? -3.767  -8.106  6.776   1.00 0.00 ? 58 TYR A HD2  3  
ATOM 3259  H HE1  . TYR A 1 58 ? -7.008  -6.675  3.364   1.00 0.00 ? 58 TYR A HE1  3  
ATOM 3260  H HE2  . TYR A 1 58 ? -4.705  -9.755  5.211   1.00 0.00 ? 58 TYR A HE2  3  
ATOM 3261  H HH   . TYR A 1 58 ? -5.750  -9.552  2.730   1.00 0.00 ? 58 TYR A HH   3  
ATOM 3262  N N    . PHE A 1 59 ? -4.525  -2.877  8.586   1.00 0.00 ? 59 PHE A N    3  
ATOM 3263  C CA   . PHE A 1 59 ? -3.941  -1.780  9.347   1.00 0.00 ? 59 PHE A CA   3  
ATOM 3264  C C    . PHE A 1 59 ? -4.924  -0.620  9.475   1.00 0.00 ? 59 PHE A C    3  
ATOM 3265  O O    . PHE A 1 59 ? -5.542  -0.207  8.494   1.00 0.00 ? 59 PHE A O    3  
ATOM 3266  C CB   . PHE A 1 59 ? -2.651  -1.298  8.682   1.00 0.00 ? 59 PHE A CB   3  
ATOM 3267  C CG   . PHE A 1 59 ? -2.831  -0.896  7.245   1.00 0.00 ? 59 PHE A CG   3  
ATOM 3268  C CD1  . PHE A 1 59 ? -2.774  -1.843  6.235   1.00 0.00 ? 59 PHE A CD1  3  
ATOM 3269  C CD2  . PHE A 1 59 ? -3.057  0.427   6.906   1.00 0.00 ? 59 PHE A CD2  3  
ATOM 3270  C CE1  . PHE A 1 59 ? -2.940  -1.477  4.913   1.00 0.00 ? 59 PHE A CE1  3  
ATOM 3271  C CE2  . PHE A 1 59 ? -3.224  0.800   5.586   1.00 0.00 ? 59 PHE A CE2  3  
ATOM 3272  C CZ   . PHE A 1 59 ? -3.165  -0.153  4.587   1.00 0.00 ? 59 PHE A CZ   3  
ATOM 3273  H H    . PHE A 1 59 ? -4.938  -2.689  7.718   1.00 0.00 ? 59 PHE A H    3  
ATOM 3274  H HA   . PHE A 1 59 ? -3.708  -2.148  10.337  1.00 0.00 ? 59 PHE A HA   3  
ATOM 3275  H HB2  . PHE A 1 59 ? -2.272  -0.443  9.220   1.00 0.00 ? 59 PHE A HB2  3  
ATOM 3276  H HB3  . PHE A 1 59 ? -1.918  -2.092  8.716   1.00 0.00 ? 59 PHE A HB3  3  
ATOM 3277  H HD1  . PHE A 1 59 ? -2.599  -2.878  6.488   1.00 0.00 ? 59 PHE A HD1  3  
ATOM 3278  H HD2  . PHE A 1 59 ? -3.103  1.174   7.686   1.00 0.00 ? 59 PHE A HD2  3  
ATOM 3279  H HE1  . PHE A 1 59 ? -2.893  -2.224  4.134   1.00 0.00 ? 59 PHE A HE1  3  
ATOM 3280  H HE2  . PHE A 1 59 ? -3.399  1.835   5.334   1.00 0.00 ? 59 PHE A HE2  3  
ATOM 3281  H HZ   . PHE A 1 59 ? -3.295  0.136   3.555   1.00 0.00 ? 59 PHE A HZ   3  
ATOM 3282  N N    . GLN A 1 60 ? -5.064  -0.100  10.691  1.00 0.00 ? 60 GLN A N    3  
ATOM 3283  C CA   . GLN A 1 60 ? -5.973  1.012   10.945  1.00 0.00 ? 60 GLN A CA   3  
ATOM 3284  C C    . GLN A 1 60 ? -5.530  2.260   10.190  1.00 0.00 ? 60 GLN A C    3  
ATOM 3285  O O    . GLN A 1 60 ? -4.489  2.844   10.490  1.00 0.00 ? 60 GLN A O    3  
ATOM 3286  C CB   . GLN A 1 60 ? -6.043  1.306   12.445  1.00 0.00 ? 60 GLN A CB   3  
ATOM 3287  C CG   . GLN A 1 60 ? -7.093  2.342   12.812  1.00 0.00 ? 60 GLN A CG   3  
ATOM 3288  C CD   . GLN A 1 60 ? -8.506  1.855   12.559  1.00 0.00 ? 60 GLN A CD   3  
ATOM 3289  O OE1  . GLN A 1 60 ? -8.936  0.843   13.114  1.00 0.00 ? 60 GLN A OE1  3  
ATOM 3290  N NE2  . GLN A 1 60 ? -9.236  2.574   11.715  1.00 0.00 ? 60 GLN A NE2  3  
ATOM 3291  H H    . GLN A 1 60 ? -4.543  -0.473  11.432  1.00 0.00 ? 60 GLN A H    3  
ATOM 3292  H HA   . GLN A 1 60 ? -6.953  0.724   10.598  1.00 0.00 ? 60 GLN A HA   3  
ATOM 3293  H HB2  . GLN A 1 60 ? -6.272  0.390   12.970  1.00 0.00 ? 60 GLN A HB2  3  
ATOM 3294  H HB3  . GLN A 1 60 ? -5.081  1.668   12.774  1.00 0.00 ? 60 GLN A HB3  3  
ATOM 3295  H HG2  . GLN A 1 60 ? -6.993  2.579   13.862  1.00 0.00 ? 60 GLN A HG2  3  
ATOM 3296  H HG3  . GLN A 1 60 ? -6.923  3.232   12.226  1.00 0.00 ? 60 GLN A HG3  3  
ATOM 3297  H HE21 . GLN A 1 60 ? -8.829  3.367   11.309  1.00 0.00 ? 60 GLN A HE21 3  
ATOM 3298  H HE22 . GLN A 1 60 ? -10.155 2.282   11.532  1.00 0.00 ? 60 GLN A HE22 3  
ATOM 3299  N N    . CYS A 1 61 ? -6.328  2.665   9.207   1.00 0.00 ? 61 CYS A N    3  
ATOM 3300  C CA   . CYS A 1 61 ? -6.019  3.845   8.409   1.00 0.00 ? 61 CYS A CA   3  
ATOM 3301  C C    . CYS A 1 61 ? -7.297  4.558   7.971   1.00 0.00 ? 61 CYS A C    3  
ATOM 3302  O O    . CYS A 1 61 ? -8.352  3.935   7.842   1.00 0.00 ? 61 CYS A O    3  
ATOM 3303  C CB   . CYS A 1 61 ? -5.191  3.454   7.183   1.00 0.00 ? 61 CYS A CB   3  
ATOM 3304  S SG   . CYS A 1 61 ? -3.426  3.811   7.340   1.00 0.00 ? 61 CYS A SG   3  
ATOM 3305  H H    . CYS A 1 61 ? -7.144  2.159   9.015   1.00 0.00 ? 61 CYS A H    3  
ATOM 3306  H HA   . CYS A 1 61 ? -5.440  4.517   9.023   1.00 0.00 ? 61 CYS A HA   3  
ATOM 3307  H HB2  . CYS A 1 61 ? -5.296  2.393   7.011   1.00 0.00 ? 61 CYS A HB2  3  
ATOM 3308  H HB3  . CYS A 1 61 ? -5.560  3.991   6.320   1.00 0.00 ? 61 CYS A HB3  3  
ATOM 3309  H HG   . CYS A 1 61 ? -3.194  3.754   8.270   1.00 0.00 ? 61 CYS A HG   3  
ATOM 3310  N N    . PRO A 1 62 ? -7.218  5.879   7.736   1.00 0.00 ? 62 PRO A N    3  
ATOM 3311  C CA   . PRO A 1 62 ? -8.374  6.675   7.310   1.00 0.00 ? 62 PRO A CA   3  
ATOM 3312  C C    . PRO A 1 62 ? -8.824  6.332   5.892   1.00 0.00 ? 62 PRO A C    3  
ATOM 3313  O O    . PRO A 1 62 ? -8.098  5.680   5.142   1.00 0.00 ? 62 PRO A O    3  
ATOM 3314  C CB   . PRO A 1 62 ? -7.858  8.115   7.373   1.00 0.00 ? 62 PRO A CB   3  
ATOM 3315  C CG   . PRO A 1 62 ? -6.382  7.997   7.213   1.00 0.00 ? 62 PRO A CG   3  
ATOM 3316  C CD   . PRO A 1 62 ? -5.998  6.697   7.865   1.00 0.00 ? 62 PRO A CD   3  
ATOM 3317  H HA   . PRO A 1 62 ? -9.207  6.558   7.988   1.00 0.00 ? 62 PRO A HA   3  
ATOM 3318  H HB2  . PRO A 1 62 ? -8.298  8.693   6.573   1.00 0.00 ? 62 PRO A HB2  3  
ATOM 3319  H HB3  . PRO A 1 62 ? -8.118  8.553   8.325   1.00 0.00 ? 62 PRO A HB3  3  
ATOM 3320  H HG2  . PRO A 1 62 ? -6.126  7.980   6.164   1.00 0.00 ? 62 PRO A HG2  3  
ATOM 3321  H HG3  . PRO A 1 62 ? -5.892  8.823   7.707   1.00 0.00 ? 62 PRO A HG3  3  
ATOM 3322  H HD2  . PRO A 1 62 ? -5.171  6.242   7.341   1.00 0.00 ? 62 PRO A HD2  3  
ATOM 3323  H HD3  . PRO A 1 62 ? -5.749  6.855   8.904   1.00 0.00 ? 62 PRO A HD3  3  
ATOM 3324  N N    . PRO A 1 63 ? -10.035 6.769   5.504   1.00 0.00 ? 63 PRO A N    3  
ATOM 3325  C CA   . PRO A 1 63 ? -10.581 6.504   4.170   1.00 0.00 ? 63 PRO A CA   3  
ATOM 3326  C C    . PRO A 1 63 ? -9.880  7.315   3.086   1.00 0.00 ? 63 PRO A C    3  
ATOM 3327  O O    . PRO A 1 63 ? -9.425  8.434   3.330   1.00 0.00 ? 63 PRO A O    3  
ATOM 3328  C CB   . PRO A 1 63 ? -12.044 6.932   4.295   1.00 0.00 ? 63 PRO A CB   3  
ATOM 3329  C CG   . PRO A 1 63 ? -12.044 7.962   5.371   1.00 0.00 ? 63 PRO A CG   3  
ATOM 3330  C CD   . PRO A 1 63 ? -10.967 7.553   6.338   1.00 0.00 ? 63 PRO A CD   3  
ATOM 3331  H HA   . PRO A 1 63 ? -10.529 5.454   3.923   1.00 0.00 ? 63 PRO A HA   3  
ATOM 3332  H HB2  . PRO A 1 63 ? -12.384 7.341   3.354   1.00 0.00 ? 63 PRO A HB2  3  
ATOM 3333  H HB3  . PRO A 1 63 ? -12.650 6.080   4.565   1.00 0.00 ? 63 PRO A HB3  3  
ATOM 3334  H HG2  . PRO A 1 63 ? -11.822 8.932   4.950   1.00 0.00 ? 63 PRO A HG2  3  
ATOM 3335  H HG3  . PRO A 1 63 ? -13.005 7.977   5.865   1.00 0.00 ? 63 PRO A HG3  3  
ATOM 3336  H HD2  . PRO A 1 63 ? -10.477 8.425   6.747   1.00 0.00 ? 63 PRO A HD2  3  
ATOM 3337  H HD3  . PRO A 1 63 ? -11.381 6.946   7.129   1.00 0.00 ? 63 PRO A HD3  3  
ATOM 3338  N N    . LYS A 1 64 ? -9.795  6.745   1.889   1.00 0.00 ? 64 LYS A N    3  
ATOM 3339  C CA   . LYS A 1 64 ? -9.149  7.415   0.765   1.00 0.00 ? 64 LYS A CA   3  
ATOM 3340  C C    . LYS A 1 64 ? -7.689  7.726   1.082   1.00 0.00 ? 64 LYS A C    3  
ATOM 3341  O O    . LYS A 1 64 ? -7.135  8.712   0.597   1.00 0.00 ? 64 LYS A O    3  
ATOM 3342  C CB   . LYS A 1 64 ? -9.893  8.706   0.419   1.00 0.00 ? 64 LYS A CB   3  
ATOM 3343  C CG   . LYS A 1 64 ? -11.390 8.515   0.234   1.00 0.00 ? 64 LYS A CG   3  
ATOM 3344  C CD   . LYS A 1 64 ? -11.694 7.482   -0.841  1.00 0.00 ? 64 LYS A CD   3  
ATOM 3345  C CE   . LYS A 1 64 ? -12.475 6.304   -0.281  1.00 0.00 ? 64 LYS A CE   3  
ATOM 3346  N NZ   . LYS A 1 64 ? -13.248 5.597   -1.339  1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3347  H H    . LYS A 1 64 ? -10.176 5.852   1.757   1.00 0.00 ? 64 LYS A H    3  
ATOM 3348  H HA   . LYS A 1 64 ? -9.186  6.750   -0.084  1.00 0.00 ? 64 LYS A HA   3  
ATOM 3349  H HB2  . LYS A 1 64 ? -9.738  9.422   1.213   1.00 0.00 ? 64 LYS A HB2  3  
ATOM 3350  H HB3  . LYS A 1 64 ? -9.488  9.106   -0.499  1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3351  H HG2  . LYS A 1 64 ? -11.818 8.184   1.169   1.00 0.00 ? 64 LYS A HG2  3  
ATOM 3352  H HG3  . LYS A 1 64 ? -11.830 9.460   -0.052  1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3353  H HD2  . LYS A 1 64 ? -12.278 7.950   -1.620  1.00 0.00 ? 64 LYS A HD2  3  
ATOM 3354  H HD3  . LYS A 1 64 ? -10.763 7.122   -1.255  1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3355  H HE2  . LYS A 1 64 ? -11.781 5.611   0.169   1.00 0.00 ? 64 LYS A HE2  3  
ATOM 3356  H HE3  . LYS A 1 64 ? -13.159 6.669   0.471   1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3357  H HZ1  . LYS A 1 64 ? -13.321 4.585   -1.112  1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3358  H HZ2  . LYS A 1 64 ? -12.775 5.702   -2.258  1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3359  H HZ3  . LYS A 1 64 ? -14.207 5.996   -1.407  1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3360  N N    . PHE A 1 65 ? -7.073  6.879   1.900   1.00 0.00 ? 65 PHE A N    3  
ATOM 3361  C CA   . PHE A 1 65 ? -5.677  7.063   2.281   1.00 0.00 ? 65 PHE A CA   3  
ATOM 3362  C C    . PHE A 1 65 ? -4.886  5.774   2.088   1.00 0.00 ? 65 PHE A C    3  
ATOM 3363  O O    . PHE A 1 65 ? -3.784  5.786   1.540   1.00 0.00 ? 65 PHE A O    3  
ATOM 3364  C CB   . PHE A 1 65 ? -5.581  7.524   3.736   1.00 0.00 ? 65 PHE A CB   3  
ATOM 3365  C CG   . PHE A 1 65 ? -5.700  9.012   3.904   1.00 0.00 ? 65 PHE A CG   3  
ATOM 3366  C CD1  . PHE A 1 65 ? -4.646  9.847   3.569   1.00 0.00 ? 65 PHE A CD1  3  
ATOM 3367  C CD2  . PHE A 1 65 ? -6.866  9.575   4.399   1.00 0.00 ? 65 PHE A CD2  3  
ATOM 3368  C CE1  . PHE A 1 65 ? -4.752  11.215  3.722   1.00 0.00 ? 65 PHE A CE1  3  
ATOM 3369  C CE2  . PHE A 1 65 ? -6.978  10.944  4.554   1.00 0.00 ? 65 PHE A CE2  3  
ATOM 3370  C CZ   . PHE A 1 65 ? -5.920  11.766  4.215   1.00 0.00 ? 65 PHE A CZ   3  
ATOM 3371  H H    . PHE A 1 65 ? -7.567  6.111   2.255   1.00 0.00 ? 65 PHE A H    3  
ATOM 3372  H HA   . PHE A 1 65 ? -5.258  7.827   1.643   1.00 0.00 ? 65 PHE A HA   3  
ATOM 3373  H HB2  . PHE A 1 65 ? -6.373  7.061   4.306   1.00 0.00 ? 65 PHE A HB2  3  
ATOM 3374  H HB3  . PHE A 1 65 ? -4.627  7.217   4.141   1.00 0.00 ? 65 PHE A HB3  3  
ATOM 3375  H HD1  . PHE A 1 65 ? -3.733  9.418   3.183   1.00 0.00 ? 65 PHE A HD1  3  
ATOM 3376  H HD2  . PHE A 1 65 ? -7.693  8.934   4.663   1.00 0.00 ? 65 PHE A HD2  3  
ATOM 3377  H HE1  . PHE A 1 65 ? -3.924  11.856  3.458   1.00 0.00 ? 65 PHE A HE1  3  
ATOM 3378  H HE2  . PHE A 1 65 ? -7.892  11.370  4.939   1.00 0.00 ? 65 PHE A HE2  3  
ATOM 3379  H HZ   . PHE A 1 65 ? -6.006  12.835  4.336   1.00 0.00 ? 65 PHE A HZ   3  
ATOM 3380  N N    . GLY A 1 66 ? -5.455  4.663   2.543   1.00 0.00 ? 66 GLY A N    3  
ATOM 3381  C CA   . GLY A 1 66 ? -4.788  3.381   2.410   1.00 0.00 ? 66 GLY A CA   3  
ATOM 3382  C C    . GLY A 1 66 ? -5.165  2.660   1.131   1.00 0.00 ? 66 GLY A C    3  
ATOM 3383  O O    . GLY A 1 66 ? -6.347  2.461   0.848   1.00 0.00 ? 66 GLY A O    3  
ATOM 3384  H H    . GLY A 1 66 ? -6.335  4.713   2.970   1.00 0.00 ? 66 GLY A H    3  
ATOM 3385  H HA2  . GLY A 1 66 ? -3.720  3.540   2.420   1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3386  H HA3  . GLY A 1 66 ? -5.056  2.760   3.252   1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3387  N N    . LEU A 1 67 ? -4.159  2.270   0.355   1.00 0.00 ? 67 LEU A N    3  
ATOM 3388  C CA   . LEU A 1 67 ? -4.392  1.568   -0.903  1.00 0.00 ? 67 LEU A CA   3  
ATOM 3389  C C    . LEU A 1 67 ? -3.610  0.260   -0.949  1.00 0.00 ? 67 LEU A C    3  
ATOM 3390  O O    . LEU A 1 67 ? -2.601  0.103   -0.261  1.00 0.00 ? 67 LEU A O    3  
ATOM 3391  C CB   . LEU A 1 67 ? -3.996  2.455   -2.085  1.00 0.00 ? 67 LEU A CB   3  
ATOM 3392  C CG   . LEU A 1 67 ? -4.643  2.081   -3.420  1.00 0.00 ? 67 LEU A CG   3  
ATOM 3393  C CD1  . LEU A 1 67 ? -6.126  2.421   -3.408  1.00 0.00 ? 67 LEU A CD1  3  
ATOM 3394  C CD2  . LEU A 1 67 ? -3.941  2.790   -4.569  1.00 0.00 ? 67 LEU A CD2  3  
ATOM 3395  H H    . LEU A 1 67 ? -3.239  2.458   0.634   1.00 0.00 ? 67 LEU A H    3  
ATOM 3396  H HA   . LEU A 1 67 ? -5.446  1.345   -0.968  1.00 0.00 ? 67 LEU A HA   3  
ATOM 3397  H HB2  . LEU A 1 67 ? -4.267  3.474   -1.850  1.00 0.00 ? 67 LEU A HB2  3  
ATOM 3398  H HB3  . LEU A 1 67 ? -2.925  2.403   -2.204  1.00 0.00 ? 67 LEU A HB3  3  
ATOM 3399  H HG   . LEU A 1 67 ? -4.547  1.016   -3.573  1.00 0.00 ? 67 LEU A HG   3  
ATOM 3400  H HD11 . LEU A 1 67 ? -6.279  3.381   -3.877  1.00 0.00 ? 67 LEU A HD11 3  
ATOM 3401  H HD12 . LEU A 1 67 ? -6.478  2.459   -2.387  1.00 0.00 ? 67 LEU A HD12 3  
ATOM 3402  H HD13 . LEU A 1 67 ? -6.674  1.664   -3.949  1.00 0.00 ? 67 LEU A HD13 3  
ATOM 3403  H HD21 . LEU A 1 67 ? -4.422  2.528   -5.500  1.00 0.00 ? 67 LEU A HD21 3  
ATOM 3404  H HD22 . LEU A 1 67 ? -2.906  2.485   -4.600  1.00 0.00 ? 67 LEU A HD22 3  
ATOM 3405  H HD23 . LEU A 1 67 ? -3.999  3.858   -4.420  1.00 0.00 ? 67 LEU A HD23 3  
ATOM 3406  N N    . PHE A 1 68 ? -4.082  -0.676  -1.766  1.00 0.00 ? 68 PHE A N    3  
ATOM 3407  C CA   . PHE A 1 68 ? -3.427  -1.973  -1.905  1.00 0.00 ? 68 PHE A CA   3  
ATOM 3408  C C    . PHE A 1 68 ? -2.853  -2.145  -3.307  1.00 0.00 ? 68 PHE A C    3  
ATOM 3409  O O    . PHE A 1 68 ? -3.570  -2.026  -4.302  1.00 0.00 ? 68 PHE A O    3  
ATOM 3410  C CB   . PHE A 1 68 ? -4.415  -3.101  -1.604  1.00 0.00 ? 68 PHE A CB   3  
ATOM 3411  C CG   . PHE A 1 68 ? -4.845  -3.156  -0.166  1.00 0.00 ? 68 PHE A CG   3  
ATOM 3412  C CD1  . PHE A 1 68 ? -3.923  -3.411  0.837   1.00 0.00 ? 68 PHE A CD1  3  
ATOM 3413  C CD2  . PHE A 1 68 ? -6.171  -2.955  0.182   1.00 0.00 ? 68 PHE A CD2  3  
ATOM 3414  C CE1  . PHE A 1 68 ? -4.316  -3.462  2.161   1.00 0.00 ? 68 PHE A CE1  3  
ATOM 3415  C CE2  . PHE A 1 68 ? -6.570  -3.005  1.504   1.00 0.00 ? 68 PHE A CE2  3  
ATOM 3416  C CZ   . PHE A 1 68 ? -5.642  -3.260  2.495   1.00 0.00 ? 68 PHE A CZ   3  
ATOM 3417  H H    . PHE A 1 68 ? -4.890  -0.491  -2.290  1.00 0.00 ? 68 PHE A H    3  
ATOM 3418  H HA   . PHE A 1 68 ? -2.619  -2.014  -1.190  1.00 0.00 ? 68 PHE A HA   3  
ATOM 3419  H HB2  . PHE A 1 68 ? -5.299  -2.968  -2.209  1.00 0.00 ? 68 PHE A HB2  3  
ATOM 3420  H HB3  . PHE A 1 68 ? -3.955  -4.047  -1.851  1.00 0.00 ? 68 PHE A HB3  3  
ATOM 3421  H HD1  . PHE A 1 68 ? -2.887  -3.568  0.577   1.00 0.00 ? 68 PHE A HD1  3  
ATOM 3422  H HD2  . PHE A 1 68 ? -6.897  -2.756  -0.592  1.00 0.00 ? 68 PHE A HD2  3  
ATOM 3423  H HE1  . PHE A 1 68 ? -3.588  -3.662  2.933   1.00 0.00 ? 68 PHE A HE1  3  
ATOM 3424  H HE2  . PHE A 1 68 ? -7.606  -2.847  1.763   1.00 0.00 ? 68 PHE A HE2  3  
ATOM 3425  H HZ   . PHE A 1 68 ? -5.951  -3.299  3.529   1.00 0.00 ? 68 PHE A HZ   3  
ATOM 3426  N N    . ALA A 1 69 ? -1.556  -2.425  -3.381  1.00 0.00 ? 69 ALA A N    3  
ATOM 3427  C CA   . ALA A 1 69 ? -0.888  -2.615  -4.662  1.00 0.00 ? 69 ALA A CA   3  
ATOM 3428  C C    . ALA A 1 69 ? 0.083   -3.791  -4.607  1.00 0.00 ? 69 ALA A C    3  
ATOM 3429  O O    . ALA A 1 69 ? 0.704   -4.046  -3.575  1.00 0.00 ? 69 ALA A O    3  
ATOM 3430  C CB   . ALA A 1 69 ? -0.157  -1.344  -5.067  1.00 0.00 ? 69 ALA A CB   3  
ATOM 3431  H H    . ALA A 1 69 ? -1.037  -2.508  -2.554  1.00 0.00 ? 69 ALA A H    3  
ATOM 3432  H HA   . ALA A 1 69 ? -1.645  -2.818  -5.405  1.00 0.00 ? 69 ALA A HA   3  
ATOM 3433  H HB1  . ALA A 1 69 ? 0.821   -1.329  -4.607  1.00 0.00 ? 69 ALA A HB1  3  
ATOM 3434  H HB2  . ALA A 1 69 ? -0.721  -0.483  -4.739  1.00 0.00 ? 69 ALA A HB2  3  
ATOM 3435  H HB3  . ALA A 1 69 ? -0.049  -1.317  -6.142  1.00 0.00 ? 69 ALA A HB3  3  
ATOM 3436  N N    . PRO A 1 70 ? 0.229   -4.530  -5.722  1.00 0.00 ? 70 PRO A N    3  
ATOM 3437  C CA   . PRO A 1 70 ? 1.133   -5.684  -5.791  1.00 0.00 ? 70 PRO A CA   3  
ATOM 3438  C C    . PRO A 1 70 ? 2.560   -5.324  -5.392  1.00 0.00 ? 70 PRO A C    3  
ATOM 3439  O O    . PRO A 1 70 ? 3.025   -4.215  -5.651  1.00 0.00 ? 70 PRO A O    3  
ATOM 3440  C CB   . PRO A 1 70 ? 1.078   -6.099  -7.264  1.00 0.00 ? 70 PRO A CB   3  
ATOM 3441  C CG   . PRO A 1 70 ? -0.221  -5.569  -7.763  1.00 0.00 ? 70 PRO A CG   3  
ATOM 3442  C CD   . PRO A 1 70 ? -0.471  -4.300  -6.998  1.00 0.00 ? 70 PRO A CD   3  
ATOM 3443  H HA   . PRO A 1 70 ? 0.782   -6.497  -5.171  1.00 0.00 ? 70 PRO A HA   3  
ATOM 3444  H HB2  . PRO A 1 70 ? 1.913   -5.663  -7.793  1.00 0.00 ? 70 PRO A HB2  3  
ATOM 3445  H HB3  . PRO A 1 70 ? 1.119   -7.175  -7.339  1.00 0.00 ? 70 PRO A HB3  3  
ATOM 3446  H HG2  . PRO A 1 70 ? -0.152  -5.363  -8.822  1.00 0.00 ? 70 PRO A HG2  3  
ATOM 3447  H HG3  . PRO A 1 70 ? -1.008  -6.283  -7.570  1.00 0.00 ? 70 PRO A HG3  3  
ATOM 3448  H HD2  . PRO A 1 70 ? -0.051  -3.454  -7.523  1.00 0.00 ? 70 PRO A HD2  3  
ATOM 3449  H HD3  . PRO A 1 70 ? -1.529  -4.159  -6.838  1.00 0.00 ? 70 PRO A HD3  3  
ATOM 3450  N N    . ILE A 1 71 ? 3.249   -6.268  -4.760  1.00 0.00 ? 71 ILE A N    3  
ATOM 3451  C CA   . ILE A 1 71 ? 4.623   -6.048  -4.324  1.00 0.00 ? 71 ILE A CA   3  
ATOM 3452  C C    . ILE A 1 71 ? 5.533   -5.731  -5.508  1.00 0.00 ? 71 ILE A C    3  
ATOM 3453  O O    . ILE A 1 71 ? 6.327   -4.792  -5.458  1.00 0.00 ? 71 ILE A O    3  
ATOM 3454  C CB   . ILE A 1 71 ? 5.177   -7.273  -3.568  1.00 0.00 ? 71 ILE A CB   3  
ATOM 3455  C CG1  . ILE A 1 71 ? 6.583   -6.983  -3.037  1.00 0.00 ? 71 ILE A CG1  3  
ATOM 3456  C CG2  . ILE A 1 71 ? 5.188   -8.498  -4.470  1.00 0.00 ? 71 ILE A CG2  3  
ATOM 3457  C CD1  . ILE A 1 71 ? 7.188   -8.135  -2.265  1.00 0.00 ? 71 ILE A CD1  3  
ATOM 3458  H H    . ILE A 1 71 ? 2.824   -7.132  -4.580  1.00 0.00 ? 71 ILE A H    3  
ATOM 3459  H HA   . ILE A 1 71 ? 4.625   -5.205  -3.649  1.00 0.00 ? 71 ILE A HA   3  
ATOM 3460  H HB   . ILE A 1 71 ? 4.523   -7.479  -2.735  1.00 0.00 ? 71 ILE A HB   3  
ATOM 3461  H HG12 . ILE A 1 71 ? 7.237   -6.763  -3.867  1.00 0.00 ? 71 ILE A HG12 3  
ATOM 3462  H HG13 . ILE A 1 71 ? 6.543   -6.126  -2.379  1.00 0.00 ? 71 ILE A HG13 3  
ATOM 3463  H HG21 . ILE A 1 71 ? 5.944   -8.378  -5.233  1.00 0.00 ? 71 ILE A HG21 3  
ATOM 3464  H HG22 . ILE A 1 71 ? 4.221   -8.610  -4.937  1.00 0.00 ? 71 ILE A HG22 3  
ATOM 3465  H HG23 . ILE A 1 71 ? 5.408   -9.377  -3.882  1.00 0.00 ? 71 ILE A HG23 3  
ATOM 3466  H HD11 . ILE A 1 71 ? 8.210   -8.283  -2.581  1.00 0.00 ? 71 ILE A HD11 3  
ATOM 3467  H HD12 . ILE A 1 71 ? 6.619   -9.033  -2.455  1.00 0.00 ? 71 ILE A HD12 3  
ATOM 3468  H HD13 . ILE A 1 71 ? 7.166   -7.912  -1.209  1.00 0.00 ? 71 ILE A HD13 3  
ATOM 3469  N N    . HIS A 1 72 ? 5.411   -6.517  -6.573  1.00 0.00 ? 72 HIS A N    3  
ATOM 3470  C CA   . HIS A 1 72 ? 6.225   -6.315  -7.767  1.00 0.00 ? 72 HIS A CA   3  
ATOM 3471  C C    . HIS A 1 72 ? 5.935   -4.960  -8.408  1.00 0.00 ? 72 HIS A C    3  
ATOM 3472  O O    . HIS A 1 72 ? 6.728   -4.460  -9.206  1.00 0.00 ? 72 HIS A O    3  
ATOM 3473  C CB   . HIS A 1 72 ? 5.980   -7.436  -8.779  1.00 0.00 ? 72 HIS A CB   3  
ATOM 3474  C CG   . HIS A 1 72 ? 4.532   -7.759  -8.981  1.00 0.00 ? 72 HIS A CG   3  
ATOM 3475  N ND1  . HIS A 1 72 ? 3.826   -8.646  -8.200  1.00 0.00 ? 72 HIS A ND1  3  
ATOM 3476  C CD2  . HIS A 1 72 ? 3.653   -7.292  -9.905  1.00 0.00 ? 72 HIS A CD2  3  
ATOM 3477  C CE1  . HIS A 1 72 ? 2.570   -8.694  -8.663  1.00 0.00 ? 72 HIS A CE1  3  
ATOM 3478  N NE2  . HIS A 1 72 ? 2.412   -7.889  -9.698  1.00 0.00 ? 72 HIS A NE2  3  
ATOM 3479  H H    . HIS A 1 72 ? 4.761   -7.250  -6.557  1.00 0.00 ? 72 HIS A H    3  
ATOM 3480  H HA   . HIS A 1 72 ? 7.262   -6.339  -7.465  1.00 0.00 ? 72 HIS A HA   3  
ATOM 3481  H HB2  . HIS A 1 72 ? 6.390   -7.145  -9.734  1.00 0.00 ? 72 HIS A HB2  3  
ATOM 3482  H HB3  . HIS A 1 72 ? 6.476   -8.333  -8.438  1.00 0.00 ? 72 HIS A HB3  3  
ATOM 3483  H HD1  . HIS A 1 72 ? 4.180   -9.155  -7.441  1.00 0.00 ? 72 HIS A HD1  3  
ATOM 3484  H HD2  . HIS A 1 72 ? 3.870   -6.574  -10.682 1.00 0.00 ? 72 HIS A HD2  3  
ATOM 3485  H HE1  . HIS A 1 72 ? 1.787   -9.309  -8.244  1.00 0.00 ? 72 HIS A HE1  3  
ATOM 3486  N N    . LYS A 1 73 ? 4.798   -4.366  -8.054  1.00 0.00 ? 73 LYS A N    3  
ATOM 3487  C CA   . LYS A 1 73 ? 4.414   -3.069  -8.598  1.00 0.00 ? 73 LYS A CA   3  
ATOM 3488  C C    . LYS A 1 73 ? 4.791   -1.940  -7.644  1.00 0.00 ? 73 LYS A C    3  
ATOM 3489  O O    . LYS A 1 73 ? 4.190   -0.866  -7.670  1.00 0.00 ? 73 LYS A O    3  
ATOM 3490  C CB   . LYS A 1 73 ? 2.909   -3.035  -8.875  1.00 0.00 ? 73 LYS A CB   3  
ATOM 3491  C CG   . LYS A 1 73 ? 2.448   -4.098  -9.861  1.00 0.00 ? 73 LYS A CG   3  
ATOM 3492  C CD   . LYS A 1 73 ? 2.077   -3.490  -11.204 1.00 0.00 ? 73 LYS A CD   3  
ATOM 3493  C CE   . LYS A 1 73 ? 0.772   -2.713  -11.127 1.00 0.00 ? 73 LYS A CE   3  
ATOM 3494  N NZ   . LYS A 1 73 ? -0.123  -3.013  -12.278 1.00 0.00 ? 73 LYS A NZ   3  
ATOM 3495  H H    . LYS A 1 73 ? 4.204   -4.810  -7.413  1.00 0.00 ? 73 LYS A H    3  
ATOM 3496  H HA   . LYS A 1 73 ? 4.944   -2.931  -9.528  1.00 0.00 ? 73 LYS A HA   3  
ATOM 3497  H HB2  . LYS A 1 73 ? 2.381   -3.185  -7.945  1.00 0.00 ? 73 LYS A HB2  3  
ATOM 3498  H HB3  . LYS A 1 73 ? 2.650   -2.066  -9.274  1.00 0.00 ? 73 LYS A HB3  3  
ATOM 3499  H HG2  . LYS A 1 73 ? 3.246   -4.809  -10.007 1.00 0.00 ? 73 LYS A HG2  3  
ATOM 3500  H HG3  . LYS A 1 73 ? 1.584   -4.601  -9.453  1.00 0.00 ? 73 LYS A HG3  3  
ATOM 3501  H HD2  . LYS A 1 73 ? 2.864   -2.820  -11.515 1.00 0.00 ? 73 LYS A HD2  3  
ATOM 3502  H HD3  . LYS A 1 73 ? 1.970   -4.284  -11.930 1.00 0.00 ? 73 LYS A HD3  3  
ATOM 3503  H HE2  . LYS A 1 73 ? 0.265   -2.977  -10.210 1.00 0.00 ? 73 LYS A HE2  3  
ATOM 3504  H HE3  . LYS A 1 73 ? 0.997   -1.656  -11.121 1.00 0.00 ? 73 LYS A HE3  3  
ATOM 3505  H HZ1  . LYS A 1 73 ? -0.312  -4.035  -12.327 1.00 0.00 ? 73 LYS A HZ1  3  
ATOM 3506  H HZ2  . LYS A 1 73 ? 0.325   -2.712  -13.167 1.00 0.00 ? 73 LYS A HZ2  3  
ATOM 3507  H HZ3  . LYS A 1 73 ? -1.026  -2.508  -12.170 1.00 0.00 ? 73 LYS A HZ3  3  
ATOM 3508  N N    . VAL A 1 74 ? 5.790   -2.187  -6.801  1.00 0.00 ? 74 VAL A N    3  
ATOM 3509  C CA   . VAL A 1 74 ? 6.245   -1.188  -5.841  1.00 0.00 ? 74 VAL A CA   3  
ATOM 3510  C C    . VAL A 1 74 ? 7.683   -0.767  -6.125  1.00 0.00 ? 74 VAL A C    3  
ATOM 3511  O O    . VAL A 1 74 ? 8.518   -1.590  -6.501  1.00 0.00 ? 74 VAL A O    3  
ATOM 3512  C CB   . VAL A 1 74 ? 6.151   -1.713  -4.395  1.00 0.00 ? 74 VAL A CB   3  
ATOM 3513  C CG1  . VAL A 1 74 ? 6.487   -0.610  -3.402  1.00 0.00 ? 74 VAL A CG1  3  
ATOM 3514  C CG2  . VAL A 1 74 ? 4.766   -2.282  -4.121  1.00 0.00 ? 74 VAL A CG2  3  
ATOM 3515  H H    . VAL A 1 74 ? 6.233   -3.061  -6.824  1.00 0.00 ? 74 VAL A H    3  
ATOM 3516  H HA   . VAL A 1 74 ? 5.602   -0.323  -5.930  1.00 0.00 ? 74 VAL A HA   3  
ATOM 3517  H HB   . VAL A 1 74 ? 6.874   -2.506  -4.274  1.00 0.00 ? 74 VAL A HB   3  
ATOM 3518  H HG11 . VAL A 1 74 ? 6.291   0.351   -3.853  1.00 0.00 ? 74 VAL A HG11 3  
ATOM 3519  H HG12 . VAL A 1 74 ? 7.530   -0.675  -3.131  1.00 0.00 ? 74 VAL A HG12 3  
ATOM 3520  H HG13 . VAL A 1 74 ? 5.878   -0.723  -2.517  1.00 0.00 ? 74 VAL A HG13 3  
ATOM 3521  H HG21 . VAL A 1 74 ? 4.252   -2.445  -5.056  1.00 0.00 ? 74 VAL A HG21 3  
ATOM 3522  H HG22 . VAL A 1 74 ? 4.203   -1.587  -3.516  1.00 0.00 ? 74 VAL A HG22 3  
ATOM 3523  H HG23 . VAL A 1 74 ? 4.861   -3.221  -3.595  1.00 0.00 ? 74 VAL A HG23 3  
ATOM 3524  N N    . ILE A 1 75 ? 7.964   0.519   -5.944  1.00 0.00 ? 75 ILE A N    3  
ATOM 3525  C CA   . ILE A 1 75 ? 9.301   1.050   -6.181  1.00 0.00 ? 75 ILE A CA   3  
ATOM 3526  C C    . ILE A 1 75 ? 9.843   1.749   -4.939  1.00 0.00 ? 75 ILE A C    3  
ATOM 3527  O O    . ILE A 1 75 ? 9.217   2.666   -4.407  1.00 0.00 ? 75 ILE A O    3  
ATOM 3528  C CB   . ILE A 1 75 ? 9.311   2.042   -7.359  1.00 0.00 ? 75 ILE A CB   3  
ATOM 3529  C CG1  . ILE A 1 75 ? 8.590   1.442   -8.568  1.00 0.00 ? 75 ILE A CG1  3  
ATOM 3530  C CG2  . ILE A 1 75 ? 10.739  2.422   -7.721  1.00 0.00 ? 75 ILE A CG2  3  
ATOM 3531  C CD1  . ILE A 1 75 ? 9.264   0.205   -9.119  1.00 0.00 ? 75 ILE A CD1  3  
ATOM 3532  H H    . ILE A 1 75 ? 7.256   1.126   -5.643  1.00 0.00 ? 75 ILE A H    3  
ATOM 3533  H HA   . ILE A 1 75 ? 9.950   0.222   -6.429  1.00 0.00 ? 75 ILE A HA   3  
ATOM 3534  H HB   . ILE A 1 75 ? 8.795   2.940   -7.050  1.00 0.00 ? 75 ILE A HB   3  
ATOM 3535  H HG12 . ILE A 1 75 ? 7.585   1.171   -8.281  1.00 0.00 ? 75 ILE A HG12 3  
ATOM 3536  H HG13 . ILE A 1 75 ? 8.549   2.179   -9.356  1.00 0.00 ? 75 ILE A HG13 3  
ATOM 3537  H HG21 . ILE A 1 75 ? 11.308  2.586   -6.818  1.00 0.00 ? 75 ILE A HG21 3  
ATOM 3538  H HG22 . ILE A 1 75 ? 10.733  3.324   -8.313  1.00 0.00 ? 75 ILE A HG22 3  
ATOM 3539  H HG23 . ILE A 1 75 ? 11.191  1.621   -8.289  1.00 0.00 ? 75 ILE A HG23 3  
ATOM 3540  H HD11 . ILE A 1 75 ? 8.772   -0.096  -10.032 1.00 0.00 ? 75 ILE A HD11 3  
ATOM 3541  H HD12 . ILE A 1 75 ? 9.199   -0.594  -8.395  1.00 0.00 ? 75 ILE A HD12 3  
ATOM 3542  H HD13 . ILE A 1 75 ? 10.302  0.422   -9.324  1.00 0.00 ? 75 ILE A HD13 3  
ATOM 3543  N N    . ARG A 1 76 ? 11.009  1.308   -4.480  1.00 0.00 ? 76 ARG A N    3  
ATOM 3544  C CA   . ARG A 1 76 ? 11.636  1.891   -3.299  1.00 0.00 ? 76 ARG A CA   3  
ATOM 3545  C C    . ARG A 1 76 ? 12.142  3.300   -3.591  1.00 0.00 ? 76 ARG A C    3  
ATOM 3546  O O    . ARG A 1 76 ? 12.802  3.536   -4.603  1.00 0.00 ? 76 ARG A O    3  
ATOM 3547  C CB   . ARG A 1 76 ? 12.790  1.006   -2.819  1.00 0.00 ? 76 ARG A CB   3  
ATOM 3548  C CG   . ARG A 1 76 ? 12.714  0.656   -1.342  1.00 0.00 ? 76 ARG A CG   3  
ATOM 3549  C CD   . ARG A 1 76 ? 12.474  -0.831  -1.130  1.00 0.00 ? 76 ARG A CD   3  
ATOM 3550  N NE   . ARG A 1 76 ? 13.053  -1.306  0.123   1.00 0.00 ? 76 ARG A NE   3  
ATOM 3551  C CZ   . ARG A 1 76 ? 13.126  -2.590  0.467   1.00 0.00 ? 76 ARG A CZ   3  
ATOM 3552  N NH1  . ARG A 1 76 ? 12.657  -3.529  -0.346  1.00 0.00 ? 76 ARG A NH1  3  
ATOM 3553  N NH2  . ARG A 1 76 ? 13.670  -2.936  1.625   1.00 0.00 ? 76 ARG A NH2  3  
ATOM 3554  H H    . ARG A 1 76 ? 11.461  0.573   -4.946  1.00 0.00 ? 76 ARG A H    3  
ATOM 3555  H HA   . ARG A 1 76 ? 10.889  1.944   -2.521  1.00 0.00 ? 76 ARG A HA   3  
ATOM 3556  H HB2  . ARG A 1 76 ? 12.783  0.088   -3.388  1.00 0.00 ? 76 ARG A HB2  3  
ATOM 3557  H HB3  . ARG A 1 76 ? 13.723  1.521   -2.997  1.00 0.00 ? 76 ARG A HB3  3  
ATOM 3558  H HG2  . ARG A 1 76 ? 13.644  0.930   -0.868  1.00 0.00 ? 76 ARG A HG2  3  
ATOM 3559  H HG3  . ARG A 1 76 ? 11.903  1.210   -0.892  1.00 0.00 ? 76 ARG A HG3  3  
ATOM 3560  H HD2  . ARG A 1 76 ? 11.409  -1.012  -1.114  1.00 0.00 ? 76 ARG A HD2  3  
ATOM 3561  H HD3  . ARG A 1 76 ? 12.918  -1.374  -1.952  1.00 0.00 ? 76 ARG A HD3  3  
ATOM 3562  H HE   . ARG A 1 76 ? 13.408  -0.633  0.742   1.00 0.00 ? 76 ARG A HE   3  
ATOM 3563  H HH11 . ARG A 1 76 ? 12.246  -3.275  -1.221  1.00 0.00 ? 76 ARG A HH11 3  
ATOM 3564  H HH12 . ARG A 1 76 ? 12.715  -4.492  -0.082  1.00 0.00 ? 76 ARG A HH12 3  
ATOM 3565  H HH21 . ARG A 1 76 ? 14.026  -2.233  2.241   1.00 0.00 ? 76 ARG A HH21 3  
ATOM 3566  H HH22 . ARG A 1 76 ? 13.725  -3.901  1.884   1.00 0.00 ? 76 ARG A HH22 3  
ATOM 3567  N N    . ILE A 1 77 ? 11.830  4.233   -2.697  1.00 0.00 ? 77 ILE A N    3  
ATOM 3568  C CA   . ILE A 1 77 ? 12.254  5.618   -2.859  1.00 0.00 ? 77 ILE A CA   3  
ATOM 3569  C C    . ILE A 1 77 ? 12.633  6.237   -1.519  1.00 0.00 ? 77 ILE A C    3  
ATOM 3570  O O    . ILE A 1 77 ? 12.474  7.440   -1.311  1.00 0.00 ? 77 ILE A O    3  
ATOM 3571  C CB   . ILE A 1 77 ? 11.150  6.472   -3.511  1.00 0.00 ? 77 ILE A CB   3  
ATOM 3572  C CG1  . ILE A 1 77 ? 9.830   6.301   -2.757  1.00 0.00 ? 77 ILE A CG1  3  
ATOM 3573  C CG2  . ILE A 1 77 ? 10.983  6.094   -4.975  1.00 0.00 ? 77 ILE A CG2  3  
ATOM 3574  C CD1  . ILE A 1 77 ? 9.031   7.582   -2.641  1.00 0.00 ? 77 ILE A CD1  3  
ATOM 3575  H H    . ILE A 1 77 ? 11.302  3.984   -1.910  1.00 0.00 ? 77 ILE A H    3  
ATOM 3576  H HA   . ILE A 1 77 ? 13.119  5.629   -3.508  1.00 0.00 ? 77 ILE A HA   3  
ATOM 3577  H HB   . ILE A 1 77 ? 11.452  7.507   -3.466  1.00 0.00 ? 77 ILE A HB   3  
ATOM 3578  H HG12 . ILE A 1 77 ? 9.220   5.576   -3.272  1.00 0.00 ? 77 ILE A HG12 3  
ATOM 3579  H HG13 . ILE A 1 77 ? 10.037  5.947   -1.758  1.00 0.00 ? 77 ILE A HG13 3  
ATOM 3580  H HG21 . ILE A 1 77 ? 10.184  6.677   -5.409  1.00 0.00 ? 77 ILE A HG21 3  
ATOM 3581  H HG22 . ILE A 1 77 ? 10.744  5.043   -5.051  1.00 0.00 ? 77 ILE A HG22 3  
ATOM 3582  H HG23 . ILE A 1 77 ? 11.902  6.292   -5.506  1.00 0.00 ? 77 ILE A HG23 3  
ATOM 3583  H HD11 . ILE A 1 77 ? 9.705   8.417   -2.518  1.00 0.00 ? 77 ILE A HD11 3  
ATOM 3584  H HD12 . ILE A 1 77 ? 8.375   7.519   -1.786  1.00 0.00 ? 77 ILE A HD12 3  
ATOM 3585  H HD13 . ILE A 1 77 ? 8.444   7.721   -3.537  1.00 0.00 ? 77 ILE A HD13 3  
ATOM 3586  N N    . GLY A 1 78 ? 13.135  5.407   -0.610  1.00 0.00 ? 78 GLY A N    3  
ATOM 3587  C CA   . GLY A 1 78 ? 13.528  5.892   0.700   1.00 0.00 ? 78 GLY A CA   3  
ATOM 3588  C C    . GLY A 1 78 ? 14.508  4.964   1.392   1.00 0.00 ? 78 GLY A C    3  
ATOM 3589  O O    . GLY A 1 78 ? 14.237  4.470   2.487   1.00 0.00 ? 78 GLY A O    3  
ATOM 3590  H H    . GLY A 1 78 ? 13.239  4.458   -0.831  1.00 0.00 ? 78 GLY A H    3  
ATOM 3591  H HA2  . GLY A 1 78 ? 13.986  6.863   0.590   1.00 0.00 ? 78 GLY A HA2  3  
ATOM 3592  H HA3  . GLY A 1 78 ? 12.646  5.989   1.315   1.00 0.00 ? 78 GLY A HA3  3  
ATOM 3593  N N    . SER A 1 79 ? 15.648  4.726   0.752   1.00 0.00 ? 79 SER A N    3  
ATOM 3594  C CA   . SER A 1 79 ? 16.671  3.851   1.312   1.00 0.00 ? 79 SER A CA   3  
ATOM 3595  C C    . SER A 1 79 ? 17.434  4.553   2.430   1.00 0.00 ? 79 SER A C    3  
ATOM 3596  O O    . SER A 1 79 ? 17.433  5.781   2.521   1.00 0.00 ? 79 SER A O    3  
ATOM 3597  C CB   . SER A 1 79 ? 17.643  3.403   0.220   1.00 0.00 ? 79 SER A CB   3  
ATOM 3598  O OG   . SER A 1 79 ? 17.218  2.189   -0.377  1.00 0.00 ? 79 SER A OG   3  
ATOM 3599  H H    . SER A 1 79 ? 15.804  5.149   -0.118  1.00 0.00 ? 79 SER A H    3  
ATOM 3600  H HA   . SER A 1 79 ? 16.176  2.982   1.720   1.00 0.00 ? 79 SER A HA   3  
ATOM 3601  H HB2  . SER A 1 79 ? 17.698  4.164   -0.545  1.00 0.00 ? 79 SER A HB2  3  
ATOM 3602  H HB3  . SER A 1 79 ? 18.623  3.255   0.651   1.00 0.00 ? 79 SER A HB3  3  
ATOM 3603  H HG   . SER A 1 79 ? 17.013  1.550   0.309   1.00 0.00 ? 79 SER A HG   3  
ATOM 3604  N N    . GLY A 1 80 ? 18.084  3.766   3.282   1.00 0.00 ? 80 GLY A N    3  
ATOM 3605  C CA   . GLY A 1 80 ? 18.842  4.329   4.383   1.00 0.00 ? 80 GLY A CA   3  
ATOM 3606  C C    . GLY A 1 80 ? 20.334  4.100   4.239   1.00 0.00 ? 80 GLY A C    3  
ATOM 3607  O O    . GLY A 1 80 ? 20.903  3.252   4.927   1.00 0.00 ? 80 GLY A O    3  
ATOM 3608  H H    . GLY A 1 80 ? 18.048  2.794   3.161   1.00 0.00 ? 80 GLY A H    3  
ATOM 3609  H HA2  . GLY A 1 80 ? 18.654  5.393   4.429   1.00 0.00 ? 80 GLY A HA2  3  
ATOM 3610  H HA3  . GLY A 1 80 ? 18.507  3.876   5.305   1.00 0.00 ? 80 GLY A HA3  3  
ATOM 3611  N N    . PRO A 1 81 ? 21.003  4.848   3.344   1.00 0.00 ? 81 PRO A N    3  
ATOM 3612  C CA   . PRO A 1 81 ? 22.446  4.712   3.122   1.00 0.00 ? 81 PRO A CA   3  
ATOM 3613  C C    . PRO A 1 81 ? 23.265  5.216   4.305   1.00 0.00 ? 81 PRO A C    3  
ATOM 3614  O O    . PRO A 1 81 ? 23.003  6.294   4.839   1.00 0.00 ? 81 PRO A O    3  
ATOM 3615  C CB   . PRO A 1 81 ? 22.700  5.580   1.887   1.00 0.00 ? 81 PRO A CB   3  
ATOM 3616  C CG   . PRO A 1 81 ? 21.601  6.584   1.898   1.00 0.00 ? 81 PRO A CG   3  
ATOM 3617  C CD   . PRO A 1 81 ? 20.405  5.884   2.480   1.00 0.00 ? 81 PRO A CD   3  
ATOM 3618  H HA   . PRO A 1 81 ? 22.718  3.688   2.908   1.00 0.00 ? 81 PRO A HA   3  
ATOM 3619  H HB2  . PRO A 1 81 ? 23.668  6.051   1.968   1.00 0.00 ? 81 PRO A HB2  3  
ATOM 3620  H HB3  . PRO A 1 81 ? 22.664  4.967   0.999   1.00 0.00 ? 81 PRO A HB3  3  
ATOM 3621  H HG2  . PRO A 1 81 ? 21.879  7.427   2.514   1.00 0.00 ? 81 PRO A HG2  3  
ATOM 3622  H HG3  . PRO A 1 81 ? 21.390  6.909   0.890   1.00 0.00 ? 81 PRO A HG3  3  
ATOM 3623  H HD2  . PRO A 1 81 ? 19.809  6.574   3.061   1.00 0.00 ? 81 PRO A HD2  3  
ATOM 3624  H HD3  . PRO A 1 81 ? 19.811  5.436   1.698   1.00 0.00 ? 81 PRO A HD3  3  
ATOM 3625  N N    . SER A 1 82 ? 24.256  4.430   4.710   1.00 0.00 ? 82 SER A N    3  
ATOM 3626  C CA   . SER A 1 82 ? 25.114  4.798   5.830   1.00 0.00 ? 82 SER A CA   3  
ATOM 3627  C C    . SER A 1 82 ? 26.330  5.584   5.350   1.00 0.00 ? 82 SER A C    3  
ATOM 3628  O O    . SER A 1 82 ? 26.546  5.738   4.148   1.00 0.00 ? 82 SER A O    3  
ATOM 3629  C CB   . SER A 1 82 ? 25.567  3.546   6.586   1.00 0.00 ? 82 SER A CB   3  
ATOM 3630  O OG   . SER A 1 82 ? 24.665  3.226   7.630   1.00 0.00 ? 82 SER A OG   3  
ATOM 3631  H H    . SER A 1 82 ? 24.416  3.584   4.244   1.00 0.00 ? 82 SER A H    3  
ATOM 3632  H HA   . SER A 1 82 ? 24.538  5.421   6.499   1.00 0.00 ? 82 SER A HA   3  
ATOM 3633  H HB2  . SER A 1 82 ? 25.615  2.714   5.901   1.00 0.00 ? 82 SER A HB2  3  
ATOM 3634  H HB3  . SER A 1 82 ? 26.545  3.720   7.010   1.00 0.00 ? 82 SER A HB3  3  
ATOM 3635  H HG   . SER A 1 82 ? 24.456  4.020   8.129   1.00 0.00 ? 82 SER A HG   3  
ATOM 3636  N N    . SER A 1 83 ? 27.120  6.079   6.298   1.00 0.00 ? 83 SER A N    3  
ATOM 3637  C CA   . SER A 1 83 ? 28.315  6.849   5.971   1.00 0.00 ? 83 SER A CA   3  
ATOM 3638  C C    . SER A 1 83 ? 29.533  6.303   6.707   1.00 0.00 ? 83 SER A C    3  
ATOM 3639  O O    . SER A 1 83 ? 29.887  6.785   7.784   1.00 0.00 ? 83 SER A O    3  
ATOM 3640  C CB   . SER A 1 83 ? 28.109  8.322   6.324   1.00 0.00 ? 83 SER A CB   3  
ATOM 3641  O OG   . SER A 1 83 ? 28.724  9.168   5.366   1.00 0.00 ? 83 SER A OG   3  
ATOM 3642  H H    . SER A 1 83 ? 26.895  5.922   7.238   1.00 0.00 ? 83 SER A H    3  
ATOM 3643  H HA   . SER A 1 83 ? 28.484  6.763   4.907   1.00 0.00 ? 83 SER A HA   3  
ATOM 3644  H HB2  . SER A 1 83 ? 27.051  8.541   6.350   1.00 0.00 ? 83 SER A HB2  3  
ATOM 3645  H HB3  . SER A 1 83 ? 28.541  8.523   7.293   1.00 0.00 ? 83 SER A HB3  3  
ATOM 3646  H HG   . SER A 1 83 ? 28.051  9.687   4.918   1.00 0.00 ? 83 SER A HG   3  
ATOM 3647  N N    . GLY A 1 84 ? 30.171  5.294   6.122   1.00 0.00 ? 84 GLY A N    3  
ATOM 3648  C CA   . GLY A 1 84 ? 31.342  4.700   6.737   1.00 0.00 ? 84 GLY A CA   3  
ATOM 3649  C C    . GLY A 1 84 ? 31.992  3.653   5.855   1.00 0.00 ? 84 GLY A C    3  
ATOM 3650  O O    . GLY A 1 84 ? 31.322  2.649   5.534   1.00 0.00 ? 84 GLY A O    3  
ATOM 3651  O OXT  . GLY A 1 84 ? 33.171  3.835   5.486   1.00 0.00 ? 84 GLY A OXT  3  
ATOM 3652  H H    . GLY A 1 84 ? 29.843  4.952   5.264   1.00 0.00 ? 84 GLY A H    3  
ATOM 3653  H HA2  . GLY A 1 84 ? 32.061  5.480   6.942   1.00 0.00 ? 84 GLY A HA2  3  
ATOM 3654  H HA3  . GLY A 1 84 ? 31.051  4.240   7.669   1.00 0.00 ? 84 GLY A HA3  3  
ATOM 3655  N N    . GLY A 1 1  ? 7.842   -9.808  -17.155 1.00 0.00 ? 1  GLY A N    4  
ATOM 3656  C CA   . GLY A 1 1  ? 8.965   -9.355  -18.021 1.00 0.00 ? 1  GLY A CA   4  
ATOM 3657  C C    . GLY A 1 1  ? 10.289  -9.317  -17.282 1.00 0.00 ? 1  GLY A C    4  
ATOM 3658  O O    . GLY A 1 1  ? 11.234  -10.015 -17.650 1.00 0.00 ? 1  GLY A O    4  
ATOM 3659  H H1   . GLY A 1 1  ? 8.169   -10.549 -16.504 1.00 0.00 ? 1  GLY A H1   4  
ATOM 3660  H H2   . GLY A 1 1  ? 7.071   -10.190 -17.739 1.00 0.00 ? 1  GLY A H2   4  
ATOM 3661  H H3   . GLY A 1 1  ? 7.476   -9.009  -16.598 1.00 0.00 ? 1  GLY A H3   4  
ATOM 3662  H HA2  . GLY A 1 1  ? 9.054   -10.030 -18.860 1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3663  H HA3  . GLY A 1 1  ? 8.744   -8.365  -18.391 1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3664  N N    . SER A 1 2  ? 10.357  -8.500  -16.236 1.00 0.00 ? 2  SER A N    4  
ATOM 3665  C CA   . SER A 1 2  ? 11.574  -8.372  -15.443 1.00 0.00 ? 2  SER A CA   4  
ATOM 3666  C C    . SER A 1 2  ? 11.296  -8.660  -13.971 1.00 0.00 ? 2  SER A C    4  
ATOM 3667  O O    . SER A 1 2  ? 10.692  -7.845  -13.273 1.00 0.00 ? 2  SER A O    4  
ATOM 3668  C CB   . SER A 1 2  ? 12.165  -6.970  -15.598 1.00 0.00 ? 2  SER A CB   4  
ATOM 3669  O OG   . SER A 1 2  ? 13.581  -7.012  -15.625 1.00 0.00 ? 2  SER A OG   4  
ATOM 3670  H H    . SER A 1 2  ? 9.569   -7.969  -15.992 1.00 0.00 ? 2  SER A H    4  
ATOM 3671  H HA   . SER A 1 2  ? 12.286  -9.096  -15.809 1.00 0.00 ? 2  SER A HA   4  
ATOM 3672  H HB2  . SER A 1 2  ? 11.813  -6.534  -16.521 1.00 0.00 ? 2  SER A HB2  4  
ATOM 3673  H HB3  . SER A 1 2  ? 11.850  -6.356  -14.767 1.00 0.00 ? 2  SER A HB3  4  
ATOM 3674  H HG   . SER A 1 2  ? 13.899  -7.546  -14.892 1.00 0.00 ? 2  SER A HG   4  
ATOM 3675  N N    . SER A 1 3  ? 11.741  -9.822  -13.506 1.00 0.00 ? 3  SER A N    4  
ATOM 3676  C CA   . SER A 1 3  ? 11.539  -10.216 -12.117 1.00 0.00 ? 3  SER A CA   4  
ATOM 3677  C C    . SER A 1 3  ? 12.841  -10.722 -11.500 1.00 0.00 ? 3  SER A C    4  
ATOM 3678  O O    . SER A 1 3  ? 13.706  -11.249 -12.199 1.00 0.00 ? 3  SER A O    4  
ATOM 3679  C CB   . SER A 1 3  ? 10.464  -11.300 -12.022 1.00 0.00 ? 3  SER A CB   4  
ATOM 3680  O OG   . SER A 1 3  ? 9.187   -10.781 -12.354 1.00 0.00 ? 3  SER A OG   4  
ATOM 3681  H H    . SER A 1 3  ? 12.216  -10.429 -14.111 1.00 0.00 ? 3  SER A H    4  
ATOM 3682  H HA   . SER A 1 3  ? 11.211  -9.346  -11.569 1.00 0.00 ? 3  SER A HA   4  
ATOM 3683  H HB2  . SER A 1 3  ? 10.701  -12.101 -12.706 1.00 0.00 ? 3  SER A HB2  4  
ATOM 3684  H HB3  . SER A 1 3  ? 10.431  -11.684 -11.014 1.00 0.00 ? 3  SER A HB3  4  
ATOM 3685  H HG   . SER A 1 3  ? 8.801   -10.362 -11.583 1.00 0.00 ? 3  SER A HG   4  
ATOM 3686  N N    . GLY A 1 4  ? 12.971  -10.557 -10.188 1.00 0.00 ? 4  GLY A N    4  
ATOM 3687  C CA   . GLY A 1 4  ? 14.169  -11.001 -9.500  1.00 0.00 ? 4  GLY A CA   4  
ATOM 3688  C C    . GLY A 1 4  ? 14.077  -10.820 -7.999  1.00 0.00 ? 4  GLY A C    4  
ATOM 3689  O O    . GLY A 1 4  ? 13.693  -11.740 -7.277  1.00 0.00 ? 4  GLY A O    4  
ATOM 3690  H H    . GLY A 1 4  ? 12.247  -10.131 -9.683  1.00 0.00 ? 4  GLY A H    4  
ATOM 3691  H HA2  . GLY A 1 4  ? 14.327  -12.047 -9.717  1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3692  H HA3  . GLY A 1 4  ? 15.012  -10.436 -9.869  1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3693  N N    . SER A 1 5  ? 14.430  -9.628  -7.525  1.00 0.00 ? 5  SER A N    4  
ATOM 3694  C CA   . SER A 1 5  ? 14.385  -9.328  -6.099  1.00 0.00 ? 5  SER A CA   4  
ATOM 3695  C C    . SER A 1 5  ? 13.296  -8.306  -5.792  1.00 0.00 ? 5  SER A C    4  
ATOM 3696  O O    . SER A 1 5  ? 13.361  -7.161  -6.242  1.00 0.00 ? 5  SER A O    4  
ATOM 3697  C CB   . SER A 1 5  ? 15.742  -8.805  -5.624  1.00 0.00 ? 5  SER A CB   4  
ATOM 3698  O OG   . SER A 1 5  ? 16.624  -9.872  -5.326  1.00 0.00 ? 5  SER A OG   4  
ATOM 3699  H H    . SER A 1 5  ? 14.727  -8.935  -8.150  1.00 0.00 ? 5  SER A H    4  
ATOM 3700  H HA   . SER A 1 5  ? 14.159  -10.245 -5.575  1.00 0.00 ? 5  SER A HA   4  
ATOM 3701  H HB2  . SER A 1 5  ? 16.182  -8.196  -6.400  1.00 0.00 ? 5  SER A HB2  4  
ATOM 3702  H HB3  . SER A 1 5  ? 15.604  -8.209  -4.734  1.00 0.00 ? 5  SER A HB3  4  
ATOM 3703  H HG   . SER A 1 5  ? 16.172  -10.521 -4.782  1.00 0.00 ? 5  SER A HG   4  
ATOM 3704  N N    . SER A 1 6  ? 12.297  -8.725  -5.023  1.00 0.00 ? 6  SER A N    4  
ATOM 3705  C CA   . SER A 1 6  ? 11.194  -7.845  -4.656  1.00 0.00 ? 6  SER A CA   4  
ATOM 3706  C C    . SER A 1 6  ? 10.731  -8.119  -3.229  1.00 0.00 ? 6  SER A C    4  
ATOM 3707  O O    . SER A 1 6  ? 10.219  -9.198  -2.928  1.00 0.00 ? 6  SER A O    4  
ATOM 3708  C CB   . SER A 1 6  ? 10.026  -8.024  -5.627  1.00 0.00 ? 6  SER A CB   4  
ATOM 3709  O OG   . SER A 1 6  ? 9.984   -9.345  -6.137  1.00 0.00 ? 6  SER A OG   4  
ATOM 3710  H H    . SER A 1 6  ? 12.301  -9.648  -4.695  1.00 0.00 ? 6  SER A H    4  
ATOM 3711  H HA   . SER A 1 6  ? 11.548  -6.827  -4.717  1.00 0.00 ? 6  SER A HA   4  
ATOM 3712  H HB2  . SER A 1 6  ? 9.099   -7.822  -5.112  1.00 0.00 ? 6  SER A HB2  4  
ATOM 3713  H HB3  . SER A 1 6  ? 10.138  -7.336  -6.452  1.00 0.00 ? 6  SER A HB3  4  
ATOM 3714  H HG   . SER A 1 6  ? 9.107   -9.529  -6.482  1.00 0.00 ? 6  SER A HG   4  
ATOM 3715  N N    . GLY A 1 7  ? 10.915  -7.137  -2.353  1.00 0.00 ? 7  GLY A N    4  
ATOM 3716  C CA   . GLY A 1 7  ? 10.510  -7.291  -0.969  1.00 0.00 ? 7  GLY A CA   4  
ATOM 3717  C C    . GLY A 1 7  ? 10.649  -6.007  -0.175  1.00 0.00 ? 7  GLY A C    4  
ATOM 3718  O O    . GLY A 1 7  ? 11.643  -5.293  -0.309  1.00 0.00 ? 7  GLY A O    4  
ATOM 3719  H H    . GLY A 1 7  ? 11.327  -6.299  -2.650  1.00 0.00 ? 7  GLY A H    4  
ATOM 3720  H HA2  . GLY A 1 7  ? 9.478   -7.609  -0.940  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3721  H HA3  . GLY A 1 7  ? 11.122  -8.053  -0.509  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3722  N N    . LEU A 1 8  ? 9.651   -5.713  0.651   1.00 0.00 ? 8  LEU A N    4  
ATOM 3723  C CA   . LEU A 1 8  ? 9.667   -4.505  1.469   1.00 0.00 ? 8  LEU A CA   4  
ATOM 3724  C C    . LEU A 1 8  ? 9.387   -4.835  2.932   1.00 0.00 ? 8  LEU A C    4  
ATOM 3725  O O    . LEU A 1 8  ? 9.255   -6.002  3.300   1.00 0.00 ? 8  LEU A O    4  
ATOM 3726  C CB   . LEU A 1 8  ? 8.633   -3.501  0.954   1.00 0.00 ? 8  LEU A CB   4  
ATOM 3727  C CG   . LEU A 1 8  ? 8.550   -3.382  -0.571  1.00 0.00 ? 8  LEU A CG   4  
ATOM 3728  C CD1  . LEU A 1 8  ? 7.339   -4.134  -1.101  1.00 0.00 ? 8  LEU A CD1  4  
ATOM 3729  C CD2  . LEU A 1 8  ? 8.498   -1.921  -0.990  1.00 0.00 ? 8  LEU A CD2  4  
ATOM 3730  H H    . LEU A 1 8  ? 8.886   -6.322  0.713   1.00 0.00 ? 8  LEU A H    4  
ATOM 3731  H HA   . LEU A 1 8  ? 10.649  -4.066  1.392   1.00 0.00 ? 8  LEU A HA   4  
ATOM 3732  H HB2  . LEU A 1 8  ? 7.662   -3.795  1.327   1.00 0.00 ? 8  LEU A HB2  4  
ATOM 3733  H HB3  . LEU A 1 8  ? 8.875   -2.529  1.357   1.00 0.00 ? 8  LEU A HB3  4  
ATOM 3734  H HG   . LEU A 1 8  ? 9.434   -3.825  -1.008  1.00 0.00 ? 8  LEU A HG   4  
ATOM 3735  H HD11 . LEU A 1 8  ? 6.577   -4.176  -0.336  1.00 0.00 ? 8  LEU A HD11 4  
ATOM 3736  H HD12 . LEU A 1 8  ? 7.629   -5.138  -1.374  1.00 0.00 ? 8  LEU A HD12 4  
ATOM 3737  H HD13 . LEU A 1 8  ? 6.950   -3.623  -1.969  1.00 0.00 ? 8  LEU A HD13 4  
ATOM 3738  H HD21 . LEU A 1 8  ? 9.501   -1.566  -1.180  1.00 0.00 ? 8  LEU A HD21 4  
ATOM 3739  H HD22 . LEU A 1 8  ? 8.053   -1.335  -0.200  1.00 0.00 ? 8  LEU A HD22 4  
ATOM 3740  H HD23 . LEU A 1 8  ? 7.906   -1.825  -1.888  1.00 0.00 ? 8  LEU A HD23 4  
ATOM 3741  N N    . ARG A 1 9  ? 9.298   -3.800  3.761   1.00 0.00 ? 9  ARG A N    4  
ATOM 3742  C CA   . ARG A 1 9  ? 9.035   -3.979  5.183   1.00 0.00 ? 9  ARG A CA   4  
ATOM 3743  C C    . ARG A 1 9  ? 7.757   -3.256  5.595   1.00 0.00 ? 9  ARG A C    4  
ATOM 3744  O O    . ARG A 1 9  ? 7.084   -2.643  4.767   1.00 0.00 ? 9  ARG A O    4  
ATOM 3745  C CB   . ARG A 1 9  ? 10.215  -3.468  6.011   1.00 0.00 ? 9  ARG A CB   4  
ATOM 3746  C CG   . ARG A 1 9  ? 11.483  -4.288  5.835   1.00 0.00 ? 9  ARG A CG   4  
ATOM 3747  C CD   . ARG A 1 9  ? 12.206  -4.488  7.156   1.00 0.00 ? 9  ARG A CD   4  
ATOM 3748  N NE   . ARG A 1 9  ? 13.633  -4.741  6.968   1.00 0.00 ? 9  ARG A NE   4  
ATOM 3749  C CZ   . ARG A 1 9  ? 14.417  -5.292  7.892   1.00 0.00 ? 9  ARG A CZ   4  
ATOM 3750  N NH1  . ARG A 1 9  ? 13.918  -5.648  9.070   1.00 0.00 ? 9  ARG A NH1  4  
ATOM 3751  N NH2  . ARG A 1 9  ? 15.703  -5.488  7.638   1.00 0.00 ? 9  ARG A NH2  4  
ATOM 3752  H H    . ARG A 1 9  ? 9.412   -2.893  3.406   1.00 0.00 ? 9  ARG A H    4  
ATOM 3753  H HA   . ARG A 1 9  ? 8.910   -5.036  5.366   1.00 0.00 ? 9  ARG A HA   4  
ATOM 3754  H HB2  . ARG A 1 9  ? 10.427  -2.449  5.721   1.00 0.00 ? 9  ARG A HB2  4  
ATOM 3755  H HB3  . ARG A 1 9  ? 9.942   -3.486  7.056   1.00 0.00 ? 9  ARG A HB3  4  
ATOM 3756  H HG2  . ARG A 1 9  ? 11.222  -5.254  5.429   1.00 0.00 ? 9  ARG A HG2  4  
ATOM 3757  H HG3  . ARG A 1 9  ? 12.140  -3.774  5.148   1.00 0.00 ? 9  ARG A HG3  4  
ATOM 3758  H HD2  . ARG A 1 9  ? 12.084  -3.600  7.758   1.00 0.00 ? 9  ARG A HD2  4  
ATOM 3759  H HD3  . ARG A 1 9  ? 11.766  -5.332  7.668   1.00 0.00 ? 9  ARG A HD3  4  
ATOM 3760  H HE   . ARG A 1 9  ? 14.028  -4.487  6.107   1.00 0.00 ? 9  ARG A HE   4  
ATOM 3761  H HH11 . ARG A 1 9  ? 12.948  -5.503  9.267   1.00 0.00 ? 9  ARG A HH11 4  
ATOM 3762  H HH12 . ARG A 1 9  ? 14.512  -6.061  9.759   1.00 0.00 ? 9  ARG A HH12 4  
ATOM 3763  H HH21 . ARG A 1 9  ? 16.084  -5.222  6.753   1.00 0.00 ? 9  ARG A HH21 4  
ATOM 3764  H HH22 . ARG A 1 9  ? 16.292  -5.903  8.333   1.00 0.00 ? 9  ARG A HH22 4  
ATOM 3765  N N    . LEU A 1 10 ? 7.429   -3.330  6.882   1.00 0.00 ? 10 LEU A N    4  
ATOM 3766  C CA   . LEU A 1 10 ? 6.232   -2.681  7.404   1.00 0.00 ? 10 LEU A CA   4  
ATOM 3767  C C    . LEU A 1 10 ? 6.560   -1.302  7.966   1.00 0.00 ? 10 LEU A C    4  
ATOM 3768  O O    . LEU A 1 10 ? 6.760   -1.142  9.170   1.00 0.00 ? 10 LEU A O    4  
ATOM 3769  C CB   . LEU A 1 10 ? 5.590   -3.547  8.490   1.00 0.00 ? 10 LEU A CB   4  
ATOM 3770  C CG   . LEU A 1 10 ? 5.156   -4.942  8.034   1.00 0.00 ? 10 LEU A CG   4  
ATOM 3771  C CD1  . LEU A 1 10 ? 5.330   -5.950  9.160   1.00 0.00 ? 10 LEU A CD1  4  
ATOM 3772  C CD2  . LEU A 1 10 ? 3.712   -4.919  7.556   1.00 0.00 ? 10 LEU A CD2  4  
ATOM 3773  H H    . LEU A 1 10 ? 8.005   -3.833  7.494   1.00 0.00 ? 10 LEU A H    4  
ATOM 3774  H HA   . LEU A 1 10 ? 5.534   -2.568  6.588   1.00 0.00 ? 10 LEU A HA   4  
ATOM 3775  H HB2  . LEU A 1 10 ? 6.300   -3.659  9.298   1.00 0.00 ? 10 LEU A HB2  4  
ATOM 3776  H HB3  . LEU A 1 10 ? 4.721   -3.029  8.867   1.00 0.00 ? 10 LEU A HB3  4  
ATOM 3777  H HG   . LEU A 1 10 ? 5.778   -5.253  7.208   1.00 0.00 ? 10 LEU A HG   4  
ATOM 3778  H HD11 . LEU A 1 10 ? 4.388   -6.088  9.669   1.00 0.00 ? 10 LEU A HD11 4  
ATOM 3779  H HD12 . LEU A 1 10 ? 6.067   -5.584  9.860   1.00 0.00 ? 10 LEU A HD12 4  
ATOM 3780  H HD13 . LEU A 1 10 ? 5.660   -6.893  8.750   1.00 0.00 ? 10 LEU A HD13 4  
ATOM 3781  H HD21 . LEU A 1 10 ? 3.052   -4.825  8.406   1.00 0.00 ? 10 LEU A HD21 4  
ATOM 3782  H HD22 . LEU A 1 10 ? 3.493   -5.836  7.030   1.00 0.00 ? 10 LEU A HD22 4  
ATOM 3783  H HD23 . LEU A 1 10 ? 3.566   -4.080  6.892   1.00 0.00 ? 10 LEU A HD23 4  
ATOM 3784  N N    . GLY A 1 11 ? 6.614   -0.307  7.085   1.00 0.00 ? 11 GLY A N    4  
ATOM 3785  C CA   . GLY A 1 11 ? 6.919   1.046   7.512   1.00 0.00 ? 11 GLY A CA   4  
ATOM 3786  C C    . GLY A 1 11 ? 8.043   1.669   6.709   1.00 0.00 ? 11 GLY A C    4  
ATOM 3787  O O    . GLY A 1 11 ? 9.010   2.179   7.275   1.00 0.00 ? 11 GLY A O    4  
ATOM 3788  H H    . GLY A 1 11 ? 6.446   -0.494  6.138   1.00 0.00 ? 11 GLY A H    4  
ATOM 3789  H HA2  . GLY A 1 11 ? 6.033   1.653   7.401   1.00 0.00 ? 11 GLY A HA2  4  
ATOM 3790  H HA3  . GLY A 1 11 ? 7.202   1.029   8.554   1.00 0.00 ? 11 GLY A HA3  4  
ATOM 3791  N N    . ASP A 1 12 ? 7.917   1.627   5.387   1.00 0.00 ? 12 ASP A N    4  
ATOM 3792  C CA   . ASP A 1 12 ? 8.932   2.192   4.504   1.00 0.00 ? 12 ASP A CA   4  
ATOM 3793  C C    . ASP A 1 12 ? 8.291   3.056   3.423   1.00 0.00 ? 12 ASP A C    4  
ATOM 3794  O O    . ASP A 1 12 ? 7.167   2.800   2.994   1.00 0.00 ? 12 ASP A O    4  
ATOM 3795  C CB   . ASP A 1 12 ? 9.755   1.075   3.859   1.00 0.00 ? 12 ASP A CB   4  
ATOM 3796  C CG   . ASP A 1 12 ? 10.860  0.574   4.768   1.00 0.00 ? 12 ASP A CG   4  
ATOM 3797  O OD1  . ASP A 1 12 ? 10.563  0.230   5.931   1.00 0.00 ? 12 ASP A OD1  4  
ATOM 3798  O OD2  . ASP A 1 12 ? 12.024  0.525   4.317   1.00 0.00 ? 12 ASP A OD2  4  
ATOM 3799  H H    . ASP A 1 12 ? 7.123   1.207   4.995   1.00 0.00 ? 12 ASP A H    4  
ATOM 3800  H HA   . ASP A 1 12 ? 9.584   2.809   5.102   1.00 0.00 ? 12 ASP A HA   4  
ATOM 3801  H HB2  . ASP A 1 12 ? 9.104   0.246   3.624   1.00 0.00 ? 12 ASP A HB2  4  
ATOM 3802  H HB3  . ASP A 1 12 ? 10.202  1.447   2.949   1.00 0.00 ? 12 ASP A HB3  4  
ATOM 3803  N N    . ARG A 1 13 ? 9.015   4.082   2.987   1.00 0.00 ? 13 ARG A N    4  
ATOM 3804  C CA   . ARG A 1 13 ? 8.518   4.985   1.955   1.00 0.00 ? 13 ARG A CA   4  
ATOM 3805  C C    . ARG A 1 13 ? 8.667   4.361   0.571   1.00 0.00 ? 13 ARG A C    4  
ATOM 3806  O O    . ARG A 1 13 ? 9.779   4.103   0.110   1.00 0.00 ? 13 ARG A O    4  
ATOM 3807  C CB   . ARG A 1 13 ? 9.265   6.320   2.013   1.00 0.00 ? 13 ARG A CB   4  
ATOM 3808  C CG   . ARG A 1 13 ? 8.437   7.453   2.599   1.00 0.00 ? 13 ARG A CG   4  
ATOM 3809  C CD   . ARG A 1 13 ? 8.948   7.870   3.969   1.00 0.00 ? 13 ARG A CD   4  
ATOM 3810  N NE   . ARG A 1 13 ? 8.253   7.173   5.048   1.00 0.00 ? 13 ARG A NE   4  
ATOM 3811  C CZ   . ARG A 1 13 ? 8.234   7.593   6.311   1.00 0.00 ? 13 ARG A CZ   4  
ATOM 3812  N NH1  . ARG A 1 13 ? 8.872   8.704   6.658   1.00 0.00 ? 13 ARG A NH1  4  
ATOM 3813  N NH2  . ARG A 1 13 ? 7.577   6.900   7.231   1.00 0.00 ? 13 ARG A NH2  4  
ATOM 3814  H H    . ARG A 1 13 ? 9.905   4.235   3.367   1.00 0.00 ? 13 ARG A H    4  
ATOM 3815  H HA   . ARG A 1 13 ? 7.470   5.160   2.147   1.00 0.00 ? 13 ARG A HA   4  
ATOM 3816  H HB2  . ARG A 1 13 ? 10.150  6.197   2.620   1.00 0.00 ? 13 ARG A HB2  4  
ATOM 3817  H HB3  . ARG A 1 13 ? 9.561   6.599   1.012   1.00 0.00 ? 13 ARG A HB3  4  
ATOM 3818  H HG2  . ARG A 1 13 ? 8.488   8.302   1.934   1.00 0.00 ? 13 ARG A HG2  4  
ATOM 3819  H HG3  . ARG A 1 13 ? 7.412   7.126   2.691   1.00 0.00 ? 13 ARG A HG3  4  
ATOM 3820  H HD2  . ARG A 1 13 ? 10.003  7.646   4.030   1.00 0.00 ? 13 ARG A HD2  4  
ATOM 3821  H HD3  . ARG A 1 13 ? 8.800   8.934   4.085   1.00 0.00 ? 13 ARG A HD3  4  
ATOM 3822  H HE   . ARG A 1 13 ? 7.774   6.350   4.820   1.00 0.00 ? 13 ARG A HE   4  
ATOM 3823  H HH11 . ARG A 1 13 ? 9.370   9.232   5.971   1.00 0.00 ? 13 ARG A HH11 4  
ATOM 3824  H HH12 . ARG A 1 13 ? 8.854   9.014   7.609   1.00 0.00 ? 13 ARG A HH12 4  
ATOM 3825  H HH21 . ARG A 1 13 ? 7.094   6.062   6.975   1.00 0.00 ? 13 ARG A HH21 4  
ATOM 3826  H HH22 . ARG A 1 13 ? 7.563   7.214   8.179   1.00 0.00 ? 13 ARG A HH22 4  
ATOM 3827  N N    . VAL A 1 14 ? 7.537   4.122   -0.089  1.00 0.00 ? 14 VAL A N    4  
ATOM 3828  C CA   . VAL A 1 14 ? 7.542   3.529   -1.421  1.00 0.00 ? 14 VAL A CA   4  
ATOM 3829  C C    . VAL A 1 14 ? 6.771   4.396   -2.410  1.00 0.00 ? 14 VAL A C    4  
ATOM 3830  O O    . VAL A 1 14 ? 5.992   5.263   -2.015  1.00 0.00 ? 14 VAL A O    4  
ATOM 3831  C CB   . VAL A 1 14 ? 6.929   2.116   -1.410  1.00 0.00 ? 14 VAL A CB   4  
ATOM 3832  C CG1  . VAL A 1 14 ? 7.799   1.163   -0.606  1.00 0.00 ? 14 VAL A CG1  4  
ATOM 3833  C CG2  . VAL A 1 14 ? 5.512   2.154   -0.856  1.00 0.00 ? 14 VAL A CG2  4  
ATOM 3834  H H    . VAL A 1 14 ? 6.681   4.349   0.330   1.00 0.00 ? 14 VAL A H    4  
ATOM 3835  H HA   . VAL A 1 14 ? 8.568   3.451   -1.749  1.00 0.00 ? 14 VAL A HA   4  
ATOM 3836  H HB   . VAL A 1 14 ? 6.884   1.756   -2.427  1.00 0.00 ? 14 VAL A HB   4  
ATOM 3837  H HG11 . VAL A 1 14 ? 8.461   0.631   -1.273  1.00 0.00 ? 14 VAL A HG11 4  
ATOM 3838  H HG12 . VAL A 1 14 ? 7.171   0.456   -0.083  1.00 0.00 ? 14 VAL A HG12 4  
ATOM 3839  H HG13 . VAL A 1 14 ? 8.383   1.723   0.109   1.00 0.00 ? 14 VAL A HG13 4  
ATOM 3840  H HG21 . VAL A 1 14 ? 5.534   1.940   0.203   1.00 0.00 ? 14 VAL A HG21 4  
ATOM 3841  H HG22 . VAL A 1 14 ? 4.909   1.412   -1.359  1.00 0.00 ? 14 VAL A HG22 4  
ATOM 3842  H HG23 . VAL A 1 14 ? 5.089   3.134   -1.017  1.00 0.00 ? 14 VAL A HG23 4  
ATOM 3843  N N    . LEU A 1 15 ? 6.994   4.157   -3.698  1.00 0.00 ? 15 LEU A N    4  
ATOM 3844  C CA   . LEU A 1 15 ? 6.319   4.916   -4.745  1.00 0.00 ? 15 LEU A CA   4  
ATOM 3845  C C    . LEU A 1 15 ? 5.323   4.040   -5.498  1.00 0.00 ? 15 LEU A C    4  
ATOM 3846  O O    . LEU A 1 15 ? 5.712   3.160   -6.266  1.00 0.00 ? 15 LEU A O    4  
ATOM 3847  C CB   . LEU A 1 15 ? 7.343   5.498   -5.721  1.00 0.00 ? 15 LEU A CB   4  
ATOM 3848  C CG   . LEU A 1 15 ? 6.790   6.542   -6.693  1.00 0.00 ? 15 LEU A CG   4  
ATOM 3849  C CD1  . LEU A 1 15 ? 6.117   7.675   -5.935  1.00 0.00 ? 15 LEU A CD1  4  
ATOM 3850  C CD2  . LEU A 1 15 ? 7.900   7.081   -7.584  1.00 0.00 ? 15 LEU A CD2  4  
ATOM 3851  H H    . LEU A 1 15 ? 7.627   3.452   -3.951  1.00 0.00 ? 15 LEU A H    4  
ATOM 3852  H HA   . LEU A 1 15 ? 5.784   5.726   -4.274  1.00 0.00 ? 15 LEU A HA   4  
ATOM 3853  H HB2  . LEU A 1 15 ? 8.136   5.956   -5.147  1.00 0.00 ? 15 LEU A HB2  4  
ATOM 3854  H HB3  . LEU A 1 15 ? 7.761   4.687   -6.299  1.00 0.00 ? 15 LEU A HB3  4  
ATOM 3855  H HG   . LEU A 1 15 ? 6.048   6.078   -7.327  1.00 0.00 ? 15 LEU A HG   4  
ATOM 3856  H HD11 . LEU A 1 15 ? 6.257   8.601   -6.471  1.00 0.00 ? 15 LEU A HD11 4  
ATOM 3857  H HD12 . LEU A 1 15 ? 6.555   7.759   -4.951  1.00 0.00 ? 15 LEU A HD12 4  
ATOM 3858  H HD13 . LEU A 1 15 ? 5.061   7.467   -5.842  1.00 0.00 ? 15 LEU A HD13 4  
ATOM 3859  H HD21 . LEU A 1 15 ? 7.475   7.723   -8.341  1.00 0.00 ? 15 LEU A HD21 4  
ATOM 3860  H HD22 . LEU A 1 15 ? 8.414   6.257   -8.057  1.00 0.00 ? 15 LEU A HD22 4  
ATOM 3861  H HD23 . LEU A 1 15 ? 8.600   7.645   -6.985  1.00 0.00 ? 15 LEU A HD23 4  
ATOM 3862  N N    . VAL A 1 16 ? 4.038   4.286   -5.271  1.00 0.00 ? 16 VAL A N    4  
ATOM 3863  C CA   . VAL A 1 16 ? 2.985   3.521   -5.928  1.00 0.00 ? 16 VAL A CA   4  
ATOM 3864  C C    . VAL A 1 16 ? 2.527   4.204   -7.211  1.00 0.00 ? 16 VAL A C    4  
ATOM 3865  O O    . VAL A 1 16 ? 1.930   5.281   -7.174  1.00 0.00 ? 16 VAL A O    4  
ATOM 3866  C CB   . VAL A 1 16 ? 1.770   3.325   -5.001  1.00 0.00 ? 16 VAL A CB   4  
ATOM 3867  C CG1  . VAL A 1 16 ? 0.772   2.361   -5.625  1.00 0.00 ? 16 VAL A CG1  4  
ATOM 3868  C CG2  . VAL A 1 16 ? 2.216   2.832   -3.634  1.00 0.00 ? 16 VAL A CG2  4  
ATOM 3869  H H    . VAL A 1 16 ? 3.790   5.001   -4.648  1.00 0.00 ? 16 VAL A H    4  
ATOM 3870  H HA   . VAL A 1 16 ? 3.385   2.547   -6.173  1.00 0.00 ? 16 VAL A HA   4  
ATOM 3871  H HB   . VAL A 1 16 ? 1.283   4.280   -4.875  1.00 0.00 ? 16 VAL A HB   4  
ATOM 3872  H HG11 . VAL A 1 16 ? 0.146   1.942   -4.851  1.00 0.00 ? 16 VAL A HG11 4  
ATOM 3873  H HG12 . VAL A 1 16 ? 1.304   1.567   -6.127  1.00 0.00 ? 16 VAL A HG12 4  
ATOM 3874  H HG13 . VAL A 1 16 ? 0.157   2.891   -6.337  1.00 0.00 ? 16 VAL A HG13 4  
ATOM 3875  H HG21 . VAL A 1 16 ? 3.091   3.382   -3.320  1.00 0.00 ? 16 VAL A HG21 4  
ATOM 3876  H HG22 . VAL A 1 16 ? 2.453   1.780   -3.690  1.00 0.00 ? 16 VAL A HG22 4  
ATOM 3877  H HG23 . VAL A 1 16 ? 1.421   2.983   -2.920  1.00 0.00 ? 16 VAL A HG23 4  
ATOM 3878  N N    . GLY A 1 17 ? 2.810   3.573   -8.346  1.00 0.00 ? 17 GLY A N    4  
ATOM 3879  C CA   . GLY A 1 17 ? 2.419   4.137   -9.625  1.00 0.00 ? 17 GLY A CA   4  
ATOM 3880  C C    . GLY A 1 17 ? 3.541   4.917   -10.282 1.00 0.00 ? 17 GLY A C    4  
ATOM 3881  O O    . GLY A 1 17 ? 3.598   5.021   -11.508 1.00 0.00 ? 17 GLY A O    4  
ATOM 3882  H H    . GLY A 1 17 ? 3.288   2.719   -8.315  1.00 0.00 ? 17 GLY A H    4  
ATOM 3883  H HA2  . GLY A 1 17 ? 2.119   3.334   -10.283 1.00 0.00 ? 17 GLY A HA2  4  
ATOM 3884  H HA3  . GLY A 1 17 ? 1.577   4.796   -9.474  1.00 0.00 ? 17 GLY A HA3  4  
ATOM 3885  N N    . GLY A 1 18 ? 4.435   5.465   -9.467  1.00 0.00 ? 18 GLY A N    4  
ATOM 3886  C CA   . GLY A 1 18 ? 5.548   6.231   -9.994  1.00 0.00 ? 18 GLY A CA   4  
ATOM 3887  C C    . GLY A 1 18 ? 5.398   7.720   -9.747  1.00 0.00 ? 18 GLY A C    4  
ATOM 3888  O O    . GLY A 1 18 ? 5.903   8.539   -10.514 1.00 0.00 ? 18 GLY A O    4  
ATOM 3889  H H    . GLY A 1 18 ? 4.338   5.347   -8.499  1.00 0.00 ? 18 GLY A H    4  
ATOM 3890  H HA2  . GLY A 1 18 ? 6.460   5.891   -9.526  1.00 0.00 ? 18 GLY A HA2  4  
ATOM 3891  H HA3  . GLY A 1 18 ? 5.617   6.060   -11.059 1.00 0.00 ? 18 GLY A HA3  4  
ATOM 3892  N N    . THR A 1 19 ? 4.699   8.070   -8.671  1.00 0.00 ? 19 THR A N    4  
ATOM 3893  C CA   . THR A 1 19 ? 4.483   9.470   -8.324  1.00 0.00 ? 19 THR A CA   4  
ATOM 3894  C C    . THR A 1 19 ? 3.905   9.598   -6.918  1.00 0.00 ? 19 THR A C    4  
ATOM 3895  O O    . THR A 1 19 ? 4.325   10.455  -6.140  1.00 0.00 ? 19 THR A O    4  
ATOM 3896  C CB   . THR A 1 19 ? 3.543   10.129  -9.336  1.00 0.00 ? 19 THR A CB   4  
ATOM 3897  O OG1  . THR A 1 19 ? 2.616   9.188   -9.845  1.00 0.00 ? 19 THR A OG1  4  
ATOM 3898  C CG2  . THR A 1 19 ? 4.268   10.744  -10.513 1.00 0.00 ? 19 THR A CG2  4  
ATOM 3899  H H    . THR A 1 19 ? 4.321   7.372   -8.098  1.00 0.00 ? 19 THR A H    4  
ATOM 3900  H HA   . THR A 1 19 ? 5.438   9.971   -8.354  1.00 0.00 ? 19 THR A HA   4  
ATOM 3901  H HB   . THR A 1 19 ? 2.992   10.915  -8.840  1.00 0.00 ? 19 THR A HB   4  
ATOM 3902  H HG1  . THR A 1 19 ? 1.987   9.635   -10.418 1.00 0.00 ? 19 THR A HG1  4  
ATOM 3903  H HG21 . THR A 1 19 ? 3.696   11.578  -10.893 1.00 0.00 ? 19 THR A HG21 4  
ATOM 3904  H HG22 . THR A 1 19 ? 4.385   10.003  -11.291 1.00 0.00 ? 19 THR A HG22 4  
ATOM 3905  H HG23 . THR A 1 19 ? 5.241   11.090  -10.197 1.00 0.00 ? 19 THR A HG23 4  
ATOM 3906  N N    . LYS A 1 20 ? 2.940   8.742   -6.600  1.00 0.00 ? 20 LYS A N    4  
ATOM 3907  C CA   . LYS A 1 20 ? 2.304   8.758   -5.288  1.00 0.00 ? 20 LYS A CA   4  
ATOM 3908  C C    . LYS A 1 20 ? 3.216   8.139   -4.234  1.00 0.00 ? 20 LYS A C    4  
ATOM 3909  O O    . LYS A 1 20 ? 3.404   6.922   -4.199  1.00 0.00 ? 20 LYS A O    4  
ATOM 3910  C CB   . LYS A 1 20 ? 0.973   8.008   -5.333  1.00 0.00 ? 20 LYS A CB   4  
ATOM 3911  C CG   . LYS A 1 20 ? 0.046   8.481   -6.440  1.00 0.00 ? 20 LYS A CG   4  
ATOM 3912  C CD   . LYS A 1 20 ? -0.766  7.332   -7.017  1.00 0.00 ? 20 LYS A CD   4  
ATOM 3913  C CE   . LYS A 1 20 ? -2.130  7.226   -6.356  1.00 0.00 ? 20 LYS A CE   4  
ATOM 3914  N NZ   . LYS A 1 20 ? -3.105  6.492   -7.208  1.00 0.00 ? 20 LYS A NZ   4  
ATOM 3915  H H    . LYS A 1 20 ? 2.648   8.082   -7.263  1.00 0.00 ? 20 LYS A H    4  
ATOM 3916  H HA   . LYS A 1 20 ? 2.118   9.789   -5.024  1.00 0.00 ? 20 LYS A HA   4  
ATOM 3917  H HB2  . LYS A 1 20 ? 1.171   6.957   -5.483  1.00 0.00 ? 20 LYS A HB2  4  
ATOM 3918  H HB3  . LYS A 1 20 ? 0.467   8.138   -4.389  1.00 0.00 ? 20 LYS A HB3  4  
ATOM 3919  H HG2  . LYS A 1 20 ? -0.632  9.220   -6.038  1.00 0.00 ? 20 LYS A HG2  4  
ATOM 3920  H HG3  . LYS A 1 20 ? 0.637   8.923   -7.229  1.00 0.00 ? 20 LYS A HG3  4  
ATOM 3921  H HD2  . LYS A 1 20 ? -0.901  7.494   -8.075  1.00 0.00 ? 20 LYS A HD2  4  
ATOM 3922  H HD3  . LYS A 1 20 ? -0.227  6.409   -6.859  1.00 0.00 ? 20 LYS A HD3  4  
ATOM 3923  H HE2  . LYS A 1 20 ? -2.022  6.706   -5.417  1.00 0.00 ? 20 LYS A HE2  4  
ATOM 3924  H HE3  . LYS A 1 20 ? -2.505  8.223   -6.172  1.00 0.00 ? 20 LYS A HE3  4  
ATOM 3925  H HZ1  . LYS A 1 20 ? -4.070  6.623   -6.842  1.00 0.00 ? 20 LYS A HZ1  4  
ATOM 3926  H HZ2  . LYS A 1 20 ? -2.884  5.475   -7.210  1.00 0.00 ? 20 LYS A HZ2  4  
ATOM 3927  H HZ3  . LYS A 1 20 ? -3.064  6.845   -8.185  1.00 0.00 ? 20 LYS A HZ3  4  
ATOM 3928  N N    . THR A 1 21 ? 3.780   8.983   -3.375  1.00 0.00 ? 21 THR A N    4  
ATOM 3929  C CA   . THR A 1 21 ? 4.671   8.518   -2.319  1.00 0.00 ? 21 THR A CA   4  
ATOM 3930  C C    . THR A 1 21 ? 3.885   8.156   -1.065  1.00 0.00 ? 21 THR A C    4  
ATOM 3931  O O    . THR A 1 21 ? 3.250   9.012   -0.449  1.00 0.00 ? 21 THR A O    4  
ATOM 3932  C CB   . THR A 1 21 ? 5.711   9.591   -1.992  1.00 0.00 ? 21 THR A CB   4  
ATOM 3933  O OG1  . THR A 1 21 ? 5.088   10.844  -1.779  1.00 0.00 ? 21 THR A OG1  4  
ATOM 3934  C CG2  . THR A 1 21 ? 6.747   9.772   -3.081  1.00 0.00 ? 21 THR A CG2  4  
ATOM 3935  H H    . THR A 1 21 ? 3.591   9.942   -3.454  1.00 0.00 ? 21 THR A H    4  
ATOM 3936  H HA   . THR A 1 21 ? 5.179   7.635   -2.680  1.00 0.00 ? 21 THR A HA   4  
ATOM 3937  H HB   . THR A 1 21 ? 6.229   9.310   -1.087  1.00 0.00 ? 21 THR A HB   4  
ATOM 3938  H HG1  . THR A 1 21 ? 4.367   10.742  -1.154  1.00 0.00 ? 21 THR A HG1  4  
ATOM 3939  H HG21 . THR A 1 21 ? 6.260   10.088  -3.993  1.00 0.00 ? 21 THR A HG21 4  
ATOM 3940  H HG22 . THR A 1 21 ? 7.258   8.836   -3.252  1.00 0.00 ? 21 THR A HG22 4  
ATOM 3941  H HG23 . THR A 1 21 ? 7.461   10.522  -2.778  1.00 0.00 ? 21 THR A HG23 4  
ATOM 3942  N N    . GLY A 1 22 ? 3.932   6.881   -0.689  1.00 0.00 ? 22 GLY A N    4  
ATOM 3943  C CA   . GLY A 1 22 ? 3.220   6.429   0.492   1.00 0.00 ? 22 GLY A CA   4  
ATOM 3944  C C    . GLY A 1 22 ? 4.032   5.454   1.321   1.00 0.00 ? 22 GLY A C    4  
ATOM 3945  O O    . GLY A 1 22 ? 4.928   4.785   0.805   1.00 0.00 ? 22 GLY A O    4  
ATOM 3946  H H    . GLY A 1 22 ? 4.455   6.244   -1.218  1.00 0.00 ? 22 GLY A H    4  
ATOM 3947  H HA2  . GLY A 1 22 ? 2.976   7.286   1.101   1.00 0.00 ? 22 GLY A HA2  4  
ATOM 3948  H HA3  . GLY A 1 22 ? 2.305   5.947   0.183   1.00 0.00 ? 22 GLY A HA3  4  
ATOM 3949  N N    . VAL A 1 23 ? 3.719   5.372   2.610   1.00 0.00 ? 23 VAL A N    4  
ATOM 3950  C CA   . VAL A 1 23 ? 4.425   4.472   3.513   1.00 0.00 ? 23 VAL A CA   4  
ATOM 3951  C C    . VAL A 1 23 ? 3.753   3.104   3.560   1.00 0.00 ? 23 VAL A C    4  
ATOM 3952  O O    . VAL A 1 23 ? 2.526   3.002   3.552   1.00 0.00 ? 23 VAL A O    4  
ATOM 3953  C CB   . VAL A 1 23 ? 4.494   5.046   4.941   1.00 0.00 ? 23 VAL A CB   4  
ATOM 3954  C CG1  . VAL A 1 23 ? 5.429   4.217   5.807   1.00 0.00 ? 23 VAL A CG1  4  
ATOM 3955  C CG2  . VAL A 1 23 ? 4.934   6.503   4.910   1.00 0.00 ? 23 VAL A CG2  4  
ATOM 3956  H H    . VAL A 1 23 ? 2.995   5.932   2.962   1.00 0.00 ? 23 VAL A H    4  
ATOM 3957  H HA   . VAL A 1 23 ? 5.434   4.354   3.145   1.00 0.00 ? 23 VAL A HA   4  
ATOM 3958  H HB   . VAL A 1 23 ? 3.505   5.001   5.374   1.00 0.00 ? 23 VAL A HB   4  
ATOM 3959  H HG11 . VAL A 1 23 ? 5.409   3.190   5.477   1.00 0.00 ? 23 VAL A HG11 4  
ATOM 3960  H HG12 . VAL A 1 23 ? 5.107   4.271   6.837   1.00 0.00 ? 23 VAL A HG12 4  
ATOM 3961  H HG13 . VAL A 1 23 ? 6.434   4.603   5.723   1.00 0.00 ? 23 VAL A HG13 4  
ATOM 3962  H HG21 . VAL A 1 23 ? 5.848   6.590   4.342   1.00 0.00 ? 23 VAL A HG21 4  
ATOM 3963  H HG22 . VAL A 1 23 ? 5.103   6.849   5.919   1.00 0.00 ? 23 VAL A HG22 4  
ATOM 3964  H HG23 . VAL A 1 23 ? 4.163   7.102   4.449   1.00 0.00 ? 23 VAL A HG23 4  
ATOM 3965  N N    . VAL A 1 24 ? 4.566   2.053   3.611   1.00 0.00 ? 24 VAL A N    4  
ATOM 3966  C CA   . VAL A 1 24 ? 4.050   0.690   3.660   1.00 0.00 ? 24 VAL A CA   4  
ATOM 3967  C C    . VAL A 1 24 ? 3.405   0.397   5.011   1.00 0.00 ? 24 VAL A C    4  
ATOM 3968  O O    . VAL A 1 24 ? 4.031   0.561   6.058   1.00 0.00 ? 24 VAL A O    4  
ATOM 3969  C CB   . VAL A 1 24 ? 5.163   -0.343  3.399   1.00 0.00 ? 24 VAL A CB   4  
ATOM 3970  C CG1  . VAL A 1 24 ? 4.583   -1.746  3.307   1.00 0.00 ? 24 VAL A CG1  4  
ATOM 3971  C CG2  . VAL A 1 24 ? 5.931   0.007   2.132   1.00 0.00 ? 24 VAL A CG2  4  
ATOM 3972  H H    . VAL A 1 24 ? 5.535   2.198   3.616   1.00 0.00 ? 24 VAL A H    4  
ATOM 3973  H HA   . VAL A 1 24 ? 3.304   0.588   2.886   1.00 0.00 ? 24 VAL A HA   4  
ATOM 3974  H HB   . VAL A 1 24 ? 5.854   -0.316  4.230   1.00 0.00 ? 24 VAL A HB   4  
ATOM 3975  H HG11 . VAL A 1 24 ? 3.543   -1.688  3.023   1.00 0.00 ? 24 VAL A HG11 4  
ATOM 3976  H HG12 . VAL A 1 24 ? 4.667   -2.233  4.267   1.00 0.00 ? 24 VAL A HG12 4  
ATOM 3977  H HG13 . VAL A 1 24 ? 5.127   -2.313  2.566   1.00 0.00 ? 24 VAL A HG13 4  
ATOM 3978  H HG21 . VAL A 1 24 ? 5.410   -0.391  1.274   1.00 0.00 ? 24 VAL A HG21 4  
ATOM 3979  H HG22 . VAL A 1 24 ? 6.922   -0.418  2.182   1.00 0.00 ? 24 VAL A HG22 4  
ATOM 3980  H HG23 . VAL A 1 24 ? 6.004   1.081   2.040   1.00 0.00 ? 24 VAL A HG23 4  
ATOM 3981  N N    . ARG A 1 25 ? 2.149   -0.037  4.980   1.00 0.00 ? 25 ARG A N    4  
ATOM 3982  C CA   . ARG A 1 25 ? 1.418   -0.353  6.201   1.00 0.00 ? 25 ARG A CA   4  
ATOM 3983  C C    . ARG A 1 25 ? 1.201   -1.858  6.334   1.00 0.00 ? 25 ARG A C    4  
ATOM 3984  O O    . ARG A 1 25 ? 1.138   -2.390  7.442   1.00 0.00 ? 25 ARG A O    4  
ATOM 3985  C CB   . ARG A 1 25 ? 0.071   0.370   6.216   1.00 0.00 ? 25 ARG A CB   4  
ATOM 3986  C CG   . ARG A 1 25 ? 0.174   1.841   6.586   1.00 0.00 ? 25 ARG A CG   4  
ATOM 3987  C CD   . ARG A 1 25 ? -0.125  2.067   8.060   1.00 0.00 ? 25 ARG A CD   4  
ATOM 3988  N NE   . ARG A 1 25 ? 0.409   3.340   8.538   1.00 0.00 ? 25 ARG A NE   4  
ATOM 3989  C CZ   . ARG A 1 25 ? 1.686   3.535   8.856   1.00 0.00 ? 25 ARG A CZ   4  
ATOM 3990  N NH1  . ARG A 1 25 ? 2.564   2.545   8.749   1.00 0.00 ? 25 ARG A NH1  4  
ATOM 3991  N NH2  . ARG A 1 25 ? 2.088   4.725   9.283   1.00 0.00 ? 25 ARG A NH2  4  
ATOM 3992  H H    . ARG A 1 25 ? 1.703   -0.148  4.114   1.00 0.00 ? 25 ARG A H    4  
ATOM 3993  H HA   . ARG A 1 25 ? 2.010   -0.012  7.039   1.00 0.00 ? 25 ARG A HA   4  
ATOM 3994  H HB2  . ARG A 1 25 ? -0.373  0.299   5.234   1.00 0.00 ? 25 ARG A HB2  4  
ATOM 3995  H HB3  . ARG A 1 25 ? -0.578  -0.115  6.931   1.00 0.00 ? 25 ARG A HB3  4  
ATOM 3996  H HG2  . ARG A 1 25 ? 1.175   2.187   6.376   1.00 0.00 ? 25 ARG A HG2  4  
ATOM 3997  H HG3  . ARG A 1 25 ? -0.534  2.401   5.994   1.00 0.00 ? 25 ARG A HG3  4  
ATOM 3998  H HD2  . ARG A 1 25 ? -1.196  2.061   8.202   1.00 0.00 ? 25 ARG A HD2  4  
ATOM 3999  H HD3  . ARG A 1 25 ? 0.318   1.264   8.631   1.00 0.00 ? 25 ARG A HD3  4  
ATOM 4000  H HE   . ARG A 1 25 ? -0.218  4.088   8.627   1.00 0.00 ? 25 ARG A HE   4  
ATOM 4001  H HH11 . ARG A 1 25 ? 2.267   1.646   8.427   1.00 0.00 ? 25 ARG A HH11 4  
ATOM 4002  H HH12 . ARG A 1 25 ? 3.522   2.699   8.989   1.00 0.00 ? 25 ARG A HH12 4  
ATOM 4003  H HH21 . ARG A 1 25 ? 1.432   5.475   9.365   1.00 0.00 ? 25 ARG A HH21 4  
ATOM 4004  H HH22 . ARG A 1 25 ? 3.049   4.872   9.522   1.00 0.00 ? 25 ARG A HH22 4  
ATOM 4005  N N    . TYR A 1 26 ? 1.085   -2.536  5.197   1.00 0.00 ? 26 TYR A N    4  
ATOM 4006  C CA   . TYR A 1 26 ? 0.873   -3.978  5.187   1.00 0.00 ? 26 TYR A CA   4  
ATOM 4007  C C    . TYR A 1 26 ? 1.886   -4.670  4.279   1.00 0.00 ? 26 TYR A C    4  
ATOM 4008  O O    . TYR A 1 26 ? 2.315   -4.109  3.271   1.00 0.00 ? 26 TYR A O    4  
ATOM 4009  C CB   . TYR A 1 26 ? -0.548  -4.302  4.723   1.00 0.00 ? 26 TYR A CB   4  
ATOM 4010  C CG   . TYR A 1 26 ? -0.952  -5.739  4.960   1.00 0.00 ? 26 TYR A CG   4  
ATOM 4011  C CD1  . TYR A 1 26 ? -0.883  -6.300  6.229   1.00 0.00 ? 26 TYR A CD1  4  
ATOM 4012  C CD2  . TYR A 1 26 ? -1.403  -6.535  3.915   1.00 0.00 ? 26 TYR A CD2  4  
ATOM 4013  C CE1  . TYR A 1 26 ? -1.252  -7.614  6.450   1.00 0.00 ? 26 TYR A CE1  4  
ATOM 4014  C CE2  . TYR A 1 26 ? -1.773  -7.849  4.127   1.00 0.00 ? 26 TYR A CE2  4  
ATOM 4015  C CZ   . TYR A 1 26 ? -1.697  -8.383  5.395   1.00 0.00 ? 26 TYR A CZ   4  
ATOM 4016  O OH   . TYR A 1 26 ? -2.065  -9.691  5.611   1.00 0.00 ? 26 TYR A OH   4  
ATOM 4017  H H    . TYR A 1 26 ? 1.143   -2.055  4.345   1.00 0.00 ? 26 TYR A H    4  
ATOM 4018  H HA   . TYR A 1 26 ? 1.005   -4.341  6.195   1.00 0.00 ? 26 TYR A HA   4  
ATOM 4019  H HB2  . TYR A 1 26 ? -1.244  -3.671  5.254   1.00 0.00 ? 26 TYR A HB2  4  
ATOM 4020  H HB3  . TYR A 1 26 ? -0.627  -4.104  3.664   1.00 0.00 ? 26 TYR A HB3  4  
ATOM 4021  H HD1  . TYR A 1 26 ? -0.536  -5.694  7.053   1.00 0.00 ? 26 TYR A HD1  4  
ATOM 4022  H HD2  . TYR A 1 26 ? -1.461  -6.114  2.921   1.00 0.00 ? 26 TYR A HD2  4  
ATOM 4023  H HE1  . TYR A 1 26 ? -1.192  -8.032  7.443   1.00 0.00 ? 26 TYR A HE1  4  
ATOM 4024  H HE2  . TYR A 1 26 ? -2.121  -8.452  3.301   1.00 0.00 ? 26 TYR A HE2  4  
ATOM 4025  H HH   . TYR A 1 26 ? -1.726  -10.241 4.901   1.00 0.00 ? 26 TYR A HH   4  
ATOM 4026  N N    . VAL A 1 27 ? 2.262   -5.892  4.644   1.00 0.00 ? 27 VAL A N    4  
ATOM 4027  C CA   . VAL A 1 27 ? 3.223   -6.660  3.864   1.00 0.00 ? 27 VAL A CA   4  
ATOM 4028  C C    . VAL A 1 27 ? 3.003   -8.158  4.041   1.00 0.00 ? 27 VAL A C    4  
ATOM 4029  O O    . VAL A 1 27 ? 3.401   -8.738  5.052   1.00 0.00 ? 27 VAL A O    4  
ATOM 4030  C CB   . VAL A 1 27 ? 4.672   -6.315  4.258   1.00 0.00 ? 27 VAL A CB   4  
ATOM 4031  C CG1  . VAL A 1 27 ? 5.659   -6.988  3.317   1.00 0.00 ? 27 VAL A CG1  4  
ATOM 4032  C CG2  . VAL A 1 27 ? 4.878   -4.808  4.271   1.00 0.00 ? 27 VAL A CG2  4  
ATOM 4033  H H    . VAL A 1 27 ? 1.884   -6.285  5.458   1.00 0.00 ? 27 VAL A H    4  
ATOM 4034  H HA   . VAL A 1 27 ? 3.087   -6.407  2.823   1.00 0.00 ? 27 VAL A HA   4  
ATOM 4035  H HB   . VAL A 1 27 ? 4.850   -6.690  5.256   1.00 0.00 ? 27 VAL A HB   4  
ATOM 4036  H HG11 . VAL A 1 27 ? 5.694   -8.046  3.527   1.00 0.00 ? 27 VAL A HG11 4  
ATOM 4037  H HG12 . VAL A 1 27 ? 6.640   -6.559  3.457   1.00 0.00 ? 27 VAL A HG12 4  
ATOM 4038  H HG13 . VAL A 1 27 ? 5.343   -6.835  2.295   1.00 0.00 ? 27 VAL A HG13 4  
ATOM 4039  H HG21 . VAL A 1 27 ? 5.916   -4.589  4.478   1.00 0.00 ? 27 VAL A HG21 4  
ATOM 4040  H HG22 . VAL A 1 27 ? 4.259   -4.367  5.038   1.00 0.00 ? 27 VAL A HG22 4  
ATOM 4041  H HG23 . VAL A 1 27 ? 4.608   -4.399  3.310   1.00 0.00 ? 27 VAL A HG23 4  
ATOM 4042  N N    . GLY A 1 28 ? 2.367   -8.779  3.054   1.00 0.00 ? 28 GLY A N    4  
ATOM 4043  C CA   . GLY A 1 28 ? 2.105   -10.204 3.121   1.00 0.00 ? 28 GLY A CA   4  
ATOM 4044  C C    . GLY A 1 28 ? 1.159   -10.672 2.032   1.00 0.00 ? 28 GLY A C    4  
ATOM 4045  O O    . GLY A 1 28 ? 1.311   -10.301 0.868   1.00 0.00 ? 28 GLY A O    4  
ATOM 4046  H H    . GLY A 1 28 ? 2.073   -8.265  2.274   1.00 0.00 ? 28 GLY A H    4  
ATOM 4047  H HA2  . GLY A 1 28 ? 3.039   -10.736 3.024   1.00 0.00 ? 28 GLY A HA2  4  
ATOM 4048  H HA3  . GLY A 1 28 ? 1.669   -10.434 4.083   1.00 0.00 ? 28 GLY A HA3  4  
ATOM 4049  N N    . GLU A 1 29 ? 0.181   -11.488 2.411   1.00 0.00 ? 29 GLU A N    4  
ATOM 4050  C CA   . GLU A 1 29 ? -0.794  -12.006 1.460   1.00 0.00 ? 29 GLU A CA   4  
ATOM 4051  C C    . GLU A 1 29 ? -2.202  -11.540 1.814   1.00 0.00 ? 29 GLU A C    4  
ATOM 4052  O O    . GLU A 1 29 ? -2.481  -11.198 2.964   1.00 0.00 ? 29 GLU A O    4  
ATOM 4053  C CB   . GLU A 1 29 ? -0.742  -13.536 1.427   1.00 0.00 ? 29 GLU A CB   4  
ATOM 4054  C CG   . GLU A 1 29 ? 0.388   -14.088 0.574   1.00 0.00 ? 29 GLU A CG   4  
ATOM 4055  C CD   . GLU A 1 29 ? 0.013   -15.379 -0.125  1.00 0.00 ? 29 GLU A CD   4  
ATOM 4056  O OE1  . GLU A 1 29 ? -0.614  -16.245 0.523   1.00 0.00 ? 29 GLU A OE1  4  
ATOM 4057  O OE2  . GLU A 1 29 ? 0.346   -15.527 -1.319  1.00 0.00 ? 29 GLU A OE2  4  
ATOM 4058  H H    . GLU A 1 29 ? 0.113   -11.747 3.354   1.00 0.00 ? 29 GLU A H    4  
ATOM 4059  H HA   . GLU A 1 29 ? -0.538  -11.626 0.482   1.00 0.00 ? 29 GLU A HA   4  
ATOM 4060  H HB2  . GLU A 1 29 ? -0.616  -13.901 2.435   1.00 0.00 ? 29 GLU A HB2  4  
ATOM 4061  H HB3  . GLU A 1 29 ? -1.677  -13.908 1.033   1.00 0.00 ? 29 GLU A HB3  4  
ATOM 4062  H HG2  . GLU A 1 29 ? 0.648   -13.355 -0.174  1.00 0.00 ? 29 GLU A HG2  4  
ATOM 4063  H HG3  . GLU A 1 29 ? 1.242   -14.273 1.208   1.00 0.00 ? 29 GLU A HG3  4  
ATOM 4064  N N    . THR A 1 30 ? -3.085  -11.529 0.822   1.00 0.00 ? 30 THR A N    4  
ATOM 4065  C CA   . THR A 1 30 ? -4.465  -11.104 1.030   1.00 0.00 ? 30 THR A CA   4  
ATOM 4066  C C    . THR A 1 30 ? -5.426  -12.280 0.879   1.00 0.00 ? 30 THR A C    4  
ATOM 4067  O O    . THR A 1 30 ? -5.004  -13.417 0.672   1.00 0.00 ? 30 THR A O    4  
ATOM 4068  C CB   . THR A 1 30 ? -4.834  -9.997  0.043   1.00 0.00 ? 30 THR A CB   4  
ATOM 4069  O OG1  . THR A 1 30 ? -4.675  -10.442 -1.291  1.00 0.00 ? 30 THR A OG1  4  
ATOM 4070  C CG2  . THR A 1 30 ? -4.002  -8.744  0.212   1.00 0.00 ? 30 THR A CG2  4  
ATOM 4071  H H    . THR A 1 30 ? -2.803  -11.813 -0.072  1.00 0.00 ? 30 THR A H    4  
ATOM 4072  H HA   . THR A 1 30 ? -4.544  -10.719 2.037   1.00 0.00 ? 30 THR A HA   4  
ATOM 4073  H HB   . THR A 1 30 ? -5.871  -9.729  0.190   1.00 0.00 ? 30 THR A HB   4  
ATOM 4074  H HG1  . THR A 1 30 ? -5.237  -9.923  -1.872  1.00 0.00 ? 30 THR A HG1  4  
ATOM 4075  H HG21 . THR A 1 30 ? -4.248  -8.041  -0.570  1.00 0.00 ? 30 THR A HG21 4  
ATOM 4076  H HG22 . THR A 1 30 ? -2.954  -8.997  0.152   1.00 0.00 ? 30 THR A HG22 4  
ATOM 4077  H HG23 . THR A 1 30 ? -4.210  -8.300  1.174   1.00 0.00 ? 30 THR A HG23 4  
ATOM 4078  N N    . ASP A 1 31 ? -6.721  -11.997 0.983   1.00 0.00 ? 31 ASP A N    4  
ATOM 4079  C CA   . ASP A 1 31 ? -7.741  -13.031 0.856   1.00 0.00 ? 31 ASP A CA   4  
ATOM 4080  C C    . ASP A 1 31 ? -8.735  -12.689 -0.250  1.00 0.00 ? 31 ASP A C    4  
ATOM 4081  O O    . ASP A 1 31 ? -9.898  -13.087 -0.196  1.00 0.00 ? 31 ASP A O    4  
ATOM 4082  C CB   . ASP A 1 31 ? -8.481  -13.209 2.184   1.00 0.00 ? 31 ASP A CB   4  
ATOM 4083  C CG   . ASP A 1 31 ? -8.830  -14.659 2.462   1.00 0.00 ? 31 ASP A CG   4  
ATOM 4084  O OD1  . ASP A 1 31 ? -8.129  -15.548 1.937   1.00 0.00 ? 31 ASP A OD1  4  
ATOM 4085  O OD2  . ASP A 1 31 ? -9.803  -14.902 3.205   1.00 0.00 ? 31 ASP A OD2  4  
ATOM 4086  H H    . ASP A 1 31 ? -6.996  -11.070 1.149   1.00 0.00 ? 31 ASP A H    4  
ATOM 4087  H HA   . ASP A 1 31 ? -7.246  -13.956 0.606   1.00 0.00 ? 31 ASP A HA   4  
ATOM 4088  H HB2  . ASP A 1 31 ? -7.858  -12.848 2.988   1.00 0.00 ? 31 ASP A HB2  4  
ATOM 4089  H HB3  . ASP A 1 31 ? -9.396  -12.635 2.159   1.00 0.00 ? 31 ASP A HB3  4  
ATOM 4090  N N    . PHE A 1 32 ? -8.270  -11.949 -1.252  1.00 0.00 ? 32 PHE A N    4  
ATOM 4091  C CA   . PHE A 1 32 ? -9.120  -11.558 -2.371  1.00 0.00 ? 32 PHE A CA   4  
ATOM 4092  C C    . PHE A 1 32 ? -8.416  -11.794 -3.702  1.00 0.00 ? 32 PHE A C    4  
ATOM 4093  O O    . PHE A 1 32 ? -9.010  -12.315 -4.646  1.00 0.00 ? 32 PHE A O    4  
ATOM 4094  C CB   . PHE A 1 32 ? -9.523  -10.086 -2.245  1.00 0.00 ? 32 PHE A CB   4  
ATOM 4095  C CG   . PHE A 1 32 ? -8.361  -9.135  -2.305  1.00 0.00 ? 32 PHE A CG   4  
ATOM 4096  C CD1  . PHE A 1 32 ? -7.881  -8.682  -3.523  1.00 0.00 ? 32 PHE A CD1  4  
ATOM 4097  C CD2  . PHE A 1 32 ? -7.750  -8.693  -1.142  1.00 0.00 ? 32 PHE A CD2  4  
ATOM 4098  C CE1  . PHE A 1 32 ? -6.814  -7.806  -3.581  1.00 0.00 ? 32 PHE A CE1  4  
ATOM 4099  C CE2  . PHE A 1 32 ? -6.683  -7.818  -1.193  1.00 0.00 ? 32 PHE A CE2  4  
ATOM 4100  C CZ   . PHE A 1 32 ? -6.214  -7.373  -2.414  1.00 0.00 ? 32 PHE A CZ   4  
ATOM 4101  H H    . PHE A 1 32 ? -7.333  -11.662 -1.241  1.00 0.00 ? 32 PHE A H    4  
ATOM 4102  H HA   . PHE A 1 32 ? -10.011 -12.168 -2.336  1.00 0.00 ? 32 PHE A HA   4  
ATOM 4103  H HB2  . PHE A 1 32 ? -10.197 -9.835  -3.049  1.00 0.00 ? 32 PHE A HB2  4  
ATOM 4104  H HB3  . PHE A 1 32 ? -10.027 -9.938  -1.300  1.00 0.00 ? 32 PHE A HB3  4  
ATOM 4105  H HD1  . PHE A 1 32 ? -8.350  -9.020  -4.436  1.00 0.00 ? 32 PHE A HD1  4  
ATOM 4106  H HD2  . PHE A 1 32 ? -8.116  -9.040  -0.187  1.00 0.00 ? 32 PHE A HD2  4  
ATOM 4107  H HE1  . PHE A 1 32 ? -6.449  -7.460  -4.537  1.00 0.00 ? 32 PHE A HE1  4  
ATOM 4108  H HE2  . PHE A 1 32 ? -6.215  -7.480  -0.280  1.00 0.00 ? 32 PHE A HE2  4  
ATOM 4109  H HZ   . PHE A 1 32 ? -5.380  -6.689  -2.457  1.00 0.00 ? 32 PHE A HZ   4  
ATOM 4110  N N    . ALA A 1 33 ? -7.145  -11.409 -3.773  1.00 0.00 ? 33 ALA A N    4  
ATOM 4111  C CA   . ALA A 1 33 ? -6.362  -11.581 -4.990  1.00 0.00 ? 33 ALA A CA   4  
ATOM 4112  C C    . ALA A 1 33 ? -5.112  -12.413 -4.724  1.00 0.00 ? 33 ALA A C    4  
ATOM 4113  O O    . ALA A 1 33 ? -4.617  -12.466 -3.598  1.00 0.00 ? 33 ALA A O    4  
ATOM 4114  C CB   . ALA A 1 33 ? -5.982  -10.225 -5.567  1.00 0.00 ? 33 ALA A CB   4  
ATOM 4115  H H    . ALA A 1 33 ? -6.726  -11.000 -2.988  1.00 0.00 ? 33 ALA A H    4  
ATOM 4116  H HA   . ALA A 1 33 ? -6.977  -12.094 -5.713  1.00 0.00 ? 33 ALA A HA   4  
ATOM 4117  H HB1  . ALA A 1 33 ? -5.502  -10.364 -6.526  1.00 0.00 ? 33 ALA A HB1  4  
ATOM 4118  H HB2  . ALA A 1 33 ? -5.303  -9.725  -4.894  1.00 0.00 ? 33 ALA A HB2  4  
ATOM 4119  H HB3  . ALA A 1 33 ? -6.872  -9.626  -5.693  1.00 0.00 ? 33 ALA A HB3  4  
ATOM 4120  N N    . LYS A 1 34 ? -4.606  -13.062 -5.768  1.00 0.00 ? 34 LYS A N    4  
ATOM 4121  C CA   . LYS A 1 34 ? -3.415  -13.892 -5.646  1.00 0.00 ? 34 LYS A CA   4  
ATOM 4122  C C    . LYS A 1 34 ? -2.166  -13.031 -5.486  1.00 0.00 ? 34 LYS A C    4  
ATOM 4123  O O    . LYS A 1 34 ? -2.243  -11.802 -5.486  1.00 0.00 ? 34 LYS A O    4  
ATOM 4124  C CB   . LYS A 1 34 ? -3.270  -14.797 -6.871  1.00 0.00 ? 34 LYS A CB   4  
ATOM 4125  C CG   . LYS A 1 34 ? -2.669  -16.157 -6.555  1.00 0.00 ? 34 LYS A CG   4  
ATOM 4126  C CD   . LYS A 1 34 ? -3.683  -17.276 -6.741  1.00 0.00 ? 34 LYS A CD   4  
ATOM 4127  C CE   . LYS A 1 34 ? -3.416  -18.066 -8.012  1.00 0.00 ? 34 LYS A CE   4  
ATOM 4128  N NZ   . LYS A 1 34 ? -3.640  -19.526 -7.817  1.00 0.00 ? 34 LYS A NZ   4  
ATOM 4129  H H    . LYS A 1 34 ? -5.046  -12.981 -6.640  1.00 0.00 ? 34 LYS A H    4  
ATOM 4130  H HA   . LYS A 1 34 ? -3.528  -14.508 -4.767  1.00 0.00 ? 34 LYS A HA   4  
ATOM 4131  H HB2  . LYS A 1 34 ? -4.246  -14.949 -7.309  1.00 0.00 ? 34 LYS A HB2  4  
ATOM 4132  H HB3  . LYS A 1 34 ? -2.635  -14.306 -7.593  1.00 0.00 ? 34 LYS A HB3  4  
ATOM 4133  H HG2  . LYS A 1 34 ? -1.831  -16.332 -7.214  1.00 0.00 ? 34 LYS A HG2  4  
ATOM 4134  H HG3  . LYS A 1 34 ? -2.329  -16.159 -5.530  1.00 0.00 ? 34 LYS A HG3  4  
ATOM 4135  H HD2  . LYS A 1 34 ? -3.626  -17.945 -5.895  1.00 0.00 ? 34 LYS A HD2  4  
ATOM 4136  H HD3  . LYS A 1 34 ? -4.673  -16.846 -6.795  1.00 0.00 ? 34 LYS A HD3  4  
ATOM 4137  H HE2  . LYS A 1 34 ? -4.078  -17.712 -8.788  1.00 0.00 ? 34 LYS A HE2  4  
ATOM 4138  H HE3  . LYS A 1 34 ? -2.391  -17.905 -8.313  1.00 0.00 ? 34 LYS A HE3  4  
ATOM 4139  H HZ1  . LYS A 1 34 ? -4.591  -19.789 -8.143  1.00 0.00 ? 34 LYS A HZ1  4  
ATOM 4140  H HZ2  . LYS A 1 34 ? -3.551  -19.769 -6.809  1.00 0.00 ? 34 LYS A HZ2  4  
ATOM 4141  H HZ3  . LYS A 1 34 ? -2.937  -20.071 -8.357  1.00 0.00 ? 34 LYS A HZ3  4  
ATOM 4142  N N    . GLY A 1 35 ? -1.017  -13.683 -5.349  1.00 0.00 ? 35 GLY A N    4  
ATOM 4143  C CA   . GLY A 1 35 ? 0.232   -12.961 -5.190  1.00 0.00 ? 35 GLY A CA   4  
ATOM 4144  C C    . GLY A 1 35 ? 0.308   -12.219 -3.871  1.00 0.00 ? 35 GLY A C    4  
ATOM 4145  O O    . GLY A 1 35 ? -0.540  -12.404 -2.996  1.00 0.00 ? 35 GLY A O    4  
ATOM 4146  H H    . GLY A 1 35 ? -1.016  -14.663 -5.356  1.00 0.00 ? 35 GLY A H    4  
ATOM 4147  H HA2  . GLY A 1 35 ? 1.050   -13.663 -5.244  1.00 0.00 ? 35 GLY A HA2  4  
ATOM 4148  H HA3  . GLY A 1 35 ? 0.329   -12.250 -5.996  1.00 0.00 ? 35 GLY A HA3  4  
ATOM 4149  N N    . GLU A 1 36 ? 1.327   -11.378 -3.725  1.00 0.00 ? 36 GLU A N    4  
ATOM 4150  C CA   . GLU A 1 36 ? 1.510   -10.605 -2.501  1.00 0.00 ? 36 GLU A CA   4  
ATOM 4151  C C    . GLU A 1 36 ? 1.165   -9.138  -2.727  1.00 0.00 ? 36 GLU A C    4  
ATOM 4152  O O    . GLU A 1 36 ? 1.676   -8.505  -3.652  1.00 0.00 ? 36 GLU A O    4  
ATOM 4153  C CB   . GLU A 1 36 ? 2.952   -10.732 -2.003  1.00 0.00 ? 36 GLU A CB   4  
ATOM 4154  C CG   . GLU A 1 36 ? 3.298   -12.120 -1.490  1.00 0.00 ? 36 GLU A CG   4  
ATOM 4155  C CD   . GLU A 1 36 ? 3.922   -12.997 -2.558  1.00 0.00 ? 36 GLU A CD   4  
ATOM 4156  O OE1  . GLU A 1 36 ? 4.506   -12.445 -3.514  1.00 0.00 ? 36 GLU A OE1  4  
ATOM 4157  O OE2  . GLU A 1 36 ? 3.826   -14.237 -2.437  1.00 0.00 ? 36 GLU A OE2  4  
ATOM 4158  H H    . GLU A 1 36 ? 1.970   -11.274 -4.457  1.00 0.00 ? 36 GLU A H    4  
ATOM 4159  H HA   . GLU A 1 36 ? 0.845   -11.008 -1.752  1.00 0.00 ? 36 GLU A HA   4  
ATOM 4160  H HB2  . GLU A 1 36 ? 3.623   -10.494 -2.816  1.00 0.00 ? 36 GLU A HB2  4  
ATOM 4161  H HB3  . GLU A 1 36 ? 3.108   -10.026 -1.202  1.00 0.00 ? 36 GLU A HB3  4  
ATOM 4162  H HG2  . GLU A 1 36 ? 3.998   -12.023 -0.672  1.00 0.00 ? 36 GLU A HG2  4  
ATOM 4163  H HG3  . GLU A 1 36 ? 2.396   -12.595 -1.136  1.00 0.00 ? 36 GLU A HG3  4  
ATOM 4164  N N    . TRP A 1 37 ? 0.295   -8.602  -1.878  1.00 0.00 ? 37 TRP A N    4  
ATOM 4165  C CA   . TRP A 1 37 ? -0.119  -7.208  -1.984  1.00 0.00 ? 37 TRP A CA   4  
ATOM 4166  C C    . TRP A 1 37 ? 0.394   -6.395  -0.801  1.00 0.00 ? 37 TRP A C    4  
ATOM 4167  O O    . TRP A 1 37 ? 0.374   -6.859  0.339   1.00 0.00 ? 37 TRP A O    4  
ATOM 4168  C CB   . TRP A 1 37 ? -1.644  -7.112  -2.061  1.00 0.00 ? 37 TRP A CB   4  
ATOM 4169  C CG   . TRP A 1 37 ? -2.218  -7.751  -3.288  1.00 0.00 ? 37 TRP A CG   4  
ATOM 4170  C CD1  . TRP A 1 37 ? -2.277  -9.087  -3.566  1.00 0.00 ? 37 TRP A CD1  4  
ATOM 4171  C CD2  . TRP A 1 37 ? -2.815  -7.082  -4.405  1.00 0.00 ? 37 TRP A CD2  4  
ATOM 4172  N NE1  . TRP A 1 37 ? -2.873  -9.288  -4.787  1.00 0.00 ? 37 TRP A NE1  4  
ATOM 4173  C CE2  . TRP A 1 37 ? -3.212  -8.073  -5.322  1.00 0.00 ? 37 TRP A CE2  4  
ATOM 4174  C CE3  . TRP A 1 37 ? -3.052  -5.740  -4.718  1.00 0.00 ? 37 TRP A CE3  4  
ATOM 4175  C CZ2  . TRP A 1 37 ? -3.834  -7.765  -6.530  1.00 0.00 ? 37 TRP A CZ2  4  
ATOM 4176  C CZ3  . TRP A 1 37 ? -3.669  -5.435  -5.917  1.00 0.00 ? 37 TRP A CZ3  4  
ATOM 4177  C CH2  . TRP A 1 37 ? -4.053  -6.443  -6.810  1.00 0.00 ? 37 TRP A CH2  4  
ATOM 4178  H H    . TRP A 1 37 ? -0.078  -9.157  -1.162  1.00 0.00 ? 37 TRP A H    4  
ATOM 4179  H HA   . TRP A 1 37 ? 0.304   -6.805  -2.893  1.00 0.00 ? 37 TRP A HA   4  
ATOM 4180  H HB2  . TRP A 1 37 ? -2.073  -7.601  -1.199  1.00 0.00 ? 37 TRP A HB2  4  
ATOM 4181  H HB3  . TRP A 1 37 ? -1.933  -6.071  -2.060  1.00 0.00 ? 37 TRP A HB3  4  
ATOM 4182  H HD1  . TRP A 1 37 ? -1.903  -9.861  -2.912  1.00 0.00 ? 37 TRP A HD1  4  
ATOM 4183  H HE1  . TRP A 1 37 ? -3.031  -10.161 -5.206  1.00 0.00 ? 37 TRP A HE1  4  
ATOM 4184  H HE3  . TRP A 1 37 ? -2.762  -4.950  -4.042  1.00 0.00 ? 37 TRP A HE3  4  
ATOM 4185  H HZ2  . TRP A 1 37 ? -4.138  -8.530  -7.228  1.00 0.00 ? 37 TRP A HZ2  4  
ATOM 4186  H HZ3  . TRP A 1 37 ? -3.859  -4.404  -6.177  1.00 0.00 ? 37 TRP A HZ3  4  
ATOM 4187  H HH2  . TRP A 1 37 ? -4.532  -6.159  -7.736  1.00 0.00 ? 37 TRP A HH2  4  
ATOM 4188  N N    . CYS A 1 38 ? 0.853   -5.179  -1.078  1.00 0.00 ? 38 CYS A N    4  
ATOM 4189  C CA   . CYS A 1 38 ? 1.372   -4.300  -0.036  1.00 0.00 ? 38 CYS A CA   4  
ATOM 4190  C C    . CYS A 1 38 ? 0.540   -3.026  0.064   1.00 0.00 ? 38 CYS A C    4  
ATOM 4191  O O    . CYS A 1 38 ? 0.351   -2.317  -0.925  1.00 0.00 ? 38 CYS A O    4  
ATOM 4192  C CB   . CYS A 1 38 ? 2.833   -3.948  -0.317  1.00 0.00 ? 38 CYS A CB   4  
ATOM 4193  S SG   . CYS A 1 38 ? 4.024   -5.089  0.426   1.00 0.00 ? 38 CYS A SG   4  
ATOM 4194  H H    . CYS A 1 38 ? 0.842   -4.864  -2.006  1.00 0.00 ? 38 CYS A H    4  
ATOM 4195  H HA   . CYS A 1 38 ? 1.313   -4.829  0.903   1.00 0.00 ? 38 CYS A HA   4  
ATOM 4196  H HB2  . CYS A 1 38 ? 2.999   -3.952  -1.384  1.00 0.00 ? 38 CYS A HB2  4  
ATOM 4197  H HB3  . CYS A 1 38 ? 3.039   -2.960  0.070   1.00 0.00 ? 38 CYS A HB3  4  
ATOM 4198  H HG   . CYS A 1 38 ? 3.543   -5.674  1.017   1.00 0.00 ? 38 CYS A HG   4  
ATOM 4199  N N    . GLY A 1 39 ? 0.045   -2.740  1.263   1.00 0.00 ? 39 GLY A N    4  
ATOM 4200  C CA   . GLY A 1 39 ? -0.760  -1.551  1.469   1.00 0.00 ? 39 GLY A CA   4  
ATOM 4201  C C    . GLY A 1 39 ? 0.082   -0.303  1.644   1.00 0.00 ? 39 GLY A C    4  
ATOM 4202  O O    . GLY A 1 39 ? 0.919   -0.231  2.544   1.00 0.00 ? 39 GLY A O    4  
ATOM 4203  H H    . GLY A 1 39 ? 0.228   -3.342  2.015   1.00 0.00 ? 39 GLY A H    4  
ATOM 4204  H HA2  . GLY A 1 39 ? -1.410  -1.417  0.616   1.00 0.00 ? 39 GLY A HA2  4  
ATOM 4205  H HA3  . GLY A 1 39 ? -1.367  -1.689  2.352   1.00 0.00 ? 39 GLY A HA3  4  
ATOM 4206  N N    . VAL A 1 40 ? -0.140  0.684   0.782   1.00 0.00 ? 40 VAL A N    4  
ATOM 4207  C CA   . VAL A 1 40 ? 0.604   1.935   0.844   1.00 0.00 ? 40 VAL A CA   4  
ATOM 4208  C C    . VAL A 1 40 ? -0.299  3.093   1.252   1.00 0.00 ? 40 VAL A C    4  
ATOM 4209  O O    . VAL A 1 40 ? -1.276  3.402   0.569   1.00 0.00 ? 40 VAL A O    4  
ATOM 4210  C CB   . VAL A 1 40 ? 1.263   2.267   -0.508  1.00 0.00 ? 40 VAL A CB   4  
ATOM 4211  C CG1  . VAL A 1 40 ? 2.197   3.459   -0.371  1.00 0.00 ? 40 VAL A CG1  4  
ATOM 4212  C CG2  . VAL A 1 40 ? 2.008   1.057   -1.050  1.00 0.00 ? 40 VAL A CG2  4  
ATOM 4213  H H    . VAL A 1 40 ? -0.821  0.567   0.087   1.00 0.00 ? 40 VAL A H    4  
ATOM 4214  H HA   . VAL A 1 40 ? 1.385   1.823   1.583   1.00 0.00 ? 40 VAL A HA   4  
ATOM 4215  H HB   . VAL A 1 40 ? 0.485   2.528   -1.211  1.00 0.00 ? 40 VAL A HB   4  
ATOM 4216  H HG11 . VAL A 1 40 ? 2.094   4.099   -1.235  1.00 0.00 ? 40 VAL A HG11 4  
ATOM 4217  H HG12 . VAL A 1 40 ? 3.218   3.111   -0.301  1.00 0.00 ? 40 VAL A HG12 4  
ATOM 4218  H HG13 . VAL A 1 40 ? 1.944   4.014   0.520   1.00 0.00 ? 40 VAL A HG13 4  
ATOM 4219  H HG21 . VAL A 1 40 ? 2.360   0.451   -0.227  1.00 0.00 ? 40 VAL A HG21 4  
ATOM 4220  H HG22 . VAL A 1 40 ? 2.850   1.387   -1.640  1.00 0.00 ? 40 VAL A HG22 4  
ATOM 4221  H HG23 . VAL A 1 40 ? 1.344   0.471   -1.669  1.00 0.00 ? 40 VAL A HG23 4  
ATOM 4222  N N    . GLU A 1 41 ? 0.032   3.730   2.371   1.00 0.00 ? 41 GLU A N    4  
ATOM 4223  C CA   . GLU A 1 41 ? -0.751  4.854   2.871   1.00 0.00 ? 41 GLU A CA   4  
ATOM 4224  C C    . GLU A 1 41 ? -0.211  6.175   2.334   1.00 0.00 ? 41 GLU A C    4  
ATOM 4225  O O    . GLU A 1 41 ? 0.914   6.569   2.642   1.00 0.00 ? 41 GLU A O    4  
ATOM 4226  C CB   . GLU A 1 41 ? -0.739  4.870   4.401   1.00 0.00 ? 41 GLU A CB   4  
ATOM 4227  C CG   . GLU A 1 41 ? -1.599  5.966   5.005   1.00 0.00 ? 41 GLU A CG   4  
ATOM 4228  C CD   . GLU A 1 41 ? -0.779  7.116   5.558   1.00 0.00 ? 41 GLU A CD   4  
ATOM 4229  O OE1  . GLU A 1 41 ? 0.294   6.853   6.140   1.00 0.00 ? 41 GLU A OE1  4  
ATOM 4230  O OE2  . GLU A 1 41 ? -1.209  8.278   5.407   1.00 0.00 ? 41 GLU A OE2  4  
ATOM 4231  H H    . GLU A 1 41 ? 0.822   3.437   2.872   1.00 0.00 ? 41 GLU A H    4  
ATOM 4232  H HA   . GLU A 1 41 ? -1.767  4.728   2.530   1.00 0.00 ? 41 GLU A HA   4  
ATOM 4233  H HB2  . GLU A 1 41 ? -1.100  3.919   4.762   1.00 0.00 ? 41 GLU A HB2  4  
ATOM 4234  H HB3  . GLU A 1 41 ? 0.277   5.010   4.741   1.00 0.00 ? 41 GLU A HB3  4  
ATOM 4235  H HG2  . GLU A 1 41 ? -2.259  6.350   4.242   1.00 0.00 ? 41 GLU A HG2  4  
ATOM 4236  H HG3  . GLU A 1 41 ? -2.187  5.545   5.808   1.00 0.00 ? 41 GLU A HG3  4  
ATOM 4237  N N    . LEU A 1 42 ? -1.020  6.855   1.529   1.00 0.00 ? 42 LEU A N    4  
ATOM 4238  C CA   . LEU A 1 42 ? -0.624  8.134   0.948   1.00 0.00 ? 42 LEU A CA   4  
ATOM 4239  C C    . LEU A 1 42 ? -0.872  9.276   1.928   1.00 0.00 ? 42 LEU A C    4  
ATOM 4240  O O    . LEU A 1 42 ? -1.751  9.190   2.786   1.00 0.00 ? 42 LEU A O    4  
ATOM 4241  C CB   . LEU A 1 42 ? -1.389  8.385   -0.353  1.00 0.00 ? 42 LEU A CB   4  
ATOM 4242  C CG   . LEU A 1 42 ? -1.042  7.437   -1.501  1.00 0.00 ? 42 LEU A CG   4  
ATOM 4243  C CD1  . LEU A 1 42 ? -1.992  7.645   -2.671  1.00 0.00 ? 42 LEU A CD1  4  
ATOM 4244  C CD2  . LEU A 1 42 ? 0.400   7.638   -1.941  1.00 0.00 ? 42 LEU A CD2  4  
ATOM 4245  H H    . LEU A 1 42 ? -1.905  6.490   1.320   1.00 0.00 ? 42 LEU A H    4  
ATOM 4246  H HA   . LEU A 1 42 ? 0.432   8.085   0.730   1.00 0.00 ? 42 LEU A HA   4  
ATOM 4247  H HB2  . LEU A 1 42 ? -2.446  8.298   -0.147  1.00 0.00 ? 42 LEU A HB2  4  
ATOM 4248  H HB3  . LEU A 1 42 ? -1.184  9.395   -0.676  1.00 0.00 ? 42 LEU A HB3  4  
ATOM 4249  H HG   . LEU A 1 42 ? -1.150  6.417   -1.162  1.00 0.00 ? 42 LEU A HG   4  
ATOM 4250  H HD11 . LEU A 1 42 ? -1.538  8.310   -3.390  1.00 0.00 ? 42 LEU A HD11 4  
ATOM 4251  H HD12 . LEU A 1 42 ? -2.915  8.078   -2.313  1.00 0.00 ? 42 LEU A HD12 4  
ATOM 4252  H HD13 . LEU A 1 42 ? -2.199  6.695   -3.141  1.00 0.00 ? 42 LEU A HD13 4  
ATOM 4253  H HD21 . LEU A 1 42 ? 0.656   6.897   -2.684  1.00 0.00 ? 42 LEU A HD21 4  
ATOM 4254  H HD22 . LEU A 1 42 ? 1.054   7.534   -1.088  1.00 0.00 ? 42 LEU A HD22 4  
ATOM 4255  H HD23 . LEU A 1 42 ? 0.513   8.626   -2.363  1.00 0.00 ? 42 LEU A HD23 4  
ATOM 4256  N N    . ASP A 1 43 ? -0.093  10.344  1.793   1.00 0.00 ? 43 ASP A N    4  
ATOM 4257  C CA   . ASP A 1 43 ? -0.228  11.503  2.667   1.00 0.00 ? 43 ASP A CA   4  
ATOM 4258  C C    . ASP A 1 43 ? -1.437  12.345  2.271   1.00 0.00 ? 43 ASP A C    4  
ATOM 4259  O O    . ASP A 1 43 ? -2.137  12.885  3.128   1.00 0.00 ? 43 ASP A O    4  
ATOM 4260  C CB   . ASP A 1 43 ? 1.041   12.356  2.617   1.00 0.00 ? 43 ASP A CB   4  
ATOM 4261  C CG   . ASP A 1 43 ? 2.105   11.864  3.578   1.00 0.00 ? 43 ASP A CG   4  
ATOM 4262  O OD1  . ASP A 1 43 ? 1.780   11.645  4.764   1.00 0.00 ? 43 ASP A OD1  4  
ATOM 4263  O OD2  . ASP A 1 43 ? 3.265   11.698  3.144   1.00 0.00 ? 43 ASP A OD2  4  
ATOM 4264  H H    . ASP A 1 43 ? 0.590   10.352  1.091   1.00 0.00 ? 43 ASP A H    4  
ATOM 4265  H HA   . ASP A 1 43 ? -0.370  11.143  3.675   1.00 0.00 ? 43 ASP A HA   4  
ATOM 4266  H HB2  . ASP A 1 43 ? 1.446   12.331  1.617   1.00 0.00 ? 43 ASP A HB2  4  
ATOM 4267  H HB3  . ASP A 1 43 ? 0.792   13.376  2.875   1.00 0.00 ? 43 ASP A HB3  4  
ATOM 4268  N N    . GLU A 1 44 ? -1.677  12.453  0.969   1.00 0.00 ? 44 GLU A N    4  
ATOM 4269  C CA   . GLU A 1 44 ? -2.802  13.229  0.461   1.00 0.00 ? 44 GLU A CA   4  
ATOM 4270  C C    . GLU A 1 44 ? -3.941  12.313  0.019   1.00 0.00 ? 44 GLU A C    4  
ATOM 4271  O O    . GLU A 1 44 ? -3.704  11.211  -0.477  1.00 0.00 ? 44 GLU A O    4  
ATOM 4272  C CB   . GLU A 1 44 ? -2.356  14.108  -0.709  1.00 0.00 ? 44 GLU A CB   4  
ATOM 4273  C CG   . GLU A 1 44 ? -1.117  14.936  -0.411  1.00 0.00 ? 44 GLU A CG   4  
ATOM 4274  C CD   . GLU A 1 44 ? -1.348  15.958  0.683   1.00 0.00 ? 44 GLU A CD   4  
ATOM 4275  O OE1  . GLU A 1 44 ? -1.297  15.578  1.872   1.00 0.00 ? 44 GLU A OE1  4  
ATOM 4276  O OE2  . GLU A 1 44 ? -1.581  17.140  0.352   1.00 0.00 ? 44 GLU A OE2  4  
ATOM 4277  H H    . GLU A 1 44 ? -1.083  12.000  0.334   1.00 0.00 ? 44 GLU A H    4  
ATOM 4278  H HA   . GLU A 1 44 ? -3.154  13.863  1.261   1.00 0.00 ? 44 GLU A HA   4  
ATOM 4279  H HB2  . GLU A 1 44 ? -2.144  13.474  -1.558  1.00 0.00 ? 44 GLU A HB2  4  
ATOM 4280  H HB3  . GLU A 1 44 ? -3.159  14.782  -0.965  1.00 0.00 ? 44 GLU A HB3  4  
ATOM 4281  H HG2  . GLU A 1 44 ? -0.322  14.273  -0.101  1.00 0.00 ? 44 GLU A HG2  4  
ATOM 4282  H HG3  . GLU A 1 44 ? -0.820  15.454  -1.312  1.00 0.00 ? 44 GLU A HG3  4  
ATOM 4283  N N    . PRO A 1 45 ? -5.199  12.756  0.195   1.00 0.00 ? 45 PRO A N    4  
ATOM 4284  C CA   . PRO A 1 45 ? -6.375  11.967  -0.190  1.00 0.00 ? 45 PRO A CA   4  
ATOM 4285  C C    . PRO A 1 45 ? -6.330  11.536  -1.652  1.00 0.00 ? 45 PRO A C    4  
ATOM 4286  O O    . PRO A 1 45 ? -6.859  12.221  -2.527  1.00 0.00 ? 45 PRO A O    4  
ATOM 4287  C CB   . PRO A 1 45 ? -7.546  12.925  0.048   1.00 0.00 ? 45 PRO A CB   4  
ATOM 4288  C CG   . PRO A 1 45 ? -7.043  13.901  1.054   1.00 0.00 ? 45 PRO A CG   4  
ATOM 4289  C CD   . PRO A 1 45 ? -5.574  14.057  0.779   1.00 0.00 ? 45 PRO A CD   4  
ATOM 4290  H HA   . PRO A 1 45 ? -6.487  11.094  0.437   1.00 0.00 ? 45 PRO A HA   4  
ATOM 4291  H HB2  . PRO A 1 45 ? -7.808  13.413  -0.879  1.00 0.00 ? 45 PRO A HB2  4  
ATOM 4292  H HB3  . PRO A 1 45 ? -8.395  12.374  0.423   1.00 0.00 ? 45 PRO A HB3  4  
ATOM 4293  H HG2  . PRO A 1 45 ? -7.550  14.847  0.935   1.00 0.00 ? 45 PRO A HG2  4  
ATOM 4294  H HG3  . PRO A 1 45 ? -7.199  13.513  2.051   1.00 0.00 ? 45 PRO A HG3  4  
ATOM 4295  H HD2  . PRO A 1 45 ? -5.405  14.860  0.077   1.00 0.00 ? 45 PRO A HD2  4  
ATOM 4296  H HD3  . PRO A 1 45 ? -5.035  14.236  1.698   1.00 0.00 ? 45 PRO A HD3  4  
ATOM 4297  N N    . LEU A 1 46 ? -5.697  10.397  -1.910  1.00 0.00 ? 46 LEU A N    4  
ATOM 4298  C CA   . LEU A 1 46 ? -5.585  9.874   -3.266  1.00 0.00 ? 46 LEU A CA   4  
ATOM 4299  C C    . LEU A 1 46 ? -5.776  8.361   -3.284  1.00 0.00 ? 46 LEU A C    4  
ATOM 4300  O O    . LEU A 1 46 ? -5.201  7.663   -4.119  1.00 0.00 ? 46 LEU A O    4  
ATOM 4301  C CB   . LEU A 1 46 ? -4.223  10.235  -3.863  1.00 0.00 ? 46 LEU A CB   4  
ATOM 4302  C CG   . LEU A 1 46 ? -3.906  11.731  -3.897  1.00 0.00 ? 46 LEU A CG   4  
ATOM 4303  C CD1  . LEU A 1 46 ? -2.405  11.960  -3.811  1.00 0.00 ? 46 LEU A CD1  4  
ATOM 4304  C CD2  . LEU A 1 46 ? -4.473  12.366  -5.159  1.00 0.00 ? 46 LEU A CD2  4  
ATOM 4305  H H    . LEU A 1 46 ? -5.296  9.895   -1.169  1.00 0.00 ? 46 LEU A H    4  
ATOM 4306  H HA   . LEU A 1 46 ? -6.361  10.330  -3.862  1.00 0.00 ? 46 LEU A HA   4  
ATOM 4307  H HB2  . LEU A 1 46 ? -3.458  9.738   -3.285  1.00 0.00 ? 46 LEU A HB2  4  
ATOM 4308  H HB3  . LEU A 1 46 ? -4.187  9.859   -4.875  1.00 0.00 ? 46 LEU A HB3  4  
ATOM 4309  H HG   . LEU A 1 46 ? -4.368  12.209  -3.046  1.00 0.00 ? 46 LEU A HG   4  
ATOM 4310  H HD11 . LEU A 1 46 ? -1.947  11.706  -4.755  1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4311  H HD12 . LEU A 1 46 ? -1.991  11.339  -3.030  1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4312  H HD13 . LEU A 1 46 ? -2.213  12.999  -3.585  1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4313  H HD21 . LEU A 1 46 ? -5.548  12.266  -5.161  1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4314  H HD22 . LEU A 1 46 ? -4.064  11.869  -6.027  1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4315  H HD23 . LEU A 1 46 ? -4.209  13.413  -5.185  1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4316  N N    . GLY A 1 47 ? -6.587  7.861   -2.358  1.00 0.00 ? 47 GLY A N    4  
ATOM 4317  C CA   . GLY A 1 47 ? -6.839  6.434   -2.285  1.00 0.00 ? 47 GLY A CA   4  
ATOM 4318  C C    . GLY A 1 47 ? -8.317  6.109   -2.193  1.00 0.00 ? 47 GLY A C    4  
ATOM 4319  O O    . GLY A 1 47 ? -9.130  6.973   -1.864  1.00 0.00 ? 47 GLY A O    4  
ATOM 4320  H H    . GLY A 1 47 ? -7.018  8.466   -1.719  1.00 0.00 ? 47 GLY A H    4  
ATOM 4321  H HA2  . GLY A 1 47 ? -6.432  5.962   -3.167  1.00 0.00 ? 47 GLY A HA2  4  
ATOM 4322  H HA3  . GLY A 1 47 ? -6.340  6.036   -1.414  1.00 0.00 ? 47 GLY A HA3  4  
ATOM 4323  N N    . LYS A 1 48 ? -8.664  4.860   -2.485  1.00 0.00 ? 48 LYS A N    4  
ATOM 4324  C CA   . LYS A 1 48 ? -10.054 4.421   -2.436  1.00 0.00 ? 48 LYS A CA   4  
ATOM 4325  C C    . LYS A 1 48 ? -10.287 3.483   -1.255  1.00 0.00 ? 48 LYS A C    4  
ATOM 4326  O O    . LYS A 1 48 ? -11.398 3.395   -0.731  1.00 0.00 ? 48 LYS A O    4  
ATOM 4327  C CB   . LYS A 1 48 ? -10.436 3.721   -3.740  1.00 0.00 ? 48 LYS A CB   4  
ATOM 4328  C CG   . LYS A 1 48 ? -9.640  2.452   -4.005  1.00 0.00 ? 48 LYS A CG   4  
ATOM 4329  C CD   . LYS A 1 48 ? -10.249 1.637   -5.134  1.00 0.00 ? 48 LYS A CD   4  
ATOM 4330  C CE   . LYS A 1 48 ? -11.264 0.634   -4.611  1.00 0.00 ? 48 LYS A CE   4  
ATOM 4331  N NZ   . LYS A 1 48 ? -12.388 1.300   -3.896  1.00 0.00 ? 48 LYS A NZ   4  
ATOM 4332  H H    . LYS A 1 48 ? -7.970  4.218   -2.741  1.00 0.00 ? 48 LYS A H    4  
ATOM 4333  H HA   . LYS A 1 48 ? -10.674 5.296   -2.313  1.00 0.00 ? 48 LYS A HA   4  
ATOM 4334  H HB2  . LYS A 1 48 ? -11.484 3.460   -3.703  1.00 0.00 ? 48 LYS A HB2  4  
ATOM 4335  H HB3  . LYS A 1 48 ? -10.272 4.400   -4.563  1.00 0.00 ? 48 LYS A HB3  4  
ATOM 4336  H HG2  . LYS A 1 48 ? -8.630  2.724   -4.275  1.00 0.00 ? 48 LYS A HG2  4  
ATOM 4337  H HG3  . LYS A 1 48 ? -9.626  1.854   -3.106  1.00 0.00 ? 48 LYS A HG3  4  
ATOM 4338  H HD2  . LYS A 1 48 ? -10.742 2.307   -5.823  1.00 0.00 ? 48 LYS A HD2  4  
ATOM 4339  H HD3  . LYS A 1 48 ? -9.461  1.106   -5.647  1.00 0.00 ? 48 LYS A HD3  4  
ATOM 4340  H HE2  . LYS A 1 48 ? -11.662 0.076   -5.446  1.00 0.00 ? 48 LYS A HE2  4  
ATOM 4341  H HE3  . LYS A 1 48 ? -10.766 -0.042  -3.932  1.00 0.00 ? 48 LYS A HE3  4  
ATOM 4342  H HZ1  . LYS A 1 48 ? -13.155 0.620   -3.724  1.00 0.00 ? 48 LYS A HZ1  4  
ATOM 4343  H HZ2  . LYS A 1 48 ? -12.758 2.087   -4.465  1.00 0.00 ? 48 LYS A HZ2  4  
ATOM 4344  H HZ3  . LYS A 1 48 ? -12.058 1.673   -2.983  1.00 0.00 ? 48 LYS A HZ3  4  
ATOM 4345  N N    . ASN A 1 49 ? -9.235  2.784   -0.841  1.00 0.00 ? 49 ASN A N    4  
ATOM 4346  C CA   . ASN A 1 49 ? -9.329  1.853   0.277   1.00 0.00 ? 49 ASN A CA   4  
ATOM 4347  C C    . ASN A 1 49 ? -8.894  2.520   1.578   1.00 0.00 ? 49 ASN A C    4  
ATOM 4348  O O    . ASN A 1 49 ? -8.406  3.649   1.575   1.00 0.00 ? 49 ASN A O    4  
ATOM 4349  C CB   . ASN A 1 49 ? -8.468  0.617   0.011   1.00 0.00 ? 49 ASN A CB   4  
ATOM 4350  C CG   . ASN A 1 49 ? -9.022  -0.246  -1.105  1.00 0.00 ? 49 ASN A CG   4  
ATOM 4351  O OD1  . ASN A 1 49 ? -9.905  -1.076  -0.883  1.00 0.00 ? 49 ASN A OD1  4  
ATOM 4352  N ND2  . ASN A 1 49 ? -8.507  -0.055  -2.314  1.00 0.00 ? 49 ASN A ND2  4  
ATOM 4353  H H    . ASN A 1 49 ? -8.376  2.897   -1.299  1.00 0.00 ? 49 ASN A H    4  
ATOM 4354  H HA   . ASN A 1 49 ? -10.360 1.548   0.370   1.00 0.00 ? 49 ASN A HA   4  
ATOM 4355  H HB2  . ASN A 1 49 ? -7.472  0.932   -0.264  1.00 0.00 ? 49 ASN A HB2  4  
ATOM 4356  H HB3  . ASN A 1 49 ? -8.416  0.022   0.912   1.00 0.00 ? 49 ASN A HB3  4  
ATOM 4357  H HD21 . ASN A 1 49 ? -7.806  0.623   -2.416  1.00 0.00 ? 49 ASN A HD21 4  
ATOM 4358  H HD22 . ASN A 1 49 ? -8.847  -0.599  -3.054  1.00 0.00 ? 49 ASN A HD22 4  
ATOM 4359  N N    . ASP A 1 50 ? -9.075  1.812   2.688   1.00 0.00 ? 50 ASP A N    4  
ATOM 4360  C CA   . ASP A 1 50 ? -8.702  2.336   3.997   1.00 0.00 ? 50 ASP A CA   4  
ATOM 4361  C C    . ASP A 1 50 ? -8.003  1.266   4.831   1.00 0.00 ? 50 ASP A C    4  
ATOM 4362  O O    . ASP A 1 50 ? -8.125  1.241   6.056   1.00 0.00 ? 50 ASP A O    4  
ATOM 4363  C CB   . ASP A 1 50 ? -9.938  2.848   4.736   1.00 0.00 ? 50 ASP A CB   4  
ATOM 4364  C CG   . ASP A 1 50 ? -11.024 1.797   4.845   1.00 0.00 ? 50 ASP A CG   4  
ATOM 4365  O OD1  . ASP A 1 50 ? -10.706 0.597   4.705   1.00 0.00 ? 50 ASP A OD1  4  
ATOM 4366  O OD2  . ASP A 1 50 ? -12.195 2.172   5.070   1.00 0.00 ? 50 ASP A OD2  4  
ATOM 4367  H H    . ASP A 1 50 ? -9.469  0.917   2.626   1.00 0.00 ? 50 ASP A H    4  
ATOM 4368  H HA   . ASP A 1 50 ? -8.019  3.157   3.842   1.00 0.00 ? 50 ASP A HA   4  
ATOM 4369  H HB2  . ASP A 1 50 ? -9.655  3.150   5.733   1.00 0.00 ? 50 ASP A HB2  4  
ATOM 4370  H HB3  . ASP A 1 50 ? -10.339 3.701   4.206   1.00 0.00 ? 50 ASP A HB3  4  
ATOM 4371  N N    . GLY A 1 51 ? -7.271  0.383   4.159   1.00 0.00 ? 51 GLY A N    4  
ATOM 4372  C CA   . GLY A 1 51 ? -6.564  -0.676  4.854   1.00 0.00 ? 51 GLY A CA   4  
ATOM 4373  C C    . GLY A 1 51 ? -7.483  -1.805  5.280   1.00 0.00 ? 51 GLY A C    4  
ATOM 4374  O O    . GLY A 1 51 ? -7.223  -2.486  6.271   1.00 0.00 ? 51 GLY A O    4  
ATOM 4375  H H    . GLY A 1 51 ? -7.211  0.452   3.183   1.00 0.00 ? 51 GLY A H    4  
ATOM 4376  H HA2  . GLY A 1 51 ? -5.803  -1.074  4.200   1.00 0.00 ? 51 GLY A HA2  4  
ATOM 4377  H HA3  . GLY A 1 51 ? -6.090  -0.262  5.731   1.00 0.00 ? 51 GLY A HA3  4  
ATOM 4378  N N    . ALA A 1 52 ? -8.562  -2.002  4.528   1.00 0.00 ? 52 ALA A N    4  
ATOM 4379  C CA   . ALA A 1 52 ? -9.523  -3.055  4.833   1.00 0.00 ? 52 ALA A CA   4  
ATOM 4380  C C    . ALA A 1 52 ? -10.179 -3.584  3.562   1.00 0.00 ? 52 ALA A C    4  
ATOM 4381  O O    . ALA A 1 52 ? -10.652 -2.811  2.728   1.00 0.00 ? 52 ALA A O    4  
ATOM 4382  C CB   . ALA A 1 52 ? -10.579 -2.541  5.801   1.00 0.00 ? 52 ALA A CB   4  
ATOM 4383  H H    . ALA A 1 52 ? -8.715  -1.427  3.751   1.00 0.00 ? 52 ALA A H    4  
ATOM 4384  H HA   . ALA A 1 52 ? -8.991  -3.863  5.314   1.00 0.00 ? 52 ALA A HA   4  
ATOM 4385  H HB1  . ALA A 1 52 ? -10.330 -2.853  6.804   1.00 0.00 ? 52 ALA A HB1  4  
ATOM 4386  H HB2  . ALA A 1 52 ? -11.544 -2.942  5.528   1.00 0.00 ? 52 ALA A HB2  4  
ATOM 4387  H HB3  . ALA A 1 52 ? -10.612 -1.463  5.758   1.00 0.00 ? 52 ALA A HB3  4  
ATOM 4388  N N    . VAL A 1 53 ? -10.204 -4.905  3.421   1.00 0.00 ? 53 VAL A N    4  
ATOM 4389  C CA   . VAL A 1 53 ? -10.803 -5.537  2.251   1.00 0.00 ? 53 VAL A CA   4  
ATOM 4390  C C    . VAL A 1 53 ? -11.512 -6.832  2.630   1.00 0.00 ? 53 VAL A C    4  
ATOM 4391  O O    . VAL A 1 53 ? -11.000 -7.625  3.419   1.00 0.00 ? 53 VAL A O    4  
ATOM 4392  C CB   . VAL A 1 53 ? -9.746  -5.841  1.174   1.00 0.00 ? 53 VAL A CB   4  
ATOM 4393  C CG1  . VAL A 1 53 ? -10.411 -6.311  -0.111  1.00 0.00 ? 53 VAL A CG1  4  
ATOM 4394  C CG2  . VAL A 1 53 ? -8.879  -4.617  0.916   1.00 0.00 ? 53 VAL A CG2  4  
ATOM 4395  H H    . VAL A 1 53 ? -9.811  -5.468  4.119   1.00 0.00 ? 53 VAL A H    4  
ATOM 4396  H HA   . VAL A 1 53 ? -11.525 -4.850  1.835   1.00 0.00 ? 53 VAL A HA   4  
ATOM 4397  H HB   . VAL A 1 53 ? -9.110  -6.635  1.535   1.00 0.00 ? 53 VAL A HB   4  
ATOM 4398  H HG11 . VAL A 1 53 ? -10.546 -5.470  -0.775  1.00 0.00 ? 53 VAL A HG11 4  
ATOM 4399  H HG12 . VAL A 1 53 ? -11.372 -6.747  0.120   1.00 0.00 ? 53 VAL A HG12 4  
ATOM 4400  H HG13 . VAL A 1 53 ? -9.786  -7.052  -0.589  1.00 0.00 ? 53 VAL A HG13 4  
ATOM 4401  H HG21 . VAL A 1 53 ? -8.295  -4.771  0.021   1.00 0.00 ? 53 VAL A HG21 4  
ATOM 4402  H HG22 . VAL A 1 53 ? -8.218  -4.461  1.756   1.00 0.00 ? 53 VAL A HG22 4  
ATOM 4403  H HG23 . VAL A 1 53 ? -9.510  -3.749  0.790   1.00 0.00 ? 53 VAL A HG23 4  
ATOM 4404  N N    . ALA A 1 54 ? -12.696 -7.038  2.062   1.00 0.00 ? 54 ALA A N    4  
ATOM 4405  C CA   . ALA A 1 54 ? -13.477 -8.237  2.339   1.00 0.00 ? 54 ALA A CA   4  
ATOM 4406  C C    . ALA A 1 54 ? -13.825 -8.337  3.820   1.00 0.00 ? 54 ALA A C    4  
ATOM 4407  O O    . ALA A 1 54 ? -13.931 -9.432  4.371   1.00 0.00 ? 54 ALA A O    4  
ATOM 4408  C CB   . ALA A 1 54 ? -12.720 -9.477  1.888   1.00 0.00 ? 54 ALA A CB   4  
ATOM 4409  H H    . ALA A 1 54 ? -13.052 -6.369  1.441   1.00 0.00 ? 54 ALA A H    4  
ATOM 4410  H HA   . ALA A 1 54 ? -14.393 -8.177  1.769   1.00 0.00 ? 54 ALA A HA   4  
ATOM 4411  H HB1  . ALA A 1 54 ? -11.721 -9.458  2.299   1.00 0.00 ? 54 ALA A HB1  4  
ATOM 4412  H HB2  . ALA A 1 54 ? -12.664 -9.492  0.809   1.00 0.00 ? 54 ALA A HB2  4  
ATOM 4413  H HB3  . ALA A 1 54 ? -13.235 -10.360 2.235   1.00 0.00 ? 54 ALA A HB3  4  
ATOM 4414  N N    . GLY A 1 55 ? -13.998 -7.185  4.461   1.00 0.00 ? 55 GLY A N    4  
ATOM 4415  C CA   . GLY A 1 55 ? -14.331 -7.165  5.873   1.00 0.00 ? 55 GLY A CA   4  
ATOM 4416  C C    . GLY A 1 55 ? -13.164 -7.573  6.751   1.00 0.00 ? 55 GLY A C    4  
ATOM 4417  O O    . GLY A 1 55 ? -13.356 -8.101  7.845   1.00 0.00 ? 55 GLY A O    4  
ATOM 4418  H H    . GLY A 1 55 ? -13.901 -6.342  3.971   1.00 0.00 ? 55 GLY A H    4  
ATOM 4419  H HA2  . GLY A 1 55 ? -14.640 -6.167  6.145   1.00 0.00 ? 55 GLY A HA2  4  
ATOM 4420  H HA3  . GLY A 1 55 ? -15.153 -7.845  6.048   1.00 0.00 ? 55 GLY A HA3  4  
ATOM 4421  N N    . THR A 1 56 ? -11.950 -7.326  6.269   1.00 0.00 ? 56 THR A N    4  
ATOM 4422  C CA   . THR A 1 56 ? -10.746 -7.671  7.017   1.00 0.00 ? 56 THR A CA   4  
ATOM 4423  C C    . THR A 1 56 ? -9.737  -6.528  6.976   1.00 0.00 ? 56 THR A C    4  
ATOM 4424  O O    . THR A 1 56 ? -9.110  -6.276  5.948   1.00 0.00 ? 56 THR A O    4  
ATOM 4425  C CB   . THR A 1 56 ? -10.116 -8.944  6.450   1.00 0.00 ? 56 THR A CB   4  
ATOM 4426  O OG1  . THR A 1 56 ? -11.074 -9.983  6.367   1.00 0.00 ? 56 THR A OG1  4  
ATOM 4427  C CG2  . THR A 1 56 ? -8.955  -9.455  7.275   1.00 0.00 ? 56 THR A CG2  4  
ATOM 4428  H H    . THR A 1 56 ? -11.861 -6.902  5.390   1.00 0.00 ? 56 THR A H    4  
ATOM 4429  H HA   . THR A 1 56 ? -11.033 -7.847  8.043   1.00 0.00 ? 56 THR A HA   4  
ATOM 4430  H HB   . THR A 1 56 ? -9.750  -8.740  5.454   1.00 0.00 ? 56 THR A HB   4  
ATOM 4431  H HG1  . THR A 1 56 ? -11.239 -10.195 5.446   1.00 0.00 ? 56 THR A HG1  4  
ATOM 4432  H HG21 . THR A 1 56 ? -8.806  -10.506 7.076   1.00 0.00 ? 56 THR A HG21 4  
ATOM 4433  H HG22 . THR A 1 56 ? -9.169  -9.315  8.325   1.00 0.00 ? 56 THR A HG22 4  
ATOM 4434  H HG23 . THR A 1 56 ? -8.060  -8.909  7.015   1.00 0.00 ? 56 THR A HG23 4  
ATOM 4435  N N    . ARG A 1 57 ? -9.585  -5.841  8.103   1.00 0.00 ? 57 ARG A N    4  
ATOM 4436  C CA   . ARG A 1 57 ? -8.650  -4.725  8.198   1.00 0.00 ? 57 ARG A CA   4  
ATOM 4437  C C    . ARG A 1 57 ? -7.280  -5.200  8.670   1.00 0.00 ? 57 ARG A C    4  
ATOM 4438  O O    . ARG A 1 57 ? -7.159  -5.830  9.721   1.00 0.00 ? 57 ARG A O    4  
ATOM 4439  C CB   . ARG A 1 57 ? -9.190  -3.659  9.153   1.00 0.00 ? 57 ARG A CB   4  
ATOM 4440  C CG   . ARG A 1 57 ? -8.292  -2.437  9.270   1.00 0.00 ? 57 ARG A CG   4  
ATOM 4441  C CD   . ARG A 1 57 ? -8.902  -1.227  8.583   1.00 0.00 ? 57 ARG A CD   4  
ATOM 4442  N NE   . ARG A 1 57 ? -10.185 -0.851  9.172   1.00 0.00 ? 57 ARG A NE   4  
ATOM 4443  C CZ   . ARG A 1 57 ? -10.752 0.343   9.016   1.00 0.00 ? 57 ARG A CZ   4  
ATOM 4444  N NH1  . ARG A 1 57 ? -10.153 1.280   8.290   1.00 0.00 ? 57 ARG A NH1  4  
ATOM 4445  N NH2  . ARG A 1 57 ? -11.921 0.603   9.584   1.00 0.00 ? 57 ARG A NH2  4  
ATOM 4446  H H    . ARG A 1 57 ? -10.112 -6.089  8.891   1.00 0.00 ? 57 ARG A H    4  
ATOM 4447  H HA   . ARG A 1 57 ? -8.549  -4.295  7.213   1.00 0.00 ? 57 ARG A HA   4  
ATOM 4448  H HB2  . ARG A 1 57 ? -10.160 -3.337  8.803   1.00 0.00 ? 57 ARG A HB2  4  
ATOM 4449  H HB3  . ARG A 1 57 ? -9.299  -4.095  10.135  1.00 0.00 ? 57 ARG A HB3  4  
ATOM 4450  H HG2  . ARG A 1 57 ? -8.146  -2.210  10.316  1.00 0.00 ? 57 ARG A HG2  4  
ATOM 4451  H HG3  . ARG A 1 57 ? -7.339  -2.659  8.812   1.00 0.00 ? 57 ARG A HG3  4  
ATOM 4452  H HD2  . ARG A 1 57 ? -8.219  -0.395  8.674   1.00 0.00 ? 57 ARG A HD2  4  
ATOM 4453  H HD3  . ARG A 1 57 ? -9.050  -1.457  7.539   1.00 0.00 ? 57 ARG A HD3  4  
ATOM 4454  H HE   . ARG A 1 57 ? -10.649 -1.524  9.713   1.00 0.00 ? 57 ARG A HE   4  
ATOM 4455  H HH11 . ARG A 1 57 ? -9.271  1.091   7.857   1.00 0.00 ? 57 ARG A HH11 4  
ATOM 4456  H HH12 . ARG A 1 57 ? -10.584 2.175   8.176   1.00 0.00 ? 57 ARG A HH12 4  
ATOM 4457  H HH21 . ARG A 1 57 ? -12.377 -0.100  10.132  1.00 0.00 ? 57 ARG A HH21 4  
ATOM 4458  H HH22 . ARG A 1 57 ? -12.347 1.500   9.467   1.00 0.00 ? 57 ARG A HH22 4  
ATOM 4459  N N    . TYR A 1 58 ? -6.251  -4.893  7.887   1.00 0.00 ? 58 TYR A N    4  
ATOM 4460  C CA   . TYR A 1 58 ? -4.889  -5.288  8.226   1.00 0.00 ? 58 TYR A CA   4  
ATOM 4461  C C    . TYR A 1 58 ? -4.186  -4.193  9.021   1.00 0.00 ? 58 TYR A C    4  
ATOM 4462  O O    . TYR A 1 58 ? -3.342  -4.474  9.872   1.00 0.00 ? 58 TYR A O    4  
ATOM 4463  C CB   . TYR A 1 58 ? -4.095  -5.601  6.956   1.00 0.00 ? 58 TYR A CB   4  
ATOM 4464  C CG   . TYR A 1 58 ? -4.831  -6.498  5.987   1.00 0.00 ? 58 TYR A CG   4  
ATOM 4465  C CD1  . TYR A 1 58 ? -5.004  -7.849  6.256   1.00 0.00 ? 58 TYR A CD1  4  
ATOM 4466  C CD2  . TYR A 1 58 ? -5.353  -5.991  4.802   1.00 0.00 ? 58 TYR A CD2  4  
ATOM 4467  C CE1  . TYR A 1 58 ? -5.676  -8.672  5.372   1.00 0.00 ? 58 TYR A CE1  4  
ATOM 4468  C CE2  . TYR A 1 58 ? -6.027  -6.808  3.914   1.00 0.00 ? 58 TYR A CE2  4  
ATOM 4469  C CZ   . TYR A 1 58 ? -6.185  -8.147  4.202   1.00 0.00 ? 58 TYR A CZ   4  
ATOM 4470  O OH   . TYR A 1 58 ? -6.855  -8.963  3.320   1.00 0.00 ? 58 TYR A OH   4  
ATOM 4471  H H    . TYR A 1 58 ? -6.411  -4.389  7.063   1.00 0.00 ? 58 TYR A H    4  
ATOM 4472  H HA   . TYR A 1 58 ? -4.943  -6.179  8.834   1.00 0.00 ? 58 TYR A HA   4  
ATOM 4473  H HB2  . TYR A 1 58 ? -3.868  -4.677  6.445   1.00 0.00 ? 58 TYR A HB2  4  
ATOM 4474  H HB3  . TYR A 1 58 ? -3.173  -6.092  7.229   1.00 0.00 ? 58 TYR A HB3  4  
ATOM 4475  H HD1  . TYR A 1 58 ? -4.604  -8.258  7.172   1.00 0.00 ? 58 TYR A HD1  4  
ATOM 4476  H HD2  . TYR A 1 58 ? -5.227  -4.943  4.580   1.00 0.00 ? 58 TYR A HD2  4  
ATOM 4477  H HE1  . TYR A 1 58 ? -5.799  -9.721  5.598   1.00 0.00 ? 58 TYR A HE1  4  
ATOM 4478  H HE2  . TYR A 1 58 ? -6.426  -6.397  2.999   1.00 0.00 ? 58 TYR A HE2  4  
ATOM 4479  H HH   . TYR A 1 58 ? -6.223  -9.513  2.851   1.00 0.00 ? 58 TYR A HH   4  
ATOM 4480  N N    . PHE A 1 59 ? -4.542  -2.944  8.739   1.00 0.00 ? 59 PHE A N    4  
ATOM 4481  C CA   . PHE A 1 59 ? -3.946  -1.805  9.427   1.00 0.00 ? 59 PHE A CA   4  
ATOM 4482  C C    . PHE A 1 59 ? -4.930  -0.642  9.506   1.00 0.00 ? 59 PHE A C    4  
ATOM 4483  O O    . PHE A 1 59 ? -5.559  -0.281  8.511   1.00 0.00 ? 59 PHE A O    4  
ATOM 4484  C CB   . PHE A 1 59 ? -2.669  -1.362  8.712   1.00 0.00 ? 59 PHE A CB   4  
ATOM 4485  C CG   . PHE A 1 59 ? -2.881  -1.027  7.263   1.00 0.00 ? 59 PHE A CG   4  
ATOM 4486  C CD1  . PHE A 1 59 ? -2.862  -2.023  6.299   1.00 0.00 ? 59 PHE A CD1  4  
ATOM 4487  C CD2  . PHE A 1 59 ? -3.098  0.283   6.864   1.00 0.00 ? 59 PHE A CD2  4  
ATOM 4488  C CE1  . PHE A 1 59 ? -3.056  -1.718  4.965   1.00 0.00 ? 59 PHE A CE1  4  
ATOM 4489  C CE2  . PHE A 1 59 ? -3.292  0.593   5.532   1.00 0.00 ? 59 PHE A CE2  4  
ATOM 4490  C CZ   . PHE A 1 59 ? -3.271  -0.409  4.582   1.00 0.00 ? 59 PHE A CZ   4  
ATOM 4491  H H    . PHE A 1 59 ? -5.221  -2.784  8.050   1.00 0.00 ? 59 PHE A H    4  
ATOM 4492  H HA   . PHE A 1 59 ? -3.696  -2.118  10.430  1.00 0.00 ? 59 PHE A HA   4  
ATOM 4493  H HB2  . PHE A 1 59 ? -2.278  -0.482  9.201   1.00 0.00 ? 59 PHE A HB2  4  
ATOM 4494  H HB3  . PHE A 1 59 ? -1.939  -2.156  8.768   1.00 0.00 ? 59 PHE A HB3  4  
ATOM 4495  H HD1  . PHE A 1 59 ? -2.694  -3.047  6.598   1.00 0.00 ? 59 PHE A HD1  4  
ATOM 4496  H HD2  . PHE A 1 59 ? -3.114  1.066   7.607   1.00 0.00 ? 59 PHE A HD2  4  
ATOM 4497  H HE1  . PHE A 1 59 ? -3.039  -2.503  4.223   1.00 0.00 ? 59 PHE A HE1  4  
ATOM 4498  H HE2  . PHE A 1 59 ? -3.461  1.618   5.236   1.00 0.00 ? 59 PHE A HE2  4  
ATOM 4499  H HZ   . PHE A 1 59 ? -3.423  -0.168  3.539   1.00 0.00 ? 59 PHE A HZ   4  
ATOM 4500  N N    . GLN A 1 60 ? -5.058  -0.061  10.694  1.00 0.00 ? 60 GLN A N    4  
ATOM 4501  C CA   . GLN A 1 60 ? -5.966  1.061   10.901  1.00 0.00 ? 60 GLN A CA   4  
ATOM 4502  C C    . GLN A 1 60 ? -5.553  2.262   10.055  1.00 0.00 ? 60 GLN A C    4  
ATOM 4503  O O    . GLN A 1 60 ? -4.420  2.737   10.145  1.00 0.00 ? 60 GLN A O    4  
ATOM 4504  C CB   . GLN A 1 60 ? -5.997  1.452   12.380  1.00 0.00 ? 60 GLN A CB   4  
ATOM 4505  C CG   . GLN A 1 60 ? -7.066  2.478   12.716  1.00 0.00 ? 60 GLN A CG   4  
ATOM 4506  C CD   . GLN A 1 60 ? -8.454  2.029   12.301  1.00 0.00 ? 60 GLN A CD   4  
ATOM 4507  O OE1  . GLN A 1 60 ? -8.980  1.044   12.817  1.00 0.00 ? 60 GLN A OE1  4  
ATOM 4508  N NE2  . GLN A 1 60 ? -9.054  2.753   11.362  1.00 0.00 ? 60 GLN A NE2  4  
ATOM 4509  H H    . GLN A 1 60 ? -4.529  -0.393  11.448  1.00 0.00 ? 60 GLN A H    4  
ATOM 4510  H HA   . GLN A 1 60 ? -6.954  0.748   10.601  1.00 0.00 ? 60 GLN A HA   4  
ATOM 4511  H HB2  . GLN A 1 60 ? -6.179  0.567   12.971  1.00 0.00 ? 60 GLN A HB2  4  
ATOM 4512  H HB3  . GLN A 1 60 ? -5.035  1.864   12.652  1.00 0.00 ? 60 GLN A HB3  4  
ATOM 4513  H HG2  . GLN A 1 60 ? -7.064  2.646   13.782  1.00 0.00 ? 60 GLN A HG2  4  
ATOM 4514  H HG3  . GLN A 1 60 ? -6.834  3.402   12.206  1.00 0.00 ? 60 GLN A HG3  4  
ATOM 4515  H HE21 . GLN A 1 60 ? -8.574  3.526   10.997  1.00 0.00 ? 60 GLN A HE21 4  
ATOM 4516  H HE22 . GLN A 1 60 ? -9.952  2.486   11.076  1.00 0.00 ? 60 GLN A HE22 4  
ATOM 4517  N N    . CYS A 1 61 ? -6.478  2.748   9.234   1.00 0.00 ? 61 CYS A N    4  
ATOM 4518  C CA   . CYS A 1 61 ? -6.210  3.894   8.373   1.00 0.00 ? 61 CYS A CA   4  
ATOM 4519  C C    . CYS A 1 61 ? -7.498  4.655   8.064   1.00 0.00 ? 61 CYS A C    4  
ATOM 4520  O O    . CYS A 1 61 ? -8.574  4.061   7.979   1.00 0.00 ? 61 CYS A O    4  
ATOM 4521  C CB   . CYS A 1 61 ? -5.546  3.438   7.072   1.00 0.00 ? 61 CYS A CB   4  
ATOM 4522  S SG   . CYS A 1 61 ? -3.748  3.618   7.059   1.00 0.00 ? 61 CYS A SG   4  
ATOM 4523  H H    . CYS A 1 61 ? -7.362  2.326   9.209   1.00 0.00 ? 61 CYS A H    4  
ATOM 4524  H HA   . CYS A 1 61 ? -5.535  4.552   8.900   1.00 0.00 ? 61 CYS A HA   4  
ATOM 4525  H HB2  . CYS A 1 61 ? -5.773  2.396   6.908   1.00 0.00 ? 61 CYS A HB2  4  
ATOM 4526  H HB3  . CYS A 1 61 ? -5.942  4.020   6.251   1.00 0.00 ? 61 CYS A HB3  4  
ATOM 4527  H HG   . CYS A 1 61 ? -3.432  3.378   6.184   1.00 0.00 ? 61 CYS A HG   4  
ATOM 4528  N N    . PRO A 1 62 ? -7.406  5.984   7.894   1.00 0.00 ? 62 PRO A N    4  
ATOM 4529  C CA   . PRO A 1 62 ? -8.569  6.824   7.594   1.00 0.00 ? 62 PRO A CA   4  
ATOM 4530  C C    . PRO A 1 62 ? -9.096  6.605   6.177   1.00 0.00 ? 62 PRO A C    4  
ATOM 4531  O O    . PRO A 1 62 ? -8.338  6.252   5.274   1.00 0.00 ? 62 PRO A O    4  
ATOM 4532  C CB   . PRO A 1 62 ? -8.029  8.247   7.750   1.00 0.00 ? 62 PRO A CB   4  
ATOM 4533  C CG   . PRO A 1 62 ? -6.569  8.129   7.477   1.00 0.00 ? 62 PRO A CG   4  
ATOM 4534  C CD   . PRO A 1 62 ? -6.161  6.771   7.979   1.00 0.00 ? 62 PRO A CD   4  
ATOM 4535  H HA   . PRO A 1 62 ? -9.366  6.659   8.304   1.00 0.00 ? 62 PRO A HA   4  
ATOM 4536  H HB2  . PRO A 1 62 ? -8.513  8.899   7.038   1.00 0.00 ? 62 PRO A HB2  4  
ATOM 4537  H HB3  . PRO A 1 62 ? -8.214  8.599   8.754   1.00 0.00 ? 62 PRO A HB3  4  
ATOM 4538  H HG2  . PRO A 1 62 ? -6.387  8.206   6.415   1.00 0.00 ? 62 PRO A HG2  4  
ATOM 4539  H HG3  . PRO A 1 62 ? -6.033  8.901   8.008   1.00 0.00 ? 62 PRO A HG3  4  
ATOM 4540  H HD2  . PRO A 1 62 ? -5.394  6.350   7.345   1.00 0.00 ? 62 PRO A HD2  4  
ATOM 4541  H HD3  . PRO A 1 62 ? -5.815  6.834   9.000   1.00 0.00 ? 62 PRO A HD3  4  
ATOM 4542  N N    . PRO A 1 63 ? -10.408 6.813   5.963   1.00 0.00 ? 63 PRO A N    4  
ATOM 4543  C CA   . PRO A 1 63 ? -11.030 6.636   4.646   1.00 0.00 ? 63 PRO A CA   4  
ATOM 4544  C C    . PRO A 1 63 ? -10.355 7.479   3.570   1.00 0.00 ? 63 PRO A C    4  
ATOM 4545  O O    . PRO A 1 63 ? -10.040 8.648   3.790   1.00 0.00 ? 63 PRO A O    4  
ATOM 4546  C CB   . PRO A 1 63 ? -12.472 7.104   4.861   1.00 0.00 ? 63 PRO A CB   4  
ATOM 4547  C CG   . PRO A 1 63 ? -12.707 6.969   6.326   1.00 0.00 ? 63 PRO A CG   4  
ATOM 4548  C CD   . PRO A 1 63 ? -11.384 7.237   6.983   1.00 0.00 ? 63 PRO A CD   4  
ATOM 4549  H HA   . PRO A 1 63 ? -11.026 5.599   4.344   1.00 0.00 ? 63 PRO A HA   4  
ATOM 4550  H HB2  . PRO A 1 63 ? -12.573 8.129   4.537   1.00 0.00 ? 63 PRO A HB2  4  
ATOM 4551  H HB3  . PRO A 1 63 ? -13.145 6.475   4.295   1.00 0.00 ? 63 PRO A HB3  4  
ATOM 4552  H HG2  . PRO A 1 63 ? -13.440 7.695   6.648   1.00 0.00 ? 63 PRO A HG2  4  
ATOM 4553  H HG3  . PRO A 1 63 ? -13.043 5.968   6.554   1.00 0.00 ? 63 PRO A HG3  4  
ATOM 4554  H HD2  . PRO A 1 63 ? -11.279 8.288   7.206   1.00 0.00 ? 63 PRO A HD2  4  
ATOM 4555  H HD3  . PRO A 1 63 ? -11.283 6.646   7.882   1.00 0.00 ? 63 PRO A HD3  4  
ATOM 4556  N N    . LYS A 1 64 ? -10.136 6.878   2.404   1.00 0.00 ? 64 LYS A N    4  
ATOM 4557  C CA   . LYS A 1 64 ? -9.497  7.575   1.294   1.00 0.00 ? 64 LYS A CA   4  
ATOM 4558  C C    . LYS A 1 64 ? -8.076  7.991   1.661   1.00 0.00 ? 64 LYS A C    4  
ATOM 4559  O O    . LYS A 1 64 ? -7.777  9.180   1.781   1.00 0.00 ? 64 LYS A O    4  
ATOM 4560  C CB   . LYS A 1 64 ? -10.318 8.804   0.893   1.00 0.00 ? 64 LYS A CB   4  
ATOM 4561  C CG   . LYS A 1 64 ? -11.803 8.520   0.742   1.00 0.00 ? 64 LYS A CG   4  
ATOM 4562  C CD   . LYS A 1 64 ? -12.130 7.980   -0.642  1.00 0.00 ? 64 LYS A CD   4  
ATOM 4563  C CE   . LYS A 1 64 ? -12.384 6.481   -0.609  1.00 0.00 ? 64 LYS A CE   4  
ATOM 4564  N NZ   . LYS A 1 64 ? -13.161 6.024   -1.795  1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4565  H H    . LYS A 1 64 ? -10.410 5.944   2.290   1.00 0.00 ? 64 LYS A H    4  
ATOM 4566  H HA   . LYS A 1 64 ? -9.455  6.893   0.457   1.00 0.00 ? 64 LYS A HA   4  
ATOM 4567  H HB2  . LYS A 1 64 ? -10.194 9.566   1.648   1.00 0.00 ? 64 LYS A HB2  4  
ATOM 4568  H HB3  . LYS A 1 64 ? -9.946  9.178   -0.049  1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4569  H HG2  . LYS A 1 64 ? -12.099 7.791   1.481   1.00 0.00 ? 64 LYS A HG2  4  
ATOM 4570  H HG3  . LYS A 1 64 ? -12.352 9.437   0.899   1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4571  H HD2  . LYS A 1 64 ? -13.014 8.476   -1.012  1.00 0.00 ? 64 LYS A HD2  4  
ATOM 4572  H HD3  . LYS A 1 64 ? -11.298 8.180   -1.302  1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4573  H HE2  . LYS A 1 64 ? -11.436 5.967   -0.591  1.00 0.00 ? 64 LYS A HE2  4  
ATOM 4574  H HE3  . LYS A 1 64 ? -12.939 6.243   0.287   1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4575  H HZ1  . LYS A 1 64 ? -13.587 5.094   -1.606  1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4576  H HZ2  . LYS A 1 64 ? -12.536 5.943   -2.621  1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4577  H HZ3  . LYS A 1 64 ? -13.917 6.704   -2.011  1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4578  N N    . PHE A 1 65 ? -7.205  7.003   1.837   1.00 0.00 ? 65 PHE A N    4  
ATOM 4579  C CA   . PHE A 1 65 ? -5.815  7.264   2.191   1.00 0.00 ? 65 PHE A CA   4  
ATOM 4580  C C    . PHE A 1 65 ? -4.925  6.086   1.806   1.00 0.00 ? 65 PHE A C    4  
ATOM 4581  O O    . PHE A 1 65 ? -3.850  6.267   1.238   1.00 0.00 ? 65 PHE A O    4  
ATOM 4582  C CB   . PHE A 1 65 ? -5.692  7.542   3.690   1.00 0.00 ? 65 PHE A CB   4  
ATOM 4583  C CG   . PHE A 1 65 ? -5.835  8.995   4.044   1.00 0.00 ? 65 PHE A CG   4  
ATOM 4584  C CD1  . PHE A 1 65 ? -4.740  9.842   4.004   1.00 0.00 ? 65 PHE A CD1  4  
ATOM 4585  C CD2  . PHE A 1 65 ? -7.065  9.512   4.417   1.00 0.00 ? 65 PHE A CD2  4  
ATOM 4586  C CE1  . PHE A 1 65 ? -4.869  11.179  4.329   1.00 0.00 ? 65 PHE A CE1  4  
ATOM 4587  C CE2  . PHE A 1 65 ? -7.200  10.848  4.744   1.00 0.00 ? 65 PHE A CE2  4  
ATOM 4588  C CZ   . PHE A 1 65 ? -6.100  11.683  4.700   1.00 0.00 ? 65 PHE A CZ   4  
ATOM 4589  H H    . PHE A 1 65 ? -7.505  6.077   1.727   1.00 0.00 ? 65 PHE A H    4  
ATOM 4590  H HA   . PHE A 1 65 ? -5.491  8.138   1.644   1.00 0.00 ? 65 PHE A HA   4  
ATOM 4591  H HB2  . PHE A 1 65 ? -6.461  6.995   4.215   1.00 0.00 ? 65 PHE A HB2  4  
ATOM 4592  H HB3  . PHE A 1 65 ? -4.723  7.209   4.033   1.00 0.00 ? 65 PHE A HB3  4  
ATOM 4593  H HD1  . PHE A 1 65 ? -3.777  9.449   3.713   1.00 0.00 ? 65 PHE A HD1  4  
ATOM 4594  H HD2  . PHE A 1 65 ? -7.926  8.861   4.453   1.00 0.00 ? 65 PHE A HD2  4  
ATOM 4595  H HE1  . PHE A 1 65 ? -4.007  11.829  4.294   1.00 0.00 ? 65 PHE A HE1  4  
ATOM 4596  H HE2  . PHE A 1 65 ? -8.164  11.240  5.033   1.00 0.00 ? 65 PHE A HE2  4  
ATOM 4597  H HZ   . PHE A 1 65 ? -6.203  12.727  4.953   1.00 0.00 ? 65 PHE A HZ   4  
ATOM 4598  N N    . GLY A 1 66 ? -5.385  4.877   2.118   1.00 0.00 ? 66 GLY A N    4  
ATOM 4599  C CA   . GLY A 1 66 ? -4.619  3.688   1.796   1.00 0.00 ? 66 GLY A CA   4  
ATOM 4600  C C    . GLY A 1 66 ? -4.787  3.267   0.350   1.00 0.00 ? 66 GLY A C    4  
ATOM 4601  O O    . GLY A 1 66 ? -5.852  3.456   -0.239  1.00 0.00 ? 66 GLY A O    4  
ATOM 4602  H H    . GLY A 1 66 ? -6.250  4.794   2.570   1.00 0.00 ? 66 GLY A H    4  
ATOM 4603  H HA2  . GLY A 1 66 ? -3.574  3.884   1.983   1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4604  H HA3  . GLY A 1 66 ? -4.944  2.880   2.435   1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4605  N N    . LEU A 1 67 ? -3.734  2.697   -0.225  1.00 0.00 ? 67 LEU A N    4  
ATOM 4606  C CA   . LEU A 1 67 ? -3.770  2.250   -1.612  1.00 0.00 ? 67 LEU A CA   4  
ATOM 4607  C C    . LEU A 1 67 ? -3.073  0.903   -1.769  1.00 0.00 ? 67 LEU A C    4  
ATOM 4608  O O    . LEU A 1 67 ? -1.845  0.822   -1.746  1.00 0.00 ? 67 LEU A O    4  
ATOM 4609  C CB   . LEU A 1 67 ? -3.110  3.289   -2.522  1.00 0.00 ? 67 LEU A CB   4  
ATOM 4610  C CG   . LEU A 1 67 ? -3.255  3.024   -4.021  1.00 0.00 ? 67 LEU A CG   4  
ATOM 4611  C CD1  . LEU A 1 67 ? -4.711  3.139   -4.445  1.00 0.00 ? 67 LEU A CD1  4  
ATOM 4612  C CD2  . LEU A 1 67 ? -2.389  3.987   -4.817  1.00 0.00 ? 67 LEU A CD2  4  
ATOM 4613  H H    . LEU A 1 67 ? -2.913  2.574   0.296   1.00 0.00 ? 67 LEU A H    4  
ATOM 4614  H HA   . LEU A 1 67 ? -4.805  2.141   -1.899  1.00 0.00 ? 67 LEU A HA   4  
ATOM 4615  H HB2  . LEU A 1 67 ? -3.544  4.254   -2.303  1.00 0.00 ? 67 LEU A HB2  4  
ATOM 4616  H HB3  . LEU A 1 67 ? -2.057  3.325   -2.286  1.00 0.00 ? 67 LEU A HB3  4  
ATOM 4617  H HG   . LEU A 1 67 ? -2.924  2.018   -4.236  1.00 0.00 ? 67 LEU A HG   4  
ATOM 4618  H HD11 . LEU A 1 67 ? -5.324  2.534   -3.794  1.00 0.00 ? 67 LEU A HD11 4  
ATOM 4619  H HD12 . LEU A 1 67 ? -4.817  2.793   -5.463  1.00 0.00 ? 67 LEU A HD12 4  
ATOM 4620  H HD13 . LEU A 1 67 ? -5.024  4.171   -4.381  1.00 0.00 ? 67 LEU A HD13 4  
ATOM 4621  H HD21 . LEU A 1 67 ? -1.977  3.478   -5.676  1.00 0.00 ? 67 LEU A HD21 4  
ATOM 4622  H HD22 . LEU A 1 67 ? -1.583  4.348   -4.193  1.00 0.00 ? 67 LEU A HD22 4  
ATOM 4623  H HD23 . LEU A 1 67 ? -2.988  4.823   -5.147  1.00 0.00 ? 67 LEU A HD23 4  
ATOM 4624  N N    . PHE A 1 68 ? -3.865  -0.153  -1.930  1.00 0.00 ? 68 PHE A N    4  
ATOM 4625  C CA   . PHE A 1 68 ? -3.323  -1.497  -2.091  1.00 0.00 ? 68 PHE A CA   4  
ATOM 4626  C C    . PHE A 1 68 ? -2.754  -1.689  -3.493  1.00 0.00 ? 68 PHE A C    4  
ATOM 4627  O O    . PHE A 1 68 ? -3.381  -1.316  -4.485  1.00 0.00 ? 68 PHE A O    4  
ATOM 4628  C CB   . PHE A 1 68 ? -4.408  -2.543  -1.822  1.00 0.00 ? 68 PHE A CB   4  
ATOM 4629  C CG   . PHE A 1 68 ? -4.812  -2.632  -0.379  1.00 0.00 ? 68 PHE A CG   4  
ATOM 4630  C CD1  . PHE A 1 68 ? -3.977  -3.227  0.553   1.00 0.00 ? 68 PHE A CD1  4  
ATOM 4631  C CD2  . PHE A 1 68 ? -6.028  -2.121  0.047   1.00 0.00 ? 68 PHE A CD2  4  
ATOM 4632  C CE1  . PHE A 1 68 ? -4.347  -3.311  1.883   1.00 0.00 ? 68 PHE A CE1  4  
ATOM 4633  C CE2  . PHE A 1 68 ? -6.404  -2.201  1.375   1.00 0.00 ? 68 PHE A CE2  4  
ATOM 4634  C CZ   . PHE A 1 68 ? -5.561  -2.798  2.293   1.00 0.00 ? 68 PHE A CZ   4  
ATOM 4635  H H    . PHE A 1 68 ? -4.836  -0.024  -1.940  1.00 0.00 ? 68 PHE A H    4  
ATOM 4636  H HA   . PHE A 1 68 ? -2.528  -1.623  -1.372  1.00 0.00 ? 68 PHE A HA   4  
ATOM 4637  H HB2  . PHE A 1 68 ? -5.287  -2.296  -2.397  1.00 0.00 ? 68 PHE A HB2  4  
ATOM 4638  H HB3  . PHE A 1 68 ? -4.045  -3.513  -2.128  1.00 0.00 ? 68 PHE A HB3  4  
ATOM 4639  H HD1  . PHE A 1 68 ? -3.027  -3.628  0.233   1.00 0.00 ? 68 PHE A HD1  4  
ATOM 4640  H HD2  . PHE A 1 68 ? -6.687  -1.654  -0.671  1.00 0.00 ? 68 PHE A HD2  4  
ATOM 4641  H HE1  . PHE A 1 68 ? -3.687  -3.779  2.599   1.00 0.00 ? 68 PHE A HE1  4  
ATOM 4642  H HE2  . PHE A 1 68 ? -7.353  -1.799  1.693   1.00 0.00 ? 68 PHE A HE2  4  
ATOM 4643  H HZ   . PHE A 1 68 ? -5.853  -2.863  3.332   1.00 0.00 ? 68 PHE A HZ   4  
ATOM 4644  N N    . ALA A 1 69 ? -1.563  -2.274  -3.568  1.00 0.00 ? 69 ALA A N    4  
ATOM 4645  C CA   . ALA A 1 69 ? -0.911  -2.517  -4.849  1.00 0.00 ? 69 ALA A CA   4  
ATOM 4646  C C    . ALA A 1 69 ? 0.007   -3.735  -4.776  1.00 0.00 ? 69 ALA A C    4  
ATOM 4647  O O    . ALA A 1 69 ? 0.630   -3.990  -3.745  1.00 0.00 ? 69 ALA A O    4  
ATOM 4648  C CB   . ALA A 1 69 ? -0.124  -1.288  -5.280  1.00 0.00 ? 69 ALA A CB   4  
ATOM 4649  H H    . ALA A 1 69 ? -1.113  -2.550  -2.742  1.00 0.00 ? 69 ALA A H    4  
ATOM 4650  H HA   . ALA A 1 69 ? -1.680  -2.700  -5.583  1.00 0.00 ? 69 ALA A HA   4  
ATOM 4651  H HB1  . ALA A 1 69 ? -0.771  -0.423  -5.263  1.00 0.00 ? 69 ALA A HB1  4  
ATOM 4652  H HB2  . ALA A 1 69 ? 0.253   -1.435  -6.282  1.00 0.00 ? 69 ALA A HB2  4  
ATOM 4653  H HB3  . ALA A 1 69 ? 0.702   -1.132  -4.603  1.00 0.00 ? 69 ALA A HB3  4  
ATOM 4654  N N    . PRO A 1 70 ? 0.104   -4.507  -5.873  1.00 0.00 ? 70 PRO A N    4  
ATOM 4655  C CA   . PRO A 1 70 ? 0.954   -5.701  -5.922  1.00 0.00 ? 70 PRO A CA   4  
ATOM 4656  C C    . PRO A 1 70 ? 2.397   -5.396  -5.540  1.00 0.00 ? 70 PRO A C    4  
ATOM 4657  O O    . PRO A 1 70 ? 2.923   -4.331  -5.862  1.00 0.00 ? 70 PRO A O    4  
ATOM 4658  C CB   . PRO A 1 70 ? 0.872   -6.143  -7.385  1.00 0.00 ? 70 PRO A CB   4  
ATOM 4659  C CG   . PRO A 1 70 ? -0.409  -5.571  -7.886  1.00 0.00 ? 70 PRO A CG   4  
ATOM 4660  C CD   . PRO A 1 70 ? -0.602  -4.277  -7.146  1.00 0.00 ? 70 PRO A CD   4  
ATOM 4661  H HA   . PRO A 1 70 ? 0.571   -6.485  -5.284  1.00 0.00 ? 70 PRO A HA   4  
ATOM 4662  H HB2  . PRO A 1 70 ? 1.719   -5.752  -7.929  1.00 0.00 ? 70 PRO A HB2  4  
ATOM 4663  H HB3  . PRO A 1 70 ? 0.868   -7.221  -7.438  1.00 0.00 ? 70 PRO A HB3  4  
ATOM 4664  H HG2  . PRO A 1 70 ? -0.339  -5.389  -8.948  1.00 0.00 ? 70 PRO A HG2  4  
ATOM 4665  H HG3  . PRO A 1 70 ? -1.222  -6.249  -7.674  1.00 0.00 ? 70 PRO A HG3  4  
ATOM 4666  H HD2  . PRO A 1 70 ? -0.157  -3.460  -7.693  1.00 0.00 ? 70 PRO A HD2  4  
ATOM 4667  H HD3  . PRO A 1 70 ? -1.653  -4.093  -6.977  1.00 0.00 ? 70 PRO A HD3  4  
ATOM 4668  N N    . ILE A 1 71 ? 3.033   -6.337  -4.849  1.00 0.00 ? 71 ILE A N    4  
ATOM 4669  C CA   . ILE A 1 71 ? 4.417   -6.166  -4.422  1.00 0.00 ? 71 ILE A CA   4  
ATOM 4670  C C    . ILE A 1 71 ? 5.335   -5.907  -5.613  1.00 0.00 ? 71 ILE A C    4  
ATOM 4671  O O    . ILE A 1 71 ? 6.158   -4.992  -5.587  1.00 0.00 ? 71 ILE A O    4  
ATOM 4672  C CB   . ILE A 1 71 ? 4.921   -7.399  -3.643  1.00 0.00 ? 71 ILE A CB   4  
ATOM 4673  C CG1  . ILE A 1 71 ? 6.342   -7.163  -3.126  1.00 0.00 ? 71 ILE A CG1  4  
ATOM 4674  C CG2  . ILE A 1 71 ? 4.870   -8.642  -4.519  1.00 0.00 ? 71 ILE A CG2  4  
ATOM 4675  C CD1  . ILE A 1 71 ? 6.573   -7.697  -1.730  1.00 0.00 ? 71 ILE A CD1  4  
ATOM 4676  H H    . ILE A 1 71 ? 2.561   -7.164  -4.621  1.00 0.00 ? 71 ILE A H    4  
ATOM 4677  H HA   . ILE A 1 71 ? 4.455   -5.311  -3.762  1.00 0.00 ? 71 ILE A HA   4  
ATOM 4678  H HB   . ILE A 1 71 ? 4.263   -7.557  -2.802  1.00 0.00 ? 71 ILE A HB   4  
ATOM 4679  H HG12 . ILE A 1 71 ? 7.044   -7.648  -3.787  1.00 0.00 ? 71 ILE A HG12 4  
ATOM 4680  H HG13 . ILE A 1 71 ? 6.542   -6.101  -3.113  1.00 0.00 ? 71 ILE A HG13 4  
ATOM 4681  H HG21 . ILE A 1 71 ? 5.050   -9.517  -3.913  1.00 0.00 ? 71 ILE A HG21 4  
ATOM 4682  H HG22 . ILE A 1 71 ? 5.628   -8.574  -5.286  1.00 0.00 ? 71 ILE A HG22 4  
ATOM 4683  H HG23 . ILE A 1 71 ? 3.897   -8.717  -4.981  1.00 0.00 ? 71 ILE A HG23 4  
ATOM 4684  H HD11 . ILE A 1 71 ? 5.722   -7.461  -1.108  1.00 0.00 ? 71 ILE A HD11 4  
ATOM 4685  H HD12 . ILE A 1 71 ? 7.460   -7.243  -1.313  1.00 0.00 ? 71 ILE A HD12 4  
ATOM 4686  H HD13 . ILE A 1 71 ? 6.701   -8.769  -1.771  1.00 0.00 ? 71 ILE A HD13 4  
ATOM 4687  N N    . HIS A 1 72 ? 5.186   -6.715  -6.659  1.00 0.00 ? 72 HIS A N    4  
ATOM 4688  C CA   . HIS A 1 72 ? 6.003   -6.568  -7.859  1.00 0.00 ? 72 HIS A CA   4  
ATOM 4689  C C    . HIS A 1 72 ? 5.749   -5.224  -8.535  1.00 0.00 ? 72 HIS A C    4  
ATOM 4690  O O    . HIS A 1 72 ? 6.589   -4.729  -9.286  1.00 0.00 ? 72 HIS A O    4  
ATOM 4691  C CB   . HIS A 1 72 ? 5.719   -7.708  -8.839  1.00 0.00 ? 72 HIS A CB   4  
ATOM 4692  C CG   . HIS A 1 72 ? 4.259   -7.979  -9.038  1.00 0.00 ? 72 HIS A CG   4  
ATOM 4693  N ND1  . HIS A 1 72 ? 3.524   -8.838  -8.253  1.00 0.00 ? 72 HIS A ND1  4  
ATOM 4694  C CD2  . HIS A 1 72 ? 3.395   -7.481  -9.960  1.00 0.00 ? 72 HIS A CD2  4  
ATOM 4695  C CE1  . HIS A 1 72 ? 2.265   -8.839  -8.711  1.00 0.00 ? 72 HIS A CE1  4  
ATOM 4696  N NE2  . HIS A 1 72 ? 2.134   -8.032  -9.745  1.00 0.00 ? 72 HIS A NE2  4  
ATOM 4697  H H    . HIS A 1 72 ? 4.511   -7.424  -6.624  1.00 0.00 ? 72 HIS A H    4  
ATOM 4698  H HA   . HIS A 1 72 ? 7.039   -6.616  -7.560  1.00 0.00 ? 72 HIS A HA   4  
ATOM 4699  H HB2  . HIS A 1 72 ? 6.143   -7.461  -9.801  1.00 0.00 ? 72 HIS A HB2  4  
ATOM 4700  H HB3  . HIS A 1 72 ? 6.178   -8.614  -8.471  1.00 0.00 ? 72 HIS A HB3  4  
ATOM 4701  H HD1  . HIS A 1 72 ? 3.862   -9.358  -7.494  1.00 0.00 ? 72 HIS A HD1  4  
ATOM 4702  H HD2  . HIS A 1 72 ? 3.636   -6.773  -10.738 1.00 0.00 ? 72 HIS A HD2  4  
ATOM 4703  H HE1  . HIS A 1 72 ? 1.461   -9.424  -8.287  1.00 0.00 ? 72 HIS A HE1  4  
ATOM 4704  N N    . LYS A 1 73 ? 4.585   -4.638  -8.267  1.00 0.00 ? 73 LYS A N    4  
ATOM 4705  C CA   . LYS A 1 73 ? 4.225   -3.351  -8.851  1.00 0.00 ? 73 LYS A CA   4  
ATOM 4706  C C    . LYS A 1 73 ? 4.760   -2.194  -8.012  1.00 0.00 ? 73 LYS A C    4  
ATOM 4707  O O    . LYS A 1 73 ? 4.918   -1.079  -8.508  1.00 0.00 ? 73 LYS A O    4  
ATOM 4708  C CB   . LYS A 1 73 ? 2.705   -3.239  -8.986  1.00 0.00 ? 73 LYS A CB   4  
ATOM 4709  C CG   . LYS A 1 73 ? 2.117   -4.158  -10.043 1.00 0.00 ? 73 LYS A CG   4  
ATOM 4710  C CD   . LYS A 1 73 ? 2.527   -3.731  -11.444 1.00 0.00 ? 73 LYS A CD   4  
ATOM 4711  C CE   . LYS A 1 73 ? 2.934   -4.924  -12.295 1.00 0.00 ? 73 LYS A CE   4  
ATOM 4712  N NZ   . LYS A 1 73 ? 2.960   -4.589  -13.745 1.00 0.00 ? 73 LYS A NZ   4  
ATOM 4713  H H    . LYS A 1 73 ? 3.955   -5.080  -7.661  1.00 0.00 ? 73 LYS A H    4  
ATOM 4714  H HA   . LYS A 1 73 ? 4.667   -3.301  -9.834  1.00 0.00 ? 73 LYS A HA   4  
ATOM 4715  H HB2  . LYS A 1 73 ? 2.252   -3.482  -8.035  1.00 0.00 ? 73 LYS A HB2  4  
ATOM 4716  H HB3  . LYS A 1 73 ? 2.453   -2.220  -9.244  1.00 0.00 ? 73 LYS A HB3  4  
ATOM 4717  H HG2  . LYS A 1 73 ? 2.470   -5.165  -9.866  1.00 0.00 ? 73 LYS A HG2  4  
ATOM 4718  H HG3  . LYS A 1 73 ? 1.040   -4.134  -9.968  1.00 0.00 ? 73 LYS A HG3  4  
ATOM 4719  H HD2  . LYS A 1 73 ? 1.691   -3.234  -11.916 1.00 0.00 ? 73 LYS A HD2  4  
ATOM 4720  H HD3  . LYS A 1 73 ? 3.361   -3.049  -11.373 1.00 0.00 ? 73 LYS A HD3  4  
ATOM 4721  H HE2  . LYS A 1 73 ? 3.919   -5.246  -11.992 1.00 0.00 ? 73 LYS A HE2  4  
ATOM 4722  H HE3  . LYS A 1 73 ? 2.228   -5.725  -12.131 1.00 0.00 ? 73 LYS A HE3  4  
ATOM 4723  H HZ1  . LYS A 1 73 ? 3.083   -3.563  -13.873 1.00 0.00 ? 73 LYS A HZ1  4  
ATOM 4724  H HZ2  . LYS A 1 73 ? 2.069   -4.878  -14.195 1.00 0.00 ? 73 LYS A HZ2  4  
ATOM 4725  H HZ3  . LYS A 1 73 ? 3.748   -5.082  -14.211 1.00 0.00 ? 73 LYS A HZ3  4  
ATOM 4726  N N    . VAL A 1 74 ? 5.036   -2.464  -6.738  1.00 0.00 ? 74 VAL A N    4  
ATOM 4727  C CA   . VAL A 1 74 ? 5.551   -1.440  -5.837  1.00 0.00 ? 74 VAL A CA   4  
ATOM 4728  C C    . VAL A 1 74 ? 7.015   -1.129  -6.135  1.00 0.00 ? 74 VAL A C    4  
ATOM 4729  O O    . VAL A 1 74 ? 7.772   -2.000  -6.561  1.00 0.00 ? 74 VAL A O    4  
ATOM 4730  C CB   . VAL A 1 74 ? 5.417   -1.868  -4.364  1.00 0.00 ? 74 VAL A CB   4  
ATOM 4731  C CG1  . VAL A 1 74 ? 5.818   -0.732  -3.435  1.00 0.00 ? 74 VAL A CG1  4  
ATOM 4732  C CG2  . VAL A 1 74 ? 3.997   -2.331  -4.070  1.00 0.00 ? 74 VAL A CG2  4  
ATOM 4733  H H    . VAL A 1 74 ? 4.891   -3.370  -6.396  1.00 0.00 ? 74 VAL A H    4  
ATOM 4734  H HA   . VAL A 1 74 ? 4.966   -0.543  -5.984  1.00 0.00 ? 74 VAL A HA   4  
ATOM 4735  H HB   . VAL A 1 74 ? 6.086   -2.699  -4.189  1.00 0.00 ? 74 VAL A HB   4  
ATOM 4736  H HG11 . VAL A 1 74 ? 6.893   -0.628  -3.438  1.00 0.00 ? 74 VAL A HG11 4  
ATOM 4737  H HG12 . VAL A 1 74 ? 5.480   -0.949  -2.433  1.00 0.00 ? 74 VAL A HG12 4  
ATOM 4738  H HG13 . VAL A 1 74 ? 5.367   0.188   -3.776  1.00 0.00 ? 74 VAL A HG13 4  
ATOM 4739  H HG21 . VAL A 1 74 ? 3.959   -3.410  -4.090  1.00 0.00 ? 74 VAL A HG21 4  
ATOM 4740  H HG22 . VAL A 1 74 ? 3.327   -1.933  -4.818  1.00 0.00 ? 74 VAL A HG22 4  
ATOM 4741  H HG23 . VAL A 1 74 ? 3.697   -1.977  -3.094  1.00 0.00 ? 74 VAL A HG23 4  
ATOM 4742  N N    . ILE A 1 75 ? 7.405   0.121   -5.905  1.00 0.00 ? 75 ILE A N    4  
ATOM 4743  C CA   . ILE A 1 75 ? 8.778   0.550   -6.146  1.00 0.00 ? 75 ILE A CA   4  
ATOM 4744  C C    . ILE A 1 75 ? 9.337   1.303   -4.945  1.00 0.00 ? 75 ILE A C    4  
ATOM 4745  O O    . ILE A 1 75 ? 8.680   2.185   -4.392  1.00 0.00 ? 75 ILE A O    4  
ATOM 4746  C CB   . ILE A 1 75 ? 8.875   1.450   -7.393  1.00 0.00 ? 75 ILE A CB   4  
ATOM 4747  C CG1  . ILE A 1 75 ? 8.139   0.810   -8.573  1.00 0.00 ? 75 ILE A CG1  4  
ATOM 4748  C CG2  . ILE A 1 75 ? 10.333  1.712   -7.746  1.00 0.00 ? 75 ILE A CG2  4  
ATOM 4749  C CD1  . ILE A 1 75 ? 6.839   1.502   -8.921  1.00 0.00 ? 75 ILE A CD1  4  
ATOM 4750  H H    . ILE A 1 75 ? 6.755   0.770   -5.564  1.00 0.00 ? 75 ILE A H    4  
ATOM 4751  H HA   . ILE A 1 75 ? 9.378   -0.333  -6.317  1.00 0.00 ? 75 ILE A HA   4  
ATOM 4752  H HB   . ILE A 1 75 ? 8.412   2.398   -7.161  1.00 0.00 ? 75 ILE A HB   4  
ATOM 4753  H HG12 . ILE A 1 75 ? 8.774   0.842   -9.446  1.00 0.00 ? 75 ILE A HG12 4  
ATOM 4754  H HG13 . ILE A 1 75 ? 7.914   -0.219  -8.334  1.00 0.00 ? 75 ILE A HG13 4  
ATOM 4755  H HG21 . ILE A 1 75 ? 10.458  2.752   -8.010  1.00 0.00 ? 75 ILE A HG21 4  
ATOM 4756  H HG22 . ILE A 1 75 ? 10.618  1.091   -8.582  1.00 0.00 ? 75 ILE A HG22 4  
ATOM 4757  H HG23 . ILE A 1 75 ? 10.957  1.480   -6.896  1.00 0.00 ? 75 ILE A HG23 4  
ATOM 4758  H HD11 . ILE A 1 75 ? 6.071   1.197   -8.224  1.00 0.00 ? 75 ILE A HD11 4  
ATOM 4759  H HD12 . ILE A 1 75 ? 6.543   1.230   -9.923  1.00 0.00 ? 75 ILE A HD12 4  
ATOM 4760  H HD13 . ILE A 1 75 ? 6.974   2.572   -8.862  1.00 0.00 ? 75 ILE A HD13 4  
ATOM 4761  N N    . ARG A 1 76 ? 10.554  0.949   -4.545  1.00 0.00 ? 76 ARG A N    4  
ATOM 4762  C CA   . ARG A 1 76 ? 11.202  1.592   -3.408  1.00 0.00 ? 76 ARG A CA   4  
ATOM 4763  C C    . ARG A 1 76 ? 11.987  2.823   -3.851  1.00 0.00 ? 76 ARG A C    4  
ATOM 4764  O O    . ARG A 1 76 ? 12.880  2.730   -4.693  1.00 0.00 ? 76 ARG A O    4  
ATOM 4765  C CB   . ARG A 1 76 ? 12.134  0.605   -2.701  1.00 0.00 ? 76 ARG A CB   4  
ATOM 4766  C CG   . ARG A 1 76 ? 12.107  0.718   -1.186  1.00 0.00 ? 76 ARG A CG   4  
ATOM 4767  C CD   . ARG A 1 76 ? 12.267  -0.640  -0.522  1.00 0.00 ? 76 ARG A CD   4  
ATOM 4768  N NE   . ARG A 1 76 ? 13.077  -0.565  0.691   1.00 0.00 ? 76 ARG A NE   4  
ATOM 4769  C CZ   . ARG A 1 76 ? 14.368  -0.239  0.701   1.00 0.00 ? 76 ARG A CZ   4  
ATOM 4770  N NH1  . ARG A 1 76 ? 14.997  0.046   -0.432  1.00 0.00 ? 76 ARG A NH1  4  
ATOM 4771  N NH2  . ARG A 1 76 ? 15.031  -0.196  1.849   1.00 0.00 ? 76 ARG A NH2  4  
ATOM 4772  H H    . ARG A 1 76 ? 11.027  0.238   -5.025  1.00 0.00 ? 76 ARG A H    4  
ATOM 4773  H HA   . ARG A 1 76 ? 10.431  1.901   -2.718  1.00 0.00 ? 76 ARG A HA   4  
ATOM 4774  H HB2  . ARG A 1 76 ? 11.844  -0.401  -2.970  1.00 0.00 ? 76 ARG A HB2  4  
ATOM 4775  H HB3  . ARG A 1 76 ? 13.145  0.779   -3.036  1.00 0.00 ? 76 ARG A HB3  4  
ATOM 4776  H HG2  . ARG A 1 76 ? 12.916  1.361   -0.868  1.00 0.00 ? 76 ARG A HG2  4  
ATOM 4777  H HG3  . ARG A 1 76 ? 11.164  1.149   -0.884  1.00 0.00 ? 76 ARG A HG3  4  
ATOM 4778  H HD2  . ARG A 1 76 ? 11.288  -1.018  -0.266  1.00 0.00 ? 76 ARG A HD2  4  
ATOM 4779  H HD3  . ARG A 1 76 ? 12.741  -1.314  -1.221  1.00 0.00 ? 76 ARG A HD3  4  
ATOM 4780  H HE   . ARG A 1 76 ? 12.637  -0.770  1.542   1.00 0.00 ? 76 ARG A HE   4  
ATOM 4781  H HH11 . ARG A 1 76 ? 14.502  0.017   -1.301  1.00 0.00 ? 76 ARG A HH11 4  
ATOM 4782  H HH12 . ARG A 1 76 ? 15.966  0.292   -0.417  1.00 0.00 ? 76 ARG A HH12 4  
ATOM 4783  H HH21 . ARG A 1 76 ? 14.562  -0.410  2.707   1.00 0.00 ? 76 ARG A HH21 4  
ATOM 4784  H HH22 . ARG A 1 76 ? 16.000  0.049   1.857   1.00 0.00 ? 76 ARG A HH22 4  
ATOM 4785  N N    . ILE A 1 77 ? 11.648  3.973   -3.278  1.00 0.00 ? 77 ILE A N    4  
ATOM 4786  C CA   . ILE A 1 77 ? 12.321  5.222   -3.616  1.00 0.00 ? 77 ILE A CA   4  
ATOM 4787  C C    . ILE A 1 77 ? 13.173  5.719   -2.452  1.00 0.00 ? 77 ILE A C    4  
ATOM 4788  O O    . ILE A 1 77 ? 14.192  6.379   -2.654  1.00 0.00 ? 77 ILE A O    4  
ATOM 4789  C CB   . ILE A 1 77 ? 11.312  6.320   -4.003  1.00 0.00 ? 77 ILE A CB   4  
ATOM 4790  C CG1  . ILE A 1 77 ? 10.203  6.422   -2.953  1.00 0.00 ? 77 ILE A CG1  4  
ATOM 4791  C CG2  . ILE A 1 77 ? 10.723  6.037   -5.377  1.00 0.00 ? 77 ILE A CG2  4  
ATOM 4792  C CD1  . ILE A 1 77 ? 9.873   7.846   -2.561  1.00 0.00 ? 77 ILE A CD1  4  
ATOM 4793  H H    . ILE A 1 77 ? 10.927  3.982   -2.614  1.00 0.00 ? 77 ILE A H    4  
ATOM 4794  H HA   . ILE A 1 77 ? 12.962  5.035   -4.465  1.00 0.00 ? 77 ILE A HA   4  
ATOM 4795  H HB   . ILE A 1 77 ? 11.839  7.260   -4.053  1.00 0.00 ? 77 ILE A HB   4  
ATOM 4796  H HG12 . ILE A 1 77 ? 9.303   5.969   -3.341  1.00 0.00 ? 77 ILE A HG12 4  
ATOM 4797  H HG13 . ILE A 1 77 ? 10.510  5.895   -2.062  1.00 0.00 ? 77 ILE A HG13 4  
ATOM 4798  H HG21 . ILE A 1 77 ? 10.127  6.878   -5.693  1.00 0.00 ? 77 ILE A HG21 4  
ATOM 4799  H HG22 . ILE A 1 77 ? 10.103  5.154   -5.328  1.00 0.00 ? 77 ILE A HG22 4  
ATOM 4800  H HG23 . ILE A 1 77 ? 11.523  5.875   -6.086  1.00 0.00 ? 77 ILE A HG23 4  
ATOM 4801  H HD11 . ILE A 1 77 ? 9.173   8.261   -3.271  1.00 0.00 ? 77 ILE A HD11 4  
ATOM 4802  H HD12 . ILE A 1 77 ? 10.776  8.438   -2.559  1.00 0.00 ? 77 ILE A HD12 4  
ATOM 4803  H HD13 . ILE A 1 77 ? 9.433   7.855   -1.575  1.00 0.00 ? 77 ILE A HD13 4  
ATOM 4804  N N    . GLY A 1 78 ? 12.749  5.398   -1.234  1.00 0.00 ? 78 GLY A N    4  
ATOM 4805  C CA   . GLY A 1 78 ? 13.486  5.820   -0.057  1.00 0.00 ? 78 GLY A CA   4  
ATOM 4806  C C    . GLY A 1 78 ? 13.157  7.243   0.352   1.00 0.00 ? 78 GLY A C    4  
ATOM 4807  O O    . GLY A 1 78 ? 12.364  7.466   1.267   1.00 0.00 ? 78 GLY A O    4  
ATOM 4808  H H    . GLY A 1 78 ? 11.930  4.869   -1.133  1.00 0.00 ? 78 GLY A H    4  
ATOM 4809  H HA2  . GLY A 1 78 ? 13.245  5.158   0.761   1.00 0.00 ? 78 GLY A HA2  4  
ATOM 4810  H HA3  . GLY A 1 78 ? 14.543  5.752   -0.264  1.00 0.00 ? 78 GLY A HA3  4  
ATOM 4811  N N    . SER A 1 79 ? 13.769  8.208   -0.327  1.00 0.00 ? 79 SER A N    4  
ATOM 4812  C CA   . SER A 1 79 ? 13.539  9.616   -0.029  1.00 0.00 ? 79 SER A CA   4  
ATOM 4813  C C    . SER A 1 79 ? 13.912  10.493  -1.221  1.00 0.00 ? 79 SER A C    4  
ATOM 4814  O O    . SER A 1 79 ? 14.989  11.088  -1.254  1.00 0.00 ? 79 SER A O    4  
ATOM 4815  C CB   . SER A 1 79 ? 14.344  10.037  1.201   1.00 0.00 ? 79 SER A CB   4  
ATOM 4816  O OG   . SER A 1 79 ? 14.465  8.969   2.123   1.00 0.00 ? 79 SER A OG   4  
ATOM 4817  H H    . SER A 1 79 ? 14.391  7.966   -1.046  1.00 0.00 ? 79 SER A H    4  
ATOM 4818  H HA   . SER A 1 79 ? 12.487  9.743   0.180   1.00 0.00 ? 79 SER A HA   4  
ATOM 4819  H HB2  . SER A 1 79 ? 15.334  10.344  0.893   1.00 0.00 ? 79 SER A HB2  4  
ATOM 4820  H HB3  . SER A 1 79 ? 13.848  10.864  1.688   1.00 0.00 ? 79 SER A HB3  4  
ATOM 4821  H HG   . SER A 1 79 ? 14.006  9.193   2.935   1.00 0.00 ? 79 SER A HG   4  
ATOM 4822  N N    . GLY A 1 80 ? 13.014  10.566  -2.199  1.00 0.00 ? 80 GLY A N    4  
ATOM 4823  C CA   . GLY A 1 80 ? 13.267  11.372  -3.379  1.00 0.00 ? 80 GLY A CA   4  
ATOM 4824  C C    . GLY A 1 80 ? 13.273  12.860  -3.078  1.00 0.00 ? 80 GLY A C    4  
ATOM 4825  O O    . GLY A 1 80 ? 13.359  13.258  -1.916  1.00 0.00 ? 80 GLY A O    4  
ATOM 4826  H H    . GLY A 1 80 ? 12.173  10.071  -2.118  1.00 0.00 ? 80 GLY A H    4  
ATOM 4827  H HA2  . GLY A 1 80 ? 14.228  11.096  -3.790  1.00 0.00 ? 80 GLY A HA2  4  
ATOM 4828  H HA3  . GLY A 1 80 ? 12.502  11.167  -4.112  1.00 0.00 ? 80 GLY A HA3  4  
ATOM 4829  N N    . PRO A 1 81 ? 13.182  13.712  -4.113  1.00 0.00 ? 81 PRO A N    4  
ATOM 4830  C CA   . PRO A 1 81 ? 13.178  15.168  -3.939  1.00 0.00 ? 81 PRO A CA   4  
ATOM 4831  C C    . PRO A 1 81 ? 11.892  15.670  -3.290  1.00 0.00 ? 81 PRO A C    4  
ATOM 4832  O O    . PRO A 1 81 ? 10.899  15.926  -3.971  1.00 0.00 ? 81 PRO A O    4  
ATOM 4833  C CB   . PRO A 1 81 ? 13.295  15.698  -5.370  1.00 0.00 ? 81 PRO A CB   4  
ATOM 4834  C CG   . PRO A 1 81 ? 12.733  14.614  -6.222  1.00 0.00 ? 81 PRO A CG   4  
ATOM 4835  C CD   . PRO A 1 81 ? 13.076  13.323  -5.532  1.00 0.00 ? 81 PRO A CD   4  
ATOM 4836  H HA   . PRO A 1 81 ? 14.025  15.500  -3.359  1.00 0.00 ? 81 PRO A HA   4  
ATOM 4837  H HB2  . PRO A 1 81 ? 12.728  16.612  -5.466  1.00 0.00 ? 81 PRO A HB2  4  
ATOM 4838  H HB3  . PRO A 1 81 ? 14.333  15.884  -5.604  1.00 0.00 ? 81 PRO A HB3  4  
ATOM 4839  H HG2  . PRO A 1 81 ? 11.661  14.726  -6.297  1.00 0.00 ? 81 PRO A HG2  4  
ATOM 4840  H HG3  . PRO A 1 81 ? 13.183  14.647  -7.203  1.00 0.00 ? 81 PRO A HG3  4  
ATOM 4841  H HD2  . PRO A 1 81 ? 12.289  12.597  -5.675  1.00 0.00 ? 81 PRO A HD2  4  
ATOM 4842  H HD3  . PRO A 1 81 ? 14.017  12.939  -5.897  1.00 0.00 ? 81 PRO A HD3  4  
ATOM 4843  N N    . SER A 1 82 ? 11.918  15.807  -1.968  1.00 0.00 ? 82 SER A N    4  
ATOM 4844  C CA   . SER A 1 82 ? 10.755  16.278  -1.226  1.00 0.00 ? 82 SER A CA   4  
ATOM 4845  C C    . SER A 1 82 ? 11.106  16.526  0.237   1.00 0.00 ? 82 SER A C    4  
ATOM 4846  O O    . SER A 1 82 ? 12.243  16.312  0.659   1.00 0.00 ? 82 SER A O    4  
ATOM 4847  C CB   . SER A 1 82 ? 9.615   15.263  -1.323  1.00 0.00 ? 82 SER A CB   4  
ATOM 4848  O OG   . SER A 1 82 ? 8.840   15.475  -2.491  1.00 0.00 ? 82 SER A OG   4  
ATOM 4849  H H    . SER A 1 82 ? 12.738  15.586  -1.480  1.00 0.00 ? 82 SER A H    4  
ATOM 4850  H HA   . SER A 1 82 ? 10.433  17.209  -1.669  1.00 0.00 ? 82 SER A HA   4  
ATOM 4851  H HB2  . SER A 1 82 ? 10.027  14.265  -1.357  1.00 0.00 ? 82 SER A HB2  4  
ATOM 4852  H HB3  . SER A 1 82 ? 8.975   15.359  -0.459  1.00 0.00 ? 82 SER A HB3  4  
ATOM 4853  H HG   . SER A 1 82 ? 8.039   15.952  -2.261  1.00 0.00 ? 82 SER A HG   4  
ATOM 4854  N N    . SER A 1 83 ? 10.123  16.978  1.009   1.00 0.00 ? 83 SER A N    4  
ATOM 4855  C CA   . SER A 1 83 ? 10.328  17.255  2.426   1.00 0.00 ? 83 SER A CA   4  
ATOM 4856  C C    . SER A 1 83 ? 9.000   17.528  3.125   1.00 0.00 ? 83 SER A C    4  
ATOM 4857  O O    . SER A 1 83 ? 8.025   17.930  2.492   1.00 0.00 ? 83 SER A O    4  
ATOM 4858  C CB   . SER A 1 83 ? 11.267  18.450  2.602   1.00 0.00 ? 83 SER A CB   4  
ATOM 4859  O OG   . SER A 1 83 ? 10.646  19.653  2.182   1.00 0.00 ? 83 SER A OG   4  
ATOM 4860  H H    . SER A 1 83 ? 9.238   17.129  0.616   1.00 0.00 ? 83 SER A H    4  
ATOM 4861  H HA   . SER A 1 83 ? 10.784  16.382  2.871   1.00 0.00 ? 83 SER A HA   4  
ATOM 4862  H HB2  . SER A 1 83 ? 11.535  18.543  3.644   1.00 0.00 ? 83 SER A HB2  4  
ATOM 4863  H HB3  . SER A 1 83 ? 12.158  18.294  2.013   1.00 0.00 ? 83 SER A HB3  4  
ATOM 4864  H HG   . SER A 1 83 ? 11.297  20.357  2.157   1.00 0.00 ? 83 SER A HG   4  
ATOM 4865  N N    . GLY A 1 84 ? 8.972   17.306  4.435   1.00 0.00 ? 84 GLY A N    4  
ATOM 4866  C CA   . GLY A 1 84 ? 7.760   17.534  5.199   1.00 0.00 ? 84 GLY A CA   4  
ATOM 4867  C C    . GLY A 1 84 ? 7.475   16.416  6.184   1.00 0.00 ? 84 GLY A C    4  
ATOM 4868  O O    . GLY A 1 84 ? 7.198   16.721  7.363   1.00 0.00 ? 84 GLY A O    4  
ATOM 4869  O OXT  . GLY A 1 84 ? 7.530   15.237  5.776   1.00 0.00 ? 84 GLY A OXT  4  
ATOM 4870  H H    . GLY A 1 84 ? 9.780   16.986  4.887   1.00 0.00 ? 84 GLY A H    4  
ATOM 4871  H HA2  . GLY A 1 84 ? 7.858   18.461  5.743   1.00 0.00 ? 84 GLY A HA2  4  
ATOM 4872  H HA3  . GLY A 1 84 ? 6.927   17.616  4.517   1.00 0.00 ? 84 GLY A HA3  4  
ATOM 4873  N N    . GLY A 1 1  ? 15.805  -20.157 -12.021 1.00 0.00 ? 1  GLY A N    5  
ATOM 4874  C CA   . GLY A 1 1  ? 15.076  -18.883 -11.773 1.00 0.00 ? 1  GLY A CA   5  
ATOM 4875  C C    . GLY A 1 1  ? 14.431  -18.840 -10.402 1.00 0.00 ? 1  GLY A C    5  
ATOM 4876  O O    . GLY A 1 1  ? 13.264  -18.471 -10.269 1.00 0.00 ? 1  GLY A O    5  
ATOM 4877  H H1   . GLY A 1 1  ? 16.822  -20.027 -11.844 1.00 0.00 ? 1  GLY A H1   5  
ATOM 4878  H H2   . GLY A 1 1  ? 15.672  -20.460 -13.005 1.00 0.00 ? 1  GLY A H2   5  
ATOM 4879  H H3   . GLY A 1 1  ? 15.447  -20.902 -11.389 1.00 0.00 ? 1  GLY A H3   5  
ATOM 4880  H HA2  . GLY A 1 1  ? 15.772  -18.061 -11.857 1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4881  H HA3  . GLY A 1 1  ? 14.309  -18.769 -12.524 1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4882  N N    . SER A 1 2  ? 15.191  -19.220 -9.380  1.00 0.00 ? 2  SER A N    5  
ATOM 4883  C CA   . SER A 1 2  ? 14.686  -19.224 -8.012  1.00 0.00 ? 2  SER A CA   5  
ATOM 4884  C C    . SER A 1 2  ? 15.239  -18.041 -7.224  1.00 0.00 ? 2  SER A C    5  
ATOM 4885  O O    . SER A 1 2  ? 14.581  -17.521 -6.323  1.00 0.00 ? 2  SER A O    5  
ATOM 4886  C CB   . SER A 1 2  ? 15.056  -20.534 -7.313  1.00 0.00 ? 2  SER A CB   5  
ATOM 4887  O OG   . SER A 1 2  ? 14.692  -21.654 -8.103  1.00 0.00 ? 2  SER A OG   5  
ATOM 4888  H H    . SER A 1 2  ? 16.113  -19.505 -9.550  1.00 0.00 ? 2  SER A H    5  
ATOM 4889  H HA   . SER A 1 2  ? 13.610  -19.142 -8.055  1.00 0.00 ? 2  SER A HA   5  
ATOM 4890  H HB2  . SER A 1 2  ? 16.122  -20.561 -7.145  1.00 0.00 ? 2  SER A HB2  5  
ATOM 4891  H HB3  . SER A 1 2  ? 14.539  -20.593 -6.367  1.00 0.00 ? 2  SER A HB3  5  
ATOM 4892  H HG   . SER A 1 2  ? 14.587  -22.423 -7.538  1.00 0.00 ? 2  SER A HG   5  
ATOM 4893  N N    . SER A 1 3  ? 16.452  -17.622 -7.570  1.00 0.00 ? 3  SER A N    5  
ATOM 4894  C CA   . SER A 1 3  ? 17.094  -16.499 -6.894  1.00 0.00 ? 3  SER A CA   5  
ATOM 4895  C C    . SER A 1 3  ? 16.259  -15.230 -7.031  1.00 0.00 ? 3  SER A C    5  
ATOM 4896  O O    . SER A 1 3  ? 16.024  -14.747 -8.139  1.00 0.00 ? 3  SER A O    5  
ATOM 4897  C CB   . SER A 1 3  ? 18.494  -16.267 -7.465  1.00 0.00 ? 3  SER A CB   5  
ATOM 4898  O OG   . SER A 1 3  ? 18.534  -16.557 -8.851  1.00 0.00 ? 3  SER A OG   5  
ATOM 4899  H H    . SER A 1 3  ? 16.927  -18.077 -8.295  1.00 0.00 ? 3  SER A H    5  
ATOM 4900  H HA   . SER A 1 3  ? 17.180  -16.748 -5.847  1.00 0.00 ? 3  SER A HA   5  
ATOM 4901  H HB2  . SER A 1 3  ? 18.774  -15.234 -7.319  1.00 0.00 ? 3  SER A HB2  5  
ATOM 4902  H HB3  . SER A 1 3  ? 19.200  -16.906 -6.955  1.00 0.00 ? 3  SER A HB3  5  
ATOM 4903  H HG   . SER A 1 3  ? 19.415  -16.381 -9.191  1.00 0.00 ? 3  SER A HG   5  
ATOM 4904  N N    . GLY A 1 4  ? 15.812  -14.697 -5.899  1.00 0.00 ? 4  GLY A N    5  
ATOM 4905  C CA   . GLY A 1 4  ? 15.008  -13.490 -5.915  1.00 0.00 ? 4  GLY A CA   5  
ATOM 4906  C C    . GLY A 1 4  ? 14.055  -13.412 -4.739  1.00 0.00 ? 4  GLY A C    5  
ATOM 4907  O O    . GLY A 1 4  ? 12.863  -13.687 -4.879  1.00 0.00 ? 4  GLY A O    5  
ATOM 4908  H H    . GLY A 1 4  ? 16.031  -15.127 -5.046  1.00 0.00 ? 4  GLY A H    5  
ATOM 4909  H HA2  . GLY A 1 4  ? 15.664  -12.633 -5.889  1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4910  H HA3  . GLY A 1 4  ? 14.436  -13.463 -6.830  1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4911  N N    . SER A 1 5  ? 14.580  -13.038 -3.577  1.00 0.00 ? 5  SER A N    5  
ATOM 4912  C CA   . SER A 1 5  ? 13.767  -12.926 -2.372  1.00 0.00 ? 5  SER A CA   5  
ATOM 4913  C C    . SER A 1 5  ? 13.152  -11.535 -2.258  1.00 0.00 ? 5  SER A C    5  
ATOM 4914  O O    . SER A 1 5  ? 13.815  -10.583 -1.842  1.00 0.00 ? 5  SER A O    5  
ATOM 4915  C CB   . SER A 1 5  ? 14.612  -13.225 -1.133  1.00 0.00 ? 5  SER A CB   5  
ATOM 4916  O OG   . SER A 1 5  ? 15.314  -14.447 -1.276  1.00 0.00 ? 5  SER A OG   5  
ATOM 4917  H H    . SER A 1 5  ? 15.538  -12.832 -3.529  1.00 0.00 ? 5  SER A H    5  
ATOM 4918  H HA   . SER A 1 5  ? 12.973  -13.653 -2.439  1.00 0.00 ? 5  SER A HA   5  
ATOM 4919  H HB2  . SER A 1 5  ? 15.328  -12.429 -0.985  1.00 0.00 ? 5  SER A HB2  5  
ATOM 4920  H HB3  . SER A 1 5  ? 13.967  -13.293 -0.268  1.00 0.00 ? 5  SER A HB3  5  
ATOM 4921  H HG   . SER A 1 5  ? 14.965  -15.093 -0.657  1.00 0.00 ? 5  SER A HG   5  
ATOM 4922  N N    . SER A 1 6  ? 11.880  -11.423 -2.629  1.00 0.00 ? 6  SER A N    5  
ATOM 4923  C CA   . SER A 1 6  ? 11.175  -10.149 -2.568  1.00 0.00 ? 6  SER A CA   5  
ATOM 4924  C C    . SER A 1 6  ? 10.465  -9.984  -1.228  1.00 0.00 ? 6  SER A C    5  
ATOM 4925  O O    . SER A 1 6  ? 10.384  -10.923 -0.437  1.00 0.00 ? 6  SER A O    5  
ATOM 4926  C CB   . SER A 1 6  ? 10.165  -10.046 -3.712  1.00 0.00 ? 6  SER A CB   5  
ATOM 4927  O OG   . SER A 1 6  ? 10.186  -8.756  -4.299  1.00 0.00 ? 6  SER A OG   5  
ATOM 4928  H H    . SER A 1 6  ? 11.405  -12.217 -2.951  1.00 0.00 ? 6  SER A H    5  
ATOM 4929  H HA   . SER A 1 6  ? 11.906  -9.361  -2.673  1.00 0.00 ? 6  SER A HA   5  
ATOM 4930  H HB2  . SER A 1 6  ? 10.407  -10.776 -4.470  1.00 0.00 ? 6  SER A HB2  5  
ATOM 4931  H HB3  . SER A 1 6  ? 9.172   -10.239 -3.333  1.00 0.00 ? 6  SER A HB3  5  
ATOM 4932  H HG   . SER A 1 6  ? 9.930   -8.103  -3.644  1.00 0.00 ? 6  SER A HG   5  
ATOM 4933  N N    . GLY A 1 7  ? 9.951   -8.783  -0.981  1.00 0.00 ? 7  GLY A N    5  
ATOM 4934  C CA   . GLY A 1 7  ? 9.253   -8.518  0.264   1.00 0.00 ? 7  GLY A CA   5  
ATOM 4935  C C    . GLY A 1 7  ? 9.728   -7.244  0.935   1.00 0.00 ? 7  GLY A C    5  
ATOM 4936  O O    . GLY A 1 7  ? 10.876  -7.156  1.372   1.00 0.00 ? 7  GLY A O    5  
ATOM 4937  H H    . GLY A 1 7  ? 10.045  -8.072  -1.648  1.00 0.00 ? 7  GLY A H    5  
ATOM 4938  H HA2  . GLY A 1 7  ? 8.196   -8.430  0.059   1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4939  H HA3  . GLY A 1 7  ? 9.411   -9.347  0.937   1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4940  N N    . LEU A 1 8  ? 8.843   -6.256  1.019   1.00 0.00 ? 8  LEU A N    5  
ATOM 4941  C CA   . LEU A 1 8  ? 9.178   -4.981  1.642   1.00 0.00 ? 8  LEU A CA   5  
ATOM 4942  C C    . LEU A 1 8  ? 8.903   -5.021  3.142   1.00 0.00 ? 8  LEU A C    5  
ATOM 4943  O O    . LEU A 1 8  ? 8.112   -5.836  3.617   1.00 0.00 ? 8  LEU A O    5  
ATOM 4944  C CB   . LEU A 1 8  ? 8.379   -3.848  0.995   1.00 0.00 ? 8  LEU A CB   5  
ATOM 4945  C CG   . LEU A 1 8  ? 8.511   -3.748  -0.526  1.00 0.00 ? 8  LEU A CG   5  
ATOM 4946  C CD1  . LEU A 1 8  ? 7.174   -3.396  -1.158  1.00 0.00 ? 8  LEU A CD1  5  
ATOM 4947  C CD2  . LEU A 1 8  ? 9.567   -2.721  -0.903  1.00 0.00 ? 8  LEU A CD2  5  
ATOM 4948  H H    . LEU A 1 8  ? 7.943   -6.388  0.653   1.00 0.00 ? 8  LEU A H    5  
ATOM 4949  H HA   . LEU A 1 8  ? 10.231  -4.802  1.486   1.00 0.00 ? 8  LEU A HA   5  
ATOM 4950  H HB2  . LEU A 1 8  ? 7.335   -3.989  1.239   1.00 0.00 ? 8  LEU A HB2  5  
ATOM 4951  H HB3  . LEU A 1 8  ? 8.707   -2.914  1.425   1.00 0.00 ? 8  LEU A HB3  5  
ATOM 4952  H HG   . LEU A 1 8  ? 8.822   -4.707  -0.916  1.00 0.00 ? 8  LEU A HG   5  
ATOM 4953  H HD11 . LEU A 1 8  ? 6.641   -2.711  -0.515  1.00 0.00 ? 8  LEU A HD11 5  
ATOM 4954  H HD12 . LEU A 1 8  ? 6.589   -4.295  -1.288  1.00 0.00 ? 8  LEU A HD12 5  
ATOM 4955  H HD13 . LEU A 1 8  ? 7.340   -2.933  -2.119  1.00 0.00 ? 8  LEU A HD13 5  
ATOM 4956  H HD21 . LEU A 1 8  ? 9.132   -1.732  -0.880  1.00 0.00 ? 8  LEU A HD21 5  
ATOM 4957  H HD22 . LEU A 1 8  ? 9.934   -2.929  -1.896  1.00 0.00 ? 8  LEU A HD22 5  
ATOM 4958  H HD23 . LEU A 1 8  ? 10.385  -2.769  -0.199  1.00 0.00 ? 8  LEU A HD23 5  
ATOM 4959  N N    . ARG A 1 9  ? 9.561   -4.136  3.884   1.00 0.00 ? 9  ARG A N    5  
ATOM 4960  C CA   . ARG A 1 9  ? 9.386   -4.071  5.330   1.00 0.00 ? 9  ARG A CA   5  
ATOM 4961  C C    . ARG A 1 9  ? 8.129   -3.287  5.692   1.00 0.00 ? 9  ARG A C    5  
ATOM 4962  O O    . ARG A 1 9  ? 7.529   -2.631  4.843   1.00 0.00 ? 9  ARG A O    5  
ATOM 4963  C CB   . ARG A 1 9  ? 10.610  -3.427  5.985   1.00 0.00 ? 9  ARG A CB   5  
ATOM 4964  C CG   . ARG A 1 9  ? 11.932  -3.992  5.491   1.00 0.00 ? 9  ARG A CG   5  
ATOM 4965  C CD   . ARG A 1 9  ? 12.499  -3.171  4.344   1.00 0.00 ? 9  ARG A CD   5  
ATOM 4966  N NE   . ARG A 1 9  ? 12.774  -3.990  3.167   1.00 0.00 ? 9  ARG A NE   5  
ATOM 4967  C CZ   . ARG A 1 9  ? 13.844  -4.772  3.041   1.00 0.00 ? 9  ARG A CZ   5  
ATOM 4968  N NH1  . ARG A 1 9  ? 14.741  -4.843  4.017   1.00 0.00 ? 9  ARG A NH1  5  
ATOM 4969  N NH2  . ARG A 1 9  ? 14.017  -5.486  1.936   1.00 0.00 ? 9  ARG A NH2  5  
ATOM 4970  H H    . ARG A 1 9  ? 10.178  -3.511  3.448   1.00 0.00 ? 9  ARG A H    5  
ATOM 4971  H HA   . ARG A 1 9  ? 9.284   -5.082  5.697   1.00 0.00 ? 9  ARG A HA   5  
ATOM 4972  H HB2  . ARG A 1 9  ? 10.597  -2.366  5.778   1.00 0.00 ? 9  ARG A HB2  5  
ATOM 4973  H HB3  . ARG A 1 9  ? 10.554  -3.578  7.052   1.00 0.00 ? 9  ARG A HB3  5  
ATOM 4974  H HG2  . ARG A 1 9  ? 12.640  -3.989  6.307   1.00 0.00 ? 9  ARG A HG2  5  
ATOM 4975  H HG3  . ARG A 1 9  ? 11.774  -5.006  5.154   1.00 0.00 ? 9  ARG A HG3  5  
ATOM 4976  H HD2  . ARG A 1 9  ? 11.786  -2.404  4.078   1.00 0.00 ? 9  ARG A HD2  5  
ATOM 4977  H HD3  . ARG A 1 9  ? 13.419  -2.708  4.671   1.00 0.00 ? 9  ARG A HD3  5  
ATOM 4978  H HE   . ARG A 1 9  ? 12.127  -3.958  2.432   1.00 0.00 ? 9  ARG A HE   5  
ATOM 4979  H HH11 . ARG A 1 9  ? 14.616  -4.309  4.852   1.00 0.00 ? 9  ARG A HH11 5  
ATOM 4980  H HH12 . ARG A 1 9  ? 15.543  -5.432  3.916   1.00 0.00 ? 9  ARG A HH12 5  
ATOM 4981  H HH21 . ARG A 1 9  ? 13.344  -5.436  1.199   1.00 0.00 ? 9  ARG A HH21 5  
ATOM 4982  H HH22 . ARG A 1 9  ? 14.821  -6.073  1.842   1.00 0.00 ? 9  ARG A HH22 5  
ATOM 4983  N N    . LEU A 1 10 ? 7.736   -3.362  6.960   1.00 0.00 ? 10 LEU A N    5  
ATOM 4984  C CA   . LEU A 1 10 ? 6.550   -2.660  7.434   1.00 0.00 ? 10 LEU A CA   5  
ATOM 4985  C C    . LEU A 1 10 ? 6.909   -1.268  7.945   1.00 0.00 ? 10 LEU A C    5  
ATOM 4986  O O    . LEU A 1 10 ? 7.379   -1.111  9.071   1.00 0.00 ? 10 LEU A O    5  
ATOM 4987  C CB   . LEU A 1 10 ? 5.867   -3.462  8.544   1.00 0.00 ? 10 LEU A CB   5  
ATOM 4988  C CG   . LEU A 1 10 ? 5.039   -4.655  8.065   1.00 0.00 ? 10 LEU A CG   5  
ATOM 4989  C CD1  . LEU A 1 10 ? 4.541   -5.469  9.249   1.00 0.00 ? 10 LEU A CD1  5  
ATOM 4990  C CD2  . LEU A 1 10 ? 3.871   -4.184  7.212   1.00 0.00 ? 10 LEU A CD2  5  
ATOM 4991  H H    . LEU A 1 10 ? 8.255   -3.903  7.590   1.00 0.00 ? 10 LEU A H    5  
ATOM 4992  H HA   . LEU A 1 10 ? 5.869   -2.560  6.603   1.00 0.00 ? 10 LEU A HA   5  
ATOM 4993  H HB2  . LEU A 1 10 ? 6.629   -3.826  9.218   1.00 0.00 ? 10 LEU A HB2  5  
ATOM 4994  H HB3  . LEU A 1 10 ? 5.216   -2.797  9.091   1.00 0.00 ? 10 LEU A HB3  5  
ATOM 4995  H HG   . LEU A 1 10 ? 5.661   -5.296  7.458   1.00 0.00 ? 10 LEU A HG   5  
ATOM 4996  H HD11 . LEU A 1 10 ? 3.530   -5.174  9.491   1.00 0.00 ? 10 LEU A HD11 5  
ATOM 4997  H HD12 . LEU A 1 10 ? 5.180   -5.293  10.102  1.00 0.00 ? 10 LEU A HD12 5  
ATOM 4998  H HD13 . LEU A 1 10 ? 4.557   -6.519  8.997   1.00 0.00 ? 10 LEU A HD13 5  
ATOM 4999  H HD21 . LEU A 1 10 ? 3.274   -3.482  7.774   1.00 0.00 ? 10 LEU A HD21 5  
ATOM 5000  H HD22 . LEU A 1 10 ? 3.263   -5.032  6.934   1.00 0.00 ? 10 LEU A HD22 5  
ATOM 5001  H HD23 . LEU A 1 10 ? 4.247   -3.704  6.321   1.00 0.00 ? 10 LEU A HD23 5  
ATOM 5002  N N    . GLY A 1 11 ? 6.685   -0.261  7.107   1.00 0.00 ? 11 GLY A N    5  
ATOM 5003  C CA   . GLY A 1 11 ? 6.991   1.106   7.491   1.00 0.00 ? 11 GLY A CA   5  
ATOM 5004  C C    . GLY A 1 11 ? 8.141   1.689   6.693   1.00 0.00 ? 11 GLY A C    5  
ATOM 5005  O O    . GLY A 1 11 ? 9.019   2.349   7.248   1.00 0.00 ? 11 GLY A O    5  
ATOM 5006  H H    . GLY A 1 11 ? 6.310   -0.446  6.222   1.00 0.00 ? 11 GLY A H    5  
ATOM 5007  H HA2  . GLY A 1 11 ? 6.114   1.717   7.336   1.00 0.00 ? 11 GLY A HA2  5  
ATOM 5008  H HA3  . GLY A 1 11 ? 7.250   1.125   8.540   1.00 0.00 ? 11 GLY A HA3  5  
ATOM 5009  N N    . ASP A 1 12 ? 8.137   1.444   5.387   1.00 0.00 ? 12 ASP A N    5  
ATOM 5010  C CA   . ASP A 1 12 ? 9.187   1.950   4.511   1.00 0.00 ? 12 ASP A CA   5  
ATOM 5011  C C    . ASP A 1 12 ? 8.602   2.835   3.415   1.00 0.00 ? 12 ASP A C    5  
ATOM 5012  O O    . ASP A 1 12 ? 7.583   2.499   2.810   1.00 0.00 ? 12 ASP A O    5  
ATOM 5013  C CB   . ASP A 1 12 ? 9.962   0.788   3.886   1.00 0.00 ? 12 ASP A CB   5  
ATOM 5014  C CG   . ASP A 1 12 ? 11.036  0.247   4.810   1.00 0.00 ? 12 ASP A CG   5  
ATOM 5015  O OD1  . ASP A 1 12 ? 10.714  -0.068  5.975   1.00 0.00 ? 12 ASP A OD1  5  
ATOM 5016  O OD2  . ASP A 1 12 ? 12.199  0.138   4.368   1.00 0.00 ? 12 ASP A OD2  5  
ATOM 5017  H H    . ASP A 1 12 ? 7.410   0.911   5.004   1.00 0.00 ? 12 ASP A H    5  
ATOM 5018  H HA   . ASP A 1 12 ? 9.863   2.540   5.110   1.00 0.00 ? 12 ASP A HA   5  
ATOM 5019  H HB2  . ASP A 1 12 ? 9.274   -0.013  3.656   1.00 0.00 ? 12 ASP A HB2  5  
ATOM 5020  H HB3  . ASP A 1 12 ? 10.432  1.126   2.975   1.00 0.00 ? 12 ASP A HB3  5  
ATOM 5021  N N    . ARG A 1 13 ? 9.253   3.965   3.163   1.00 0.00 ? 13 ARG A N    5  
ATOM 5022  C CA   . ARG A 1 13 ? 8.797   4.898   2.139   1.00 0.00 ? 13 ARG A CA   5  
ATOM 5023  C C    . ARG A 1 13 ? 8.952   4.297   0.746   1.00 0.00 ? 13 ARG A C    5  
ATOM 5024  O O    . ARG A 1 13 ? 10.060  3.963   0.323   1.00 0.00 ? 13 ARG A O    5  
ATOM 5025  C CB   . ARG A 1 13 ? 9.580   6.210   2.231   1.00 0.00 ? 13 ARG A CB   5  
ATOM 5026  C CG   . ARG A 1 13 ? 8.965   7.220   3.185   1.00 0.00 ? 13 ARG A CG   5  
ATOM 5027  C CD   . ARG A 1 13 ? 9.469   7.025   4.607   1.00 0.00 ? 13 ARG A CD   5  
ATOM 5028  N NE   . ARG A 1 13 ? 10.010  8.260   5.169   1.00 0.00 ? 13 ARG A NE   5  
ATOM 5029  C CZ   . ARG A 1 13 ? 10.817  8.303   6.227   1.00 0.00 ? 13 ARG A CZ   5  
ATOM 5030  N NH1  . ARG A 1 13 ? 11.176  7.182   6.842   1.00 0.00 ? 13 ARG A NH1  5  
ATOM 5031  N NH2  . ARG A 1 13 ? 11.265  9.468   6.673   1.00 0.00 ? 13 ARG A NH2  5  
ATOM 5032  H H    . ARG A 1 13 ? 10.059  4.178   3.678   1.00 0.00 ? 13 ARG A H    5  
ATOM 5033  H HA   . ARG A 1 13 ? 7.752   5.100   2.316   1.00 0.00 ? 13 ARG A HA   5  
ATOM 5034  H HB2  . ARG A 1 13 ? 10.583  5.995   2.566   1.00 0.00 ? 13 ARG A HB2  5  
ATOM 5035  H HB3  . ARG A 1 13 ? 9.626   6.657   1.249   1.00 0.00 ? 13 ARG A HB3  5  
ATOM 5036  H HG2  . ARG A 1 13 ? 9.223   8.215   2.857   1.00 0.00 ? 13 ARG A HG2  5  
ATOM 5037  H HG3  . ARG A 1 13 ? 7.891   7.104   3.175   1.00 0.00 ? 13 ARG A HG3  5  
ATOM 5038  H HD2  . ARG A 1 13 ? 8.647   6.691   5.224   1.00 0.00 ? 13 ARG A HD2  5  
ATOM 5039  H HD3  . ARG A 1 13 ? 10.244  6.273   4.603   1.00 0.00 ? 13 ARG A HD3  5  
ATOM 5040  H HE   . ARG A 1 13 ? 9.759   9.103   4.736   1.00 0.00 ? 13 ARG A HE   5  
ATOM 5041  H HH11 . ARG A 1 13 ? 10.842  6.300   6.511   1.00 0.00 ? 13 ARG A HH11 5  
ATOM 5042  H HH12 . ARG A 1 13 ? 11.783  7.220   7.636   1.00 0.00 ? 13 ARG A HH12 5  
ATOM 5043  H HH21 . ARG A 1 13 ? 10.997  10.315  6.214   1.00 0.00 ? 13 ARG A HH21 5  
ATOM 5044  H HH22 . ARG A 1 13 ? 11.871  9.500   7.468   1.00 0.00 ? 13 ARG A HH22 5  
ATOM 5045  N N    . VAL A 1 14 ? 7.836   4.163   0.037   1.00 0.00 ? 14 VAL A N    5  
ATOM 5046  C CA   . VAL A 1 14 ? 7.849   3.601   -1.308  1.00 0.00 ? 14 VAL A CA   5  
ATOM 5047  C C    . VAL A 1 14 ? 7.079   4.488   -2.281  1.00 0.00 ? 14 VAL A C    5  
ATOM 5048  O O    . VAL A 1 14 ? 6.477   5.486   -1.884  1.00 0.00 ? 14 VAL A O    5  
ATOM 5049  C CB   . VAL A 1 14 ? 7.243   2.186   -1.334  1.00 0.00 ? 14 VAL A CB   5  
ATOM 5050  C CG1  . VAL A 1 14 ? 8.132   1.209   -0.581  1.00 0.00 ? 14 VAL A CG1  5  
ATOM 5051  C CG2  . VAL A 1 14 ? 5.837   2.196   -0.754  1.00 0.00 ? 14 VAL A CG2  5  
ATOM 5052  H H    . VAL A 1 14 ? 6.984   4.447   0.428   1.00 0.00 ? 14 VAL A H    5  
ATOM 5053  H HA   . VAL A 1 14 ? 8.878   3.537   -1.633  1.00 0.00 ? 14 VAL A HA   5  
ATOM 5054  H HB   . VAL A 1 14 ? 7.182   1.861   -2.362  1.00 0.00 ? 14 VAL A HB   5  
ATOM 5055  H HG11 . VAL A 1 14 ? 8.000   1.349   0.482   1.00 0.00 ? 14 VAL A HG11 5  
ATOM 5056  H HG12 . VAL A 1 14 ? 9.165   1.387   -0.841  1.00 0.00 ? 14 VAL A HG12 5  
ATOM 5057  H HG13 . VAL A 1 14 ? 7.863   0.197   -0.847  1.00 0.00 ? 14 VAL A HG13 5  
ATOM 5058  H HG21 . VAL A 1 14 ? 5.871   2.549   0.266   1.00 0.00 ? 14 VAL A HG21 5  
ATOM 5059  H HG22 . VAL A 1 14 ? 5.431   1.196   -0.775  1.00 0.00 ? 14 VAL A HG22 5  
ATOM 5060  H HG23 . VAL A 1 14 ? 5.209   2.851   -1.341  1.00 0.00 ? 14 VAL A HG23 5  
ATOM 5061  N N    . LEU A 1 15 ? 7.103   4.117   -3.556  1.00 0.00 ? 15 LEU A N    5  
ATOM 5062  C CA   . LEU A 1 15 ? 6.407   4.877   -4.588  1.00 0.00 ? 15 LEU A CA   5  
ATOM 5063  C C    . LEU A 1 15 ? 5.445   3.984   -5.366  1.00 0.00 ? 15 LEU A C    5  
ATOM 5064  O O    . LEU A 1 15 ? 5.826   2.919   -5.850  1.00 0.00 ? 15 LEU A O    5  
ATOM 5065  C CB   . LEU A 1 15 ? 7.414   5.517   -5.546  1.00 0.00 ? 15 LEU A CB   5  
ATOM 5066  C CG   . LEU A 1 15 ? 6.868   6.678   -6.380  1.00 0.00 ? 15 LEU A CG   5  
ATOM 5067  C CD1  . LEU A 1 15 ? 6.260   7.742   -5.481  1.00 0.00 ? 15 LEU A CD1  5  
ATOM 5068  C CD2  . LEU A 1 15 ? 7.968   7.274   -7.245  1.00 0.00 ? 15 LEU A CD2  5  
ATOM 5069  H H    . LEU A 1 15 ? 7.600   3.312   -3.811  1.00 0.00 ? 15 LEU A H    5  
ATOM 5070  H HA   . LEU A 1 15 ? 5.841   5.657   -4.101  1.00 0.00 ? 15 LEU A HA   5  
ATOM 5071  H HB2  . LEU A 1 15 ? 8.250   5.880   -4.965  1.00 0.00 ? 15 LEU A HB2  5  
ATOM 5072  H HB3  . LEU A 1 15 ? 7.771   4.755   -6.222  1.00 0.00 ? 15 LEU A HB3  5  
ATOM 5073  H HG   . LEU A 1 15 ? 6.090   6.308   -7.033  1.00 0.00 ? 15 LEU A HG   5  
ATOM 5074  H HD11 . LEU A 1 15 ? 6.966   8.008   -4.708  1.00 0.00 ? 15 LEU A HD11 5  
ATOM 5075  H HD12 . LEU A 1 15 ? 5.359   7.358   -5.026  1.00 0.00 ? 15 LEU A HD12 5  
ATOM 5076  H HD13 . LEU A 1 15 ? 6.022   8.617   -6.067  1.00 0.00 ? 15 LEU A HD13 5  
ATOM 5077  H HD21 . LEU A 1 15 ? 7.705   8.286   -7.516  1.00 0.00 ? 15 LEU A HD21 5  
ATOM 5078  H HD22 . LEU A 1 15 ? 8.084   6.680   -8.140  1.00 0.00 ? 15 LEU A HD22 5  
ATOM 5079  H HD23 . LEU A 1 15 ? 8.897   7.279   -6.694  1.00 0.00 ? 15 LEU A HD23 5  
ATOM 5080  N N    . VAL A 1 16 ? 4.197   4.426   -5.481  1.00 0.00 ? 16 VAL A N    5  
ATOM 5081  C CA   . VAL A 1 16 ? 3.182   3.666   -6.200  1.00 0.00 ? 16 VAL A CA   5  
ATOM 5082  C C    . VAL A 1 16 ? 2.901   4.282   -7.566  1.00 0.00 ? 16 VAL A C    5  
ATOM 5083  O O    . VAL A 1 16 ? 2.242   5.316   -7.669  1.00 0.00 ? 16 VAL A O    5  
ATOM 5084  C CB   . VAL A 1 16 ? 1.865   3.590   -5.404  1.00 0.00 ? 16 VAL A CB   5  
ATOM 5085  C CG1  . VAL A 1 16 ? 0.886   2.640   -6.076  1.00 0.00 ? 16 VAL A CG1  5  
ATOM 5086  C CG2  . VAL A 1 16 ? 2.135   3.166   -3.967  1.00 0.00 ? 16 VAL A CG2  5  
ATOM 5087  H H    . VAL A 1 16 ? 3.954   5.284   -5.074  1.00 0.00 ? 16 VAL A H    5  
ATOM 5088  H HA   . VAL A 1 16 ? 3.554   2.661   -6.339  1.00 0.00 ? 16 VAL A HA   5  
ATOM 5089  H HB   . VAL A 1 16 ? 1.421   4.576   -5.388  1.00 0.00 ? 16 VAL A HB   5  
ATOM 5090  H HG11 . VAL A 1 16 ? 0.805   1.733   -5.493  1.00 0.00 ? 16 VAL A HG11 5  
ATOM 5091  H HG12 . VAL A 1 16 ? 1.239   2.399   -7.067  1.00 0.00 ? 16 VAL A HG12 5  
ATOM 5092  H HG13 . VAL A 1 16 ? -0.084  3.111   -6.145  1.00 0.00 ? 16 VAL A HG13 5  
ATOM 5093  H HG21 . VAL A 1 16 ? 1.230   3.271   -3.386  1.00 0.00 ? 16 VAL A HG21 5  
ATOM 5094  H HG22 . VAL A 1 16 ? 2.908   3.791   -3.546  1.00 0.00 ? 16 VAL A HG22 5  
ATOM 5095  H HG23 . VAL A 1 16 ? 2.456   2.135   -3.951  1.00 0.00 ? 16 VAL A HG23 5  
ATOM 5096  N N    . GLY A 1 17 ? 3.408   3.640   -8.613  1.00 0.00 ? 17 GLY A N    5  
ATOM 5097  C CA   . GLY A 1 17 ? 3.200   4.141   -9.960  1.00 0.00 ? 17 GLY A CA   5  
ATOM 5098  C C    . GLY A 1 17 ? 4.310   5.072   -10.408 1.00 0.00 ? 17 GLY A C    5  
ATOM 5099  O O    . GLY A 1 17 ? 4.839   4.932   -11.511 1.00 0.00 ? 17 GLY A O    5  
ATOM 5100  H H    . GLY A 1 17 ? 3.926   2.821   -8.472  1.00 0.00 ? 17 GLY A H    5  
ATOM 5101  H HA2  . GLY A 1 17 ? 3.152   3.304   -10.641 1.00 0.00 ? 17 GLY A HA2  5  
ATOM 5102  H HA3  . GLY A 1 17 ? 2.262   4.674   -9.994  1.00 0.00 ? 17 GLY A HA3  5  
ATOM 5103  N N    . GLY A 1 18 ? 4.663   6.025   -9.551  1.00 0.00 ? 18 GLY A N    5  
ATOM 5104  C CA   . GLY A 1 18 ? 5.714   6.967   -9.884  1.00 0.00 ? 18 GLY A CA   5  
ATOM 5105  C C    . GLY A 1 18 ? 5.491   8.337   -9.272  1.00 0.00 ? 18 GLY A C    5  
ATOM 5106  O O    . GLY A 1 18 ? 6.426   9.130   -9.157  1.00 0.00 ? 18 GLY A O    5  
ATOM 5107  H H    . GLY A 1 18 ? 4.206   6.088   -8.686  1.00 0.00 ? 18 GLY A H    5  
ATOM 5108  H HA2  . GLY A 1 18 ? 6.657   6.577   -9.529  1.00 0.00 ? 18 GLY A HA2  5  
ATOM 5109  H HA3  . GLY A 1 18 ? 5.763   7.069   -10.958 1.00 0.00 ? 18 GLY A HA3  5  
ATOM 5110  N N    . THR A 1 19 ? 4.251   8.621   -8.882  1.00 0.00 ? 19 THR A N    5  
ATOM 5111  C CA   . THR A 1 19 ? 3.916   9.909   -8.284  1.00 0.00 ? 19 THR A CA   5  
ATOM 5112  C C    . THR A 1 19 ? 3.329   9.732   -6.887  1.00 0.00 ? 19 THR A C    5  
ATOM 5113  O O    . THR A 1 19 ? 3.678   10.462  -5.959  1.00 0.00 ? 19 THR A O    5  
ATOM 5114  C CB   . THR A 1 19 ? 2.924   10.663  -9.172  1.00 0.00 ? 19 THR A CB   5  
ATOM 5115  O OG1  . THR A 1 19 ? 3.256   10.504  -10.541 1.00 0.00 ? 19 THR A OG1  5  
ATOM 5116  C CG2  . THR A 1 19 ? 2.869   12.147  -8.882  1.00 0.00 ? 19 THR A CG2  5  
ATOM 5117  H H    . THR A 1 19 ? 3.546   7.953   -9.002  1.00 0.00 ? 19 THR A H    5  
ATOM 5118  H HA   . THR A 1 19 ? 4.825   10.486  -8.209  1.00 0.00 ? 19 THR A HA   5  
ATOM 5119  H HB   . THR A 1 19 ? 1.935   10.257  -9.013  1.00 0.00 ? 19 THR A HB   5  
ATOM 5120  H HG1  . THR A 1 19 ? 2.624   9.912   -10.956 1.00 0.00 ? 19 THR A HG1  5  
ATOM 5121  H HG21 . THR A 1 19 ? 2.623   12.302  -7.842  1.00 0.00 ? 19 THR A HG21 5  
ATOM 5122  H HG22 . THR A 1 19 ? 2.114   12.606  -9.503  1.00 0.00 ? 19 THR A HG22 5  
ATOM 5123  H HG23 . THR A 1 19 ? 3.830   12.591  -9.095  1.00 0.00 ? 19 THR A HG23 5  
ATOM 5124  N N    . LYS A 1 20 ? 2.433   8.760   -6.745  1.00 0.00 ? 20 LYS A N    5  
ATOM 5125  C CA   . LYS A 1 20 ? 1.794   8.493   -5.461  1.00 0.00 ? 20 LYS A CA   5  
ATOM 5126  C C    . LYS A 1 20 ? 2.823   8.080   -4.412  1.00 0.00 ? 20 LYS A C    5  
ATOM 5127  O O    . LYS A 1 20 ? 3.256   6.928   -4.372  1.00 0.00 ? 20 LYS A O    5  
ATOM 5128  C CB   . LYS A 1 20 ? 0.737   7.399   -5.612  1.00 0.00 ? 20 LYS A CB   5  
ATOM 5129  C CG   . LYS A 1 20 ? -0.519  7.865   -6.332  1.00 0.00 ? 20 LYS A CG   5  
ATOM 5130  C CD   . LYS A 1 20 ? -0.999  6.835   -7.343  1.00 0.00 ? 20 LYS A CD   5  
ATOM 5131  C CE   . LYS A 1 20 ? -2.494  6.953   -7.592  1.00 0.00 ? 20 LYS A CE   5  
ATOM 5132  N NZ   . LYS A 1 20 ? -2.834  6.759   -9.029  1.00 0.00 ? 20 LYS A NZ   5  
ATOM 5133  H H    . LYS A 1 20 ? 2.192   8.214   -7.521  1.00 0.00 ? 20 LYS A H    5  
ATOM 5134  H HA   . LYS A 1 20 ? 1.313   9.403   -5.135  1.00 0.00 ? 20 LYS A HA   5  
ATOM 5135  H HB2  . LYS A 1 20 ? 1.163   6.577   -6.168  1.00 0.00 ? 20 LYS A HB2  5  
ATOM 5136  H HB3  . LYS A 1 20 ? 0.454   7.049   -4.631  1.00 0.00 ? 20 LYS A HB3  5  
ATOM 5137  H HG2  . LYS A 1 20 ? -1.300  8.030   -5.604  1.00 0.00 ? 20 LYS A HG2  5  
ATOM 5138  H HG3  . LYS A 1 20 ? -0.304  8.789   -6.848  1.00 0.00 ? 20 LYS A HG3  5  
ATOM 5139  H HD2  . LYS A 1 20 ? -0.475  6.989   -8.274  1.00 0.00 ? 20 LYS A HD2  5  
ATOM 5140  H HD3  . LYS A 1 20 ? -0.782  5.846   -6.965  1.00 0.00 ? 20 LYS A HD3  5  
ATOM 5141  H HE2  . LYS A 1 20 ? -3.005  6.203   -7.007  1.00 0.00 ? 20 LYS A HE2  5  
ATOM 5142  H HE3  . LYS A 1 20 ? -2.821  7.935   -7.283  1.00 0.00 ? 20 LYS A HE3  5  
ATOM 5143  H HZ1  . LYS A 1 20 ? -3.100  5.769   -9.203  1.00 0.00 ? 20 LYS A HZ1  5  
ATOM 5144  H HZ2  . LYS A 1 20 ? -2.016  6.997   -9.626  1.00 0.00 ? 20 LYS A HZ2  5  
ATOM 5145  H HZ3  . LYS A 1 20 ? -3.631  7.374   -9.293  1.00 0.00 ? 20 LYS A HZ3  5  
ATOM 5146  N N    . THR A 1 21 ? 3.209   9.029   -3.564  1.00 0.00 ? 21 THR A N    5  
ATOM 5147  C CA   . THR A 1 21 ? 4.185   8.764   -2.513  1.00 0.00 ? 21 THR A CA   5  
ATOM 5148  C C    . THR A 1 21 ? 3.493   8.303   -1.234  1.00 0.00 ? 21 THR A C    5  
ATOM 5149  O O    . THR A 1 21 ? 2.633   9.002   -0.696  1.00 0.00 ? 21 THR A O    5  
ATOM 5150  C CB   . THR A 1 21 ? 5.016   10.017  -2.234  1.00 0.00 ? 21 THR A CB   5  
ATOM 5151  O OG1  . THR A 1 21 ? 4.235   11.186  -2.405  1.00 0.00 ? 21 THR A OG1  5  
ATOM 5152  C CG2  . THR A 1 21 ? 6.231   10.141  -3.127  1.00 0.00 ? 21 THR A CG2  5  
ATOM 5153  H H    . THR A 1 21 ? 2.827   9.927   -3.646  1.00 0.00 ? 21 THR A H    5  
ATOM 5154  H HA   . THR A 1 21 ? 4.839   7.978   -2.857  1.00 0.00 ? 21 THR A HA   5  
ATOM 5155  H HB   . THR A 1 21 ? 5.361   9.986   -1.209  1.00 0.00 ? 21 THR A HB   5  
ATOM 5156  H HG1  . THR A 1 21 ? 3.422   11.106  -1.900  1.00 0.00 ? 21 THR A HG1  5  
ATOM 5157  H HG21 . THR A 1 21 ? 6.851   10.956  -2.782  1.00 0.00 ? 21 THR A HG21 5  
ATOM 5158  H HG22 . THR A 1 21 ? 5.913   10.335  -4.142  1.00 0.00 ? 21 THR A HG22 5  
ATOM 5159  H HG23 . THR A 1 21 ? 6.796   9.221   -3.097  1.00 0.00 ? 21 THR A HG23 5  
ATOM 5160  N N    . GLY A 1 22 ? 3.873   7.125   -0.753  1.00 0.00 ? 22 GLY A N    5  
ATOM 5161  C CA   . GLY A 1 22 ? 3.277   6.592   0.459   1.00 0.00 ? 22 GLY A CA   5  
ATOM 5162  C C    . GLY A 1 22 ? 4.154   5.553   1.129   1.00 0.00 ? 22 GLY A C    5  
ATOM 5163  O O    . GLY A 1 22 ? 4.930   4.865   0.467   1.00 0.00 ? 22 GLY A O    5  
ATOM 5164  H H    . GLY A 1 22 ? 4.562   6.612   -1.224  1.00 0.00 ? 22 GLY A H    5  
ATOM 5165  H HA2  . GLY A 1 22 ? 3.108   7.405   1.151   1.00 0.00 ? 22 GLY A HA2  5  
ATOM 5166  H HA3  . GLY A 1 22 ? 2.327   6.142   0.212   1.00 0.00 ? 22 GLY A HA3  5  
ATOM 5167  N N    . VAL A 1 23 ? 4.028   5.438   2.448   1.00 0.00 ? 23 VAL A N    5  
ATOM 5168  C CA   . VAL A 1 23 ? 4.814   4.474   3.209   1.00 0.00 ? 23 VAL A CA   5  
ATOM 5169  C C    . VAL A 1 23 ? 4.091   3.137   3.316   1.00 0.00 ? 23 VAL A C    5  
ATOM 5170  O O    . VAL A 1 23 ? 2.864   3.088   3.400   1.00 0.00 ? 23 VAL A O    5  
ATOM 5171  C CB   . VAL A 1 23 ? 5.119   4.994   4.628   1.00 0.00 ? 23 VAL A CB   5  
ATOM 5172  C CG1  . VAL A 1 23 ? 6.127   4.091   5.322   1.00 0.00 ? 23 VAL A CG1  5  
ATOM 5173  C CG2  . VAL A 1 23 ? 5.622   6.429   4.575   1.00 0.00 ? 23 VAL A CG2  5  
ATOM 5174  H H    . VAL A 1 23 ? 3.391   6.015   2.920   1.00 0.00 ? 23 VAL A H    5  
ATOM 5175  H HA   . VAL A 1 23 ? 5.752   4.327   2.694   1.00 0.00 ? 23 VAL A HA   5  
ATOM 5176  H HB   . VAL A 1 23 ? 4.203   4.978   5.200   1.00 0.00 ? 23 VAL A HB   5  
ATOM 5177  H HG11 . VAL A 1 23 ? 7.106   4.246   4.892   1.00 0.00 ? 23 VAL A HG11 5  
ATOM 5178  H HG12 . VAL A 1 23 ? 5.837   3.059   5.192   1.00 0.00 ? 23 VAL A HG12 5  
ATOM 5179  H HG13 . VAL A 1 23 ? 6.156   4.326   6.376   1.00 0.00 ? 23 VAL A HG13 5  
ATOM 5180  H HG21 . VAL A 1 23 ? 6.407   6.563   5.306   1.00 0.00 ? 23 VAL A HG21 5  
ATOM 5181  H HG22 . VAL A 1 23 ? 4.809   7.104   4.792   1.00 0.00 ? 23 VAL A HG22 5  
ATOM 5182  H HG23 . VAL A 1 23 ? 6.010   6.637   3.589   1.00 0.00 ? 23 VAL A HG23 5  
ATOM 5183  N N    . VAL A 1 24 ? 4.859   2.052   3.310   1.00 0.00 ? 24 VAL A N    5  
ATOM 5184  C CA   . VAL A 1 24 ? 4.290   0.713   3.405   1.00 0.00 ? 24 VAL A CA   5  
ATOM 5185  C C    . VAL A 1 24 ? 3.744   0.447   4.804   1.00 0.00 ? 24 VAL A C    5  
ATOM 5186  O O    . VAL A 1 24 ? 4.481   0.495   5.789   1.00 0.00 ? 24 VAL A O    5  
ATOM 5187  C CB   . VAL A 1 24 ? 5.333   -0.367  3.061   1.00 0.00 ? 24 VAL A CB   5  
ATOM 5188  C CG1  . VAL A 1 24 ? 4.674   -1.735  2.967   1.00 0.00 ? 24 VAL A CG1  5  
ATOM 5189  C CG2  . VAL A 1 24 ? 6.052   -0.023  1.766   1.00 0.00 ? 24 VAL A CG2  5  
ATOM 5190  H H    . VAL A 1 24 ? 5.831   2.155   3.241   1.00 0.00 ? 24 VAL A H    5  
ATOM 5191  H HA   . VAL A 1 24 ? 3.481   0.643   2.693   1.00 0.00 ? 24 VAL A HA   5  
ATOM 5192  H HB   . VAL A 1 24 ? 6.064   -0.400  3.856   1.00 0.00 ? 24 VAL A HB   5  
ATOM 5193  H HG11 . VAL A 1 24 ? 4.713   -2.220  3.932   1.00 0.00 ? 24 VAL A HG11 5  
ATOM 5194  H HG12 . VAL A 1 24 ? 5.199   -2.338  2.241   1.00 0.00 ? 24 VAL A HG12 5  
ATOM 5195  H HG13 . VAL A 1 24 ? 3.644   -1.619  2.663   1.00 0.00 ? 24 VAL A HG13 5  
ATOM 5196  H HG21 . VAL A 1 24 ? 6.271   -0.930  1.223   1.00 0.00 ? 24 VAL A HG21 5  
ATOM 5197  H HG22 . VAL A 1 24 ? 6.973   0.494   1.992   1.00 0.00 ? 24 VAL A HG22 5  
ATOM 5198  H HG23 . VAL A 1 24 ? 5.421   0.614   1.163   1.00 0.00 ? 24 VAL A HG23 5  
ATOM 5199  N N    . ARG A 1 25 ? 2.447   0.164   4.883   1.00 0.00 ? 25 ARG A N    5  
ATOM 5200  C CA   . ARG A 1 25 ? 1.802   -0.109  6.162   1.00 0.00 ? 25 ARG A CA   5  
ATOM 5201  C C    . ARG A 1 25 ? 1.523   -1.601  6.323   1.00 0.00 ? 25 ARG A C    5  
ATOM 5202  O O    . ARG A 1 25 ? 1.523   -2.126  7.436   1.00 0.00 ? 25 ARG A O    5  
ATOM 5203  C CB   . ARG A 1 25 ? 0.497   0.680   6.279   1.00 0.00 ? 25 ARG A CB   5  
ATOM 5204  C CG   . ARG A 1 25 ? 0.689   2.098   6.792   1.00 0.00 ? 25 ARG A CG   5  
ATOM 5205  C CD   . ARG A 1 25 ? 1.390   2.112   8.141   1.00 0.00 ? 25 ARG A CD   5  
ATOM 5206  N NE   . ARG A 1 25 ? 1.245   3.398   8.820   1.00 0.00 ? 25 ARG A NE   5  
ATOM 5207  C CZ   . ARG A 1 25 ? 2.028   3.802   9.818   1.00 0.00 ? 25 ARG A CZ   5  
ATOM 5208  N NH1  . ARG A 1 25 ? 3.010   3.024   10.257  1.00 0.00 ? 25 ARG A NH1  5  
ATOM 5209  N NH2  . ARG A 1 25 ? 1.828   4.986   10.380  1.00 0.00 ? 25 ARG A NH2  5  
ATOM 5210  H H    . ARG A 1 25 ? 1.912   0.140   4.063   1.00 0.00 ? 25 ARG A H    5  
ATOM 5211  H HA   . ARG A 1 25 ? 2.474   0.206   6.947   1.00 0.00 ? 25 ARG A HA   5  
ATOM 5212  H HB2  . ARG A 1 25 ? 0.034   0.733   5.304   1.00 0.00 ? 25 ARG A HB2  5  
ATOM 5213  H HB3  . ARG A 1 25 ? -0.165  0.162   6.955   1.00 0.00 ? 25 ARG A HB3  5  
ATOM 5214  H HG2  . ARG A 1 25 ? 1.286   2.650   6.083   1.00 0.00 ? 25 ARG A HG2  5  
ATOM 5215  H HG3  . ARG A 1 25 ? -0.279  2.567   6.894   1.00 0.00 ? 25 ARG A HG3  5  
ATOM 5216  H HD2  . ARG A 1 25 ? 0.963   1.339   8.763   1.00 0.00 ? 25 ARG A HD2  5  
ATOM 5217  H HD3  . ARG A 1 25 ? 2.440   1.912   7.989   1.00 0.00 ? 25 ARG A HD3  5  
ATOM 5218  H HE   . ARG A 1 25 ? 0.527   3.993   8.517   1.00 0.00 ? 25 ARG A HE   5  
ATOM 5219  H HH11 . ARG A 1 25 ? 3.166   2.129   9.838   1.00 0.00 ? 25 ARG A HH11 5  
ATOM 5220  H HH12 . ARG A 1 25 ? 3.595   3.333   11.006  1.00 0.00 ? 25 ARG A HH12 5  
ATOM 5221  H HH21 . ARG A 1 25 ? 1.090   5.576   10.053  1.00 0.00 ? 25 ARG A HH21 5  
ATOM 5222  H HH22 . ARG A 1 25 ? 2.417   5.289   11.130  1.00 0.00 ? 25 ARG A HH22 5  
ATOM 5223  N N    . TYR A 1 26 ? 1.288   -2.278  5.204   1.00 0.00 ? 26 TYR A N    5  
ATOM 5224  C CA   . TYR A 1 26 ? 1.009   -3.709  5.221   1.00 0.00 ? 26 TYR A CA   5  
ATOM 5225  C C    . TYR A 1 26 ? 1.765   -4.424  4.105   1.00 0.00 ? 26 TYR A C    5  
ATOM 5226  O O    . TYR A 1 26 ? 1.886   -3.908  2.994   1.00 0.00 ? 26 TYR A O    5  
ATOM 5227  C CB   . TYR A 1 26 ? -0.493  -3.960  5.076   1.00 0.00 ? 26 TYR A CB   5  
ATOM 5228  C CG   . TYR A 1 26 ? -0.878  -5.418  5.185   1.00 0.00 ? 26 TYR A CG   5  
ATOM 5229  C CD1  . TYR A 1 26 ? -1.060  -6.016  6.426   1.00 0.00 ? 26 TYR A CD1  5  
ATOM 5230  C CD2  . TYR A 1 26 ? -1.056  -6.196  4.049   1.00 0.00 ? 26 TYR A CD2  5  
ATOM 5231  C CE1  . TYR A 1 26 ? -1.411  -7.348  6.530   1.00 0.00 ? 26 TYR A CE1  5  
ATOM 5232  C CE2  . TYR A 1 26 ? -1.408  -7.530  4.145   1.00 0.00 ? 26 TYR A CE2  5  
ATOM 5233  C CZ   . TYR A 1 26 ? -1.583  -8.101  5.388   1.00 0.00 ? 26 TYR A CZ   5  
ATOM 5234  O OH   . TYR A 1 26 ? -1.933  -9.427  5.489   1.00 0.00 ? 26 TYR A OH   5  
ATOM 5235  H H    . TYR A 1 26 ? 1.302   -1.805  4.346   1.00 0.00 ? 26 TYR A H    5  
ATOM 5236  H HA   . TYR A 1 26 ? 1.340   -4.100  6.171   1.00 0.00 ? 26 TYR A HA   5  
ATOM 5237  H HB2  . TYR A 1 26 ? -1.017  -3.421  5.851   1.00 0.00 ? 26 TYR A HB2  5  
ATOM 5238  H HB3  . TYR A 1 26 ? -0.820  -3.601  4.111   1.00 0.00 ? 26 TYR A HB3  5  
ATOM 5239  H HD1  . TYR A 1 26 ? -0.925  -5.424  7.319   1.00 0.00 ? 26 TYR A HD1  5  
ATOM 5240  H HD2  . TYR A 1 26 ? -0.918  -5.747  3.077   1.00 0.00 ? 26 TYR A HD2  5  
ATOM 5241  H HE1  . TYR A 1 26 ? -1.549  -7.795  7.504   1.00 0.00 ? 26 TYR A HE1  5  
ATOM 5242  H HE2  . TYR A 1 26 ? -1.542  -8.119  3.250   1.00 0.00 ? 26 TYR A HE2  5  
ATOM 5243  H HH   . TYR A 1 26 ? -2.601  -9.532  6.171   1.00 0.00 ? 26 TYR A HH   5  
ATOM 5244  N N    . VAL A 1 27 ? 2.272   -5.615  4.409   1.00 0.00 ? 27 VAL A N    5  
ATOM 5245  C CA   . VAL A 1 27 ? 3.016   -6.401  3.432   1.00 0.00 ? 27 VAL A CA   5  
ATOM 5246  C C    . VAL A 1 27 ? 2.712   -7.888  3.577   1.00 0.00 ? 27 VAL A C    5  
ATOM 5247  O O    . VAL A 1 27 ? 2.499   -8.384  4.684   1.00 0.00 ? 27 VAL A O    5  
ATOM 5248  C CB   . VAL A 1 27 ? 4.533   -6.183  3.576   1.00 0.00 ? 27 VAL A CB   5  
ATOM 5249  C CG1  . VAL A 1 27 ? 5.280   -6.852  2.432   1.00 0.00 ? 27 VAL A CG1  5  
ATOM 5250  C CG2  . VAL A 1 27 ? 4.856   -4.697  3.636   1.00 0.00 ? 27 VAL A CG2  5  
ATOM 5251  H H    . VAL A 1 27 ? 2.141   -5.973  5.312   1.00 0.00 ? 27 VAL A H    5  
ATOM 5252  H HA   . VAL A 1 27 ? 2.717   -6.076  2.446   1.00 0.00 ? 27 VAL A HA   5  
ATOM 5253  H HB   . VAL A 1 27 ? 4.856   -6.637  4.502   1.00 0.00 ? 27 VAL A HB   5  
ATOM 5254  H HG11 . VAL A 1 27 ? 5.016   -6.373  1.501   1.00 0.00 ? 27 VAL A HG11 5  
ATOM 5255  H HG12 . VAL A 1 27 ? 5.010   -7.896  2.390   1.00 0.00 ? 27 VAL A HG12 5  
ATOM 5256  H HG13 . VAL A 1 27 ? 6.344   -6.760  2.595   1.00 0.00 ? 27 VAL A HG13 5  
ATOM 5257  H HG21 . VAL A 1 27 ? 4.244   -4.226  4.392   1.00 0.00 ? 27 VAL A HG21 5  
ATOM 5258  H HG22 . VAL A 1 27 ? 4.654   -4.245  2.676   1.00 0.00 ? 27 VAL A HG22 5  
ATOM 5259  H HG23 . VAL A 1 27 ? 5.899   -4.565  3.885   1.00 0.00 ? 27 VAL A HG23 5  
ATOM 5260  N N    . GLY A 1 28 ? 2.692   -8.594  2.451   1.00 0.00 ? 28 GLY A N    5  
ATOM 5261  C CA   . GLY A 1 28 ? 2.413   -10.019 2.474   1.00 0.00 ? 28 GLY A CA   5  
ATOM 5262  C C    . GLY A 1 28 ? 1.311   -10.410 1.509   1.00 0.00 ? 28 GLY A C    5  
ATOM 5263  O O    . GLY A 1 28 ? 0.902   -9.610  0.668   1.00 0.00 ? 28 GLY A O    5  
ATOM 5264  H H    . GLY A 1 28 ? 2.868   -8.146  1.599   1.00 0.00 ? 28 GLY A H    5  
ATOM 5265  H HA2  . GLY A 1 28 ? 3.313   -10.555 2.212   1.00 0.00 ? 28 GLY A HA2  5  
ATOM 5266  H HA3  . GLY A 1 28 ? 2.117   -10.302 3.474   1.00 0.00 ? 28 GLY A HA3  5  
ATOM 5267  N N    . GLU A 1 29 ? 0.829   -11.642 1.631   1.00 0.00 ? 29 GLU A N    5  
ATOM 5268  C CA   . GLU A 1 29 ? -0.232  -12.138 0.762   1.00 0.00 ? 29 GLU A CA   5  
ATOM 5269  C C    . GLU A 1 29 ? -1.596  -11.644 1.233   1.00 0.00 ? 29 GLU A C    5  
ATOM 5270  O O    . GLU A 1 29 ? -1.703  -10.971 2.259   1.00 0.00 ? 29 GLU A O    5  
ATOM 5271  C CB   . GLU A 1 29 ? -0.217  -13.667 0.724   1.00 0.00 ? 29 GLU A CB   5  
ATOM 5272  C CG   . GLU A 1 29 ? 0.981   -14.244 -0.014  1.00 0.00 ? 29 GLU A CG   5  
ATOM 5273  C CD   . GLU A 1 29 ? 1.162   -15.727 0.240   1.00 0.00 ? 29 GLU A CD   5  
ATOM 5274  O OE1  . GLU A 1 29 ? 0.690   -16.212 1.291   1.00 0.00 ? 29 GLU A OE1  5  
ATOM 5275  O OE2  . GLU A 1 29 ? 1.776   -16.405 -0.610  1.00 0.00 ? 29 GLU A OE2  5  
ATOM 5276  H H    . GLU A 1 29 ? 1.196   -12.233 2.322   1.00 0.00 ? 29 GLU A H    5  
ATOM 5277  H HA   . GLU A 1 29 ? -0.049  -11.759 -0.232  1.00 0.00 ? 29 GLU A HA   5  
ATOM 5278  H HB2  . GLU A 1 29 ? -0.203  -14.041 1.736   1.00 0.00 ? 29 GLU A HB2  5  
ATOM 5279  H HB3  . GLU A 1 29 ? -1.115  -14.013 0.233   1.00 0.00 ? 29 GLU A HB3  5  
ATOM 5280  H HG2  . GLU A 1 29 ? 0.843   -14.091 -1.075  1.00 0.00 ? 29 GLU A HG2  5  
ATOM 5281  H HG3  . GLU A 1 29 ? 1.871   -13.726 0.310   1.00 0.00 ? 29 GLU A HG3  5  
ATOM 5282  N N    . THR A 1 30 ? -2.636  -11.981 0.478   1.00 0.00 ? 30 THR A N    5  
ATOM 5283  C CA   . THR A 1 30 ? -3.993  -11.572 0.818   1.00 0.00 ? 30 THR A CA   5  
ATOM 5284  C C    . THR A 1 30 ? -4.996  -12.666 0.464   1.00 0.00 ? 30 THR A C    5  
ATOM 5285  O O    . THR A 1 30 ? -4.618  -13.741 -0.002  1.00 0.00 ? 30 THR A O    5  
ATOM 5286  C CB   . THR A 1 30 ? -4.357  -10.277 0.090   1.00 0.00 ? 30 THR A CB   5  
ATOM 5287  O OG1  . THR A 1 30 ? -4.196  -10.428 -1.309  1.00 0.00 ? 30 THR A OG1  5  
ATOM 5288  C CG2  . THR A 1 30 ? -3.522  -9.092  0.524   1.00 0.00 ? 30 THR A CG2  5  
ATOM 5289  H H    . THR A 1 30 ? -2.486  -12.519 -0.328  1.00 0.00 ? 30 THR A H    5  
ATOM 5290  H HA   . THR A 1 30 ? -4.030  -11.398 1.883   1.00 0.00 ? 30 THR A HA   5  
ATOM 5291  H HB   . THR A 1 30 ? -5.393  -10.043 0.290   1.00 0.00 ? 30 THR A HB   5  
ATOM 5292  H HG1  . THR A 1 30 ? -4.696  -11.190 -1.609  1.00 0.00 ? 30 THR A HG1  5  
ATOM 5293  H HG21 . THR A 1 30 ? -3.611  -8.303  -0.207  1.00 0.00 ? 30 THR A HG21 5  
ATOM 5294  H HG22 . THR A 1 30 ? -2.487  -9.392  0.606   1.00 0.00 ? 30 THR A HG22 5  
ATOM 5295  H HG23 . THR A 1 30 ? -3.871  -8.736  1.482   1.00 0.00 ? 30 THR A HG23 5  
ATOM 5296  N N    . ASP A 1 31 ? -6.275  -12.384 0.688   1.00 0.00 ? 31 ASP A N    5  
ATOM 5297  C CA   . ASP A 1 31 ? -7.333  -13.344 0.393   1.00 0.00 ? 31 ASP A CA   5  
ATOM 5298  C C    . ASP A 1 31 ? -8.152  -12.898 -0.815  1.00 0.00 ? 31 ASP A C    5  
ATOM 5299  O O    . ASP A 1 31 ? -8.591  -13.720 -1.617  1.00 0.00 ? 31 ASP A O    5  
ATOM 5300  C CB   . ASP A 1 31 ? -8.247  -13.518 1.607   1.00 0.00 ? 31 ASP A CB   5  
ATOM 5301  C CG   . ASP A 1 31 ? -7.607  -14.354 2.698   1.00 0.00 ? 31 ASP A CG   5  
ATOM 5302  O OD1  . ASP A 1 31 ? -6.592  -13.908 3.270   1.00 0.00 ? 31 ASP A OD1  5  
ATOM 5303  O OD2  . ASP A 1 31 ? -8.123  -15.456 2.978   1.00 0.00 ? 31 ASP A OD2  5  
ATOM 5304  H H    . ASP A 1 31 ? -6.514  -11.510 1.062   1.00 0.00 ? 31 ASP A H    5  
ATOM 5305  H HA   . ASP A 1 31 ? -6.867  -14.291 0.167   1.00 0.00 ? 31 ASP A HA   5  
ATOM 5306  H HB2  . ASP A 1 31 ? -8.480  -12.545 2.016   1.00 0.00 ? 31 ASP A HB2  5  
ATOM 5307  H HB3  . ASP A 1 31 ? -9.161  -14.001 1.296   1.00 0.00 ? 31 ASP A HB3  5  
ATOM 5308  N N    . PHE A 1 32 ? -8.351  -11.589 -0.937  1.00 0.00 ? 32 PHE A N    5  
ATOM 5309  C CA   . PHE A 1 32 ? -9.117  -11.033 -2.046  1.00 0.00 ? 32 PHE A CA   5  
ATOM 5310  C C    . PHE A 1 32 ? -8.430  -11.316 -3.378  1.00 0.00 ? 32 PHE A C    5  
ATOM 5311  O O    . PHE A 1 32 ? -9.087  -11.474 -4.407  1.00 0.00 ? 32 PHE A O    5  
ATOM 5312  C CB   . PHE A 1 32 ? -9.300  -9.526  -1.862  1.00 0.00 ? 32 PHE A CB   5  
ATOM 5313  C CG   . PHE A 1 32 ? -8.006  -8.780  -1.700  1.00 0.00 ? 32 PHE A CG   5  
ATOM 5314  C CD1  . PHE A 1 32 ? -7.222  -8.481  -2.802  1.00 0.00 ? 32 PHE A CD1  5  
ATOM 5315  C CD2  . PHE A 1 32 ? -7.574  -8.380  -0.447  1.00 0.00 ? 32 PHE A CD2  5  
ATOM 5316  C CE1  . PHE A 1 32 ? -6.031  -7.795  -2.658  1.00 0.00 ? 32 PHE A CE1  5  
ATOM 5317  C CE2  . PHE A 1 32 ? -6.384  -7.694  -0.295  1.00 0.00 ? 32 PHE A CE2  5  
ATOM 5318  C CZ   . PHE A 1 32 ? -5.612  -7.401  -1.401  1.00 0.00 ? 32 PHE A CZ   5  
ATOM 5319  H H    . PHE A 1 32 ? -7.975  -10.983 -0.264  1.00 0.00 ? 32 PHE A H    5  
ATOM 5320  H HA   . PHE A 1 32 ? -10.088 -11.507 -2.048  1.00 0.00 ? 32 PHE A HA   5  
ATOM 5321  H HB2  . PHE A 1 32 ? -9.808  -9.124  -2.725  1.00 0.00 ? 32 PHE A HB2  5  
ATOM 5322  H HB3  . PHE A 1 32 ? -9.900  -9.347  -0.981  1.00 0.00 ? 32 PHE A HB3  5  
ATOM 5323  H HD1  . PHE A 1 32 ? -7.549  -8.788  -3.785  1.00 0.00 ? 32 PHE A HD1  5  
ATOM 5324  H HD2  . PHE A 1 32 ? -8.177  -8.608  0.420   1.00 0.00 ? 32 PHE A HD2  5  
ATOM 5325  H HE1  . PHE A 1 32 ? -5.428  -7.567  -3.525  1.00 0.00 ? 32 PHE A HE1  5  
ATOM 5326  H HE2  . PHE A 1 32 ? -6.058  -7.387  0.688   1.00 0.00 ? 32 PHE A HE2  5  
ATOM 5327  H HZ   . PHE A 1 32 ? -4.681  -6.865  -1.286  1.00 0.00 ? 32 PHE A HZ   5  
ATOM 5328  N N    . ALA A 1 33 ? -7.102  -11.377 -3.352  1.00 0.00 ? 33 ALA A N    5  
ATOM 5329  C CA   . ALA A 1 33 ? -6.325  -11.641 -4.557  1.00 0.00 ? 33 ALA A CA   5  
ATOM 5330  C C    . ALA A 1 33 ? -5.157  -12.576 -4.265  1.00 0.00 ? 33 ALA A C    5  
ATOM 5331  O O    . ALA A 1 33 ? -4.705  -12.683 -3.125  1.00 0.00 ? 33 ALA A O    5  
ATOM 5332  C CB   . ALA A 1 33 ? -5.822  -10.335 -5.156  1.00 0.00 ? 33 ALA A CB   5  
ATOM 5333  H H    . ALA A 1 33 ? -6.634  -11.242 -2.502  1.00 0.00 ? 33 ALA A H    5  
ATOM 5334  H HA   . ALA A 1 33 ? -6.979  -12.110 -5.278  1.00 0.00 ? 33 ALA A HA   5  
ATOM 5335  H HB1  . ALA A 1 33 ? -6.634  -9.834  -5.661  1.00 0.00 ? 33 ALA A HB1  5  
ATOM 5336  H HB2  . ALA A 1 33 ? -5.033  -10.545 -5.863  1.00 0.00 ? 33 ALA A HB2  5  
ATOM 5337  H HB3  . ALA A 1 33 ? -5.441  -9.701  -4.368  1.00 0.00 ? 33 ALA A HB3  5  
ATOM 5338  N N    . LYS A 1 34 ? -4.674  -13.251 -5.302  1.00 0.00 ? 34 LYS A N    5  
ATOM 5339  C CA   . LYS A 1 34 ? -3.557  -14.178 -5.157  1.00 0.00 ? 34 LYS A CA   5  
ATOM 5340  C C    . LYS A 1 34 ? -2.225  -13.456 -5.322  1.00 0.00 ? 34 LYS A C    5  
ATOM 5341  O O    . LYS A 1 34 ? -2.098  -12.545 -6.141  1.00 0.00 ? 34 LYS A O    5  
ATOM 5342  C CB   . LYS A 1 34 ? -3.669  -15.308 -6.182  1.00 0.00 ? 34 LYS A CB   5  
ATOM 5343  C CG   . LYS A 1 34 ? -5.038  -15.970 -6.213  1.00 0.00 ? 34 LYS A CG   5  
ATOM 5344  C CD   . LYS A 1 34 ? -4.973  -17.417 -5.751  1.00 0.00 ? 34 LYS A CD   5  
ATOM 5345  C CE   . LYS A 1 34 ? -5.420  -17.563 -4.305  1.00 0.00 ? 34 LYS A CE   5  
ATOM 5346  N NZ   . LYS A 1 34 ? -4.467  -18.386 -3.509  1.00 0.00 ? 34 LYS A NZ   5  
ATOM 5347  H H    . LYS A 1 34 ? -5.076  -13.123 -6.186  1.00 0.00 ? 34 LYS A H    5  
ATOM 5348  H HA   . LYS A 1 34 ? -3.604  -14.600 -4.163  1.00 0.00 ? 34 LYS A HA   5  
ATOM 5349  H HB2  . LYS A 1 34 ? -3.464  -14.908 -7.163  1.00 0.00 ? 34 LYS A HB2  5  
ATOM 5350  H HB3  . LYS A 1 34 ? -2.932  -16.063 -5.950  1.00 0.00 ? 34 LYS A HB3  5  
ATOM 5351  H HG2  . LYS A 1 34 ? -5.704  -15.424 -5.562  1.00 0.00 ? 34 LYS A HG2  5  
ATOM 5352  H HG3  . LYS A 1 34 ? -5.417  -15.940 -7.225  1.00 0.00 ? 34 LYS A HG3  5  
ATOM 5353  H HD2  . LYS A 1 34 ? -5.618  -18.014 -6.379  1.00 0.00 ? 34 LYS A HD2  5  
ATOM 5354  H HD3  . LYS A 1 34 ? -3.955  -17.768 -5.841  1.00 0.00 ? 34 LYS A HD3  5  
ATOM 5355  H HE2  . LYS A 1 34 ? -5.491  -16.582 -3.861  1.00 0.00 ? 34 LYS A HE2  5  
ATOM 5356  H HE3  . LYS A 1 34 ? -6.391  -18.036 -4.289  1.00 0.00 ? 34 LYS A HE3  5  
ATOM 5357  H HZ1  . LYS A 1 34 ? -4.716  -19.393 -3.584  1.00 0.00 ? 34 LYS A HZ1  5  
ATOM 5358  H HZ2  . LYS A 1 34 ? -4.501  -18.104 -2.509  1.00 0.00 ? 34 LYS A HZ2  5  
ATOM 5359  H HZ3  . LYS A 1 34 ? -3.498  -18.251 -3.863  1.00 0.00 ? 34 LYS A HZ3  5  
ATOM 5360  N N    . GLY A 1 35 ? -1.232  -13.869 -4.540  1.00 0.00 ? 35 GLY A N    5  
ATOM 5361  C CA   . GLY A 1 35 ? 0.079   -13.250 -4.617  1.00 0.00 ? 35 GLY A CA   5  
ATOM 5362  C C    . GLY A 1 35 ? 0.402   -12.418 -3.392  1.00 0.00 ? 35 GLY A C    5  
ATOM 5363  O O    . GLY A 1 35 ? -0.299  -12.485 -2.383  1.00 0.00 ? 35 GLY A O    5  
ATOM 5364  H H    . GLY A 1 35 ? -1.390  -14.599 -3.906  1.00 0.00 ? 35 GLY A H    5  
ATOM 5365  H HA2  . GLY A 1 35 ? 0.824   -14.025 -4.719  1.00 0.00 ? 35 GLY A HA2  5  
ATOM 5366  H HA3  . GLY A 1 35 ? 0.114   -12.615 -5.490  1.00 0.00 ? 35 GLY A HA3  5  
ATOM 5367  N N    . GLU A 1 36 ? 1.469   -11.630 -3.481  1.00 0.00 ? 36 GLU A N    5  
ATOM 5368  C CA   . GLU A 1 36 ? 1.887   -10.780 -2.372  1.00 0.00 ? 36 GLU A CA   5  
ATOM 5369  C C    . GLU A 1 36 ? 1.535   -9.321  -2.643  1.00 0.00 ? 36 GLU A C    5  
ATOM 5370  O O    . GLU A 1 36 ? 2.122   -8.682  -3.515  1.00 0.00 ? 36 GLU A O    5  
ATOM 5371  C CB   . GLU A 1 36 ? 3.393   -10.917 -2.137  1.00 0.00 ? 36 GLU A CB   5  
ATOM 5372  C CG   . GLU A 1 36 ? 3.766   -12.107 -1.267  1.00 0.00 ? 36 GLU A CG   5  
ATOM 5373  C CD   . GLU A 1 36 ? 5.249   -12.421 -1.317  1.00 0.00 ? 36 GLU A CD   5  
ATOM 5374  O OE1  . GLU A 1 36 ? 6.017   -11.783 -0.566  1.00 0.00 ? 36 GLU A OE1  5  
ATOM 5375  O OE2  . GLU A 1 36 ? 5.642   -13.306 -2.106  1.00 0.00 ? 36 GLU A OE2  5  
ATOM 5376  H H    . GLU A 1 36 ? 1.988   -11.620 -4.312  1.00 0.00 ? 36 GLU A H    5  
ATOM 5377  H HA   . GLU A 1 36 ? 1.362   -11.107 -1.488  1.00 0.00 ? 36 GLU A HA   5  
ATOM 5378  H HB2  . GLU A 1 36 ? 3.886   -11.027 -3.090  1.00 0.00 ? 36 GLU A HB2  5  
ATOM 5379  H HB3  . GLU A 1 36 ? 3.753   -10.019 -1.655  1.00 0.00 ? 36 GLU A HB3  5  
ATOM 5380  H HG2  . GLU A 1 36 ? 3.495   -11.890 -0.246  1.00 0.00 ? 36 GLU A HG2  5  
ATOM 5381  H HG3  . GLU A 1 36 ? 3.218   -12.973 -1.609  1.00 0.00 ? 36 GLU A HG3  5  
ATOM 5382  N N    . TRP A 1 37 ? 0.572   -8.800  -1.889  1.00 0.00 ? 37 TRP A N    5  
ATOM 5383  C CA   . TRP A 1 37 ? 0.142   -7.416  -2.048  1.00 0.00 ? 37 TRP A CA   5  
ATOM 5384  C C    . TRP A 1 37 ? 0.839   -6.510  -1.038  1.00 0.00 ? 37 TRP A C    5  
ATOM 5385  O O    . TRP A 1 37 ? 1.353   -6.976  -0.022  1.00 0.00 ? 37 TRP A O    5  
ATOM 5386  C CB   . TRP A 1 37 ? -1.375  -7.310  -1.885  1.00 0.00 ? 37 TRP A CB   5  
ATOM 5387  C CG   . TRP A 1 37 ? -2.139  -7.946  -3.006  1.00 0.00 ? 37 TRP A CG   5  
ATOM 5388  C CD1  . TRP A 1 37 ? -2.330  -9.281  -3.214  1.00 0.00 ? 37 TRP A CD1  5  
ATOM 5389  C CD2  . TRP A 1 37 ? -2.812  -7.273  -4.076  1.00 0.00 ? 37 TRP A CD2  5  
ATOM 5390  N NE1  . TRP A 1 37 ? -3.082  -9.480  -4.347  1.00 0.00 ? 37 TRP A NE1  5  
ATOM 5391  C CE2  . TRP A 1 37 ? -3.390  -8.262  -4.893  1.00 0.00 ? 37 TRP A CE2  5  
ATOM 5392  C CE3  . TRP A 1 37 ? -2.984  -5.928  -4.420  1.00 0.00 ? 37 TRP A CE3  5  
ATOM 5393  C CZ2  . TRP A 1 37 ? -4.127  -7.949  -6.034  1.00 0.00 ? 37 TRP A CZ2  5  
ATOM 5394  C CZ3  . TRP A 1 37 ? -3.715  -5.620  -5.553  1.00 0.00 ? 37 TRP A CZ3  5  
ATOM 5395  C CH2  . TRP A 1 37 ? -4.279  -6.627  -6.347  1.00 0.00 ? 37 TRP A CH2  5  
ATOM 5396  H H    . TRP A 1 37 ? 0.141   -9.359  -1.210  1.00 0.00 ? 37 TRP A H    5  
ATOM 5397  H HA   . TRP A 1 37 ? 0.411   -7.099  -3.044  1.00 0.00 ? 37 TRP A HA   5  
ATOM 5398  H HB2  . TRP A 1 37 ? -1.667  -7.796  -0.966  1.00 0.00 ? 37 TRP A HB2  5  
ATOM 5399  H HB3  . TRP A 1 37 ? -1.654  -6.267  -1.840  1.00 0.00 ? 37 TRP A HB3  5  
ATOM 5400  H HD1  . TRP A 1 37 ? -1.940  -10.058 -2.573  1.00 0.00 ? 37 TRP A HD1  5  
ATOM 5401  H HE1  . TRP A 1 37 ? -3.353  -10.351 -4.704  1.00 0.00 ? 37 TRP A HE1  5  
ATOM 5402  H HE3  . TRP A 1 37 ? -2.557  -5.139  -3.821  1.00 0.00 ? 37 TRP A HE3  5  
ATOM 5403  H HZ2  . TRP A 1 37 ? -4.569  -8.713  -6.656  1.00 0.00 ? 37 TRP A HZ2  5  
ATOM 5404  H HZ3  . TRP A 1 37 ? -3.858  -4.588  -5.835  1.00 0.00 ? 37 TRP A HZ3  5  
ATOM 5405  H HH2  . TRP A 1 37 ? -4.841  -6.339  -7.222  1.00 0.00 ? 37 TRP A HH2  5  
ATOM 5406  N N    . CYS A 1 38 ? 0.854   -5.212  -1.327  1.00 0.00 ? 38 CYS A N    5  
ATOM 5407  C CA   . CYS A 1 38 ? 1.488   -4.241  -0.444  1.00 0.00 ? 38 CYS A CA   5  
ATOM 5408  C C    . CYS A 1 38 ? 0.588   -3.027  -0.232  1.00 0.00 ? 38 CYS A C    5  
ATOM 5409  O O    . CYS A 1 38 ? 0.177   -2.372  -1.190  1.00 0.00 ? 38 CYS A O    5  
ATOM 5410  C CB   . CYS A 1 38 ? 2.836   -3.800  -1.022  1.00 0.00 ? 38 CYS A CB   5  
ATOM 5411  S SG   . CYS A 1 38 ? 4.254   -4.196  0.028   1.00 0.00 ? 38 CYS A SG   5  
ATOM 5412  H H    . CYS A 1 38 ? 0.428   -4.901  -2.153  1.00 0.00 ? 38 CYS A H    5  
ATOM 5413  H HA   . CYS A 1 38 ? 1.656   -4.720  0.509   1.00 0.00 ? 38 CYS A HA   5  
ATOM 5414  H HB2  . CYS A 1 38 ? 2.987   -4.289  -1.974  1.00 0.00 ? 38 CYS A HB2  5  
ATOM 5415  H HB3  . CYS A 1 38 ? 2.825   -2.730  -1.171  1.00 0.00 ? 38 CYS A HB3  5  
ATOM 5416  H HG   . CYS A 1 38 ? 4.620   -3.371  0.353   1.00 0.00 ? 38 CYS A HG   5  
ATOM 5417  N N    . GLY A 1 39 ? 0.285   -2.735  1.028   1.00 0.00 ? 39 GLY A N    5  
ATOM 5418  C CA   . GLY A 1 39 ? -0.564  -1.601  1.343   1.00 0.00 ? 39 GLY A CA   5  
ATOM 5419  C C    . GLY A 1 39 ? 0.230   -0.336  1.601   1.00 0.00 ? 39 GLY A C    5  
ATOM 5420  O O    . GLY A 1 39 ? 0.824   -0.174  2.666   1.00 0.00 ? 39 GLY A O    5  
ATOM 5421  H H    . GLY A 1 39 ? 0.641   -3.293  1.751   1.00 0.00 ? 39 GLY A H    5  
ATOM 5422  H HA2  . GLY A 1 39 ? -1.236  -1.428  0.516   1.00 0.00 ? 39 GLY A HA2  5  
ATOM 5423  H HA3  . GLY A 1 39 ? -1.145  -1.833  2.223   1.00 0.00 ? 39 GLY A HA3  5  
ATOM 5424  N N    . VAL A 1 40 ? 0.240   0.563   0.622   1.00 0.00 ? 40 VAL A N    5  
ATOM 5425  C CA   . VAL A 1 40 ? 0.968   1.820   0.747   1.00 0.00 ? 40 VAL A CA   5  
ATOM 5426  C C    . VAL A 1 40 ? 0.054   2.937   1.242   1.00 0.00 ? 40 VAL A C    5  
ATOM 5427  O O    . VAL A 1 40 ? -0.977  3.223   0.634   1.00 0.00 ? 40 VAL A O    5  
ATOM 5428  C CB   . VAL A 1 40 ? 1.597   2.242   -0.594  1.00 0.00 ? 40 VAL A CB   5  
ATOM 5429  C CG1  . VAL A 1 40 ? 2.478   3.468   -0.411  1.00 0.00 ? 40 VAL A CG1  5  
ATOM 5430  C CG2  . VAL A 1 40 ? 2.391   1.092   -1.198  1.00 0.00 ? 40 VAL A CG2  5  
ATOM 5431  H H    . VAL A 1 40 ? -0.252  0.377   -0.204  1.00 0.00 ? 40 VAL A H    5  
ATOM 5432  H HA   . VAL A 1 40 ? 1.763   1.675   1.464   1.00 0.00 ? 40 VAL A HA   5  
ATOM 5433  H HB   . VAL A 1 40 ? 0.800   2.498   -1.278  1.00 0.00 ? 40 VAL A HB   5  
ATOM 5434  H HG11 . VAL A 1 40 ? 1.893   4.361   -0.579  1.00 0.00 ? 40 VAL A HG11 5  
ATOM 5435  H HG12 . VAL A 1 40 ? 3.293   3.435   -1.119  1.00 0.00 ? 40 VAL A HG12 5  
ATOM 5436  H HG13 . VAL A 1 40 ? 2.874   3.481   0.593   1.00 0.00 ? 40 VAL A HG13 5  
ATOM 5437  H HG21 . VAL A 1 40 ? 3.444   1.249   -1.018  1.00 0.00 ? 40 VAL A HG21 5  
ATOM 5438  H HG22 . VAL A 1 40 ? 2.211   1.051   -2.262  1.00 0.00 ? 40 VAL A HG22 5  
ATOM 5439  H HG23 . VAL A 1 40 ? 2.082   0.162   -0.744  1.00 0.00 ? 40 VAL A HG23 5  
ATOM 5440  N N    . GLU A 1 41 ? 0.440   3.563   2.350   1.00 0.00 ? 41 GLU A N    5  
ATOM 5441  C CA   . GLU A 1 41 ? -0.345  4.648   2.926   1.00 0.00 ? 41 GLU A CA   5  
ATOM 5442  C C    . GLU A 1 41 ? 0.010   5.982   2.277   1.00 0.00 ? 41 GLU A C    5  
ATOM 5443  O O    . GLU A 1 41 ? 1.179   6.364   2.218   1.00 0.00 ? 41 GLU A O    5  
ATOM 5444  C CB   . GLU A 1 41 ? -0.114  4.725   4.437   1.00 0.00 ? 41 GLU A CB   5  
ATOM 5445  C CG   . GLU A 1 41 ? -1.169  5.534   5.173   1.00 0.00 ? 41 GLU A CG   5  
ATOM 5446  C CD   . GLU A 1 41 ? -0.741  6.969   5.415   1.00 0.00 ? 41 GLU A CD   5  
ATOM 5447  O OE1  . GLU A 1 41 ? 0.424   7.181   5.813   1.00 0.00 ? 41 GLU A OE1  5  
ATOM 5448  O OE2  . GLU A 1 41 ? -1.570  7.879   5.206   1.00 0.00 ? 41 GLU A OE2  5  
ATOM 5449  H H    . GLU A 1 41 ? 1.272   3.289   2.789   1.00 0.00 ? 41 GLU A H    5  
ATOM 5450  H HA   . GLU A 1 41 ? -1.388  4.438   2.741   1.00 0.00 ? 41 GLU A HA   5  
ATOM 5451  H HB2  . GLU A 1 41 ? -0.112  3.724   4.841   1.00 0.00 ? 41 GLU A HB2  5  
ATOM 5452  H HB3  . GLU A 1 41 ? 0.849   5.180   4.619   1.00 0.00 ? 41 GLU A HB3  5  
ATOM 5453  H HG2  . GLU A 1 41 ? -2.075  5.539   4.586   1.00 0.00 ? 41 GLU A HG2  5  
ATOM 5454  H HG3  . GLU A 1 41 ? -1.363  5.066   6.127   1.00 0.00 ? 41 GLU A HG3  5  
ATOM 5455  N N    . LEU A 1 42 ? -1.007  6.688   1.793   1.00 0.00 ? 42 LEU A N    5  
ATOM 5456  C CA   . LEU A 1 42 ? -0.803  7.979   1.148   1.00 0.00 ? 42 LEU A CA   5  
ATOM 5457  C C    . LEU A 1 42 ? -1.201  9.120   2.078   1.00 0.00 ? 42 LEU A C    5  
ATOM 5458  O O    . LEU A 1 42 ? -2.006  8.938   2.992   1.00 0.00 ? 42 LEU A O    5  
ATOM 5459  C CB   . LEU A 1 42 ? -1.610  8.058   -0.149  1.00 0.00 ? 42 LEU A CB   5  
ATOM 5460  C CG   . LEU A 1 42 ? -1.229  7.026   -1.212  1.00 0.00 ? 42 LEU A CG   5  
ATOM 5461  C CD1  . LEU A 1 42 ? -2.132  7.156   -2.429  1.00 0.00 ? 42 LEU A CD1  5  
ATOM 5462  C CD2  . LEU A 1 42 ? 0.231   7.186   -1.610  1.00 0.00 ? 42 LEU A CD2  5  
ATOM 5463  H H    . LEU A 1 42 ? -1.916  6.331   1.871   1.00 0.00 ? 42 LEU A H    5  
ATOM 5464  H HA   . LEU A 1 42 ? 0.247   8.071   0.914   1.00 0.00 ? 42 LEU A HA   5  
ATOM 5465  H HB2  . LEU A 1 42 ? -2.654  7.927   0.093   1.00 0.00 ? 42 LEU A HB2  5  
ATOM 5466  H HB3  . LEU A 1 42 ? -1.477  9.043   -0.572  1.00 0.00 ? 42 LEU A HB3  5  
ATOM 5467  H HG   . LEU A 1 42 ? -1.360  6.034   -0.804  1.00 0.00 ? 42 LEU A HG   5  
ATOM 5468  H HD11 . LEU A 1 42 ? -2.215  6.197   -2.919  1.00 0.00 ? 42 LEU A HD11 5  
ATOM 5469  H HD12 . LEU A 1 42 ? -1.709  7.875   -3.115  1.00 0.00 ? 42 LEU A HD12 5  
ATOM 5470  H HD13 . LEU A 1 42 ? -3.111  7.487   -2.117  1.00 0.00 ? 42 LEU A HD13 5  
ATOM 5471  H HD21 . LEU A 1 42 ? 0.501   6.406   -2.306  1.00 0.00 ? 42 LEU A HD21 5  
ATOM 5472  H HD22 . LEU A 1 42 ? 0.853   7.113   -0.729  1.00 0.00 ? 42 LEU A HD22 5  
ATOM 5473  H HD23 . LEU A 1 42 ? 0.375   8.150   -2.073  1.00 0.00 ? 42 LEU A HD23 5  
ATOM 5474  N N    . ASP A 1 43 ? -0.630  10.297  1.843   1.00 0.00 ? 43 ASP A N    5  
ATOM 5475  C CA   . ASP A 1 43 ? -0.925  11.467  2.661   1.00 0.00 ? 43 ASP A CA   5  
ATOM 5476  C C    . ASP A 1 43 ? -2.252  12.098  2.251   1.00 0.00 ? 43 ASP A C    5  
ATOM 5477  O O    . ASP A 1 43 ? -3.032  12.533  3.099   1.00 0.00 ? 43 ASP A O    5  
ATOM 5478  C CB   . ASP A 1 43 ? 0.201   12.496  2.539   1.00 0.00 ? 43 ASP A CB   5  
ATOM 5479  C CG   . ASP A 1 43 ? 1.438   12.094  3.318   1.00 0.00 ? 43 ASP A CG   5  
ATOM 5480  O OD1  . ASP A 1 43 ? 1.846   10.918  3.217   1.00 0.00 ? 43 ASP A OD1  5  
ATOM 5481  O OD2  . ASP A 1 43 ? 1.998   12.954  4.029   1.00 0.00 ? 43 ASP A OD2  5  
ATOM 5482  H H    . ASP A 1 43 ? 0.005   10.380  1.101   1.00 0.00 ? 43 ASP A H    5  
ATOM 5483  H HA   . ASP A 1 43 ? -0.996  11.144  3.688   1.00 0.00 ? 43 ASP A HA   5  
ATOM 5484  H HB2  . ASP A 1 43 ? 0.472   12.604  1.500   1.00 0.00 ? 43 ASP A HB2  5  
ATOM 5485  H HB3  . ASP A 1 43 ? -0.147  13.447  2.917   1.00 0.00 ? 43 ASP A HB3  5  
ATOM 5486  N N    . GLU A 1 44 ? -2.503  12.144  0.947   1.00 0.00 ? 44 GLU A N    5  
ATOM 5487  C CA   . GLU A 1 44 ? -3.736  12.722  0.426   1.00 0.00 ? 44 GLU A CA   5  
ATOM 5488  C C    . GLU A 1 44 ? -4.711  11.628  -0.007  1.00 0.00 ? 44 GLU A C    5  
ATOM 5489  O O    . GLU A 1 44 ? -4.296  10.566  -0.472  1.00 0.00 ? 44 GLU A O    5  
ATOM 5490  C CB   . GLU A 1 44 ? -3.432  13.646  -0.755  1.00 0.00 ? 44 GLU A CB   5  
ATOM 5491  C CG   . GLU A 1 44 ? -3.021  15.049  -0.338  1.00 0.00 ? 44 GLU A CG   5  
ATOM 5492  C CD   . GLU A 1 44 ? -1.843  15.052  0.616   1.00 0.00 ? 44 GLU A CD   5  
ATOM 5493  O OE1  . GLU A 1 44 ? -0.960  14.181  0.470   1.00 0.00 ? 44 GLU A OE1  5  
ATOM 5494  O OE2  . GLU A 1 44 ? -1.804  15.924  1.508   1.00 0.00 ? 44 GLU A OE2  5  
ATOM 5495  H H    . GLU A 1 44 ? -1.843  11.781  0.320   1.00 0.00 ? 44 GLU A H    5  
ATOM 5496  H HA   . GLU A 1 44 ? -4.190  13.300  1.216   1.00 0.00 ? 44 GLU A HA   5  
ATOM 5497  H HB2  . GLU A 1 44 ? -2.631  13.216  -1.336  1.00 0.00 ? 44 GLU A HB2  5  
ATOM 5498  H HB3  . GLU A 1 44 ? -4.314  13.721  -1.375  1.00 0.00 ? 44 GLU A HB3  5  
ATOM 5499  H HG2  . GLU A 1 44 ? -2.750  15.608  -1.221  1.00 0.00 ? 44 GLU A HG2  5  
ATOM 5500  H HG3  . GLU A 1 44 ? -3.860  15.527  0.146   1.00 0.00 ? 44 GLU A HG3  5  
ATOM 5501  N N    . PRO A 1 45 ? -6.025  11.874  0.141   1.00 0.00 ? 45 PRO A N    5  
ATOM 5502  C CA   . PRO A 1 45 ? -7.057  10.902  -0.239  1.00 0.00 ? 45 PRO A CA   5  
ATOM 5503  C C    . PRO A 1 45 ? -6.909  10.434  -1.682  1.00 0.00 ? 45 PRO A C    5  
ATOM 5504  O O    . PRO A 1 45 ? -7.495  11.013  -2.596  1.00 0.00 ? 45 PRO A O    5  
ATOM 5505  C CB   . PRO A 1 45 ? -8.365  11.679  -0.062  1.00 0.00 ? 45 PRO A CB   5  
ATOM 5506  C CG   . PRO A 1 45 ? -8.044  12.744  0.929   1.00 0.00 ? 45 PRO A CG   5  
ATOM 5507  C CD   . PRO A 1 45 ? -6.607  13.114  0.686   1.00 0.00 ? 45 PRO A CD   5  
ATOM 5508  H HA   . PRO A 1 45 ? -7.052  10.045  0.418   1.00 0.00 ? 45 PRO A HA   5  
ATOM 5509  H HB2  . PRO A 1 45 ? -8.668  12.097  -1.010  1.00 0.00 ? 45 PRO A HB2  5  
ATOM 5510  H HB3  . PRO A 1 45 ? -9.132  11.016  0.308   1.00 0.00 ? 45 PRO A HB3  5  
ATOM 5511  H HG2  . PRO A 1 45 ? -8.684  13.600  0.768   1.00 0.00 ? 45 PRO A HG2  5  
ATOM 5512  H HG3  . PRO A 1 45 ? -8.170  12.364  1.931   1.00 0.00 ? 45 PRO A HG3  5  
ATOM 5513  H HD2  . PRO A 1 45 ? -6.541  13.920  -0.029  1.00 0.00 ? 45 PRO A HD2  5  
ATOM 5514  H HD3  . PRO A 1 45 ? -6.128  13.389  1.614   1.00 0.00 ? 45 PRO A HD3  5  
ATOM 5515  N N    . LEU A 1 46 ? -6.122  9.381   -1.880  1.00 0.00 ? 46 LEU A N    5  
ATOM 5516  C CA   . LEU A 1 46 ? -5.897  8.835   -3.213  1.00 0.00 ? 46 LEU A CA   5  
ATOM 5517  C C    . LEU A 1 46 ? -5.818  7.312   -3.169  1.00 0.00 ? 46 LEU A C    5  
ATOM 5518  O O    . LEU A 1 46 ? -5.112  6.694   -3.966  1.00 0.00 ? 46 LEU A O    5  
ATOM 5519  C CB   . LEU A 1 46 ? -4.610  9.406   -3.812  1.00 0.00 ? 46 LEU A CB   5  
ATOM 5520  C CG   . LEU A 1 46 ? -4.465  10.925  -3.705  1.00 0.00 ? 46 LEU A CG   5  
ATOM 5521  C CD1  . LEU A 1 46 ? -3.013  11.336  -3.884  1.00 0.00 ? 46 LEU A CD1  5  
ATOM 5522  C CD2  . LEU A 1 46 ? -5.348  11.618  -4.732  1.00 0.00 ? 46 LEU A CD2  5  
ATOM 5523  H H    . LEU A 1 46 ? -5.683  8.962   -1.111  1.00 0.00 ? 46 LEU A H    5  
ATOM 5524  H HA   . LEU A 1 46 ? -6.732  9.123   -3.834  1.00 0.00 ? 46 LEU A HA   5  
ATOM 5525  H HB2  . LEU A 1 46 ? -3.770  8.948   -3.309  1.00 0.00 ? 46 LEU A HB2  5  
ATOM 5526  H HB3  . LEU A 1 46 ? -4.573  9.137   -4.856  1.00 0.00 ? 46 LEU A HB3  5  
ATOM 5527  H HG   . LEU A 1 46 ? -4.783  11.242  -2.722  1.00 0.00 ? 46 LEU A HG   5  
ATOM 5528  H HD11 . LEU A 1 46 ? -2.464  11.124  -2.979  1.00 0.00 ? 46 LEU A HD11 5  
ATOM 5529  H HD12 . LEU A 1 46 ? -2.961  12.394  -4.095  1.00 0.00 ? 46 LEU A HD12 5  
ATOM 5530  H HD13 . LEU A 1 46 ? -2.581  10.784  -4.705  1.00 0.00 ? 46 LEU A HD13 5  
ATOM 5531  H HD21 . LEU A 1 46 ? -4.761  11.862  -5.605  1.00 0.00 ? 46 LEU A HD21 5  
ATOM 5532  H HD22 . LEU A 1 46 ? -5.754  12.522  -4.306  1.00 0.00 ? 46 LEU A HD22 5  
ATOM 5533  H HD23 . LEU A 1 46 ? -6.156  10.958  -5.016  1.00 0.00 ? 46 LEU A HD23 5  
ATOM 5534  N N    . GLY A 1 47 ? -6.549  6.713   -2.234  1.00 0.00 ? 47 GLY A N    5  
ATOM 5535  C CA   . GLY A 1 47 ? -6.548  5.268   -2.103  1.00 0.00 ? 47 GLY A CA   5  
ATOM 5536  C C    . GLY A 1 47 ? -7.874  4.649   -2.500  1.00 0.00 ? 47 GLY A C    5  
ATOM 5537  O O    . GLY A 1 47 ? -8.810  5.356   -2.872  1.00 0.00 ? 47 GLY A O    5  
ATOM 5538  H H    . GLY A 1 47 ? -7.092  7.257   -1.627  1.00 0.00 ? 47 GLY A H    5  
ATOM 5539  H HA2  . GLY A 1 47 ? -5.770  4.861   -2.733  1.00 0.00 ? 47 GLY A HA2  5  
ATOM 5540  H HA3  . GLY A 1 47 ? -6.336  5.011   -1.076  1.00 0.00 ? 47 GLY A HA3  5  
ATOM 5541  N N    . LYS A 1 48 ? -7.953  3.324   -2.421  1.00 0.00 ? 48 LYS A N    5  
ATOM 5542  C CA   . LYS A 1 48 ? -9.174  2.609   -2.775  1.00 0.00 ? 48 LYS A CA   5  
ATOM 5543  C C    . LYS A 1 48 ? -10.062 2.411   -1.551  1.00 0.00 ? 48 LYS A C    5  
ATOM 5544  O O    . LYS A 1 48 ? -11.288 2.379   -1.661  1.00 0.00 ? 48 LYS A O    5  
ATOM 5545  C CB   . LYS A 1 48 ? -8.834  1.254   -3.397  1.00 0.00 ? 48 LYS A CB   5  
ATOM 5546  C CG   . LYS A 1 48 ? -7.887  1.349   -4.583  1.00 0.00 ? 48 LYS A CG   5  
ATOM 5547  C CD   . LYS A 1 48 ? -8.644  1.397   -5.902  1.00 0.00 ? 48 LYS A CD   5  
ATOM 5548  C CE   . LYS A 1 48 ? -8.298  2.644   -6.701  1.00 0.00 ? 48 LYS A CE   5  
ATOM 5549  N NZ   . LYS A 1 48 ? -8.237  2.368   -8.162  1.00 0.00 ? 48 LYS A NZ   5  
ATOM 5550  H H    . LYS A 1 48 ? -7.172  2.816   -2.117  1.00 0.00 ? 48 LYS A H    5  
ATOM 5551  H HA   . LYS A 1 48 ? -9.708  3.205   -3.500  1.00 0.00 ? 48 LYS A HA   5  
ATOM 5552  H HB2  . LYS A 1 48 ? -8.372  0.631   -2.645  1.00 0.00 ? 48 LYS A HB2  5  
ATOM 5553  H HB3  . LYS A 1 48 ? -9.747  0.785   -3.730  1.00 0.00 ? 48 LYS A HB3  5  
ATOM 5554  H HG2  . LYS A 1 48 ? -7.294  2.247   -4.485  1.00 0.00 ? 48 LYS A HG2  5  
ATOM 5555  H HG3  . LYS A 1 48 ? -7.237  0.486   -4.582  1.00 0.00 ? 48 LYS A HG3  5  
ATOM 5556  H HD2  . LYS A 1 48 ? -8.387  0.526   -6.485  1.00 0.00 ? 48 LYS A HD2  5  
ATOM 5557  H HD3  . LYS A 1 48 ? -9.705  1.395   -5.698  1.00 0.00 ? 48 LYS A HD3  5  
ATOM 5558  H HE2  . LYS A 1 48 ? -9.052  3.395   -6.518  1.00 0.00 ? 48 LYS A HE2  5  
ATOM 5559  H HE3  . LYS A 1 48 ? -7.338  3.012   -6.371  1.00 0.00 ? 48 LYS A HE3  5  
ATOM 5560  H HZ1  . LYS A 1 48 ? -9.174  2.506   -8.593  1.00 0.00 ? 48 LYS A HZ1  5  
ATOM 5561  H HZ2  . LYS A 1 48 ? -7.933  1.386   -8.328  1.00 0.00 ? 48 LYS A HZ2  5  
ATOM 5562  H HZ3  . LYS A 1 48 ? -7.559  3.010   -8.620  1.00 0.00 ? 48 LYS A HZ3  5  
ATOM 5563  N N    . ASN A 1 49 ? -9.437  2.278   -0.386  1.00 0.00 ? 49 ASN A N    5  
ATOM 5564  C CA   . ASN A 1 49 ? -10.172 2.083   0.859   1.00 0.00 ? 49 ASN A CA   5  
ATOM 5565  C C    . ASN A 1 49 ? -9.274  2.330   2.067   1.00 0.00 ? 49 ASN A C    5  
ATOM 5566  O O    . ASN A 1 49 ? -8.094  2.653   1.922   1.00 0.00 ? 49 ASN A O    5  
ATOM 5567  C CB   . ASN A 1 49 ? -10.756 0.668   0.921   1.00 0.00 ? 49 ASN A CB   5  
ATOM 5568  C CG   . ASN A 1 49 ? -9.816  -0.378  0.350   1.00 0.00 ? 49 ASN A CG   5  
ATOM 5569  O OD1  . ASN A 1 49 ? -10.112 -1.006  -0.666  1.00 0.00 ? 49 ASN A OD1  5  
ATOM 5570  N ND2  . ASN A 1 49 ? -8.677  -0.570  1.004   1.00 0.00 ? 49 ASN A ND2  5  
ATOM 5571  H H    . ASN A 1 49 ? -8.457  2.313   -0.362  1.00 0.00 ? 49 ASN A H    5  
ATOM 5572  H HA   . ASN A 1 49 ? -10.982 2.796   0.879   1.00 0.00 ? 49 ASN A HA   5  
ATOM 5573  H HB2  . ASN A 1 49 ? -10.960 0.415   1.950   1.00 0.00 ? 49 ASN A HB2  5  
ATOM 5574  H HB3  . ASN A 1 49 ? -11.678 0.642   0.359   1.00 0.00 ? 49 ASN A HB3  5  
ATOM 5575  H HD21 . ASN A 1 49 ? -8.508  -0.035  1.806   1.00 0.00 ? 49 ASN A HD21 5  
ATOM 5576  H HD22 . ASN A 1 49 ? -8.051  -1.240  0.657   1.00 0.00 ? 49 ASN A HD22 5  
ATOM 5577  N N    . ASP A 1 50 ? -9.840  2.179   3.260   1.00 0.00 ? 50 ASP A N    5  
ATOM 5578  C CA   . ASP A 1 50 ? -9.092  2.387   4.495   1.00 0.00 ? 50 ASP A CA   5  
ATOM 5579  C C    . ASP A 1 50 ? -8.407  1.098   4.943   1.00 0.00 ? 50 ASP A C    5  
ATOM 5580  O O    . ASP A 1 50 ? -8.610  0.633   6.065   1.00 0.00 ? 50 ASP A O    5  
ATOM 5581  C CB   . ASP A 1 50 ? -10.020 2.899   5.598   1.00 0.00 ? 50 ASP A CB   5  
ATOM 5582  C CG   . ASP A 1 50 ? -11.264 2.047   5.752   1.00 0.00 ? 50 ASP A CG   5  
ATOM 5583  O OD1  . ASP A 1 50 ? -12.099 2.043   4.822   1.00 0.00 ? 50 ASP A OD1  5  
ATOM 5584  O OD2  . ASP A 1 50 ? -11.403 1.383   6.800   1.00 0.00 ? 50 ASP A OD2  5  
ATOM 5585  H H    . ASP A 1 50 ? -10.784 1.921   3.312   1.00 0.00 ? 50 ASP A H    5  
ATOM 5586  H HA   . ASP A 1 50 ? -8.334  3.132   4.300   1.00 0.00 ? 50 ASP A HA   5  
ATOM 5587  H HB2  . ASP A 1 50 ? -9.487  2.898   6.537   1.00 0.00 ? 50 ASP A HB2  5  
ATOM 5588  H HB3  . ASP A 1 50 ? -10.323 3.910   5.364   1.00 0.00 ? 50 ASP A HB3  5  
ATOM 5589  N N    . GLY A 1 51 ? -7.596  0.528   4.059   1.00 0.00 ? 51 GLY A N    5  
ATOM 5590  C CA   . GLY A 1 51 ? -6.892  -0.701  4.381   1.00 0.00 ? 51 GLY A CA   5  
ATOM 5591  C C    . GLY A 1 51 ? -7.826  -1.810  4.829   1.00 0.00 ? 51 GLY A C    5  
ATOM 5592  O O    . GLY A 1 51 ? -7.420  -2.715  5.557   1.00 0.00 ? 51 GLY A O    5  
ATOM 5593  H H    . GLY A 1 51 ? -7.471  0.945   3.182   1.00 0.00 ? 51 GLY A H    5  
ATOM 5594  H HA2  . GLY A 1 51 ? -6.351  -1.032  3.507   1.00 0.00 ? 51 GLY A HA2  5  
ATOM 5595  H HA3  . GLY A 1 51 ? -6.185  -0.501  5.173   1.00 0.00 ? 51 GLY A HA3  5  
ATOM 5596  N N    . ALA A 1 52 ? -9.080  -1.739  4.393   1.00 0.00 ? 52 ALA A N    5  
ATOM 5597  C CA   . ALA A 1 52 ? -10.072 -2.744  4.755   1.00 0.00 ? 52 ALA A CA   5  
ATOM 5598  C C    . ALA A 1 52 ? -10.680 -3.387  3.514   1.00 0.00 ? 52 ALA A C    5  
ATOM 5599  O O    . ALA A 1 52 ? -11.467 -2.762  2.801   1.00 0.00 ? 52 ALA A O    5  
ATOM 5600  C CB   . ALA A 1 52 ? -11.160 -2.124  5.618   1.00 0.00 ? 52 ALA A CB   5  
ATOM 5601  H H    . ALA A 1 52 ? -9.344  -0.993  3.815   1.00 0.00 ? 52 ALA A H    5  
ATOM 5602  H HA   . ALA A 1 52 ? -9.575  -3.508  5.336   1.00 0.00 ? 52 ALA A HA   5  
ATOM 5603  H HB1  . ALA A 1 52 ? -11.589 -2.883  6.257   1.00 0.00 ? 52 ALA A HB1  5  
ATOM 5604  H HB2  . ALA A 1 52 ? -11.930 -1.710  4.984   1.00 0.00 ? 52 ALA A HB2  5  
ATOM 5605  H HB3  . ALA A 1 52 ? -10.734 -1.340  6.226   1.00 0.00 ? 52 ALA A HB3  5  
ATOM 5606  N N    . VAL A 1 53 ? -10.312 -4.638  3.260   1.00 0.00 ? 53 VAL A N    5  
ATOM 5607  C CA   . VAL A 1 53 ? -10.821 -5.366  2.104   1.00 0.00 ? 53 VAL A CA   5  
ATOM 5608  C C    . VAL A 1 53 ? -11.902 -6.359  2.515   1.00 0.00 ? 53 VAL A C    5  
ATOM 5609  O O    . VAL A 1 53 ? -11.647 -7.290  3.278   1.00 0.00 ? 53 VAL A O    5  
ATOM 5610  C CB   . VAL A 1 53 ? -9.695  -6.122  1.376   1.00 0.00 ? 53 VAL A CB   5  
ATOM 5611  C CG1  . VAL A 1 53 ? -10.203 -6.707  0.067   1.00 0.00 ? 53 VAL A CG1  5  
ATOM 5612  C CG2  . VAL A 1 53 ? -8.506  -5.205  1.132   1.00 0.00 ? 53 VAL A CG2  5  
ATOM 5613  H H    . VAL A 1 53 ? -9.681  -5.082  3.865   1.00 0.00 ? 53 VAL A H    5  
ATOM 5614  H HA   . VAL A 1 53 ? -11.247 -4.647  1.419   1.00 0.00 ? 53 VAL A HA   5  
ATOM 5615  H HB   . VAL A 1 53 ? -9.369  -6.937  2.006   1.00 0.00 ? 53 VAL A HB   5  
ATOM 5616  H HG11 . VAL A 1 53 ? -10.529 -7.724  0.230   1.00 0.00 ? 53 VAL A HG11 5  
ATOM 5617  H HG12 . VAL A 1 53 ? -9.409  -6.696  -0.664  1.00 0.00 ? 53 VAL A HG12 5  
ATOM 5618  H HG13 . VAL A 1 53 ? -11.032 -6.116  -0.293  1.00 0.00 ? 53 VAL A HG13 5  
ATOM 5619  H HG21 . VAL A 1 53 ? -8.843  -4.179  1.099   1.00 0.00 ? 53 VAL A HG21 5  
ATOM 5620  H HG22 . VAL A 1 53 ? -8.040  -5.461  0.192   1.00 0.00 ? 53 VAL A HG22 5  
ATOM 5621  H HG23 . VAL A 1 53 ? -7.791  -5.322  1.933   1.00 0.00 ? 53 VAL A HG23 5  
ATOM 5622  N N    . ALA A 1 54 ? -13.113 -6.153  2.003   1.00 0.00 ? 54 ALA A N    5  
ATOM 5623  C CA   . ALA A 1 54 ? -14.234 -7.030  2.317   1.00 0.00 ? 54 ALA A CA   5  
ATOM 5624  C C    . ALA A 1 54 ? -14.540 -7.020  3.810   1.00 0.00 ? 54 ALA A C    5  
ATOM 5625  O O    . ALA A 1 54 ? -15.030 -8.006  4.360   1.00 0.00 ? 54 ALA A O    5  
ATOM 5626  C CB   . ALA A 1 54 ? -13.942 -8.448  1.846   1.00 0.00 ? 54 ALA A CB   5  
ATOM 5627  H H    . ALA A 1 54 ? -13.254 -5.393  1.402   1.00 0.00 ? 54 ALA A H    5  
ATOM 5628  H HA   . ALA A 1 54 ? -15.099 -6.669  1.780   1.00 0.00 ? 54 ALA A HA   5  
ATOM 5629  H HB1  . ALA A 1 54 ? -14.760 -9.096  2.128   1.00 0.00 ? 54 ALA A HB1  5  
ATOM 5630  H HB2  . ALA A 1 54 ? -13.029 -8.798  2.305   1.00 0.00 ? 54 ALA A HB2  5  
ATOM 5631  H HB3  . ALA A 1 54 ? -13.833 -8.455  0.772   1.00 0.00 ? 54 ALA A HB3  5  
ATOM 5632  N N    . GLY A 1 55 ? -14.249 -5.899  4.462   1.00 0.00 ? 55 GLY A N    5  
ATOM 5633  C CA   . GLY A 1 55 ? -14.501 -5.782  5.887   1.00 0.00 ? 55 GLY A CA   5  
ATOM 5634  C C    . GLY A 1 55 ? -13.271 -6.078  6.721   1.00 0.00 ? 55 GLY A C    5  
ATOM 5635  O O    . GLY A 1 55 ? -13.118 -5.552  7.824   1.00 0.00 ? 55 GLY A O    5  
ATOM 5636  H H    . GLY A 1 55 ? -13.860 -5.144  3.973   1.00 0.00 ? 55 GLY A H    5  
ATOM 5637  H HA2  . GLY A 1 55 ? -14.834 -4.777  6.101   1.00 0.00 ? 55 GLY A HA2  5  
ATOM 5638  H HA3  . GLY A 1 55 ? -15.283 -6.475  6.161   1.00 0.00 ? 55 GLY A HA3  5  
ATOM 5639  N N    . THR A 1 56 ? -12.390 -6.923  6.194   1.00 0.00 ? 56 THR A N    5  
ATOM 5640  C CA   . THR A 1 56 ? -11.166 -7.289  6.898   1.00 0.00 ? 56 THR A CA   5  
ATOM 5641  C C    . THR A 1 56 ? -10.120 -6.186  6.782   1.00 0.00 ? 56 THR A C    5  
ATOM 5642  O O    . THR A 1 56 ? -9.607  -5.914  5.696   1.00 0.00 ? 56 THR A O    5  
ATOM 5643  C CB   . THR A 1 56 ? -10.607 -8.599  6.341   1.00 0.00 ? 56 THR A CB   5  
ATOM 5644  O OG1  . THR A 1 56 ? -11.643 -9.546  6.151   1.00 0.00 ? 56 THR A OG1  5  
ATOM 5645  C CG2  . THR A 1 56 ? -9.564  -9.233  7.236   1.00 0.00 ? 56 THR A CG2  5  
ATOM 5646  H H    . THR A 1 56 ? -12.567 -7.309  5.312   1.00 0.00 ? 56 THR A H    5  
ATOM 5647  H HA   . THR A 1 56 ? -11.412 -7.427  7.940   1.00 0.00 ? 56 THR A HA   5  
ATOM 5648  H HB   . THR A 1 56 ? -10.146 -8.404  5.383   1.00 0.00 ? 56 THR A HB   5  
ATOM 5649  H HG1  . THR A 1 56 ? -12.156 -9.308  5.376   1.00 0.00 ? 56 THR A HG1  5  
ATOM 5650  H HG21 . THR A 1 56 ? -8.686  -8.605  7.265   1.00 0.00 ? 56 THR A HG21 5  
ATOM 5651  H HG22 . THR A 1 56 ? -9.300  -10.205 6.847   1.00 0.00 ? 56 THR A HG22 5  
ATOM 5652  H HG23 . THR A 1 56 ? -9.963  -9.341  8.234   1.00 0.00 ? 56 THR A HG23 5  
ATOM 5653  N N    . ARG A 1 57 ? -9.808  -5.551  7.908   1.00 0.00 ? 57 ARG A N    5  
ATOM 5654  C CA   . ARG A 1 57 ? -8.823  -4.477  7.933   1.00 0.00 ? 57 ARG A CA   5  
ATOM 5655  C C    . ARG A 1 57 ? -7.549  -4.924  8.643   1.00 0.00 ? 57 ARG A C    5  
ATOM 5656  O O    . ARG A 1 57 ? -7.544  -5.134  9.857   1.00 0.00 ? 57 ARG A O    5  
ATOM 5657  C CB   . ARG A 1 57 ? -9.402  -3.243  8.628   1.00 0.00 ? 57 ARG A CB   5  
ATOM 5658  C CG   . ARG A 1 57 ? -8.450  -2.058  8.658   1.00 0.00 ? 57 ARG A CG   5  
ATOM 5659  C CD   . ARG A 1 57 ? -9.144  -0.800  9.151   1.00 0.00 ? 57 ARG A CD   5  
ATOM 5660  N NE   . ARG A 1 57 ? -9.924  -1.043  10.363  1.00 0.00 ? 57 ARG A NE   5  
ATOM 5661  C CZ   . ARG A 1 57 ? -9.385  -1.260  11.560  1.00 0.00 ? 57 ARG A CZ   5  
ATOM 5662  N NH1  . ARG A 1 57 ? -8.066  -1.265  11.712  1.00 0.00 ? 57 ARG A NH1  5  
ATOM 5663  N NH2  . ARG A 1 57 ? -10.166 -1.472  12.611  1.00 0.00 ? 57 ARG A NH2  5  
ATOM 5664  H H    . ARG A 1 57 ? -10.251 -5.813  8.742   1.00 0.00 ? 57 ARG A H    5  
ATOM 5665  H HA   . ARG A 1 57 ? -8.581  -4.224  6.912   1.00 0.00 ? 57 ARG A HA   5  
ATOM 5666  H HB2  . ARG A 1 57 ? -10.300 -2.942  8.111   1.00 0.00 ? 57 ARG A HB2  5  
ATOM 5667  H HB3  . ARG A 1 57 ? -9.652  -3.501  9.646   1.00 0.00 ? 57 ARG A HB3  5  
ATOM 5668  H HG2  . ARG A 1 57 ? -7.627  -2.287  9.319   1.00 0.00 ? 57 ARG A HG2  5  
ATOM 5669  H HG3  . ARG A 1 57 ? -8.076  -1.885  7.659   1.00 0.00 ? 57 ARG A HG3  5  
ATOM 5670  H HD2  . ARG A 1 57 ? -8.395  -0.050  9.362   1.00 0.00 ? 57 ARG A HD2  5  
ATOM 5671  H HD3  . ARG A 1 57 ? -9.803  -0.440  8.376   1.00 0.00 ? 57 ARG A HD3  5  
ATOM 5672  H HE   . ARG A 1 57 ? -10.900 -1.046  10.280  1.00 0.00 ? 57 ARG A HE   5  
ATOM 5673  H HH11 . ARG A 1 57 ? -7.471  -1.105  10.924  1.00 0.00 ? 57 ARG A HH11 5  
ATOM 5674  H HH12 . ARG A 1 57 ? -7.667  -1.427  12.614  1.00 0.00 ? 57 ARG A HH12 5  
ATOM 5675  H HH21 . ARG A 1 57 ? -11.160 -1.470  12.503  1.00 0.00 ? 57 ARG A HH21 5  
ATOM 5676  H HH22 . ARG A 1 57 ? -9.761  -1.636  13.511  1.00 0.00 ? 57 ARG A HH22 5  
ATOM 5677  N N    . TYR A 1 58 ? -6.470  -5.067  7.880   1.00 0.00 ? 58 TYR A N    5  
ATOM 5678  C CA   . TYR A 1 58 ? -5.191  -5.490  8.437   1.00 0.00 ? 58 TYR A CA   5  
ATOM 5679  C C    . TYR A 1 58 ? -4.537  -4.357  9.222   1.00 0.00 ? 58 TYR A C    5  
ATOM 5680  O O    . TYR A 1 58 ? -3.980  -4.575  10.297  1.00 0.00 ? 58 TYR A O    5  
ATOM 5681  C CB   . TYR A 1 58 ? -4.254  -5.958  7.321   1.00 0.00 ? 58 TYR A CB   5  
ATOM 5682  C CG   . TYR A 1 58 ? -4.908  -6.899  6.335   1.00 0.00 ? 58 TYR A CG   5  
ATOM 5683  C CD1  . TYR A 1 58 ? -5.549  -6.413  5.201   1.00 0.00 ? 58 TYR A CD1  5  
ATOM 5684  C CD2  . TYR A 1 58 ? -4.886  -8.274  6.535   1.00 0.00 ? 58 TYR A CD2  5  
ATOM 5685  C CE1  . TYR A 1 58 ? -6.148  -7.269  4.297   1.00 0.00 ? 58 TYR A CE1  5  
ATOM 5686  C CE2  . TYR A 1 58 ? -5.481  -9.136  5.635   1.00 0.00 ? 58 TYR A CE2  5  
ATOM 5687  C CZ   . TYR A 1 58 ? -6.111  -8.629  4.518   1.00 0.00 ? 58 TYR A CZ   5  
ATOM 5688  O OH   . TYR A 1 58 ? -6.706  -9.484  3.620   1.00 0.00 ? 58 TYR A OH   5  
ATOM 5689  H H    . TYR A 1 58 ? -6.537  -4.885  6.919   1.00 0.00 ? 58 TYR A H    5  
ATOM 5690  H HA   . TYR A 1 58 ? -5.378  -6.316  9.107   1.00 0.00 ? 58 TYR A HA   5  
ATOM 5691  H HB2  . TYR A 1 58 ? -3.900  -5.098  6.774   1.00 0.00 ? 58 TYR A HB2  5  
ATOM 5692  H HB3  . TYR A 1 58 ? -3.411  -6.471  7.761   1.00 0.00 ? 58 TYR A HB3  5  
ATOM 5693  H HD1  . TYR A 1 58 ? -5.575  -5.346  5.030   1.00 0.00 ? 58 TYR A HD1  5  
ATOM 5694  H HD2  . TYR A 1 58 ? -4.392  -8.668  7.411   1.00 0.00 ? 58 TYR A HD2  5  
ATOM 5695  H HE1  . TYR A 1 58 ? -6.641  -6.871  3.422   1.00 0.00 ? 58 TYR A HE1  5  
ATOM 5696  H HE2  . TYR A 1 58 ? -5.453  -10.202 5.809   1.00 0.00 ? 58 TYR A HE2  5  
ATOM 5697  H HH   . TYR A 1 58 ? -7.612  -9.653  3.889   1.00 0.00 ? 58 TYR A HH   5  
ATOM 5698  N N    . PHE A 1 59 ? -4.608  -3.147  8.676   1.00 0.00 ? 59 PHE A N    5  
ATOM 5699  C CA   . PHE A 1 59 ? -4.022  -1.981  9.326   1.00 0.00 ? 59 PHE A CA   5  
ATOM 5700  C C    . PHE A 1 59 ? -5.039  -0.848  9.433   1.00 0.00 ? 59 PHE A C    5  
ATOM 5701  O O    . PHE A 1 59 ? -5.877  -0.667  8.550   1.00 0.00 ? 59 PHE A O    5  
ATOM 5702  C CB   . PHE A 1 59 ? -2.791  -1.505  8.553   1.00 0.00 ? 59 PHE A CB   5  
ATOM 5703  C CG   . PHE A 1 59 ? -3.088  -1.109  7.135   1.00 0.00 ? 59 PHE A CG   5  
ATOM 5704  C CD1  . PHE A 1 59 ? -3.118  -2.060  6.127   1.00 0.00 ? 59 PHE A CD1  5  
ATOM 5705  C CD2  . PHE A 1 59 ? -3.338  0.214   6.809   1.00 0.00 ? 59 PHE A CD2  5  
ATOM 5706  C CE1  . PHE A 1 59 ? -3.391  -1.698  4.821   1.00 0.00 ? 59 PHE A CE1  5  
ATOM 5707  C CE2  . PHE A 1 59 ? -3.611  0.583   5.506   1.00 0.00 ? 59 PHE A CE2  5  
ATOM 5708  C CZ   . PHE A 1 59 ? -3.638  -0.375  4.511   1.00 0.00 ? 59 PHE A CZ   5  
ATOM 5709  H H    . PHE A 1 59 ? -5.065  -3.037  7.815   1.00 0.00 ? 59 PHE A H    5  
ATOM 5710  H HA   . PHE A 1 59 ? -3.720  -2.272  10.321  1.00 0.00 ? 59 PHE A HA   5  
ATOM 5711  H HB2  . PHE A 1 59 ? -2.368  -0.648  9.055   1.00 0.00 ? 59 PHE A HB2  5  
ATOM 5712  H HB3  . PHE A 1 59 ? -2.060  -2.300  8.531   1.00 0.00 ? 59 PHE A HB3  5  
ATOM 5713  H HD1  . PHE A 1 59 ? -2.924  -3.095  6.369   1.00 0.00 ? 59 PHE A HD1  5  
ATOM 5714  H HD2  . PHE A 1 59 ? -3.317  0.964   7.586   1.00 0.00 ? 59 PHE A HD2  5  
ATOM 5715  H HE1  . PHE A 1 59 ? -3.411  -2.449  4.045   1.00 0.00 ? 59 PHE A HE1  5  
ATOM 5716  H HE2  . PHE A 1 59 ? -3.805  1.618   5.266   1.00 0.00 ? 59 PHE A HE2  5  
ATOM 5717  H HZ   . PHE A 1 59 ? -3.852  -0.090  3.491   1.00 0.00 ? 59 PHE A HZ   5  
ATOM 5718  N N    . GLN A 1 60 ? -4.957  -0.087  10.520  1.00 0.00 ? 60 GLN A N    5  
ATOM 5719  C CA   . GLN A 1 60 ? -5.869  1.029   10.742  1.00 0.00 ? 60 GLN A CA   5  
ATOM 5720  C C    . GLN A 1 60 ? -5.408  2.268   9.982   1.00 0.00 ? 60 GLN A C    5  
ATOM 5721  O O    . GLN A 1 60 ? -4.277  2.725   10.147  1.00 0.00 ? 60 GLN A O    5  
ATOM 5722  C CB   . GLN A 1 60 ? -5.970  1.340   12.237  1.00 0.00 ? 60 GLN A CB   5  
ATOM 5723  C CG   . GLN A 1 60 ? -6.965  2.442   12.563  1.00 0.00 ? 60 GLN A CG   5  
ATOM 5724  C CD   . GLN A 1 60 ? -8.402  1.964   12.509  1.00 0.00 ? 60 GLN A CD   5  
ATOM 5725  O OE1  . GLN A 1 60 ? -8.876  1.280   13.416  1.00 0.00 ? 60 GLN A OE1  5  
ATOM 5726  N NE2  . GLN A 1 60 ? -9.105  2.323   11.440  1.00 0.00 ? 60 GLN A NE2  5  
ATOM 5727  H H    . GLN A 1 60 ? -4.267  -0.282  11.188  1.00 0.00 ? 60 GLN A H    5  
ATOM 5728  H HA   . GLN A 1 60 ? -6.843  0.738   10.378  1.00 0.00 ? 60 GLN A HA   5  
ATOM 5729  H HB2  . GLN A 1 60 ? -6.273  0.445   12.760  1.00 0.00 ? 60 GLN A HB2  5  
ATOM 5730  H HB3  . GLN A 1 60 ? -4.998  1.645   12.597  1.00 0.00 ? 60 GLN A HB3  5  
ATOM 5731  H HG2  . GLN A 1 60 ? -6.762  2.810   13.559  1.00 0.00 ? 60 GLN A HG2  5  
ATOM 5732  H HG3  . GLN A 1 60 ? -6.840  3.245   11.852  1.00 0.00 ? 60 GLN A HG3  5  
ATOM 5733  H HE21 . GLN A 1 60 ? -8.661  2.868   10.757  1.00 0.00 ? 60 GLN A HE21 5  
ATOM 5734  H HE22 . GLN A 1 60 ? -10.037 2.028   11.378  1.00 0.00 ? 60 GLN A HE22 5  
ATOM 5735  N N    . CYS A 1 61 ? -6.291  2.806   9.147   1.00 0.00 ? 61 CYS A N    5  
ATOM 5736  C CA   . CYS A 1 61 ? -5.974  3.992   8.360   1.00 0.00 ? 61 CYS A CA   5  
ATOM 5737  C C    . CYS A 1 61 ? -7.242  4.765   8.003   1.00 0.00 ? 61 CYS A C    5  
ATOM 5738  O O    . CYS A 1 61 ? -8.330  4.193   7.941   1.00 0.00 ? 61 CYS A O    5  
ATOM 5739  C CB   . CYS A 1 61 ? -5.225  3.597   7.085   1.00 0.00 ? 61 CYS A CB   5  
ATOM 5740  S SG   . CYS A 1 61 ? -3.426  3.734   7.212   1.00 0.00 ? 61 CYS A SG   5  
ATOM 5741  H H    . CYS A 1 61 ? -7.176  2.396   9.058   1.00 0.00 ? 61 CYS A H    5  
ATOM 5742  H HA   . CYS A 1 61 ? -5.336  4.626   8.958   1.00 0.00 ? 61 CYS A HA   5  
ATOM 5743  H HB2  . CYS A 1 61 ? -5.459  2.571   6.843   1.00 0.00 ? 61 CYS A HB2  5  
ATOM 5744  H HB3  . CYS A 1 61 ? -5.547  4.234   6.274   1.00 0.00 ? 61 CYS A HB3  5  
ATOM 5745  H HG   . CYS A 1 61 ? -3.037  3.068   6.641   1.00 0.00 ? 61 CYS A HG   5  
ATOM 5746  N N    . PRO A 1 62 ? -7.118  6.082   7.763   1.00 0.00 ? 62 PRO A N    5  
ATOM 5747  C CA   . PRO A 1 62 ? -8.262  6.932   7.410   1.00 0.00 ? 62 PRO A CA   5  
ATOM 5748  C C    . PRO A 1 62 ? -8.983  6.439   6.158   1.00 0.00 ? 62 PRO A C    5  
ATOM 5749  O O    . PRO A 1 62 ? -8.503  5.540   5.468   1.00 0.00 ? 62 PRO A O    5  
ATOM 5750  C CB   . PRO A 1 62 ? -7.630  8.306   7.156   1.00 0.00 ? 62 PRO A CB   5  
ATOM 5751  C CG   . PRO A 1 62 ? -6.327  8.272   7.877   1.00 0.00 ? 62 PRO A CG   5  
ATOM 5752  C CD   . PRO A 1 62 ? -5.859  6.846   7.815   1.00 0.00 ? 62 PRO A CD   5  
ATOM 5753  H HA   . PRO A 1 62 ? -8.967  7.002   8.226   1.00 0.00 ? 62 PRO A HA   5  
ATOM 5754  H HB2  . PRO A 1 62 ? -7.490  8.448   6.094   1.00 0.00 ? 62 PRO A HB2  5  
ATOM 5755  H HB3  . PRO A 1 62 ? -8.275  9.079   7.545   1.00 0.00 ? 62 PRO A HB3  5  
ATOM 5756  H HG2  . PRO A 1 62 ? -5.618  8.921   7.386   1.00 0.00 ? 62 PRO A HG2  5  
ATOM 5757  H HG3  . PRO A 1 62 ? -6.467  8.575   8.903   1.00 0.00 ? 62 PRO A HG3  5  
ATOM 5758  H HD2  . PRO A 1 62 ? -5.269  6.679   6.925   1.00 0.00 ? 62 PRO A HD2  5  
ATOM 5759  H HD3  . PRO A 1 62 ? -5.292  6.594   8.699   1.00 0.00 ? 62 PRO A HD3  5  
ATOM 5760  N N    . PRO A 1 63 ? -10.153 7.026   5.846   1.00 0.00 ? 63 PRO A N    5  
ATOM 5761  C CA   . PRO A 1 63 ? -10.939 6.641   4.670   1.00 0.00 ? 63 PRO A CA   5  
ATOM 5762  C C    . PRO A 1 63 ? -10.276 7.073   3.366   1.00 0.00 ? 63 PRO A C    5  
ATOM 5763  O O    . PRO A 1 63 ? -9.916  8.238   3.197   1.00 0.00 ? 63 PRO A O    5  
ATOM 5764  C CB   . PRO A 1 63 ? -12.263 7.383   4.868   1.00 0.00 ? 63 PRO A CB   5  
ATOM 5765  C CG   . PRO A 1 63 ? -11.915 8.560   5.712   1.00 0.00 ? 63 PRO A CG   5  
ATOM 5766  C CD   . PRO A 1 63 ? -10.799 8.108   6.614   1.00 0.00 ? 63 PRO A CD   5  
ATOM 5767  H HA   . PRO A 1 63 ? -11.119 5.576   4.646   1.00 0.00 ? 63 PRO A HA   5  
ATOM 5768  H HB2  . PRO A 1 63 ? -12.655 7.686   3.908   1.00 0.00 ? 63 PRO A HB2  5  
ATOM 5769  H HB3  . PRO A 1 63 ? -12.970 6.736   5.366   1.00 0.00 ? 63 PRO A HB3  5  
ATOM 5770  H HG2  . PRO A 1 63 ? -11.584 9.375   5.086   1.00 0.00 ? 63 PRO A HG2  5  
ATOM 5771  H HG3  . PRO A 1 63 ? -12.772 8.857   6.297   1.00 0.00 ? 63 PRO A HG3  5  
ATOM 5772  H HD2  . PRO A 1 63 ? -10.108 8.919   6.794   1.00 0.00 ? 63 PRO A HD2  5  
ATOM 5773  H HD3  . PRO A 1 63 ? -11.195 7.734   7.547   1.00 0.00 ? 63 PRO A HD3  5  
ATOM 5774  N N    . LYS A 1 64 ? -10.119 6.126   2.446   1.00 0.00 ? 64 LYS A N    5  
ATOM 5775  C CA   . LYS A 1 64 ? -9.499  6.408   1.156   1.00 0.00 ? 64 LYS A CA   5  
ATOM 5776  C C    . LYS A 1 64 ? -8.047  6.844   1.334   1.00 0.00 ? 64 LYS A C    5  
ATOM 5777  O O    . LYS A 1 64 ? -7.596  7.807   0.712   1.00 0.00 ? 64 LYS A O    5  
ATOM 5778  C CB   . LYS A 1 64 ? -10.284 7.491   0.414   1.00 0.00 ? 64 LYS A CB   5  
ATOM 5779  C CG   . LYS A 1 64 ? -11.782 7.232   0.365   1.00 0.00 ? 64 LYS A CG   5  
ATOM 5780  C CD   . LYS A 1 64 ? -12.214 6.711   -0.996  1.00 0.00 ? 64 LYS A CD   5  
ATOM 5781  C CE   . LYS A 1 64 ? -11.672 5.315   -1.256  1.00 0.00 ? 64 LYS A CE   5  
ATOM 5782  N NZ   . LYS A 1 64 ? -12.118 4.782   -2.574  1.00 0.00 ? 64 LYS A NZ   5  
ATOM 5783  H H    . LYS A 1 64 ? -10.427 5.216   2.639   1.00 0.00 ? 64 LYS A H    5  
ATOM 5784  H HA   . LYS A 1 64 ? -9.518  5.499   0.574   1.00 0.00 ? 64 LYS A HA   5  
ATOM 5785  H HB2  . LYS A 1 64 ? -10.120 8.439   0.906   1.00 0.00 ? 64 LYS A HB2  5  
ATOM 5786  H HB3  . LYS A 1 64 ? -9.918  7.554   -0.601  1.00 0.00 ? 64 LYS A HB3  5  
ATOM 5787  H HG2  . LYS A 1 64 ? -12.034 6.499   1.116   1.00 0.00 ? 64 LYS A HG2  5  
ATOM 5788  H HG3  . LYS A 1 64 ? -12.304 8.155   0.570   1.00 0.00 ? 64 LYS A HG3  5  
ATOM 5789  H HD2  . LYS A 1 64 ? -13.293 6.680   -1.032  1.00 0.00 ? 64 LYS A HD2  5  
ATOM 5790  H HD3  . LYS A 1 64 ? -11.845 7.379   -1.760  1.00 0.00 ? 64 LYS A HD3  5  
ATOM 5791  H HE2  . LYS A 1 64 ? -10.594 5.352   -1.240  1.00 0.00 ? 64 LYS A HE2  5  
ATOM 5792  H HE3  . LYS A 1 64 ? -12.021 4.656   -0.475  1.00 0.00 ? 64 LYS A HE3  5  
ATOM 5793  H HZ1  . LYS A 1 64 ? -11.365 4.205   -2.999  1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 5794  H HZ2  . LYS A 1 64 ? -12.343 5.567   -3.219  1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 5795  H HZ3  . LYS A 1 64 ? -12.967 4.193   -2.453  1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 5796  N N    . PHE A 1 65 ? -7.320  6.130   2.187   1.00 0.00 ? 65 PHE A N    5  
ATOM 5797  C CA   . PHE A 1 65 ? -5.919  6.442   2.447   1.00 0.00 ? 65 PHE A CA   5  
ATOM 5798  C C    . PHE A 1 65 ? -5.025  5.252   2.113   1.00 0.00 ? 65 PHE A C    5  
ATOM 5799  O O    . PHE A 1 65 ? -4.054  5.383   1.368   1.00 0.00 ? 65 PHE A O    5  
ATOM 5800  C CB   . PHE A 1 65 ? -5.727  6.844   3.911   1.00 0.00 ? 65 PHE A CB   5  
ATOM 5801  C CG   . PHE A 1 65 ? -5.820  8.326   4.144   1.00 0.00 ? 65 PHE A CG   5  
ATOM 5802  C CD1  . PHE A 1 65 ? -6.907  9.047   3.675   1.00 0.00 ? 65 PHE A CD1  5  
ATOM 5803  C CD2  . PHE A 1 65 ? -4.822  8.996   4.831   1.00 0.00 ? 65 PHE A CD2  5  
ATOM 5804  C CE1  . PHE A 1 65 ? -6.995  10.410  3.888   1.00 0.00 ? 65 PHE A CE1  5  
ATOM 5805  C CE2  . PHE A 1 65 ? -4.904  10.359  5.047   1.00 0.00 ? 65 PHE A CE2  5  
ATOM 5806  C CZ   . PHE A 1 65 ? -5.993  11.067  4.575   1.00 0.00 ? 65 PHE A CZ   5  
ATOM 5807  H H    . PHE A 1 65 ? -7.736  5.375   2.653   1.00 0.00 ? 65 PHE A H    5  
ATOM 5808  H HA   . PHE A 1 65 ? -5.643  7.273   1.815   1.00 0.00 ? 65 PHE A HA   5  
ATOM 5809  H HB2  . PHE A 1 65 ? -6.487  6.367   4.510   1.00 0.00 ? 65 PHE A HB2  5  
ATOM 5810  H HB3  . PHE A 1 65 ? -4.754  6.515   4.243   1.00 0.00 ? 65 PHE A HB3  5  
ATOM 5811  H HD1  . PHE A 1 65 ? -7.692  8.535   3.139   1.00 0.00 ? 65 PHE A HD1  5  
ATOM 5812  H HD2  . PHE A 1 65 ? -3.970  8.443   5.201   1.00 0.00 ? 65 PHE A HD2  5  
ATOM 5813  H HE1  . PHE A 1 65 ? -7.847  10.960  3.518   1.00 0.00 ? 65 PHE A HE1  5  
ATOM 5814  H HE2  . PHE A 1 65 ? -4.119  10.869  5.585   1.00 0.00 ? 65 PHE A HE2  5  
ATOM 5815  H HZ   . PHE A 1 65 ? -6.060  12.131  4.743   1.00 0.00 ? 65 PHE A HZ   5  
ATOM 5816  N N    . GLY A 1 66 ? -5.360  4.092   2.669   1.00 0.00 ? 66 GLY A N    5  
ATOM 5817  C CA   . GLY A 1 66 ? -4.579  2.897   2.418   1.00 0.00 ? 66 GLY A CA   5  
ATOM 5818  C C    . GLY A 1 66 ? -4.709  2.407   0.989   1.00 0.00 ? 66 GLY A C    5  
ATOM 5819  O O    . GLY A 1 66 ? -5.806  2.084   0.534   1.00 0.00 ? 66 GLY A O    5  
ATOM 5820  H H    . GLY A 1 66 ? -6.146  4.049   3.255   1.00 0.00 ? 66 GLY A H    5  
ATOM 5821  H HA2  . GLY A 1 66 ? -3.539  3.111   2.620   1.00 0.00 ? 66 GLY A HA2  5  
ATOM 5822  H HA3  . GLY A 1 66 ? -4.911  2.115   3.086   1.00 0.00 ? 66 GLY A HA3  5  
ATOM 5823  N N    . LEU A 1 67 ? -3.586  2.353   0.280   1.00 0.00 ? 67 LEU A N    5  
ATOM 5824  C CA   . LEU A 1 67 ? -3.578  1.899   -1.106  1.00 0.00 ? 67 LEU A CA   5  
ATOM 5825  C C    . LEU A 1 67 ? -3.047  0.473   -1.209  1.00 0.00 ? 67 LEU A C    5  
ATOM 5826  O O    . LEU A 1 67 ? -1.892  0.204   -0.877  1.00 0.00 ? 67 LEU A O    5  
ATOM 5827  C CB   . LEU A 1 67 ? -2.727  2.835   -1.966  1.00 0.00 ? 67 LEU A CB   5  
ATOM 5828  C CG   . LEU A 1 67 ? -2.897  2.658   -3.477  1.00 0.00 ? 67 LEU A CG   5  
ATOM 5829  C CD1  . LEU A 1 67 ? -3.789  3.750   -4.047  1.00 0.00 ? 67 LEU A CD1  5  
ATOM 5830  C CD2  . LEU A 1 67 ? -1.542  2.660   -4.171  1.00 0.00 ? 67 LEU A CD2  5  
ATOM 5831  H H    . LEU A 1 67 ? -2.743  2.624   0.699   1.00 0.00 ? 67 LEU A H    5  
ATOM 5832  H HA   . LEU A 1 67 ? -4.596  1.919   -1.466  1.00 0.00 ? 67 LEU A HA   5  
ATOM 5833  H HB2  . LEU A 1 67 ? -2.983  3.854   -1.711  1.00 0.00 ? 67 LEU A HB2  5  
ATOM 5834  H HB3  . LEU A 1 67 ? -1.689  2.670   -1.720  1.00 0.00 ? 67 LEU A HB3  5  
ATOM 5835  H HG   . LEU A 1 67 ? -3.372  1.707   -3.670  1.00 0.00 ? 67 LEU A HG   5  
ATOM 5836  H HD11 . LEU A 1 67 ? -3.463  3.998   -5.046  1.00 0.00 ? 67 LEU A HD11 5  
ATOM 5837  H HD12 . LEU A 1 67 ? -3.728  4.629   -3.420  1.00 0.00 ? 67 LEU A HD12 5  
ATOM 5838  H HD13 . LEU A 1 67 ? -4.811  3.401   -4.078  1.00 0.00 ? 67 LEU A HD13 5  
ATOM 5839  H HD21 . LEU A 1 67 ? -1.129  3.657   -4.151  1.00 0.00 ? 67 LEU A HD21 5  
ATOM 5840  H HD22 . LEU A 1 67 ? -1.663  2.341   -5.196  1.00 0.00 ? 67 LEU A HD22 5  
ATOM 5841  H HD23 . LEU A 1 67 ? -0.875  1.983   -3.658  1.00 0.00 ? 67 LEU A HD23 5  
ATOM 5842  N N    . PHE A 1 68 ? -3.898  -0.438  -1.671  1.00 0.00 ? 68 PHE A N    5  
ATOM 5843  C CA   . PHE A 1 68 ? -3.513  -1.837  -1.818  1.00 0.00 ? 68 PHE A CA   5  
ATOM 5844  C C    . PHE A 1 68 ? -3.070  -2.132  -3.248  1.00 0.00 ? 68 PHE A C    5  
ATOM 5845  O O    . PHE A 1 68 ? -3.882  -2.133  -4.172  1.00 0.00 ? 68 PHE A O    5  
ATOM 5846  C CB   . PHE A 1 68 ? -4.677  -2.751  -1.431  1.00 0.00 ? 68 PHE A CB   5  
ATOM 5847  C CG   . PHE A 1 68 ? -4.568  -3.302  -0.037  1.00 0.00 ? 68 PHE A CG   5  
ATOM 5848  C CD1  . PHE A 1 68 ? -3.407  -3.926  0.387   1.00 0.00 ? 68 PHE A CD1  5  
ATOM 5849  C CD2  . PHE A 1 68 ? -5.630  -3.197  0.848   1.00 0.00 ? 68 PHE A CD2  5  
ATOM 5850  C CE1  . PHE A 1 68 ? -3.303  -4.434  1.668   1.00 0.00 ? 68 PHE A CE1  5  
ATOM 5851  C CE2  . PHE A 1 68 ? -5.533  -3.702  2.131   1.00 0.00 ? 68 PHE A CE2  5  
ATOM 5852  C CZ   . PHE A 1 68 ? -4.369  -4.321  2.541   1.00 0.00 ? 68 PHE A CZ   5  
ATOM 5853  H H    . PHE A 1 68 ? -4.805  -0.163  -1.919  1.00 0.00 ? 68 PHE A H    5  
ATOM 5854  H HA   . PHE A 1 68 ? -2.683  -2.024  -1.151  1.00 0.00 ? 68 PHE A HA   5  
ATOM 5855  H HB2  . PHE A 1 68 ? -5.600  -2.194  -1.496  1.00 0.00 ? 68 PHE A HB2  5  
ATOM 5856  H HB3  . PHE A 1 68 ? -4.715  -3.585  -2.116  1.00 0.00 ? 68 PHE A HB3  5  
ATOM 5857  H HD1  . PHE A 1 68 ? -2.573  -4.014  -0.295  1.00 0.00 ? 68 PHE A HD1  5  
ATOM 5858  H HD2  . PHE A 1 68 ? -6.541  -2.713  0.528   1.00 0.00 ? 68 PHE A HD2  5  
ATOM 5859  H HE1  . PHE A 1 68 ? -2.392  -4.918  1.987   1.00 0.00 ? 68 PHE A HE1  5  
ATOM 5860  H HE2  . PHE A 1 68 ? -6.367  -3.614  2.811   1.00 0.00 ? 68 PHE A HE2  5  
ATOM 5861  H HZ   . PHE A 1 68 ? -4.291  -4.718  3.542   1.00 0.00 ? 68 PHE A HZ   5  
ATOM 5862  N N    . ALA A 1 69 ? -1.777  -2.383  -3.421  1.00 0.00 ? 69 ALA A N    5  
ATOM 5863  C CA   . ALA A 1 69 ? -1.225  -2.681  -4.737  1.00 0.00 ? 69 ALA A CA   5  
ATOM 5864  C C    . ALA A 1 69 ? -0.234  -3.840  -4.667  1.00 0.00 ? 69 ALA A C    5  
ATOM 5865  O O    . ALA A 1 69 ? 0.419   -4.047  -3.644  1.00 0.00 ? 69 ALA A O    5  
ATOM 5866  C CB   . ALA A 1 69 ? -0.558  -1.444  -5.320  1.00 0.00 ? 69 ALA A CB   5  
ATOM 5867  H H    . ALA A 1 69 ? -1.179  -2.369  -2.644  1.00 0.00 ? 69 ALA A H    5  
ATOM 5868  H HA   . ALA A 1 69 ? -2.043  -2.959  -5.385  1.00 0.00 ? 69 ALA A HA   5  
ATOM 5869  H HB1  . ALA A 1 69 ? -1.247  -0.941  -5.981  1.00 0.00 ? 69 ALA A HB1  5  
ATOM 5870  H HB2  . ALA A 1 69 ? 0.323   -1.736  -5.872  1.00 0.00 ? 69 ALA A HB2  5  
ATOM 5871  H HB3  . ALA A 1 69 ? -0.275  -0.777  -4.520  1.00 0.00 ? 69 ALA A HB3  5  
ATOM 5872  N N    . PRO A 1 70 ? -0.107  -4.612  -5.760  1.00 0.00 ? 70 PRO A N    5  
ATOM 5873  C CA   . PRO A 1 70 ? 0.812   -5.754  -5.817  1.00 0.00 ? 70 PRO A CA   5  
ATOM 5874  C C    . PRO A 1 70 ? 2.234   -5.371  -5.421  1.00 0.00 ? 70 PRO A C    5  
ATOM 5875  O O    . PRO A 1 70 ? 2.680   -4.253  -5.677  1.00 0.00 ? 70 PRO A O    5  
ATOM 5876  C CB   . PRO A 1 70 ? 0.763   -6.180  -7.286  1.00 0.00 ? 70 PRO A CB   5  
ATOM 5877  C CG   . PRO A 1 70 ? -0.560  -5.702  -7.777  1.00 0.00 ? 70 PRO A CG   5  
ATOM 5878  C CD   . PRO A 1 70 ? -0.848  -4.433  -7.024  1.00 0.00 ? 70 PRO A CD   5  
ATOM 5879  H HA   . PRO A 1 70 ? 0.472   -6.566  -5.191  1.00 0.00 ? 70 PRO A HA   5  
ATOM 5880  H HB2  . PRO A 1 70 ? 1.577   -5.717  -7.825  1.00 0.00 ? 70 PRO A HB2  5  
ATOM 5881  H HB3  . PRO A 1 70 ? 0.843   -7.254  -7.354  1.00 0.00 ? 70 PRO A HB3  5  
ATOM 5882  H HG2  . PRO A 1 70 ? -0.507  -5.504  -8.838  1.00 0.00 ? 70 PRO A HG2  5  
ATOM 5883  H HG3  . PRO A 1 70 ? -1.318  -6.441  -7.569  1.00 0.00 ? 70 PRO A HG3  5  
ATOM 5884  H HD2  . PRO A 1 70 ? -0.479  -3.577  -7.569  1.00 0.00 ? 70 PRO A HD2  5  
ATOM 5885  H HD3  . PRO A 1 70 ? -1.907  -4.337  -6.838  1.00 0.00 ? 70 PRO A HD3  5  
ATOM 5886  N N    . ILE A 1 71 ? 2.942   -6.307  -4.797  1.00 0.00 ? 71 ILE A N    5  
ATOM 5887  C CA   . ILE A 1 71 ? 4.314   -6.068  -4.367  1.00 0.00 ? 71 ILE A CA   5  
ATOM 5888  C C    . ILE A 1 71 ? 5.198   -5.672  -5.545  1.00 0.00 ? 71 ILE A C    5  
ATOM 5889  O O    . ILE A 1 71 ? 5.991   -4.735  -5.452  1.00 0.00 ? 71 ILE A O    5  
ATOM 5890  C CB   . ILE A 1 71 ? 4.911   -7.312  -3.678  1.00 0.00 ? 71 ILE A CB   5  
ATOM 5891  C CG1  . ILE A 1 71 ? 6.311   -7.008  -3.142  1.00 0.00 ? 71 ILE A CG1  5  
ATOM 5892  C CG2  . ILE A 1 71 ? 4.949   -8.488  -4.642  1.00 0.00 ? 71 ILE A CG2  5  
ATOM 5893  C CD1  . ILE A 1 71 ? 6.916   -8.145  -2.350  1.00 0.00 ? 71 ILE A CD1  5  
ATOM 5894  H H    . ILE A 1 71 ? 2.530   -7.179  -4.622  1.00 0.00 ? 71 ILE A H    5  
ATOM 5895  H HA   . ILE A 1 71 ? 4.301   -5.258  -3.651  1.00 0.00 ? 71 ILE A HA   5  
ATOM 5896  H HB   . ILE A 1 71 ? 4.269   -7.579  -2.852  1.00 0.00 ? 71 ILE A HB   5  
ATOM 5897  H HG12 . ILE A 1 71 ? 6.969   -6.796  -3.972  1.00 0.00 ? 71 ILE A HG12 5  
ATOM 5898  H HG13 . ILE A 1 71 ? 6.263   -6.142  -2.498  1.00 0.00 ? 71 ILE A HG13 5  
ATOM 5899  H HG21 . ILE A 1 71 ? 3.980   -8.609  -5.102  1.00 0.00 ? 71 ILE A HG21 5  
ATOM 5900  H HG22 . ILE A 1 71 ? 5.207   -9.388  -4.104  1.00 0.00 ? 71 ILE A HG22 5  
ATOM 5901  H HG23 . ILE A 1 71 ? 5.691   -8.302  -5.407  1.00 0.00 ? 71 ILE A HG23 5  
ATOM 5902  H HD11 . ILE A 1 71 ? 7.993   -8.072  -2.379  1.00 0.00 ? 71 ILE A HD11 5  
ATOM 5903  H HD12 . ILE A 1 71 ? 6.607   -9.087  -2.779  1.00 0.00 ? 71 ILE A HD12 5  
ATOM 5904  H HD13 . ILE A 1 71 ? 6.579   -8.089  -1.325  1.00 0.00 ? 71 ILE A HD13 5  
ATOM 5905  N N    . HIS A 1 72 ? 5.058   -6.392  -6.653  1.00 0.00 ? 72 HIS A N    5  
ATOM 5906  C CA   . HIS A 1 72 ? 5.843   -6.115  -7.849  1.00 0.00 ? 72 HIS A CA   5  
ATOM 5907  C C    . HIS A 1 72 ? 5.592   -4.696  -8.352  1.00 0.00 ? 72 HIS A C    5  
ATOM 5908  O O    . HIS A 1 72 ? 6.454   -4.093  -8.992  1.00 0.00 ? 72 HIS A O    5  
ATOM 5909  C CB   . HIS A 1 72 ? 5.510   -7.125  -8.949  1.00 0.00 ? 72 HIS A CB   5  
ATOM 5910  C CG   . HIS A 1 72 ? 4.066   -7.128  -9.341  1.00 0.00 ? 72 HIS A CG   5  
ATOM 5911  N ND1  . HIS A 1 72 ? 3.177   -8.119  -8.989  1.00 0.00 ? 72 HIS A ND1  5  
ATOM 5912  C CD2  . HIS A 1 72 ? 3.356   -6.232  -10.074 1.00 0.00 ? 72 HIS A CD2  5  
ATOM 5913  C CE1  . HIS A 1 72 ? 1.981   -7.803  -9.507  1.00 0.00 ? 72 HIS A CE1  5  
ATOM 5914  N NE2  . HIS A 1 72 ? 2.038   -6.665  -10.174 1.00 0.00 ? 72 HIS A NE2  5  
ATOM 5915  H H    . HIS A 1 72 ? 4.409   -7.127  -6.667  1.00 0.00 ? 72 HIS A H    5  
ATOM 5916  H HA   . HIS A 1 72 ? 6.887   -6.212  -7.590  1.00 0.00 ? 72 HIS A HA   5  
ATOM 5917  H HB2  . HIS A 1 72 ? 6.093   -6.894  -9.829  1.00 0.00 ? 72 HIS A HB2  5  
ATOM 5918  H HB3  . HIS A 1 72 ? 5.765   -8.117  -8.606  1.00 0.00 ? 72 HIS A HB3  5  
ATOM 5919  H HD1  . HIS A 1 72 ? 3.381   -8.915  -8.456  1.00 0.00 ? 72 HIS A HD1  5  
ATOM 5920  H HD2  . HIS A 1 72 ? 3.743   -5.324  -10.514 1.00 0.00 ? 72 HIS A HD2  5  
ATOM 5921  H HE1  . HIS A 1 72 ? 1.090   -8.399  -9.392  1.00 0.00 ? 72 HIS A HE1  5  
ATOM 5922  N N    . LYS A 1 73 ? 4.408   -4.168  -8.058  1.00 0.00 ? 73 LYS A N    5  
ATOM 5923  C CA   . LYS A 1 73 ? 4.046   -2.820  -8.480  1.00 0.00 ? 73 LYS A CA   5  
ATOM 5924  C C    . LYS A 1 73 ? 4.733   -1.773  -7.608  1.00 0.00 ? 73 LYS A C    5  
ATOM 5925  O O    . LYS A 1 73 ? 5.021   -0.666  -8.061  1.00 0.00 ? 73 LYS A O    5  
ATOM 5926  C CB   . LYS A 1 73 ? 2.529   -2.633  -8.421  1.00 0.00 ? 73 LYS A CB   5  
ATOM 5927  C CG   . LYS A 1 73 ? 1.809   -3.111  -9.672  1.00 0.00 ? 73 LYS A CG   5  
ATOM 5928  C CD   . LYS A 1 73 ? 1.716   -2.010  -10.716 1.00 0.00 ? 73 LYS A CD   5  
ATOM 5929  C CE   . LYS A 1 73 ? 1.934   -2.552  -12.118 1.00 0.00 ? 73 LYS A CE   5  
ATOM 5930  N NZ   . LYS A 1 73 ? 2.102   -1.460  -13.117 1.00 0.00 ? 73 LYS A NZ   5  
ATOM 5931  H H    . LYS A 1 73 ? 3.762   -4.697  -7.544  1.00 0.00 ? 73 LYS A H    5  
ATOM 5932  H HA   . LYS A 1 73 ? 4.376   -2.693  -9.500  1.00 0.00 ? 73 LYS A HA   5  
ATOM 5933  H HB2  . LYS A 1 73 ? 2.143   -3.185  -7.576  1.00 0.00 ? 73 LYS A HB2  5  
ATOM 5934  H HB3  . LYS A 1 73 ? 2.312   -1.585  -8.284  1.00 0.00 ? 73 LYS A HB3  5  
ATOM 5935  H HG2  . LYS A 1 73 ? 2.350   -3.946  -10.090 1.00 0.00 ? 73 LYS A HG2  5  
ATOM 5936  H HG3  . LYS A 1 73 ? 0.811   -3.425  -9.402  1.00 0.00 ? 73 LYS A HG3  5  
ATOM 5937  H HD2  . LYS A 1 73 ? 0.736   -1.559  -10.663 1.00 0.00 ? 73 LYS A HD2  5  
ATOM 5938  H HD3  . LYS A 1 73 ? 2.469   -1.264  -10.506 1.00 0.00 ? 73 LYS A HD3  5  
ATOM 5939  H HE2  . LYS A 1 73 ? 2.822   -3.167  -12.119 1.00 0.00 ? 73 LYS A HE2  5  
ATOM 5940  H HE3  . LYS A 1 73 ? 1.080   -3.153  -12.395 1.00 0.00 ? 73 LYS A HE3  5  
ATOM 5941  H HZ1  . LYS A 1 73 ? 2.330   -1.860  -14.049 1.00 0.00 ? 73 LYS A HZ1  5  
ATOM 5942  H HZ2  . LYS A 1 73 ? 2.871   -0.825  -12.826 1.00 0.00 ? 73 LYS A HZ2  5  
ATOM 5943  H HZ3  . LYS A 1 73 ? 1.223   -0.908  -13.194 1.00 0.00 ? 73 LYS A HZ3  5  
ATOM 5944  N N    . VAL A 1 74 ? 4.990   -2.129  -6.354  1.00 0.00 ? 74 VAL A N    5  
ATOM 5945  C CA   . VAL A 1 74 ? 5.641   -1.220  -5.420  1.00 0.00 ? 74 VAL A CA   5  
ATOM 5946  C C    . VAL A 1 74 ? 7.073   -0.920  -5.854  1.00 0.00 ? 74 VAL A C    5  
ATOM 5947  O O    . VAL A 1 74 ? 7.753   -1.778  -6.416  1.00 0.00 ? 74 VAL A O    5  
ATOM 5948  C CB   . VAL A 1 74 ? 5.661   -1.797  -3.991  1.00 0.00 ? 74 VAL A CB   5  
ATOM 5949  C CG1  . VAL A 1 74 ? 6.196   -0.769  -3.005  1.00 0.00 ? 74 VAL A CG1  5  
ATOM 5950  C CG2  . VAL A 1 74 ? 4.270   -2.263  -3.582  1.00 0.00 ? 74 VAL A CG2  5  
ATOM 5951  H H    . VAL A 1 74 ? 4.736   -3.026  -6.049  1.00 0.00 ? 74 VAL A H    5  
ATOM 5952  H HA   . VAL A 1 74 ? 5.080   -0.297  -5.406  1.00 0.00 ? 74 VAL A HA   5  
ATOM 5953  H HB   . VAL A 1 74 ? 6.322   -2.651  -3.978  1.00 0.00 ? 74 VAL A HB   5  
ATOM 5954  H HG11 . VAL A 1 74 ? 7.159   -0.413  -3.342  1.00 0.00 ? 74 VAL A HG11 5  
ATOM 5955  H HG12 . VAL A 1 74 ? 6.302   -1.225  -2.032  1.00 0.00 ? 74 VAL A HG12 5  
ATOM 5956  H HG13 . VAL A 1 74 ? 5.508   0.061   -2.942  1.00 0.00 ? 74 VAL A HG13 5  
ATOM 5957  H HG21 . VAL A 1 74 ? 3.656   -2.380  -4.462  1.00 0.00 ? 74 VAL A HG21 5  
ATOM 5958  H HG22 . VAL A 1 74 ? 3.823   -1.531  -2.926  1.00 0.00 ? 74 VAL A HG22 5  
ATOM 5959  H HG23 . VAL A 1 74 ? 4.345   -3.209  -3.067  1.00 0.00 ? 74 VAL A HG23 5  
ATOM 5960  N N    . ILE A 1 75 ? 7.523   0.302   -5.590  1.00 0.00 ? 75 ILE A N    5  
ATOM 5961  C CA   . ILE A 1 75 ? 8.872   0.714   -5.954  1.00 0.00 ? 75 ILE A CA   5  
ATOM 5962  C C    . ILE A 1 75 ? 9.556   1.436   -4.799  1.00 0.00 ? 75 ILE A C    5  
ATOM 5963  O O    . ILE A 1 75 ? 9.098   2.487   -4.351  1.00 0.00 ? 75 ILE A O    5  
ATOM 5964  C CB   . ILE A 1 75 ? 8.865   1.637   -7.188  1.00 0.00 ? 75 ILE A CB   5  
ATOM 5965  C CG1  . ILE A 1 75 ? 8.013   1.028   -8.304  1.00 0.00 ? 75 ILE A CG1  5  
ATOM 5966  C CG2  . ILE A 1 75 ? 10.285  1.883   -7.674  1.00 0.00 ? 75 ILE A CG2  5  
ATOM 5967  C CD1  . ILE A 1 75 ? 7.812   1.953   -9.484  1.00 0.00 ? 75 ILE A CD1  5  
ATOM 5968  H H    . ILE A 1 75 ? 6.932   0.942   -5.140  1.00 0.00 ? 75 ILE A H    5  
ATOM 5969  H HA   . ILE A 1 75 ? 9.438   -0.173  -6.198  1.00 0.00 ? 75 ILE A HA   5  
ATOM 5970  H HB   . ILE A 1 75 ? 8.441   2.586   -6.898  1.00 0.00 ? 75 ILE A HB   5  
ATOM 5971  H HG12 . ILE A 1 75 ? 8.492   0.130   -8.664  1.00 0.00 ? 75 ILE A HG12 5  
ATOM 5972  H HG13 . ILE A 1 75 ? 7.040   0.777   -7.908  1.00 0.00 ? 75 ILE A HG13 5  
ATOM 5973  H HG21 . ILE A 1 75 ? 10.656  2.805   -7.248  1.00 0.00 ? 75 ILE A HG21 5  
ATOM 5974  H HG22 . ILE A 1 75 ? 10.290  1.956   -8.751  1.00 0.00 ? 75 ILE A HG22 5  
ATOM 5975  H HG23 . ILE A 1 75 ? 10.918  1.064   -7.366  1.00 0.00 ? 75 ILE A HG23 5  
ATOM 5976  H HD11 . ILE A 1 75 ? 8.735   2.033   -10.040 1.00 0.00 ? 75 ILE A HD11 5  
ATOM 5977  H HD12 . ILE A 1 75 ? 7.518   2.930   -9.130  1.00 0.00 ? 75 ILE A HD12 5  
ATOM 5978  H HD13 . ILE A 1 75 ? 7.039   1.555   -10.126 1.00 0.00 ? 75 ILE A HD13 5  
ATOM 5979  N N    . ARG A 1 76 ? 10.658  0.865   -4.320  1.00 0.00 ? 76 ARG A N    5  
ATOM 5980  C CA   . ARG A 1 76 ? 11.406  1.454   -3.216  1.00 0.00 ? 76 ARG A CA   5  
ATOM 5981  C C    . ARG A 1 76 ? 11.989  2.806   -3.614  1.00 0.00 ? 76 ARG A C    5  
ATOM 5982  O O    . ARG A 1 76 ? 12.604  2.941   -4.672  1.00 0.00 ? 76 ARG A O    5  
ATOM 5983  C CB   . ARG A 1 76 ? 12.526  0.511   -2.772  1.00 0.00 ? 76 ARG A CB   5  
ATOM 5984  C CG   . ARG A 1 76 ? 12.696  0.435   -1.264  1.00 0.00 ? 76 ARG A CG   5  
ATOM 5985  C CD   . ARG A 1 76 ? 13.416  -0.838  -0.848  1.00 0.00 ? 76 ARG A CD   5  
ATOM 5986  N NE   . ARG A 1 76 ? 13.920  -0.762  0.521   1.00 0.00 ? 76 ARG A NE   5  
ATOM 5987  C CZ   . ARG A 1 76 ? 14.548  -1.761  1.138   1.00 0.00 ? 76 ARG A CZ   5  
ATOM 5988  N NH1  . ARG A 1 76 ? 14.751  -2.913  0.511   1.00 0.00 ? 76 ARG A NH1  5  
ATOM 5989  N NH2  . ARG A 1 76 ? 14.973  -1.608  2.384   1.00 0.00 ? 76 ARG A NH2  5  
ATOM 5990  H H    . ARG A 1 76 ? 10.973  0.027   -4.719  1.00 0.00 ? 76 ARG A H    5  
ATOM 5991  H HA   . ARG A 1 76 ? 10.723  1.599   -2.392  1.00 0.00 ? 76 ARG A HA   5  
ATOM 5992  H HB2  . ARG A 1 76 ? 12.312  -0.481  -3.139  1.00 0.00 ? 76 ARG A HB2  5  
ATOM 5993  H HB3  . ARG A 1 76 ? 13.459  0.850   -3.200  1.00 0.00 ? 76 ARG A HB3  5  
ATOM 5994  H HG2  . ARG A 1 76 ? 13.271  1.286   -0.931  1.00 0.00 ? 76 ARG A HG2  5  
ATOM 5995  H HG3  . ARG A 1 76 ? 11.720  0.454   -0.799  1.00 0.00 ? 76 ARG A HG3  5  
ATOM 5996  H HD2  . ARG A 1 76 ? 12.728  -1.667  -0.922  1.00 0.00 ? 76 ARG A HD2  5  
ATOM 5997  H HD3  . ARG A 1 76 ? 14.248  -1.001  -1.519  1.00 0.00 ? 76 ARG A HD3  5  
ATOM 5998  H HE   . ARG A 1 76 ? 13.783  0.078   1.008   1.00 0.00 ? 76 ARG A HE   5  
ATOM 5999  H HH11 . ARG A 1 76 ? 14.432  -3.036  -0.429  1.00 0.00 ? 76 ARG A HH11 5  
ATOM 6000  H HH12 . ARG A 1 76 ? 15.222  -3.661  0.979   1.00 0.00 ? 76 ARG A HH12 5  
ATOM 6001  H HH21 . ARG A 1 76 ? 14.823  -0.743  2.860   1.00 0.00 ? 76 ARG A HH21 5  
ATOM 6002  H HH22 . ARG A 1 76 ? 15.445  -2.359  2.847   1.00 0.00 ? 76 ARG A HH22 5  
ATOM 6003  N N    . ILE A 1 77 ? 11.793  3.805   -2.760  1.00 0.00 ? 77 ILE A N    5  
ATOM 6004  C CA   . ILE A 1 77 ? 12.299  5.147   -3.022  1.00 0.00 ? 77 ILE A CA   5  
ATOM 6005  C C    . ILE A 1 77 ? 12.851  5.784   -1.752  1.00 0.00 ? 77 ILE A C    5  
ATOM 6006  O O    . ILE A 1 77 ? 12.807  7.004   -1.588  1.00 0.00 ? 77 ILE A O    5  
ATOM 6007  C CB   . ILE A 1 77 ? 11.204  6.057   -3.605  1.00 0.00 ? 77 ILE A CB   5  
ATOM 6008  C CG1  . ILE A 1 77 ? 9.926   5.956   -2.769  1.00 0.00 ? 77 ILE A CG1  5  
ATOM 6009  C CG2  . ILE A 1 77 ? 10.924  5.691   -5.055  1.00 0.00 ? 77 ILE A CG2  5  
ATOM 6010  C CD1  . ILE A 1 77 ? 9.228   7.284   -2.570  1.00 0.00 ? 77 ILE A CD1  5  
ATOM 6011  H H    . ILE A 1 77 ? 11.296  3.636   -1.932  1.00 0.00 ? 77 ILE A H    5  
ATOM 6012  H HA   . ILE A 1 77 ? 13.095  5.066   -3.748  1.00 0.00 ? 77 ILE A HA   5  
ATOM 6013  H HB   . ILE A 1 77 ? 11.561  7.076   -3.581  1.00 0.00 ? 77 ILE A HB   5  
ATOM 6014  H HG12 . ILE A 1 77 ? 9.233   5.289   -3.260  1.00 0.00 ? 77 ILE A HG12 5  
ATOM 6015  H HG13 . ILE A 1 77 ? 10.172  5.560   -1.795  1.00 0.00 ? 77 ILE A HG13 5  
ATOM 6016  H HG21 . ILE A 1 77 ? 11.822  5.828   -5.640  1.00 0.00 ? 77 ILE A HG21 5  
ATOM 6017  H HG22 . ILE A 1 77 ? 10.141  6.325   -5.444  1.00 0.00 ? 77 ILE A HG22 5  
ATOM 6018  H HG23 . ILE A 1 77 ? 10.611  4.658   -5.112  1.00 0.00 ? 77 ILE A HG23 5  
ATOM 6019  H HD11 . ILE A 1 77 ? 8.892   7.661   -3.525  1.00 0.00 ? 77 ILE A HD11 5  
ATOM 6020  H HD12 . ILE A 1 77 ? 9.915   7.989   -2.126  1.00 0.00 ? 77 ILE A HD12 5  
ATOM 6021  H HD13 . ILE A 1 77 ? 8.377   7.149   -1.917  1.00 0.00 ? 77 ILE A HD13 5  
ATOM 6022  N N    . GLY A 1 78 ? 13.371  4.952   -0.856  1.00 0.00 ? 78 GLY A N    5  
ATOM 6023  C CA   . GLY A 1 78 ? 13.925  5.452   0.389   1.00 0.00 ? 78 GLY A CA   5  
ATOM 6024  C C    . GLY A 1 78 ? 15.439  5.503   0.371   1.00 0.00 ? 78 GLY A C    5  
ATOM 6025  O O    . GLY A 1 78 ? 16.095  4.950   1.253   1.00 0.00 ? 78 GLY A O    5  
ATOM 6026  H H    . GLY A 1 78 ? 13.379  3.989   -1.041  1.00 0.00 ? 78 GLY A H    5  
ATOM 6027  H HA2  . GLY A 1 78 ? 13.543  6.448   0.564   1.00 0.00 ? 78 GLY A HA2  5  
ATOM 6028  H HA3  . GLY A 1 78 ? 13.606  4.810   1.196   1.00 0.00 ? 78 GLY A HA3  5  
ATOM 6029  N N    . SER A 1 79 ? 15.996  6.169   -0.636  1.00 0.00 ? 79 SER A N    5  
ATOM 6030  C CA   . SER A 1 79 ? 17.443  6.289   -0.764  1.00 0.00 ? 79 SER A CA   5  
ATOM 6031  C C    . SER A 1 79 ? 17.852  7.742   -0.994  1.00 0.00 ? 79 SER A C    5  
ATOM 6032  O O    . SER A 1 79 ? 17.025  8.578   -1.361  1.00 0.00 ? 79 SER A O    5  
ATOM 6033  C CB   . SER A 1 79 ? 17.948  5.415   -1.914  1.00 0.00 ? 79 SER A CB   5  
ATOM 6034  O OG   . SER A 1 79 ? 19.000  4.567   -1.485  1.00 0.00 ? 79 SER A OG   5  
ATOM 6035  H H    . SER A 1 79 ? 15.420  6.590   -1.307  1.00 0.00 ? 79 SER A H    5  
ATOM 6036  H HA   . SER A 1 79 ? 17.888  5.947   0.159   1.00 0.00 ? 79 SER A HA   5  
ATOM 6037  H HB2  . SER A 1 79 ? 17.137  4.803   -2.280  1.00 0.00 ? 79 SER A HB2  5  
ATOM 6038  H HB3  . SER A 1 79 ? 18.312  6.044   -2.712  1.00 0.00 ? 79 SER A HB3  5  
ATOM 6039  H HG   . SER A 1 79 ? 18.968  3.742   -1.977  1.00 0.00 ? 79 SER A HG   5  
ATOM 6040  N N    . GLY A 1 80 ? 19.129  8.035   -0.775  1.00 0.00 ? 80 GLY A N    5  
ATOM 6041  C CA   . GLY A 1 80 ? 19.622  9.387   -0.965  1.00 0.00 ? 80 GLY A CA   5  
ATOM 6042  C C    . GLY A 1 80 ? 21.128  9.436   -1.146  1.00 0.00 ? 80 GLY A C    5  
ATOM 6043  O O    . GLY A 1 80 ? 21.623  9.321   -2.267  1.00 0.00 ? 80 GLY A O    5  
ATOM 6044  H H    . GLY A 1 80 ? 19.742  7.328   -0.484  1.00 0.00 ? 80 GLY A H    5  
ATOM 6045  H HA2  . GLY A 1 80 ? 19.152  9.810   -1.840  1.00 0.00 ? 80 GLY A HA2  5  
ATOM 6046  H HA3  . GLY A 1 80 ? 19.354  9.980   -0.103  1.00 0.00 ? 80 GLY A HA3  5  
ATOM 6047  N N    . PRO A 1 81 ? 21.890  9.607   -0.052  1.00 0.00 ? 81 PRO A N    5  
ATOM 6048  C CA   . PRO A 1 81 ? 23.354  9.669   -0.110  1.00 0.00 ? 81 PRO A CA   5  
ATOM 6049  C C    . PRO A 1 81 ? 23.954  8.474   -0.843  1.00 0.00 ? 81 PRO A C    5  
ATOM 6050  O O    . PRO A 1 81 ? 25.005  8.583   -1.473  1.00 0.00 ? 81 PRO A O    5  
ATOM 6051  C CB   . PRO A 1 81 ? 23.772  9.660   1.362   1.00 0.00 ? 81 PRO A CB   5  
ATOM 6052  C CG   . PRO A 1 81 ? 22.595  10.205  2.094   1.00 0.00 ? 81 PRO A CG   5  
ATOM 6053  C CD   . PRO A 1 81 ? 21.385  9.752   1.326   1.00 0.00 ? 81 PRO A CD   5  
ATOM 6054  H HA   . PRO A 1 81 ? 23.692  10.582  -0.579  1.00 0.00 ? 81 PRO A HA   5  
ATOM 6055  H HB2  . PRO A 1 81 ? 23.996  8.649   1.669   1.00 0.00 ? 81 PRO A HB2  5  
ATOM 6056  H HB3  . PRO A 1 81 ? 24.643  10.285  1.495   1.00 0.00 ? 81 PRO A HB3  5  
ATOM 6057  H HG2  . PRO A 1 81 ? 22.573  9.809   3.098   1.00 0.00 ? 81 PRO A HG2  5  
ATOM 6058  H HG3  . PRO A 1 81 ? 22.644  11.284  2.115   1.00 0.00 ? 81 PRO A HG3  5  
ATOM 6059  H HD2  . PRO A 1 81 ? 21.027  8.808   1.708   1.00 0.00 ? 81 PRO A HD2  5  
ATOM 6060  H HD3  . PRO A 1 81 ? 20.606  10.500  1.374   1.00 0.00 ? 81 PRO A HD3  5  
ATOM 6061  N N    . SER A 1 82 ? 23.279  7.331   -0.753  1.00 0.00 ? 82 SER A N    5  
ATOM 6062  C CA   . SER A 1 82 ? 23.745  6.115   -1.407  1.00 0.00 ? 82 SER A CA   5  
ATOM 6063  C C    . SER A 1 82 ? 23.007  5.888   -2.723  1.00 0.00 ? 82 SER A C    5  
ATOM 6064  O O    . SER A 1 82 ? 22.730  4.750   -3.102  1.00 0.00 ? 82 SER A O    5  
ATOM 6065  C CB   . SER A 1 82 ? 23.552  4.909   -0.486  1.00 0.00 ? 82 SER A CB   5  
ATOM 6066  O OG   . SER A 1 82 ? 24.544  4.876   0.526   1.00 0.00 ? 82 SER A OG   5  
ATOM 6067  H H    . SER A 1 82 ? 22.447  7.308   -0.236  1.00 0.00 ? 82 SER A H    5  
ATOM 6068  H HA   . SER A 1 82 ? 24.798  6.234   -1.616  1.00 0.00 ? 82 SER A HA   5  
ATOM 6069  H HB2  . SER A 1 82 ? 22.581  4.967   -0.018  1.00 0.00 ? 82 SER A HB2  5  
ATOM 6070  H HB3  . SER A 1 82 ? 23.619  4.001   -1.067  1.00 0.00 ? 82 SER A HB3  5  
ATOM 6071  H HG   . SER A 1 82 ? 24.342  5.536   1.194   1.00 0.00 ? 82 SER A HG   5  
ATOM 6072  N N    . SER A 1 83 ? 22.689  6.978   -3.413  1.00 0.00 ? 83 SER A N    5  
ATOM 6073  C CA   . SER A 1 83 ? 21.982  6.898   -4.686  1.00 0.00 ? 83 SER A CA   5  
ATOM 6074  C C    . SER A 1 83 ? 22.860  7.397   -5.829  1.00 0.00 ? 83 SER A C    5  
ATOM 6075  O O    . SER A 1 83 ? 23.219  6.635   -6.727  1.00 0.00 ? 83 SER A O    5  
ATOM 6076  C CB   . SER A 1 83 ? 20.690  7.716   -4.628  1.00 0.00 ? 83 SER A CB   5  
ATOM 6077  O OG   . SER A 1 83 ? 19.807  7.350   -5.674  1.00 0.00 ? 83 SER A OG   5  
ATOM 6078  H H    . SER A 1 83 ? 22.936  7.858   -3.057  1.00 0.00 ? 83 SER A H    5  
ATOM 6079  H HA   . SER A 1 83 ? 21.735  5.863   -4.864  1.00 0.00 ? 83 SER A HA   5  
ATOM 6080  H HB2  . SER A 1 83 ? 20.199  7.542   -3.682  1.00 0.00 ? 83 SER A HB2  5  
ATOM 6081  H HB3  . SER A 1 83 ? 20.926  8.766   -4.722  1.00 0.00 ? 83 SER A HB3  5  
ATOM 6082  H HG   . SER A 1 83 ? 20.298  7.273   -6.496  1.00 0.00 ? 83 SER A HG   5  
ATOM 6083  N N    . GLY A 1 84 ? 23.203  8.680   -5.789  1.00 0.00 ? 84 GLY A N    5  
ATOM 6084  C CA   . GLY A 1 84 ? 24.036  9.258   -6.826  1.00 0.00 ? 84 GLY A CA   5  
ATOM 6085  C C    . GLY A 1 84 ? 23.346  9.286   -8.177  1.00 0.00 ? 84 GLY A C    5  
ATOM 6086  O O    . GLY A 1 84 ? 24.054  9.332   -9.205  1.00 0.00 ? 84 GLY A O    5  
ATOM 6087  O OXT  . GLY A 1 84 ? 22.098  9.260   -8.205  1.00 0.00 ? 84 GLY A OXT  5  
ATOM 6088  H H    . GLY A 1 84 ? 22.886  9.240   -5.050  1.00 0.00 ? 84 GLY A H    5  
ATOM 6089  H HA2  . GLY A 1 84 ? 24.293  10.269  -6.546  1.00 0.00 ? 84 GLY A HA2  5  
ATOM 6090  H HA3  . GLY A 1 84 ? 24.943  8.677   -6.911  1.00 0.00 ? 84 GLY A HA3  5  
ATOM 6091  N N    . GLY A 1 1  ? 3.345   -13.921 10.759  1.00 0.00 ? 1  GLY A N    6  
ATOM 6092  C CA   . GLY A 1 1  ? 3.569   -13.925 12.230  1.00 0.00 ? 1  GLY A CA   6  
ATOM 6093  C C    . GLY A 1 1  ? 4.007   -12.572 12.754  1.00 0.00 ? 1  GLY A C    6  
ATOM 6094  O O    . GLY A 1 1  ? 3.271   -11.590 12.651  1.00 0.00 ? 1  GLY A O    6  
ATOM 6095  H H1   . GLY A 1 1  ? 3.101   -14.878 10.431  1.00 0.00 ? 1  GLY A H1   6  
ATOM 6096  H H2   . GLY A 1 1  ? 4.205   -13.607 10.266  1.00 0.00 ? 1  GLY A H2   6  
ATOM 6097  H H3   . GLY A 1 1  ? 2.566   -13.275 10.518  1.00 0.00 ? 1  GLY A H3   6  
ATOM 6098  H HA2  . GLY A 1 1  ? 2.651   -14.209 12.722  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 6099  H HA3  . GLY A 1 1  ? 4.331   -14.653 12.465  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 6100  N N    . SER A 1 2  ? 5.210   -12.520 13.318  1.00 0.00 ? 2  SER A N    6  
ATOM 6101  C CA   . SER A 1 2  ? 5.747   -11.276 13.860  1.00 0.00 ? 2  SER A CA   6  
ATOM 6102  C C    . SER A 1 2  ? 7.082   -10.931 13.209  1.00 0.00 ? 2  SER A C    6  
ATOM 6103  O O    . SER A 1 2  ? 7.330   -9.779  12.851  1.00 0.00 ? 2  SER A O    6  
ATOM 6104  C CB   . SER A 1 2  ? 5.919   -11.389 15.376  1.00 0.00 ? 2  SER A CB   6  
ATOM 6105  O OG   . SER A 1 2  ? 4.667   -11.555 16.021  1.00 0.00 ? 2  SER A OG   6  
ATOM 6106  H H    . SER A 1 2  ? 5.750   -13.335 13.370  1.00 0.00 ? 2  SER A H    6  
ATOM 6107  H HA   . SER A 1 2  ? 5.041   -10.488 13.644  1.00 0.00 ? 2  SER A HA   6  
ATOM 6108  H HB2  . SER A 1 2  ? 6.542   -12.241 15.603  1.00 0.00 ? 2  SER A HB2  6  
ATOM 6109  H HB3  . SER A 1 2  ? 6.386   -10.491 15.751  1.00 0.00 ? 2  SER A HB3  6  
ATOM 6110  H HG   . SER A 1 2  ? 4.700   -12.328 16.590  1.00 0.00 ? 2  SER A HG   6  
ATOM 6111  N N    . SER A 1 3  ? 7.939   -11.935 13.061  1.00 0.00 ? 3  SER A N    6  
ATOM 6112  C CA   . SER A 1 3  ? 9.249   -11.738 12.452  1.00 0.00 ? 3  SER A CA   6  
ATOM 6113  C C    . SER A 1 3  ? 9.251   -12.202 10.999  1.00 0.00 ? 3  SER A C    6  
ATOM 6114  O O    . SER A 1 3  ? 8.613   -13.197 10.654  1.00 0.00 ? 3  SER A O    6  
ATOM 6115  C CB   . SER A 1 3  ? 10.320  -12.492 13.242  1.00 0.00 ? 3  SER A CB   6  
ATOM 6116  O OG   . SER A 1 3  ? 10.068  -13.888 13.239  1.00 0.00 ? 3  SER A OG   6  
ATOM 6117  H H    . SER A 1 3  ? 7.685   -12.831 13.366  1.00 0.00 ? 3  SER A H    6  
ATOM 6118  H HA   . SER A 1 3  ? 9.472   -10.681 12.480  1.00 0.00 ? 3  SER A HA   6  
ATOM 6119  H HB2  . SER A 1 3  ? 11.287  -12.314 12.796  1.00 0.00 ? 3  SER A HB2  6  
ATOM 6120  H HB3  . SER A 1 3  ? 10.324  -12.142 14.264  1.00 0.00 ? 3  SER A HB3  6  
ATOM 6121  H HG   . SER A 1 3  ? 10.157  -14.230 14.131  1.00 0.00 ? 3  SER A HG   6  
ATOM 6122  N N    . GLY A 1 4  ? 9.971   -11.474 10.151  1.00 0.00 ? 4  GLY A N    6  
ATOM 6123  C CA   . GLY A 1 4  ? 10.041  -11.828 8.746   1.00 0.00 ? 4  GLY A CA   6  
ATOM 6124  C C    . GLY A 1 4  ? 10.868  -10.844 7.941   1.00 0.00 ? 4  GLY A C    6  
ATOM 6125  O O    . GLY A 1 4  ? 11.474  -9.929  8.499   1.00 0.00 ? 4  GLY A O    6  
ATOM 6126  H H    . GLY A 1 4  ? 10.459  -10.692 10.483  1.00 0.00 ? 4  GLY A H    6  
ATOM 6127  H HA2  . GLY A 1 4  ? 10.480  -12.810 8.655   1.00 0.00 ? 4  GLY A HA2  6  
ATOM 6128  H HA3  . GLY A 1 4  ? 9.040   -11.854 8.342   1.00 0.00 ? 4  GLY A HA3  6  
ATOM 6129  N N    . SER A 1 5  ? 10.894  -11.035 6.626   1.00 0.00 ? 5  SER A N    6  
ATOM 6130  C CA   . SER A 1 5  ? 11.653  -10.157 5.742   1.00 0.00 ? 5  SER A CA   6  
ATOM 6131  C C    . SER A 1 5  ? 10.902  -9.917  4.437   1.00 0.00 ? 5  SER A C    6  
ATOM 6132  O O    . SER A 1 5  ? 10.451  -8.805  4.166   1.00 0.00 ? 5  SER A O    6  
ATOM 6133  C CB   . SER A 1 5  ? 13.029  -10.761 5.448   1.00 0.00 ? 5  SER A CB   6  
ATOM 6134  O OG   . SER A 1 5  ? 14.014  -9.750  5.326   1.00 0.00 ? 5  SER A OG   6  
ATOM 6135  H H    . SER A 1 5  ? 10.392  -11.782 6.241   1.00 0.00 ? 5  SER A H    6  
ATOM 6136  H HA   . SER A 1 5  ? 11.786  -9.212  6.247   1.00 0.00 ? 5  SER A HA   6  
ATOM 6137  H HB2  . SER A 1 5  ? 13.309  -11.423 6.254   1.00 0.00 ? 5  SER A HB2  6  
ATOM 6138  H HB3  . SER A 1 5  ? 12.985  -11.318 4.524   1.00 0.00 ? 5  SER A HB3  6  
ATOM 6139  H HG   . SER A 1 5  ? 14.459  -9.837  4.479   1.00 0.00 ? 5  SER A HG   6  
ATOM 6140  N N    . SER A 1 6  ? 10.771  -10.969 3.634   1.00 0.00 ? 6  SER A N    6  
ATOM 6141  C CA   . SER A 1 6  ? 10.074  -10.877 2.354   1.00 0.00 ? 6  SER A CA   6  
ATOM 6142  C C    . SER A 1 6  ? 10.787  -9.913  1.409   1.00 0.00 ? 6  SER A C    6  
ATOM 6143  O O    . SER A 1 6  ? 11.525  -10.335 0.519   1.00 0.00 ? 6  SER A O    6  
ATOM 6144  C CB   . SER A 1 6  ? 8.625   -10.431 2.566   1.00 0.00 ? 6  SER A CB   6  
ATOM 6145  O OG   . SER A 1 6  ? 7.874   -11.436 3.223   1.00 0.00 ? 6  SER A OG   6  
ATOM 6146  H H    . SER A 1 6  ? 11.154  -11.828 3.906   1.00 0.00 ? 6  SER A H    6  
ATOM 6147  H HA   . SER A 1 6  ? 10.075  -11.861 1.908   1.00 0.00 ? 6  SER A HA   6  
ATOM 6148  H HB2  . SER A 1 6  ? 8.610   -9.536  3.169   1.00 0.00 ? 6  SER A HB2  6  
ATOM 6149  H HB3  . SER A 1 6  ? 8.170   -10.228 1.608   1.00 0.00 ? 6  SER A HB3  6  
ATOM 6150  H HG   . SER A 1 6  ? 7.526   -11.089 4.048   1.00 0.00 ? 6  SER A HG   6  
ATOM 6151  N N    . GLY A 1 7  ? 10.563  -8.617  1.608   1.00 0.00 ? 7  GLY A N    6  
ATOM 6152  C CA   . GLY A 1 7  ? 11.192  -7.618  0.765   1.00 0.00 ? 7  GLY A CA   6  
ATOM 6153  C C    . GLY A 1 7  ? 11.052  -6.216  1.322   1.00 0.00 ? 7  GLY A C    6  
ATOM 6154  O O    . GLY A 1 7  ? 12.049  -5.549  1.600   1.00 0.00 ? 7  GLY A O    6  
ATOM 6155  H H    . GLY A 1 7  ? 9.965   -8.338  2.332   1.00 0.00 ? 7  GLY A H    6  
ATOM 6156  H HA2  . GLY A 1 7  ? 12.242  -7.854  0.670   1.00 0.00 ? 7  GLY A HA2  6  
ATOM 6157  H HA3  . GLY A 1 7  ? 10.738  -7.652  -0.215  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 6158  N N    . LEU A 1 8  ? 9.813   -5.766  1.484   1.00 0.00 ? 8  LEU A N    6  
ATOM 6159  C CA   . LEU A 1 8  ? 9.546   -4.433  2.012   1.00 0.00 ? 8  LEU A CA   6  
ATOM 6160  C C    . LEU A 1 8  ? 9.128   -4.502  3.478   1.00 0.00 ? 8  LEU A C    6  
ATOM 6161  O O    . LEU A 1 8  ? 8.159   -5.175  3.827   1.00 0.00 ? 8  LEU A O    6  
ATOM 6162  C CB   . LEU A 1 8  ? 8.454   -3.746  1.189   1.00 0.00 ? 8  LEU A CB   6  
ATOM 6163  C CG   . LEU A 1 8  ? 8.723   -3.682  -0.316  1.00 0.00 ? 8  LEU A CG   6  
ATOM 6164  C CD1  . LEU A 1 8  ? 7.423   -3.806  -1.096  1.00 0.00 ? 8  LEU A CD1  6  
ATOM 6165  C CD2  . LEU A 1 8  ? 9.440   -2.390  -0.673  1.00 0.00 ? 8  LEU A CD2  6  
ATOM 6166  H H    . LEU A 1 8  ? 9.059   -6.345  1.244   1.00 0.00 ? 8  LEU A H    6  
ATOM 6167  H HA   . LEU A 1 8  ? 10.457  -3.859  1.936   1.00 0.00 ? 8  LEU A HA   6  
ATOM 6168  H HB2  . LEU A 1 8  ? 7.527   -4.276  1.347   1.00 0.00 ? 8  LEU A HB2  6  
ATOM 6169  H HB3  . LEU A 1 8  ? 8.340   -2.736  1.554   1.00 0.00 ? 8  LEU A HB3  6  
ATOM 6170  H HG   . LEU A 1 8  ? 9.360   -4.509  -0.596  1.00 0.00 ? 8  LEU A HG   6  
ATOM 6171  H HD11 . LEU A 1 8  ? 7.060   -2.822  -1.350  1.00 0.00 ? 8  LEU A HD11 6  
ATOM 6172  H HD12 . LEU A 1 8  ? 6.688   -4.317  -0.492  1.00 0.00 ? 8  LEU A HD12 6  
ATOM 6173  H HD13 . LEU A 1 8  ? 7.598   -4.369  -2.000  1.00 0.00 ? 8  LEU A HD13 6  
ATOM 6174  H HD21 . LEU A 1 8  ? 9.113   -1.601  -0.013  1.00 0.00 ? 8  LEU A HD21 6  
ATOM 6175  H HD22 . LEU A 1 8  ? 9.210   -2.122  -1.695  1.00 0.00 ? 8  LEU A HD22 6  
ATOM 6176  H HD23 . LEU A 1 8  ? 10.506  -2.530  -0.569  1.00 0.00 ? 8  LEU A HD23 6  
ATOM 6177  N N    . ARG A 1 9  ? 9.868   -3.800  4.331   1.00 0.00 ? 9  ARG A N    6  
ATOM 6178  C CA   . ARG A 1 9  ? 9.576   -3.781  5.759   1.00 0.00 ? 9  ARG A CA   6  
ATOM 6179  C C    . ARG A 1 9  ? 8.545   -2.707  6.091   1.00 0.00 ? 9  ARG A C    6  
ATOM 6180  O O    . ARG A 1 9  ? 8.368   -1.749  5.339   1.00 0.00 ? 9  ARG A O    6  
ATOM 6181  C CB   . ARG A 1 9  ? 10.858  -3.536  6.559   1.00 0.00 ? 9  ARG A CB   6  
ATOM 6182  C CG   . ARG A 1 9  ? 11.850  -4.686  6.483   1.00 0.00 ? 9  ARG A CG   6  
ATOM 6183  C CD   . ARG A 1 9  ? 13.212  -4.285  7.029   1.00 0.00 ? 9  ARG A CD   6  
ATOM 6184  N NE   . ARG A 1 9  ? 14.179  -4.041  5.962   1.00 0.00 ? 9  ARG A NE   6  
ATOM 6185  C CZ   . ARG A 1 9  ? 15.497  -4.026  6.146   1.00 0.00 ? 9  ARG A CZ   6  
ATOM 6186  N NH1  . ARG A 1 9  ? 16.009  -4.240  7.352   1.00 0.00 ? 9  ARG A NH1  6  
ATOM 6187  N NH2  . ARG A 1 9  ? 16.306  -3.797  5.121   1.00 0.00 ? 9  ARG A NH2  6  
ATOM 6188  H H    . ARG A 1 9  ? 10.629  -3.283  3.992   1.00 0.00 ? 9  ARG A H    6  
ATOM 6189  H HA   . ARG A 1 9  ? 9.174   -4.745  6.028   1.00 0.00 ? 9  ARG A HA   6  
ATOM 6190  H HB2  . ARG A 1 9  ? 11.340  -2.647  6.181   1.00 0.00 ? 9  ARG A HB2  6  
ATOM 6191  H HB3  . ARG A 1 9  ? 10.597  -3.382  7.595   1.00 0.00 ? 9  ARG A HB3  6  
ATOM 6192  H HG2  . ARG A 1 9  ? 11.471  -5.515  7.062   1.00 0.00 ? 9  ARG A HG2  6  
ATOM 6193  H HG3  . ARG A 1 9  ? 11.960  -4.985  5.451   1.00 0.00 ? 9  ARG A HG3  6  
ATOM 6194  H HD2  . ARG A 1 9  ? 13.100  -3.384  7.614   1.00 0.00 ? 9  ARG A HD2  6  
ATOM 6195  H HD3  . ARG A 1 9  ? 13.580  -5.080  7.661   1.00 0.00 ? 9  ARG A HD3  6  
ATOM 6196  H HE   . ARG A 1 9  ? 13.828  -3.879  5.061   1.00 0.00 ? 9  ARG A HE   6  
ATOM 6197  H HH11 . ARG A 1 9  ? 15.404  -4.413  8.129   1.00 0.00 ? 9  ARG A HH11 6  
ATOM 6198  H HH12 . ARG A 1 9  ? 17.000  -4.228  7.483   1.00 0.00 ? 9  ARG A HH12 6  
ATOM 6199  H HH21 . ARG A 1 9  ? 15.927  -3.636  4.210   1.00 0.00 ? 9  ARG A HH21 6  
ATOM 6200  H HH22 . ARG A 1 9  ? 17.297  -3.785  5.259   1.00 0.00 ? 9  ARG A HH22 6  
ATOM 6201  N N    . LEU A 1 10 ? 7.867   -2.875  7.222   1.00 0.00 ? 10 LEU A N    6  
ATOM 6202  C CA   . LEU A 1 10 ? 6.852   -1.920  7.654   1.00 0.00 ? 10 LEU A CA   6  
ATOM 6203  C C    . LEU A 1 10 ? 7.485   -0.578  8.007   1.00 0.00 ? 10 LEU A C    6  
ATOM 6204  O O    . LEU A 1 10 ? 8.544   -0.524  8.632   1.00 0.00 ? 10 LEU A O    6  
ATOM 6205  C CB   . LEU A 1 10 ? 6.086   -2.469  8.860   1.00 0.00 ? 10 LEU A CB   6  
ATOM 6206  C CG   . LEU A 1 10 ? 5.327   -3.772  8.606   1.00 0.00 ? 10 LEU A CG   6  
ATOM 6207  C CD1  . LEU A 1 10 ? 4.998   -4.462  9.921   1.00 0.00 ? 10 LEU A CD1  6  
ATOM 6208  C CD2  . LEU A 1 10 ? 4.057   -3.502  7.813   1.00 0.00 ? 10 LEU A CD2  6  
ATOM 6209  H H    . LEU A 1 10 ? 8.053   -3.659  7.779   1.00 0.00 ? 10 LEU A H    6  
ATOM 6210  H HA   . LEU A 1 10 ? 6.163   -1.776  6.835   1.00 0.00 ? 10 LEU A HA   6  
ATOM 6211  H HB2  . LEU A 1 10 ? 6.791   -2.637  9.661   1.00 0.00 ? 10 LEU A HB2  6  
ATOM 6212  H HB3  . LEU A 1 10 ? 5.376   -1.721  9.178   1.00 0.00 ? 10 LEU A HB3  6  
ATOM 6213  H HG   . LEU A 1 10 ? 5.950   -4.437  8.026   1.00 0.00 ? 10 LEU A HG   6  
ATOM 6214  H HD11 . LEU A 1 10 ? 5.077   -5.532  9.795   1.00 0.00 ? 10 LEU A HD11 6  
ATOM 6215  H HD12 . LEU A 1 10 ? 3.993   -4.208  10.221  1.00 0.00 ? 10 LEU A HD12 6  
ATOM 6216  H HD13 . LEU A 1 10 ? 5.693   -4.138  10.681  1.00 0.00 ? 10 LEU A HD13 6  
ATOM 6217  H HD21 . LEU A 1 10 ? 4.312   -3.297  6.784   1.00 0.00 ? 10 LEU A HD21 6  
ATOM 6218  H HD22 . LEU A 1 10 ? 3.545   -2.649  8.233   1.00 0.00 ? 10 LEU A HD22 6  
ATOM 6219  H HD23 . LEU A 1 10 ? 3.413   -4.368  7.858   1.00 0.00 ? 10 LEU A HD23 6  
ATOM 6220  N N    . GLY A 1 11 ? 6.828   0.504   7.603   1.00 0.00 ? 11 GLY A N    6  
ATOM 6221  C CA   . GLY A 1 11 ? 7.339   1.832   7.886   1.00 0.00 ? 11 GLY A CA   6  
ATOM 6222  C C    . GLY A 1 11 ? 8.359   2.291   6.863   1.00 0.00 ? 11 GLY A C    6  
ATOM 6223  O O    . GLY A 1 11 ? 9.269   3.056   7.184   1.00 0.00 ? 11 GLY A O    6  
ATOM 6224  H H    . GLY A 1 11 ? 5.988   0.400   7.108   1.00 0.00 ? 11 GLY A H    6  
ATOM 6225  H HA2  . GLY A 1 11 ? 6.516   2.530   7.895   1.00 0.00 ? 11 GLY A HA2  6  
ATOM 6226  H HA3  . GLY A 1 11 ? 7.803   1.826   8.862   1.00 0.00 ? 11 GLY A HA3  6  
ATOM 6227  N N    . ASP A 1 12 ? 8.209   1.823   5.629   1.00 0.00 ? 12 ASP A N    6  
ATOM 6228  C CA   . ASP A 1 12 ? 9.124   2.191   4.554   1.00 0.00 ? 12 ASP A CA   6  
ATOM 6229  C C    . ASP A 1 12 ? 8.404   2.999   3.479   1.00 0.00 ? 12 ASP A C    6  
ATOM 6230  O O    . ASP A 1 12 ? 7.263   2.704   3.125   1.00 0.00 ? 12 ASP A O    6  
ATOM 6231  C CB   . ASP A 1 12 ? 9.746   0.937   3.935   1.00 0.00 ? 12 ASP A CB   6  
ATOM 6232  C CG   . ASP A 1 12 ? 11.091  0.596   4.550   1.00 0.00 ? 12 ASP A CG   6  
ATOM 6233  O OD1  . ASP A 1 12 ? 11.111  -0.122  5.571   1.00 0.00 ? 12 ASP A OD1  6  
ATOM 6234  O OD2  . ASP A 1 12 ? 12.122  1.046   4.009   1.00 0.00 ? 12 ASP A OD2  6  
ATOM 6235  H H    . ASP A 1 12 ? 7.464   1.217   5.435   1.00 0.00 ? 12 ASP A H    6  
ATOM 6236  H HA   . ASP A 1 12 ? 9.908   2.798   4.980   1.00 0.00 ? 12 ASP A HA   6  
ATOM 6237  H HB2  . ASP A 1 12 ? 9.081   0.101   4.085   1.00 0.00 ? 12 ASP A HB2  6  
ATOM 6238  H HB3  . ASP A 1 12 ? 9.886   1.096   2.876   1.00 0.00 ? 12 ASP A HB3  6  
ATOM 6239  N N    . ARG A 1 13 ? 9.079   4.022   2.964   1.00 0.00 ? 13 ARG A N    6  
ATOM 6240  C CA   . ARG A 1 13 ? 8.505   4.874   1.929   1.00 0.00 ? 13 ARG A CA   6  
ATOM 6241  C C    . ARG A 1 13 ? 8.653   4.232   0.554   1.00 0.00 ? 13 ARG A C    6  
ATOM 6242  O O    . ARG A 1 13 ? 9.762   3.918   0.120   1.00 0.00 ? 13 ARG A O    6  
ATOM 6243  C CB   . ARG A 1 13 ? 9.176   6.249   1.941   1.00 0.00 ? 13 ARG A CB   6  
ATOM 6244  C CG   . ARG A 1 13 ? 8.440   7.277   2.786   1.00 0.00 ? 13 ARG A CG   6  
ATOM 6245  C CD   . ARG A 1 13 ? 9.394   8.070   3.667   1.00 0.00 ? 13 ARG A CD   6  
ATOM 6246  N NE   . ARG A 1 13 ? 9.580   9.436   3.182   1.00 0.00 ? 13 ARG A NE   6  
ATOM 6247  C CZ   . ARG A 1 13 ? 10.409  9.767   2.195   1.00 0.00 ? 13 ARG A CZ   6  
ATOM 6248  N NH1  . ARG A 1 13 ? 11.132  8.837   1.583   1.00 0.00 ? 13 ARG A NH1  6  
ATOM 6249  N NH2  . ARG A 1 13 ? 10.517  11.034  1.818   1.00 0.00 ? 13 ARG A NH2  6  
ATOM 6250  H H    . ARG A 1 13 ? 9.986   4.208   3.286   1.00 0.00 ? 13 ARG A H    6  
ATOM 6251  H HA   . ARG A 1 13 ? 7.454   4.994   2.146   1.00 0.00 ? 13 ARG A HA   6  
ATOM 6252  H HB2  . ARG A 1 13 ? 10.178  6.144   2.329   1.00 0.00 ? 13 ARG A HB2  6  
ATOM 6253  H HB3  . ARG A 1 13 ? 9.228   6.620   0.928   1.00 0.00 ? 13 ARG A HB3  6  
ATOM 6254  H HG2  . ARG A 1 13 ? 7.919   7.960   2.132   1.00 0.00 ? 13 ARG A HG2  6  
ATOM 6255  H HG3  . ARG A 1 13 ? 7.726   6.765   3.415   1.00 0.00 ? 13 ARG A HG3  6  
ATOM 6256  H HD2  . ARG A 1 13 ? 8.993   8.106   4.668   1.00 0.00 ? 13 ARG A HD2  6  
ATOM 6257  H HD3  . ARG A 1 13 ? 10.352  7.569   3.682   1.00 0.00 ? 13 ARG A HD3  6  
ATOM 6258  H HE   . ARG A 1 13 ? 9.060   10.144  3.615   1.00 0.00 ? 13 ARG A HE   6  
ATOM 6259  H HH11 . ARG A 1 13 ? 11.056  7.880   1.861   1.00 0.00 ? 13 ARG A HH11 6  
ATOM 6260  H HH12 . ARG A 1 13 ? 11.753  9.093   0.842   1.00 0.00 ? 13 ARG A HH12 6  
ATOM 6261  H HH21 . ARG A 1 13 ? 9.976   11.739  2.275   1.00 0.00 ? 13 ARG A HH21 6  
ATOM 6262  H HH22 . ARG A 1 13 ? 11.141  11.284  1.077   1.00 0.00 ? 13 ARG A HH22 6  
ATOM 6263  N N    . VAL A 1 14 ? 7.529   4.040   -0.129  1.00 0.00 ? 14 VAL A N    6  
ATOM 6264  C CA   . VAL A 1 14 ? 7.535   3.436   -1.456  1.00 0.00 ? 14 VAL A CA   6  
ATOM 6265  C C    . VAL A 1 14 ? 6.732   4.275   -2.445  1.00 0.00 ? 14 VAL A C    6  
ATOM 6266  O O    . VAL A 1 14 ? 6.066   5.235   -2.063  1.00 0.00 ? 14 VAL A O    6  
ATOM 6267  C CB   . VAL A 1 14 ? 6.956   2.009   -1.424  1.00 0.00 ? 14 VAL A CB   6  
ATOM 6268  C CG1  . VAL A 1 14 ? 7.864   1.081   -0.631  1.00 0.00 ? 14 VAL A CG1  6  
ATOM 6269  C CG2  . VAL A 1 14 ? 5.551   2.015   -0.844  1.00 0.00 ? 14 VAL A CG2  6  
ATOM 6270  H H    . VAL A 1 14 ? 6.676   4.311   0.270   1.00 0.00 ? 14 VAL A H    6  
ATOM 6271  H HA   . VAL A 1 14 ? 8.559   3.380   -1.793  1.00 0.00 ? 14 VAL A HA   6  
ATOM 6272  H HB   . VAL A 1 14 ? 6.903   1.642   -2.439  1.00 0.00 ? 14 VAL A HB   6  
ATOM 6273  H HG11 . VAL A 1 14 ? 8.801   0.958   -1.156  1.00 0.00 ? 14 VAL A HG11 6  
ATOM 6274  H HG12 . VAL A 1 14 ? 7.387   0.119   -0.519  1.00 0.00 ? 14 VAL A HG12 6  
ATOM 6275  H HG13 . VAL A 1 14 ? 8.051   1.507   0.343   1.00 0.00 ? 14 VAL A HG13 6  
ATOM 6276  H HG21 . VAL A 1 14 ? 5.603   2.137   0.227   1.00 0.00 ? 14 VAL A HG21 6  
ATOM 6277  H HG22 . VAL A 1 14 ? 5.062   1.080   -1.076  1.00 0.00 ? 14 VAL A HG22 6  
ATOM 6278  H HG23 . VAL A 1 14 ? 4.988   2.832   -1.273  1.00 0.00 ? 14 VAL A HG23 6  
ATOM 6279  N N    . LEU A 1 15 ? 6.801   3.902   -3.719  1.00 0.00 ? 15 LEU A N    6  
ATOM 6280  C CA   . LEU A 1 15 ? 6.082   4.618   -4.766  1.00 0.00 ? 15 LEU A CA   6  
ATOM 6281  C C    . LEU A 1 15 ? 5.084   3.700   -5.465  1.00 0.00 ? 15 LEU A C    6  
ATOM 6282  O O    . LEU A 1 15 ? 5.449   2.636   -5.963  1.00 0.00 ? 15 LEU A O    6  
ATOM 6283  C CB   . LEU A 1 15 ? 7.064   5.194   -5.787  1.00 0.00 ? 15 LEU A CB   6  
ATOM 6284  C CG   . LEU A 1 15 ? 6.575   6.441   -6.524  1.00 0.00 ? 15 LEU A CG   6  
ATOM 6285  C CD1  . LEU A 1 15 ? 6.190   7.530   -5.534  1.00 0.00 ? 15 LEU A CD1  6  
ATOM 6286  C CD2  . LEU A 1 15 ? 7.643   6.944   -7.485  1.00 0.00 ? 15 LEU A CD2  6  
ATOM 6287  H H    . LEU A 1 15 ? 7.349   3.127   -3.961  1.00 0.00 ? 15 LEU A H    6  
ATOM 6288  H HA   . LEU A 1 15 ? 5.542   5.430   -4.301  1.00 0.00 ? 15 LEU A HA   6  
ATOM 6289  H HB2  . LEU A 1 15 ? 7.982   5.440   -5.273  1.00 0.00 ? 15 LEU A HB2  6  
ATOM 6290  H HB3  . LEU A 1 15 ? 7.276   4.430   -6.520  1.00 0.00 ? 15 LEU A HB3  6  
ATOM 6291  H HG   . LEU A 1 15 ? 5.697   6.190   -7.101  1.00 0.00 ? 15 LEU A HG   6  
ATOM 6292  H HD11 . LEU A 1 15 ? 6.664   7.338   -4.584  1.00 0.00 ? 15 LEU A HD11 6  
ATOM 6293  H HD12 . LEU A 1 15 ? 5.117   7.536   -5.406  1.00 0.00 ? 15 LEU A HD12 6  
ATOM 6294  H HD13 . LEU A 1 15 ? 6.512   8.491   -5.910  1.00 0.00 ? 15 LEU A HD13 6  
ATOM 6295  H HD21 . LEU A 1 15 ? 8.070   6.108   -8.019  1.00 0.00 ? 15 LEU A HD21 6  
ATOM 6296  H HD22 . LEU A 1 15 ? 8.420   7.449   -6.927  1.00 0.00 ? 15 LEU A HD22 6  
ATOM 6297  H HD23 . LEU A 1 15 ? 7.200   7.633   -8.189  1.00 0.00 ? 15 LEU A HD23 6  
ATOM 6298  N N    . VAL A 1 16 ? 3.823   4.119   -5.496  1.00 0.00 ? 16 VAL A N    6  
ATOM 6299  C CA   . VAL A 1 16 ? 2.773   3.334   -6.133  1.00 0.00 ? 16 VAL A CA   6  
ATOM 6300  C C    . VAL A 1 16 ? 2.402   3.913   -7.494  1.00 0.00 ? 16 VAL A C    6  
ATOM 6301  O O    . VAL A 1 16 ? 1.701   4.920   -7.581  1.00 0.00 ? 16 VAL A O    6  
ATOM 6302  C CB   . VAL A 1 16 ? 1.510   3.266   -5.254  1.00 0.00 ? 16 VAL A CB   6  
ATOM 6303  C CG1  . VAL A 1 16 ? 0.505   2.286   -5.838  1.00 0.00 ? 16 VAL A CG1  6  
ATOM 6304  C CG2  . VAL A 1 16 ? 1.871   2.885   -3.828  1.00 0.00 ? 16 VAL A CG2  6  
ATOM 6305  H H    . VAL A 1 16 ? 3.593   4.977   -5.080  1.00 0.00 ? 16 VAL A H    6  
ATOM 6306  H HA   . VAL A 1 16 ? 3.145   2.329   -6.269  1.00 0.00 ? 16 VAL A HA   6  
ATOM 6307  H HB   . VAL A 1 16 ? 1.055   4.247   -5.239  1.00 0.00 ? 16 VAL A HB   6  
ATOM 6308  H HG11 . VAL A 1 16 ? -0.343  2.202   -5.173  1.00 0.00 ? 16 VAL A HG11 6  
ATOM 6309  H HG12 . VAL A 1 16 ? 0.970   1.318   -5.952  1.00 0.00 ? 16 VAL A HG12 6  
ATOM 6310  H HG13 . VAL A 1 16 ? 0.172   2.641   -6.801  1.00 0.00 ? 16 VAL A HG13 6  
ATOM 6311  H HG21 . VAL A 1 16 ? 2.655   3.536   -3.469  1.00 0.00 ? 16 VAL A HG21 6  
ATOM 6312  H HG22 . VAL A 1 16 ? 2.215   1.862   -3.803  1.00 0.00 ? 16 VAL A HG22 6  
ATOM 6313  H HG23 . VAL A 1 16 ? 1.001   2.988   -3.196  1.00 0.00 ? 16 VAL A HG23 6  
ATOM 6314  N N    . GLY A 1 17 ? 2.878   3.268   -8.554  1.00 0.00 ? 17 GLY A N    6  
ATOM 6315  C CA   . GLY A 1 17 ? 2.585   3.733   -9.898  1.00 0.00 ? 17 GLY A CA   6  
ATOM 6316  C C    . GLY A 1 17 ? 3.688   4.607   -10.462 1.00 0.00 ? 17 GLY A C    6  
ATOM 6317  O O    . GLY A 1 17 ? 3.869   4.682   -11.678 1.00 0.00 ? 17 GLY A O    6  
ATOM 6318  H H    . GLY A 1 17 ? 3.431   2.470   -8.424  1.00 0.00 ? 17 GLY A H    6  
ATOM 6319  H HA2  . GLY A 1 17 ? 2.455   2.877   -10.543 1.00 0.00 ? 17 GLY A HA2  6  
ATOM 6320  H HA3  . GLY A 1 17 ? 1.666   4.300   -9.878  1.00 0.00 ? 17 GLY A HA3  6  
ATOM 6321  N N    . GLY A 1 18 ? 4.426   5.270   -9.578  1.00 0.00 ? 18 GLY A N    6  
ATOM 6322  C CA   . GLY A 1 18 ? 5.507   6.136   -10.013 1.00 0.00 ? 18 GLY A CA   6  
ATOM 6323  C C    . GLY A 1 18 ? 5.230   7.599   -9.731  1.00 0.00 ? 18 GLY A C    6  
ATOM 6324  O O    . GLY A 1 18 ? 5.750   8.479   -10.415 1.00 0.00 ? 18 GLY A O    6  
ATOM 6325  H H    . GLY A 1 18 ? 4.236   5.172   -8.621  1.00 0.00 ? 18 GLY A H    6  
ATOM 6326  H HA2  . GLY A 1 18 ? 6.412   5.847   -9.500  1.00 0.00 ? 18 GLY A HA2  6  
ATOM 6327  H HA3  . GLY A 1 18 ? 5.652   6.006   -11.076 1.00 0.00 ? 18 GLY A HA3  6  
ATOM 6328  N N    . THR A 1 19 ? 4.405   7.859   -8.721  1.00 0.00 ? 19 THR A N    6  
ATOM 6329  C CA   . THR A 1 19 ? 4.059   9.227   -8.350  1.00 0.00 ? 19 THR A CA   6  
ATOM 6330  C C    . THR A 1 19 ? 3.471   9.276   -6.943  1.00 0.00 ? 19 THR A C    6  
ATOM 6331  O O    . THR A 1 19 ? 3.834   10.133  -6.137  1.00 0.00 ? 19 THR A O    6  
ATOM 6332  C CB   . THR A 1 19 ? 3.063   9.815   -9.352  1.00 0.00 ? 19 THR A CB   6  
ATOM 6333  O OG1  . THR A 1 19 ? 3.105   9.105   -10.577 1.00 0.00 ? 19 THR A OG1  6  
ATOM 6334  C CG2  . THR A 1 19 ? 3.316   11.275  -9.660  1.00 0.00 ? 19 THR A CG2  6  
ATOM 6335  H H    . THR A 1 19 ? 4.021   7.116   -8.213  1.00 0.00 ? 19 THR A H    6  
ATOM 6336  H HA   . THR A 1 19 ? 4.965   9.815   -8.369  1.00 0.00 ? 19 THR A HA   6  
ATOM 6337  H HB   . THR A 1 19 ? 2.066   9.729   -8.945  1.00 0.00 ? 19 THR A HB   6  
ATOM 6338  H HG1  . THR A 1 19 ? 2.629   8.275   -10.483 1.00 0.00 ? 19 THR A HG1  6  
ATOM 6339  H HG21 . THR A 1 19 ? 2.799   11.546  -10.568 1.00 0.00 ? 19 THR A HG21 6  
ATOM 6340  H HG22 . THR A 1 19 ? 4.376   11.438  -9.786  1.00 0.00 ? 19 THR A HG22 6  
ATOM 6341  H HG23 . THR A 1 19 ? 2.953   11.882  -8.844  1.00 0.00 ? 19 THR A HG23 6  
ATOM 6342  N N    . LYS A 1 20 ? 2.561   8.350   -6.655  1.00 0.00 ? 20 LYS A N    6  
ATOM 6343  C CA   . LYS A 1 20 ? 1.922   8.288   -5.346  1.00 0.00 ? 20 LYS A CA   6  
ATOM 6344  C C    . LYS A 1 20 ? 2.924   7.884   -4.270  1.00 0.00 ? 20 LYS A C    6  
ATOM 6345  O O    . LYS A 1 20 ? 3.241   6.705   -4.113  1.00 0.00 ? 20 LYS A O    6  
ATOM 6346  C CB   . LYS A 1 20 ? 0.758   7.295   -5.372  1.00 0.00 ? 20 LYS A CB   6  
ATOM 6347  C CG   . LYS A 1 20 ? -0.526  7.878   -5.941  1.00 0.00 ? 20 LYS A CG   6  
ATOM 6348  C CD   . LYS A 1 20 ? -0.695  7.524   -7.409  1.00 0.00 ? 20 LYS A CD   6  
ATOM 6349  C CE   . LYS A 1 20 ? -1.410  8.629   -8.171  1.00 0.00 ? 20 LYS A CE   6  
ATOM 6350  N NZ   . LYS A 1 20 ? -2.854  8.704   -7.815  1.00 0.00 ? 20 LYS A NZ   6  
ATOM 6351  H H    . LYS A 1 20 ? 2.314   7.695   -7.340  1.00 0.00 ? 20 LYS A H    6  
ATOM 6352  H HA   . LYS A 1 20 ? 1.540   9.270   -5.116  1.00 0.00 ? 20 LYS A HA   6  
ATOM 6353  H HB2  . LYS A 1 20 ? 1.038   6.444   -5.974  1.00 0.00 ? 20 LYS A HB2  6  
ATOM 6354  H HB3  . LYS A 1 20 ? 0.560   6.963   -4.364  1.00 0.00 ? 20 LYS A HB3  6  
ATOM 6355  H HG2  . LYS A 1 20 ? -1.365  7.484   -5.387  1.00 0.00 ? 20 LYS A HG2  6  
ATOM 6356  H HG3  . LYS A 1 20 ? -0.497  8.953   -5.840  1.00 0.00 ? 20 LYS A HG3  6  
ATOM 6357  H HD2  . LYS A 1 20 ? 0.280   7.372   -7.848  1.00 0.00 ? 20 LYS A HD2  6  
ATOM 6358  H HD3  . LYS A 1 20 ? -1.274  6.614   -7.486  1.00 0.00 ? 20 LYS A HD3  6  
ATOM 6359  H HE2  . LYS A 1 20 ? -0.942  9.573   -7.933  1.00 0.00 ? 20 LYS A HE2  6  
ATOM 6360  H HE3  . LYS A 1 20 ? -1.317  8.438   -9.229  1.00 0.00 ? 20 LYS A HE3  6  
ATOM 6361  H HZ1  . LYS A 1 20 ? -3.299  7.771   -7.930  1.00 0.00 ? 20 LYS A HZ1  6  
ATOM 6362  H HZ2  . LYS A 1 20 ? -3.339  9.385   -8.433  1.00 0.00 ? 20 LYS A HZ2  6  
ATOM 6363  H HZ3  . LYS A 1 20 ? -2.964  9.010   -6.828  1.00 0.00 ? 20 LYS A HZ3  6  
ATOM 6364  N N    . THR A 1 21 ? 3.421   8.871   -3.531  1.00 0.00 ? 21 THR A N    6  
ATOM 6365  C CA   . THR A 1 21 ? 4.388   8.619   -2.469  1.00 0.00 ? 21 THR A CA   6  
ATOM 6366  C C    . THR A 1 21 ? 3.682   8.308   -1.153  1.00 0.00 ? 21 THR A C    6  
ATOM 6367  O O    . THR A 1 21 ? 2.937   9.133   -0.627  1.00 0.00 ? 21 THR A O    6  
ATOM 6368  C CB   . THR A 1 21 ? 5.309   9.826   -2.294  1.00 0.00 ? 21 THR A CB   6  
ATOM 6369  O OG1  . THR A 1 21 ? 4.609   10.913  -1.716  1.00 0.00 ? 21 THR A OG1  6  
ATOM 6370  C CG2  . THR A 1 21 ? 5.916   10.311  -3.593  1.00 0.00 ? 21 THR A CG2  6  
ATOM 6371  H H    . THR A 1 21 ? 3.130   9.791   -3.704  1.00 0.00 ? 21 THR A H    6  
ATOM 6372  H HA   . THR A 1 21 ? 4.980   7.764   -2.758  1.00 0.00 ? 21 THR A HA   6  
ATOM 6373  H HB   . THR A 1 21 ? 6.120   9.554   -1.632  1.00 0.00 ? 21 THR A HB   6  
ATOM 6374  H HG1  . THR A 1 21 ? 5.236   11.576  -1.416  1.00 0.00 ? 21 THR A HG1  6  
ATOM 6375  H HG21 . THR A 1 21 ? 5.132   10.477  -4.316  1.00 0.00 ? 21 THR A HG21 6  
ATOM 6376  H HG22 . THR A 1 21 ? 6.602   9.566   -3.970  1.00 0.00 ? 21 THR A HG22 6  
ATOM 6377  H HG23 . THR A 1 21 ? 6.448   11.235  -3.421  1.00 0.00 ? 21 THR A HG23 6  
ATOM 6378  N N    . GLY A 1 22 ? 3.923   7.111   -0.628  1.00 0.00 ? 22 GLY A N    6  
ATOM 6379  C CA   . GLY A 1 22 ? 3.304   6.712   0.622   1.00 0.00 ? 22 GLY A CA   6  
ATOM 6380  C C    . GLY A 1 22 ? 4.115   5.667   1.364   1.00 0.00 ? 22 GLY A C    6  
ATOM 6381  O O    . GLY A 1 22 ? 4.955   4.989   0.773   1.00 0.00 ? 22 GLY A O    6  
ATOM 6382  H H    . GLY A 1 22 ? 4.527   6.494   -1.093  1.00 0.00 ? 22 GLY A H    6  
ATOM 6383  H HA2  . GLY A 1 22 ? 3.196   7.582   1.252   1.00 0.00 ? 22 GLY A HA2  6  
ATOM 6384  H HA3  . GLY A 1 22 ? 2.324   6.308   0.413   1.00 0.00 ? 22 GLY A HA3  6  
ATOM 6385  N N    . VAL A 1 23 ? 3.863   5.538   2.663   1.00 0.00 ? 23 VAL A N    6  
ATOM 6386  C CA   . VAL A 1 23 ? 4.576   4.571   3.487   1.00 0.00 ? 23 VAL A CA   6  
ATOM 6387  C C    . VAL A 1 23 ? 3.854   3.227   3.506   1.00 0.00 ? 23 VAL A C    6  
ATOM 6388  O O    . VAL A 1 23 ? 2.626   3.170   3.433   1.00 0.00 ? 23 VAL A O    6  
ATOM 6389  C CB   . VAL A 1 23 ? 4.737   5.073   4.934   1.00 0.00 ? 23 VAL A CB   6  
ATOM 6390  C CG1  . VAL A 1 23 ? 5.632   4.137   5.730   1.00 0.00 ? 23 VAL A CG1  6  
ATOM 6391  C CG2  . VAL A 1 23 ? 5.289   6.491   4.950   1.00 0.00 ? 23 VAL A CG2  6  
ATOM 6392  H H    . VAL A 1 23 ? 3.182   6.108   3.076   1.00 0.00 ? 23 VAL A H    6  
ATOM 6393  H HA   . VAL A 1 23 ? 5.561   4.433   3.064   1.00 0.00 ? 23 VAL A HA   6  
ATOM 6394  H HB   . VAL A 1 23 ? 3.762   5.085   5.400   1.00 0.00 ? 23 VAL A HB   6  
ATOM 6395  H HG11 . VAL A 1 23 ? 5.847   4.576   6.693   1.00 0.00 ? 23 VAL A HG11 6  
ATOM 6396  H HG12 . VAL A 1 23 ? 6.556   3.978   5.192   1.00 0.00 ? 23 VAL A HG12 6  
ATOM 6397  H HG13 . VAL A 1 23 ? 5.130   3.191   5.870   1.00 0.00 ? 23 VAL A HG13 6  
ATOM 6398  H HG21 . VAL A 1 23 ? 4.858   7.055   4.135   1.00 0.00 ? 23 VAL A HG21 6  
ATOM 6399  H HG22 . VAL A 1 23 ? 6.362   6.460   4.838   1.00 0.00 ? 23 VAL A HG22 6  
ATOM 6400  H HG23 . VAL A 1 23 ? 5.039   6.964   5.888   1.00 0.00 ? 23 VAL A HG23 6  
ATOM 6401  N N    . VAL A 1 24 ? 4.624   2.149   3.605   1.00 0.00 ? 24 VAL A N    6  
ATOM 6402  C CA   . VAL A 1 24 ? 4.058   0.806   3.634   1.00 0.00 ? 24 VAL A CA   6  
ATOM 6403  C C    . VAL A 1 24 ? 3.429   0.505   4.991   1.00 0.00 ? 24 VAL A C    6  
ATOM 6404  O O    . VAL A 1 24 ? 4.068   0.661   6.031   1.00 0.00 ? 24 VAL A O    6  
ATOM 6405  C CB   . VAL A 1 24 ? 5.125   -0.263  3.328   1.00 0.00 ? 24 VAL A CB   6  
ATOM 6406  C CG1  . VAL A 1 24 ? 4.487   -1.636  3.197   1.00 0.00 ? 24 VAL A CG1  6  
ATOM 6407  C CG2  . VAL A 1 24 ? 5.895   0.098   2.066   1.00 0.00 ? 24 VAL A CG2  6  
ATOM 6408  H H    . VAL A 1 24 ? 5.597   2.259   3.660   1.00 0.00 ? 24 VAL A H    6  
ATOM 6409  H HA   . VAL A 1 24 ? 3.293   0.749   2.873   1.00 0.00 ? 24 VAL A HA   6  
ATOM 6410  H HB   . VAL A 1 24 ? 5.822   -0.292  4.153   1.00 0.00 ? 24 VAL A HB   6  
ATOM 6411  H HG11 . VAL A 1 24 ? 5.179   -2.311  2.717   1.00 0.00 ? 24 VAL A HG11 6  
ATOM 6412  H HG12 . VAL A 1 24 ? 3.587   -1.560  2.602   1.00 0.00 ? 24 VAL A HG12 6  
ATOM 6413  H HG13 . VAL A 1 24 ? 4.238   -2.013  4.178   1.00 0.00 ? 24 VAL A HG13 6  
ATOM 6414  H HG21 . VAL A 1 24 ? 6.052   1.165   2.031   1.00 0.00 ? 24 VAL A HG21 6  
ATOM 6415  H HG22 . VAL A 1 24 ? 5.330   -0.212  1.200   1.00 0.00 ? 24 VAL A HG22 6  
ATOM 6416  H HG23 . VAL A 1 24 ? 6.850   -0.406  2.072   1.00 0.00 ? 24 VAL A HG23 6  
ATOM 6417  N N    . ARG A 1 25 ? 2.171   0.074   4.972   1.00 0.00 ? 25 ARG A N    6  
ATOM 6418  C CA   . ARG A 1 25 ? 1.455   -0.248  6.201   1.00 0.00 ? 25 ARG A CA   6  
ATOM 6419  C C    . ARG A 1 25 ? 1.235   -1.753  6.326   1.00 0.00 ? 25 ARG A C    6  
ATOM 6420  O O    . ARG A 1 25 ? 1.154   -2.287  7.433   1.00 0.00 ? 25 ARG A O    6  
ATOM 6421  C CB   . ARG A 1 25 ? 0.111   0.481   6.238   1.00 0.00 ? 25 ARG A CB   6  
ATOM 6422  C CG   . ARG A 1 25 ? 0.166   1.824   6.948   1.00 0.00 ? 25 ARG A CG   6  
ATOM 6423  C CD   . ARG A 1 25 ? 0.155   1.655   8.458   1.00 0.00 ? 25 ARG A CD   6  
ATOM 6424  N NE   . ARG A 1 25 ? 0.035   2.936   9.151   1.00 0.00 ? 25 ARG A NE   6  
ATOM 6425  C CZ   . ARG A 1 25 ? -0.301  3.057   10.433  1.00 0.00 ? 25 ARG A CZ   6  
ATOM 6426  N NH1  . ARG A 1 25 ? -0.551  1.978   11.166  1.00 0.00 ? 25 ARG A NH1  6  
ATOM 6427  N NH2  . ARG A 1 25 ? -0.387  4.259   10.985  1.00 0.00 ? 25 ARG A NH2  6  
ATOM 6428  H H    . ARG A 1 25 ? 1.715   -0.029  4.111   1.00 0.00 ? 25 ARG A H    6  
ATOM 6429  H HA   . ARG A 1 25 ? 2.058   0.086   7.032   1.00 0.00 ? 25 ARG A HA   6  
ATOM 6430  H HB2  . ARG A 1 25 ? -0.223  0.648   5.224   1.00 0.00 ? 25 ARG A HB2  6  
ATOM 6431  H HB3  . ARG A 1 25 ? -0.610  -0.142  6.746   1.00 0.00 ? 25 ARG A HB3  6  
ATOM 6432  H HG2  . ARG A 1 25 ? 1.072   2.335   6.659   1.00 0.00 ? 25 ARG A HG2  6  
ATOM 6433  H HG3  . ARG A 1 25 ? -0.691  2.412   6.653   1.00 0.00 ? 25 ARG A HG3  6  
ATOM 6434  H HD2  . ARG A 1 25 ? -0.682  1.029   8.731   1.00 0.00 ? 25 ARG A HD2  6  
ATOM 6435  H HD3  . ARG A 1 25 ? 1.075   1.178   8.762   1.00 0.00 ? 25 ARG A HD3  6  
ATOM 6436  H HE   . ARG A 1 25 ? 0.214   3.749   8.633   1.00 0.00 ? 25 ARG A HE   6  
ATOM 6437  H HH11 . ARG A 1 25 ? -0.487  1.068   10.756  1.00 0.00 ? 25 ARG A HH11 6  
ATOM 6438  H HH12 . ARG A 1 25 ? -0.802  2.076   12.129  1.00 0.00 ? 25 ARG A HH12 6  
ATOM 6439  H HH21 . ARG A 1 25 ? -0.200  5.075   10.438  1.00 0.00 ? 25 ARG A HH21 6  
ATOM 6440  H HH22 . ARG A 1 25 ? -0.640  4.350   11.949  1.00 0.00 ? 25 ARG A HH22 6  
ATOM 6441  N N    . TYR A 1 26 ? 1.140   -2.430  5.187   1.00 0.00 ? 26 TYR A N    6  
ATOM 6442  C CA   . TYR A 1 26 ? 0.929   -3.873  5.172   1.00 0.00 ? 26 TYR A CA   6  
ATOM 6443  C C    . TYR A 1 26 ? 1.816   -4.541  4.125   1.00 0.00 ? 26 TYR A C    6  
ATOM 6444  O O    . TYR A 1 26 ? 2.010   -4.009  3.032   1.00 0.00 ? 26 TYR A O    6  
ATOM 6445  C CB   . TYR A 1 26 ? -0.539  -4.191  4.891   1.00 0.00 ? 26 TYR A CB   6  
ATOM 6446  C CG   . TYR A 1 26 ? -0.906  -5.638  5.142   1.00 0.00 ? 26 TYR A CG   6  
ATOM 6447  C CD1  . TYR A 1 26 ? -0.751  -6.205  6.401   1.00 0.00 ? 26 TYR A CD1  6  
ATOM 6448  C CD2  . TYR A 1 26 ? -1.405  -6.434  4.120   1.00 0.00 ? 26 TYR A CD2  6  
ATOM 6449  C CE1  . TYR A 1 26 ? -1.083  -7.526  6.634   1.00 0.00 ? 26 TYR A CE1  6  
ATOM 6450  C CE2  . TYR A 1 26 ? -1.740  -7.756  4.345   1.00 0.00 ? 26 TYR A CE2  6  
ATOM 6451  C CZ   . TYR A 1 26 ? -1.578  -8.296  5.602   1.00 0.00 ? 26 TYR A CZ   6  
ATOM 6452  O OH   . TYR A 1 26 ? -1.910  -9.612  5.831   1.00 0.00 ? 26 TYR A OH   6  
ATOM 6453  H H    . TYR A 1 26 ? 1.214   -1.950  4.337   1.00 0.00 ? 26 TYR A H    6  
ATOM 6454  H HA   . TYR A 1 26 ? 1.192   -4.257  6.146   1.00 0.00 ? 26 TYR A HA   6  
ATOM 6455  H HB2  . TYR A 1 26 ? -1.161  -3.578  5.526   1.00 0.00 ? 26 TYR A HB2  6  
ATOM 6456  H HB3  . TYR A 1 26 ? -0.757  -3.968  3.857   1.00 0.00 ? 26 TYR A HB3  6  
ATOM 6457  H HD1  . TYR A 1 26 ? -0.364  -5.598  7.206   1.00 0.00 ? 26 TYR A HD1  6  
ATOM 6458  H HD2  . TYR A 1 26 ? -1.531  -6.008  3.135   1.00 0.00 ? 26 TYR A HD2  6  
ATOM 6459  H HE1  . TYR A 1 26 ? -0.957  -7.949  7.619   1.00 0.00 ? 26 TYR A HE1  6  
ATOM 6460  H HE2  . TYR A 1 26 ? -2.126  -8.360  3.537   1.00 0.00 ? 26 TYR A HE2  6  
ATOM 6461  H HH   . TYR A 1 26 ? -2.417  -9.678  6.642   1.00 0.00 ? 26 TYR A HH   6  
ATOM 6462  N N    . VAL A 1 27 ? 2.352   -5.707  4.467   1.00 0.00 ? 27 VAL A N    6  
ATOM 6463  C CA   . VAL A 1 27 ? 3.218   -6.447  3.558   1.00 0.00 ? 27 VAL A CA   6  
ATOM 6464  C C    . VAL A 1 27 ? 2.948   -7.946  3.639   1.00 0.00 ? 27 VAL A C    6  
ATOM 6465  O O    . VAL A 1 27 ? 3.198   -8.577  4.666   1.00 0.00 ? 27 VAL A O    6  
ATOM 6466  C CB   . VAL A 1 27 ? 4.705   -6.186  3.863   1.00 0.00 ? 27 VAL A CB   6  
ATOM 6467  C CG1  . VAL A 1 27 ? 5.589   -6.826  2.803   1.00 0.00 ? 27 VAL A CG1  6  
ATOM 6468  C CG2  . VAL A 1 27 ? 4.974   -4.691  3.962   1.00 0.00 ? 27 VAL A CG2  6  
ATOM 6469  H H    . VAL A 1 27 ? 2.160   -6.079  5.354   1.00 0.00 ? 27 VAL A H    6  
ATOM 6470  H HA   . VAL A 1 27 ? 3.012   -6.107  2.553   1.00 0.00 ? 27 VAL A HA   6  
ATOM 6471  H HB   . VAL A 1 27 ? 4.940   -6.635  4.816   1.00 0.00 ? 27 VAL A HB   6  
ATOM 6472  H HG11 . VAL A 1 27 ? 6.463   -7.252  3.274   1.00 0.00 ? 27 VAL A HG11 6  
ATOM 6473  H HG12 . VAL A 1 27 ? 5.894   -6.076  2.089   1.00 0.00 ? 27 VAL A HG12 6  
ATOM 6474  H HG13 . VAL A 1 27 ? 5.038   -7.604  2.297   1.00 0.00 ? 27 VAL A HG13 6  
ATOM 6475  H HG21 . VAL A 1 27 ? 4.222   -4.153  3.404   1.00 0.00 ? 27 VAL A HG21 6  
ATOM 6476  H HG22 . VAL A 1 27 ? 5.950   -4.473  3.555   1.00 0.00 ? 27 VAL A HG22 6  
ATOM 6477  H HG23 . VAL A 1 27 ? 4.940   -4.388  4.998   1.00 0.00 ? 27 VAL A HG23 6  
ATOM 6478  N N    . GLY A 1 28 ? 2.435   -8.509  2.550   1.00 0.00 ? 28 GLY A N    6  
ATOM 6479  C CA   . GLY A 1 28 ? 2.139   -9.930  2.519   1.00 0.00 ? 28 GLY A CA   6  
ATOM 6480  C C    . GLY A 1 28 ? 1.171   -10.295 1.411   1.00 0.00 ? 28 GLY A C    6  
ATOM 6481  O O    . GLY A 1 28 ? 0.942   -9.508  0.493   1.00 0.00 ? 28 GLY A O    6  
ATOM 6482  H H    . GLY A 1 28 ? 2.255   -7.956  1.762   1.00 0.00 ? 28 GLY A H    6  
ATOM 6483  H HA2  . GLY A 1 28 ? 3.060   -10.475 2.373   1.00 0.00 ? 28 GLY A HA2  6  
ATOM 6484  H HA3  . GLY A 1 28 ? 1.708   -10.217 3.467   1.00 0.00 ? 28 GLY A HA3  6  
ATOM 6485  N N    . GLU A 1 29 ? 0.602   -11.494 1.496   1.00 0.00 ? 29 GLU A N    6  
ATOM 6486  C CA   . GLU A 1 29 ? -0.346  -11.963 0.492   1.00 0.00 ? 29 GLU A CA   6  
ATOM 6487  C C    . GLU A 1 29 ? -1.773  -11.577 0.870   1.00 0.00 ? 29 GLU A C    6  
ATOM 6488  O O    . GLU A 1 29 ? -2.003  -10.934 1.893   1.00 0.00 ? 29 GLU A O    6  
ATOM 6489  C CB   . GLU A 1 29 ? -0.242  -13.480 0.332   1.00 0.00 ? 29 GLU A CB   6  
ATOM 6490  C CG   . GLU A 1 29 ? 1.077   -13.939 -0.267  1.00 0.00 ? 29 GLU A CG   6  
ATOM 6491  C CD   . GLU A 1 29 ? 1.318   -15.424 -0.078  1.00 0.00 ? 29 GLU A CD   6  
ATOM 6492  O OE1  . GLU A 1 29 ? 1.326   -15.880 1.085   1.00 0.00 ? 29 GLU A OE1  6  
ATOM 6493  O OE2  . GLU A 1 29 ? 1.498   -16.130 -1.092  1.00 0.00 ? 29 GLU A OE2  6  
ATOM 6494  H H    . GLU A 1 29 ? 0.825   -12.075 2.252   1.00 0.00 ? 29 GLU A H    6  
ATOM 6495  H HA   . GLU A 1 29 ? -0.094  -11.493 -0.446  1.00 0.00 ? 29 GLU A HA   6  
ATOM 6496  H HB2  . GLU A 1 29 ? -0.352  -13.941 1.302   1.00 0.00 ? 29 GLU A HB2  6  
ATOM 6497  H HB3  . GLU A 1 29 ? -1.041  -13.819 -0.310  1.00 0.00 ? 29 GLU A HB3  6  
ATOM 6498  H HG2  . GLU A 1 29 ? 1.072   -13.724 -1.326  1.00 0.00 ? 29 GLU A HG2  6  
ATOM 6499  H HG3  . GLU A 1 29 ? 1.882   -13.396 0.206   1.00 0.00 ? 29 GLU A HG3  6  
ATOM 6500  N N    . THR A 1 30 ? -2.728  -11.976 0.035   1.00 0.00 ? 30 THR A N    6  
ATOM 6501  C CA   . THR A 1 30 ? -4.132  -11.673 0.280   1.00 0.00 ? 30 THR A CA   6  
ATOM 6502  C C    . THR A 1 30 ? -5.017  -12.857 -0.092  1.00 0.00 ? 30 THR A C    6  
ATOM 6503  O O    . THR A 1 30 ? -4.540  -13.857 -0.628  1.00 0.00 ? 30 THR A O    6  
ATOM 6504  C CB   . THR A 1 30 ? -4.556  -10.436 -0.513  1.00 0.00 ? 30 THR A CB   6  
ATOM 6505  O OG1  . THR A 1 30 ? -4.548  -10.706 -1.904  1.00 0.00 ? 30 THR A OG1  6  
ATOM 6506  C CG2  . THR A 1 30 ? -3.664  -9.236  -0.274  1.00 0.00 ? 30 THR A CG2  6  
ATOM 6507  H H    . THR A 1 30 ? -2.481  -12.487 -0.764  1.00 0.00 ? 30 THR A H    6  
ATOM 6508  H HA   . THR A 1 30 ? -4.248  -11.470 1.335   1.00 0.00 ? 30 THR A HA   6  
ATOM 6509  H HB   . THR A 1 30 ? -5.560  -10.163 -0.226  1.00 0.00 ? 30 THR A HB   6  
ATOM 6510  H HG1  . THR A 1 30 ? -4.872  -9.939  -2.381  1.00 0.00 ? 30 THR A HG1  6  
ATOM 6511  H HG21 . THR A 1 30 ? -4.271  -8.349  -0.178  1.00 0.00 ? 30 THR A HG21 6  
ATOM 6512  H HG22 . THR A 1 30 ? -2.987  -9.121  -1.108  1.00 0.00 ? 30 THR A HG22 6  
ATOM 6513  H HG23 . THR A 1 30 ? -3.096  -9.385  0.633   1.00 0.00 ? 30 THR A HG23 6  
ATOM 6514  N N    . ASP A 1 31 ? -6.310  -12.738 0.195   1.00 0.00 ? 31 ASP A N    6  
ATOM 6515  C CA   . ASP A 1 31 ? -7.262  -13.800 -0.111  1.00 0.00 ? 31 ASP A CA   6  
ATOM 6516  C C    . ASP A 1 31 ? -8.199  -13.381 -1.239  1.00 0.00 ? 31 ASP A C    6  
ATOM 6517  O O    . ASP A 1 31 ? -8.636  -14.211 -2.036  1.00 0.00 ? 31 ASP A O    6  
ATOM 6518  C CB   . ASP A 1 31 ? -8.073  -14.159 1.134   1.00 0.00 ? 31 ASP A CB   6  
ATOM 6519  C CG   . ASP A 1 31 ? -7.436  -15.276 1.937   1.00 0.00 ? 31 ASP A CG   6  
ATOM 6520  O OD1  . ASP A 1 31 ? -6.312  -15.077 2.443   1.00 0.00 ? 31 ASP A OD1  6  
ATOM 6521  O OD2  . ASP A 1 31 ? -8.061  -16.350 2.061   1.00 0.00 ? 31 ASP A OD2  6  
ATOM 6522  H H    . ASP A 1 31 ? -6.630  -11.917 0.622   1.00 0.00 ? 31 ASP A H    6  
ATOM 6523  H HA   . ASP A 1 31 ? -6.701  -14.666 -0.427  1.00 0.00 ? 31 ASP A HA   6  
ATOM 6524  H HB2  . ASP A 1 31 ? -8.155  -13.288 1.768   1.00 0.00 ? 31 ASP A HB2  6  
ATOM 6525  H HB3  . ASP A 1 31 ? -9.062  -14.475 0.834   1.00 0.00 ? 31 ASP A HB3  6  
ATOM 6526  N N    . PHE A 1 32 ? -8.502  -12.089 -1.301  1.00 0.00 ? 32 PHE A N    6  
ATOM 6527  C CA   . PHE A 1 32 ? -9.388  -11.561 -2.333  1.00 0.00 ? 32 PHE A CA   6  
ATOM 6528  C C    . PHE A 1 32 ? -8.692  -11.545 -3.690  1.00 0.00 ? 32 PHE A C    6  
ATOM 6529  O O    . PHE A 1 32 ? -9.288  -11.895 -4.709  1.00 0.00 ? 32 PHE A O    6  
ATOM 6530  C CB   . PHE A 1 32 ? -9.847  -10.149 -1.966  1.00 0.00 ? 32 PHE A CB   6  
ATOM 6531  C CG   . PHE A 1 32 ? -8.715  -9.205  -1.678  1.00 0.00 ? 32 PHE A CG   6  
ATOM 6532  C CD1  . PHE A 1 32 ? -8.081  -8.528  -2.709  1.00 0.00 ? 32 PHE A CD1  6  
ATOM 6533  C CD2  . PHE A 1 32 ? -8.284  -8.995  -0.378  1.00 0.00 ? 32 PHE A CD2  6  
ATOM 6534  C CE1  . PHE A 1 32 ? -7.039  -7.659  -2.447  1.00 0.00 ? 32 PHE A CE1  6  
ATOM 6535  C CE2  . PHE A 1 32 ? -7.241  -8.128  -0.111  1.00 0.00 ? 32 PHE A CE2  6  
ATOM 6536  C CZ   . PHE A 1 32 ? -6.619  -7.458  -1.147  1.00 0.00 ? 32 PHE A CZ   6  
ATOM 6537  H H    . PHE A 1 32 ? -8.122  -11.477 -0.637  1.00 0.00 ? 32 PHE A H    6  
ATOM 6538  H HA   . PHE A 1 32 ? -10.251 -12.207 -2.392  1.00 0.00 ? 32 PHE A HA   6  
ATOM 6539  H HB2  . PHE A 1 32 ? -10.420 -9.740  -2.785  1.00 0.00 ? 32 PHE A HB2  6  
ATOM 6540  H HB3  . PHE A 1 32 ? -10.471 -10.200 -1.085  1.00 0.00 ? 32 PHE A HB3  6  
ATOM 6541  H HD1  . PHE A 1 32 ? -8.410  -8.685  -3.726  1.00 0.00 ? 32 PHE A HD1  6  
ATOM 6542  H HD2  . PHE A 1 32 ? -8.770  -9.518  0.432   1.00 0.00 ? 32 PHE A HD2  6  
ATOM 6543  H HE1  . PHE A 1 32 ? -6.554  -7.138  -3.259  1.00 0.00 ? 32 PHE A HE1  6  
ATOM 6544  H HE2  . PHE A 1 32 ? -6.915  -7.972  0.907   1.00 0.00 ? 32 PHE A HE2  6  
ATOM 6545  H HZ   . PHE A 1 32 ? -5.804  -6.780  -0.940  1.00 0.00 ? 32 PHE A HZ   6  
ATOM 6546  N N    . ALA A 1 33 ? -7.427  -11.137 -3.696  1.00 0.00 ? 33 ALA A N    6  
ATOM 6547  C CA   . ALA A 1 33 ? -6.649  -11.075 -4.928  1.00 0.00 ? 33 ALA A CA   6  
ATOM 6548  C C    . ALA A 1 33 ? -5.576  -12.157 -4.954  1.00 0.00 ? 33 ALA A C    6  
ATOM 6549  O O    . ALA A 1 33 ? -5.197  -12.696 -3.914  1.00 0.00 ? 33 ALA A O    6  
ATOM 6550  C CB   . ALA A 1 33 ? -6.017  -9.700  -5.084  1.00 0.00 ? 33 ALA A CB   6  
ATOM 6551  H H    . ALA A 1 33 ? -7.007  -10.871 -2.852  1.00 0.00 ? 33 ALA A H    6  
ATOM 6552  H HA   . ALA A 1 33 ? -7.324  -11.231 -5.756  1.00 0.00 ? 33 ALA A HA   6  
ATOM 6553  H HB1  . ALA A 1 33 ? -5.522  -9.638  -6.041  1.00 0.00 ? 33 ALA A HB1  6  
ATOM 6554  H HB2  . ALA A 1 33 ? -5.298  -9.542  -4.295  1.00 0.00 ? 33 ALA A HB2  6  
ATOM 6555  H HB3  . ALA A 1 33 ? -6.786  -8.943  -5.026  1.00 0.00 ? 33 ALA A HB3  6  
ATOM 6556  N N    . LYS A 1 34 ? -5.090  -12.472 -6.151  1.00 0.00 ? 34 LYS A N    6  
ATOM 6557  C CA   . LYS A 1 34 ? -4.061  -13.492 -6.313  1.00 0.00 ? 34 LYS A CA   6  
ATOM 6558  C C    . LYS A 1 34 ? -2.674  -12.860 -6.367  1.00 0.00 ? 34 LYS A C    6  
ATOM 6559  O O    . LYS A 1 34 ? -2.463  -11.856 -7.050  1.00 0.00 ? 34 LYS A O    6  
ATOM 6560  C CB   . LYS A 1 34 ? -4.313  -14.304 -7.584  1.00 0.00 ? 34 LYS A CB   6  
ATOM 6561  C CG   . LYS A 1 34 ? -5.602  -15.109 -7.545  1.00 0.00 ? 34 LYS A CG   6  
ATOM 6562  C CD   . LYS A 1 34 ? -5.594  -16.222 -8.581  1.00 0.00 ? 34 LYS A CD   6  
ATOM 6563  C CE   . LYS A 1 34 ? -4.701  -17.375 -8.153  1.00 0.00 ? 34 LYS A CE   6  
ATOM 6564  N NZ   . LYS A 1 34 ? -5.314  -18.177 -7.058  1.00 0.00 ? 34 LYS A NZ   6  
ATOM 6565  H H    . LYS A 1 34 ? -5.433  -12.009 -6.943  1.00 0.00 ? 34 LYS A H    6  
ATOM 6566  H HA   . LYS A 1 34 ? -4.109  -14.151 -5.459  1.00 0.00 ? 34 LYS A HA   6  
ATOM 6567  H HB2  . LYS A 1 34 ? -4.361  -13.629 -8.426  1.00 0.00 ? 34 LYS A HB2  6  
ATOM 6568  H HB3  . LYS A 1 34 ? -3.490  -14.989 -7.730  1.00 0.00 ? 34 LYS A HB3  6  
ATOM 6569  H HG2  . LYS A 1 34 ? -5.713  -15.545 -6.564  1.00 0.00 ? 34 LYS A HG2  6  
ATOM 6570  H HG3  . LYS A 1 34 ? -6.433  -14.449 -7.745  1.00 0.00 ? 34 LYS A HG3  6  
ATOM 6571  H HD2  . LYS A 1 34 ? -6.602  -16.590 -8.708  1.00 0.00 ? 34 LYS A HD2  6  
ATOM 6572  H HD3  . LYS A 1 34 ? -5.232  -15.826 -9.519  1.00 0.00 ? 34 LYS A HD3  6  
ATOM 6573  H HE2  . LYS A 1 34 ? -4.529  -18.017 -9.004  1.00 0.00 ? 34 LYS A HE2  6  
ATOM 6574  H HE3  . LYS A 1 34 ? -3.758  -16.974 -7.809  1.00 0.00 ? 34 LYS A HE3  6  
ATOM 6575  H HZ1  . LYS A 1 34 ? -4.578  -18.504 -6.399  1.00 0.00 ? 34 LYS A HZ1  6  
ATOM 6576  H HZ2  . LYS A 1 34 ? -5.803  -19.005 -7.453  1.00 0.00 ? 34 LYS A HZ2  6  
ATOM 6577  H HZ3  . LYS A 1 34 ? -6.001  -17.599 -6.533  1.00 0.00 ? 34 LYS A HZ3  6  
ATOM 6578  N N    . GLY A 1 35 ? -1.729  -13.453 -5.643  1.00 0.00 ? 35 GLY A N    6  
ATOM 6579  C CA   . GLY A 1 35 ? -0.374  -12.934 -5.623  1.00 0.00 ? 35 GLY A CA   6  
ATOM 6580  C C    . GLY A 1 35 ? -0.062  -12.178 -4.347  1.00 0.00 ? 35 GLY A C    6  
ATOM 6581  O O    . GLY A 1 35 ? -0.890  -12.109 -3.439  1.00 0.00 ? 35 GLY A O    6  
ATOM 6582  H H    . GLY A 1 35 ? -1.955  -14.249 -5.119  1.00 0.00 ? 35 GLY A H    6  
ATOM 6583  H HA2  . GLY A 1 35 ? 0.316   -13.758 -5.718  1.00 0.00 ? 35 GLY A HA2  6  
ATOM 6584  H HA3  . GLY A 1 35 ? -0.243  -12.269 -6.463  1.00 0.00 ? 35 GLY A HA3  6  
ATOM 6585  N N    . GLU A 1 36 ? 1.137   -11.609 -4.277  1.00 0.00 ? 36 GLU A N    6  
ATOM 6586  C CA   . GLU A 1 36 ? 1.559   -10.854 -3.103  1.00 0.00 ? 36 GLU A CA   6  
ATOM 6587  C C    . GLU A 1 36 ? 1.267   -9.367  -3.279  1.00 0.00 ? 36 GLU A C    6  
ATOM 6588  O O    . GLU A 1 36 ? 1.650   -8.763  -4.281  1.00 0.00 ? 36 GLU A O    6  
ATOM 6589  C CB   . GLU A 1 36 ? 3.051   -11.067 -2.843  1.00 0.00 ? 36 GLU A CB   6  
ATOM 6590  C CG   . GLU A 1 36 ? 3.395   -11.234 -1.372  1.00 0.00 ? 36 GLU A CG   6  
ATOM 6591  C CD   . GLU A 1 36 ? 4.889   -11.317 -1.128  1.00 0.00 ? 36 GLU A CD   6  
ATOM 6592  O OE1  . GLU A 1 36 ? 5.459   -12.415 -1.301  1.00 0.00 ? 36 GLU A OE1  6  
ATOM 6593  O OE2  . GLU A 1 36 ? 5.489   -10.284 -0.764  1.00 0.00 ? 36 GLU A OE2  6  
ATOM 6594  H H    . GLU A 1 36 ? 1.754   -11.698 -5.034  1.00 0.00 ? 36 GLU A H    6  
ATOM 6595  H HA   . GLU A 1 36 ? 0.999   -11.220 -2.255  1.00 0.00 ? 36 GLU A HA   6  
ATOM 6596  H HB2  . GLU A 1 36 ? 3.373   -11.955 -3.368  1.00 0.00 ? 36 GLU A HB2  6  
ATOM 6597  H HB3  . GLU A 1 36 ? 3.597   -10.217 -3.224  1.00 0.00 ? 36 GLU A HB3  6  
ATOM 6598  H HG2  . GLU A 1 36 ? 3.004   -10.388 -0.826  1.00 0.00 ? 36 GLU A HG2  6  
ATOM 6599  H HG3  . GLU A 1 36 ? 2.934   -12.140 -1.008  1.00 0.00 ? 36 GLU A HG3  6  
ATOM 6600  N N    . TRP A 1 37 ? 0.586   -8.782  -2.299  1.00 0.00 ? 37 TRP A N    6  
ATOM 6601  C CA   . TRP A 1 37 ? 0.244   -7.365  -2.345  1.00 0.00 ? 37 TRP A CA   6  
ATOM 6602  C C    . TRP A 1 37 ? 0.936   -6.600  -1.222  1.00 0.00 ? 37 TRP A C    6  
ATOM 6603  O O    . TRP A 1 37 ? 1.469   -7.198  -0.287  1.00 0.00 ? 37 TRP A O    6  
ATOM 6604  C CB   . TRP A 1 37 ? -1.272  -7.183  -2.243  1.00 0.00 ? 37 TRP A CB   6  
ATOM 6605  C CG   . TRP A 1 37 ? -2.020  -7.773  -3.400  1.00 0.00 ? 37 TRP A CG   6  
ATOM 6606  C CD1  . TRP A 1 37 ? -2.216  -9.099  -3.657  1.00 0.00 ? 37 TRP A CD1  6  
ATOM 6607  C CD2  . TRP A 1 37 ? -2.669  -7.057  -4.457  1.00 0.00 ? 37 TRP A CD2  6  
ATOM 6608  N NE1  . TRP A 1 37 ? -2.948  -9.252  -4.810  1.00 0.00 ? 37 TRP A NE1  6  
ATOM 6609  C CE2  . TRP A 1 37 ? -3.239  -8.013  -5.318  1.00 0.00 ? 37 TRP A CE2  6  
ATOM 6610  C CE3  . TRP A 1 37 ? -2.826  -5.701  -4.756  1.00 0.00 ? 37 TRP A CE3  6  
ATOM 6611  C CZ2  . TRP A 1 37 ? -3.952  -7.655  -6.460  1.00 0.00 ? 37 TRP A CZ2  6  
ATOM 6612  C CZ3  . TRP A 1 37 ? -3.533  -5.347  -5.890  1.00 0.00 ? 37 TRP A CZ3  6  
ATOM 6613  C CH2  . TRP A 1 37 ? -4.090  -6.320  -6.729  1.00 0.00 ? 37 TRP A CH2  6  
ATOM 6614  H H    . TRP A 1 37 ? 0.309   -9.316  -1.525  1.00 0.00 ? 37 TRP A H    6  
ATOM 6615  H HA   . TRP A 1 37 ? 0.581   -6.973  -3.292  1.00 0.00 ? 37 TRP A HA   6  
ATOM 6616  H HB2  . TRP A 1 37 ? -1.625  -7.658  -1.341  1.00 0.00 ? 37 TRP A HB2  6  
ATOM 6617  H HB3  . TRP A 1 37 ? -1.499  -6.127  -2.202  1.00 0.00 ? 37 TRP A HB3  6  
ATOM 6618  H HD1  . TRP A 1 37 ? -1.844  -9.901  -3.038  1.00 0.00 ? 37 TRP A HD1  6  
ATOM 6619  H HE1  . TRP A 1 37 ? -3.220  -10.108 -5.203  1.00 0.00 ? 37 TRP A HE1  6  
ATOM 6620  H HE3  . TRP A 1 37 ? -2.404  -4.936  -4.122  1.00 0.00 ? 37 TRP A HE3  6  
ATOM 6621  H HZ2  . TRP A 1 37 ? -4.388  -8.393  -7.117  1.00 0.00 ? 37 TRP A HZ2  6  
ATOM 6622  H HZ3  . TRP A 1 37 ? -3.663  -4.304  -6.138  1.00 0.00 ? 37 TRP A HZ3  6  
ATOM 6623  H HH2  . TRP A 1 37 ? -4.635  -5.998  -7.604  1.00 0.00 ? 37 TRP A HH2  6  
ATOM 6624  N N    . CYS A 1 38 ? 0.923   -5.275  -1.319  1.00 0.00 ? 38 CYS A N    6  
ATOM 6625  C CA   . CYS A 1 38 ? 1.551   -4.428  -0.312  1.00 0.00 ? 38 CYS A CA   6  
ATOM 6626  C C    . CYS A 1 38 ? 0.792   -3.114  -0.155  1.00 0.00 ? 38 CYS A C    6  
ATOM 6627  O O    . CYS A 1 38 ? 0.701   -2.323  -1.095  1.00 0.00 ? 38 CYS A O    6  
ATOM 6628  C CB   . CYS A 1 38 ? 3.008   -4.149  -0.685  1.00 0.00 ? 38 CYS A CB   6  
ATOM 6629  S SG   . CYS A 1 38 ? 4.142   -4.140  0.724   1.00 0.00 ? 38 CYS A SG   6  
ATOM 6630  H H    . CYS A 1 38 ? 0.483   -4.856  -2.088  1.00 0.00 ? 38 CYS A H    6  
ATOM 6631  H HA   . CYS A 1 38 ? 1.525   -4.958  0.629   1.00 0.00 ? 38 CYS A HA   6  
ATOM 6632  H HB2  . CYS A 1 38 ? 3.347   -4.909  -1.373  1.00 0.00 ? 38 CYS A HB2  6  
ATOM 6633  H HB3  . CYS A 1 38 ? 3.071   -3.183  -1.164  1.00 0.00 ? 38 CYS A HB3  6  
ATOM 6634  H HG   . CYS A 1 38 ? 3.921   -3.385  1.276   1.00 0.00 ? 38 CYS A HG   6  
ATOM 6635  N N    . GLY A 1 39 ? 0.252   -2.887  1.037   1.00 0.00 ? 39 GLY A N    6  
ATOM 6636  C CA   . GLY A 1 39 ? -0.491  -1.667  1.295   1.00 0.00 ? 39 GLY A CA   6  
ATOM 6637  C C    . GLY A 1 39 ? 0.415   -0.468  1.496   1.00 0.00 ? 39 GLY A C    6  
ATOM 6638  O O    . GLY A 1 39 ? 1.480   -0.582  2.102   1.00 0.00 ? 39 GLY A O    6  
ATOM 6639  H H    . GLY A 1 39 ? 0.358   -3.553  1.748   1.00 0.00 ? 39 GLY A H    6  
ATOM 6640  H HA2  . GLY A 1 39 ? -1.146  -1.474  0.458   1.00 0.00 ? 39 GLY A HA2  6  
ATOM 6641  H HA3  . GLY A 1 39 ? -1.091  -1.804  2.182   1.00 0.00 ? 39 GLY A HA3  6  
ATOM 6642  N N    . VAL A 1 40 ? -0.009  0.684   0.985   1.00 0.00 ? 40 VAL A N    6  
ATOM 6643  C CA   . VAL A 1 40 ? 0.771   1.908   1.111   1.00 0.00 ? 40 VAL A CA   6  
ATOM 6644  C C    . VAL A 1 40 ? -0.121  3.094   1.463   1.00 0.00 ? 40 VAL A C    6  
ATOM 6645  O O    . VAL A 1 40 ? -1.008  3.466   0.695   1.00 0.00 ? 40 VAL A O    6  
ATOM 6646  C CB   . VAL A 1 40 ? 1.536   2.224   -0.188  1.00 0.00 ? 40 VAL A CB   6  
ATOM 6647  C CG1  . VAL A 1 40 ? 2.493   3.386   0.023   1.00 0.00 ? 40 VAL A CG1  6  
ATOM 6648  C CG2  . VAL A 1 40 ? 2.279   0.993   -0.682  1.00 0.00 ? 40 VAL A CG2  6  
ATOM 6649  H H    . VAL A 1 40 ? -0.867  0.709   0.512   1.00 0.00 ? 40 VAL A H    6  
ATOM 6650  H HA   . VAL A 1 40 ? 1.492   1.765   1.903   1.00 0.00 ? 40 VAL A HA   6  
ATOM 6651  H HB   . VAL A 1 40 ? 0.817   2.511   -0.943  1.00 0.00 ? 40 VAL A HB   6  
ATOM 6652  H HG11 . VAL A 1 40 ? 3.482   3.004   0.233   1.00 0.00 ? 40 VAL A HG11 6  
ATOM 6653  H HG12 . VAL A 1 40 ? 2.155   3.985   0.855   1.00 0.00 ? 40 VAL A HG12 6  
ATOM 6654  H HG13 . VAL A 1 40 ? 2.524   3.994   -0.869  1.00 0.00 ? 40 VAL A HG13 6  
ATOM 6655  H HG21 . VAL A 1 40 ? 1.585   0.173   -0.795  1.00 0.00 ? 40 VAL A HG21 6  
ATOM 6656  H HG22 . VAL A 1 40 ? 3.043   0.722   0.033   1.00 0.00 ? 40 VAL A HG22 6  
ATOM 6657  H HG23 . VAL A 1 40 ? 2.739   1.208   -1.636  1.00 0.00 ? 40 VAL A HG23 6  
ATOM 6658  N N    . GLU A 1 41 ? 0.120   3.685   2.629   1.00 0.00 ? 41 GLU A N    6  
ATOM 6659  C CA   . GLU A 1 41 ? -0.662  4.828   3.083   1.00 0.00 ? 41 GLU A CA   6  
ATOM 6660  C C    . GLU A 1 41 ? -0.112  6.128   2.505   1.00 0.00 ? 41 GLU A C    6  
ATOM 6661  O O    . GLU A 1 41 ? 0.998   6.545   2.837   1.00 0.00 ? 41 GLU A O    6  
ATOM 6662  C CB   . GLU A 1 41 ? -0.665  4.898   4.612   1.00 0.00 ? 41 GLU A CB   6  
ATOM 6663  C CG   . GLU A 1 41 ? -1.520  6.024   5.168   1.00 0.00 ? 41 GLU A CG   6  
ATOM 6664  C CD   . GLU A 1 41 ? -0.691  7.199   5.654   1.00 0.00 ? 41 GLU A CD   6  
ATOM 6665  O OE1  . GLU A 1 41 ? -0.089  7.891   4.807   1.00 0.00 ? 41 GLU A OE1  6  
ATOM 6666  O OE2  . GLU A 1 41 ? -0.646  7.426   6.882   1.00 0.00 ? 41 GLU A OE2  6  
ATOM 6667  H H    . GLU A 1 41 ? 0.841   3.342   3.198   1.00 0.00 ? 41 GLU A H    6  
ATOM 6668  H HA   . GLU A 1 41 ? -1.676  4.695   2.735   1.00 0.00 ? 41 GLU A HA   6  
ATOM 6669  H HB2  . GLU A 1 41 ? -1.041  3.963   5.002   1.00 0.00 ? 41 GLU A HB2  6  
ATOM 6670  H HB3  . GLU A 1 41 ? 0.349   5.039   4.955   1.00 0.00 ? 41 GLU A HB3  6  
ATOM 6671  H HG2  . GLU A 1 41 ? -2.186  6.371   4.392   1.00 0.00 ? 41 GLU A HG2  6  
ATOM 6672  H HG3  . GLU A 1 41 ? -2.099  5.645   5.996   1.00 0.00 ? 41 GLU A HG3  6  
ATOM 6673  N N    . LEU A 1 42 ? -0.894  6.764   1.640   1.00 0.00 ? 42 LEU A N    6  
ATOM 6674  C CA   . LEU A 1 42 ? -0.485  8.016   1.015   1.00 0.00 ? 42 LEU A CA   6  
ATOM 6675  C C    . LEU A 1 42 ? -0.622  9.180   1.991   1.00 0.00 ? 42 LEU A C    6  
ATOM 6676  O O    . LEU A 1 42 ? -1.323  9.080   2.998   1.00 0.00 ? 42 LEU A O    6  
ATOM 6677  C CB   . LEU A 1 42 ? -1.321  8.284   -0.237  1.00 0.00 ? 42 LEU A CB   6  
ATOM 6678  C CG   . LEU A 1 42 ? -1.023  7.365   -1.423  1.00 0.00 ? 42 LEU A CG   6  
ATOM 6679  C CD1  . LEU A 1 42 ? -2.073  7.539   -2.510  1.00 0.00 ? 42 LEU A CD1  6  
ATOM 6680  C CD2  . LEU A 1 42 ? 0.367   7.642   -1.975  1.00 0.00 ? 42 LEU A CD2  6  
ATOM 6681  H H    . LEU A 1 42 ? -1.768  6.381   1.415   1.00 0.00 ? 42 LEU A H    6  
ATOM 6682  H HA   . LEU A 1 42 ? 0.553   7.921   0.731   1.00 0.00 ? 42 LEU A HA   6  
ATOM 6683  H HB2  . LEU A 1 42 ? -2.365  8.176   0.023   1.00 0.00 ? 42 LEU A HB2  6  
ATOM 6684  H HB3  . LEU A 1 42 ? -1.149  9.303   -0.549  1.00 0.00 ? 42 LEU A HB3  6  
ATOM 6685  H HG   . LEU A 1 42 ? -1.054  6.338   -1.091  1.00 0.00 ? 42 LEU A HG   6  
ATOM 6686  H HD11 . LEU A 1 42 ? -1.750  7.032   -3.407  1.00 0.00 ? 42 LEU A HD11 6  
ATOM 6687  H HD12 . LEU A 1 42 ? -2.205  8.590   -2.718  1.00 0.00 ? 42 LEU A HD12 6  
ATOM 6688  H HD13 . LEU A 1 42 ? -3.010  7.118   -2.176  1.00 0.00 ? 42 LEU A HD13 6  
ATOM 6689  H HD21 . LEU A 1 42 ? 0.829   6.712   -2.270  1.00 0.00 ? 42 LEU A HD21 6  
ATOM 6690  H HD22 . LEU A 1 42 ? 0.969   8.117   -1.214  1.00 0.00 ? 42 LEU A HD22 6  
ATOM 6691  H HD23 . LEU A 1 42 ? 0.292   8.295   -2.832  1.00 0.00 ? 42 LEU A HD23 6  
ATOM 6692  N N    . ASP A 1 43 ? 0.054   10.284  1.687   1.00 0.00 ? 43 ASP A N    6  
ATOM 6693  C CA   . ASP A 1 43 ? 0.008   11.467  2.538   1.00 0.00 ? 43 ASP A CA   6  
ATOM 6694  C C    . ASP A 1 43 ? -1.131  12.393  2.122   1.00 0.00 ? 43 ASP A C    6  
ATOM 6695  O O    . ASP A 1 43 ? -1.722  13.078  2.956   1.00 0.00 ? 43 ASP A O    6  
ATOM 6696  C CB   . ASP A 1 43 ? 1.340   12.217  2.476   1.00 0.00 ? 43 ASP A CB   6  
ATOM 6697  C CG   . ASP A 1 43 ? 2.437   11.511  3.249   1.00 0.00 ? 43 ASP A CG   6  
ATOM 6698  O OD1  . ASP A 1 43 ? 2.526   11.720  4.477   1.00 0.00 ? 43 ASP A OD1  6  
ATOM 6699  O OD2  . ASP A 1 43 ? 3.207   10.751  2.625   1.00 0.00 ? 43 ASP A OD2  6  
ATOM 6700  H H    . ASP A 1 43 ? 0.597   10.303  0.871   1.00 0.00 ? 43 ASP A H    6  
ATOM 6701  H HA   . ASP A 1 43 ? -0.163  11.139  3.552   1.00 0.00 ? 43 ASP A HA   6  
ATOM 6702  H HB2  . ASP A 1 43 ? 1.650   12.304  1.446   1.00 0.00 ? 43 ASP A HB2  6  
ATOM 6703  H HB3  . ASP A 1 43 ? 1.209   13.205  2.893   1.00 0.00 ? 43 ASP A HB3  6  
ATOM 6704  N N    . GLU A 1 44 ? -1.431  12.409  0.827   1.00 0.00 ? 44 GLU A N    6  
ATOM 6705  C CA   . GLU A 1 44 ? -2.499  13.252  0.302   1.00 0.00 ? 44 GLU A CA   6  
ATOM 6706  C C    . GLU A 1 44 ? -3.714  12.412  -0.088  1.00 0.00 ? 44 GLU A C    6  
ATOM 6707  O O    . GLU A 1 44 ? -3.570  11.292  -0.579  1.00 0.00 ? 44 GLU A O    6  
ATOM 6708  C CB   . GLU A 1 44 ? -2.002  14.045  -0.908  1.00 0.00 ? 44 GLU A CB   6  
ATOM 6709  C CG   . GLU A 1 44 ? -0.684  14.762  -0.667  1.00 0.00 ? 44 GLU A CG   6  
ATOM 6710  C CD   . GLU A 1 44 ? 0.092   15.001  -1.947  1.00 0.00 ? 44 GLU A CD   6  
ATOM 6711  O OE1  . GLU A 1 44 ? -0.491  15.562  -2.899  1.00 0.00 ? 44 GLU A OE1  6  
ATOM 6712  O OE2  . GLU A 1 44 ? 1.283   14.626  -1.999  1.00 0.00 ? 44 GLU A OE2  6  
ATOM 6713  H H    . GLU A 1 44 ? -0.923  11.842  0.212   1.00 0.00 ? 44 GLU A H    6  
ATOM 6714  H HA   . GLU A 1 44 ? -2.787  13.943  1.080   1.00 0.00 ? 44 GLU A HA   6  
ATOM 6715  H HB2  . GLU A 1 44 ? -1.873  13.367  -1.739  1.00 0.00 ? 44 GLU A HB2  6  
ATOM 6716  H HB3  . GLU A 1 44 ? -2.747  14.783  -1.170  1.00 0.00 ? 44 GLU A HB3  6  
ATOM 6717  H HG2  . GLU A 1 44 ? -0.887  15.715  -0.204  1.00 0.00 ? 44 GLU A HG2  6  
ATOM 6718  H HG3  . GLU A 1 44 ? -0.079  14.161  -0.003  1.00 0.00 ? 44 GLU A HG3  6  
ATOM 6719  N N    . PRO A 1 45 ? -4.931  12.943  0.124   1.00 0.00 ? 45 PRO A N    6  
ATOM 6720  C CA   . PRO A 1 45 ? -6.171  12.232  -0.212  1.00 0.00 ? 45 PRO A CA   6  
ATOM 6721  C C    . PRO A 1 45 ? -6.198  11.773  -1.666  1.00 0.00 ? 45 PRO A C    6  
ATOM 6722  O O    . PRO A 1 45 ? -6.617  12.516  -2.554  1.00 0.00 ? 45 PRO A O    6  
ATOM 6723  C CB   . PRO A 1 45 ? -7.263  13.274  0.039   1.00 0.00 ? 45 PRO A CB   6  
ATOM 6724  C CG   . PRO A 1 45 ? -6.667  14.226  1.017   1.00 0.00 ? 45 PRO A CG   6  
ATOM 6725  C CD   . PRO A 1 45 ? -5.198  14.272  0.704   1.00 0.00 ? 45 PRO A CD   6  
ATOM 6726  H HA   . PRO A 1 45 ? -6.325  11.381  0.436   1.00 0.00 ? 45 PRO A HA   6  
ATOM 6727  H HB2  . PRO A 1 45 ? -7.515  13.766  -0.889  1.00 0.00 ? 45 PRO A HB2  6  
ATOM 6728  H HB3  . PRO A 1 45 ? -8.139  12.791  0.446   1.00 0.00 ? 45 PRO A HB3  6  
ATOM 6729  H HG2  . PRO A 1 45 ? -7.107  15.204  0.894   1.00 0.00 ? 45 PRO A HG2  6  
ATOM 6730  H HG3  . PRO A 1 45 ? -6.823  13.866  2.023   1.00 0.00 ? 45 PRO A HG3  6  
ATOM 6731  H HD2  . PRO A 1 45 ? -4.988  15.054  -0.010  1.00 0.00 ? 45 PRO A HD2  6  
ATOM 6732  H HD3  . PRO A 1 45 ? -4.623  14.420  1.606   1.00 0.00 ? 45 PRO A HD3  6  
ATOM 6733  N N    . LEU A 1 46 ? -5.751  10.544  -1.902  1.00 0.00 ? 46 LEU A N    6  
ATOM 6734  C CA   . LEU A 1 46 ? -5.726  9.987   -3.249  1.00 0.00 ? 46 LEU A CA   6  
ATOM 6735  C C    . LEU A 1 46 ? -5.856  8.467   -3.212  1.00 0.00 ? 46 LEU A C    6  
ATOM 6736  O O    . LEU A 1 46 ? -5.319  7.767   -4.070  1.00 0.00 ? 46 LEU A O    6  
ATOM 6737  C CB   . LEU A 1 46 ? -4.432  10.382  -3.964  1.00 0.00 ? 46 LEU A CB   6  
ATOM 6738  C CG   . LEU A 1 46 ? -4.290  11.874  -4.268  1.00 0.00 ? 46 LEU A CG   6  
ATOM 6739  C CD1  . LEU A 1 46 ? -2.872  12.194  -4.715  1.00 0.00 ? 46 LEU A CD1  6  
ATOM 6740  C CD2  . LEU A 1 46 ? -5.294  12.299  -5.328  1.00 0.00 ? 46 LEU A CD2  6  
ATOM 6741  H H    . LEU A 1 46 ? -5.431  10.000  -1.153  1.00 0.00 ? 46 LEU A H    6  
ATOM 6742  H HA   . LEU A 1 46 ? -6.565  10.394  -3.792  1.00 0.00 ? 46 LEU A HA   6  
ATOM 6743  H HB2  . LEU A 1 46 ? -3.598  10.080  -3.346  1.00 0.00 ? 46 LEU A HB2  6  
ATOM 6744  H HB3  . LEU A 1 46 ? -4.381  9.841   -4.896  1.00 0.00 ? 46 LEU A HB3  6  
ATOM 6745  H HG   . LEU A 1 46 ? -4.491  12.438  -3.368  1.00 0.00 ? 46 LEU A HG   6  
ATOM 6746  H HD11 . LEU A 1 46 ? -2.172  11.848  -3.970  1.00 0.00 ? 46 LEU A HD11 6  
ATOM 6747  H HD12 . LEU A 1 46 ? -2.766  13.262  -4.840  1.00 0.00 ? 46 LEU A HD12 6  
ATOM 6748  H HD13 . LEU A 1 46 ? -2.670  11.700  -5.654  1.00 0.00 ? 46 LEU A HD13 6  
ATOM 6749  H HD21 . LEU A 1 46 ? -5.373  13.375  -5.338  1.00 0.00 ? 46 LEU A HD21 6  
ATOM 6750  H HD22 . LEU A 1 46 ? -6.259  11.869  -5.103  1.00 0.00 ? 46 LEU A HD22 6  
ATOM 6751  H HD23 . LEU A 1 46 ? -4.963  11.953  -6.296  1.00 0.00 ? 46 LEU A HD23 6  
ATOM 6752  N N    . GLY A 1 47 ? -6.573  7.964   -2.212  1.00 0.00 ? 47 GLY A N    6  
ATOM 6753  C CA   . GLY A 1 47 ? -6.761  6.531   -2.081  1.00 0.00 ? 47 GLY A CA   6  
ATOM 6754  C C    . GLY A 1 47 ? -8.196  6.110   -2.326  1.00 0.00 ? 47 GLY A C    6  
ATOM 6755  O O    . GLY A 1 47 ? -9.106  6.939   -2.306  1.00 0.00 ? 47 GLY A O    6  
ATOM 6756  H H    . GLY A 1 47 ? -6.977  8.571   -1.557  1.00 0.00 ? 47 GLY A H    6  
ATOM 6757  H HA2  . GLY A 1 47 ? -6.124  6.029   -2.794  1.00 0.00 ? 47 GLY A HA2  6  
ATOM 6758  H HA3  . GLY A 1 47 ? -6.475  6.231   -1.084  1.00 0.00 ? 47 GLY A HA3  6  
ATOM 6759  N N    . LYS A 1 48 ? -8.401  4.817   -2.557  1.00 0.00 ? 48 LYS A N    6  
ATOM 6760  C CA   . LYS A 1 48 ? -9.736  4.287   -2.806  1.00 0.00 ? 48 LYS A CA   6  
ATOM 6761  C C    . LYS A 1 48 ? -10.229 3.468   -1.617  1.00 0.00 ? 48 LYS A C    6  
ATOM 6762  O O    . LYS A 1 48 ? -11.432 3.377   -1.370  1.00 0.00 ? 48 LYS A O    6  
ATOM 6763  C CB   . LYS A 1 48 ? -9.736  3.423   -4.069  1.00 0.00 ? 48 LYS A CB   6  
ATOM 6764  C CG   . LYS A 1 48 ? -8.845  2.197   -3.968  1.00 0.00 ? 48 LYS A CG   6  
ATOM 6765  C CD   . LYS A 1 48 ? -9.305  1.095   -4.909  1.00 0.00 ? 48 LYS A CD   6  
ATOM 6766  C CE   . LYS A 1 48 ? -8.126  0.378   -5.546  1.00 0.00 ? 48 LYS A CE   6  
ATOM 6767  N NZ   . LYS A 1 48 ? -8.548  -0.478  -6.690  1.00 0.00 ? 48 LYS A NZ   6  
ATOM 6768  H H    . LYS A 1 48 ? -7.635  4.205   -2.559  1.00 0.00 ? 48 LYS A H    6  
ATOM 6769  H HA   . LYS A 1 48 ? -10.402 5.123   -2.953  1.00 0.00 ? 48 LYS A HA   6  
ATOM 6770  H HB2  . LYS A 1 48 ? -10.746 3.093   -4.266  1.00 0.00 ? 48 LYS A HB2  6  
ATOM 6771  H HB3  . LYS A 1 48 ? -9.395  4.022   -4.900  1.00 0.00 ? 48 LYS A HB3  6  
ATOM 6772  H HG2  . LYS A 1 48 ? -7.834  2.475   -4.224  1.00 0.00 ? 48 LYS A HG2  6  
ATOM 6773  H HG3  . LYS A 1 48 ? -8.872  1.826   -2.954  1.00 0.00 ? 48 LYS A HG3  6  
ATOM 6774  H HD2  . LYS A 1 48 ? -9.889  0.379   -4.351  1.00 0.00 ? 48 LYS A HD2  6  
ATOM 6775  H HD3  . LYS A 1 48 ? -9.914  1.530   -5.688  1.00 0.00 ? 48 LYS A HD3  6  
ATOM 6776  H HE2  . LYS A 1 48 ? -7.422  1.115   -5.902  1.00 0.00 ? 48 LYS A HE2  6  
ATOM 6777  H HE3  . LYS A 1 48 ? -7.651  -0.242  -4.800  1.00 0.00 ? 48 LYS A HE3  6  
ATOM 6778  H HZ1  . LYS A 1 48 ? -9.364  -1.062  -6.417  1.00 0.00 ? 48 LYS A HZ1  6  
ATOM 6779  H HZ2  . LYS A 1 48 ? -7.768  -1.103  -6.977  1.00 0.00 ? 48 LYS A HZ2  6  
ATOM 6780  H HZ3  . LYS A 1 48 ? -8.816  0.116   -7.501  1.00 0.00 ? 48 LYS A HZ3  6  
ATOM 6781  N N    . ASN A 1 49 ? -9.293  2.874   -0.882  1.00 0.00 ? 49 ASN A N    6  
ATOM 6782  C CA   . ASN A 1 49 ? -9.635  2.064   0.282   1.00 0.00 ? 49 ASN A CA   6  
ATOM 6783  C C    . ASN A 1 49 ? -8.994  2.629   1.545   1.00 0.00 ? 49 ASN A C    6  
ATOM 6784  O O    . ASN A 1 49 ? -8.369  3.690   1.515   1.00 0.00 ? 49 ASN A O    6  
ATOM 6785  C CB   . ASN A 1 49 ? -9.186  0.617   0.071   1.00 0.00 ? 49 ASN A CB   6  
ATOM 6786  C CG   . ASN A 1 49 ? -9.756  0.014   -1.197  1.00 0.00 ? 49 ASN A CG   6  
ATOM 6787  O OD1  . ASN A 1 49 ? -10.972 -0.046  -1.379  1.00 0.00 ? 49 ASN A OD1  6  
ATOM 6788  N ND2  . ASN A 1 49 ? -8.876  -0.439  -2.085  1.00 0.00 ? 49 ASN A ND2  6  
ATOM 6789  H H    . ASN A 1 49 ? -8.351  2.983   -1.128  1.00 0.00 ? 49 ASN A H    6  
ATOM 6790  H HA   . ASN A 1 49 ? -10.709 2.085   0.396   1.00 0.00 ? 49 ASN A HA   6  
ATOM 6791  H HB2  . ASN A 1 49 ? -8.108  0.586   0.009   1.00 0.00 ? 49 ASN A HB2  6  
ATOM 6792  H HB3  . ASN A 1 49 ? -9.511  0.021   0.911   1.00 0.00 ? 49 ASN A HB3  6  
ATOM 6793  H HD21 . ASN A 1 49 ? -7.922  -0.358  -1.873  1.00 0.00 ? 49 ASN A HD21 6  
ATOM 6794  H HD22 . ASN A 1 49 ? -9.217  -0.834  -2.914  1.00 0.00 ? 49 ASN A HD22 6  
ATOM 6795  N N    . ASP A 1 50 ? -9.153  1.914   2.654   1.00 0.00 ? 50 ASP A N    6  
ATOM 6796  C CA   . ASP A 1 50 ? -8.590  2.345   3.928   1.00 0.00 ? 50 ASP A CA   6  
ATOM 6797  C C    . ASP A 1 50 ? -7.920  1.178   4.648   1.00 0.00 ? 50 ASP A C    6  
ATOM 6798  O O    . ASP A 1 50 ? -8.013  1.054   5.869   1.00 0.00 ? 50 ASP A O    6  
ATOM 6799  C CB   . ASP A 1 50 ? -9.681  2.950   4.813   1.00 0.00 ? 50 ASP A CB   6  
ATOM 6800  C CG   . ASP A 1 50 ? -10.778 1.955   5.139   1.00 0.00 ? 50 ASP A CG   6  
ATOM 6801  O OD1  . ASP A 1 50 ? -10.997 1.027   4.332   1.00 0.00 ? 50 ASP A OD1  6  
ATOM 6802  O OD2  . ASP A 1 50 ? -11.418 2.104   6.202   1.00 0.00 ? 50 ASP A OD2  6  
ATOM 6803  H H    . ASP A 1 50 ? -9.662  1.078   2.614   1.00 0.00 ? 50 ASP A H    6  
ATOM 6804  H HA   . ASP A 1 50 ? -7.846  3.101   3.723   1.00 0.00 ? 50 ASP A HA   6  
ATOM 6805  H HB2  . ASP A 1 50 ? -9.240  3.286   5.740   1.00 0.00 ? 50 ASP A HB2  6  
ATOM 6806  H HB3  . ASP A 1 50 ? -10.123 3.793   4.304   1.00 0.00 ? 50 ASP A HB3  6  
ATOM 6807  N N    . GLY A 1 51 ? -7.247  0.326   3.882   1.00 0.00 ? 51 GLY A N    6  
ATOM 6808  C CA   . GLY A 1 51 ? -6.572  -0.819  4.464   1.00 0.00 ? 51 GLY A CA   6  
ATOM 6809  C C    . GLY A 1 51 ? -7.543  -1.873  4.960   1.00 0.00 ? 51 GLY A C    6  
ATOM 6810  O O    . GLY A 1 51 ? -7.237  -2.620  5.889   1.00 0.00 ? 51 GLY A O    6  
ATOM 6811  H H    . GLY A 1 51 ? -7.209  0.476   2.915   1.00 0.00 ? 51 GLY A H    6  
ATOM 6812  H HA2  . GLY A 1 51 ? -5.928  -1.261  3.718   1.00 0.00 ? 51 GLY A HA2  6  
ATOM 6813  H HA3  . GLY A 1 51 ? -5.968  -0.484  5.293   1.00 0.00 ? 51 GLY A HA3  6  
ATOM 6814  N N    . ALA A 1 52 ? -8.717  -1.933  4.340   1.00 0.00 ? 52 ALA A N    6  
ATOM 6815  C CA   . ALA A 1 52 ? -9.736  -2.903  4.723   1.00 0.00 ? 52 ALA A CA   6  
ATOM 6816  C C    . ALA A 1 52 ? -10.405 -3.510  3.495   1.00 0.00 ? 52 ALA A C    6  
ATOM 6817  O O    . ALA A 1 52 ? -11.201 -2.856  2.822   1.00 0.00 ? 52 ALA A O    6  
ATOM 6818  C CB   . ALA A 1 52 ? -10.774 -2.248  5.623   1.00 0.00 ? 52 ALA A CB   6  
ATOM 6819  H H    . ALA A 1 52 ? -8.902  -1.310  3.607   1.00 0.00 ? 52 ALA A H    6  
ATOM 6820  H HA   . ALA A 1 52 ? -9.253  -3.689  5.284   1.00 0.00 ? 52 ALA A HA   6  
ATOM 6821  H HB1  . ALA A 1 52 ? -11.738 -2.704  5.450   1.00 0.00 ? 52 ALA A HB1  6  
ATOM 6822  H HB2  . ALA A 1 52 ? -10.829 -1.193  5.400   1.00 0.00 ? 52 ALA A HB2  6  
ATOM 6823  H HB3  . ALA A 1 52 ? -10.492 -2.384  6.656   1.00 0.00 ? 52 ALA A HB3  6  
ATOM 6824  N N    . VAL A 1 53 ? -10.075 -4.765  3.209   1.00 0.00 ? 53 VAL A N    6  
ATOM 6825  C CA   . VAL A 1 53 ? -10.644 -5.461  2.060   1.00 0.00 ? 53 VAL A CA   6  
ATOM 6826  C C    . VAL A 1 53 ? -11.627 -6.539  2.502   1.00 0.00 ? 53 VAL A C    6  
ATOM 6827  O O    . VAL A 1 53 ? -11.341 -7.322  3.409   1.00 0.00 ? 53 VAL A O    6  
ATOM 6828  C CB   . VAL A 1 53 ? -9.546  -6.107  1.195   1.00 0.00 ? 53 VAL A CB   6  
ATOM 6829  C CG1  . VAL A 1 53 ? -10.135 -6.652  -0.097  1.00 0.00 ? 53 VAL A CG1  6  
ATOM 6830  C CG2  . VAL A 1 53 ? -8.436  -5.108  0.904   1.00 0.00 ? 53 VAL A CG2  6  
ATOM 6831  H H    . VAL A 1 53 ? -9.433  -5.234  3.782   1.00 0.00 ? 53 VAL A H    6  
ATOM 6832  H HA   . VAL A 1 53 ? -11.168 -4.735  1.456   1.00 0.00 ? 53 VAL A HA   6  
ATOM 6833  H HB   . VAL A 1 53 ? -9.121  -6.934  1.747   1.00 0.00 ? 53 VAL A HB   6  
ATOM 6834  H HG11 . VAL A 1 53 ? -10.383 -7.697  0.032   1.00 0.00 ? 53 VAL A HG11 6  
ATOM 6835  H HG12 . VAL A 1 53 ? -9.413  -6.550  -0.893  1.00 0.00 ? 53 VAL A HG12 6  
ATOM 6836  H HG13 . VAL A 1 53 ? -11.028 -6.099  -0.347  1.00 0.00 ? 53 VAL A HG13 6  
ATOM 6837  H HG21 . VAL A 1 53 ? -8.861  -4.217  0.464   1.00 0.00 ? 53 VAL A HG21 6  
ATOM 6838  H HG22 . VAL A 1 53 ? -7.728  -5.546  0.216   1.00 0.00 ? 53 VAL A HG22 6  
ATOM 6839  H HG23 . VAL A 1 53 ? -7.934  -4.851  1.825   1.00 0.00 ? 53 VAL A HG23 6  
ATOM 6840  N N    . ALA A 1 54 ? -12.787 -6.575  1.855   1.00 0.00 ? 54 ALA A N    6  
ATOM 6841  C CA   . ALA A 1 54 ? -13.815 -7.557  2.179   1.00 0.00 ? 54 ALA A CA   6  
ATOM 6842  C C    . ALA A 1 54 ? -14.254 -7.436  3.636   1.00 0.00 ? 54 ALA A C    6  
ATOM 6843  O O    . ALA A 1 54 ? -14.739 -8.401  4.228   1.00 0.00 ? 54 ALA A O    6  
ATOM 6844  C CB   . ALA A 1 54 ? -13.307 -8.962  1.895   1.00 0.00 ? 54 ALA A CB   6  
ATOM 6845  H H    . ALA A 1 54 ? -12.956 -5.924  1.142   1.00 0.00 ? 54 ALA A H    6  
ATOM 6846  H HA   . ALA A 1 54 ? -14.666 -7.371  1.541   1.00 0.00 ? 54 ALA A HA   6  
ATOM 6847  H HB1  . ALA A 1 54 ? -13.804 -9.663  2.549   1.00 0.00 ? 54 ALA A HB1  6  
ATOM 6848  H HB2  . ALA A 1 54 ? -12.243 -9.002  2.066   1.00 0.00 ? 54 ALA A HB2  6  
ATOM 6849  H HB3  . ALA A 1 54 ? -13.517 -9.218  0.866   1.00 0.00 ? 54 ALA A HB3  6  
ATOM 6850  N N    . GLY A 1 55 ? -14.086 -6.248  4.209   1.00 0.00 ? 55 GLY A N    6  
ATOM 6851  C CA   . GLY A 1 55 ? -14.474 -6.029  5.589   1.00 0.00 ? 55 GLY A CA   6  
ATOM 6852  C C    . GLY A 1 55 ? -13.317 -6.203  6.554   1.00 0.00 ? 55 GLY A C    6  
ATOM 6853  O O    . GLY A 1 55 ? -13.277 -5.567  7.607   1.00 0.00 ? 55 GLY A O    6  
ATOM 6854  H H    . GLY A 1 55 ? -13.696 -5.514  3.688   1.00 0.00 ? 55 GLY A H    6  
ATOM 6855  H HA2  . GLY A 1 55 ? -14.861 -5.026  5.688   1.00 0.00 ? 55 GLY A HA2  6  
ATOM 6856  H HA3  . GLY A 1 55 ? -15.253 -6.731  5.848   1.00 0.00 ? 55 GLY A HA3  6  
ATOM 6857  N N    . THR A 1 56 ? -12.373 -7.067  6.195   1.00 0.00 ? 56 THR A N    6  
ATOM 6858  C CA   . THR A 1 56 ? -11.211 -7.322  7.039   1.00 0.00 ? 56 THR A CA   6  
ATOM 6859  C C    . THR A 1 56 ? -10.222 -6.162  6.969   1.00 0.00 ? 56 THR A C    6  
ATOM 6860  O O    . THR A 1 56 ? -9.765  -5.788  5.889   1.00 0.00 ? 56 THR A O    6  
ATOM 6861  C CB   . THR A 1 56 ? -10.522 -8.620  6.616   1.00 0.00 ? 56 THR A CB   6  
ATOM 6862  O OG1  . THR A 1 56 ? -11.475 -9.644  6.393   1.00 0.00 ? 56 THR A OG1  6  
ATOM 6863  C CG2  . THR A 1 56 ? -9.530  -9.132  7.637   1.00 0.00 ? 56 THR A CG2  6  
ATOM 6864  H H    . THR A 1 56 ? -12.459 -7.544  5.345   1.00 0.00 ? 56 THR A H    6  
ATOM 6865  H HA   . THR A 1 56 ? -11.555 -7.423  8.057   1.00 0.00 ? 56 THR A HA   6  
ATOM 6866  H HB   . THR A 1 56 ? -9.986  -8.448  5.693   1.00 0.00 ? 56 THR A HB   6  
ATOM 6867  H HG1  . THR A 1 56 ? -11.683 -9.690  5.456   1.00 0.00 ? 56 THR A HG1  6  
ATOM 6868  H HG21 . THR A 1 56 ? -9.129  -10.079 7.308   1.00 0.00 ? 56 THR A HG21 6  
ATOM 6869  H HG22 . THR A 1 56 ? -10.027 -9.264  8.587   1.00 0.00 ? 56 THR A HG22 6  
ATOM 6870  H HG23 . THR A 1 56 ? -8.726  -8.420  7.747   1.00 0.00 ? 56 THR A HG23 6  
ATOM 6871  N N    . ARG A 1 57 ? -9.899  -5.597  8.127   1.00 0.00 ? 57 ARG A N    6  
ATOM 6872  C CA   . ARG A 1 57 ? -8.964  -4.478  8.197   1.00 0.00 ? 57 ARG A CA   6  
ATOM 6873  C C    . ARG A 1 57 ? -7.594  -4.943  8.681   1.00 0.00 ? 57 ARG A C    6  
ATOM 6874  O O    . ARG A 1 57 ? -7.399  -5.198  9.869   1.00 0.00 ? 57 ARG A O    6  
ATOM 6875  C CB   . ARG A 1 57 ? -9.506  -3.393  9.128   1.00 0.00 ? 57 ARG A CB   6  
ATOM 6876  C CG   . ARG A 1 57 ? -8.602  -2.174  9.231   1.00 0.00 ? 57 ARG A CG   6  
ATOM 6877  C CD   . ARG A 1 57 ? -9.396  -0.880  9.143   1.00 0.00 ? 57 ARG A CD   6  
ATOM 6878  N NE   . ARG A 1 57 ? -10.127 -0.600  10.377  1.00 0.00 ? 57 ARG A NE   6  
ATOM 6879  C CZ   . ARG A 1 57 ? -10.710 0.566   10.644  1.00 0.00 ? 57 ARG A CZ   6  
ATOM 6880  N NH1  . ARG A 1 57 ? -10.649 1.563   9.769   1.00 0.00 ? 57 ARG A NH1  6  
ATOM 6881  N NH2  . ARG A 1 57 ? -11.355 0.737   11.790  1.00 0.00 ? 57 ARG A NH2  6  
ATOM 6882  H H    . ARG A 1 57 ? -10.296 -5.939  8.954   1.00 0.00 ? 57 ARG A H    6  
ATOM 6883  H HA   . ARG A 1 57 ? -8.862  -4.069  7.203   1.00 0.00 ? 57 ARG A HA   6  
ATOM 6884  H HB2  . ARG A 1 57 ? -10.470 -3.071  8.763   1.00 0.00 ? 57 ARG A HB2  6  
ATOM 6885  H HB3  . ARG A 1 57 ? -9.626  -3.809  10.117  1.00 0.00 ? 57 ARG A HB3  6  
ATOM 6886  H HG2  . ARG A 1 57 ? -8.084  -2.202  10.178  1.00 0.00 ? 57 ARG A HG2  6  
ATOM 6887  H HG3  . ARG A 1 57 ? -7.884  -2.201  8.425   1.00 0.00 ? 57 ARG A HG3  6  
ATOM 6888  H HD2  . ARG A 1 57 ? -8.713  -0.066  8.948   1.00 0.00 ? 57 ARG A HD2  6  
ATOM 6889  H HD3  . ARG A 1 57 ? -10.100 -0.960  8.328   1.00 0.00 ? 57 ARG A HD3  6  
ATOM 6890  H HE   . ARG A 1 57 ? -10.187 -1.319  11.040  1.00 0.00 ? 57 ARG A HE   6  
ATOM 6891  H HH11 . ARG A 1 57 ? -10.164 1.440   8.904   1.00 0.00 ? 57 ARG A HH11 6  
ATOM 6892  H HH12 . ARG A 1 57 ? -11.090 2.437   9.977   1.00 0.00 ? 57 ARG A HH12 6  
ATOM 6893  H HH21 . ARG A 1 57 ? -11.403 -0.010  12.453  1.00 0.00 ? 57 ARG A HH21 6  
ATOM 6894  H HH22 . ARG A 1 57 ? -11.793 1.614   11.991  1.00 0.00 ? 57 ARG A HH22 6  
ATOM 6895  N N    . TYR A 1 58 ? -6.650  -5.051  7.752   1.00 0.00 ? 58 TYR A N    6  
ATOM 6896  C CA   . TYR A 1 58 ? -5.298  -5.485  8.084   1.00 0.00 ? 58 TYR A CA   6  
ATOM 6897  C C    . TYR A 1 58 ? -4.581  -4.433  8.923   1.00 0.00 ? 58 TYR A C    6  
ATOM 6898  O O    . TYR A 1 58 ? -3.812  -4.762  9.826   1.00 0.00 ? 58 TYR A O    6  
ATOM 6899  C CB   . TYR A 1 58 ? -4.503  -5.766  6.808   1.00 0.00 ? 58 TYR A CB   6  
ATOM 6900  C CG   . TYR A 1 58 ? -5.210  -6.692  5.844   1.00 0.00 ? 58 TYR A CG   6  
ATOM 6901  C CD1  . TYR A 1 58 ? -5.223  -8.065  6.054   1.00 0.00 ? 58 TYR A CD1  6  
ATOM 6902  C CD2  . TYR A 1 58 ? -5.865  -6.193  4.726   1.00 0.00 ? 58 TYR A CD2  6  
ATOM 6903  C CE1  . TYR A 1 58 ? -5.868  -8.915  5.176   1.00 0.00 ? 58 TYR A CE1  6  
ATOM 6904  C CE2  . TYR A 1 58 ? -6.513  -7.036  3.843   1.00 0.00 ? 58 TYR A CE2  6  
ATOM 6905  C CZ   . TYR A 1 58 ? -6.511  -8.396  4.073   1.00 0.00 ? 58 TYR A CZ   6  
ATOM 6906  O OH   . TYR A 1 58 ? -7.156  -9.239  3.196   1.00 0.00 ? 58 TYR A OH   6  
ATOM 6907  H H    . TYR A 1 58 ? -6.867  -4.833  6.821   1.00 0.00 ? 58 TYR A H    6  
ATOM 6908  H HA   . TYR A 1 58 ? -5.374  -6.395  8.658   1.00 0.00 ? 58 TYR A HA   6  
ATOM 6909  H HB2  . TYR A 1 58 ? -4.317  -4.834  6.295   1.00 0.00 ? 58 TYR A HB2  6  
ATOM 6910  H HB3  . TYR A 1 58 ? -3.558  -6.220  7.074   1.00 0.00 ? 58 TYR A HB3  6  
ATOM 6911  H HD1  . TYR A 1 58 ? -4.717  -8.469  6.919   1.00 0.00 ? 58 TYR A HD1  6  
ATOM 6912  H HD2  . TYR A 1 58 ? -5.865  -5.128  4.549   1.00 0.00 ? 58 TYR A HD2  6  
ATOM 6913  H HE1  . TYR A 1 58 ? -5.866  -9.980  5.357   1.00 0.00 ? 58 TYR A HE1  6  
ATOM 6914  H HE2  . TYR A 1 58 ? -7.017  -6.629  2.980   1.00 0.00 ? 58 TYR A HE2  6  
ATOM 6915  H HH   . TYR A 1 58 ? -6.636  -10.037 3.078   1.00 0.00 ? 58 TYR A HH   6  
ATOM 6916  N N    . PHE A 1 59 ? -4.837  -3.164  8.619   1.00 0.00 ? 59 PHE A N    6  
ATOM 6917  C CA   . PHE A 1 59 ? -4.216  -2.064  9.346   1.00 0.00 ? 59 PHE A CA   6  
ATOM 6918  C C    . PHE A 1 59 ? -5.185  -0.894  9.494   1.00 0.00 ? 59 PHE A C    6  
ATOM 6919  O O    . PHE A 1 59 ? -6.103  -0.729  8.691   1.00 0.00 ? 59 PHE A O    6  
ATOM 6920  C CB   . PHE A 1 59 ? -2.946  -1.603  8.629   1.00 0.00 ? 59 PHE A CB   6  
ATOM 6921  C CG   . PHE A 1 59 ? -3.162  -1.264  7.181   1.00 0.00 ? 59 PHE A CG   6  
ATOM 6922  C CD1  . PHE A 1 59 ? -3.169  -2.258  6.217   1.00 0.00 ? 59 PHE A CD1  6  
ATOM 6923  C CD2  . PHE A 1 59 ? -3.358  0.050   6.786   1.00 0.00 ? 59 PHE A CD2  6  
ATOM 6924  C CE1  . PHE A 1 59 ? -3.366  -1.949  4.885   1.00 0.00 ? 59 PHE A CE1  6  
ATOM 6925  C CE2  . PHE A 1 59 ? -3.557  0.365   5.455   1.00 0.00 ? 59 PHE A CE2  6  
ATOM 6926  C CZ   . PHE A 1 59 ? -3.560  -0.636  4.503   1.00 0.00 ? 59 PHE A CZ   6  
ATOM 6927  H H    . PHE A 1 59 ? -5.459  -2.964  7.888   1.00 0.00 ? 59 PHE A H    6  
ATOM 6928  H HA   . PHE A 1 59 ? -3.953  -2.424  10.330  1.00 0.00 ? 59 PHE A HA   6  
ATOM 6929  H HB2  . PHE A 1 59 ? -2.562  -0.722  9.122   1.00 0.00 ? 59 PHE A HB2  6  
ATOM 6930  H HB3  . PHE A 1 59 ? -2.207  -2.388  8.681   1.00 0.00 ? 59 PHE A HB3  6  
ATOM 6931  H HD1  . PHE A 1 59 ? -3.017  -3.285  6.514   1.00 0.00 ? 59 PHE A HD1  6  
ATOM 6932  H HD2  . PHE A 1 59 ? -3.355  0.834   7.529   1.00 0.00 ? 59 PHE A HD2  6  
ATOM 6933  H HE1  . PHE A 1 59 ? -3.369  -2.734  4.142   1.00 0.00 ? 59 PHE A HE1  6  
ATOM 6934  H HE2  . PHE A 1 59 ? -3.709  1.392   5.159   1.00 0.00 ? 59 PHE A HE2  6  
ATOM 6935  H HZ   . PHE A 1 59 ? -3.715  -0.393  3.463   1.00 0.00 ? 59 PHE A HZ   6  
ATOM 6936  N N    . GLN A 1 60 ? -4.973  -0.085  10.528  1.00 0.00 ? 60 GLN A N    6  
ATOM 6937  C CA   . GLN A 1 60 ? -5.827  1.070   10.783  1.00 0.00 ? 60 GLN A CA   6  
ATOM 6938  C C    . GLN A 1 60 ? -5.440  2.242   9.886   1.00 0.00 ? 60 GLN A C    6  
ATOM 6939  O O    . GLN A 1 60 ? -4.305  2.715   9.922   1.00 0.00 ? 60 GLN A O    6  
ATOM 6940  C CB   . GLN A 1 60 ? -5.734  1.484   12.252  1.00 0.00 ? 60 GLN A CB   6  
ATOM 6941  C CG   . GLN A 1 60 ? -6.657  2.632   12.622  1.00 0.00 ? 60 GLN A CG   6  
ATOM 6942  C CD   . GLN A 1 60 ? -8.123  2.264   12.495  1.00 0.00 ? 60 GLN A CD   6  
ATOM 6943  O OE1  . GLN A 1 60 ? -8.572  1.257   13.042  1.00 0.00 ? 60 GLN A OE1  6  
ATOM 6944  N NE2  . GLN A 1 60 ? -8.878  3.082   11.770  1.00 0.00 ? 60 GLN A NE2  6  
ATOM 6945  H H    . GLN A 1 60 ? -4.225  -0.269  11.133  1.00 0.00 ? 60 GLN A H    6  
ATOM 6946  H HA   . GLN A 1 60 ? -6.845  0.785   10.562  1.00 0.00 ? 60 GLN A HA   6  
ATOM 6947  H HB2  . GLN A 1 60 ? -5.985  0.634   12.870  1.00 0.00 ? 60 GLN A HB2  6  
ATOM 6948  H HB3  . GLN A 1 60 ? -4.718  1.785   12.465  1.00 0.00 ? 60 GLN A HB3  6  
ATOM 6949  H HG2  . GLN A 1 60 ? -6.462  2.920   13.644  1.00 0.00 ? 60 GLN A HG2  6  
ATOM 6950  H HG3  . GLN A 1 60 ? -6.453  3.467   11.968  1.00 0.00 ? 60 GLN A HG3  6  
ATOM 6951  H HE21 . GLN A 1 60 ? -8.452  3.867   11.364  1.00 0.00 ? 60 GLN A HE21 6  
ATOM 6952  H HE22 . GLN A 1 60 ? -9.829  2.869   11.671  1.00 0.00 ? 60 GLN A HE22 6  
ATOM 6953  N N    . CYS A 1 61 ? -6.393  2.706   9.083   1.00 0.00 ? 61 CYS A N    6  
ATOM 6954  C CA   . CYS A 1 61 ? -6.151  3.823   8.178   1.00 0.00 ? 61 CYS A CA   6  
ATOM 6955  C C    . CYS A 1 61 ? -7.456  4.544   7.842   1.00 0.00 ? 61 CYS A C    6  
ATOM 6956  O O    . CYS A 1 61 ? -8.515  3.922   7.765   1.00 0.00 ? 61 CYS A O    6  
ATOM 6957  C CB   . CYS A 1 61 ? -5.482  3.331   6.893   1.00 0.00 ? 61 CYS A CB   6  
ATOM 6958  S SG   . CYS A 1 61 ? -3.676  3.424   6.920   1.00 0.00 ? 61 CYS A SG   6  
ATOM 6959  H H    . CYS A 1 61 ? -7.279  2.287   9.099   1.00 0.00 ? 61 CYS A H    6  
ATOM 6960  H HA   . CYS A 1 61 ? -5.489  4.515   8.676   1.00 0.00 ? 61 CYS A HA   6  
ATOM 6961  H HB2  . CYS A 1 61 ? -5.753  2.299   6.728   1.00 0.00 ? 61 CYS A HB2  6  
ATOM 6962  H HB3  . CYS A 1 61 ? -5.830  3.927   6.063   1.00 0.00 ? 61 CYS A HB3  6  
ATOM 6963  H HG   . CYS A 1 61 ? -3.394  3.916   6.146   1.00 0.00 ? 61 CYS A HG   6  
ATOM 6964  N N    . PRO A 1 62 ? -7.395  5.872   7.639   1.00 0.00 ? 62 PRO A N    6  
ATOM 6965  C CA   . PRO A 1 62 ? -8.577  6.674   7.312   1.00 0.00 ? 62 PRO A CA   6  
ATOM 6966  C C    . PRO A 1 62 ? -9.051  6.453   5.877   1.00 0.00 ? 62 PRO A C    6  
ATOM 6967  O O    . PRO A 1 62 ? -8.295  5.972   5.033   1.00 0.00 ? 62 PRO A O    6  
ATOM 6968  C CB   . PRO A 1 62 ? -8.088  8.111   7.497   1.00 0.00 ? 62 PRO A CB   6  
ATOM 6969  C CG   . PRO A 1 62 ? -6.625  8.045   7.228   1.00 0.00 ? 62 PRO A CG   6  
ATOM 6970  C CD   . PRO A 1 62 ? -6.171  6.694   7.713   1.00 0.00 ? 62 PRO A CD   6  
ATOM 6971  H HA   . PRO A 1 62 ? -9.391  6.477   7.994   1.00 0.00 ? 62 PRO A HA   6  
ATOM 6972  H HB2  . PRO A 1 62 ? -8.592  8.759   6.797   1.00 0.00 ? 62 PRO A HB2  6  
ATOM 6973  H HB3  . PRO A 1 62 ? -8.289  8.435   8.507   1.00 0.00 ? 62 PRO A HB3  6  
ATOM 6974  H HG2  . PRO A 1 62 ? -6.442  8.143   6.168   1.00 0.00 ? 62 PRO A HG2  6  
ATOM 6975  H HG3  . PRO A 1 62 ? -6.116  8.828   7.771   1.00 0.00 ? 62 PRO A HG3  6  
ATOM 6976  H HD2  . PRO A 1 62 ? -5.402  6.300   7.066   1.00 0.00 ? 62 PRO A HD2  6  
ATOM 6977  H HD3  . PRO A 1 62 ? -5.814  6.760   8.730   1.00 0.00 ? 62 PRO A HD3  6  
ATOM 6978  N N    . PRO A 1 63 ? -10.315 6.803   5.580   1.00 0.00 ? 63 PRO A N    6  
ATOM 6979  C CA   . PRO A 1 63 ? -10.887 6.640   4.239   1.00 0.00 ? 63 PRO A CA   6  
ATOM 6980  C C    . PRO A 1 63 ? -10.126 7.439   3.186   1.00 0.00 ? 63 PRO A C    6  
ATOM 6981  O O    . PRO A 1 63 ? -9.721  8.576   3.427   1.00 0.00 ? 63 PRO A O    6  
ATOM 6982  C CB   . PRO A 1 63 ? -12.317 7.176   4.382   1.00 0.00 ? 63 PRO A CB   6  
ATOM 6983  C CG   . PRO A 1 63 ? -12.601 7.144   5.845   1.00 0.00 ? 63 PRO A CG   6  
ATOM 6984  C CD   . PRO A 1 63 ? -11.284 7.381   6.525   1.00 0.00 ? 63 PRO A CD   6  
ATOM 6985  H HA   . PRO A 1 63 ? -10.917 5.600   3.948   1.00 0.00 ? 63 PRO A HA   6  
ATOM 6986  H HB2  . PRO A 1 63 ? -12.365 8.184   3.994   1.00 0.00 ? 63 PRO A HB2  6  
ATOM 6987  H HB3  . PRO A 1 63 ? -12.998 6.542   3.835   1.00 0.00 ? 63 PRO A HB3  6  
ATOM 6988  H HG2  . PRO A 1 63 ? -13.301 7.925   6.100   1.00 0.00 ? 63 PRO A HG2  6  
ATOM 6989  H HG3  . PRO A 1 63 ? -12.997 6.177   6.121   1.00 0.00 ? 63 PRO A HG3  6  
ATOM 6990  H HD2  . PRO A 1 63 ? -11.112 8.440   6.658   1.00 0.00 ? 63 PRO A HD2  6  
ATOM 6991  H HD3  . PRO A 1 63 ? -11.252 6.868   7.474   1.00 0.00 ? 63 PRO A HD3  6  
ATOM 6992  N N    . LYS A 1 64 ? -9.937  6.836   2.016   1.00 0.00 ? 64 LYS A N    6  
ATOM 6993  C CA   . LYS A 1 64 ? -9.226  7.492   0.924   1.00 0.00 ? 64 LYS A CA   6  
ATOM 6994  C C    . LYS A 1 64 ? -7.786  7.806   1.320   1.00 0.00 ? 64 LYS A C    6  
ATOM 6995  O O    . LYS A 1 64 ? -7.313  8.930   1.148   1.00 0.00 ? 64 LYS A O    6  
ATOM 6996  C CB   . LYS A 1 64 ? -9.949  8.778   0.515   1.00 0.00 ? 64 LYS A CB   6  
ATOM 6997  C CG   . LYS A 1 64 ? -11.446 8.599   0.321   1.00 0.00 ? 64 LYS A CG   6  
ATOM 6998  C CD   . LYS A 1 64 ? -11.777 8.204   -1.110  1.00 0.00 ? 64 LYS A CD   6  
ATOM 6999  C CE   . LYS A 1 64 ? -11.943 6.700   -1.247  1.00 0.00 ? 64 LYS A CE   6  
ATOM 7000  N NZ   . LYS A 1 64 ? -12.661 6.332   -2.498  1.00 0.00 ? 64 LYS A NZ   6  
ATOM 7001  H H    . LYS A 1 64 ? -10.284 5.929   1.884   1.00 0.00 ? 64 LYS A H    6  
ATOM 7002  H HA   . LYS A 1 64 ? -9.214  6.815   0.083   1.00 0.00 ? 64 LYS A HA   6  
ATOM 7003  H HB2  . LYS A 1 64 ? -9.794  9.522   1.282   1.00 0.00 ? 64 LYS A HB2  6  
ATOM 7004  H HB3  . LYS A 1 64 ? -9.527  9.135   -0.411  1.00 0.00 ? 64 LYS A HB3  6  
ATOM 7005  H HG2  . LYS A 1 64 ? -11.796 7.826   0.988   1.00 0.00 ? 64 LYS A HG2  6  
ATOM 7006  H HG3  . LYS A 1 64 ? -11.942 9.529   0.553   1.00 0.00 ? 64 LYS A HG3  6  
ATOM 7007  H HD2  . LYS A 1 64 ? -12.698 8.686   -1.401  1.00 0.00 ? 64 LYS A HD2  6  
ATOM 7008  H HD3  . LYS A 1 64 ? -10.978 8.531   -1.757  1.00 0.00 ? 64 LYS A HD3  6  
ATOM 7009  H HE2  . LYS A 1 64 ? -10.965 6.242   -1.257  1.00 0.00 ? 64 LYS A HE2  6  
ATOM 7010  H HE3  . LYS A 1 64 ? -12.503 6.333   -0.399  1.00 0.00 ? 64 LYS A HE3  6  
ATOM 7011  H HZ1  . LYS A 1 64 ? -12.429 7.007   -3.256  1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 7012  H HZ2  . LYS A 1 64 ? -13.689 6.347   -2.339  1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 7013  H HZ3  . LYS A 1 64 ? -12.384 5.377   -2.803  1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 7014  N N    . PHE A 1 65 ? -7.093  6.805   1.852   1.00 0.00 ? 65 PHE A N    6  
ATOM 7015  C CA   . PHE A 1 65 ? -5.706  6.974   2.271   1.00 0.00 ? 65 PHE A CA   6  
ATOM 7016  C C    . PHE A 1 65 ? -4.920  5.680   2.084   1.00 0.00 ? 65 PHE A C    6  
ATOM 7017  O O    . PHE A 1 65 ? -3.810  5.689   1.553   1.00 0.00 ? 65 PHE A O    6  
ATOM 7018  C CB   . PHE A 1 65 ? -5.645  7.417   3.734   1.00 0.00 ? 65 PHE A CB   6  
ATOM 7019  C CG   . PHE A 1 65 ? -5.584  8.907   3.909   1.00 0.00 ? 65 PHE A CG   6  
ATOM 7020  C CD1  . PHE A 1 65 ? -4.372  9.577   3.843   1.00 0.00 ? 65 PHE A CD1  6  
ATOM 7021  C CD2  . PHE A 1 65 ? -6.738  9.639   4.138   1.00 0.00 ? 65 PHE A CD2  6  
ATOM 7022  C CE1  . PHE A 1 65 ? -4.313  10.947  4.002   1.00 0.00 ? 65 PHE A CE1  6  
ATOM 7023  C CE2  . PHE A 1 65 ? -6.685  11.010  4.299   1.00 0.00 ? 65 PHE A CE2  6  
ATOM 7024  C CZ   . PHE A 1 65 ? -5.470  11.665  4.231   1.00 0.00 ? 65 PHE A CZ   6  
ATOM 7025  H H    . PHE A 1 65 ? -7.523  5.932   1.964   1.00 0.00 ? 65 PHE A H    6  
ATOM 7026  H HA   . PHE A 1 65 ? -5.265  7.742   1.654   1.00 0.00 ? 65 PHE A HA   6  
ATOM 7027  H HB2  . PHE A 1 65 ? -6.523  7.058   4.250   1.00 0.00 ? 65 PHE A HB2  6  
ATOM 7028  H HB3  . PHE A 1 65 ? -4.764  6.991   4.195   1.00 0.00 ? 65 PHE A HB3  6  
ATOM 7029  H HD1  . PHE A 1 65 ? -3.466  9.015   3.664   1.00 0.00 ? 65 PHE A HD1  6  
ATOM 7030  H HD2  . PHE A 1 65 ? -7.689  9.127   4.193   1.00 0.00 ? 65 PHE A HD2  6  
ATOM 7031  H HE1  . PHE A 1 65 ? -3.361  11.458  3.949   1.00 0.00 ? 65 PHE A HE1  6  
ATOM 7032  H HE2  . PHE A 1 65 ? -7.591  11.570  4.476   1.00 0.00 ? 65 PHE A HE2  6  
ATOM 7033  H HZ   . PHE A 1 65 ? -5.427  12.738  4.356   1.00 0.00 ? 65 PHE A HZ   6  
ATOM 7034  N N    . GLY A 1 66 ? -5.505  4.570   2.523   1.00 0.00 ? 66 GLY A N    6  
ATOM 7035  C CA   . GLY A 1 66 ? -4.843  3.285   2.395   1.00 0.00 ? 66 GLY A CA   6  
ATOM 7036  C C    . GLY A 1 66 ? -5.050  2.662   1.028   1.00 0.00 ? 66 GLY A C    6  
ATOM 7037  O O    . GLY A 1 66 ? -6.176  2.337   0.651   1.00 0.00 ? 66 GLY A O    6  
ATOM 7038  H H    . GLY A 1 66 ? -6.390  4.624   2.938   1.00 0.00 ? 66 GLY A H    6  
ATOM 7039  H HA2  . GLY A 1 66 ? -3.785  3.418   2.561   1.00 0.00 ? 66 GLY A HA2  6  
ATOM 7040  H HA3  . GLY A 1 66 ? -5.235  2.615   3.146   1.00 0.00 ? 66 GLY A HA3  6  
ATOM 7041  N N    . LEU A 1 67 ? -3.962  2.497   0.285   1.00 0.00 ? 67 LEU A N    6  
ATOM 7042  C CA   . LEU A 1 67 ? -4.027  1.909   -1.048  1.00 0.00 ? 67 LEU A CA   6  
ATOM 7043  C C    . LEU A 1 67 ? -3.478  0.487   -1.043  1.00 0.00 ? 67 LEU A C    6  
ATOM 7044  O O    . LEU A 1 67 ? -2.635  0.139   -0.215  1.00 0.00 ? 67 LEU A O    6  
ATOM 7045  C CB   . LEU A 1 67 ? -3.249  2.767   -2.046  1.00 0.00 ? 67 LEU A CB   6  
ATOM 7046  C CG   . LEU A 1 67 ? -3.412  2.362   -3.512  1.00 0.00 ? 67 LEU A CG   6  
ATOM 7047  C CD1  . LEU A 1 67 ? -4.878  2.393   -3.914  1.00 0.00 ? 67 LEU A CD1  6  
ATOM 7048  C CD2  . LEU A 1 67 ? -2.593  3.277   -4.410  1.00 0.00 ? 67 LEU A CD2  6  
ATOM 7049  H H    . LEU A 1 67 ? -3.092  2.776   0.642   1.00 0.00 ? 67 LEU A H    6  
ATOM 7050  H HA   . LEU A 1 67 ? -5.066  1.879   -1.345  1.00 0.00 ? 67 LEU A HA   6  
ATOM 7051  H HB2  . LEU A 1 67 ? -3.573  3.792   -1.937  1.00 0.00 ? 67 LEU A HB2  6  
ATOM 7052  H HB3  . LEU A 1 67 ? -2.200  2.711   -1.796  1.00 0.00 ? 67 LEU A HB3  6  
ATOM 7053  H HG   . LEU A 1 67 ? -3.052  1.353   -3.643  1.00 0.00 ? 67 LEU A HG   6  
ATOM 7054  H HD11 . LEU A 1 67 ? -5.432  1.693   -3.306  1.00 0.00 ? 67 LEU A HD11 6  
ATOM 7055  H HD12 . LEU A 1 67 ? -4.972  2.119   -4.954  1.00 0.00 ? 67 LEU A HD12 6  
ATOM 7056  H HD13 . LEU A 1 67 ? -5.272  3.388   -3.767  1.00 0.00 ? 67 LEU A HD13 6  
ATOM 7057  H HD21 . LEU A 1 67 ? -2.453  2.806   -5.373  1.00 0.00 ? 67 LEU A HD21 6  
ATOM 7058  H HD22 . LEU A 1 67 ? -1.630  3.460   -3.956  1.00 0.00 ? 67 LEU A HD22 6  
ATOM 7059  H HD23 . LEU A 1 67 ? -3.112  4.214   -4.540  1.00 0.00 ? 67 LEU A HD23 6  
ATOM 7060  N N    . PHE A 1 68 ? -3.960  -0.332  -1.971  1.00 0.00 ? 68 PHE A N    6  
ATOM 7061  C CA   . PHE A 1 68 ? -3.517  -1.718  -2.075  1.00 0.00 ? 68 PHE A CA   6  
ATOM 7062  C C    . PHE A 1 68 ? -2.985  -2.017  -3.473  1.00 0.00 ? 68 PHE A C    6  
ATOM 7063  O O    . PHE A 1 68 ? -3.748  -2.076  -4.438  1.00 0.00 ? 68 PHE A O    6  
ATOM 7064  C CB   . PHE A 1 68 ? -4.667  -2.669  -1.740  1.00 0.00 ? 68 PHE A CB   6  
ATOM 7065  C CG   . PHE A 1 68 ? -4.850  -2.895  -0.266  1.00 0.00 ? 68 PHE A CG   6  
ATOM 7066  C CD1  . PHE A 1 68 ? -3.803  -3.366  0.511   1.00 0.00 ? 68 PHE A CD1  6  
ATOM 7067  C CD2  . PHE A 1 68 ? -6.069  -2.638  0.341   1.00 0.00 ? 68 PHE A CD2  6  
ATOM 7068  C CE1  . PHE A 1 68 ? -3.969  -3.576  1.866   1.00 0.00 ? 68 PHE A CE1  6  
ATOM 7069  C CE2  . PHE A 1 68 ? -6.240  -2.847  1.697   1.00 0.00 ? 68 PHE A CE2  6  
ATOM 7070  C CZ   . PHE A 1 68 ? -5.189  -3.316  2.460   1.00 0.00 ? 68 PHE A CZ   6  
ATOM 7071  H H    . PHE A 1 68 ? -4.630  0.003   -2.603  1.00 0.00 ? 68 PHE A H    6  
ATOM 7072  H HA   . PHE A 1 68 ? -2.720  -1.865  -1.361  1.00 0.00 ? 68 PHE A HA   6  
ATOM 7073  H HB2  . PHE A 1 68 ? -5.587  -2.260  -2.130  1.00 0.00 ? 68 PHE A HB2  6  
ATOM 7074  H HB3  . PHE A 1 68 ? -4.479  -3.626  -2.204  1.00 0.00 ? 68 PHE A HB3  6  
ATOM 7075  H HD1  . PHE A 1 68 ? -2.850  -3.569  0.048   1.00 0.00 ? 68 PHE A HD1  6  
ATOM 7076  H HD2  . PHE A 1 68 ? -6.891  -2.272  -0.255  1.00 0.00 ? 68 PHE A HD2  6  
ATOM 7077  H HE1  . PHE A 1 68 ? -3.146  -3.943  2.462   1.00 0.00 ? 68 PHE A HE1  6  
ATOM 7078  H HE2  . PHE A 1 68 ? -7.195  -2.642  2.158   1.00 0.00 ? 68 PHE A HE2  6  
ATOM 7079  H HZ   . PHE A 1 68 ? -5.320  -3.479  3.520   1.00 0.00 ? 68 PHE A HZ   6  
ATOM 7080  N N    . ALA A 1 69 ? -1.674  -2.205  -3.575  1.00 0.00 ? 69 ALA A N    6  
ATOM 7081  C CA   . ALA A 1 69 ? -1.042  -2.498  -4.855  1.00 0.00 ? 69 ALA A CA   6  
ATOM 7082  C C    . ALA A 1 69 ? -0.104  -3.697  -4.744  1.00 0.00 ? 69 ALA A C    6  
ATOM 7083  O O    . ALA A 1 69 ? 0.489   -3.935  -3.691  1.00 0.00 ? 69 ALA A O    6  
ATOM 7084  C CB   . ALA A 1 69 ? -0.286  -1.279  -5.362  1.00 0.00 ? 69 ALA A CB   6  
ATOM 7085  H H    . ALA A 1 69 ? -1.118  -2.145  -2.770  1.00 0.00 ? 69 ALA A H    6  
ATOM 7086  H HA   . ALA A 1 69 ? -1.823  -2.729  -5.567  1.00 0.00 ? 69 ALA A HA   6  
ATOM 7087  H HB1  . ALA A 1 69 ? 0.418   -0.955  -4.611  1.00 0.00 ? 69 ALA A HB1  6  
ATOM 7088  H HB2  . ALA A 1 69 ? -0.985  -0.482  -5.568  1.00 0.00 ? 69 ALA A HB2  6  
ATOM 7089  H HB3  . ALA A 1 69 ? 0.245   -1.535  -6.266  1.00 0.00 ? 69 ALA A HB3  6  
ATOM 7090  N N    . PRO A 1 70 ? 0.045   -4.471  -5.832  1.00 0.00 ? 70 PRO A N    6  
ATOM 7091  C CA   . PRO A 1 70 ? 0.918   -5.650  -5.850  1.00 0.00 ? 70 PRO A CA   6  
ATOM 7092  C C    . PRO A 1 70 ? 2.343   -5.319  -5.417  1.00 0.00 ? 70 PRO A C    6  
ATOM 7093  O O    . PRO A 1 70 ? 2.811   -4.195  -5.595  1.00 0.00 ? 70 PRO A O    6  
ATOM 7094  C CB   . PRO A 1 70 ? 0.894   -6.095  -7.315  1.00 0.00 ? 70 PRO A CB   6  
ATOM 7095  C CG   . PRO A 1 70 ? -0.381  -5.551  -7.858  1.00 0.00 ? 70 PRO A CG   6  
ATOM 7096  C CD   . PRO A 1 70 ? -0.623  -4.259  -7.130  1.00 0.00 ? 70 PRO A CD   6  
ATOM 7097  H HA   . PRO A 1 70 ? 0.528   -6.440  -5.224  1.00 0.00 ? 70 PRO A HA   6  
ATOM 7098  H HB2  . PRO A 1 70 ? 1.751   -5.686  -7.832  1.00 0.00 ? 70 PRO A HB2  6  
ATOM 7099  H HB3  . PRO A 1 70 ? 0.916   -7.173  -7.367  1.00 0.00 ? 70 PRO A HB3  6  
ATOM 7100  H HG2  . PRO A 1 70 ? -0.281  -5.370  -8.919  1.00 0.00 ? 70 PRO A HG2  6  
ATOM 7101  H HG3  . PRO A 1 70 ? -1.187  -6.245  -7.670  1.00 0.00 ? 70 PRO A HG3  6  
ATOM 7102  H HD2  . PRO A 1 70 ? -0.177  -3.434  -7.664  1.00 0.00 ? 70 PRO A HD2  6  
ATOM 7103  H HD3  . PRO A 1 70 ? -1.682  -4.095  -6.995  1.00 0.00 ? 70 PRO A HD3  6  
ATOM 7104  N N    . ILE A 1 71 ? 3.027   -6.306  -4.845  1.00 0.00 ? 71 ILE A N    6  
ATOM 7105  C CA   . ILE A 1 71 ? 4.397   -6.116  -4.387  1.00 0.00 ? 71 ILE A CA   6  
ATOM 7106  C C    . ILE A 1 71 ? 5.316   -5.726  -5.541  1.00 0.00 ? 71 ILE A C    6  
ATOM 7107  O O    . ILE A 1 71 ? 6.115   -4.796  -5.424  1.00 0.00 ? 71 ILE A O    6  
ATOM 7108  C CB   . ILE A 1 71 ? 4.944   -7.389  -3.706  1.00 0.00 ? 71 ILE A CB   6  
ATOM 7109  C CG1  . ILE A 1 71 ? 6.343   -7.133  -3.140  1.00 0.00 ? 71 ILE A CG1  6  
ATOM 7110  C CG2  . ILE A 1 71 ? 4.967   -8.551  -4.687  1.00 0.00 ? 71 ILE A CG2  6  
ATOM 7111  C CD1  . ILE A 1 71 ? 6.765   -8.143  -2.096  1.00 0.00 ? 71 ILE A CD1  6  
ATOM 7112  H H    . ILE A 1 71 ? 2.599   -7.179  -4.730  1.00 0.00 ? 71 ILE A H    6  
ATOM 7113  H HA   . ILE A 1 71 ? 4.396   -5.318  -3.658  1.00 0.00 ? 71 ILE A HA   6  
ATOM 7114  H HB   . ILE A 1 71 ? 4.279   -7.649  -2.897  1.00 0.00 ? 71 ILE A HB   6  
ATOM 7115  H HG12 . ILE A 1 71 ? 7.062   -7.169  -3.945  1.00 0.00 ? 71 ILE A HG12 6  
ATOM 7116  H HG13 . ILE A 1 71 ? 6.366   -6.154  -2.685  1.00 0.00 ? 71 ILE A HG13 6  
ATOM 7117  H HG21 . ILE A 1 71 ? 5.724   -8.374  -5.438  1.00 0.00 ? 71 ILE A HG21 6  
ATOM 7118  H HG22 . ILE A 1 71 ? 4.002   -8.641  -5.164  1.00 0.00 ? 71 ILE A HG22 6  
ATOM 7119  H HG23 . ILE A 1 71 ? 5.193   -9.465  -4.157  1.00 0.00 ? 71 ILE A HG23 6  
ATOM 7120  H HD11 . ILE A 1 71 ? 6.508   -9.137  -2.432  1.00 0.00 ? 71 ILE A HD11 6  
ATOM 7121  H HD12 . ILE A 1 71 ? 6.257   -7.935  -1.166  1.00 0.00 ? 71 ILE A HD12 6  
ATOM 7122  H HD13 . ILE A 1 71 ? 7.832   -8.079  -1.945  1.00 0.00 ? 71 ILE A HD13 6  
ATOM 7123  N N    . HIS A 1 72 ? 5.197   -6.440  -6.656  1.00 0.00 ? 72 HIS A N    6  
ATOM 7124  C CA   . HIS A 1 72 ? 6.018   -6.163  -7.829  1.00 0.00 ? 72 HIS A CA   6  
ATOM 7125  C C    . HIS A 1 72 ? 5.738   -4.767  -8.382  1.00 0.00 ? 72 HIS A C    6  
ATOM 7126  O O    . HIS A 1 72 ? 6.536   -4.221  -9.144  1.00 0.00 ? 72 HIS A O    6  
ATOM 7127  C CB   . HIS A 1 72 ? 5.775   -7.214  -8.915  1.00 0.00 ? 72 HIS A CB   6  
ATOM 7128  C CG   . HIS A 1 72 ? 4.329   -7.534  -9.134  1.00 0.00 ? 72 HIS A CG   6  
ATOM 7129  N ND1  . HIS A 1 72 ? 3.634   -8.479  -8.412  1.00 0.00 ? 72 HIS A ND1  6  
ATOM 7130  C CD2  . HIS A 1 72 ? 3.443   -7.014  -10.020 1.00 0.00 ? 72 HIS A CD2  6  
ATOM 7131  C CE1  . HIS A 1 72 ? 2.376   -8.505  -8.874  1.00 0.00 ? 72 HIS A CE1  6  
ATOM 7132  N NE2  . HIS A 1 72 ? 2.208   -7.634  -9.850  1.00 0.00 ? 72 HIS A NE2  6  
ATOM 7133  H H    . HIS A 1 72 ? 4.542   -7.167  -6.691  1.00 0.00 ? 72 HIS A H    6  
ATOM 7134  H HA   . HIS A 1 72 ? 7.053   -6.210  -7.524  1.00 0.00 ? 72 HIS A HA   6  
ATOM 7135  H HB2  . HIS A 1 72 ? 6.180   -6.855  -9.850  1.00 0.00 ? 72 HIS A HB2  6  
ATOM 7136  H HB3  . HIS A 1 72 ? 6.280   -8.129  -8.639  1.00 0.00 ? 72 HIS A HB3  6  
ATOM 7137  H HD1  . HIS A 1 72 ? 3.996   -9.036  -7.691  1.00 0.00 ? 72 HIS A HD1  6  
ATOM 7138  H HD2  . HIS A 1 72 ? 3.651   -6.242  -10.747 1.00 0.00 ? 72 HIS A HD2  6  
ATOM 7139  H HE1  . HIS A 1 72 ? 1.601   -9.154  -8.494  1.00 0.00 ? 72 HIS A HE1  6  
ATOM 7140  N N    . LYS A 1 73 ? 4.602   -4.191  -7.994  1.00 0.00 ? 73 LYS A N    6  
ATOM 7141  C CA   . LYS A 1 73 ? 4.227   -2.858  -8.452  1.00 0.00 ? 73 LYS A CA   6  
ATOM 7142  C C    . LYS A 1 73 ? 4.610   -1.797  -7.425  1.00 0.00 ? 73 LYS A C    6  
ATOM 7143  O O    . LYS A 1 73 ? 4.018   -0.718  -7.383  1.00 0.00 ? 73 LYS A O    6  
ATOM 7144  C CB   . LYS A 1 73 ? 2.723   -2.796  -8.728  1.00 0.00 ? 73 LYS A CB   6  
ATOM 7145  C CG   . LYS A 1 73 ? 2.257   -3.784  -9.785  1.00 0.00 ? 73 LYS A CG   6  
ATOM 7146  C CD   . LYS A 1 73 ? 2.074   -3.113  -11.136 1.00 0.00 ? 73 LYS A CD   6  
ATOM 7147  C CE   . LYS A 1 73 ? 1.816   -4.133  -12.234 1.00 0.00 ? 73 LYS A CE   6  
ATOM 7148  N NZ   . LYS A 1 73 ? 1.450   -3.481  -13.522 1.00 0.00 ? 73 LYS A NZ   6  
ATOM 7149  H H    . LYS A 1 73 ? 4.004   -4.671  -7.385  1.00 0.00 ? 73 LYS A H    6  
ATOM 7150  H HA   . LYS A 1 73 ? 4.760   -2.662  -9.371  1.00 0.00 ? 73 LYS A HA   6  
ATOM 7151  H HB2  . LYS A 1 73 ? 2.192   -3.005  -7.812  1.00 0.00 ? 73 LYS A HB2  6  
ATOM 7152  H HB3  . LYS A 1 73 ? 2.472   -1.800  -9.061  1.00 0.00 ? 73 LYS A HB3  6  
ATOM 7153  H HG2  . LYS A 1 73 ? 2.994   -4.568  -9.881  1.00 0.00 ? 73 LYS A HG2  6  
ATOM 7154  H HG3  . LYS A 1 73 ? 1.315   -4.211  -9.473  1.00 0.00 ? 73 LYS A HG3  6  
ATOM 7155  H HD2  . LYS A 1 73 ? 1.234   -2.438  -11.081 1.00 0.00 ? 73 LYS A HD2  6  
ATOM 7156  H HD3  . LYS A 1 73 ? 2.969   -2.558  -11.375 1.00 0.00 ? 73 LYS A HD3  6  
ATOM 7157  H HE2  . LYS A 1 73 ? 2.710   -4.721  -12.380 1.00 0.00 ? 73 LYS A HE2  6  
ATOM 7158  H HE3  . LYS A 1 73 ? 1.008   -4.778  -11.924 1.00 0.00 ? 73 LYS A HE3  6  
ATOM 7159  H HZ1  . LYS A 1 73 ? 0.856   -4.120  -14.090 1.00 0.00 ? 73 LYS A HZ1  6  
ATOM 7160  H HZ2  . LYS A 1 73 ? 2.308   -3.250  -14.062 1.00 0.00 ? 73 LYS A HZ2  6  
ATOM 7161  H HZ3  . LYS A 1 73 ? 0.922   -2.604  -13.341 1.00 0.00 ? 73 LYS A HZ3  6  
ATOM 7162  N N    . VAL A 1 74 ? 5.604   -2.107  -6.597  1.00 0.00 ? 74 VAL A N    6  
ATOM 7163  C CA   . VAL A 1 74 ? 6.063   -1.177  -5.572  1.00 0.00 ? 74 VAL A CA   6  
ATOM 7164  C C    . VAL A 1 74 ? 7.512   -0.769  -5.812  1.00 0.00 ? 74 VAL A C    6  
ATOM 7165  O O    . VAL A 1 74 ? 8.411   -1.610  -5.824  1.00 0.00 ? 74 VAL A O    6  
ATOM 7166  C CB   . VAL A 1 74 ? 5.938   -1.787  -4.162  1.00 0.00 ? 74 VAL A CB   6  
ATOM 7167  C CG1  . VAL A 1 74 ? 6.275   -0.751  -3.099  1.00 0.00 ? 74 VAL A CG1  6  
ATOM 7168  C CG2  . VAL A 1 74 ? 4.541   -2.350  -3.944  1.00 0.00 ? 74 VAL A CG2  6  
ATOM 7169  H H    . VAL A 1 74 ? 6.039   -2.981  -6.677  1.00 0.00 ? 74 VAL A H    6  
ATOM 7170  H HA   . VAL A 1 74 ? 5.439   -0.296  -5.617  1.00 0.00 ? 74 VAL A HA   6  
ATOM 7171  H HB   . VAL A 1 74 ? 6.647   -2.598  -4.079  1.00 0.00 ? 74 VAL A HB   6  
ATOM 7172  H HG11 . VAL A 1 74 ? 5.612   0.095   -3.197  1.00 0.00 ? 74 VAL A HG11 6  
ATOM 7173  H HG12 . VAL A 1 74 ? 7.296   -0.426  -3.225  1.00 0.00 ? 74 VAL A HG12 6  
ATOM 7174  H HG13 . VAL A 1 74 ? 6.155   -1.190  -2.119  1.00 0.00 ? 74 VAL A HG13 6  
ATOM 7175  H HG21 . VAL A 1 74 ? 4.614   -3.316  -3.467  1.00 0.00 ? 74 VAL A HG21 6  
ATOM 7176  H HG22 . VAL A 1 74 ? 4.042   -2.456  -4.895  1.00 0.00 ? 74 VAL A HG22 6  
ATOM 7177  H HG23 . VAL A 1 74 ? 3.976   -1.680  -3.314  1.00 0.00 ? 74 VAL A HG23 6  
ATOM 7178  N N    . ILE A 1 75 ? 7.733   0.528   -6.000  1.00 0.00 ? 75 ILE A N    6  
ATOM 7179  C CA   . ILE A 1 75 ? 9.074   1.048   -6.240  1.00 0.00 ? 75 ILE A CA   6  
ATOM 7180  C C    . ILE A 1 75 ? 9.664   1.651   -4.970  1.00 0.00 ? 75 ILE A C    6  
ATOM 7181  O O    . ILE A 1 75 ? 9.197   2.684   -4.487  1.00 0.00 ? 75 ILE A O    6  
ATOM 7182  C CB   . ILE A 1 75 ? 9.074   2.116   -7.350  1.00 0.00 ? 75 ILE A CB   6  
ATOM 7183  C CG1  . ILE A 1 75 ? 8.304   1.615   -8.576  1.00 0.00 ? 75 ILE A CG1  6  
ATOM 7184  C CG2  . ILE A 1 75 ? 10.500  2.488   -7.727  1.00 0.00 ? 75 ILE A CG2  6  
ATOM 7185  C CD1  . ILE A 1 75 ? 7.233   2.572   -9.049  1.00 0.00 ? 75 ILE A CD1  6  
ATOM 7186  H H    . ILE A 1 75 ? 6.976   1.150   -5.979  1.00 0.00 ? 75 ILE A H    6  
ATOM 7187  H HA   . ILE A 1 75 ? 9.698   0.226   -6.559  1.00 0.00 ? 75 ILE A HA   6  
ATOM 7188  H HB   . ILE A 1 75 ? 8.588   3.000   -6.967  1.00 0.00 ? 75 ILE A HB   6  
ATOM 7189  H HG12 . ILE A 1 75 ? 8.996   1.463   -9.392  1.00 0.00 ? 75 ILE A HG12 6  
ATOM 7190  H HG13 . ILE A 1 75 ? 7.829   0.674   -8.336  1.00 0.00 ? 75 ILE A HG13 6  
ATOM 7191  H HG21 . ILE A 1 75 ? 11.163  1.671   -7.482  1.00 0.00 ? 75 ILE A HG21 6  
ATOM 7192  H HG22 . ILE A 1 75 ? 10.799  3.370   -7.178  1.00 0.00 ? 75 ILE A HG22 6  
ATOM 7193  H HG23 . ILE A 1 75 ? 10.553  2.689   -8.787  1.00 0.00 ? 75 ILE A HG23 6  
ATOM 7194  H HD11 . ILE A 1 75 ? 7.694   3.481   -9.406  1.00 0.00 ? 75 ILE A HD11 6  
ATOM 7195  H HD12 . ILE A 1 75 ? 6.569   2.803   -8.229  1.00 0.00 ? 75 ILE A HD12 6  
ATOM 7196  H HD13 . ILE A 1 75 ? 6.670   2.116   -9.850  1.00 0.00 ? 75 ILE A HD13 6  
ATOM 7197  N N    . ARG A 1 76 ? 10.691  1.001   -4.434  1.00 0.00 ? 76 ARG A N    6  
ATOM 7198  C CA   . ARG A 1 76 ? 11.345  1.475   -3.220  1.00 0.00 ? 76 ARG A CA   6  
ATOM 7199  C C    . ARG A 1 76 ? 12.113  2.765   -3.483  1.00 0.00 ? 76 ARG A C    6  
ATOM 7200  O O    . ARG A 1 76 ? 12.762  2.913   -4.519  1.00 0.00 ? 76 ARG A O    6  
ATOM 7201  C CB   . ARG A 1 76 ? 12.293  0.404   -2.676  1.00 0.00 ? 76 ARG A CB   6  
ATOM 7202  C CG   . ARG A 1 76 ? 12.317  0.328   -1.159  1.00 0.00 ? 76 ARG A CG   6  
ATOM 7203  C CD   . ARG A 1 76 ? 13.502  -0.485  -0.660  1.00 0.00 ? 76 ARG A CD   6  
ATOM 7204  N NE   . ARG A 1 76 ? 14.106  0.104   0.533   1.00 0.00 ? 76 ARG A NE   6  
ATOM 7205  C CZ   . ARG A 1 76 ? 15.332  -0.187  0.963   1.00 0.00 ? 76 ARG A CZ   6  
ATOM 7206  N NH1  . ARG A 1 76 ? 16.086  -1.055  0.301   1.00 0.00 ? 76 ARG A NH1  6  
ATOM 7207  N NH2  . ARG A 1 76 ? 15.805  0.394   2.058   1.00 0.00 ? 76 ARG A NH2  6  
ATOM 7208  H H    . ARG A 1 76 ? 11.018  0.184   -4.865  1.00 0.00 ? 76 ARG A H    6  
ATOM 7209  H HA   . ARG A 1 76 ? 10.578  1.670   -2.486  1.00 0.00 ? 76 ARG A HA   6  
ATOM 7210  H HB2  . ARG A 1 76 ? 11.987  -0.558  -3.058  1.00 0.00 ? 76 ARG A HB2  6  
ATOM 7211  H HB3  . ARG A 1 76 ? 13.294  0.617   -3.021  1.00 0.00 ? 76 ARG A HB3  6  
ATOM 7212  H HG2  . ARG A 1 76 ? 12.387  1.328   -0.758  1.00 0.00 ? 76 ARG A HG2  6  
ATOM 7213  H HG3  . ARG A 1 76 ? 11.404  -0.137  -0.816  1.00 0.00 ? 76 ARG A HG3  6  
ATOM 7214  H HD2  . ARG A 1 76 ? 13.164  -1.483  -0.425  1.00 0.00 ? 76 ARG A HD2  6  
ATOM 7215  H HD3  . ARG A 1 76 ? 14.245  -0.532  -1.443  1.00 0.00 ? 76 ARG A HD3  6  
ATOM 7216  H HE   . ARG A 1 76 ? 13.570  0.748   1.040   1.00 0.00 ? 76 ARG A HE   6  
ATOM 7217  H HH11 . ARG A 1 76 ? 15.737  -1.496  -0.525  1.00 0.00 ? 76 ARG A HH11 6  
ATOM 7218  H HH12 . ARG A 1 76 ? 17.007  -1.269  0.630   1.00 0.00 ? 76 ARG A HH12 6  
ATOM 7219  H HH21 . ARG A 1 76 ? 15.240  1.049   2.559   1.00 0.00 ? 76 ARG A HH21 6  
ATOM 7220  H HH22 . ARG A 1 76 ? 16.726  0.176   2.381   1.00 0.00 ? 76 ARG A HH22 6  
ATOM 7221  N N    . ILE A 1 77 ? 12.036  3.697   -2.539  1.00 0.00 ? 77 ILE A N    6  
ATOM 7222  C CA   . ILE A 1 77 ? 12.726  4.975   -2.669  1.00 0.00 ? 77 ILE A CA   6  
ATOM 7223  C C    . ILE A 1 77 ? 13.388  5.379   -1.357  1.00 0.00 ? 77 ILE A C    6  
ATOM 7224  O O    . ILE A 1 77 ? 12.822  6.142   -0.572  1.00 0.00 ? 77 ILE A O    6  
ATOM 7225  C CB   . ILE A 1 77 ? 11.759  6.093   -3.108  1.00 0.00 ? 77 ILE A CB   6  
ATOM 7226  C CG1  . ILE A 1 77 ? 10.494  6.072   -2.248  1.00 0.00 ? 77 ILE A CG1  6  
ATOM 7227  C CG2  . ILE A 1 77 ? 11.408  5.941   -4.580  1.00 0.00 ? 77 ILE A CG2  6  
ATOM 7228  C CD1  . ILE A 1 77 ? 9.972   7.450   -1.907  1.00 0.00 ? 77 ILE A CD1  6  
ATOM 7229  H H    . ILE A 1 77 ? 11.504  3.521   -1.735  1.00 0.00 ? 77 ILE A H    6  
ATOM 7230  H HA   . ILE A 1 77 ? 13.487  4.868   -3.427  1.00 0.00 ? 77 ILE A HA   6  
ATOM 7231  H HB   . ILE A 1 77 ? 12.259  7.041   -2.979  1.00 0.00 ? 77 ILE A HB   6  
ATOM 7232  H HG12 . ILE A 1 77 ? 9.715   5.544   -2.778  1.00 0.00 ? 77 ILE A HG12 6  
ATOM 7233  H HG13 . ILE A 1 77 ? 10.706  5.558   -1.321  1.00 0.00 ? 77 ILE A HG13 6  
ATOM 7234  H HG21 . ILE A 1 77 ? 10.920  6.840   -4.928  1.00 0.00 ? 77 ILE A HG21 6  
ATOM 7235  H HG22 . ILE A 1 77 ? 10.745  5.098   -4.708  1.00 0.00 ? 77 ILE A HG22 6  
ATOM 7236  H HG23 . ILE A 1 77 ? 12.311  5.777   -5.151  1.00 0.00 ? 77 ILE A HG23 6  
ATOM 7237  H HD11 . ILE A 1 77 ? 10.280  7.716   -0.907  1.00 0.00 ? 77 ILE A HD11 6  
ATOM 7238  H HD12 . ILE A 1 77 ? 8.893   7.451   -1.964  1.00 0.00 ? 77 ILE A HD12 6  
ATOM 7239  H HD13 . ILE A 1 77 ? 10.370  8.169   -2.609  1.00 0.00 ? 77 ILE A HD13 6  
ATOM 7240  N N    . GLY A 1 78 ? 14.590  4.863   -1.123  1.00 0.00 ? 78 GLY A N    6  
ATOM 7241  C CA   . GLY A 1 78 ? 15.310  5.181   0.096   1.00 0.00 ? 78 GLY A CA   6  
ATOM 7242  C C    . GLY A 1 78 ? 16.812  5.209   -0.108  1.00 0.00 ? 78 GLY A C    6  
ATOM 7243  O O    . GLY A 1 78 ? 17.339  4.522   -0.984  1.00 0.00 ? 78 GLY A O    6  
ATOM 7244  H H    . GLY A 1 78 ? 14.991  4.261   -1.785  1.00 0.00 ? 78 GLY A H    6  
ATOM 7245  H HA2  . GLY A 1 78 ? 14.988  6.149   0.449   1.00 0.00 ? 78 GLY A HA2  6  
ATOM 7246  H HA3  . GLY A 1 78 ? 15.074  4.439   0.844   1.00 0.00 ? 78 GLY A HA3  6  
ATOM 7247  N N    . SER A 1 79 ? 17.502  6.006   0.700   1.00 0.00 ? 79 SER A N    6  
ATOM 7248  C CA   . SER A 1 79 ? 18.954  6.122   0.604   1.00 0.00 ? 79 SER A CA   6  
ATOM 7249  C C    . SER A 1 79 ? 19.609  5.892   1.961   1.00 0.00 ? 79 SER A C    6  
ATOM 7250  O O    . SER A 1 79 ? 18.995  6.115   3.004   1.00 0.00 ? 79 SER A O    6  
ATOM 7251  C CB   . SER A 1 79 ? 19.341  7.499   0.064   1.00 0.00 ? 79 SER A CB   6  
ATOM 7252  O OG   . SER A 1 79 ? 19.482  7.473   -1.346  1.00 0.00 ? 79 SER A OG   6  
ATOM 7253  H H    . SER A 1 79 ? 17.026  6.528   1.377   1.00 0.00 ? 79 SER A H    6  
ATOM 7254  H HA   . SER A 1 79 ? 19.301  5.364   -0.083  1.00 0.00 ? 79 SER A HA   6  
ATOM 7255  H HB2  . SER A 1 79 ? 18.574  8.213   0.322   1.00 0.00 ? 79 SER A HB2  6  
ATOM 7256  H HB3  . SER A 1 79 ? 20.280  7.804   0.502   1.00 0.00 ? 79 SER A HB3  6  
ATOM 7257  H HG   . SER A 1 79 ? 20.170  6.848   -1.588  1.00 0.00 ? 79 SER A HG   6  
ATOM 7258  N N    . GLY A 1 80 ? 20.860  5.444   1.940   1.00 0.00 ? 80 GLY A N    6  
ATOM 7259  C CA   . GLY A 1 80 ? 21.579  5.192   3.176   1.00 0.00 ? 80 GLY A CA   6  
ATOM 7260  C C    . GLY A 1 80 ? 22.220  3.818   3.206   1.00 0.00 ? 80 GLY A C    6  
ATOM 7261  O O    . GLY A 1 80 ? 23.446  3.703   3.211   1.00 0.00 ? 80 GLY A O    6  
ATOM 7262  H H    . GLY A 1 80 ? 21.300  5.285   1.079   1.00 0.00 ? 80 GLY A H    6  
ATOM 7263  H HA2  . GLY A 1 80 ? 22.350  5.940   3.289   1.00 0.00 ? 80 GLY A HA2  6  
ATOM 7264  H HA3  . GLY A 1 80 ? 20.890  5.274   4.004   1.00 0.00 ? 80 GLY A HA3  6  
ATOM 7265  N N    . PRO A 1 81 ? 21.410  2.745   3.228   1.00 0.00 ? 81 PRO A N    6  
ATOM 7266  C CA   . PRO A 1 81 ? 21.920  1.371   3.258   1.00 0.00 ? 81 PRO A CA   6  
ATOM 7267  C C    . PRO A 1 81 ? 22.572  0.965   1.941   1.00 0.00 ? 81 PRO A C    6  
ATOM 7268  O O    . PRO A 1 81 ? 22.100  1.330   0.864   1.00 0.00 ? 81 PRO A O    6  
ATOM 7269  C CB   . PRO A 1 81 ? 20.667  0.532   3.516   1.00 0.00 ? 81 PRO A CB   6  
ATOM 7270  C CG   . PRO A 1 81 ? 19.545  1.356   2.988   1.00 0.00 ? 81 PRO A CG   6  
ATOM 7271  C CD   . PRO A 1 81 ? 19.936  2.789   3.224   1.00 0.00 ? 81 PRO A CD   6  
ATOM 7272  H HA   . PRO A 1 81 ? 22.625  1.228   4.065   1.00 0.00 ? 81 PRO A HA   6  
ATOM 7273  H HB2  . PRO A 1 81 ? 20.746  -0.410  2.994   1.00 0.00 ? 81 PRO A HB2  6  
ATOM 7274  H HB3  . PRO A 1 81 ? 20.561  0.354   4.576   1.00 0.00 ? 81 PRO A HB3  6  
ATOM 7275  H HG2  . PRO A 1 81 ? 19.418  1.171   1.932   1.00 0.00 ? 81 PRO A HG2  6  
ATOM 7276  H HG3  . PRO A 1 81 ? 18.635  1.124   3.522   1.00 0.00 ? 81 PRO A HG3  6  
ATOM 7277  H HD2  . PRO A 1 81 ? 19.571  3.417   2.425   1.00 0.00 ? 81 PRO A HD2  6  
ATOM 7278  H HD3  . PRO A 1 81 ? 19.559  3.131   4.177   1.00 0.00 ? 81 PRO A HD3  6  
ATOM 7279  N N    . SER A 1 82 ? 23.659  0.205   2.033   1.00 0.00 ? 82 SER A N    6  
ATOM 7280  C CA   . SER A 1 82 ? 24.375  -0.252  0.847   1.00 0.00 ? 82 SER A CA   6  
ATOM 7281  C C    . SER A 1 82 ? 25.121  -1.552  1.131   1.00 0.00 ? 82 SER A C    6  
ATOM 7282  O O    . SER A 1 82 ? 24.877  -2.573  0.489   1.00 0.00 ? 82 SER A O    6  
ATOM 7283  C CB   . SER A 1 82 ? 25.355  0.823   0.372   1.00 0.00 ? 82 SER A CB   6  
ATOM 7284  O OG   . SER A 1 82 ? 24.845  1.516   -0.753  1.00 0.00 ? 82 SER A OG   6  
ATOM 7285  H H    . SER A 1 82 ? 23.987  -0.055  2.920   1.00 0.00 ? 82 SER A H    6  
ATOM 7286  H HA   . SER A 1 82 ? 23.647  -0.431  0.070   1.00 0.00 ? 82 SER A HA   6  
ATOM 7287  H HB2  . SER A 1 82 ? 25.523  1.532   1.170   1.00 0.00 ? 82 SER A HB2  6  
ATOM 7288  H HB3  . SER A 1 82 ? 26.292  0.360   0.100   1.00 0.00 ? 82 SER A HB3  6  
ATOM 7289  H HG   . SER A 1 82 ? 24.793  0.916   -1.501  1.00 0.00 ? 82 SER A HG   6  
ATOM 7290  N N    . SER A 1 83 ? 26.034  -1.506  2.095   1.00 0.00 ? 83 SER A N    6  
ATOM 7291  C CA   . SER A 1 83 ? 26.817  -2.680  2.463   1.00 0.00 ? 83 SER A CA   6  
ATOM 7292  C C    . SER A 1 83 ? 26.319  -3.280  3.775   1.00 0.00 ? 83 SER A C    6  
ATOM 7293  O O    . SER A 1 83 ? 25.508  -2.675  4.476   1.00 0.00 ? 83 SER A O    6  
ATOM 7294  C CB   . SER A 1 83 ? 28.297  -2.315  2.587   1.00 0.00 ? 83 SER A CB   6  
ATOM 7295  O OG   . SER A 1 83 ? 28.983  -2.542  1.367   1.00 0.00 ? 83 SER A OG   6  
ATOM 7296  H H    . SER A 1 83 ? 26.185  -0.663  2.573   1.00 0.00 ? 83 SER A H    6  
ATOM 7297  H HA   . SER A 1 83 ? 26.702  -3.414  1.680   1.00 0.00 ? 83 SER A HA   6  
ATOM 7298  H HB2  . SER A 1 83 ? 28.387  -1.271  2.846   1.00 0.00 ? 83 SER A HB2  6  
ATOM 7299  H HB3  . SER A 1 83 ? 28.752  -2.917  3.359   1.00 0.00 ? 83 SER A HB3  6  
ATOM 7300  H HG   . SER A 1 83 ? 29.320  -3.440  1.352   1.00 0.00 ? 83 SER A HG   6  
ATOM 7301  N N    . GLY A 1 84 ? 26.809  -4.471  4.099   1.00 0.00 ? 84 GLY A N    6  
ATOM 7302  C CA   . GLY A 1 84 ? 26.403  -5.132  5.326   1.00 0.00 ? 84 GLY A CA   6  
ATOM 7303  C C    . GLY A 1 84 ? 27.018  -6.510  5.473   1.00 0.00 ? 84 GLY A C    6  
ATOM 7304  O O    . GLY A 1 84 ? 28.024  -6.637  6.202   1.00 0.00 ? 84 GLY A O    6  
ATOM 7305  O OXT  . GLY A 1 84 ? 26.492  -7.462  4.861   1.00 0.00 ? 84 GLY A OXT  6  
ATOM 7306  H H    . GLY A 1 84 ? 27.453  -4.905  3.501   1.00 0.00 ? 84 GLY A H    6  
ATOM 7307  H HA2  . GLY A 1 84 ? 26.705  -4.524  6.165   1.00 0.00 ? 84 GLY A HA2  6  
ATOM 7308  H HA3  . GLY A 1 84 ? 25.328  -5.227  5.331   1.00 0.00 ? 84 GLY A HA3  6  
ATOM 7309  N N    . GLY A 1 1  ? 6.815   -8.228  -13.296 1.00 0.00 ? 1  GLY A N    7  
ATOM 7310  C CA   . GLY A 1 1  ? 8.250   -7.840  -13.389 1.00 0.00 ? 1  GLY A CA   7  
ATOM 7311  C C    . GLY A 1 1  ? 8.839   -7.460  -12.044 1.00 0.00 ? 1  GLY A C    7  
ATOM 7312  O O    . GLY A 1 1  ? 8.340   -6.555  -11.374 1.00 0.00 ? 1  GLY A O    7  
ATOM 7313  H H1   . GLY A 1 1  ? 6.684   -9.199  -13.649 1.00 0.00 ? 1  GLY A H1   7  
ATOM 7314  H H2   . GLY A 1 1  ? 6.232   -7.583  -13.866 1.00 0.00 ? 1  GLY A H2   7  
ATOM 7315  H H3   . GLY A 1 1  ? 6.495   -8.184  -12.307 1.00 0.00 ? 1  GLY A H3   7  
ATOM 7316  H HA2  . GLY A 1 1  ? 8.811   -8.670  -13.793 1.00 0.00 ? 1  GLY A HA2  7  
ATOM 7317  H HA3  . GLY A 1 1  ? 8.341   -6.999  -14.059 1.00 0.00 ? 1  GLY A HA3  7  
ATOM 7318  N N    . SER A 1 2  ? 9.901   -8.153  -11.647 1.00 0.00 ? 2  SER A N    7  
ATOM 7319  C CA   . SER A 1 2  ? 10.559  -7.883  -10.374 1.00 0.00 ? 2  SER A CA   7  
ATOM 7320  C C    . SER A 1 2  ? 11.908  -7.205  -10.590 1.00 0.00 ? 2  SER A C    7  
ATOM 7321  O O    . SER A 1 2  ? 12.863  -7.834  -11.045 1.00 0.00 ? 2  SER A O    7  
ATOM 7322  C CB   . SER A 1 2  ? 10.747  -9.183  -9.588  1.00 0.00 ? 2  SER A CB   7  
ATOM 7323  O OG   . SER A 1 2  ? 9.498   -9.769  -9.263  1.00 0.00 ? 2  SER A OG   7  
ATOM 7324  H H    . SER A 1 2  ? 10.252  -8.862  -12.226 1.00 0.00 ? 2  SER A H    7  
ATOM 7325  H HA   . SER A 1 2  ? 9.923   -7.220  -9.807  1.00 0.00 ? 2  SER A HA   7  
ATOM 7326  H HB2  . SER A 1 2  ? 11.313  -9.882  -10.186 1.00 0.00 ? 2  SER A HB2  7  
ATOM 7327  H HB3  . SER A 1 2  ? 11.283  -8.973  -8.674  1.00 0.00 ? 2  SER A HB3  7  
ATOM 7328  H HG   . SER A 1 2  ? 8.904   -9.092  -8.930  1.00 0.00 ? 2  SER A HG   7  
ATOM 7329  N N    . SER A 1 3  ? 11.977  -5.920  -10.260 1.00 0.00 ? 3  SER A N    7  
ATOM 7330  C CA   . SER A 1 3  ? 13.210  -5.157  -10.418 1.00 0.00 ? 3  SER A CA   7  
ATOM 7331  C C    . SER A 1 3  ? 13.857  -4.881  -9.065  1.00 0.00 ? 3  SER A C    7  
ATOM 7332  O O    . SER A 1 3  ? 15.080  -4.794  -8.957  1.00 0.00 ? 3  SER A O    7  
ATOM 7333  C CB   . SER A 1 3  ? 12.928  -3.837  -11.139 1.00 0.00 ? 3  SER A CB   7  
ATOM 7334  O OG   . SER A 1 3  ? 12.466  -4.065  -12.460 1.00 0.00 ? 3  SER A OG   7  
ATOM 7335  H H    . SER A 1 3  ? 11.182  -5.474  -9.903  1.00 0.00 ? 3  SER A H    7  
ATOM 7336  H HA   . SER A 1 3  ? 13.889  -5.745  -11.016 1.00 0.00 ? 3  SER A HA   7  
ATOM 7337  H HB2  . SER A 1 3  ? 12.173  -3.287  -10.598 1.00 0.00 ? 3  SER A HB2  7  
ATOM 7338  H HB3  . SER A 1 3  ? 13.836  -3.253  -11.185 1.00 0.00 ? 3  SER A HB3  7  
ATOM 7339  H HG   . SER A 1 3  ? 13.022  -4.724  -12.884 1.00 0.00 ? 3  SER A HG   7  
ATOM 7340  N N    . GLY A 1 4  ? 13.028  -4.746  -8.036  1.00 0.00 ? 4  GLY A N    7  
ATOM 7341  C CA   . GLY A 1 4  ? 13.538  -4.483  -6.703  1.00 0.00 ? 4  GLY A CA   7  
ATOM 7342  C C    . GLY A 1 4  ? 12.438  -4.431  -5.661  1.00 0.00 ? 4  GLY A C    7  
ATOM 7343  O O    . GLY A 1 4  ? 12.343  -3.472  -4.895  1.00 0.00 ? 4  GLY A O    7  
ATOM 7344  H H    . GLY A 1 4  ? 12.062  -4.825  -8.182  1.00 0.00 ? 4  GLY A H    7  
ATOM 7345  H HA2  . GLY A 1 4  ? 14.235  -5.262  -6.435  1.00 0.00 ? 4  GLY A HA2  7  
ATOM 7346  H HA3  . GLY A 1 4  ? 14.057  -3.536  -6.709  1.00 0.00 ? 4  GLY A HA3  7  
ATOM 7347  N N    . SER A 1 5  ? 11.604  -5.466  -5.631  1.00 0.00 ? 5  SER A N    7  
ATOM 7348  C CA   . SER A 1 5  ? 10.506  -5.535  -4.675  1.00 0.00 ? 5  SER A CA   7  
ATOM 7349  C C    . SER A 1 5  ? 10.042  -6.975  -4.483  1.00 0.00 ? 5  SER A C    7  
ATOM 7350  O O    . SER A 1 5  ? 9.279   -7.506  -5.292  1.00 0.00 ? 5  SER A O    7  
ATOM 7351  C CB   . SER A 1 5  ? 9.336   -4.668  -5.147  1.00 0.00 ? 5  SER A CB   7  
ATOM 7352  O OG   . SER A 1 5  ? 9.356   -3.399  -4.517  1.00 0.00 ? 5  SER A OG   7  
ATOM 7353  H H    . SER A 1 5  ? 11.731  -6.201  -6.268  1.00 0.00 ? 5  SER A H    7  
ATOM 7354  H HA   . SER A 1 5  ? 10.864  -5.157  -3.730  1.00 0.00 ? 5  SER A HA   7  
ATOM 7355  H HB2  . SER A 1 5  ? 9.403   -4.526  -6.215  1.00 0.00 ? 5  SER A HB2  7  
ATOM 7356  H HB3  . SER A 1 5  ? 8.404   -5.160  -4.907  1.00 0.00 ? 5  SER A HB3  7  
ATOM 7357  H HG   . SER A 1 5  ? 10.252  -3.054  -4.518  1.00 0.00 ? 5  SER A HG   7  
ATOM 7358  N N    . SER A 1 6  ? 10.508  -7.603  -3.409  1.00 0.00 ? 6  SER A N    7  
ATOM 7359  C CA   . SER A 1 6  ? 10.141  -8.983  -3.111  1.00 0.00 ? 6  SER A CA   7  
ATOM 7360  C C    . SER A 1 6  ? 10.362  -9.297  -1.635  1.00 0.00 ? 6  SER A C    7  
ATOM 7361  O O    . SER A 1 6  ? 10.672  -10.431 -1.271  1.00 0.00 ? 6  SER A O    7  
ATOM 7362  C CB   . SER A 1 6  ? 10.953  -9.947  -3.977  1.00 0.00 ? 6  SER A CB   7  
ATOM 7363  O OG   . SER A 1 6  ? 10.268  -10.256 -5.178  1.00 0.00 ? 6  SER A OG   7  
ATOM 7364  H H    . SER A 1 6  ? 11.112  -7.128  -2.802  1.00 0.00 ? 6  SER A H    7  
ATOM 7365  H HA   . SER A 1 6  ? 9.093   -9.103  -3.339  1.00 0.00 ? 6  SER A HA   7  
ATOM 7366  H HB2  . SER A 1 6  ? 11.902  -9.493  -4.225  1.00 0.00 ? 6  SER A HB2  7  
ATOM 7367  H HB3  . SER A 1 6  ? 11.125  -10.862 -3.429  1.00 0.00 ? 6  SER A HB3  7  
ATOM 7368  H HG   . SER A 1 6  ? 10.724  -10.967 -5.633  1.00 0.00 ? 6  SER A HG   7  
ATOM 7369  N N    . GLY A 1 7  ? 10.198  -8.285  -0.789  1.00 0.00 ? 7  GLY A N    7  
ATOM 7370  C CA   . GLY A 1 7  ? 10.384  -8.474  0.638   1.00 0.00 ? 7  GLY A CA   7  
ATOM 7371  C C    . GLY A 1 7  ? 10.493  -7.161  1.388   1.00 0.00 ? 7  GLY A C    7  
ATOM 7372  O O    . GLY A 1 7  ? 11.377  -6.990  2.228   1.00 0.00 ? 7  GLY A O    7  
ATOM 7373  H H    . GLY A 1 7  ? 9.950   -7.404  -1.136  1.00 0.00 ? 7  GLY A H    7  
ATOM 7374  H HA2  . GLY A 1 7  ? 9.544   -9.030  1.029   1.00 0.00 ? 7  GLY A HA2  7  
ATOM 7375  H HA3  . GLY A 1 7  ? 11.286  -9.045  0.800   1.00 0.00 ? 7  GLY A HA3  7  
ATOM 7376  N N    . LEU A 1 8  ? 9.595   -6.231  1.082   1.00 0.00 ? 8  LEU A N    7  
ATOM 7377  C CA   . LEU A 1 8  ? 9.595   -4.926  1.733   1.00 0.00 ? 8  LEU A CA   7  
ATOM 7378  C C    . LEU A 1 8  ? 9.248   -5.055  3.212   1.00 0.00 ? 8  LEU A C    7  
ATOM 7379  O O    . LEU A 1 8  ? 8.556   -5.988  3.619   1.00 0.00 ? 8  LEU A O    7  
ATOM 7380  C CB   . LEU A 1 8  ? 8.600   -3.989  1.043   1.00 0.00 ? 8  LEU A CB   7  
ATOM 7381  C CG   . LEU A 1 8  ? 8.741   -3.900  -0.477  1.00 0.00 ? 8  LEU A CG   7  
ATOM 7382  C CD1  . LEU A 1 8  ? 7.449   -3.399  -1.104  1.00 0.00 ? 8  LEU A CD1  7  
ATOM 7383  C CD2  . LEU A 1 8  ? 9.904   -2.993  -0.850  1.00 0.00 ? 8  LEU A CD2  7  
ATOM 7384  H H    . LEU A 1 8  ? 8.915   -6.427  0.403   1.00 0.00 ? 8  LEU A H    7  
ATOM 7385  H HA   . LEU A 1 8  ? 10.588  -4.511  1.643   1.00 0.00 ? 8  LEU A HA   7  
ATOM 7386  H HB2  . LEU A 1 8  ? 7.601   -4.330  1.273   1.00 0.00 ? 8  LEU A HB2  7  
ATOM 7387  H HB3  . LEU A 1 8  ? 8.727   -2.999  1.454   1.00 0.00 ? 8  LEU A HB3  7  
ATOM 7388  H HG   . LEU A 1 8  ? 8.944   -4.885  -0.871  1.00 0.00 ? 8  LEU A HG   7  
ATOM 7389  H HD11 . LEU A 1 8  ? 6.800   -4.237  -1.309  1.00 0.00 ? 8  LEU A HD11 7  
ATOM 7390  H HD12 . LEU A 1 8  ? 7.673   -2.883  -2.025  1.00 0.00 ? 8  LEU A HD12 7  
ATOM 7391  H HD13 . LEU A 1 8  ? 6.958   -2.721  -0.422  1.00 0.00 ? 8  LEU A HD13 7  
ATOM 7392  H HD21 . LEU A 1 8  ? 9.533   -2.001  -1.063  1.00 0.00 ? 8  LEU A HD21 7  
ATOM 7393  H HD22 . LEU A 1 8  ? 10.402  -3.387  -1.724  1.00 0.00 ? 8  LEU A HD22 7  
ATOM 7394  H HD23 . LEU A 1 8  ? 10.604  -2.947  -0.028  1.00 0.00 ? 8  LEU A HD23 7  
ATOM 7395  N N    . ARG A 1 9  ? 9.734   -4.112  4.013   1.00 0.00 ? 9  ARG A N    7  
ATOM 7396  C CA   . ARG A 1 9  ? 9.476   -4.121  5.449   1.00 0.00 ? 9  ARG A CA   7  
ATOM 7397  C C    . ARG A 1 9  ? 8.211   -3.334  5.779   1.00 0.00 ? 9  ARG A C    7  
ATOM 7398  O O    . ARG A 1 9  ? 7.489   -2.898  4.883   1.00 0.00 ? 9  ARG A O    7  
ATOM 7399  C CB   . ARG A 1 9  ? 10.668  -3.533  6.205   1.00 0.00 ? 9  ARG A CB   7  
ATOM 7400  C CG   . ARG A 1 9  ? 11.995  -4.183  5.850   1.00 0.00 ? 9  ARG A CG   7  
ATOM 7401  C CD   . ARG A 1 9  ? 12.289  -5.377  6.743   1.00 0.00 ? 9  ARG A CD   7  
ATOM 7402  N NE   . ARG A 1 9  ? 13.090  -5.006  7.907   1.00 0.00 ? 9  ARG A NE   7  
ATOM 7403  C CZ   . ARG A 1 9  ? 13.194  -5.752  9.004   1.00 0.00 ? 9  ARG A CZ   7  
ATOM 7404  N NH1  . ARG A 1 9  ? 12.549  -6.910  9.092   1.00 0.00 ? 9  ARG A NH1  7  
ATOM 7405  N NH2  . ARG A 1 9  ? 13.944  -5.341  10.017  1.00 0.00 ? 9  ARG A NH2  7  
ATOM 7406  H H    . ARG A 1 9  ? 10.279  -3.394  3.630   1.00 0.00 ? 9  ARG A H    7  
ATOM 7407  H HA   . ARG A 1 9  ? 9.337   -5.147  5.754   1.00 0.00 ? 9  ARG A HA   7  
ATOM 7408  H HB2  . ARG A 1 9  ? 10.736  -2.478  5.983   1.00 0.00 ? 9  ARG A HB2  7  
ATOM 7409  H HB3  . ARG A 1 9  ? 10.503  -3.658  7.265   1.00 0.00 ? 9  ARG A HB3  7  
ATOM 7410  H HG2  . ARG A 1 9  ? 11.958  -4.516  4.823   1.00 0.00 ? 9  ARG A HG2  7  
ATOM 7411  H HG3  . ARG A 1 9  ? 12.784  -3.454  5.966   1.00 0.00 ? 9  ARG A HG3  7  
ATOM 7412  H HD2  . ARG A 1 9  ? 11.352  -5.795  7.082   1.00 0.00 ? 9  ARG A HD2  7  
ATOM 7413  H HD3  . ARG A 1 9  ? 12.825  -6.118  6.168   1.00 0.00 ? 9  ARG A HD3  7  
ATOM 7414  H HE   . ARG A 1 9  ? 13.576  -4.156  7.869   1.00 0.00 ? 9  ARG A HE   7  
ATOM 7415  H HH11 . ARG A 1 9  ? 11.982  -7.226  8.332   1.00 0.00 ? 9  ARG A HH11 7  
ATOM 7416  H HH12 . ARG A 1 9  ? 12.632  -7.466  9.919   1.00 0.00 ? 9  ARG A HH12 7  
ATOM 7417  H HH21 . ARG A 1 9  ? 14.433  -4.470  9.956   1.00 0.00 ? 9  ARG A HH21 7  
ATOM 7418  H HH22 . ARG A 1 9  ? 14.022  -5.902  10.841  1.00 0.00 ? 9  ARG A HH22 7  
ATOM 7419  N N    . LEU A 1 10 ? 7.950   -3.158  7.069   1.00 0.00 ? 10 LEU A N    7  
ATOM 7420  C CA   . LEU A 1 10 ? 6.773   -2.424  7.519   1.00 0.00 ? 10 LEU A CA   7  
ATOM 7421  C C    . LEU A 1 10 ? 7.165   -1.066  8.093   1.00 0.00 ? 10 LEU A C    7  
ATOM 7422  O O    . LEU A 1 10 ? 7.338   -0.920  9.303   1.00 0.00 ? 10 LEU A O    7  
ATOM 7423  C CB   . LEU A 1 10 ? 6.011   -3.234  8.569   1.00 0.00 ? 10 LEU A CB   7  
ATOM 7424  C CG   . LEU A 1 10 ? 5.468   -4.578  8.081   1.00 0.00 ? 10 LEU A CG   7  
ATOM 7425  C CD1  . LEU A 1 10 ? 5.529   -5.615  9.192   1.00 0.00 ? 10 LEU A CD1  7  
ATOM 7426  C CD2  . LEU A 1 10 ? 4.041   -4.422  7.574   1.00 0.00 ? 10 LEU A CD2  7  
ATOM 7427  H H    . LEU A 1 10 ? 8.565   -3.530  7.737   1.00 0.00 ? 10 LEU A H    7  
ATOM 7428  H HA   . LEU A 1 10 ? 6.134   -2.268  6.662   1.00 0.00 ? 10 LEU A HA   7  
ATOM 7429  H HB2  . LEU A 1 10 ? 6.675   -3.418  9.402   1.00 0.00 ? 10 LEU A HB2  7  
ATOM 7430  H HB3  . LEU A 1 10 ? 5.180   -2.640  8.917   1.00 0.00 ? 10 LEU A HB3  7  
ATOM 7431  H HG   . LEU A 1 10 ? 6.078   -4.930  7.262   1.00 0.00 ? 10 LEU A HG   7  
ATOM 7432  H HD11 . LEU A 1 10 ? 4.732   -5.434  9.899   1.00 0.00 ? 10 LEU A HD11 7  
ATOM 7433  H HD12 . LEU A 1 10 ? 6.480   -5.545  9.698   1.00 0.00 ? 10 LEU A HD12 7  
ATOM 7434  H HD13 . LEU A 1 10 ? 5.417   -6.603  8.770   1.00 0.00 ? 10 LEU A HD13 7  
ATOM 7435  H HD21 . LEU A 1 10 ? 3.730   -5.337  7.091   1.00 0.00 ? 10 LEU A HD21 7  
ATOM 7436  H HD22 . LEU A 1 10 ? 3.998   -3.608  6.865   1.00 0.00 ? 10 LEU A HD22 7  
ATOM 7437  H HD23 . LEU A 1 10 ? 3.385   -4.212  8.404   1.00 0.00 ? 10 LEU A HD23 7  
ATOM 7438  N N    . GLY A 1 11 ? 7.303   -0.077  7.217   1.00 0.00 ? 11 GLY A N    7  
ATOM 7439  C CA   . GLY A 1 11 ? 7.674   1.256   7.655   1.00 0.00 ? 11 GLY A CA   7  
ATOM 7440  C C    . GLY A 1 11 ? 8.696   1.904   6.744   1.00 0.00 ? 11 GLY A C    7  
ATOM 7441  O O    . GLY A 1 11 ? 9.673   2.489   7.211   1.00 0.00 ? 11 GLY A O    7  
ATOM 7442  H H    . GLY A 1 11 ? 7.152   -0.253  6.264   1.00 0.00 ? 11 GLY A H    7  
ATOM 7443  H HA2  . GLY A 1 11 ? 6.788   1.873   7.681   1.00 0.00 ? 11 GLY A HA2  7  
ATOM 7444  H HA3  . GLY A 1 11 ? 8.085   1.193   8.653   1.00 0.00 ? 11 GLY A HA3  7  
ATOM 7445  N N    . ASP A 1 12 ? 8.471   1.799   5.438   1.00 0.00 ? 12 ASP A N    7  
ATOM 7446  C CA   . ASP A 1 12 ? 9.381   2.380   4.457   1.00 0.00 ? 12 ASP A CA   7  
ATOM 7447  C C    . ASP A 1 12 ? 8.609   3.144   3.386   1.00 0.00 ? 12 ASP A C    7  
ATOM 7448  O O    . ASP A 1 12 ? 7.551   2.705   2.937   1.00 0.00 ? 12 ASP A O    7  
ATOM 7449  C CB   . ASP A 1 12 ? 10.230  1.286   3.808   1.00 0.00 ? 12 ASP A CB   7  
ATOM 7450  C CG   . ASP A 1 12 ? 11.548  1.074   4.526   1.00 0.00 ? 12 ASP A CG   7  
ATOM 7451  O OD1  . ASP A 1 12 ? 12.281  2.065   4.725   1.00 0.00 ? 12 ASP A OD1  7  
ATOM 7452  O OD2  . ASP A 1 12 ? 11.847  -0.083  4.890   1.00 0.00 ? 12 ASP A OD2  7  
ATOM 7453  H H    . ASP A 1 12 ? 7.674   1.321   5.127   1.00 0.00 ? 12 ASP A H    7  
ATOM 7454  H HA   . ASP A 1 12 ? 10.031  3.069   4.975   1.00 0.00 ? 12 ASP A HA   7  
ATOM 7455  H HB2  . ASP A 1 12 ? 9.680   0.356   3.821   1.00 0.00 ? 12 ASP A HB2  7  
ATOM 7456  H HB3  . ASP A 1 12 ? 10.439  1.561   2.784   1.00 0.00 ? 12 ASP A HB3  7  
ATOM 7457  N N    . ARG A 1 13 ? 9.146   4.292   2.983   1.00 0.00 ? 13 ARG A N    7  
ATOM 7458  C CA   . ARG A 1 13 ? 8.507   5.118   1.965   1.00 0.00 ? 13 ARG A CA   7  
ATOM 7459  C C    . ARG A 1 13 ? 8.716   4.525   0.575   1.00 0.00 ? 13 ARG A C    7  
ATOM 7460  O O    . ARG A 1 13 ? 9.843   4.444   0.087   1.00 0.00 ? 13 ARG A O    7  
ATOM 7461  C CB   . ARG A 1 13 ? 9.059   6.544   2.018   1.00 0.00 ? 13 ARG A CB   7  
ATOM 7462  C CG   . ARG A 1 13 ? 8.066   7.559   2.562   1.00 0.00 ? 13 ARG A CG   7  
ATOM 7463  C CD   . ARG A 1 13 ? 8.730   8.535   3.520   1.00 0.00 ? 13 ARG A CD   7  
ATOM 7464  N NE   . ARG A 1 13 ? 7.855   8.891   4.633   1.00 0.00 ? 13 ARG A NE   7  
ATOM 7465  C CZ   . ARG A 1 13 ? 8.050   9.945   5.423   1.00 0.00 ? 13 ARG A CZ   7  
ATOM 7466  N NH1  . ARG A 1 13 ? 9.088   10.747  5.226   1.00 0.00 ? 13 ARG A NH1  7  
ATOM 7467  N NH2  . ARG A 1 13 ? 7.205   10.196  6.413   1.00 0.00 ? 13 ARG A NH2  7  
ATOM 7468  H H    . ARG A 1 13 ? 9.991   4.589   3.379   1.00 0.00 ? 13 ARG A H    7  
ATOM 7469  H HA   . ARG A 1 13 ? 7.448   5.142   2.177   1.00 0.00 ? 13 ARG A HA   7  
ATOM 7470  H HB2  . ARG A 1 13 ? 9.935   6.556   2.649   1.00 0.00 ? 13 ARG A HB2  7  
ATOM 7471  H HB3  . ARG A 1 13 ? 9.341   6.849   1.021   1.00 0.00 ? 13 ARG A HB3  7  
ATOM 7472  H HG2  . ARG A 1 13 ? 7.644   8.114   1.736   1.00 0.00 ? 13 ARG A HG2  7  
ATOM 7473  H HG3  . ARG A 1 13 ? 7.280   7.034   3.084   1.00 0.00 ? 13 ARG A HG3  7  
ATOM 7474  H HD2  . ARG A 1 13 ? 9.628   8.079   3.911   1.00 0.00 ? 13 ARG A HD2  7  
ATOM 7475  H HD3  . ARG A 1 13 ? 8.991   9.432   2.977   1.00 0.00 ? 13 ARG A HD3  7  
ATOM 7476  H HE   . ARG A 1 13 ? 7.081   8.315   4.802   1.00 0.00 ? 13 ARG A HE   7  
ATOM 7477  H HH11 . ARG A 1 13 ? 9.730   10.564  4.481   1.00 0.00 ? 13 ARG A HH11 7  
ATOM 7478  H HH12 . ARG A 1 13 ? 9.229   11.537  5.822   1.00 0.00 ? 13 ARG A HH12 7  
ATOM 7479  H HH21 . ARG A 1 13 ? 6.421   9.595   6.567   1.00 0.00 ? 13 ARG A HH21 7  
ATOM 7480  H HH22 . ARG A 1 13 ? 7.351   10.988  7.007   1.00 0.00 ? 13 ARG A HH22 7  
ATOM 7481  N N    . VAL A 1 14 ? 7.622   4.113   -0.058  1.00 0.00 ? 14 VAL A N    7  
ATOM 7482  C CA   . VAL A 1 14 ? 7.684   3.529   -1.391  1.00 0.00 ? 14 VAL A CA   7  
ATOM 7483  C C    . VAL A 1 14 ? 6.975   4.413   -2.411  1.00 0.00 ? 14 VAL A C    7  
ATOM 7484  O O    . VAL A 1 14 ? 6.438   5.466   -2.066  1.00 0.00 ? 14 VAL A O    7  
ATOM 7485  C CB   . VAL A 1 14 ? 7.052   2.125   -1.421  1.00 0.00 ? 14 VAL A CB   7  
ATOM 7486  C CG1  . VAL A 1 14 ? 7.955   1.116   -0.728  1.00 0.00 ? 14 VAL A CG1  7  
ATOM 7487  C CG2  . VAL A 1 14 ? 5.673   2.148   -0.779  1.00 0.00 ? 14 VAL A CG2  7  
ATOM 7488  H H    . VAL A 1 14 ? 6.751   4.205   0.384   1.00 0.00 ? 14 VAL A H    7  
ATOM 7489  H HA   . VAL A 1 14 ? 8.725   3.438   -1.669  1.00 0.00 ? 14 VAL A HA   7  
ATOM 7490  H HB   . VAL A 1 14 ? 6.939   1.824   -2.453  1.00 0.00 ? 14 VAL A HB   7  
ATOM 7491  H HG11 . VAL A 1 14 ? 7.785   1.153   0.337   1.00 0.00 ? 14 VAL A HG11 7  
ATOM 7492  H HG12 . VAL A 1 14 ? 8.987   1.354   -0.938  1.00 0.00 ? 14 VAL A HG12 7  
ATOM 7493  H HG13 . VAL A 1 14 ? 7.733   0.125   -1.094  1.00 0.00 ? 14 VAL A HG13 7  
ATOM 7494  H HG21 . VAL A 1 14 ? 5.243   1.158   -0.815  1.00 0.00 ? 14 VAL A HG21 7  
ATOM 7495  H HG22 . VAL A 1 14 ? 5.037   2.837   -1.314  1.00 0.00 ? 14 VAL A HG22 7  
ATOM 7496  H HG23 . VAL A 1 14 ? 5.761   2.463   0.251   1.00 0.00 ? 14 VAL A HG23 7  
ATOM 7497  N N    . LEU A 1 15 ? 6.979   3.981   -3.668  1.00 0.00 ? 15 LEU A N    7  
ATOM 7498  C CA   . LEU A 1 15 ? 6.336   4.734   -4.738  1.00 0.00 ? 15 LEU A CA   7  
ATOM 7499  C C    . LEU A 1 15 ? 5.238   3.909   -5.402  1.00 0.00 ? 15 LEU A C    7  
ATOM 7500  O O    . LEU A 1 15 ? 5.482   2.798   -5.872  1.00 0.00 ? 15 LEU A O    7  
ATOM 7501  C CB   . LEU A 1 15 ? 7.368   5.165   -5.781  1.00 0.00 ? 15 LEU A CB   7  
ATOM 7502  C CG   . LEU A 1 15 ? 6.946   6.341   -6.664  1.00 0.00 ? 15 LEU A CG   7  
ATOM 7503  C CD1  . LEU A 1 15 ? 6.610   7.553   -5.810  1.00 0.00 ? 15 LEU A CD1  7  
ATOM 7504  C CD2  . LEU A 1 15 ? 8.042   6.677   -7.663  1.00 0.00 ? 15 LEU A CD2  7  
ATOM 7505  H H    . LEU A 1 15 ? 7.424   3.134   -3.881  1.00 0.00 ? 15 LEU A H    7  
ATOM 7506  H HA   . LEU A 1 15 ? 5.890   5.616   -4.300  1.00 0.00 ? 15 LEU A HA   7  
ATOM 7507  H HB2  . LEU A 1 15 ? 8.278   5.438   -5.265  1.00 0.00 ? 15 LEU A HB2  7  
ATOM 7508  H HB3  . LEU A 1 15 ? 7.577   4.320   -6.420  1.00 0.00 ? 15 LEU A HB3  7  
ATOM 7509  H HG   . LEU A 1 15 ? 6.059   6.066   -7.217  1.00 0.00 ? 15 LEU A HG   7  
ATOM 7510  H HD11 . LEU A 1 15 ? 6.886   8.453   -6.340  1.00 0.00 ? 15 LEU A HD11 7  
ATOM 7511  H HD12 . LEU A 1 15 ? 7.156   7.501   -4.879  1.00 0.00 ? 15 LEU A HD12 7  
ATOM 7512  H HD13 . LEU A 1 15 ? 5.549   7.567   -5.605  1.00 0.00 ? 15 LEU A HD13 7  
ATOM 7513  H HD21 . LEU A 1 15 ? 8.724   7.390   -7.224  1.00 0.00 ? 15 LEU A HD21 7  
ATOM 7514  H HD22 . LEU A 1 15 ? 7.600   7.101   -8.553  1.00 0.00 ? 15 LEU A HD22 7  
ATOM 7515  H HD23 . LEU A 1 15 ? 8.580   5.777   -7.924  1.00 0.00 ? 15 LEU A HD23 7  
ATOM 7516  N N    . VAL A 1 16 ? 4.029   4.459   -5.436  1.00 0.00 ? 16 VAL A N    7  
ATOM 7517  C CA   . VAL A 1 16 ? 2.894   3.774   -6.044  1.00 0.00 ? 16 VAL A CA   7  
ATOM 7518  C C    . VAL A 1 16 ? 2.429   4.496   -7.304  1.00 0.00 ? 16 VAL A C    7  
ATOM 7519  O O    . VAL A 1 16 ? 2.302   5.721   -7.320  1.00 0.00 ? 16 VAL A O    7  
ATOM 7520  C CB   . VAL A 1 16 ? 1.711   3.665   -5.061  1.00 0.00 ? 16 VAL A CB   7  
ATOM 7521  C CG1  . VAL A 1 16 ? 0.592   2.823   -5.658  1.00 0.00 ? 16 VAL A CG1  7  
ATOM 7522  C CG2  . VAL A 1 16 ? 2.172   3.087   -3.731  1.00 0.00 ? 16 VAL A CG2  7  
ATOM 7523  H H    . VAL A 1 16 ? 3.897   5.348   -5.045  1.00 0.00 ? 16 VAL A H    7  
ATOM 7524  H HA   . VAL A 1 16 ? 3.209   2.775   -6.307  1.00 0.00 ? 16 VAL A HA   7  
ATOM 7525  H HB   . VAL A 1 16 ? 1.326   4.659   -4.882  1.00 0.00 ? 16 VAL A HB   7  
ATOM 7526  H HG11 . VAL A 1 16 ? 0.789   2.651   -6.706  1.00 0.00 ? 16 VAL A HG11 7  
ATOM 7527  H HG12 . VAL A 1 16 ? -0.347  3.346   -5.550  1.00 0.00 ? 16 VAL A HG12 7  
ATOM 7528  H HG13 . VAL A 1 16 ? 0.537   1.877   -5.141  1.00 0.00 ? 16 VAL A HG13 7  
ATOM 7529  H HG21 . VAL A 1 16 ? 3.236   3.235   -3.622  1.00 0.00 ? 16 VAL A HG21 7  
ATOM 7530  H HG22 . VAL A 1 16 ? 1.951   2.031   -3.702  1.00 0.00 ? 16 VAL A HG22 7  
ATOM 7531  H HG23 . VAL A 1 16 ? 1.655   3.585   -2.923  1.00 0.00 ? 16 VAL A HG23 7  
ATOM 7532  N N    . GLY A 1 17 ? 2.176   3.729   -8.359  1.00 0.00 ? 17 GLY A N    7  
ATOM 7533  C CA   . GLY A 1 17 ? 1.729   4.313   -9.611  1.00 0.00 ? 17 GLY A CA   7  
ATOM 7534  C C    . GLY A 1 17 ? 2.766   5.229   -10.231 1.00 0.00 ? 17 GLY A C    7  
ATOM 7535  O O    . GLY A 1 17 ? 2.434   6.096   -11.040 1.00 0.00 ? 17 GLY A O    7  
ATOM 7536  H H    . GLY A 1 17 ? 2.296   2.759   -8.289  1.00 0.00 ? 17 GLY A H    7  
ATOM 7537  H HA2  . GLY A 1 17 ? 1.506   3.517   -10.306 1.00 0.00 ? 17 GLY A HA2  7  
ATOM 7538  H HA3  . GLY A 1 17 ? 0.828   4.880   -9.429  1.00 0.00 ? 17 GLY A HA3  7  
ATOM 7539  N N    . GLY A 1 18 ? 4.028   5.038   -9.854  1.00 0.00 ? 18 GLY A N    7  
ATOM 7540  C CA   . GLY A 1 18 ? 5.096   5.862   -10.390 1.00 0.00 ? 18 GLY A CA   7  
ATOM 7541  C C    . GLY A 1 18 ? 4.877   7.341   -10.133 1.00 0.00 ? 18 GLY A C    7  
ATOM 7542  O O    . GLY A 1 18 ? 5.148   8.174   -10.998 1.00 0.00 ? 18 GLY A O    7  
ATOM 7543  H H    . GLY A 1 18 ? 4.235   4.331   -9.208  1.00 0.00 ? 18 GLY A H    7  
ATOM 7544  H HA2  . GLY A 1 18 ? 6.029   5.563   -9.935  1.00 0.00 ? 18 GLY A HA2  7  
ATOM 7545  H HA3  . GLY A 1 18 ? 5.160   5.699   -11.456 1.00 0.00 ? 18 GLY A HA3  7  
ATOM 7546  N N    . THR A 1 19 ? 4.386   7.667   -8.943  1.00 0.00 ? 19 THR A N    7  
ATOM 7547  C CA   . THR A 1 19 ? 4.132   9.056   -8.576  1.00 0.00 ? 19 THR A CA   7  
ATOM 7548  C C    . THR A 1 19 ? 3.642   9.159   -7.133  1.00 0.00 ? 19 THR A C    7  
ATOM 7549  O O    . THR A 1 19 ? 4.257   9.832   -6.306  1.00 0.00 ? 19 THR A O    7  
ATOM 7550  C CB   . THR A 1 19 ? 3.101   9.677   -9.524  1.00 0.00 ? 19 THR A CB   7  
ATOM 7551  O OG1  . THR A 1 19 ? 2.433   8.675   -10.269 1.00 0.00 ? 19 THR A OG1  7  
ATOM 7552  C CG2  . THR A 1 19 ? 3.706   10.654  -10.508 1.00 0.00 ? 19 THR A CG2  7  
ATOM 7553  H H    . THR A 1 19 ? 4.190   6.958   -8.295  1.00 0.00 ? 19 THR A H    7  
ATOM 7554  H HA   . THR A 1 19 ? 5.061   9.597   -8.666  1.00 0.00 ? 19 THR A HA   7  
ATOM 7555  H HB   . THR A 1 19 ? 2.364   10.211  -8.939  1.00 0.00 ? 19 THR A HB   7  
ATOM 7556  H HG1  . THR A 1 19 ? 1.858   8.173   -9.688  1.00 0.00 ? 19 THR A HG1  7  
ATOM 7557  H HG21 . THR A 1 19 ? 4.512   11.192  -10.031 1.00 0.00 ? 19 THR A HG21 7  
ATOM 7558  H HG22 . THR A 1 19 ? 2.950   11.352  -10.835 1.00 0.00 ? 19 THR A HG22 7  
ATOM 7559  H HG23 . THR A 1 19 ? 4.090   10.114  -11.360 1.00 0.00 ? 19 THR A HG23 7  
ATOM 7560  N N    . LYS A 1 20 ? 2.533   8.488   -6.841  1.00 0.00 ? 20 LYS A N    7  
ATOM 7561  C CA   . LYS A 1 20 ? 1.960   8.504   -5.499  1.00 0.00 ? 20 LYS A CA   7  
ATOM 7562  C C    . LYS A 1 20 ? 2.949   7.956   -4.476  1.00 0.00 ? 20 LYS A C    7  
ATOM 7563  O O    . LYS A 1 20 ? 3.222   6.756   -4.442  1.00 0.00 ? 20 LYS A O    7  
ATOM 7564  C CB   . LYS A 1 20 ? 0.668   7.686   -5.465  1.00 0.00 ? 20 LYS A CB   7  
ATOM 7565  C CG   . LYS A 1 20 ? -0.411  8.216   -6.396  1.00 0.00 ? 20 LYS A CG   7  
ATOM 7566  C CD   . LYS A 1 20 ? -1.180  7.083   -7.062  1.00 0.00 ? 20 LYS A CD   7  
ATOM 7567  C CE   . LYS A 1 20 ? -2.682  7.261   -6.905  1.00 0.00 ? 20 LYS A CE   7  
ATOM 7568  N NZ   . LYS A 1 20 ? -3.227  6.428   -5.797  1.00 0.00 ? 20 LYS A NZ   7  
ATOM 7569  H H    . LYS A 1 20 ? 2.088   7.970   -7.544  1.00 0.00 ? 20 LYS A H    7  
ATOM 7570  H HA   . LYS A 1 20 ? 1.733   9.530   -5.249  1.00 0.00 ? 20 LYS A HA   7  
ATOM 7571  H HB2  . LYS A 1 20 ? 0.893   6.669   -5.749  1.00 0.00 ? 20 LYS A HB2  7  
ATOM 7572  H HB3  . LYS A 1 20 ? 0.279   7.693   -4.458  1.00 0.00 ? 20 LYS A HB3  7  
ATOM 7573  H HG2  . LYS A 1 20 ? -1.100  8.820   -5.825  1.00 0.00 ? 20 LYS A HG2  7  
ATOM 7574  H HG3  . LYS A 1 20 ? 0.053   8.821   -7.161  1.00 0.00 ? 20 LYS A HG3  7  
ATOM 7575  H HD2  . LYS A 1 20 ? -0.939  7.068   -8.114  1.00 0.00 ? 20 LYS A HD2  7  
ATOM 7576  H HD3  . LYS A 1 20 ? -0.888  6.147   -6.609  1.00 0.00 ? 20 LYS A HD3  7  
ATOM 7577  H HE2  . LYS A 1 20 ? -2.889  8.301   -6.697  1.00 0.00 ? 20 LYS A HE2  7  
ATOM 7578  H HE3  . LYS A 1 20 ? -3.164  6.977   -7.829  1.00 0.00 ? 20 LYS A HE3  7  
ATOM 7579  H HZ1  . LYS A 1 20 ? -3.513  5.495   -6.159  1.00 0.00 ? 20 LYS A HZ1  7  
ATOM 7580  H HZ2  . LYS A 1 20 ? -4.057  6.892   -5.376  1.00 0.00 ? 20 LYS A HZ2  7  
ATOM 7581  H HZ3  . LYS A 1 20 ? -2.505  6.297   -5.060  1.00 0.00 ? 20 LYS A HZ3  7  
ATOM 7582  N N    . THR A 1 21 ? 3.483   8.842   -3.641  1.00 0.00 ? 21 THR A N    7  
ATOM 7583  C CA   . THR A 1 21 ? 4.440   8.446   -2.616  1.00 0.00 ? 21 THR A CA   7  
ATOM 7584  C C    . THR A 1 21 ? 3.727   8.082   -1.318  1.00 0.00 ? 21 THR A C    7  
ATOM 7585  O O    . THR A 1 21 ? 2.994   8.893   -0.752  1.00 0.00 ? 21 THR A O    7  
ATOM 7586  C CB   . THR A 1 21 ? 5.443   9.572   -2.360  1.00 0.00 ? 21 THR A CB   7  
ATOM 7587  O OG1  . THR A 1 21 ? 4.815   10.666  -1.715  1.00 0.00 ? 21 THR A OG1  7  
ATOM 7588  C CG2  . THR A 1 21 ? 6.090   10.095  -3.624  1.00 0.00 ? 21 THR A CG2  7  
ATOM 7589  H H    . THR A 1 21 ? 3.225   9.784   -3.716  1.00 0.00 ? 21 THR A H    7  
ATOM 7590  H HA   . THR A 1 21 ? 4.972   7.578   -2.975  1.00 0.00 ? 21 THR A HA   7  
ATOM 7591  H HB   . THR A 1 21 ? 6.227   9.203   -1.715  1.00 0.00 ? 21 THR A HB   7  
ATOM 7592  H HG1  . THR A 1 21 ? 4.177   11.066  -2.310  1.00 0.00 ? 21 THR A HG1  7  
ATOM 7593  H HG21 . THR A 1 21 ? 6.822   9.383   -3.974  1.00 0.00 ? 21 THR A HG21 7  
ATOM 7594  H HG22 . THR A 1 21 ? 6.574   11.038  -3.418  1.00 0.00 ? 21 THR A HG22 7  
ATOM 7595  H HG23 . THR A 1 21 ? 5.335   10.237  -4.383  1.00 0.00 ? 21 THR A HG23 7  
ATOM 7596  N N    . GLY A 1 22 ? 3.945   6.856   -0.851  1.00 0.00 ? 22 GLY A N    7  
ATOM 7597  C CA   . GLY A 1 22 ? 3.315   6.408   0.377   1.00 0.00 ? 22 GLY A CA   7  
ATOM 7598  C C    . GLY A 1 22 ? 4.167   5.411   1.137   1.00 0.00 ? 22 GLY A C    7  
ATOM 7599  O O    . GLY A 1 22 ? 5.006   4.726   0.550   1.00 0.00 ? 22 GLY A O    7  
ATOM 7600  H H    . GLY A 1 22 ? 4.538   6.253   -1.344  1.00 0.00 ? 22 GLY A H    7  
ATOM 7601  H HA2  . GLY A 1 22 ? 3.133   7.264   1.009   1.00 0.00 ? 22 GLY A HA2  7  
ATOM 7602  H HA3  . GLY A 1 22 ? 2.369   5.945   0.135   1.00 0.00 ? 22 GLY A HA3  7  
ATOM 7603  N N    . VAL A 1 23 ? 3.954   5.329   2.446   1.00 0.00 ? 23 VAL A N    7  
ATOM 7604  C CA   . VAL A 1 23 ? 4.710   4.410   3.289   1.00 0.00 ? 23 VAL A CA   7  
ATOM 7605  C C    . VAL A 1 23 ? 4.013   3.055   3.383   1.00 0.00 ? 23 VAL A C    7  
ATOM 7606  O O    . VAL A 1 23 ? 2.792   2.982   3.517   1.00 0.00 ? 23 VAL A O    7  
ATOM 7607  C CB   . VAL A 1 23 ? 4.903   4.976   4.708   1.00 0.00 ? 23 VAL A CB   7  
ATOM 7608  C CG1  . VAL A 1 23 ? 5.831   4.083   5.521   1.00 0.00 ? 23 VAL A CG1  7  
ATOM 7609  C CG2  . VAL A 1 23 ? 5.439   6.399   4.650   1.00 0.00 ? 23 VAL A CG2  7  
ATOM 7610  H H    . VAL A 1 23 ? 3.273   5.902   2.855   1.00 0.00 ? 23 VAL A H    7  
ATOM 7611  H HA   . VAL A 1 23 ? 5.684   4.271   2.842   1.00 0.00 ? 23 VAL A HA   7  
ATOM 7612  H HB   . VAL A 1 23 ? 3.941   4.997   5.200   1.00 0.00 ? 23 VAL A HB   7  
ATOM 7613  H HG11 . VAL A 1 23 ? 6.816   4.522   5.553   1.00 0.00 ? 23 VAL A HG11 7  
ATOM 7614  H HG12 . VAL A 1 23 ? 5.886   3.108   5.060   1.00 0.00 ? 23 VAL A HG12 7  
ATOM 7615  H HG13 . VAL A 1 23 ? 5.446   3.986   6.525   1.00 0.00 ? 23 VAL A HG13 7  
ATOM 7616  H HG21 . VAL A 1 23 ? 6.503   6.391   4.836   1.00 0.00 ? 23 VAL A HG21 7  
ATOM 7617  H HG22 . VAL A 1 23 ? 4.948   7.000   5.400   1.00 0.00 ? 23 VAL A HG22 7  
ATOM 7618  H HG23 . VAL A 1 23 ? 5.248   6.816   3.673   1.00 0.00 ? 23 VAL A HG23 7  
ATOM 7619  N N    . VAL A 1 24 ? 4.799   1.985   3.313   1.00 0.00 ? 24 VAL A N    7  
ATOM 7620  C CA   . VAL A 1 24 ? 4.259   0.633   3.393   1.00 0.00 ? 24 VAL A CA   7  
ATOM 7621  C C    . VAL A 1 24 ? 3.658   0.361   4.767   1.00 0.00 ? 24 VAL A C    7  
ATOM 7622  O O    . VAL A 1 24 ? 4.324   0.523   5.790   1.00 0.00 ? 24 VAL A O    7  
ATOM 7623  C CB   . VAL A 1 24 ? 5.341   -0.423  3.101   1.00 0.00 ? 24 VAL A CB   7  
ATOM 7624  C CG1  . VAL A 1 24 ? 4.721   -1.807  2.990   1.00 0.00 ? 24 VAL A CG1  7  
ATOM 7625  C CG2  . VAL A 1 24 ? 6.104   -0.070  1.833   1.00 0.00 ? 24 VAL A CG2  7  
ATOM 7626  H H    . VAL A 1 24 ? 5.766   2.107   3.207   1.00 0.00 ? 24 VAL A H    7  
ATOM 7627  H HA   . VAL A 1 24 ? 3.483   0.540   2.647   1.00 0.00 ? 24 VAL A HA   7  
ATOM 7628  H HB   . VAL A 1 24 ? 6.039   -0.430  3.924   1.00 0.00 ? 24 VAL A HB   7  
ATOM 7629  H HG11 . VAL A 1 24 ? 5.485   -2.556  3.138   1.00 0.00 ? 24 VAL A HG11 7  
ATOM 7630  H HG12 . VAL A 1 24 ? 4.283   -1.929  2.011   1.00 0.00 ? 24 VAL A HG12 7  
ATOM 7631  H HG13 . VAL A 1 24 ? 3.955   -1.920  3.743   1.00 0.00 ? 24 VAL A HG13 7  
ATOM 7632  H HG21 . VAL A 1 24 ? 5.478   0.537   1.194   1.00 0.00 ? 24 VAL A HG21 7  
ATOM 7633  H HG22 . VAL A 1 24 ? 6.377   -0.976  1.312   1.00 0.00 ? 24 VAL A HG22 7  
ATOM 7634  H HG23 . VAL A 1 24 ? 6.996   0.481   2.091   1.00 0.00 ? 24 VAL A HG23 7  
ATOM 7635  N N    . ARG A 1 25 ? 2.395   -0.053  4.784   1.00 0.00 ? 25 ARG A N    7  
ATOM 7636  C CA   . ARG A 1 25 ? 1.703   -0.347  6.035   1.00 0.00 ? 25 ARG A CA   7  
ATOM 7637  C C    . ARG A 1 25 ? 1.467   -1.848  6.186   1.00 0.00 ? 25 ARG A C    7  
ATOM 7638  O O    . ARG A 1 25 ? 1.427   -2.370  7.300   1.00 0.00 ? 25 ARG A O    7  
ATOM 7639  C CB   . ARG A 1 25 ? 0.369   0.398   6.091   1.00 0.00 ? 25 ARG A CB   7  
ATOM 7640  C CG   . ARG A 1 25 ? 0.510   1.870   6.444   1.00 0.00 ? 25 ARG A CG   7  
ATOM 7641  C CD   . ARG A 1 25 ? 0.541   2.081   7.950   1.00 0.00 ? 25 ARG A CD   7  
ATOM 7642  N NE   . ARG A 1 25 ? 0.769   3.481   8.301   1.00 0.00 ? 25 ARG A NE   7  
ATOM 7643  C CZ   . ARG A 1 25 ? 1.963   4.066   8.275   1.00 0.00 ? 25 ARG A CZ   7  
ATOM 7644  N NH1  . ARG A 1 25 ? 3.040   3.379   7.915   1.00 0.00 ? 25 ARG A NH1  7  
ATOM 7645  N NH2  . ARG A 1 25 ? 2.083   5.344   8.609   1.00 0.00 ? 25 ARG A NH2  7  
ATOM 7646  H H    . ARG A 1 25 ? 1.917   -0.163  3.937   1.00 0.00 ? 25 ARG A H    7  
ATOM 7647  H HA   . ARG A 1 25 ? 2.330   -0.010  6.847   1.00 0.00 ? 25 ARG A HA   7  
ATOM 7648  H HB2  . ARG A 1 25 ? -0.112  0.325   5.128   1.00 0.00 ? 25 ARG A HB2  7  
ATOM 7649  H HB3  . ARG A 1 25 ? -0.260  -0.070  6.835   1.00 0.00 ? 25 ARG A HB3  7  
ATOM 7650  H HG2  . ARG A 1 25 ? 1.428   2.246   6.020   1.00 0.00 ? 25 ARG A HG2  7  
ATOM 7651  H HG3  . ARG A 1 25 ? -0.329  2.410   6.031   1.00 0.00 ? 25 ARG A HG3  7  
ATOM 7652  H HD2  . ARG A 1 25 ? -0.405  1.766   8.364   1.00 0.00 ? 25 ARG A HD2  7  
ATOM 7653  H HD3  . ARG A 1 25 ? 1.335   1.480   8.367   1.00 0.00 ? 25 ARG A HD3  7  
ATOM 7654  H HE   . ARG A 1 25 ? -0.010  4.012   8.571   1.00 0.00 ? 25 ARG A HE   7  
ATOM 7655  H HH11 . ARG A 1 25 ? 2.957   2.415   7.661   1.00 0.00 ? 25 ARG A HH11 7  
ATOM 7656  H HH12 . ARG A 1 25 ? 3.934   3.825   7.896   1.00 0.00 ? 25 ARG A HH12 7  
ATOM 7657  H HH21 . ARG A 1 25 ? 1.275   5.867   8.881   1.00 0.00 ? 25 ARG A HH21 7  
ATOM 7658  H HH22 . ARG A 1 25 ? 2.981   5.784   8.590   1.00 0.00 ? 25 ARG A HH22 7  
ATOM 7659  N N    . TYR A 1 26 ? 1.312   -2.535  5.060   1.00 0.00 ? 26 TYR A N    7  
ATOM 7660  C CA   . TYR A 1 26 ? 1.080   -3.974  5.068   1.00 0.00 ? 26 TYR A CA   7  
ATOM 7661  C C    . TYR A 1 26 ? 2.011   -4.681  4.089   1.00 0.00 ? 26 TYR A C    7  
ATOM 7662  O O    . TYR A 1 26 ? 2.357   -4.134  3.041   1.00 0.00 ? 26 TYR A O    7  
ATOM 7663  C CB   . TYR A 1 26 ? -0.377  -4.279  4.715   1.00 0.00 ? 26 TYR A CB   7  
ATOM 7664  C CG   . TYR A 1 26 ? -0.737  -5.742  4.835   1.00 0.00 ? 26 TYR A CG   7  
ATOM 7665  C CD1  . TYR A 1 26 ? -0.588  -6.605  3.756   1.00 0.00 ? 26 TYR A CD1  7  
ATOM 7666  C CD2  . TYR A 1 26 ? -1.226  -6.262  6.027   1.00 0.00 ? 26 TYR A CD2  7  
ATOM 7667  C CE1  . TYR A 1 26 ? -0.916  -7.943  3.861   1.00 0.00 ? 26 TYR A CE1  7  
ATOM 7668  C CE2  . TYR A 1 26 ? -1.556  -7.600  6.140   1.00 0.00 ? 26 TYR A CE2  7  
ATOM 7669  C CZ   . TYR A 1 26 ? -1.400  -8.435  5.055   1.00 0.00 ? 26 TYR A CZ   7  
ATOM 7670  O OH   . TYR A 1 26 ? -1.728  -9.767  5.164   1.00 0.00 ? 26 TYR A OH   7  
ATOM 7671  H H    . TYR A 1 26 ? 1.356   -2.064  4.201   1.00 0.00 ? 26 TYR A H    7  
ATOM 7672  H HA   . TYR A 1 26 ? 1.283   -4.337  6.065   1.00 0.00 ? 26 TYR A HA   7  
ATOM 7673  H HB2  . TYR A 1 26 ? -1.024  -3.724  5.378   1.00 0.00 ? 26 TYR A HB2  7  
ATOM 7674  H HB3  . TYR A 1 26 ? -0.565  -3.972  3.697   1.00 0.00 ? 26 TYR A HB3  7  
ATOM 7675  H HD1  . TYR A 1 26 ? -0.210  -6.216  2.821   1.00 0.00 ? 26 TYR A HD1  7  
ATOM 7676  H HD2  . TYR A 1 26 ? -1.348  -5.605  6.876   1.00 0.00 ? 26 TYR A HD2  7  
ATOM 7677  H HE1  . TYR A 1 26 ? -0.794  -8.597  3.011   1.00 0.00 ? 26 TYR A HE1  7  
ATOM 7678  H HE2  . TYR A 1 26 ? -1.935  -7.984  7.076   1.00 0.00 ? 26 TYR A HE2  7  
ATOM 7679  H HH   . TYR A 1 26 ? -2.566  -9.927  4.725   1.00 0.00 ? 26 TYR A HH   7  
ATOM 7680  N N    . VAL A 1 27 ? 2.415   -5.898  4.438   1.00 0.00 ? 27 VAL A N    7  
ATOM 7681  C CA   . VAL A 1 27 ? 3.307   -6.679  3.588   1.00 0.00 ? 27 VAL A CA   7  
ATOM 7682  C C    . VAL A 1 27 ? 3.048   -8.174  3.749   1.00 0.00 ? 27 VAL A C    7  
ATOM 7683  O O    . VAL A 1 27 ? 3.496   -8.792  4.714   1.00 0.00 ? 27 VAL A O    7  
ATOM 7684  C CB   . VAL A 1 27 ? 4.785   -6.388  3.910   1.00 0.00 ? 27 VAL A CB   7  
ATOM 7685  C CG1  . VAL A 1 27 ? 5.698   -7.075  2.907   1.00 0.00 ? 27 VAL A CG1  7  
ATOM 7686  C CG2  . VAL A 1 27 ? 5.039   -4.888  3.933   1.00 0.00 ? 27 VAL A CG2  7  
ATOM 7687  H H    . VAL A 1 27 ? 2.106   -6.280  5.285   1.00 0.00 ? 27 VAL A H    7  
ATOM 7688  H HA   . VAL A 1 27 ? 3.121   -6.399  2.562   1.00 0.00 ? 27 VAL A HA   7  
ATOM 7689  H HB   . VAL A 1 27 ? 5.003   -6.783  4.891   1.00 0.00 ? 27 VAL A HB   7  
ATOM 7690  H HG11 . VAL A 1 27 ? 6.565   -7.465  3.418   1.00 0.00 ? 27 VAL A HG11 7  
ATOM 7691  H HG12 . VAL A 1 27 ? 6.010   -6.363  2.157   1.00 0.00 ? 27 VAL A HG12 7  
ATOM 7692  H HG13 . VAL A 1 27 ? 5.165   -7.886  2.432   1.00 0.00 ? 27 VAL A HG13 7  
ATOM 7693  H HG21 . VAL A 1 27 ? 4.793   -4.466  2.970   1.00 0.00 ? 27 VAL A HG21 7  
ATOM 7694  H HG22 . VAL A 1 27 ? 6.081   -4.703  4.152   1.00 0.00 ? 27 VAL A HG22 7  
ATOM 7695  H HG23 . VAL A 1 27 ? 4.426   -4.430  4.694   1.00 0.00 ? 27 VAL A HG23 7  
ATOM 7696  N N    . GLY A 1 28 ? 2.322   -8.748  2.795   1.00 0.00 ? 28 GLY A N    7  
ATOM 7697  C CA   . GLY A 1 28 ? 2.016   -10.165 2.849   1.00 0.00 ? 28 GLY A CA   7  
ATOM 7698  C C    . GLY A 1 28 ? 0.868   -10.545 1.934   1.00 0.00 ? 28 GLY A C    7  
ATOM 7699  O O    . GLY A 1 28 ? 0.526   -9.801  1.015   1.00 0.00 ? 28 GLY A O    7  
ATOM 7700  H H    . GLY A 1 28 ? 1.991   -8.205  2.049   1.00 0.00 ? 28 GLY A H    7  
ATOM 7701  H HA2  . GLY A 1 28 ? 2.894   -10.723 2.558   1.00 0.00 ? 28 GLY A HA2  7  
ATOM 7702  H HA3  . GLY A 1 28 ? 1.754   -10.428 3.864   1.00 0.00 ? 28 GLY A HA3  7  
ATOM 7703  N N    . GLU A 1 29 ? 0.274   -11.707 2.185   1.00 0.00 ? 29 GLU A N    7  
ATOM 7704  C CA   . GLU A 1 29 ? -0.842  -12.185 1.376   1.00 0.00 ? 29 GLU A CA   7  
ATOM 7705  C C    . GLU A 1 29 ? -2.137  -11.479 1.765   1.00 0.00 ? 29 GLU A C    7  
ATOM 7706  O O    . GLU A 1 29 ? -2.149  -10.629 2.655   1.00 0.00 ? 29 GLU A O    7  
ATOM 7707  C CB   . GLU A 1 29 ? -1.004  -13.697 1.536   1.00 0.00 ? 29 GLU A CB   7  
ATOM 7708  C CG   . GLU A 1 29 ? 0.144   -14.498 0.945   1.00 0.00 ? 29 GLU A CG   7  
ATOM 7709  C CD   . GLU A 1 29 ? 0.430   -15.768 1.723   1.00 0.00 ? 29 GLU A CD   7  
ATOM 7710  O OE1  . GLU A 1 29 ? 0.394   -15.722 2.971   1.00 0.00 ? 29 GLU A OE1  7  
ATOM 7711  O OE2  . GLU A 1 29 ? 0.689   -16.809 1.084   1.00 0.00 ? 29 GLU A OE2  7  
ATOM 7712  H H    . GLU A 1 29 ? 0.592   -12.257 2.931   1.00 0.00 ? 29 GLU A H    7  
ATOM 7713  H HA   . GLU A 1 29 ? -0.621  -11.962 0.342   1.00 0.00 ? 29 GLU A HA   7  
ATOM 7714  H HB2  . GLU A 1 29 ? -1.074  -13.931 2.588   1.00 0.00 ? 29 GLU A HB2  7  
ATOM 7715  H HB3  . GLU A 1 29 ? -1.917  -14.003 1.046   1.00 0.00 ? 29 GLU A HB3  7  
ATOM 7716  H HG2  . GLU A 1 29 ? -0.105  -14.765 -0.071  1.00 0.00 ? 29 GLU A HG2  7  
ATOM 7717  H HG3  . GLU A 1 29 ? 1.033   -13.884 0.948   1.00 0.00 ? 29 GLU A HG3  7  
ATOM 7718  N N    . THR A 1 30 ? -3.225  -11.837 1.091   1.00 0.00 ? 30 THR A N    7  
ATOM 7719  C CA   . THR A 1 30 ? -4.525  -11.238 1.367   1.00 0.00 ? 30 THR A CA   7  
ATOM 7720  C C    . THR A 1 30 ? -5.621  -12.300 1.385   1.00 0.00 ? 30 THR A C    7  
ATOM 7721  O O    . THR A 1 30 ? -5.347  -13.490 1.234   1.00 0.00 ? 30 THR A O    7  
ATOM 7722  C CB   . THR A 1 30 ? -4.852  -10.173 0.319   1.00 0.00 ? 30 THR A CB   7  
ATOM 7723  O OG1  . THR A 1 30 ? -4.799  -10.720 -0.987  1.00 0.00 ? 30 THR A OG1  7  
ATOM 7724  C CG2  . THR A 1 30 ? -3.911  -8.988  0.357   1.00 0.00 ? 30 THR A CG2  7  
ATOM 7725  H H    . THR A 1 30 ? -3.151  -12.521 0.392   1.00 0.00 ? 30 THR A H    7  
ATOM 7726  H HA   . THR A 1 30 ? -4.477  -10.771 2.339   1.00 0.00 ? 30 THR A HA   7  
ATOM 7727  H HB   . THR A 1 30 ? -5.853  -9.805  0.493   1.00 0.00 ? 30 THR A HB   7  
ATOM 7728  H HG1  . THR A 1 30 ? -5.489  -11.380 -1.085  1.00 0.00 ? 30 THR A HG1  7  
ATOM 7729  H HG21 . THR A 1 30 ? -3.990  -8.435  -0.566  1.00 0.00 ? 30 THR A HG21 7  
ATOM 7730  H HG22 . THR A 1 30 ? -2.897  -9.337  0.483   1.00 0.00 ? 30 THR A HG22 7  
ATOM 7731  H HG23 . THR A 1 30 ? -4.176  -8.345  1.185   1.00 0.00 ? 30 THR A HG23 7  
ATOM 7732  N N    . ASP A 1 31 ? -6.861  -11.861 1.573   1.00 0.00 ? 31 ASP A N    7  
ATOM 7733  C CA   . ASP A 1 31 ? -7.998  -12.774 1.612   1.00 0.00 ? 31 ASP A CA   7  
ATOM 7734  C C    . ASP A 1 31 ? -8.986  -12.461 0.494   1.00 0.00 ? 31 ASP A C    7  
ATOM 7735  O O    . ASP A 1 31 ? -10.191 -12.668 0.642   1.00 0.00 ? 31 ASP A O    7  
ATOM 7736  C CB   . ASP A 1 31 ? -8.699  -12.690 2.968   1.00 0.00 ? 31 ASP A CB   7  
ATOM 7737  C CG   . ASP A 1 31 ? -9.193  -14.040 3.450   1.00 0.00 ? 31 ASP A CG   7  
ATOM 7738  O OD1  . ASP A 1 31 ? -8.365  -14.829 3.954   1.00 0.00 ? 31 ASP A OD1  7  
ATOM 7739  O OD2  . ASP A 1 31 ? -10.405 -14.309 3.323   1.00 0.00 ? 31 ASP A OD2  7  
ATOM 7740  H H    . ASP A 1 31 ? -7.015  -10.900 1.687   1.00 0.00 ? 31 ASP A H    7  
ATOM 7741  H HA   . ASP A 1 31 ? -7.621  -13.777 1.473   1.00 0.00 ? 31 ASP A HA   7  
ATOM 7742  H HB2  . ASP A 1 31 ? -8.008  -12.298 3.700   1.00 0.00 ? 31 ASP A HB2  7  
ATOM 7743  H HB3  . ASP A 1 31 ? -9.546  -12.024 2.888   1.00 0.00 ? 31 ASP A HB3  7  
ATOM 7744  N N    . PHE A 1 32 ? -8.471  -11.961 -0.624  1.00 0.00 ? 32 PHE A N    7  
ATOM 7745  C CA   . PHE A 1 32 ? -9.311  -11.621 -1.767  1.00 0.00 ? 32 PHE A CA   7  
ATOM 7746  C C    . PHE A 1 32 ? -8.627  -11.999 -3.078  1.00 0.00 ? 32 PHE A C    7  
ATOM 7747  O O    . PHE A 1 32 ? -9.240  -12.606 -3.957  1.00 0.00 ? 32 PHE A O    7  
ATOM 7748  C CB   . PHE A 1 32 ? -9.638  -10.126 -1.760  1.00 0.00 ? 32 PHE A CB   7  
ATOM 7749  C CG   . PHE A 1 32 ? -8.438  -9.244  -1.956  1.00 0.00 ? 32 PHE A CG   7  
ATOM 7750  C CD1  . PHE A 1 32 ? -7.703  -8.801  -0.869  1.00 0.00 ? 32 PHE A CD1  7  
ATOM 7751  C CD2  . PHE A 1 32 ? -8.045  -8.859  -3.228  1.00 0.00 ? 32 PHE A CD2  7  
ATOM 7752  C CE1  . PHE A 1 32 ? -6.598  -7.989  -1.046  1.00 0.00 ? 32 PHE A CE1  7  
ATOM 7753  C CE2  . PHE A 1 32 ? -6.942  -8.048  -3.411  1.00 0.00 ? 32 PHE A CE2  7  
ATOM 7754  C CZ   . PHE A 1 32 ? -6.218  -7.612  -2.319  1.00 0.00 ? 32 PHE A CZ   7  
ATOM 7755  H H    . PHE A 1 32 ? -7.504  -11.819 -0.682  1.00 0.00 ? 32 PHE A H    7  
ATOM 7756  H HA   . PHE A 1 32 ? -10.229 -12.182 -1.681  1.00 0.00 ? 32 PHE A HA   7  
ATOM 7757  H HB2  . PHE A 1 32 ? -10.339 -9.915  -2.555  1.00 0.00 ? 32 PHE A HB2  7  
ATOM 7758  H HB3  . PHE A 1 32 ? -10.090 -9.869  -0.813  1.00 0.00 ? 32 PHE A HB3  7  
ATOM 7759  H HD1  . PHE A 1 32 ? -8.000  -9.095  0.128   1.00 0.00 ? 32 PHE A HD1  7  
ATOM 7760  H HD2  . PHE A 1 32 ? -8.611  -9.199  -4.083  1.00 0.00 ? 32 PHE A HD2  7  
ATOM 7761  H HE1  . PHE A 1 32 ? -6.034  -7.649  -0.190  1.00 0.00 ? 32 PHE A HE1  7  
ATOM 7762  H HE2  . PHE A 1 32 ? -6.646  -7.755  -4.409  1.00 0.00 ? 32 PHE A HE2  7  
ATOM 7763  H HZ   . PHE A 1 32 ? -5.355  -6.979  -2.460  1.00 0.00 ? 32 PHE A HZ   7  
ATOM 7764  N N    . ALA A 1 33 ? -7.354  -11.638 -3.203  1.00 0.00 ? 33 ALA A N    7  
ATOM 7765  C CA   . ALA A 1 33 ? -6.587  -11.940 -4.405  1.00 0.00 ? 33 ALA A CA   7  
ATOM 7766  C C    . ALA A 1 33 ? -5.495  -12.964 -4.117  1.00 0.00 ? 33 ALA A C    7  
ATOM 7767  O O    . ALA A 1 33 ? -5.020  -13.080 -2.987  1.00 0.00 ? 33 ALA A O    7  
ATOM 7768  C CB   . ALA A 1 33 ? -5.982  -10.667 -4.978  1.00 0.00 ? 33 ALA A CB   7  
ATOM 7769  H H    . ALA A 1 33 ? -6.919  -11.157 -2.467  1.00 0.00 ? 33 ALA A H    7  
ATOM 7770  H HA   . ALA A 1 33 ? -7.266  -12.349 -5.139  1.00 0.00 ? 33 ALA A HA   7  
ATOM 7771  H HB1  . ALA A 1 33 ? -6.753  -9.919  -5.088  1.00 0.00 ? 33 ALA A HB1  7  
ATOM 7772  H HB2  . ALA A 1 33 ? -5.545  -10.879 -5.943  1.00 0.00 ? 33 ALA A HB2  7  
ATOM 7773  H HB3  . ALA A 1 33 ? -5.217  -10.300 -4.310  1.00 0.00 ? 33 ALA A HB3  7  
ATOM 7774  N N    . LYS A 1 34 ? -5.100  -13.706 -5.146  1.00 0.00 ? 34 LYS A N    7  
ATOM 7775  C CA   . LYS A 1 34 ? -4.063  -14.721 -5.003  1.00 0.00 ? 34 LYS A CA   7  
ATOM 7776  C C    . LYS A 1 34 ? -2.685  -14.135 -5.294  1.00 0.00 ? 34 LYS A C    7  
ATOM 7777  O O    . LYS A 1 34 ? -2.449  -13.581 -6.368  1.00 0.00 ? 34 LYS A O    7  
ATOM 7778  C CB   . LYS A 1 34 ? -4.338  -15.897 -5.942  1.00 0.00 ? 34 LYS A CB   7  
ATOM 7779  C CG   . LYS A 1 34 ? -5.702  -16.536 -5.733  1.00 0.00 ? 34 LYS A CG   7  
ATOM 7780  C CD   . LYS A 1 34 ? -5.832  -17.838 -6.508  1.00 0.00 ? 34 LYS A CD   7  
ATOM 7781  C CE   . LYS A 1 34 ? -7.008  -18.664 -6.014  1.00 0.00 ? 34 LYS A CE   7  
ATOM 7782  N NZ   . LYS A 1 34 ? -8.300  -17.942 -6.176  1.00 0.00 ? 34 LYS A NZ   7  
ATOM 7783  H H    . LYS A 1 34 ? -5.516  -13.567 -6.023  1.00 0.00 ? 34 LYS A H    7  
ATOM 7784  H HA   . LYS A 1 34 ? -4.083  -15.075 -3.983  1.00 0.00 ? 34 LYS A HA   7  
ATOM 7785  H HB2  . LYS A 1 34 ? -4.282  -15.549 -6.963  1.00 0.00 ? 34 LYS A HB2  7  
ATOM 7786  H HB3  . LYS A 1 34 ? -3.583  -16.652 -5.786  1.00 0.00 ? 34 LYS A HB3  7  
ATOM 7787  H HG2  . LYS A 1 34 ? -5.836  -16.741 -4.682  1.00 0.00 ? 34 LYS A HG2  7  
ATOM 7788  H HG3  . LYS A 1 34 ? -6.465  -15.850 -6.069  1.00 0.00 ? 34 LYS A HG3  7  
ATOM 7789  H HD2  . LYS A 1 34 ? -5.977  -17.611 -7.553  1.00 0.00 ? 34 LYS A HD2  7  
ATOM 7790  H HD3  . LYS A 1 34 ? -4.924  -18.411 -6.384  1.00 0.00 ? 34 LYS A HD3  7  
ATOM 7791  H HE2  . LYS A 1 34 ? -7.048  -19.584 -6.579  1.00 0.00 ? 34 LYS A HE2  7  
ATOM 7792  H HE3  . LYS A 1 34 ? -6.860  -18.890 -4.968  1.00 0.00 ? 34 LYS A HE3  7  
ATOM 7793  H HZ1  . LYS A 1 34 ? -8.172  -16.931 -5.969  1.00 0.00 ? 34 LYS A HZ1  7  
ATOM 7794  H HZ2  . LYS A 1 34 ? -9.011  -18.330 -5.523  1.00 0.00 ? 34 LYS A HZ2  7  
ATOM 7795  H HZ3  . LYS A 1 34 ? -8.648  -18.045 -7.150  1.00 0.00 ? 34 LYS A HZ3  7  
ATOM 7796  N N    . GLY A 1 35 ? -1.778  -14.262 -4.330  1.00 0.00 ? 35 GLY A N    7  
ATOM 7797  C CA   . GLY A 1 35 ? -0.436  -13.741 -4.502  1.00 0.00 ? 35 GLY A CA   7  
ATOM 7798  C C    . GLY A 1 35 ? 0.040   -12.955 -3.296  1.00 0.00 ? 35 GLY A C    7  
ATOM 7799  O O    . GLY A 1 35 ? -0.195  -13.353 -2.155  1.00 0.00 ? 35 GLY A O    7  
ATOM 7800  H H    . GLY A 1 35 ? -2.024  -14.713 -3.495  1.00 0.00 ? 35 GLY A H    7  
ATOM 7801  H HA2  . GLY A 1 35 ? 0.241   -14.567 -4.669  1.00 0.00 ? 35 GLY A HA2  7  
ATOM 7802  H HA3  . GLY A 1 35 ? -0.419  -13.096 -5.368  1.00 0.00 ? 35 GLY A HA3  7  
ATOM 7803  N N    . GLU A 1 36 ? 0.710   -11.836 -3.548  1.00 0.00 ? 36 GLU A N    7  
ATOM 7804  C CA   . GLU A 1 36 ? 1.220   -10.991 -2.474  1.00 0.00 ? 36 GLU A CA   7  
ATOM 7805  C C    . GLU A 1 36 ? 0.956   -9.518  -2.768  1.00 0.00 ? 36 GLU A C    7  
ATOM 7806  O O    . GLU A 1 36 ? 1.232   -9.035  -3.867  1.00 0.00 ? 36 GLU A O    7  
ATOM 7807  C CB   . GLU A 1 36 ? 2.721   -11.228 -2.280  1.00 0.00 ? 36 GLU A CB   7  
ATOM 7808  C CG   . GLU A 1 36 ? 3.053   -12.038 -1.038  1.00 0.00 ? 36 GLU A CG   7  
ATOM 7809  C CD   . GLU A 1 36 ? 4.532   -12.345 -0.920  1.00 0.00 ? 36 GLU A CD   7  
ATOM 7810  O OE1  . GLU A 1 36 ? 5.329   -11.392 -0.788  1.00 0.00 ? 36 GLU A OE1  7  
ATOM 7811  O OE2  . GLU A 1 36 ? 4.896   -13.540 -0.962  1.00 0.00 ? 36 GLU A OE2  7  
ATOM 7812  H H    . GLU A 1 36 ? 0.866   -11.571 -4.479  1.00 0.00 ? 36 GLU A H    7  
ATOM 7813  H HA   . GLU A 1 36 ? 0.703   -11.262 -1.566  1.00 0.00 ? 36 GLU A HA   7  
ATOM 7814  H HB2  . GLU A 1 36 ? 3.104   -11.756 -3.141  1.00 0.00 ? 36 GLU A HB2  7  
ATOM 7815  H HB3  . GLU A 1 36 ? 3.220   -10.272 -2.205  1.00 0.00 ? 36 GLU A HB3  7  
ATOM 7816  H HG2  . GLU A 1 36 ? 2.747   -11.478 -0.166  1.00 0.00 ? 36 GLU A HG2  7  
ATOM 7817  H HG3  . GLU A 1 36 ? 2.508   -12.970 -1.075  1.00 0.00 ? 36 GLU A HG3  7  
ATOM 7818  N N    . TRP A 1 37 ? 0.420   -8.809  -1.780  1.00 0.00 ? 37 TRP A N    7  
ATOM 7819  C CA   . TRP A 1 37 ? 0.118   -7.391  -1.933  1.00 0.00 ? 37 TRP A CA   7  
ATOM 7820  C C    . TRP A 1 37 ? 0.765   -6.575  -0.817  1.00 0.00 ? 37 TRP A C    7  
ATOM 7821  O O    . TRP A 1 37 ? 1.186   -7.123  0.202   1.00 0.00 ? 37 TRP A O    7  
ATOM 7822  C CB   . TRP A 1 37 ? -1.395  -7.167  -1.933  1.00 0.00 ? 37 TRP A CB   7  
ATOM 7823  C CG   . TRP A 1 37 ? -2.089  -7.800  -3.100  1.00 0.00 ? 37 TRP A CG   7  
ATOM 7824  C CD1  . TRP A 1 37 ? -2.281  -9.134  -3.315  1.00 0.00 ? 37 TRP A CD1  7  
ATOM 7825  C CD2  . TRP A 1 37 ? -2.683  -7.125  -4.214  1.00 0.00 ? 37 TRP A CD2  7  
ATOM 7826  N NE1  . TRP A 1 37 ? -2.959  -9.330  -4.493  1.00 0.00 ? 37 TRP A NE1  7  
ATOM 7827  C CE2  . TRP A 1 37 ? -3.216  -8.112  -5.064  1.00 0.00 ? 37 TRP A CE2  7  
ATOM 7828  C CE3  . TRP A 1 37 ? -2.817  -5.781  -4.575  1.00 0.00 ? 37 TRP A CE3  7  
ATOM 7829  C CZ2  . TRP A 1 37 ? -3.873  -7.796  -6.252  1.00 0.00 ? 37 TRP A CZ2  7  
ATOM 7830  C CZ3  . TRP A 1 37 ? -3.468  -5.469  -5.754  1.00 0.00 ? 37 TRP A CZ3  7  
ATOM 7831  C CH2  . TRP A 1 37 ? -3.989  -6.473  -6.580  1.00 0.00 ? 37 TRP A CH2  7  
ATOM 7832  H H    . TRP A 1 37 ? 0.224   -9.251  -0.928  1.00 0.00 ? 37 TRP A H    7  
ATOM 7833  H HA   . TRP A 1 37 ? 0.521   -7.066  -2.880  1.00 0.00 ? 37 TRP A HA   7  
ATOM 7834  H HB2  . TRP A 1 37 ? -1.814  -7.584  -1.030  1.00 0.00 ? 37 TRP A HB2  7  
ATOM 7835  H HB3  . TRP A 1 37 ? -1.595  -6.106  -1.960  1.00 0.00 ? 37 TRP A HB3  7  
ATOM 7836  H HD1  . TRP A 1 37 ? -1.943  -9.913  -2.646  1.00 0.00 ? 37 TRP A HD1  7  
ATOM 7837  H HE1  . TRP A 1 37 ? -3.215  -10.200 -4.865  1.00 0.00 ? 37 TRP A HE1  7  
ATOM 7838  H HE3  . TRP A 1 37 ? -2.422  -4.993  -3.951  1.00 0.00 ? 37 TRP A HE3  7  
ATOM 7839  H HZ2  . TRP A 1 37 ? -4.280  -8.558  -6.899  1.00 0.00 ? 37 TRP A HZ2  7  
ATOM 7840  H HZ3  . TRP A 1 37 ? -3.581  -4.436  -6.049  1.00 0.00 ? 37 TRP A HZ3  7  
ATOM 7841  H HH2  . TRP A 1 37 ? -4.489  -6.184  -7.492  1.00 0.00 ? 37 TRP A HH2  7  
ATOM 7842  N N    . CYS A 1 38 ? 0.839   -5.263  -1.017  1.00 0.00 ? 38 CYS A N    7  
ATOM 7843  C CA   . CYS A 1 38 ? 1.433   -4.372  -0.028  1.00 0.00 ? 38 CYS A CA   7  
ATOM 7844  C C    . CYS A 1 38 ? 0.627   -3.083  0.096   1.00 0.00 ? 38 CYS A C    7  
ATOM 7845  O O    . CYS A 1 38 ? 0.390   -2.388  -0.893  1.00 0.00 ? 38 CYS A O    7  
ATOM 7846  C CB   . CYS A 1 38 ? 2.880   -4.048  -0.406  1.00 0.00 ? 38 CYS A CB   7  
ATOM 7847  S SG   . CYS A 1 38 ? 4.101   -5.152  0.340   1.00 0.00 ? 38 CYS A SG   7  
ATOM 7848  H H    . CYS A 1 38 ? 0.485   -4.885  -1.850  1.00 0.00 ? 38 CYS A H    7  
ATOM 7849  H HA   . CYS A 1 38 ? 1.425   -4.880  0.924   1.00 0.00 ? 38 CYS A HA   7  
ATOM 7850  H HB2  . CYS A 1 38 ? 2.988   -4.118  -1.479  1.00 0.00 ? 38 CYS A HB2  7  
ATOM 7851  H HB3  . CYS A 1 38 ? 3.110   -3.041  -0.091  1.00 0.00 ? 38 CYS A HB3  7  
ATOM 7852  H HG   . CYS A 1 38 ? 4.948   -4.699  0.342   1.00 0.00 ? 38 CYS A HG   7  
ATOM 7853  N N    . GLY A 1 39 ? 0.210   -2.768  1.318   1.00 0.00 ? 39 GLY A N    7  
ATOM 7854  C CA   . GLY A 1 39 ? -0.565  -1.563  1.549   1.00 0.00 ? 39 GLY A CA   7  
ATOM 7855  C C    . GLY A 1 39 ? 0.307   -0.330  1.679   1.00 0.00 ? 39 GLY A C    7  
ATOM 7856  O O    . GLY A 1 39 ? 1.325   -0.351  2.370   1.00 0.00 ? 39 GLY A O    7  
ATOM 7857  H H    . GLY A 1 39 ? 0.429   -3.359  2.069   1.00 0.00 ? 39 GLY A H    7  
ATOM 7858  H HA2  . GLY A 1 39 ? -1.248  -1.423  0.725   1.00 0.00 ? 39 GLY A HA2  7  
ATOM 7859  H HA3  . GLY A 1 39 ? -1.135  -1.684  2.459   1.00 0.00 ? 39 GLY A HA3  7  
ATOM 7860  N N    . VAL A 1 40 ? -0.090  0.747   1.009   1.00 0.00 ? 40 VAL A N    7  
ATOM 7861  C CA   . VAL A 1 40 ? 0.663   1.994   1.051   1.00 0.00 ? 40 VAL A CA   7  
ATOM 7862  C C    . VAL A 1 40 ? -0.239  3.169   1.419   1.00 0.00 ? 40 VAL A C    7  
ATOM 7863  O O    . VAL A 1 40 ? -1.239  3.428   0.751   1.00 0.00 ? 40 VAL A O    7  
ATOM 7864  C CB   . VAL A 1 40 ? 1.341   2.287   -0.300  1.00 0.00 ? 40 VAL A CB   7  
ATOM 7865  C CG1  . VAL A 1 40 ? 2.287   3.471   -0.179  1.00 0.00 ? 40 VAL A CG1  7  
ATOM 7866  C CG2  . VAL A 1 40 ? 2.078   1.055   -0.805  1.00 0.00 ? 40 VAL A CG2  7  
ATOM 7867  H H    . VAL A 1 40 ? -0.910  0.702   0.475   1.00 0.00 ? 40 VAL A H    7  
ATOM 7868  H HA   . VAL A 1 40 ? 1.432   1.894   1.802   1.00 0.00 ? 40 VAL A HA   7  
ATOM 7869  H HB   . VAL A 1 40 ? 0.574   2.541   -1.017  1.00 0.00 ? 40 VAL A HB   7  
ATOM 7870  H HG11 . VAL A 1 40 ? 2.214   4.083   -1.066  1.00 0.00 ? 40 VAL A HG11 7  
ATOM 7871  H HG12 . VAL A 1 40 ? 3.300   3.112   -0.072  1.00 0.00 ? 40 VAL A HG12 7  
ATOM 7872  H HG13 . VAL A 1 40 ? 2.019   4.059   0.686   1.00 0.00 ? 40 VAL A HG13 7  
ATOM 7873  H HG21 . VAL A 1 40 ? 1.457   0.183   -0.667  1.00 0.00 ? 40 VAL A HG21 7  
ATOM 7874  H HG22 . VAL A 1 40 ? 2.998   0.935   -0.253  1.00 0.00 ? 40 VAL A HG22 7  
ATOM 7875  H HG23 . VAL A 1 40 ? 2.302   1.176   -1.855  1.00 0.00 ? 40 VAL A HG23 7  
ATOM 7876  N N    . GLU A 1 41 ? 0.124   3.875   2.485   1.00 0.00 ? 41 GLU A N    7  
ATOM 7877  C CA   . GLU A 1 41 ? -0.652  5.022   2.941   1.00 0.00 ? 41 GLU A CA   7  
ATOM 7878  C C    . GLU A 1 41 ? -0.127  6.314   2.325   1.00 0.00 ? 41 GLU A C    7  
ATOM 7879  O O    . GLU A 1 41 ? 1.067   6.603   2.389   1.00 0.00 ? 41 GLU A O    7  
ATOM 7880  C CB   . GLU A 1 41 ? -0.613  5.117   4.467   1.00 0.00 ? 41 GLU A CB   7  
ATOM 7881  C CG   . GLU A 1 41 ? -1.550  6.170   5.035   1.00 0.00 ? 41 GLU A CG   7  
ATOM 7882  C CD   . GLU A 1 41 ? -0.839  7.467   5.367   1.00 0.00 ? 41 GLU A CD   7  
ATOM 7883  O OE1  . GLU A 1 41 ? 0.033   7.885   4.574   1.00 0.00 ? 41 GLU A OE1  7  
ATOM 7884  O OE2  . GLU A 1 41 ? -1.151  8.064   6.418   1.00 0.00 ? 41 GLU A OE2  7  
ATOM 7885  H H    . GLU A 1 41 ? 0.931   3.619   2.976   1.00 0.00 ? 41 GLU A H    7  
ATOM 7886  H HA   . GLU A 1 41 ? -1.676  4.877   2.625   1.00 0.00 ? 41 GLU A HA   7  
ATOM 7887  H HB2  . GLU A 1 41 ? -0.887  4.160   4.884   1.00 0.00 ? 41 GLU A HB2  7  
ATOM 7888  H HB3  . GLU A 1 41 ? 0.394   5.359   4.775   1.00 0.00 ? 41 GLU A HB3  7  
ATOM 7889  H HG2  . GLU A 1 41 ? -2.322  6.376   4.310   1.00 0.00 ? 41 GLU A HG2  7  
ATOM 7890  H HG3  . GLU A 1 41 ? -2.001  5.782   5.938   1.00 0.00 ? 41 GLU A HG3  7  
ATOM 7891  N N    . LEU A 1 42 ? -1.028  7.087   1.727   1.00 0.00 ? 42 LEU A N    7  
ATOM 7892  C CA   . LEU A 1 42 ? -0.655  8.350   1.098   1.00 0.00 ? 42 LEU A CA   7  
ATOM 7893  C C    . LEU A 1 42 ? -0.837  9.515   2.065   1.00 0.00 ? 42 LEU A C    7  
ATOM 7894  O O    . LEU A 1 42 ? -1.492  9.381   3.099   1.00 0.00 ? 42 LEU A O    7  
ATOM 7895  C CB   . LEU A 1 42 ? -1.491  8.581   -0.161  1.00 0.00 ? 42 LEU A CB   7  
ATOM 7896  C CG   . LEU A 1 42 ? -1.125  7.695   -1.353  1.00 0.00 ? 42 LEU A CG   7  
ATOM 7897  C CD1  . LEU A 1 42 ? -2.197  7.779   -2.429  1.00 0.00 ? 42 LEU A CD1  7  
ATOM 7898  C CD2  . LEU A 1 42 ? 0.231   8.095   -1.916  1.00 0.00 ? 42 LEU A CD2  7  
ATOM 7899  H H    . LEU A 1 42 ? -1.965  6.803   1.708   1.00 0.00 ? 42 LEU A H    7  
ATOM 7900  H HA   . LEU A 1 42 ? 0.387   8.287   0.821   1.00 0.00 ? 42 LEU A HA   7  
ATOM 7901  H HB2  . LEU A 1 42 ? -2.529  8.409   0.084   1.00 0.00 ? 42 LEU A HB2  7  
ATOM 7902  H HB3  . LEU A 1 42 ? -1.376  9.613   -0.460  1.00 0.00 ? 42 LEU A HB3  7  
ATOM 7903  H HG   . LEU A 1 42 ? -1.062  6.668   -1.024  1.00 0.00 ? 42 LEU A HG   7  
ATOM 7904  H HD11 . LEU A 1 42 ? -1.923  8.532   -3.153  1.00 0.00 ? 42 LEU A HD11 7  
ATOM 7905  H HD12 . LEU A 1 42 ? -3.142  8.040   -1.976  1.00 0.00 ? 42 LEU A HD12 7  
ATOM 7906  H HD13 . LEU A 1 42 ? -2.287  6.822   -2.922  1.00 0.00 ? 42 LEU A HD13 7  
ATOM 7907  H HD21 . LEU A 1 42 ? 0.805   8.596   -1.150  1.00 0.00 ? 42 LEU A HD21 7  
ATOM 7908  H HD22 . LEU A 1 42 ? 0.090   8.762   -2.754  1.00 0.00 ? 42 LEU A HD22 7  
ATOM 7909  H HD23 . LEU A 1 42 ? 0.759   7.212   -2.244  1.00 0.00 ? 42 LEU A HD23 7  
ATOM 7910  N N    . ASP A 1 43 ? -0.252  10.658  1.723   1.00 0.00 ? 43 ASP A N    7  
ATOM 7911  C CA   . ASP A 1 43 ? -0.349  11.847  2.560   1.00 0.00 ? 43 ASP A CA   7  
ATOM 7912  C C    . ASP A 1 43 ? -1.648  12.599  2.290   1.00 0.00 ? 43 ASP A C    7  
ATOM 7913  O O    . ASP A 1 43 ? -2.284  13.112  3.211   1.00 0.00 ? 43 ASP A O    7  
ATOM 7914  C CB   . ASP A 1 43 ? 0.847   12.769  2.316   1.00 0.00 ? 43 ASP A CB   7  
ATOM 7915  C CG   . ASP A 1 43 ? 2.151   12.165  2.798   1.00 0.00 ? 43 ASP A CG   7  
ATOM 7916  O OD1  . ASP A 1 43 ? 2.361   10.953  2.579   1.00 0.00 ? 43 ASP A OD1  7  
ATOM 7917  O OD2  . ASP A 1 43 ? 2.962   12.903  3.397   1.00 0.00 ? 43 ASP A OD2  7  
ATOM 7918  H H    . ASP A 1 43 ? 0.257   10.702  0.886   1.00 0.00 ? 43 ASP A H    7  
ATOM 7919  H HA   . ASP A 1 43 ? -0.340  11.528  3.592   1.00 0.00 ? 43 ASP A HA   7  
ATOM 7920  H HB2  . ASP A 1 43 ? 0.933   12.963  1.257   1.00 0.00 ? 43 ASP A HB2  7  
ATOM 7921  H HB3  . ASP A 1 43 ? 0.688   13.701  2.838   1.00 0.00 ? 43 ASP A HB3  7  
ATOM 7922  N N    . GLU A 1 44 ? -2.037  12.659  1.021   1.00 0.00 ? 44 GLU A N    7  
ATOM 7923  C CA   . GLU A 1 44 ? -3.262  13.348  0.628   1.00 0.00 ? 44 GLU A CA   7  
ATOM 7924  C C    . GLU A 1 44 ? -4.319  12.351  0.158   1.00 0.00 ? 44 GLU A C    7  
ATOM 7925  O O    . GLU A 1 44 ? -3.991  11.273  -0.336  1.00 0.00 ? 44 GLU A O    7  
ATOM 7926  C CB   . GLU A 1 44 ? -2.969  14.358  -0.483  1.00 0.00 ? 44 GLU A CB   7  
ATOM 7927  C CG   . GLU A 1 44 ? -1.947  15.413  -0.092  1.00 0.00 ? 44 GLU A CG   7  
ATOM 7928  C CD   . GLU A 1 44 ? -1.379  16.146  -1.291  1.00 0.00 ? 44 GLU A CD   7  
ATOM 7929  O OE1  . GLU A 1 44 ? -2.166  16.762  -2.040  1.00 0.00 ? 44 GLU A OE1  7  
ATOM 7930  O OE2  . GLU A 1 44 ? -0.145  16.104  -1.483  1.00 0.00 ? 44 GLU A OE2  7  
ATOM 7931  H H    . GLU A 1 44 ? -1.489  12.230  0.331   1.00 0.00 ? 44 GLU A H    7  
ATOM 7932  H HA   . GLU A 1 44 ? -3.638  13.874  1.492   1.00 0.00 ? 44 GLU A HA   7  
ATOM 7933  H HB2  . GLU A 1 44 ? -2.596  13.829  -1.347  1.00 0.00 ? 44 GLU A HB2  7  
ATOM 7934  H HB3  . GLU A 1 44 ? -3.888  14.860  -0.748  1.00 0.00 ? 44 GLU A HB3  7  
ATOM 7935  H HG2  . GLU A 1 44 ? -2.421  16.133  0.558   1.00 0.00 ? 44 GLU A HG2  7  
ATOM 7936  H HG3  . GLU A 1 44 ? -1.136  14.932  0.435   1.00 0.00 ? 44 GLU A HG3  7  
ATOM 7937  N N    . PRO A 1 45 ? -5.610  12.702  0.308   1.00 0.00 ? 45 PRO A N    7  
ATOM 7938  C CA   . PRO A 1 45 ? -6.717  11.832  -0.104  1.00 0.00 ? 45 PRO A CA   7  
ATOM 7939  C C    . PRO A 1 45 ? -6.608  11.410  -1.565  1.00 0.00 ? 45 PRO A C    7  
ATOM 7940  O O    . PRO A 1 45 ? -7.164  12.057  -2.452  1.00 0.00 ? 45 PRO A O    7  
ATOM 7941  C CB   . PRO A 1 45 ? -7.958  12.704  0.108   1.00 0.00 ? 45 PRO A CB   7  
ATOM 7942  C CG   . PRO A 1 45 ? -7.548  13.710  1.128   1.00 0.00 ? 45 PRO A CG   7  
ATOM 7943  C CD   . PRO A 1 45 ? -6.088  13.970  0.888   1.00 0.00 ? 45 PRO A CD   7  
ATOM 7944  H HA   . PRO A 1 45 ? -6.780  10.952  0.520   1.00 0.00 ? 45 PRO A HA   7  
ATOM 7945  H HB2  . PRO A 1 45 ? -8.232  13.176  -0.824  1.00 0.00 ? 45 PRO A HB2  7  
ATOM 7946  H HB3  . PRO A 1 45 ? -8.774  12.094  0.462   1.00 0.00 ? 45 PRO A HB3  7  
ATOM 7947  H HG2  . PRO A 1 45 ? -8.117  14.618  0.998   1.00 0.00 ? 45 PRO A HG2  7  
ATOM 7948  H HG3  . PRO A 1 45 ? -7.700  13.309  2.120   1.00 0.00 ? 45 PRO A HG3  7  
ATOM 7949  H HD2  . PRO A 1 45 ? -5.958  14.786  0.193   1.00 0.00 ? 45 PRO A HD2  7  
ATOM 7950  H HD3  . PRO A 1 45 ? -5.583  14.180  1.820   1.00 0.00 ? 45 PRO A HD3  7  
ATOM 7951  N N    . LEU A 1 46 ? -5.887  10.319  -1.808  1.00 0.00 ? 46 LEU A N    7  
ATOM 7952  C CA   . LEU A 1 46 ? -5.706  9.811   -3.162  1.00 0.00 ? 46 LEU A CA   7  
ATOM 7953  C C    . LEU A 1 46 ? -5.654  8.285   -3.169  1.00 0.00 ? 46 LEU A C    7  
ATOM 7954  O O    . LEU A 1 46 ? -4.986  7.681   -4.007  1.00 0.00 ? 46 LEU A O    7  
ATOM 7955  C CB   . LEU A 1 46 ? -4.422  10.378  -3.774  1.00 0.00 ? 46 LEU A CB   7  
ATOM 7956  C CG   . LEU A 1 46 ? -4.419  11.893  -3.984  1.00 0.00 ? 46 LEU A CG   7  
ATOM 7957  C CD1  . LEU A 1 46 ? -2.999  12.434  -3.946  1.00 0.00 ? 46 LEU A CD1  7  
ATOM 7958  C CD2  . LEU A 1 46 ? -5.092  12.248  -5.301  1.00 0.00 ? 46 LEU A CD2  7  
ATOM 7959  H H    . LEU A 1 46 ? -5.469  9.846   -1.059  1.00 0.00 ? 46 LEU A H    7  
ATOM 7960  H HA   . LEU A 1 46 ? -6.549  10.133  -3.754  1.00 0.00 ? 46 LEU A HA   7  
ATOM 7961  H HB2  . LEU A 1 46 ? -3.597  10.123  -3.126  1.00 0.00 ? 46 LEU A HB2  7  
ATOM 7962  H HB3  . LEU A 1 46 ? -4.266  9.904   -4.732  1.00 0.00 ? 46 LEU A HB3  7  
ATOM 7963  H HG   . LEU A 1 46 ? -4.976  12.362  -3.187  1.00 0.00 ? 46 LEU A HG   7  
ATOM 7964  H HD11 . LEU A 1 46 ? -3.024  13.501  -3.786  1.00 0.00 ? 46 LEU A HD11 7  
ATOM 7965  H HD12 . LEU A 1 46 ? -2.507  12.222  -4.884  1.00 0.00 ? 46 LEU A HD12 7  
ATOM 7966  H HD13 . LEU A 1 46 ? -2.456  11.963  -3.140  1.00 0.00 ? 46 LEU A HD13 7  
ATOM 7967  H HD21 . LEU A 1 46 ? -5.762  11.452  -5.591  1.00 0.00 ? 46 LEU A HD21 7  
ATOM 7968  H HD22 . LEU A 1 46 ? -4.339  12.381  -6.065  1.00 0.00 ? 46 LEU A HD22 7  
ATOM 7969  H HD23 . LEU A 1 46 ? -5.652  13.164  -5.185  1.00 0.00 ? 46 LEU A HD23 7  
ATOM 7970  N N    . GLY A 1 47 ? -6.362  7.670   -2.227  1.00 0.00 ? 47 GLY A N    7  
ATOM 7971  C CA   . GLY A 1 47 ? -6.383  6.222   -2.142  1.00 0.00 ? 47 GLY A CA   7  
ATOM 7972  C C    . GLY A 1 47 ? -7.699  5.632   -2.611  1.00 0.00 ? 47 GLY A C    7  
ATOM 7973  O O    . GLY A 1 47 ? -8.536  6.335   -3.177  1.00 0.00 ? 47 GLY A O    7  
ATOM 7974  H H    . GLY A 1 47 ? -6.875  8.205   -1.585  1.00 0.00 ? 47 GLY A H    7  
ATOM 7975  H HA2  . GLY A 1 47 ? -5.585  5.825   -2.753  1.00 0.00 ? 47 GLY A HA2  7  
ATOM 7976  H HA3  . GLY A 1 47 ? -6.216  5.930   -1.117  1.00 0.00 ? 47 GLY A HA3  7  
ATOM 7977  N N    . LYS A 1 48 ? -7.882  4.337   -2.374  1.00 0.00 ? 48 LYS A N    7  
ATOM 7978  C CA   . LYS A 1 48 ? -9.105  3.652   -2.777  1.00 0.00 ? 48 LYS A CA   7  
ATOM 7979  C C    . LYS A 1 48 ? -9.883  3.168   -1.557  1.00 0.00 ? 48 LYS A C    7  
ATOM 7980  O O    . LYS A 1 48 ? -11.113 3.220   -1.531  1.00 0.00 ? 48 LYS A O    7  
ATOM 7981  C CB   . LYS A 1 48 ? -8.775  2.469   -3.688  1.00 0.00 ? 48 LYS A CB   7  
ATOM 7982  C CG   . LYS A 1 48 ? -8.325  2.880   -5.080  1.00 0.00 ? 48 LYS A CG   7  
ATOM 7983  C CD   . LYS A 1 48 ? -9.421  2.657   -6.111  1.00 0.00 ? 48 LYS A CD   7  
ATOM 7984  C CE   . LYS A 1 48 ? -9.462  3.781   -7.133  1.00 0.00 ? 48 LYS A CE   7  
ATOM 7985  N NZ   . LYS A 1 48 ? -10.461 3.521   -8.206  1.00 0.00 ? 48 LYS A NZ   7  
ATOM 7986  H H    . LYS A 1 48 ? -7.178  3.830   -1.919  1.00 0.00 ? 48 LYS A H    7  
ATOM 7987  H HA   . LYS A 1 48 ? -9.716  4.355   -3.322  1.00 0.00 ? 48 LYS A HA   7  
ATOM 7988  H HB2  . LYS A 1 48 ? -7.984  1.890   -3.234  1.00 0.00 ? 48 LYS A HB2  7  
ATOM 7989  H HB3  . LYS A 1 48 ? -9.653  1.847   -3.784  1.00 0.00 ? 48 LYS A HB3  7  
ATOM 7990  H HG2  . LYS A 1 48 ? -8.064  3.928   -5.069  1.00 0.00 ? 48 LYS A HG2  7  
ATOM 7991  H HG3  . LYS A 1 48 ? -7.460  2.295   -5.356  1.00 0.00 ? 48 LYS A HG3  7  
ATOM 7992  H HD2  . LYS A 1 48 ? -9.236  1.725   -6.623  1.00 0.00 ? 48 LYS A HD2  7  
ATOM 7993  H HD3  . LYS A 1 48 ? -10.374 2.608   -5.604  1.00 0.00 ? 48 LYS A HD3  7  
ATOM 7994  H HE2  . LYS A 1 48 ? -9.721  4.700   -6.629  1.00 0.00 ? 48 LYS A HE2  7  
ATOM 7995  H HE3  . LYS A 1 48 ? -8.483  3.880   -7.579  1.00 0.00 ? 48 LYS A HE3  7  
ATOM 7996  H HZ1  . LYS A 1 48 ? -10.164 2.705   -8.780  1.00 0.00 ? 48 LYS A HZ1  7  
ATOM 7997  H HZ2  . LYS A 1 48 ? -10.546 4.351   -8.825  1.00 0.00 ? 48 LYS A HZ2  7  
ATOM 7998  H HZ3  . LYS A 1 48 ? -11.390 3.318   -7.787  1.00 0.00 ? 48 LYS A HZ3  7  
ATOM 7999  N N    . ASN A 1 49 ? -9.158  2.695   -0.548  1.00 0.00 ? 49 ASN A N    7  
ATOM 8000  C CA   . ASN A 1 49 ? -9.779  2.202   0.675   1.00 0.00 ? 49 ASN A CA   7  
ATOM 8001  C C    . ASN A 1 49 ? -8.991  2.645   1.903   1.00 0.00 ? 49 ASN A C    7  
ATOM 8002  O O    . ASN A 1 49 ? -8.009  3.379   1.791   1.00 0.00 ? 49 ASN A O    7  
ATOM 8003  C CB   . ASN A 1 49 ? -9.877  0.676   0.640   1.00 0.00 ? 49 ASN A CB   7  
ATOM 8004  C CG   . ASN A 1 49 ? -10.789 0.180   -0.466  1.00 0.00 ? 49 ASN A CG   7  
ATOM 8005  O OD1  . ASN A 1 49 ? -12.003 0.379   -0.422  1.00 0.00 ? 49 ASN A OD1  7  
ATOM 8006  N ND2  . ASN A 1 49 ? -10.205 -0.470  -1.466  1.00 0.00 ? 49 ASN A ND2  7  
ATOM 8007  H H    . ASN A 1 49 ? -8.181  2.680   -0.627  1.00 0.00 ? 49 ASN A H    7  
ATOM 8008  H HA   . ASN A 1 49 ? -10.774 2.616   0.732   1.00 0.00 ? 49 ASN A HA   7  
ATOM 8009  H HB2  . ASN A 1 49 ? -8.893  0.261   0.482   1.00 0.00 ? 49 ASN A HB2  7  
ATOM 8010  H HB3  . ASN A 1 49 ? -10.265 0.324   1.585   1.00 0.00 ? 49 ASN A HB3  7  
ATOM 8011  H HD21 . ASN A 1 49 ? -9.233  -0.592  -1.434  1.00 0.00 ? 49 ASN A HD21 7  
ATOM 8012  H HD22 . ASN A 1 49 ? -10.770 -0.801  -2.195  1.00 0.00 ? 49 ASN A HD22 7  
ATOM 8013  N N    . ASP A 1 50 ? -9.429  2.195   3.076   1.00 0.00 ? 50 ASP A N    7  
ATOM 8014  C CA   . ASP A 1 50 ? -8.765  2.546   4.325   1.00 0.00 ? 50 ASP A CA   7  
ATOM 8015  C C    . ASP A 1 50 ? -8.010  1.349   4.895   1.00 0.00 ? 50 ASP A C    7  
ATOM 8016  O O    . ASP A 1 50 ? -7.978  1.144   6.109   1.00 0.00 ? 50 ASP A O    7  
ATOM 8017  C CB   . ASP A 1 50 ? -9.785  3.054   5.345   1.00 0.00 ? 50 ASP A CB   7  
ATOM 8018  C CG   . ASP A 1 50 ? -10.996 2.148   5.451   1.00 0.00 ? 50 ASP A CG   7  
ATOM 8019  O OD1  . ASP A 1 50 ? -10.814 0.912   5.463   1.00 0.00 ? 50 ASP A OD1  7  
ATOM 8020  O OD2  . ASP A 1 50 ? -12.127 2.674   5.522   1.00 0.00 ? 50 ASP A OD2  7  
ATOM 8021  H H    . ASP A 1 50 ? -10.218 1.614   3.100   1.00 0.00 ? 50 ASP A H    7  
ATOM 8022  H HA   . ASP A 1 50 ? -8.058  3.335   4.114   1.00 0.00 ? 50 ASP A HA   7  
ATOM 8023  H HB2  . ASP A 1 50 ? -9.317  3.112   6.316   1.00 0.00 ? 50 ASP A HB2  7  
ATOM 8024  H HB3  . ASP A 1 50 ? -10.119 4.039   5.051   1.00 0.00 ? 50 ASP A HB3  7  
ATOM 8025  N N    . GLY A 1 51 ? -7.404  0.563   4.012   1.00 0.00 ? 51 GLY A N    7  
ATOM 8026  C CA   . GLY A 1 51 ? -6.659  -0.603  4.447   1.00 0.00 ? 51 GLY A CA   7  
ATOM 8027  C C    . GLY A 1 51 ? -7.561  -1.751  4.853   1.00 0.00 ? 51 GLY A C    7  
ATOM 8028  O O    . GLY A 1 51 ? -7.272  -2.468  5.811   1.00 0.00 ? 51 GLY A O    7  
ATOM 8029  H H    . GLY A 1 51 ? -7.463  0.776   3.058   1.00 0.00 ? 51 GLY A H    7  
ATOM 8030  H HA2  . GLY A 1 51 ? -6.020  -0.930  3.639   1.00 0.00 ? 51 GLY A HA2  7  
ATOM 8031  H HA3  . GLY A 1 51 ? -6.042  -0.329  5.290   1.00 0.00 ? 51 GLY A HA3  7  
ATOM 8032  N N    . ALA A 1 52 ? -8.658  -1.926  4.123   1.00 0.00 ? 52 ALA A N    7  
ATOM 8033  C CA   . ALA A 1 52 ? -9.606  -2.994  4.412   1.00 0.00 ? 52 ALA A CA   7  
ATOM 8034  C C    . ALA A 1 52 ? -10.158 -3.600  3.127   1.00 0.00 ? 52 ALA A C    7  
ATOM 8035  O O    . ALA A 1 52 ? -10.241 -2.930  2.099   1.00 0.00 ? 52 ALA A O    7  
ATOM 8036  C CB   . ALA A 1 52 ? -10.740 -2.472  5.282   1.00 0.00 ? 52 ALA A CB   7  
ATOM 8037  H H    . ALA A 1 52 ? -8.834  -1.321  3.372   1.00 0.00 ? 52 ALA A H    7  
ATOM 8038  H HA   . ALA A 1 52 ? -9.084  -3.762  4.966   1.00 0.00 ? 52 ALA A HA   7  
ATOM 8039  H HB1  . ALA A 1 52 ? -10.524 -2.681  6.320   1.00 0.00 ? 52 ALA A HB1  7  
ATOM 8040  H HB2  . ALA A 1 52 ? -11.663 -2.958  5.002   1.00 0.00 ? 52 ALA A HB2  7  
ATOM 8041  H HB3  . ALA A 1 52 ? -10.838 -1.405  5.143   1.00 0.00 ? 52 ALA A HB3  7  
ATOM 8042  N N    . VAL A 1 53 ? -10.535 -4.873  3.194   1.00 0.00 ? 53 VAL A N    7  
ATOM 8043  C CA   . VAL A 1 53 ? -11.078 -5.570  2.034   1.00 0.00 ? 53 VAL A CA   7  
ATOM 8044  C C    . VAL A 1 53 ? -12.169 -6.553  2.446   1.00 0.00 ? 53 VAL A C    7  
ATOM 8045  O O    . VAL A 1 53 ? -11.926 -7.474  3.225   1.00 0.00 ? 53 VAL A O    7  
ATOM 8046  C CB   . VAL A 1 53 ? -9.981  -6.331  1.269   1.00 0.00 ? 53 VAL A CB   7  
ATOM 8047  C CG1  . VAL A 1 53 ? -10.525 -6.881  -0.041  1.00 0.00 ? 53 VAL A CG1  7  
ATOM 8048  C CG2  . VAL A 1 53 ? -8.782  -5.428  1.019   1.00 0.00 ? 53 VAL A CG2  7  
ATOM 8049  H H    . VAL A 1 53 ? -10.444 -5.355  4.042   1.00 0.00 ? 53 VAL A H    7  
ATOM 8050  H HA   . VAL A 1 53 ? -11.505 -4.831  1.371   1.00 0.00 ? 53 VAL A HA   7  
ATOM 8051  H HB   . VAL A 1 53 ? -9.656  -7.162  1.876   1.00 0.00 ? 53 VAL A HB   7  
ATOM 8052  H HG11 . VAL A 1 53 ? -11.307 -7.595  0.167   1.00 0.00 ? 53 VAL A HG11 7  
ATOM 8053  H HG12 . VAL A 1 53 ? -9.728  -7.367  -0.585  1.00 0.00 ? 53 VAL A HG12 7  
ATOM 8054  H HG13 . VAL A 1 53 ? -10.924 -6.072  -0.633  1.00 0.00 ? 53 VAL A HG13 7  
ATOM 8055  H HG21 . VAL A 1 53 ? -8.428  -5.030  1.958   1.00 0.00 ? 53 VAL A HG21 7  
ATOM 8056  H HG22 . VAL A 1 53 ? -9.072  -4.615  0.370   1.00 0.00 ? 53 VAL A HG22 7  
ATOM 8057  H HG23 . VAL A 1 53 ? -7.993  -5.998  0.551   1.00 0.00 ? 53 VAL A HG23 7  
ATOM 8058  N N    . ALA A 1 54 ? -13.371 -6.350  1.918   1.00 0.00 ? 54 ALA A N    7  
ATOM 8059  C CA   . ALA A 1 54 ? -14.500 -7.219  2.231   1.00 0.00 ? 54 ALA A CA   7  
ATOM 8060  C C    . ALA A 1 54 ? -14.805 -7.208  3.725   1.00 0.00 ? 54 ALA A C    7  
ATOM 8061  O O    . ALA A 1 54 ? -15.293 -8.194  4.276   1.00 0.00 ? 54 ALA A O    7  
ATOM 8062  C CB   . ALA A 1 54 ? -14.220 -8.637  1.758   1.00 0.00 ? 54 ALA A CB   7  
ATOM 8063  H H    . ALA A 1 54 ? -13.504 -5.598  1.304   1.00 0.00 ? 54 ALA A H    7  
ATOM 8064  H HA   . ALA A 1 54 ? -15.363 -6.849  1.696   1.00 0.00 ? 54 ALA A HA   7  
ATOM 8065  H HB1  . ALA A 1 54 ? -13.456 -8.618  0.995   1.00 0.00 ? 54 ALA A HB1  7  
ATOM 8066  H HB2  . ALA A 1 54 ? -15.124 -9.066  1.352   1.00 0.00 ? 54 ALA A HB2  7  
ATOM 8067  H HB3  . ALA A 1 54 ? -13.881 -9.234  2.591   1.00 0.00 ? 54 ALA A HB3  7  
ATOM 8068  N N    . GLY A 1 55 ? -14.512 -6.086  4.376   1.00 0.00 ? 55 GLY A N    7  
ATOM 8069  C CA   . GLY A 1 55 ? -14.762 -5.969  5.800   1.00 0.00 ? 55 GLY A CA   7  
ATOM 8070  C C    . GLY A 1 55 ? -13.530 -6.265  6.633   1.00 0.00 ? 55 GLY A C    7  
ATOM 8071  O O    . GLY A 1 55 ? -13.380 -5.745  7.738   1.00 0.00 ? 55 GLY A O    7  
ATOM 8072  H H    . GLY A 1 55 ? -14.124 -5.332  3.885   1.00 0.00 ? 55 GLY A H    7  
ATOM 8073  H HA2  . GLY A 1 55 ? -15.095 -4.963  6.014   1.00 0.00 ? 55 GLY A HA2  7  
ATOM 8074  H HA3  . GLY A 1 55 ? -15.544 -6.661  6.075   1.00 0.00 ? 55 GLY A HA3  7  
ATOM 8075  N N    . THR A 1 56 ? -12.647 -7.104  6.102   1.00 0.00 ? 56 THR A N    7  
ATOM 8076  C CA   . THR A 1 56 ? -11.422 -7.469  6.804   1.00 0.00 ? 56 THR A CA   7  
ATOM 8077  C C    . THR A 1 56 ? -10.385 -6.355  6.704   1.00 0.00 ? 56 THR A C    7  
ATOM 8078  O O    . THR A 1 56 ? -9.983  -5.964  5.610   1.00 0.00 ? 56 THR A O    7  
ATOM 8079  C CB   . THR A 1 56 ? -10.849 -8.767  6.232   1.00 0.00 ? 56 THR A CB   7  
ATOM 8080  O OG1  . THR A 1 56 ? -11.889 -9.623  5.790   1.00 0.00 ? 56 THR A OG1  7  
ATOM 8081  C CG2  . THR A 1 56 ? -10.009 -9.541  7.225   1.00 0.00 ? 56 THR A CG2  7  
ATOM 8082  H H    . THR A 1 56 ? -12.823 -7.487  5.217   1.00 0.00 ? 56 THR A H    7  
ATOM 8083  H HA   . THR A 1 56 ? -11.669 -7.624  7.843   1.00 0.00 ? 56 THR A HA   7  
ATOM 8084  H HB   . THR A 1 56 ? -10.223 -8.530  5.383   1.00 0.00 ? 56 THR A HB   7  
ATOM 8085  H HG1  . THR A 1 56 ? -11.866 -9.687  4.832   1.00 0.00 ? 56 THR A HG1  7  
ATOM 8086  H HG21 . THR A 1 56 ? -9.081  -9.836  6.759   1.00 0.00 ? 56 THR A HG21 7  
ATOM 8087  H HG22 . THR A 1 56 ? -10.548 -10.421 7.543   1.00 0.00 ? 56 THR A HG22 7  
ATOM 8088  H HG23 . THR A 1 56 ? -9.800  -8.918  8.082   1.00 0.00 ? 56 THR A HG23 7  
ATOM 8089  N N    . ARG A 1 57 ? -9.956  -5.849  7.857   1.00 0.00 ? 57 ARG A N    7  
ATOM 8090  C CA   . ARG A 1 57 ? -8.965  -4.779  7.901   1.00 0.00 ? 57 ARG A CA   7  
ATOM 8091  C C    . ARG A 1 57 ? -7.639  -5.289  8.455   1.00 0.00 ? 57 ARG A C    7  
ATOM 8092  O O    . ARG A 1 57 ? -7.577  -5.797  9.575   1.00 0.00 ? 57 ARG A O    7  
ATOM 8093  C CB   . ARG A 1 57 ? -9.475  -3.617  8.754   1.00 0.00 ? 57 ARG A CB   7  
ATOM 8094  C CG   . ARG A 1 57 ? -8.533  -2.423  8.781   1.00 0.00 ? 57 ARG A CG   7  
ATOM 8095  C CD   . ARG A 1 57 ? -9.263  -1.128  8.461   1.00 0.00 ? 57 ARG A CD   7  
ATOM 8096  N NE   . ARG A 1 57 ? -10.126 -0.699  9.559   1.00 0.00 ? 57 ARG A NE   7  
ATOM 8097  C CZ   . ARG A 1 57 ? -11.123 0.173   9.422   1.00 0.00 ? 57 ARG A CZ   7  
ATOM 8098  N NH1  . ARG A 1 57 ? -11.385 0.710   8.238   1.00 0.00 ? 57 ARG A NH1  7  
ATOM 8099  N NH2  . ARG A 1 57 ? -11.860 0.506   10.472  1.00 0.00 ? 57 ARG A NH2  7  
ATOM 8100  H H    . ARG A 1 57 ? -10.314 -6.203  8.698   1.00 0.00 ? 57 ARG A H    7  
ATOM 8101  H HA   . ARG A 1 57 ? -8.809  -4.431  6.890   1.00 0.00 ? 57 ARG A HA   7  
ATOM 8102  H HB2  . ARG A 1 57 ? -10.428 -3.290  8.363   1.00 0.00 ? 57 ARG A HB2  7  
ATOM 8103  H HB3  . ARG A 1 57 ? -9.612  -3.963  9.768   1.00 0.00 ? 57 ARG A HB3  7  
ATOM 8104  H HG2  . ARG A 1 57 ? -8.097  -2.344  9.765   1.00 0.00 ? 57 ARG A HG2  7  
ATOM 8105  H HG3  . ARG A 1 57 ? -7.753  -2.577  8.051   1.00 0.00 ? 57 ARG A HG3  7  
ATOM 8106  H HD2  . ARG A 1 57 ? -8.531  -0.356  8.270   1.00 0.00 ? 57 ARG A HD2  7  
ATOM 8107  H HD3  . ARG A 1 57 ? -9.865  -1.278  7.578   1.00 0.00 ? 57 ARG A HD3  7  
ATOM 8108  H HE   . ARG A 1 57 ? -9.954  -1.082  10.445  1.00 0.00 ? 57 ARG A HE   7  
ATOM 8109  H HH11 . ARG A 1 57 ? -10.834 0.463   7.441   1.00 0.00 ? 57 ARG A HH11 7  
ATOM 8110  H HH12 . ARG A 1 57 ? -12.136 1.364   8.142   1.00 0.00 ? 57 ARG A HH12 7  
ATOM 8111  H HH21 . ARG A 1 57 ? -11.667 0.103   11.367  1.00 0.00 ? 57 ARG A HH21 7  
ATOM 8112  H HH22 . ARG A 1 57 ? -12.609 1.161   10.371  1.00 0.00 ? 57 ARG A HH22 7  
ATOM 8113  N N    . TYR A 1 58 ? -6.580  -5.152  7.664   1.00 0.00 ? 58 TYR A N    7  
ATOM 8114  C CA   . TYR A 1 58 ? -5.254  -5.598  8.077   1.00 0.00 ? 58 TYR A CA   7  
ATOM 8115  C C    . TYR A 1 58 ? -4.587  -4.563  8.977   1.00 0.00 ? 58 TYR A C    7  
ATOM 8116  O O    . TYR A 1 58 ? -4.182  -4.872  10.098  1.00 0.00 ? 58 TYR A O    7  
ATOM 8117  C CB   . TYR A 1 58 ? -4.379  -5.863  6.849   1.00 0.00 ? 58 TYR A CB   7  
ATOM 8118  C CG   . TYR A 1 58 ? -5.030  -6.766  5.826   1.00 0.00 ? 58 TYR A CG   7  
ATOM 8119  C CD1  . TYR A 1 58 ? -5.929  -6.259  4.896   1.00 0.00 ? 58 TYR A CD1  7  
ATOM 8120  C CD2  . TYR A 1 58 ? -4.743  -8.125  5.788   1.00 0.00 ? 58 TYR A CD2  7  
ATOM 8121  C CE1  . TYR A 1 58 ? -6.525  -7.082  3.959   1.00 0.00 ? 58 TYR A CE1  7  
ATOM 8122  C CE2  . TYR A 1 58 ? -5.335  -8.954  4.854   1.00 0.00 ? 58 TYR A CE2  7  
ATOM 8123  C CZ   . TYR A 1 58 ? -6.225  -8.427  3.942   1.00 0.00 ? 58 TYR A CZ   7  
ATOM 8124  O OH   . TYR A 1 58 ? -6.817  -9.248  3.010   1.00 0.00 ? 58 TYR A OH   7  
ATOM 8125  H H    . TYR A 1 58 ? -6.693  -4.739  6.782   1.00 0.00 ? 58 TYR A H    7  
ATOM 8126  H HA   . TYR A 1 58 ? -5.372  -6.517  8.629   1.00 0.00 ? 58 TYR A HA   7  
ATOM 8127  H HB2  . TYR A 1 58 ? -4.153  -4.924  6.367   1.00 0.00 ? 58 TYR A HB2  7  
ATOM 8128  H HB3  . TYR A 1 58 ? -3.458  -6.329  7.168   1.00 0.00 ? 58 TYR A HB3  7  
ATOM 8129  H HD1  . TYR A 1 58 ? -6.162  -5.205  4.911   1.00 0.00 ? 58 TYR A HD1  7  
ATOM 8130  H HD2  . TYR A 1 58 ? -4.046  -8.535  6.504   1.00 0.00 ? 58 TYR A HD2  7  
ATOM 8131  H HE1  . TYR A 1 58 ? -7.222  -6.669  3.245   1.00 0.00 ? 58 TYR A HE1  7  
ATOM 8132  H HE2  . TYR A 1 58 ? -5.100  -10.007 4.841   1.00 0.00 ? 58 TYR A HE2  7  
ATOM 8133  H HH   . TYR A 1 58 ? -7.236  -9.989  3.456   1.00 0.00 ? 58 TYR A HH   7  
ATOM 8134  N N    . PHE A 1 59 ? -4.476  -3.336  8.480   1.00 0.00 ? 59 PHE A N    7  
ATOM 8135  C CA   . PHE A 1 59 ? -3.858  -2.256  9.240   1.00 0.00 ? 59 PHE A CA   7  
ATOM 8136  C C    . PHE A 1 59 ? -4.841  -1.110  9.453   1.00 0.00 ? 59 PHE A C    7  
ATOM 8137  O O    . PHE A 1 59 ? -5.776  -0.927  8.674   1.00 0.00 ? 59 PHE A O    7  
ATOM 8138  C CB   . PHE A 1 59 ? -2.609  -1.746  8.518   1.00 0.00 ? 59 PHE A CB   7  
ATOM 8139  C CG   . PHE A 1 59 ? -2.862  -1.343  7.093   1.00 0.00 ? 59 PHE A CG   7  
ATOM 8140  C CD1  . PHE A 1 59 ? -2.966  -2.300  6.097   1.00 0.00 ? 59 PHE A CD1  7  
ATOM 8141  C CD2  . PHE A 1 59 ? -2.995  -0.007  6.751   1.00 0.00 ? 59 PHE A CD2  7  
ATOM 8142  C CE1  . PHE A 1 59 ? -3.199  -1.931  4.785   1.00 0.00 ? 59 PHE A CE1  7  
ATOM 8143  C CE2  . PHE A 1 59 ? -3.228  0.368   5.441   1.00 0.00 ? 59 PHE A CE2  7  
ATOM 8144  C CZ   . PHE A 1 59 ? -3.330  -0.596  4.457   1.00 0.00 ? 59 PHE A CZ   7  
ATOM 8145  H H    . PHE A 1 59 ? -4.818  -3.152  7.580   1.00 0.00 ? 59 PHE A H    7  
ATOM 8146  H HA   . PHE A 1 59 ? -3.570  -2.651  10.203  1.00 0.00 ? 59 PHE A HA   7  
ATOM 8147  H HB2  . PHE A 1 59 ? -2.225  -0.885  9.043   1.00 0.00 ? 59 PHE A HB2  7  
ATOM 8148  H HB3  . PHE A 1 59 ? -1.860  -2.524  8.516   1.00 0.00 ? 59 PHE A HB3  7  
ATOM 8149  H HD1  . PHE A 1 59 ? -2.865  -3.345  6.352   1.00 0.00 ? 59 PHE A HD1  7  
ATOM 8150  H HD2  . PHE A 1 59 ? -2.915  0.748   7.519   1.00 0.00 ? 59 PHE A HD2  7  
ATOM 8151  H HE1  . PHE A 1 59 ? -3.279  -2.687  4.018   1.00 0.00 ? 59 PHE A HE1  7  
ATOM 8152  H HE2  . PHE A 1 59 ? -3.330  1.412   5.188   1.00 0.00 ? 59 PHE A HE2  7  
ATOM 8153  H HZ   . PHE A 1 59 ? -3.512  -0.307  3.433   1.00 0.00 ? 59 PHE A HZ   7  
ATOM 8154  N N    . GLN A 1 60 ? -4.622  -0.338  10.513  1.00 0.00 ? 60 GLN A N    7  
ATOM 8155  C CA   . GLN A 1 60 ? -5.488  0.792   10.829  1.00 0.00 ? 60 GLN A CA   7  
ATOM 8156  C C    . GLN A 1 60 ? -5.055  2.040   10.068  1.00 0.00 ? 60 GLN A C    7  
ATOM 8157  O O    . GLN A 1 60 ? -3.950  2.545   10.262  1.00 0.00 ? 60 GLN A O    7  
ATOM 8158  C CB   . GLN A 1 60 ? -5.475  1.067   12.334  1.00 0.00 ? 60 GLN A CB   7  
ATOM 8159  C CG   . GLN A 1 60 ? -6.537  2.059   12.780  1.00 0.00 ? 60 GLN A CG   7  
ATOM 8160  C CD   . GLN A 1 60 ? -7.944  1.578   12.485  1.00 0.00 ? 60 GLN A CD   7  
ATOM 8161  O OE1  . GLN A 1 60 ? -8.563  0.895   13.302  1.00 0.00 ? 60 GLN A OE1  7  
ATOM 8162  N NE2  . GLN A 1 60 ? -8.457  1.932   11.313  1.00 0.00 ? 60 GLN A NE2  7  
ATOM 8163  H H    . GLN A 1 60 ? -3.859  -0.534  11.098  1.00 0.00 ? 60 GLN A H    7  
ATOM 8164  H HA   . GLN A 1 60 ? -6.493  0.532   10.529  1.00 0.00 ? 60 GLN A HA   7  
ATOM 8165  H HB2  . GLN A 1 60 ? -5.637  0.138   12.859  1.00 0.00 ? 60 GLN A HB2  7  
ATOM 8166  H HB3  . GLN A 1 60 ? -4.507  1.461   12.607  1.00 0.00 ? 60 GLN A HB3  7  
ATOM 8167  H HG2  . GLN A 1 60 ? -6.442  2.215   13.843  1.00 0.00 ? 60 GLN A HG2  7  
ATOM 8168  H HG3  . GLN A 1 60 ? -6.376  2.994   12.264  1.00 0.00 ? 60 GLN A HG3  7  
ATOM 8169  H HE21 . GLN A 1 60 ? -7.907  2.477   10.711  1.00 0.00 ? 60 GLN A HE21 7  
ATOM 8170  H HE22 . GLN A 1 60 ? -9.366  1.635   11.097  1.00 0.00 ? 60 GLN A HE22 7  
ATOM 8171  N N    . CYS A 1 61 ? -5.933  2.532   9.200   1.00 0.00 ? 61 CYS A N    7  
ATOM 8172  C CA   . CYS A 1 61 ? -5.642  3.722   8.409   1.00 0.00 ? 61 CYS A CA   7  
ATOM 8173  C C    . CYS A 1 61 ? -6.904  4.553   8.191   1.00 0.00 ? 61 CYS A C    7  
ATOM 8174  O O    . CYS A 1 61 ? -8.016  4.025   8.211   1.00 0.00 ? 61 CYS A O    7  
ATOM 8175  C CB   . CYS A 1 61 ? -5.035  3.329   7.061   1.00 0.00 ? 61 CYS A CB   7  
ATOM 8176  S SG   . CYS A 1 61 ? -3.227  3.364   7.026   1.00 0.00 ? 61 CYS A SG   7  
ATOM 8177  H H    . CYS A 1 61 ? -6.798  2.085   9.089   1.00 0.00 ? 61 CYS A H    7  
ATOM 8178  H HA   . CYS A 1 61 ? -4.926  4.316   8.956   1.00 0.00 ? 61 CYS A HA   7  
ATOM 8179  H HB2  . CYS A 1 61 ? -5.347  2.326   6.813   1.00 0.00 ? 61 CYS A HB2  7  
ATOM 8180  H HB3  . CYS A 1 61 ? -5.392  4.009   6.301   1.00 0.00 ? 61 CYS A HB3  7  
ATOM 8181  H HG   . CYS A 1 61 ? -2.937  4.128   7.530   1.00 0.00 ? 61 CYS A HG   7  
ATOM 8182  N N    . PRO A 1 62 ? -6.747  5.871   7.977   1.00 0.00 ? 62 PRO A N    7  
ATOM 8183  C CA   . PRO A 1 62 ? -7.882  6.774   7.753   1.00 0.00 ? 62 PRO A CA   7  
ATOM 8184  C C    . PRO A 1 62 ? -8.588  6.499   6.428   1.00 0.00 ? 62 PRO A C    7  
ATOM 8185  O O    . PRO A 1 62 ? -8.106  5.716   5.609   1.00 0.00 ? 62 PRO A O    7  
ATOM 8186  C CB   . PRO A 1 62 ? -7.237  8.162   7.738   1.00 0.00 ? 62 PRO A CB   7  
ATOM 8187  C CG   . PRO A 1 62 ? -5.818  7.920   7.354   1.00 0.00 ? 62 PRO A CG   7  
ATOM 8188  C CD   . PRO A 1 62 ? -5.457  6.582   7.935   1.00 0.00 ? 62 PRO A CD   7  
ATOM 8189  H HA   . PRO A 1 62 ? -8.598  6.714   8.559   1.00 0.00 ? 62 PRO A HA   7  
ATOM 8190  H HB2  . PRO A 1 62 ? -7.742  8.788   7.016   1.00 0.00 ? 62 PRO A HB2  7  
ATOM 8191  H HB3  . PRO A 1 62 ? -7.309  8.607   8.719   1.00 0.00 ? 62 PRO A HB3  7  
ATOM 8192  H HG2  . PRO A 1 62 ? -5.728  7.900   6.278   1.00 0.00 ? 62 PRO A HG2  7  
ATOM 8193  H HG3  . PRO A 1 62 ? -5.188  8.692   7.772   1.00 0.00 ? 62 PRO A HG3  7  
ATOM 8194  H HD2  . PRO A 1 62 ? -4.755  6.070   7.293   1.00 0.00 ? 62 PRO A HD2  7  
ATOM 8195  H HD3  . PRO A 1 62 ? -5.049  6.699   8.927   1.00 0.00 ? 62 PRO A HD3  7  
ATOM 8196  N N    . PRO A 1 63 ? -9.745  7.143   6.199   1.00 0.00 ? 63 PRO A N    7  
ATOM 8197  C CA   . PRO A 1 63 ? -10.518 6.963   4.966   1.00 0.00 ? 63 PRO A CA   7  
ATOM 8198  C C    . PRO A 1 63 ? -9.837  7.598   3.757   1.00 0.00 ? 63 PRO A C    7  
ATOM 8199  O O    . PRO A 1 63 ? -9.348  8.725   3.828   1.00 0.00 ? 63 PRO A O    7  
ATOM 8200  C CB   . PRO A 1 63 ? -11.839 7.672   5.268   1.00 0.00 ? 63 PRO A CB   7  
ATOM 8201  C CG   . PRO A 1 63 ? -11.494 8.694   6.294   1.00 0.00 ? 63 PRO A CG   7  
ATOM 8202  C CD   . PRO A 1 63 ? -10.392 8.095   7.123   1.00 0.00 ? 63 PRO A CD   7  
ATOM 8203  H HA   . PRO A 1 63 ? -10.703 5.918   4.764   1.00 0.00 ? 63 PRO A HA   7  
ATOM 8204  H HB2  . PRO A 1 63 ? -12.220 8.129   4.366   1.00 0.00 ? 63 PRO A HB2  7  
ATOM 8205  H HB3  . PRO A 1 63 ? -12.555 6.959   5.648   1.00 0.00 ? 63 PRO A HB3  7  
ATOM 8206  H HG2  . PRO A 1 63 ? -11.151 9.597   5.811   1.00 0.00 ? 63 PRO A HG2  7  
ATOM 8207  H HG3  . PRO A 1 63 ? -12.355 8.901   6.911   1.00 0.00 ? 63 PRO A HG3  7  
ATOM 8208  H HD2  . PRO A 1 63 ? -9.696  8.859   7.437   1.00 0.00 ? 63 PRO A HD2  7  
ATOM 8209  H HD3  . PRO A 1 63 ? -10.801 7.580   7.980   1.00 0.00 ? 63 PRO A HD3  7  
ATOM 8210  N N    . LYS A 1 64 ? -9.809  6.865   2.649   1.00 0.00 ? 64 LYS A N    7  
ATOM 8211  C CA   . LYS A 1 64 ? -9.189  7.355   1.423   1.00 0.00 ? 64 LYS A CA   7  
ATOM 8212  C C    . LYS A 1 64 ? -7.703  7.634   1.637   1.00 0.00 ? 64 LYS A C    7  
ATOM 8213  O O    . LYS A 1 64 ? -7.208  8.712   1.304   1.00 0.00 ? 64 LYS A O    7  
ATOM 8214  C CB   . LYS A 1 64 ? -9.896  8.624   0.942   1.00 0.00 ? 64 LYS A CB   7  
ATOM 8215  C CG   . LYS A 1 64 ? -11.325 8.385   0.480   1.00 0.00 ? 64 LYS A CG   7  
ATOM 8216  C CD   . LYS A 1 64 ? -11.389 8.098   -1.011  1.00 0.00 ? 64 LYS A CD   7  
ATOM 8217  C CE   . LYS A 1 64 ? -11.262 6.611   -1.301  1.00 0.00 ? 64 LYS A CE   7  
ATOM 8218  N NZ   . LYS A 1 64 ? -12.454 6.082   -2.020  1.00 0.00 ? 64 LYS A NZ   7  
ATOM 8219  H H    . LYS A 1 64 ? -10.216 5.974   2.654   1.00 0.00 ? 64 LYS A H    7  
ATOM 8220  H HA   . LYS A 1 64 ? -9.292  6.589   0.670   1.00 0.00 ? 64 LYS A HA   7  
ATOM 8221  H HB2  . LYS A 1 64 ? -9.917  9.340   1.750   1.00 0.00 ? 64 LYS A HB2  7  
ATOM 8222  H HB3  . LYS A 1 64 ? -9.340  9.042   0.116   1.00 0.00 ? 64 LYS A HB3  7  
ATOM 8223  H HG2  . LYS A 1 64 ? -11.730 7.539   1.017   1.00 0.00 ? 64 LYS A HG2  7  
ATOM 8224  H HG3  . LYS A 1 64 ? -11.914 9.265   0.694   1.00 0.00 ? 64 LYS A HG3  7  
ATOM 8225  H HD2  . LYS A 1 64 ? -12.335 8.449   -1.395  1.00 0.00 ? 64 LYS A HD2  7  
ATOM 8226  H HD3  . LYS A 1 64 ? -10.582 8.622   -1.503  1.00 0.00 ? 64 LYS A HD3  7  
ATOM 8227  H HE2  . LYS A 1 64 ? -10.385 6.449   -1.910  1.00 0.00 ? 64 LYS A HE2  7  
ATOM 8228  H HE3  . LYS A 1 64 ? -11.153 6.080   -0.366  1.00 0.00 ? 64 LYS A HE3  7  
ATOM 8229  H HZ1  . LYS A 1 64 ? -12.280 6.078   -3.046  1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 8230  H HZ2  . LYS A 1 64 ? -13.284 6.676   -1.823  1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 8231  H HZ3  . LYS A 1 64 ? -12.656 5.110   -1.711  1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 8232  N N    . PHE A 1 65 ? -6.996  6.657   2.194   1.00 0.00 ? 65 PHE A N    7  
ATOM 8233  C CA   . PHE A 1 65 ? -5.569  6.797   2.452   1.00 0.00 ? 65 PHE A CA   7  
ATOM 8234  C C    . PHE A 1 65 ? -4.839  5.479   2.209   1.00 0.00 ? 65 PHE A C    7  
ATOM 8235  O O    . PHE A 1 65 ? -3.822  5.439   1.518   1.00 0.00 ? 65 PHE A O    7  
ATOM 8236  C CB   . PHE A 1 65 ? -5.331  7.271   3.888   1.00 0.00 ? 65 PHE A CB   7  
ATOM 8237  C CG   . PHE A 1 65 ? -5.155  8.757   4.007   1.00 0.00 ? 65 PHE A CG   7  
ATOM 8238  C CD1  . PHE A 1 65 ? -6.217  9.615   3.772   1.00 0.00 ? 65 PHE A CD1  7  
ATOM 8239  C CD2  . PHE A 1 65 ? -3.926  9.296   4.355   1.00 0.00 ? 65 PHE A CD2  7  
ATOM 8240  C CE1  . PHE A 1 65 ? -6.058  10.984  3.881   1.00 0.00 ? 65 PHE A CE1  7  
ATOM 8241  C CE2  . PHE A 1 65 ? -3.760  10.664  4.464   1.00 0.00 ? 65 PHE A CE2  7  
ATOM 8242  C CZ   . PHE A 1 65 ? -4.828  11.509  4.227   1.00 0.00 ? 65 PHE A CZ   7  
ATOM 8243  H H    . PHE A 1 65 ? -7.446  5.821   2.438   1.00 0.00 ? 65 PHE A H    7  
ATOM 8244  H HA   . PHE A 1 65 ? -5.181  7.539   1.769   1.00 0.00 ? 65 PHE A HA   7  
ATOM 8245  H HB2  . PHE A 1 65 ? -6.176  6.986   4.498   1.00 0.00 ? 65 PHE A HB2  7  
ATOM 8246  H HB3  . PHE A 1 65 ? -4.440  6.797   4.273   1.00 0.00 ? 65 PHE A HB3  7  
ATOM 8247  H HD1  . PHE A 1 65 ? -7.179  9.205   3.502   1.00 0.00 ? 65 PHE A HD1  7  
ATOM 8248  H HD2  . PHE A 1 65 ? -3.092  8.638   4.539   1.00 0.00 ? 65 PHE A HD2  7  
ATOM 8249  H HE1  . PHE A 1 65 ? -6.894  11.642  3.694   1.00 0.00 ? 65 PHE A HE1  7  
ATOM 8250  H HE2  . PHE A 1 65 ? -2.798  11.073  4.735   1.00 0.00 ? 65 PHE A HE2  7  
ATOM 8251  H HZ   . PHE A 1 65 ? -4.701  12.578  4.313   1.00 0.00 ? 65 PHE A HZ   7  
ATOM 8252  N N    . GLY A 1 66 ? -5.367  4.402   2.784   1.00 0.00 ? 66 GLY A N    7  
ATOM 8253  C CA   . GLY A 1 66 ? -4.754  3.098   2.617   1.00 0.00 ? 66 GLY A CA   7  
ATOM 8254  C C    . GLY A 1 66 ? -4.975  2.525   1.231   1.00 0.00 ? 66 GLY A C    7  
ATOM 8255  O O    . GLY A 1 66 ? -6.077  2.084   0.904   1.00 0.00 ? 66 GLY A O    7  
ATOM 8256  H H    . GLY A 1 66 ? -6.180  4.495   3.324   1.00 0.00 ? 66 GLY A H    7  
ATOM 8257  H HA2  . GLY A 1 66 ? -3.691  3.187   2.792   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 8258  H HA3  . GLY A 1 66 ? -5.171  2.420   3.346   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 8259  N N    . LEU A 1 67 ? -3.928  2.533   0.415   1.00 0.00 ? 67 LEU A N    7  
ATOM 8260  C CA   . LEU A 1 67 ? -4.014  2.011   -0.945  1.00 0.00 ? 67 LEU A CA   7  
ATOM 8261  C C    . LEU A 1 67 ? -3.322  0.656   -1.053  1.00 0.00 ? 67 LEU A C    7  
ATOM 8262  O O    . LEU A 1 67 ? -2.197  0.483   -0.583  1.00 0.00 ? 67 LEU A O    7  
ATOM 8263  C CB   . LEU A 1 67 ? -3.386  2.997   -1.932  1.00 0.00 ? 67 LEU A CB   7  
ATOM 8264  C CG   . LEU A 1 67 ? -3.601  2.658   -3.410  1.00 0.00 ? 67 LEU A CG   7  
ATOM 8265  C CD1  . LEU A 1 67 ? -4.536  3.668   -4.061  1.00 0.00 ? 67 LEU A CD1  7  
ATOM 8266  C CD2  . LEU A 1 67 ? -2.272  2.610   -4.148  1.00 0.00 ? 67 LEU A CD2  7  
ATOM 8267  H H    . LEU A 1 67 ? -3.076  2.898   0.733   1.00 0.00 ? 67 LEU A H    7  
ATOM 8268  H HA   . LEU A 1 67 ? -5.058  1.889   -1.187  1.00 0.00 ? 67 LEU A HA   7  
ATOM 8269  H HB2  . LEU A 1 67 ? -3.801  3.977   -1.742  1.00 0.00 ? 67 LEU A HB2  7  
ATOM 8270  H HB3  . LEU A 1 67 ? -2.324  3.033   -1.744  1.00 0.00 ? 67 LEU A HB3  7  
ATOM 8271  H HG   . LEU A 1 67 ? -4.062  1.684   -3.485  1.00 0.00 ? 67 LEU A HG   7  
ATOM 8272  H HD11 . LEU A 1 67 ? -5.555  3.451   -3.777  1.00 0.00 ? 67 LEU A HD11 7  
ATOM 8273  H HD12 . LEU A 1 67 ? -4.441  3.605   -5.135  1.00 0.00 ? 67 LEU A HD12 7  
ATOM 8274  H HD13 . LEU A 1 67 ? -4.275  4.663   -3.734  1.00 0.00 ? 67 LEU A HD13 7  
ATOM 8275  H HD21 . LEU A 1 67 ? -2.410  2.135   -5.108  1.00 0.00 ? 67 LEU A HD21 7  
ATOM 8276  H HD22 . LEU A 1 67 ? -1.558  2.045   -3.566  1.00 0.00 ? 67 LEU A HD22 7  
ATOM 8277  H HD23 . LEU A 1 67 ? -1.903  3.614   -4.293  1.00 0.00 ? 67 LEU A HD23 7  
ATOM 8278  N N    . PHE A 1 68 ? -4.002  -0.302  -1.676  1.00 0.00 ? 68 PHE A N    7  
ATOM 8279  C CA   . PHE A 1 68 ? -3.452  -1.641  -1.847  1.00 0.00 ? 68 PHE A CA   7  
ATOM 8280  C C    . PHE A 1 68 ? -2.870  -1.816  -3.245  1.00 0.00 ? 68 PHE A C    7  
ATOM 8281  O O    . PHE A 1 68 ? -3.550  -1.587  -4.245  1.00 0.00 ? 68 PHE A O    7  
ATOM 8282  C CB   . PHE A 1 68 ? -4.534  -2.694  -1.598  1.00 0.00 ? 68 PHE A CB   7  
ATOM 8283  C CG   . PHE A 1 68 ? -4.905  -2.846  -0.150  1.00 0.00 ? 68 PHE A CG   7  
ATOM 8284  C CD1  . PHE A 1 68 ? -4.090  -3.557  0.716   1.00 0.00 ? 68 PHE A CD1  7  
ATOM 8285  C CD2  . PHE A 1 68 ? -6.069  -2.278  0.343   1.00 0.00 ? 68 PHE A CD2  7  
ATOM 8286  C CE1  . PHE A 1 68 ? -4.429  -3.699  2.048   1.00 0.00 ? 68 PHE A CE1  7  
ATOM 8287  C CE2  . PHE A 1 68 ? -6.413  -2.417  1.674   1.00 0.00 ? 68 PHE A CE2  7  
ATOM 8288  C CZ   . PHE A 1 68 ? -5.591  -3.127  2.527   1.00 0.00 ? 68 PHE A CZ   7  
ATOM 8289  H H    . PHE A 1 68 ? -4.893  -0.101  -2.030  1.00 0.00 ? 68 PHE A H    7  
ATOM 8290  H HA   . PHE A 1 68 ? -2.664  -1.772  -1.121  1.00 0.00 ? 68 PHE A HA   7  
ATOM 8291  H HB2  . PHE A 1 68 ? -5.426  -2.419  -2.142  1.00 0.00 ? 68 PHE A HB2  7  
ATOM 8292  H HB3  . PHE A 1 68 ? -4.183  -3.651  -1.955  1.00 0.00 ? 68 PHE A HB3  7  
ATOM 8293  H HD1  . PHE A 1 68 ? -3.181  -4.003  0.342   1.00 0.00 ? 68 PHE A HD1  7  
ATOM 8294  H HD2  . PHE A 1 68 ? -6.712  -1.722  -0.324  1.00 0.00 ? 68 PHE A HD2  7  
ATOM 8295  H HE1  . PHE A 1 68 ? -3.786  -4.256  2.714   1.00 0.00 ? 68 PHE A HE1  7  
ATOM 8296  H HE2  . PHE A 1 68 ? -7.323  -1.970  2.047   1.00 0.00 ? 68 PHE A HE2  7  
ATOM 8297  H HZ   . PHE A 1 68 ? -5.859  -3.237  3.569   1.00 0.00 ? 68 PHE A HZ   7  
ATOM 8298  N N    . ALA A 1 69 ? -1.607  -2.224  -3.308  1.00 0.00 ? 69 ALA A N    7  
ATOM 8299  C CA   . ALA A 1 69 ? -0.934  -2.430  -4.584  1.00 0.00 ? 69 ALA A CA   7  
ATOM 8300  C C    . ALA A 1 69 ? -0.022  -3.654  -4.532  1.00 0.00 ? 69 ALA A C    7  
ATOM 8301  O O    . ALA A 1 69 ? 0.577   -3.947  -3.497  1.00 0.00 ? 69 ALA A O    7  
ATOM 8302  C CB   . ALA A 1 69 ? -0.136  -1.192  -4.965  1.00 0.00 ? 69 ALA A CB   7  
ATOM 8303  H H    . ALA A 1 69 ? -1.116  -2.391  -2.476  1.00 0.00 ? 69 ALA A H    7  
ATOM 8304  H HA   . ALA A 1 69 ? -1.691  -2.587  -5.338  1.00 0.00 ? 69 ALA A HA   7  
ATOM 8305  H HB1  . ALA A 1 69 ? -0.790  -0.332  -4.981  1.00 0.00 ? 69 ALA A HB1  7  
ATOM 8306  H HB2  . ALA A 1 69 ? 0.299   -1.331  -5.944  1.00 0.00 ? 69 ALA A HB2  7  
ATOM 8307  H HB3  . ALA A 1 69 ? 0.650   -1.032  -4.241  1.00 0.00 ? 69 ALA A HB3  7  
ATOM 8308  N N    . PRO A 1 70 ? 0.097   -4.388  -5.653  1.00 0.00 ? 70 PRO A N    7  
ATOM 8309  C CA   . PRO A 1 70 ? 0.943   -5.584  -5.724  1.00 0.00 ? 70 PRO A CA   7  
ATOM 8310  C C    . PRO A 1 70 ? 2.377   -5.303  -5.291  1.00 0.00 ? 70 PRO A C    7  
ATOM 8311  O O    . PRO A 1 70 ? 2.931   -4.246  -5.593  1.00 0.00 ? 70 PRO A O    7  
ATOM 8312  C CB   . PRO A 1 70 ? 0.901   -5.968  -7.206  1.00 0.00 ? 70 PRO A CB   7  
ATOM 8313  C CG   . PRO A 1 70 ? -0.366  -5.376  -7.717  1.00 0.00 ? 70 PRO A CG   7  
ATOM 8314  C CD   . PRO A 1 70 ? -0.579  -4.112  -6.934  1.00 0.00 ? 70 PRO A CD   7  
ATOM 8315  H HA   . PRO A 1 70 ? 0.541   -6.389  -5.129  1.00 0.00 ? 70 PRO A HA   7  
ATOM 8316  H HB2  . PRO A 1 70 ? 1.763   -5.556  -7.711  1.00 0.00 ? 70 PRO A HB2  7  
ATOM 8317  H HB3  . PRO A 1 70 ? 0.900   -7.044  -7.301  1.00 0.00 ? 70 PRO A HB3  7  
ATOM 8318  H HG2  . PRO A 1 70 ? -0.269  -5.153  -8.769  1.00 0.00 ? 70 PRO A HG2  7  
ATOM 8319  H HG3  . PRO A 1 70 ? -1.185  -6.062  -7.552  1.00 0.00 ? 70 PRO A HG3  7  
ATOM 8320  H HD2  . PRO A 1 70 ? -0.122  -3.273  -7.438  1.00 0.00 ? 70 PRO A HD2  7  
ATOM 8321  H HD3  . PRO A 1 70 ? -1.633  -3.934  -6.783  1.00 0.00 ? 70 PRO A HD3  7  
ATOM 8322  N N    . ILE A 1 71 ? 2.974   -6.254  -4.580  1.00 0.00 ? 71 ILE A N    7  
ATOM 8323  C CA   . ILE A 1 71 ? 4.343   -6.106  -4.104  1.00 0.00 ? 71 ILE A CA   7  
ATOM 8324  C C    . ILE A 1 71 ? 5.308   -5.869  -5.263  1.00 0.00 ? 71 ILE A C    7  
ATOM 8325  O O    . ILE A 1 71 ? 6.151   -4.973  -5.207  1.00 0.00 ? 71 ILE A O    7  
ATOM 8326  C CB   . ILE A 1 71 ? 4.798   -7.344  -3.304  1.00 0.00 ? 71 ILE A CB   7  
ATOM 8327  C CG1  . ILE A 1 71 ? 6.201   -7.128  -2.733  1.00 0.00 ? 71 ILE A CG1  7  
ATOM 8328  C CG2  . ILE A 1 71 ? 4.763   -8.589  -4.179  1.00 0.00 ? 71 ILE A CG2  7  
ATOM 8329  C CD1  . ILE A 1 71 ? 6.445   -7.865  -1.435  1.00 0.00 ? 71 ILE A CD1  7  
ATOM 8330  H H    . ILE A 1 71 ? 2.481   -7.074  -4.370  1.00 0.00 ? 71 ILE A H    7  
ATOM 8331  H HA   . ILE A 1 71 ? 4.373   -5.249  -3.446  1.00 0.00 ? 71 ILE A HA   7  
ATOM 8332  H HB   . ILE A 1 71 ? 4.106   -7.491  -2.489  1.00 0.00 ? 71 ILE A HB   7  
ATOM 8333  H HG12 . ILE A 1 71 ? 6.932   -7.470  -3.451  1.00 0.00 ? 71 ILE A HG12 7  
ATOM 8334  H HG13 . ILE A 1 71 ? 6.349   -6.073  -2.550  1.00 0.00 ? 71 ILE A HG13 7  
ATOM 8335  H HG21 . ILE A 1 71 ? 4.746   -9.469  -3.553  1.00 0.00 ? 71 ILE A HG21 7  
ATOM 8336  H HG22 . ILE A 1 71 ? 5.639   -8.611  -4.809  1.00 0.00 ? 71 ILE A HG22 7  
ATOM 8337  H HG23 . ILE A 1 71 ? 3.876   -8.570  -4.796  1.00 0.00 ? 71 ILE A HG23 7  
ATOM 8338  H HD11 . ILE A 1 71 ? 5.938   -7.355  -0.629  1.00 0.00 ? 71 ILE A HD11 7  
ATOM 8339  H HD12 . ILE A 1 71 ? 7.506   -7.893  -1.230  1.00 0.00 ? 71 ILE A HD12 7  
ATOM 8340  H HD13 . ILE A 1 71 ? 6.067   -8.874  -1.517  1.00 0.00 ? 71 ILE A HD13 7  
ATOM 8341  N N    . HIS A 1 72 ? 5.179   -6.674  -6.312  1.00 0.00 ? 72 HIS A N    7  
ATOM 8342  C CA   . HIS A 1 72 ? 6.041   -6.548  -7.482  1.00 0.00 ? 72 HIS A CA   7  
ATOM 8343  C C    . HIS A 1 72 ? 5.842   -5.199  -8.167  1.00 0.00 ? 72 HIS A C    7  
ATOM 8344  O O    . HIS A 1 72 ? 6.719   -4.726  -8.891  1.00 0.00 ? 72 HIS A O    7  
ATOM 8345  C CB   . HIS A 1 72 ? 5.763   -7.681  -8.472  1.00 0.00 ? 72 HIS A CB   7  
ATOM 8346  C CG   . HIS A 1 72 ? 4.325   -7.787  -8.876  1.00 0.00 ? 72 HIS A CG   7  
ATOM 8347  N ND1  . HIS A 1 72 ? 3.409   -8.599  -8.246  1.00 0.00 ? 72 HIS A ND1  7  
ATOM 8348  C CD2  . HIS A 1 72 ? 3.648   -7.161  -9.872  1.00 0.00 ? 72 HIS A CD2  7  
ATOM 8349  C CE1  . HIS A 1 72 ? 2.231   -8.447  -8.865  1.00 0.00 ? 72 HIS A CE1  7  
ATOM 8350  N NE2  . HIS A 1 72 ? 2.322   -7.584  -9.860  1.00 0.00 ? 72 HIS A NE2  7  
ATOM 8351  H H    . HIS A 1 72 ? 4.487   -7.368  -6.301  1.00 0.00 ? 72 HIS A H    7  
ATOM 8352  H HA   . HIS A 1 72 ? 7.064   -6.619  -7.147  1.00 0.00 ? 72 HIS A HA   7  
ATOM 8353  H HB2  . HIS A 1 72 ? 6.347   -7.519  -9.366  1.00 0.00 ? 72 HIS A HB2  7  
ATOM 8354  H HB3  . HIS A 1 72 ? 6.054   -8.620  -8.023  1.00 0.00 ? 72 HIS A HB3  7  
ATOM 8355  H HD1  . HIS A 1 72 ? 3.587   -9.185  -7.481  1.00 0.00 ? 72 HIS A HD1  7  
ATOM 8356  H HD2  . HIS A 1 72 ? 4.063   -6.448  -10.569 1.00 0.00 ? 72 HIS A HD2  7  
ATOM 8357  H HE1  . HIS A 1 72 ? 1.323   -8.962  -8.586  1.00 0.00 ? 72 HIS A HE1  7  
ATOM 8358  N N    . LYS A 1 73 ? 4.686   -4.583  -7.937  1.00 0.00 ? 73 LYS A N    7  
ATOM 8359  C CA   . LYS A 1 73 ? 4.379   -3.288  -8.534  1.00 0.00 ? 73 LYS A CA   7  
ATOM 8360  C C    . LYS A 1 73 ? 4.984   -2.148  -7.719  1.00 0.00 ? 73 LYS A C    7  
ATOM 8361  O O    . LYS A 1 73 ? 5.223   -1.059  -8.241  1.00 0.00 ? 73 LYS A O    7  
ATOM 8362  C CB   . LYS A 1 73 ? 2.865   -3.103  -8.647  1.00 0.00 ? 73 LYS A CB   7  
ATOM 8363  C CG   . LYS A 1 73 ? 2.253   -3.812  -9.844  1.00 0.00 ? 73 LYS A CG   7  
ATOM 8364  C CD   . LYS A 1 73 ? 2.129   -2.881  -11.040 1.00 0.00 ? 73 LYS A CD   7  
ATOM 8365  C CE   . LYS A 1 73 ? 2.321   -3.628  -12.350 1.00 0.00 ? 73 LYS A CE   7  
ATOM 8366  N NZ   . LYS A 1 73 ? 1.373   -3.163  -13.400 1.00 0.00 ? 73 LYS A NZ   7  
ATOM 8367  H H    . LYS A 1 73 ? 4.024   -5.006  -7.352  1.00 0.00 ? 73 LYS A H    7  
ATOM 8368  H HA   . LYS A 1 73 ? 4.808   -3.272  -9.525  1.00 0.00 ? 73 LYS A HA   7  
ATOM 8369  H HB2  . LYS A 1 73 ? 2.400   -3.487  -7.752  1.00 0.00 ? 73 LYS A HB2  7  
ATOM 8370  H HB3  . LYS A 1 73 ? 2.647   -2.048  -8.731  1.00 0.00 ? 73 LYS A HB3  7  
ATOM 8371  H HG2  . LYS A 1 73 ? 2.879   -4.648  -10.115 1.00 0.00 ? 73 LYS A HG2  7  
ATOM 8372  H HG3  . LYS A 1 73 ? 1.269   -4.170  -9.574  1.00 0.00 ? 73 LYS A HG3  7  
ATOM 8373  H HD2  . LYS A 1 73 ? 1.147   -2.433  -11.035 1.00 0.00 ? 73 LYS A HD2  7  
ATOM 8374  H HD3  . LYS A 1 73 ? 2.881   -2.109  -10.962 1.00 0.00 ? 73 LYS A HD3  7  
ATOM 8375  H HE2  . LYS A 1 73 ? 3.332   -3.469  -12.695 1.00 0.00 ? 73 LYS A HE2  7  
ATOM 8376  H HE3  . LYS A 1 73 ? 2.162   -4.683  -12.175 1.00 0.00 ? 73 LYS A HE3  7  
ATOM 8377  H HZ1  . LYS A 1 73 ? 1.054   -2.196  -13.189 1.00 0.00 ? 73 LYS A HZ1  7  
ATOM 8378  H HZ2  . LYS A 1 73 ? 0.544   -3.789  -13.436 1.00 0.00 ? 73 LYS A HZ2  7  
ATOM 8379  H HZ3  . LYS A 1 73 ? 1.839   -3.169  -14.330 1.00 0.00 ? 73 LYS A HZ3  7  
ATOM 8380  N N    . VAL A 1 74 ? 5.227   -2.402  -6.436  1.00 0.00 ? 74 VAL A N    7  
ATOM 8381  C CA   . VAL A 1 74 ? 5.801   -1.393  -5.555  1.00 0.00 ? 74 VAL A CA   7  
ATOM 8382  C C    . VAL A 1 74 ? 7.246   -1.088  -5.934  1.00 0.00 ? 74 VAL A C    7  
ATOM 8383  O O    . VAL A 1 74 ? 8.027   -1.993  -6.227  1.00 0.00 ? 74 VAL A O    7  
ATOM 8384  C CB   . VAL A 1 74 ? 5.753   -1.839  -4.082  1.00 0.00 ? 74 VAL A CB   7  
ATOM 8385  C CG1  . VAL A 1 74 ? 6.194   -0.709  -3.165  1.00 0.00 ? 74 VAL A CG1  7  
ATOM 8386  C CG2  . VAL A 1 74 ? 4.356   -2.318  -3.716  1.00 0.00 ? 74 VAL A CG2  7  
ATOM 8387  H H    . VAL A 1 74 ? 5.015   -3.288  -6.074  1.00 0.00 ? 74 VAL A H    7  
ATOM 8388  H HA   . VAL A 1 74 ? 5.214   -0.491  -5.655  1.00 0.00 ? 74 VAL A HA   7  
ATOM 8389  H HB   . VAL A 1 74 ? 6.437   -2.665  -3.953  1.00 0.00 ? 74 VAL A HB   7  
ATOM 8390  H HG11 . VAL A 1 74 ? 6.780   0.003   -3.727  1.00 0.00 ? 74 VAL A HG11 7  
ATOM 8391  H HG12 . VAL A 1 74 ? 6.792   -1.111  -2.360  1.00 0.00 ? 74 VAL A HG12 7  
ATOM 8392  H HG13 . VAL A 1 74 ? 5.324   -0.217  -2.755  1.00 0.00 ? 74 VAL A HG13 7  
ATOM 8393  H HG21 . VAL A 1 74 ? 3.623   -1.715  -4.230  1.00 0.00 ? 74 VAL A HG21 7  
ATOM 8394  H HG22 . VAL A 1 74 ? 4.211   -2.226  -2.649  1.00 0.00 ? 74 VAL A HG22 7  
ATOM 8395  H HG23 . VAL A 1 74 ? 4.242   -3.351  -4.007  1.00 0.00 ? 74 VAL A HG23 7  
ATOM 8396  N N    . ILE A 1 75 ? 7.595   0.195   -5.926  1.00 0.00 ? 75 ILE A N    7  
ATOM 8397  C CA   . ILE A 1 75 ? 8.946   0.623   -6.268  1.00 0.00 ? 75 ILE A CA   7  
ATOM 8398  C C    . ILE A 1 75 ? 9.610   1.331   -5.092  1.00 0.00 ? 75 ILE A C    7  
ATOM 8399  O O    . ILE A 1 75 ? 9.204   2.427   -4.705  1.00 0.00 ? 75 ILE A O    7  
ATOM 8400  C CB   . ILE A 1 75 ? 8.947   1.565   -7.486  1.00 0.00 ? 75 ILE A CB   7  
ATOM 8401  C CG1  . ILE A 1 75 ? 8.112   0.969   -8.621  1.00 0.00 ? 75 ILE A CG1  7  
ATOM 8402  C CG2  . ILE A 1 75 ? 10.371  1.830   -7.950  1.00 0.00 ? 75 ILE A CG2  7  
ATOM 8403  C CD1  . ILE A 1 75 ? 7.778   1.961   -9.712  1.00 0.00 ? 75 ILE A CD1  7  
ATOM 8404  H H    . ILE A 1 75 ? 6.928   0.871   -5.683  1.00 0.00 ? 75 ILE A H    7  
ATOM 8405  H HA   . ILE A 1 75 ? 9.522   -0.257  -6.517  1.00 0.00 ? 75 ILE A HA   7  
ATOM 8406  H HB   . ILE A 1 75 ? 8.512   2.506   -7.186  1.00 0.00 ? 75 ILE A HB   7  
ATOM 8407  H HG12 . ILE A 1 75 ? 8.659   0.154   -9.072  1.00 0.00 ? 75 ILE A HG12 7  
ATOM 8408  H HG13 . ILE A 1 75 ? 7.184   0.593   -8.216  1.00 0.00 ? 75 ILE A HG13 7  
ATOM 8409  H HG21 . ILE A 1 75 ? 10.905  0.894   -8.028  1.00 0.00 ? 75 ILE A HG21 7  
ATOM 8410  H HG22 . ILE A 1 75 ? 10.869  2.470   -7.238  1.00 0.00 ? 75 ILE A HG22 7  
ATOM 8411  H HG23 . ILE A 1 75 ? 10.351  2.313   -8.916  1.00 0.00 ? 75 ILE A HG23 7  
ATOM 8412  H HD11 . ILE A 1 75 ? 7.614   1.436   -10.641 1.00 0.00 ? 75 ILE A HD11 7  
ATOM 8413  H HD12 . ILE A 1 75 ? 8.596   2.656   -9.830  1.00 0.00 ? 75 ILE A HD12 7  
ATOM 8414  H HD13 . ILE A 1 75 ? 6.883   2.503   -9.443  1.00 0.00 ? 75 ILE A HD13 7  
ATOM 8415  N N    . ARG A 1 76 ? 10.634  0.698   -4.528  1.00 0.00 ? 76 ARG A N    7  
ATOM 8416  C CA   . ARG A 1 76 ? 11.355  1.269   -3.396  1.00 0.00 ? 76 ARG A CA   7  
ATOM 8417  C C    . ARG A 1 76 ? 11.974  2.613   -3.768  1.00 0.00 ? 76 ARG A C    7  
ATOM 8418  O O    . ARG A 1 76 ? 12.702  2.720   -4.755  1.00 0.00 ? 76 ARG A O    7  
ATOM 8419  C CB   . ARG A 1 76 ? 12.442  0.304   -2.919  1.00 0.00 ? 76 ARG A CB   7  
ATOM 8420  C CG   . ARG A 1 76 ? 12.523  0.181   -1.405  1.00 0.00 ? 76 ARG A CG   7  
ATOM 8421  C CD   . ARG A 1 76 ? 12.614  -1.272  -0.966  1.00 0.00 ? 76 ARG A CD   7  
ATOM 8422  N NE   . ARG A 1 76 ? 13.986  -1.771  -1.009  1.00 0.00 ? 76 ARG A NE   7  
ATOM 8423  C CZ   . ARG A 1 76 ? 14.382  -2.903  -0.430  1.00 0.00 ? 76 ARG A CZ   7  
ATOM 8424  N NH1  . ARG A 1 76 ? 13.514  -3.654  0.236   1.00 0.00 ? 76 ARG A NH1  7  
ATOM 8425  N NH2  . ARG A 1 76 ? 15.649  -3.284  -0.518  1.00 0.00 ? 76 ARG A NH2  7  
ATOM 8426  H H    . ARG A 1 76 ? 10.911  -0.173  -4.882  1.00 0.00 ? 76 ARG A H    7  
ATOM 8427  H HA   . ARG A 1 76 ? 10.645  1.423   -2.596  1.00 0.00 ? 76 ARG A HA   7  
ATOM 8428  H HB2  . ARG A 1 76 ? 12.242  -0.675  -3.329  1.00 0.00 ? 76 ARG A HB2  7  
ATOM 8429  H HB3  . ARG A 1 76 ? 13.398  0.648   -3.282  1.00 0.00 ? 76 ARG A HB3  7  
ATOM 8430  H HG2  . ARG A 1 76 ? 13.399  0.707   -1.057  1.00 0.00 ? 76 ARG A HG2  7  
ATOM 8431  H HG3  . ARG A 1 76 ? 11.639  0.624   -0.971  1.00 0.00 ? 76 ARG A HG3  7  
ATOM 8432  H HD2  . ARG A 1 76 ? 12.244  -1.353  0.045   1.00 0.00 ? 76 ARG A HD2  7  
ATOM 8433  H HD3  . ARG A 1 76 ? 12.001  -1.872  -1.622  1.00 0.00 ? 76 ARG A HD3  7  
ATOM 8434  H HE   . ARG A 1 76 ? 14.648  -1.235  -1.494  1.00 0.00 ? 76 ARG A HE   7  
ATOM 8435  H HH11 . ARG A 1 76 ? 12.557  -3.372  0.305   1.00 0.00 ? 76 ARG A HH11 7  
ATOM 8436  H HH12 . ARG A 1 76 ? 13.817  -4.504  0.668   1.00 0.00 ? 76 ARG A HH12 7  
ATOM 8437  H HH21 . ARG A 1 76 ? 16.307  -2.721  -1.018  1.00 0.00 ? 76 ARG A HH21 7  
ATOM 8438  H HH22 . ARG A 1 76 ? 15.946  -4.133  -0.083  1.00 0.00 ? 76 ARG A HH22 7  
ATOM 8439  N N    . ILE A 1 77 ? 11.679  3.634   -2.971  1.00 0.00 ? 77 ILE A N    7  
ATOM 8440  C CA   . ILE A 1 77 ? 12.206  4.971   -3.217  1.00 0.00 ? 77 ILE A CA   7  
ATOM 8441  C C    . ILE A 1 77 ? 12.802  5.569   -1.947  1.00 0.00 ? 77 ILE A C    7  
ATOM 8442  O O    . ILE A 1 77 ? 12.079  5.924   -1.017  1.00 0.00 ? 77 ILE A O    7  
ATOM 8443  C CB   . ILE A 1 77 ? 11.113  5.917   -3.750  1.00 0.00 ? 77 ILE A CB   7  
ATOM 8444  C CG1  . ILE A 1 77 ? 9.865   5.845   -2.864  1.00 0.00 ? 77 ILE A CG1  7  
ATOM 8445  C CG2  . ILE A 1 77 ? 10.769  5.567   -5.191  1.00 0.00 ? 77 ILE A CG2  7  
ATOM 8446  C CD1  . ILE A 1 77 ? 9.390   7.197   -2.381  1.00 0.00 ? 77 ILE A CD1  7  
ATOM 8447  H H    . ILE A 1 77 ? 11.093  3.486   -2.201  1.00 0.00 ? 77 ILE A H    7  
ATOM 8448  H HA   . ILE A 1 77 ? 12.981  4.892   -3.965  1.00 0.00 ? 77 ILE A HA   7  
ATOM 8449  H HB   . ILE A 1 77 ? 11.500  6.924   -3.733  1.00 0.00 ? 77 ILE A HB   7  
ATOM 8450  H HG12 . ILE A 1 77 ? 9.060   5.391   -3.421  1.00 0.00 ? 77 ILE A HG12 7  
ATOM 8451  H HG13 . ILE A 1 77 ? 10.082  5.238   -1.996  1.00 0.00 ? 77 ILE A HG13 7  
ATOM 8452  H HG21 . ILE A 1 77 ? 10.318  4.587   -5.226  1.00 0.00 ? 77 ILE A HG21 7  
ATOM 8453  H HG22 . ILE A 1 77 ? 11.669  5.571   -5.787  1.00 0.00 ? 77 ILE A HG22 7  
ATOM 8454  H HG23 . ILE A 1 77 ? 10.075  6.297   -5.582  1.00 0.00 ? 77 ILE A HG23 7  
ATOM 8455  H HD11 . ILE A 1 77 ? 9.406   7.899   -3.201  1.00 0.00 ? 77 ILE A HD11 7  
ATOM 8456  H HD12 . ILE A 1 77 ? 10.043  7.548   -1.594  1.00 0.00 ? 77 ILE A HD12 7  
ATOM 8457  H HD13 . ILE A 1 77 ? 8.383   7.110   -2.000  1.00 0.00 ? 77 ILE A HD13 7  
ATOM 8458  N N    . GLY A 1 78 ? 14.127  5.677   -1.915  1.00 0.00 ? 78 GLY A N    7  
ATOM 8459  C CA   . GLY A 1 78 ? 14.797  6.233   -0.753  1.00 0.00 ? 78 GLY A CA   7  
ATOM 8460  C C    . GLY A 1 78 ? 16.262  6.526   -1.013  1.00 0.00 ? 78 GLY A C    7  
ATOM 8461  O O    . GLY A 1 78 ? 17.139  5.981   -0.342  1.00 0.00 ? 78 GLY A O    7  
ATOM 8462  H H    . GLY A 1 78 ? 14.653  5.377   -2.684  1.00 0.00 ? 78 GLY A H    7  
ATOM 8463  H HA2  . GLY A 1 78 ? 14.302  7.150   -0.471  1.00 0.00 ? 78 GLY A HA2  7  
ATOM 8464  H HA3  . GLY A 1 78 ? 14.721  5.529   0.063   1.00 0.00 ? 78 GLY A HA3  7  
ATOM 8465  N N    . SER A 1 79 ? 16.526  7.390   -1.988  1.00 0.00 ? 79 SER A N    7  
ATOM 8466  C CA   . SER A 1 79 ? 17.895  7.756   -2.334  1.00 0.00 ? 79 SER A CA   7  
ATOM 8467  C C    . SER A 1 79 ? 18.009  9.257   -2.584  1.00 0.00 ? 79 SER A C    7  
ATOM 8468  O O    . SER A 1 79 ? 17.028  9.992   -2.463  1.00 0.00 ? 79 SER A O    7  
ATOM 8469  C CB   . SER A 1 79 ? 18.355  6.980   -3.572  1.00 0.00 ? 79 SER A CB   7  
ATOM 8470  O OG   . SER A 1 79 ? 19.425  6.106   -3.257  1.00 0.00 ? 79 SER A OG   7  
ATOM 8471  H H    . SER A 1 79 ? 15.785  7.791   -2.485  1.00 0.00 ? 79 SER A H    7  
ATOM 8472  H HA   . SER A 1 79 ? 18.529  7.493   -1.500  1.00 0.00 ? 79 SER A HA   7  
ATOM 8473  H HB2  . SER A 1 79 ? 17.531  6.397   -3.955  1.00 0.00 ? 79 SER A HB2  7  
ATOM 8474  H HB3  . SER A 1 79 ? 18.686  7.676   -4.329  1.00 0.00 ? 79 SER A HB3  7  
ATOM 8475  H HG   . SER A 1 79 ? 20.194  6.619   -3.001  1.00 0.00 ? 79 SER A HG   7  
ATOM 8476  N N    . GLY A 1 80 ? 19.211  9.706   -2.932  1.00 0.00 ? 80 GLY A N    7  
ATOM 8477  C CA   . GLY A 1 80 ? 19.427  11.117  -3.192  1.00 0.00 ? 80 GLY A CA   7  
ATOM 8478  C C    . GLY A 1 80 ? 20.835  11.411  -3.677  1.00 0.00 ? 80 GLY A C    7  
ATOM 8479  O O    . GLY A 1 80 ? 21.777  10.705  -3.314  1.00 0.00 ? 80 GLY A O    7  
ATOM 8480  H H    . GLY A 1 80 ? 19.956  9.074   -3.012  1.00 0.00 ? 80 GLY A H    7  
ATOM 8481  H HA2  . GLY A 1 80 ? 18.724  11.444  -3.943  1.00 0.00 ? 80 GLY A HA2  7  
ATOM 8482  H HA3  . GLY A 1 80 ? 19.249  11.671  -2.283  1.00 0.00 ? 80 GLY A HA3  7  
ATOM 8483  N N    . PRO A 1 81 ? 21.012  12.455  -4.505  1.00 0.00 ? 81 PRO A N    7  
ATOM 8484  C CA   . PRO A 1 81 ? 22.327  12.830  -5.033  1.00 0.00 ? 81 PRO A CA   7  
ATOM 8485  C C    . PRO A 1 81 ? 23.236  13.418  -3.959  1.00 0.00 ? 81 PRO A C    7  
ATOM 8486  O O    . PRO A 1 81 ? 24.460  13.307  -4.039  1.00 0.00 ? 81 PRO A O    7  
ATOM 8487  C CB   . PRO A 1 81 ? 21.997  13.886  -6.091  1.00 0.00 ? 81 PRO A CB   7  
ATOM 8488  C CG   . PRO A 1 81 ? 20.701  14.471  -5.649  1.00 0.00 ? 81 PRO A CG   7  
ATOM 8489  C CD   . PRO A 1 81 ? 19.945  13.350  -4.989  1.00 0.00 ? 81 PRO A CD   7  
ATOM 8490  H HA   . PRO A 1 81 ? 22.820  11.990  -5.500  1.00 0.00 ? 81 PRO A HA   7  
ATOM 8491  H HB2  . PRO A 1 81 ? 22.780  14.630  -6.116  1.00 0.00 ? 81 PRO A HB2  7  
ATOM 8492  H HB3  . PRO A 1 81 ? 21.908  13.415  -7.058  1.00 0.00 ? 81 PRO A HB3  7  
ATOM 8493  H HG2  . PRO A 1 81 ? 20.880  15.269  -4.944  1.00 0.00 ? 81 PRO A HG2  7  
ATOM 8494  H HG3  . PRO A 1 81 ? 20.153  14.839  -6.504  1.00 0.00 ? 81 PRO A HG3  7  
ATOM 8495  H HD2  . PRO A 1 81 ? 19.354  13.728  -4.166  1.00 0.00 ? 81 PRO A HD2  7  
ATOM 8496  H HD3  . PRO A 1 81 ? 19.315  12.846  -5.707  1.00 0.00 ? 81 PRO A HD3  7  
ATOM 8497  N N    . SER A 1 82 ? 22.630  14.044  -2.956  1.00 0.00 ? 82 SER A N    7  
ATOM 8498  C CA   . SER A 1 82 ? 23.385  14.650  -1.866  1.00 0.00 ? 82 SER A CA   7  
ATOM 8499  C C    . SER A 1 82 ? 23.332  13.779  -0.615  1.00 0.00 ? 82 SER A C    7  
ATOM 8500  O O    . SER A 1 82 ? 22.606  12.785  -0.569  1.00 0.00 ? 82 SER A O    7  
ATOM 8501  C CB   . SER A 1 82 ? 22.838  16.045  -1.553  1.00 0.00 ? 82 SER A CB   7  
ATOM 8502  O OG   . SER A 1 82 ? 21.456  16.129  -1.849  1.00 0.00 ? 82 SER A OG   7  
ATOM 8503  H H    . SER A 1 82 ? 21.652  14.100  -2.949  1.00 0.00 ? 82 SER A H    7  
ATOM 8504  H HA   . SER A 1 82 ? 24.412  14.740  -2.184  1.00 0.00 ? 82 SER A HA   7  
ATOM 8505  H HB2  . SER A 1 82 ? 22.983  16.259  -0.505  1.00 0.00 ? 82 SER A HB2  7  
ATOM 8506  H HB3  . SER A 1 82 ? 23.366  16.777  -2.146  1.00 0.00 ? 82 SER A HB3  7  
ATOM 8507  H HG   . SER A 1 82 ? 21.321  16.734  -2.582  1.00 0.00 ? 82 SER A HG   7  
ATOM 8508  N N    . SER A 1 83 ? 24.104  14.158  0.397   1.00 0.00 ? 83 SER A N    7  
ATOM 8509  C CA   . SER A 1 83 ? 24.145  13.411  1.649   1.00 0.00 ? 83 SER A CA   7  
ATOM 8510  C C    . SER A 1 83 ? 24.392  14.343  2.831   1.00 0.00 ? 83 SER A C    7  
ATOM 8511  O O    . SER A 1 83 ? 25.249  15.225  2.770   1.00 0.00 ? 83 SER A O    7  
ATOM 8512  C CB   . SER A 1 83 ? 25.236  12.340  1.593   1.00 0.00 ? 83 SER A CB   7  
ATOM 8513  O OG   . SER A 1 83 ? 25.147  11.583  0.399   1.00 0.00 ? 83 SER A OG   7  
ATOM 8514  H H    . SER A 1 83 ? 24.661  14.958  0.300   1.00 0.00 ? 83 SER A H    7  
ATOM 8515  H HA   . SER A 1 83 ? 23.188  12.930  1.779   1.00 0.00 ? 83 SER A HA   7  
ATOM 8516  H HB2  . SER A 1 83 ? 26.206  12.814  1.632   1.00 0.00 ? 83 SER A HB2  7  
ATOM 8517  H HB3  . SER A 1 83 ? 25.128  11.674  2.436   1.00 0.00 ? 83 SER A HB3  7  
ATOM 8518  H HG   . SER A 1 83 ? 26.029  11.428  0.051   1.00 0.00 ? 83 SER A HG   7  
ATOM 8519  N N    . GLY A 1 84 ? 23.634  14.142  3.905   1.00 0.00 ? 84 GLY A N    7  
ATOM 8520  C CA   . GLY A 1 84 ? 23.786  14.972  5.085   1.00 0.00 ? 84 GLY A CA   7  
ATOM 8521  C C    . GLY A 1 84 ? 22.806  14.607  6.181   1.00 0.00 ? 84 GLY A C    7  
ATOM 8522  O O    . GLY A 1 84 ? 21.670  14.206  5.853   1.00 0.00 ? 84 GLY A O    7  
ATOM 8523  O OXT  . GLY A 1 84 ? 23.174  14.721  7.369   1.00 0.00 ? 84 GLY A OXT  7  
ATOM 8524  H H    . GLY A 1 84 ? 22.968  13.424  3.895   1.00 0.00 ? 84 GLY A H    7  
ATOM 8525  H HA2  . GLY A 1 84 ? 24.792  14.860  5.464   1.00 0.00 ? 84 GLY A HA2  7  
ATOM 8526  H HA3  . GLY A 1 84 ? 23.631  16.004  4.808   1.00 0.00 ? 84 GLY A HA3  7  
ATOM 8527  N N    . GLY A 1 1  ? 4.116   -11.694 -9.748  1.00 0.00 ? 1  GLY A N    8  
ATOM 8528  C CA   . GLY A 1 1  ? 5.496   -11.193 -9.498  1.00 0.00 ? 1  GLY A CA   8  
ATOM 8529  C C    . GLY A 1 1  ? 6.551   -12.025 -10.201 1.00 0.00 ? 1  GLY A C    8  
ATOM 8530  O O    . GLY A 1 1  ? 7.529   -12.448 -9.585  1.00 0.00 ? 1  GLY A O    8  
ATOM 8531  H H1   . GLY A 1 1  ? 4.098   -12.276 -10.609 1.00 0.00 ? 1  GLY A H1   8  
ATOM 8532  H H2   . GLY A 1 1  ? 3.462   -10.893 -9.870  1.00 0.00 ? 1  GLY A H2   8  
ATOM 8533  H H3   . GLY A 1 1  ? 3.795   -12.270 -8.944  1.00 0.00 ? 1  GLY A H3   8  
ATOM 8534  H HA2  . GLY A 1 1  ? 5.566   -10.173 -9.848  1.00 0.00 ? 1  GLY A HA2  8  
ATOM 8535  H HA3  . GLY A 1 1  ? 5.687   -11.212 -8.435  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 8536  N N    . SER A 1 2  ? 6.353   -12.261 -11.492 1.00 0.00 ? 2  SER A N    8  
ATOM 8537  C CA   . SER A 1 2  ? 7.294   -13.048 -12.280 1.00 0.00 ? 2  SER A CA   8  
ATOM 8538  C C    . SER A 1 2  ? 8.190   -12.145 -13.120 1.00 0.00 ? 2  SER A C    8  
ATOM 8539  O O    . SER A 1 2  ? 8.619   -12.520 -14.211 1.00 0.00 ? 2  SER A O    8  
ATOM 8540  C CB   . SER A 1 2  ? 6.543   -14.025 -13.186 1.00 0.00 ? 2  SER A CB   8  
ATOM 8541  O OG   . SER A 1 2  ? 6.061   -13.374 -14.350 1.00 0.00 ? 2  SER A OG   8  
ATOM 8542  H H    . SER A 1 2  ? 5.553   -11.897 -11.928 1.00 0.00 ? 2  SER A H    8  
ATOM 8543  H HA   . SER A 1 2  ? 7.911   -13.610 -11.594 1.00 0.00 ? 2  SER A HA   8  
ATOM 8544  H HB2  . SER A 1 2  ? 7.207   -14.821 -13.484 1.00 0.00 ? 2  SER A HB2  8  
ATOM 8545  H HB3  . SER A 1 2  ? 5.703   -14.439 -12.648 1.00 0.00 ? 2  SER A HB3  8  
ATOM 8546  H HG   . SER A 1 2  ? 5.498   -12.640 -14.096 1.00 0.00 ? 2  SER A HG   8  
ATOM 8547  N N    . SER A 1 3  ? 8.470   -10.952 -12.605 1.00 0.00 ? 3  SER A N    8  
ATOM 8548  C CA   . SER A 1 3  ? 9.315   -9.994  -13.308 1.00 0.00 ? 3  SER A CA   8  
ATOM 8549  C C    . SER A 1 3  ? 10.166  -9.194  -12.328 1.00 0.00 ? 3  SER A C    8  
ATOM 8550  O O    . SER A 1 3  ? 9.735   -8.160  -11.818 1.00 0.00 ? 3  SER A O    8  
ATOM 8551  C CB   . SER A 1 3  ? 8.457   -9.046  -14.149 1.00 0.00 ? 3  SER A CB   8  
ATOM 8552  O OG   . SER A 1 3  ? 8.294   -9.538  -15.468 1.00 0.00 ? 3  SER A OG   8  
ATOM 8553  H H    . SER A 1 3  ? 8.098   -10.709 -11.731 1.00 0.00 ? 3  SER A H    8  
ATOM 8554  H HA   . SER A 1 3  ? 9.968   -10.549 -13.964 1.00 0.00 ? 3  SER A HA   8  
ATOM 8555  H HB2  . SER A 1 3  ? 7.483   -8.945  -13.693 1.00 0.00 ? 3  SER A HB2  8  
ATOM 8556  H HB3  . SER A 1 3  ? 8.934   -8.077  -14.194 1.00 0.00 ? 3  SER A HB3  8  
ATOM 8557  H HG   . SER A 1 3  ? 8.096   -10.477 -15.437 1.00 0.00 ? 3  SER A HG   8  
ATOM 8558  N N    . GLY A 1 4  ? 11.375  -9.679  -12.068 1.00 0.00 ? 4  GLY A N    8  
ATOM 8559  C CA   . GLY A 1 4  ? 12.267  -8.997  -11.149 1.00 0.00 ? 4  GLY A CA   8  
ATOM 8560  C C    . GLY A 1 4  ? 12.061  -9.428  -9.710  1.00 0.00 ? 4  GLY A C    8  
ATOM 8561  O O    . GLY A 1 4  ? 11.563  -10.522 -9.448  1.00 0.00 ? 4  GLY A O    8  
ATOM 8562  H H    . GLY A 1 4  ? 11.665  -10.509 -12.504 1.00 0.00 ? 4  GLY A H    8  
ATOM 8563  H HA2  . GLY A 1 4  ? 13.287  -9.207  -11.433 1.00 0.00 ? 4  GLY A HA2  8  
ATOM 8564  H HA3  . GLY A 1 4  ? 12.096  -7.933  -11.223 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 8565  N N    . SER A 1 5  ? 12.445  -8.564  -8.776  1.00 0.00 ? 5  SER A N    8  
ATOM 8566  C CA   . SER A 1 5  ? 12.300  -8.861  -7.355  1.00 0.00 ? 5  SER A CA   8  
ATOM 8567  C C    . SER A 1 5  ? 12.320  -7.580  -6.527  1.00 0.00 ? 5  SER A C    8  
ATOM 8568  O O    . SER A 1 5  ? 13.298  -6.833  -6.544  1.00 0.00 ? 5  SER A O    8  
ATOM 8569  C CB   . SER A 1 5  ? 13.416  -9.799  -6.892  1.00 0.00 ? 5  SER A CB   8  
ATOM 8570  O OG   . SER A 1 5  ? 13.475  -10.960 -7.701  1.00 0.00 ? 5  SER A OG   8  
ATOM 8571  H H    . SER A 1 5  ? 12.835  -7.708  -9.047  1.00 0.00 ? 5  SER A H    8  
ATOM 8572  H HA   . SER A 1 5  ? 11.348  -9.352  -7.215  1.00 0.00 ? 5  SER A HA   8  
ATOM 8573  H HB2  . SER A 1 5  ? 14.363  -9.285  -6.954  1.00 0.00 ? 5  SER A HB2  8  
ATOM 8574  H HB3  . SER A 1 5  ? 13.233  -10.094 -5.869  1.00 0.00 ? 5  SER A HB3  8  
ATOM 8575  H HG   . SER A 1 5  ? 13.851  -10.738 -8.555  1.00 0.00 ? 5  SER A HG   8  
ATOM 8576  N N    . SER A 1 6  ? 11.233  -7.333  -5.803  1.00 0.00 ? 6  SER A N    8  
ATOM 8577  C CA   . SER A 1 6  ? 11.125  -6.143  -4.967  1.00 0.00 ? 6  SER A CA   8  
ATOM 8578  C C    . SER A 1 6  ? 11.017  -6.523  -3.493  1.00 0.00 ? 6  SER A C    8  
ATOM 8579  O O    . SER A 1 6  ? 9.935   -6.846  -3.002  1.00 0.00 ? 6  SER A O    8  
ATOM 8580  C CB   . SER A 1 6  ? 9.913   -5.309  -5.385  1.00 0.00 ? 6  SER A CB   8  
ATOM 8581  O OG   . SER A 1 6  ? 10.305  -4.015  -5.809  1.00 0.00 ? 6  SER A OG   8  
ATOM 8582  H H    . SER A 1 6  ? 10.487  -7.967  -5.830  1.00 0.00 ? 6  SER A H    8  
ATOM 8583  H HA   . SER A 1 6  ? 12.021  -5.556  -5.108  1.00 0.00 ? 6  SER A HA   8  
ATOM 8584  H HB2  . SER A 1 6  ? 9.405   -5.801  -6.201  1.00 0.00 ? 6  SER A HB2  8  
ATOM 8585  H HB3  . SER A 1 6  ? 9.236   -5.210  -4.548  1.00 0.00 ? 6  SER A HB3  8  
ATOM 8586  H HG   . SER A 1 6  ? 10.952  -3.660  -5.195  1.00 0.00 ? 6  SER A HG   8  
ATOM 8587  N N    . GLY A 1 7  ? 12.146  -6.484  -2.792  1.00 0.00 ? 7  GLY A N    8  
ATOM 8588  C CA   . GLY A 1 7  ? 12.155  -6.827  -1.382  1.00 0.00 ? 7  GLY A CA   8  
ATOM 8589  C C    . GLY A 1 7  ? 11.970  -5.617  -0.488  1.00 0.00 ? 7  GLY A C    8  
ATOM 8590  O O    . GLY A 1 7  ? 12.916  -4.869  -0.240  1.00 0.00 ? 7  GLY A O    8  
ATOM 8591  H H    . GLY A 1 7  ? 12.978  -6.220  -3.235  1.00 0.00 ? 7  GLY A H    8  
ATOM 8592  H HA2  . GLY A 1 7  ? 11.357  -7.529  -1.189  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 8593  H HA3  . GLY A 1 7  ? 13.098  -7.296  -1.143  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 8594  N N    . LEU A 1 8  ? 10.748  -5.424  -0.002  1.00 0.00 ? 8  LEU A N    8  
ATOM 8595  C CA   . LEU A 1 8  ? 10.442  -4.296  0.872   1.00 0.00 ? 8  LEU A CA   8  
ATOM 8596  C C    . LEU A 1 8  ? 9.992   -4.781  2.246   1.00 0.00 ? 8  LEU A C    8  
ATOM 8597  O O    . LEU A 1 8  ? 9.577   -5.928  2.406   1.00 0.00 ? 8  LEU A O    8  
ATOM 8598  C CB   . LEU A 1 8  ? 9.355   -3.421  0.246   1.00 0.00 ? 8  LEU A CB   8  
ATOM 8599  C CG   . LEU A 1 8  ? 9.600   -3.027  -1.213  1.00 0.00 ? 8  LEU A CG   8  
ATOM 8600  C CD1  . LEU A 1 8  ? 8.775   -3.899  -2.147  1.00 0.00 ? 8  LEU A CD1  8  
ATOM 8601  C CD2  . LEU A 1 8  ? 9.279   -1.556  -1.430  1.00 0.00 ? 8  LEU A CD2  8  
ATOM 8602  H H    . LEU A 1 8  ? 10.036  -6.056  -0.234  1.00 0.00 ? 8  LEU A H    8  
ATOM 8603  H HA   . LEU A 1 8  ? 11.342  -3.711  0.986   1.00 0.00 ? 8  LEU A HA   8  
ATOM 8604  H HB2  . LEU A 1 8  ? 8.417   -3.954  0.302   1.00 0.00 ? 8  LEU A HB2  8  
ATOM 8605  H HB3  . LEU A 1 8  ? 9.270   -2.517  0.831   1.00 0.00 ? 8  LEU A HB3  8  
ATOM 8606  H HG   . LEU A 1 8  ? 10.643  -3.181  -1.449  1.00 0.00 ? 8  LEU A HG   8  
ATOM 8607  H HD11 . LEU A 1 8  ? 7.898   -4.253  -1.628  1.00 0.00 ? 8  LEU A HD11 8  
ATOM 8608  H HD12 . LEU A 1 8  ? 9.368   -4.742  -2.470  1.00 0.00 ? 8  LEU A HD12 8  
ATOM 8609  H HD13 . LEU A 1 8  ? 8.475   -3.320  -3.008  1.00 0.00 ? 8  LEU A HD13 8  
ATOM 8610  H HD21 . LEU A 1 8  ? 10.185  -0.975  -1.354  1.00 0.00 ? 8  LEU A HD21 8  
ATOM 8611  H HD22 . LEU A 1 8  ? 8.575   -1.227  -0.681  1.00 0.00 ? 8  LEU A HD22 8  
ATOM 8612  H HD23 . LEU A 1 8  ? 8.848   -1.422  -2.411  1.00 0.00 ? 8  LEU A HD23 8  
ATOM 8613  N N    . ARG A 1 9  ? 10.075  -3.896  3.235   1.00 0.00 ? 9  ARG A N    8  
ATOM 8614  C CA   . ARG A 1 9  ? 9.676   -4.233  4.597   1.00 0.00 ? 9  ARG A CA   8  
ATOM 8615  C C    . ARG A 1 9  ? 8.616   -3.261  5.107   1.00 0.00 ? 9  ARG A C    8  
ATOM 8616  O O    . ARG A 1 9  ? 8.120   -2.420  4.357   1.00 0.00 ? 9  ARG A O    8  
ATOM 8617  C CB   . ARG A 1 9  ? 10.891  -4.215  5.526   1.00 0.00 ? 9  ARG A CB   8  
ATOM 8618  C CG   . ARG A 1 9  ? 12.075  -5.008  4.996   1.00 0.00 ? 9  ARG A CG   8  
ATOM 8619  C CD   . ARG A 1 9  ? 12.475  -6.122  5.950   1.00 0.00 ? 9  ARG A CD   8  
ATOM 8620  N NE   . ARG A 1 9  ? 13.451  -7.031  5.352   1.00 0.00 ? 9  ARG A NE   8  
ATOM 8621  C CZ   . ARG A 1 9  ? 13.145  -7.958  4.449   1.00 0.00 ? 9  ARG A CZ   8  
ATOM 8622  N NH1  . ARG A 1 9  ? 11.891  -8.104  4.037   1.00 0.00 ? 9  ARG A NH1  8  
ATOM 8623  N NH2  . ARG A 1 9  ? 14.093  -8.743  3.956   1.00 0.00 ? 9  ARG A NH2  8  
ATOM 8624  H H    . ARG A 1 9  ? 10.413  -2.997  3.045   1.00 0.00 ? 9  ARG A H    8  
ATOM 8625  H HA   . ARG A 1 9  ? 9.258   -5.228  4.584   1.00 0.00 ? 9  ARG A HA   8  
ATOM 8626  H HB2  . ARG A 1 9  ? 11.206  -3.191  5.668   1.00 0.00 ? 9  ARG A HB2  8  
ATOM 8627  H HB3  . ARG A 1 9  ? 10.604  -4.629  6.482   1.00 0.00 ? 9  ARG A HB3  8  
ATOM 8628  H HG2  . ARG A 1 9  ? 11.807  -5.443  4.045   1.00 0.00 ? 9  ARG A HG2  8  
ATOM 8629  H HG3  . ARG A 1 9  ? 12.913  -4.340  4.864   1.00 0.00 ? 9  ARG A HG3  8  
ATOM 8630  H HD2  . ARG A 1 9  ? 12.905  -5.682  6.838   1.00 0.00 ? 9  ARG A HD2  8  
ATOM 8631  H HD3  . ARG A 1 9  ? 11.592  -6.684  6.219   1.00 0.00 ? 9  ARG A HD3  8  
ATOM 8632  H HE   . ARG A 1 9  ? 14.384  -6.945  5.639   1.00 0.00 ? 9  ARG A HE   8  
ATOM 8633  H HH11 . ARG A 1 9  ? 11.171  -7.516  4.404   1.00 0.00 ? 9  ARG A HH11 8  
ATOM 8634  H HH12 . ARG A 1 9  ? 11.667  -8.803  3.357   1.00 0.00 ? 9  ARG A HH12 8  
ATOM 8635  H HH21 . ARG A 1 9  ? 15.038  -8.637  4.263   1.00 0.00 ? 9  ARG A HH21 8  
ATOM 8636  H HH22 . ARG A 1 9  ? 13.862  -9.441  3.277   1.00 0.00 ? 9  ARG A HH22 8  
ATOM 8637  N N    . LEU A 1 10 ? 8.275   -3.382  6.385   1.00 0.00 ? 10 LEU A N    8  
ATOM 8638  C CA   . LEU A 1 10 ? 7.274   -2.515  6.994   1.00 0.00 ? 10 LEU A CA   8  
ATOM 8639  C C    . LEU A 1 10 ? 7.879   -1.164  7.363   1.00 0.00 ? 10 LEU A C    8  
ATOM 8640  O O    . LEU A 1 10 ? 8.949   -1.096  7.967   1.00 0.00 ? 10 LEU A O    8  
ATOM 8641  C CB   . LEU A 1 10 ? 6.680   -3.179  8.238   1.00 0.00 ? 10 LEU A CB   8  
ATOM 8642  C CG   . LEU A 1 10 ? 5.457   -4.059  7.980   1.00 0.00 ? 10 LEU A CG   8  
ATOM 8643  C CD1  . LEU A 1 10 ? 5.202   -4.978  9.165   1.00 0.00 ? 10 LEU A CD1  8  
ATOM 8644  C CD2  . LEU A 1 10 ? 4.235   -3.201  7.695   1.00 0.00 ? 10 LEU A CD2  8  
ATOM 8645  H H    . LEU A 1 10 ? 8.706   -4.072  6.932   1.00 0.00 ? 10 LEU A H    8  
ATOM 8646  H HA   . LEU A 1 10 ? 6.487   -2.358  6.272   1.00 0.00 ? 10 LEU A HA   8  
ATOM 8647  H HB2  . LEU A 1 10 ? 7.448   -3.787  8.696   1.00 0.00 ? 10 LEU A HB2  8  
ATOM 8648  H HB3  . LEU A 1 10 ? 6.398   -2.403  8.934   1.00 0.00 ? 10 LEU A HB3  8  
ATOM 8649  H HG   . LEU A 1 10 ? 5.643   -4.677  7.114   1.00 0.00 ? 10 LEU A HG   8  
ATOM 8650  H HD11 . LEU A 1 10 ? 4.503   -4.505  9.841   1.00 0.00 ? 10 LEU A HD11 8  
ATOM 8651  H HD12 . LEU A 1 10 ? 6.131   -5.166  9.683   1.00 0.00 ? 10 LEU A HD12 8  
ATOM 8652  H HD13 . LEU A 1 10 ? 4.788   -5.911  8.815   1.00 0.00 ? 10 LEU A HD13 8  
ATOM 8653  H HD21 . LEU A 1 10 ? 3.663   -3.075  8.603   1.00 0.00 ? 10 LEU A HD21 8  
ATOM 8654  H HD22 . LEU A 1 10 ? 3.622   -3.683  6.947   1.00 0.00 ? 10 LEU A HD22 8  
ATOM 8655  H HD23 . LEU A 1 10 ? 4.550   -2.234  7.331   1.00 0.00 ? 10 LEU A HD23 8  
ATOM 8656  N N    . GLY A 1 11 ? 7.186   -0.091  6.995   1.00 0.00 ? 11 GLY A N    8  
ATOM 8657  C CA   . GLY A 1 11 ? 7.671   1.244   7.296   1.00 0.00 ? 11 GLY A CA   8  
ATOM 8658  C C    . GLY A 1 11 ? 8.732   1.709   6.318   1.00 0.00 ? 11 GLY A C    8  
ATOM 8659  O O    . GLY A 1 11 ? 9.841   2.064   6.717   1.00 0.00 ? 11 GLY A O    8  
ATOM 8660  H H    . GLY A 1 11 ? 6.339   -0.206  6.516   1.00 0.00 ? 11 GLY A H    8  
ATOM 8661  H HA2  . GLY A 1 11 ? 6.840   1.933   7.263   1.00 0.00 ? 11 GLY A HA2  8  
ATOM 8662  H HA3  . GLY A 1 11 ? 8.089   1.247   8.292   1.00 0.00 ? 11 GLY A HA3  8  
ATOM 8663  N N    . ASP A 1 12 ? 8.391   1.706   5.033   1.00 0.00 ? 12 ASP A N    8  
ATOM 8664  C CA   . ASP A 1 12 ? 9.322   2.130   3.995   1.00 0.00 ? 12 ASP A CA   8  
ATOM 8665  C C    . ASP A 1 12 ? 8.617   2.988   2.948   1.00 0.00 ? 12 ASP A C    8  
ATOM 8666  O O    . ASP A 1 12 ? 7.614   2.573   2.367   1.00 0.00 ? 12 ASP A O    8  
ATOM 8667  C CB   . ASP A 1 12 ? 9.964   0.913   3.327   1.00 0.00 ? 12 ASP A CB   8  
ATOM 8668  C CG   . ASP A 1 12 ? 11.435  1.126   3.026   1.00 0.00 ? 12 ASP A CG   8  
ATOM 8669  O OD1  . ASP A 1 12 ? 11.750  2.004   2.197   1.00 0.00 ? 12 ASP A OD1  8  
ATOM 8670  O OD2  . ASP A 1 12 ? 12.271  0.414   3.622   1.00 0.00 ? 12 ASP A OD2  8  
ATOM 8671  H H    . ASP A 1 12 ? 7.492   1.412   4.777   1.00 0.00 ? 12 ASP A H    8  
ATOM 8672  H HA   . ASP A 1 12 ? 10.096  2.722   4.464   1.00 0.00 ? 12 ASP A HA   8  
ATOM 8673  H HB2  . ASP A 1 12 ? 9.869   0.060   3.981   1.00 0.00 ? 12 ASP A HB2  8  
ATOM 8674  H HB3  . ASP A 1 12 ? 9.451   0.707   2.398   1.00 0.00 ? 12 ASP A HB3  8  
ATOM 8675  N N    . ARG A 1 13 ? 9.146   4.184   2.715   1.00 0.00 ? 13 ARG A N    8  
ATOM 8676  C CA   . ARG A 1 13 ? 8.566   5.098   1.738   1.00 0.00 ? 13 ARG A CA   8  
ATOM 8677  C C    . ARG A 1 13 ? 8.611   4.498   0.337   1.00 0.00 ? 13 ARG A C    8  
ATOM 8678  O O    . ARG A 1 13 ? 9.687   4.257   -0.211  1.00 0.00 ? 13 ARG A O    8  
ATOM 8679  C CB   . ARG A 1 13 ? 9.308   6.436   1.758   1.00 0.00 ? 13 ARG A CB   8  
ATOM 8680  C CG   . ARG A 1 13 ? 8.688   7.461   2.696   1.00 0.00 ? 13 ARG A CG   8  
ATOM 8681  C CD   . ARG A 1 13 ? 9.668   7.902   3.771   1.00 0.00 ? 13 ARG A CD   8  
ATOM 8682  N NE   . ARG A 1 13 ? 9.010   8.110   5.059   1.00 0.00 ? 13 ARG A NE   8  
ATOM 8683  C CZ   . ARG A 1 13 ? 8.680   7.125   5.891   1.00 0.00 ? 13 ARG A CZ   8  
ATOM 8684  N NH1  . ARG A 1 13 ? 8.941   5.862   5.573   1.00 0.00 ? 13 ARG A NH1  8  
ATOM 8685  N NH2  . ARG A 1 13 ? 8.084   7.402   7.043   1.00 0.00 ? 13 ARG A NH2  8  
ATOM 8686  H H    . ARG A 1 13 ? 9.946   4.458   3.210   1.00 0.00 ? 13 ARG A H    8  
ATOM 8687  H HA   . ARG A 1 13 ? 7.535   5.265   2.012   1.00 0.00 ? 13 ARG A HA   8  
ATOM 8688  H HB2  . ARG A 1 13 ? 10.329  6.264   2.068   1.00 0.00 ? 13 ARG A HB2  8  
ATOM 8689  H HB3  . ARG A 1 13 ? 9.310   6.849   0.760   1.00 0.00 ? 13 ARG A HB3  8  
ATOM 8690  H HG2  . ARG A 1 13 ? 8.388   8.324   2.122   1.00 0.00 ? 13 ARG A HG2  8  
ATOM 8691  H HG3  . ARG A 1 13 ? 7.822   7.022   3.169   1.00 0.00 ? 13 ARG A HG3  8  
ATOM 8692  H HD2  . ARG A 1 13 ? 10.427  7.141   3.884   1.00 0.00 ? 13 ARG A HD2  8  
ATOM 8693  H HD3  . ARG A 1 13 ? 10.132  8.827   3.461   1.00 0.00 ? 13 ARG A HD3  8  
ATOM 8694  H HE   . ARG A 1 13 ? 8.805   9.032   5.318   1.00 0.00 ? 13 ARG A HE   8  
ATOM 8695  H HH11 . ARG A 1 13 ? 9.390   5.647   4.707   1.00 0.00 ? 13 ARG A HH11 8  
ATOM 8696  H HH12 . ARG A 1 13 ? 8.690   5.127   6.203   1.00 0.00 ? 13 ARG A HH12 8  
ATOM 8697  H HH21 . ARG A 1 13 ? 7.885   8.351   7.287   1.00 0.00 ? 13 ARG A HH21 8  
ATOM 8698  H HH22 . ARG A 1 13 ? 7.835   6.661   7.667   1.00 0.00 ? 13 ARG A HH22 8  
ATOM 8699  N N    . VAL A 1 14 ? 7.437   4.260   -0.238  1.00 0.00 ? 14 VAL A N    8  
ATOM 8700  C CA   . VAL A 1 14 ? 7.343   3.687   -1.576  1.00 0.00 ? 14 VAL A CA   8  
ATOM 8701  C C    . VAL A 1 14 ? 6.499   4.565   -2.494  1.00 0.00 ? 14 VAL A C    8  
ATOM 8702  O O    . VAL A 1 14 ? 5.819   5.484   -2.038  1.00 0.00 ? 14 VAL A O    8  
ATOM 8703  C CB   . VAL A 1 14 ? 6.735   2.273   -1.538  1.00 0.00 ? 14 VAL A CB   8  
ATOM 8704  C CG1  . VAL A 1 14 ? 7.729   1.277   -0.963  1.00 0.00 ? 14 VAL A CG1  8  
ATOM 8705  C CG2  . VAL A 1 14 ? 5.441   2.270   -0.737  1.00 0.00 ? 14 VAL A CG2  8  
ATOM 8706  H H    . VAL A 1 14 ? 6.614   4.473   0.250   1.00 0.00 ? 14 VAL A H    8  
ATOM 8707  H HA   . VAL A 1 14 ? 8.342   3.616   -1.979  1.00 0.00 ? 14 VAL A HA   8  
ATOM 8708  H HB   . VAL A 1 14 ? 6.505   1.975   -2.551  1.00 0.00 ? 14 VAL A HB   8  
ATOM 8709  H HG11 . VAL A 1 14 ? 7.500   1.097   0.077   1.00 0.00 ? 14 VAL A HG11 8  
ATOM 8710  H HG12 . VAL A 1 14 ? 8.729   1.677   -1.047  1.00 0.00 ? 14 VAL A HG12 8  
ATOM 8711  H HG13 . VAL A 1 14 ? 7.666   0.348   -1.511  1.00 0.00 ? 14 VAL A HG13 8  
ATOM 8712  H HG21 . VAL A 1 14 ? 4.930   1.330   -0.881  1.00 0.00 ? 14 VAL A HG21 8  
ATOM 8713  H HG22 . VAL A 1 14 ? 4.809   3.079   -1.070  1.00 0.00 ? 14 VAL A HG22 8  
ATOM 8714  H HG23 . VAL A 1 14 ? 5.668   2.399   0.311   1.00 0.00 ? 14 VAL A HG23 8  
ATOM 8715  N N    . LEU A 1 15 ? 6.549   4.275   -3.790  1.00 0.00 ? 15 LEU A N    8  
ATOM 8716  C CA   . LEU A 1 15 ? 5.789   5.036   -4.775  1.00 0.00 ? 15 LEU A CA   8  
ATOM 8717  C C    . LEU A 1 15 ? 4.795   4.137   -5.505  1.00 0.00 ? 15 LEU A C    8  
ATOM 8718  O O    . LEU A 1 15 ? 5.186   3.268   -6.284  1.00 0.00 ? 15 LEU A O    8  
ATOM 8719  C CB   . LEU A 1 15 ? 6.734   5.694   -5.782  1.00 0.00 ? 15 LEU A CB   8  
ATOM 8720  C CG   . LEU A 1 15 ? 6.095   6.763   -6.669  1.00 0.00 ? 15 LEU A CG   8  
ATOM 8721  C CD1  . LEU A 1 15 ? 5.541   7.899   -5.822  1.00 0.00 ? 15 LEU A CD1  8  
ATOM 8722  C CD2  . LEU A 1 15 ? 7.105   7.291   -7.677  1.00 0.00 ? 15 LEU A CD2  8  
ATOM 8723  H H    . LEU A 1 15 ? 7.110   3.529   -4.091  1.00 0.00 ? 15 LEU A H    8  
ATOM 8724  H HA   . LEU A 1 15 ? 5.242   5.805   -4.250  1.00 0.00 ? 15 LEU A HA   8  
ATOM 8725  H HB2  . LEU A 1 15 ? 7.548   6.149   -5.234  1.00 0.00 ? 15 LEU A HB2  8  
ATOM 8726  H HB3  . LEU A 1 15 ? 7.140   4.924   -6.420  1.00 0.00 ? 15 LEU A HB3  8  
ATOM 8727  H HG   . LEU A 1 15 ? 5.274   6.323   -7.215  1.00 0.00 ? 15 LEU A HG   8  
ATOM 8728  H HD11 . LEU A 1 15 ? 4.773   7.517   -5.166  1.00 0.00 ? 15 LEU A HD11 8  
ATOM 8729  H HD12 . LEU A 1 15 ? 5.119   8.656   -6.467  1.00 0.00 ? 15 LEU A HD12 8  
ATOM 8730  H HD13 . LEU A 1 15 ? 6.337   8.330   -5.234  1.00 0.00 ? 15 LEU A HD13 8  
ATOM 8731  H HD21 . LEU A 1 15 ? 7.841   7.895   -7.167  1.00 0.00 ? 15 LEU A HD21 8  
ATOM 8732  H HD22 . LEU A 1 15 ? 6.595   7.891   -8.416  1.00 0.00 ? 15 LEU A HD22 8  
ATOM 8733  H HD23 . LEU A 1 15 ? 7.595   6.461   -8.164  1.00 0.00 ? 15 LEU A HD23 8  
ATOM 8734  N N    . VAL A 1 16 ? 3.511   4.352   -5.246  1.00 0.00 ? 16 VAL A N    8  
ATOM 8735  C CA   . VAL A 1 16 ? 2.461   3.560   -5.875  1.00 0.00 ? 16 VAL A CA   8  
ATOM 8736  C C    . VAL A 1 16 ? 1.942   4.238   -7.138  1.00 0.00 ? 16 VAL A C    8  
ATOM 8737  O O    . VAL A 1 16 ? 1.319   5.297   -7.075  1.00 0.00 ? 16 VAL A O    8  
ATOM 8738  C CB   . VAL A 1 16 ? 1.282   3.324   -4.914  1.00 0.00 ? 16 VAL A CB   8  
ATOM 8739  C CG1  . VAL A 1 16 ? 0.293   2.336   -5.512  1.00 0.00 ? 16 VAL A CG1  8  
ATOM 8740  C CG2  . VAL A 1 16 ? 1.784   2.836   -3.563  1.00 0.00 ? 16 VAL A CG2  8  
ATOM 8741  H H    . VAL A 1 16 ? 3.261   5.058   -4.613  1.00 0.00 ? 16 VAL A H    8  
ATOM 8742  H HA   . VAL A 1 16 ? 2.881   2.600   -6.140  1.00 0.00 ? 16 VAL A HA   8  
ATOM 8743  H HB   . VAL A 1 16 ? 0.770   4.264   -4.765  1.00 0.00 ? 16 VAL A HB   8  
ATOM 8744  H HG11 . VAL A 1 16 ? 0.825   1.471   -5.877  1.00 0.00 ? 16 VAL A HG11 8  
ATOM 8745  H HG12 . VAL A 1 16 ? -0.237  2.805   -6.328  1.00 0.00 ? 16 VAL A HG12 8  
ATOM 8746  H HG13 . VAL A 1 16 ? -0.414  2.030   -4.754  1.00 0.00 ? 16 VAL A HG13 8  
ATOM 8747  H HG21 . VAL A 1 16 ? 1.058   2.164   -3.131  1.00 0.00 ? 16 VAL A HG21 8  
ATOM 8748  H HG22 . VAL A 1 16 ? 1.928   3.681   -2.906  1.00 0.00 ? 16 VAL A HG22 8  
ATOM 8749  H HG23 . VAL A 1 16 ? 2.722   2.319   -3.694  1.00 0.00 ? 16 VAL A HG23 8  
ATOM 8750  N N    . GLY A 1 17 ? 2.204   3.620   -8.286  1.00 0.00 ? 17 GLY A N    8  
ATOM 8751  C CA   . GLY A 1 17 ? 1.755   4.177   -9.548  1.00 0.00 ? 17 GLY A CA   8  
ATOM 8752  C C    . GLY A 1 17 ? 2.804   5.052   -10.208 1.00 0.00 ? 17 GLY A C    8  
ATOM 8753  O O    . GLY A 1 17 ? 2.752   5.290   -11.414 1.00 0.00 ? 17 GLY A O    8  
ATOM 8754  H H    . GLY A 1 17 ? 2.705   2.778   -8.275  1.00 0.00 ? 17 GLY A H    8  
ATOM 8755  H HA2  . GLY A 1 17 ? 1.506   3.368   -10.219 1.00 0.00 ? 17 GLY A HA2  8  
ATOM 8756  H HA3  . GLY A 1 17 ? 0.868   4.769   -9.372  1.00 0.00 ? 17 GLY A HA3  8  
ATOM 8757  N N    . GLY A 1 18 ? 3.757   5.535   -9.416  1.00 0.00 ? 18 GLY A N    8  
ATOM 8758  C CA   . GLY A 1 18 ? 4.805   6.383   -9.952  1.00 0.00 ? 18 GLY A CA   8  
ATOM 8759  C C    . GLY A 1 18 ? 4.500   7.858   -9.775  1.00 0.00 ? 18 GLY A C    8  
ATOM 8760  O O    . GLY A 1 18 ? 4.945   8.689   -10.565 1.00 0.00 ? 18 GLY A O    8  
ATOM 8761  H H    . GLY A 1 18 ? 3.749   5.314   -8.461  1.00 0.00 ? 18 GLY A H    8  
ATOM 8762  H HA2  . GLY A 1 18 ? 5.732   6.155   -9.445  1.00 0.00 ? 18 GLY A HA2  8  
ATOM 8763  H HA3  . GLY A 1 18 ? 4.921   6.174   -11.004 1.00 0.00 ? 18 GLY A HA3  8  
ATOM 8764  N N    . THR A 1 19 ? 3.737   8.180   -8.736  1.00 0.00 ? 19 THR A N    8  
ATOM 8765  C CA   . THR A 1 19 ? 3.369   9.564   -8.457  1.00 0.00 ? 19 THR A CA   8  
ATOM 8766  C C    . THR A 1 19 ? 2.909   9.723   -7.011  1.00 0.00 ? 19 THR A C    8  
ATOM 8767  O O    . THR A 1 19 ? 3.302   10.665  -6.324  1.00 0.00 ? 19 THR A O    8  
ATOM 8768  C CB   . THR A 1 19 ? 2.264   10.021  -9.410  1.00 0.00 ? 19 THR A CB   8  
ATOM 8769  O OG1  . THR A 1 19 ? 2.349   9.331   -10.644 1.00 0.00 ? 19 THR A OG1  8  
ATOM 8770  C CG2  . THR A 1 19 ? 2.309   11.504  -9.710  1.00 0.00 ? 19 THR A CG2  8  
ATOM 8771  H H    . THR A 1 19 ? 3.413   7.471   -8.143  1.00 0.00 ? 19 THR A H    8  
ATOM 8772  H HA   . THR A 1 19 ? 4.245   10.177  -8.613  1.00 0.00 ? 19 THR A HA   8  
ATOM 8773  H HB   . THR A 1 19 ? 1.305   9.803   -8.963  1.00 0.00 ? 19 THR A HB   8  
ATOM 8774  H HG1  . THR A 1 19 ? 1.599   9.566   -11.194 1.00 0.00 ? 19 THR A HG1  8  
ATOM 8775  H HG21 . THR A 1 19 ? 3.335   11.817  -9.830  1.00 0.00 ? 19 THR A HG21 8  
ATOM 8776  H HG22 . THR A 1 19 ? 1.858   12.050  -8.894  1.00 0.00 ? 19 THR A HG22 8  
ATOM 8777  H HG23 . THR A 1 19 ? 1.763   11.703  -10.621 1.00 0.00 ? 19 THR A HG23 8  
ATOM 8778  N N    . LYS A 1 20 ? 2.073   8.795   -6.557  1.00 0.00 ? 20 LYS A N    8  
ATOM 8779  C CA   . LYS A 1 20 ? 1.558   8.831   -5.192  1.00 0.00 ? 20 LYS A CA   8  
ATOM 8780  C C    . LYS A 1 20 ? 2.550   8.198   -4.221  1.00 0.00 ? 20 LYS A C    8  
ATOM 8781  O O    . LYS A 1 20 ? 2.787   6.992   -4.259  1.00 0.00 ? 20 LYS A O    8  
ATOM 8782  C CB   . LYS A 1 20 ? 0.214   8.106   -5.112  1.00 0.00 ? 20 LYS A CB   8  
ATOM 8783  C CG   . LYS A 1 20 ? -0.765  8.518   -6.200  1.00 0.00 ? 20 LYS A CG   8  
ATOM 8784  C CD   . LYS A 1 20 ? -1.375  7.309   -6.892  1.00 0.00 ? 20 LYS A CD   8  
ATOM 8785  C CE   . LYS A 1 20 ? -2.593  7.694   -7.715  1.00 0.00 ? 20 LYS A CE   8  
ATOM 8786  N NZ   . LYS A 1 20 ? -3.056  6.573   -8.581  1.00 0.00 ? 20 LYS A NZ   8  
ATOM 8787  H H    . LYS A 1 20 ? 1.795   8.068   -7.152  1.00 0.00 ? 20 LYS A H    8  
ATOM 8788  H HA   . LYS A 1 20 ? 1.416   9.866   -4.920  1.00 0.00 ? 20 LYS A HA   8  
ATOM 8789  H HB2  . LYS A 1 20 ? 0.386   7.043   -5.195  1.00 0.00 ? 20 LYS A HB2  8  
ATOM 8790  H HB3  . LYS A 1 20 ? -0.237  8.315   -4.154  1.00 0.00 ? 20 LYS A HB3  8  
ATOM 8791  H HG2  . LYS A 1 20 ? -1.557  9.102   -5.756  1.00 0.00 ? 20 LYS A HG2  8  
ATOM 8792  H HG3  . LYS A 1 20 ? -0.243  9.116   -6.933  1.00 0.00 ? 20 LYS A HG3  8  
ATOM 8793  H HD2  . LYS A 1 20 ? -0.636  6.870   -7.546  1.00 0.00 ? 20 LYS A HD2  8  
ATOM 8794  H HD3  . LYS A 1 20 ? -1.670  6.588   -6.143  1.00 0.00 ? 20 LYS A HD3  8  
ATOM 8795  H HE2  . LYS A 1 20 ? -3.392  7.972   -7.044  1.00 0.00 ? 20 LYS A HE2  8  
ATOM 8796  H HE3  . LYS A 1 20 ? -2.338  8.538   -8.339  1.00 0.00 ? 20 LYS A HE3  8  
ATOM 8797  H HZ1  . LYS A 1 20 ? -3.593  5.884   -8.017  1.00 0.00 ? 20 LYS A HZ1  8  
ATOM 8798  H HZ2  . LYS A 1 20 ? -2.240  6.092   -9.010  1.00 0.00 ? 20 LYS A HZ2  8  
ATOM 8799  H HZ3  . LYS A 1 20 ? -3.668  6.937   -9.339  1.00 0.00 ? 20 LYS A HZ3  8  
ATOM 8800  N N    . THR A 1 21 ? 3.126   9.023   -3.352  1.00 0.00 ? 21 THR A N    8  
ATOM 8801  C CA   . THR A 1 21 ? 4.092   8.543   -2.369  1.00 0.00 ? 21 THR A CA   8  
ATOM 8802  C C    . THR A 1 21 ? 3.392   8.086   -1.095  1.00 0.00 ? 21 THR A C    8  
ATOM 8803  O O    . THR A 1 21 ? 2.547   8.796   -0.549  1.00 0.00 ? 21 THR A O    8  
ATOM 8804  C CB   . THR A 1 21 ? 5.106   9.642   -2.043  1.00 0.00 ? 21 THR A CB   8  
ATOM 8805  O OG1  . THR A 1 21 ? 4.471   10.906  -1.972  1.00 0.00 ? 21 THR A OG1  8  
ATOM 8806  C CG2  . THR A 1 21 ? 6.223   9.746   -3.059  1.00 0.00 ? 21 THR A CG2  8  
ATOM 8807  H H    . THR A 1 21 ? 2.897   9.975   -3.371  1.00 0.00 ? 21 THR A H    8  
ATOM 8808  H HA   . THR A 1 21 ? 4.614   7.701   -2.802  1.00 0.00 ? 21 THR A HA   8  
ATOM 8809  H HB   . THR A 1 21 ? 5.552   9.431   -1.082  1.00 0.00 ? 21 THR A HB   8  
ATOM 8810  H HG1  . THR A 1 21 ? 5.122   11.580  -1.769  1.00 0.00 ? 21 THR A HG1  8  
ATOM 8811  H HG21 . THR A 1 21 ? 7.027   10.338  -2.649  1.00 0.00 ? 21 THR A HG21 8  
ATOM 8812  H HG22 . THR A 1 21 ? 5.849   10.216  -3.957  1.00 0.00 ? 21 THR A HG22 8  
ATOM 8813  H HG23 . THR A 1 21 ? 6.588   8.757   -3.295  1.00 0.00 ? 21 THR A HG23 8  
ATOM 8814  N N    . GLY A 1 22 ? 3.750   6.896   -0.624  1.00 0.00 ? 22 GLY A N    8  
ATOM 8815  C CA   . GLY A 1 22 ? 3.147   6.364   0.585   1.00 0.00 ? 22 GLY A CA   8  
ATOM 8816  C C    . GLY A 1 22 ? 4.016   5.319   1.255   1.00 0.00 ? 22 GLY A C    8  
ATOM 8817  O O    . GLY A 1 22 ? 4.811   4.647   0.597   1.00 0.00 ? 22 GLY A O    8  
ATOM 8818  H H    . GLY A 1 22 ? 4.429   6.374   -1.100  1.00 0.00 ? 22 GLY A H    8  
ATOM 8819  H HA2  . GLY A 1 22 ? 2.980   7.176   1.277   1.00 0.00 ? 22 GLY A HA2  8  
ATOM 8820  H HA3  . GLY A 1 22 ? 2.196   5.918   0.333   1.00 0.00 ? 22 GLY A HA3  8  
ATOM 8821  N N    . VAL A 1 23 ? 3.866   5.182   2.569   1.00 0.00 ? 23 VAL A N    8  
ATOM 8822  C CA   . VAL A 1 23 ? 4.645   4.211   3.330   1.00 0.00 ? 23 VAL A CA   8  
ATOM 8823  C C    . VAL A 1 23 ? 3.931   2.866   3.398   1.00 0.00 ? 23 VAL A C    8  
ATOM 8824  O O    . VAL A 1 23 ? 2.702   2.801   3.355   1.00 0.00 ? 23 VAL A O    8  
ATOM 8825  C CB   . VAL A 1 23 ? 4.919   4.707   4.761   1.00 0.00 ? 23 VAL A CB   8  
ATOM 8826  C CG1  . VAL A 1 23 ? 5.901   3.786   5.468   1.00 0.00 ? 23 VAL A CG1  8  
ATOM 8827  C CG2  . VAL A 1 23 ? 5.437   6.137   4.742   1.00 0.00 ? 23 VAL A CG2  8  
ATOM 8828  H H    . VAL A 1 23 ? 3.218   5.746   3.038   1.00 0.00 ? 23 VAL A H    8  
ATOM 8829  H HA   . VAL A 1 23 ? 5.594   4.079   2.828   1.00 0.00 ? 23 VAL A HA   8  
ATOM 8830  H HB   . VAL A 1 23 ? 3.988   4.692   5.309   1.00 0.00 ? 23 VAL A HB   8  
ATOM 8831  H HG11 . VAL A 1 23 ? 6.117   4.177   6.451   1.00 0.00 ? 23 VAL A HG11 8  
ATOM 8832  H HG12 . VAL A 1 23 ? 6.815   3.727   4.895   1.00 0.00 ? 23 VAL A HG12 8  
ATOM 8833  H HG13 . VAL A 1 23 ? 5.468   2.801   5.559   1.00 0.00 ? 23 VAL A HG13 8  
ATOM 8834  H HG21 . VAL A 1 23 ? 6.131   6.258   3.923   1.00 0.00 ? 23 VAL A HG21 8  
ATOM 8835  H HG22 . VAL A 1 23 ? 5.939   6.352   5.674   1.00 0.00 ? 23 VAL A HG22 8  
ATOM 8836  H HG23 . VAL A 1 23 ? 4.609   6.820   4.615   1.00 0.00 ? 23 VAL A HG23 8  
ATOM 8837  N N    . VAL A 1 24 ? 4.708   1.794   3.506   1.00 0.00 ? 24 VAL A N    8  
ATOM 8838  C CA   . VAL A 1 24 ? 4.150   0.449   3.582   1.00 0.00 ? 24 VAL A CA   8  
ATOM 8839  C C    . VAL A 1 24 ? 3.582   0.170   4.970   1.00 0.00 ? 24 VAL A C    8  
ATOM 8840  O O    . VAL A 1 24 ? 4.302   0.213   5.967   1.00 0.00 ? 24 VAL A O    8  
ATOM 8841  C CB   . VAL A 1 24 ? 5.208   -0.620  3.247   1.00 0.00 ? 24 VAL A CB   8  
ATOM 8842  C CG1  . VAL A 1 24 ? 4.571   -1.999  3.175   1.00 0.00 ? 24 VAL A CG1  8  
ATOM 8843  C CG2  . VAL A 1 24 ? 5.915   -0.283  1.943   1.00 0.00 ? 24 VAL A CG2  8  
ATOM 8844  H H    . VAL A 1 24 ? 5.681   1.910   3.536   1.00 0.00 ? 24 VAL A H    8  
ATOM 8845  H HA   . VAL A 1 24 ? 3.353   0.377   2.856   1.00 0.00 ? 24 VAL A HA   8  
ATOM 8846  H HB   . VAL A 1 24 ? 5.943   -0.629  4.039   1.00 0.00 ? 24 VAL A HB   8  
ATOM 8847  H HG11 . VAL A 1 24 ? 4.348   -2.239  2.145   1.00 0.00 ? 24 VAL A HG11 8  
ATOM 8848  H HG12 . VAL A 1 24 ? 3.659   -2.006  3.751   1.00 0.00 ? 24 VAL A HG12 8  
ATOM 8849  H HG13 . VAL A 1 24 ? 5.256   -2.733  3.575   1.00 0.00 ? 24 VAL A HG13 8  
ATOM 8850  H HG21 . VAL A 1 24 ? 6.973   -0.478  2.045   1.00 0.00 ? 24 VAL A HG21 8  
ATOM 8851  H HG22 . VAL A 1 24 ? 5.764   0.760   1.708   1.00 0.00 ? 24 VAL A HG22 8  
ATOM 8852  H HG23 . VAL A 1 24 ? 5.514   -0.892  1.147   1.00 0.00 ? 24 VAL A HG23 8  
ATOM 8853  N N    . ARG A 1 25 ? 2.285   -0.118  5.026   1.00 0.00 ? 25 ARG A N    8  
ATOM 8854  C CA   . ARG A 1 25 ? 1.620   -0.404  6.292   1.00 0.00 ? 25 ARG A CA   8  
ATOM 8855  C C    . ARG A 1 25 ? 1.314   -1.893  6.426   1.00 0.00 ? 25 ARG A C    8  
ATOM 8856  O O    . ARG A 1 25 ? 1.213   -2.417  7.536   1.00 0.00 ? 25 ARG A O    8  
ATOM 8857  C CB   . ARG A 1 25 ? 0.327   0.407   6.405   1.00 0.00 ? 25 ARG A CB   8  
ATOM 8858  C CG   . ARG A 1 25 ? 0.504   1.737   7.120   1.00 0.00 ? 25 ARG A CG   8  
ATOM 8859  C CD   . ARG A 1 25 ? 0.799   1.540   8.597   1.00 0.00 ? 25 ARG A CD   8  
ATOM 8860  N NE   . ARG A 1 25 ? 1.511   2.681   9.170   1.00 0.00 ? 25 ARG A NE   8  
ATOM 8861  C CZ   . ARG A 1 25 ? 0.922   3.817   9.531   1.00 0.00 ? 25 ARG A CZ   8  
ATOM 8862  N NH1  . ARG A 1 25 ? -0.389  3.971   9.379   1.00 0.00 ? 25 ARG A NH1  8  
ATOM 8863  N NH2  . ARG A 1 25 ? 1.643   4.805   10.044  1.00 0.00 ? 25 ARG A NH2  8  
ATOM 8864  H H    . ARG A 1 25 ? 1.764   -0.136  4.196   1.00 0.00 ? 25 ARG A H    8  
ATOM 8865  H HA   . ARG A 1 25 ? 2.286   -0.112  7.089   1.00 0.00 ? 25 ARG A HA   8  
ATOM 8866  H HB2  . ARG A 1 25 ? -0.051  0.603   5.413   1.00 0.00 ? 25 ARG A HB2  8  
ATOM 8867  H HB3  . ARG A 1 25 ? -0.403  -0.174  6.950   1.00 0.00 ? 25 ARG A HB3  8  
ATOM 8868  H HG2  . ARG A 1 25 ? 1.326   2.271   6.666   1.00 0.00 ? 25 ARG A HG2  8  
ATOM 8869  H HG3  . ARG A 1 25 ? -0.404  2.313   7.017   1.00 0.00 ? 25 ARG A HG3  8  
ATOM 8870  H HD2  . ARG A 1 25 ? -0.134  1.410   9.124   1.00 0.00 ? 25 ARG A HD2  8  
ATOM 8871  H HD3  . ARG A 1 25 ? 1.405   0.654   8.715   1.00 0.00 ? 25 ARG A HD3  8  
ATOM 8872  H HE   . ARG A 1 25 ? 2.480   2.594   9.292   1.00 0.00 ? 25 ARG A HE   8  
ATOM 8873  H HH11 . ARG A 1 25 ? -0.938  3.232   8.993   1.00 0.00 ? 25 ARG A HH11 8  
ATOM 8874  H HH12 . ARG A 1 25 ? -0.825  4.828   9.653   1.00 0.00 ? 25 ARG A HH12 8  
ATOM 8875  H HH21 . ARG A 1 25 ? 2.631   4.695   10.160  1.00 0.00 ? 25 ARG A HH21 8  
ATOM 8876  H HH22 . ARG A 1 25 ? 1.201   5.659   10.316  1.00 0.00 ? 25 ARG A HH22 8  
ATOM 8877  N N    . TYR A 1 26 ? 1.169   -2.571  5.291   1.00 0.00 ? 26 TYR A N    8  
ATOM 8878  C CA   . TYR A 1 26 ? 0.876   -3.999  5.287   1.00 0.00 ? 26 TYR A CA   8  
ATOM 8879  C C    . TYR A 1 26 ? 1.816   -4.743  4.343   1.00 0.00 ? 26 TYR A C    8  
ATOM 8880  O O    . TYR A 1 26 ? 2.185   -4.230  3.287   1.00 0.00 ? 26 TYR A O    8  
ATOM 8881  C CB   . TYR A 1 26 ? -0.576  -4.242  4.875   1.00 0.00 ? 26 TYR A CB   8  
ATOM 8882  C CG   . TYR A 1 26 ? -1.111  -5.589  5.307   1.00 0.00 ? 26 TYR A CG   8  
ATOM 8883  C CD1  . TYR A 1 26 ? -1.176  -5.933  6.652   1.00 0.00 ? 26 TYR A CD1  8  
ATOM 8884  C CD2  . TYR A 1 26 ? -1.552  -6.516  4.371   1.00 0.00 ? 26 TYR A CD2  8  
ATOM 8885  C CE1  . TYR A 1 26 ? -1.664  -7.162  7.051   1.00 0.00 ? 26 TYR A CE1  8  
ATOM 8886  C CE2  . TYR A 1 26 ? -2.043  -7.747  4.763   1.00 0.00 ? 26 TYR A CE2  8  
ATOM 8887  C CZ   . TYR A 1 26 ? -2.097  -8.066  6.103   1.00 0.00 ? 26 TYR A CZ   8  
ATOM 8888  O OH   . TYR A 1 26 ? -2.584  -9.291  6.496   1.00 0.00 ? 26 TYR A OH   8  
ATOM 8889  H H    . TYR A 1 26 ? 1.262   -2.101  4.437   1.00 0.00 ? 26 TYR A H    8  
ATOM 8890  H HA   . TYR A 1 26 ? 1.025   -4.371  6.290   1.00 0.00 ? 26 TYR A HA   8  
ATOM 8891  H HB2  . TYR A 1 26 ? -1.201  -3.481  5.316   1.00 0.00 ? 26 TYR A HB2  8  
ATOM 8892  H HB3  . TYR A 1 26 ? -0.652  -4.184  3.799   1.00 0.00 ? 26 TYR A HB3  8  
ATOM 8893  H HD1  . TYR A 1 26 ? -0.838  -5.223  7.392   1.00 0.00 ? 26 TYR A HD1  8  
ATOM 8894  H HD2  . TYR A 1 26 ? -1.508  -6.263  3.321   1.00 0.00 ? 26 TYR A HD2  8  
ATOM 8895  H HE1  . TYR A 1 26 ? -1.707  -7.411  8.101   1.00 0.00 ? 26 TYR A HE1  8  
ATOM 8896  H HE2  . TYR A 1 26 ? -2.380  -8.454  4.019   1.00 0.00 ? 26 TYR A HE2  8  
ATOM 8897  H HH   . TYR A 1 26 ? -3.336  -9.527  5.948   1.00 0.00 ? 26 TYR A HH   8  
ATOM 8898  N N    . VAL A 1 27 ? 2.201   -5.952  4.734   1.00 0.00 ? 27 VAL A N    8  
ATOM 8899  C CA   . VAL A 1 27 ? 3.100   -6.765  3.924   1.00 0.00 ? 27 VAL A CA   8  
ATOM 8900  C C    . VAL A 1 27 ? 2.749   -8.246  4.035   1.00 0.00 ? 27 VAL A C    8  
ATOM 8901  O O    . VAL A 1 27 ? 2.702   -8.803  5.132   1.00 0.00 ? 27 VAL A O    8  
ATOM 8902  C CB   . VAL A 1 27 ? 4.569   -6.562  4.340   1.00 0.00 ? 27 VAL A CB   8  
ATOM 8903  C CG1  . VAL A 1 27 ? 5.502   -7.326  3.413   1.00 0.00 ? 27 VAL A CG1  8  
ATOM 8904  C CG2  . VAL A 1 27 ? 4.917   -5.081  4.355   1.00 0.00 ? 27 VAL A CG2  8  
ATOM 8905  H H    . VAL A 1 27 ? 1.875   -6.305  5.587   1.00 0.00 ? 27 VAL A H    8  
ATOM 8906  H HA   . VAL A 1 27 ? 2.991   -6.456  2.894   1.00 0.00 ? 27 VAL A HA   8  
ATOM 8907  H HB   . VAL A 1 27 ? 4.695   -6.949  5.340   1.00 0.00 ? 27 VAL A HB   8  
ATOM 8908  H HG11 . VAL A 1 27 ? 5.196   -7.174  2.388   1.00 0.00 ? 27 VAL A HG11 8  
ATOM 8909  H HG12 . VAL A 1 27 ? 5.460   -8.379  3.649   1.00 0.00 ? 27 VAL A HG12 8  
ATOM 8910  H HG13 . VAL A 1 27 ? 6.512   -6.968  3.544   1.00 0.00 ? 27 VAL A HG13 8  
ATOM 8911  H HG21 . VAL A 1 27 ? 4.227   -4.555  4.998   1.00 0.00 ? 27 VAL A HG21 8  
ATOM 8912  H HG22 . VAL A 1 27 ? 4.850   -4.685  3.352   1.00 0.00 ? 27 VAL A HG22 8  
ATOM 8913  H HG23 . VAL A 1 27 ? 5.923   -4.952  4.727   1.00 0.00 ? 27 VAL A HG23 8  
ATOM 8914  N N    . GLY A 1 28 ? 2.503   -8.878  2.893   1.00 0.00 ? 28 GLY A N    8  
ATOM 8915  C CA   . GLY A 1 28 ? 2.160   -10.287 2.882   1.00 0.00 ? 28 GLY A CA   8  
ATOM 8916  C C    . GLY A 1 28 ? 1.100   -10.618 1.849   1.00 0.00 ? 28 GLY A C    8  
ATOM 8917  O O    . GLY A 1 28 ? 0.915   -9.879  0.882   1.00 0.00 ? 28 GLY A O    8  
ATOM 8918  H H    . GLY A 1 28 ? 2.556   -8.382  2.048   1.00 0.00 ? 28 GLY A H    8  
ATOM 8919  H HA2  . GLY A 1 28 ? 3.049   -10.861 2.667   1.00 0.00 ? 28 GLY A HA2  8  
ATOM 8920  H HA3  . GLY A 1 28 ? 1.794   -10.565 3.859   1.00 0.00 ? 28 GLY A HA3  8  
ATOM 8921  N N    . GLU A 1 29 ? 0.404   -11.731 2.054   1.00 0.00 ? 29 GLU A N    8  
ATOM 8922  C CA   . GLU A 1 29 ? -0.642  -12.157 1.133   1.00 0.00 ? 29 GLU A CA   8  
ATOM 8923  C C    . GLU A 1 29 ? -1.990  -11.558 1.525   1.00 0.00 ? 29 GLU A C    8  
ATOM 8924  O O    . GLU A 1 29 ? -2.077  -10.755 2.453   1.00 0.00 ? 29 GLU A O    8  
ATOM 8925  C CB   . GLU A 1 29 ? -0.738  -13.683 1.106   1.00 0.00 ? 29 GLU A CB   8  
ATOM 8926  C CG   . GLU A 1 29 ? 0.590   -14.371 0.837   1.00 0.00 ? 29 GLU A CG   8  
ATOM 8927  C CD   . GLU A 1 29 ? 0.428   -15.834 0.473   1.00 0.00 ? 29 GLU A CD   8  
ATOM 8928  O OE1  . GLU A 1 29 ? -0.225  -16.568 1.244   1.00 0.00 ? 29 GLU A OE1  8  
ATOM 8929  O OE2  . GLU A 1 29 ? 0.953   -16.244 -0.583  1.00 0.00 ? 29 GLU A OE2  8  
ATOM 8930  H H    . GLU A 1 29 ? 0.598   -12.279 2.843   1.00 0.00 ? 29 GLU A H    8  
ATOM 8931  H HA   . GLU A 1 29 ? -0.379  -11.805 0.147   1.00 0.00 ? 29 GLU A HA   8  
ATOM 8932  H HB2  . GLU A 1 29 ? -1.110  -14.026 2.060   1.00 0.00 ? 29 GLU A HB2  8  
ATOM 8933  H HB3  . GLU A 1 29 ? -1.433  -13.976 0.332   1.00 0.00 ? 29 GLU A HB3  8  
ATOM 8934  H HG2  . GLU A 1 29 ? 1.085   -13.866 0.021   1.00 0.00 ? 29 GLU A HG2  8  
ATOM 8935  H HG3  . GLU A 1 29 ? 1.203   -14.302 1.726   1.00 0.00 ? 29 GLU A HG3  8  
ATOM 8936  N N    . THR A 1 30 ? -3.038  -11.954 0.810   1.00 0.00 ? 30 THR A N    8  
ATOM 8937  C CA   . THR A 1 30 ? -4.381  -11.455 1.084   1.00 0.00 ? 30 THR A CA   8  
ATOM 8938  C C    . THR A 1 30 ? -5.409  -12.578 0.990   1.00 0.00 ? 30 THR A C    8  
ATOM 8939  O O    . THR A 1 30 ? -5.054  -13.749 0.854   1.00 0.00 ? 30 THR A O    8  
ATOM 8940  C CB   . THR A 1 30 ? -4.740  -10.336 0.105   1.00 0.00 ? 30 THR A CB   8  
ATOM 8941  O OG1  . THR A 1 30 ? -4.890  -10.847 -1.208  1.00 0.00 ? 30 THR A OG1  8  
ATOM 8942  C CG2  . THR A 1 30 ? -3.707  -9.231  0.052   1.00 0.00 ? 30 THR A CG2  8  
ATOM 8943  H H    . THR A 1 30 ? -2.906  -12.595 0.082   1.00 0.00 ? 30 THR A H    8  
ATOM 8944  H HA   . THR A 1 30 ? -4.389  -11.058 2.087   1.00 0.00 ? 30 THR A HA   8  
ATOM 8945  H HB   . THR A 1 30 ? -5.681  -9.896  0.407   1.00 0.00 ? 30 THR A HB   8  
ATOM 8946  H HG1  . THR A 1 30 ? -4.035  -11.133 -1.539  1.00 0.00 ? 30 THR A HG1  8  
ATOM 8947  H HG21 . THR A 1 30 ? -3.827  -8.586  0.910   1.00 0.00 ? 30 THR A HG21 8  
ATOM 8948  H HG22 . THR A 1 30 ? -3.840  -8.656  -0.852  1.00 0.00 ? 30 THR A HG22 8  
ATOM 8949  H HG23 . THR A 1 30 ? -2.717  -9.663  0.063   1.00 0.00 ? 30 THR A HG23 8  
ATOM 8950  N N    . ASP A 1 31 ? -6.686  -12.214 1.064   1.00 0.00 ? 31 ASP A N    8  
ATOM 8951  C CA   . ASP A 1 31 ? -7.765  -13.192 0.987   1.00 0.00 ? 31 ASP A CA   8  
ATOM 8952  C C    . ASP A 1 31 ? -8.759  -12.825 -0.111  1.00 0.00 ? 31 ASP A C    8  
ATOM 8953  O O    . ASP A 1 31 ? -9.941  -13.155 -0.026  1.00 0.00 ? 31 ASP A O    8  
ATOM 8954  C CB   . ASP A 1 31 ? -8.489  -13.289 2.332   1.00 0.00 ? 31 ASP A CB   8  
ATOM 8955  C CG   . ASP A 1 31 ? -9.179  -14.626 2.521   1.00 0.00 ? 31 ASP A CG   8  
ATOM 8956  O OD1  . ASP A 1 31 ? -8.492  -15.603 2.884   1.00 0.00 ? 31 ASP A OD1  8  
ATOM 8957  O OD2  . ASP A 1 31 ? -10.407 -14.695 2.306   1.00 0.00 ? 31 ASP A OD2  8  
ATOM 8958  H H    . ASP A 1 31 ? -6.907  -11.265 1.173   1.00 0.00 ? 31 ASP A H    8  
ATOM 8959  H HA   . ASP A 1 31 ? -7.327  -14.150 0.755   1.00 0.00 ? 31 ASP A HA   8  
ATOM 8960  H HB2  . ASP A 1 31 ? -7.772  -13.160 3.130   1.00 0.00 ? 31 ASP A HB2  8  
ATOM 8961  H HB3  . ASP A 1 31 ? -9.232  -12.508 2.391   1.00 0.00 ? 31 ASP A HB3  8  
ATOM 8962  N N    . PHE A 1 32 ? -8.271  -12.143 -1.142  1.00 0.00 ? 32 PHE A N    8  
ATOM 8963  C CA   . PHE A 1 32 ? -9.118  -11.736 -2.257  1.00 0.00 ? 32 PHE A CA   8  
ATOM 8964  C C    . PHE A 1 32 ? -8.423  -11.986 -3.592  1.00 0.00 ? 32 PHE A C    8  
ATOM 8965  O O    . PHE A 1 32 ? -9.029  -12.502 -4.531  1.00 0.00 ? 32 PHE A O    8  
ATOM 8966  C CB   . PHE A 1 32 ? -9.491  -10.256 -2.131  1.00 0.00 ? 32 PHE A CB   8  
ATOM 8967  C CG   . PHE A 1 32 ? -8.308  -9.331  -2.156  1.00 0.00 ? 32 PHE A CG   8  
ATOM 8968  C CD1  . PHE A 1 32 ? -7.798  -8.871  -3.360  1.00 0.00 ? 32 PHE A CD1  8  
ATOM 8969  C CD2  . PHE A 1 32 ? -7.709  -8.919  -0.977  1.00 0.00 ? 32 PHE A CD2  8  
ATOM 8970  C CE1  . PHE A 1 32 ? -6.710  -8.018  -3.386  1.00 0.00 ? 32 PHE A CE1  8  
ATOM 8971  C CE2  . PHE A 1 32 ? -6.622  -8.066  -0.997  1.00 0.00 ? 32 PHE A CE2  8  
ATOM 8972  C CZ   . PHE A 1 32 ? -6.123  -7.614  -2.203  1.00 0.00 ? 32 PHE A CZ   8  
ATOM 8973  H H    . PHE A 1 32 ? -7.319  -11.910 -1.155  1.00 0.00 ? 32 PHE A H    8  
ATOM 8974  H HA   . PHE A 1 32 ? -10.020 -12.328 -2.220  1.00 0.00 ? 32 PHE A HA   8  
ATOM 8975  H HB2  . PHE A 1 32 ? -10.141 -9.986  -2.949  1.00 0.00 ? 32 PHE A HB2  8  
ATOM 8976  H HB3  . PHE A 1 32 ? -10.015 -10.104 -1.197  1.00 0.00 ? 32 PHE A HB3  8  
ATOM 8977  H HD1  . PHE A 1 32 ? -8.258  -9.185  -4.286  1.00 0.00 ? 32 PHE A HD1  8  
ATOM 8978  H HD2  . PHE A 1 32 ? -8.099  -9.272  -0.034  1.00 0.00 ? 32 PHE A HD2  8  
ATOM 8979  H HE1  . PHE A 1 32 ? -6.322  -7.666  -4.330  1.00 0.00 ? 32 PHE A HE1  8  
ATOM 8980  H HE2  . PHE A 1 32 ? -6.164  -7.752  -0.070  1.00 0.00 ? 32 PHE A HE2  8  
ATOM 8981  H HZ   . PHE A 1 32 ? -5.273  -6.947  -2.221  1.00 0.00 ? 32 PHE A HZ   8  
ATOM 8982  N N    . ALA A 1 33 ? -7.148  -11.618 -3.669  1.00 0.00 ? 33 ALA A N    8  
ATOM 8983  C CA   . ALA A 1 33 ? -6.371  -11.803 -4.888  1.00 0.00 ? 33 ALA A CA   8  
ATOM 8984  C C    . ALA A 1 33 ? -5.233  -12.794 -4.668  1.00 0.00 ? 33 ALA A C    8  
ATOM 8985  O O    . ALA A 1 33 ? -4.981  -13.224 -3.542  1.00 0.00 ? 33 ALA A O    8  
ATOM 8986  C CB   . ALA A 1 33 ? -5.826  -10.469 -5.374  1.00 0.00 ? 33 ALA A CB   8  
ATOM 8987  H H    . ALA A 1 33 ? -6.720  -11.210 -2.887  1.00 0.00 ? 33 ALA A H    8  
ATOM 8988  H HA   . ALA A 1 33 ? -7.032  -12.193 -5.648  1.00 0.00 ? 33 ALA A HA   8  
ATOM 8989  H HB1  . ALA A 1 33 ? -5.502  -9.883  -4.526  1.00 0.00 ? 33 ALA A HB1  8  
ATOM 8990  H HB2  . ALA A 1 33 ? -6.600  -9.935  -5.905  1.00 0.00 ? 33 ALA A HB2  8  
ATOM 8991  H HB3  . ALA A 1 33 ? -4.989  -10.641 -6.034  1.00 0.00 ? 33 ALA A HB3  8  
ATOM 8992  N N    . LYS A 1 34 ? -4.549  -13.152 -5.749  1.00 0.00 ? 34 LYS A N    8  
ATOM 8993  C CA   . LYS A 1 34 ? -3.436  -14.092 -5.673  1.00 0.00 ? 34 LYS A CA   8  
ATOM 8994  C C    . LYS A 1 34 ? -2.100  -13.362 -5.765  1.00 0.00 ? 34 LYS A C    8  
ATOM 8995  O O    . LYS A 1 34 ? -1.992  -12.325 -6.417  1.00 0.00 ? 34 LYS A O    8  
ATOM 8996  C CB   . LYS A 1 34 ? -3.542  -15.132 -6.790  1.00 0.00 ? 34 LYS A CB   8  
ATOM 8997  C CG   . LYS A 1 34 ? -4.386  -16.339 -6.418  1.00 0.00 ? 34 LYS A CG   8  
ATOM 8998  C CD   . LYS A 1 34 ? -5.048  -16.954 -7.641  1.00 0.00 ? 34 LYS A CD   8  
ATOM 8999  C CE   . LYS A 1 34 ? -5.125  -18.468 -7.531  1.00 0.00 ? 34 LYS A CE   8  
ATOM 9000  N NZ   . LYS A 1 34 ? -5.689  -18.903 -6.223  1.00 0.00 ? 34 LYS A NZ   8  
ATOM 9001  H H    . LYS A 1 34 ? -4.797  -12.775 -6.619  1.00 0.00 ? 34 LYS A H    8  
ATOM 9002  H HA   . LYS A 1 34 ? -3.493  -14.595 -4.719  1.00 0.00 ? 34 LYS A HA   8  
ATOM 9003  H HB2  . LYS A 1 34 ? -3.983  -14.665 -7.659  1.00 0.00 ? 34 LYS A HB2  8  
ATOM 9004  H HB3  . LYS A 1 34 ? -2.549  -15.475 -7.040  1.00 0.00 ? 34 LYS A HB3  8  
ATOM 9005  H HG2  . LYS A 1 34 ? -3.751  -17.081 -5.955  1.00 0.00 ? 34 LYS A HG2  8  
ATOM 9006  H HG3  . LYS A 1 34 ? -5.151  -16.032 -5.721  1.00 0.00 ? 34 LYS A HG3  8  
ATOM 9007  H HD2  . LYS A 1 34 ? -6.048  -16.558 -7.733  1.00 0.00 ? 34 LYS A HD2  8  
ATOM 9008  H HD3  . LYS A 1 34 ? -4.474  -16.694 -8.518  1.00 0.00 ? 34 LYS A HD3  8  
ATOM 9009  H HE2  . LYS A 1 34 ? -5.754  -18.842 -8.325  1.00 0.00 ? 34 LYS A HE2  8  
ATOM 9010  H HE3  . LYS A 1 34 ? -4.131  -18.875 -7.638  1.00 0.00 ? 34 LYS A HE3  8  
ATOM 9011  H HZ1  . LYS A 1 34 ? -6.280  -18.147 -5.820  1.00 0.00 ? 34 LYS A HZ1  8  
ATOM 9012  H HZ2  . LYS A 1 34 ? -4.920  -19.118 -5.557  1.00 0.00 ? 34 LYS A HZ2  8  
ATOM 9013  H HZ3  . LYS A 1 34 ? -6.272  -19.754 -6.350  1.00 0.00 ? 34 LYS A HZ3  8  
ATOM 9014  N N    . GLY A 1 35 ? -1.084  -13.914 -5.108  1.00 0.00 ? 35 GLY A N    8  
ATOM 9015  C CA   . GLY A 1 35 ? 0.232   -13.303 -5.129  1.00 0.00 ? 35 GLY A CA   8  
ATOM 9016  C C    . GLY A 1 35 ? 0.528   -12.518 -3.866  1.00 0.00 ? 35 GLY A C    8  
ATOM 9017  O O    . GLY A 1 35 ? -0.160  -12.672 -2.856  1.00 0.00 ? 35 GLY A O    8  
ATOM 9018  H H    . GLY A 1 35 ? -1.230  -14.742 -4.604  1.00 0.00 ? 35 GLY A H    8  
ATOM 9019  H HA2  . GLY A 1 35 ? 0.975   -14.078 -5.240  1.00 0.00 ? 35 GLY A HA2  8  
ATOM 9020  H HA3  . GLY A 1 35 ? 0.293   -12.636 -5.976  1.00 0.00 ? 35 GLY A HA3  8  
ATOM 9021  N N    . GLU A 1 36 ? 1.555   -11.676 -3.922  1.00 0.00 ? 36 GLU A N    8  
ATOM 9022  C CA   . GLU A 1 36 ? 1.940   -10.864 -2.773  1.00 0.00 ? 36 GLU A CA   8  
ATOM 9023  C C    . GLU A 1 36 ? 1.446   -9.430  -2.928  1.00 0.00 ? 36 GLU A C    8  
ATOM 9024  O O    . GLU A 1 36 ? 1.541   -8.844  -4.007  1.00 0.00 ? 36 GLU A O    8  
ATOM 9025  C CB   . GLU A 1 36 ? 3.461   -10.877 -2.602  1.00 0.00 ? 36 GLU A CB   8  
ATOM 9026  C CG   . GLU A 1 36 ? 3.909   -10.869 -1.149  1.00 0.00 ? 36 GLU A CG   8  
ATOM 9027  C CD   . GLU A 1 36 ? 5.007   -11.878 -0.872  1.00 0.00 ? 36 GLU A CD   8  
ATOM 9028  O OE1  . GLU A 1 36 ? 4.678   -13.039 -0.549  1.00 0.00 ? 36 GLU A OE1  8  
ATOM 9029  O OE2  . GLU A 1 36 ? 6.195   -11.508 -0.976  1.00 0.00 ? 36 GLU A OE2  8  
ATOM 9030  H H    . GLU A 1 36 ? 2.064   -11.598 -4.755  1.00 0.00 ? 36 GLU A H    8  
ATOM 9031  H HA   . GLU A 1 36 ? 1.486   -11.296 -1.895  1.00 0.00 ? 36 GLU A HA   8  
ATOM 9032  H HB2  . GLU A 1 36 ? 3.858   -11.763 -3.075  1.00 0.00 ? 36 GLU A HB2  8  
ATOM 9033  H HB3  . GLU A 1 36 ? 3.874   -10.005 -3.088  1.00 0.00 ? 36 GLU A HB3  8  
ATOM 9034  H HG2  . GLU A 1 36 ? 4.279   -9.884  -0.906  1.00 0.00 ? 36 GLU A HG2  8  
ATOM 9035  H HG3  . GLU A 1 36 ? 3.061   -11.099 -0.523  1.00 0.00 ? 36 GLU A HG3  8  
ATOM 9036  N N    . TRP A 1 37 ? 0.919   -8.871  -1.844  1.00 0.00 ? 37 TRP A N    8  
ATOM 9037  C CA   . TRP A 1 37 ? 0.410   -7.505  -1.859  1.00 0.00 ? 37 TRP A CA   8  
ATOM 9038  C C    . TRP A 1 37 ? 0.952   -6.709  -0.677  1.00 0.00 ? 37 TRP A C    8  
ATOM 9039  O O    . TRP A 1 37 ? 1.198   -7.261  0.396   1.00 0.00 ? 37 TRP A O    8  
ATOM 9040  C CB   . TRP A 1 37 ? -1.119  -7.508  -1.828  1.00 0.00 ? 37 TRP A CB   8  
ATOM 9041  C CG   . TRP A 1 37 ? -1.737  -8.133  -3.042  1.00 0.00 ? 37 TRP A CG   8  
ATOM 9042  C CD1  . TRP A 1 37 ? -1.844  -9.467  -3.313  1.00 0.00 ? 37 TRP A CD1  8  
ATOM 9043  C CD2  . TRP A 1 37 ? -2.331  -7.449  -4.150  1.00 0.00 ? 37 TRP A CD2  8  
ATOM 9044  N NE1  . TRP A 1 37 ? -2.470  -9.654  -4.522  1.00 0.00 ? 37 TRP A NE1  8  
ATOM 9045  C CE2  . TRP A 1 37 ? -2.779  -8.430  -5.055  1.00 0.00 ? 37 TRP A CE2  8  
ATOM 9046  C CE3  . TRP A 1 37 ? -2.531  -6.102  -4.465  1.00 0.00 ? 37 TRP A CE3  8  
ATOM 9047  C CZ2  . TRP A 1 37 ? -3.412  -8.106  -6.253  1.00 0.00 ? 37 TRP A CZ2  8  
ATOM 9048  C CZ3  . TRP A 1 37 ? -3.159  -5.781  -5.654  1.00 0.00 ? 37 TRP A CZ3  8  
ATOM 9049  C CH2  . TRP A 1 37 ? -3.594  -6.779  -6.534  1.00 0.00 ? 37 TRP A CH2  8  
ATOM 9050  H H    . TRP A 1 37 ? 0.872   -9.389  -1.013  1.00 0.00 ? 37 TRP A H    8  
ATOM 9051  H HA   . TRP A 1 37 ? 0.741   -7.038  -2.775  1.00 0.00 ? 37 TRP A HA   8  
ATOM 9052  H HB2  . TRP A 1 37 ? -1.454  -8.061  -0.963  1.00 0.00 ? 37 TRP A HB2  8  
ATOM 9053  H HB3  . TRP A 1 37 ? -1.474  -6.490  -1.759  1.00 0.00 ? 37 TRP A HB3  8  
ATOM 9054  H HD1  . TRP A 1 37 ? -1.483  -10.250 -2.662  1.00 0.00 ? 37 TRP A HD1  8  
ATOM 9055  H HE1  . TRP A 1 37 ? -2.663  -10.521 -4.934  1.00 0.00 ? 37 TRP A HE1  8  
ATOM 9056  H HE3  . TRP A 1 37 ? -2.203  -5.318  -3.797  1.00 0.00 ? 37 TRP A HE3  8  
ATOM 9057  H HZ2  . TRP A 1 37 ? -3.753  -8.863  -6.942  1.00 0.00 ? 37 TRP A HZ2  8  
ATOM 9058  H HZ3  . TRP A 1 37 ? -3.321  -4.745  -5.913  1.00 0.00 ? 37 TRP A HZ3  8  
ATOM 9059  H HH2  . TRP A 1 37 ? -4.079  -6.482  -7.452  1.00 0.00 ? 37 TRP A HH2  8  
ATOM 9060  N N    . CYS A 1 38 ? 1.136   -5.409  -0.879  1.00 0.00 ? 38 CYS A N    8  
ATOM 9061  C CA   . CYS A 1 38 ? 1.650   -4.537  0.171   1.00 0.00 ? 38 CYS A CA   8  
ATOM 9062  C C    . CYS A 1 38 ? 0.823   -3.258  0.269   1.00 0.00 ? 38 CYS A C    8  
ATOM 9063  O O    . CYS A 1 38 ? 0.702   -2.510  -0.701  1.00 0.00 ? 38 CYS A O    8  
ATOM 9064  C CB   . CYS A 1 38 ? 3.115   -4.191  -0.095  1.00 0.00 ? 38 CYS A CB   8  
ATOM 9065  S SG   . CYS A 1 38 ? 4.292   -5.335  0.663   1.00 0.00 ? 38 CYS A SG   8  
ATOM 9066  H H    . CYS A 1 38 ? 0.923   -5.026  -1.756  1.00 0.00 ? 38 CYS A H    8  
ATOM 9067  H HA   . CYS A 1 38 ? 1.578   -5.069  1.107   1.00 0.00 ? 38 CYS A HA   8  
ATOM 9068  H HB2  . CYS A 1 38 ? 3.291   -4.198  -1.160  1.00 0.00 ? 38 CYS A HB2  8  
ATOM 9069  H HB3  . CYS A 1 38 ? 3.320   -3.204  0.292   1.00 0.00 ? 38 CYS A HB3  8  
ATOM 9070  H HG   . CYS A 1 38 ? 4.879   -4.826  1.227   1.00 0.00 ? 38 CYS A HG   8  
ATOM 9071  N N    . GLY A 1 39 ? 0.257   -3.014  1.446   1.00 0.00 ? 39 GLY A N    8  
ATOM 9072  C CA   . GLY A 1 39 ? -0.550  -1.825  1.649   1.00 0.00 ? 39 GLY A CA   8  
ATOM 9073  C C    . GLY A 1 39 ? 0.289   -0.570  1.777   1.00 0.00 ? 39 GLY A C    8  
ATOM 9074  O O    . GLY A 1 39 ? 1.240   -0.528  2.558   1.00 0.00 ? 39 GLY A O    8  
ATOM 9075  H H    . GLY A 1 39 ? 0.389   -3.647  2.183   1.00 0.00 ? 39 GLY A H    8  
ATOM 9076  H HA2  . GLY A 1 39 ? -1.221  -1.713  0.811   1.00 0.00 ? 39 GLY A HA2  8  
ATOM 9077  H HA3  . GLY A 1 39 ? -1.133  -1.950  2.549   1.00 0.00 ? 39 GLY A HA3  8  
ATOM 9078  N N    . VAL A 1 40 ? -0.063  0.455   1.009   1.00 0.00 ? 40 VAL A N    8  
ATOM 9079  C CA   . VAL A 1 40 ? 0.666   1.718   1.038   1.00 0.00 ? 40 VAL A CA   8  
ATOM 9080  C C    . VAL A 1 40 ? -0.191  2.832   1.631   1.00 0.00 ? 40 VAL A C    8  
ATOM 9081  O O    . VAL A 1 40 ? -1.388  2.921   1.358   1.00 0.00 ? 40 VAL A O    8  
ATOM 9082  C CB   . VAL A 1 40 ? 1.126   2.134   -0.371  1.00 0.00 ? 40 VAL A CB   8  
ATOM 9083  C CG1  . VAL A 1 40 ? 2.040   3.347   -0.300  1.00 0.00 ? 40 VAL A CG1  8  
ATOM 9084  C CG2  . VAL A 1 40 ? 1.818   0.975   -1.071  1.00 0.00 ? 40 VAL A CG2  8  
ATOM 9085  H H    . VAL A 1 40 ? -0.829  0.360   0.407   1.00 0.00 ? 40 VAL A H    8  
ATOM 9086  H HA   . VAL A 1 40 ? 1.542   1.584   1.655   1.00 0.00 ? 40 VAL A HA   8  
ATOM 9087  H HB   . VAL A 1 40 ? 0.252   2.404   -0.948  1.00 0.00 ? 40 VAL A HB   8  
ATOM 9088  H HG11 . VAL A 1 40 ? 2.497   3.396   0.678   1.00 0.00 ? 40 VAL A HG11 8  
ATOM 9089  H HG12 . VAL A 1 40 ? 1.463   4.244   -0.473  1.00 0.00 ? 40 VAL A HG12 8  
ATOM 9090  H HG13 . VAL A 1 40 ? 2.810   3.263   -1.052  1.00 0.00 ? 40 VAL A HG13 8  
ATOM 9091  H HG21 . VAL A 1 40 ? 2.595   1.355   -1.717  1.00 0.00 ? 40 VAL A HG21 8  
ATOM 9092  H HG22 . VAL A 1 40 ? 1.097   0.426   -1.659  1.00 0.00 ? 40 VAL A HG22 8  
ATOM 9093  H HG23 . VAL A 1 40 ? 2.254   0.317   -0.332  1.00 0.00 ? 40 VAL A HG23 8  
ATOM 9094  N N    . GLU A 1 41 ? 0.431   3.680   2.443   1.00 0.00 ? 41 GLU A N    8  
ATOM 9095  C CA   . GLU A 1 41 ? -0.273  4.790   3.075   1.00 0.00 ? 41 GLU A CA   8  
ATOM 9096  C C    . GLU A 1 41 ? 0.195   6.126   2.507   1.00 0.00 ? 41 GLU A C    8  
ATOM 9097  O O    . GLU A 1 41 ? 1.291   6.593   2.817   1.00 0.00 ? 41 GLU A O    8  
ATOM 9098  C CB   . GLU A 1 41 ? -0.056  4.763   4.590   1.00 0.00 ? 41 GLU A CB   8  
ATOM 9099  C CG   . GLU A 1 41 ? -1.084  5.568   5.367   1.00 0.00 ? 41 GLU A CG   8  
ATOM 9100  C CD   . GLU A 1 41 ? -0.552  6.916   5.814   1.00 0.00 ? 41 GLU A CD   8  
ATOM 9101  O OE1  . GLU A 1 41 ? 0.672   7.025   6.037   1.00 0.00 ? 41 GLU A OE1  8  
ATOM 9102  O OE2  . GLU A 1 41 ? -1.359  7.859   5.942   1.00 0.00 ? 41 GLU A OE2  8  
ATOM 9103  H H    . GLU A 1 41 ? 1.387   3.557   2.622   1.00 0.00 ? 41 GLU A H    8  
ATOM 9104  H HA   . GLU A 1 41 ? -1.326  4.675   2.870   1.00 0.00 ? 41 GLU A HA   8  
ATOM 9105  H HB2  . GLU A 1 41 ? -0.101  3.739   4.930   1.00 0.00 ? 41 GLU A HB2  8  
ATOM 9106  H HB3  . GLU A 1 41 ? 0.923   5.162   4.808   1.00 0.00 ? 41 GLU A HB3  8  
ATOM 9107  H HG2  . GLU A 1 41 ? -1.946  5.730   4.737   1.00 0.00 ? 41 GLU A HG2  8  
ATOM 9108  H HG3  . GLU A 1 41 ? -1.378  5.005   6.240   1.00 0.00 ? 41 GLU A HG3  8  
ATOM 9109  N N    . LEU A 1 42 ? -0.641  6.733   1.672   1.00 0.00 ? 42 LEU A N    8  
ATOM 9110  C CA   . LEU A 1 42 ? -0.312  8.016   1.060   1.00 0.00 ? 42 LEU A CA   8  
ATOM 9111  C C    . LEU A 1 42 ? -0.425  9.149   2.074   1.00 0.00 ? 42 LEU A C    8  
ATOM 9112  O O    . LEU A 1 42 ? -1.011  8.982   3.144   1.00 0.00 ? 42 LEU A O    8  
ATOM 9113  C CB   . LEU A 1 42 ? -1.235  8.286   -0.130  1.00 0.00 ? 42 LEU A CB   8  
ATOM 9114  C CG   . LEU A 1 42 ? -1.288  7.170   -1.175  1.00 0.00 ? 42 LEU A CG   8  
ATOM 9115  C CD1  . LEU A 1 42 ? -2.349  7.471   -2.223  1.00 0.00 ? 42 LEU A CD1  8  
ATOM 9116  C CD2  . LEU A 1 42 ? 0.073   6.990   -1.829  1.00 0.00 ? 42 LEU A CD2  8  
ATOM 9117  H H    . LEU A 1 42 ? -1.500  6.310   1.464   1.00 0.00 ? 42 LEU A H    8  
ATOM 9118  H HA   . LEU A 1 42 ? 0.707   7.962   0.709   1.00 0.00 ? 42 LEU A HA   8  
ATOM 9119  H HB2  . LEU A 1 42 ? -2.236  8.446   0.247   1.00 0.00 ? 42 LEU A HB2  8  
ATOM 9120  H HB3  . LEU A 1 42 ? -0.903  9.190   -0.618  1.00 0.00 ? 42 LEU A HB3  8  
ATOM 9121  H HG   . LEU A 1 42 ? -1.552  6.243   -0.689  1.00 0.00 ? 42 LEU A HG   8  
ATOM 9122  H HD11 . LEU A 1 42 ? -1.885  7.926   -3.085  1.00 0.00 ? 42 LEU A HD11 8  
ATOM 9123  H HD12 . LEU A 1 42 ? -3.081  8.148   -1.809  1.00 0.00 ? 42 LEU A HD12 8  
ATOM 9124  H HD13 . LEU A 1 42 ? -2.835  6.552   -2.517  1.00 0.00 ? 42 LEU A HD13 8  
ATOM 9125  H HD21 . LEU A 1 42 ? 0.694   6.367   -1.203  1.00 0.00 ? 42 LEU A HD21 8  
ATOM 9126  H HD22 . LEU A 1 42 ? 0.543   7.954   -1.957  1.00 0.00 ? 42 LEU A HD22 8  
ATOM 9127  H HD23 . LEU A 1 42 ? -0.050  6.520   -2.793  1.00 0.00 ? 42 LEU A HD23 8  
ATOM 9128  N N    . ASP A 1 43 ? 0.140   10.302  1.731   1.00 0.00 ? 43 ASP A N    8  
ATOM 9129  C CA   . ASP A 1 43 ? 0.104   11.463  2.612   1.00 0.00 ? 43 ASP A CA   8  
ATOM 9130  C C    . ASP A 1 43 ? -1.099  12.347  2.297   1.00 0.00 ? 43 ASP A C    8  
ATOM 9131  O O    . ASP A 1 43 ? -1.653  12.997  3.184   1.00 0.00 ? 43 ASP A O    8  
ATOM 9132  C CB   . ASP A 1 43 ? 1.396   12.272  2.478   1.00 0.00 ? 43 ASP A CB   8  
ATOM 9133  C CG   . ASP A 1 43 ? 2.577   11.591  3.141   1.00 0.00 ? 43 ASP A CG   8  
ATOM 9134  O OD1  . ASP A 1 43 ? 2.997   10.523  2.651   1.00 0.00 ? 43 ASP A OD1  8  
ATOM 9135  O OD2  . ASP A 1 43 ? 3.079   12.126  4.151   1.00 0.00 ? 43 ASP A OD2  8  
ATOM 9136  H H    . ASP A 1 43 ? 0.594   10.373  0.865   1.00 0.00 ? 43 ASP A H    8  
ATOM 9137  H HA   . ASP A 1 43 ? 0.017   11.107  3.627   1.00 0.00 ? 43 ASP A HA   8  
ATOM 9138  H HB2  . ASP A 1 43 ? 1.622   12.405  1.431   1.00 0.00 ? 43 ASP A HB2  8  
ATOM 9139  H HB3  . ASP A 1 43 ? 1.255   13.240  2.937   1.00 0.00 ? 43 ASP A HB3  8  
ATOM 9140  N N    . GLU A 1 44 ? -1.497  12.366  1.029   1.00 0.00 ? 44 GLU A N    8  
ATOM 9141  C CA   . GLU A 1 44 ? -2.635  13.170  0.596   1.00 0.00 ? 44 GLU A CA   8  
ATOM 9142  C C    . GLU A 1 44 ? -3.788  12.279  0.143   1.00 0.00 ? 44 GLU A C    8  
ATOM 9143  O O    . GLU A 1 44 ? -3.576  11.143  -0.282  1.00 0.00 ? 44 GLU A O    8  
ATOM 9144  C CB   . GLU A 1 44 ? -2.221  14.108  -0.539  1.00 0.00 ? 44 GLU A CB   8  
ATOM 9145  C CG   . GLU A 1 44 ? -1.761  15.476  -0.061  1.00 0.00 ? 44 GLU A CG   8  
ATOM 9146  C CD   . GLU A 1 44 ? -1.294  16.364  -1.197  1.00 0.00 ? 44 GLU A CD   8  
ATOM 9147  O OE1  . GLU A 1 44 ? -2.146  17.035  -1.816  1.00 0.00 ? 44 GLU A OE1  8  
ATOM 9148  O OE2  . GLU A 1 44 ? -0.075  16.388  -1.468  1.00 0.00 ? 44 GLU A OE2  8  
ATOM 9149  H H    . GLU A 1 44 ? -1.015  11.826  0.368   1.00 0.00 ? 44 GLU A H    8  
ATOM 9150  H HA   . GLU A 1 44 ? -2.962  13.760  1.439   1.00 0.00 ? 44 GLU A HA   8  
ATOM 9151  H HB2  . GLU A 1 44 ? -1.411  13.652  -1.089  1.00 0.00 ? 44 GLU A HB2  8  
ATOM 9152  H HB3  . GLU A 1 44 ? -3.062  14.246  -1.201  1.00 0.00 ? 44 GLU A HB3  8  
ATOM 9153  H HG2  . GLU A 1 44 ? -2.585  15.963  0.441   1.00 0.00 ? 44 GLU A HG2  8  
ATOM 9154  H HG3  . GLU A 1 44 ? -0.945  15.344  0.634   1.00 0.00 ? 44 GLU A HG3  8  
ATOM 9155  N N    . PRO A 1 45 ? -5.030  12.786  0.226   1.00 0.00 ? 45 PRO A N    8  
ATOM 9156  C CA   . PRO A 1 45 ? -6.220  12.030  -0.178  1.00 0.00 ? 45 PRO A CA   8  
ATOM 9157  C C    . PRO A 1 45 ? -6.109  11.493  -1.602  1.00 0.00 ? 45 PRO A C    8  
ATOM 9158  O O    . PRO A 1 45 ? -6.522  12.150  -2.558  1.00 0.00 ? 45 PRO A O    8  
ATOM 9159  C CB   . PRO A 1 45 ? -7.349  13.059  -0.083  1.00 0.00 ? 45 PRO A CB   8  
ATOM 9160  C CG   . PRO A 1 45 ? -6.863  14.068  0.900   1.00 0.00 ? 45 PRO A CG   8  
ATOM 9161  C CD   . PRO A 1 45 ? -5.372  14.132  0.721   1.00 0.00 ? 45 PRO A CD   8  
ATOM 9162  H HA   . PRO A 1 45 ? -6.418  11.211  0.498   1.00 0.00 ? 45 PRO A HA   8  
ATOM 9163  H HB2  . PRO A 1 45 ? -7.519  13.503  -1.054  1.00 0.00 ? 45 PRO A HB2  8  
ATOM 9164  H HB3  . PRO A 1 45 ? -8.252  12.577  0.261   1.00 0.00 ? 45 PRO A HB3  8  
ATOM 9165  H HG2  . PRO A 1 45 ? -7.308  15.029  0.691   1.00 0.00 ? 45 PRO A HG2  8  
ATOM 9166  H HG3  . PRO A 1 45 ? -7.106  13.749  1.903   1.00 0.00 ? 45 PRO A HG3  8  
ATOM 9167  H HD2  . PRO A 1 45 ? -5.111  14.888  -0.006  1.00 0.00 ? 45 PRO A HD2  8  
ATOM 9168  H HD3  . PRO A 1 45 ? -4.886  14.331  1.665   1.00 0.00 ? 45 PRO A HD3  8  
ATOM 9169  N N    . LEU A 1 46 ? -5.549  10.296  -1.735  1.00 0.00 ? 46 LEU A N    8  
ATOM 9170  C CA   . LEU A 1 46 ? -5.384  9.670   -3.041  1.00 0.00 ? 46 LEU A CA   8  
ATOM 9171  C C    . LEU A 1 46 ? -5.512  8.153   -2.938  1.00 0.00 ? 46 LEU A C    8  
ATOM 9172  O O    . LEU A 1 46 ? -4.892  7.415   -3.704  1.00 0.00 ? 46 LEU A O    8  
ATOM 9173  C CB   . LEU A 1 46 ? -4.025  10.039  -3.639  1.00 0.00 ? 46 LEU A CB   8  
ATOM 9174  C CG   . LEU A 1 46 ? -3.883  11.498  -4.074  1.00 0.00 ? 46 LEU A CG   8  
ATOM 9175  C CD1  . LEU A 1 46 ? -2.419  11.858  -4.265  1.00 0.00 ? 46 LEU A CD1  8  
ATOM 9176  C CD2  . LEU A 1 46 ? -4.668  11.750  -5.353  1.00 0.00 ? 46 LEU A CD2  8  
ATOM 9177  H H    . LEU A 1 46 ? -5.241  9.820   -0.935  1.00 0.00 ? 46 LEU A H    8  
ATOM 9178  H HA   . LEU A 1 46 ? -6.164  10.042  -3.688  1.00 0.00 ? 46 LEU A HA   8  
ATOM 9179  H HB2  . LEU A 1 46 ? -3.262  9.828   -2.902  1.00 0.00 ? 46 LEU A HB2  8  
ATOM 9180  H HB3  . LEU A 1 46 ? -3.852  9.411   -4.500  1.00 0.00 ? 46 LEU A HB3  8  
ATOM 9181  H HG   . LEU A 1 46 ? -4.287  12.137  -3.302  1.00 0.00 ? 46 LEU A HG   8  
ATOM 9182  H HD11 . LEU A 1 46 ? -2.032  12.286  -3.351  1.00 0.00 ? 46 LEU A HD11 8  
ATOM 9183  H HD12 . LEU A 1 46 ? -2.326  12.577  -5.066  1.00 0.00 ? 46 LEU A HD12 8  
ATOM 9184  H HD13 . LEU A 1 46 ? -1.859  10.969  -4.511  1.00 0.00 ? 46 LEU A HD13 8  
ATOM 9185  H HD21 . LEU A 1 46 ? -5.099  12.739  -5.323  1.00 0.00 ? 46 LEU A HD21 8  
ATOM 9186  H HD22 . LEU A 1 46 ? -5.455  11.017  -5.442  1.00 0.00 ? 46 LEU A HD22 8  
ATOM 9187  H HD23 . LEU A 1 46 ? -4.005  11.671  -6.203  1.00 0.00 ? 46 LEU A HD23 8  
ATOM 9188  N N    . GLY A 1 47 ? -6.321  7.696   -1.988  1.00 0.00 ? 47 GLY A N    8  
ATOM 9189  C CA   . GLY A 1 47 ? -6.516  6.269   -1.803  1.00 0.00 ? 47 GLY A CA   8  
ATOM 9190  C C    . GLY A 1 47 ? -7.909  5.818   -2.195  1.00 0.00 ? 47 GLY A C    8  
ATOM 9191  O O    . GLY A 1 47 ? -8.713  6.615   -2.680  1.00 0.00 ? 47 GLY A O    8  
ATOM 9192  H H    . GLY A 1 47 ? -6.789  8.331   -1.408  1.00 0.00 ? 47 GLY A H    8  
ATOM 9193  H HA2  . GLY A 1 47 ? -5.795  5.738   -2.405  1.00 0.00 ? 47 GLY A HA2  8  
ATOM 9194  H HA3  . GLY A 1 47 ? -6.351  6.027   -0.763  1.00 0.00 ? 47 GLY A HA3  8  
ATOM 9195  N N    . LYS A 1 48 ? -8.195  4.537   -1.987  1.00 0.00 ? 48 LYS A N    8  
ATOM 9196  C CA   . LYS A 1 48 ? -9.500  3.980   -2.321  1.00 0.00 ? 48 LYS A CA   8  
ATOM 9197  C C    . LYS A 1 48 ? -10.246 3.546   -1.064  1.00 0.00 ? 48 LYS A C    8  
ATOM 9198  O O    . LYS A 1 48 ? -11.465 3.695   -0.970  1.00 0.00 ? 48 LYS A O    8  
ATOM 9199  C CB   . LYS A 1 48 ? -9.342  2.791   -3.270  1.00 0.00 ? 48 LYS A CB   8  
ATOM 9200  C CG   . LYS A 1 48 ? -8.819  3.174   -4.644  1.00 0.00 ? 48 LYS A CG   8  
ATOM 9201  C CD   . LYS A 1 48 ? -9.928  3.173   -5.685  1.00 0.00 ? 48 LYS A CD   8  
ATOM 9202  C CE   . LYS A 1 48 ? -10.438 4.578   -5.959  1.00 0.00 ? 48 LYS A CE   8  
ATOM 9203  N NZ   . LYS A 1 48 ? -9.865  5.143   -7.212  1.00 0.00 ? 48 LYS A NZ   8  
ATOM 9204  H H    . LYS A 1 48 ? -7.512  3.952   -1.596  1.00 0.00 ? 48 LYS A H    8  
ATOM 9205  H HA   . LYS A 1 48 ? -10.073 4.750   -2.817  1.00 0.00 ? 48 LYS A HA   8  
ATOM 9206  H HB2  . LYS A 1 48 ? -8.653  2.085   -2.831  1.00 0.00 ? 48 LYS A HB2  8  
ATOM 9207  H HB3  . LYS A 1 48 ? -10.303 2.313   -3.394  1.00 0.00 ? 48 LYS A HB3  8  
ATOM 9208  H HG2  . LYS A 1 48 ? -8.390  4.163   -4.594  1.00 0.00 ? 48 LYS A HG2  8  
ATOM 9209  H HG3  . LYS A 1 48 ? -8.060  2.465   -4.941  1.00 0.00 ? 48 LYS A HG3  8  
ATOM 9210  H HD2  . LYS A 1 48 ? -9.546  2.754   -6.604  1.00 0.00 ? 48 LYS A HD2  8  
ATOM 9211  H HD3  . LYS A 1 48 ? -10.745 2.566   -5.324  1.00 0.00 ? 48 LYS A HD3  8  
ATOM 9212  H HE2  . LYS A 1 48 ? -11.514 4.546   -6.049  1.00 0.00 ? 48 LYS A HE2  8  
ATOM 9213  H HE3  . LYS A 1 48 ? -10.165 5.215   -5.130  1.00 0.00 ? 48 LYS A HE3  8  
ATOM 9214  H HZ1  . LYS A 1 48 ? -9.563  4.375   -7.846  1.00 0.00 ? 48 LYS A HZ1  8  
ATOM 9215  H HZ2  . LYS A 1 48 ? -9.042  5.739   -6.993  1.00 0.00 ? 48 LYS A HZ2  8  
ATOM 9216  H HZ3  . LYS A 1 48 ? -10.578 5.721   -7.702  1.00 0.00 ? 48 LYS A HZ3  8  
ATOM 9217  N N    . ASN A 1 49 ? -9.506  3.009   -0.098  1.00 0.00 ? 49 ASN A N    8  
ATOM 9218  C CA   . ASN A 1 49 ? -10.098 2.554   1.154   1.00 0.00 ? 49 ASN A CA   8  
ATOM 9219  C C    . ASN A 1 49 ? -9.190  2.880   2.336   1.00 0.00 ? 49 ASN A C    8  
ATOM 9220  O O    . ASN A 1 49 ? -8.169  3.550   2.180   1.00 0.00 ? 49 ASN A O    8  
ATOM 9221  C CB   . ASN A 1 49 ? -10.361 1.048   1.100   1.00 0.00 ? 49 ASN A CB   8  
ATOM 9222  C CG   . ASN A 1 49 ? -11.213 0.653   -0.092  1.00 0.00 ? 49 ASN A CG   8  
ATOM 9223  O OD1  . ASN A 1 49 ? -12.346 1.111   -0.238  1.00 0.00 ? 49 ASN A OD1  8  
ATOM 9224  N ND2  . ASN A 1 49 ? -10.670 -0.203  -0.949  1.00 0.00 ? 49 ASN A ND2  8  
ATOM 9225  H H    . ASN A 1 49 ? -8.540  2.917   -0.232  1.00 0.00 ? 49 ASN A H    8  
ATOM 9226  H HA   . ASN A 1 49 ? -11.037 3.070   1.284   1.00 0.00 ? 49 ASN A HA   8  
ATOM 9227  H HB2  . ASN A 1 49 ? -9.420  0.526   1.034   1.00 0.00 ? 49 ASN A HB2  8  
ATOM 9228  H HB3  . ASN A 1 49 ? -10.873 0.746   2.002   1.00 0.00 ? 49 ASN A HB3  8  
ATOM 9229  H HD21 . ASN A 1 49 ? -9.763  -0.527  -0.768  1.00 0.00 ? 49 ASN A HD21 8  
ATOM 9230  H HD22 . ASN A 1 49 ? -11.198 -0.476  -1.728  1.00 0.00 ? 49 ASN A HD22 8  
ATOM 9231  N N    . ASP A 1 50 ? -9.568  2.402   3.517   1.00 0.00 ? 50 ASP A N    8  
ATOM 9232  C CA   . ASP A 1 50 ? -8.788  2.642   4.724   1.00 0.00 ? 50 ASP A CA   8  
ATOM 9233  C C    . ASP A 1 50 ? -7.985  1.404   5.109   1.00 0.00 ? 50 ASP A C    8  
ATOM 9234  O O    . ASP A 1 50 ? -7.878  1.061   6.286   1.00 0.00 ? 50 ASP A O    8  
ATOM 9235  C CB   . ASP A 1 50 ? -9.707  3.048   5.878   1.00 0.00 ? 50 ASP A CB   8  
ATOM 9236  C CG   . ASP A 1 50 ? -10.907 2.129   6.013   1.00 0.00 ? 50 ASP A CG   8  
ATOM 9237  O OD1  . ASP A 1 50 ? -11.901 2.341   5.286   1.00 0.00 ? 50 ASP A OD1  8  
ATOM 9238  O OD2  . ASP A 1 50 ? -10.852 1.199   6.844   1.00 0.00 ? 50 ASP A OD2  8  
ATOM 9239  H H    . ASP A 1 50 ? -10.392 1.875   3.576   1.00 0.00 ? 50 ASP A H    8  
ATOM 9240  H HA   . ASP A 1 50 ? -8.103  3.452   4.521   1.00 0.00 ? 50 ASP A HA   8  
ATOM 9241  H HB2  . ASP A 1 50 ? -9.150  3.017   6.803   1.00 0.00 ? 50 ASP A HB2  8  
ATOM 9242  H HB3  . ASP A 1 50 ? -10.063 4.054   5.711   1.00 0.00 ? 50 ASP A HB3  8  
ATOM 9243  N N    . GLY A 1 51 ? -7.422  0.735   4.107   1.00 0.00 ? 51 GLY A N    8  
ATOM 9244  C CA   . GLY A 1 51 ? -6.636  -0.458  4.360   1.00 0.00 ? 51 GLY A CA   8  
ATOM 9245  C C    . GLY A 1 51 ? -7.495  -1.648  4.742   1.00 0.00 ? 51 GLY A C    8  
ATOM 9246  O O    . GLY A 1 51 ? -7.045  -2.544  5.455   1.00 0.00 ? 51 GLY A O    8  
ATOM 9247  H H    . GLY A 1 51 ? -7.541  1.055   3.188   1.00 0.00 ? 51 GLY A H    8  
ATOM 9248  H HA2  . GLY A 1 51 ? -6.075  -0.702  3.470   1.00 0.00 ? 51 GLY A HA2  8  
ATOM 9249  H HA3  . GLY A 1 51 ? -5.944  -0.256  5.165   1.00 0.00 ? 51 GLY A HA3  8  
ATOM 9250  N N    . ALA A 1 52 ? -8.736  -1.656  4.266   1.00 0.00 ? 52 ALA A N    8  
ATOM 9251  C CA   . ALA A 1 52 ? -9.660  -2.745  4.560   1.00 0.00 ? 52 ALA A CA   8  
ATOM 9252  C C    . ALA A 1 52 ? -10.321 -3.264  3.288   1.00 0.00 ? 52 ALA A C    8  
ATOM 9253  O O    . ALA A 1 52 ? -10.952 -2.506  2.551   1.00 0.00 ? 52 ALA A O    8  
ATOM 9254  C CB   . ALA A 1 52 ? -10.715 -2.284  5.556   1.00 0.00 ? 52 ALA A CB   8  
ATOM 9255  H H    . ALA A 1 52 ? -9.037  -0.913  3.702   1.00 0.00 ? 52 ALA A H    8  
ATOM 9256  H HA   . ALA A 1 52 ? -9.096  -3.546  5.014   1.00 0.00 ? 52 ALA A HA   8  
ATOM 9257  H HB1  . ALA A 1 52 ? -11.533 -2.989  5.565   1.00 0.00 ? 52 ALA A HB1  8  
ATOM 9258  H HB2  . ALA A 1 52 ? -11.082 -1.311  5.266   1.00 0.00 ? 52 ALA A HB2  8  
ATOM 9259  H HB3  . ALA A 1 52 ? -10.279 -2.226  6.542   1.00 0.00 ? 52 ALA A HB3  8  
ATOM 9260  N N    . VAL A 1 53 ? -10.171 -4.560  3.036   1.00 0.00 ? 53 VAL A N    8  
ATOM 9261  C CA   . VAL A 1 53 ? -10.753 -5.181  1.852   1.00 0.00 ? 53 VAL A CA   8  
ATOM 9262  C C    . VAL A 1 53 ? -11.821 -6.199  2.237   1.00 0.00 ? 53 VAL A C    8  
ATOM 9263  O O    . VAL A 1 53 ? -11.586 -7.078  3.066   1.00 0.00 ? 53 VAL A O    8  
ATOM 9264  C CB   . VAL A 1 53 ? -9.678  -5.879  0.997   1.00 0.00 ? 53 VAL A CB   8  
ATOM 9265  C CG1  . VAL A 1 53 ? -10.274 -6.379  -0.310  1.00 0.00 ? 53 VAL A CG1  8  
ATOM 9266  C CG2  . VAL A 1 53 ? -8.510  -4.940  0.732   1.00 0.00 ? 53 VAL A CG2  8  
ATOM 9267  H H    . VAL A 1 53 ? -9.656  -5.112  3.661   1.00 0.00 ? 53 VAL A H    8  
ATOM 9268  H HA   . VAL A 1 53 ? -11.208 -4.403  1.257   1.00 0.00 ? 53 VAL A HA   8  
ATOM 9269  H HB   . VAL A 1 53 ? -9.308  -6.732  1.547   1.00 0.00 ? 53 VAL A HB   8  
ATOM 9270  H HG11 . VAL A 1 53 ? -11.342 -6.499  -0.196  1.00 0.00 ? 53 VAL A HG11 8  
ATOM 9271  H HG12 . VAL A 1 53 ? -9.831  -7.330  -0.568  1.00 0.00 ? 53 VAL A HG12 8  
ATOM 9272  H HG13 . VAL A 1 53 ? -10.073 -5.664  -1.094  1.00 0.00 ? 53 VAL A HG13 8  
ATOM 9273  H HG21 . VAL A 1 53 ? -8.584  -4.545  -0.270  1.00 0.00 ? 53 VAL A HG21 8  
ATOM 9274  H HG22 . VAL A 1 53 ? -7.582  -5.482  0.837   1.00 0.00 ? 53 VAL A HG22 8  
ATOM 9275  H HG23 . VAL A 1 53 ? -8.533  -4.126  1.442   1.00 0.00 ? 53 VAL A HG23 8  
ATOM 9276  N N    . ALA A 1 54 ? -12.995 -6.076  1.627   1.00 0.00 ? 54 ALA A N    8  
ATOM 9277  C CA   . ALA A 1 54 ? -14.100 -6.986  1.905   1.00 0.00 ? 54 ALA A CA   8  
ATOM 9278  C C    . ALA A 1 54 ? -14.498 -6.932  3.376   1.00 0.00 ? 54 ALA A C    8  
ATOM 9279  O O    . ALA A 1 54 ? -14.698 -7.966  4.014   1.00 0.00 ? 54 ALA A O    8  
ATOM 9280  C CB   . ALA A 1 54 ? -13.726 -8.406  1.507   1.00 0.00 ? 54 ALA A CB   8  
ATOM 9281  H H    . ALA A 1 54 ? -13.122 -5.356  0.974   1.00 0.00 ? 54 ALA A H    8  
ATOM 9282  H HA   . ALA A 1 54 ? -14.944 -6.680  1.303   1.00 0.00 ? 54 ALA A HA   8  
ATOM 9283  H HB1  . ALA A 1 54 ? -12.934 -8.762  2.148   1.00 0.00 ? 54 ALA A HB1  8  
ATOM 9284  H HB2  . ALA A 1 54 ? -13.389 -8.415  0.480   1.00 0.00 ? 54 ALA A HB2  8  
ATOM 9285  H HB3  . ALA A 1 54 ? -14.589 -9.047  1.608   1.00 0.00 ? 54 ALA A HB3  8  
ATOM 9286  N N    . GLY A 1 55 ? -14.610 -5.720  3.909   1.00 0.00 ? 55 GLY A N    8  
ATOM 9287  C CA   . GLY A 1 55 ? -14.984 -5.554  5.301   1.00 0.00 ? 55 GLY A CA   8  
ATOM 9288  C C    . GLY A 1 55 ? -13.978 -6.175  6.251   1.00 0.00 ? 55 GLY A C    8  
ATOM 9289  O O    . GLY A 1 55 ? -14.330 -6.590  7.355   1.00 0.00 ? 55 GLY A O    8  
ATOM 9290  H H    . GLY A 1 55 ? -14.439 -4.932  3.352   1.00 0.00 ? 55 GLY A H    8  
ATOM 9291  H HA2  . GLY A 1 55 ? -15.064 -4.498  5.518   1.00 0.00 ? 55 GLY A HA2  8  
ATOM 9292  H HA3  . GLY A 1 55 ? -15.947 -6.017  5.462   1.00 0.00 ? 55 GLY A HA3  8  
ATOM 9293  N N    . THR A 1 56 ? -12.722 -6.237  5.820   1.00 0.00 ? 56 THR A N    8  
ATOM 9294  C CA   . THR A 1 56 ? -11.662 -6.811  6.639   1.00 0.00 ? 56 THR A CA   8  
ATOM 9295  C C    . THR A 1 56 ? -10.458 -5.876  6.705   1.00 0.00 ? 56 THR A C    8  
ATOM 9296  O O    . THR A 1 56 ? -9.645  -5.827  5.782   1.00 0.00 ? 56 THR A O    8  
ATOM 9297  C CB   . THR A 1 56 ? -11.236 -8.170  6.080   1.00 0.00 ? 56 THR A CB   8  
ATOM 9298  O OG1  . THR A 1 56 ? -12.367 -8.932  5.699   1.00 0.00 ? 56 THR A OG1  8  
ATOM 9299  C CG2  . THR A 1 56 ? -10.435 -8.996  7.063   1.00 0.00 ? 56 THR A CG2  8  
ATOM 9300  H H    . THR A 1 56 ? -12.503 -5.889  4.930   1.00 0.00 ? 56 THR A H    8  
ATOM 9301  H HA   . THR A 1 56 ? -12.051 -6.949  7.637   1.00 0.00 ? 56 THR A HA   8  
ATOM 9302  H HB   . THR A 1 56 ? -10.622 -8.011  5.205   1.00 0.00 ? 56 THR A HB   8  
ATOM 9303  H HG1  . THR A 1 56 ? -12.905 -9.117  6.473   1.00 0.00 ? 56 THR A HG1  8  
ATOM 9304  H HG21 . THR A 1 56 ? -9.465  -8.544  7.207   1.00 0.00 ? 56 THR A HG21 8  
ATOM 9305  H HG22 . THR A 1 56 ? -10.311 -9.997  6.675   1.00 0.00 ? 56 THR A HG22 8  
ATOM 9306  H HG23 . THR A 1 56 ? -10.957 -9.039  8.008   1.00 0.00 ? 56 THR A HG23 8  
ATOM 9307  N N    . ARG A 1 57 ? -10.351 -5.134  7.803   1.00 0.00 ? 57 ARG A N    8  
ATOM 9308  C CA   . ARG A 1 57 ? -9.247  -4.200  7.989   1.00 0.00 ? 57 ARG A CA   8  
ATOM 9309  C C    . ARG A 1 57 ? -7.999  -4.924  8.484   1.00 0.00 ? 57 ARG A C    8  
ATOM 9310  O O    . ARG A 1 57 ? -7.981  -5.466  9.589   1.00 0.00 ? 57 ARG A O    8  
ATOM 9311  C CB   . ARG A 1 57 ? -9.642  -3.102  8.980   1.00 0.00 ? 57 ARG A CB   8  
ATOM 9312  C CG   . ARG A 1 57 ? -8.601  -2.002  9.113   1.00 0.00 ? 57 ARG A CG   8  
ATOM 9313  C CD   . ARG A 1 57 ? -9.165  -0.647  8.715   1.00 0.00 ? 57 ARG A CD   8  
ATOM 9314  N NE   . ARG A 1 57 ? -10.453 -0.381  9.353   1.00 0.00 ? 57 ARG A NE   8  
ATOM 9315  C CZ   . ARG A 1 57 ? -10.596 -0.102  10.647  1.00 0.00 ? 57 ARG A CZ   8  
ATOM 9316  N NH1  . ARG A 1 57 ? -9.536  -0.049  11.443  1.00 0.00 ? 57 ARG A NH1  8  
ATOM 9317  N NH2  . ARG A 1 57 ? -11.803 0.127   11.145  1.00 0.00 ? 57 ARG A NH2  8  
ATOM 9318  H H    . ARG A 1 57 ? -11.031 -5.217  8.504   1.00 0.00 ? 57 ARG A H    8  
ATOM 9319  H HA   . ARG A 1 57 ? -9.030  -3.748  7.033   1.00 0.00 ? 57 ARG A HA   8  
ATOM 9320  H HB2  . ARG A 1 57 ? -10.570 -2.657  8.654   1.00 0.00 ? 57 ARG A HB2  8  
ATOM 9321  H HB3  . ARG A 1 57 ? -9.789  -3.549  9.952   1.00 0.00 ? 57 ARG A HB3  8  
ATOM 9322  H HG2  . ARG A 1 57 ? -8.270  -1.954  10.140  1.00 0.00 ? 57 ARG A HG2  8  
ATOM 9323  H HG3  . ARG A 1 57 ? -7.762  -2.234  8.474   1.00 0.00 ? 57 ARG A HG3  8  
ATOM 9324  H HD2  . ARG A 1 57 ? -8.465  0.121   9.010   1.00 0.00 ? 57 ARG A HD2  8  
ATOM 9325  H HD3  . ARG A 1 57 ? -9.293  -0.625  7.644   1.00 0.00 ? 57 ARG A HD3  8  
ATOM 9326  H HE   . ARG A 1 57 ? -11.253 -0.414  8.787   1.00 0.00 ? 57 ARG A HE   8  
ATOM 9327  H HH11 . ARG A 1 57 ? -8.623  -0.220  11.073  1.00 0.00 ? 57 ARG A HH11 8  
ATOM 9328  H HH12 . ARG A 1 57 ? -9.650  0.161   12.414  1.00 0.00 ? 57 ARG A HH12 8  
ATOM 9329  H HH21 . ARG A 1 57 ? -12.606 0.088   10.550  1.00 0.00 ? 57 ARG A HH21 8  
ATOM 9330  H HH22 . ARG A 1 57 ? -11.912 0.336   12.117  1.00 0.00 ? 57 ARG A HH22 8  
ATOM 9331  N N    . TYR A 1 58 ? -6.957  -4.927  7.659   1.00 0.00 ? 58 TYR A N    8  
ATOM 9332  C CA   . TYR A 1 58 ? -5.704  -5.584  8.014   1.00 0.00 ? 58 TYR A CA   8  
ATOM 9333  C C    . TYR A 1 58 ? -4.851  -4.685  8.902   1.00 0.00 ? 58 TYR A C    8  
ATOM 9334  O O    . TYR A 1 58 ? -4.238  -5.148  9.865   1.00 0.00 ? 58 TYR A O    8  
ATOM 9335  C CB   . TYR A 1 58 ? -4.926  -5.959  6.751   1.00 0.00 ? 58 TYR A CB   8  
ATOM 9336  C CG   . TYR A 1 58 ? -5.766  -6.661  5.708   1.00 0.00 ? 58 TYR A CG   8  
ATOM 9337  C CD1  . TYR A 1 58 ? -6.541  -5.938  4.810   1.00 0.00 ? 58 TYR A CD1  8  
ATOM 9338  C CD2  . TYR A 1 58 ? -5.784  -8.048  5.622   1.00 0.00 ? 58 TYR A CD2  8  
ATOM 9339  C CE1  . TYR A 1 58 ? -7.310  -6.576  3.856   1.00 0.00 ? 58 TYR A CE1  8  
ATOM 9340  C CE2  . TYR A 1 58 ? -6.550  -8.693  4.669   1.00 0.00 ? 58 TYR A CE2  8  
ATOM 9341  C CZ   . TYR A 1 58 ? -7.311  -7.954  3.790   1.00 0.00 ? 58 TYR A CZ   8  
ATOM 9342  O OH   . TYR A 1 58 ? -8.075  -8.593  2.841   1.00 0.00 ? 58 TYR A OH   8  
ATOM 9343  H H    . TYR A 1 58 ? -7.032  -4.478  6.792   1.00 0.00 ? 58 TYR A H    8  
ATOM 9344  H HA   . TYR A 1 58 ? -5.944  -6.485  8.558   1.00 0.00 ? 58 TYR A HA   8  
ATOM 9345  H HB2  . TYR A 1 58 ? -4.525  -5.062  6.304   1.00 0.00 ? 58 TYR A HB2  8  
ATOM 9346  H HB3  . TYR A 1 58 ? -4.112  -6.616  7.020   1.00 0.00 ? 58 TYR A HB3  8  
ATOM 9347  H HD1  . TYR A 1 58 ? -6.537  -4.859  4.864   1.00 0.00 ? 58 TYR A HD1  8  
ATOM 9348  H HD2  . TYR A 1 58 ? -5.187  -8.625  6.313   1.00 0.00 ? 58 TYR A HD2  8  
ATOM 9349  H HE1  . TYR A 1 58 ? -7.905  -5.996  3.167   1.00 0.00 ? 58 TYR A HE1  8  
ATOM 9350  H HE2  . TYR A 1 58 ? -6.551  -9.772  4.619   1.00 0.00 ? 58 TYR A HE2  8  
ATOM 9351  H HH   . TYR A 1 58 ? -8.538  -9.330  3.246   1.00 0.00 ? 58 TYR A HH   8  
ATOM 9352  N N    . PHE A 1 59 ? -4.815  -3.398  8.574   1.00 0.00 ? 59 PHE A N    8  
ATOM 9353  C CA   . PHE A 1 59 ? -4.037  -2.433  9.342   1.00 0.00 ? 59 PHE A CA   8  
ATOM 9354  C C    . PHE A 1 59 ? -4.841  -1.161  9.589   1.00 0.00 ? 59 PHE A C    8  
ATOM 9355  O O    . PHE A 1 59 ? -5.519  -0.659  8.693   1.00 0.00 ? 59 PHE A O    8  
ATOM 9356  C CB   . PHE A 1 59 ? -2.737  -2.096  8.610   1.00 0.00 ? 59 PHE A CB   8  
ATOM 9357  C CG   . PHE A 1 59 ? -2.953  -1.457  7.267   1.00 0.00 ? 59 PHE A CG   8  
ATOM 9358  C CD1  . PHE A 1 59 ? -3.211  -2.233  6.149   1.00 0.00 ? 59 PHE A CD1  8  
ATOM 9359  C CD2  . PHE A 1 59 ? -2.898  -0.079  7.124   1.00 0.00 ? 59 PHE A CD2  8  
ATOM 9360  C CE1  . PHE A 1 59 ? -3.411  -1.648  4.913   1.00 0.00 ? 59 PHE A CE1  8  
ATOM 9361  C CE2  . PHE A 1 59 ? -3.096  0.511   5.891   1.00 0.00 ? 59 PHE A CE2  8  
ATOM 9362  C CZ   . PHE A 1 59 ? -3.353  -0.274  4.784   1.00 0.00 ? 59 PHE A CZ   8  
ATOM 9363  H H    . PHE A 1 59 ? -5.325  -3.090  7.795   1.00 0.00 ? 59 PHE A H    8  
ATOM 9364  H HA   . PHE A 1 59 ? -3.797  -2.884  10.293  1.00 0.00 ? 59 PHE A HA   8  
ATOM 9365  H HB2  . PHE A 1 59 ? -2.158  -1.412  9.213   1.00 0.00 ? 59 PHE A HB2  8  
ATOM 9366  H HB3  . PHE A 1 59 ? -2.170  -3.004  8.460   1.00 0.00 ? 59 PHE A HB3  8  
ATOM 9367  H HD1  . PHE A 1 59 ? -3.257  -3.308  6.249   1.00 0.00 ? 59 PHE A HD1  8  
ATOM 9368  H HD2  . PHE A 1 59 ? -2.697  0.535   7.989   1.00 0.00 ? 59 PHE A HD2  8  
ATOM 9369  H HE1  . PHE A 1 59 ? -3.612  -2.264  4.049   1.00 0.00 ? 59 PHE A HE1  8  
ATOM 9370  H HE2  . PHE A 1 59 ? -3.052  1.585   5.793   1.00 0.00 ? 59 PHE A HE2  8  
ATOM 9371  H HZ   . PHE A 1 59 ? -3.509  0.186   3.819   1.00 0.00 ? 59 PHE A HZ   8  
ATOM 9372  N N    . GLN A 1 60 ? -4.759  -0.643  10.811  1.00 0.00 ? 60 GLN A N    8  
ATOM 9373  C CA   . GLN A 1 60 ? -5.479  0.571   11.176  1.00 0.00 ? 60 GLN A CA   8  
ATOM 9374  C C    . GLN A 1 60 ? -5.040  1.746   10.307  1.00 0.00 ? 60 GLN A C    8  
ATOM 9375  O O    . GLN A 1 60 ? -3.848  1.950   10.077  1.00 0.00 ? 60 GLN A O    8  
ATOM 9376  C CB   . GLN A 1 60 ? -5.251  0.901   12.652  1.00 0.00 ? 60 GLN A CB   8  
ATOM 9377  C CG   . GLN A 1 60 ? -6.043  2.103   13.137  1.00 0.00 ? 60 GLN A CG   8  
ATOM 9378  C CD   . GLN A 1 60 ? -7.540  1.913   12.989  1.00 0.00 ? 60 GLN A CD   8  
ATOM 9379  O OE1  . GLN A 1 60 ? -8.130  1.029   13.610  1.00 0.00 ? 60 GLN A OE1  8  
ATOM 9380  N NE2  . GLN A 1 60 ? -8.162  2.745   12.162  1.00 0.00 ? 60 GLN A NE2  8  
ATOM 9381  H H    . GLN A 1 60 ? -4.201  -1.089  11.482  1.00 0.00 ? 60 GLN A H    8  
ATOM 9382  H HA   . GLN A 1 60 ? -6.531  0.393   11.015  1.00 0.00 ? 60 GLN A HA   8  
ATOM 9383  H HB2  . GLN A 1 60 ? -5.534  0.044   13.248  1.00 0.00 ? 60 GLN A HB2  8  
ATOM 9384  H HB3  . GLN A 1 60 ? -4.200  1.102   12.807  1.00 0.00 ? 60 GLN A HB3  8  
ATOM 9385  H HG2  . GLN A 1 60 ? -5.819  2.268   14.181  1.00 0.00 ? 60 GLN A HG2  8  
ATOM 9386  H HG3  . GLN A 1 60 ? -5.746  2.969   12.564  1.00 0.00 ? 60 GLN A HG3  8  
ATOM 9387  H HE21 . GLN A 1 60 ? -7.628  3.425   11.700  1.00 0.00 ? 60 GLN A HE21 8  
ATOM 9388  H HE22 . GLN A 1 60 ? -9.130  2.645   12.046  1.00 0.00 ? 60 GLN A HE22 8  
ATOM 9389  N N    . CYS A 1 61 ? -6.013  2.517   9.829   1.00 0.00 ? 61 CYS A N    8  
ATOM 9390  C CA   . CYS A 1 61 ? -5.727  3.673   8.986   1.00 0.00 ? 61 CYS A CA   8  
ATOM 9391  C C    . CYS A 1 61 ? -7.007  4.444   8.671   1.00 0.00 ? 61 CYS A C    8  
ATOM 9392  O O    . CYS A 1 61 ? -8.088  3.862   8.588   1.00 0.00 ? 61 CYS A O    8  
ATOM 9393  C CB   . CYS A 1 61 ? -5.049  3.229   7.688   1.00 0.00 ? 61 CYS A CB   8  
ATOM 9394  S SG   . CYS A 1 61 ? -3.261  3.497   7.661   1.00 0.00 ? 61 CYS A SG   8  
ATOM 9395  H H    . CYS A 1 61 ? -6.944  2.303   10.047  1.00 0.00 ? 61 CYS A H    8  
ATOM 9396  H HA   . CYS A 1 61 ? -5.055  4.320   9.530   1.00 0.00 ? 61 CYS A HA   8  
ATOM 9397  H HB2  . CYS A 1 61 ? -5.224  2.174   7.542   1.00 0.00 ? 61 CYS A HB2  8  
ATOM 9398  H HB3  . CYS A 1 61 ? -5.477  3.777   6.860   1.00 0.00 ? 61 CYS A HB3  8  
ATOM 9399  H HG   . CYS A 1 61 ? -3.102  4.440   7.743   1.00 0.00 ? 61 CYS A HG   8  
ATOM 9400  N N    . PRO A 1 62 ? -6.900  5.773   8.491   1.00 0.00 ? 62 PRO A N    8  
ATOM 9401  C CA   . PRO A 1 62 ? -8.054  6.623   8.184   1.00 0.00 ? 62 PRO A CA   8  
ATOM 9402  C C    . PRO A 1 62 ? -8.540  6.446   6.748   1.00 0.00 ? 62 PRO A C    8  
ATOM 9403  O O    . PRO A 1 62 ? -7.836  5.884   5.910   1.00 0.00 ? 62 PRO A O    8  
ATOM 9404  C CB   . PRO A 1 62 ? -7.513  8.036   8.395   1.00 0.00 ? 62 PRO A CB   8  
ATOM 9405  C CG   . PRO A 1 62 ? -6.054  7.925   8.120   1.00 0.00 ? 62 PRO A CG   8  
ATOM 9406  C CD   . PRO A 1 62 ? -5.647  6.548   8.573   1.00 0.00 ? 62 PRO A CD   8  
ATOM 9407  H HA   . PRO A 1 62 ? -8.872  6.441   8.865   1.00 0.00 ? 62 PRO A HA   8  
ATOM 9408  H HB2  . PRO A 1 62 ? -7.996  8.716   7.708   1.00 0.00 ? 62 PRO A HB2  8  
ATOM 9409  H HB3  . PRO A 1 62 ? -7.699  8.349   9.412   1.00 0.00 ? 62 PRO A HB3  8  
ATOM 9410  H HG2  . PRO A 1 62 ? -5.871  8.040   7.061   1.00 0.00 ? 62 PRO A HG2  8  
ATOM 9411  H HG3  . PRO A 1 62 ? -5.517  8.677   8.677   1.00 0.00 ? 62 PRO A HG3  8  
ATOM 9412  H HD2  . PRO A 1 62 ? -4.897  6.140   7.912   1.00 0.00 ? 62 PRO A HD2  8  
ATOM 9413  H HD3  . PRO A 1 62 ? -5.280  6.579   9.588   1.00 0.00 ? 62 PRO A HD3  8  
ATOM 9414  N N    . PRO A 1 63 ? -9.759  6.926   6.445   1.00 0.00 ? 63 PRO A N    8  
ATOM 9415  C CA   . PRO A 1 63 ? -10.340 6.818   5.101   1.00 0.00 ? 63 PRO A CA   8  
ATOM 9416  C C    . PRO A 1 63 ? -9.497  7.531   4.049   1.00 0.00 ? 63 PRO A C    8  
ATOM 9417  O O    . PRO A 1 63 ? -8.917  8.584   4.313   1.00 0.00 ? 63 PRO A O    8  
ATOM 9418  C CB   . PRO A 1 63 ? -11.709 7.497   5.238   1.00 0.00 ? 63 PRO A CB   8  
ATOM 9419  C CG   . PRO A 1 63 ? -11.999 7.498   6.700   1.00 0.00 ? 63 PRO A CG   8  
ATOM 9420  C CD   . PRO A 1 63 ? -10.666 7.606   7.383   1.00 0.00 ? 63 PRO A CD   8  
ATOM 9421  H HA   . PRO A 1 63 ? -10.475 5.786   4.812   1.00 0.00 ? 63 PRO A HA   8  
ATOM 9422  H HB2  . PRO A 1 63 ? -11.654 8.503   4.846   1.00 0.00 ? 63 PRO A HB2  8  
ATOM 9423  H HB3  . PRO A 1 63 ? -12.449 6.932   4.691   1.00 0.00 ? 63 PRO A HB3  8  
ATOM 9424  H HG2  . PRO A 1 63 ? -12.619 8.346   6.952   1.00 0.00 ? 63 PRO A HG2  8  
ATOM 9425  H HG3  . PRO A 1 63 ? -12.488 6.577   6.978   1.00 0.00 ? 63 PRO A HG3  8  
ATOM 9426  H HD2  . PRO A 1 63 ? -10.388 8.642   7.510   1.00 0.00 ? 63 PRO A HD2  8  
ATOM 9427  H HD3  . PRO A 1 63 ? -10.687 7.098   8.336   1.00 0.00 ? 63 PRO A HD3  8  
ATOM 9428  N N    . LYS A 1 64 ? -9.439  6.952   2.853   1.00 0.00 ? 64 LYS A N    8  
ATOM 9429  C CA   . LYS A 1 64 ? -8.671  7.534   1.759   1.00 0.00 ? 64 LYS A CA   8  
ATOM 9430  C C    . LYS A 1 64 ? -7.193  7.644   2.125   1.00 0.00 ? 64 LYS A C    8  
ATOM 9431  O O    . LYS A 1 64 ? -6.503  8.567   1.693   1.00 0.00 ? 64 LYS A O    8  
ATOM 9432  C CB   . LYS A 1 64 ? -9.227  8.913   1.395   1.00 0.00 ? 64 LYS A CB   8  
ATOM 9433  C CG   . LYS A 1 64 ? -10.139 8.898   0.179   1.00 0.00 ? 64 LYS A CG   8  
ATOM 9434  C CD   . LYS A 1 64 ? -11.509 8.329   0.516   1.00 0.00 ? 64 LYS A CD   8  
ATOM 9435  C CE   . LYS A 1 64 ? -11.582 6.841   0.221   1.00 0.00 ? 64 LYS A CE   8  
ATOM 9436  N NZ   . LYS A 1 64 ? -12.354 6.105   1.261   1.00 0.00 ? 64 LYS A NZ   8  
ATOM 9437  H H    . LYS A 1 64 ? -9.926  6.116   2.704   1.00 0.00 ? 64 LYS A H    8  
ATOM 9438  H HA   . LYS A 1 64 ? -8.767  6.880   0.904   1.00 0.00 ? 64 LYS A HA   8  
ATOM 9439  H HB2  . LYS A 1 64 ? -9.790  9.294   2.235   1.00 0.00 ? 64 LYS A HB2  8  
ATOM 9440  H HB3  . LYS A 1 64 ? -8.404  9.582   1.191   1.00 0.00 ? 64 LYS A HB3  8  
ATOM 9441  H HG2  . LYS A 1 64 ? -10.260 9.908   -0.181  1.00 0.00 ? 64 LYS A HG2  8  
ATOM 9442  H HG3  . LYS A 1 64 ? -9.687  8.290   -0.591  1.00 0.00 ? 64 LYS A HG3  8  
ATOM 9443  H HD2  . LYS A 1 64 ? -11.705 8.488   1.566   1.00 0.00 ? 64 LYS A HD2  8  
ATOM 9444  H HD3  . LYS A 1 64 ? -12.255 8.842   -0.073  1.00 0.00 ? 64 LYS A HD3  8  
ATOM 9445  H HE2  . LYS A 1 64 ? -12.062 6.699   -0.736  1.00 0.00 ? 64 LYS A HE2  8  
ATOM 9446  H HE3  . LYS A 1 64 ? -10.578 6.444   0.181   1.00 0.00 ? 64 LYS A HE3  8  
ATOM 9447  H HZ1  . LYS A 1 64 ? -12.168 6.513   2.199   1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 9448  H HZ2  . LYS A 1 64 ? -12.075 5.103   1.270   1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 9449  H HZ3  . LYS A 1 64 ? -13.372 6.167   1.061   1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 9450  N N    . PHE A 1 65 ? -6.713  6.696   2.923   1.00 0.00 ? 65 PHE A N    8  
ATOM 9451  C CA   . PHE A 1 65 ? -5.317  6.688   3.345   1.00 0.00 ? 65 PHE A CA   8  
ATOM 9452  C C    . PHE A 1 65 ? -4.762  5.267   3.361   1.00 0.00 ? 65 PHE A C    8  
ATOM 9453  O O    . PHE A 1 65 ? -3.980  4.904   4.241   1.00 0.00 ? 65 PHE A O    8  
ATOM 9454  C CB   . PHE A 1 65 ? -5.175  7.320   4.731   1.00 0.00 ? 65 PHE A CB   8  
ATOM 9455  C CG   . PHE A 1 65 ? -5.100  8.820   4.701   1.00 0.00 ? 65 PHE A CG   8  
ATOM 9456  C CD1  . PHE A 1 65 ? -3.955  9.460   4.251   1.00 0.00 ? 65 PHE A CD1  8  
ATOM 9457  C CD2  . PHE A 1 65 ? -6.172  9.590   5.122   1.00 0.00 ? 65 PHE A CD2  8  
ATOM 9458  C CE1  . PHE A 1 65 ? -3.883  10.840  4.222   1.00 0.00 ? 65 PHE A CE1  8  
ATOM 9459  C CE2  . PHE A 1 65 ? -6.106  10.969  5.095   1.00 0.00 ? 65 PHE A CE2  8  
ATOM 9460  C CZ   . PHE A 1 65 ? -4.960  11.595  4.645   1.00 0.00 ? 65 PHE A CZ   8  
ATOM 9461  H H    . PHE A 1 65 ? -7.311  5.985   3.235   1.00 0.00 ? 65 PHE A H    8  
ATOM 9462  H HA   . PHE A 1 65 ? -4.753  7.273   2.634   1.00 0.00 ? 65 PHE A HA   8  
ATOM 9463  H HB2  . PHE A 1 65 ? -6.026  7.043   5.334   1.00 0.00 ? 65 PHE A HB2  8  
ATOM 9464  H HB3  . PHE A 1 65 ? -4.273  6.951   5.197   1.00 0.00 ? 65 PHE A HB3  8  
ATOM 9465  H HD1  . PHE A 1 65 ? -3.114  8.870   3.921   1.00 0.00 ? 65 PHE A HD1  8  
ATOM 9466  H HD2  . PHE A 1 65 ? -7.069  9.101   5.474   1.00 0.00 ? 65 PHE A HD2  8  
ATOM 9467  H HE1  . PHE A 1 65 ? -2.986  11.327  3.871   1.00 0.00 ? 65 PHE A HE1  8  
ATOM 9468  H HE2  . PHE A 1 65 ? -6.949  11.558  5.426   1.00 0.00 ? 65 PHE A HE2  8  
ATOM 9469  H HZ   . PHE A 1 65 ? -4.906  12.675  4.623   1.00 0.00 ? 65 PHE A HZ   8  
ATOM 9470  N N    . GLY A 1 66 ? -5.171  4.467   2.382   1.00 0.00 ? 66 GLY A N    8  
ATOM 9471  C CA   . GLY A 1 66 ? -4.706  3.096   2.300   1.00 0.00 ? 66 GLY A CA   8  
ATOM 9472  C C    . GLY A 1 66 ? -4.949  2.482   0.936   1.00 0.00 ? 66 GLY A C    8  
ATOM 9473  O O    . GLY A 1 66 ? -6.091  2.212   0.564   1.00 0.00 ? 66 GLY A O    8  
ATOM 9474  H H    . GLY A 1 66 ? -5.794  4.812   1.708   1.00 0.00 ? 66 GLY A H    8  
ATOM 9475  H HA2  . GLY A 1 66 ? -3.646  3.073   2.509   1.00 0.00 ? 66 GLY A HA2  8  
ATOM 9476  H HA3  . GLY A 1 66 ? -5.221  2.506   3.044   1.00 0.00 ? 66 GLY A HA3  8  
ATOM 9477  N N    . LEU A 1 67 ? -3.874  2.262   0.186   1.00 0.00 ? 67 LEU A N    8  
ATOM 9478  C CA   . LEU A 1 67 ? -3.976  1.678   -1.146  1.00 0.00 ? 67 LEU A CA   8  
ATOM 9479  C C    . LEU A 1 67 ? -3.180  0.380   -1.235  1.00 0.00 ? 67 LEU A C    8  
ATOM 9480  O O    . LEU A 1 67 ? -2.002  0.336   -0.881  1.00 0.00 ? 67 LEU A O    8  
ATOM 9481  C CB   . LEU A 1 67 ? -3.476  2.668   -2.200  1.00 0.00 ? 67 LEU A CB   8  
ATOM 9482  C CG   . LEU A 1 67 ? -3.646  2.212   -3.650  1.00 0.00 ? 67 LEU A CG   8  
ATOM 9483  C CD1  . LEU A 1 67 ? -5.108  2.283   -4.063  1.00 0.00 ? 67 LEU A CD1  8  
ATOM 9484  C CD2  . LEU A 1 67 ? -2.785  3.058   -4.577  1.00 0.00 ? 67 LEU A CD2  8  
ATOM 9485  H H    . LEU A 1 67 ? -2.990  2.500   0.537   1.00 0.00 ? 67 LEU A H    8  
ATOM 9486  H HA   . LEU A 1 67 ? -5.016  1.462   -1.334  1.00 0.00 ? 67 LEU A HA   8  
ATOM 9487  H HB2  . LEU A 1 67 ? -4.011  3.598   -2.070  1.00 0.00 ? 67 LEU A HB2  8  
ATOM 9488  H HB3  . LEU A 1 67 ? -2.426  2.849   -2.024  1.00 0.00 ? 67 LEU A HB3  8  
ATOM 9489  H HG   . LEU A 1 67 ? -3.324  1.185   -3.737  1.00 0.00 ? 67 LEU A HG   8  
ATOM 9490  H HD11 . LEU A 1 67 ? -5.659  1.494   -3.575  1.00 0.00 ? 67 LEU A HD11 8  
ATOM 9491  H HD12 . LEU A 1 67 ? -5.185  2.165   -5.134  1.00 0.00 ? 67 LEU A HD12 8  
ATOM 9492  H HD13 . LEU A 1 67 ? -5.517  3.240   -3.777  1.00 0.00 ? 67 LEU A HD13 8  
ATOM 9493  H HD21 . LEU A 1 67 ? -1.913  3.404   -4.043  1.00 0.00 ? 67 LEU A HD21 8  
ATOM 9494  H HD22 . LEU A 1 67 ? -3.356  3.908   -4.923  1.00 0.00 ? 67 LEU A HD22 8  
ATOM 9495  H HD23 . LEU A 1 67 ? -2.477  2.463   -5.424  1.00 0.00 ? 67 LEU A HD23 8  
ATOM 9496  N N    . PHE A 1 68 ? -3.832  -0.676  -1.711  1.00 0.00 ? 68 PHE A N    8  
ATOM 9497  C CA   . PHE A 1 68 ? -3.186  -1.976  -1.848  1.00 0.00 ? 68 PHE A CA   8  
ATOM 9498  C C    . PHE A 1 68 ? -2.644  -2.168  -3.261  1.00 0.00 ? 68 PHE A C    8  
ATOM 9499  O O    . PHE A 1 68 ? -3.358  -1.959  -4.242  1.00 0.00 ? 68 PHE A O    8  
ATOM 9500  C CB   . PHE A 1 68 ? -4.170  -3.097  -1.511  1.00 0.00 ? 68 PHE A CB   8  
ATOM 9501  C CG   . PHE A 1 68 ? -4.622  -3.091  -0.078  1.00 0.00 ? 68 PHE A CG   8  
ATOM 9502  C CD1  . PHE A 1 68 ? -3.916  -3.792  0.887   1.00 0.00 ? 68 PHE A CD1  8  
ATOM 9503  C CD2  . PHE A 1 68 ? -5.750  -2.383  0.303   1.00 0.00 ? 68 PHE A CD2  8  
ATOM 9504  C CE1  . PHE A 1 68 ? -4.330  -3.789  2.206   1.00 0.00 ? 68 PHE A CE1  8  
ATOM 9505  C CE2  . PHE A 1 68 ? -6.169  -2.376  1.620   1.00 0.00 ? 68 PHE A CE2  8  
ATOM 9506  C CZ   . PHE A 1 68 ? -5.457  -3.079  2.573   1.00 0.00 ? 68 PHE A CZ   8  
ATOM 9507  H H    . PHE A 1 68 ? -4.770  -0.579  -1.977  1.00 0.00 ? 68 PHE A H    8  
ATOM 9508  H HA   . PHE A 1 68 ? -2.361  -2.012  -1.151  1.00 0.00 ? 68 PHE A HA   8  
ATOM 9509  H HB2  . PHE A 1 68 ? -5.045  -2.998  -2.134  1.00 0.00 ? 68 PHE A HB2  8  
ATOM 9510  H HB3  . PHE A 1 68 ? -3.700  -4.050  -1.708  1.00 0.00 ? 68 PHE A HB3  8  
ATOM 9511  H HD1  . PHE A 1 68 ? -3.035  -4.347  0.602   1.00 0.00 ? 68 PHE A HD1  8  
ATOM 9512  H HD2  . PHE A 1 68 ? -6.308  -1.834  -0.441  1.00 0.00 ? 68 PHE A HD2  8  
ATOM 9513  H HE1  . PHE A 1 68 ? -3.772  -4.339  2.949   1.00 0.00 ? 68 PHE A HE1  8  
ATOM 9514  H HE2  . PHE A 1 68 ? -7.050  -1.821  1.904   1.00 0.00 ? 68 PHE A HE2  8  
ATOM 9515  H HZ   . PHE A 1 68 ? -5.782  -3.076  3.603   1.00 0.00 ? 68 PHE A HZ   8  
ATOM 9516  N N    . ALA A 1 69 ? -1.380  -2.566  -3.356  1.00 0.00 ? 69 ALA A N    8  
ATOM 9517  C CA   . ALA A 1 69 ? -0.745  -2.786  -4.650  1.00 0.00 ? 69 ALA A CA   8  
ATOM 9518  C C    . ALA A 1 69 ? 0.284   -3.910  -4.573  1.00 0.00 ? 69 ALA A C    8  
ATOM 9519  O O    . ALA A 1 69 ? 0.939   -4.094  -3.546  1.00 0.00 ? 69 ALA A O    8  
ATOM 9520  C CB   . ALA A 1 69 ? -0.092  -1.503  -5.141  1.00 0.00 ? 69 ALA A CB   8  
ATOM 9521  H H    . ALA A 1 69 ? -0.863  -2.715  -2.538  1.00 0.00 ? 69 ALA A H    8  
ATOM 9522  H HA   . ALA A 1 69 ? -1.516  -3.062  -5.355  1.00 0.00 ? 69 ALA A HA   8  
ATOM 9523  H HB1  . ALA A 1 69 ? 0.966   -1.531  -4.924  1.00 0.00 ? 69 ALA A HB1  8  
ATOM 9524  H HB2  . ALA A 1 69 ? -0.540  -0.656  -4.641  1.00 0.00 ? 69 ALA A HB2  8  
ATOM 9525  H HB3  . ALA A 1 69 ? -0.238  -1.409  -6.206  1.00 0.00 ? 69 ALA A HB3  8  
ATOM 9526  N N    . PRO A 1 70 ? 0.443   -4.682  -5.663  1.00 0.00 ? 70 PRO A N    8  
ATOM 9527  C CA   . PRO A 1 70 ? 1.402   -5.792  -5.711  1.00 0.00 ? 70 PRO A CA   8  
ATOM 9528  C C    . PRO A 1 70 ? 2.813   -5.352  -5.339  1.00 0.00 ? 70 PRO A C    8  
ATOM 9529  O O    . PRO A 1 70 ? 3.225   -4.233  -5.646  1.00 0.00 ? 70 PRO A O    8  
ATOM 9530  C CB   . PRO A 1 70 ? 1.351   -6.248  -7.171  1.00 0.00 ? 70 PRO A CB   8  
ATOM 9531  C CG   . PRO A 1 70 ? 0.017   -5.808  -7.663  1.00 0.00 ? 70 PRO A CG   8  
ATOM 9532  C CD   . PRO A 1 70 ? -0.294  -4.534  -6.932  1.00 0.00 ? 70 PRO A CD   8  
ATOM 9533  H HA   . PRO A 1 70 ? 1.098   -6.603  -5.066  1.00 0.00 ? 70 PRO A HA   8  
ATOM 9534  H HB2  . PRO A 1 70 ? 2.152   -5.778  -7.724  1.00 0.00 ? 70 PRO A HB2  8  
ATOM 9535  H HB3  . PRO A 1 70 ? 1.455   -7.321  -7.219  1.00 0.00 ? 70 PRO A HB3  8  
ATOM 9536  H HG2  . PRO A 1 70 ? 0.059   -5.629  -8.728  1.00 0.00 ? 70 PRO A HG2  8  
ATOM 9537  H HG3  . PRO A 1 70 ? -0.724  -6.561  -7.438  1.00 0.00 ? 70 PRO A HG3  8  
ATOM 9538  H HD2  . PRO A 1 70 ? 0.064   -3.681  -7.489  1.00 0.00 ? 70 PRO A HD2  8  
ATOM 9539  H HD3  . PRO A 1 70 ? -1.355  -4.451  -6.753  1.00 0.00 ? 70 PRO A HD3  8  
ATOM 9540  N N    . ILE A 1 71 ? 3.549   -6.237  -4.675  1.00 0.00 ? 71 ILE A N    8  
ATOM 9541  C CA   . ILE A 1 71 ? 4.915   -5.937  -4.261  1.00 0.00 ? 71 ILE A CA   8  
ATOM 9542  C C    . ILE A 1 71 ? 5.797   -5.617  -5.465  1.00 0.00 ? 71 ILE A C    8  
ATOM 9543  O O    . ILE A 1 71 ? 6.549   -4.642  -5.453  1.00 0.00 ? 71 ILE A O    8  
ATOM 9544  C CB   . ILE A 1 71 ? 5.534   -7.109  -3.472  1.00 0.00 ? 71 ILE A CB   8  
ATOM 9545  C CG1  . ILE A 1 71 ? 6.928   -6.735  -2.961  1.00 0.00 ? 71 ILE A CG1  8  
ATOM 9546  C CG2  . ILE A 1 71 ? 5.596   -8.362  -4.334  1.00 0.00 ? 71 ILE A CG2  8  
ATOM 9547  C CD1  . ILE A 1 71 ? 7.165   -7.118  -1.517  1.00 0.00 ? 71 ILE A CD1  8  
ATOM 9548  H H    . ILE A 1 71 ? 3.166   -7.112  -4.458  1.00 0.00 ? 71 ILE A H    8  
ATOM 9549  H HA   . ILE A 1 71 ? 4.882   -5.073  -3.613  1.00 0.00 ? 71 ILE A HA   8  
ATOM 9550  H HB   . ILE A 1 71 ? 4.896   -7.318  -2.626  1.00 0.00 ? 71 ILE A HB   8  
ATOM 9551  H HG12 . ILE A 1 71 ? 7.672   -7.237  -3.563  1.00 0.00 ? 71 ILE A HG12 8  
ATOM 9552  H HG13 . ILE A 1 71 ? 7.063   -5.667  -3.050  1.00 0.00 ? 71 ILE A HG13 8  
ATOM 9553  H HG21 . ILE A 1 71 ? 6.433   -8.291  -5.012  1.00 0.00 ? 71 ILE A HG21 8  
ATOM 9554  H HG22 . ILE A 1 71 ? 4.681   -8.454  -4.900  1.00 0.00 ? 71 ILE A HG22 8  
ATOM 9555  H HG23 . ILE A 1 71 ? 5.717   -9.228  -3.701  1.00 0.00 ? 71 ILE A HG23 8  
ATOM 9556  H HD11 . ILE A 1 71 ? 7.039   -6.247  -0.889  1.00 0.00 ? 71 ILE A HD11 8  
ATOM 9557  H HD12 . ILE A 1 71 ? 8.170   -7.497  -1.406  1.00 0.00 ? 71 ILE A HD12 8  
ATOM 9558  H HD13 . ILE A 1 71 ? 6.458   -7.879  -1.225  1.00 0.00 ? 71 ILE A HD13 8  
ATOM 9559  N N    . HIS A 1 72 ? 5.699   -6.441  -6.504  1.00 0.00 ? 72 HIS A N    8  
ATOM 9560  C CA   . HIS A 1 72 ? 6.490   -6.239  -7.713  1.00 0.00 ? 72 HIS A CA   8  
ATOM 9561  C C    . HIS A 1 72 ? 6.120   -4.925  -8.400  1.00 0.00 ? 72 HIS A C    8  
ATOM 9562  O O    . HIS A 1 72 ? 6.885   -4.404  -9.210  1.00 0.00 ? 72 HIS A O    8  
ATOM 9563  C CB   . HIS A 1 72 ? 6.296   -7.409  -8.681  1.00 0.00 ? 72 HIS A CB   8  
ATOM 9564  C CG   . HIS A 1 72 ? 4.868   -7.820  -8.854  1.00 0.00 ? 72 HIS A CG   8  
ATOM 9565  N ND1  . HIS A 1 72 ? 4.218   -8.708  -8.027  1.00 0.00 ? 72 HIS A ND1  8  
ATOM 9566  C CD2  . HIS A 1 72 ? 3.958   -7.448  -9.791  1.00 0.00 ? 72 HIS A CD2  8  
ATOM 9567  C CE1  . HIS A 1 72 ? 2.964   -8.847  -8.476  1.00 0.00 ? 72 HIS A CE1  8  
ATOM 9568  N NE2  . HIS A 1 72 ? 2.754   -8.103  -9.545  1.00 0.00 ? 72 HIS A NE2  8  
ATOM 9569  H H    . HIS A 1 72 ? 5.081   -7.199  -6.456  1.00 0.00 ? 72 HIS A H    8  
ATOM 9570  H HA   . HIS A 1 72 ? 7.529   -6.196  -7.422  1.00 0.00 ? 72 HIS A HA   8  
ATOM 9571  H HB2  . HIS A 1 72 ? 6.681   -7.131  -9.651  1.00 0.00 ? 72 HIS A HB2  8  
ATOM 9572  H HB3  . HIS A 1 72 ? 6.847   -8.263  -8.314  1.00 0.00 ? 72 HIS A HB3  8  
ATOM 9573  H HD1  . HIS A 1 72 ? 4.606   -9.160  -7.247  1.00 0.00 ? 72 HIS A HD1  8  
ATOM 9574  H HD2  . HIS A 1 72 ? 4.130   -6.757  -10.603 1.00 0.00 ? 72 HIS A HD2  8  
ATOM 9575  H HE1  . HIS A 1 72 ? 2.220   -9.484  -8.021  1.00 0.00 ? 72 HIS A HE1  8  
ATOM 9576  N N    . LYS A 1 73 ? 4.945   -4.394  -8.070  1.00 0.00 ? 73 LYS A N    8  
ATOM 9577  C CA   . LYS A 1 73 ? 4.484   -3.140  -8.656  1.00 0.00 ? 73 LYS A CA   8  
ATOM 9578  C C    . LYS A 1 73 ? 4.786   -1.960  -7.736  1.00 0.00 ? 73 LYS A C    8  
ATOM 9579  O O    . LYS A 1 73 ? 4.123   -0.925  -7.804  1.00 0.00 ? 73 LYS A O    8  
ATOM 9580  C CB   . LYS A 1 73 ? 2.982   -3.209  -8.938  1.00 0.00 ? 73 LYS A CB   8  
ATOM 9581  C CG   . LYS A 1 73 ? 2.601   -4.275  -9.950  1.00 0.00 ? 73 LYS A CG   8  
ATOM 9582  C CD   . LYS A 1 73 ? 2.447   -3.691  -11.345 1.00 0.00 ? 73 LYS A CD   8  
ATOM 9583  C CE   . LYS A 1 73 ? 2.635   -4.753  -12.416 1.00 0.00 ? 73 LYS A CE   8  
ATOM 9584  N NZ   . LYS A 1 73 ? 1.336   -5.324  -12.866 1.00 0.00 ? 73 LYS A NZ   8  
ATOM 9585  H H    . LYS A 1 73 ? 4.377   -4.852  -7.418  1.00 0.00 ? 73 LYS A H    8  
ATOM 9586  H HA   . LYS A 1 73 ? 5.009   -2.998  -9.588  1.00 0.00 ? 73 LYS A HA   8  
ATOM 9587  H HB2  . LYS A 1 73 ? 2.464   -3.418  -8.014  1.00 0.00 ? 73 LYS A HB2  8  
ATOM 9588  H HB3  . LYS A 1 73 ? 2.655   -2.251  -9.315  1.00 0.00 ? 73 LYS A HB3  8  
ATOM 9589  H HG2  . LYS A 1 73 ? 3.373   -5.030  -9.971  1.00 0.00 ? 73 LYS A HG2  8  
ATOM 9590  H HG3  . LYS A 1 73 ? 1.664   -4.723  -9.652  1.00 0.00 ? 73 LYS A HG3  8  
ATOM 9591  H HD2  . LYS A 1 73 ? 1.459   -3.268  -11.441 1.00 0.00 ? 73 LYS A HD2  8  
ATOM 9592  H HD3  . LYS A 1 73 ? 3.188   -2.917  -11.483 1.00 0.00 ? 73 LYS A HD3  8  
ATOM 9593  H HE2  . LYS A 1 73 ? 3.133   -4.306  -13.263 1.00 0.00 ? 73 LYS A HE2  8  
ATOM 9594  H HE3  . LYS A 1 73 ? 3.249   -5.546  -12.016 1.00 0.00 ? 73 LYS A HE3  8  
ATOM 9595  H HZ1  . LYS A 1 73 ? 1.496   -6.208  -13.390 1.00 0.00 ? 73 LYS A HZ1  8  
ATOM 9596  H HZ2  . LYS A 1 73 ? 0.844   -4.650  -13.486 1.00 0.00 ? 73 LYS A HZ2  8  
ATOM 9597  H HZ3  . LYS A 1 73 ? 0.732   -5.527  -12.044 1.00 0.00 ? 73 LYS A HZ3  8  
ATOM 9598  N N    . VAL A 1 74 ? 5.787   -2.122  -6.876  1.00 0.00 ? 74 VAL A N    8  
ATOM 9599  C CA   . VAL A 1 74 ? 6.171   -1.067  -5.946  1.00 0.00 ? 74 VAL A CA   8  
ATOM 9600  C C    . VAL A 1 74 ? 7.545   -0.503  -6.290  1.00 0.00 ? 74 VAL A C    8  
ATOM 9601  O O    . VAL A 1 74 ? 8.487   -1.251  -6.550  1.00 0.00 ? 74 VAL A O    8  
ATOM 9602  C CB   . VAL A 1 74 ? 6.188   -1.578  -4.493  1.00 0.00 ? 74 VAL A CB   8  
ATOM 9603  C CG1  . VAL A 1 74 ? 6.401   -0.426  -3.523  1.00 0.00 ? 74 VAL A CG1  8  
ATOM 9604  C CG2  . VAL A 1 74 ? 4.902   -2.323  -4.173  1.00 0.00 ? 74 VAL A CG2  8  
ATOM 9605  H H    . VAL A 1 74 ? 6.280   -2.969  -6.867  1.00 0.00 ? 74 VAL A H    8  
ATOM 9606  H HA   . VAL A 1 74 ? 5.438   -0.276  -6.018  1.00 0.00 ? 74 VAL A HA   8  
ATOM 9607  H HB   . VAL A 1 74 ? 7.014   -2.266  -4.385  1.00 0.00 ? 74 VAL A HB   8  
ATOM 9608  H HG11 . VAL A 1 74 ? 6.331   -0.792  -2.509  1.00 0.00 ? 74 VAL A HG11 8  
ATOM 9609  H HG12 . VAL A 1 74 ? 5.643   0.326   -3.687  1.00 0.00 ? 74 VAL A HG12 8  
ATOM 9610  H HG13 . VAL A 1 74 ? 7.377   0.005   -3.684  1.00 0.00 ? 74 VAL A HG13 8  
ATOM 9611  H HG21 . VAL A 1 74 ? 4.963   -3.329  -4.561  1.00 0.00 ? 74 VAL A HG21 8  
ATOM 9612  H HG22 . VAL A 1 74 ? 4.067   -1.812  -4.628  1.00 0.00 ? 74 VAL A HG22 8  
ATOM 9613  H HG23 . VAL A 1 74 ? 4.763   -2.359  -3.103  1.00 0.00 ? 74 VAL A HG23 8  
ATOM 9614  N N    . ILE A 1 75 ? 7.651   0.822   -6.288  1.00 0.00 ? 75 ILE A N    8  
ATOM 9615  C CA   . ILE A 1 75 ? 8.910   1.488   -6.600  1.00 0.00 ? 75 ILE A CA   8  
ATOM 9616  C C    . ILE A 1 75 ? 9.532   2.101   -5.349  1.00 0.00 ? 75 ILE A C    8  
ATOM 9617  O O    . ILE A 1 75 ? 8.977   3.028   -4.760  1.00 0.00 ? 75 ILE A O    8  
ATOM 9618  C CB   . ILE A 1 75 ? 8.717   2.594   -7.656  1.00 0.00 ? 75 ILE A CB   8  
ATOM 9619  C CG1  . ILE A 1 75 ? 7.910   2.061   -8.842  1.00 0.00 ? 75 ILE A CG1  8  
ATOM 9620  C CG2  . ILE A 1 75 ? 10.063  3.126   -8.120  1.00 0.00 ? 75 ILE A CG2  8  
ATOM 9621  C CD1  . ILE A 1 75 ? 8.546   0.863   -9.515  1.00 0.00 ? 75 ILE A CD1  8  
ATOM 9622  H H    . ILE A 1 75 ? 6.864   1.365   -6.072  1.00 0.00 ? 75 ILE A H    8  
ATOM 9623  H HA   . ILE A 1 75 ? 9.588   0.750   -7.002  1.00 0.00 ? 75 ILE A HA   8  
ATOM 9624  H HB   . ILE A 1 75 ? 8.174   3.407   -7.198  1.00 0.00 ? 75 ILE A HB   8  
ATOM 9625  H HG12 . ILE A 1 75 ? 6.929   1.766   -8.499  1.00 0.00 ? 75 ILE A HG12 8  
ATOM 9626  H HG13 . ILE A 1 75 ? 7.809   2.842   -9.580  1.00 0.00 ? 75 ILE A HG13 8  
ATOM 9627  H HG21 . ILE A 1 75 ? 10.820  2.370   -7.971  1.00 0.00 ? 75 ILE A HG21 8  
ATOM 9628  H HG22 . ILE A 1 75 ? 10.318  4.008   -7.550  1.00 0.00 ? 75 ILE A HG22 8  
ATOM 9629  H HG23 . ILE A 1 75 ? 10.008  3.379   -9.169  1.00 0.00 ? 75 ILE A HG23 8  
ATOM 9630  H HD11 . ILE A 1 75 ? 7.871   0.468   -10.259 1.00 0.00 ? 75 ILE A HD11 8  
ATOM 9631  H HD12 . ILE A 1 75 ? 8.752   0.103   -8.776  1.00 0.00 ? 75 ILE A HD12 8  
ATOM 9632  H HD13 . ILE A 1 75 ? 9.468   1.164   -9.989  1.00 0.00 ? 75 ILE A HD13 8  
ATOM 9633  N N    . ARG A 1 76 ? 10.684  1.575   -4.949  1.00 0.00 ? 76 ARG A N    8  
ATOM 9634  C CA   . ARG A 1 76 ? 11.380  2.070   -3.768  1.00 0.00 ? 76 ARG A CA   8  
ATOM 9635  C C    . ARG A 1 76 ? 11.848  3.508   -3.975  1.00 0.00 ? 76 ARG A C    8  
ATOM 9636  O O    . ARG A 1 76 ? 12.274  3.882   -5.069  1.00 0.00 ? 76 ARG A O    8  
ATOM 9637  C CB   . ARG A 1 76 ? 12.574  1.170   -3.440  1.00 0.00 ? 76 ARG A CB   8  
ATOM 9638  C CG   . ARG A 1 76 ? 12.428  0.423   -2.123  1.00 0.00 ? 76 ARG A CG   8  
ATOM 9639  C CD   . ARG A 1 76 ? 12.544  -1.081  -2.314  1.00 0.00 ? 76 ARG A CD   8  
ATOM 9640  N NE   . ARG A 1 76 ? 13.914  -1.489  -2.618  1.00 0.00 ? 76 ARG A NE   8  
ATOM 9641  C CZ   . ARG A 1 76 ? 14.877  -1.587  -1.705  1.00 0.00 ? 76 ARG A CZ   8  
ATOM 9642  N NH1  . ARG A 1 76 ? 14.627  -1.306  -0.433  1.00 0.00 ? 76 ARG A NH1  8  
ATOM 9643  N NH2  . ARG A 1 76 ? 16.095  -1.967  -2.066  1.00 0.00 ? 76 ARG A NH2  8  
ATOM 9644  H H    . ARG A 1 76 ? 11.076  0.837   -5.461  1.00 0.00 ? 76 ARG A H    8  
ATOM 9645  H HA   . ARG A 1 76 ? 10.686  2.047   -2.941  1.00 0.00 ? 76 ARG A HA   8  
ATOM 9646  H HB2  . ARG A 1 76 ? 12.690  0.444   -4.231  1.00 0.00 ? 76 ARG A HB2  8  
ATOM 9647  H HB3  . ARG A 1 76 ? 13.467  1.776   -3.387  1.00 0.00 ? 76 ARG A HB3  8  
ATOM 9648  H HG2  . ARG A 1 76 ? 13.203  0.750   -1.447  1.00 0.00 ? 76 ARG A HG2  8  
ATOM 9649  H HG3  . ARG A 1 76 ? 11.461  0.649   -1.699  1.00 0.00 ? 76 ARG A HG3  8  
ATOM 9650  H HD2  . ARG A 1 76 ? 12.225  -1.572  -1.408  1.00 0.00 ? 76 ARG A HD2  8  
ATOM 9651  H HD3  . ARG A 1 76 ? 11.900  -1.378  -3.130  1.00 0.00 ? 76 ARG A HD3  8  
ATOM 9652  H HE   . ARG A 1 76 ? 14.126  -1.703  -3.551  1.00 0.00 ? 76 ARG A HE   8  
ATOM 9653  H HH11 . ARG A 1 76 ? 13.711  -1.019  -0.154  1.00 0.00 ? 76 ARG A HH11 8  
ATOM 9654  H HH12 . ARG A 1 76 ? 15.356  -1.380  0.248   1.00 0.00 ? 76 ARG A HH12 8  
ATOM 9655  H HH21 . ARG A 1 76 ? 16.289  -2.180  -3.024  1.00 0.00 ? 76 ARG A HH21 8  
ATOM 9656  H HH22 . ARG A 1 76 ? 16.820  -2.040  -1.381  1.00 0.00 ? 76 ARG A HH22 8  
ATOM 9657  N N    . ILE A 1 77 ? 11.766  4.309   -2.918  1.00 0.00 ? 77 ILE A N    8  
ATOM 9658  C CA   . ILE A 1 77 ? 12.181  5.705   -2.983  1.00 0.00 ? 77 ILE A CA   8  
ATOM 9659  C C    . ILE A 1 77 ? 12.692  6.189   -1.630  1.00 0.00 ? 77 ILE A C    8  
ATOM 9660  O O    . ILE A 1 77 ? 12.551  7.362   -1.285  1.00 0.00 ? 77 ILE A O    8  
ATOM 9661  C CB   . ILE A 1 77 ? 11.023  6.614   -3.437  1.00 0.00 ? 77 ILE A CB   8  
ATOM 9662  C CG1  . ILE A 1 77 ? 9.806   6.415   -2.534  1.00 0.00 ? 77 ILE A CG1  8  
ATOM 9663  C CG2  . ILE A 1 77 ? 10.665  6.331   -4.888  1.00 0.00 ? 77 ILE A CG2  8  
ATOM 9664  C CD1  . ILE A 1 77 ? 9.058   7.696   -2.235  1.00 0.00 ? 77 ILE A CD1  8  
ATOM 9665  H H    . ILE A 1 77 ? 11.418  3.953   -2.075  1.00 0.00 ? 77 ILE A H    8  
ATOM 9666  H HA   . ILE A 1 77 ? 12.979  5.783   -3.708  1.00 0.00 ? 77 ILE A HA   8  
ATOM 9667  H HB   . ILE A 1 77 ? 11.352  7.641   -3.367  1.00 0.00 ? 77 ILE A HB   8  
ATOM 9668  H HG12 . ILE A 1 77 ? 9.117   5.735   -3.013  1.00 0.00 ? 77 ILE A HG12 8  
ATOM 9669  H HG13 . ILE A 1 77 ? 10.128  5.991   -1.594  1.00 0.00 ? 77 ILE A HG13 8  
ATOM 9670  H HG21 . ILE A 1 77 ? 11.558  6.378   -5.495  1.00 0.00 ? 77 ILE A HG21 8  
ATOM 9671  H HG22 . ILE A 1 77 ? 9.956   7.067   -5.235  1.00 0.00 ? 77 ILE A HG22 8  
ATOM 9672  H HG23 . ILE A 1 77 ? 10.229  5.346   -4.967  1.00 0.00 ? 77 ILE A HG23 8  
ATOM 9673  H HD11 . ILE A 1 77 ? 8.028   7.592   -2.542  1.00 0.00 ? 77 ILE A HD11 8  
ATOM 9674  H HD12 . ILE A 1 77 ? 9.514   8.514   -2.775  1.00 0.00 ? 77 ILE A HD12 8  
ATOM 9675  H HD13 . ILE A 1 77 ? 9.099   7.899   -1.175  1.00 0.00 ? 77 ILE A HD13 8  
ATOM 9676  N N    . GLY A 1 78 ? 13.285  5.276   -0.868  1.00 0.00 ? 78 GLY A N    8  
ATOM 9677  C CA   . GLY A 1 78 ? 13.809  5.626   0.439   1.00 0.00 ? 78 GLY A CA   8  
ATOM 9678  C C    . GLY A 1 78 ? 14.962  4.736   0.860   1.00 0.00 ? 78 GLY A C    8  
ATOM 9679  O O    . GLY A 1 78 ? 15.962  5.216   1.392   1.00 0.00 ? 78 GLY A O    8  
ATOM 9680  H H    . GLY A 1 78 ? 13.368  4.357   -1.197  1.00 0.00 ? 78 GLY A H    8  
ATOM 9681  H HA2  . GLY A 1 78 ? 14.149  6.651   0.416   1.00 0.00 ? 78 GLY A HA2  8  
ATOM 9682  H HA3  . GLY A 1 78 ? 13.016  5.538   1.167   1.00 0.00 ? 78 GLY A HA3  8  
ATOM 9683  N N    . SER A 1 79 ? 14.821  3.436   0.621   1.00 0.00 ? 79 SER A N    8  
ATOM 9684  C CA   . SER A 1 79 ? 15.858  2.473   0.978   1.00 0.00 ? 79 SER A CA   8  
ATOM 9685  C C    . SER A 1 79 ? 16.036  2.402   2.492   1.00 0.00 ? 79 SER A C    8  
ATOM 9686  O O    . SER A 1 79 ? 17.158  2.329   2.993   1.00 0.00 ? 79 SER A O    8  
ATOM 9687  C CB   . SER A 1 79 ? 17.185  2.848   0.312   1.00 0.00 ? 79 SER A CB   8  
ATOM 9688  O OG   . SER A 1 79 ? 17.010  3.087   -1.073  1.00 0.00 ? 79 SER A OG   8  
ATOM 9689  H H    . SER A 1 79 ? 14.000  3.115   0.194   1.00 0.00 ? 79 SER A H    8  
ATOM 9690  H HA   . SER A 1 79 ? 15.546  1.504   0.620   1.00 0.00 ? 79 SER A HA   8  
ATOM 9691  H HB2  . SER A 1 79 ? 17.577  3.741   0.773   1.00 0.00 ? 79 SER A HB2  8  
ATOM 9692  H HB3  . SER A 1 79 ? 17.888  2.038   0.439   1.00 0.00 ? 79 SER A HB3  8  
ATOM 9693  H HG   . SER A 1 79 ? 16.657  2.300   -1.492  1.00 0.00 ? 79 SER A HG   8  
ATOM 9694  N N    . GLY A 1 80 ? 14.920  2.422   3.215   1.00 0.00 ? 80 GLY A N    8  
ATOM 9695  C CA   . GLY A 1 80 ? 14.973  2.357   4.663   1.00 0.00 ? 80 GLY A CA   8  
ATOM 9696  C C    . GLY A 1 80 ? 15.636  3.577   5.276   1.00 0.00 ? 80 GLY A C    8  
ATOM 9697  O O    . GLY A 1 80 ? 16.830  3.549   5.578   1.00 0.00 ? 80 GLY A O    8  
ATOM 9698  H H    . GLY A 1 80 ? 14.054  2.479   2.760   1.00 0.00 ? 80 GLY A H    8  
ATOM 9699  H HA2  . GLY A 1 80 ? 13.967  2.277   5.046   1.00 0.00 ? 80 GLY A HA2  8  
ATOM 9700  H HA3  . GLY A 1 80 ? 15.527  1.476   4.952   1.00 0.00 ? 80 GLY A HA3  8  
ATOM 9701  N N    . PRO A 1 81 ? 14.881  4.671   5.474   1.00 0.00 ? 81 PRO A N    8  
ATOM 9702  C CA   . PRO A 1 81 ? 15.417  5.904   6.061   1.00 0.00 ? 81 PRO A CA   8  
ATOM 9703  C C    . PRO A 1 81 ? 16.120  5.654   7.391   1.00 0.00 ? 81 PRO A C    8  
ATOM 9704  O O    . PRO A 1 81 ? 15.502  5.715   8.452   1.00 0.00 ? 81 PRO A O    8  
ATOM 9705  C CB   . PRO A 1 81 ? 14.173  6.772   6.270   1.00 0.00 ? 81 PRO A CB   8  
ATOM 9706  C CG   . PRO A 1 81 ? 13.186  6.266   5.276   1.00 0.00 ? 81 PRO A CG   8  
ATOM 9707  C CD   . PRO A 1 81 ? 13.450  4.792   5.144   1.00 0.00 ? 81 PRO A CD   8  
ATOM 9708  H HA   . PRO A 1 81 ? 16.097  6.400   5.384   1.00 0.00 ? 81 PRO A HA   8  
ATOM 9709  H HB2  . PRO A 1 81 ? 13.813  6.652   7.282   1.00 0.00 ? 81 PRO A HB2  8  
ATOM 9710  H HB3  . PRO A 1 81 ? 14.419  7.808   6.089   1.00 0.00 ? 81 PRO A HB3  8  
ATOM 9711  H HG2  . PRO A 1 81 ? 12.182  6.437   5.635   1.00 0.00 ? 81 PRO A HG2  8  
ATOM 9712  H HG3  . PRO A 1 81 ? 13.336  6.759   4.326   1.00 0.00 ? 81 PRO A HG3  8  
ATOM 9713  H HD2  . PRO A 1 81 ? 12.844  4.236   5.844   1.00 0.00 ? 81 PRO A HD2  8  
ATOM 9714  H HD3  . PRO A 1 81 ? 13.258  4.462   4.134   1.00 0.00 ? 81 PRO A HD3  8  
ATOM 9715  N N    . SER A 1 82 ? 17.418  5.370   7.324   1.00 0.00 ? 82 SER A N    8  
ATOM 9716  C CA   . SER A 1 82 ? 18.206  5.109   8.523   1.00 0.00 ? 82 SER A CA   8  
ATOM 9717  C C    . SER A 1 82 ? 19.377  6.079   8.627   1.00 0.00 ? 82 SER A C    8  
ATOM 9718  O O    . SER A 1 82 ? 19.671  6.601   9.702   1.00 0.00 ? 82 SER A O    8  
ATOM 9719  C CB   . SER A 1 82 ? 18.721  3.668   8.515   1.00 0.00 ? 82 SER A CB   8  
ATOM 9720  O OG   . SER A 1 82 ? 17.654  2.743   8.630   1.00 0.00 ? 82 SER A OG   8  
ATOM 9721  H H    . SER A 1 82 ? 17.854  5.334   6.447   1.00 0.00 ? 82 SER A H    8  
ATOM 9722  H HA   . SER A 1 82 ? 17.563  5.247   9.380   1.00 0.00 ? 82 SER A HA   8  
ATOM 9723  H HB2  . SER A 1 82 ? 19.245  3.480   7.591   1.00 0.00 ? 82 SER A HB2  8  
ATOM 9724  H HB3  . SER A 1 82 ? 19.396  3.525   9.347   1.00 0.00 ? 82 SER A HB3  8  
ATOM 9725  H HG   . SER A 1 82 ? 17.917  1.901   8.254   1.00 0.00 ? 82 SER A HG   8  
ATOM 9726  N N    . SER A 1 83 ? 20.044  6.318   7.502   1.00 0.00 ? 83 SER A N    8  
ATOM 9727  C CA   . SER A 1 83 ? 21.184  7.225   7.466   1.00 0.00 ? 83 SER A CA   8  
ATOM 9728  C C    . SER A 1 83 ? 22.301  6.732   8.380   1.00 0.00 ? 83 SER A C    8  
ATOM 9729  O O    . SER A 1 83 ? 22.259  6.937   9.593   1.00 0.00 ? 83 SER A O    8  
ATOM 9730  C CB   . SER A 1 83 ? 20.755  8.633   7.880   1.00 0.00 ? 83 SER A CB   8  
ATOM 9731  O OG   . SER A 1 83 ? 19.422  8.900   7.479   1.00 0.00 ? 83 SER A OG   8  
ATOM 9732  H H    . SER A 1 83 ? 19.762  5.871   6.676   1.00 0.00 ? 83 SER A H    8  
ATOM 9733  H HA   . SER A 1 83 ? 21.552  7.256   6.452   1.00 0.00 ? 83 SER A HA   8  
ATOM 9734  H HB2  . SER A 1 83 ? 20.818  8.726   8.954   1.00 0.00 ? 83 SER A HB2  8  
ATOM 9735  H HB3  . SER A 1 83 ? 21.408  9.358   7.418   1.00 0.00 ? 83 SER A HB3  8  
ATOM 9736  H HG   . SER A 1 83 ? 19.154  9.761   7.806   1.00 0.00 ? 83 SER A HG   8  
ATOM 9737  N N    . GLY A 1 84 ? 23.299  6.082   7.790   1.00 0.00 ? 84 GLY A N    8  
ATOM 9738  C CA   . GLY A 1 84 ? 24.412  5.570   8.566   1.00 0.00 ? 84 GLY A CA   8  
ATOM 9739  C C    . GLY A 1 84 ? 25.602  5.202   7.702   1.00 0.00 ? 84 GLY A C    8  
ATOM 9740  O O    . GLY A 1 84 ? 26.683  4.930   8.264   1.00 0.00 ? 84 GLY A O    8  
ATOM 9741  O OXT  . GLY A 1 84 ? 25.452  5.184   6.462   1.00 0.00 ? 84 GLY A OXT  8  
ATOM 9742  H H    . GLY A 1 84 ? 23.278  5.949   6.819   1.00 0.00 ? 84 GLY A H    8  
ATOM 9743  H HA2  . GLY A 1 84 ? 24.718  6.324   9.276   1.00 0.00 ? 84 GLY A HA2  8  
ATOM 9744  H HA3  . GLY A 1 84 ? 24.088  4.693   9.106   1.00 0.00 ? 84 GLY A HA3  8  
ATOM 9745  N N    . GLY A 1 1  ? 16.563  -7.341  -14.500 1.00 0.00 ? 1  GLY A N    9  
ATOM 9746  C CA   . GLY A 1 1  ? 15.442  -6.946  -13.604 1.00 0.00 ? 1  GLY A CA   9  
ATOM 9747  C C    . GLY A 1 1  ? 15.893  -6.038  -12.477 1.00 0.00 ? 1  GLY A C    9  
ATOM 9748  O O    . GLY A 1 1  ? 16.222  -4.874  -12.703 1.00 0.00 ? 1  GLY A O    9  
ATOM 9749  H H1   . GLY A 1 1  ? 16.907  -8.290  -14.245 1.00 0.00 ? 1  GLY A H1   9  
ATOM 9750  H H2   . GLY A 1 1  ? 17.348  -6.665  -14.411 1.00 0.00 ? 1  GLY A H2   9  
ATOM 9751  H H3   . GLY A 1 1  ? 16.243  -7.354  -15.489 1.00 0.00 ? 1  GLY A H3   9  
ATOM 9752  H HA2  . GLY A 1 1  ? 14.693  -6.432  -14.187 1.00 0.00 ? 1  GLY A HA2  9  
ATOM 9753  H HA3  . GLY A 1 1  ? 15.004  -7.838  -13.179 1.00 0.00 ? 1  GLY A HA3  9  
ATOM 9754  N N    . SER A 1 2  ? 15.908  -6.572  -11.259 1.00 0.00 ? 2  SER A N    9  
ATOM 9755  C CA   . SER A 1 2  ? 16.322  -5.801  -10.092 1.00 0.00 ? 2  SER A CA   9  
ATOM 9756  C C    . SER A 1 2  ? 16.455  -6.700  -8.867  1.00 0.00 ? 2  SER A C    9  
ATOM 9757  O O    . SER A 1 2  ? 15.734  -7.690  -8.729  1.00 0.00 ? 2  SER A O    9  
ATOM 9758  C CB   . SER A 1 2  ? 15.316  -4.682  -9.812  1.00 0.00 ? 2  SER A CB   9  
ATOM 9759  O OG   . SER A 1 2  ? 15.730  -3.465  -10.409 1.00 0.00 ? 2  SER A OG   9  
ATOM 9760  H H    . SER A 1 2  ? 15.634  -7.506  -11.144 1.00 0.00 ? 2  SER A H    9  
ATOM 9761  H HA   . SER A 1 2  ? 17.284  -5.363  -10.309 1.00 0.00 ? 2  SER A HA   9  
ATOM 9762  H HB2  . SER A 1 2  ? 14.353  -4.957  -10.216 1.00 0.00 ? 2  SER A HB2  9  
ATOM 9763  H HB3  . SER A 1 2  ? 15.232  -4.536  -8.746  1.00 0.00 ? 2  SER A HB3  9  
ATOM 9764  H HG   . SER A 1 2  ? 16.067  -2.874  -9.732  1.00 0.00 ? 2  SER A HG   9  
ATOM 9765  N N    . SER A 1 3  ? 17.380  -6.350  -7.980  1.00 0.00 ? 3  SER A N    9  
ATOM 9766  C CA   . SER A 1 3  ? 17.608  -7.125  -6.766  1.00 0.00 ? 3  SER A CA   9  
ATOM 9767  C C    . SER A 1 3  ? 16.568  -6.787  -5.702  1.00 0.00 ? 3  SER A C    9  
ATOM 9768  O O    . SER A 1 3  ? 16.328  -5.617  -5.404  1.00 0.00 ? 3  SER A O    9  
ATOM 9769  C CB   . SER A 1 3  ? 19.013  -6.861  -6.223  1.00 0.00 ? 3  SER A CB   9  
ATOM 9770  O OG   . SER A 1 3  ? 19.977  -6.903  -7.260  1.00 0.00 ? 3  SER A OG   9  
ATOM 9771  H H    . SER A 1 3  ? 17.923  -5.551  -8.146  1.00 0.00 ? 3  SER A H    9  
ATOM 9772  H HA   . SER A 1 3  ? 17.520  -8.170  -7.019  1.00 0.00 ? 3  SER A HA   9  
ATOM 9773  H HB2  . SER A 1 3  ? 19.042  -5.884  -5.763  1.00 0.00 ? 3  SER A HB2  9  
ATOM 9774  H HB3  . SER A 1 3  ? 19.260  -7.613  -5.488  1.00 0.00 ? 3  SER A HB3  9  
ATOM 9775  H HG   . SER A 1 3  ? 20.012  -7.788  -7.630  1.00 0.00 ? 3  SER A HG   9  
ATOM 9776  N N    . GLY A 1 4  ? 15.954  -7.820  -5.133  1.00 0.00 ? 4  GLY A N    9  
ATOM 9777  C CA   . GLY A 1 4  ? 14.947  -7.611  -4.109  1.00 0.00 ? 4  GLY A CA   9  
ATOM 9778  C C    . GLY A 1 4  ? 13.536  -7.686  -4.658  1.00 0.00 ? 4  GLY A C    9  
ATOM 9779  O O    . GLY A 1 4  ? 13.197  -8.615  -5.390  1.00 0.00 ? 4  GLY A O    9  
ATOM 9780  H H    . GLY A 1 4  ? 16.187  -8.730  -5.411  1.00 0.00 ? 4  GLY A H    9  
ATOM 9781  H HA2  . GLY A 1 4  ? 15.065  -8.366  -3.345  1.00 0.00 ? 4  GLY A HA2  9  
ATOM 9782  H HA3  . GLY A 1 4  ? 15.097  -6.638  -3.664  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 9783  N N    . SER A 1 5  ? 12.712  -6.705  -4.303  1.00 0.00 ? 5  SER A N    9  
ATOM 9784  C CA   . SER A 1 5  ? 11.330  -6.663  -4.766  1.00 0.00 ? 5  SER A CA   9  
ATOM 9785  C C    . SER A 1 5  ? 10.565  -7.899  -4.306  1.00 0.00 ? 5  SER A C    9  
ATOM 9786  O O    . SER A 1 5  ? 9.653   -8.366  -4.987  1.00 0.00 ? 5  SER A O    9  
ATOM 9787  C CB   . SER A 1 5  ? 11.284  -6.559  -6.291  1.00 0.00 ? 5  SER A CB   9  
ATOM 9788  O OG   . SER A 1 5  ? 11.429  -5.216  -6.717  1.00 0.00 ? 5  SER A OG   9  
ATOM 9789  H H    . SER A 1 5  ? 13.043  -5.992  -3.717  1.00 0.00 ? 5  SER A H    9  
ATOM 9790  H HA   . SER A 1 5  ? 10.865  -5.787  -4.341  1.00 0.00 ? 5  SER A HA   9  
ATOM 9791  H HB2  . SER A 1 5  ? 12.086  -7.146  -6.715  1.00 0.00 ? 5  SER A HB2  9  
ATOM 9792  H HB3  . SER A 1 5  ? 10.336  -6.937  -6.646  1.00 0.00 ? 5  SER A HB3  9  
ATOM 9793  H HG   . SER A 1 5  ? 12.344  -4.944  -6.610  1.00 0.00 ? 5  SER A HG   9  
ATOM 9794  N N    . SER A 1 6  ? 10.942  -8.424  -3.144  1.00 0.00 ? 6  SER A N    9  
ATOM 9795  C CA   . SER A 1 6  ? 10.291  -9.606  -2.593  1.00 0.00 ? 6  SER A CA   9  
ATOM 9796  C C    . SER A 1 6  ? 9.967   -9.411  -1.116  1.00 0.00 ? 6  SER A C    9  
ATOM 9797  O O    . SER A 1 6  ? 8.808   -9.494  -0.709  1.00 0.00 ? 6  SER A O    9  
ATOM 9798  C CB   . SER A 1 6  ? 11.184  -10.836 -2.774  1.00 0.00 ? 6  SER A CB   9  
ATOM 9799  O OG   . SER A 1 6  ? 12.542  -10.524 -2.514  1.00 0.00 ? 6  SER A OG   9  
ATOM 9800  H H    . SER A 1 6  ? 11.675  -8.006  -2.647  1.00 0.00 ? 6  SER A H    9  
ATOM 9801  H HA   . SER A 1 6  ? 9.369   -9.760  -3.135  1.00 0.00 ? 6  SER A HA   9  
ATOM 9802  H HB2  . SER A 1 6  ? 10.869  -11.610 -2.091  1.00 0.00 ? 6  SER A HB2  9  
ATOM 9803  H HB3  . SER A 1 6  ? 11.098  -11.195 -3.788  1.00 0.00 ? 6  SER A HB3  9  
ATOM 9804  H HG   . SER A 1 6  ? 12.905  -10.033 -3.255  1.00 0.00 ? 6  SER A HG   9  
ATOM 9805  N N    . GLY A 1 7  ? 10.997  -9.152  -0.318  1.00 0.00 ? 7  GLY A N    9  
ATOM 9806  C CA   . GLY A 1 7  ? 10.800  -8.950  1.105   1.00 0.00 ? 7  GLY A CA   9  
ATOM 9807  C C    . GLY A 1 7  ? 10.964  -7.499  1.513   1.00 0.00 ? 7  GLY A C    9  
ATOM 9808  O O    . GLY A 1 7  ? 12.075  -6.972  1.525   1.00 0.00 ? 7  GLY A O    9  
ATOM 9809  H H    . GLY A 1 7  ? 11.899  -9.098  -0.699  1.00 0.00 ? 7  GLY A H    9  
ATOM 9810  H HA2  . GLY A 1 7  ? 9.806   -9.278  1.371   1.00 0.00 ? 7  GLY A HA2  9  
ATOM 9811  H HA3  . GLY A 1 7  ? 11.521  -9.547  1.645   1.00 0.00 ? 7  GLY A HA3  9  
ATOM 9812  N N    . LEU A 1 8  ? 9.851   -6.852  1.849   1.00 0.00 ? 8  LEU A N    9  
ATOM 9813  C CA   . LEU A 1 8  ? 9.875   -5.453  2.259   1.00 0.00 ? 8  LEU A CA   9  
ATOM 9814  C C    . LEU A 1 8  ? 9.666   -5.325  3.764   1.00 0.00 ? 8  LEU A C    9  
ATOM 9815  O O    . LEU A 1 8  ? 9.277   -6.284  4.431   1.00 0.00 ? 8  LEU A O    9  
ATOM 9816  C CB   . LEU A 1 8  ? 8.796   -4.663  1.514   1.00 0.00 ? 8  LEU A CB   9  
ATOM 9817  C CG   . LEU A 1 8  ? 8.799   -4.833  -0.005  1.00 0.00 ? 8  LEU A CG   9  
ATOM 9818  C CD1  . LEU A 1 8  ? 7.467   -4.399  -0.594  1.00 0.00 ? 8  LEU A CD1  9  
ATOM 9819  C CD2  . LEU A 1 8  ? 9.942   -4.043  -0.627  1.00 0.00 ? 8  LEU A CD2  9  
ATOM 9820  H H    . LEU A 1 8  ? 8.995   -7.327  1.819   1.00 0.00 ? 8  LEU A H    9  
ATOM 9821  H HA   . LEU A 1 8  ? 10.843  -5.049  2.005   1.00 0.00 ? 8  LEU A HA   9  
ATOM 9822  H HB2  . LEU A 1 8  ? 7.831   -4.973  1.889   1.00 0.00 ? 8  LEU A HB2  9  
ATOM 9823  H HB3  . LEU A 1 8  ? 8.930   -3.614  1.736   1.00 0.00 ? 8  LEU A HB3  9  
ATOM 9824  H HG   . LEU A 1 8  ? 8.946   -5.877  -0.243  1.00 0.00 ? 8  LEU A HG   9  
ATOM 9825  H HD11 . LEU A 1 8  ? 7.570   -4.271  -1.662  1.00 0.00 ? 8  LEU A HD11 9  
ATOM 9826  H HD12 . LEU A 1 8  ? 7.163   -3.464  -0.146  1.00 0.00 ? 8  LEU A HD12 9  
ATOM 9827  H HD13 . LEU A 1 8  ? 6.722   -5.154  -0.393  1.00 0.00 ? 8  LEU A HD13 9  
ATOM 9828  H HD21 . LEU A 1 8  ? 10.849  -4.222  -0.068  1.00 0.00 ? 8  LEU A HD21 9  
ATOM 9829  H HD22 . LEU A 1 8  ? 9.706   -2.990  -0.602  1.00 0.00 ? 8  LEU A HD22 9  
ATOM 9830  H HD23 . LEU A 1 8  ? 10.081  -4.356  -1.651  1.00 0.00 ? 8  LEU A HD23 9  
ATOM 9831  N N    . ARG A 1 9  ? 9.927   -4.133  4.292   1.00 0.00 ? 9  ARG A N    9  
ATOM 9832  C CA   . ARG A 1 9  ? 9.767   -3.879  5.720   1.00 0.00 ? 9  ARG A CA   9  
ATOM 9833  C C    . ARG A 1 9  ? 8.538   -3.015  5.983   1.00 0.00 ? 9  ARG A C    9  
ATOM 9834  O O    . ARG A 1 9  ? 8.119   -2.237  5.127   1.00 0.00 ? 9  ARG A O    9  
ATOM 9835  C CB   . ARG A 1 9  ? 11.015  -3.196  6.282   1.00 0.00 ? 9  ARG A CB   9  
ATOM 9836  C CG   . ARG A 1 9  ? 12.316  -3.851  5.848   1.00 0.00 ? 9  ARG A CG   9  
ATOM 9837  C CD   . ARG A 1 9  ? 13.514  -3.238  6.558   1.00 0.00 ? 9  ARG A CD   9  
ATOM 9838  N NE   . ARG A 1 9  ? 14.608  -2.948  5.634   1.00 0.00 ? 9  ARG A NE   9  
ATOM 9839  C CZ   . ARG A 1 9  ? 15.737  -2.338  5.991   1.00 0.00 ? 9  ARG A CZ   9  
ATOM 9840  N NH1  . ARG A 1 9  ? 15.924  -1.955  7.247   1.00 0.00 ? 9  ARG A NH1  9  
ATOM 9841  N NH2  . ARG A 1 9  ? 16.681  -2.111  5.087   1.00 0.00 ? 9  ARG A NH2  9  
ATOM 9842  H H    . ARG A 1 9  ? 10.234  -3.408  3.709   1.00 0.00 ? 9  ARG A H    9  
ATOM 9843  H HA   . ARG A 1 9  ? 9.635   -4.830  6.213   1.00 0.00 ? 9  ARG A HA   9  
ATOM 9844  H HB2  . ARG A 1 9  ? 11.027  -2.167  5.952   1.00 0.00 ? 9  ARG A HB2  9  
ATOM 9845  H HB3  . ARG A 1 9  ? 10.969  -3.217  7.361   1.00 0.00 ? 9  ARG A HB3  9  
ATOM 9846  H HG2  . ARG A 1 9  ? 12.273  -4.904  6.081   1.00 0.00 ? 9  ARG A HG2  9  
ATOM 9847  H HG3  . ARG A 1 9  ? 12.435  -3.720  4.782   1.00 0.00 ? 9  ARG A HG3  9  
ATOM 9848  H HD2  . ARG A 1 9  ? 13.204  -2.320  7.034   1.00 0.00 ? 9  ARG A HD2  9  
ATOM 9849  H HD3  . ARG A 1 9  ? 13.864  -3.932  7.309   1.00 0.00 ? 9  ARG A HD3  9  
ATOM 9850  H HE   . ARG A 1 9  ? 14.496  -3.220  4.700   1.00 0.00 ? 9  ARG A HE   9  
ATOM 9851  H HH11 . ARG A 1 9  ? 15.217  -2.123  7.933   1.00 0.00 ? 9  ARG A HH11 9  
ATOM 9852  H HH12 . ARG A 1 9  ? 16.775  -1.499  7.509   1.00 0.00 ? 9  ARG A HH12 9  
ATOM 9853  H HH21 . ARG A 1 9  ? 16.546  -2.399  4.140   1.00 0.00 ? 9  ARG A HH21 9  
ATOM 9854  H HH22 . ARG A 1 9  ? 17.529  -1.654  5.355   1.00 0.00 ? 9  ARG A HH22 9  
ATOM 9855  N N    . LEU A 1 10 ? 7.965   -3.157  7.173   1.00 0.00 ? 10 LEU A N    9  
ATOM 9856  C CA   . LEU A 1 10 ? 6.784   -2.390  7.549   1.00 0.00 ? 10 LEU A CA   9  
ATOM 9857  C C    . LEU A 1 10 ? 7.170   -0.989  8.014   1.00 0.00 ? 10 LEU A C    9  
ATOM 9858  O O    . LEU A 1 10 ? 7.819   -0.824  9.047   1.00 0.00 ? 10 LEU A O    9  
ATOM 9859  C CB   . LEU A 1 10 ? 6.011   -3.111  8.655   1.00 0.00 ? 10 LEU A CB   9  
ATOM 9860  C CG   . LEU A 1 10 ? 5.474   -4.492  8.273   1.00 0.00 ? 10 LEU A CG   9  
ATOM 9861  C CD1  . LEU A 1 10 ? 5.514   -5.429  9.471   1.00 0.00 ? 10 LEU A CD1  9  
ATOM 9862  C CD2  . LEU A 1 10 ? 4.059   -4.381  7.727   1.00 0.00 ? 10 LEU A CD2  9  
ATOM 9863  H H    . LEU A 1 10 ? 8.345   -3.793  7.814   1.00 0.00 ? 10 LEU A H    9  
ATOM 9864  H HA   . LEU A 1 10 ? 6.153   -2.305  6.677   1.00 0.00 ? 10 LEU A HA   9  
ATOM 9865  H HB2  . LEU A 1 10 ? 6.665   -3.223  9.507   1.00 0.00 ? 10 LEU A HB2  9  
ATOM 9866  H HB3  . LEU A 1 10 ? 5.174   -2.493  8.942   1.00 0.00 ? 10 LEU A HB3  9  
ATOM 9867  H HG   . LEU A 1 10 ? 6.100   -4.913  7.499   1.00 0.00 ? 10 LEU A HG   9  
ATOM 9868  H HD11 . LEU A 1 10 ? 5.775   -6.424  9.141   1.00 0.00 ? 10 LEU A HD11 9  
ATOM 9869  H HD12 . LEU A 1 10 ? 4.544   -5.449  9.945   1.00 0.00 ? 10 LEU A HD12 9  
ATOM 9870  H HD13 . LEU A 1 10 ? 6.252   -5.080  10.177  1.00 0.00 ? 10 LEU A HD13 9  
ATOM 9871  H HD21 . LEU A 1 10 ? 3.350   -4.567  8.522   1.00 0.00 ? 10 LEU A HD21 9  
ATOM 9872  H HD22 . LEU A 1 10 ? 3.917   -5.108  6.942   1.00 0.00 ? 10 LEU A HD22 9  
ATOM 9873  H HD23 . LEU A 1 10 ? 3.903   -3.388  7.331   1.00 0.00 ? 10 LEU A HD23 9  
ATOM 9874  N N    . GLY A 1 11 ? 6.768   0.016   7.243   1.00 0.00 ? 11 GLY A N    9  
ATOM 9875  C CA   . GLY A 1 11 ? 7.082   1.389   7.593   1.00 0.00 ? 11 GLY A CA   9  
ATOM 9876  C C    . GLY A 1 11 ? 8.144   1.989   6.692   1.00 0.00 ? 11 GLY A C    9  
ATOM 9877  O O    . GLY A 1 11 ? 9.004   2.740   7.150   1.00 0.00 ? 11 GLY A O    9  
ATOM 9878  H H    . GLY A 1 11 ? 6.255   -0.175  6.431   1.00 0.00 ? 11 GLY A H    9  
ATOM 9879  H HA2  . GLY A 1 11 ? 6.184   1.983   7.516   1.00 0.00 ? 11 GLY A HA2  9  
ATOM 9880  H HA3  . GLY A 1 11 ? 7.435   1.419   8.614   1.00 0.00 ? 11 GLY A HA3  9  
ATOM 9881  N N    . ASP A 1 12 ? 8.083   1.656   5.406   1.00 0.00 ? 12 ASP A N    9  
ATOM 9882  C CA   . ASP A 1 12 ? 9.047   2.167   4.438   1.00 0.00 ? 12 ASP A CA   9  
ATOM 9883  C C    . ASP A 1 12 ? 8.354   3.021   3.381   1.00 0.00 ? 12 ASP A C    9  
ATOM 9884  O O    . ASP A 1 12 ? 7.227   2.735   2.978   1.00 0.00 ? 12 ASP A O    9  
ATOM 9885  C CB   . ASP A 1 12 ? 9.791   1.008   3.769   1.00 0.00 ? 12 ASP A CB   9  
ATOM 9886  C CG   . ASP A 1 12 ? 11.214  0.868   4.274   1.00 0.00 ? 12 ASP A CG   9  
ATOM 9887  O OD1  . ASP A 1 12 ? 11.934  1.888   4.309   1.00 0.00 ? 12 ASP A OD1  9  
ATOM 9888  O OD2  . ASP A 1 12 ? 11.609  -0.261  4.634   1.00 0.00 ? 12 ASP A OD2  9  
ATOM 9889  H H    . ASP A 1 12 ? 7.374   1.053   5.102   1.00 0.00 ? 12 ASP A H    9  
ATOM 9890  H HA   . ASP A 1 12 ? 9.758   2.781   4.969   1.00 0.00 ? 12 ASP A HA   9  
ATOM 9891  H HB2  . ASP A 1 12 ? 9.266   0.087   3.971   1.00 0.00 ? 12 ASP A HB2  9  
ATOM 9892  H HB3  . ASP A 1 12 ? 9.822   1.173   2.702   1.00 0.00 ? 12 ASP A HB3  9  
ATOM 9893  N N    . ARG A 1 13 ? 9.035   4.073   2.938   1.00 0.00 ? 13 ARG A N    9  
ATOM 9894  C CA   . ARG A 1 13 ? 8.484   4.970   1.927   1.00 0.00 ? 13 ARG A CA   9  
ATOM 9895  C C    . ARG A 1 13 ? 8.641   4.376   0.531   1.00 0.00 ? 13 ARG A C    9  
ATOM 9896  O O    . ARG A 1 13 ? 9.750   4.288   0.003   1.00 0.00 ? 13 ARG A O    9  
ATOM 9897  C CB   . ARG A 1 13 ? 9.173   6.334   1.996   1.00 0.00 ? 13 ARG A CB   9  
ATOM 9898  C CG   . ARG A 1 13 ? 8.225   7.504   1.787   1.00 0.00 ? 13 ARG A CG   9  
ATOM 9899  C CD   . ARG A 1 13 ? 8.825   8.805   2.294   1.00 0.00 ? 13 ARG A CD   9  
ATOM 9900  N NE   . ARG A 1 13 ? 8.245   9.216   3.571   1.00 0.00 ? 13 ARG A NE   9  
ATOM 9901  C CZ   . ARG A 1 13 ? 8.812   10.096  4.394   1.00 0.00 ? 13 ARG A CZ   9  
ATOM 9902  N NH1  . ARG A 1 13 ? 9.972   10.658  4.079   1.00 0.00 ? 13 ARG A NH1  9  
ATOM 9903  N NH2  . ARG A 1 13 ? 8.217   10.413  5.535   1.00 0.00 ? 13 ARG A NH2  9  
ATOM 9904  H H    . ARG A 1 13 ? 9.929   4.250   3.297   1.00 0.00 ? 13 ARG A H    9  
ATOM 9905  H HA   . ARG A 1 13 ? 7.432   5.096   2.135   1.00 0.00 ? 13 ARG A HA   9  
ATOM 9906  H HB2  . ARG A 1 13 ? 9.636   6.442   2.966   1.00 0.00 ? 13 ARG A HB2  9  
ATOM 9907  H HB3  . ARG A 1 13 ? 9.938   6.378   1.235   1.00 0.00 ? 13 ARG A HB3  9  
ATOM 9908  H HG2  . ARG A 1 13 ? 8.016   7.603   0.733   1.00 0.00 ? 13 ARG A HG2  9  
ATOM 9909  H HG3  . ARG A 1 13 ? 7.306   7.310   2.322   1.00 0.00 ? 13 ARG A HG3  9  
ATOM 9910  H HD2  . ARG A 1 13 ? 9.889   8.672   2.420   1.00 0.00 ? 13 ARG A HD2  9  
ATOM 9911  H HD3  . ARG A 1 13 ? 8.644   9.579   1.562   1.00 0.00 ? 13 ARG A HD3  9  
ATOM 9912  H HE   . ARG A 1 13 ? 7.388   8.817   3.828   1.00 0.00 ? 13 ARG A HE   9  
ATOM 9913  H HH11 . ARG A 1 13 ? 10.427  10.422  3.220   1.00 0.00 ? 13 ARG A HH11 9  
ATOM 9914  H HH12 . ARG A 1 13 ? 10.393  11.318  4.702   1.00 0.00 ? 13 ARG A HH12 9  
ATOM 9915  H HH21 . ARG A 1 13 ? 7.342   9.994   5.777   1.00 0.00 ? 13 ARG A HH21 9  
ATOM 9916  H HH22 . ARG A 1 13 ? 8.642   11.074  6.154   1.00 0.00 ? 13 ARG A HH22 9  
ATOM 9917  N N    . VAL A 1 14 ? 7.523   3.971   -0.064  1.00 0.00 ? 14 VAL A N    9  
ATOM 9918  C CA   . VAL A 1 14 ? 7.536   3.387   -1.399  1.00 0.00 ? 14 VAL A CA   9  
ATOM 9919  C C    . VAL A 1 14 ? 6.783   4.264   -2.392  1.00 0.00 ? 14 VAL A C    9  
ATOM 9920  O O    . VAL A 1 14 ? 6.043   5.167   -2.001  1.00 0.00 ? 14 VAL A O    9  
ATOM 9921  C CB   . VAL A 1 14 ? 6.912   1.978   -1.401  1.00 0.00 ? 14 VAL A CB   9  
ATOM 9922  C CG1  . VAL A 1 14 ? 7.758   1.016   -0.581  1.00 0.00 ? 14 VAL A CG1  9  
ATOM 9923  C CG2  . VAL A 1 14 ? 5.485   2.027   -0.876  1.00 0.00 ? 14 VAL A CG2  9  
ATOM 9924  H H    . VAL A 1 14 ? 6.669   4.068   0.408   1.00 0.00 ? 14 VAL A H    9  
ATOM 9925  H HA   . VAL A 1 14 ? 8.566   3.301   -1.716  1.00 0.00 ? 14 VAL A HA   9  
ATOM 9926  H HB   . VAL A 1 14 ? 6.885   1.621   -2.420  1.00 0.00 ? 14 VAL A HB   9  
ATOM 9927  H HG11 . VAL A 1 14 ? 7.411   0.006   -0.742  1.00 0.00 ? 14 VAL A HG11 9  
ATOM 9928  H HG12 . VAL A 1 14 ? 7.673   1.264   0.466   1.00 0.00 ? 14 VAL A HG12 9  
ATOM 9929  H HG13 . VAL A 1 14 ? 8.791   1.095   -0.887  1.00 0.00 ? 14 VAL A HG13 9  
ATOM 9930  H HG21 . VAL A 1 14 ? 5.082   1.026   -0.834  1.00 0.00 ? 14 VAL A HG21 9  
ATOM 9931  H HG22 . VAL A 1 14 ? 4.879   2.631   -1.535  1.00 0.00 ? 14 VAL A HG22 9  
ATOM 9932  H HG23 . VAL A 1 14 ? 5.481   2.458   0.115   1.00 0.00 ? 14 VAL A HG23 9  
ATOM 9933  N N    . LEU A 1 15 ? 6.976   3.992   -3.679  1.00 0.00 ? 15 LEU A N    9  
ATOM 9934  C CA   . LEU A 1 15 ? 6.314   4.756   -4.729  1.00 0.00 ? 15 LEU A CA   9  
ATOM 9935  C C    . LEU A 1 15 ? 5.236   3.920   -5.412  1.00 0.00 ? 15 LEU A C    9  
ATOM 9936  O O    . LEU A 1 15 ? 5.502   2.815   -5.885  1.00 0.00 ? 15 LEU A O    9  
ATOM 9937  C CB   . LEU A 1 15 ? 7.335   5.235   -5.763  1.00 0.00 ? 15 LEU A CB   9  
ATOM 9938  C CG   . LEU A 1 15 ? 6.953   6.514   -6.507  1.00 0.00 ? 15 LEU A CG   9  
ATOM 9939  C CD1  . LEU A 1 15 ? 6.760   7.663   -5.530  1.00 0.00 ? 15 LEU A CD1  9  
ATOM 9940  C CD2  . LEU A 1 15 ? 8.012   6.865   -7.542  1.00 0.00 ? 15 LEU A CD2  9  
ATOM 9941  H H    . LEU A 1 15 ? 7.577   3.260   -3.927  1.00 0.00 ? 15 LEU A H    9  
ATOM 9942  H HA   . LEU A 1 15 ? 5.849   5.617   -4.271  1.00 0.00 ? 15 LEU A HA   9  
ATOM 9943  H HB2  . LEU A 1 15 ? 8.276   5.405   -5.257  1.00 0.00 ? 15 LEU A HB2  9  
ATOM 9944  H HB3  . LEU A 1 15 ? 7.474   4.450   -6.491  1.00 0.00 ? 15 LEU A HB3  9  
ATOM 9945  H HG   . LEU A 1 15 ? 6.018   6.356   -7.025  1.00 0.00 ? 15 LEU A HG   9  
ATOM 9946  H HD11 . LEU A 1 15 ? 5.800   7.565   -5.043  1.00 0.00 ? 15 LEU A HD11 9  
ATOM 9947  H HD12 . LEU A 1 15 ? 6.798   8.601   -6.064  1.00 0.00 ? 15 LEU A HD12 9  
ATOM 9948  H HD13 . LEU A 1 15 ? 7.543   7.640   -4.787  1.00 0.00 ? 15 LEU A HD13 9  
ATOM 9949  H HD21 . LEU A 1 15 ? 7.657   7.677   -8.160  1.00 0.00 ? 15 LEU A HD21 9  
ATOM 9950  H HD22 . LEU A 1 15 ? 8.208   6.002   -8.161  1.00 0.00 ? 15 LEU A HD22 9  
ATOM 9951  H HD23 . LEU A 1 15 ? 8.920   7.163   -7.041  1.00 0.00 ? 15 LEU A HD23 9  
ATOM 9952  N N    . VAL A 1 16 ? 4.021   4.454   -5.458  1.00 0.00 ? 16 VAL A N    9  
ATOM 9953  C CA   . VAL A 1 16 ? 2.904   3.756   -6.082  1.00 0.00 ? 16 VAL A CA   9  
ATOM 9954  C C    . VAL A 1 16 ? 2.473   4.448   -7.371  1.00 0.00 ? 16 VAL A C    9  
ATOM 9955  O O    . VAL A 1 16 ? 1.822   5.492   -7.339  1.00 0.00 ? 16 VAL A O    9  
ATOM 9956  C CB   . VAL A 1 16 ? 1.694   3.669   -5.131  1.00 0.00 ? 16 VAL A CB   9  
ATOM 9957  C CG1  . VAL A 1 16 ? 0.616   2.773   -5.718  1.00 0.00 ? 16 VAL A CG1  9  
ATOM 9958  C CG2  . VAL A 1 16 ? 2.128   3.169   -3.762  1.00 0.00 ? 16 VAL A CG2  9  
ATOM 9959  H H    . VAL A 1 16 ? 3.871   5.338   -5.063  1.00 0.00 ? 16 VAL A H    9  
ATOM 9960  H HA   . VAL A 1 16 ? 3.225   2.751   -6.314  1.00 0.00 ? 16 VAL A HA   9  
ATOM 9961  H HB   . VAL A 1 16 ? 1.282   4.661   -5.015  1.00 0.00 ? 16 VAL A HB   9  
ATOM 9962  H HG11 . VAL A 1 16 ? 0.120   2.236   -4.922  1.00 0.00 ? 16 VAL A HG11 9  
ATOM 9963  H HG12 . VAL A 1 16 ? 1.066   2.067   -6.401  1.00 0.00 ? 16 VAL A HG12 9  
ATOM 9964  H HG13 . VAL A 1 16 ? -0.106  3.377   -6.248  1.00 0.00 ? 16 VAL A HG13 9  
ATOM 9965  H HG21 . VAL A 1 16 ? 3.029   2.581   -3.862  1.00 0.00 ? 16 VAL A HG21 9  
ATOM 9966  H HG22 . VAL A 1 16 ? 1.345   2.559   -3.337  1.00 0.00 ? 16 VAL A HG22 9  
ATOM 9967  H HG23 . VAL A 1 16 ? 2.318   4.013   -3.115  1.00 0.00 ? 16 VAL A HG23 9  
ATOM 9968  N N    . GLY A 1 17 ? 2.840   3.859   -8.504  1.00 0.00 ? 17 GLY A N    9  
ATOM 9969  C CA   . GLY A 1 17 ? 2.481   4.433   -9.789  1.00 0.00 ? 17 GLY A CA   9  
ATOM 9970  C C    . GLY A 1 17 ? 3.579   5.306   -10.363 1.00 0.00 ? 17 GLY A C    9  
ATOM 9971  O O    . GLY A 1 17 ? 3.655   5.500   -11.577 1.00 0.00 ? 17 GLY A O    9  
ATOM 9972  H H    . GLY A 1 17 ? 3.357   3.027   -8.469  1.00 0.00 ? 17 GLY A H    9  
ATOM 9973  H HA2  . GLY A 1 17 ? 2.274   3.631   -10.482 1.00 0.00 ? 17 GLY A HA2  9  
ATOM 9974  H HA3  . GLY A 1 17 ? 1.589   5.027   -9.667  1.00 0.00 ? 17 GLY A HA3  9  
ATOM 9975  N N    . GLY A 1 18 ? 4.430   5.837   -9.491  1.00 0.00 ? 18 GLY A N    9  
ATOM 9976  C CA   . GLY A 1 18 ? 5.516   6.690   -9.940  1.00 0.00 ? 18 GLY A CA   9  
ATOM 9977  C C    . GLY A 1 18 ? 5.237   8.160   -9.692  1.00 0.00 ? 18 GLY A C    9  
ATOM 9978  O O    . GLY A 1 18 ? 5.752   9.024   -10.401 1.00 0.00 ? 18 GLY A O    9  
ATOM 9979  H H    . GLY A 1 18 ? 4.320   5.649   -8.535  1.00 0.00 ? 18 GLY A H    9  
ATOM 9980  H HA2  . GLY A 1 18 ? 6.417   6.412   -9.415  1.00 0.00 ? 18 GLY A HA2  9  
ATOM 9981  H HA3  . GLY A 1 18 ? 5.665   6.537   -10.998 1.00 0.00 ? 18 GLY A HA3  9  
ATOM 9982  N N    . THR A 1 19 ? 4.420   8.443   -8.683  1.00 0.00 ? 19 THR A N    9  
ATOM 9983  C CA   . THR A 1 19 ? 4.073   9.818   -8.342  1.00 0.00 ? 19 THR A CA   9  
ATOM 9984  C C    . THR A 1 19 ? 3.514   9.901   -6.926  1.00 0.00 ? 19 THR A C    9  
ATOM 9985  O O    . THR A 1 19 ? 3.887   10.782  -6.151  1.00 0.00 ? 19 THR A O    9  
ATOM 9986  C CB   . THR A 1 19 ? 3.053   10.370  -9.338  1.00 0.00 ? 19 THR A CB   9  
ATOM 9987  O OG1  . THR A 1 19 ? 2.169   9.349   -9.768  1.00 0.00 ? 19 THR A OG1  9  
ATOM 9988  C CG2  . THR A 1 19 ? 3.688   10.976  -10.571 1.00 0.00 ? 19 THR A CG2  9  
ATOM 9989  H H    . THR A 1 19 ? 4.041   7.710   -8.154  1.00 0.00 ? 19 THR A H    9  
ATOM 9990  H HA   . THR A 1 19 ? 4.974   10.410  -8.396  1.00 0.00 ? 19 THR A HA   9  
ATOM 9991  H HB   . THR A 1 19 ? 2.471   11.140  -8.853  1.00 0.00 ? 19 THR A HB   9  
ATOM 9992  H HG1  . THR A 1 19 ? 1.466   9.736   -10.296 1.00 0.00 ? 19 THR A HG1  9  
ATOM 9993  H HG21 . THR A 1 19 ? 2.963   11.592  -11.084 1.00 0.00 ? 19 THR A HG21 9  
ATOM 9994  H HG22 . THR A 1 19 ? 4.020   10.188  -11.230 1.00 0.00 ? 19 THR A HG22 9  
ATOM 9995  H HG23 . THR A 1 19 ? 4.532   11.583  -10.280 1.00 0.00 ? 19 THR A HG23 9  
ATOM 9996  N N    . LYS A 1 20 ? 2.618   8.978   -6.594  1.00 0.00 ? 20 LYS A N    9  
ATOM 9997  C CA   . LYS A 1 20 ? 2.007   8.946   -5.270  1.00 0.00 ? 20 LYS A CA   9  
ATOM 9998  C C    . LYS A 1 20 ? 2.935   8.281   -4.260  1.00 0.00 ? 20 LYS A C    9  
ATOM 9999  O O    . LYS A 1 20 ? 3.100   7.061   -4.262  1.00 0.00 ? 20 LYS A O    9  
ATOM 10000 C CB   . LYS A 1 20 ? 0.671   8.202   -5.320  1.00 0.00 ? 20 LYS A CB   9  
ATOM 10001 C CG   . LYS A 1 20 ? -0.241  8.663   -6.446  1.00 0.00 ? 20 LYS A CG   9  
ATOM 10002 C CD   . LYS A 1 20 ? -0.738  7.492   -7.280  1.00 0.00 ? 20 LYS A CD   9  
ATOM 10003 C CE   . LYS A 1 20 ? -2.197  7.665   -7.669  1.00 0.00 ? 20 LYS A CE   9  
ATOM 10004 N NZ   . LYS A 1 20 ? -2.791  6.397   -8.175  1.00 0.00 ? 20 LYS A NZ   9  
ATOM 10005 H H    . LYS A 1 20 ? 2.361   8.302   -7.255  1.00 0.00 ? 20 LYS A H    9  
ATOM 10006 H HA   . LYS A 1 20 ? 1.829   9.965   -4.962  1.00 0.00 ? 20 LYS A HA   9  
ATOM 10007 H HB2  . LYS A 1 20 ? 0.865   7.147   -5.450  1.00 0.00 ? 20 LYS A HB2  9  
ATOM 10008 H HB3  . LYS A 1 20 ? 0.154   8.350   -4.383  1.00 0.00 ? 20 LYS A HB3  9  
ATOM 10009 H HG2  . LYS A 1 20 ? -1.091  9.175   -6.020  1.00 0.00 ? 20 LYS A HG2  9  
ATOM 10010 H HG3  . LYS A 1 20 ? 0.307   9.341   -7.084  1.00 0.00 ? 20 LYS A HG3  9  
ATOM 10011 H HD2  . LYS A 1 20 ? -0.142  7.424   -8.177  1.00 0.00 ? 20 LYS A HD2  9  
ATOM 10012 H HD3  . LYS A 1 20 ? -0.633  6.584   -6.705  1.00 0.00 ? 20 LYS A HD3  9  
ATOM 10013 H HE2  . LYS A 1 20 ? -2.752  7.992   -6.802  1.00 0.00 ? 20 LYS A HE2  9  
ATOM 10014 H HE3  . LYS A 1 20 ? -2.263  8.418   -8.442  1.00 0.00 ? 20 LYS A HE3  9  
ATOM 10015 H HZ1  . LYS A 1 20 ? -3.474  6.599   -8.932  1.00 0.00 ? 20 LYS A HZ1  9  
ATOM 10016 H HZ2  . LYS A 1 20 ? -3.280  5.900   -7.404  1.00 0.00 ? 20 LYS A HZ2  9  
ATOM 10017 H HZ3  . LYS A 1 20 ? -2.044  5.779   -8.552  1.00 0.00 ? 20 LYS A HZ3  9  
ATOM 10018 N N    . THR A 1 21 ? 3.539   9.091   -3.397  1.00 0.00 ? 21 THR A N    9  
ATOM 10019 C CA   . THR A 1 21 ? 4.451   8.582   -2.380  1.00 0.00 ? 21 THR A CA   9  
ATOM 10020 C C    . THR A 1 21 ? 3.689   8.157   -1.129  1.00 0.00 ? 21 THR A C    9  
ATOM 10021 O O    . THR A 1 21 ? 2.934   8.941   -0.553  1.00 0.00 ? 21 THR A O    9  
ATOM 10022 C CB   . THR A 1 21 ? 5.492   9.643   -2.022  1.00 0.00 ? 21 THR A CB   9  
ATOM 10023 O OG1  . THR A 1 21 ? 4.890   10.723  -1.331  1.00 0.00 ? 21 THR A OG1  9  
ATOM 10024 C CG2  . THR A 1 21 ? 6.205   10.212  -3.229  1.00 0.00 ? 21 THR A CG2  9  
ATOM 10025 H H    . THR A 1 21 ? 3.367   10.055  -3.445  1.00 0.00 ? 21 THR A H    9  
ATOM 10026 H HA   . THR A 1 21 ? 4.956   7.719   -2.790  1.00 0.00 ? 21 THR A HA   9  
ATOM 10027 H HB   . THR A 1 21 ? 6.236   9.199   -1.377  1.00 0.00 ? 21 THR A HB   9  
ATOM 10028 H HG1  . THR A 1 21 ? 4.172   11.081  -1.859  1.00 0.00 ? 21 THR A HG1  9  
ATOM 10029 H HG21 . THR A 1 21 ? 6.755   11.096  -2.939  1.00 0.00 ? 21 THR A HG21 9  
ATOM 10030 H HG22 . THR A 1 21 ? 5.481   10.470  -3.986  1.00 0.00 ? 21 THR A HG22 9  
ATOM 10031 H HG23 . THR A 1 21 ? 6.891   9.475   -3.622  1.00 0.00 ? 21 THR A HG23 9  
ATOM 10032 N N    . GLY A 1 22 ? 3.891   6.910   -0.715  1.00 0.00 ? 22 GLY A N    9  
ATOM 10033 C CA   . GLY A 1 22 ? 3.216   6.403   0.465   1.00 0.00 ? 22 GLY A CA   9  
ATOM 10034 C C    . GLY A 1 22 ? 4.054   5.394   1.225   1.00 0.00 ? 22 GLY A C    9  
ATOM 10035 O O    . GLY A 1 22 ? 4.872   4.688   0.636   1.00 0.00 ? 22 GLY A O    9  
ATOM 10036 H H    . GLY A 1 22 ? 4.504   6.331   -1.214  1.00 0.00 ? 22 GLY A H    9  
ATOM 10037 H HA2  . GLY A 1 22 ? 2.987   7.231   1.120   1.00 0.00 ? 22 GLY A HA2  9  
ATOM 10038 H HA3  . GLY A 1 22 ? 2.292   5.931   0.162   1.00 0.00 ? 22 GLY A HA3  9  
ATOM 10039 N N    . VAL A 1 23 ? 3.852   5.327   2.537   1.00 0.00 ? 23 VAL A N    9  
ATOM 10040 C CA   . VAL A 1 23 ? 4.595   4.398   3.378   1.00 0.00 ? 23 VAL A CA   9  
ATOM 10041 C C    . VAL A 1 23 ? 3.886   3.051   3.468   1.00 0.00 ? 23 VAL A C    9  
ATOM 10042 O O    . VAL A 1 23 ? 2.661   2.988   3.564   1.00 0.00 ? 23 VAL A O    9  
ATOM 10043 C CB   . VAL A 1 23 ? 4.789   4.958   4.800   1.00 0.00 ? 23 VAL A CB   9  
ATOM 10044 C CG1  . VAL A 1 23 ? 5.732   4.072   5.599   1.00 0.00 ? 23 VAL A CG1  9  
ATOM 10045 C CG2  . VAL A 1 23 ? 5.307   6.388   4.744   1.00 0.00 ? 23 VAL A CG2  9  
ATOM 10046 H H    . VAL A 1 23 ? 3.185   5.916   2.948   1.00 0.00 ? 23 VAL A H    9  
ATOM 10047 H HA   . VAL A 1 23 ? 5.569   4.252   2.935   1.00 0.00 ? 23 VAL A HA   9  
ATOM 10048 H HB   . VAL A 1 23 ? 3.831   4.964   5.296   1.00 0.00 ? 23 VAL A HB   9  
ATOM 10049 H HG11 . VAL A 1 23 ? 5.157   3.362   6.175   1.00 0.00 ? 23 VAL A HG11 9  
ATOM 10050 H HG12 . VAL A 1 23 ? 6.323   4.684   6.265   1.00 0.00 ? 23 VAL A HG12 9  
ATOM 10051 H HG13 . VAL A 1 23 ? 6.386   3.541   4.923   1.00 0.00 ? 23 VAL A HG13 9  
ATOM 10052 H HG21 . VAL A 1 23 ? 5.895   6.592   5.627   1.00 0.00 ? 23 VAL A HG21 9  
ATOM 10053 H HG22 . VAL A 1 23 ? 4.473   7.072   4.702   1.00 0.00 ? 23 VAL A HG22 9  
ATOM 10054 H HG23 . VAL A 1 23 ? 5.921   6.514   3.866   1.00 0.00 ? 23 VAL A HG23 9  
ATOM 10055 N N    . VAL A 1 24 ? 4.665   1.975   3.435   1.00 0.00 ? 24 VAL A N    9  
ATOM 10056 C CA   . VAL A 1 24 ? 4.113   0.629   3.513   1.00 0.00 ? 24 VAL A CA   9  
ATOM 10057 C C    . VAL A 1 24 ? 3.519   0.358   4.891   1.00 0.00 ? 24 VAL A C    9  
ATOM 10058 O O    . VAL A 1 24 ? 4.189   0.527   5.910   1.00 0.00 ? 24 VAL A O    9  
ATOM 10059 C CB   . VAL A 1 24 ? 5.183   -0.436  3.209   1.00 0.00 ? 24 VAL A CB   9  
ATOM 10060 C CG1  . VAL A 1 24 ? 4.550   -1.815  3.101   1.00 0.00 ? 24 VAL A CG1  9  
ATOM 10061 C CG2  . VAL A 1 24 ? 5.936   -0.087  1.934   1.00 0.00 ? 24 VAL A CG2  9  
ATOM 10062 H H    . VAL A 1 24 ? 5.636   2.090   3.357   1.00 0.00 ? 24 VAL A H    9  
ATOM 10063 H HA   . VAL A 1 24 ? 3.331   0.546   2.772   1.00 0.00 ? 24 VAL A HA   9  
ATOM 10064 H HB   . VAL A 1 24 ? 5.889   -0.452  4.025   1.00 0.00 ? 24 VAL A HB   9  
ATOM 10065 H HG11 . VAL A 1 24 ? 3.515   -1.714  2.809   1.00 0.00 ? 24 VAL A HG11 9  
ATOM 10066 H HG12 . VAL A 1 24 ? 4.607   -2.313  4.058   1.00 0.00 ? 24 VAL A HG12 9  
ATOM 10067 H HG13 . VAL A 1 24 ? 5.077   -2.397  2.361   1.00 0.00 ? 24 VAL A HG13 9  
ATOM 10068 H HG21 . VAL A 1 24 ? 5.231   0.117   1.143   1.00 0.00 ? 24 VAL A HG21 9  
ATOM 10069 H HG22 . VAL A 1 24 ? 6.566   -0.917  1.649   1.00 0.00 ? 24 VAL A HG22 9  
ATOM 10070 H HG23 . VAL A 1 24 ? 6.549   0.786   2.106   1.00 0.00 ? 24 VAL A HG23 9  
ATOM 10071 N N    . ARG A 1 25 ? 2.259   -0.064  4.915   1.00 0.00 ? 25 ARG A N    9  
ATOM 10072 C CA   . ARG A 1 25 ? 1.575   -0.358  6.167   1.00 0.00 ? 25 ARG A CA   9  
ATOM 10073 C C    . ARG A 1 25 ? 1.356   -1.860  6.331   1.00 0.00 ? 25 ARG A C    9  
ATOM 10074 O O    . ARG A 1 25 ? 1.278   -2.367  7.451   1.00 0.00 ? 25 ARG A O    9  
ATOM 10075 C CB   . ARG A 1 25 ? 0.232   0.375   6.225   1.00 0.00 ? 25 ARG A CB   9  
ATOM 10076 C CG   . ARG A 1 25 ? 0.286   1.679   7.003   1.00 0.00 ? 25 ARG A CG   9  
ATOM 10077 C CD   . ARG A 1 25 ? 0.530   1.433   8.484   1.00 0.00 ? 25 ARG A CD   9  
ATOM 10078 N NE   . ARG A 1 25 ? 1.180   2.572   9.129   1.00 0.00 ? 25 ARG A NE   9  
ATOM 10079 C CZ   . ARG A 1 25 ? 0.537   3.672   9.511   1.00 0.00 ? 25 ARG A CZ   9  
ATOM 10080 N NH1  . ARG A 1 25 ? -0.770  3.789   9.313   1.00 0.00 ? 25 ARG A NH1  9  
ATOM 10081 N NH2  . ARG A 1 25 ? 1.204   4.660   10.094  1.00 0.00 ? 25 ARG A NH2  9  
ATOM 10082 H H    . ARG A 1 25 ? 1.779   -0.179  4.069   1.00 0.00 ? 25 ARG A H    9  
ATOM 10083 H HA   . ARG A 1 25 ? 2.200   -0.008  6.975   1.00 0.00 ? 25 ARG A HA   9  
ATOM 10084 H HB2  . ARG A 1 25 ? -0.087  0.596   5.216   1.00 0.00 ? 25 ARG A HB2  9  
ATOM 10085 H HB3  . ARG A 1 25 ? -0.498  -0.268  6.691   1.00 0.00 ? 25 ARG A HB3  9  
ATOM 10086 H HG2  . ARG A 1 25 ? 1.088   2.288   6.612   1.00 0.00 ? 25 ARG A HG2  9  
ATOM 10087 H HG3  . ARG A 1 25 ? -0.654  2.198   6.884   1.00 0.00 ? 25 ARG A HG3  9  
ATOM 10088 H HD2  . ARG A 1 25 ? -0.419  1.252   8.966   1.00 0.00 ? 25 ARG A HD2  9  
ATOM 10089 H HD3  . ARG A 1 25 ? 1.160   0.563   8.591   1.00 0.00 ? 25 ARG A HD3  9  
ATOM 10090 H HE   . ARG A 1 25 ? 2.145   2.512   9.285   1.00 0.00 ? 25 ARG A HE   9  
ATOM 10091 H HH11 . ARG A 1 25 ? -1.279  3.049   8.874   1.00 0.00 ? 25 ARG A HH11 9  
ATOM 10092 H HH12 . ARG A 1 25 ? -1.247  4.619   9.604   1.00 0.00 ? 25 ARG A HH12 9  
ATOM 10093 H HH21 . ARG A 1 25 ? 2.189   4.577   10.245  1.00 0.00 ? 25 ARG A HH21 9  
ATOM 10094 H HH22 . ARG A 1 25 ? 0.721   5.488   10.382  1.00 0.00 ? 25 ARG A HH22 9  
ATOM 10095 N N    . TYR A 1 26 ? 1.261   -2.567  5.209   1.00 0.00 ? 26 TYR A N    9  
ATOM 10096 C CA   . TYR A 1 26 ? 1.053   -4.009  5.231   1.00 0.00 ? 26 TYR A CA   9  
ATOM 10097 C C    . TYR A 1 26 ? 1.926   -4.699  4.188   1.00 0.00 ? 26 TYR A C    9  
ATOM 10098 O O    . TYR A 1 26 ? 2.053   -4.227  3.059   1.00 0.00 ? 26 TYR A O    9  
ATOM 10099 C CB   . TYR A 1 26 ? -0.420  -4.339  4.978   1.00 0.00 ? 26 TYR A CB   9  
ATOM 10100 C CG   . TYR A 1 26 ? -0.774  -5.781  5.263   1.00 0.00 ? 26 TYR A CG   9  
ATOM 10101 C CD1  . TYR A 1 26 ? -0.693  -6.294  6.551   1.00 0.00 ? 26 TYR A CD1  9  
ATOM 10102 C CD2  . TYR A 1 26 ? -1.191  -6.628  4.244   1.00 0.00 ? 26 TYR A CD2  9  
ATOM 10103 C CE1  . TYR A 1 26 ? -1.016  -7.612  6.816   1.00 0.00 ? 26 TYR A CE1  9  
ATOM 10104 C CE2  . TYR A 1 26 ? -1.516  -7.946  4.500   1.00 0.00 ? 26 TYR A CE2  9  
ATOM 10105 C CZ   . TYR A 1 26 ? -1.427  -8.433  5.787   1.00 0.00 ? 26 TYR A CZ   9  
ATOM 10106 O OH   . TYR A 1 26 ? -1.749  -9.745  6.046   1.00 0.00 ? 26 TYR A OH   9  
ATOM 10107 H H    . TYR A 1 26 ? 1.333   -2.108  4.347   1.00 0.00 ? 26 TYR A H    9  
ATOM 10108 H HA   . TYR A 1 26 ? 1.330   -4.370  6.210   1.00 0.00 ? 26 TYR A HA   9  
ATOM 10109 H HB2  . TYR A 1 26 ? -1.034  -3.715  5.610   1.00 0.00 ? 26 TYR A HB2  9  
ATOM 10110 H HB3  . TYR A 1 26 ? -0.654  -4.136  3.943   1.00 0.00 ? 26 TYR A HB3  9  
ATOM 10111 H HD1  . TYR A 1 26 ? -0.371  -5.649  7.355   1.00 0.00 ? 26 TYR A HD1  9  
ATOM 10112 H HD2  . TYR A 1 26 ? -1.261  -6.243  3.237   1.00 0.00 ? 26 TYR A HD2  9  
ATOM 10113 H HE1  . TYR A 1 26 ? -0.945  -7.993  7.823   1.00 0.00 ? 26 TYR A HE1  9  
ATOM 10114 H HE2  . TYR A 1 26 ? -1.838  -8.589  3.694   1.00 0.00 ? 26 TYR A HE2  9  
ATOM 10115 H HH   . TYR A 1 26 ? -0.948  -10.274 6.065   1.00 0.00 ? 26 TYR A HH   9  
ATOM 10116 N N    . VAL A 1 27 ? 2.527   -5.820  4.575   1.00 0.00 ? 27 VAL A N    9  
ATOM 10117 C CA   . VAL A 1 27 ? 3.389   -6.573  3.673   1.00 0.00 ? 27 VAL A CA   9  
ATOM 10118 C C    . VAL A 1 27 ? 3.121   -8.071  3.781   1.00 0.00 ? 27 VAL A C    9  
ATOM 10119 O O    . VAL A 1 27 ? 3.353   -8.679  4.826   1.00 0.00 ? 27 VAL A O    9  
ATOM 10120 C CB   . VAL A 1 27 ? 4.878   -6.306  3.968   1.00 0.00 ? 27 VAL A CB   9  
ATOM 10121 C CG1  . VAL A 1 27 ? 5.760   -6.964  2.917   1.00 0.00 ? 27 VAL A CG1  9  
ATOM 10122 C CG2  . VAL A 1 27 ? 5.147   -4.811  4.039   1.00 0.00 ? 27 VAL A CG2  9  
ATOM 10123 H H    . VAL A 1 27 ? 2.388   -6.146  5.488   1.00 0.00 ? 27 VAL A H    9  
ATOM 10124 H HA   . VAL A 1 27 ? 3.180   -6.251  2.664   1.00 0.00 ? 27 VAL A HA   9  
ATOM 10125 H HB   . VAL A 1 27 ? 5.117   -6.738  4.928   1.00 0.00 ? 27 VAL A HB   9  
ATOM 10126 H HG11 . VAL A 1 27 ? 5.281   -7.863  2.556   1.00 0.00 ? 27 VAL A HG11 9  
ATOM 10127 H HG12 . VAL A 1 27 ? 6.714   -7.216  3.355   1.00 0.00 ? 27 VAL A HG12 9  
ATOM 10128 H HG13 . VAL A 1 27 ? 5.911   -6.281  2.095   1.00 0.00 ? 27 VAL A HG13 9  
ATOM 10129 H HG21 . VAL A 1 27 ? 6.131   -4.603  3.646   1.00 0.00 ? 27 VAL A HG21 9  
ATOM 10130 H HG22 . VAL A 1 27 ? 5.094   -4.484  5.067   1.00 0.00 ? 27 VAL A HG22 9  
ATOM 10131 H HG23 . VAL A 1 27 ? 4.408   -4.283  3.454   1.00 0.00 ? 27 VAL A HG23 9  
ATOM 10132 N N    . GLY A 1 28 ? 2.631   -8.658  2.695   1.00 0.00 ? 28 GLY A N    9  
ATOM 10133 C CA   . GLY A 1 28 ? 2.338   -10.079 2.687   1.00 0.00 ? 28 GLY A CA   9  
ATOM 10134 C C    . GLY A 1 28 ? 1.313   -10.454 1.635   1.00 0.00 ? 28 GLY A C    9  
ATOM 10135 O O    . GLY A 1 28 ? 1.006   -9.659  0.747   1.00 0.00 ? 28 GLY A O    9  
ATOM 10136 H H    . GLY A 1 28 ? 2.467   -8.121  1.891   1.00 0.00 ? 28 GLY A H    9  
ATOM 10137 H HA2  . GLY A 1 28 ? 3.251   -10.622 2.495   1.00 0.00 ? 28 GLY A HA2  9  
ATOM 10138 H HA3  . GLY A 1 28 ? 1.961   -10.363 3.659   1.00 0.00 ? 28 GLY A HA3  9  
ATOM 10139 N N    . GLU A 1 29 ? 0.785   -11.669 1.734   1.00 0.00 ? 29 GLU A N    9  
ATOM 10140 C CA   . GLU A 1 29 ? -0.212  -12.149 0.783   1.00 0.00 ? 29 GLU A CA   9  
ATOM 10141 C C    . GLU A 1 29 ? -1.609  -11.685 1.180   1.00 0.00 ? 29 GLU A C    9  
ATOM 10142 O O    . GLU A 1 29 ? -1.886  -11.448 2.355   1.00 0.00 ? 29 GLU A O    9  
ATOM 10143 C CB   . GLU A 1 29 ? -0.174  -13.677 0.699   1.00 0.00 ? 29 GLU A CB   9  
ATOM 10144 C CG   . GLU A 1 29 ? 1.066   -14.217 0.006   1.00 0.00 ? 29 GLU A CG   9  
ATOM 10145 C CD   . GLU A 1 29 ? 0.830   -15.569 -0.638  1.00 0.00 ? 29 GLU A CD   9  
ATOM 10146 O OE1  . GLU A 1 29 ? 0.304   -15.603 -1.771  1.00 0.00 ? 29 GLU A OE1  9  
ATOM 10147 O OE2  . GLU A 1 29 ? 1.171   -16.593 -0.011  1.00 0.00 ? 29 GLU A OE2  9  
ATOM 10148 H H    . GLU A 1 29 ? 1.071   -12.257 2.464   1.00 0.00 ? 29 GLU A H    9  
ATOM 10149 H HA   . GLU A 1 29 ? 0.030   -11.738 -0.186  1.00 0.00 ? 29 GLU A HA   9  
ATOM 10150 H HB2  . GLU A 1 29 ? -0.205  -14.081 1.700   1.00 0.00 ? 29 GLU A HB2  9  
ATOM 10151 H HB3  . GLU A 1 29 ? -1.042  -14.017 0.156   1.00 0.00 ? 29 GLU A HB3  9  
ATOM 10152 H HG2  . GLU A 1 29 ? 1.368   -13.518 -0.760  1.00 0.00 ? 29 GLU A HG2  9  
ATOM 10153 H HG3  . GLU A 1 29 ? 1.857   -14.315 0.735   1.00 0.00 ? 29 GLU A HG3  9  
ATOM 10154 N N    . THR A 1 30 ? -2.487  -11.557 0.190   1.00 0.00 ? 30 THR A N    9  
ATOM 10155 C CA   . THR A 1 30 ? -3.857  -11.121 0.435   1.00 0.00 ? 30 THR A CA   9  
ATOM 10156 C C    . THR A 1 30 ? -4.806  -12.314 0.486   1.00 0.00 ? 30 THR A C    9  
ATOM 10157 O O    . THR A 1 30 ? -4.379  -13.464 0.393   1.00 0.00 ? 30 THR A O    9  
ATOM 10158 C CB   . THR A 1 30 ? -4.305  -10.144 -0.653  1.00 0.00 ? 30 THR A CB   9  
ATOM 10159 O OG1  . THR A 1 30 ? -4.248  -10.754 -1.930  1.00 0.00 ? 30 THR A OG1  9  
ATOM 10160 C CG2  . THR A 1 30 ? -3.469  -8.884  -0.708  1.00 0.00 ? 30 THR A CG2  9  
ATOM 10161 H H    . THR A 1 30 ? -2.208  -11.761 -0.727  1.00 0.00 ? 30 THR A H    9  
ATOM 10162 H HA   . THR A 1 30 ? -3.879  -10.618 1.390   1.00 0.00 ? 30 THR A HA   9  
ATOM 10163 H HB   . THR A 1 30 ? -5.328  -9.854  -0.462  1.00 0.00 ? 30 THR A HB   9  
ATOM 10164 H HG1  . THR A 1 30 ? -4.724  -11.588 -1.908  1.00 0.00 ? 30 THR A HG1  9  
ATOM 10165 H HG21 . THR A 1 30 ? -2.607  -8.995  -0.066  1.00 0.00 ? 30 THR A HG21 9  
ATOM 10166 H HG22 . THR A 1 30 ? -4.061  -8.044  -0.376  1.00 0.00 ? 30 THR A HG22 9  
ATOM 10167 H HG23 . THR A 1 30 ? -3.141  -8.714  -1.723  1.00 0.00 ? 30 THR A HG23 9  
ATOM 10168 N N    . ASP A 1 31 ? -6.096  -12.031 0.634   1.00 0.00 ? 31 ASP A N    9  
ATOM 10169 C CA   . ASP A 1 31 ? -7.107  -13.081 0.698   1.00 0.00 ? 31 ASP A CA   9  
ATOM 10170 C C    . ASP A 1 31 ? -7.845  -13.206 -0.631  1.00 0.00 ? 31 ASP A C    9  
ATOM 10171 O O    . ASP A 1 31 ? -8.280  -14.294 -1.011  1.00 0.00 ? 31 ASP A O    9  
ATOM 10172 C CB   . ASP A 1 31 ? -8.102  -12.792 1.823   1.00 0.00 ? 31 ASP A CB   9  
ATOM 10173 C CG   . ASP A 1 31 ? -7.601  -13.263 3.174   1.00 0.00 ? 31 ASP A CG   9  
ATOM 10174 O OD1  . ASP A 1 31 ? -6.368  -13.392 3.338   1.00 0.00 ? 31 ASP A OD1  9  
ATOM 10175 O OD2  . ASP A 1 31 ? -8.438  -13.501 4.068   1.00 0.00 ? 31 ASP A OD2  9  
ATOM 10176 H H    . ASP A 1 31 ? -6.375  -11.095 0.702   1.00 0.00 ? 31 ASP A H    9  
ATOM 10177 H HA   . ASP A 1 31 ? -6.603  -14.013 0.905   1.00 0.00 ? 31 ASP A HA   9  
ATOM 10178 H HB2  . ASP A 1 31 ? -8.278  -11.728 1.876   1.00 0.00 ? 31 ASP A HB2  9  
ATOM 10179 H HB3  . ASP A 1 31 ? -9.032  -13.296 1.609   1.00 0.00 ? 31 ASP A HB3  9  
ATOM 10180 N N    . PHE A 1 32 ? -7.983  -12.087 -1.334  1.00 0.00 ? 32 PHE A N    9  
ATOM 10181 C CA   . PHE A 1 32 ? -8.669  -12.071 -2.620  1.00 0.00 ? 32 PHE A CA   9  
ATOM 10182 C C    . PHE A 1 32 ? -7.701  -12.375 -3.758  1.00 0.00 ? 32 PHE A C    9  
ATOM 10183 O O    . PHE A 1 32 ? -8.005  -13.166 -4.651  1.00 0.00 ? 32 PHE A O    9  
ATOM 10184 C CB   . PHE A 1 32 ? -9.333  -10.712 -2.850  1.00 0.00 ? 32 PHE A CB   9  
ATOM 10185 C CG   . PHE A 1 32 ? -8.382  -9.553  -2.738  1.00 0.00 ? 32 PHE A CG   9  
ATOM 10186 C CD1  . PHE A 1 32 ? -7.656  -9.126  -3.838  1.00 0.00 ? 32 PHE A CD1  9  
ATOM 10187 C CD2  . PHE A 1 32 ? -8.216  -8.893  -1.531  1.00 0.00 ? 32 PHE A CD2  9  
ATOM 10188 C CE1  . PHE A 1 32 ? -6.782  -8.061  -3.737  1.00 0.00 ? 32 PHE A CE1  9  
ATOM 10189 C CE2  . PHE A 1 32 ? -7.344  -7.827  -1.424  1.00 0.00 ? 32 PHE A CE2  9  
ATOM 10190 C CZ   . PHE A 1 32 ? -6.625  -7.410  -2.528  1.00 0.00 ? 32 PHE A CZ   9  
ATOM 10191 H H    . PHE A 1 32 ? -7.615  -11.250 -0.978  1.00 0.00 ? 32 PHE A H    9  
ATOM 10192 H HA   . PHE A 1 32 ? -9.433  -12.834 -2.598  1.00 0.00 ? 32 PHE A HA   9  
ATOM 10193 H HB2  . PHE A 1 32 ? -9.763  -10.692 -3.841  1.00 0.00 ? 32 PHE A HB2  9  
ATOM 10194 H HB3  . PHE A 1 32 ? -10.117 -10.573 -2.121  1.00 0.00 ? 32 PHE A HB3  9  
ATOM 10195 H HD1  . PHE A 1 32 ? -7.779  -9.634  -4.783  1.00 0.00 ? 32 PHE A HD1  9  
ATOM 10196 H HD2  . PHE A 1 32 ? -8.778  -9.217  -0.668  1.00 0.00 ? 32 PHE A HD2  9  
ATOM 10197 H HE1  . PHE A 1 32 ? -6.221  -7.738  -4.601  1.00 0.00 ? 32 PHE A HE1  9  
ATOM 10198 H HE2  . PHE A 1 32 ? -7.223  -7.319  -0.478  1.00 0.00 ? 32 PHE A HE2  9  
ATOM 10199 H HZ   . PHE A 1 32 ? -5.942  -6.578  -2.447  1.00 0.00 ? 32 PHE A HZ   9  
ATOM 10200 N N    . ALA A 1 33 ? -6.532  -11.743 -3.718  1.00 0.00 ? 33 ALA A N    9  
ATOM 10201 C CA   . ALA A 1 33 ? -5.519  -11.947 -4.746  1.00 0.00 ? 33 ALA A CA   9  
ATOM 10202 C C    . ALA A 1 33 ? -4.764  -13.253 -4.524  1.00 0.00 ? 33 ALA A C    9  
ATOM 10203 O O    . ALA A 1 33 ? -5.066  -14.005 -3.597  1.00 0.00 ? 33 ALA A O    9  
ATOM 10204 C CB   . ALA A 1 33 ? -4.550  -10.774 -4.771  1.00 0.00 ? 33 ALA A CB   9  
ATOM 10205 H H    . ALA A 1 33 ? -6.348  -11.125 -2.982  1.00 0.00 ? 33 ALA A H    9  
ATOM 10206 H HA   . ALA A 1 33 ? -6.019  -11.989 -5.704  1.00 0.00 ? 33 ALA A HA   9  
ATOM 10207 H HB1  . ALA A 1 33 ? -3.725  -10.975 -4.103  1.00 0.00 ? 33 ALA A HB1  9  
ATOM 10208 H HB2  . ALA A 1 33 ? -5.062  -9.878  -4.451  1.00 0.00 ? 33 ALA A HB2  9  
ATOM 10209 H HB3  . ALA A 1 33 ? -4.177  -10.636 -5.774  1.00 0.00 ? 33 ALA A HB3  9  
ATOM 10210 N N    . LYS A 1 34 ? -3.784  -13.517 -5.381  1.00 0.00 ? 34 LYS A N    9  
ATOM 10211 C CA   . LYS A 1 34 ? -2.985  -14.733 -5.279  1.00 0.00 ? 34 LYS A CA   9  
ATOM 10212 C C    . LYS A 1 34 ? -1.491  -14.414 -5.276  1.00 0.00 ? 34 LYS A C    9  
ATOM 10213 O O    . LYS A 1 34 ? -0.662  -15.287 -5.533  1.00 0.00 ? 34 LYS A O    9  
ATOM 10214 C CB   . LYS A 1 34 ? -3.309  -15.677 -6.438  1.00 0.00 ? 34 LYS A CB   9  
ATOM 10215 C CG   . LYS A 1 34 ? -2.957  -17.129 -6.159  1.00 0.00 ? 34 LYS A CG   9  
ATOM 10216 C CD   . LYS A 1 34 ? -4.177  -17.923 -5.718  1.00 0.00 ? 34 LYS A CD   9  
ATOM 10217 C CE   . LYS A 1 34 ? -4.015  -19.404 -6.020  1.00 0.00 ? 34 LYS A CE   9  
ATOM 10218 N NZ   . LYS A 1 34 ? -2.817  -19.981 -5.350  1.00 0.00 ? 34 LYS A NZ   9  
ATOM 10219 H H    . LYS A 1 34 ? -3.592  -12.879 -6.099  1.00 0.00 ? 34 LYS A H    9  
ATOM 10220 H HA   . LYS A 1 34 ? -3.239  -15.220 -4.350  1.00 0.00 ? 34 LYS A HA   9  
ATOM 10221 H HB2  . LYS A 1 34 ? -4.368  -15.618 -6.649  1.00 0.00 ? 34 LYS A HB2  9  
ATOM 10222 H HB3  . LYS A 1 34 ? -2.760  -15.356 -7.310  1.00 0.00 ? 34 LYS A HB3  9  
ATOM 10223 H HG2  . LYS A 1 34 ? -2.559  -17.571 -7.059  1.00 0.00 ? 34 LYS A HG2  9  
ATOM 10224 H HG3  . LYS A 1 34 ? -2.213  -17.164 -5.377  1.00 0.00 ? 34 LYS A HG3  9  
ATOM 10225 H HD2  . LYS A 1 34 ? -4.312  -17.796 -4.655  1.00 0.00 ? 34 LYS A HD2  9  
ATOM 10226 H HD3  . LYS A 1 34 ? -5.045  -17.550 -6.241  1.00 0.00 ? 34 LYS A HD3  9  
ATOM 10227 H HE2  . LYS A 1 34 ? -4.895  -19.927 -5.676  1.00 0.00 ? 34 LYS A HE2  9  
ATOM 10228 H HE3  . LYS A 1 34 ? -3.916  -19.532 -7.088  1.00 0.00 ? 34 LYS A HE3  9  
ATOM 10229 H HZ1  . LYS A 1 34 ? -2.742  -20.995 -5.563  1.00 0.00 ? 34 LYS A HZ1  9  
ATOM 10230 H HZ2  . LYS A 1 34 ? -2.890  -19.859 -4.319  1.00 0.00 ? 34 LYS A HZ2  9  
ATOM 10231 H HZ3  . LYS A 1 34 ? -1.956  -19.502 -5.683  1.00 0.00 ? 34 LYS A HZ3  9  
ATOM 10232 N N    . GLY A 1 35 ? -1.153  -13.162 -4.984  1.00 0.00 ? 35 GLY A N    9  
ATOM 10233 C CA   . GLY A 1 35 ? 0.242   -12.759 -4.956  1.00 0.00 ? 35 GLY A CA   9  
ATOM 10234 C C    . GLY A 1 35 ? 0.591   -11.967 -3.710  1.00 0.00 ? 35 GLY A C    9  
ATOM 10235 O O    . GLY A 1 35 ? -0.161  -11.968 -2.736  1.00 0.00 ? 35 GLY A O    9  
ATOM 10236 H H    . GLY A 1 35 ? -1.853  -12.508 -4.788  1.00 0.00 ? 35 GLY A H    9  
ATOM 10237 H HA2  . GLY A 1 35 ? 0.862   -13.642 -4.993  1.00 0.00 ? 35 GLY A HA2  9  
ATOM 10238 H HA3  . GLY A 1 35 ? 0.446   -12.151 -5.825  1.00 0.00 ? 35 GLY A HA3  9  
ATOM 10239 N N    . GLU A 1 36 ? 1.734   -11.292 -3.743  1.00 0.00 ? 36 GLU A N    9  
ATOM 10240 C CA   . GLU A 1 36 ? 2.182   -10.493 -2.607  1.00 0.00 ? 36 GLU A CA   9  
ATOM 10241 C C    . GLU A 1 36 ? 1.839   -9.020  -2.811  1.00 0.00 ? 36 GLU A C    9  
ATOM 10242 O O    . GLU A 1 36 ? 2.437   -8.343  -3.648  1.00 0.00 ? 36 GLU A O    9  
ATOM 10243 C CB   . GLU A 1 36 ? 3.690   -10.659 -2.403  1.00 0.00 ? 36 GLU A CB   9  
ATOM 10244 C CG   . GLU A 1 36 ? 4.051   -11.442 -1.152  1.00 0.00 ? 36 GLU A CG   9  
ATOM 10245 C CD   . GLU A 1 36 ? 5.183   -10.804 -0.370  1.00 0.00 ? 36 GLU A CD   9  
ATOM 10246 O OE1  . GLU A 1 36 ? 5.312   -9.562  -0.419  1.00 0.00 ? 36 GLU A OE1  9  
ATOM 10247 O OE2  . GLU A 1 36 ? 5.940   -11.546 0.290   1.00 0.00 ? 36 GLU A OE2  9  
ATOM 10248 H H    . GLU A 1 36 ? 2.291   -11.331 -4.548  1.00 0.00 ? 36 GLU A H    9  
ATOM 10249 H HA   . GLU A 1 36 ? 1.667   -10.851 -1.728  1.00 0.00 ? 36 GLU A HA   9  
ATOM 10250 H HB2  . GLU A 1 36 ? 4.101   -11.177 -3.257  1.00 0.00 ? 36 GLU A HB2  9  
ATOM 10251 H HB3  . GLU A 1 36 ? 4.144   -9.681  -2.334  1.00 0.00 ? 36 GLU A HB3  9  
ATOM 10252 H HG2  . GLU A 1 36 ? 3.181   -11.497 -0.514  1.00 0.00 ? 36 GLU A HG2  9  
ATOM 10253 H HG3  . GLU A 1 36 ? 4.348   -12.440 -1.440  1.00 0.00 ? 36 GLU A HG3  9  
ATOM 10254 N N    . TRP A 1 37 ? 0.874   -8.530  -2.040  1.00 0.00 ? 37 TRP A N    9  
ATOM 10255 C CA   . TRP A 1 37 ? 0.453   -7.137  -2.135  1.00 0.00 ? 37 TRP A CA   9  
ATOM 10256 C C    . TRP A 1 37 ? 0.874   -6.356  -0.894  1.00 0.00 ? 37 TRP A C    9  
ATOM 10257 O O    . TRP A 1 37 ? 0.982   -6.915  0.197   1.00 0.00 ? 37 TRP A O    9  
ATOM 10258 C CB   . TRP A 1 37 ? -1.064  -7.054  -2.313  1.00 0.00 ? 37 TRP A CB   9  
ATOM 10259 C CG   . TRP A 1 37 ? -1.563  -7.803  -3.510  1.00 0.00 ? 37 TRP A CG   9  
ATOM 10260 C CD1  . TRP A 1 37 ? -1.444  -9.143  -3.748  1.00 0.00 ? 37 TRP A CD1  9  
ATOM 10261 C CD2  . TRP A 1 37 ? -2.259  -7.256  -4.636  1.00 0.00 ? 37 TRP A CD2  9  
ATOM 10262 N NE1  . TRP A 1 37 ? -2.024  -9.462  -4.952  1.00 0.00 ? 37 TRP A NE1  9  
ATOM 10263 C CE2  . TRP A 1 37 ? -2.532  -8.321  -5.516  1.00 0.00 ? 37 TRP A CE2  9  
ATOM 10264 C CE3  . TRP A 1 37 ? -2.681  -5.969  -4.986  1.00 0.00 ? 37 TRP A CE3  9  
ATOM 10265 C CZ2  . TRP A 1 37 ? -3.205  -8.137  -6.722  1.00 0.00 ? 37 TRP A CZ2  9  
ATOM 10266 C CZ3  . TRP A 1 37 ? -3.348  -5.789  -6.182  1.00 0.00 ? 37 TRP A CZ3  9  
ATOM 10267 C CH2  . TRP A 1 37 ? -3.605  -6.868  -7.037  1.00 0.00 ? 37 TRP A CH2  9  
ATOM 10268 H H    . TRP A 1 37 ? 0.436   -9.119  -1.390  1.00 0.00 ? 37 TRP A H    9  
ATOM 10269 H HA   . TRP A 1 37 ? 0.933   -6.704  -2.999  1.00 0.00 ? 37 TRP A HA   9  
ATOM 10270 H HB2  . TRP A 1 37 ? -1.546  -7.464  -1.438  1.00 0.00 ? 37 TRP A HB2  9  
ATOM 10271 H HB3  . TRP A 1 37 ? -1.350  -6.018  -2.424  1.00 0.00 ? 37 TRP A HB3  9  
ATOM 10272 H HD1  . TRP A 1 37 ? -0.961  -9.837  -3.078  1.00 0.00 ? 37 TRP A HD1  9  
ATOM 10273 H HE1  . TRP A 1 37 ? -2.068  -10.360 -5.342  1.00 0.00 ? 37 TRP A HE1  9  
ATOM 10274 H HE3  . TRP A 1 37 ? -2.491  -5.126  -4.339  1.00 0.00 ? 37 TRP A HE3  9  
ATOM 10275 H HZ2  . TRP A 1 37 ? -3.411  -8.959  -7.392  1.00 0.00 ? 37 TRP A HZ2  9  
ATOM 10276 H HZ3  . TRP A 1 37 ? -3.680  -4.802  -6.468  1.00 0.00 ? 37 TRP A HZ3  9  
ATOM 10277 H HH2  . TRP A 1 37 ? -4.129  -6.680  -7.963  1.00 0.00 ? 37 TRP A HH2  9  
ATOM 10278 N N    . CYS A 1 38 ? 1.112   -5.060  -1.069  1.00 0.00 ? 38 CYS A N    9  
ATOM 10279 C CA   . CYS A 1 38 ? 1.522   -4.203  0.036   1.00 0.00 ? 38 CYS A CA   9  
ATOM 10280 C C    . CYS A 1 38 ? 0.632   -2.967  0.125   1.00 0.00 ? 38 CYS A C    9  
ATOM 10281 O O    . CYS A 1 38 ? 0.509   -2.207  -0.835  1.00 0.00 ? 38 CYS A O    9  
ATOM 10282 C CB   . CYS A 1 38 ? 2.983   -3.780  -0.133  1.00 0.00 ? 38 CYS A CB   9  
ATOM 10283 S SG   . CYS A 1 38 ? 4.174   -4.966  0.532   1.00 0.00 ? 38 CYS A SG   9  
ATOM 10284 H H    . CYS A 1 38 ? 1.009   -4.672  -1.964  1.00 0.00 ? 38 CYS A H    9  
ATOM 10285 H HA   . CYS A 1 38 ? 1.424   -4.768  0.950   1.00 0.00 ? 38 CYS A HA   9  
ATOM 10286 H HB2  . CYS A 1 38 ? 3.195   -3.659  -1.184  1.00 0.00 ? 38 CYS A HB2  9  
ATOM 10287 H HB3  . CYS A 1 38 ? 3.138   -2.838  0.372   1.00 0.00 ? 38 CYS A HB3  9  
ATOM 10288 H HG   . CYS A 1 38 ? 3.891   -5.847  0.278   1.00 0.00 ? 38 CYS A HG   9  
ATOM 10289 N N    . GLY A 1 39 ? 0.013   -2.772  1.286   1.00 0.00 ? 39 GLY A N    9  
ATOM 10290 C CA   . GLY A 1 39 ? -0.856  -1.627  1.478   1.00 0.00 ? 39 GLY A CA   9  
ATOM 10291 C C    . GLY A 1 39 ? -0.083  -0.353  1.762   1.00 0.00 ? 39 GLY A C    9  
ATOM 10292 O O    . GLY A 1 39 ? 0.421   -0.159  2.869   1.00 0.00 ? 39 GLY A O    9  
ATOM 10293 H H    . GLY A 1 39 ? 0.149   -3.410  2.015   1.00 0.00 ? 39 GLY A H    9  
ATOM 10294 H HA2  . GLY A 1 39 ? -1.448  -1.483  0.586   1.00 0.00 ? 39 GLY A HA2  9  
ATOM 10295 H HA3  . GLY A 1 39 ? -1.518  -1.825  2.308   1.00 0.00 ? 39 GLY A HA3  9  
ATOM 10296 N N    . VAL A 1 40 ? 0.013   0.515   0.761   1.00 0.00 ? 40 VAL A N    9  
ATOM 10297 C CA   . VAL A 1 40 ? 0.731   1.775   0.910   1.00 0.00 ? 40 VAL A CA   9  
ATOM 10298 C C    . VAL A 1 40 ? -0.202  2.889   1.371   1.00 0.00 ? 40 VAL A C    9  
ATOM 10299 O O    . VAL A 1 40 ? -1.303  3.047   0.845   1.00 0.00 ? 40 VAL A O    9  
ATOM 10300 C CB   . VAL A 1 40 ? 1.402   2.198   -0.410  1.00 0.00 ? 40 VAL A CB   9  
ATOM 10301 C CG1  . VAL A 1 40 ? 2.308   3.400   -0.189  1.00 0.00 ? 40 VAL A CG1  9  
ATOM 10302 C CG2  . VAL A 1 40 ? 2.182   1.037   -1.009  1.00 0.00 ? 40 VAL A CG2  9  
ATOM 10303 H H    . VAL A 1 40 ? -0.410  0.303   -0.097  1.00 0.00 ? 40 VAL A H    9  
ATOM 10304 H HA   . VAL A 1 40 ? 1.503   1.633   1.652   1.00 0.00 ? 40 VAL A HA   9  
ATOM 10305 H HB   . VAL A 1 40 ? 0.629   2.483   -1.109  1.00 0.00 ? 40 VAL A HB   9  
ATOM 10306 H HG11 . VAL A 1 40 ? 2.010   3.914   0.713   1.00 0.00 ? 40 VAL A HG11 9  
ATOM 10307 H HG12 . VAL A 1 40 ? 2.226   4.072   -1.030  1.00 0.00 ? 40 VAL A HG12 9  
ATOM 10308 H HG13 . VAL A 1 40 ? 3.331   3.067   -0.092  1.00 0.00 ? 40 VAL A HG13 9  
ATOM 10309 H HG21 . VAL A 1 40 ? 1.560   0.517   -1.723  1.00 0.00 ? 40 VAL A HG21 9  
ATOM 10310 H HG22 . VAL A 1 40 ? 2.475   0.356   -0.223  1.00 0.00 ? 40 VAL A HG22 9  
ATOM 10311 H HG23 . VAL A 1 40 ? 3.063   1.413   -1.507  1.00 0.00 ? 40 VAL A HG23 9  
ATOM 10312 N N    . GLU A 1 41 ? 0.247   3.659   2.357   1.00 0.00 ? 41 GLU A N    9  
ATOM 10313 C CA   . GLU A 1 41 ? -0.547  4.759   2.891   1.00 0.00 ? 41 GLU A CA   9  
ATOM 10314 C C    . GLU A 1 41 ? -0.016  6.101   2.398   1.00 0.00 ? 41 GLU A C    9  
ATOM 10315 O O    . GLU A 1 41 ? 1.026   6.572   2.854   1.00 0.00 ? 41 GLU A O    9  
ATOM 10316 C CB   . GLU A 1 41 ? -0.542  4.725   4.420   1.00 0.00 ? 41 GLU A CB   9  
ATOM 10317 C CG   . GLU A 1 41 ? -1.419  5.792   5.055   1.00 0.00 ? 41 GLU A CG   9  
ATOM 10318 C CD   . GLU A 1 41 ? -0.613  6.912   5.682   1.00 0.00 ? 41 GLU A CD   9  
ATOM 10319 O OE1  . GLU A 1 41 ? -0.063  7.742   4.929   1.00 0.00 ? 41 GLU A OE1  9  
ATOM 10320 O OE2  . GLU A 1 41 ? -0.533  6.960   6.928   1.00 0.00 ? 41 GLU A OE2  9  
ATOM 10321 H H    . GLU A 1 41 ? 1.134   3.482   2.735   1.00 0.00 ? 41 GLU A H    9  
ATOM 10322 H HA   . GLU A 1 41 ? -1.561  4.636   2.539   1.00 0.00 ? 41 GLU A HA   9  
ATOM 10323 H HB2  . GLU A 1 41 ? -0.895  3.758   4.748   1.00 0.00 ? 41 GLU A HB2  9  
ATOM 10324 H HB3  . GLU A 1 41 ? 0.470   4.866   4.769   1.00 0.00 ? 41 GLU A HB3  9  
ATOM 10325 H HG2  . GLU A 1 41 ? -2.060  6.213   4.293   1.00 0.00 ? 41 GLU A HG2  9  
ATOM 10326 H HG3  . GLU A 1 41 ? -2.027  5.332   5.820   1.00 0.00 ? 41 GLU A HG3  9  
ATOM 10327 N N    . LEU A 1 42 ? -0.738  6.712   1.465   1.00 0.00 ? 42 LEU A N    9  
ATOM 10328 C CA   . LEU A 1 42 ? -0.340  8.000   0.910   1.00 0.00 ? 42 LEU A CA   9  
ATOM 10329 C C    . LEU A 1 42 ? -0.563  9.121   1.920   1.00 0.00 ? 42 LEU A C    9  
ATOM 10330 O O    . LEU A 1 42 ? -1.248  8.937   2.926   1.00 0.00 ? 42 LEU A O    9  
ATOM 10331 C CB   . LEU A 1 42 ? -1.122  8.290   -0.373  1.00 0.00 ? 42 LEU A CB   9  
ATOM 10332 C CG   . LEU A 1 42 ? -0.834  7.338   -1.535  1.00 0.00 ? 42 LEU A CG   9  
ATOM 10333 C CD1  . LEU A 1 42 ? -1.802  7.587   -2.680  1.00 0.00 ? 42 LEU A CD1  9  
ATOM 10334 C CD2  . LEU A 1 42 ? 0.604   7.491   -2.005  1.00 0.00 ? 42 LEU A CD2  9  
ATOM 10335 H H    . LEU A 1 42 ? -1.559  6.286   1.142   1.00 0.00 ? 42 LEU A H    9  
ATOM 10336 H HA   . LEU A 1 42 ? 0.713   7.949   0.676   1.00 0.00 ? 42 LEU A HA   9  
ATOM 10337 H HB2  . LEU A 1 42 ? -2.176  8.240   -0.145  1.00 0.00 ? 42 LEU A HB2  9  
ATOM 10338 H HB3  . LEU A 1 42 ? -0.888  9.293   -0.694  1.00 0.00 ? 42 LEU A HB3  9  
ATOM 10339 H HG   . LEU A 1 42 ? -0.971  6.320   -1.199  1.00 0.00 ? 42 LEU A HG   9  
ATOM 10340 H HD11 . LEU A 1 42 ? -1.893  8.650   -2.850  1.00 0.00 ? 42 LEU A HD11 9  
ATOM 10341 H HD12 . LEU A 1 42 ? -2.770  7.178   -2.431  1.00 0.00 ? 42 LEU A HD12 9  
ATOM 10342 H HD13 . LEU A 1 42 ? -1.430  7.110   -3.576  1.00 0.00 ? 42 LEU A HD13 9  
ATOM 10343 H HD21 . LEU A 1 42 ? 1.272   7.091   -1.257  1.00 0.00 ? 42 LEU A HD21 9  
ATOM 10344 H HD22 . LEU A 1 42 ? 0.822   8.537   -2.160  1.00 0.00 ? 42 LEU A HD22 9  
ATOM 10345 H HD23 . LEU A 1 42 ? 0.738   6.954   -2.933  1.00 0.00 ? 42 LEU A HD23 9  
ATOM 10346 N N    . ASP A 1 43 ? 0.018   10.284  1.643   1.00 0.00 ? 43 ASP A N    9  
ATOM 10347 C CA   . ASP A 1 43 ? -0.118  11.437  2.526   1.00 0.00 ? 43 ASP A CA   9  
ATOM 10348 C C    . ASP A 1 43 ? -1.292  12.314  2.100   1.00 0.00 ? 43 ASP A C    9  
ATOM 10349 O O    . ASP A 1 43 ? -1.927  12.964  2.931   1.00 0.00 ? 43 ASP A O    9  
ATOM 10350 C CB   . ASP A 1 43 ? 1.172   12.259  2.529   1.00 0.00 ? 43 ASP A CB   9  
ATOM 10351 C CG   . ASP A 1 43 ? 2.299   11.564  3.265   1.00 0.00 ? 43 ASP A CG   9  
ATOM 10352 O OD1  . ASP A 1 43 ? 2.210   11.439  4.506   1.00 0.00 ? 43 ASP A OD1  9  
ATOM 10353 O OD2  . ASP A 1 43 ? 3.271   11.144  2.603   1.00 0.00 ? 43 ASP A OD2  9  
ATOM 10354 H H    . ASP A 1 43 ? 0.551   10.369  0.825   1.00 0.00 ? 43 ASP A H    9  
ATOM 10355 H HA   . ASP A 1 43 ? -0.302  11.070  3.525   1.00 0.00 ? 43 ASP A HA   9  
ATOM 10356 H HB2  . ASP A 1 43 ? 1.484   12.430  1.509   1.00 0.00 ? 43 ASP A HB2  9  
ATOM 10357 H HB3  . ASP A 1 43 ? 0.984   13.209  3.007   1.00 0.00 ? 43 ASP A HB3  9  
ATOM 10358 N N    . GLU A 1 44 ? -1.575  12.325  0.802   1.00 0.00 ? 44 GLU A N    9  
ATOM 10359 C CA   . GLU A 1 44 ? -2.672  13.122  0.265   1.00 0.00 ? 44 GLU A CA   9  
ATOM 10360 C C    . GLU A 1 44 ? -3.904  12.253  0.020   1.00 0.00 ? 44 GLU A C    9  
ATOM 10361 O O    . GLU A 1 44 ? -3.797  11.036  -0.125  1.00 0.00 ? 44 GLU A O    9  
ATOM 10362 C CB   . GLU A 1 44 ? -2.246  13.802  -1.037  1.00 0.00 ? 44 GLU A CB   9  
ATOM 10363 C CG   . GLU A 1 44 ? -1.325  14.992  -0.829  1.00 0.00 ? 44 GLU A CG   9  
ATOM 10364 C CD   . GLU A 1 44 ? -1.212  15.864  -2.063  1.00 0.00 ? 44 GLU A CD   9  
ATOM 10365 O OE1  . GLU A 1 44 ? -1.396  15.337  -3.181  1.00 0.00 ? 44 GLU A OE1  9  
ATOM 10366 O OE2  . GLU A 1 44 ? -0.940  17.074  -1.913  1.00 0.00 ? 44 GLU A OE2  9  
ATOM 10367 H H    . GLU A 1 44 ? -1.032  11.786  0.189   1.00 0.00 ? 44 GLU A H    9  
ATOM 10368 H HA   . GLU A 1 44 ? -2.920  13.879  0.994   1.00 0.00 ? 44 GLU A HA   9  
ATOM 10369 H HB2  . GLU A 1 44 ? -1.733  13.080  -1.655  1.00 0.00 ? 44 GLU A HB2  9  
ATOM 10370 H HB3  . GLU A 1 44 ? -3.130  14.143  -1.557  1.00 0.00 ? 44 GLU A HB3  9  
ATOM 10371 H HG2  . GLU A 1 44 ? -1.711  15.592  -0.018  1.00 0.00 ? 44 GLU A HG2  9  
ATOM 10372 H HG3  . GLU A 1 44 ? -0.341  14.629  -0.571  1.00 0.00 ? 44 GLU A HG3  9  
ATOM 10373 N N    . PRO A 1 45 ? -5.096  12.871  -0.032  1.00 0.00 ? 45 PRO A N    9  
ATOM 10374 C CA   . PRO A 1 45 ? -6.351  12.148  -0.263  1.00 0.00 ? 45 PRO A CA   9  
ATOM 10375 C C    . PRO A 1 45 ? -6.437  11.578  -1.675  1.00 0.00 ? 45 PRO A C    9  
ATOM 10376 O O    . PRO A 1 45 ? -7.268  12.002  -2.478  1.00 0.00 ? 45 PRO A O    9  
ATOM 10377 C CB   . PRO A 1 45 ? -7.426  13.217  -0.048  1.00 0.00 ? 45 PRO A CB   9  
ATOM 10378 C CG   . PRO A 1 45 ? -6.738  14.509  -0.320  1.00 0.00 ? 45 PRO A CG   9  
ATOM 10379 C CD   . PRO A 1 45 ? -5.316  14.321  0.129   1.00 0.00 ? 45 PRO A CD   9  
ATOM 10380 H HA   . PRO A 1 45 ? -6.483  11.350  0.453   1.00 0.00 ? 45 PRO A HA   9  
ATOM 10381 H HB2  . PRO A 1 45 ? -8.244  13.051  -0.735  1.00 0.00 ? 45 PRO A HB2  9  
ATOM 10382 H HB3  . PRO A 1 45 ? -7.789  13.168  0.968   1.00 0.00 ? 45 PRO A HB3  9  
ATOM 10383 H HG2  . PRO A 1 45 ? -6.772  14.728  -1.377  1.00 0.00 ? 45 PRO A HG2  9  
ATOM 10384 H HG3  . PRO A 1 45 ? -7.208  15.301  0.245   1.00 0.00 ? 45 PRO A HG3  9  
ATOM 10385 H HD2  . PRO A 1 45 ? -4.644  14.886  -0.500  1.00 0.00 ? 45 PRO A HD2  9  
ATOM 10386 H HD3  . PRO A 1 45 ? -5.204  14.615  1.162   1.00 0.00 ? 45 PRO A HD3  9  
ATOM 10387 N N    . LEU A 1 46 ? -5.570  10.614  -1.972  1.00 0.00 ? 46 LEU A N    9  
ATOM 10388 C CA   . LEU A 1 46 ? -5.547  9.986   -3.288  1.00 0.00 ? 46 LEU A CA   9  
ATOM 10389 C C    . LEU A 1 46 ? -5.726  8.475   -3.175  1.00 0.00 ? 46 LEU A C    9  
ATOM 10390 O O    . LEU A 1 46 ? -5.233  7.718   -4.011  1.00 0.00 ? 46 LEU A O    9  
ATOM 10391 C CB   . LEU A 1 46 ? -4.231  10.303  -4.002  1.00 0.00 ? 46 LEU A CB   9  
ATOM 10392 C CG   . LEU A 1 46 ? -3.898  11.791  -4.119  1.00 0.00 ? 46 LEU A CG   9  
ATOM 10393 C CD1  . LEU A 1 46 ? -2.402  11.990  -4.299  1.00 0.00 ? 46 LEU A CD1  9  
ATOM 10394 C CD2  . LEU A 1 46 ? -4.666  12.419  -5.272  1.00 0.00 ? 46 LEU A CD2  9  
ATOM 10395 H H    . LEU A 1 46 ? -4.932  10.319  -1.290  1.00 0.00 ? 46 LEU A H    9  
ATOM 10396 H HA   . LEU A 1 46 ? -6.365  10.391  -3.864  1.00 0.00 ? 46 LEU A HA   9  
ATOM 10397 H HB2  . LEU A 1 46 ? -3.430  9.815   -3.467  1.00 0.00 ? 46 LEU A HB2  9  
ATOM 10398 H HB3  . LEU A 1 46 ? -4.279  9.889   -4.999  1.00 0.00 ? 46 LEU A HB3  9  
ATOM 10399 H HG   . LEU A 1 46 ? -4.193  12.290  -3.207  1.00 0.00 ? 46 LEU A HG   9  
ATOM 10400 H HD11 . LEU A 1 46 ? -1.868  11.388  -3.578  1.00 0.00 ? 46 LEU A HD11 9  
ATOM 10401 H HD12 . LEU A 1 46 ? -2.157  13.031  -4.152  1.00 0.00 ? 46 LEU A HD12 9  
ATOM 10402 H HD13 . LEU A 1 46 ? -2.117  11.690  -5.297  1.00 0.00 ? 46 LEU A HD13 9  
ATOM 10403 H HD21 . LEU A 1 46 ? -4.082  13.222  -5.697  1.00 0.00 ? 46 LEU A HD21 9  
ATOM 10404 H HD22 . LEU A 1 46 ? -5.604  12.809  -4.909  1.00 0.00 ? 46 LEU A HD22 9  
ATOM 10405 H HD23 . LEU A 1 46 ? -4.855  11.671  -6.027  1.00 0.00 ? 46 LEU A HD23 9  
ATOM 10406 N N    . GLY A 1 47 ? -6.436  8.043   -2.137  1.00 0.00 ? 47 GLY A N    9  
ATOM 10407 C CA   . GLY A 1 47 ? -6.667  6.624   -1.936  1.00 0.00 ? 47 GLY A CA   9  
ATOM 10408 C C    . GLY A 1 47 ? -8.120  6.240   -2.133  1.00 0.00 ? 47 GLY A C    9  
ATOM 10409 O O    . GLY A 1 47 ? -8.999  7.101   -2.156  1.00 0.00 ? 47 GLY A O    9  
ATOM 10410 H H    . GLY A 1 47 ? -6.805  8.692   -1.502  1.00 0.00 ? 47 GLY A H    9  
ATOM 10411 H HA2  . GLY A 1 47 ? -6.061  6.069   -2.636  1.00 0.00 ? 47 GLY A HA2  9  
ATOM 10412 H HA3  . GLY A 1 47 ? -6.370  6.361   -0.931  1.00 0.00 ? 47 GLY A HA3  9  
ATOM 10413 N N    . LYS A 1 48 ? -8.373  4.942   -2.275  1.00 0.00 ? 48 LYS A N    9  
ATOM 10414 C CA   . LYS A 1 48 ? -9.730  4.445   -2.472  1.00 0.00 ? 48 LYS A CA   9  
ATOM 10415 C C    . LYS A 1 48 ? -10.170 3.584   -1.293  1.00 0.00 ? 48 LYS A C    9  
ATOM 10416 O O    . LYS A 1 48 ? -11.331 3.620   -0.884  1.00 0.00 ? 48 LYS A O    9  
ATOM 10417 C CB   . LYS A 1 48 ? -9.815  3.636   -3.768  1.00 0.00 ? 48 LYS A CB   9  
ATOM 10418 C CG   . LYS A 1 48 ? -9.787  4.494   -5.024  1.00 0.00 ? 48 LYS A CG   9  
ATOM 10419 C CD   . LYS A 1 48 ? -9.891  3.644   -6.281  1.00 0.00 ? 48 LYS A CD   9  
ATOM 10420 C CE   . LYS A 1 48 ? -10.755 4.313   -7.338  1.00 0.00 ? 48 LYS A CE   9  
ATOM 10421 N NZ   . LYS A 1 48 ? -12.004 3.547   -7.601  1.00 0.00 ? 48 LYS A NZ   9  
ATOM 10422 H H    . LYS A 1 48 ? -7.629  4.305   -2.248  1.00 0.00 ? 48 LYS A H    9  
ATOM 10423 H HA   . LYS A 1 48 ? -10.388 5.297   -2.546  1.00 0.00 ? 48 LYS A HA   9  
ATOM 10424 H HB2  . LYS A 1 48 ? -8.982  2.951   -3.807  1.00 0.00 ? 48 LYS A HB2  9  
ATOM 10425 H HB3  . LYS A 1 48 ? -10.736 3.071   -3.766  1.00 0.00 ? 48 LYS A HB3  9  
ATOM 10426 H HG2  . LYS A 1 48 ? -10.619 5.182   -4.997  1.00 0.00 ? 48 LYS A HG2  9  
ATOM 10427 H HG3  . LYS A 1 48 ? -8.859  5.046   -5.049  1.00 0.00 ? 48 LYS A HG3  9  
ATOM 10428 H HD2  . LYS A 1 48 ? -8.900  3.493   -6.684  1.00 0.00 ? 48 LYS A HD2  9  
ATOM 10429 H HD3  . LYS A 1 48 ? -10.326 2.690   -6.023  1.00 0.00 ? 48 LYS A HD3  9  
ATOM 10430 H HE2  . LYS A 1 48 ? -11.017 5.305   -6.999  1.00 0.00 ? 48 LYS A HE2  9  
ATOM 10431 H HE3  . LYS A 1 48 ? -10.188 4.386   -8.255  1.00 0.00 ? 48 LYS A HE3  9  
ATOM 10432 H HZ1  . LYS A 1 48 ? -11.881 2.937   -8.435  1.00 0.00 ? 48 LYS A HZ1  9  
ATOM 10433 H HZ2  . LYS A 1 48 ? -12.794 4.199   -7.777  1.00 0.00 ? 48 LYS A HZ2  9  
ATOM 10434 H HZ3  . LYS A 1 48 ? -12.237 2.951   -6.780  1.00 0.00 ? 48 LYS A HZ3  9  
ATOM 10435 N N    . ASN A 1 49 ? -9.236  2.809   -0.750  1.00 0.00 ? 49 ASN A N    9  
ATOM 10436 C CA   . ASN A 1 49 ? -9.528  1.939   0.383   1.00 0.00 ? 49 ASN A CA   9  
ATOM 10437 C C    . ASN A 1 49 ? -8.884  2.473   1.659   1.00 0.00 ? 49 ASN A C    9  
ATOM 10438 O O    . ASN A 1 49 ? -8.132  3.447   1.626   1.00 0.00 ? 49 ASN A O    9  
ATOM 10439 C CB   . ASN A 1 49 ? -9.034  0.518   0.101   1.00 0.00 ? 49 ASN A CB   9  
ATOM 10440 C CG   . ASN A 1 49 ? -10.169 -0.433  -0.226  1.00 0.00 ? 49 ASN A CG   9  
ATOM 10441 O OD1  . ASN A 1 49 ? -10.731 -1.076  0.662   1.00 0.00 ? 49 ASN A OD1  9  
ATOM 10442 N ND2  . ASN A 1 49 ? -10.512 -0.530  -1.505  1.00 0.00 ? 49 ASN A ND2  9  
ATOM 10443 H H    . ASN A 1 49 ? -8.329  2.823   -1.120  1.00 0.00 ? 49 ASN A H    9  
ATOM 10444 H HA   . ASN A 1 49 ? -10.600 1.918   0.517   1.00 0.00 ? 49 ASN A HA   9  
ATOM 10445 H HB2  . ASN A 1 49 ? -8.356  0.540   -0.740  1.00 0.00 ? 49 ASN A HB2  9  
ATOM 10446 H HB3  . ASN A 1 49 ? -8.513  0.144   0.969   1.00 0.00 ? 49 ASN A HB3  9  
ATOM 10447 H HD21 . ASN A 1 49 ? -10.020 0.011   -2.157  1.00 0.00 ? 49 ASN A HD21 9  
ATOM 10448 H HD22 . ASN A 1 49 ? -11.242 -1.138  -1.744  1.00 0.00 ? 49 ASN A HD22 9  
ATOM 10449 N N    . ASP A 1 50 ? -9.184  1.828   2.781   1.00 0.00 ? 50 ASP A N    9  
ATOM 10450 C CA   . ASP A 1 50 ? -8.634  2.237   4.069   1.00 0.00 ? 50 ASP A CA   9  
ATOM 10451 C C    . ASP A 1 50 ? -8.007  1.051   4.794   1.00 0.00 ? 50 ASP A C    9  
ATOM 10452 O O    . ASP A 1 50 ? -8.003  0.993   6.023   1.00 0.00 ? 50 ASP A O    9  
ATOM 10453 C CB   . ASP A 1 50 ? -9.728  2.860   4.939   1.00 0.00 ? 50 ASP A CB   9  
ATOM 10454 C CG   . ASP A 1 50 ? -10.917 1.938   5.121   1.00 0.00 ? 50 ASP A CG   9  
ATOM 10455 O OD1  . ASP A 1 50 ? -10.852 1.052   6.000   1.00 0.00 ? 50 ASP A OD1  9  
ATOM 10456 O OD2  . ASP A 1 50 ? -11.913 2.102   4.385   1.00 0.00 ? 50 ASP A OD2  9  
ATOM 10457 H H    . ASP A 1 50 ? -9.790  1.058   2.743   1.00 0.00 ? 50 ASP A H    9  
ATOM 10458 H HA   . ASP A 1 50 ? -7.869  2.975   3.883   1.00 0.00 ? 50 ASP A HA   9  
ATOM 10459 H HB2  . ASP A 1 50 ? -9.319  3.087   5.912   1.00 0.00 ? 50 ASP A HB2  9  
ATOM 10460 H HB3  . ASP A 1 50 ? -10.071 3.774   4.475   1.00 0.00 ? 50 ASP A HB3  9  
ATOM 10461 N N    . GLY A 1 51 ? -7.475  0.107   4.024   1.00 0.00 ? 51 GLY A N    9  
ATOM 10462 C CA   . GLY A 1 51 ? -6.852  -1.065  4.610   1.00 0.00 ? 51 GLY A CA   9  
ATOM 10463 C C    . GLY A 1 51 ? -7.867  -2.076  5.103   1.00 0.00 ? 51 GLY A C    9  
ATOM 10464 O O    . GLY A 1 51 ? -7.603  -2.821  6.047   1.00 0.00 ? 51 GLY A O    9  
ATOM 10465 H H    . GLY A 1 51 ? -7.507  0.207   3.049   1.00 0.00 ? 51 GLY A H    9  
ATOM 10466 H HA2  . GLY A 1 51 ? -6.223  -1.534  3.868   1.00 0.00 ? 51 GLY A HA2  9  
ATOM 10467 H HA3  . GLY A 1 51 ? -6.237  -0.753  5.442   1.00 0.00 ? 51 GLY A HA3  9  
ATOM 10468 N N    . ALA A 1 52 ? -9.032  -2.104  4.463   1.00 0.00 ? 52 ALA A N    9  
ATOM 10469 C CA   . ALA A 1 52 ? -10.091 -3.031  4.842   1.00 0.00 ? 52 ALA A CA   9  
ATOM 10470 C C    . ALA A 1 52 ? -10.732 -3.665  3.612   1.00 0.00 ? 52 ALA A C    9  
ATOM 10471 O O    . ALA A 1 52 ? -11.409 -2.990  2.836   1.00 0.00 ? 52 ALA A O    9  
ATOM 10472 C CB   . ALA A 1 52 ? -11.142 -2.318  5.679   1.00 0.00 ? 52 ALA A CB   9  
ATOM 10473 H H    . ALA A 1 52 ? -9.183  -1.484  3.719   1.00 0.00 ? 52 ALA A H    9  
ATOM 10474 H HA   . ALA A 1 52 ? -9.650  -3.810  5.447   1.00 0.00 ? 52 ALA A HA   9  
ATOM 10475 H HB1  . ALA A 1 52 ? -10.657 -1.640  6.366   1.00 0.00 ? 52 ALA A HB1  9  
ATOM 10476 H HB2  . ALA A 1 52 ? -11.713 -3.046  6.236   1.00 0.00 ? 52 ALA A HB2  9  
ATOM 10477 H HB3  . ALA A 1 52 ? -11.803 -1.762  5.030   1.00 0.00 ? 52 ALA A HB3  9  
ATOM 10478 N N    . VAL A 1 53 ? -10.514 -4.965  3.441   1.00 0.00 ? 53 VAL A N    9  
ATOM 10479 C CA   . VAL A 1 53 ? -11.069 -5.690  2.305   1.00 0.00 ? 53 VAL A CA   9  
ATOM 10480 C C    . VAL A 1 53 ? -11.894 -6.887  2.766   1.00 0.00 ? 53 VAL A C    9  
ATOM 10481 O O    . VAL A 1 53 ? -11.502 -7.605  3.685   1.00 0.00 ? 53 VAL A O    9  
ATOM 10482 C CB   . VAL A 1 53 ? -9.962  -6.182  1.354   1.00 0.00 ? 53 VAL A CB   9  
ATOM 10483 C CG1  . VAL A 1 53 ? -10.565 -6.756  0.082   1.00 0.00 ? 53 VAL A CG1  9  
ATOM 10484 C CG2  . VAL A 1 53 ? -8.995  -5.052  1.032   1.00 0.00 ? 53 VAL A CG2  9  
ATOM 10485 H H    . VAL A 1 53 ? -9.965  -5.447  4.094   1.00 0.00 ? 53 VAL A H    9  
ATOM 10486 H HA   . VAL A 1 53 ? -11.711 -5.013  1.757   1.00 0.00 ? 53 VAL A HA   9  
ATOM 10487 H HB   . VAL A 1 53 ? -9.412  -6.967  1.851   1.00 0.00 ? 53 VAL A HB   9  
ATOM 10488 H HG11 . VAL A 1 53 ? -10.642 -5.979  -0.664  1.00 0.00 ? 53 VAL A HG11 9  
ATOM 10489 H HG12 . VAL A 1 53 ? -11.548 -7.149  0.295   1.00 0.00 ? 53 VAL A HG12 9  
ATOM 10490 H HG13 . VAL A 1 53 ? -9.933  -7.550  -0.289  1.00 0.00 ? 53 VAL A HG13 9  
ATOM 10491 H HG21 . VAL A 1 53 ? -8.155  -5.094  1.709   1.00 0.00 ? 53 VAL A HG21 9  
ATOM 10492 H HG22 . VAL A 1 53 ? -9.499  -4.104  1.142   1.00 0.00 ? 53 VAL A HG22 9  
ATOM 10493 H HG23 . VAL A 1 53 ? -8.644  -5.158  0.016   1.00 0.00 ? 53 VAL A HG23 9  
ATOM 10494 N N    . ALA A 1 54 ? -13.039 -7.093  2.124   1.00 0.00 ? 54 ALA A N    9  
ATOM 10495 C CA   . ALA A 1 54 ? -13.919 -8.202  2.470   1.00 0.00 ? 54 ALA A CA   9  
ATOM 10496 C C    . ALA A 1 54 ? -14.386 -8.103  3.917   1.00 0.00 ? 54 ALA A C    9  
ATOM 10497 O O    . ALA A 1 54 ? -14.621 -9.116  4.575   1.00 0.00 ? 54 ALA A O    9  
ATOM 10498 C CB   . ALA A 1 54 ? -13.214 -9.529  2.231   1.00 0.00 ? 54 ALA A CB   9  
ATOM 10499 H H    . ALA A 1 54 ? -13.298 -6.484  1.401   1.00 0.00 ? 54 ALA A H    9  
ATOM 10500 H HA   . ALA A 1 54 ? -14.782 -8.158  1.820   1.00 0.00 ? 54 ALA A HA   9  
ATOM 10501 H HB1  . ALA A 1 54 ? -12.196 -9.464  2.586   1.00 0.00 ? 54 ALA A HB1  9  
ATOM 10502 H HB2  . ALA A 1 54 ? -13.212 -9.751  1.173   1.00 0.00 ? 54 ALA A HB2  9  
ATOM 10503 H HB3  . ALA A 1 54 ? -13.732 -10.314 2.762   1.00 0.00 ? 54 ALA A HB3  9  
ATOM 10504 N N    . GLY A 1 55 ? -14.519 -6.875  4.408   1.00 0.00 ? 55 GLY A N    9  
ATOM 10505 C CA   . GLY A 1 55 ? -14.956 -6.666  5.775   1.00 0.00 ? 55 GLY A CA   9  
ATOM 10506 C C    . GLY A 1 55 ? -13.890 -7.032  6.788   1.00 0.00 ? 55 GLY A C    9  
ATOM 10507 O O    . GLY A 1 55 ? -14.201 -7.416  7.917   1.00 0.00 ? 55 GLY A O    9  
ATOM 10508 H H    . GLY A 1 55 ? -14.317 -6.105  3.837   1.00 0.00 ? 55 GLY A H    9  
ATOM 10509 H HA2  . GLY A 1 55 ? -15.217 -5.626  5.903   1.00 0.00 ? 55 GLY A HA2  9  
ATOM 10510 H HA3  . GLY A 1 55 ? -15.834 -7.271  5.957   1.00 0.00 ? 55 GLY A HA3  9  
ATOM 10511 N N    . THR A 1 56 ? -12.629 -6.914  6.386   1.00 0.00 ? 56 THR A N    9  
ATOM 10512 C CA   . THR A 1 56 ? -11.513 -7.234  7.267   1.00 0.00 ? 56 THR A CA   9  
ATOM 10513 C C    . THR A 1 56 ? -10.437 -6.156  7.198   1.00 0.00 ? 56 THR A C    9  
ATOM 10514 O O    . THR A 1 56 ? -9.792  -5.974  6.165   1.00 0.00 ? 56 THR A O    9  
ATOM 10515 C CB   . THR A 1 56 ? -10.915 -8.592  6.893   1.00 0.00 ? 56 THR A CB   9  
ATOM 10516 O OG1  . THR A 1 56 ? -11.925 -9.583  6.827   1.00 0.00 ? 56 THR A OG1  9  
ATOM 10517 C CG2  . THR A 1 56 ? -9.864  -9.073  7.870   1.00 0.00 ? 56 THR A CG2  9  
ATOM 10518 H H    . THR A 1 56 ? -12.445 -6.602  5.475   1.00 0.00 ? 56 THR A H    9  
ATOM 10519 H HA   . THR A 1 56 ? -11.891 -7.285  8.277   1.00 0.00 ? 56 THR A HA   9  
ATOM 10520 H HB   . THR A 1 56 ? -10.452 -8.514  5.920   1.00 0.00 ? 56 THR A HB   9  
ATOM 10521 H HG1  . THR A 1 56 ? -11.734 -10.189 6.107   1.00 0.00 ? 56 THR A HG1  9  
ATOM 10522 H HG21 . THR A 1 56 ? -9.632  -8.282  8.568   1.00 0.00 ? 56 THR A HG21 9  
ATOM 10523 H HG22 . THR A 1 56 ? -8.970  -9.349  7.329   1.00 0.00 ? 56 THR A HG22 9  
ATOM 10524 H HG23 . THR A 1 56 ? -10.238 -9.931  8.408   1.00 0.00 ? 56 THR A HG23 9  
ATOM 10525 N N    . ARG A 1 57 ? -10.248 -5.443  8.303   1.00 0.00 ? 57 ARG A N    9  
ATOM 10526 C CA   . ARG A 1 57 ? -9.251  -4.382  8.367   1.00 0.00 ? 57 ARG A CA   9  
ATOM 10527 C C    . ARG A 1 57 ? -7.906  -4.927  8.837   1.00 0.00 ? 57 ARG A C    9  
ATOM 10528 O O    . ARG A 1 57 ? -7.748  -5.306  9.997   1.00 0.00 ? 57 ARG A O    9  
ATOM 10529 C CB   . ARG A 1 57 ? -9.719  -3.269  9.308   1.00 0.00 ? 57 ARG A CB   9  
ATOM 10530 C CG   . ARG A 1 57 ? -8.748  -2.103  9.402   1.00 0.00 ? 57 ARG A CG   9  
ATOM 10531 C CD   . ARG A 1 57 ? -9.478  -0.789  9.624   1.00 0.00 ? 57 ARG A CD   9  
ATOM 10532 N NE   . ARG A 1 57 ? -10.363 -0.842  10.785  1.00 0.00 ? 57 ARG A NE   9  
ATOM 10533 C CZ   . ARG A 1 57 ? -9.933  -0.863  12.044  1.00 0.00 ? 57 ARG A CZ   9  
ATOM 10534 N NH1  . ARG A 1 57 ? -8.633  -0.835  12.310  1.00 0.00 ? 57 ARG A NH1  9  
ATOM 10535 N NH2  . ARG A 1 57 ? -10.806 -0.912  13.042  1.00 0.00 ? 57 ARG A NH2  9  
ATOM 10536 H H    . ARG A 1 57 ? -10.793 -5.636  9.094   1.00 0.00 ? 57 ARG A H    9  
ATOM 10537 H HA   . ARG A 1 57 ? -9.134  -3.975  7.374   1.00 0.00 ? 57 ARG A HA   9  
ATOM 10538 H HB2  . ARG A 1 57 ? -10.668 -2.893  8.958   1.00 0.00 ? 57 ARG A HB2  9  
ATOM 10539 H HB3  . ARG A 1 57 ? -9.849  -3.681  10.298  1.00 0.00 ? 57 ARG A HB3  9  
ATOM 10540 H HG2  . ARG A 1 57 ? -8.075  -2.274  10.228  1.00 0.00 ? 57 ARG A HG2  9  
ATOM 10541 H HG3  . ARG A 1 57 ? -8.186  -2.042  8.481   1.00 0.00 ? 57 ARG A HG3  9  
ATOM 10542 H HD2  . ARG A 1 57 ? -8.748  -0.008  9.776   1.00 0.00 ? 57 ARG A HD2  9  
ATOM 10543 H HD3  . ARG A 1 57 ? -10.065 -0.565  8.745   1.00 0.00 ? 57 ARG A HD3  9  
ATOM 10544 H HE   . ARG A 1 57 ? -11.328 -0.865  10.617  1.00 0.00 ? 57 ARG A HE   9  
ATOM 10545 H HH11 . ARG A 1 57 ? -7.969  -0.797  11.563  1.00 0.00 ? 57 ARG A HH11 9  
ATOM 10546 H HH12 . ARG A 1 57 ? -8.317  -0.850  13.259  1.00 0.00 ? 57 ARG A HH12 9  
ATOM 10547 H HH21 . ARG A 1 57 ? -11.787 -0.934  12.847  1.00 0.00 ? 57 ARG A HH21 9  
ATOM 10548 H HH22 . ARG A 1 57 ? -10.482 -0.928  13.988  1.00 0.00 ? 57 ARG A HH22 9  
ATOM 10549 N N    . TYR A 1 58 ? -6.938  -4.963  7.926   1.00 0.00 ? 58 TYR A N    9  
ATOM 10550 C CA   . TYR A 1 58 ? -5.606  -5.462  8.247   1.00 0.00 ? 58 TYR A CA   9  
ATOM 10551 C C    . TYR A 1 58 ? -4.807  -4.420  9.023   1.00 0.00 ? 58 TYR A C    9  
ATOM 10552 O O    . TYR A 1 58 ? -4.095  -4.749  9.972   1.00 0.00 ? 58 TYR A O    9  
ATOM 10553 C CB   . TYR A 1 58 ? -4.860  -5.844  6.968   1.00 0.00 ? 58 TYR A CB   9  
ATOM 10554 C CG   . TYR A 1 58 ? -5.682  -6.678  6.012   1.00 0.00 ? 58 TYR A CG   9  
ATOM 10555 C CD1  . TYR A 1 58 ? -5.910  -8.027  6.255   1.00 0.00 ? 58 TYR A CD1  9  
ATOM 10556 C CD2  . TYR A 1 58 ? -6.232  -6.117  4.866   1.00 0.00 ? 58 TYR A CD2  9  
ATOM 10557 C CE1  . TYR A 1 58 ? -6.662  -8.792  5.384   1.00 0.00 ? 58 TYR A CE1  9  
ATOM 10558 C CE2  . TYR A 1 58 ? -6.985  -6.875  3.990   1.00 0.00 ? 58 TYR A CE2  9  
ATOM 10559 C CZ   . TYR A 1 58 ? -7.196  -8.212  4.254   1.00 0.00 ? 58 TYR A CZ   9  
ATOM 10560 O OH   . TYR A 1 58 ? -7.945  -8.972  3.384   1.00 0.00 ? 58 TYR A OH   9  
ATOM 10561 H H    . TYR A 1 58 ? -7.124  -4.647  7.018   1.00 0.00 ? 58 TYR A H    9  
ATOM 10562 H HA   . TYR A 1 58 ? -5.721  -6.342  8.862   1.00 0.00 ? 58 TYR A HA   9  
ATOM 10563 H HB2  . TYR A 1 58 ? -4.565  -4.944  6.450   1.00 0.00 ? 58 TYR A HB2  9  
ATOM 10564 H HB3  . TYR A 1 58 ? -3.978  -6.409  7.228   1.00 0.00 ? 58 TYR A HB3  9  
ATOM 10565 H HD1  . TYR A 1 58 ? -5.491  -8.478  7.142   1.00 0.00 ? 58 TYR A HD1  9  
ATOM 10566 H HD2  . TYR A 1 58 ? -6.065  -5.069  4.662   1.00 0.00 ? 58 TYR A HD2  9  
ATOM 10567 H HE1  . TYR A 1 58 ? -6.827  -9.840  5.591   1.00 0.00 ? 58 TYR A HE1  9  
ATOM 10568 H HE2  . TYR A 1 58 ? -7.404  -6.421  3.105   1.00 0.00 ? 58 TYR A HE2  9  
ATOM 10569 H HH   . TYR A 1 58 ? -8.777  -8.527  3.205   1.00 0.00 ? 58 TYR A HH   9  
ATOM 10570 N N    . PHE A 1 59 ? -4.933  -3.161  8.614   1.00 0.00 ? 59 PHE A N    9  
ATOM 10571 C CA   . PHE A 1 59 ? -4.223  -2.071  9.271   1.00 0.00 ? 59 PHE A CA   9  
ATOM 10572 C C    . PHE A 1 59 ? -5.113  -0.837  9.391   1.00 0.00 ? 59 PHE A C    9  
ATOM 10573 O O    . PHE A 1 59 ? -5.711  -0.394  8.410   1.00 0.00 ? 59 PHE A O    9  
ATOM 10574 C CB   . PHE A 1 59 ? -2.951  -1.721  8.497   1.00 0.00 ? 59 PHE A CB   9  
ATOM 10575 C CG   . PHE A 1 59 ? -3.204  -1.325  7.070   1.00 0.00 ? 59 PHE A CG   9  
ATOM 10576 C CD1  . PHE A 1 59 ? -3.234  -2.281  6.067   1.00 0.00 ? 59 PHE A CD1  9  
ATOM 10577 C CD2  . PHE A 1 59 ? -3.415  0.002   6.732   1.00 0.00 ? 59 PHE A CD2  9  
ATOM 10578 C CE1  . PHE A 1 59 ? -3.466  -1.920  4.754   1.00 0.00 ? 59 PHE A CE1  9  
ATOM 10579 C CE2  . PHE A 1 59 ? -3.648  0.369   5.420   1.00 0.00 ? 59 PHE A CE2  9  
ATOM 10580 C CZ   . PHE A 1 59 ? -3.674  -0.593  4.430   1.00 0.00 ? 59 PHE A CZ   9  
ATOM 10581 H H    . PHE A 1 59 ? -5.515  -2.962  7.852   1.00 0.00 ? 59 PHE A H    9  
ATOM 10582 H HA   . PHE A 1 59 ? -3.951  -2.401  10.262  1.00 0.00 ? 59 PHE A HA   9  
ATOM 10583 H HB2  . PHE A 1 59 ? -2.455  -0.896  8.986   1.00 0.00 ? 59 PHE A HB2  9  
ATOM 10584 H HB3  . PHE A 1 59 ? -2.293  -2.578  8.493   1.00 0.00 ? 59 PHE A HB3  9  
ATOM 10585 H HD1  . PHE A 1 59 ? -3.072  -3.319  6.319   1.00 0.00 ? 59 PHE A HD1  9  
ATOM 10586 H HD2  . PHE A 1 59 ? -3.393  0.755   7.506   1.00 0.00 ? 59 PHE A HD2  9  
ATOM 10587 H HE1  . PHE A 1 59 ? -3.487  -2.674  3.981   1.00 0.00 ? 59 PHE A HE1  9  
ATOM 10588 H HE2  . PHE A 1 59 ? -3.809  1.407   5.170   1.00 0.00 ? 59 PHE A HE2  9  
ATOM 10589 H HZ   . PHE A 1 59 ? -3.856  -0.309  3.404   1.00 0.00 ? 59 PHE A HZ   9  
ATOM 10590 N N    . GLN A 1 60 ? -5.199  -0.291  10.599  1.00 0.00 ? 60 GLN A N    9  
ATOM 10591 C CA   . GLN A 1 60 ? -6.017  0.891   10.848  1.00 0.00 ? 60 GLN A CA   9  
ATOM 10592 C C    . GLN A 1 60 ? -5.533  2.074   10.015  1.00 0.00 ? 60 GLN A C    9  
ATOM 10593 O O    . GLN A 1 60 ? -4.403  2.536   10.176  1.00 0.00 ? 60 GLN A O    9  
ATOM 10594 C CB   . GLN A 1 60 ? -5.989  1.252   12.333  1.00 0.00 ? 60 GLN A CB   9  
ATOM 10595 C CG   . GLN A 1 60 ? -6.878  2.432   12.690  1.00 0.00 ? 60 GLN A CG   9  
ATOM 10596 C CD   . GLN A 1 60 ? -8.348  2.148   12.456  1.00 0.00 ? 60 GLN A CD   9  
ATOM 10597 O OE1  . GLN A 1 60 ? -9.030  1.594   13.320  1.00 0.00 ? 60 GLN A OE1  9  
ATOM 10598 N NE2  . GLN A 1 60 ? -8.845  2.524   11.284  1.00 0.00 ? 60 GLN A NE2  9  
ATOM 10599 H H    . GLN A 1 60 ? -4.699  -0.690  11.341  1.00 0.00 ? 60 GLN A H    9  
ATOM 10600 H HA   . GLN A 1 60 ? -7.031  0.656   10.562  1.00 0.00 ? 60 GLN A HA   9  
ATOM 10601 H HB2  . GLN A 1 60 ? -6.317  0.397   12.906  1.00 0.00 ? 60 GLN A HB2  9  
ATOM 10602 H HB3  . GLN A 1 60 ? -4.975  1.495   12.615  1.00 0.00 ? 60 GLN A HB3  9  
ATOM 10603 H HG2  . GLN A 1 60 ? -6.735  2.672   13.733  1.00 0.00 ? 60 GLN A HG2  9  
ATOM 10604 H HG3  . GLN A 1 60 ? -6.589  3.279   12.084  1.00 0.00 ? 60 GLN A HG3  9  
ATOM 10605 H HE21 . GLN A 1 60 ? -8.243  2.960   10.644  1.00 0.00 ? 60 GLN A HE21 9  
ATOM 10606 H HE22 . GLN A 1 60 ? -9.793  2.353   11.106  1.00 0.00 ? 60 GLN A HE22 9  
ATOM 10607 N N    . CYS A 1 61 ? -6.395  2.561   9.129   1.00 0.00 ? 61 CYS A N    9  
ATOM 10608 C CA   . CYS A 1 61 ? -6.056  3.692   8.274   1.00 0.00 ? 61 CYS A CA   9  
ATOM 10609 C C    . CYS A 1 61 ? -7.302  4.502   7.923   1.00 0.00 ? 61 CYS A C    9  
ATOM 10610 O O    . CYS A 1 61 ? -8.393  3.948   7.783   1.00 0.00 ? 61 CYS A O    9  
ATOM 10611 C CB   . CYS A 1 61 ? -5.370  3.204   6.995   1.00 0.00 ? 61 CYS A CB   9  
ATOM 10612 S SG   . CYS A 1 61 ? -3.571  3.380   7.011   1.00 0.00 ? 61 CYS A SG   9  
ATOM 10613 H H    . CYS A 1 61 ? -7.281  2.150   9.049   1.00 0.00 ? 61 CYS A H    9  
ATOM 10614 H HA   . CYS A 1 61 ? -5.371  4.323   8.819   1.00 0.00 ? 61 CYS A HA   9  
ATOM 10615 H HB2  . CYS A 1 61 ? -5.595  2.157   6.852   1.00 0.00 ? 61 CYS A HB2  9  
ATOM 10616 H HB3  . CYS A 1 61 ? -5.748  3.766   6.154   1.00 0.00 ? 61 CYS A HB3  9  
ATOM 10617 H HG   . CYS A 1 61 ? -3.293  3.666   6.137   1.00 0.00 ? 61 CYS A HG   9  
ATOM 10618 N N    . PRO A 1 62 ? -7.155  5.830   7.774   1.00 0.00 ? 62 PRO A N    9  
ATOM 10619 C CA   . PRO A 1 62 ? -8.276  6.715   7.439   1.00 0.00 ? 62 PRO A CA   9  
ATOM 10620 C C    . PRO A 1 62 ? -8.721  6.562   5.986   1.00 0.00 ? 62 PRO A C    9  
ATOM 10621 O O    . PRO A 1 62 ? -7.916  6.243   5.112   1.00 0.00 ? 62 PRO A O    9  
ATOM 10622 C CB   . PRO A 1 62 ? -7.705  8.112   7.679   1.00 0.00 ? 62 PRO A CB   9  
ATOM 10623 C CG   . PRO A 1 62 ? -6.238  7.962   7.466   1.00 0.00 ? 62 PRO A CG   9  
ATOM 10624 C CD   . PRO A 1 62 ? -5.889  6.573   7.924   1.00 0.00 ? 62 PRO A CD   9  
ATOM 10625 H HA   . PRO A 1 62 ? -9.118  6.549   8.094   1.00 0.00 ? 62 PRO A HA   9  
ATOM 10626 H HB2  . PRO A 1 62 ? -8.139  8.807   6.975   1.00 0.00 ? 62 PRO A HB2  9  
ATOM 10627 H HB3  . PRO A 1 62 ? -7.927  8.427   8.688   1.00 0.00 ? 62 PRO A HB3  9  
ATOM 10628 H HG2  . PRO A 1 62 ? -6.006  8.081   6.418   1.00 0.00 ? 62 PRO A HG2  9  
ATOM 10629 H HG3  . PRO A 1 62 ? -5.705  8.695   8.055   1.00 0.00 ? 62 PRO A HG3  9  
ATOM 10630 H HD2  . PRO A 1 62 ? -5.119  6.151   7.296   1.00 0.00 ? 62 PRO A HD2  9  
ATOM 10631 H HD3  . PRO A 1 62 ? -5.570  6.584   8.956   1.00 0.00 ? 62 PRO A HD3  9  
ATOM 10632 N N    . PRO A 1 63 ? -10.019 6.790   5.707   1.00 0.00 ? 63 PRO A N    9  
ATOM 10633 C CA   . PRO A 1 63 ? -10.566 6.677   4.351   1.00 0.00 ? 63 PRO A CA   9  
ATOM 10634 C C    . PRO A 1 63 ? -9.802  7.532   3.345   1.00 0.00 ? 63 PRO A C    9  
ATOM 10635 O O    . PRO A 1 63 ? -9.390  8.650   3.653   1.00 0.00 ? 63 PRO A O    9  
ATOM 10636 C CB   . PRO A 1 63 ? -12.003 7.183   4.499   1.00 0.00 ? 63 PRO A CB   9  
ATOM 10637 C CG   . PRO A 1 63 ? -12.334 6.976   5.936   1.00 0.00 ? 63 PRO A CG   9  
ATOM 10638 C CD   . PRO A 1 63 ? -11.050 7.174   6.689   1.00 0.00 ? 63 PRO A CD   9  
ATOM 10639 H HA   . PRO A 1 63 ? -10.575 5.651   4.013   1.00 0.00 ? 63 PRO A HA   9  
ATOM 10640 H HB2  . PRO A 1 63 ? -12.048 8.228   4.229   1.00 0.00 ? 63 PRO A HB2  9  
ATOM 10641 H HB3  . PRO A 1 63 ? -12.656 6.611   3.858   1.00 0.00 ? 63 PRO A HB3  9  
ATOM 10642 H HG2  . PRO A 1 63 ? -13.070 7.701   6.251   1.00 0.00 ? 63 PRO A HG2  9  
ATOM 10643 H HG3  . PRO A 1 63 ? -12.706 5.973   6.086   1.00 0.00 ? 63 PRO A HG3  9  
ATOM 10644 H HD2  . PRO A 1 63 ? -10.938 8.209   6.981   1.00 0.00 ? 63 PRO A HD2  9  
ATOM 10645 H HD3  . PRO A 1 63 ? -11.016 6.531   7.555   1.00 0.00 ? 63 PRO A HD3  9  
ATOM 10646 N N    . LYS A 1 64 ? -9.618  6.999   2.141   1.00 0.00 ? 64 LYS A N    9  
ATOM 10647 C CA   . LYS A 1 64 ? -8.905  7.714   1.088   1.00 0.00 ? 64 LYS A CA   9  
ATOM 10648 C C    . LYS A 1 64 ? -7.449  7.949   1.482   1.00 0.00 ? 64 LYS A C    9  
ATOM 10649 O O    . LYS A 1 64 ? -6.985  9.089   1.538   1.00 0.00 ? 64 LYS A O    9  
ATOM 10650 C CB   . LYS A 1 64 ? -9.591  9.049   0.792   1.00 0.00 ? 64 LYS A CB   9  
ATOM 10651 C CG   . LYS A 1 64 ? -11.102 8.940   0.659   1.00 0.00 ? 64 LYS A CG   9  
ATOM 10652 C CD   . LYS A 1 64 ? -11.497 8.172   -0.591  1.00 0.00 ? 64 LYS A CD   9  
ATOM 10653 C CE   . LYS A 1 64 ? -11.678 6.691   -0.302  1.00 0.00 ? 64 LYS A CE   9  
ATOM 10654 N NZ   . LYS A 1 64 ? -12.765 6.092   -1.126  1.00 0.00 ? 64 LYS A NZ   9  
ATOM 10655 H H    . LYS A 1 64 ? -9.971  6.103   1.956   1.00 0.00 ? 64 LYS A H    9  
ATOM 10656 H HA   . LYS A 1 64 ? -8.929  7.102   0.199   1.00 0.00 ? 64 LYS A HA   9  
ATOM 10657 H HB2  . LYS A 1 64 ? -9.370  9.741   1.591   1.00 0.00 ? 64 LYS A HB2  9  
ATOM 10658 H HB3  . LYS A 1 64 ? -9.199  9.444   -0.134  1.00 0.00 ? 64 LYS A HB3  9  
ATOM 10659 H HG2  . LYS A 1 64 ? -11.493 8.425   1.524   1.00 0.00 ? 64 LYS A HG2  9  
ATOM 10660 H HG3  . LYS A 1 64 ? -11.522 9.934   0.609   1.00 0.00 ? 64 LYS A HG3  9  
ATOM 10661 H HD2  . LYS A 1 64 ? -12.428 8.571   -0.967  1.00 0.00 ? 64 LYS A HD2  9  
ATOM 10662 H HD3  . LYS A 1 64 ? -10.725 8.294   -1.336  1.00 0.00 ? 64 LYS A HD3  9  
ATOM 10663 H HE2  . LYS A 1 64 ? -10.751 6.180   -0.519  1.00 0.00 ? 64 LYS A HE2  9  
ATOM 10664 H HE3  . LYS A 1 64 ? -11.921 6.568   0.742   1.00 0.00 ? 64 LYS A HE3  9  
ATOM 10665 H HZ1  . LYS A 1 64 ? -12.363 5.638   -1.972  1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 10666 H HZ2  . LYS A 1 64 ? -13.433 6.830   -1.428  1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 10667 H HZ3  . LYS A 1 64 ? -13.280 5.378   -0.574  1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 10668 N N    . PHE A 1 65 ? -6.731  6.864   1.751   1.00 0.00 ? 65 PHE A N    9  
ATOM 10669 C CA   . PHE A 1 65 ? -5.328  6.950   2.137   1.00 0.00 ? 65 PHE A CA   9  
ATOM 10670 C C    . PHE A 1 65 ? -4.620  5.619   1.911   1.00 0.00 ? 65 PHE A C    9  
ATOM 10671 O O    . PHE A 1 65 ? -3.515  5.576   1.367   1.00 0.00 ? 65 PHE A O    9  
ATOM 10672 C CB   . PHE A 1 65 ? -5.206  7.363   3.605   1.00 0.00 ? 65 PHE A CB   9  
ATOM 10673 C CG   . PHE A 1 65 ? -5.388  8.837   3.830   1.00 0.00 ? 65 PHE A CG   9  
ATOM 10674 C CD1  . PHE A 1 65 ? -4.373  9.729   3.520   1.00 0.00 ? 65 PHE A CD1  9  
ATOM 10675 C CD2  . PHE A 1 65 ? -6.573  9.330   4.350   1.00 0.00 ? 65 PHE A CD2  9  
ATOM 10676 C CE1  . PHE A 1 65 ? -4.538  11.085  3.726   1.00 0.00 ? 65 PHE A CE1  9  
ATOM 10677 C CE2  . PHE A 1 65 ? -6.743  10.686  4.559   1.00 0.00 ? 65 PHE A CE2  9  
ATOM 10678 C CZ   . PHE A 1 65 ? -5.724  11.565  4.246   1.00 0.00 ? 65 PHE A CZ   9  
ATOM 10679 H H    . PHE A 1 65 ? -7.156  5.983   1.688   1.00 0.00 ? 65 PHE A H    9  
ATOM 10680 H HA   . PHE A 1 65 ? -4.860  7.703   1.520   1.00 0.00 ? 65 PHE A HA   9  
ATOM 10681 H HB2  . PHE A 1 65 ? -5.958  6.844   4.182   1.00 0.00 ? 65 PHE A HB2  9  
ATOM 10682 H HB3  . PHE A 1 65 ? -4.226  7.089   3.969   1.00 0.00 ? 65 PHE A HB3  9  
ATOM 10683 H HD1  . PHE A 1 65 ? -3.445  9.355   3.115   1.00 0.00 ? 65 PHE A HD1  9  
ATOM 10684 H HD2  . PHE A 1 65 ? -7.370  8.645   4.595   1.00 0.00 ? 65 PHE A HD2  9  
ATOM 10685 H HE1  . PHE A 1 65 ? -3.739  11.770  3.481   1.00 0.00 ? 65 PHE A HE1  9  
ATOM 10686 H HE2  . PHE A 1 65 ? -7.672  11.059  4.965   1.00 0.00 ? 65 PHE A HE2  9  
ATOM 10687 H HZ   . PHE A 1 65 ? -5.856  12.624  4.407   1.00 0.00 ? 65 PHE A HZ   9  
ATOM 10688 N N    . GLY A 1 66 ? -5.262  4.533   2.329   1.00 0.00 ? 66 GLY A N    9  
ATOM 10689 C CA   . GLY A 1 66 ? -4.679  3.216   2.160   1.00 0.00 ? 66 GLY A CA   9  
ATOM 10690 C C    . GLY A 1 66 ? -4.950  2.636   0.786   1.00 0.00 ? 66 GLY A C    9  
ATOM 10691 O O    . GLY A 1 66 ? -6.102  2.402   0.420   1.00 0.00 ? 66 GLY A O    9  
ATOM 10692 H H    . GLY A 1 66 ? -6.140  4.628   2.754   1.00 0.00 ? 66 GLY A H    9  
ATOM 10693 H HA2  . GLY A 1 66 ? -3.611  3.284   2.306   1.00 0.00 ? 66 GLY A HA2  9  
ATOM 10694 H HA3  . GLY A 1 66 ? -5.092  2.553   2.907   1.00 0.00 ? 66 GLY A HA3  9  
ATOM 10695 N N    . LEU A 1 67 ? -3.887  2.405   0.023   1.00 0.00 ? 67 LEU A N    9  
ATOM 10696 C CA   . LEU A 1 67 ? -4.017  1.851   -1.320  1.00 0.00 ? 67 LEU A CA   9  
ATOM 10697 C C    . LEU A 1 67 ? -3.257  0.535   -1.444  1.00 0.00 ? 67 LEU A C    9  
ATOM 10698 O O    . LEU A 1 67 ? -2.060  0.468   -1.166  1.00 0.00 ? 67 LEU A O    9  
ATOM 10699 C CB   . LEU A 1 67 ? -3.502  2.851   -2.358  1.00 0.00 ? 67 LEU A CB   9  
ATOM 10700 C CG   . LEU A 1 67 ? -4.095  2.693   -3.760  1.00 0.00 ? 67 LEU A CG   9  
ATOM 10701 C CD1  . LEU A 1 67 ? -4.504  4.045   -4.325  1.00 0.00 ? 67 LEU A CD1  9  
ATOM 10702 C CD2  . LEU A 1 67 ? -3.103  2.005   -4.685  1.00 0.00 ? 67 LEU A CD2  9  
ATOM 10703 H H    . LEU A 1 67 ? -2.994  2.614   0.369   1.00 0.00 ? 67 LEU A H    9  
ATOM 10704 H HA   . LEU A 1 67 ? -5.065  1.666   -1.503  1.00 0.00 ? 67 LEU A HA   9  
ATOM 10705 H HB2  . LEU A 1 67 ? -3.722  3.848   -2.004  1.00 0.00 ? 67 LEU A HB2  9  
ATOM 10706 H HB3  . LEU A 1 67 ? -2.430  2.742   -2.430  1.00 0.00 ? 67 LEU A HB3  9  
ATOM 10707 H HG   . LEU A 1 67 ? -4.981  2.077   -3.702  1.00 0.00 ? 67 LEU A HG   9  
ATOM 10708 H HD11 . LEU A 1 67 ? -3.904  4.821   -3.871  1.00 0.00 ? 67 LEU A HD11 9  
ATOM 10709 H HD12 . LEU A 1 67 ? -5.547  4.225   -4.113  1.00 0.00 ? 67 LEU A HD12 9  
ATOM 10710 H HD13 . LEU A 1 67 ? -4.349  4.051   -5.394  1.00 0.00 ? 67 LEU A HD13 9  
ATOM 10711 H HD21 . LEU A 1 67 ? -3.265  0.938   -4.658  1.00 0.00 ? 67 LEU A HD21 9  
ATOM 10712 H HD22 . LEU A 1 67 ? -2.097  2.224   -4.361  1.00 0.00 ? 67 LEU A HD22 9  
ATOM 10713 H HD23 . LEU A 1 67 ? -3.242  2.365   -5.694  1.00 0.00 ? 67 LEU A HD23 9  
ATOM 10714 N N    . PHE A 1 68 ? -3.963  -0.512  -1.862  1.00 0.00 ? 68 PHE A N    9  
ATOM 10715 C CA   . PHE A 1 68 ? -3.355  -1.828  -2.024  1.00 0.00 ? 68 PHE A CA   9  
ATOM 10716 C C    . PHE A 1 68 ? -2.794  -1.998  -3.433  1.00 0.00 ? 68 PHE A C    9  
ATOM 10717 O O    . PHE A 1 68 ? -3.503  -1.807  -4.420  1.00 0.00 ? 68 PHE A O    9  
ATOM 10718 C CB   . PHE A 1 68 ? -4.381  -2.925  -1.736  1.00 0.00 ? 68 PHE A CB   9  
ATOM 10719 C CG   . PHE A 1 68 ? -4.708  -3.076  -0.277  1.00 0.00 ? 68 PHE A CG   9  
ATOM 10720 C CD1  . PHE A 1 68 ? -3.889  -3.821  0.556   1.00 0.00 ? 68 PHE A CD1  9  
ATOM 10721 C CD2  . PHE A 1 68 ? -5.835  -2.474  0.259   1.00 0.00 ? 68 PHE A CD2  9  
ATOM 10722 C CE1  . PHE A 1 68 ? -4.187  -3.961  1.897   1.00 0.00 ? 68 PHE A CE1  9  
ATOM 10723 C CE2  . PHE A 1 68 ? -6.137  -2.612  1.601   1.00 0.00 ? 68 PHE A CE2  9  
ATOM 10724 C CZ   . PHE A 1 68 ? -5.313  -3.357  2.420   1.00 0.00 ? 68 PHE A CZ   9  
ATOM 10725 H H    . PHE A 1 68 ? -4.913  -0.396  -2.068  1.00 0.00 ? 68 PHE A H    9  
ATOM 10726 H HA   . PHE A 1 68 ? -2.546  -1.909  -1.314  1.00 0.00 ? 68 PHE A HA   9  
ATOM 10727 H HB2  . PHE A 1 68 ? -5.298  -2.697  -2.259  1.00 0.00 ? 68 PHE A HB2  9  
ATOM 10728 H HB3  . PHE A 1 68 ? -3.996  -3.869  -2.091  1.00 0.00 ? 68 PHE A HB3  9  
ATOM 10729 H HD1  . PHE A 1 68 ? -3.007  -4.293  0.147   1.00 0.00 ? 68 PHE A HD1  9  
ATOM 10730 H HD2  . PHE A 1 68 ? -6.481  -1.892  -0.381  1.00 0.00 ? 68 PHE A HD2  9  
ATOM 10731 H HE1  . PHE A 1 68 ? -3.540  -4.544  2.537   1.00 0.00 ? 68 PHE A HE1  9  
ATOM 10732 H HE2  . PHE A 1 68 ? -7.020  -2.138  2.007   1.00 0.00 ? 68 PHE A HE2  9  
ATOM 10733 H HZ   . PHE A 1 68 ? -5.548  -3.466  3.469   1.00 0.00 ? 68 PHE A HZ   9  
ATOM 10734 N N    . ALA A 1 69 ? -1.519  -2.360  -3.517  1.00 0.00 ? 69 ALA A N    9  
ATOM 10735 C CA   . ALA A 1 69 ? -0.864  -2.557  -4.803  1.00 0.00 ? 69 ALA A CA   9  
ATOM 10736 C C    . ALA A 1 69 ? 0.134   -3.712  -4.742  1.00 0.00 ? 69 ALA A C    9  
ATOM 10737 O O    . ALA A 1 69 ? 0.800   -3.911  -3.725  1.00 0.00 ? 69 ALA A O    9  
ATOM 10738 C CB   . ALA A 1 69 ? -0.167  -1.279  -5.242  1.00 0.00 ? 69 ALA A CB   9  
ATOM 10739 H H    . ALA A 1 69 ? -1.005  -2.499  -2.693  1.00 0.00 ? 69 ALA A H    9  
ATOM 10740 H HA   . ALA A 1 69 ? -1.627  -2.791  -5.531  1.00 0.00 ? 69 ALA A HA   9  
ATOM 10741 H HB1  . ALA A 1 69 ? 0.590   -1.015  -4.519  1.00 0.00 ? 69 ALA A HB1  9  
ATOM 10742 H HB2  . ALA A 1 69 ? -0.891  -0.480  -5.313  1.00 0.00 ? 69 ALA A HB2  9  
ATOM 10743 H HB3  . ALA A 1 69 ? 0.293   -1.431  -6.207  1.00 0.00 ? 69 ALA A HB3  9  
ATOM 10744 N N    . PRO A 1 70 ? 0.254   -4.491  -5.832  1.00 0.00 ? 70 PRO A N    9  
ATOM 10745 C CA   . PRO A 1 70 ? 1.180   -5.627  -5.890  1.00 0.00 ? 70 PRO A CA   9  
ATOM 10746 C C    . PRO A 1 70 ? 2.610   -5.223  -5.554  1.00 0.00 ? 70 PRO A C    9  
ATOM 10747 O O    . PRO A 1 70 ? 3.042   -4.114  -5.867  1.00 0.00 ? 70 PRO A O    9  
ATOM 10748 C CB   . PRO A 1 70 ? 1.085   -6.095  -7.345  1.00 0.00 ? 70 PRO A CB   9  
ATOM 10749 C CG   . PRO A 1 70 ? -0.244  -5.616  -7.815  1.00 0.00 ? 70 PRO A CG   9  
ATOM 10750 C CD   . PRO A 1 70 ? -0.499  -4.325  -7.089  1.00 0.00 ? 70 PRO A CD   9  
ATOM 10751 H HA   . PRO A 1 70 ? 0.867   -6.424  -5.231  1.00 0.00 ? 70 PRO A HA   9  
ATOM 10752 H HB2  . PRO A 1 70 ? 1.889   -5.658  -7.919  1.00 0.00 ? 70 PRO A HB2  9  
ATOM 10753 H HB3  . PRO A 1 70 ? 1.151   -7.172  -7.384  1.00 0.00 ? 70 PRO A HB3  9  
ATOM 10754 H HG2  . PRO A 1 70 ? -0.218  -5.447  -8.882  1.00 0.00 ? 70 PRO A HG2  9  
ATOM 10755 H HG3  . PRO A 1 70 ? -1.005  -6.341  -7.569  1.00 0.00 ? 70 PRO A HG3  9  
ATOM 10756 H HD2  . PRO A 1 70 ? -0.121  -3.490  -7.659  1.00 0.00 ? 70 PRO A HD2  9  
ATOM 10757 H HD3  . PRO A 1 70 ? -1.554  -4.205  -6.894  1.00 0.00 ? 70 PRO A HD3  9  
ATOM 10758 N N    . ILE A 1 71 ? 3.342   -6.129  -4.913  1.00 0.00 ? 71 ILE A N    9  
ATOM 10759 C CA   . ILE A 1 71 ? 4.725   -5.864  -4.535  1.00 0.00 ? 71 ILE A CA   9  
ATOM 10760 C C    . ILE A 1 71 ? 5.576   -5.535  -5.759  1.00 0.00 ? 71 ILE A C    9  
ATOM 10761 O O    . ILE A 1 71 ? 6.350   -4.576  -5.750  1.00 0.00 ? 71 ILE A O    9  
ATOM 10762 C CB   . ILE A 1 71 ? 5.344   -7.064  -3.790  1.00 0.00 ? 71 ILE A CB   9  
ATOM 10763 C CG1  . ILE A 1 71 ? 6.760   -6.728  -3.317  1.00 0.00 ? 71 ILE A CG1  9  
ATOM 10764 C CG2  . ILE A 1 71 ? 5.356   -8.298  -4.681  1.00 0.00 ? 71 ILE A CG2  9  
ATOM 10765 C CD1  . ILE A 1 71 ? 7.199   -7.528  -2.109  1.00 0.00 ? 71 ILE A CD1  9  
ATOM 10766 H H    . ILE A 1 71 ? 2.943   -6.995  -4.690  1.00 0.00 ? 71 ILE A H    9  
ATOM 10767 H HA   . ILE A 1 71 ? 4.730   -5.013  -3.869  1.00 0.00 ? 71 ILE A HA   9  
ATOM 10768 H HB   . ILE A 1 71 ? 4.729   -7.280  -2.930  1.00 0.00 ? 71 ILE A HB   9  
ATOM 10769 H HG12 . ILE A 1 71 ? 7.458   -6.928  -4.117  1.00 0.00 ? 71 ILE A HG12 9  
ATOM 10770 H HG13 . ILE A 1 71 ? 6.808   -5.681  -3.058  1.00 0.00 ? 71 ILE A HG13 9  
ATOM 10771 H HG21 . ILE A 1 71 ? 6.073   -8.161  -5.477  1.00 0.00 ? 71 ILE A HG21 9  
ATOM 10772 H HG22 . ILE A 1 71 ? 4.373   -8.447  -5.103  1.00 0.00 ? 71 ILE A HG22 9  
ATOM 10773 H HG23 . ILE A 1 71 ? 5.630   -9.163  -4.095  1.00 0.00 ? 71 ILE A HG23 9  
ATOM 10774 H HD11 . ILE A 1 71 ? 7.492   -8.520  -2.421  1.00 0.00 ? 71 ILE A HD11 9  
ATOM 10775 H HD12 . ILE A 1 71 ? 6.382   -7.598  -1.407  1.00 0.00 ? 71 ILE A HD12 9  
ATOM 10776 H HD13 . ILE A 1 71 ? 8.038   -7.037  -1.637  1.00 0.00 ? 71 ILE A HD13 9  
ATOM 10777 N N    . HIS A 1 72 ? 5.427   -6.333  -6.812  1.00 0.00 ? 72 HIS A N    9  
ATOM 10778 C CA   . HIS A 1 72 ? 6.184   -6.122  -8.042  1.00 0.00 ? 72 HIS A CA   9  
ATOM 10779 C C    . HIS A 1 72 ? 5.803   -4.797  -8.698  1.00 0.00 ? 72 HIS A C    9  
ATOM 10780 O O    . HIS A 1 72 ? 6.563   -4.252  -9.499  1.00 0.00 ? 72 HIS A O    9  
ATOM 10781 C CB   . HIS A 1 72 ? 5.947   -7.276  -9.019  1.00 0.00 ? 72 HIS A CB   9  
ATOM 10782 C CG   . HIS A 1 72 ? 4.508   -7.663  -9.158  1.00 0.00 ? 72 HIS A CG   9  
ATOM 10783 N ND1  . HIS A 1 72 ? 3.872   -8.565  -8.334  1.00 0.00 ? 72 HIS A ND1  9  
ATOM 10784 C CD2  . HIS A 1 72 ? 3.574   -7.250  -10.053 1.00 0.00 ? 72 HIS A CD2  9  
ATOM 10785 C CE1  . HIS A 1 72 ? 2.601   -8.671  -8.745  1.00 0.00 ? 72 HIS A CE1  9  
ATOM 10786 N NE2  . HIS A 1 72 ? 2.368   -7.894  -9.785  1.00 0.00 ? 72 HIS A NE2  9  
ATOM 10787 H H    . HIS A 1 72 ? 4.795   -7.080  -6.761  1.00 0.00 ? 72 HIS A H    9  
ATOM 10788 H HA   . HIS A 1 72 ? 7.231   -6.092  -7.783  1.00 0.00 ? 72 HIS A HA   9  
ATOM 10789 H HB2  . HIS A 1 72 ? 6.309   -6.991  -9.994  1.00 0.00 ? 72 HIS A HB2  9  
ATOM 10790 H HB3  . HIS A 1 72 ? 6.494   -8.144  -8.678  1.00 0.00 ? 72 HIS A HB3  9  
ATOM 10791 H HD1  . HIS A 1 72 ? 4.277   -9.044  -7.582  1.00 0.00 ? 72 HIS A HD1  9  
ATOM 10792 H HD2  . HIS A 1 72 ? 3.730   -6.539  -10.850 1.00 0.00 ? 72 HIS A HD2  9  
ATOM 10793 H HE1  . HIS A 1 72 ? 1.862   -9.309  -8.283  1.00 0.00 ? 72 HIS A HE1  9  
ATOM 10794 N N    . LYS A 1 73 ? 4.627   -4.280  -8.352  1.00 0.00 ? 73 LYS A N    9  
ATOM 10795 C CA   . LYS A 1 73 ? 4.155   -3.018  -8.910  1.00 0.00 ? 73 LYS A CA   9  
ATOM 10796 C C    . LYS A 1 73 ? 4.473   -1.852  -7.976  1.00 0.00 ? 73 LYS A C    9  
ATOM 10797 O O    . LYS A 1 73 ? 3.826   -0.806  -8.035  1.00 0.00 ? 73 LYS A O    9  
ATOM 10798 C CB   . LYS A 1 73 ? 2.648   -3.082  -9.167  1.00 0.00 ? 73 LYS A CB   9  
ATOM 10799 C CG   . LYS A 1 73 ? 2.270   -3.945  -10.359 1.00 0.00 ? 73 LYS A CG   9  
ATOM 10800 C CD   . LYS A 1 73 ? 2.725   -3.319  -11.667 1.00 0.00 ? 73 LYS A CD   9  
ATOM 10801 C CE   . LYS A 1 73 ? 4.011   -3.953  -12.171 1.00 0.00 ? 73 LYS A CE   9  
ATOM 10802 N NZ   . LYS A 1 73 ? 3.749   -5.013  -13.184 1.00 0.00 ? 73 LYS A NZ   9  
ATOM 10803 H H    . LYS A 1 73 ? 4.065   -4.757  -7.708  1.00 0.00 ? 73 LYS A H    9  
ATOM 10804 H HA   . LYS A 1 73 ? 4.664   -2.860  -9.849  1.00 0.00 ? 73 LYS A HA   9  
ATOM 10805 H HB2  . LYS A 1 73 ? 2.163   -3.484  -8.289  1.00 0.00 ? 73 LYS A HB2  9  
ATOM 10806 H HB3  . LYS A 1 73 ? 2.282   -2.082  -9.344  1.00 0.00 ? 73 LYS A HB3  9  
ATOM 10807 H HG2  . LYS A 1 73 ? 2.738   -4.913  -10.253 1.00 0.00 ? 73 LYS A HG2  9  
ATOM 10808 H HG3  . LYS A 1 73 ? 1.196   -4.062  -10.379 1.00 0.00 ? 73 LYS A HG3  9  
ATOM 10809 H HD2  . LYS A 1 73 ? 1.952   -3.458  -12.409 1.00 0.00 ? 73 LYS A HD2  9  
ATOM 10810 H HD3  . LYS A 1 73 ? 2.891   -2.263  -11.512 1.00 0.00 ? 73 LYS A HD3  9  
ATOM 10811 H HE2  . LYS A 1 73 ? 4.625   -3.185  -12.618 1.00 0.00 ? 73 LYS A HE2  9  
ATOM 10812 H HE3  . LYS A 1 73 ? 4.534   -4.390  -11.333 1.00 0.00 ? 73 LYS A HE3  9  
ATOM 10813 H HZ1  . LYS A 1 73 ? 4.432   -5.789  -13.073 1.00 0.00 ? 73 LYS A HZ1  9  
ATOM 10814 H HZ2  . LYS A 1 73 ? 3.839   -4.620  -14.143 1.00 0.00 ? 73 LYS A HZ2  9  
ATOM 10815 H HZ3  . LYS A 1 73 ? 2.787   -5.390  -13.065 1.00 0.00 ? 73 LYS A HZ3  9  
ATOM 10816 N N    . VAL A 1 74 ? 5.471   -2.035  -7.116  1.00 0.00 ? 74 VAL A N    9  
ATOM 10817 C CA   . VAL A 1 74 ? 5.868   -0.995  -6.175  1.00 0.00 ? 74 VAL A CA   9  
ATOM 10818 C C    . VAL A 1 74 ? 7.364   -0.710  -6.269  1.00 0.00 ? 74 VAL A C    9  
ATOM 10819 O O    . VAL A 1 74 ? 8.164   -1.616  -6.503  1.00 0.00 ? 74 VAL A O    9  
ATOM 10820 C CB   . VAL A 1 74 ? 5.521   -1.386  -4.726  1.00 0.00 ? 74 VAL A CB   9  
ATOM 10821 C CG1  . VAL A 1 74 ? 5.797   -0.229  -3.777  1.00 0.00 ? 74 VAL A CG1  9  
ATOM 10822 C CG2  . VAL A 1 74 ? 4.069   -1.835  -4.625  1.00 0.00 ? 74 VAL A CG2  9  
ATOM 10823 H H    . VAL A 1 74 ? 5.952   -2.889  -7.114  1.00 0.00 ? 74 VAL A H    9  
ATOM 10824 H HA   . VAL A 1 74 ? 5.324   -0.095  -6.423  1.00 0.00 ? 74 VAL A HA   9  
ATOM 10825 H HB   . VAL A 1 74 ? 6.152   -2.216  -4.438  1.00 0.00 ? 74 VAL A HB   9  
ATOM 10826 H HG11 . VAL A 1 74 ? 5.063   -0.230  -2.985  1.00 0.00 ? 74 VAL A HG11 9  
ATOM 10827 H HG12 . VAL A 1 74 ? 5.740   0.703   -4.320  1.00 0.00 ? 74 VAL A HG12 9  
ATOM 10828 H HG13 . VAL A 1 74 ? 6.784   -0.339  -3.353  1.00 0.00 ? 74 VAL A HG13 9  
ATOM 10829 H HG21 . VAL A 1 74 ? 3.494   -1.081  -4.109  1.00 0.00 ? 74 VAL A HG21 9  
ATOM 10830 H HG22 . VAL A 1 74 ? 4.018   -2.764  -4.077  1.00 0.00 ? 74 VAL A HG22 9  
ATOM 10831 H HG23 . VAL A 1 74 ? 3.667   -1.978  -5.616  1.00 0.00 ? 74 VAL A HG23 9  
ATOM 10832 N N    . ILE A 1 75 ? 7.733   0.552   -6.085  1.00 0.00 ? 75 ILE A N    9  
ATOM 10833 C CA   . ILE A 1 75 ? 9.133   0.957   -6.149  1.00 0.00 ? 75 ILE A CA   9  
ATOM 10834 C C    . ILE A 1 75 ? 9.584   1.579   -4.832  1.00 0.00 ? 75 ILE A C    9  
ATOM 10835 O O    . ILE A 1 75 ? 9.055   2.604   -4.404  1.00 0.00 ? 75 ILE A O    9  
ATOM 10836 C CB   . ILE A 1 75 ? 9.376   1.964   -7.290  1.00 0.00 ? 75 ILE A CB   9  
ATOM 10837 C CG1  . ILE A 1 75 ? 8.789   1.440   -8.602  1.00 0.00 ? 75 ILE A CG1  9  
ATOM 10838 C CG2  . ILE A 1 75 ? 10.864  2.243   -7.445  1.00 0.00 ? 75 ILE A CG2  9  
ATOM 10839 C CD1  . ILE A 1 75 ? 8.054   2.495   -9.400  1.00 0.00 ? 75 ILE A CD1  9  
ATOM 10840 H H    . ILE A 1 75 ? 7.048   1.229   -5.902  1.00 0.00 ? 75 ILE A H    9  
ATOM 10841 H HA   . ILE A 1 75 ? 9.727   0.075   -6.343  1.00 0.00 ? 75 ILE A HA   9  
ATOM 10842 H HB   . ILE A 1 75 ? 8.888   2.892   -7.031  1.00 0.00 ? 75 ILE A HB   9  
ATOM 10843 H HG12 . ILE A 1 75 ? 9.587   1.055   -9.219  1.00 0.00 ? 75 ILE A HG12 9  
ATOM 10844 H HG13 . ILE A 1 75 ? 8.092   0.642   -8.384  1.00 0.00 ? 75 ILE A HG13 9  
ATOM 10845 H HG21 . ILE A 1 75 ? 11.373  2.001   -6.523  1.00 0.00 ? 75 ILE A HG21 9  
ATOM 10846 H HG22 . ILE A 1 75 ? 11.014  3.288   -7.674  1.00 0.00 ? 75 ILE A HG22 9  
ATOM 10847 H HG23 . ILE A 1 75 ? 11.262  1.639   -8.246  1.00 0.00 ? 75 ILE A HG23 9  
ATOM 10848 H HD11 . ILE A 1 75 ? 7.096   2.689   -8.943  1.00 0.00 ? 75 ILE A HD11 9  
ATOM 10849 H HD12 . ILE A 1 75 ? 7.907   2.144   -10.411 1.00 0.00 ? 75 ILE A HD12 9  
ATOM 10850 H HD13 . ILE A 1 75 ? 8.637   3.404   -9.416  1.00 0.00 ? 75 ILE A HD13 9  
ATOM 10851 N N    . ARG A 1 76 ? 10.567  0.952   -4.194  1.00 0.00 ? 76 ARG A N    9  
ATOM 10852 C CA   . ARG A 1 76 ? 11.091  1.445   -2.926  1.00 0.00 ? 76 ARG A CA   9  
ATOM 10853 C C    . ARG A 1 76 ? 11.869  2.742   -3.127  1.00 0.00 ? 76 ARG A C    9  
ATOM 10854 O O    . ARG A 1 76 ? 12.308  3.048   -4.235  1.00 0.00 ? 76 ARG A O    9  
ATOM 10855 C CB   . ARG A 1 76 ? 11.988  0.388   -2.276  1.00 0.00 ? 76 ARG A CB   9  
ATOM 10856 C CG   . ARG A 1 76 ? 11.432  -0.167  -0.975  1.00 0.00 ? 76 ARG A CG   9  
ATOM 10857 C CD   . ARG A 1 76 ? 12.117  -1.466  -0.584  1.00 0.00 ? 76 ARG A CD   9  
ATOM 10858 N NE   . ARG A 1 76 ? 13.281  -1.238  0.270   1.00 0.00 ? 76 ARG A NE   9  
ATOM 10859 C CZ   . ARG A 1 76 ? 14.504  -0.981  -0.191  1.00 0.00 ? 76 ARG A CZ   9  
ATOM 10860 N NH1  . ARG A 1 76 ? 14.733  -0.920  -1.497  1.00 0.00 ? 76 ARG A NH1  9  
ATOM 10861 N NH2  . ARG A 1 76 ? 15.503  -0.785  0.659   1.00 0.00 ? 76 ARG A NH2  9  
ATOM 10862 H H    . ARG A 1 76 ? 10.950  0.140   -4.585  1.00 0.00 ? 76 ARG A H    9  
ATOM 10863 H HA   . ARG A 1 76 ? 10.252  1.641   -2.275  1.00 0.00 ? 76 ARG A HA   9  
ATOM 10864 H HB2  . ARG A 1 76 ? 12.115  -0.433  -2.967  1.00 0.00 ? 76 ARG A HB2  9  
ATOM 10865 H HB3  . ARG A 1 76 ? 12.954  0.825   -2.071  1.00 0.00 ? 76 ARG A HB3  9  
ATOM 10866 H HG2  . ARG A 1 76 ? 11.584  0.559   -0.191  1.00 0.00 ? 76 ARG A HG2  9  
ATOM 10867 H HG3  . ARG A 1 76 ? 10.374  -0.349  -1.097  1.00 0.00 ? 76 ARG A HG3  9  
ATOM 10868 H HD2  . ARG A 1 76 ? 11.408  -2.083  -0.050  1.00 0.00 ? 76 ARG A HD2  9  
ATOM 10869 H HD3  . ARG A 1 76 ? 12.432  -1.978  -1.480  1.00 0.00 ? 76 ARG A HD3  9  
ATOM 10870 H HE   . ARG A 1 76 ? 13.145  -1.277  1.239   1.00 0.00 ? 76 ARG A HE   9  
ATOM 10871 H HH11 . ARG A 1 76 ? 13.987  -1.067  -2.145  1.00 0.00 ? 76 ARG A HH11 9  
ATOM 10872 H HH12 . ARG A 1 76 ? 15.656  -0.727  -1.833  1.00 0.00 ? 76 ARG A HH12 9  
ATOM 10873 H HH21 . ARG A 1 76 ? 15.338  -0.830  1.644   1.00 0.00 ? 76 ARG A HH21 9  
ATOM 10874 H HH22 . ARG A 1 76 ? 16.423  -0.593  0.315   1.00 0.00 ? 76 ARG A HH22 9  
ATOM 10875 N N    . ILE A 1 77 ? 12.037  3.499   -2.048  1.00 0.00 ? 77 ILE A N    9  
ATOM 10876 C CA   . ILE A 1 77 ? 12.762  4.762   -2.107  1.00 0.00 ? 77 ILE A CA   9  
ATOM 10877 C C    . ILE A 1 77 ? 13.834  4.832   -1.025  1.00 0.00 ? 77 ILE A C    9  
ATOM 10878 O O    . ILE A 1 77 ? 15.002  5.094   -1.310  1.00 0.00 ? 77 ILE A O    9  
ATOM 10879 C CB   . ILE A 1 77 ? 11.812  5.964   -1.950  1.00 0.00 ? 77 ILE A CB   9  
ATOM 10880 C CG1  . ILE A 1 77 ? 10.613  5.821   -2.890  1.00 0.00 ? 77 ILE A CG1  9  
ATOM 10881 C CG2  . ILE A 1 77 ? 12.552  7.265   -2.222  1.00 0.00 ? 77 ILE A CG2  9  
ATOM 10882 C CD1  . ILE A 1 77 ? 9.458   6.733   -2.539  1.00 0.00 ? 77 ILE A CD1  9  
ATOM 10883 H H    . ILE A 1 77 ? 11.664  3.202   -1.192  1.00 0.00 ? 77 ILE A H    9  
ATOM 10884 H HA   . ILE A 1 77 ? 13.237  4.830   -3.075  1.00 0.00 ? 77 ILE A HA   9  
ATOM 10885 H HB   . ILE A 1 77 ? 11.459  5.986   -0.930  1.00 0.00 ? 77 ILE A HB   9  
ATOM 10886 H HG12 . ILE A 1 77 ? 10.924  6.053   -3.897  1.00 0.00 ? 77 ILE A HG12 9  
ATOM 10887 H HG13 . ILE A 1 77 ? 10.256  4.802   -2.854  1.00 0.00 ? 77 ILE A HG13 9  
ATOM 10888 H HG21 . ILE A 1 77 ? 11.847  8.024   -2.528  1.00 0.00 ? 77 ILE A HG21 9  
ATOM 10889 H HG22 . ILE A 1 77 ? 13.277  7.109   -3.007  1.00 0.00 ? 77 ILE A HG22 9  
ATOM 10890 H HG23 . ILE A 1 77 ? 13.059  7.586   -1.323  1.00 0.00 ? 77 ILE A HG23 9  
ATOM 10891 H HD11 . ILE A 1 77 ? 9.638   7.189   -1.577  1.00 0.00 ? 77 ILE A HD11 9  
ATOM 10892 H HD12 . ILE A 1 77 ? 8.544   6.157   -2.500  1.00 0.00 ? 77 ILE A HD12 9  
ATOM 10893 H HD13 . ILE A 1 77 ? 9.365   7.503   -3.291  1.00 0.00 ? 77 ILE A HD13 9  
ATOM 10894 N N    . GLY A 1 78 ? 13.428  4.596   0.219   1.00 0.00 ? 78 GLY A N    9  
ATOM 10895 C CA   . GLY A 1 78 ? 14.366  4.637   1.325   1.00 0.00 ? 78 GLY A CA   9  
ATOM 10896 C C    . GLY A 1 78 ? 15.030  3.297   1.572   1.00 0.00 ? 78 GLY A C    9  
ATOM 10897 O O    . GLY A 1 78 ? 14.353  2.295   1.808   1.00 0.00 ? 78 GLY A O    9  
ATOM 10898 H H    . GLY A 1 78 ? 12.484  4.393   0.386   1.00 0.00 ? 78 GLY A H    9  
ATOM 10899 H HA2  . GLY A 1 78 ? 15.129  5.370   1.109   1.00 0.00 ? 78 GLY A HA2  9  
ATOM 10900 H HA3  . GLY A 1 78 ? 13.838  4.935   2.220   1.00 0.00 ? 78 GLY A HA3  9  
ATOM 10901 N N    . SER A 1 79 ? 16.357  3.277   1.518   1.00 0.00 ? 79 SER A N    9  
ATOM 10902 C CA   . SER A 1 79 ? 17.113  2.049   1.737   1.00 0.00 ? 79 SER A CA   9  
ATOM 10903 C C    . SER A 1 79 ? 17.623  1.973   3.172   1.00 0.00 ? 79 SER A C    9  
ATOM 10904 O O    . SER A 1 79 ? 17.750  0.888   3.740   1.00 0.00 ? 79 SER A O    9  
ATOM 10905 C CB   . SER A 1 79 ? 18.288  1.967   0.760   1.00 0.00 ? 79 SER A CB   9  
ATOM 10906 O OG   . SER A 1 79 ? 18.874  0.677   0.775   1.00 0.00 ? 79 SER A OG   9  
ATOM 10907 H H    . SER A 1 79 ? 16.841  4.107   1.326   1.00 0.00 ? 79 SER A H    9  
ATOM 10908 H HA   . SER A 1 79 ? 16.450  1.216   1.559   1.00 0.00 ? 79 SER A HA   9  
ATOM 10909 H HB2  . SER A 1 79 ? 17.937  2.178   -0.239  1.00 0.00 ? 79 SER A HB2  9  
ATOM 10910 H HB3  . SER A 1 79 ? 19.036  2.693   1.040   1.00 0.00 ? 79 SER A HB3  9  
ATOM 10911 H HG   . SER A 1 79 ? 19.042  0.411   1.682   1.00 0.00 ? 79 SER A HG   9  
ATOM 10912 N N    . GLY A 1 80 ? 17.915  3.132   3.753   1.00 0.00 ? 80 GLY A N    9  
ATOM 10913 C CA   . GLY A 1 80 ? 18.407  3.174   5.118   1.00 0.00 ? 80 GLY A CA   9  
ATOM 10914 C C    . GLY A 1 80 ? 18.858  4.563   5.530   1.00 0.00 ? 80 GLY A C    9  
ATOM 10915 O O    . GLY A 1 80 ? 18.708  5.518   4.767   1.00 0.00 ? 80 GLY A O    9  
ATOM 10916 H H    . GLY A 1 80 ? 17.793  3.965   3.252   1.00 0.00 ? 80 GLY A H    9  
ATOM 10917 H HA2  . GLY A 1 80 ? 17.620  2.850   5.783   1.00 0.00 ? 80 GLY A HA2  9  
ATOM 10918 H HA3  . GLY A 1 80 ? 19.242  2.495   5.208   1.00 0.00 ? 80 GLY A HA3  9  
ATOM 10919 N N    . PRO A 1 81 ? 19.418  4.709   6.744   1.00 0.00 ? 81 PRO A N    9  
ATOM 10920 C CA   . PRO A 1 81 ? 19.889  6.004   7.245   1.00 0.00 ? 81 PRO A CA   9  
ATOM 10921 C C    . PRO A 1 81 ? 21.130  6.495   6.507   1.00 0.00 ? 81 PRO A C    9  
ATOM 10922 O O    . PRO A 1 81 ? 21.504  5.948   5.469   1.00 0.00 ? 81 PRO A O    9  
ATOM 10923 C CB   . PRO A 1 81 ? 20.216  5.720   8.713   1.00 0.00 ? 81 PRO A CB   9  
ATOM 10924 C CG   . PRO A 1 81 ? 20.517  4.262   8.758   1.00 0.00 ? 81 PRO A CG   9  
ATOM 10925 C CD   . PRO A 1 81 ? 19.635  3.625   7.720   1.00 0.00 ? 81 PRO A CD   9  
ATOM 10926 H HA   . PRO A 1 81 ? 19.116  6.756   7.185   1.00 0.00 ? 81 PRO A HA   9  
ATOM 10927 H HB2  . PRO A 1 81 ? 21.070  6.310   9.015   1.00 0.00 ? 81 PRO A HB2  9  
ATOM 10928 H HB3  . PRO A 1 81 ? 19.365  5.967   9.329   1.00 0.00 ? 81 PRO A HB3  9  
ATOM 10929 H HG2  . PRO A 1 81 ? 21.557  4.094   8.521   1.00 0.00 ? 81 PRO A HG2  9  
ATOM 10930 H HG3  . PRO A 1 81 ? 20.286  3.870   9.737   1.00 0.00 ? 81 PRO A HG3  9  
ATOM 10931 H HD2  . PRO A 1 81 ? 20.138  2.788   7.261   1.00 0.00 ? 81 PRO A HD2  9  
ATOM 10932 H HD3  . PRO A 1 81 ? 18.700  3.311   8.160   1.00 0.00 ? 81 PRO A HD3  9  
ATOM 10933 N N    . SER A 1 82 ? 21.765  7.528   7.049   1.00 0.00 ? 82 SER A N    9  
ATOM 10934 C CA   . SER A 1 82 ? 22.966  8.092   6.443   1.00 0.00 ? 82 SER A CA   9  
ATOM 10935 C C    . SER A 1 82 ? 24.222  7.461   7.034   1.00 0.00 ? 82 SER A C    9  
ATOM 10936 O O    . SER A 1 82 ? 24.480  7.574   8.232   1.00 0.00 ? 82 SER A O    9  
ATOM 10937 C CB   . SER A 1 82 ? 23.000  9.608   6.641   1.00 0.00 ? 82 SER A CB   9  
ATOM 10938 O OG   . SER A 1 82 ? 21.988  10.246  5.882   1.00 0.00 ? 82 SER A OG   9  
ATOM 10939 H H    . SER A 1 82 ? 21.419  7.921   7.878   1.00 0.00 ? 82 SER A H    9  
ATOM 10940 H HA   . SER A 1 82 ? 22.934  7.877   5.385   1.00 0.00 ? 82 SER A HA   9  
ATOM 10941 H HB2  . SER A 1 82 ? 22.845  9.836   7.686   1.00 0.00 ? 82 SER A HB2  9  
ATOM 10942 H HB3  . SER A 1 82 ? 23.962  9.988   6.329   1.00 0.00 ? 82 SER A HB3  9  
ATOM 10943 H HG   . SER A 1 82 ? 22.007  9.914   4.981   1.00 0.00 ? 82 SER A HG   9  
ATOM 10944 N N    . SER A 1 83 ? 25.001  6.797   6.186   1.00 0.00 ? 83 SER A N    9  
ATOM 10945 C CA   . SER A 1 83 ? 26.230  6.148   6.625   1.00 0.00 ? 83 SER A CA   9  
ATOM 10946 C C    . SER A 1 83 ? 27.338  6.325   5.591   1.00 0.00 ? 83 SER A C    9  
ATOM 10947 O O    . SER A 1 83 ? 27.123  6.911   4.530   1.00 0.00 ? 83 SER A O    9  
ATOM 10948 C CB   . SER A 1 83 ? 25.984  4.658   6.875   1.00 0.00 ? 83 SER A CB   9  
ATOM 10949 O OG   . SER A 1 83 ? 25.649  4.418   8.231   1.00 0.00 ? 83 SER A OG   9  
ATOM 10950 H H    . SER A 1 83 ? 24.741  6.742   5.243   1.00 0.00 ? 83 SER A H    9  
ATOM 10951 H HA   . SER A 1 83 ? 26.539  6.612   7.549   1.00 0.00 ? 83 SER A HA   9  
ATOM 10952 H HB2  . SER A 1 83 ? 25.170  4.321   6.251   1.00 0.00 ? 83 SER A HB2  9  
ATOM 10953 H HB3  . SER A 1 83 ? 26.878  4.102   6.633   1.00 0.00 ? 83 SER A HB3  9  
ATOM 10954 H HG   . SER A 1 83 ? 26.442  4.194   8.722   1.00 0.00 ? 83 SER A HG   9  
ATOM 10955 N N    . GLY A 1 84 ? 28.523  5.815   5.908   1.00 0.00 ? 84 GLY A N    9  
ATOM 10956 C CA   . GLY A 1 84 ? 29.647  5.926   4.997   1.00 0.00 ? 84 GLY A CA   9  
ATOM 10957 C C    . GLY A 1 84 ? 30.892  5.241   5.524   1.00 0.00 ? 84 GLY A C    9  
ATOM 10958 O O    . GLY A 1 84 ? 31.701  4.763   4.701   1.00 0.00 ? 84 GLY A O    9  
ATOM 10959 O OXT  . GLY A 1 84 ? 31.059  5.182   6.761   1.00 0.00 ? 84 GLY A OXT  9  
ATOM 10960 H H    . GLY A 1 84 ? 28.636  5.357   6.768   1.00 0.00 ? 84 GLY A H    9  
ATOM 10961 H HA2  . GLY A 1 84 ? 29.375  5.480   4.052   1.00 0.00 ? 84 GLY A HA2  9  
ATOM 10962 H HA3  . GLY A 1 84 ? 29.865  6.972   4.840   1.00 0.00 ? 84 GLY A HA3  9  
ATOM 10963 N N    . GLY A 1 1  ? 0.113   -15.324 7.526   1.00 0.00 ? 1  GLY A N    10 
ATOM 10964 C CA   . GLY A 1 1  ? 0.778   -16.637 7.306   1.00 0.00 ? 1  GLY A CA   10 
ATOM 10965 C C    . GLY A 1 1  ? 2.179   -16.684 7.884   1.00 0.00 ? 1  GLY A C    10 
ATOM 10966 O O    . GLY A 1 1  ? 2.377   -17.135 9.012   1.00 0.00 ? 1  GLY A O    10 
ATOM 10967 H H1   . GLY A 1 1  ? -0.392  -15.030 6.666   1.00 0.00 ? 1  GLY A H1   10 
ATOM 10968 H H2   . GLY A 1 1  ? 0.820   -14.600 7.764   1.00 0.00 ? 1  GLY A H2   10 
ATOM 10969 H H3   . GLY A 1 1  ? -0.569  -15.397 8.309   1.00 0.00 ? 1  GLY A H3   10 
ATOM 10970 H HA2  . GLY A 1 1  ? 0.183   -17.412 7.767   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 10971 H HA3  . GLY A 1 1  ? 0.833   -16.827 6.243   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 10972 N N    . SER A 1 2  ? 3.152   -16.217 7.109   1.00 0.00 ? 2  SER A N    10 
ATOM 10973 C CA   . SER A 1 2  ? 4.542   -16.207 7.551   1.00 0.00 ? 2  SER A CA   10 
ATOM 10974 C C    . SER A 1 2  ? 5.204   -14.871 7.232   1.00 0.00 ? 2  SER A C    10 
ATOM 10975 O O    . SER A 1 2  ? 5.394   -14.523 6.067   1.00 0.00 ? 2  SER A O    10 
ATOM 10976 C CB   . SER A 1 2  ? 5.319   -17.345 6.886   1.00 0.00 ? 2  SER A CB   10 
ATOM 10977 O OG   . SER A 1 2  ? 6.515   -17.627 7.592   1.00 0.00 ? 2  SER A OG   10 
ATOM 10978 H H    . SER A 1 2  ? 2.931   -15.872 6.219   1.00 0.00 ? 2  SER A H    10 
ATOM 10979 H HA   . SER A 1 2  ? 4.552   -16.354 8.620   1.00 0.00 ? 2  SER A HA   10 
ATOM 10980 H HB2  . SER A 1 2  ? 4.707   -18.235 6.870   1.00 0.00 ? 2  SER A HB2  10 
ATOM 10981 H HB3  . SER A 1 2  ? 5.570   -17.065 5.874   1.00 0.00 ? 2  SER A HB3  10 
ATOM 10982 H HG   . SER A 1 2  ? 6.310   -17.803 8.513   1.00 0.00 ? 2  SER A HG   10 
ATOM 10983 N N    . SER A 1 3  ? 5.554   -14.125 8.276   1.00 0.00 ? 3  SER A N    10 
ATOM 10984 C CA   . SER A 1 3  ? 6.196   -12.827 8.108   1.00 0.00 ? 3  SER A CA   10 
ATOM 10985 C C    . SER A 1 3  ? 7.658   -12.883 8.536   1.00 0.00 ? 3  SER A C    10 
ATOM 10986 O O    . SER A 1 3  ? 7.968   -13.206 9.683   1.00 0.00 ? 3  SER A O    10 
ATOM 10987 C CB   . SER A 1 3  ? 5.455   -11.760 8.916   1.00 0.00 ? 3  SER A CB   10 
ATOM 10988 O OG   . SER A 1 3  ? 5.099   -12.247 10.198  1.00 0.00 ? 3  SER A OG   10 
ATOM 10989 H H    . SER A 1 3  ? 5.377   -14.457 9.180   1.00 0.00 ? 3  SER A H    10 
ATOM 10990 H HA   . SER A 1 3  ? 6.150   -12.568 7.060   1.00 0.00 ? 3  SER A HA   10 
ATOM 10991 H HB2  . SER A 1 3  ? 6.093   -10.897 9.038   1.00 0.00 ? 3  SER A HB2  10 
ATOM 10992 H HB3  . SER A 1 3  ? 4.557   -11.472 8.391   1.00 0.00 ? 3  SER A HB3  10 
ATOM 10993 H HG   . SER A 1 3  ? 4.196   -11.991 10.398  1.00 0.00 ? 3  SER A HG   10 
ATOM 10994 N N    . GLY A 1 4  ? 8.555   -12.567 7.607   1.00 0.00 ? 4  GLY A N    10 
ATOM 10995 C CA   . GLY A 1 4  ? 9.973   -12.587 7.909   1.00 0.00 ? 4  GLY A CA   10 
ATOM 10996 C C    . GLY A 1 4  ? 10.765  -11.625 7.044   1.00 0.00 ? 4  GLY A C    10 
ATOM 10997 O O    . GLY A 1 4  ? 11.114  -10.529 7.483   1.00 0.00 ? 4  GLY A O    10 
ATOM 10998 H H    . GLY A 1 4  ? 8.249   -12.317 6.710   1.00 0.00 ? 4  GLY A H    10 
ATOM 10999 H HA2  . GLY A 1 4  ? 10.114  -12.320 8.945   1.00 0.00 ? 4  GLY A HA2  10 
ATOM 11000 H HA3  . GLY A 1 4  ? 10.349  -13.587 7.751   1.00 0.00 ? 4  GLY A HA3  10 
ATOM 11001 N N    . SER A 1 5  ? 11.048  -12.035 5.812   1.00 0.00 ? 5  SER A N    10 
ATOM 11002 C CA   . SER A 1 5  ? 11.803  -11.201 4.883   1.00 0.00 ? 5  SER A CA   10 
ATOM 11003 C C    . SER A 1 5  ? 11.513  -11.596 3.439   1.00 0.00 ? 5  SER A C    10 
ATOM 11004 O O    . SER A 1 5  ? 12.291  -12.318 2.814   1.00 0.00 ? 5  SER A O    10 
ATOM 11005 C CB   . SER A 1 5  ? 13.303  -11.317 5.164   1.00 0.00 ? 5  SER A CB   10 
ATOM 11006 O OG   . SER A 1 5  ? 13.581  -11.112 6.539   1.00 0.00 ? 5  SER A OG   10 
ATOM 11007 H H    . SER A 1 5  ? 10.743  -12.919 5.520   1.00 0.00 ? 5  SER A H    10 
ATOM 11008 H HA   . SER A 1 5  ? 11.496  -10.177 5.033   1.00 0.00 ? 5  SER A HA   10 
ATOM 11009 H HB2  . SER A 1 5  ? 13.644  -12.302 4.884   1.00 0.00 ? 5  SER A HB2  10 
ATOM 11010 H HB3  . SER A 1 5  ? 13.833  -10.574 4.588   1.00 0.00 ? 5  SER A HB3  10 
ATOM 11011 H HG   . SER A 1 5  ? 14.320  -10.507 6.629   1.00 0.00 ? 5  SER A HG   10 
ATOM 11012 N N    . SER A 1 6  ? 10.390  -11.118 2.914   1.00 0.00 ? 6  SER A N    10 
ATOM 11013 C CA   . SER A 1 6  ? 9.997   -11.421 1.543   1.00 0.00 ? 6  SER A CA   10 
ATOM 11014 C C    . SER A 1 6  ? 10.586  -10.402 0.571   1.00 0.00 ? 6  SER A C    10 
ATOM 11015 O O    . SER A 1 6  ? 11.210  -10.768 -0.425  1.00 0.00 ? 6  SER A O    10 
ATOM 11016 C CB   . SER A 1 6  ? 8.472   -11.439 1.419   1.00 0.00 ? 6  SER A CB   10 
ATOM 11017 O OG   . SER A 1 6  ? 7.925   -12.593 2.033   1.00 0.00 ? 6  SER A OG   10 
ATOM 11018 H H    . SER A 1 6  ? 9.812   -10.546 3.462   1.00 0.00 ? 6  SER A H    10 
ATOM 11019 H HA   . SER A 1 6  ? 10.381  -12.398 1.296   1.00 0.00 ? 6  SER A HA   10 
ATOM 11020 H HB2  . SER A 1 6  ? 8.063   -10.563 1.899   1.00 0.00 ? 6  SER A HB2  10 
ATOM 11021 H HB3  . SER A 1 6  ? 8.198   -11.437 0.374   1.00 0.00 ? 6  SER A HB3  10 
ATOM 11022 H HG   . SER A 1 6  ? 8.252   -12.663 2.932   1.00 0.00 ? 6  SER A HG   10 
ATOM 11023 N N    . GLY A 1 7  ? 10.383  -9.123  0.869   1.00 0.00 ? 7  GLY A N    10 
ATOM 11024 C CA   . GLY A 1 7  ? 10.901  -8.072  0.013   1.00 0.00 ? 7  GLY A CA   10 
ATOM 11025 C C    . GLY A 1 7  ? 10.967  -6.731  0.715   1.00 0.00 ? 7  GLY A C    10 
ATOM 11026 O O    . GLY A 1 7  ? 12.053  -6.220  0.991   1.00 0.00 ? 7  GLY A O    10 
ATOM 11027 H H    . GLY A 1 7  ? 9.879   -8.890  1.676   1.00 0.00 ? 7  GLY A H    10 
ATOM 11028 H HA2  . GLY A 1 7  ? 11.894  -8.344  -0.314  1.00 0.00 ? 7  GLY A HA2  10 
ATOM 11029 H HA3  . GLY A 1 7  ? 10.261  -7.980  -0.853  1.00 0.00 ? 7  GLY A HA3  10 
ATOM 11030 N N    . LEU A 1 8  ? 9.803   -6.160  1.008   1.00 0.00 ? 8  LEU A N    10 
ATOM 11031 C CA   . LEU A 1 8  ? 9.734   -4.870  1.684   1.00 0.00 ? 8  LEU A CA   10 
ATOM 11032 C C    . LEU A 1 8  ? 9.406   -5.048  3.163   1.00 0.00 ? 8  LEU A C    10 
ATOM 11033 O O    . LEU A 1 8  ? 8.769   -6.026  3.554   1.00 0.00 ? 8  LEU A O    10 
ATOM 11034 C CB   . LEU A 1 8  ? 8.681   -3.979  1.020   1.00 0.00 ? 8  LEU A CB   10 
ATOM 11035 C CG   . LEU A 1 8  ? 8.711   -3.971  -0.510  1.00 0.00 ? 8  LEU A CG   10 
ATOM 11036 C CD1  . LEU A 1 8  ? 7.622   -3.064  -1.060  1.00 0.00 ? 8  LEU A CD1  10 
ATOM 11037 C CD2  . LEU A 1 8  ? 10.079  -3.533  -1.012  1.00 0.00 ? 8  LEU A CD2  10 
ATOM 11038 H H    . LEU A 1 8  ? 8.972   -6.617  0.763   1.00 0.00 ? 8  LEU A H    10 
ATOM 11039 H HA   . LEU A 1 8  ? 10.699  -4.397  1.596   1.00 0.00 ? 8  LEU A HA   10 
ATOM 11040 H HB2  . LEU A 1 8  ? 7.705   -4.312  1.339   1.00 0.00 ? 8  LEU A HB2  10 
ATOM 11041 H HB3  . LEU A 1 8  ? 8.827   -2.967  1.365   1.00 0.00 ? 8  LEU A HB3  10 
ATOM 11042 H HG   . LEU A 1 8  ? 8.526   -4.972  -0.871  1.00 0.00 ? 8  LEU A HG   10 
ATOM 11043 H HD11 . LEU A 1 8  ? 7.213   -3.498  -1.960  1.00 0.00 ? 8  LEU A HD11 10 
ATOM 11044 H HD12 . LEU A 1 8  ? 8.043   -2.094  -1.286  1.00 0.00 ? 8  LEU A HD12 10 
ATOM 11045 H HD13 . LEU A 1 8  ? 6.839   -2.954  -0.325  1.00 0.00 ? 8  LEU A HD13 10 
ATOM 11046 H HD21 . LEU A 1 8  ? 10.253  -3.950  -1.993  1.00 0.00 ? 8  LEU A HD21 10 
ATOM 11047 H HD22 . LEU A 1 8  ? 10.842  -3.882  -0.333  1.00 0.00 ? 8  LEU A HD22 10 
ATOM 11048 H HD23 . LEU A 1 8  ? 10.112  -2.455  -1.068  1.00 0.00 ? 8  LEU A HD23 10 
ATOM 11049 N N    . ARG A 1 9  ? 9.846   -4.096  3.980   1.00 0.00 ? 9  ARG A N    10 
ATOM 11050 C CA   . ARG A 1 9  ? 9.600   -4.149  5.417   1.00 0.00 ? 9  ARG A CA   10 
ATOM 11051 C C    . ARG A 1 9  ? 8.409   -3.275  5.798   1.00 0.00 ? 9  ARG A C    10 
ATOM 11052 O O    . ARG A 1 9  ? 8.007   -2.391  5.041   1.00 0.00 ? 9  ARG A O    10 
ATOM 11053 C CB   . ARG A 1 9  ? 10.844  -3.699  6.185   1.00 0.00 ? 9  ARG A CB   10 
ATOM 11054 C CG   . ARG A 1 9  ? 11.221  -2.248  5.938   1.00 0.00 ? 9  ARG A CG   10 
ATOM 11055 C CD   . ARG A 1 9  ? 12.626  -1.945  6.430   1.00 0.00 ? 9  ARG A CD   10 
ATOM 11056 N NE   . ARG A 1 9  ? 12.997  -0.549  6.207   1.00 0.00 ? 9  ARG A NE   10 
ATOM 11057 C CZ   . ARG A 1 9  ? 14.252  -0.105  6.213   1.00 0.00 ? 9  ARG A CZ   10 
ATOM 11058 N NH1  . ARG A 1 9  ? 15.258  -0.942  6.431   1.00 0.00 ? 9  ARG A NH1  10 
ATOM 11059 N NH2  . ARG A 1 9  ? 14.501  1.179   6.001   1.00 0.00 ? 9  ARG A NH2  10 
ATOM 11060 H H    . ARG A 1 9  ? 10.348  -3.342  3.608   1.00 0.00 ? 9  ARG A H    10 
ATOM 11061 H HA   . ARG A 1 9  ? 9.378   -5.173  5.678   1.00 0.00 ? 9  ARG A HA   10 
ATOM 11062 H HB2  . ARG A 1 9  ? 10.666  -3.827  7.242   1.00 0.00 ? 9  ARG A HB2  10 
ATOM 11063 H HB3  . ARG A 1 9  ? 11.678  -4.320  5.891   1.00 0.00 ? 9  ARG A HB3  10 
ATOM 11064 H HG2  . ARG A 1 9  ? 11.172  -2.047  4.878   1.00 0.00 ? 9  ARG A HG2  10 
ATOM 11065 H HG3  . ARG A 1 9  ? 10.521  -1.610  6.459   1.00 0.00 ? 9  ARG A HG3  10 
ATOM 11066 H HD2  . ARG A 1 9  ? 12.676  -2.155  7.489   1.00 0.00 ? 9  ARG A HD2  10 
ATOM 11067 H HD3  . ARG A 1 9  ? 13.323  -2.581  5.906   1.00 0.00 ? 9  ARG A HD3  10 
ATOM 11068 H HE   . ARG A 1 9  ? 12.272  0.091   6.045   1.00 0.00 ? 9  ARG A HE   10 
ATOM 11069 H HH11 . ARG A 1 9  ? 15.077  -1.912  6.592   1.00 0.00 ? 9  ARG A HH11 10 
ATOM 11070 H HH12 . ARG A 1 9  ? 16.199  -0.602  6.434   1.00 0.00 ? 9  ARG A HH12 10 
ATOM 11071 H HH21 . ARG A 1 9  ? 13.747  1.815   5.836   1.00 0.00 ? 9  ARG A HH21 10 
ATOM 11072 H HH22 . ARG A 1 9  ? 15.444  1.514   6.005   1.00 0.00 ? 9  ARG A HH22 10 
ATOM 11073 N N    . LEU A 1 10 ? 7.849   -3.529  6.976   1.00 0.00 ? 10 LEU A N    10 
ATOM 11074 C CA   . LEU A 1 10 ? 6.704   -2.766  7.458   1.00 0.00 ? 10 LEU A CA   10 
ATOM 11075 C C    . LEU A 1 10 ? 7.139   -1.397  7.973   1.00 0.00 ? 10 LEU A C    10 
ATOM 11076 O O    . LEU A 1 10 ? 7.725   -1.286  9.050   1.00 0.00 ? 10 LEU A O    10 
ATOM 11077 C CB   . LEU A 1 10 ? 5.984   -3.535  8.568   1.00 0.00 ? 10 LEU A CB   10 
ATOM 11078 C CG   . LEU A 1 10 ? 5.702   -5.007  8.258   1.00 0.00 ? 10 LEU A CG   10 
ATOM 11079 C CD1  . LEU A 1 10 ? 5.964   -5.873  9.480   1.00 0.00 ? 10 LEU A CD1  10 
ATOM 11080 C CD2  . LEU A 1 10 ? 4.270   -5.185  7.774   1.00 0.00 ? 10 LEU A CD2  10 
ATOM 11081 H H    . LEU A 1 10 ? 8.215   -4.247  7.534   1.00 0.00 ? 10 LEU A H    10 
ATOM 11082 H HA   . LEU A 1 10 ? 6.025   -2.628  6.631   1.00 0.00 ? 10 LEU A HA   10 
ATOM 11083 H HB2  . LEU A 1 10 ? 6.589   -3.485  9.462   1.00 0.00 ? 10 LEU A HB2  10 
ATOM 11084 H HB3  . LEU A 1 10 ? 5.042   -3.045  8.765   1.00 0.00 ? 10 LEU A HB3  10 
ATOM 11085 H HG   . LEU A 1 10 ? 6.364   -5.335  7.469   1.00 0.00 ? 10 LEU A HG   10 
ATOM 11086 H HD11 . LEU A 1 10 ? 6.221   -6.873  9.166   1.00 0.00 ? 10 LEU A HD11 10 
ATOM 11087 H HD12 . LEU A 1 10 ? 5.077   -5.906  10.096  1.00 0.00 ? 10 LEU A HD12 10 
ATOM 11088 H HD13 . LEU A 1 10 ? 6.781   -5.454  10.049  1.00 0.00 ? 10 LEU A HD13 10 
ATOM 11089 H HD21 . LEU A 1 10 ? 3.885   -6.131  8.126   1.00 0.00 ? 10 LEU A HD21 10 
ATOM 11090 H HD22 . LEU A 1 10 ? 4.249   -5.167  6.695   1.00 0.00 ? 10 LEU A HD22 10 
ATOM 11091 H HD23 . LEU A 1 10 ? 3.657   -4.382  8.159   1.00 0.00 ? 10 LEU A HD23 10 
ATOM 11092 N N    . GLY A 1 11 ? 6.848   -0.359  7.196   1.00 0.00 ? 11 GLY A N    10 
ATOM 11093 C CA   . GLY A 1 11 ? 7.217   0.988   7.590   1.00 0.00 ? 11 GLY A CA   10 
ATOM 11094 C C    . GLY A 1 11 ? 8.241   1.606   6.658   1.00 0.00 ? 11 GLY A C    10 
ATOM 11095 O O    . GLY A 1 11 ? 9.118   2.350   7.096   1.00 0.00 ? 11 GLY A O    10 
ATOM 11096 H H    . GLY A 1 11 ? 6.379   -0.509  6.349   1.00 0.00 ? 11 GLY A H    10 
ATOM 11097 H HA2  . GLY A 1 11 ? 6.331   1.606   7.593   1.00 0.00 ? 11 GLY A HA2  10 
ATOM 11098 H HA3  . GLY A 1 11 ? 7.626   0.961   8.589   1.00 0.00 ? 11 GLY A HA3  10 
ATOM 11099 N N    . ASP A 1 12 ? 8.130   1.295   5.370   1.00 0.00 ? 12 ASP A N    10 
ATOM 11100 C CA   . ASP A 1 12 ? 9.054   1.826   4.374   1.00 0.00 ? 12 ASP A CA   10 
ATOM 11101 C C    . ASP A 1 12 ? 8.318   2.697   3.360   1.00 0.00 ? 12 ASP A C    10 
ATOM 11102 O O    . ASP A 1 12 ? 7.184   2.405   2.983   1.00 0.00 ? 12 ASP A O    10 
ATOM 11103 C CB   . ASP A 1 12 ? 9.771   0.682   3.654   1.00 0.00 ? 12 ASP A CB   10 
ATOM 11104 C CG   . ASP A 1 12 ? 10.935  1.169   2.812   1.00 0.00 ? 12 ASP A CG   10 
ATOM 11105 O OD1  . ASP A 1 12 ? 10.696  1.604   1.665   1.00 0.00 ? 12 ASP A OD1  10 
ATOM 11106 O OD2  . ASP A 1 12 ? 12.083  1.114   3.299   1.00 0.00 ? 12 ASP A OD2  10 
ATOM 11107 H H    . ASP A 1 12 ? 7.409   0.696   5.083   1.00 0.00 ? 12 ASP A H    10 
ATOM 11108 H HA   . ASP A 1 12 ? 9.785   2.430   4.888   1.00 0.00 ? 12 ASP A HA   10 
ATOM 11109 H HB2  . ASP A 1 12 ? 10.149  -0.015  4.386   1.00 0.00 ? 12 ASP A HB2  10 
ATOM 11110 H HB3  . ASP A 1 12 ? 9.069   0.175   3.008   1.00 0.00 ? 12 ASP A HB3  10 
ATOM 11111 N N    . ARG A 1 13 ? 8.973   3.769   2.925   1.00 0.00 ? 13 ARG A N    10 
ATOM 11112 C CA   . ARG A 1 13 ? 8.381   4.683   1.956   1.00 0.00 ? 13 ARG A CA   10 
ATOM 11113 C C    . ARG A 1 13 ? 8.496   4.126   0.541   1.00 0.00 ? 13 ARG A C    10 
ATOM 11114 O O    . ARG A 1 13 ? 9.589   3.794   0.080   1.00 0.00 ? 13 ARG A O    10 
ATOM 11115 C CB   . ARG A 1 13 ? 9.057   6.054   2.036   1.00 0.00 ? 13 ARG A CB   10 
ATOM 11116 C CG   . ARG A 1 13 ? 8.280   7.068   2.861   1.00 0.00 ? 13 ARG A CG   10 
ATOM 11117 C CD   . ARG A 1 13 ? 9.075   7.536   4.069   1.00 0.00 ? 13 ARG A CD   10 
ATOM 11118 N NE   . ARG A 1 13 ? 8.755   8.913   4.435   1.00 0.00 ? 13 ARG A NE   10 
ATOM 11119 C CZ   . ARG A 1 13 ? 9.511   9.665   5.234   1.00 0.00 ? 13 ARG A CZ   10 
ATOM 11120 N NH1  . ARG A 1 13 ? 10.632  9.174   5.751   1.00 0.00 ? 13 ARG A NH1  10 
ATOM 11121 N NH2  . ARG A 1 13 ? 9.146   10.907  5.515   1.00 0.00 ? 13 ARG A NH2  10 
ATOM 11122 H H    . ARG A 1 13 ? 9.874   3.949   3.263   1.00 0.00 ? 13 ARG A H    10 
ATOM 11123 H HA   . ARG A 1 13 ? 7.335   4.794   2.201   1.00 0.00 ? 13 ARG A HA   10 
ATOM 11124 H HB2  . ARG A 1 13 ? 10.036  5.933   2.479   1.00 0.00 ? 13 ARG A HB2  10 
ATOM 11125 H HB3  . ARG A 1 13 ? 9.172   6.446   1.036   1.00 0.00 ? 13 ARG A HB3  10 
ATOM 11126 H HG2  . ARG A 1 13 ? 8.053   7.922   2.241   1.00 0.00 ? 13 ARG A HG2  10 
ATOM 11127 H HG3  . ARG A 1 13 ? 7.361   6.613   3.200   1.00 0.00 ? 13 ARG A HG3  10 
ATOM 11128 H HD2  . ARG A 1 13 ? 8.850   6.890   4.905   1.00 0.00 ? 13 ARG A HD2  10 
ATOM 11129 H HD3  . ARG A 1 13 ? 10.129  7.471   3.839   1.00 0.00 ? 13 ARG A HD3  10 
ATOM 11130 H HE   . ARG A 1 13 ? 7.933   9.300   4.068   1.00 0.00 ? 13 ARG A HE   10 
ATOM 11131 H HH11 . ARG A 1 13 ? 10.912  8.238   5.542   1.00 0.00 ? 13 ARG A HH11 10 
ATOM 11132 H HH12 . ARG A 1 13 ? 11.195  9.744   6.350   1.00 0.00 ? 13 ARG A HH12 10 
ATOM 11133 H HH21 . ARG A 1 13 ? 8.303   11.281  5.127   1.00 0.00 ? 13 ARG A HH21 10 
ATOM 11134 H HH22 . ARG A 1 13 ? 9.715   11.472  6.114   1.00 0.00 ? 13 ARG A HH22 10 
ATOM 11135 N N    . VAL A 1 14 ? 7.361   4.024   -0.145  1.00 0.00 ? 14 VAL A N    10 
ATOM 11136 C CA   . VAL A 1 14 ? 7.335   3.507   -1.507  1.00 0.00 ? 14 VAL A CA   10 
ATOM 11137 C C    . VAL A 1 14 ? 6.479   4.388   -2.413  1.00 0.00 ? 14 VAL A C    10 
ATOM 11138 O O    . VAL A 1 14 ? 5.574   5.079   -1.946  1.00 0.00 ? 14 VAL A O    10 
ATOM 11139 C CB   . VAL A 1 14 ? 6.794   2.066   -1.551  1.00 0.00 ? 14 VAL A CB   10 
ATOM 11140 C CG1  . VAL A 1 14 ? 7.816   1.094   -0.983  1.00 0.00 ? 14 VAL A CG1  10 
ATOM 11141 C CG2  . VAL A 1 14 ? 5.476   1.967   -0.797  1.00 0.00 ? 14 VAL A CG2  10 
ATOM 11142 H H    . VAL A 1 14 ? 6.522   4.306   0.276   1.00 0.00 ? 14 VAL A H    10 
ATOM 11143 H HA   . VAL A 1 14 ? 8.349   3.501   -1.882  1.00 0.00 ? 14 VAL A HA   10 
ATOM 11144 H HB   . VAL A 1 14 ? 6.614   1.801   -2.583  1.00 0.00 ? 14 VAL A HB   10 
ATOM 11145 H HG11 . VAL A 1 14 ? 7.304   0.295   -0.467  1.00 0.00 ? 14 VAL A HG11 10 
ATOM 11146 H HG12 . VAL A 1 14 ? 8.462   1.614   -0.291  1.00 0.00 ? 14 VAL A HG12 10 
ATOM 11147 H HG13 . VAL A 1 14 ? 8.407   0.682   -1.788  1.00 0.00 ? 14 VAL A HG13 10 
ATOM 11148 H HG21 . VAL A 1 14 ? 4.671   2.309   -1.432  1.00 0.00 ? 14 VAL A HG21 10 
ATOM 11149 H HG22 . VAL A 1 14 ? 5.522   2.581   0.089   1.00 0.00 ? 14 VAL A HG22 10 
ATOM 11150 H HG23 . VAL A 1 14 ? 5.299   0.939   -0.515  1.00 0.00 ? 14 VAL A HG23 10 
ATOM 11151 N N    . LEU A 1 15 ? 6.771   4.355   -3.708  1.00 0.00 ? 15 LEU A N    10 
ATOM 11152 C CA   . LEU A 1 15 ? 6.027   5.150   -4.679  1.00 0.00 ? 15 LEU A CA   10 
ATOM 11153 C C    . LEU A 1 15 ? 4.975   4.301   -5.385  1.00 0.00 ? 15 LEU A C    10 
ATOM 11154 O O    . LEU A 1 15 ? 5.297   3.296   -6.019  1.00 0.00 ? 15 LEU A O    10 
ATOM 11155 C CB   . LEU A 1 15 ? 6.980   5.760   -5.708  1.00 0.00 ? 15 LEU A CB   10 
ATOM 11156 C CG   . LEU A 1 15 ? 6.426   6.965   -6.469  1.00 0.00 ? 15 LEU A CG   10 
ATOM 11157 C CD1  . LEU A 1 15 ? 6.010   8.062   -5.502  1.00 0.00 ? 15 LEU A CD1  10 
ATOM 11158 C CD2  . LEU A 1 15 ? 7.455   7.488   -7.461  1.00 0.00 ? 15 LEU A CD2  10 
ATOM 11159 H H    . LEU A 1 15 ? 7.504   3.783   -4.019  1.00 0.00 ? 15 LEU A H    10 
ATOM 11160 H HA   . LEU A 1 15 ? 5.531   5.946   -4.144  1.00 0.00 ? 15 LEU A HA   10 
ATOM 11161 H HB2  . LEU A 1 15 ? 7.881   6.068   -5.195  1.00 0.00 ? 15 LEU A HB2  10 
ATOM 11162 H HB3  . LEU A 1 15 ? 7.240   4.997   -6.426  1.00 0.00 ? 15 LEU A HB3  10 
ATOM 11163 H HG   . LEU A 1 15 ? 5.551   6.659   -7.025  1.00 0.00 ? 15 LEU A HG   10 
ATOM 11164 H HD11 . LEU A 1 15 ? 5.125   7.752   -4.966  1.00 0.00 ? 15 LEU A HD11 10 
ATOM 11165 H HD12 . LEU A 1 15 ? 5.797   8.966   -6.053  1.00 0.00 ? 15 LEU A HD12 10 
ATOM 11166 H HD13 . LEU A 1 15 ? 6.809   8.247   -4.800  1.00 0.00 ? 15 LEU A HD13 10 
ATOM 11167 H HD21 . LEU A 1 15 ? 7.740   6.695   -8.135  1.00 0.00 ? 15 LEU A HD21 10 
ATOM 11168 H HD22 . LEU A 1 15 ? 8.326   7.836   -6.925  1.00 0.00 ? 15 LEU A HD22 10 
ATOM 11169 H HD23 . LEU A 1 15 ? 7.029   8.305   -8.024  1.00 0.00 ? 15 LEU A HD23 10 
ATOM 11170 N N    . VAL A 1 16 ? 3.716   4.713   -5.270  1.00 0.00 ? 16 VAL A N    10 
ATOM 11171 C CA   . VAL A 1 16 ? 2.616   3.990   -5.897  1.00 0.00 ? 16 VAL A CA   10 
ATOM 11172 C C    . VAL A 1 16 ? 2.196   4.655   -7.203  1.00 0.00 ? 16 VAL A C    10 
ATOM 11173 O O    . VAL A 1 16 ? 1.559   5.708   -7.198  1.00 0.00 ? 16 VAL A O    10 
ATOM 11174 C CB   . VAL A 1 16 ? 1.395   3.904   -4.963  1.00 0.00 ? 16 VAL A CB   10 
ATOM 11175 C CG1  . VAL A 1 16 ? 0.337   2.982   -5.548  1.00 0.00 ? 16 VAL A CG1  10 
ATOM 11176 C CG2  . VAL A 1 16 ? 1.814   3.435   -3.577  1.00 0.00 ? 16 VAL A CG2  10 
ATOM 11177 H H    . VAL A 1 16 ? 3.523   5.520   -4.751  1.00 0.00 ? 16 VAL A H    10 
ATOM 11178 H HA   . VAL A 1 16 ? 2.954   2.985   -6.107  1.00 0.00 ? 16 VAL A HA   10 
ATOM 11179 H HB   . VAL A 1 16 ? 0.968   4.892   -4.870  1.00 0.00 ? 16 VAL A HB   10 
ATOM 11180 H HG11 . VAL A 1 16 ? 0.276   3.136   -6.615  1.00 0.00 ? 16 VAL A HG11 10 
ATOM 11181 H HG12 . VAL A 1 16 ? -0.620  3.200   -5.098  1.00 0.00 ? 16 VAL A HG12 10 
ATOM 11182 H HG13 . VAL A 1 16 ? 0.604   1.955   -5.348  1.00 0.00 ? 16 VAL A HG13 10 
ATOM 11183 H HG21 . VAL A 1 16 ? 2.690   3.983   -3.261  1.00 0.00 ? 16 VAL A HG21 10 
ATOM 11184 H HG22 . VAL A 1 16 ? 2.042   2.380   -3.609  1.00 0.00 ? 16 VAL A HG22 10 
ATOM 11185 H HG23 . VAL A 1 16 ? 1.009   3.609   -2.879  1.00 0.00 ? 16 VAL A HG23 10 
ATOM 11186 N N    . GLY A 1 17 ? 2.556   4.032   -8.321  1.00 0.00 ? 17 GLY A N    10 
ATOM 11187 C CA   . GLY A 1 17 ? 2.208   4.579   -9.620  1.00 0.00 ? 17 GLY A CA   10 
ATOM 11188 C C    . GLY A 1 17 ? 3.339   5.381   -10.233 1.00 0.00 ? 17 GLY A C    10 
ATOM 11189 O O    . GLY A 1 17 ? 3.491   5.417   -11.453 1.00 0.00 ? 17 GLY A O    10 
ATOM 11190 H H    . GLY A 1 17 ? 3.064   3.196   -8.263  1.00 0.00 ? 17 GLY A H    10 
ATOM 11191 H HA2  . GLY A 1 17 ? 1.955   3.766   -10.284 1.00 0.00 ? 17 GLY A HA2  10 
ATOM 11192 H HA3  . GLY A 1 17 ? 1.345   5.220   -9.508  1.00 0.00 ? 17 GLY A HA3  10 
ATOM 11193 N N    . GLY A 1 18 ? 4.132   6.026   -9.385  1.00 0.00 ? 18 GLY A N    10 
ATOM 11194 C CA   . GLY A 1 18 ? 5.245   6.822   -9.868  1.00 0.00 ? 18 GLY A CA   10 
ATOM 11195 C C    . GLY A 1 18 ? 5.051   8.304   -9.612  1.00 0.00 ? 18 GLY A C    10 
ATOM 11196 O O    . GLY A 1 18 ? 5.492   9.139   -10.402 1.00 0.00 ? 18 GLY A O    10 
ATOM 11197 H H    . GLY A 1 18 ? 3.963   5.959   -8.422  1.00 0.00 ? 18 GLY A H    10 
ATOM 11198 H HA2  . GLY A 1 18 ? 6.149   6.498   -9.374  1.00 0.00 ? 18 GLY A HA2  10 
ATOM 11199 H HA3  . GLY A 1 18 ? 5.353   6.663   -10.931 1.00 0.00 ? 18 GLY A HA3  10 
ATOM 11200 N N    . THR A 1 19 ? 4.390   8.630   -8.506  1.00 0.00 ? 19 THR A N    10 
ATOM 11201 C CA   . THR A 1 19 ? 4.139   10.021  -8.149  1.00 0.00 ? 19 THR A CA   10 
ATOM 11202 C C    . THR A 1 19 ? 3.617   10.130  -6.720  1.00 0.00 ? 19 THR A C    10 
ATOM 11203 O O    . THR A 1 19 ? 4.110   10.931  -5.926  1.00 0.00 ? 19 THR A O    10 
ATOM 11204 C CB   . THR A 1 19 ? 3.136   10.645  -9.120  1.00 0.00 ? 19 THR A CB   10 
ATOM 11205 O OG1  . THR A 1 19 ? 2.245   9.664   -9.621  1.00 0.00 ? 19 THR A OG1  10 
ATOM 11206 C CG2  . THR A 1 19 ? 3.792   11.318  -10.307 1.00 0.00 ? 19 THR A CG2  10 
ATOM 11207 H H    . THR A 1 19 ? 4.064   7.918   -7.917  1.00 0.00 ? 19 THR A H    10 
ATOM 11208 H HA   . THR A 1 19 ? 5.074   10.556  -8.219  1.00 0.00 ? 19 THR A HA   10 
ATOM 11209 H HB   . THR A 1 19 ? 2.558   11.392  -8.595  1.00 0.00 ? 19 THR A HB   10 
ATOM 11210 H HG1  . THR A 1 19 ? 1.475   9.609   -9.051  1.00 0.00 ? 19 THR A HG1  10 
ATOM 11211 H HG21 . THR A 1 19 ? 4.865   11.294  -10.186 1.00 0.00 ? 19 THR A HG21 10 
ATOM 11212 H HG22 . THR A 1 19 ? 3.459   12.344  -10.368 1.00 0.00 ? 19 THR A HG22 10 
ATOM 11213 H HG23 . THR A 1 19 ? 3.519   10.797  -11.212 1.00 0.00 ? 19 THR A HG23 10 
ATOM 11214 N N    . LYS A 1 20 ? 2.614   9.317   -6.398  1.00 0.00 ? 20 LYS A N    10 
ATOM 11215 C CA   . LYS A 1 20 ? 2.026   9.322   -5.064  1.00 0.00 ? 20 LYS A CA   10 
ATOM 11216 C C    . LYS A 1 20 ? 2.931   8.605   -4.068  1.00 0.00 ? 20 LYS A C    10 
ATOM 11217 O O    . LYS A 1 20 ? 3.080   7.385   -4.115  1.00 0.00 ? 20 LYS A O    10 
ATOM 11218 C CB   . LYS A 1 20 ? 0.648   8.658   -5.089  1.00 0.00 ? 20 LYS A CB   10 
ATOM 11219 C CG   . LYS A 1 20 ? -0.225  9.114   -6.246  1.00 0.00 ? 20 LYS A CG   10 
ATOM 11220 C CD   . LYS A 1 20 ? -0.367  8.031   -7.303  1.00 0.00 ? 20 LYS A CD   10 
ATOM 11221 C CE   . LYS A 1 20 ? -1.665  8.175   -8.081  1.00 0.00 ? 20 LYS A CE   10 
ATOM 11222 N NZ   . LYS A 1 20 ? -2.821  7.595   -7.343  1.00 0.00 ? 20 LYS A NZ   10 
ATOM 11223 H H    . LYS A 1 20 ? 2.263   8.700   -7.073  1.00 0.00 ? 20 LYS A H    10 
ATOM 11224 H HA   . LYS A 1 20 ? 1.914   10.351  -4.755  1.00 0.00 ? 20 LYS A HA   10 
ATOM 11225 H HB2  . LYS A 1 20 ? 0.778   7.588   -5.163  1.00 0.00 ? 20 LYS A HB2  10 
ATOM 11226 H HB3  . LYS A 1 20 ? 0.135   8.887   -4.167  1.00 0.00 ? 20 LYS A HB3  10 
ATOM 11227 H HG2  . LYS A 1 20 ? -1.206  9.364   -5.868  1.00 0.00 ? 20 LYS A HG2  10 
ATOM 11228 H HG3  . LYS A 1 20 ? 0.221   9.989   -6.697  1.00 0.00 ? 20 LYS A HG3  10 
ATOM 11229 H HD2  . LYS A 1 20 ? 0.462   8.103   -7.992  1.00 0.00 ? 20 LYS A HD2  10 
ATOM 11230 H HD3  . LYS A 1 20 ? -0.353  7.066   -6.819  1.00 0.00 ? 20 LYS A HD3  10 
ATOM 11231 H HE2  . LYS A 1 20 ? -1.851  9.225   -8.254  1.00 0.00 ? 20 LYS A HE2  10 
ATOM 11232 H HE3  . LYS A 1 20 ? -1.562  7.667   -9.027  1.00 0.00 ? 20 LYS A HE3  10 
ATOM 11233 H HZ1  . LYS A 1 20 ? -3.313  8.339   -6.808  1.00 0.00 ? 20 LYS A HZ1  10 
ATOM 11234 H HZ2  . LYS A 1 20 ? -2.492  6.866   -6.677  1.00 0.00 ? 20 LYS A HZ2  10 
ATOM 11235 H HZ3  . LYS A 1 20 ? -3.490  7.162   -8.010  1.00 0.00 ? 20 LYS A HZ3  10 
ATOM 11236 N N    . THR A 1 21 ? 3.534   9.373   -3.166  1.00 0.00 ? 21 THR A N    10 
ATOM 11237 C CA   . THR A 1 21 ? 4.425   8.813   -2.157  1.00 0.00 ? 21 THR A CA   10 
ATOM 11238 C C    . THR A 1 21 ? 3.636   8.315   -0.951  1.00 0.00 ? 21 THR A C    10 
ATOM 11239 O O    . THR A 1 21 ? 2.860   9.061   -0.353  1.00 0.00 ? 21 THR A O    10 
ATOM 11240 C CB   . THR A 1 21 ? 5.449   9.859   -1.715  1.00 0.00 ? 21 THR A CB   10 
ATOM 11241 O OG1  . THR A 1 21 ? 4.835   10.857  -0.918  1.00 0.00 ? 21 THR A OG1  10 
ATOM 11242 C CG2  . THR A 1 21 ? 6.134   10.553  -2.872  1.00 0.00 ? 21 THR A CG2  10 
ATOM 11243 H H    . THR A 1 21 ? 3.376   10.341  -3.179  1.00 0.00 ? 21 THR A H    10 
ATOM 11244 H HA   . THR A 1 21 ? 4.946   7.978   -2.602  1.00 0.00 ? 21 THR A HA   10 
ATOM 11245 H HB   . THR A 1 21 ? 6.211   9.373   -1.122  1.00 0.00 ? 21 THR A HB   10 
ATOM 11246 H HG1  . THR A 1 21 ? 4.057   11.193  -1.370  1.00 0.00 ? 21 THR A HG1  10 
ATOM 11247 H HG21 . THR A 1 21 ? 6.349   9.832   -3.647  1.00 0.00 ? 21 THR A HG21 10 
ATOM 11248 H HG22 . THR A 1 21 ? 7.055   11.000  -2.530  1.00 0.00 ? 21 THR A HG22 10 
ATOM 11249 H HG23 . THR A 1 21 ? 5.485   11.322  -3.266  1.00 0.00 ? 21 THR A HG23 10 
ATOM 11250 N N    . GLY A 1 22 ? 3.841   7.051   -0.597  1.00 0.00 ? 22 GLY A N    10 
ATOM 11251 C CA   . GLY A 1 22 ? 3.141   6.476   0.537   1.00 0.00 ? 22 GLY A CA   10 
ATOM 11252 C C    . GLY A 1 22 ? 3.992   5.479   1.298   1.00 0.00 ? 22 GLY A C    10 
ATOM 11253 O O    . GLY A 1 22 ? 4.864   4.829   0.722   1.00 0.00 ? 22 GLY A O    10 
ATOM 11254 H H    . GLY A 1 22 ? 4.472   6.503   -1.111  1.00 0.00 ? 22 GLY A H    10 
ATOM 11255 H HA2  . GLY A 1 22 ? 2.850   7.271   1.207   1.00 0.00 ? 22 GLY A HA2  10 
ATOM 11256 H HA3  . GLY A 1 22 ? 2.252   5.976   0.181   1.00 0.00 ? 22 GLY A HA3  10 
ATOM 11257 N N    . VAL A 1 23 ? 3.738   5.358   2.597   1.00 0.00 ? 23 VAL A N    10 
ATOM 11258 C CA   . VAL A 1 23 ? 4.487   4.433   3.439   1.00 0.00 ? 23 VAL A CA   10 
ATOM 11259 C C    . VAL A 1 23 ? 3.844   3.051   3.445   1.00 0.00 ? 23 VAL A C    10 
ATOM 11260 O O    . VAL A 1 23 ? 2.626   2.921   3.317   1.00 0.00 ? 23 VAL A O    10 
ATOM 11261 C CB   . VAL A 1 23 ? 4.589   4.945   4.888   1.00 0.00 ? 23 VAL A CB   10 
ATOM 11262 C CG1  . VAL A 1 23 ? 5.549   4.084   5.694   1.00 0.00 ? 23 VAL A CG1  10 
ATOM 11263 C CG2  . VAL A 1 23 ? 5.019   6.404   4.910   1.00 0.00 ? 23 VAL A CG2  10 
ATOM 11264 H H    . VAL A 1 23 ? 3.030   5.903   2.999   1.00 0.00 ? 23 VAL A H    10 
ATOM 11265 H HA   . VAL A 1 23 ? 5.488   4.352   3.037   1.00 0.00 ? 23 VAL A HA   10 
ATOM 11266 H HB   . VAL A 1 23 ? 3.611   4.875   5.342   1.00 0.00 ? 23 VAL A HB   10 
ATOM 11267 H HG11 . VAL A 1 23 ? 6.299   3.669   5.036   1.00 0.00 ? 23 VAL A HG11 10 
ATOM 11268 H HG12 . VAL A 1 23 ? 5.003   3.282   6.167   1.00 0.00 ? 23 VAL A HG12 10 
ATOM 11269 H HG13 . VAL A 1 23 ? 6.028   4.689   6.448   1.00 0.00 ? 23 VAL A HG13 10 
ATOM 11270 H HG21 . VAL A 1 23 ? 4.149   7.035   5.014   1.00 0.00 ? 23 VAL A HG21 10 
ATOM 11271 H HG22 . VAL A 1 23 ? 5.529   6.644   3.988   1.00 0.00 ? 23 VAL A HG22 10 
ATOM 11272 H HG23 . VAL A 1 23 ? 5.687   6.570   5.743   1.00 0.00 ? 23 VAL A HG23 10 
ATOM 11273 N N    . VAL A 1 24 ? 4.669   2.020   3.595   1.00 0.00 ? 24 VAL A N    10 
ATOM 11274 C CA   . VAL A 1 24 ? 4.181   0.647   3.620   1.00 0.00 ? 24 VAL A CA   10 
ATOM 11275 C C    . VAL A 1 24 ? 3.584   0.301   4.980   1.00 0.00 ? 24 VAL A C    10 
ATOM 11276 O O    . VAL A 1 24 ? 4.277   0.329   5.998   1.00 0.00 ? 24 VAL A O    10 
ATOM 11277 C CB   . VAL A 1 24 ? 5.305   -0.356  3.294   1.00 0.00 ? 24 VAL A CB   10 
ATOM 11278 C CG1  . VAL A 1 24 ? 4.745   -1.766  3.172   1.00 0.00 ? 24 VAL A CG1  10 
ATOM 11279 C CG2  . VAL A 1 24 ? 6.032   0.048   2.020   1.00 0.00 ? 24 VAL A CG2  10 
ATOM 11280 H H    . VAL A 1 24 ? 5.630   2.188   3.693   1.00 0.00 ? 24 VAL A H    10 
ATOM 11281 H HA   . VAL A 1 24 ? 3.413   0.553   2.865   1.00 0.00 ? 24 VAL A HA   10 
ATOM 11282 H HB   . VAL A 1 24 ? 6.015   -0.346  4.108   1.00 0.00 ? 24 VAL A HB   10 
ATOM 11283 H HG11 . VAL A 1 24 ? 5.527   -2.438  2.852   1.00 0.00 ? 24 VAL A HG11 10 
ATOM 11284 H HG12 . VAL A 1 24 ? 3.945   -1.773  2.446   1.00 0.00 ? 24 VAL A HG12 10 
ATOM 11285 H HG13 . VAL A 1 24 ? 4.364   -2.086  4.130   1.00 0.00 ? 24 VAL A HG13 10 
ATOM 11286 H HG21 . VAL A 1 24 ? 5.700   -0.575  1.203   1.00 0.00 ? 24 VAL A HG21 10 
ATOM 11287 H HG22 . VAL A 1 24 ? 7.096   -0.076  2.158   1.00 0.00 ? 24 VAL A HG22 10 
ATOM 11288 H HG23 . VAL A 1 24 ? 5.816   1.082   1.794   1.00 0.00 ? 24 VAL A HG23 10 
ATOM 11289 N N    . ARG A 1 25 ? 2.296   -0.023  4.989   1.00 0.00 ? 25 ARG A N    10 
ATOM 11290 C CA   . ARG A 1 25 ? 1.605   -0.374  6.224   1.00 0.00 ? 25 ARG A CA   10 
ATOM 11291 C C    . ARG A 1 25 ? 1.429   -1.884  6.340   1.00 0.00 ? 25 ARG A C    10 
ATOM 11292 O O    . ARG A 1 25 ? 1.376   -2.430  7.443   1.00 0.00 ? 25 ARG A O    10 
ATOM 11293 C CB   . ARG A 1 25 ? 0.241   0.316   6.283   1.00 0.00 ? 25 ARG A CB   10 
ATOM 11294 C CG   . ARG A 1 25 ? 0.326   1.809   6.553   1.00 0.00 ? 25 ARG A CG   10 
ATOM 11295 C CD   . ARG A 1 25 ? 0.343   2.107   8.043   1.00 0.00 ? 25 ARG A CD   10 
ATOM 11296 N NE   . ARG A 1 25 ? 0.257   3.539   8.317   1.00 0.00 ? 25 ARG A NE   10 
ATOM 11297 C CZ   . ARG A 1 25 ? 1.289   4.375   8.224   1.00 0.00 ? 25 ARG A CZ   10 
ATOM 11298 N NH1  . ARG A 1 25 ? 2.485   3.927   7.863   1.00 0.00 ? 25 ARG A NH1  10 
ATOM 11299 N NH2  . ARG A 1 25 ? 1.124   5.662   8.492   1.00 0.00 ? 25 ARG A NH2  10 
ATOM 11300 H H    . ARG A 1 25 ? 1.798   -0.026  4.145   1.00 0.00 ? 25 ARG A H    10 
ATOM 11301 H HA   . ARG A 1 25 ? 2.208   -0.028  7.051   1.00 0.00 ? 25 ARG A HA   10 
ATOM 11302 H HB2  . ARG A 1 25 ? -0.263  0.171   5.339   1.00 0.00 ? 25 ARG A HB2  10 
ATOM 11303 H HB3  . ARG A 1 25 ? -0.344  -0.137  7.068   1.00 0.00 ? 25 ARG A HB3  10 
ATOM 11304 H HG2  . ARG A 1 25 ? 1.232   2.194   6.108   1.00 0.00 ? 25 ARG A HG2  10 
ATOM 11305 H HG3  . ARG A 1 25 ? -0.530  2.294   6.107   1.00 0.00 ? 25 ARG A HG3  10 
ATOM 11306 H HD2  . ARG A 1 25 ? -0.498  1.611   8.505   1.00 0.00 ? 25 ARG A HD2  10 
ATOM 11307 H HD3  . ARG A 1 25 ? 1.262   1.723   8.463   1.00 0.00 ? 25 ARG A HD3  10 
ATOM 11308 H HE   . ARG A 1 25 ? -0.615  3.897   8.585   1.00 0.00 ? 25 ARG A HE   10 
ATOM 11309 H HH11 . ARG A 1 25 ? 2.615   2.956   7.659   1.00 0.00 ? 25 ARG A HH11 10 
ATOM 11310 H HH12 . ARG A 1 25 ? 3.256   4.559   7.795   1.00 0.00 ? 25 ARG A HH12 10 
ATOM 11311 H HH21 . ARG A 1 25 ? 0.225   6.006   8.764   1.00 0.00 ? 25 ARG A HH21 10 
ATOM 11312 H HH22 . ARG A 1 25 ? 1.899   6.292   8.422   1.00 0.00 ? 25 ARG A HH22 10 
ATOM 11313 N N    . TYR A 1 26 ? 1.339   -2.556  5.196   1.00 0.00 ? 26 TYR A N    10 
ATOM 11314 C CA   . TYR A 1 26 ? 1.168   -4.003  5.170   1.00 0.00 ? 26 TYR A CA   10 
ATOM 11315 C C    . TYR A 1 26 ? 2.151   -4.649  4.202   1.00 0.00 ? 26 TYR A C    10 
ATOM 11316 O O    . TYR A 1 26 ? 2.548   -4.042  3.206   1.00 0.00 ? 26 TYR A O    10 
ATOM 11317 C CB   . TYR A 1 26 ? -0.266  -4.362  4.776   1.00 0.00 ? 26 TYR A CB   10 
ATOM 11318 C CG   . TYR A 1 26 ? -0.645  -5.788  5.100   1.00 0.00 ? 26 TYR A CG   10 
ATOM 11319 C CD1  . TYR A 1 26 ? -1.063  -6.143  6.378   1.00 0.00 ? 26 TYR A CD1  10 
ATOM 11320 C CD2  . TYR A 1 26 ? -0.585  -6.783  4.131   1.00 0.00 ? 26 TYR A CD2  10 
ATOM 11321 C CE1  . TYR A 1 26 ? -1.410  -7.446  6.679   1.00 0.00 ? 26 TYR A CE1  10 
ATOM 11322 C CE2  . TYR A 1 26 ? -0.931  -8.087  4.424   1.00 0.00 ? 26 TYR A CE2  10 
ATOM 11323 C CZ   . TYR A 1 26 ? -1.343  -8.414  5.699   1.00 0.00 ? 26 TYR A CZ   10 
ATOM 11324 O OH   . TYR A 1 26 ? -1.687  -9.713  5.996   1.00 0.00 ? 26 TYR A OH   10 
ATOM 11325 H H    . TYR A 1 26 ? 1.386   -2.066  4.349   1.00 0.00 ? 26 TYR A H    10 
ATOM 11326 H HA   . TYR A 1 26 ? 1.362   -4.377  6.165   1.00 0.00 ? 26 TYR A HA   10 
ATOM 11327 H HB2  . TYR A 1 26 ? -0.950  -3.710  5.298   1.00 0.00 ? 26 TYR A HB2  10 
ATOM 11328 H HB3  . TYR A 1 26 ? -0.384  -4.219  3.711   1.00 0.00 ? 26 TYR A HB3  10 
ATOM 11329 H HD1  . TYR A 1 26 ? -1.115  -5.382  7.143   1.00 0.00 ? 26 TYR A HD1  10 
ATOM 11330 H HD2  . TYR A 1 26 ? -0.262  -6.523  3.134   1.00 0.00 ? 26 TYR A HD2  10 
ATOM 11331 H HE1  . TYR A 1 26 ? -1.732  -7.702  7.677   1.00 0.00 ? 26 TYR A HE1  10 
ATOM 11332 H HE2  . TYR A 1 26 ? -0.878  -8.846  3.657   1.00 0.00 ? 26 TYR A HE2  10 
ATOM 11333 H HH   . TYR A 1 26 ? -1.060  -10.312 5.584   1.00 0.00 ? 26 TYR A HH   10 
ATOM 11334 N N    . VAL A 1 27 ? 2.542   -5.884  4.498   1.00 0.00 ? 27 VAL A N    10 
ATOM 11335 C CA   . VAL A 1 27 ? 3.479   -6.614  3.654   1.00 0.00 ? 27 VAL A CA   10 
ATOM 11336 C C    . VAL A 1 27 ? 3.258   -8.118  3.760   1.00 0.00 ? 27 VAL A C    10 
ATOM 11337 O O    . VAL A 1 27 ? 3.634   -8.743  4.752   1.00 0.00 ? 27 VAL A O    10 
ATOM 11338 C CB   . VAL A 1 27 ? 4.939   -6.290  4.028   1.00 0.00 ? 27 VAL A CB   10 
ATOM 11339 C CG1  . VAL A 1 27 ? 5.900   -6.925  3.035   1.00 0.00 ? 27 VAL A CG1  10 
ATOM 11340 C CG2  . VAL A 1 27 ? 5.151   -4.786  4.099   1.00 0.00 ? 27 VAL A CG2  10 
ATOM 11341 H H    . VAL A 1 27 ? 2.191   -6.316  5.306   1.00 0.00 ? 27 VAL A H    10 
ATOM 11342 H HA   . VAL A 1 27 ? 3.315   -6.306  2.631   1.00 0.00 ? 27 VAL A HA   10 
ATOM 11343 H HB   . VAL A 1 27 ? 5.139   -6.706  5.004   1.00 0.00 ? 27 VAL A HB   10 
ATOM 11344 H HG11 . VAL A 1 27 ? 5.466   -7.832  2.641   1.00 0.00 ? 27 VAL A HG11 10 
ATOM 11345 H HG12 . VAL A 1 27 ? 6.831   -7.158  3.533   1.00 0.00 ? 27 VAL A HG12 10 
ATOM 11346 H HG13 . VAL A 1 27 ? 6.088   -6.236  2.225   1.00 0.00 ? 27 VAL A HG13 10 
ATOM 11347 H HG21 . VAL A 1 27 ? 4.544   -4.374  4.891   1.00 0.00 ? 27 VAL A HG21 10 
ATOM 11348 H HG22 . VAL A 1 27 ? 4.866   -4.338  3.159   1.00 0.00 ? 27 VAL A HG22 10 
ATOM 11349 H HG23 . VAL A 1 27 ? 6.192   -4.578  4.297   1.00 0.00 ? 27 VAL A HG23 10 
ATOM 11350 N N    . GLY A 1 28 ? 2.643   -8.694  2.731   1.00 0.00 ? 28 GLY A N    10 
ATOM 11351 C CA   . GLY A 1 28 ? 2.382   -10.121 2.728   1.00 0.00 ? 28 GLY A CA   10 
ATOM 11352 C C    . GLY A 1 28 ? 1.245   -10.498 1.798   1.00 0.00 ? 28 GLY A C    10 
ATOM 11353 O O    . GLY A 1 28 ? 0.939   -9.770  0.854   1.00 0.00 ? 28 GLY A O    10 
ATOM 11354 H H    . GLY A 1 28 ? 2.366   -8.144  1.969   1.00 0.00 ? 28 GLY A H    10 
ATOM 11355 H HA2  . GLY A 1 28 ? 3.276   -10.639 2.414   1.00 0.00 ? 28 GLY A HA2  10 
ATOM 11356 H HA3  . GLY A 1 28 ? 2.130   -10.433 3.731   1.00 0.00 ? 28 GLY A HA3  10 
ATOM 11357 N N    . GLU A 1 29 ? 0.617   -11.638 2.066   1.00 0.00 ? 29 GLU A N    10 
ATOM 11358 C CA   . GLU A 1 29 ? -0.493  -12.109 1.247   1.00 0.00 ? 29 GLU A CA   10 
ATOM 11359 C C    . GLU A 1 29 ? -1.810  -11.498 1.712   1.00 0.00 ? 29 GLU A C    10 
ATOM 11360 O O    . GLU A 1 29 ? -1.837  -10.689 2.640   1.00 0.00 ? 29 GLU A O    10 
ATOM 11361 C CB   . GLU A 1 29 ? -0.581  -13.636 1.298   1.00 0.00 ? 29 GLU A CB   10 
ATOM 11362 C CG   . GLU A 1 29 ? 0.656   -14.335 0.759   1.00 0.00 ? 29 GLU A CG   10 
ATOM 11363 C CD   . GLU A 1 29 ? 0.790   -15.757 1.270   1.00 0.00 ? 29 GLU A CD   10 
ATOM 11364 O OE1  . GLU A 1 29 ? -0.249  -16.377 1.578   1.00 0.00 ? 29 GLU A OE1  10 
ATOM 11365 O OE2  . GLU A 1 29 ? 1.934   -16.250 1.361   1.00 0.00 ? 29 GLU A OE2  10 
ATOM 11366 H H    . GLU A 1 29 ? 0.907   -12.175 2.833   1.00 0.00 ? 29 GLU A H    10 
ATOM 11367 H HA   . GLU A 1 29 ? -0.307  -11.803 0.228   1.00 0.00 ? 29 GLU A HA   10 
ATOM 11368 H HB2  . GLU A 1 29 ? -0.724  -13.943 2.323   1.00 0.00 ? 29 GLU A HB2  10 
ATOM 11369 H HB3  . GLU A 1 29 ? -1.432  -13.956 0.714   1.00 0.00 ? 29 GLU A HB3  10 
ATOM 11370 H HG2  . GLU A 1 29 ? 0.600   -14.360 -0.318  1.00 0.00 ? 29 GLU A HG2  10 
ATOM 11371 H HG3  . GLU A 1 29 ? 1.530   -13.776 1.061   1.00 0.00 ? 29 GLU A HG3  10 
ATOM 11372 N N    . THR A 1 30 ? -2.901  -11.890 1.062   1.00 0.00 ? 30 THR A N    10 
ATOM 11373 C CA   . THR A 1 30 ? -4.222  -11.381 1.410   1.00 0.00 ? 30 THR A CA   10 
ATOM 11374 C C    . THR A 1 30 ? -5.249  -12.508 1.436   1.00 0.00 ? 30 THR A C    10 
ATOM 11375 O O    . THR A 1 30 ? -4.916  -13.671 1.205   1.00 0.00 ? 30 THR A O    10 
ATOM 11376 C CB   . THR A 1 30 ? -4.657  -10.305 0.414   1.00 0.00 ? 30 THR A CB   10 
ATOM 11377 O OG1  . THR A 1 30 ? -4.215  -10.625 -0.893  1.00 0.00 ? 30 THR A OG1  10 
ATOM 11378 C CG2  . THR A 1 30 ? -4.130  -8.928  0.754   1.00 0.00 ? 30 THR A CG2  10 
ATOM 11379 H H    . THR A 1 30 ? -2.815  -12.538 0.332   1.00 0.00 ? 30 THR A H    10 
ATOM 11380 H HA   . THR A 1 30 ? -4.160  -10.944 2.395   1.00 0.00 ? 30 THR A HA   10 
ATOM 11381 H HB   . THR A 1 30 ? -5.736  -10.253 0.404   1.00 0.00 ? 30 THR A HB   10 
ATOM 11382 H HG1  . THR A 1 30 ? -4.528  -9.957  -1.509  1.00 0.00 ? 30 THR A HG1  10 
ATOM 11383 H HG21 . THR A 1 30 ? -3.083  -8.868  0.493   1.00 0.00 ? 30 THR A HG21 10 
ATOM 11384 H HG22 . THR A 1 30 ? -4.248  -8.747  1.811   1.00 0.00 ? 30 THR A HG22 10 
ATOM 11385 H HG23 . THR A 1 30 ? -4.682  -8.184  0.197   1.00 0.00 ? 30 THR A HG23 10 
ATOM 11386 N N    . ASP A 1 31 ? -6.498  -12.156 1.720   1.00 0.00 ? 31 ASP A N    10 
ATOM 11387 C CA   . ASP A 1 31 ? -7.574  -13.139 1.777   1.00 0.00 ? 31 ASP A CA   10 
ATOM 11388 C C    . ASP A 1 31 ? -8.555  -12.938 0.626   1.00 0.00 ? 31 ASP A C    10 
ATOM 11389 O O    . ASP A 1 31 ? -9.749  -13.201 0.762   1.00 0.00 ? 31 ASP A O    10 
ATOM 11390 C CB   . ASP A 1 31 ? -8.312  -13.040 3.113   1.00 0.00 ? 31 ASP A CB   10 
ATOM 11391 C CG   . ASP A 1 31 ? -7.592  -13.777 4.226   1.00 0.00 ? 31 ASP A CG   10 
ATOM 11392 O OD1  . ASP A 1 31 ? -6.726  -13.161 4.883   1.00 0.00 ? 31 ASP A OD1  10 
ATOM 11393 O OD2  . ASP A 1 31 ? -7.894  -14.970 4.441   1.00 0.00 ? 31 ASP A OD2  10 
ATOM 11394 H H    . ASP A 1 31 ? -6.702  -11.214 1.896   1.00 0.00 ? 31 ASP A H    10 
ATOM 11395 H HA   . ASP A 1 31 ? -7.132  -14.119 1.691   1.00 0.00 ? 31 ASP A HA   10 
ATOM 11396 H HB2  . ASP A 1 31 ? -8.400  -12.001 3.393   1.00 0.00 ? 31 ASP A HB2  10 
ATOM 11397 H HB3  . ASP A 1 31 ? -9.299  -13.465 3.004   1.00 0.00 ? 31 ASP A HB3  10 
ATOM 11398 N N    . PHE A 1 32 ? -8.041  -12.472 -0.507  1.00 0.00 ? 32 PHE A N    10 
ATOM 11399 C CA   . PHE A 1 32 ? -8.870  -12.237 -1.683  1.00 0.00 ? 32 PHE A CA   10 
ATOM 11400 C C    . PHE A 1 32 ? -8.049  -12.367 -2.962  1.00 0.00 ? 32 PHE A C    10 
ATOM 11401 O O    . PHE A 1 32 ? -8.457  -13.040 -3.907  1.00 0.00 ? 32 PHE A O    10 
ATOM 11402 C CB   . PHE A 1 32 ? -9.511  -10.849 -1.613  1.00 0.00 ? 32 PHE A CB   10 
ATOM 11403 C CG   . PHE A 1 32 ? -8.514  -9.734  -1.487  1.00 0.00 ? 32 PHE A CG   10 
ATOM 11404 C CD1  . PHE A 1 32 ? -8.087  -9.305  -0.240  1.00 0.00 ? 32 PHE A CD1  10 
ATOM 11405 C CD2  . PHE A 1 32 ? -8.003  -9.114  -2.616  1.00 0.00 ? 32 PHE A CD2  10 
ATOM 11406 C CE1  . PHE A 1 32 ? -7.169  -8.278  -0.122  1.00 0.00 ? 32 PHE A CE1  10 
ATOM 11407 C CE2  . PHE A 1 32 ? -7.085  -8.086  -2.504  1.00 0.00 ? 32 PHE A CE2  10 
ATOM 11408 C CZ   . PHE A 1 32 ? -6.668  -7.669  -1.256  1.00 0.00 ? 32 PHE A CZ   10 
ATOM 11409 H H    . PHE A 1 32 ? -7.080  -12.282 -0.554  1.00 0.00 ? 32 PHE A H    10 
ATOM 11410 H HA   . PHE A 1 32 ? -9.651  -12.983 -1.693  1.00 0.00 ? 32 PHE A HA   10 
ATOM 11411 H HB2  . PHE A 1 32 ? -10.087 -10.681 -2.510  1.00 0.00 ? 32 PHE A HB2  10 
ATOM 11412 H HB3  . PHE A 1 32 ? -10.169 -10.808 -0.756  1.00 0.00 ? 32 PHE A HB3  10 
ATOM 11413 H HD1  . PHE A 1 32 ? -8.479  -9.781  0.646   1.00 0.00 ? 32 PHE A HD1  10 
ATOM 11414 H HD2  . PHE A 1 32 ? -8.328  -9.440  -3.593  1.00 0.00 ? 32 PHE A HD2  10 
ATOM 11415 H HE1  . PHE A 1 32 ? -6.845  -7.954  0.855   1.00 0.00 ? 32 PHE A HE1  10 
ATOM 11416 H HE2  . PHE A 1 32 ? -6.693  -7.612  -3.391  1.00 0.00 ? 32 PHE A HE2  10 
ATOM 11417 H HZ   . PHE A 1 32 ? -5.950  -6.867  -1.165  1.00 0.00 ? 32 PHE A HZ   10 
ATOM 11418 N N    . ALA A 1 33 ? -6.890  -11.717 -2.982  1.00 0.00 ? 33 ALA A N    10 
ATOM 11419 C CA   . ALA A 1 33 ? -6.010  -11.760 -4.143  1.00 0.00 ? 33 ALA A CA   10 
ATOM 11420 C C    . ALA A 1 33 ? -4.744  -12.556 -3.841  1.00 0.00 ? 33 ALA A C    10 
ATOM 11421 O O    . ALA A 1 33 ? -3.904  -12.127 -3.051  1.00 0.00 ? 33 ALA A O    10 
ATOM 11422 C CB   . ALA A 1 33 ? -5.655  -10.350 -4.589  1.00 0.00 ? 33 ALA A CB   10 
ATOM 11423 H H    . ALA A 1 33 ? -6.619  -11.198 -2.196  1.00 0.00 ? 33 ALA A H    10 
ATOM 11424 H HA   . ALA A 1 33 ? -6.544  -12.244 -4.948  1.00 0.00 ? 33 ALA A HA   10 
ATOM 11425 H HB1  . ALA A 1 33 ? -4.987  -9.902  -3.868  1.00 0.00 ? 33 ALA A HB1  10 
ATOM 11426 H HB2  . ALA A 1 33 ? -6.556  -9.758  -4.662  1.00 0.00 ? 33 ALA A HB2  10 
ATOM 11427 H HB3  . ALA A 1 33 ? -5.170  -10.388 -5.554  1.00 0.00 ? 33 ALA A HB3  10 
ATOM 11428 N N    . LYS A 1 34 ? -4.616  -13.717 -4.475  1.00 0.00 ? 34 LYS A N    10 
ATOM 11429 C CA   . LYS A 1 34 ? -3.453  -14.572 -4.273  1.00 0.00 ? 34 LYS A CA   10 
ATOM 11430 C C    . LYS A 1 34 ? -2.171  -13.855 -4.687  1.00 0.00 ? 34 LYS A C    10 
ATOM 11431 O O    . LYS A 1 34 ? -2.215  -12.800 -5.318  1.00 0.00 ? 34 LYS A O    10 
ATOM 11432 C CB   . LYS A 1 34 ? -3.604  -15.871 -5.067  1.00 0.00 ? 34 LYS A CB   10 
ATOM 11433 C CG   . LYS A 1 34 ? -3.136  -17.104 -4.310  1.00 0.00 ? 34 LYS A CG   10 
ATOM 11434 C CD   . LYS A 1 34 ? -3.972  -17.342 -3.063  1.00 0.00 ? 34 LYS A CD   10 
ATOM 11435 C CE   . LYS A 1 34 ? -3.701  -18.713 -2.465  1.00 0.00 ? 34 LYS A CE   10 
ATOM 11436 N NZ   . LYS A 1 34 ? -4.161  -19.810 -3.360  1.00 0.00 ? 34 LYS A NZ   10 
ATOM 11437 H H    . LYS A 1 34 ? -5.320  -14.005 -5.093  1.00 0.00 ? 34 LYS A H    10 
ATOM 11438 H HA   . LYS A 1 34 ? -3.395  -14.808 -3.221  1.00 0.00 ? 34 LYS A HA   10 
ATOM 11439 H HB2  . LYS A 1 34 ? -4.646  -16.006 -5.320  1.00 0.00 ? 34 LYS A HB2  10 
ATOM 11440 H HB3  . LYS A 1 34 ? -3.029  -15.794 -5.978  1.00 0.00 ? 34 LYS A HB3  10 
ATOM 11441 H HG2  . LYS A 1 34 ? -3.218  -17.964 -4.956  1.00 0.00 ? 34 LYS A HG2  10 
ATOM 11442 H HG3  . LYS A 1 34 ? -2.105  -16.966 -4.021  1.00 0.00 ? 34 LYS A HG3  10 
ATOM 11443 H HD2  . LYS A 1 34 ? -3.731  -16.587 -2.330  1.00 0.00 ? 34 LYS A HD2  10 
ATOM 11444 H HD3  . LYS A 1 34 ? -5.018  -17.273 -3.324  1.00 0.00 ? 34 LYS A HD3  10 
ATOM 11445 H HE2  . LYS A 1 34 ? -2.638  -18.817 -2.301  1.00 0.00 ? 34 LYS A HE2  10 
ATOM 11446 H HE3  . LYS A 1 34 ? -4.219  -18.788 -1.520  1.00 0.00 ? 34 LYS A HE3  10 
ATOM 11447 H HZ1  . LYS A 1 34 ? -4.036  -20.731 -2.890  1.00 0.00 ? 34 LYS A HZ1  10 
ATOM 11448 H HZ2  . LYS A 1 34 ? -3.610  -19.807 -4.242  1.00 0.00 ? 34 LYS A HZ2  10 
ATOM 11449 H HZ3  . LYS A 1 34 ? -5.168  -19.685 -3.591  1.00 0.00 ? 34 LYS A HZ3  10 
ATOM 11450 N N    . GLY A 1 35 ? -1.032  -14.437 -4.326  1.00 0.00 ? 35 GLY A N    10 
ATOM 11451 C CA   . GLY A 1 35 ? 0.245   -13.840 -4.668  1.00 0.00 ? 35 GLY A CA   10 
ATOM 11452 C C    . GLY A 1 35 ? 0.840   -13.049 -3.520  1.00 0.00 ? 35 GLY A C    10 
ATOM 11453 O O    . GLY A 1 35 ? 1.020   -13.575 -2.422  1.00 0.00 ? 35 GLY A O    10 
ATOM 11454 H H    . GLY A 1 35 ? -1.059  -15.277 -3.824  1.00 0.00 ? 35 GLY A H    10 
ATOM 11455 H HA2  . GLY A 1 35 ? 0.934   -14.624 -4.945  1.00 0.00 ? 35 GLY A HA2  10 
ATOM 11456 H HA3  . GLY A 1 35 ? 0.108   -13.180 -5.511  1.00 0.00 ? 35 GLY A HA3  10 
ATOM 11457 N N    . GLU A 1 36 ? 1.146   -11.780 -3.773  1.00 0.00 ? 36 GLU A N    10 
ATOM 11458 C CA   . GLU A 1 36 ? 1.724   -10.915 -2.752  1.00 0.00 ? 36 GLU A CA   10 
ATOM 11459 C C    . GLU A 1 36 ? 1.285   -9.468  -2.952  1.00 0.00 ? 36 GLU A C    10 
ATOM 11460 O O    . GLU A 1 36 ? 1.329   -8.943  -4.064  1.00 0.00 ? 36 GLU A O    10 
ATOM 11461 C CB   . GLU A 1 36 ? 3.251   -11.007 -2.782  1.00 0.00 ? 36 GLU A CB   10 
ATOM 11462 C CG   . GLU A 1 36 ? 3.887   -11.018 -1.401  1.00 0.00 ? 36 GLU A CG   10 
ATOM 11463 C CD   . GLU A 1 36 ? 5.010   -12.028 -1.284  1.00 0.00 ? 36 GLU A CD   10 
ATOM 11464 O OE1  . GLU A 1 36 ? 5.600   -12.383 -2.326  1.00 0.00 ? 36 GLU A OE1  10 
ATOM 11465 O OE2  . GLU A 1 36 ? 5.301   -12.465 -0.151  1.00 0.00 ? 36 GLU A OE2  10 
ATOM 11466 H H    . GLU A 1 36 ? 0.978   -11.418 -4.669  1.00 0.00 ? 36 GLU A H    10 
ATOM 11467 H HA   . GLU A 1 36 ? 1.370   -11.256 -1.791  1.00 0.00 ? 36 GLU A HA   10 
ATOM 11468 H HB2  . GLU A 1 36 ? 3.535   -11.915 -3.293  1.00 0.00 ? 36 GLU A HB2  10 
ATOM 11469 H HB3  . GLU A 1 36 ? 3.641   -10.161 -3.327  1.00 0.00 ? 36 GLU A HB3  10 
ATOM 11470 H HG2  . GLU A 1 36 ? 4.283   -10.035 -1.194  1.00 0.00 ? 36 GLU A HG2  10 
ATOM 11471 H HG3  . GLU A 1 36 ? 3.126   -11.260 -0.671  1.00 0.00 ? 36 GLU A HG3  10 
ATOM 11472 N N    . TRP A 1 37 ? 0.864   -8.828  -1.866  1.00 0.00 ? 37 TRP A N    10 
ATOM 11473 C CA   . TRP A 1 37 ? 0.419   -7.440  -1.921  1.00 0.00 ? 37 TRP A CA   10 
ATOM 11474 C C    . TRP A 1 37 ? 1.071   -6.616  -0.816  1.00 0.00 ? 37 TRP A C    10 
ATOM 11475 O O    . TRP A 1 37 ? 1.406   -7.139  0.246   1.00 0.00 ? 37 TRP A O    10 
ATOM 11476 C CB   . TRP A 1 37 ? -1.104  -7.365  -1.797  1.00 0.00 ? 37 TRP A CB   10 
ATOM 11477 C CG   . TRP A 1 37 ? -1.825  -8.001  -2.947  1.00 0.00 ? 37 TRP A CG   10 
ATOM 11478 C CD1  . TRP A 1 37 ? -2.005  -9.336  -3.165  1.00 0.00 ? 37 TRP A CD1  10 
ATOM 11479 C CD2  . TRP A 1 37 ? -2.464  -7.326  -4.037  1.00 0.00 ? 37 TRP A CD2  10 
ATOM 11480 N NE1  . TRP A 1 37 ? -2.715  -9.533  -4.324  1.00 0.00 ? 37 TRP A NE1  10 
ATOM 11481 C CE2  . TRP A 1 37 ? -3.009  -8.315  -4.877  1.00 0.00 ? 37 TRP A CE2  10 
ATOM 11482 C CE3  . TRP A 1 37 ? -2.629  -5.981  -4.384  1.00 0.00 ? 37 TRP A CE3  10 
ATOM 11483 C CZ2  . TRP A 1 37 ? -3.707  -8.001  -6.042  1.00 0.00 ? 37 TRP A CZ2  10 
ATOM 11484 C CZ3  . TRP A 1 37 ? -3.321  -5.672  -5.539  1.00 0.00 ? 37 TRP A CZ3  10 
ATOM 11485 C CH2  . TRP A 1 37 ? -3.852  -6.677  -6.356  1.00 0.00 ? 37 TRP A CH2  10 
ATOM 11486 H H    . TRP A 1 37 ? 0.853   -9.300  -1.007  1.00 0.00 ? 37 TRP A H    10 
ATOM 11487 H HA   . TRP A 1 37 ? 0.713   -7.036  -2.878  1.00 0.00 ? 37 TRP A HA   10 
ATOM 11488 H HB2  . TRP A 1 37 ? -1.410  -7.869  -0.893  1.00 0.00 ? 37 TRP A HB2  10 
ATOM 11489 H HB3  . TRP A 1 37 ? -1.404  -6.329  -1.745  1.00 0.00 ? 37 TRP A HB3  10 
ATOM 11490 H HD1  . TRP A 1 37 ? -1.635  -10.114 -2.514  1.00 0.00 ? 37 TRP A HD1  10 
ATOM 11491 H HE1  . TRP A 1 37 ? -2.970  -10.404 -4.694  1.00 0.00 ? 37 TRP A HE1  10 
ATOM 11492 H HE3  . TRP A 1 37 ? -2.226  -5.192  -3.766  1.00 0.00 ? 37 TRP A HE3  10 
ATOM 11493 H HZ2  . TRP A 1 37 ? -4.122  -8.764  -6.682  1.00 0.00 ? 37 TRP A HZ2  10 
ATOM 11494 H HZ3  . TRP A 1 37 ? -3.458  -4.638  -5.823  1.00 0.00 ? 37 TRP A HZ3  10 
ATOM 11495 H HH2  . TRP A 1 37 ? -4.385  -6.389  -7.250  1.00 0.00 ? 37 TRP A HH2  10 
ATOM 11496 N N    . CYS A 1 38 ? 1.250   -5.325  -1.073  1.00 0.00 ? 38 CYS A N    10 
ATOM 11497 C CA   . CYS A 1 38 ? 1.862   -4.429  -0.100  1.00 0.00 ? 38 CYS A CA   10 
ATOM 11498 C C    . CYS A 1 38 ? 1.034   -3.159  0.065   1.00 0.00 ? 38 CYS A C    10 
ATOM 11499 O O    . CYS A 1 38 ? 0.974   -2.323  -0.836  1.00 0.00 ? 38 CYS A O    10 
ATOM 11500 C CB   . CYS A 1 38 ? 3.287   -4.074  -0.530  1.00 0.00 ? 38 CYS A CB   10 
ATOM 11501 S SG   . CYS A 1 38 ? 4.570   -5.044  0.300   1.00 0.00 ? 38 CYS A SG   10 
ATOM 11502 H H    . CYS A 1 38 ? 0.962   -4.966  -1.940  1.00 0.00 ? 38 CYS A H    10 
ATOM 11503 H HA   . CYS A 1 38 ? 1.900   -4.946  0.847   1.00 0.00 ? 38 CYS A HA   10 
ATOM 11504 H HB2  . CYS A 1 38 ? 3.387   -4.240  -1.592  1.00 0.00 ? 38 CYS A HB2  10 
ATOM 11505 H HB3  . CYS A 1 38 ? 3.472   -3.032  -0.315  1.00 0.00 ? 38 CYS A HB3  10 
ATOM 11506 H HG   . CYS A 1 38 ? 5.159   -4.432  0.747   1.00 0.00 ? 38 CYS A HG   10 
ATOM 11507 N N    . GLY A 1 39 ? 0.397   -3.021  1.223   1.00 0.00 ? 39 GLY A N    10 
ATOM 11508 C CA   . GLY A 1 39 ? -0.419  -1.851  1.487   1.00 0.00 ? 39 GLY A CA   10 
ATOM 11509 C C    . GLY A 1 39 ? 0.405   -0.586  1.613   1.00 0.00 ? 39 GLY A C    10 
ATOM 11510 O O    . GLY A 1 39 ? 1.383   -0.545  2.361   1.00 0.00 ? 39 GLY A O    10 
ATOM 11511 H H    . GLY A 1 39 ? 0.482   -3.721  1.905   1.00 0.00 ? 39 GLY A H    10 
ATOM 11512 H HA2  . GLY A 1 39 ? -1.124  -1.729  0.678   1.00 0.00 ? 39 GLY A HA2  10 
ATOM 11513 H HA3  . GLY A 1 39 ? -0.965  -2.006  2.406   1.00 0.00 ? 39 GLY A HA3  10 
ATOM 11514 N N    . VAL A 1 40 ? 0.010   0.451   0.880   1.00 0.00 ? 40 VAL A N    10 
ATOM 11515 C CA   . VAL A 1 40 ? 0.718   1.724   0.912   1.00 0.00 ? 40 VAL A CA   10 
ATOM 11516 C C    . VAL A 1 40 ? -0.218  2.862   1.307   1.00 0.00 ? 40 VAL A C    10 
ATOM 11517 O O    . VAL A 1 40 ? -1.266  3.057   0.691   1.00 0.00 ? 40 VAL A O    10 
ATOM 11518 C CB   . VAL A 1 40 ? 1.354   2.048   -0.453  1.00 0.00 ? 40 VAL A CB   10 
ATOM 11519 C CG1  . VAL A 1 40 ? 2.247   3.274   -0.348  1.00 0.00 ? 40 VAL A CG1  10 
ATOM 11520 C CG2  . VAL A 1 40 ? 2.135   0.852   -0.973  1.00 0.00 ? 40 VAL A CG2  10 
ATOM 11521 H H    . VAL A 1 40 ? -0.777  0.356   0.304   1.00 0.00 ? 40 VAL A H    10 
ATOM 11522 H HA   . VAL A 1 40 ? 1.507   1.650   1.646   1.00 0.00 ? 40 VAL A HA   10 
ATOM 11523 H HB   . VAL A 1 40 ? 0.561   2.266   -1.154  1.00 0.00 ? 40 VAL A HB   10 
ATOM 11524 H HG11 . VAL A 1 40 ? 1.639   4.166   -0.383  1.00 0.00 ? 40 VAL A HG11 10 
ATOM 11525 H HG12 . VAL A 1 40 ? 2.945   3.282   -1.174  1.00 0.00 ? 40 VAL A HG12 10 
ATOM 11526 H HG13 . VAL A 1 40 ? 2.791   3.246   0.583   1.00 0.00 ? 40 VAL A HG13 10 
ATOM 11527 H HG21 . VAL A 1 40 ? 1.504   0.265   -1.624  1.00 0.00 ? 40 VAL A HG21 10 
ATOM 11528 H HG22 . VAL A 1 40 ? 2.459   0.243   -0.142  1.00 0.00 ? 40 VAL A HG22 10 
ATOM 11529 H HG23 . VAL A 1 40 ? 2.998   1.197   -1.524  1.00 0.00 ? 40 VAL A HG23 10 
ATOM 11530 N N    . GLU A 1 41 ? 0.166   3.608   2.336   1.00 0.00 ? 41 GLU A N    10 
ATOM 11531 C CA   . GLU A 1 41 ? -0.640  4.727   2.811   1.00 0.00 ? 41 GLU A CA   10 
ATOM 11532 C C    . GLU A 1 41 ? -0.154  6.042   2.213   1.00 0.00 ? 41 GLU A C    10 
ATOM 11533 O O    . GLU A 1 41 ? 0.831   6.618   2.673   1.00 0.00 ? 41 GLU A O    10 
ATOM 11534 C CB   . GLU A 1 41 ? -0.595  4.801   4.338   1.00 0.00 ? 41 GLU A CB   10 
ATOM 11535 C CG   . GLU A 1 41 ? -1.679  5.684   4.936   1.00 0.00 ? 41 GLU A CG   10 
ATOM 11536 C CD   . GLU A 1 41 ? -1.158  6.579   6.043   1.00 0.00 ? 41 GLU A CD   10 
ATOM 11537 O OE1  . GLU A 1 41 ? 0.032   6.956   5.991   1.00 0.00 ? 41 GLU A OE1  10 
ATOM 11538 O OE2  . GLU A 1 41 ? -1.940  6.903   6.961   1.00 0.00 ? 41 GLU A OE2  10 
ATOM 11539 H H    . GLU A 1 41 ? 1.012   3.403   2.786   1.00 0.00 ? 41 GLU A H    10 
ATOM 11540 H HA   . GLU A 1 41 ? -1.659  4.557   2.498   1.00 0.00 ? 41 GLU A HA   10 
ATOM 11541 H HB2  . GLU A 1 41 ? -0.709  3.805   4.739   1.00 0.00 ? 41 GLU A HB2  10 
ATOM 11542 H HB3  . GLU A 1 41 ? 0.365   5.193   4.640   1.00 0.00 ? 41 GLU A HB3  10 
ATOM 11543 H HG2  . GLU A 1 41 ? -2.091  6.305   4.154   1.00 0.00 ? 41 GLU A HG2  10 
ATOM 11544 H HG3  . GLU A 1 41 ? -2.457  5.051   5.339   1.00 0.00 ? 41 GLU A HG3  10 
ATOM 11545 N N    . LEU A 1 42 ? -0.852  6.511   1.185   1.00 0.00 ? 42 LEU A N    10 
ATOM 11546 C CA   . LEU A 1 42 ? -0.493  7.759   0.522   1.00 0.00 ? 42 LEU A CA   10 
ATOM 11547 C C    . LEU A 1 42 ? -0.625  8.940   1.479   1.00 0.00 ? 42 LEU A C    10 
ATOM 11548 O O    . LEU A 1 42 ? -1.311  8.853   2.497   1.00 0.00 ? 42 LEU A O    10 
ATOM 11549 C CB   . LEU A 1 42 ? -1.377  7.981   -0.706  1.00 0.00 ? 42 LEU A CB   10 
ATOM 11550 C CG   . LEU A 1 42 ? -1.228  6.930   -1.807  1.00 0.00 ? 42 LEU A CG   10 
ATOM 11551 C CD1  . LEU A 1 42 ? -2.164  7.235   -2.967  1.00 0.00 ? 42 LEU A CD1  10 
ATOM 11552 C CD2  . LEU A 1 42 ? 0.214   6.865   -2.287  1.00 0.00 ? 42 LEU A CD2  10 
ATOM 11553 H H    . LEU A 1 42 ? -1.629  6.006   0.863   1.00 0.00 ? 42 LEU A H    10 
ATOM 11554 H HA   . LEU A 1 42 ? 0.536   7.681   0.204   1.00 0.00 ? 42 LEU A HA   10 
ATOM 11555 H HB2  . LEU A 1 42 ? -2.408  7.992   -0.384  1.00 0.00 ? 42 LEU A HB2  10 
ATOM 11556 H HB3  . LEU A 1 42 ? -1.138  8.946   -1.126  1.00 0.00 ? 42 LEU A HB3  10 
ATOM 11557 H HG   . LEU A 1 42 ? -1.495  5.962   -1.409  1.00 0.00 ? 42 LEU A HG   10 
ATOM 11558 H HD11 . LEU A 1 42 ? -2.195  8.302   -3.134  1.00 0.00 ? 42 LEU A HD11 10 
ATOM 11559 H HD12 . LEU A 1 42 ? -3.156  6.878   -2.732  1.00 0.00 ? 42 LEU A HD12 10 
ATOM 11560 H HD13 . LEU A 1 42 ? -1.806  6.741   -3.858  1.00 0.00 ? 42 LEU A HD13 10 
ATOM 11561 H HD21 . LEU A 1 42 ? 0.233   6.623   -3.339  1.00 0.00 ? 42 LEU A HD21 10 
ATOM 11562 H HD22 . LEU A 1 42 ? 0.743   6.103   -1.732  1.00 0.00 ? 42 LEU A HD22 10 
ATOM 11563 H HD23 . LEU A 1 42 ? 0.690   7.821   -2.129  1.00 0.00 ? 42 LEU A HD23 10 
ATOM 11564 N N    . ASP A 1 43 ? 0.038   10.042  1.144   1.00 0.00 ? 43 ASP A N    10 
ATOM 11565 C CA   . ASP A 1 43 ? -0.005  11.240  1.975   1.00 0.00 ? 43 ASP A CA   10 
ATOM 11566 C C    . ASP A 1 43 ? -1.210  12.105  1.622   1.00 0.00 ? 43 ASP A C    10 
ATOM 11567 O O    . ASP A 1 43 ? -1.768  12.790  2.480   1.00 0.00 ? 43 ASP A O    10 
ATOM 11568 C CB   . ASP A 1 43 ? 1.284   12.048  1.807   1.00 0.00 ? 43 ASP A CB   10 
ATOM 11569 C CG   . ASP A 1 43 ? 2.367   11.617  2.776   1.00 0.00 ? 43 ASP A CG   10 
ATOM 11570 O OD1  . ASP A 1 43 ? 2.634   10.401  2.865   1.00 0.00 ? 43 ASP A OD1  10 
ATOM 11571 O OD2  . ASP A 1 43 ? 2.949   12.497  3.445   1.00 0.00 ? 43 ASP A OD2  10 
ATOM 11572 H H    . ASP A 1 43 ? 0.569   10.050  0.321   1.00 0.00 ? 43 ASP A H    10 
ATOM 11573 H HA   . ASP A 1 43 ? -0.090  10.926  3.004   1.00 0.00 ? 43 ASP A HA   10 
ATOM 11574 H HB2  . ASP A 1 43 ? 1.654   11.919  0.801   1.00 0.00 ? 43 ASP A HB2  10 
ATOM 11575 H HB3  . ASP A 1 43 ? 1.069   13.094  1.975   1.00 0.00 ? 43 ASP A HB3  10 
ATOM 11576 N N    . GLU A 1 44 ? -1.609  12.068  0.355   1.00 0.00 ? 44 GLU A N    10 
ATOM 11577 C CA   . GLU A 1 44 ? -2.751  12.849  -0.109  1.00 0.00 ? 44 GLU A CA   10 
ATOM 11578 C C    . GLU A 1 44 ? -3.967  11.953  -0.337  1.00 0.00 ? 44 GLU A C    10 
ATOM 11579 O O    . GLU A 1 44 ? -3.840  10.843  -0.853  1.00 0.00 ? 44 GLU A O    10 
ATOM 11580 C CB   . GLU A 1 44 ? -2.398  13.587  -1.402  1.00 0.00 ? 44 GLU A CB   10 
ATOM 11581 C CG   . GLU A 1 44 ? -1.190  14.500  -1.271  1.00 0.00 ? 44 GLU A CG   10 
ATOM 11582 C CD   . GLU A 1 44 ? -0.774  15.111  -2.596  1.00 0.00 ? 44 GLU A CD   10 
ATOM 11583 O OE1  . GLU A 1 44 ? -1.522  15.965  -3.116  1.00 0.00 ? 44 GLU A OE1  10 
ATOM 11584 O OE2  . GLU A 1 44 ? 0.298   14.733  -3.113  1.00 0.00 ? 44 GLU A OE2  10 
ATOM 11585 H H    . GLU A 1 44 ? -1.126  11.503  -0.283  1.00 0.00 ? 44 GLU A H    10 
ATOM 11586 H HA   . GLU A 1 44 ? -2.986  13.573  0.655   1.00 0.00 ? 44 GLU A HA   10 
ATOM 11587 H HB2  . GLU A 1 44 ? -2.189  12.858  -2.173  1.00 0.00 ? 44 GLU A HB2  10 
ATOM 11588 H HB3  . GLU A 1 44 ? -3.244  14.185  -1.704  1.00 0.00 ? 44 GLU A HB3  10 
ATOM 11589 H HG2  . GLU A 1 44 ? -1.431  15.298  -0.585  1.00 0.00 ? 44 GLU A HG2  10 
ATOM 11590 H HG3  . GLU A 1 44 ? -0.362  13.927  -0.880  1.00 0.00 ? 44 GLU A HG3  10 
ATOM 11591 N N    . PRO A 1 45 ? -5.168  12.424  0.044   1.00 0.00 ? 45 PRO A N    10 
ATOM 11592 C CA   . PRO A 1 45 ? -6.406  11.655  -0.126  1.00 0.00 ? 45 PRO A CA   10 
ATOM 11593 C C    . PRO A 1 45 ? -6.607  11.198  -1.566  1.00 0.00 ? 45 PRO A C    10 
ATOM 11594 O O    . PRO A 1 45 ? -7.235  11.893  -2.366  1.00 0.00 ? 45 PRO A O    10 
ATOM 11595 C CB   . PRO A 1 45 ? -7.504  12.642  0.279   1.00 0.00 ? 45 PRO A CB   10 
ATOM 11596 C CG   . PRO A 1 45 ? -6.826  13.619  1.175   1.00 0.00 ? 45 PRO A CG   10 
ATOM 11597 C CD   . PRO A 1 45 ? -5.417  13.738  0.668   1.00 0.00 ? 45 PRO A CD   10 
ATOM 11598 H HA   . PRO A 1 45 ? -6.430  10.796  0.529   1.00 0.00 ? 45 PRO A HA   10 
ATOM 11599 H HB2  . PRO A 1 45 ? -7.900  13.124  -0.603  1.00 0.00 ? 45 PRO A HB2  10 
ATOM 11600 H HB3  . PRO A 1 45 ? -8.293  12.115  0.794   1.00 0.00 ? 45 PRO A HB3  10 
ATOM 11601 H HG2  . PRO A 1 45 ? -7.326  14.576  1.121   1.00 0.00 ? 45 PRO A HG2  10 
ATOM 11602 H HG3  . PRO A 1 45 ? -6.830  13.251  2.191   1.00 0.00 ? 45 PRO A HG3  10 
ATOM 11603 H HD2  . PRO A 1 45 ? -5.343  14.532  -0.061  1.00 0.00 ? 45 PRO A HD2  10 
ATOM 11604 H HD3  . PRO A 1 45 ? -4.735  13.910  1.487   1.00 0.00 ? 45 PRO A HD3  10 
ATOM 11605 N N    . LEU A 1 46 ? -6.071  10.027  -1.893  1.00 0.00 ? 46 LEU A N    10 
ATOM 11606 C CA   . LEU A 1 46 ? -6.194  9.480   -3.239  1.00 0.00 ? 46 LEU A CA   10 
ATOM 11607 C C    . LEU A 1 46 ? -6.182  7.955   -3.212  1.00 0.00 ? 46 LEU A C    10 
ATOM 11608 O O    . LEU A 1 46 ? -5.720  7.310   -4.154  1.00 0.00 ? 46 LEU A O    10 
ATOM 11609 C CB   . LEU A 1 46 ? -5.059  9.995   -4.126  1.00 0.00 ? 46 LEU A CB   10 
ATOM 11610 C CG   . LEU A 1 46 ? -5.143  11.479  -4.489  1.00 0.00 ? 46 LEU A CG   10 
ATOM 11611 C CD1  . LEU A 1 46 ? -3.831  11.958  -5.089  1.00 0.00 ? 46 LEU A CD1  10 
ATOM 11612 C CD2  . LEU A 1 46 ? -6.294  11.725  -5.452  1.00 0.00 ? 46 LEU A CD2  10 
ATOM 11613 H H    . LEU A 1 46 ? -5.581  9.519   -1.213  1.00 0.00 ? 46 LEU A H    10 
ATOM 11614 H HA   . LEU A 1 46 ? -7.137  9.812   -3.647  1.00 0.00 ? 46 LEU A HA   10 
ATOM 11615 H HB2  . LEU A 1 46 ? -4.123  9.823   -3.614  1.00 0.00 ? 46 LEU A HB2  10 
ATOM 11616 H HB3  . LEU A 1 46 ? -5.059  9.424   -5.043  1.00 0.00 ? 46 LEU A HB3  10 
ATOM 11617 H HG   . LEU A 1 46 ? -5.329  12.051  -3.591  1.00 0.00 ? 46 LEU A HG   10 
ATOM 11618 H HD11 . LEU A 1 46 ? -3.012  11.407  -4.652  1.00 0.00 ? 46 LEU A HD11 10 
ATOM 11619 H HD12 . LEU A 1 46 ? -3.705  13.011  -4.884  1.00 0.00 ? 46 LEU A HD12 10 
ATOM 11620 H HD13 . LEU A 1 46 ? -3.844  11.799  -6.157  1.00 0.00 ? 46 LEU A HD13 10 
ATOM 11621 H HD21 . LEU A 1 46 ? -6.332  10.929  -6.179  1.00 0.00 ? 46 LEU A HD21 10 
ATOM 11622 H HD22 . LEU A 1 46 ? -6.145  12.668  -5.958  1.00 0.00 ? 46 LEU A HD22 10 
ATOM 11623 H HD23 . LEU A 1 46 ? -7.224  11.756  -4.903  1.00 0.00 ? 46 LEU A HD23 10 
ATOM 11624 N N    . GLY A 1 47 ? -6.694  7.382   -2.127  1.00 0.00 ? 47 GLY A N    10 
ATOM 11625 C CA   . GLY A 1 47 ? -6.734  5.938   -1.998  1.00 0.00 ? 47 GLY A CA   10 
ATOM 11626 C C    . GLY A 1 47 ? -8.132  5.379   -2.175  1.00 0.00 ? 47 GLY A C    10 
ATOM 11627 O O    . GLY A 1 47 ? -9.096  6.132   -2.310  1.00 0.00 ? 47 GLY A O    10 
ATOM 11628 H H    . GLY A 1 47 ? -7.048  7.946   -1.408  1.00 0.00 ? 47 GLY A H    10 
ATOM 11629 H HA2  . GLY A 1 47 ? -6.087  5.503   -2.745  1.00 0.00 ? 47 GLY A HA2  10 
ATOM 11630 H HA3  . GLY A 1 47 ? -6.369  5.665   -1.020  1.00 0.00 ? 47 GLY A HA3  10 
ATOM 11631 N N    . LYS A 1 48 ? -8.243  4.054   -2.174  1.00 0.00 ? 48 LYS A N    10 
ATOM 11632 C CA   . LYS A 1 48 ? -9.534  3.395   -2.336  1.00 0.00 ? 48 LYS A CA   10 
ATOM 11633 C C    . LYS A 1 48 ? -9.994  2.769   -1.024  1.00 0.00 ? 48 LYS A C    10 
ATOM 11634 O O    . LYS A 1 48 ? -11.192 2.680   -0.753  1.00 0.00 ? 48 LYS A O    10 
ATOM 11635 C CB   . LYS A 1 48 ? -9.451  2.324   -3.425  1.00 0.00 ? 48 LYS A CB   10 
ATOM 11636 C CG   . LYS A 1 48 ? -9.369  2.893   -4.832  1.00 0.00 ? 48 LYS A CG   10 
ATOM 11637 C CD   . LYS A 1 48 ? -10.178 2.063   -5.817  1.00 0.00 ? 48 LYS A CD   10 
ATOM 11638 C CE   . LYS A 1 48 ? -11.537 2.688   -6.088  1.00 0.00 ? 48 LYS A CE   10 
ATOM 11639 N NZ   . LYS A 1 48 ? -12.332 2.852   -4.840  1.00 0.00 ? 48 LYS A NZ   10 
ATOM 11640 H H    . LYS A 1 48 ? -7.437  3.507   -2.063  1.00 0.00 ? 48 LYS A H    10 
ATOM 11641 H HA   . LYS A 1 48 ? -10.252 4.145   -2.635  1.00 0.00 ? 48 LYS A HA   10 
ATOM 11642 H HB2  . LYS A 1 48 ? -8.573  1.720   -3.252  1.00 0.00 ? 48 LYS A HB2  10 
ATOM 11643 H HB3  . LYS A 1 48 ? -10.328 1.695   -3.363  1.00 0.00 ? 48 LYS A HB3  10 
ATOM 11644 H HG2  . LYS A 1 48 ? -9.755  3.901   -4.826  1.00 0.00 ? 48 LYS A HG2  10 
ATOM 11645 H HG3  . LYS A 1 48 ? -8.336  2.903   -5.147  1.00 0.00 ? 48 LYS A HG3  10 
ATOM 11646 H HD2  . LYS A 1 48 ? -9.634  1.994   -6.748  1.00 0.00 ? 48 LYS A HD2  10 
ATOM 11647 H HD3  . LYS A 1 48 ? -10.321 1.074   -5.407  1.00 0.00 ? 48 LYS A HD3  10 
ATOM 11648 H HE2  . LYS A 1 48 ? -11.389 3.657   -6.541  1.00 0.00 ? 48 LYS A HE2  10 
ATOM 11649 H HE3  . LYS A 1 48 ? -12.082 2.051   -6.771  1.00 0.00 ? 48 LYS A HE3  10 
ATOM 11650 H HZ1  . LYS A 1 48 ? -11.903 3.585   -4.237  1.00 0.00 ? 48 LYS A HZ1  10 
ATOM 11651 H HZ2  . LYS A 1 48 ? -12.357 1.957   -4.312  1.00 0.00 ? 48 LYS A HZ2  10 
ATOM 11652 H HZ3  . LYS A 1 48 ? -13.306 3.134   -5.070  1.00 0.00 ? 48 LYS A HZ3  10 
ATOM 11653 N N    . ASN A 1 49 ? -9.035  2.338   -0.211  1.00 0.00 ? 49 ASN A N    10 
ATOM 11654 C CA   . ASN A 1 49 ? -9.342  1.720   1.074   1.00 0.00 ? 49 ASN A CA   10 
ATOM 11655 C C    . ASN A 1 49 ? -8.299  2.097   2.122   1.00 0.00 ? 49 ASN A C    10 
ATOM 11656 O O    . ASN A 1 49 ? -7.145  2.372   1.794   1.00 0.00 ? 49 ASN A O    10 
ATOM 11657 C CB   . ASN A 1 49 ? -9.408  0.199   0.929   1.00 0.00 ? 49 ASN A CB   10 
ATOM 11658 C CG   . ASN A 1 49 ? -10.758 -0.275  0.425   1.00 0.00 ? 49 ASN A CG   10 
ATOM 11659 O OD1  . ASN A 1 49 ? -11.780 -0.088  1.086   1.00 0.00 ? 49 ASN A OD1  10 
ATOM 11660 N ND2  . ASN A 1 49 ? -10.768 -0.893  -0.750  1.00 0.00 ? 49 ASN A ND2  10 
ATOM 11661 H H    . ASN A 1 49 ? -8.098  2.437   -0.482  1.00 0.00 ? 49 ASN A H    10 
ATOM 11662 H HA   . ASN A 1 49 ? -10.305 2.085   1.395   1.00 0.00 ? 49 ASN A HA   10 
ATOM 11663 H HB2  . ASN A 1 49 ? -8.652  -0.124  0.230   1.00 0.00 ? 49 ASN A HB2  10 
ATOM 11664 H HB3  . ASN A 1 49 ? -9.222  -0.257  1.890   1.00 0.00 ? 49 ASN A HB3  10 
ATOM 11665 H HD21 . ASN A 1 49 ? -9.915  -1.007  -1.220  1.00 0.00 ? 49 ASN A HD21 10 
ATOM 11666 H HD22 . ASN A 1 49 ? -11.626 -1.210  -1.099  1.00 0.00 ? 49 ASN A HD22 10 
ATOM 11667 N N    . ASP A 1 50 ? -8.714  2.105   3.385   1.00 0.00 ? 50 ASP A N    10 
ATOM 11668 C CA   . ASP A 1 50 ? -7.818  2.447   4.483   1.00 0.00 ? 50 ASP A CA   10 
ATOM 11669 C C    . ASP A 1 50 ? -7.216  1.190   5.103   1.00 0.00 ? 50 ASP A C    10 
ATOM 11670 O O    . ASP A 1 50 ? -7.157  1.054   6.327   1.00 0.00 ? 50 ASP A O    10 
ATOM 11671 C CB   . ASP A 1 50 ? -8.564  3.252   5.549   1.00 0.00 ? 50 ASP A CB   10 
ATOM 11672 C CG   . ASP A 1 50 ? -9.712  2.474   6.163   1.00 0.00 ? 50 ASP A CG   10 
ATOM 11673 O OD1  . ASP A 1 50 ? -10.208 1.533   5.508   1.00 0.00 ? 50 ASP A OD1  10 
ATOM 11674 O OD2  . ASP A 1 50 ? -10.114 2.807   7.297   1.00 0.00 ? 50 ASP A OD2  10 
ATOM 11675 H H    . ASP A 1 50 ? -9.646  1.876   3.583   1.00 0.00 ? 50 ASP A H    10 
ATOM 11676 H HA   . ASP A 1 50 ? -7.018  3.052   4.081   1.00 0.00 ? 50 ASP A HA   10 
ATOM 11677 H HB2  . ASP A 1 50 ? -7.876  3.522   6.335   1.00 0.00 ? 50 ASP A HB2  10 
ATOM 11678 H HB3  . ASP A 1 50 ? -8.962  4.151   5.099   1.00 0.00 ? 50 ASP A HB3  10 
ATOM 11679 N N    . GLY A 1 51 ? -6.770  0.272   4.252   1.00 0.00 ? 51 GLY A N    10 
ATOM 11680 C CA   . GLY A 1 51 ? -6.179  -0.963  4.734   1.00 0.00 ? 51 GLY A CA   10 
ATOM 11681 C C    . GLY A 1 51 ? -7.220  -2.016  5.062   1.00 0.00 ? 51 GLY A C    10 
ATOM 11682 O O    . GLY A 1 51 ? -6.966  -2.921  5.857   1.00 0.00 ? 51 GLY A O    10 
ATOM 11683 H H    . GLY A 1 51 ? -6.843  0.435   3.288   1.00 0.00 ? 51 GLY A H    10 
ATOM 11684 H HA2  . GLY A 1 51 ? -5.516  -1.351  3.976   1.00 0.00 ? 51 GLY A HA2  10 
ATOM 11685 H HA3  . GLY A 1 51 ? -5.605  -0.750  5.624   1.00 0.00 ? 51 GLY A HA3  10 
ATOM 11686 N N    . ALA A 1 52 ? -8.394  -1.899  4.450   1.00 0.00 ? 52 ALA A N    10 
ATOM 11687 C CA   . ALA A 1 52 ? -9.475  -2.850  4.683   1.00 0.00 ? 52 ALA A CA   10 
ATOM 11688 C C    . ALA A 1 52 ? -9.936  -3.486  3.376   1.00 0.00 ? 52 ALA A C    10 
ATOM 11689 O O    . ALA A 1 52 ? -9.737  -2.927  2.297   1.00 0.00 ? 52 ALA A O    10 
ATOM 11690 C CB   . ALA A 1 52 ? -10.640 -2.162  5.381   1.00 0.00 ? 52 ALA A CB   10 
ATOM 11691 H H    . ALA A 1 52 ? -8.538  -1.157  3.827   1.00 0.00 ? 52 ALA A H    10 
ATOM 11692 H HA   . ALA A 1 52 ? -9.102  -3.624  5.336   1.00 0.00 ? 52 ALA A HA   10 
ATOM 11693 H HB1  . ALA A 1 52 ? -11.519 -2.214  4.755   1.00 0.00 ? 52 ALA A HB1  10 
ATOM 11694 H HB2  . ALA A 1 52 ? -10.390 -1.127  5.564   1.00 0.00 ? 52 ALA A HB2  10 
ATOM 11695 H HB3  . ALA A 1 52 ? -10.839 -2.656  6.320   1.00 0.00 ? 52 ALA A HB3  10 
ATOM 11696 N N    . VAL A 1 53 ? -10.550 -4.660  3.480   1.00 0.00 ? 53 VAL A N    10 
ATOM 11697 C CA   . VAL A 1 53 ? -11.040 -5.373  2.308   1.00 0.00 ? 53 VAL A CA   10 
ATOM 11698 C C    . VAL A 1 53 ? -12.284 -6.190  2.643   1.00 0.00 ? 53 VAL A C    10 
ATOM 11699 O O    . VAL A 1 53 ? -12.211 -7.181  3.368   1.00 0.00 ? 53 VAL A O    10 
ATOM 11700 C CB   . VAL A 1 53 ? -9.962  -6.312  1.732   1.00 0.00 ? 53 VAL A CB   10 
ATOM 11701 C CG1  . VAL A 1 53 ? -10.414 -6.888  0.398   1.00 0.00 ? 53 VAL A CG1  10 
ATOM 11702 C CG2  . VAL A 1 53 ? -8.638  -5.577  1.583   1.00 0.00 ? 53 VAL A CG2  10 
ATOM 11703 H H    . VAL A 1 53 ? -10.679 -5.054  4.368   1.00 0.00 ? 53 VAL A H    10 
ATOM 11704 H HA   . VAL A 1 53 ? -11.292 -4.642  1.554   1.00 0.00 ? 53 VAL A HA   10 
ATOM 11705 H HB   . VAL A 1 53 ? -9.819  -7.130  2.423   1.00 0.00 ? 53 VAL A HB   10 
ATOM 11706 H HG11 . VAL A 1 53 ? -10.110 -7.922  0.332   1.00 0.00 ? 53 VAL A HG11 10 
ATOM 11707 H HG12 . VAL A 1 53 ? -9.962  -6.328  -0.406  1.00 0.00 ? 53 VAL A HG12 10 
ATOM 11708 H HG13 . VAL A 1 53 ? -11.489 -6.823  0.324   1.00 0.00 ? 53 VAL A HG13 10 
ATOM 11709 H HG21 . VAL A 1 53 ? -7.921  -6.222  1.100   1.00 0.00 ? 53 VAL A HG21 10 
ATOM 11710 H HG22 . VAL A 1 53 ? -8.271  -5.296  2.559   1.00 0.00 ? 53 VAL A HG22 10 
ATOM 11711 H HG23 . VAL A 1 53 ? -8.784  -4.689  0.985   1.00 0.00 ? 53 VAL A HG23 10 
ATOM 11712 N N    . ALA A 1 54 ? -13.423 -5.766  2.108   1.00 0.00 ? 54 ALA A N    10 
ATOM 11713 C CA   . ALA A 1 54 ? -14.685 -6.457  2.350   1.00 0.00 ? 54 ALA A CA   10 
ATOM 11714 C C    . ALA A 1 54 ? -15.049 -6.435  3.830   1.00 0.00 ? 54 ALA A C    10 
ATOM 11715 O O    . ALA A 1 54 ? -15.707 -7.348  4.331   1.00 0.00 ? 54 ALA A O    10 
ATOM 11716 C CB   . ALA A 1 54 ? -14.607 -7.890  1.843   1.00 0.00 ? 54 ALA A CB   10 
ATOM 11717 H H    . ALA A 1 54 ? -13.418 -4.970  1.538   1.00 0.00 ? 54 ALA A H    10 
ATOM 11718 H HA   . ALA A 1 54 ? -15.456 -5.946  1.793   1.00 0.00 ? 54 ALA A HA   10 
ATOM 11719 H HB1  . ALA A 1 54 ? -15.244 -8.520  2.447   1.00 0.00 ? 54 ALA A HB1  10 
ATOM 11720 H HB2  . ALA A 1 54 ? -13.588 -8.241  1.910   1.00 0.00 ? 54 ALA A HB2  10 
ATOM 11721 H HB3  . ALA A 1 54 ? -14.934 -7.928  0.815   1.00 0.00 ? 54 ALA A HB3  10 
ATOM 11722 N N    . GLY A 1 55 ? -14.618 -5.389  4.527   1.00 0.00 ? 55 GLY A N    10 
ATOM 11723 C CA   . GLY A 1 55 ? -14.911 -5.268  5.944   1.00 0.00 ? 55 GLY A CA   10 
ATOM 11724 C C    . GLY A 1 55 ? -13.727 -5.638  6.816   1.00 0.00 ? 55 GLY A C    10 
ATOM 11725 O O    . GLY A 1 55 ? -13.572 -5.111  7.918   1.00 0.00 ? 55 GLY A O    10 
ATOM 11726 H H    . GLY A 1 55 ? -14.099 -4.692  4.075   1.00 0.00 ? 55 GLY A H    10 
ATOM 11727 H HA2  . GLY A 1 55 ? -15.195 -4.249  6.155   1.00 0.00 ? 55 GLY A HA2  10 
ATOM 11728 H HA3  . GLY A 1 55 ? -15.738 -5.919  6.185   1.00 0.00 ? 55 GLY A HA3  10 
ATOM 11729 N N    . THR A 1 56 ? -12.890 -6.544  6.323   1.00 0.00 ? 56 THR A N    10 
ATOM 11730 C CA   . THR A 1 56 ? -11.715 -6.984  7.066   1.00 0.00 ? 56 THR A CA   10 
ATOM 11731 C C    . THR A 1 56 ? -10.603 -5.941  6.990   1.00 0.00 ? 56 THR A C    10 
ATOM 11732 O O    . THR A 1 56 ? -10.195 -5.531  5.904   1.00 0.00 ? 56 THR A O    10 
ATOM 11733 C CB   . THR A 1 56 ? -11.213 -8.323  6.523   1.00 0.00 ? 56 THR A CB   10 
ATOM 11734 O OG1  . THR A 1 56 ? -12.241 -9.295  6.558   1.00 0.00 ? 56 THR A OG1  10 
ATOM 11735 C CG2  . THR A 1 56 ? -10.032 -8.875  7.291   1.00 0.00 ? 56 THR A CG2  10 
ATOM 11736 H H    . THR A 1 56 ? -13.067 -6.928  5.439   1.00 0.00 ? 56 THR A H    10 
ATOM 11737 H HA   . THR A 1 56 ? -12.003 -7.110  8.098   1.00 0.00 ? 56 THR A HA   10 
ATOM 11738 H HB   . THR A 1 56 ? -10.907 -8.190  5.495   1.00 0.00 ? 56 THR A HB   10 
ATOM 11739 H HG1  . THR A 1 56 ? -12.637 -9.311  7.433   1.00 0.00 ? 56 THR A HG1  10 
ATOM 11740 H HG21 . THR A 1 56 ? -9.455  -9.523  6.647   1.00 0.00 ? 56 THR A HG21 10 
ATOM 11741 H HG22 . THR A 1 56 ? -10.386 -9.436  8.142   1.00 0.00 ? 56 THR A HG22 10 
ATOM 11742 H HG23 . THR A 1 56 ? -9.410  -8.060  7.630   1.00 0.00 ? 56 THR A HG23 10 
ATOM 11743 N N    . ARG A 1 57 ? -10.115 -5.517  8.152   1.00 0.00 ? 57 ARG A N    10 
ATOM 11744 C CA   . ARG A 1 57 ? -9.051  -4.523  8.217   1.00 0.00 ? 57 ARG A CA   10 
ATOM 11745 C C    . ARG A 1 57 ? -7.780  -5.122  8.810   1.00 0.00 ? 57 ARG A C    10 
ATOM 11746 O O    . ARG A 1 57 ? -7.767  -5.562  9.959   1.00 0.00 ? 57 ARG A O    10 
ATOM 11747 C CB   . ARG A 1 57 ? -9.497  -3.319  9.047   1.00 0.00 ? 57 ARG A CB   10 
ATOM 11748 C CG   . ARG A 1 57 ? -8.638  -2.082  8.836   1.00 0.00 ? 57 ARG A CG   10 
ATOM 11749 C CD   . ARG A 1 57 ? -9.384  -0.811  9.209   1.00 0.00 ? 57 ARG A CD   10 
ATOM 11750 N NE   . ARG A 1 57 ? -10.711 -0.753  8.598   1.00 0.00 ? 57 ARG A NE   10 
ATOM 11751 C CZ   . ARG A 1 57 ? -11.681 0.059   9.010   1.00 0.00 ? 57 ARG A CZ   10 
ATOM 11752 N NH1  . ARG A 1 57 ? -11.479 0.880   10.033  1.00 0.00 ? 57 ARG A NH1  10 
ATOM 11753 N NH2  . ARG A 1 57 ? -12.857 0.050   8.397   1.00 0.00 ? 57 ARG A NH2  10 
ATOM 11754 H H    . ARG A 1 57 ? -10.480 -5.881  8.986   1.00 0.00 ? 57 ARG A H    10 
ATOM 11755 H HA   . ARG A 1 57 ? -8.843  -4.196  7.209   1.00 0.00 ? 57 ARG A HA   10 
ATOM 11756 H HB2  . ARG A 1 57 ? -10.515 -3.073  8.786   1.00 0.00 ? 57 ARG A HB2  10 
ATOM 11757 H HB3  . ARG A 1 57 ? -9.457  -3.583  10.093  1.00 0.00 ? 57 ARG A HB3  10 
ATOM 11758 H HG2  . ARG A 1 57 ? -7.754  -2.161  9.450   1.00 0.00 ? 57 ARG A HG2  10 
ATOM 11759 H HG3  . ARG A 1 57 ? -8.352  -2.030  7.795   1.00 0.00 ? 57 ARG A HG3  10 
ATOM 11760 H HD2  . ARG A 1 57 ? -9.492  -0.773  10.282  1.00 0.00 ? 57 ARG A HD2  10 
ATOM 11761 H HD3  . ARG A 1 57 ? -8.808  0.040   8.876   1.00 0.00 ? 57 ARG A HD3  10 
ATOM 11762 H HE   . ARG A 1 57 ? -10.886 -1.350  7.840   1.00 0.00 ? 57 ARG A HE   10 
ATOM 11763 H HH11 . ARG A 1 57 ? -10.595 0.891   10.500  1.00 0.00 ? 57 ARG A HH11 10 
ATOM 11764 H HH12 . ARG A 1 57 ? -12.213 1.487   10.338  1.00 0.00 ? 57 ARG A HH12 10 
ATOM 11765 H HH21 . ARG A 1 57 ? -13.015 -0.566  7.626   1.00 0.00 ? 57 ARG A HH21 10 
ATOM 11766 H HH22 . ARG A 1 57 ? -13.586 0.660   8.707   1.00 0.00 ? 57 ARG A HH22 10 
ATOM 11767 N N    . TYR A 1 58 ? -6.713  -5.133  8.018   1.00 0.00 ? 58 TYR A N    10 
ATOM 11768 C CA   . TYR A 1 58 ? -5.435  -5.676  8.465   1.00 0.00 ? 58 TYR A CA   10 
ATOM 11769 C C    . TYR A 1 58 ? -4.660  -4.644  9.277   1.00 0.00 ? 58 TYR A C    10 
ATOM 11770 O O    . TYR A 1 58 ? -4.166  -4.939  10.365  1.00 0.00 ? 58 TYR A O    10 
ATOM 11771 C CB   . TYR A 1 58 ? -4.602  -6.128  7.264   1.00 0.00 ? 58 TYR A CB   10 
ATOM 11772 C CG   . TYR A 1 58 ? -5.337  -7.070  6.336   1.00 0.00 ? 58 TYR A CG   10 
ATOM 11773 C CD1  . TYR A 1 58 ? -6.222  -6.584  5.382   1.00 0.00 ? 58 TYR A CD1  10 
ATOM 11774 C CD2  . TYR A 1 58 ? -5.145  -8.443  6.414   1.00 0.00 ? 58 TYR A CD2  10 
ATOM 11775 C CE1  . TYR A 1 58 ? -6.896  -7.440  4.533   1.00 0.00 ? 58 TYR A CE1  10 
ATOM 11776 C CE2  . TYR A 1 58 ? -5.814  -9.306  5.568   1.00 0.00 ? 58 TYR A CE2  10 
ATOM 11777 C CZ   . TYR A 1 58 ? -6.689  -8.800  4.630   1.00 0.00 ? 58 TYR A CZ   10 
ATOM 11778 O OH   . TYR A 1 58 ? -7.358  -9.656  3.785   1.00 0.00 ? 58 TYR A OH   10 
ATOM 11779 H H    . TYR A 1 58 ? -6.785  -4.767  7.113   1.00 0.00 ? 58 TYR A H    10 
ATOM 11780 H HA   . TYR A 1 58 ? -5.640  -6.531  9.092   1.00 0.00 ? 58 TYR A HA   10 
ATOM 11781 H HB2  . TYR A 1 58 ? -4.308  -5.261  6.692   1.00 0.00 ? 58 TYR A HB2  10 
ATOM 11782 H HB3  . TYR A 1 58 ? -3.716  -6.635  7.619   1.00 0.00 ? 58 TYR A HB3  10 
ATOM 11783 H HD1  . TYR A 1 58 ? -6.382  -5.518  5.309   1.00 0.00 ? 58 TYR A HD1  10 
ATOM 11784 H HD2  . TYR A 1 58 ? -4.460  -8.836  7.151   1.00 0.00 ? 58 TYR A HD2  10 
ATOM 11785 H HE1  . TYR A 1 58 ? -7.581  -7.044  3.798   1.00 0.00 ? 58 TYR A HE1  10 
ATOM 11786 H HE2  . TYR A 1 58 ? -5.652  -10.371 5.645   1.00 0.00 ? 58 TYR A HE2  10 
ATOM 11787 H HH   . TYR A 1 58 ? -8.264  -9.359  3.680   1.00 0.00 ? 58 TYR A HH   10 
ATOM 11788 N N    . PHE A 1 59 ? -4.560  -3.432  8.741   1.00 0.00 ? 59 PHE A N    10 
ATOM 11789 C CA   . PHE A 1 59 ? -3.847  -2.353  9.415   1.00 0.00 ? 59 PHE A CA   10 
ATOM 11790 C C    . PHE A 1 59 ? -4.719  -1.108  9.523   1.00 0.00 ? 59 PHE A C    10 
ATOM 11791 O O    . PHE A 1 59 ? -5.360  -0.700  8.554   1.00 0.00 ? 59 PHE A O    10 
ATOM 11792 C CB   . PHE A 1 59 ? -2.554  -2.022  8.666   1.00 0.00 ? 59 PHE A CB   10 
ATOM 11793 C CG   . PHE A 1 59 ? -2.781  -1.525  7.268   1.00 0.00 ? 59 PHE A CG   10 
ATOM 11794 C CD1  . PHE A 1 59 ? -2.876  -2.414  6.210   1.00 0.00 ? 59 PHE A CD1  10 
ATOM 11795 C CD2  . PHE A 1 59 ? -2.901  -0.169  7.011   1.00 0.00 ? 59 PHE A CD2  10 
ATOM 11796 C CE1  . PHE A 1 59 ? -3.085  -1.960  4.921   1.00 0.00 ? 59 PHE A CE1  10 
ATOM 11797 C CE2  . PHE A 1 59 ? -3.111  0.291   5.725   1.00 0.00 ? 59 PHE A CE2  10 
ATOM 11798 C CZ   . PHE A 1 59 ? -3.202  -0.606  4.679   1.00 0.00 ? 59 PHE A CZ   10 
ATOM 11799 H H    . PHE A 1 59 ? -4.976  -3.257  7.871   1.00 0.00 ? 59 PHE A H    10 
ATOM 11800 H HA   . PHE A 1 59 ? -3.599  -2.692  10.409  1.00 0.00 ? 59 PHE A HA   10 
ATOM 11801 H HB2  . PHE A 1 59 ? -2.019  -1.256  9.208   1.00 0.00 ? 59 PHE A HB2  10 
ATOM 11802 H HB3  . PHE A 1 59 ? -1.942  -2.910  8.609   1.00 0.00 ? 59 PHE A HB3  10 
ATOM 11803 H HD1  . PHE A 1 59 ? -2.785  -3.474  6.398   1.00 0.00 ? 59 PHE A HD1  10 
ATOM 11804 H HD2  . PHE A 1 59 ? -2.829  0.534   7.829   1.00 0.00 ? 59 PHE A HD2  10 
ATOM 11805 H HE1  . PHE A 1 59 ? -3.155  -2.664  4.104   1.00 0.00 ? 59 PHE A HE1  10 
ATOM 11806 H HE2  . PHE A 1 59 ? -3.201  1.351   5.538   1.00 0.00 ? 59 PHE A HE2  10 
ATOM 11807 H HZ   . PHE A 1 59 ? -3.365  -0.249  3.672   1.00 0.00 ? 59 PHE A HZ   10 
ATOM 11808 N N    . GLN A 1 60 ? -4.741  -0.508  10.709  1.00 0.00 ? 60 GLN A N    10 
ATOM 11809 C CA   . GLN A 1 60 ? -5.537  0.690   10.946  1.00 0.00 ? 60 GLN A CA   10 
ATOM 11810 C C    . GLN A 1 60 ? -5.042  1.854   10.093  1.00 0.00 ? 60 GLN A C    10 
ATOM 11811 O O    . GLN A 1 60 ? -3.836  2.052   9.935   1.00 0.00 ? 60 GLN A O    10 
ATOM 11812 C CB   . GLN A 1 60 ? -5.492  1.073   12.426  1.00 0.00 ? 60 GLN A CB   10 
ATOM 11813 C CG   . GLN A 1 60 ? -6.344  2.284   12.768  1.00 0.00 ? 60 GLN A CG   10 
ATOM 11814 C CD   . GLN A 1 60 ? -7.829  1.981   12.733  1.00 0.00 ? 60 GLN A CD   10 
ATOM 11815 O OE1  . GLN A 1 60 ? -8.293  1.022   13.352  1.00 0.00 ? 60 GLN A OE1  10 
ATOM 11816 N NE2  . GLN A 1 60 ? -8.583  2.796   12.006  1.00 0.00 ? 60 GLN A NE2  10 
ATOM 11817 H H    . GLN A 1 60 ? -4.210  -0.882  11.443  1.00 0.00 ? 60 GLN A H    10 
ATOM 11818 H HA   . GLN A 1 60 ? -6.558  0.469   10.672  1.00 0.00 ? 60 GLN A HA   10 
ATOM 11819 H HB2  . GLN A 1 60 ? -5.841  0.237   13.013  1.00 0.00 ? 60 GLN A HB2  10 
ATOM 11820 H HB3  . GLN A 1 60 ? -4.470  1.291   12.699  1.00 0.00 ? 60 GLN A HB3  10 
ATOM 11821 H HG2  . GLN A 1 60 ? -6.085  2.622   13.761  1.00 0.00 ? 60 GLN A HG2  10 
ATOM 11822 H HG3  . GLN A 1 60 ? -6.135  3.068   12.055  1.00 0.00 ? 60 GLN A HG3  10 
ATOM 11823 H HE21 . GLN A 1 60 ? -8.145  3.538   11.539  1.00 0.00 ? 60 GLN A HE21 10 
ATOM 11824 H HE22 . GLN A 1 60 ? -9.547  2.623   11.966  1.00 0.00 ? 60 GLN A HE22 10 
ATOM 11825 N N    . CYS A 1 61 ? -5.979  2.621   9.546   1.00 0.00 ? 61 CYS A N    10 
ATOM 11826 C CA   . CYS A 1 61 ? -5.640  3.766   8.709   1.00 0.00 ? 61 CYS A CA   10 
ATOM 11827 C C    . CYS A 1 61 ? -6.872  4.627   8.439   1.00 0.00 ? 61 CYS A C    10 
AT