data_2CQE
# 
_entry.id   2CQE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CQE         
RCSB  RCSB024505   
WWPDB D_1000024505 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002101040.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CQE 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Someya, T.'                                             1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Terada, T.'                                             5 
'Shirouzu, M.'                                           6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the Zinc-finger domain in KIAA1064 protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Someya, T.'   1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Terada, T.'   5 
primary 'Shirouzu, M.' 6 
primary 'Yokoyama, S.' 7 
# 
_cell.entry_id           2CQE 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CQE 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'KIAA1064 protein' 10755.919 1 ? ? 'Zinc-finger domain' ? 
2 non-polymer syn 'ZINC ION'         65.409    2 ? ? ?                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAG
AEDEKEVEELKKSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAG
AEDEKEVEELKKSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002101040.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  GLU n 
1 9  LEU n 
1 10 PRO n 
1 11 LYS n 
1 12 LYS n 
1 13 ARG n 
1 14 GLU n 
1 15 LEU n 
1 16 CYS n 
1 17 LYS n 
1 18 PHE n 
1 19 TYR n 
1 20 ILE n 
1 21 THR n 
1 22 GLY n 
1 23 PHE n 
1 24 CYS n 
1 25 ALA n 
1 26 ARG n 
1 27 ALA n 
1 28 GLU n 
1 29 ASN n 
1 30 CYS n 
1 31 PRO n 
1 32 TYR n 
1 33 MET n 
1 34 HIS n 
1 35 GLY n 
1 36 ASP n 
1 37 PHE n 
1 38 PRO n 
1 39 CYS n 
1 40 LYS n 
1 41 LEU n 
1 42 TYR n 
1 43 HIS n 
1 44 THR n 
1 45 THR n 
1 46 GLY n 
1 47 ASN n 
1 48 CYS n 
1 49 ILE n 
1 50 ASN n 
1 51 GLY n 
1 52 ASP n 
1 53 ASP n 
1 54 CYS n 
1 55 MET n 
1 56 PHE n 
1 57 SER n 
1 58 HIS n 
1 59 ASP n 
1 60 PRO n 
1 61 LEU n 
1 62 THR n 
1 63 GLU n 
1 64 GLU n 
1 65 THR n 
1 66 ARG n 
1 67 GLU n 
1 68 LEU n 
1 69 LEU n 
1 70 ASP n 
1 71 LYS n 
1 72 MET n 
1 73 LEU n 
1 74 ALA n 
1 75 ASP n 
1 76 ASP n 
1 77 ALA n 
1 78 GLU n 
1 79 ALA n 
1 80 GLY n 
1 81 ALA n 
1 82 GLU n 
1 83 ASP n 
1 84 GLU n 
1 85 LYS n 
1 86 GLU n 
1 87 VAL n 
1 88 GLU n 
1 89 GLU n 
1 90 LEU n 
1 91 LYS n 
1 92 LYS n 
1 93 SER n 
1 94 GLY n 
1 95 PRO n 
1 96 SER n 
1 97 SER n 
1 98 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 C19orf7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P041012-01 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9UPT8_HUMAN 
_struct_ref.pdbx_db_accession          Q9UPT8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEV
EELKK
;
_struct_ref.pdbx_align_begin           429 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CQE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UPT8 
_struct_ref_seq.db_align_beg                  429 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  513 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       429 
_struct_ref_seq.pdbx_auth_seq_align_end       513 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CQE GLY A 1  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 422 1  
1 2CQE SER A 2  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 423 2  
1 2CQE SER A 3  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 424 3  
1 2CQE GLY A 4  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 425 4  
1 2CQE SER A 5  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 426 5  
1 2CQE SER A 6  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 427 6  
1 2CQE GLY A 7  ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 428 7  
1 2CQE SER A 93 ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 514 8  
1 2CQE GLY A 94 ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 515 9  
1 2CQE PRO A 95 ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 516 10 
1 2CQE SER A 96 ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 517 11 
1 2CQE SER A 97 ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 518 12 
1 2CQE GLY A 98 ? UNP Q9UPT8 ? ? 'CLONING ARTIFACT' 519 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.34mM PROTEIN U-15N,13C; 20mM d-Tris-HCL; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2CQE 
_pdbx_nmr_refine.method             'torsion angle dynamics, restrainted molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2CQE 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CQE 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRview 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9295   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2CQE 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CQE 
_struct.title                     'Solution Structure of the Zinc-finger domain in KIAA1064 protein' 
_struct.pdbx_descriptor           'KIAA1064 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CQE 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;CCCH Zinc-finger, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transcription
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 40 ? THR A 45 ? LYS A 461 THR A 466 1 ? 6  
HELX_P HELX_P2 2 THR A 65 ? GLU A 78 ? THR A 486 GLU A 499 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 16 SG  ? ? A ZN 622 A CYS 437 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 24 SG  ? ? A ZN 622 A CYS 445 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 30 SG  ? ? A ZN 622 A CYS 451 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 34 NE2 ? ? A ZN 622 A HIS 455 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 39 SG  ? ? A ZN 822 A CYS 460 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 48 SG  ? ? A ZN 822 A CYS 469 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 54 SG  ? ? A ZN 822 A CYS 475 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 58 NE2 ? ? A ZN 822 A HIS 479 1_555 ? ? ? ? ? ? ? 2.330 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 622' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 822' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 16 ? CYS A 437 . ? 1_555 ? 
2 AC1 4 CYS A 24 ? CYS A 445 . ? 1_555 ? 
3 AC1 4 CYS A 30 ? CYS A 451 . ? 1_555 ? 
4 AC1 4 HIS A 34 ? HIS A 455 . ? 1_555 ? 
5 AC2 4 CYS A 39 ? CYS A 460 . ? 1_555 ? 
6 AC2 4 CYS A 48 ? CYS A 469 . ? 1_555 ? 
7 AC2 4 CYS A 54 ? CYS A 475 . ? 1_555 ? 
8 AC2 4 HIS A 58 ? HIS A 479 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2CQE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CQE 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 15.325  -16.750 7.962   1.00 0.00 ? 422 GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 16.066  -16.749 6.714   1.00 0.00 ? 422 GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 17.542  -17.033 6.917   1.00 0.00 ? 422 GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 18.202  -16.377 7.721   1.00 0.00 ? 422 GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 15.806  -16.751 8.816   1.00 0.00 ? 422 GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? 15.652  -17.502 6.061   1.00 0.00 ? 422 GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? 15.959  -15.782 6.246   1.00 0.00 ? 422 GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? 18.059  -18.016 6.186   1.00 0.00 ? 423 SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? 19.465  -18.389 6.293   1.00 0.00 ? 423 SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? 20.142  -18.355 4.927   1.00 0.00 ? 423 SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? 21.252  -17.842 4.784   1.00 0.00 ? 423 SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? 19.598  -19.784 6.907   1.00 0.00 ? 423 SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? 18.801  -20.726 6.209   1.00 0.00 ? 423 SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? 17.481  -18.502 5.562   1.00 0.00 ? 423 SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? 19.950  -17.673 6.940   1.00 0.00 ? 423 SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? 20.630  -20.099 6.859   1.00 0.00 ? 423 SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? 19.279  -19.753 7.938   1.00 0.00 ? 423 SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? 19.318  -21.516 6.035   1.00 0.00 ? 423 SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? 19.465  -18.905 3.924   1.00 0.00 ? 424 SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? 20.001  -18.942 2.569   1.00 0.00 ? 424 SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? 20.115  -17.534 1.991   1.00 0.00 ? 424 SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? 21.208  -17.066 1.677   1.00 0.00 ? 424 SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? 19.114  -19.805 1.669   1.00 0.00 ? 424 SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? 17.768  -19.363 1.706   1.00 0.00 ? 424 SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? 18.584  -19.298 4.101   1.00 0.00 ? 424 SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? 20.987  -19.380 2.614   1.00 0.00 ? 424 SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? 19.472  -19.747 0.653   1.00 0.00 ? 424 SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? 19.153  -20.830 2.007   1.00 0.00 ? 424 SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? 17.226  -19.941 1.164   1.00 0.00 ? 424 SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? 18.974  -16.864 1.854   1.00 0.00 ? 425 GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? 18.966  -15.517 1.314   1.00 0.00 ? 425 GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? 19.044  -15.498 -0.200  1.00 0.00 ? 425 GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? 18.295  -14.776 -0.858  1.00 0.00 ? 425 GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? 18.132  -17.288 2.121   1.00 0.00 ? 425 GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? 18.058  -15.022 1.624   1.00 0.00 ? 425 GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? 19.812  -14.977 1.713   1.00 0.00 ? 425 GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? 19.953  -16.293 -0.754  1.00 0.00 ? 426 SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? 20.130  -16.361 -2.200  1.00 0.00 ? 426 SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? 18.836  -16.791 -2.886  1.00 0.00 ? 426 SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? 17.980  -17.431 -2.275  1.00 0.00 ? 426 SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? 21.255  -17.336 -2.552  1.00 0.00 ? 426 SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? 21.583  -17.260 -3.929  1.00 0.00 ? 426 SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? 20.521  -16.846 -0.176  1.00 0.00 ? 426 SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? 20.398  -15.375 -2.548  1.00 0.00 ? 426 SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? 22.132  -17.095 -1.972  1.00 0.00 ? 426 SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? 20.939  -18.344 -2.325  1.00 0.00 ? 426 SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? 21.952  -16.395 -4.123  1.00 0.00 ? 426 SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? 18.702  -16.433 -4.159  1.00 0.00 ? 427 SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? 17.511  -16.777 -4.928  1.00 0.00 ? 427 SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? 17.864  -17.030 -6.390  1.00 0.00 ? 427 SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? 18.233  -16.111 -7.120  1.00 0.00 ? 427 SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? 16.473  -15.658 -4.828  1.00 0.00 ? 427 SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? 17.025  -14.413 -5.222  1.00 0.00 ? 427 SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? 19.419  -15.923 -4.590  1.00 0.00 ? 427 SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? 17.096  -17.681 -4.508  1.00 0.00 ? 427 SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? 15.637  -15.887 -5.472  1.00 0.00 ? 427 SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? 16.130  -15.579 -3.807  1.00 0.00 ? 427 SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? 16.580  -14.103 -6.015  1.00 0.00 ? 427 SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? 17.748  -18.286 -6.812  1.00 0.00 ? 428 GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? 18.058  -18.639 -8.185  1.00 0.00 ? 428 GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? 17.654  -17.558 -9.167  1.00 0.00 ? 428 GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? 16.606  -16.931 -9.012  1.00 0.00 ? 428 GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? 17.450  -18.978 -6.185  1.00 0.00 ? 428 GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? 19.121  -18.809 -8.270  1.00 0.00 ? 428 GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? 17.537  -19.551 -8.436  1.00 0.00 ? 428 GLY A HA3  1  
ATOM   66    N  N    . GLU A 1 8  ? 18.487  -17.339 -10.179 1.00 0.00 ? 429 GLU A N    1  
ATOM   67    C  CA   . GLU A 1 8  ? 18.211  -16.323 -11.189 1.00 0.00 ? 429 GLU A CA   1  
ATOM   68    C  C    . GLU A 1 8  ? 17.197  -16.833 -12.210 1.00 0.00 ? 429 GLU A C    1  
ATOM   69    O  O    . GLU A 1 8  ? 17.519  -17.667 -13.058 1.00 0.00 ? 429 GLU A O    1  
ATOM   70    C  CB   . GLU A 1 8  ? 19.503  -15.912 -11.898 1.00 0.00 ? 429 GLU A CB   1  
ATOM   71    C  CG   . GLU A 1 8  ? 20.435  -15.083 -11.031 1.00 0.00 ? 429 GLU A CG   1  
ATOM   72    C  CD   . GLU A 1 8  ? 20.653  -15.693 -9.660  1.00 0.00 ? 429 GLU A CD   1  
ATOM   73    O  OE1  . GLU A 1 8  ? 20.947  -16.905 -9.589  1.00 0.00 ? 429 GLU A OE1  1  
ATOM   74    O  OE2  . GLU A 1 8  ? 20.529  -14.959 -8.657  1.00 0.00 ? 429 GLU A OE2  1  
ATOM   75    H  H    . GLU A 1 8  ? 19.307  -17.871 -10.249 1.00 0.00 ? 429 GLU A H    1  
ATOM   76    H  HA   . GLU A 1 8  ? 17.796  -15.462 -10.688 1.00 0.00 ? 429 GLU A HA   1  
ATOM   77    H  HB2  . GLU A 1 8  ? 20.029  -16.803 -12.207 1.00 0.00 ? 429 GLU A HB2  1  
ATOM   78    H  HB3  . GLU A 1 8  ? 19.249  -15.333 -12.774 1.00 0.00 ? 429 GLU A HB3  1  
ATOM   79    H  HG2  . GLU A 1 8  ? 21.391  -15.003 -11.527 1.00 0.00 ? 429 GLU A HG2  1  
ATOM   80    H  HG3  . GLU A 1 8  ? 20.011  -14.098 -10.908 1.00 0.00 ? 429 GLU A HG3  1  
ATOM   81    N  N    . LEU A 1 9  ? 15.972  -16.327 -12.122 1.00 0.00 ? 430 LEU A N    1  
ATOM   82    C  CA   . LEU A 1 9  ? 14.910  -16.730 -13.037 1.00 0.00 ? 430 LEU A CA   1  
ATOM   83    C  C    . LEU A 1 9  ? 14.077  -15.527 -13.468 1.00 0.00 ? 430 LEU A C    1  
ATOM   84    O  O    . LEU A 1 9  ? 14.065  -14.483 -12.816 1.00 0.00 ? 430 LEU A O    1  
ATOM   85    C  CB   . LEU A 1 9  ? 14.012  -17.778 -12.377 1.00 0.00 ? 430 LEU A CB   1  
ATOM   86    C  CG   . LEU A 1 9  ? 14.454  -19.233 -12.531 1.00 0.00 ? 430 LEU A CG   1  
ATOM   87    C  CD1  . LEU A 1 9  ? 15.404  -19.624 -11.408 1.00 0.00 ? 430 LEU A CD1  1  
ATOM   88    C  CD2  . LEU A 1 9  ? 13.246  -20.158 -12.556 1.00 0.00 ? 430 LEU A CD2  1  
ATOM   89    H  H    . LEU A 1 9  ? 15.776  -15.666 -11.426 1.00 0.00 ? 430 LEU A H    1  
ATOM   90    H  HA   . LEU A 1 9  ? 15.373  -17.163 -13.911 1.00 0.00 ? 430 LEU A HA   1  
ATOM   91    H  HB2  . LEU A 1 9  ? 13.966  -17.556 -11.322 1.00 0.00 ? 430 LEU A HB2  1  
ATOM   92    H  HB3  . LEU A 1 9  ? 13.025  -17.684 -12.807 1.00 0.00 ? 430 LEU A HB3  1  
ATOM   93    H  HG   . LEU A 1 9  ? 14.982  -19.346 -13.468 1.00 0.00 ? 430 LEU A HG   1  
ATOM   94    H  HD11 . LEU A 1 9  ? 15.762  -20.628 -11.573 1.00 0.00 ? 430 LEU A HD11 1  
ATOM   95    H  HD12 . LEU A 1 9  ? 14.882  -19.578 -10.464 1.00 0.00 ? 430 LEU A HD12 1  
ATOM   96    H  HD13 . LEU A 1 9  ? 16.240  -18.940 -11.390 1.00 0.00 ? 430 LEU A HD13 1  
ATOM   97    H  HD21 . LEU A 1 9  ? 13.001  -20.457 -11.547 1.00 0.00 ? 430 LEU A HD21 1  
ATOM   98    H  HD22 . LEU A 1 9  ? 13.476  -21.034 -13.145 1.00 0.00 ? 430 LEU A HD22 1  
ATOM   99    H  HD23 . LEU A 1 9  ? 12.405  -19.640 -12.992 1.00 0.00 ? 430 LEU A HD23 1  
ATOM   100   N  N    . PRO A 1 10 ? 13.359  -15.676 -14.592 1.00 0.00 ? 431 PRO A N    1  
ATOM   101   C  CA   . PRO A 1 10 ? 12.507  -14.613 -15.133 1.00 0.00 ? 431 PRO A CA   1  
ATOM   102   C  C    . PRO A 1 10 ? 11.279  -14.358 -14.266 1.00 0.00 ? 431 PRO A C    1  
ATOM   103   O  O    . PRO A 1 10 ? 10.183  -14.832 -14.568 1.00 0.00 ? 431 PRO A O    1  
ATOM   104   C  CB   . PRO A 1 10 ? 12.091  -15.155 -16.503 1.00 0.00 ? 431 PRO A CB   1  
ATOM   105   C  CG   . PRO A 1 10 ? 12.188  -16.636 -16.370 1.00 0.00 ? 431 PRO A CG   1  
ATOM   106   C  CD   . PRO A 1 10 ? 13.325  -16.893 -15.420 1.00 0.00 ? 431 PRO A CD   1  
ATOM   107   H  HA   . PRO A 1 10 ? 13.055  -13.691 -15.260 1.00 0.00 ? 431 PRO A HA   1  
ATOM   108   H  HB2  . PRO A 1 10 ? 11.081  -14.843 -16.725 1.00 0.00 ? 431 PRO A HB2  1  
ATOM   109   H  HB3  . PRO A 1 10 ? 12.764  -14.783 -17.261 1.00 0.00 ? 431 PRO A HB3  1  
ATOM   110   H  HG2  . PRO A 1 10 ? 11.267  -17.029 -15.967 1.00 0.00 ? 431 PRO A HG2  1  
ATOM   111   H  HG3  . PRO A 1 10 ? 12.397  -17.078 -17.333 1.00 0.00 ? 431 PRO A HG3  1  
ATOM   112   H  HD2  . PRO A 1 10 ? 13.122  -17.765 -14.816 1.00 0.00 ? 431 PRO A HD2  1  
ATOM   113   H  HD3  . PRO A 1 10 ? 14.250  -17.015 -15.963 1.00 0.00 ? 431 PRO A HD3  1  
ATOM   114   N  N    . LYS A 1 11 ? 11.468  -13.605 -13.188 1.00 0.00 ? 432 LYS A N    1  
ATOM   115   C  CA   . LYS A 1 11 ? 10.375  -13.283 -12.278 1.00 0.00 ? 432 LYS A CA   1  
ATOM   116   C  C    . LYS A 1 11 ? 10.555  -11.891 -11.681 1.00 0.00 ? 432 LYS A C    1  
ATOM   117   O  O    . LYS A 1 11 ? 11.591  -11.587 -11.089 1.00 0.00 ? 432 LYS A O    1  
ATOM   118   C  CB   . LYS A 1 11 ? 10.295  -14.323 -11.158 1.00 0.00 ? 432 LYS A CB   1  
ATOM   119   C  CG   . LYS A 1 11 ? 9.876   -15.702 -11.637 1.00 0.00 ? 432 LYS A CG   1  
ATOM   120   C  CD   . LYS A 1 11 ? 8.398   -15.746 -11.986 1.00 0.00 ? 432 LYS A CD   1  
ATOM   121   C  CE   . LYS A 1 11 ? 7.880   -17.175 -12.041 1.00 0.00 ? 432 LYS A CE   1  
ATOM   122   N  NZ   . LYS A 1 11 ? 8.029   -17.767 -13.399 1.00 0.00 ? 432 LYS A NZ   1  
ATOM   123   H  H    . LYS A 1 11 ? 12.364  -13.255 -13.000 1.00 0.00 ? 432 LYS A H    1  
ATOM   124   H  HA   . LYS A 1 11 ? 9.455   -13.304 -12.843 1.00 0.00 ? 432 LYS A HA   1  
ATOM   125   H  HB2  . LYS A 1 11 ? 11.265  -14.407 -10.690 1.00 0.00 ? 432 LYS A HB2  1  
ATOM   126   H  HB3  . LYS A 1 11 ? 9.578   -13.988 -10.422 1.00 0.00 ? 432 LYS A HB3  1  
ATOM   127   H  HG2  . LYS A 1 11 ? 10.450  -15.958 -12.515 1.00 0.00 ? 432 LYS A HG2  1  
ATOM   128   H  HG3  . LYS A 1 11 ? 10.073  -16.421 -10.854 1.00 0.00 ? 432 LYS A HG3  1  
ATOM   129   H  HD2  . LYS A 1 11 ? 7.843   -15.203 -11.235 1.00 0.00 ? 432 LYS A HD2  1  
ATOM   130   H  HD3  . LYS A 1 11 ? 8.251   -15.282 -12.951 1.00 0.00 ? 432 LYS A HD3  1  
ATOM   131   H  HE2  . LYS A 1 11 ? 8.435   -17.773 -11.335 1.00 0.00 ? 432 LYS A HE2  1  
ATOM   132   H  HE3  . LYS A 1 11 ? 6.835   -17.176 -11.769 1.00 0.00 ? 432 LYS A HE3  1  
ATOM   133   H  HZ1  . LYS A 1 11 ? 7.818   -18.785 -13.370 1.00 0.00 ? 432 LYS A HZ1  1  
ATOM   134   H  HZ2  . LYS A 1 11 ? 9.002   -17.636 -13.742 1.00 0.00 ? 432 LYS A HZ2  1  
ATOM   135   H  HZ3  . LYS A 1 11 ? 7.374   -17.307 -14.063 1.00 0.00 ? 432 LYS A HZ3  1  
ATOM   136   N  N    . LYS A 1 12 ? 9.540   -11.049 -11.839 1.00 0.00 ? 433 LYS A N    1  
ATOM   137   C  CA   . LYS A 1 12 ? 9.584   -9.689  -11.314 1.00 0.00 ? 433 LYS A CA   1  
ATOM   138   C  C    . LYS A 1 12 ? 9.158   -9.657  -9.850  1.00 0.00 ? 433 LYS A C    1  
ATOM   139   O  O    . LYS A 1 12 ? 8.039   -10.042 -9.511  1.00 0.00 ? 433 LYS A O    1  
ATOM   140   C  CB   . LYS A 1 12 ? 8.679   -8.772  -12.140 1.00 0.00 ? 433 LYS A CB   1  
ATOM   141   C  CG   . LYS A 1 12 ? 9.035   -8.735  -13.616 1.00 0.00 ? 433 LYS A CG   1  
ATOM   142   C  CD   . LYS A 1 12 ? 10.026  -7.625  -13.924 1.00 0.00 ? 433 LYS A CD   1  
ATOM   143   C  CE   . LYS A 1 12 ? 10.041  -7.287  -15.407 1.00 0.00 ? 433 LYS A CE   1  
ATOM   144   N  NZ   . LYS A 1 12 ? 8.842   -6.502  -15.809 1.00 0.00 ? 433 LYS A NZ   1  
ATOM   145   H  H    . LYS A 1 12 ? 8.740   -11.349 -12.321 1.00 0.00 ? 433 LYS A H    1  
ATOM   146   H  HA   . LYS A 1 12 ? 10.602  -9.338  -11.388 1.00 0.00 ? 433 LYS A HA   1  
ATOM   147   H  HB2  . LYS A 1 12 ? 7.659   -9.113  -12.045 1.00 0.00 ? 433 LYS A HB2  1  
ATOM   148   H  HB3  . LYS A 1 12 ? 8.752   -7.767  -11.749 1.00 0.00 ? 433 LYS A HB3  1  
ATOM   149   H  HG2  . LYS A 1 12 ? 9.473   -9.682  -13.895 1.00 0.00 ? 433 LYS A HG2  1  
ATOM   150   H  HG3  . LYS A 1 12 ? 8.134   -8.570  -14.190 1.00 0.00 ? 433 LYS A HG3  1  
ATOM   151   H  HD2  . LYS A 1 12 ? 9.748   -6.742  -13.368 1.00 0.00 ? 433 LYS A HD2  1  
ATOM   152   H  HD3  . LYS A 1 12 ? 11.014  -7.945  -13.625 1.00 0.00 ? 433 LYS A HD3  1  
ATOM   153   H  HE2  . LYS A 1 12 ? 10.927  -6.710  -15.621 1.00 0.00 ? 433 LYS A HE2  1  
ATOM   154   H  HE3  . LYS A 1 12 ? 10.066  -8.207  -15.972 1.00 0.00 ? 433 LYS A HE3  1  
ATOM   155   H  HZ1  . LYS A 1 12 ? 8.875   -5.555  -15.381 1.00 0.00 ? 433 LYS A HZ1  1  
ATOM   156   H  HZ2  . LYS A 1 12 ? 7.977   -6.983  -15.491 1.00 0.00 ? 433 LYS A HZ2  1  
ATOM   157   H  HZ3  . LYS A 1 12 ? 8.810   -6.403  -16.844 1.00 0.00 ? 433 LYS A HZ3  1  
ATOM   158   N  N    . ARG A 1 13 ? 10.057  -9.194  -8.987  1.00 0.00 ? 434 ARG A N    1  
ATOM   159   C  CA   . ARG A 1 13 ? 9.773   -9.112  -7.559  1.00 0.00 ? 434 ARG A CA   1  
ATOM   160   C  C    . ARG A 1 13 ? 9.395   -7.688  -7.161  1.00 0.00 ? 434 ARG A C    1  
ATOM   161   O  O    . ARG A 1 13 ? 9.844   -7.181  -6.135  1.00 0.00 ? 434 ARG A O    1  
ATOM   162   C  CB   . ARG A 1 13 ? 10.986  -9.574  -6.749  1.00 0.00 ? 434 ARG A CB   1  
ATOM   163   C  CG   . ARG A 1 13 ? 12.312  -9.348  -7.456  1.00 0.00 ? 434 ARG A CG   1  
ATOM   164   C  CD   . ARG A 1 13 ? 12.651  -10.502 -8.387  1.00 0.00 ? 434 ARG A CD   1  
ATOM   165   N  NE   . ARG A 1 13 ? 14.092  -10.643 -8.582  1.00 0.00 ? 434 ARG A NE   1  
ATOM   166   C  CZ   . ARG A 1 13 ? 14.889  -11.281 -7.733  1.00 0.00 ? 434 ARG A CZ   1  
ATOM   167   N  NH1  . ARG A 1 13 ? 14.389  -11.834 -6.637  1.00 0.00 ? 434 ARG A NH1  1  
ATOM   168   N  NH2  . ARG A 1 13 ? 16.190  -11.366 -7.980  1.00 0.00 ? 434 ARG A NH2  1  
ATOM   169   H  H    . ARG A 1 13 ? 10.932  -8.902  -9.318  1.00 0.00 ? 434 ARG A H    1  
ATOM   170   H  HA   . ARG A 1 13 ? 8.940   -9.766  -7.348  1.00 0.00 ? 434 ARG A HA   1  
ATOM   171   H  HB2  . ARG A 1 13 ? 11.006  -9.036  -5.813  1.00 0.00 ? 434 ARG A HB2  1  
ATOM   172   H  HB3  . ARG A 1 13 ? 10.886  -10.630 -6.546  1.00 0.00 ? 434 ARG A HB3  1  
ATOM   173   H  HG2  . ARG A 1 13 ? 12.251  -8.439  -8.035  1.00 0.00 ? 434 ARG A HG2  1  
ATOM   174   H  HG3  . ARG A 1 13 ? 13.092  -9.253  -6.715  1.00 0.00 ? 434 ARG A HG3  1  
ATOM   175   H  HD2  . ARG A 1 13 ? 12.264  -11.416 -7.962  1.00 0.00 ? 434 ARG A HD2  1  
ATOM   176   H  HD3  . ARG A 1 13 ? 12.183  -10.324 -9.344  1.00 0.00 ? 434 ARG A HD3  1  
ATOM   177   H  HE   . ARG A 1 13 ? 14.482  -10.241 -9.386  1.00 0.00 ? 434 ARG A HE   1  
ATOM   178   H  HH11 . ARG A 1 13 ? 13.410  -11.772 -6.449  1.00 0.00 ? 434 ARG A HH11 1  
ATOM   179   H  HH12 . ARG A 1 13 ? 14.992  -12.315 -6.000  1.00 0.00 ? 434 ARG A HH12 1  
ATOM   180   H  HH21 . ARG A 1 13 ? 16.571  -10.951 -8.806  1.00 0.00 ? 434 ARG A HH21 1  
ATOM   181   H  HH22 . ARG A 1 13 ? 16.790  -11.846 -7.341  1.00 0.00 ? 434 ARG A HH22 1  
ATOM   182   N  N    . GLU A 1 14 ? 8.566   -7.050  -7.982  1.00 0.00 ? 435 GLU A N    1  
ATOM   183   C  CA   . GLU A 1 14 ? 8.129   -5.685  -7.716  1.00 0.00 ? 435 GLU A CA   1  
ATOM   184   C  C    . GLU A 1 14 ? 6.629   -5.637  -7.442  1.00 0.00 ? 435 GLU A C    1  
ATOM   185   O  O    . GLU A 1 14 ? 5.897   -6.574  -7.766  1.00 0.00 ? 435 GLU A O    1  
ATOM   186   C  CB   . GLU A 1 14 ? 8.473   -4.776  -8.898  1.00 0.00 ? 435 GLU A CB   1  
ATOM   187   C  CG   . GLU A 1 14 ? 8.180   -3.307  -8.641  1.00 0.00 ? 435 GLU A CG   1  
ATOM   188   C  CD   . GLU A 1 14 ? 9.029   -2.729  -7.526  1.00 0.00 ? 435 GLU A CD   1  
ATOM   189   O  OE1  . GLU A 1 14 ? 10.096  -3.307  -7.232  1.00 0.00 ? 435 GLU A OE1  1  
ATOM   190   O  OE2  . GLU A 1 14 ? 8.625   -1.699  -6.947  1.00 0.00 ? 435 GLU A OE2  1  
ATOM   191   H  H    . GLU A 1 14 ? 8.242   -7.508  -8.786  1.00 0.00 ? 435 GLU A H    1  
ATOM   192   H  HA   . GLU A 1 14 ? 8.654   -5.334  -6.840  1.00 0.00 ? 435 GLU A HA   1  
ATOM   193   H  HB2  . GLU A 1 14 ? 9.524   -4.879  -9.122  1.00 0.00 ? 435 GLU A HB2  1  
ATOM   194   H  HB3  . GLU A 1 14 ? 7.898   -5.091  -9.757  1.00 0.00 ? 435 GLU A HB3  1  
ATOM   195   H  HG2  . GLU A 1 14 ? 8.375   -2.751  -9.546  1.00 0.00 ? 435 GLU A HG2  1  
ATOM   196   H  HG3  . GLU A 1 14 ? 7.139   -3.202  -8.373  1.00 0.00 ? 435 GLU A HG3  1  
ATOM   197   N  N    . LEU A 1 15 ? 6.177   -4.541  -6.844  1.00 0.00 ? 436 LEU A N    1  
ATOM   198   C  CA   . LEU A 1 15 ? 4.764   -4.370  -6.526  1.00 0.00 ? 436 LEU A CA   1  
ATOM   199   C  C    . LEU A 1 15 ? 3.956   -4.060  -7.783  1.00 0.00 ? 436 LEU A C    1  
ATOM   200   O  O    . LEU A 1 15 ? 3.999   -2.944  -8.302  1.00 0.00 ? 436 LEU A O    1  
ATOM   201   C  CB   . LEU A 1 15 ? 4.583   -3.248  -5.501  1.00 0.00 ? 436 LEU A CB   1  
ATOM   202   C  CG   . LEU A 1 15 ? 3.140   -2.852  -5.187  1.00 0.00 ? 436 LEU A CG   1  
ATOM   203   C  CD1  . LEU A 1 15 ? 2.465   -3.922  -4.343  1.00 0.00 ? 436 LEU A CD1  1  
ATOM   204   C  CD2  . LEU A 1 15 ? 3.099   -1.506  -4.478  1.00 0.00 ? 436 LEU A CD2  1  
ATOM   205   H  H    . LEU A 1 15 ? 6.808   -3.828  -6.610  1.00 0.00 ? 436 LEU A H    1  
ATOM   206   H  HA   . LEU A 1 15 ? 4.405   -5.296  -6.102  1.00 0.00 ? 436 LEU A HA   1  
ATOM   207   H  HB2  . LEU A 1 15 ? 5.047   -3.565  -4.580  1.00 0.00 ? 436 LEU A HB2  1  
ATOM   208   H  HB3  . LEU A 1 15 ? 5.094   -2.373  -5.877  1.00 0.00 ? 436 LEU A HB3  1  
ATOM   209   H  HG   . LEU A 1 15 ? 2.589   -2.761  -6.112  1.00 0.00 ? 436 LEU A HG   1  
ATOM   210   H  HD11 . LEU A 1 15 ? 3.209   -4.448  -3.764  1.00 0.00 ? 436 LEU A HD11 1  
ATOM   211   H  HD12 . LEU A 1 15 ? 1.953   -4.620  -4.989  1.00 0.00 ? 436 LEU A HD12 1  
ATOM   212   H  HD13 . LEU A 1 15 ? 1.752   -3.458  -3.677  1.00 0.00 ? 436 LEU A HD13 1  
ATOM   213   H  HD21 . LEU A 1 15 ? 3.954   -1.419  -3.823  1.00 0.00 ? 436 LEU A HD21 1  
ATOM   214   H  HD22 . LEU A 1 15 ? 2.192   -1.434  -3.896  1.00 0.00 ? 436 LEU A HD22 1  
ATOM   215   H  HD23 . LEU A 1 15 ? 3.123   -0.713  -5.210  1.00 0.00 ? 436 LEU A HD23 1  
ATOM   216   N  N    . CYS A 1 16 ? 3.219   -5.054  -8.266  1.00 0.00 ? 437 CYS A N    1  
ATOM   217   C  CA   . CYS A 1 16 ? 2.400   -4.889  -9.460  1.00 0.00 ? 437 CYS A CA   1  
ATOM   218   C  C    . CYS A 1 16 ? 1.676   -3.545  -9.442  1.00 0.00 ? 437 CYS A C    1  
ATOM   219   O  O    . CYS A 1 16 ? 1.118   -3.141  -8.422  1.00 0.00 ? 437 CYS A O    1  
ATOM   220   C  CB   . CYS A 1 16 ? 1.382   -6.027  -9.568  1.00 0.00 ? 437 CYS A CB   1  
ATOM   221   S  SG   . CYS A 1 16 ? 0.478   -6.068  -11.148 1.00 0.00 ? 437 CYS A SG   1  
ATOM   222   H  H    . CYS A 1 16 ? 3.226   -5.922  -7.807  1.00 0.00 ? 437 CYS A H    1  
ATOM   223   H  HA   . CYS A 1 16 ? 3.053   -4.920  -10.318 1.00 0.00 ? 437 CYS A HA   1  
ATOM   224   H  HB2  . CYS A 1 16 ? 1.896   -6.971  -9.459  1.00 0.00 ? 437 CYS A HB2  1  
ATOM   225   H  HB3  . CYS A 1 16 ? 0.656   -5.926  -8.775  1.00 0.00 ? 437 CYS A HB3  1  
ATOM   226   N  N    . LYS A 1 17 ? 1.691   -2.857  -10.579 1.00 0.00 ? 438 LYS A N    1  
ATOM   227   C  CA   . LYS A 1 17 ? 1.036   -1.560  -10.696 1.00 0.00 ? 438 LYS A CA   1  
ATOM   228   C  C    . LYS A 1 17 ? -0.482  -1.713  -10.683 1.00 0.00 ? 438 LYS A C    1  
ATOM   229   O  O    . LYS A 1 17 ? -1.216  -0.724  -10.667 1.00 0.00 ? 438 LYS A O    1  
ATOM   230   C  CB   . LYS A 1 17 ? 1.477   -0.857  -11.982 1.00 0.00 ? 438 LYS A CB   1  
ATOM   231   C  CG   . LYS A 1 17 ? 2.818   -0.155  -11.862 1.00 0.00 ? 438 LYS A CG   1  
ATOM   232   C  CD   . LYS A 1 17 ? 3.964   -1.072  -12.256 1.00 0.00 ? 438 LYS A CD   1  
ATOM   233   C  CE   . LYS A 1 17 ? 4.523   -1.815  -11.052 1.00 0.00 ? 438 LYS A CE   1  
ATOM   234   N  NZ   . LYS A 1 17 ? 5.635   -1.065  -10.405 1.00 0.00 ? 438 LYS A NZ   1  
ATOM   235   H  H    . LYS A 1 17 ? 2.152   -3.232  -11.358 1.00 0.00 ? 438 LYS A H    1  
ATOM   236   H  HA   . LYS A 1 17 ? 1.332   -0.960  -9.849  1.00 0.00 ? 438 LYS A HA   1  
ATOM   237   H  HB2  . LYS A 1 17 ? 1.547   -1.590  -12.772 1.00 0.00 ? 438 LYS A HB2  1  
ATOM   238   H  HB3  . LYS A 1 17 ? 0.732   -0.121  -12.250 1.00 0.00 ? 438 LYS A HB3  1  
ATOM   239   H  HG2  . LYS A 1 17 ? 2.822   0.708   -12.512 1.00 0.00 ? 438 LYS A HG2  1  
ATOM   240   H  HG3  . LYS A 1 17 ? 2.958   0.162   -10.838 1.00 0.00 ? 438 LYS A HG3  1  
ATOM   241   H  HD2  . LYS A 1 17 ? 3.607   -1.793  -12.975 1.00 0.00 ? 438 LYS A HD2  1  
ATOM   242   H  HD3  . LYS A 1 17 ? 4.752   -0.479  -12.699 1.00 0.00 ? 438 LYS A HD3  1  
ATOM   243   H  HE2  . LYS A 1 17 ? 3.730   -1.957  -10.334 1.00 0.00 ? 438 LYS A HE2  1  
ATOM   244   H  HE3  . LYS A 1 17 ? 4.890   -2.777  -11.378 1.00 0.00 ? 438 LYS A HE3  1  
ATOM   245   H  HZ1  . LYS A 1 17 ? 6.004   -0.342  -11.055 1.00 0.00 ? 438 LYS A HZ1  1  
ATOM   246   H  HZ2  . LYS A 1 17 ? 6.406   -1.716  -10.155 1.00 0.00 ? 438 LYS A HZ2  1  
ATOM   247   H  HZ3  . LYS A 1 17 ? 5.296   -0.598  -9.540  1.00 0.00 ? 438 LYS A HZ3  1  
ATOM   248   N  N    . PHE A 1 18 ? -0.946  -2.958  -10.688 1.00 0.00 ? 439 PHE A N    1  
ATOM   249   C  CA   . PHE A 1 18 ? -2.377  -3.240  -10.676 1.00 0.00 ? 439 PHE A CA   1  
ATOM   250   C  C    . PHE A 1 18 ? -2.823  -3.729  -9.301  1.00 0.00 ? 439 PHE A C    1  
ATOM   251   O  O    . PHE A 1 18 ? -3.801  -3.232  -8.741  1.00 0.00 ? 439 PHE A O    1  
ATOM   252   C  CB   . PHE A 1 18 ? -2.721  -4.287  -11.738 1.00 0.00 ? 439 PHE A CB   1  
ATOM   253   C  CG   . PHE A 1 18 ? -2.394  -3.850  -13.137 1.00 0.00 ? 439 PHE A CG   1  
ATOM   254   C  CD1  . PHE A 1 18 ? -3.094  -2.815  -13.735 1.00 0.00 ? 439 PHE A CD1  1  
ATOM   255   C  CD2  . PHE A 1 18 ? -1.388  -4.476  -13.855 1.00 0.00 ? 439 PHE A CD2  1  
ATOM   256   C  CE1  . PHE A 1 18 ? -2.796  -2.411  -15.023 1.00 0.00 ? 439 PHE A CE1  1  
ATOM   257   C  CE2  . PHE A 1 18 ? -1.085  -4.076  -15.143 1.00 0.00 ? 439 PHE A CE2  1  
ATOM   258   C  CZ   . PHE A 1 18 ? -1.790  -3.043  -15.728 1.00 0.00 ? 439 PHE A CZ   1  
ATOM   259   H  H    . PHE A 1 18 ? -0.311  -3.705  -10.701 1.00 0.00 ? 439 PHE A H    1  
ATOM   260   H  HA   . PHE A 1 18 ? -2.897  -2.323  -10.905 1.00 0.00 ? 439 PHE A HA   1  
ATOM   261   H  HB2  . PHE A 1 18 ? -2.166  -5.191  -11.535 1.00 0.00 ? 439 PHE A HB2  1  
ATOM   262   H  HB3  . PHE A 1 18 ? -3.778  -4.500  -11.693 1.00 0.00 ? 439 PHE A HB3  1  
ATOM   263   H  HD1  . PHE A 1 18 ? -3.881  -2.320  -13.184 1.00 0.00 ? 439 PHE A HD1  1  
ATOM   264   H  HD2  . PHE A 1 18 ? -0.836  -5.285  -13.400 1.00 0.00 ? 439 PHE A HD2  1  
ATOM   265   H  HE1  . PHE A 1 18 ? -3.350  -1.602  -15.477 1.00 0.00 ? 439 PHE A HE1  1  
ATOM   266   H  HE2  . PHE A 1 18 ? -0.298  -4.572  -15.692 1.00 0.00 ? 439 PHE A HE2  1  
ATOM   267   H  HZ   . PHE A 1 18 ? -1.555  -2.728  -16.734 1.00 0.00 ? 439 PHE A HZ   1  
ATOM   268   N  N    . TYR A 1 19 ? -2.100  -4.705  -8.763  1.00 0.00 ? 440 TYR A N    1  
ATOM   269   C  CA   . TYR A 1 19 ? -2.423  -5.263  -7.455  1.00 0.00 ? 440 TYR A CA   1  
ATOM   270   C  C    . TYR A 1 19 ? -2.770  -4.159  -6.462  1.00 0.00 ? 440 TYR A C    1  
ATOM   271   O  O    . TYR A 1 19 ? -3.633  -4.332  -5.601  1.00 0.00 ? 440 TYR A O    1  
ATOM   272   C  CB   . TYR A 1 19 ? -1.249  -6.089  -6.927  1.00 0.00 ? 440 TYR A CB   1  
ATOM   273   C  CG   . TYR A 1 19 ? -1.595  -6.928  -5.717  1.00 0.00 ? 440 TYR A CG   1  
ATOM   274   C  CD1  . TYR A 1 19 ? -2.483  -7.991  -5.815  1.00 0.00 ? 440 TYR A CD1  1  
ATOM   275   C  CD2  . TYR A 1 19 ? -1.034  -6.656  -4.475  1.00 0.00 ? 440 TYR A CD2  1  
ATOM   276   C  CE1  . TYR A 1 19 ? -2.803  -8.759  -4.712  1.00 0.00 ? 440 TYR A CE1  1  
ATOM   277   C  CE2  . TYR A 1 19 ? -1.346  -7.419  -3.368  1.00 0.00 ? 440 TYR A CE2  1  
ATOM   278   C  CZ   . TYR A 1 19 ? -2.231  -8.470  -3.491  1.00 0.00 ? 440 TYR A CZ   1  
ATOM   279   O  OH   . TYR A 1 19 ? -2.546  -9.232  -2.390  1.00 0.00 ? 440 TYR A OH   1  
ATOM   280   H  H    . TYR A 1 19 ? -1.332  -5.059  -9.258  1.00 0.00 ? 440 TYR A H    1  
ATOM   281   H  HA   . TYR A 1 19 ? -3.281  -5.909  -7.573  1.00 0.00 ? 440 TYR A HA   1  
ATOM   282   H  HB2  . TYR A 1 19 ? -0.907  -6.755  -7.704  1.00 0.00 ? 440 TYR A HB2  1  
ATOM   283   H  HB3  . TYR A 1 19 ? -0.444  -5.423  -6.651  1.00 0.00 ? 440 TYR A HB3  1  
ATOM   284   H  HD1  . TYR A 1 19 ? -2.929  -8.216  -6.773  1.00 0.00 ? 440 TYR A HD1  1  
ATOM   285   H  HD2  . TYR A 1 19 ? -0.341  -5.832  -4.382  1.00 0.00 ? 440 TYR A HD2  1  
ATOM   286   H  HE1  . TYR A 1 19 ? -3.496  -9.582  -4.809  1.00 0.00 ? 440 TYR A HE1  1  
ATOM   287   H  HE2  . TYR A 1 19 ? -0.899  -7.193  -2.411  1.00 0.00 ? 440 TYR A HE2  1  
ATOM   288   H  HH   . TYR A 1 19 ? -2.635  -8.663  -1.622  1.00 0.00 ? 440 TYR A HH   1  
ATOM   289   N  N    . ILE A 1 20 ? -2.092  -3.023  -6.589  1.00 0.00 ? 441 ILE A N    1  
ATOM   290   C  CA   . ILE A 1 20 ? -2.330  -1.889  -5.704  1.00 0.00 ? 441 ILE A CA   1  
ATOM   291   C  C    . ILE A 1 20 ? -3.822  -1.656  -5.498  1.00 0.00 ? 441 ILE A C    1  
ATOM   292   O  O    . ILE A 1 20 ? -4.265  -1.335  -4.395  1.00 0.00 ? 441 ILE A O    1  
ATOM   293   C  CB   . ILE A 1 20 ? -1.692  -0.601  -6.257  1.00 0.00 ? 441 ILE A CB   1  
ATOM   294   C  CG1  . ILE A 1 20 ? -0.184  -0.789  -6.438  1.00 0.00 ? 441 ILE A CG1  1  
ATOM   295   C  CG2  . ILE A 1 20 ? -1.978  0.571   -5.331  1.00 0.00 ? 441 ILE A CG2  1  
ATOM   296   C  CD1  . ILE A 1 20 ? 0.477   0.336   -7.203  1.00 0.00 ? 441 ILE A CD1  1  
ATOM   297   H  H    . ILE A 1 20 ? -1.417  -2.946  -7.295  1.00 0.00 ? 441 ILE A H    1  
ATOM   298   H  HA   . ILE A 1 20 ? -1.875  -2.111  -4.750  1.00 0.00 ? 441 ILE A HA   1  
ATOM   299   H  HB   . ILE A 1 20 ? -2.138  -0.388  -7.216  1.00 0.00 ? 441 ILE A HB   1  
ATOM   300   H  HG12 . ILE A 1 20 ? 0.283   -0.849  -5.468  1.00 0.00 ? 441 ILE A HG12 1  
ATOM   301   H  HG13 . ILE A 1 20 ? -0.006  -1.708  -6.976  1.00 0.00 ? 441 ILE A HG13 1  
ATOM   302   H  HG21 . ILE A 1 20 ? -2.860  0.359   -4.744  1.00 0.00 ? 441 ILE A HG21 1  
ATOM   303   H  HG22 . ILE A 1 20 ? -1.136  0.723   -4.672  1.00 0.00 ? 441 ILE A HG22 1  
ATOM   304   H  HG23 . ILE A 1 20 ? -2.142  1.463   -5.917  1.00 0.00 ? 441 ILE A HG23 1  
ATOM   305   H  HD11 . ILE A 1 20 ? 0.332   0.185   -8.263  1.00 0.00 ? 441 ILE A HD11 1  
ATOM   306   H  HD12 . ILE A 1 20 ? 0.041   1.278   -6.909  1.00 0.00 ? 441 ILE A HD12 1  
ATOM   307   H  HD13 . ILE A 1 20 ? 1.536   0.346   -6.984  1.00 0.00 ? 441 ILE A HD13 1  
ATOM   308   N  N    . THR A 1 21 ? -4.595  -1.822  -6.567  1.00 0.00 ? 442 THR A N    1  
ATOM   309   C  CA   . THR A 1 21 ? -6.039  -1.631  -6.503  1.00 0.00 ? 442 THR A CA   1  
ATOM   310   C  C    . THR A 1 21 ? -6.766  -2.966  -6.398  1.00 0.00 ? 442 THR A C    1  
ATOM   311   O  O    . THR A 1 21 ? -7.767  -3.086  -5.692  1.00 0.00 ? 442 THR A O    1  
ATOM   312   C  CB   . THR A 1 21 ? -6.560  -0.871  -7.737  1.00 0.00 ? 442 THR A CB   1  
ATOM   313   O  OG1  . THR A 1 21 ? -6.309  -1.632  -8.924  1.00 0.00 ? 442 THR A OG1  1  
ATOM   314   C  CG2  . THR A 1 21 ? -5.894  0.493   -7.854  1.00 0.00 ? 442 THR A CG2  1  
ATOM   315   H  H    . THR A 1 21 ? -4.183  -2.078  -7.418  1.00 0.00 ? 442 THR A H    1  
ATOM   316   H  HA   . THR A 1 21 ? -6.259  -1.042  -5.624  1.00 0.00 ? 442 THR A HA   1  
ATOM   317   H  HB   . THR A 1 21 ? -7.625  -0.727  -7.629  1.00 0.00 ? 442 THR A HB   1  
ATOM   318   H  HG1  . THR A 1 21 ? -6.213  -1.038  -9.672  1.00 0.00 ? 442 THR A HG1  1  
ATOM   319   H  HG21 . THR A 1 21 ? -4.827  0.384   -7.728  1.00 0.00 ? 442 THR A HG21 1  
ATOM   320   H  HG22 . THR A 1 21 ? -6.282  1.149   -7.089  1.00 0.00 ? 442 THR A HG22 1  
ATOM   321   H  HG23 . THR A 1 21 ? -6.101  0.911   -8.827  1.00 0.00 ? 442 THR A HG23 1  
ATOM   322   N  N    . GLY A 1 22 ? -6.256  -3.970  -7.106  1.00 0.00 ? 443 GLY A N    1  
ATOM   323   C  CA   . GLY A 1 22 ? -6.871  -5.284  -7.078  1.00 0.00 ? 443 GLY A CA   1  
ATOM   324   C  C    . GLY A 1 22 ? -7.393  -5.709  -8.436  1.00 0.00 ? 443 GLY A C    1  
ATOM   325   O  O    . GLY A 1 22 ? -7.871  -6.832  -8.602  1.00 0.00 ? 443 GLY A O    1  
ATOM   326   H  H    . GLY A 1 22 ? -5.457  -3.816  -7.651  1.00 0.00 ? 443 GLY A H    1  
ATOM   327   H  HA2  . GLY A 1 22 ? -6.139  -6.005  -6.744  1.00 0.00 ? 443 GLY A HA2  1  
ATOM   328   H  HA3  . GLY A 1 22 ? -7.693  -5.270  -6.378  1.00 0.00 ? 443 GLY A HA3  1  
ATOM   329   N  N    . PHE A 1 23 ? -7.304  -4.810  -9.410  1.00 0.00 ? 444 PHE A N    1  
ATOM   330   C  CA   . PHE A 1 23 ? -7.774  -5.096  -10.761 1.00 0.00 ? 444 PHE A CA   1  
ATOM   331   C  C    . PHE A 1 23 ? -6.611  -5.479  -11.672 1.00 0.00 ? 444 PHE A C    1  
ATOM   332   O  O    . PHE A 1 23 ? -6.146  -4.671  -12.476 1.00 0.00 ? 444 PHE A O    1  
ATOM   333   C  CB   . PHE A 1 23 ? -8.509  -3.884  -11.336 1.00 0.00 ? 444 PHE A CB   1  
ATOM   334   C  CG   . PHE A 1 23 ? -8.664  -3.929  -12.829 1.00 0.00 ? 444 PHE A CG   1  
ATOM   335   C  CD1  . PHE A 1 23 ? -9.259  -5.018  -13.445 1.00 0.00 ? 444 PHE A CD1  1  
ATOM   336   C  CD2  . PHE A 1 23 ? -8.213  -2.882  -13.617 1.00 0.00 ? 444 PHE A CD2  1  
ATOM   337   C  CE1  . PHE A 1 23 ? -9.403  -5.063  -14.819 1.00 0.00 ? 444 PHE A CE1  1  
ATOM   338   C  CE2  . PHE A 1 23 ? -8.354  -2.921  -14.991 1.00 0.00 ? 444 PHE A CE2  1  
ATOM   339   C  CZ   . PHE A 1 23 ? -8.949  -4.013  -15.593 1.00 0.00 ? 444 PHE A CZ   1  
ATOM   340   H  H    . PHE A 1 23 ? -6.913  -3.932  -9.216  1.00 0.00 ? 444 PHE A H    1  
ATOM   341   H  HA   . PHE A 1 23 ? -8.459  -5.928  -10.703 1.00 0.00 ? 444 PHE A HA   1  
ATOM   342   H  HB2  . PHE A 1 23 ? -9.497  -3.832  -10.902 1.00 0.00 ? 444 PHE A HB2  1  
ATOM   343   H  HB3  . PHE A 1 23 ? -7.963  -2.988  -11.084 1.00 0.00 ? 444 PHE A HB3  1  
ATOM   344   H  HD1  . PHE A 1 23 ? -9.615  -5.840  -12.839 1.00 0.00 ? 444 PHE A HD1  1  
ATOM   345   H  HD2  . PHE A 1 23 ? -7.746  -2.028  -13.148 1.00 0.00 ? 444 PHE A HD2  1  
ATOM   346   H  HE1  . PHE A 1 23 ? -9.868  -5.918  -15.286 1.00 0.00 ? 444 PHE A HE1  1  
ATOM   347   H  HE2  . PHE A 1 23 ? -7.998  -2.100  -15.595 1.00 0.00 ? 444 PHE A HE2  1  
ATOM   348   H  HZ   . PHE A 1 23 ? -9.061  -4.046  -16.666 1.00 0.00 ? 444 PHE A HZ   1  
ATOM   349   N  N    . CYS A 1 24 ? -6.147  -6.717  -11.539 1.00 0.00 ? 445 CYS A N    1  
ATOM   350   C  CA   . CYS A 1 24 ? -5.038  -7.209  -12.348 1.00 0.00 ? 445 CYS A CA   1  
ATOM   351   C  C    . CYS A 1 24 ? -5.499  -8.323  -13.283 1.00 0.00 ? 445 CYS A C    1  
ATOM   352   O  O    . CYS A 1 24 ? -5.768  -9.442  -12.846 1.00 0.00 ? 445 CYS A O    1  
ATOM   353   C  CB   . CYS A 1 24 ? -3.909  -7.716  -11.449 1.00 0.00 ? 445 CYS A CB   1  
ATOM   354   S  SG   . CYS A 1 24 ? -2.506  -8.444  -12.356 1.00 0.00 ? 445 CYS A SG   1  
ATOM   355   H  H    . CYS A 1 24 ? -6.559  -7.315  -10.880 1.00 0.00 ? 445 CYS A H    1  
ATOM   356   H  HA   . CYS A 1 24 ? -4.670  -6.386  -12.943 1.00 0.00 ? 445 CYS A HA   1  
ATOM   357   H  HB2  . CYS A 1 24 ? -3.528  -6.893  -10.862 1.00 0.00 ? 445 CYS A HB2  1  
ATOM   358   H  HB3  . CYS A 1 24 ? -4.300  -8.473  -10.786 1.00 0.00 ? 445 CYS A HB3  1  
ATOM   359   N  N    . ALA A 1 25 ? -5.587  -8.009  -14.571 1.00 0.00 ? 446 ALA A N    1  
ATOM   360   C  CA   . ALA A 1 25 ? -6.013  -8.984  -15.568 1.00 0.00 ? 446 ALA A CA   1  
ATOM   361   C  C    . ALA A 1 25 ? -5.407  -10.355 -15.289 1.00 0.00 ? 446 ALA A C    1  
ATOM   362   O  O    . ALA A 1 25 ? -6.127  -11.335 -15.098 1.00 0.00 ? 446 ALA A O    1  
ATOM   363   C  CB   . ALA A 1 25 ? -5.634  -8.511  -16.964 1.00 0.00 ? 446 ALA A CB   1  
ATOM   364   H  H    . ALA A 1 25 ? -5.358  -7.100  -14.858 1.00 0.00 ? 446 ALA A H    1  
ATOM   365   H  HA   . ALA A 1 25 ? -7.089  -9.061  -15.521 1.00 0.00 ? 446 ALA A HA   1  
ATOM   366   H  HB1  . ALA A 1 25 ? -4.563  -8.380  -17.020 1.00 0.00 ? 446 ALA A HB1  1  
ATOM   367   H  HB2  . ALA A 1 25 ? -5.945  -9.247  -17.689 1.00 0.00 ? 446 ALA A HB2  1  
ATOM   368   H  HB3  . ALA A 1 25 ? -6.123  -7.571  -17.171 1.00 0.00 ? 446 ALA A HB3  1  
ATOM   369   N  N    . ARG A 1 26 ? -4.079  -10.417 -15.267 1.00 0.00 ? 447 ARG A N    1  
ATOM   370   C  CA   . ARG A 1 26 ? -3.377  -11.669 -15.013 1.00 0.00 ? 447 ARG A CA   1  
ATOM   371   C  C    . ARG A 1 26 ? -3.239  -11.921 -13.515 1.00 0.00 ? 447 ARG A C    1  
ATOM   372   O  O    . ARG A 1 26 ? -2.506  -11.216 -12.822 1.00 0.00 ? 447 ARG A O    1  
ATOM   373   C  CB   . ARG A 1 26 ? -1.994  -11.644 -15.667 1.00 0.00 ? 447 ARG A CB   1  
ATOM   374   C  CG   . ARG A 1 26 ? -2.025  -11.888 -17.167 1.00 0.00 ? 447 ARG A CG   1  
ATOM   375   C  CD   . ARG A 1 26 ? -0.623  -11.921 -17.755 1.00 0.00 ? 447 ARG A CD   1  
ATOM   376   N  NE   . ARG A 1 26 ? -0.641  -12.105 -19.203 1.00 0.00 ? 447 ARG A NE   1  
ATOM   377   C  CZ   . ARG A 1 26 ? -0.746  -11.104 -20.070 1.00 0.00 ? 447 ARG A CZ   1  
ATOM   378   N  NH1  . ARG A 1 26 ? -0.841  -9.855  -19.636 1.00 0.00 ? 447 ARG A NH1  1  
ATOM   379   N  NH2  . ARG A 1 26 ? -0.755  -11.351 -21.374 1.00 0.00 ? 447 ARG A NH2  1  
ATOM   380   H  H    . ARG A 1 26 ? -3.560  -9.601  -15.427 1.00 0.00 ? 447 ARG A H    1  
ATOM   381   H  HA   . ARG A 1 26 ? -3.957  -12.469 -15.449 1.00 0.00 ? 447 ARG A HA   1  
ATOM   382   H  HB2  . ARG A 1 26 ? -1.542  -10.679 -15.491 1.00 0.00 ? 447 ARG A HB2  1  
ATOM   383   H  HB3  . ARG A 1 26 ? -1.381  -12.408 -15.213 1.00 0.00 ? 447 ARG A HB3  1  
ATOM   384   H  HG2  . ARG A 1 26 ? -2.506  -12.835 -17.359 1.00 0.00 ? 447 ARG A HG2  1  
ATOM   385   H  HG3  . ARG A 1 26 ? -2.585  -11.095 -17.639 1.00 0.00 ? 447 ARG A HG3  1  
ATOM   386   H  HD2  . ARG A 1 26 ? -0.128  -10.989 -17.526 1.00 0.00 ? 447 ARG A HD2  1  
ATOM   387   H  HD3  . ARG A 1 26 ? -0.078  -12.738 -17.304 1.00 0.00 ? 447 ARG A HD3  1  
ATOM   388   H  HE   . ARG A 1 26 ? -0.572  -13.020 -19.546 1.00 0.00 ? 447 ARG A HE   1  
ATOM   389   H  HH11 . ARG A 1 26 ? -0.833  -9.665  -18.654 1.00 0.00 ? 447 ARG A HH11 1  
ATOM   390   H  HH12 . ARG A 1 26 ? -0.918  -9.102  -20.291 1.00 0.00 ? 447 ARG A HH12 1  
ATOM   391   H  HH21 . ARG A 1 26 ? -0.683  -12.292 -21.704 1.00 0.00 ? 447 ARG A HH21 1  
ATOM   392   H  HH22 . ARG A 1 26 ? -0.834  -10.597 -22.025 1.00 0.00 ? 447 ARG A HH22 1  
ATOM   393   N  N    . ALA A 1 27 ? -3.949  -12.930 -13.021 1.00 0.00 ? 448 ALA A N    1  
ATOM   394   C  CA   . ALA A 1 27 ? -3.905  -13.275 -11.606 1.00 0.00 ? 448 ALA A CA   1  
ATOM   395   C  C    . ALA A 1 27 ? -2.674  -14.117 -11.285 1.00 0.00 ? 448 ALA A C    1  
ATOM   396   O  O    . ALA A 1 27 ? -1.698  -13.617 -10.729 1.00 0.00 ? 448 ALA A O    1  
ATOM   397   C  CB   . ALA A 1 27 ? -5.172  -14.014 -11.203 1.00 0.00 ? 448 ALA A CB   1  
ATOM   398   H  H    . ALA A 1 27 ? -4.516  -13.455 -13.624 1.00 0.00 ? 448 ALA A H    1  
ATOM   399   H  HA   . ALA A 1 27 ? -3.857  -12.356 -11.039 1.00 0.00 ? 448 ALA A HA   1  
ATOM   400   H  HB1  . ALA A 1 27 ? -5.218  -14.959 -11.725 1.00 0.00 ? 448 ALA A HB1  1  
ATOM   401   H  HB2  . ALA A 1 27 ? -5.162  -14.191 -10.138 1.00 0.00 ? 448 ALA A HB2  1  
ATOM   402   H  HB3  . ALA A 1 27 ? -6.034  -13.417 -11.462 1.00 0.00 ? 448 ALA A HB3  1  
ATOM   403   N  N    . GLU A 1 28 ? -2.730  -15.397 -11.639 1.00 0.00 ? 449 GLU A N    1  
ATOM   404   C  CA   . GLU A 1 28 ? -1.620  -16.308 -11.386 1.00 0.00 ? 449 GLU A CA   1  
ATOM   405   C  C    . GLU A 1 28 ? -0.546  -16.168 -12.461 1.00 0.00 ? 449 GLU A C    1  
ATOM   406   O  O    . GLU A 1 28 ? 0.516   -16.783 -12.375 1.00 0.00 ? 449 GLU A O    1  
ATOM   407   C  CB   . GLU A 1 28 ? -2.119  -17.754 -11.333 1.00 0.00 ? 449 GLU A CB   1  
ATOM   408   C  CG   . GLU A 1 28 ? -1.100  -18.729 -10.768 1.00 0.00 ? 449 GLU A CG   1  
ATOM   409   C  CD   . GLU A 1 28 ? -1.073  -18.732 -9.252  1.00 0.00 ? 449 GLU A CD   1  
ATOM   410   O  OE1  . GLU A 1 28 ? -1.004  -17.635 -8.659  1.00 0.00 ? 449 GLU A OE1  1  
ATOM   411   O  OE2  . GLU A 1 28 ? -1.121  -19.830 -8.659  1.00 0.00 ? 449 GLU A OE2  1  
ATOM   412   H  H    . GLU A 1 28 ? -3.537  -15.737 -12.079 1.00 0.00 ? 449 GLU A H    1  
ATOM   413   H  HA   . GLU A 1 28 ? -1.191  -16.050 -10.429 1.00 0.00 ? 449 GLU A HA   1  
ATOM   414   H  HB2  . GLU A 1 28 ? -3.006  -17.794 -10.717 1.00 0.00 ? 449 GLU A HB2  1  
ATOM   415   H  HB3  . GLU A 1 28 ? -2.373  -18.071 -12.334 1.00 0.00 ? 449 GLU A HB3  1  
ATOM   416   H  HG2  . GLU A 1 28 ? -1.345  -19.724 -11.110 1.00 0.00 ? 449 GLU A HG2  1  
ATOM   417   H  HG3  . GLU A 1 28 ? -0.120  -18.456 -11.131 1.00 0.00 ? 449 GLU A HG3  1  
ATOM   418   N  N    . ASN A 1 29 ? -0.832  -15.355 -13.472 1.00 0.00 ? 450 ASN A N    1  
ATOM   419   C  CA   . ASN A 1 29 ? 0.108   -15.135 -14.565 1.00 0.00 ? 450 ASN A CA   1  
ATOM   420   C  C    . ASN A 1 29 ? 0.875   -13.831 -14.368 1.00 0.00 ? 450 ASN A C    1  
ATOM   421   O  O    . ASN A 1 29 ? 1.627   -13.402 -15.244 1.00 0.00 ? 450 ASN A O    1  
ATOM   422   C  CB   . ASN A 1 29 ? -0.631  -15.107 -15.904 1.00 0.00 ? 450 ASN A CB   1  
ATOM   423   C  CG   . ASN A 1 29 ? -1.436  -16.370 -16.146 1.00 0.00 ? 450 ASN A CG   1  
ATOM   424   O  OD1  . ASN A 1 29 ? -1.152  -17.420 -15.572 1.00 0.00 ? 450 ASN A OD1  1  
ATOM   425   N  ND2  . ASN A 1 29 ? -2.448  -16.271 -17.001 1.00 0.00 ? 450 ASN A ND2  1  
ATOM   426   H  H    . ASN A 1 29 ? -1.696  -14.893 -13.485 1.00 0.00 ? 450 ASN A H    1  
ATOM   427   H  HA   . ASN A 1 29 ? 0.810   -15.955 -14.569 1.00 0.00 ? 450 ASN A HA   1  
ATOM   428   H  HB2  . ASN A 1 29 ? -1.307  -14.265 -15.918 1.00 0.00 ? 450 ASN A HB2  1  
ATOM   429   H  HB3  . ASN A 1 29 ? 0.087   -15.001 -16.704 1.00 0.00 ? 450 ASN A HB3  1  
ATOM   430   H  HD21 . ASN A 1 29 ? -2.616  -15.402 -17.422 1.00 0.00 ? 450 ASN A HD21 1  
ATOM   431   H  HD22 . ASN A 1 29 ? -2.985  -17.072 -17.176 1.00 0.00 ? 450 ASN A HD22 1  
ATOM   432   N  N    . CYS A 1 30 ? 0.680   -13.205 -13.212 1.00 0.00 ? 451 CYS A N    1  
ATOM   433   C  CA   . CYS A 1 30 ? 1.353   -11.950 -12.898 1.00 0.00 ? 451 CYS A CA   1  
ATOM   434   C  C    . CYS A 1 30 ? 2.784   -12.202 -12.432 1.00 0.00 ? 451 CYS A C    1  
ATOM   435   O  O    . CYS A 1 30 ? 3.026   -12.749 -11.356 1.00 0.00 ? 451 CYS A O    1  
ATOM   436   C  CB   . CYS A 1 30 ? 0.580   -11.189 -11.820 1.00 0.00 ? 451 CYS A CB   1  
ATOM   437   S  SG   . CYS A 1 30 ? 1.217   -9.515  -11.490 1.00 0.00 ? 451 CYS A SG   1  
ATOM   438   H  H    . CYS A 1 30 ? 0.069   -13.597 -12.553 1.00 0.00 ? 451 CYS A H    1  
ATOM   439   H  HA   . CYS A 1 30 ? 1.380   -11.354 -13.798 1.00 0.00 ? 451 CYS A HA   1  
ATOM   440   H  HB2  . CYS A 1 30 ? -0.451  -11.092 -12.127 1.00 0.00 ? 451 CYS A HB2  1  
ATOM   441   H  HB3  . CYS A 1 30 ? 0.623   -11.746 -10.896 1.00 0.00 ? 451 CYS A HB3  1  
ATOM   442   N  N    . PRO A 1 31 ? 3.757   -11.794 -13.261 1.00 0.00 ? 452 PRO A N    1  
ATOM   443   C  CA   . PRO A 1 31 ? 5.180   -11.963 -12.955 1.00 0.00 ? 452 PRO A CA   1  
ATOM   444   C  C    . PRO A 1 31 ? 5.639   -11.062 -11.814 1.00 0.00 ? 452 PRO A C    1  
ATOM   445   O  O    . PRO A 1 31 ? 6.814   -11.058 -11.447 1.00 0.00 ? 452 PRO A O    1  
ATOM   446   C  CB   . PRO A 1 31 ? 5.873   -11.567 -14.261 1.00 0.00 ? 452 PRO A CB   1  
ATOM   447   C  CG   . PRO A 1 31 ? 4.914   -10.649 -14.935 1.00 0.00 ? 452 PRO A CG   1  
ATOM   448   C  CD   . PRO A 1 31 ? 3.541   -11.134 -14.560 1.00 0.00 ? 452 PRO A CD   1  
ATOM   449   H  HA   . PRO A 1 31 ? 5.415   -12.990 -12.717 1.00 0.00 ? 452 PRO A HA   1  
ATOM   450   H  HB2  . PRO A 1 31 ? 6.808   -11.071 -14.039 1.00 0.00 ? 452 PRO A HB2  1  
ATOM   451   H  HB3  . PRO A 1 31 ? 6.060   -12.449 -14.855 1.00 0.00 ? 452 PRO A HB3  1  
ATOM   452   H  HG2  . PRO A 1 31 ? 5.063   -9.639  -14.584 1.00 0.00 ? 452 PRO A HG2  1  
ATOM   453   H  HG3  . PRO A 1 31 ? 5.049   -10.699 -16.006 1.00 0.00 ? 452 PRO A HG3  1  
ATOM   454   H  HD2  . PRO A 1 31 ? 2.860   -10.302 -14.462 1.00 0.00 ? 452 PRO A HD2  1  
ATOM   455   H  HD3  . PRO A 1 31 ? 3.177   -11.839 -15.293 1.00 0.00 ? 452 PRO A HD3  1  
ATOM   456   N  N    . TYR A 1 32 ? 4.705   -10.299 -11.256 1.00 0.00 ? 453 TYR A N    1  
ATOM   457   C  CA   . TYR A 1 32 ? 5.015   -9.391  -10.158 1.00 0.00 ? 453 TYR A CA   1  
ATOM   458   C  C    . TYR A 1 32 ? 4.566   -9.979  -8.823  1.00 0.00 ? 453 TYR A C    1  
ATOM   459   O  O    . TYR A 1 32 ? 4.015   -11.078 -8.770  1.00 0.00 ? 453 TYR A O    1  
ATOM   460   C  CB   . TYR A 1 32 ? 4.342   -8.036  -10.383 1.00 0.00 ? 453 TYR A CB   1  
ATOM   461   C  CG   . TYR A 1 32 ? 5.043   -7.175  -11.409 1.00 0.00 ? 453 TYR A CG   1  
ATOM   462   C  CD1  . TYR A 1 32 ? 4.801   -7.344  -12.767 1.00 0.00 ? 453 TYR A CD1  1  
ATOM   463   C  CD2  . TYR A 1 32 ? 5.948   -6.195  -11.022 1.00 0.00 ? 453 TYR A CD2  1  
ATOM   464   C  CE1  . TYR A 1 32 ? 5.440   -6.560  -13.709 1.00 0.00 ? 453 TYR A CE1  1  
ATOM   465   C  CE2  . TYR A 1 32 ? 6.590   -5.406  -11.956 1.00 0.00 ? 453 TYR A CE2  1  
ATOM   466   C  CZ   . TYR A 1 32 ? 6.333   -5.592  -13.299 1.00 0.00 ? 453 TYR A CZ   1  
ATOM   467   O  OH   . TYR A 1 32 ? 6.972   -4.809  -14.233 1.00 0.00 ? 453 TYR A OH   1  
ATOM   468   H  H    . TYR A 1 32 ? 3.786   -10.346 -11.592 1.00 0.00 ? 453 TYR A H    1  
ATOM   469   H  HA   . TYR A 1 32 ? 6.086   -9.251  -10.135 1.00 0.00 ? 453 TYR A HA   1  
ATOM   470   H  HB2  . TYR A 1 32 ? 3.330   -8.196  -10.721 1.00 0.00 ? 453 TYR A HB2  1  
ATOM   471   H  HB3  . TYR A 1 32 ? 4.323   -7.492  -9.450  1.00 0.00 ? 453 TYR A HB3  1  
ATOM   472   H  HD1  . TYR A 1 32 ? 4.102   -8.103  -13.086 1.00 0.00 ? 453 TYR A HD1  1  
ATOM   473   H  HD2  . TYR A 1 32 ? 6.147   -6.052  -9.970  1.00 0.00 ? 453 TYR A HD2  1  
ATOM   474   H  HE1  . TYR A 1 32 ? 5.239   -6.706  -14.760 1.00 0.00 ? 453 TYR A HE1  1  
ATOM   475   H  HE2  . TYR A 1 32 ? 7.289   -4.648  -11.635 1.00 0.00 ? 453 TYR A HE2  1  
ATOM   476   H  HH   . TYR A 1 32 ? 6.360   -4.151  -14.570 1.00 0.00 ? 453 TYR A HH   1  
ATOM   477   N  N    . MET A 1 33 ? 4.807   -9.237  -7.747  1.00 0.00 ? 454 MET A N    1  
ATOM   478   C  CA   . MET A 1 33 ? 4.426   -9.682  -6.412  1.00 0.00 ? 454 MET A CA   1  
ATOM   479   C  C    . MET A 1 33 ? 3.072   -9.105  -6.011  1.00 0.00 ? 454 MET A C    1  
ATOM   480   O  O    . MET A 1 33 ? 2.751   -7.963  -6.342  1.00 0.00 ? 454 MET A O    1  
ATOM   481   C  CB   . MET A 1 33 ? 5.490   -9.273  -5.392  1.00 0.00 ? 454 MET A CB   1  
ATOM   482   C  CG   . MET A 1 33 ? 6.806   -10.016 -5.555  1.00 0.00 ? 454 MET A CG   1  
ATOM   483   S  SD   . MET A 1 33 ? 6.774   -11.658 -4.811  1.00 0.00 ? 454 MET A SD   1  
ATOM   484   C  CE   . MET A 1 33 ? 7.769   -11.386 -3.346  1.00 0.00 ? 454 MET A CE   1  
ATOM   485   H  H    . MET A 1 33 ? 5.249   -8.369  -7.853  1.00 0.00 ? 454 MET A H    1  
ATOM   486   H  HA   . MET A 1 33 ? 4.354   -10.760 -6.430  1.00 0.00 ? 454 MET A HA   1  
ATOM   487   H  HB2  . MET A 1 33 ? 5.684   -8.216  -5.495  1.00 0.00 ? 454 MET A HB2  1  
ATOM   488   H  HB3  . MET A 1 33 ? 5.114   -9.467  -4.398  1.00 0.00 ? 454 MET A HB3  1  
ATOM   489   H  HG2  . MET A 1 33 ? 7.019   -10.119 -6.609  1.00 0.00 ? 454 MET A HG2  1  
ATOM   490   H  HG3  . MET A 1 33 ? 7.590   -9.439  -5.087  1.00 0.00 ? 454 MET A HG3  1  
ATOM   491   H  HE1  . MET A 1 33 ? 8.809   -11.314 -3.626  1.00 0.00 ? 454 MET A HE1  1  
ATOM   492   H  HE2  . MET A 1 33 ? 7.461   -10.468 -2.868  1.00 0.00 ? 454 MET A HE2  1  
ATOM   493   H  HE3  . MET A 1 33 ? 7.636   -12.212 -2.663  1.00 0.00 ? 454 MET A HE3  1  
ATOM   494   N  N    . HIS A 1 34 ? 2.282   -9.901  -5.297  1.00 0.00 ? 455 HIS A N    1  
ATOM   495   C  CA   . HIS A 1 34 ? 0.963   -9.467  -4.851  1.00 0.00 ? 455 HIS A CA   1  
ATOM   496   C  C    . HIS A 1 34 ? 0.863   -9.508  -3.329  1.00 0.00 ? 455 HIS A C    1  
ATOM   497   O  O    . HIS A 1 34 ? 0.949   -8.477  -2.664  1.00 0.00 ? 455 HIS A O    1  
ATOM   498   C  CB   . HIS A 1 34 ? -0.123  -10.350 -5.469  1.00 0.00 ? 455 HIS A CB   1  
ATOM   499   C  CG   . HIS A 1 34 ? -0.479  -9.966  -6.872  1.00 0.00 ? 455 HIS A CG   1  
ATOM   500   N  ND1  . HIS A 1 34 ? -1.581  -10.468 -7.532  1.00 0.00 ? 455 HIS A ND1  1  
ATOM   501   C  CD2  . HIS A 1 34 ? 0.126   -9.123  -7.741  1.00 0.00 ? 455 HIS A CD2  1  
ATOM   502   C  CE1  . HIS A 1 34 ? -1.636  -9.952  -8.747  1.00 0.00 ? 455 HIS A CE1  1  
ATOM   503   N  NE2  . HIS A 1 34 ? -0.612  -9.132  -8.898  1.00 0.00 ? 455 HIS A NE2  1  
ATOM   504   H  H    . HIS A 1 34 ? 2.594   -10.800 -5.064  1.00 0.00 ? 455 HIS A H    1  
ATOM   505   H  HA   . HIS A 1 34 ? 0.819   -8.450  -5.181  1.00 0.00 ? 455 HIS A HA   1  
ATOM   506   H  HB2  . HIS A 1 34 ? 0.220   -11.374 -5.482  1.00 0.00 ? 455 HIS A HB2  1  
ATOM   507   H  HB3  . HIS A 1 34 ? -1.018  -10.282 -4.868  1.00 0.00 ? 455 HIS A HB3  1  
ATOM   508   H  HD1  . HIS A 1 34 ? -2.225  -11.109 -7.166  1.00 0.00 ? 455 HIS A HD1  1  
ATOM   509   H  HD2  . HIS A 1 34 ? 1.024   -8.550  -7.558  1.00 0.00 ? 455 HIS A HD2  1  
ATOM   510   H  HE1  . HIS A 1 34 ? -2.391  -10.163 -9.490  1.00 0.00 ? 455 HIS A HE1  1  
ATOM   511   N  N    . GLY A 1 35 ? 0.680   -10.708 -2.785  1.00 0.00 ? 456 GLY A N    1  
ATOM   512   C  CA   . GLY A 1 35 ? 0.571   -10.860 -1.346  1.00 0.00 ? 456 GLY A CA   1  
ATOM   513   C  C    . GLY A 1 35 ? 1.923   -10.879 -0.660  1.00 0.00 ? 456 GLY A C    1  
ATOM   514   O  O    . GLY A 1 35 ? 2.231   -9.998  0.144   1.00 0.00 ? 456 GLY A O    1  
ATOM   515   H  H    . GLY A 1 35 ? 0.619   -11.495 -3.365  1.00 0.00 ? 456 GLY A H    1  
ATOM   516   H  HA2  . GLY A 1 35 ? -0.010  -10.040 -0.951  1.00 0.00 ? 456 GLY A HA2  1  
ATOM   517   H  HA3  . GLY A 1 35 ? 0.059   -11.787 -1.131  1.00 0.00 ? 456 GLY A HA3  1  
ATOM   518   N  N    . ASP A 1 36 ? 2.731   -11.884 -0.977  1.00 0.00 ? 457 ASP A N    1  
ATOM   519   C  CA   . ASP A 1 36 ? 4.057   -12.015 -0.385  1.00 0.00 ? 457 ASP A CA   1  
ATOM   520   C  C    . ASP A 1 36 ? 4.676   -10.643 -0.131  1.00 0.00 ? 457 ASP A C    1  
ATOM   521   O  O    . ASP A 1 36 ? 5.215   -10.384 0.946   1.00 0.00 ? 457 ASP A O    1  
ATOM   522   C  CB   . ASP A 1 36 ? 4.968   -12.837 -1.298  1.00 0.00 ? 457 ASP A CB   1  
ATOM   523   C  CG   . ASP A 1 36 ? 4.702   -14.326 -1.191  1.00 0.00 ? 457 ASP A CG   1  
ATOM   524   O  OD1  . ASP A 1 36 ? 3.567   -14.701 -0.830  1.00 0.00 ? 457 ASP A OD1  1  
ATOM   525   O  OD2  . ASP A 1 36 ? 5.629   -15.116 -1.468  1.00 0.00 ? 457 ASP A OD2  1  
ATOM   526   H  H    . ASP A 1 36 ? 2.428   -12.555 -1.624  1.00 0.00 ? 457 ASP A H    1  
ATOM   527   H  HA   . ASP A 1 36 ? 3.951   -12.528 0.559   1.00 0.00 ? 457 ASP A HA   1  
ATOM   528   H  HB2  . ASP A 1 36 ? 4.808   -12.535 -2.322  1.00 0.00 ? 457 ASP A HB2  1  
ATOM   529   H  HB3  . ASP A 1 36 ? 5.998   -12.653 -1.029  1.00 0.00 ? 457 ASP A HB3  1  
ATOM   530   N  N    . PHE A 1 37 ? 4.596   -9.770  -1.129  1.00 0.00 ? 458 PHE A N    1  
ATOM   531   C  CA   . PHE A 1 37 ? 5.149   -8.425  -1.014  1.00 0.00 ? 458 PHE A CA   1  
ATOM   532   C  C    . PHE A 1 37 ? 4.819   -7.815  0.345   1.00 0.00 ? 458 PHE A C    1  
ATOM   533   O  O    . PHE A 1 37 ? 3.669   -7.804  0.785   1.00 0.00 ? 458 PHE A O    1  
ATOM   534   C  CB   . PHE A 1 37 ? 4.610   -7.532  -2.133  1.00 0.00 ? 458 PHE A CB   1  
ATOM   535   C  CG   . PHE A 1 37 ? 5.402   -6.270  -2.327  1.00 0.00 ? 458 PHE A CG   1  
ATOM   536   C  CD1  . PHE A 1 37 ? 6.598   -6.289  -3.027  1.00 0.00 ? 458 PHE A CD1  1  
ATOM   537   C  CD2  . PHE A 1 37 ? 4.951   -5.067  -1.811  1.00 0.00 ? 458 PHE A CD2  1  
ATOM   538   C  CE1  . PHE A 1 37 ? 7.329   -5.130  -3.207  1.00 0.00 ? 458 PHE A CE1  1  
ATOM   539   C  CE2  . PHE A 1 37 ? 5.678   -3.904  -1.988  1.00 0.00 ? 458 PHE A CE2  1  
ATOM   540   C  CZ   . PHE A 1 37 ? 6.868   -3.936  -2.688  1.00 0.00 ? 458 PHE A CZ   1  
ATOM   541   H  H    . PHE A 1 37 ? 4.154   -10.036 -1.962  1.00 0.00 ? 458 PHE A H    1  
ATOM   542   H  HA   . PHE A 1 37 ? 6.222   -8.500  -1.111  1.00 0.00 ? 458 PHE A HA   1  
ATOM   543   H  HB2  . PHE A 1 37 ? 4.627   -8.080  -3.062  1.00 0.00 ? 458 PHE A HB2  1  
ATOM   544   H  HB3  . PHE A 1 37 ? 3.592   -7.254  -1.902  1.00 0.00 ? 458 PHE A HB3  1  
ATOM   545   H  HD1  . PHE A 1 37 ? 6.959   -7.222  -3.435  1.00 0.00 ? 458 PHE A HD1  1  
ATOM   546   H  HD2  . PHE A 1 37 ? 4.019   -5.041  -1.263  1.00 0.00 ? 458 PHE A HD2  1  
ATOM   547   H  HE1  . PHE A 1 37 ? 8.259   -5.157  -3.755  1.00 0.00 ? 458 PHE A HE1  1  
ATOM   548   H  HE2  . PHE A 1 37 ? 5.314   -2.973  -1.580  1.00 0.00 ? 458 PHE A HE2  1  
ATOM   549   H  HZ   . PHE A 1 37 ? 7.437   -3.029  -2.826  1.00 0.00 ? 458 PHE A HZ   1  
ATOM   550   N  N    . PRO A 1 38 ? 5.851   -7.295  1.026   1.00 0.00 ? 459 PRO A N    1  
ATOM   551   C  CA   . PRO A 1 38 ? 5.696   -6.673  2.344   1.00 0.00 ? 459 PRO A CA   1  
ATOM   552   C  C    . PRO A 1 38 ? 4.946   -5.347  2.275   1.00 0.00 ? 459 PRO A C    1  
ATOM   553   O  O    . PRO A 1 38 ? 5.071   -4.601  1.303   1.00 0.00 ? 459 PRO A O    1  
ATOM   554   C  CB   . PRO A 1 38 ? 7.139   -6.448  2.802   1.00 0.00 ? 459 PRO A CB   1  
ATOM   555   C  CG   . PRO A 1 38 ? 7.927   -6.356  1.541   1.00 0.00 ? 459 PRO A CG   1  
ATOM   556   C  CD   . PRO A 1 38 ? 7.248   -7.273  0.561   1.00 0.00 ? 459 PRO A CD   1  
ATOM   557   H  HA   . PRO A 1 38 ? 5.195   -7.332  3.038   1.00 0.00 ? 459 PRO A HA   1  
ATOM   558   H  HB2  . PRO A 1 38 ? 7.199   -5.532  3.374   1.00 0.00 ? 459 PRO A HB2  1  
ATOM   559   H  HB3  . PRO A 1 38 ? 7.462   -7.280  3.409   1.00 0.00 ? 459 PRO A HB3  1  
ATOM   560   H  HG2  . PRO A 1 38 ? 7.916   -5.341  1.174   1.00 0.00 ? 459 PRO A HG2  1  
ATOM   561   H  HG3  . PRO A 1 38 ? 8.941   -6.682  1.717   1.00 0.00 ? 459 PRO A HG3  1  
ATOM   562   H  HD2  . PRO A 1 38 ? 7.315   -6.873  -0.440  1.00 0.00 ? 459 PRO A HD2  1  
ATOM   563   H  HD3  . PRO A 1 38 ? 7.683   -8.261  0.605   1.00 0.00 ? 459 PRO A HD3  1  
ATOM   564   N  N    . CYS A 1 39 ? 4.167   -5.058  3.312   1.00 0.00 ? 460 CYS A N    1  
ATOM   565   C  CA   . CYS A 1 39 ? 3.397   -3.821  3.370   1.00 0.00 ? 460 CYS A CA   1  
ATOM   566   C  C    . CYS A 1 39 ? 4.317   -2.615  3.534   1.00 0.00 ? 460 CYS A C    1  
ATOM   567   O  O    . CYS A 1 39 ? 5.349   -2.693  4.200   1.00 0.00 ? 460 CYS A O    1  
ATOM   568   C  CB   . CYS A 1 39 ? 2.395   -3.874  4.525   1.00 0.00 ? 460 CYS A CB   1  
ATOM   569   S  SG   . CYS A 1 39 ? 1.124   -2.571  4.466   1.00 0.00 ? 460 CYS A SG   1  
ATOM   570   H  H    . CYS A 1 39 ? 4.109   -5.692  4.058   1.00 0.00 ? 460 CYS A H    1  
ATOM   571   H  HA   . CYS A 1 39 ? 2.857   -3.723  2.441   1.00 0.00 ? 460 CYS A HA   1  
ATOM   572   H  HB2  . CYS A 1 39 ? 1.888   -4.827  4.508   1.00 0.00 ? 460 CYS A HB2  1  
ATOM   573   H  HB3  . CYS A 1 39 ? 2.928   -3.772  5.459   1.00 0.00 ? 460 CYS A HB3  1  
ATOM   574   N  N    . LYS A 1 40 ? 3.934   -1.499  2.923   1.00 0.00 ? 461 LYS A N    1  
ATOM   575   C  CA   . LYS A 1 40 ? 4.722   -0.274  3.001   1.00 0.00 ? 461 LYS A CA   1  
ATOM   576   C  C    . LYS A 1 40 ? 4.469   0.452   4.319   1.00 0.00 ? 461 LYS A C    1  
ATOM   577   O  O    . LYS A 1 40 ? 5.366   0.575   5.154   1.00 0.00 ? 461 LYS A O    1  
ATOM   578   C  CB   . LYS A 1 40 ? 4.387   0.648   1.826   1.00 0.00 ? 461 LYS A CB   1  
ATOM   579   C  CG   . LYS A 1 40 ? 5.160   1.955   1.840   1.00 0.00 ? 461 LYS A CG   1  
ATOM   580   C  CD   . LYS A 1 40 ? 4.604   2.942   0.828   1.00 0.00 ? 461 LYS A CD   1  
ATOM   581   C  CE   . LYS A 1 40 ? 5.428   4.220   0.784   1.00 0.00 ? 461 LYS A CE   1  
ATOM   582   N  NZ   . LYS A 1 40 ? 6.529   4.136   -0.214  1.00 0.00 ? 461 LYS A NZ   1  
ATOM   583   H  H    . LYS A 1 40 ? 3.100   -1.499  2.406   1.00 0.00 ? 461 LYS A H    1  
ATOM   584   H  HA   . LYS A 1 40 ? 5.765   -0.547  2.949   1.00 0.00 ? 461 LYS A HA   1  
ATOM   585   H  HB2  . LYS A 1 40 ? 4.610   0.131   0.904   1.00 0.00 ? 461 LYS A HB2  1  
ATOM   586   H  HB3  . LYS A 1 40 ? 3.332   0.877   1.854   1.00 0.00 ? 461 LYS A HB3  1  
ATOM   587   H  HG2  . LYS A 1 40 ? 5.094   2.391   2.826   1.00 0.00 ? 461 LYS A HG2  1  
ATOM   588   H  HG3  . LYS A 1 40 ? 6.195   1.754   1.602   1.00 0.00 ? 461 LYS A HG3  1  
ATOM   589   H  HD2  . LYS A 1 40 ? 4.615   2.486   -0.151  1.00 0.00 ? 461 LYS A HD2  1  
ATOM   590   H  HD3  . LYS A 1 40 ? 3.587   3.189   1.100   1.00 0.00 ? 461 LYS A HD3  1  
ATOM   591   H  HE2  . LYS A 1 40 ? 4.779   5.042   0.524   1.00 0.00 ? 461 LYS A HE2  1  
ATOM   592   H  HE3  . LYS A 1 40 ? 5.852   4.392   1.762   1.00 0.00 ? 461 LYS A HE3  1  
ATOM   593   H  HZ1  . LYS A 1 40 ? 6.163   3.779   -1.120  1.00 0.00 ? 461 LYS A HZ1  1  
ATOM   594   H  HZ2  . LYS A 1 40 ? 7.271   3.491   0.125   1.00 0.00 ? 461 LYS A HZ2  1  
ATOM   595   H  HZ3  . LYS A 1 40 ? 6.946   5.076   -0.367  1.00 0.00 ? 461 LYS A HZ3  1  
ATOM   596   N  N    . LEU A 1 41 ? 3.243   0.930   4.499   1.00 0.00 ? 462 LEU A N    1  
ATOM   597   C  CA   . LEU A 1 41 ? 2.871   1.643   5.717   1.00 0.00 ? 462 LEU A CA   1  
ATOM   598   C  C    . LEU A 1 41 ? 3.395   0.919   6.953   1.00 0.00 ? 462 LEU A C    1  
ATOM   599   O  O    . LEU A 1 41 ? 4.155   1.483   7.740   1.00 0.00 ? 462 LEU A O    1  
ATOM   600   C  CB   . LEU A 1 41 ? 1.351   1.788   5.803   1.00 0.00 ? 462 LEU A CB   1  
ATOM   601   C  CG   . LEU A 1 41 ? 0.732   2.888   4.940   1.00 0.00 ? 462 LEU A CG   1  
ATOM   602   C  CD1  . LEU A 1 41 ? -0.781  2.900   5.093   1.00 0.00 ? 462 LEU A CD1  1  
ATOM   603   C  CD2  . LEU A 1 41 ? 1.318   4.245   5.304   1.00 0.00 ? 462 LEU A CD2  1  
ATOM   604   H  H    . LEU A 1 41 ? 2.571   0.801   3.799   1.00 0.00 ? 462 LEU A H    1  
ATOM   605   H  HA   . LEU A 1 41 ? 3.317   2.625   5.674   1.00 0.00 ? 462 LEU A HA   1  
ATOM   606   H  HB2  . LEU A 1 41 ? 0.912   0.848   5.505   1.00 0.00 ? 462 LEU A HB2  1  
ATOM   607   H  HB3  . LEU A 1 41 ? 1.097   1.992   6.833   1.00 0.00 ? 462 LEU A HB3  1  
ATOM   608   H  HG   . LEU A 1 41 ? 0.960   2.693   3.901   1.00 0.00 ? 462 LEU A HG   1  
ATOM   609   H  HD11 . LEU A 1 41 ? -1.210  3.585   4.378   1.00 0.00 ? 462 LEU A HD11 1  
ATOM   610   H  HD12 . LEU A 1 41 ? -1.038  3.215   6.094   1.00 0.00 ? 462 LEU A HD12 1  
ATOM   611   H  HD13 . LEU A 1 41 ? -1.168  1.907   4.919   1.00 0.00 ? 462 LEU A HD13 1  
ATOM   612   H  HD21 . LEU A 1 41 ? 0.666   5.026   4.942   1.00 0.00 ? 462 LEU A HD21 1  
ATOM   613   H  HD22 . LEU A 1 41 ? 2.293   4.350   4.850   1.00 0.00 ? 462 LEU A HD22 1  
ATOM   614   H  HD23 . LEU A 1 41 ? 1.410   4.321   6.377   1.00 0.00 ? 462 LEU A HD23 1  
ATOM   615   N  N    . TYR A 1 42 ? 2.984   -0.334  7.117   1.00 0.00 ? 463 TYR A N    1  
ATOM   616   C  CA   . TYR A 1 42 ? 3.412   -1.136  8.257   1.00 0.00 ? 463 TYR A CA   1  
ATOM   617   C  C    . TYR A 1 42 ? 4.883   -0.889  8.576   1.00 0.00 ? 463 TYR A C    1  
ATOM   618   O  O    . TYR A 1 42 ? 5.324   -1.076  9.710   1.00 0.00 ? 463 TYR A O    1  
ATOM   619   C  CB   . TYR A 1 42 ? 3.181   -2.622  7.977   1.00 0.00 ? 463 TYR A CB   1  
ATOM   620   C  CG   . TYR A 1 42 ? 3.677   -3.530  9.081   1.00 0.00 ? 463 TYR A CG   1  
ATOM   621   C  CD1  . TYR A 1 42 ? 2.934   -3.716  10.240  1.00 0.00 ? 463 TYR A CD1  1  
ATOM   622   C  CD2  . TYR A 1 42 ? 4.887   -4.201  8.963   1.00 0.00 ? 463 TYR A CD2  1  
ATOM   623   C  CE1  . TYR A 1 42 ? 3.383   -4.544  11.250  1.00 0.00 ? 463 TYR A CE1  1  
ATOM   624   C  CE2  . TYR A 1 42 ? 5.344   -5.032  9.968   1.00 0.00 ? 463 TYR A CE2  1  
ATOM   625   C  CZ   . TYR A 1 42 ? 4.588   -5.200  11.110  1.00 0.00 ? 463 TYR A CZ   1  
ATOM   626   O  OH   . TYR A 1 42 ? 5.038   -6.026  12.114  1.00 0.00 ? 463 TYR A OH   1  
ATOM   627   H  H    . TYR A 1 42 ? 2.378   -0.729  6.456   1.00 0.00 ? 463 TYR A H    1  
ATOM   628   H  HA   . TYR A 1 42 ? 2.816   -0.844  9.110   1.00 0.00 ? 463 TYR A HA   1  
ATOM   629   H  HB2  . TYR A 1 42 ? 2.124   -2.799  7.853   1.00 0.00 ? 463 TYR A HB2  1  
ATOM   630   H  HB3  . TYR A 1 42 ? 3.696   -2.894  7.067   1.00 0.00 ? 463 TYR A HB3  1  
ATOM   631   H  HD1  . TYR A 1 42 ? 1.990   -3.201  10.346  1.00 0.00 ? 463 TYR A HD1  1  
ATOM   632   H  HD2  . TYR A 1 42 ? 5.477   -4.068  8.067   1.00 0.00 ? 463 TYR A HD2  1  
ATOM   633   H  HE1  . TYR A 1 42 ? 2.791   -4.675  12.144  1.00 0.00 ? 463 TYR A HE1  1  
ATOM   634   H  HE2  . TYR A 1 42 ? 6.287   -5.546  9.859   1.00 0.00 ? 463 TYR A HE2  1  
ATOM   635   H  HH   . TYR A 1 42 ? 4.389   -6.055  12.820  1.00 0.00 ? 463 TYR A HH   1  
ATOM   636   N  N    . HIS A 1 43 ? 5.638   -0.466  7.567   1.00 0.00 ? 464 HIS A N    1  
ATOM   637   C  CA   . HIS A 1 43 ? 7.060   -0.191  7.738   1.00 0.00 ? 464 HIS A CA   1  
ATOM   638   C  C    . HIS A 1 43 ? 7.309   1.306   7.891   1.00 0.00 ? 464 HIS A C    1  
ATOM   639   O  O    . HIS A 1 43 ? 7.959   1.745   8.840   1.00 0.00 ? 464 HIS A O    1  
ATOM   640   C  CB   . HIS A 1 43 ? 7.853   -0.734  6.549   1.00 0.00 ? 464 HIS A CB   1  
ATOM   641   C  CG   . HIS A 1 43 ? 7.945   -2.228  6.522   1.00 0.00 ? 464 HIS A CG   1  
ATOM   642   N  ND1  . HIS A 1 43 ? 8.248   -2.983  7.636   1.00 0.00 ? 464 HIS A ND1  1  
ATOM   643   C  CD2  . HIS A 1 43 ? 7.771   -3.109  5.509   1.00 0.00 ? 464 HIS A CD2  1  
ATOM   644   C  CE1  . HIS A 1 43 ? 8.258   -4.263  7.308   1.00 0.00 ? 464 HIS A CE1  1  
ATOM   645   N  NE2  . HIS A 1 43 ? 7.972   -4.366  6.023   1.00 0.00 ? 464 HIS A NE2  1  
ATOM   646   H  H    . HIS A 1 43 ? 5.228   -0.336  6.686   1.00 0.00 ? 464 HIS A H    1  
ATOM   647   H  HA   . HIS A 1 43 ? 7.388   -0.691  8.637   1.00 0.00 ? 464 HIS A HA   1  
ATOM   648   H  HB2  . HIS A 1 43 ? 7.378   -0.415  5.633   1.00 0.00 ? 464 HIS A HB2  1  
ATOM   649   H  HB3  . HIS A 1 43 ? 8.858   -0.339  6.584   1.00 0.00 ? 464 HIS A HB3  1  
ATOM   650   H  HD2  . HIS A 1 43 ? 7.522   -2.867  4.485   1.00 0.00 ? 464 HIS A HD2  1  
ATOM   651   H  HE1  . HIS A 1 43 ? 8.465   -5.086  7.976   1.00 0.00 ? 464 HIS A HE1  1  
ATOM   652   H  HE2  . HIS A 1 43 ? 7.997   -5.197  5.504   1.00 0.00 ? 464 HIS A HE2  1  
ATOM   653   N  N    . THR A 1 44 ? 6.789   2.087   6.949   1.00 0.00 ? 465 THR A N    1  
ATOM   654   C  CA   . THR A 1 44 ? 6.956   3.534   6.977   1.00 0.00 ? 465 THR A CA   1  
ATOM   655   C  C    . THR A 1 44 ? 7.035   4.051   8.409   1.00 0.00 ? 465 THR A C    1  
ATOM   656   O  O    . THR A 1 44 ? 7.892   4.872   8.738   1.00 0.00 ? 465 THR A O    1  
ATOM   657   C  CB   . THR A 1 44 ? 5.802   4.248   6.249   1.00 0.00 ? 465 THR A CB   1  
ATOM   658   O  OG1  . THR A 1 44 ? 4.567   4.005   6.932   1.00 0.00 ? 465 THR A OG1  1  
ATOM   659   C  CG2  . THR A 1 44 ? 5.693   3.771   4.809   1.00 0.00 ? 465 THR A CG2  1  
ATOM   660   H  H    . THR A 1 44 ? 6.281   1.678   6.218   1.00 0.00 ? 465 THR A H    1  
ATOM   661   H  HA   . THR A 1 44 ? 7.878   3.773   6.467   1.00 0.00 ? 465 THR A HA   1  
ATOM   662   H  HB   . THR A 1 44 ? 6.000   5.310   6.247   1.00 0.00 ? 465 THR A HB   1  
ATOM   663   H  HG1  . THR A 1 44 ? 4.648   4.282   7.848   1.00 0.00 ? 465 THR A HG1  1  
ATOM   664   H  HG21 . THR A 1 44 ? 4.655   3.601   4.563   1.00 0.00 ? 465 THR A HG21 1  
ATOM   665   H  HG22 . THR A 1 44 ? 6.246   2.851   4.692   1.00 0.00 ? 465 THR A HG22 1  
ATOM   666   H  HG23 . THR A 1 44 ? 6.100   4.522   4.149   1.00 0.00 ? 465 THR A HG23 1  
ATOM   667   N  N    . THR A 1 45 ? 6.137   3.564   9.260   1.00 0.00 ? 466 THR A N    1  
ATOM   668   C  CA   . THR A 1 45 ? 6.105   3.976   10.657  1.00 0.00 ? 466 THR A CA   1  
ATOM   669   C  C    . THR A 1 45 ? 6.160   2.771   11.588  1.00 0.00 ? 466 THR A C    1  
ATOM   670   O  O    . THR A 1 45 ? 6.750   2.832   12.666  1.00 0.00 ? 466 THR A O    1  
ATOM   671   C  CB   . THR A 1 45 ? 4.839   4.796   10.971  1.00 0.00 ? 466 THR A CB   1  
ATOM   672   O  OG1  . THR A 1 45 ? 3.670   4.012   10.711  1.00 0.00 ? 466 THR A OG1  1  
ATOM   673   C  CG2  . THR A 1 45 ? 4.798   6.069   10.139  1.00 0.00 ? 466 THR A CG2  1  
ATOM   674   H  H    . THR A 1 45 ? 5.480   2.912   8.938   1.00 0.00 ? 466 THR A H    1  
ATOM   675   H  HA   . THR A 1 45 ? 6.968   4.600   10.840  1.00 0.00 ? 466 THR A HA   1  
ATOM   676   H  HB   . THR A 1 45 ? 4.856   5.068   12.017  1.00 0.00 ? 466 THR A HB   1  
ATOM   677   H  HG1  . THR A 1 45 ? 3.425   3.530   11.505  1.00 0.00 ? 466 THR A HG1  1  
ATOM   678   H  HG21 . THR A 1 45 ? 5.363   6.843   10.637  1.00 0.00 ? 466 THR A HG21 1  
ATOM   679   H  HG22 . THR A 1 45 ? 3.774   6.389   10.021  1.00 0.00 ? 466 THR A HG22 1  
ATOM   680   H  HG23 . THR A 1 45 ? 5.230   5.877   9.168   1.00 0.00 ? 466 THR A HG23 1  
ATOM   681   N  N    . GLY A 1 46 ? 5.540   1.673   11.164  1.00 0.00 ? 467 GLY A N    1  
ATOM   682   C  CA   . GLY A 1 46 ? 5.531   0.467   11.972  1.00 0.00 ? 467 GLY A CA   1  
ATOM   683   C  C    . GLY A 1 46 ? 4.150   -0.147  12.082  1.00 0.00 ? 467 GLY A C    1  
ATOM   684   O  O    . GLY A 1 46 ? 4.004   -1.368  12.080  1.00 0.00 ? 467 GLY A O    1  
ATOM   685   H  H    . GLY A 1 46 ? 5.086   1.682   10.296  1.00 0.00 ? 467 GLY A H    1  
ATOM   686   H  HA2  . GLY A 1 46 ? 6.201   -0.255  11.529  1.00 0.00 ? 467 GLY A HA2  1  
ATOM   687   H  HA3  . GLY A 1 46 ? 5.885   0.710   12.964  1.00 0.00 ? 467 GLY A HA3  1  
ATOM   688   N  N    . ASN A 1 47 ? 3.133   0.703   12.180  1.00 0.00 ? 468 ASN A N    1  
ATOM   689   C  CA   . ASN A 1 47 ? 1.755   0.236   12.294  1.00 0.00 ? 468 ASN A CA   1  
ATOM   690   C  C    . ASN A 1 47 ? 0.981   0.508   11.008  1.00 0.00 ? 468 ASN A C    1  
ATOM   691   O  O    . ASN A 1 47 ? 1.144   1.555   10.381  1.00 0.00 ? 468 ASN A O    1  
ATOM   692   C  CB   . ASN A 1 47 ? 1.060   0.917   13.475  1.00 0.00 ? 468 ASN A CB   1  
ATOM   693   C  CG   . ASN A 1 47 ? 1.970   1.054   14.681  1.00 0.00 ? 468 ASN A CG   1  
ATOM   694   O  OD1  . ASN A 1 47 ? 2.842   1.922   14.720  1.00 0.00 ? 468 ASN A OD1  1  
ATOM   695   N  ND2  . ASN A 1 47 ? 1.770   0.194   15.673  1.00 0.00 ? 468 ASN A ND2  1  
ATOM   696   H  H    . ASN A 1 47 ? 3.312   1.666   12.177  1.00 0.00 ? 468 ASN A H    1  
ATOM   697   H  HA   . ASN A 1 47 ? 1.780   -0.829  12.468  1.00 0.00 ? 468 ASN A HA   1  
ATOM   698   H  HB2  . ASN A 1 47 ? 0.741   1.905   13.176  1.00 0.00 ? 468 ASN A HB2  1  
ATOM   699   H  HB3  . ASN A 1 47 ? 0.197   0.336   13.761  1.00 0.00 ? 468 ASN A HB3  1  
ATOM   700   H  HD21 . ASN A 1 47 ? 1.057   -0.471  15.573  1.00 0.00 ? 468 ASN A HD21 1  
ATOM   701   H  HD22 . ASN A 1 47 ? 2.343   0.260   16.465  1.00 0.00 ? 468 ASN A HD22 1  
ATOM   702   N  N    . CYS A 1 48 ? 0.136   -0.442  10.621  1.00 0.00 ? 469 CYS A N    1  
ATOM   703   C  CA   . CYS A 1 48 ? -0.664  -0.306  9.410   1.00 0.00 ? 469 CYS A CA   1  
ATOM   704   C  C    . CYS A 1 48 ? -2.091  0.117   9.746   1.00 0.00 ? 469 CYS A C    1  
ATOM   705   O  O    . CYS A 1 48 ? -2.708  -0.420  10.667  1.00 0.00 ? 469 CYS A O    1  
ATOM   706   C  CB   . CYS A 1 48 ? -0.681  -1.625  8.634   1.00 0.00 ? 469 CYS A CB   1  
ATOM   707   S  SG   . CYS A 1 48 ? -1.506  -1.524  7.013   1.00 0.00 ? 469 CYS A SG   1  
ATOM   708   H  H    . CYS A 1 48 ? 0.050   -1.255  11.162  1.00 0.00 ? 469 CYS A H    1  
ATOM   709   H  HA   . CYS A 1 48 ? -0.211  0.457   8.796   1.00 0.00 ? 469 CYS A HA   1  
ATOM   710   H  HB2  . CYS A 1 48 ? 0.336   -1.947  8.465   1.00 0.00 ? 469 CYS A HB2  1  
ATOM   711   H  HB3  . CYS A 1 48 ? -1.196  -2.372  9.220   1.00 0.00 ? 469 CYS A HB3  1  
ATOM   712   N  N    . ILE A 1 49 ? -2.609  1.082   8.994   1.00 0.00 ? 470 ILE A N    1  
ATOM   713   C  CA   . ILE A 1 49 ? -3.963  1.576   9.211   1.00 0.00 ? 470 ILE A CA   1  
ATOM   714   C  C    . ILE A 1 49 ? -4.991  0.467   9.017   1.00 0.00 ? 470 ILE A C    1  
ATOM   715   O  O    . ILE A 1 49 ? -5.942  0.346   9.788   1.00 0.00 ? 470 ILE A O    1  
ATOM   716   C  CB   . ILE A 1 49 ? -4.296  2.741   8.260   1.00 0.00 ? 470 ILE A CB   1  
ATOM   717   C  CG1  . ILE A 1 49 ? -5.707  3.265   8.536   1.00 0.00 ? 470 ILE A CG1  1  
ATOM   718   C  CG2  . ILE A 1 49 ? -4.164  2.296   6.811   1.00 0.00 ? 470 ILE A CG2  1  
ATOM   719   C  CD1  . ILE A 1 49 ? -5.804  4.110   9.787   1.00 0.00 ? 470 ILE A CD1  1  
ATOM   720   H  H    . ILE A 1 49 ? -2.068  1.471   8.276   1.00 0.00 ? 470 ILE A H    1  
ATOM   721   H  HA   . ILE A 1 49 ? -4.026  1.938   10.227  1.00 0.00 ? 470 ILE A HA   1  
ATOM   722   H  HB   . ILE A 1 49 ? -3.585  3.534   8.435   1.00 0.00 ? 470 ILE A HB   1  
ATOM   723   H  HG12 . ILE A 1 49 ? -6.029  3.869   7.702   1.00 0.00 ? 470 ILE A HG12 1  
ATOM   724   H  HG13 . ILE A 1 49 ? -6.379  2.426   8.648   1.00 0.00 ? 470 ILE A HG13 1  
ATOM   725   H  HG21 . ILE A 1 49 ? -3.256  1.724   6.692   1.00 0.00 ? 470 ILE A HG21 1  
ATOM   726   H  HG22 . ILE A 1 49 ? -5.012  1.684   6.545   1.00 0.00 ? 470 ILE A HG22 1  
ATOM   727   H  HG23 . ILE A 1 49 ? -4.130  3.164   6.170   1.00 0.00 ? 470 ILE A HG23 1  
ATOM   728   H  HD11 . ILE A 1 49 ? -5.231  3.650   10.578  1.00 0.00 ? 470 ILE A HD11 1  
ATOM   729   H  HD12 . ILE A 1 49 ? -5.416  5.097   9.586   1.00 0.00 ? 470 ILE A HD12 1  
ATOM   730   H  HD13 . ILE A 1 49 ? -6.839  4.186   10.090  1.00 0.00 ? 470 ILE A HD13 1  
ATOM   731   N  N    . ASN A 1 50 ? -4.791  -0.344  7.983   1.00 0.00 ? 471 ASN A N    1  
ATOM   732   C  CA   . ASN A 1 50 ? -5.700  -1.445  7.688   1.00 0.00 ? 471 ASN A CA   1  
ATOM   733   C  C    . ASN A 1 50 ? -5.922  -2.313  8.924   1.00 0.00 ? 471 ASN A C    1  
ATOM   734   O  O    . ASN A 1 50 ? -7.054  -2.497  9.370   1.00 0.00 ? 471 ASN A O    1  
ATOM   735   C  CB   . ASN A 1 50 ? -5.146  -2.299  6.545   1.00 0.00 ? 471 ASN A CB   1  
ATOM   736   C  CG   . ASN A 1 50 ? -5.546  -1.769  5.182   1.00 0.00 ? 471 ASN A CG   1  
ATOM   737   O  OD1  . ASN A 1 50 ? -6.720  -1.497  4.929   1.00 0.00 ? 471 ASN A OD1  1  
ATOM   738   N  ND2  . ASN A 1 50 ? -4.568  -1.619  4.296   1.00 0.00 ? 471 ASN A ND2  1  
ATOM   739   H  H    . ASN A 1 50 ? -4.014  -0.197  7.404   1.00 0.00 ? 471 ASN A H    1  
ATOM   740   H  HA   . ASN A 1 50 ? -6.645  -1.023  7.385   1.00 0.00 ? 471 ASN A HA   1  
ATOM   741   H  HB2  . ASN A 1 50 ? -4.068  -2.311  6.603   1.00 0.00 ? 471 ASN A HB2  1  
ATOM   742   H  HB3  . ASN A 1 50 ? -5.520  -3.307  6.643   1.00 0.00 ? 471 ASN A HB3  1  
ATOM   743   H  HD21 . ASN A 1 50 ? -3.656  -1.855  4.568   1.00 0.00 ? 471 ASN A HD21 1  
ATOM   744   H  HD22 . ASN A 1 50 ? -4.798  -1.277  3.407   1.00 0.00 ? 471 ASN A HD22 1  
ATOM   745   N  N    . GLY A 1 51 ? -4.833  -2.842  9.472   1.00 0.00 ? 472 GLY A N    1  
ATOM   746   C  CA   . GLY A 1 51 ? -4.930  -3.683  10.651  1.00 0.00 ? 472 GLY A CA   1  
ATOM   747   C  C    . GLY A 1 51 ? -4.480  -5.106  10.387  1.00 0.00 ? 472 GLY A C    1  
ATOM   748   O  O    . GLY A 1 51 ? -3.605  -5.343  9.554   1.00 0.00 ? 472 GLY A O    1  
ATOM   749   H  H    . GLY A 1 51 ? -3.956  -2.661  9.073   1.00 0.00 ? 472 GLY A H    1  
ATOM   750   H  HA2  . GLY A 1 51 ? -4.315  -3.261  11.432  1.00 0.00 ? 472 GLY A HA2  1  
ATOM   751   H  HA3  . GLY A 1 51 ? -5.957  -3.699  10.984  1.00 0.00 ? 472 GLY A HA3  1  
ATOM   752   N  N    . ASP A 1 52 ? -5.077  -6.055  11.099  1.00 0.00 ? 473 ASP A N    1  
ATOM   753   C  CA   . ASP A 1 52 ? -4.732  -7.463  10.938  1.00 0.00 ? 473 ASP A CA   1  
ATOM   754   C  C    . ASP A 1 52 ? -5.335  -8.027  9.655   1.00 0.00 ? 473 ASP A C    1  
ATOM   755   O  O    . ASP A 1 52 ? -4.933  -9.091  9.184   1.00 0.00 ? 473 ASP A O    1  
ATOM   756   C  CB   . ASP A 1 52 ? -5.218  -8.271  12.142  1.00 0.00 ? 473 ASP A CB   1  
ATOM   757   C  CG   . ASP A 1 52 ? -4.687  -7.729  13.455  1.00 0.00 ? 473 ASP A CG   1  
ATOM   758   O  OD1  . ASP A 1 52 ? -3.497  -7.353  13.504  1.00 0.00 ? 473 ASP A OD1  1  
ATOM   759   O  OD2  . ASP A 1 52 ? -5.462  -7.680  14.433  1.00 0.00 ? 473 ASP A OD2  1  
ATOM   760   H  H    . ASP A 1 52 ? -5.767  -5.804  11.748  1.00 0.00 ? 473 ASP A H    1  
ATOM   761   H  HA   . ASP A 1 52 ? -3.656  -7.536  10.878  1.00 0.00 ? 473 ASP A HA   1  
ATOM   762   H  HB2  . ASP A 1 52 ? -6.297  -8.244  12.174  1.00 0.00 ? 473 ASP A HB2  1  
ATOM   763   H  HB3  . ASP A 1 52 ? -4.890  -9.294  12.037  1.00 0.00 ? 473 ASP A HB3  1  
ATOM   764   N  N    . ASP A 1 53 ? -6.301  -7.307  9.095   1.00 0.00 ? 474 ASP A N    1  
ATOM   765   C  CA   . ASP A 1 53 ? -6.960  -7.736  7.867   1.00 0.00 ? 474 ASP A CA   1  
ATOM   766   C  C    . ASP A 1 53 ? -6.464  -6.925  6.673   1.00 0.00 ? 474 ASP A C    1  
ATOM   767   O  O    . ASP A 1 53 ? -7.254  -6.482  5.839   1.00 0.00 ? 474 ASP A O    1  
ATOM   768   C  CB   . ASP A 1 53 ? -8.477  -7.594  8.001   1.00 0.00 ? 474 ASP A CB   1  
ATOM   769   C  CG   . ASP A 1 53 ? -8.890  -6.212  8.467   1.00 0.00 ? 474 ASP A CG   1  
ATOM   770   O  OD1  . ASP A 1 53 ? -9.052  -5.320  7.608   1.00 0.00 ? 474 ASP A OD1  1  
ATOM   771   O  OD2  . ASP A 1 53 ? -9.052  -6.022  9.691   1.00 0.00 ? 474 ASP A OD2  1  
ATOM   772   H  H    . ASP A 1 53 ? -6.577  -6.467  9.518   1.00 0.00 ? 474 ASP A H    1  
ATOM   773   H  HA   . ASP A 1 53 ? -6.717  -8.775  7.706   1.00 0.00 ? 474 ASP A HA   1  
ATOM   774   H  HB2  . ASP A 1 53 ? -8.935  -7.782  7.040   1.00 0.00 ? 474 ASP A HB2  1  
ATOM   775   H  HB3  . ASP A 1 53 ? -8.838  -8.319  8.715   1.00 0.00 ? 474 ASP A HB3  1  
ATOM   776   N  N    . CYS A 1 54 ? -5.151  -6.733  6.599   1.00 0.00 ? 475 CYS A N    1  
ATOM   777   C  CA   . CYS A 1 54 ? -4.549  -5.975  5.509   1.00 0.00 ? 475 CYS A CA   1  
ATOM   778   C  C    . CYS A 1 54 ? -4.430  -6.831  4.252   1.00 0.00 ? 475 CYS A C    1  
ATOM   779   O  O    . CYS A 1 54 ? -4.242  -8.044  4.330   1.00 0.00 ? 475 CYS A O    1  
ATOM   780   C  CB   . CYS A 1 54 ? -3.168  -5.460  5.921   1.00 0.00 ? 475 CYS A CB   1  
ATOM   781   S  SG   . CYS A 1 54 ? -2.560  -4.073  4.908   1.00 0.00 ? 475 CYS A SG   1  
ATOM   782   H  H    . CYS A 1 54 ? -4.572  -7.111  7.295   1.00 0.00 ? 475 CYS A H    1  
ATOM   783   H  HA   . CYS A 1 54 ? -5.190  -5.133  5.298   1.00 0.00 ? 475 CYS A HA   1  
ATOM   784   H  HB2  . CYS A 1 54 ? -3.209  -5.123  6.947   1.00 0.00 ? 475 CYS A HB2  1  
ATOM   785   H  HB3  . CYS A 1 54 ? -2.453  -6.265  5.840   1.00 0.00 ? 475 CYS A HB3  1  
ATOM   786   N  N    . MET A 1 55 ? -4.542  -6.189  3.093   1.00 0.00 ? 476 MET A N    1  
ATOM   787   C  CA   . MET A 1 55 ? -4.446  -6.891  1.819   1.00 0.00 ? 476 MET A CA   1  
ATOM   788   C  C    . MET A 1 55 ? -2.995  -7.235  1.495   1.00 0.00 ? 476 MET A C    1  
ATOM   789   O  O    . MET A 1 55 ? -2.720  -8.001  0.572   1.00 0.00 ? 476 MET A O    1  
ATOM   790   C  CB   . MET A 1 55 ? -5.043  -6.040  0.697   1.00 0.00 ? 476 MET A CB   1  
ATOM   791   C  CG   . MET A 1 55 ? -4.231  -4.794  0.382   1.00 0.00 ? 476 MET A CG   1  
ATOM   792   S  SD   . MET A 1 55 ? -2.769  -5.150  -0.612  1.00 0.00 ? 476 MET A SD   1  
ATOM   793   C  CE   . MET A 1 55 ? -3.482  -5.209  -2.254  1.00 0.00 ? 476 MET A CE   1  
ATOM   794   H  H    . MET A 1 55 ? -4.692  -5.220  3.095   1.00 0.00 ? 476 MET A H    1  
ATOM   795   H  HA   . MET A 1 55 ? -5.011  -7.808  1.902   1.00 0.00 ? 476 MET A HA   1  
ATOM   796   H  HB2  . MET A 1 55 ? -5.105  -6.638  -0.200  1.00 0.00 ? 476 MET A HB2  1  
ATOM   797   H  HB3  . MET A 1 55 ? -6.037  -5.731  0.984   1.00 0.00 ? 476 MET A HB3  1  
ATOM   798   H  HG2  . MET A 1 55 ? -4.856  -4.100  -0.160  1.00 0.00 ? 476 MET A HG2  1  
ATOM   799   H  HG3  . MET A 1 55 ? -3.917  -4.342  1.311   1.00 0.00 ? 476 MET A HG3  1  
ATOM   800   H  HE1  . MET A 1 55 ? -2.955  -4.522  -2.900  1.00 0.00 ? 476 MET A HE1  1  
ATOM   801   H  HE2  . MET A 1 55 ? -3.397  -6.211  -2.647  1.00 0.00 ? 476 MET A HE2  1  
ATOM   802   H  HE3  . MET A 1 55 ? -4.524  -4.928  -2.204  1.00 0.00 ? 476 MET A HE3  1  
ATOM   803   N  N    . PHE A 1 56 ? -2.072  -6.663  2.261   1.00 0.00 ? 477 PHE A N    1  
ATOM   804   C  CA   . PHE A 1 56 ? -0.649  -6.907  2.054   1.00 0.00 ? 477 PHE A CA   1  
ATOM   805   C  C    . PHE A 1 56 ? -0.081  -7.783  3.167   1.00 0.00 ? 477 PHE A C    1  
ATOM   806   O  O    . PHE A 1 56 ? -0.665  -7.892  4.245   1.00 0.00 ? 477 PHE A O    1  
ATOM   807   C  CB   . PHE A 1 56 ? 0.114   -5.583  1.992   1.00 0.00 ? 477 PHE A CB   1  
ATOM   808   C  CG   . PHE A 1 56 ? -0.046  -4.859  0.686   1.00 0.00 ? 477 PHE A CG   1  
ATOM   809   C  CD1  . PHE A 1 56 ? 0.334   -5.457  -0.504  1.00 0.00 ? 477 PHE A CD1  1  
ATOM   810   C  CD2  . PHE A 1 56 ? -0.577  -3.579  0.649   1.00 0.00 ? 477 PHE A CD2  1  
ATOM   811   C  CE1  . PHE A 1 56 ? 0.187   -4.794  -1.708  1.00 0.00 ? 477 PHE A CE1  1  
ATOM   812   C  CE2  . PHE A 1 56 ? -0.726  -2.911  -0.552  1.00 0.00 ? 477 PHE A CE2  1  
ATOM   813   C  CZ   . PHE A 1 56 ? -0.343  -3.519  -1.731  1.00 0.00 ? 477 PHE A CZ   1  
ATOM   814   H  H    . PHE A 1 56 ? -2.354  -6.061  2.981   1.00 0.00 ? 477 PHE A H    1  
ATOM   815   H  HA   . PHE A 1 56 ? -0.535  -7.423  1.113   1.00 0.00 ? 477 PHE A HA   1  
ATOM   816   H  HB2  . PHE A 1 56 ? -0.242  -4.933  2.777   1.00 0.00 ? 477 PHE A HB2  1  
ATOM   817   H  HB3  . PHE A 1 56 ? 1.166   -5.775  2.140   1.00 0.00 ? 477 PHE A HB3  1  
ATOM   818   H  HD1  . PHE A 1 56 ? 0.749   -6.455  -0.487  1.00 0.00 ? 477 PHE A HD1  1  
ATOM   819   H  HD2  . PHE A 1 56 ? -0.876  -3.102  1.571   1.00 0.00 ? 477 PHE A HD2  1  
ATOM   820   H  HE1  . PHE A 1 56 ? 0.488   -5.272  -2.628  1.00 0.00 ? 477 PHE A HE1  1  
ATOM   821   H  HE2  . PHE A 1 56 ? -1.141  -1.914  -0.567  1.00 0.00 ? 477 PHE A HE2  1  
ATOM   822   H  HZ   . PHE A 1 56 ? -0.459  -2.999  -2.671  1.00 0.00 ? 477 PHE A HZ   1  
ATOM   823   N  N    . SER A 1 57 ? 1.062   -8.406  2.897   1.00 0.00 ? 478 SER A N    1  
ATOM   824   C  CA   . SER A 1 57 ? 1.707   -9.277  3.872   1.00 0.00 ? 478 SER A CA   1  
ATOM   825   C  C    . SER A 1 57 ? 2.436   -8.457  4.933   1.00 0.00 ? 478 SER A C    1  
ATOM   826   O  O    . SER A 1 57 ? 3.012   -7.409  4.637   1.00 0.00 ? 478 SER A O    1  
ATOM   827   C  CB   . SER A 1 57 ? 2.690   -10.219 3.175   1.00 0.00 ? 478 SER A CB   1  
ATOM   828   O  OG   . SER A 1 57 ? 2.013   -11.113 2.310   1.00 0.00 ? 478 SER A OG   1  
ATOM   829   H  H    . SER A 1 57 ? 1.479   -8.280  2.019   1.00 0.00 ? 478 SER A H    1  
ATOM   830   H  HA   . SER A 1 57 ? 0.939   -9.863  4.353   1.00 0.00 ? 478 SER A HA   1  
ATOM   831   H  HB2  . SER A 1 57 ? 3.392   -9.638  2.596   1.00 0.00 ? 478 SER A HB2  1  
ATOM   832   H  HB3  . SER A 1 57 ? 3.225   -10.792 3.919   1.00 0.00 ? 478 SER A HB3  1  
ATOM   833   H  HG   . SER A 1 57 ? 1.390   -10.624 1.768   1.00 0.00 ? 478 SER A HG   1  
ATOM   834   N  N    . HIS A 1 58 ? 2.407   -8.942  6.170   1.00 0.00 ? 479 HIS A N    1  
ATOM   835   C  CA   . HIS A 1 58 ? 3.064   -8.255  7.276   1.00 0.00 ? 479 HIS A CA   1  
ATOM   836   C  C    . HIS A 1 58 ? 4.216   -9.091  7.827   1.00 0.00 ? 479 HIS A C    1  
ATOM   837   O  O    . HIS A 1 58 ? 4.517   -9.042  9.020   1.00 0.00 ? 479 HIS A O    1  
ATOM   838   C  CB   . HIS A 1 58 ? 2.059   -7.955  8.389   1.00 0.00 ? 479 HIS A CB   1  
ATOM   839   C  CG   . HIS A 1 58 ? 1.167   -6.790  8.091   1.00 0.00 ? 479 HIS A CG   1  
ATOM   840   N  ND1  . HIS A 1 58 ? 0.378   -6.183  9.045   1.00 0.00 ? 479 HIS A ND1  1  
ATOM   841   C  CD2  . HIS A 1 58 ? 0.942   -6.119  6.937   1.00 0.00 ? 479 HIS A CD2  1  
ATOM   842   C  CE1  . HIS A 1 58 ? -0.294  -5.190  8.491   1.00 0.00 ? 479 HIS A CE1  1  
ATOM   843   N  NE2  . HIS A 1 58 ? 0.030   -5.129  7.212   1.00 0.00 ? 479 HIS A NE2  1  
ATOM   844   H  H    . HIS A 1 58 ? 1.932   -9.781  6.343   1.00 0.00 ? 479 HIS A H    1  
ATOM   845   H  HA   . HIS A 1 58 ? 3.460   -7.324  6.900   1.00 0.00 ? 479 HIS A HA   1  
ATOM   846   H  HB2  . HIS A 1 58 ? 1.432   -8.822  8.541   1.00 0.00 ? 479 HIS A HB2  1  
ATOM   847   H  HB3  . HIS A 1 58 ? 2.595   -7.739  9.301   1.00 0.00 ? 479 HIS A HB3  1  
ATOM   848   H  HD1  . HIS A 1 58 ? 0.319   -6.442  9.988   1.00 0.00 ? 479 HIS A HD1  1  
ATOM   849   H  HD2  . HIS A 1 58 ? 1.395   -6.323  5.977   1.00 0.00 ? 479 HIS A HD2  1  
ATOM   850   H  HE1  . HIS A 1 58 ? -0.990  -4.538  8.997   1.00 0.00 ? 479 HIS A HE1  1  
ATOM   851   N  N    . ASP A 1 59 ? 4.855   -9.859  6.951   1.00 0.00 ? 480 ASP A N    1  
ATOM   852   C  CA   . ASP A 1 59 ? 5.973   -10.706 7.349   1.00 0.00 ? 480 ASP A CA   1  
ATOM   853   C  C    . ASP A 1 59 ? 7.216   -9.868  7.631   1.00 0.00 ? 480 ASP A C    1  
ATOM   854   O  O    . ASP A 1 59 ? 7.342   -8.729  7.181   1.00 0.00 ? 480 ASP A O    1  
ATOM   855   C  CB   . ASP A 1 59 ? 6.274   -11.736 6.260   1.00 0.00 ? 480 ASP A CB   1  
ATOM   856   C  CG   . ASP A 1 59 ? 5.497   -13.024 6.451   1.00 0.00 ? 480 ASP A CG   1  
ATOM   857   O  OD1  . ASP A 1 59 ? 5.510   -13.563 7.576   1.00 0.00 ? 480 ASP A OD1  1  
ATOM   858   O  OD2  . ASP A 1 59 ? 4.876   -13.493 5.474   1.00 0.00 ? 480 ASP A OD2  1  
ATOM   859   H  H    . ASP A 1 59 ? 4.568   -9.855  6.014   1.00 0.00 ? 480 ASP A H    1  
ATOM   860   H  HA   . ASP A 1 59 ? 5.691   -11.224 8.254   1.00 0.00 ? 480 ASP A HA   1  
ATOM   861   H  HB2  . ASP A 1 59 ? 6.013   -11.320 5.298   1.00 0.00 ? 480 ASP A HB2  1  
ATOM   862   H  HB3  . ASP A 1 59 ? 7.329   -11.968 6.274   1.00 0.00 ? 480 ASP A HB3  1  
ATOM   863   N  N    . PRO A 1 60 ? 8.157   -10.442 8.395   1.00 0.00 ? 481 PRO A N    1  
ATOM   864   C  CA   . PRO A 1 60 ? 9.407   -9.765  8.754   1.00 0.00 ? 481 PRO A CA   1  
ATOM   865   C  C    . PRO A 1 60 ? 10.340  -9.598  7.560   1.00 0.00 ? 481 PRO A C    1  
ATOM   866   O  O    . PRO A 1 60 ? 10.744  -10.578 6.933   1.00 0.00 ? 481 PRO A O    1  
ATOM   867   C  CB   . PRO A 1 60 ? 10.031  -10.701 9.793   1.00 0.00 ? 481 PRO A CB   1  
ATOM   868   C  CG   . PRO A 1 60 ? 9.464   -12.043 9.482   1.00 0.00 ? 481 PRO A CG   1  
ATOM   869   C  CD   . PRO A 1 60 ? 8.074   -11.797 8.966   1.00 0.00 ? 481 PRO A CD   1  
ATOM   870   H  HA   . PRO A 1 60 ? 9.221   -8.800  9.203   1.00 0.00 ? 481 PRO A HA   1  
ATOM   871   H  HB2  . PRO A 1 60 ? 11.107  -10.691 9.690   1.00 0.00 ? 481 PRO A HB2  1  
ATOM   872   H  HB3  . PRO A 1 60 ? 9.756   -10.377 10.786  1.00 0.00 ? 481 PRO A HB3  1  
ATOM   873   H  HG2  . PRO A 1 60 ? 10.064  -12.529 8.728   1.00 0.00 ? 481 PRO A HG2  1  
ATOM   874   H  HG3  . PRO A 1 60 ? 9.430   -12.643 10.380  1.00 0.00 ? 481 PRO A HG3  1  
ATOM   875   H  HD2  . PRO A 1 60 ? 7.819   -12.521 8.206   1.00 0.00 ? 481 PRO A HD2  1  
ATOM   876   H  HD3  . PRO A 1 60 ? 7.359   -11.830 9.776   1.00 0.00 ? 481 PRO A HD3  1  
ATOM   877   N  N    . LEU A 1 61 ? 10.679  -8.351  7.250   1.00 0.00 ? 482 LEU A N    1  
ATOM   878   C  CA   . LEU A 1 61 ? 11.566  -8.055  6.130   1.00 0.00 ? 482 LEU A CA   1  
ATOM   879   C  C    . LEU A 1 61 ? 12.743  -9.025  6.097   1.00 0.00 ? 482 LEU A C    1  
ATOM   880   O  O    . LEU A 1 61 ? 13.202  -9.498  7.137   1.00 0.00 ? 482 LEU A O    1  
ATOM   881   C  CB   . LEU A 1 61 ? 12.077  -6.617  6.226   1.00 0.00 ? 482 LEU A CB   1  
ATOM   882   C  CG   . LEU A 1 61 ? 11.076  -5.522  5.855   1.00 0.00 ? 482 LEU A CG   1  
ATOM   883   C  CD1  . LEU A 1 61 ? 11.744  -4.156  5.885   1.00 0.00 ? 482 LEU A CD1  1  
ATOM   884   C  CD2  . LEU A 1 61 ? 10.473  -5.793  4.485   1.00 0.00 ? 482 LEU A CD2  1  
ATOM   885   H  H    . LEU A 1 61 ? 10.325  -7.612  7.787   1.00 0.00 ? 482 LEU A H    1  
ATOM   886   H  HA   . LEU A 1 61 ? 10.997  -8.167  5.219   1.00 0.00 ? 482 LEU A HA   1  
ATOM   887   H  HB2  . LEU A 1 61 ? 12.393  -6.445  7.243   1.00 0.00 ? 482 LEU A HB2  1  
ATOM   888   H  HB3  . LEU A 1 61 ? 12.929  -6.525  5.566   1.00 0.00 ? 482 LEU A HB3  1  
ATOM   889   H  HG   . LEU A 1 61 ? 10.274  -5.517  6.580   1.00 0.00 ? 482 LEU A HG   1  
ATOM   890   H  HD11 . LEU A 1 61 ? 10.990  -3.389  5.971   1.00 0.00 ? 482 LEU A HD11 1  
ATOM   891   H  HD12 . LEU A 1 61 ? 12.305  -4.010  4.974   1.00 0.00 ? 482 LEU A HD12 1  
ATOM   892   H  HD13 . LEU A 1 61 ? 12.413  -4.101  6.732   1.00 0.00 ? 482 LEU A HD13 1  
ATOM   893   H  HD21 . LEU A 1 61 ? 11.108  -6.477  3.941   1.00 0.00 ? 482 LEU A HD21 1  
ATOM   894   H  HD22 . LEU A 1 61 ? 10.391  -4.865  3.938   1.00 0.00 ? 482 LEU A HD22 1  
ATOM   895   H  HD23 . LEU A 1 61 ? 9.492   -6.230  4.604   1.00 0.00 ? 482 LEU A HD23 1  
ATOM   896   N  N    . THR A 1 62 ? 13.229  -9.316  4.894   1.00 0.00 ? 483 THR A N    1  
ATOM   897   C  CA   . THR A 1 62 ? 14.353  -10.228 4.724   1.00 0.00 ? 483 THR A CA   1  
ATOM   898   C  C    . THR A 1 62 ? 15.415  -9.628  3.809   1.00 0.00 ? 483 THR A C    1  
ATOM   899   O  O    . THR A 1 62 ? 15.116  -8.777  2.972   1.00 0.00 ? 483 THR A O    1  
ATOM   900   C  CB   . THR A 1 62 ? 13.897  -11.580 4.145   1.00 0.00 ? 483 THR A CB   1  
ATOM   901   O  OG1  . THR A 1 62 ? 13.085  -11.367 2.985   1.00 0.00 ? 483 THR A OG1  1  
ATOM   902   C  CG2  . THR A 1 62 ? 13.115  -12.376 5.179   1.00 0.00 ? 483 THR A CG2  1  
ATOM   903   H  H    . THR A 1 62 ? 12.820  -8.907  4.103   1.00 0.00 ? 483 THR A H    1  
ATOM   904   H  HA   . THR A 1 62 ? 14.788  -10.405 5.697   1.00 0.00 ? 483 THR A HA   1  
ATOM   905   H  HB   . THR A 1 62 ? 14.772  -12.147 3.863   1.00 0.00 ? 483 THR A HB   1  
ATOM   906   H  HG1  . THR A 1 62 ? 13.419  -11.898 2.258   1.00 0.00 ? 483 THR A HG1  1  
ATOM   907   H  HG21 . THR A 1 62 ? 13.097  -13.417 4.894   1.00 0.00 ? 483 THR A HG21 1  
ATOM   908   H  HG22 . THR A 1 62 ? 12.104  -12.000 5.233   1.00 0.00 ? 483 THR A HG22 1  
ATOM   909   H  HG23 . THR A 1 62 ? 13.588  -12.275 6.144   1.00 0.00 ? 483 THR A HG23 1  
ATOM   910   N  N    . GLU A 1 63 ? 16.655  -10.077 3.975   1.00 0.00 ? 484 GLU A N    1  
ATOM   911   C  CA   . GLU A 1 63 ? 17.760  -9.583  3.163   1.00 0.00 ? 484 GLU A CA   1  
ATOM   912   C  C    . GLU A 1 63 ? 17.328  -9.398  1.711   1.00 0.00 ? 484 GLU A C    1  
ATOM   913   O  O    . GLU A 1 63 ? 17.831  -8.519  1.011   1.00 0.00 ? 484 GLU A O    1  
ATOM   914   C  CB   . GLU A 1 63 ? 18.946  -10.548 3.235   1.00 0.00 ? 484 GLU A CB   1  
ATOM   915   C  CG   . GLU A 1 63 ? 20.120  -10.135 2.363   1.00 0.00 ? 484 GLU A CG   1  
ATOM   916   C  CD   . GLU A 1 63 ? 21.132  -11.250 2.181   1.00 0.00 ? 484 GLU A CD   1  
ATOM   917   O  OE1  . GLU A 1 63 ? 21.607  -11.792 3.201   1.00 0.00 ? 484 GLU A OE1  1  
ATOM   918   O  OE2  . GLU A 1 63 ? 21.449  -11.579 1.019   1.00 0.00 ? 484 GLU A OE2  1  
ATOM   919   H  H    . GLU A 1 63 ? 16.830  -10.756 4.660   1.00 0.00 ? 484 GLU A H    1  
ATOM   920   H  HA   . GLU A 1 63 ? 18.062  -8.626  3.561   1.00 0.00 ? 484 GLU A HA   1  
ATOM   921   H  HB2  . GLU A 1 63 ? 19.286  -10.605 4.258   1.00 0.00 ? 484 GLU A HB2  1  
ATOM   922   H  HB3  . GLU A 1 63 ? 18.617  -11.527 2.919   1.00 0.00 ? 484 GLU A HB3  1  
ATOM   923   H  HG2  . GLU A 1 63 ? 19.747  -9.847  1.391   1.00 0.00 ? 484 GLU A HG2  1  
ATOM   924   H  HG3  . GLU A 1 63 ? 20.614  -9.291  2.822   1.00 0.00 ? 484 GLU A HG3  1  
ATOM   925   N  N    . GLU A 1 64 ? 16.394  -10.233 1.266   1.00 0.00 ? 485 GLU A N    1  
ATOM   926   C  CA   . GLU A 1 64 ? 15.896  -10.162 -0.102  1.00 0.00 ? 485 GLU A CA   1  
ATOM   927   C  C    . GLU A 1 64 ? 14.864  -9.048  -0.248  1.00 0.00 ? 485 GLU A C    1  
ATOM   928   O  O    . GLU A 1 64 ? 15.144  -7.997  -0.825  1.00 0.00 ? 485 GLU A O    1  
ATOM   929   C  CB   . GLU A 1 64 ? 15.280  -11.501 -0.514  1.00 0.00 ? 485 GLU A CB   1  
ATOM   930   C  CG   . GLU A 1 64 ? 16.285  -12.638 -0.584  1.00 0.00 ? 485 GLU A CG   1  
ATOM   931   C  CD   . GLU A 1 64 ? 17.085  -12.631 -1.873  1.00 0.00 ? 485 GLU A CD   1  
ATOM   932   O  OE1  . GLU A 1 64 ? 16.473  -12.781 -2.951  1.00 0.00 ? 485 GLU A OE1  1  
ATOM   933   O  OE2  . GLU A 1 64 ? 18.322  -12.476 -1.803  1.00 0.00 ? 485 GLU A OE2  1  
ATOM   934   H  H    . GLU A 1 64 ? 16.032  -10.912 1.873   1.00 0.00 ? 485 GLU A H    1  
ATOM   935   H  HA   . GLU A 1 64 ? 16.733  -9.948  -0.749  1.00 0.00 ? 485 GLU A HA   1  
ATOM   936   H  HB2  . GLU A 1 64 ? 14.515  -11.767 0.201   1.00 0.00 ? 485 GLU A HB2  1  
ATOM   937   H  HB3  . GLU A 1 64 ? 14.826  -11.389 -1.488  1.00 0.00 ? 485 GLU A HB3  1  
ATOM   938   H  HG2  . GLU A 1 64 ? 16.969  -12.548 0.246   1.00 0.00 ? 485 GLU A HG2  1  
ATOM   939   H  HG3  . GLU A 1 64 ? 15.754  -13.576 -0.512  1.00 0.00 ? 485 GLU A HG3  1  
ATOM   940   N  N    . THR A 1 65 ? 13.666  -9.286  0.278   1.00 0.00 ? 486 THR A N    1  
ATOM   941   C  CA   . THR A 1 65 ? 12.591  -8.305  0.206   1.00 0.00 ? 486 THR A CA   1  
ATOM   942   C  C    . THR A 1 65 ? 13.106  -6.901  0.501   1.00 0.00 ? 486 THR A C    1  
ATOM   943   O  O    . THR A 1 65 ? 12.791  -5.951  -0.216  1.00 0.00 ? 486 THR A O    1  
ATOM   944   C  CB   . THR A 1 65 ? 11.456  -8.641  1.192   1.00 0.00 ? 486 THR A CB   1  
ATOM   945   O  OG1  . THR A 1 65 ? 11.943  -8.580  2.537   1.00 0.00 ? 486 THR A OG1  1  
ATOM   946   C  CG2  . THR A 1 65 ? 10.890  -10.025 0.914   1.00 0.00 ? 486 THR A CG2  1  
ATOM   947   H  H    . THR A 1 65 ? 13.504  -10.142 0.725   1.00 0.00 ? 486 THR A H    1  
ATOM   948   H  HA   . THR A 1 65 ? 12.187  -8.326  -0.796  1.00 0.00 ? 486 THR A HA   1  
ATOM   949   H  HB   . THR A 1 65 ? 10.667  -7.913  1.070   1.00 0.00 ? 486 THR A HB   1  
ATOM   950   H  HG1  . THR A 1 65 ? 12.208  -7.680  2.742   1.00 0.00 ? 486 THR A HG1  1  
ATOM   951   H  HG21 . THR A 1 65 ? 10.147  -9.960  0.133   1.00 0.00 ? 486 THR A HG21 1  
ATOM   952   H  HG22 . THR A 1 65 ? 10.435  -10.415 1.812   1.00 0.00 ? 486 THR A HG22 1  
ATOM   953   H  HG23 . THR A 1 65 ? 11.686  -10.683 0.599   1.00 0.00 ? 486 THR A HG23 1  
ATOM   954   N  N    . ARG A 1 66 ? 13.901  -6.778  1.559   1.00 0.00 ? 487 ARG A N    1  
ATOM   955   C  CA   . ARG A 1 66 ? 14.460  -5.489  1.949   1.00 0.00 ? 487 ARG A CA   1  
ATOM   956   C  C    . ARG A 1 66 ? 14.916  -4.701  0.724   1.00 0.00 ? 487 ARG A C    1  
ATOM   957   O  O    . ARG A 1 66 ? 14.625  -3.513  0.595   1.00 0.00 ? 487 ARG A O    1  
ATOM   958   C  CB   . ARG A 1 66 ? 15.635  -5.687  2.908   1.00 0.00 ? 487 ARG A CB   1  
ATOM   959   C  CG   . ARG A 1 66 ? 15.801  -4.557  3.910   1.00 0.00 ? 487 ARG A CG   1  
ATOM   960   C  CD   . ARG A 1 66 ? 16.178  -3.254  3.222   1.00 0.00 ? 487 ARG A CD   1  
ATOM   961   N  NE   . ARG A 1 66 ? 16.668  -2.257  4.170   1.00 0.00 ? 487 ARG A NE   1  
ATOM   962   C  CZ   . ARG A 1 66 ? 15.873  -1.480  4.896   1.00 0.00 ? 487 ARG A CZ   1  
ATOM   963   N  NH1  . ARG A 1 66 ? 14.556  -1.585  4.785   1.00 0.00 ? 487 ARG A NH1  1  
ATOM   964   N  NH2  . ARG A 1 66 ? 16.394  -0.596  5.737   1.00 0.00 ? 487 ARG A NH2  1  
ATOM   965   H  H    . ARG A 1 66 ? 14.116  -7.572  2.091   1.00 0.00 ? 487 ARG A H    1  
ATOM   966   H  HA   . ARG A 1 66 ? 13.685  -4.930  2.453   1.00 0.00 ? 487 ARG A HA   1  
ATOM   967   H  HB2  . ARG A 1 66 ? 15.485  -6.606  3.457   1.00 0.00 ? 487 ARG A HB2  1  
ATOM   968   H  HB3  . ARG A 1 66 ? 16.544  -5.765  2.332   1.00 0.00 ? 487 ARG A HB3  1  
ATOM   969   H  HG2  . ARG A 1 66 ? 14.869  -4.415  4.437   1.00 0.00 ? 487 ARG A HG2  1  
ATOM   970   H  HG3  . ARG A 1 66 ? 16.577  -4.822  4.612   1.00 0.00 ? 487 ARG A HG3  1  
ATOM   971   H  HD2  . ARG A 1 66 ? 16.951  -3.456  2.496   1.00 0.00 ? 487 ARG A HD2  1  
ATOM   972   H  HD3  . ARG A 1 66 ? 15.306  -2.862  2.720   1.00 0.00 ? 487 ARG A HD3  1  
ATOM   973   H  HE   . ARG A 1 66 ? 17.638  -2.162  4.268   1.00 0.00 ? 487 ARG A HE   1  
ATOM   974   H  HH11 . ARG A 1 66 ? 14.160  -2.251  4.152   1.00 0.00 ? 487 ARG A HH11 1  
ATOM   975   H  HH12 . ARG A 1 66 ? 13.959  -0.999  5.334   1.00 0.00 ? 487 ARG A HH12 1  
ATOM   976   H  HH21 . ARG A 1 66 ? 17.386  -0.514  5.825   1.00 0.00 ? 487 ARG A HH21 1  
ATOM   977   H  HH22 . ARG A 1 66 ? 15.795  -0.011  6.284   1.00 0.00 ? 487 ARG A HH22 1  
ATOM   978   N  N    . GLU A 1 67 ? 15.633  -5.373  -0.172  1.00 0.00 ? 488 GLU A N    1  
ATOM   979   C  CA   . GLU A 1 67 ? 16.131  -4.735  -1.385  1.00 0.00 ? 488 GLU A CA   1  
ATOM   980   C  C    . GLU A 1 67 ? 14.987  -4.111  -2.179  1.00 0.00 ? 488 GLU A C    1  
ATOM   981   O  O    . GLU A 1 67 ? 15.133  -3.032  -2.755  1.00 0.00 ? 488 GLU A O    1  
ATOM   982   C  CB   . GLU A 1 67 ? 16.875  -5.752  -2.253  1.00 0.00 ? 488 GLU A CB   1  
ATOM   983   C  CG   . GLU A 1 67 ? 18.217  -6.175  -1.680  1.00 0.00 ? 488 GLU A CG   1  
ATOM   984   C  CD   . GLU A 1 67 ? 19.132  -4.997  -1.405  1.00 0.00 ? 488 GLU A CD   1  
ATOM   985   O  OE1  . GLU A 1 67 ? 19.693  -4.444  -2.374  1.00 0.00 ? 488 GLU A OE1  1  
ATOM   986   O  OE2  . GLU A 1 67 ? 19.286  -4.629  -0.222  1.00 0.00 ? 488 GLU A OE2  1  
ATOM   987   H  H    . GLU A 1 67 ? 15.832  -6.319  -0.012  1.00 0.00 ? 488 GLU A H    1  
ATOM   988   H  HA   . GLU A 1 67 ? 16.817  -3.955  -1.092  1.00 0.00 ? 488 GLU A HA   1  
ATOM   989   H  HB2  . GLU A 1 67 ? 16.259  -6.632  -2.364  1.00 0.00 ? 488 GLU A HB2  1  
ATOM   990   H  HB3  . GLU A 1 67 ? 17.044  -5.318  -3.228  1.00 0.00 ? 488 GLU A HB3  1  
ATOM   991   H  HG2  . GLU A 1 67 ? 18.048  -6.704  -0.754  1.00 0.00 ? 488 GLU A HG2  1  
ATOM   992   H  HG3  . GLU A 1 67 ? 18.703  -6.833  -2.385  1.00 0.00 ? 488 GLU A HG3  1  
ATOM   993   N  N    . LEU A 1 68 ? 13.850  -4.797  -2.207  1.00 0.00 ? 489 LEU A N    1  
ATOM   994   C  CA   . LEU A 1 68 ? 12.681  -4.312  -2.931  1.00 0.00 ? 489 LEU A CA   1  
ATOM   995   C  C    . LEU A 1 68 ? 12.330  -2.889  -2.508  1.00 0.00 ? 489 LEU A C    1  
ATOM   996   O  O    . LEU A 1 68 ? 12.428  -1.952  -3.301  1.00 0.00 ? 489 LEU A O    1  
ATOM   997   C  CB   . LEU A 1 68 ? 11.486  -5.236  -2.690  1.00 0.00 ? 489 LEU A CB   1  
ATOM   998   C  CG   . LEU A 1 68 ? 11.669  -6.693  -3.116  1.00 0.00 ? 489 LEU A CG   1  
ATOM   999   C  CD1  . LEU A 1 68 ? 10.345  -7.439  -3.051  1.00 0.00 ? 489 LEU A CD1  1  
ATOM   1000  C  CD2  . LEU A 1 68 ? 12.257  -6.769  -4.518  1.00 0.00 ? 489 LEU A CD2  1  
ATOM   1001  H  H    . LEU A 1 68 ? 13.795  -5.651  -1.729  1.00 0.00 ? 489 LEU A H    1  
ATOM   1002  H  HA   . LEU A 1 68 ? 12.919  -4.313  -3.984  1.00 0.00 ? 489 LEU A HA   1  
ATOM   1003  H  HB2  . LEU A 1 68 ? 11.269  -5.226  -1.633  1.00 0.00 ? 489 LEU A HB2  1  
ATOM   1004  H  HB3  . LEU A 1 68 ? 10.643  -4.835  -3.233  1.00 0.00 ? 489 LEU A HB3  1  
ATOM   1005  H  HG   . LEU A 1 68 ? 12.357  -7.177  -2.437  1.00 0.00 ? 489 LEU A HG   1  
ATOM   1006  H  HD11 . LEU A 1 68 ? 10.178  -7.789  -2.044  1.00 0.00 ? 489 LEU A HD11 1  
ATOM   1007  H  HD12 . LEU A 1 68 ? 10.372  -8.281  -3.726  1.00 0.00 ? 489 LEU A HD12 1  
ATOM   1008  H  HD13 . LEU A 1 68 ? 9.543   -6.774  -3.339  1.00 0.00 ? 489 LEU A HD13 1  
ATOM   1009  H  HD21 . LEU A 1 68 ? 11.671  -6.158  -5.187  1.00 0.00 ? 489 LEU A HD21 1  
ATOM   1010  H  HD22 . LEU A 1 68 ? 12.241  -7.794  -4.860  1.00 0.00 ? 489 LEU A HD22 1  
ATOM   1011  H  HD23 . LEU A 1 68 ? 13.275  -6.411  -4.501  1.00 0.00 ? 489 LEU A HD23 1  
ATOM   1012  N  N    . LEU A 1 69 ? 11.924  -2.734  -1.253  1.00 0.00 ? 490 LEU A N    1  
ATOM   1013  C  CA   . LEU A 1 69 ? 11.561  -1.424  -0.722  1.00 0.00 ? 490 LEU A CA   1  
ATOM   1014  C  C    . LEU A 1 69 ? 12.526  -0.351  -1.214  1.00 0.00 ? 490 LEU A C    1  
ATOM   1015  O  O    . LEU A 1 69 ? 12.115  0.637   -1.823  1.00 0.00 ? 490 LEU A O    1  
ATOM   1016  C  CB   . LEU A 1 69 ? 11.551  -1.456  0.807   1.00 0.00 ? 490 LEU A CB   1  
ATOM   1017  C  CG   . LEU A 1 69 ? 10.497  -2.356  1.453   1.00 0.00 ? 490 LEU A CG   1  
ATOM   1018  C  CD1  . LEU A 1 69 ? 10.761  -2.502  2.944   1.00 0.00 ? 490 LEU A CD1  1  
ATOM   1019  C  CD2  . LEU A 1 69 ? 9.101   -1.803  1.208   1.00 0.00 ? 490 LEU A CD2  1  
ATOM   1020  H  H    . LEU A 1 69 ? 11.866  -3.518  -0.668  1.00 0.00 ? 490 LEU A H    1  
ATOM   1021  H  HA   . LEU A 1 69 ? 10.568  -1.187  -1.076  1.00 0.00 ? 490 LEU A HA   1  
ATOM   1022  H  HB2  . LEU A 1 69 ? 12.522  -1.795  1.136   1.00 0.00 ? 490 LEU A HB2  1  
ATOM   1023  H  HB3  . LEU A 1 69 ? 11.386  -0.447  1.157   1.00 0.00 ? 490 LEU A HB3  1  
ATOM   1024  H  HG   . LEU A 1 69 ? 10.551  -3.340  1.007   1.00 0.00 ? 490 LEU A HG   1  
ATOM   1025  H  HD11 . LEU A 1 69 ? 9.884   -2.904  3.427   1.00 0.00 ? 490 LEU A HD11 1  
ATOM   1026  H  HD12 . LEU A 1 69 ? 10.993  -1.535  3.364   1.00 0.00 ? 490 LEU A HD12 1  
ATOM   1027  H  HD13 . LEU A 1 69 ? 11.596  -3.170  3.098   1.00 0.00 ? 490 LEU A HD13 1  
ATOM   1028  H  HD21 . LEU A 1 69 ? 9.092   -1.248  0.282   1.00 0.00 ? 490 LEU A HD21 1  
ATOM   1029  H  HD22 . LEU A 1 69 ? 8.826   -1.148  2.022   1.00 0.00 ? 490 LEU A HD22 1  
ATOM   1030  H  HD23 . LEU A 1 69 ? 8.396   -2.619  1.147   1.00 0.00 ? 490 LEU A HD23 1  
ATOM   1031  N  N    . ASP A 1 70 ? 13.812  -0.552  -0.948  1.00 0.00 ? 491 ASP A N    1  
ATOM   1032  C  CA   . ASP A 1 70 ? 14.838  0.396   -1.366  1.00 0.00 ? 491 ASP A CA   1  
ATOM   1033  C  C    . ASP A 1 70 ? 14.545  0.932   -2.764  1.00 0.00 ? 491 ASP A C    1  
ATOM   1034  O  O    . ASP A 1 70 ? 14.675  2.129   -3.022  1.00 0.00 ? 491 ASP A O    1  
ATOM   1035  C  CB   . ASP A 1 70 ? 16.216  -0.265  -1.338  1.00 0.00 ? 491 ASP A CB   1  
ATOM   1036  C  CG   . ASP A 1 70 ? 16.656  -0.628  0.067   1.00 0.00 ? 491 ASP A CG   1  
ATOM   1037  O  OD1  . ASP A 1 70 ? 16.099  -0.059  1.029   1.00 0.00 ? 491 ASP A OD1  1  
ATOM   1038  O  OD2  . ASP A 1 70 ? 17.556  -1.482  0.204   1.00 0.00 ? 491 ASP A OD2  1  
ATOM   1039  H  H    . ASP A 1 70 ? 14.078  -1.359  -0.459  1.00 0.00 ? 491 ASP A H    1  
ATOM   1040  H  HA   . ASP A 1 70 ? 14.830  1.221   -0.669  1.00 0.00 ? 491 ASP A HA   1  
ATOM   1041  H  HB2  . ASP A 1 70 ? 16.188  -1.168  -1.930  1.00 0.00 ? 491 ASP A HB2  1  
ATOM   1042  H  HB3  . ASP A 1 70 ? 16.943  0.414   -1.759  1.00 0.00 ? 491 ASP A HB3  1  
ATOM   1043  N  N    . LYS A 1 71 ? 14.150  0.038   -3.664  1.00 0.00 ? 492 LYS A N    1  
ATOM   1044  C  CA   . LYS A 1 71 ? 13.838  0.419   -5.036  1.00 0.00 ? 492 LYS A CA   1  
ATOM   1045  C  C    . LYS A 1 71 ? 12.448  1.038   -5.126  1.00 0.00 ? 492 LYS A C    1  
ATOM   1046  O  O    . LYS A 1 71 ? 12.296  2.189   -5.536  1.00 0.00 ? 492 LYS A O    1  
ATOM   1047  C  CB   . LYS A 1 71 ? 13.926  -0.800  -5.958  1.00 0.00 ? 492 LYS A CB   1  
ATOM   1048  C  CG   . LYS A 1 71 ? 14.058  -0.442  -7.428  1.00 0.00 ? 492 LYS A CG   1  
ATOM   1049  C  CD   . LYS A 1 71 ? 15.509  -0.210  -7.817  1.00 0.00 ? 492 LYS A CD   1  
ATOM   1050  C  CE   . LYS A 1 71 ? 16.201  -1.512  -8.190  1.00 0.00 ? 492 LYS A CE   1  
ATOM   1051  N  NZ   . LYS A 1 71 ? 17.676  -1.428  -8.009  1.00 0.00 ? 492 LYS A NZ   1  
ATOM   1052  H  H    . LYS A 1 71 ? 14.065  -0.903  -3.398  1.00 0.00 ? 492 LYS A H    1  
ATOM   1053  H  HA   . LYS A 1 71 ? 14.567  1.150   -5.351  1.00 0.00 ? 492 LYS A HA   1  
ATOM   1054  H  HB2  . LYS A 1 71 ? 14.785  -1.390  -5.674  1.00 0.00 ? 492 LYS A HB2  1  
ATOM   1055  H  HB3  . LYS A 1 71 ? 13.033  -1.396  -5.833  1.00 0.00 ? 492 LYS A HB3  1  
ATOM   1056  H  HG2  . LYS A 1 71 ? 13.662  -1.251  -8.023  1.00 0.00 ? 492 LYS A HG2  1  
ATOM   1057  H  HG3  . LYS A 1 71 ? 13.494  0.459   -7.622  1.00 0.00 ? 492 LYS A HG3  1  
ATOM   1058  H  HD2  . LYS A 1 71 ? 15.543  0.458   -8.665  1.00 0.00 ? 492 LYS A HD2  1  
ATOM   1059  H  HD3  . LYS A 1 71 ? 16.029  0.238   -6.982  1.00 0.00 ? 492 LYS A HD3  1  
ATOM   1060  H  HE2  . LYS A 1 71 ? 15.814  -2.302  -7.565  1.00 0.00 ? 492 LYS A HE2  1  
ATOM   1061  H  HE3  . LYS A 1 71 ? 15.986  -1.735  -9.225  1.00 0.00 ? 492 LYS A HE3  1  
ATOM   1062  H  HZ1  . LYS A 1 71 ? 18.152  -2.116  -8.627  1.00 0.00 ? 492 LYS A HZ1  1  
ATOM   1063  H  HZ2  . LYS A 1 71 ? 17.927  -1.636  -7.021  1.00 0.00 ? 492 LYS A HZ2  1  
ATOM   1064  H  HZ3  . LYS A 1 71 ? 18.012  -0.473  -8.247  1.00 0.00 ? 492 LYS A HZ3  1  
ATOM   1065  N  N    . MET A 1 72 ? 11.435  0.269   -4.740  1.00 0.00 ? 493 MET A N    1  
ATOM   1066  C  CA   . MET A 1 72 ? 10.057  0.745   -4.775  1.00 0.00 ? 493 MET A CA   1  
ATOM   1067  C  C    . MET A 1 72 ? 9.968   2.187   -4.288  1.00 0.00 ? 493 MET A C    1  
ATOM   1068  O  O    . MET A 1 72 ? 9.522   3.073   -5.018  1.00 0.00 ? 493 MET A O    1  
ATOM   1069  C  CB   . MET A 1 72 ? 9.164   -0.152  -3.916  1.00 0.00 ? 493 MET A CB   1  
ATOM   1070  C  CG   . MET A 1 72 ? 7.681   0.003   -4.214  1.00 0.00 ? 493 MET A CG   1  
ATOM   1071  S  SD   . MET A 1 72 ? 6.974   1.483   -3.465  1.00 0.00 ? 493 MET A SD   1  
ATOM   1072  C  CE   . MET A 1 72 ? 6.641   0.897   -1.805  1.00 0.00 ? 493 MET A CE   1  
ATOM   1073  H  H    . MET A 1 72 ? 11.619  -0.640  -4.423  1.00 0.00 ? 493 MET A H    1  
ATOM   1074  H  HA   . MET A 1 72 ? 9.718   0.701   -5.799  1.00 0.00 ? 493 MET A HA   1  
ATOM   1075  H  HB2  . MET A 1 72 ? 9.437   -1.183  -4.087  1.00 0.00 ? 493 MET A HB2  1  
ATOM   1076  H  HB3  . MET A 1 72 ? 9.326   0.087   -2.876  1.00 0.00 ? 493 MET A HB3  1  
ATOM   1077  H  HG2  . MET A 1 72 ? 7.546   0.059   -5.284  1.00 0.00 ? 493 MET A HG2  1  
ATOM   1078  H  HG3  . MET A 1 72 ? 7.159   -0.862  -3.832  1.00 0.00 ? 493 MET A HG3  1  
ATOM   1079  H  HE1  . MET A 1 72 ? 5.754   0.282   -1.812  1.00 0.00 ? 493 MET A HE1  1  
ATOM   1080  H  HE2  . MET A 1 72 ? 7.481   0.315   -1.455  1.00 0.00 ? 493 MET A HE2  1  
ATOM   1081  H  HE3  . MET A 1 72 ? 6.489   1.742   -1.149  1.00 0.00 ? 493 MET A HE3  1  
ATOM   1082  N  N    . LEU A 1 73 ? 10.394  2.417   -3.051  1.00 0.00 ? 494 LEU A N    1  
ATOM   1083  C  CA   . LEU A 1 73 ? 10.362  3.753   -2.466  1.00 0.00 ? 494 LEU A CA   1  
ATOM   1084  C  C    . LEU A 1 73 ? 11.143  4.742   -3.325  1.00 0.00 ? 494 LEU A C    1  
ATOM   1085  O  O    . LEU A 1 73 ? 10.582  5.706   -3.846  1.00 0.00 ? 494 LEU A O    1  
ATOM   1086  C  CB   . LEU A 1 73 ? 10.937  3.725   -1.049  1.00 0.00 ? 494 LEU A CB   1  
ATOM   1087  C  CG   . LEU A 1 73 ? 9.993   3.234   0.049   1.00 0.00 ? 494 LEU A CG   1  
ATOM   1088  C  CD1  . LEU A 1 73 ? 9.472   1.843   -0.279  1.00 0.00 ? 494 LEU A CD1  1  
ATOM   1089  C  CD2  . LEU A 1 73 ? 10.697  3.237   1.398   1.00 0.00 ? 494 LEU A CD2  1  
ATOM   1090  H  H    . LEU A 1 73 ? 10.739  1.671   -2.517  1.00 0.00 ? 494 LEU A H    1  
ATOM   1091  H  HA   . LEU A 1 73 ? 9.331   4.070   -2.421  1.00 0.00 ? 494 LEU A HA   1  
ATOM   1092  H  HB2  . LEU A 1 73 ? 11.801  3.079   -1.056  1.00 0.00 ? 494 LEU A HB2  1  
ATOM   1093  H  HB3  . LEU A 1 73 ? 11.244  4.731   -0.798  1.00 0.00 ? 494 LEU A HB3  1  
ATOM   1094  H  HG   . LEU A 1 73 ? 9.145   3.901   0.111   1.00 0.00 ? 494 LEU A HG   1  
ATOM   1095  H  HD11 . LEU A 1 73 ? 10.290  1.139   -0.264  1.00 0.00 ? 494 LEU A HD11 1  
ATOM   1096  H  HD12 . LEU A 1 73 ? 9.021   1.850   -1.260  1.00 0.00 ? 494 LEU A HD12 1  
ATOM   1097  H  HD13 . LEU A 1 73 ? 8.733   1.554   0.454   1.00 0.00 ? 494 LEU A HD13 1  
ATOM   1098  H  HD21 . LEU A 1 73 ? 10.585  4.207   1.859   1.00 0.00 ? 494 LEU A HD21 1  
ATOM   1099  H  HD22 . LEU A 1 73 ? 11.747  3.025   1.257   1.00 0.00 ? 494 LEU A HD22 1  
ATOM   1100  H  HD23 . LEU A 1 73 ? 10.259  2.483   2.034   1.00 0.00 ? 494 LEU A HD23 1  
ATOM   1101  N  N    . ALA A 1 74 ? 12.441  4.496   -3.470  1.00 0.00 ? 495 ALA A N    1  
ATOM   1102  C  CA   . ALA A 1 74 ? 13.299  5.363   -4.269  1.00 0.00 ? 495 ALA A CA   1  
ATOM   1103  C  C    . ALA A 1 74 ? 12.592  5.810   -5.544  1.00 0.00 ? 495 ALA A C    1  
ATOM   1104  O  O    . ALA A 1 74 ? 12.634  6.985   -5.909  1.00 0.00 ? 495 ALA A O    1  
ATOM   1105  C  CB   . ALA A 1 74 ? 14.600  4.651   -4.607  1.00 0.00 ? 495 ALA A CB   1  
ATOM   1106  H  H    . ALA A 1 74 ? 12.831  3.712   -3.030  1.00 0.00 ? 495 ALA A H    1  
ATOM   1107  H  HA   . ALA A 1 74 ? 13.537  6.234   -3.677  1.00 0.00 ? 495 ALA A HA   1  
ATOM   1108  H  HB1  . ALA A 1 74 ? 14.385  3.766   -5.190  1.00 0.00 ? 495 ALA A HB1  1  
ATOM   1109  H  HB2  . ALA A 1 74 ? 15.235  5.312   -5.177  1.00 0.00 ? 495 ALA A HB2  1  
ATOM   1110  H  HB3  . ALA A 1 74 ? 15.103  4.367   -3.694  1.00 0.00 ? 495 ALA A HB3  1  
ATOM   1111  N  N    . ASP A 1 75 ? 11.943  4.866   -6.217  1.00 0.00 ? 496 ASP A N    1  
ATOM   1112  C  CA   . ASP A 1 75 ? 11.226  5.164   -7.452  1.00 0.00 ? 496 ASP A CA   1  
ATOM   1113  C  C    . ASP A 1 75 ? 10.095  6.155   -7.198  1.00 0.00 ? 496 ASP A C    1  
ATOM   1114  O  O    . ASP A 1 75 ? 10.055  7.233   -7.791  1.00 0.00 ? 496 ASP A O    1  
ATOM   1115  C  CB   . ASP A 1 75 ? 10.668  3.879   -8.065  1.00 0.00 ? 496 ASP A CB   1  
ATOM   1116  C  CG   . ASP A 1 75 ? 10.056  4.108   -9.433  1.00 0.00 ? 496 ASP A CG   1  
ATOM   1117  O  OD1  . ASP A 1 75 ? 9.590   5.237   -9.692  1.00 0.00 ? 496 ASP A OD1  1  
ATOM   1118  O  OD2  . ASP A 1 75 ? 10.042  3.158   -10.244 1.00 0.00 ? 496 ASP A OD2  1  
ATOM   1119  H  H    . ASP A 1 75 ? 11.946  3.948   -5.876  1.00 0.00 ? 496 ASP A H    1  
ATOM   1120  H  HA   . ASP A 1 75 ? 11.927  5.607   -8.144  1.00 0.00 ? 496 ASP A HA   1  
ATOM   1121  H  HB2  . ASP A 1 75 ? 11.467  3.158   -8.165  1.00 0.00 ? 496 ASP A HB2  1  
ATOM   1122  H  HB3  . ASP A 1 75 ? 9.907   3.478   -7.412  1.00 0.00 ? 496 ASP A HB3  1  
ATOM   1123  N  N    . ASP A 1 76 ? 9.176   5.782   -6.314  1.00 0.00 ? 497 ASP A N    1  
ATOM   1124  C  CA   . ASP A 1 76 ? 8.043   6.637   -5.982  1.00 0.00 ? 497 ASP A CA   1  
ATOM   1125  C  C    . ASP A 1 76 ? 8.516   7.955   -5.377  1.00 0.00 ? 497 ASP A C    1  
ATOM   1126  O  O    . ASP A 1 76 ? 8.321   9.022   -5.958  1.00 0.00 ? 497 ASP A O    1  
ATOM   1127  C  CB   . ASP A 1 76 ? 7.105   5.922   -5.007  1.00 0.00 ? 497 ASP A CB   1  
ATOM   1128  C  CG   . ASP A 1 76 ? 6.568   4.621   -5.571  1.00 0.00 ? 497 ASP A CG   1  
ATOM   1129  O  OD1  . ASP A 1 76 ? 7.383   3.780   -6.002  1.00 0.00 ? 497 ASP A OD1  1  
ATOM   1130  O  OD2  . ASP A 1 76 ? 5.331   4.445   -5.580  1.00 0.00 ? 497 ASP A OD2  1  
ATOM   1131  H  H    . ASP A 1 76 ? 9.262   4.910   -5.874  1.00 0.00 ? 497 ASP A H    1  
ATOM   1132  H  HA   . ASP A 1 76 ? 7.506   6.847   -6.895  1.00 0.00 ? 497 ASP A HA   1  
ATOM   1133  H  HB2  . ASP A 1 76 ? 7.642   5.703   -4.096  1.00 0.00 ? 497 ASP A HB2  1  
ATOM   1134  H  HB3  . ASP A 1 76 ? 6.270   6.569   -4.782  1.00 0.00 ? 497 ASP A HB3  1  
ATOM   1135  N  N    . ALA A 1 77 ? 9.139   7.873   -4.205  1.00 0.00 ? 498 ALA A N    1  
ATOM   1136  C  CA   . ALA A 1 77 ? 9.641   9.058   -3.522  1.00 0.00 ? 498 ALA A CA   1  
ATOM   1137  C  C    . ALA A 1 77 ? 10.250  10.046  -4.512  1.00 0.00 ? 498 ALA A C    1  
ATOM   1138  O  O    . ALA A 1 77 ? 9.768   11.168  -4.658  1.00 0.00 ? 498 ALA A O    1  
ATOM   1139  C  CB   . ALA A 1 77 ? 10.665  8.666   -2.467  1.00 0.00 ? 498 ALA A CB   1  
ATOM   1140  H  H    . ALA A 1 77 ? 9.265   6.994   -3.792  1.00 0.00 ? 498 ALA A H    1  
ATOM   1141  H  HA   . ALA A 1 77 ? 8.809   9.533   -3.022  1.00 0.00 ? 498 ALA A HA   1  
ATOM   1142  H  HB1  . ALA A 1 77 ? 11.605  9.153   -2.681  1.00 0.00 ? 498 ALA A HB1  1  
ATOM   1143  H  HB2  . ALA A 1 77 ? 10.314  8.972   -1.493  1.00 0.00 ? 498 ALA A HB2  1  
ATOM   1144  H  HB3  . ALA A 1 77 ? 10.803  7.595   -2.481  1.00 0.00 ? 498 ALA A HB3  1  
ATOM   1145  N  N    . GLU A 1 78 ? 11.313  9.620   -5.188  1.00 0.00 ? 499 GLU A N    1  
ATOM   1146  C  CA   . GLU A 1 78 ? 11.988  10.469  -6.162  1.00 0.00 ? 499 GLU A CA   1  
ATOM   1147  C  C    . GLU A 1 78 ? 10.993  11.035  -7.172  1.00 0.00 ? 499 GLU A C    1  
ATOM   1148  O  O    . GLU A 1 78 ? 10.918  12.247  -7.372  1.00 0.00 ? 499 GLU A O    1  
ATOM   1149  C  CB   . GLU A 1 78 ? 13.077  9.679   -6.891  1.00 0.00 ? 499 GLU A CB   1  
ATOM   1150  C  CG   . GLU A 1 78 ? 14.175  10.553  -7.475  1.00 0.00 ? 499 GLU A CG   1  
ATOM   1151  C  CD   . GLU A 1 78 ? 15.116  11.093  -6.416  1.00 0.00 ? 499 GLU A CD   1  
ATOM   1152  O  OE1  . GLU A 1 78 ? 15.305  10.410  -5.387  1.00 0.00 ? 499 GLU A OE1  1  
ATOM   1153  O  OE2  . GLU A 1 78 ? 15.665  12.197  -6.615  1.00 0.00 ? 499 GLU A OE2  1  
ATOM   1154  H  H    . GLU A 1 78 ? 11.651  8.714   -5.027  1.00 0.00 ? 499 GLU A H    1  
ATOM   1155  H  HA   . GLU A 1 78 ? 12.446  11.287  -5.628  1.00 0.00 ? 499 GLU A HA   1  
ATOM   1156  H  HB2  . GLU A 1 78 ? 13.528  8.986   -6.197  1.00 0.00 ? 499 GLU A HB2  1  
ATOM   1157  H  HB3  . GLU A 1 78 ? 12.623  9.123   -7.697  1.00 0.00 ? 499 GLU A HB3  1  
ATOM   1158  H  HG2  . GLU A 1 78 ? 14.747  9.968   -8.179  1.00 0.00 ? 499 GLU A HG2  1  
ATOM   1159  H  HG3  . GLU A 1 78 ? 13.718  11.387  -7.988  1.00 0.00 ? 499 GLU A HG3  1  
ATOM   1160  N  N    . ALA A 1 79 ? 10.232  10.149  -7.805  1.00 0.00 ? 500 ALA A N    1  
ATOM   1161  C  CA   . ALA A 1 79 ? 9.242   10.559  -8.792  1.00 0.00 ? 500 ALA A CA   1  
ATOM   1162  C  C    . ALA A 1 79 ? 7.906   10.878  -8.130  1.00 0.00 ? 500 ALA A C    1  
ATOM   1163  O  O    . ALA A 1 79 ? 7.051   10.006  -7.983  1.00 0.00 ? 500 ALA A O    1  
ATOM   1164  C  CB   . ALA A 1 79 ? 9.065   9.475   -9.845  1.00 0.00 ? 500 ALA A CB   1  
ATOM   1165  H  H    . ALA A 1 79 ? 10.339  9.196   -7.602  1.00 0.00 ? 500 ALA A H    1  
ATOM   1166  H  HA   . ALA A 1 79 ? 9.609   11.448  -9.284  1.00 0.00 ? 500 ALA A HA   1  
ATOM   1167  H  HB1  . ALA A 1 79 ? 9.769   9.638   -10.649 1.00 0.00 ? 500 ALA A HB1  1  
ATOM   1168  H  HB2  . ALA A 1 79 ? 9.245   8.508   -9.400  1.00 0.00 ? 500 ALA A HB2  1  
ATOM   1169  H  HB3  . ALA A 1 79 ? 8.059   9.512   -10.234 1.00 0.00 ? 500 ALA A HB3  1  
ATOM   1170  N  N    . GLY A 1 80 ? 7.733   12.135  -7.731  1.00 0.00 ? 501 GLY A N    1  
ATOM   1171  C  CA   . GLY A 1 80 ? 6.499   12.546  -7.087  1.00 0.00 ? 501 GLY A CA   1  
ATOM   1172  C  C    . GLY A 1 80 ? 5.693   13.506  -7.940  1.00 0.00 ? 501 GLY A C    1  
ATOM   1173  O  O    . GLY A 1 80 ? 6.253   14.381  -8.599  1.00 0.00 ? 501 GLY A O    1  
ATOM   1174  H  H    . GLY A 1 80 ? 8.450   12.788  -7.874  1.00 0.00 ? 501 GLY A H    1  
ATOM   1175  H  HA2  . GLY A 1 80 ? 5.901   11.669  -6.887  1.00 0.00 ? 501 GLY A HA2  1  
ATOM   1176  H  HA3  . GLY A 1 80 ? 6.738   13.028  -6.151  1.00 0.00 ? 501 GLY A HA3  1  
ATOM   1177  N  N    . ALA A 1 81 ? 4.374   13.342  -7.927  1.00 0.00 ? 502 ALA A N    1  
ATOM   1178  C  CA   . ALA A 1 81 ? 3.490   14.201  -8.704  1.00 0.00 ? 502 ALA A CA   1  
ATOM   1179  C  C    . ALA A 1 81 ? 2.633   15.074  -7.794  1.00 0.00 ? 502 ALA A C    1  
ATOM   1180  O  O    . ALA A 1 81 ? 2.251   14.658  -6.701  1.00 0.00 ? 502 ALA A O    1  
ATOM   1181  C  CB   . ALA A 1 81 ? 2.608   13.363  -9.618  1.00 0.00 ? 502 ALA A CB   1  
ATOM   1182  H  H    . ALA A 1 81 ? 3.987   12.627  -7.381  1.00 0.00 ? 502 ALA A H    1  
ATOM   1183  H  HA   . ALA A 1 81 ? 4.104   14.839  -9.323  1.00 0.00 ? 502 ALA A HA   1  
ATOM   1184  H  HB1  . ALA A 1 81 ? 1.747   13.015  -9.066  1.00 0.00 ? 502 ALA A HB1  1  
ATOM   1185  H  HB2  . ALA A 1 81 ? 2.282   13.964  -10.453 1.00 0.00 ? 502 ALA A HB2  1  
ATOM   1186  H  HB3  . ALA A 1 81 ? 3.170   12.516  -9.981  1.00 0.00 ? 502 ALA A HB3  1  
ATOM   1187  N  N    . GLU A 1 82 ? 2.336   16.286  -8.251  1.00 0.00 ? 503 GLU A N    1  
ATOM   1188  C  CA   . GLU A 1 82 ? 1.525   17.218  -7.476  1.00 0.00 ? 503 GLU A CA   1  
ATOM   1189  C  C    . GLU A 1 82 ? 0.047   16.847  -7.553  1.00 0.00 ? 503 GLU A C    1  
ATOM   1190  O  O    . GLU A 1 82 ? -0.438  16.397  -8.592  1.00 0.00 ? 503 GLU A O    1  
ATOM   1191  C  CB   . GLU A 1 82 ? 1.731   18.648  -7.978  1.00 0.00 ? 503 GLU A CB   1  
ATOM   1192  C  CG   . GLU A 1 82 ? 1.331   19.711  -6.969  1.00 0.00 ? 503 GLU A CG   1  
ATOM   1193  C  CD   . GLU A 1 82 ? 1.885   21.080  -7.313  1.00 0.00 ? 503 GLU A CD   1  
ATOM   1194  O  OE1  . GLU A 1 82 ? 3.046   21.359  -6.947  1.00 0.00 ? 503 GLU A OE1  1  
ATOM   1195  O  OE2  . GLU A 1 82 ? 1.158   21.872  -7.948  1.00 0.00 ? 503 GLU A OE2  1  
ATOM   1196  H  H    . GLU A 1 82 ? 2.670   16.561  -9.131  1.00 0.00 ? 503 GLU A H    1  
ATOM   1197  H  HA   . GLU A 1 82 ? 1.845   17.158  -6.447  1.00 0.00 ? 503 GLU A HA   1  
ATOM   1198  H  HB2  . GLU A 1 82 ? 2.774   18.785  -8.221  1.00 0.00 ? 503 GLU A HB2  1  
ATOM   1199  H  HB3  . GLU A 1 82 ? 1.141   18.791  -8.872  1.00 0.00 ? 503 GLU A HB3  1  
ATOM   1200  H  HG2  . GLU A 1 82 ? 0.254   19.773  -6.938  1.00 0.00 ? 503 GLU A HG2  1  
ATOM   1201  H  HG3  . GLU A 1 82 ? 1.702   19.423  -5.996  1.00 0.00 ? 503 GLU A HG3  1  
ATOM   1202  N  N    . ASP A 1 83 ? -0.664  17.039  -6.448  1.00 0.00 ? 504 ASP A N    1  
ATOM   1203  C  CA   . ASP A 1 83 ? -2.087  16.725  -6.389  1.00 0.00 ? 504 ASP A CA   1  
ATOM   1204  C  C    . ASP A 1 83 ? -2.832  17.742  -5.530  1.00 0.00 ? 504 ASP A C    1  
ATOM   1205  O  O    . ASP A 1 83 ? -2.457  17.996  -4.386  1.00 0.00 ? 504 ASP A O    1  
ATOM   1206  C  CB   . ASP A 1 83 ? -2.298  15.317  -5.833  1.00 0.00 ? 504 ASP A CB   1  
ATOM   1207  C  CG   . ASP A 1 83 ? -1.760  14.242  -6.757  1.00 0.00 ? 504 ASP A CG   1  
ATOM   1208  O  OD1  . ASP A 1 83 ? -0.565  13.899  -6.635  1.00 0.00 ? 504 ASP A OD1  1  
ATOM   1209  O  OD2  . ASP A 1 83 ? -2.533  13.744  -7.600  1.00 0.00 ? 504 ASP A OD2  1  
ATOM   1210  H  H    . ASP A 1 83 ? -0.221  17.400  -5.651  1.00 0.00 ? 504 ASP A H    1  
ATOM   1211  H  HA   . ASP A 1 83 ? -2.477  16.768  -7.395  1.00 0.00 ? 504 ASP A HA   1  
ATOM   1212  H  HB2  . ASP A 1 83 ? -1.793  15.233  -4.881  1.00 0.00 ? 504 ASP A HB2  1  
ATOM   1213  H  HB3  . ASP A 1 83 ? -3.355  15.148  -5.691  1.00 0.00 ? 504 ASP A HB3  1  
ATOM   1214  N  N    . GLU A 1 84 ? -3.889  18.322  -6.091  1.00 0.00 ? 505 GLU A N    1  
ATOM   1215  C  CA   . GLU A 1 84 ? -4.685  19.313  -5.377  1.00 0.00 ? 505 GLU A CA   1  
ATOM   1216  C  C    . GLU A 1 84 ? -5.056  18.811  -3.984  1.00 0.00 ? 505 GLU A C    1  
ATOM   1217  O  O    . GLU A 1 84 ? -5.020  17.610  -3.714  1.00 0.00 ? 505 GLU A O    1  
ATOM   1218  C  CB   . GLU A 1 84 ? -5.954  19.645  -6.165  1.00 0.00 ? 505 GLU A CB   1  
ATOM   1219  C  CG   . GLU A 1 84 ? -6.833  18.437  -6.441  1.00 0.00 ? 505 GLU A CG   1  
ATOM   1220  C  CD   . GLU A 1 84 ? -8.073  18.789  -7.240  1.00 0.00 ? 505 GLU A CD   1  
ATOM   1221  O  OE1  . GLU A 1 84 ? -7.993  19.701  -8.090  1.00 0.00 ? 505 GLU A OE1  1  
ATOM   1222  O  OE2  . GLU A 1 84 ? -9.123  18.151  -7.016  1.00 0.00 ? 505 GLU A OE2  1  
ATOM   1223  H  H    . GLU A 1 84 ? -4.138  18.078  -7.007  1.00 0.00 ? 505 GLU A H    1  
ATOM   1224  H  HA   . GLU A 1 84 ? -4.090  20.207  -5.277  1.00 0.00 ? 505 GLU A HA   1  
ATOM   1225  H  HB2  . GLU A 1 84 ? -6.532  20.366  -5.606  1.00 0.00 ? 505 GLU A HB2  1  
ATOM   1226  H  HB3  . GLU A 1 84 ? -5.670  20.081  -7.112  1.00 0.00 ? 505 GLU A HB3  1  
ATOM   1227  H  HG2  . GLU A 1 84 ? -6.260  17.710  -6.996  1.00 0.00 ? 505 GLU A HG2  1  
ATOM   1228  H  HG3  . GLU A 1 84 ? -7.140  18.009  -5.498  1.00 0.00 ? 505 GLU A HG3  1  
ATOM   1229  N  N    . LYS A 1 85 ? -5.412  19.739  -3.102  1.00 0.00 ? 506 LYS A N    1  
ATOM   1230  C  CA   . LYS A 1 85 ? -5.790  19.393  -1.737  1.00 0.00 ? 506 LYS A CA   1  
ATOM   1231  C  C    . LYS A 1 85 ? -6.475  20.569  -1.048  1.00 0.00 ? 506 LYS A C    1  
ATOM   1232  O  O    . LYS A 1 85 ? -6.245  21.726  -1.401  1.00 0.00 ? 506 LYS A O    1  
ATOM   1233  C  CB   . LYS A 1 85 ? -4.557  18.967  -0.937  1.00 0.00 ? 506 LYS A CB   1  
ATOM   1234  C  CG   . LYS A 1 85 ? -3.548  20.084  -0.733  1.00 0.00 ? 506 LYS A CG   1  
ATOM   1235  C  CD   . LYS A 1 85 ? -2.656  19.817  0.467   1.00 0.00 ? 506 LYS A CD   1  
ATOM   1236  C  CE   . LYS A 1 85 ? -1.439  18.990  0.084   1.00 0.00 ? 506 LYS A CE   1  
ATOM   1237  N  NZ   . LYS A 1 85 ? -0.380  19.822  -0.552  1.00 0.00 ? 506 LYS A NZ   1  
ATOM   1238  H  H    . LYS A 1 85 ? -5.421  20.680  -3.377  1.00 0.00 ? 506 LYS A H    1  
ATOM   1239  H  HA   . LYS A 1 85 ? -6.482  18.566  -1.784  1.00 0.00 ? 506 LYS A HA   1  
ATOM   1240  H  HB2  . LYS A 1 85 ? -4.877  18.617  0.034   1.00 0.00 ? 506 LYS A HB2  1  
ATOM   1241  H  HB3  . LYS A 1 85 ? -4.066  18.158  -1.459  1.00 0.00 ? 506 LYS A HB3  1  
ATOM   1242  H  HG2  . LYS A 1 85 ? -2.931  20.165  -1.615  1.00 0.00 ? 506 LYS A HG2  1  
ATOM   1243  H  HG3  . LYS A 1 85 ? -4.080  21.012  -0.576  1.00 0.00 ? 506 LYS A HG3  1  
ATOM   1244  H  HD2  . LYS A 1 85 ? -2.323  20.760  0.874   1.00 0.00 ? 506 LYS A HD2  1  
ATOM   1245  H  HD3  . LYS A 1 85 ? -3.224  19.281  1.215   1.00 0.00 ? 506 LYS A HD3  1  
ATOM   1246  H  HE2  . LYS A 1 85 ? -1.037  18.531  0.974   1.00 0.00 ? 506 LYS A HE2  1  
ATOM   1247  H  HE3  . LYS A 1 85 ? -1.746  18.221  -0.610  1.00 0.00 ? 506 LYS A HE3  1  
ATOM   1248  H  HZ1  . LYS A 1 85 ? -0.203  19.494  -1.523  1.00 0.00 ? 506 LYS A HZ1  1  
ATOM   1249  H  HZ2  . LYS A 1 85 ? 0.503   19.754  -0.009  1.00 0.00 ? 506 LYS A HZ2  1  
ATOM   1250  H  HZ3  . LYS A 1 85 ? -0.679  20.818  -0.583  1.00 0.00 ? 506 LYS A HZ3  1  
ATOM   1251  N  N    . GLU A 1 86 ? -7.315  20.265  -0.064  1.00 0.00 ? 507 GLU A N    1  
ATOM   1252  C  CA   . GLU A 1 86 ? -8.032  21.298  0.674   1.00 0.00 ? 507 GLU A CA   1  
ATOM   1253  C  C    . GLU A 1 86 ? -8.688  20.718  1.924   1.00 0.00 ? 507 GLU A C    1  
ATOM   1254  O  O    . GLU A 1 86 ? -8.659  19.508  2.149   1.00 0.00 ? 507 GLU A O    1  
ATOM   1255  C  CB   . GLU A 1 86 ? -9.093  21.949  -0.216  1.00 0.00 ? 507 GLU A CB   1  
ATOM   1256  C  CG   . GLU A 1 86 ? -10.092 20.961  -0.795  1.00 0.00 ? 507 GLU A CG   1  
ATOM   1257  C  CD   . GLU A 1 86 ? -10.881 21.539  -1.953  1.00 0.00 ? 507 GLU A CD   1  
ATOM   1258  O  OE1  . GLU A 1 86 ? -10.991 22.781  -2.034  1.00 0.00 ? 507 GLU A OE1  1  
ATOM   1259  O  OE2  . GLU A 1 86 ? -11.388 20.751  -2.779  1.00 0.00 ? 507 GLU A OE2  1  
ATOM   1260  H  H    . GLU A 1 86 ? -7.457  19.324  0.171   1.00 0.00 ? 507 GLU A H    1  
ATOM   1261  H  HA   . GLU A 1 86 ? -7.317  22.049  0.973   1.00 0.00 ? 507 GLU A HA   1  
ATOM   1262  H  HB2  . GLU A 1 86 ? -9.636  22.679  0.366   1.00 0.00 ? 507 GLU A HB2  1  
ATOM   1263  H  HB3  . GLU A 1 86 ? -8.599  22.450  -1.036  1.00 0.00 ? 507 GLU A HB3  1  
ATOM   1264  H  HG2  . GLU A 1 86 ? -9.557  20.090  -1.143  1.00 0.00 ? 507 GLU A HG2  1  
ATOM   1265  H  HG3  . GLU A 1 86 ? -10.783 20.670  -0.017  1.00 0.00 ? 507 GLU A HG3  1  
ATOM   1266  N  N    . VAL A 1 87 ? -9.278  21.591  2.735   1.00 0.00 ? 508 VAL A N    1  
ATOM   1267  C  CA   . VAL A 1 87 ? -9.941  21.167  3.962   1.00 0.00 ? 508 VAL A CA   1  
ATOM   1268  C  C    . VAL A 1 87 ? -11.457 21.185  3.802   1.00 0.00 ? 508 VAL A C    1  
ATOM   1269  O  O    . VAL A 1 87 ? -12.083 22.243  3.846   1.00 0.00 ? 508 VAL A O    1  
ATOM   1270  C  CB   . VAL A 1 87 ? -9.551  22.066  5.150   1.00 0.00 ? 508 VAL A CB   1  
ATOM   1271  C  CG1  . VAL A 1 87 ? -10.285 21.634  6.410   1.00 0.00 ? 508 VAL A CG1  1  
ATOM   1272  C  CG2  . VAL A 1 87 ? -8.045  22.039  5.366   1.00 0.00 ? 508 VAL A CG2  1  
ATOM   1273  H  H    . VAL A 1 87 ? -9.267  22.543  2.502   1.00 0.00 ? 508 VAL A H    1  
ATOM   1274  H  HA   . VAL A 1 87 ? -9.624  20.158  4.182   1.00 0.00 ? 508 VAL A HA   1  
ATOM   1275  H  HB   . VAL A 1 87 ? -9.843  23.080  4.920   1.00 0.00 ? 508 VAL A HB   1  
ATOM   1276  H  HG11 . VAL A 1 87 ? -10.090 22.344  7.201   1.00 0.00 ? 508 VAL A HG11 1  
ATOM   1277  H  HG12 . VAL A 1 87 ? -11.347 21.595  6.213   1.00 0.00 ? 508 VAL A HG12 1  
ATOM   1278  H  HG13 . VAL A 1 87 ? -9.939  20.656  6.712   1.00 0.00 ? 508 VAL A HG13 1  
ATOM   1279  H  HG21 . VAL A 1 87 ? -7.580  21.459  4.583   1.00 0.00 ? 508 VAL A HG21 1  
ATOM   1280  H  HG22 . VAL A 1 87 ? -7.660  23.049  5.342   1.00 0.00 ? 508 VAL A HG22 1  
ATOM   1281  H  HG23 . VAL A 1 87 ? -7.826  21.593  6.324   1.00 0.00 ? 508 VAL A HG23 1  
ATOM   1282  N  N    . GLU A 1 88 ? -12.041 20.005  3.616   1.00 0.00 ? 509 GLU A N    1  
ATOM   1283  C  CA   . GLU A 1 88 ? -13.485 19.886  3.449   1.00 0.00 ? 509 GLU A CA   1  
ATOM   1284  C  C    . GLU A 1 88 ? -14.224 20.645  4.547   1.00 0.00 ? 509 GLU A C    1  
ATOM   1285  O  O    . GLU A 1 88 ? -13.769 20.703  5.689   1.00 0.00 ? 509 GLU A O    1  
ATOM   1286  C  CB   . GLU A 1 88 ? -13.902 18.414  3.461   1.00 0.00 ? 509 GLU A CB   1  
ATOM   1287  C  CG   . GLU A 1 88 ? -13.698 17.734  4.805   1.00 0.00 ? 509 GLU A CG   1  
ATOM   1288  C  CD   . GLU A 1 88 ? -14.292 16.340  4.849   1.00 0.00 ? 509 GLU A CD   1  
ATOM   1289  O  OE1  . GLU A 1 88 ? -15.355 16.128  4.229   1.00 0.00 ? 509 GLU A OE1  1  
ATOM   1290  O  OE2  . GLU A 1 88 ? -13.694 15.461  5.504   1.00 0.00 ? 509 GLU A OE2  1  
ATOM   1291  H  H    . GLU A 1 88 ? -11.488 19.196  3.590   1.00 0.00 ? 509 GLU A H    1  
ATOM   1292  H  HA   . GLU A 1 88 ? -13.744 20.316  2.494   1.00 0.00 ? 509 GLU A HA   1  
ATOM   1293  H  HB2  . GLU A 1 88 ? -14.948 18.347  3.202   1.00 0.00 ? 509 GLU A HB2  1  
ATOM   1294  H  HB3  . GLU A 1 88 ? -13.322 17.882  2.721   1.00 0.00 ? 509 GLU A HB3  1  
ATOM   1295  H  HG2  . GLU A 1 88 ? -12.639 17.664  5.002   1.00 0.00 ? 509 GLU A HG2  1  
ATOM   1296  H  HG3  . GLU A 1 88 ? -14.167 18.334  5.572   1.00 0.00 ? 509 GLU A HG3  1  
ATOM   1297  N  N    . GLU A 1 89 ? -15.366 21.224  4.192   1.00 0.00 ? 510 GLU A N    1  
ATOM   1298  C  CA   . GLU A 1 89 ? -16.168 21.981  5.147   1.00 0.00 ? 510 GLU A CA   1  
ATOM   1299  C  C    . GLU A 1 89 ? -16.871 21.046  6.128   1.00 0.00 ? 510 GLU A C    1  
ATOM   1300  O  O    . GLU A 1 89 ? -17.502 20.068  5.726   1.00 0.00 ? 510 GLU A O    1  
ATOM   1301  C  CB   . GLU A 1 89 ? -17.200 22.839  4.413   1.00 0.00 ? 510 GLU A CB   1  
ATOM   1302  C  CG   . GLU A 1 89 ? -16.690 24.222  4.044   1.00 0.00 ? 510 GLU A CG   1  
ATOM   1303  C  CD   . GLU A 1 89 ? -17.499 24.864  2.933   1.00 0.00 ? 510 GLU A CD   1  
ATOM   1304  O  OE1  . GLU A 1 89 ? -18.650 25.269  3.195   1.00 0.00 ? 510 GLU A OE1  1  
ATOM   1305  O  OE2  . GLU A 1 89 ? -16.978 24.962  1.802   1.00 0.00 ? 510 GLU A OE2  1  
ATOM   1306  H  H    . GLU A 1 89 ? -15.677 21.142  3.266   1.00 0.00 ? 510 GLU A H    1  
ATOM   1307  H  HA   . GLU A 1 89 ? -15.503 22.628  5.699   1.00 0.00 ? 510 GLU A HA   1  
ATOM   1308  H  HB2  . GLU A 1 89 ? -17.494 22.331  3.506   1.00 0.00 ? 510 GLU A HB2  1  
ATOM   1309  H  HB3  . GLU A 1 89 ? -18.068 22.956  5.046   1.00 0.00 ? 510 GLU A HB3  1  
ATOM   1310  H  HG2  . GLU A 1 89 ? -16.740 24.855  4.917   1.00 0.00 ? 510 GLU A HG2  1  
ATOM   1311  H  HG3  . GLU A 1 89 ? -15.663 24.138  3.719   1.00 0.00 ? 510 GLU A HG3  1  
ATOM   1312  N  N    . LEU A 1 90 ? -16.757 21.355  7.415   1.00 0.00 ? 511 LEU A N    1  
ATOM   1313  C  CA   . LEU A 1 90 ? -17.381 20.544  8.454   1.00 0.00 ? 511 LEU A CA   1  
ATOM   1314  C  C    . LEU A 1 90 ? -18.899 20.695  8.425   1.00 0.00 ? 511 LEU A C    1  
ATOM   1315  O  O    . LEU A 1 90 ? -19.634 19.713  8.531   1.00 0.00 ? 511 LEU A O    1  
ATOM   1316  C  CB   . LEU A 1 90 ? -16.844 20.941  9.830   1.00 0.00 ? 511 LEU A CB   1  
ATOM   1317  C  CG   . LEU A 1 90 ? -15.541 20.267  10.261  1.00 0.00 ? 511 LEU A CG   1  
ATOM   1318  C  CD1  . LEU A 1 90 ? -14.883 21.048  11.388  1.00 0.00 ? 511 LEU A CD1  1  
ATOM   1319  C  CD2  . LEU A 1 90 ? -15.799 18.829  10.687  1.00 0.00 ? 511 LEU A CD2  1  
ATOM   1320  H  H    . LEU A 1 90 ? -16.242 22.147  7.673   1.00 0.00 ? 511 LEU A H    1  
ATOM   1321  H  HA   . LEU A 1 90 ? -17.131 19.511  8.263   1.00 0.00 ? 511 LEU A HA   1  
ATOM   1322  H  HB2  . LEU A 1 90 ? -16.678 22.007  9.825   1.00 0.00 ? 511 LEU A HB2  1  
ATOM   1323  H  HB3  . LEU A 1 90 ? -17.601 20.699  10.562  1.00 0.00 ? 511 LEU A HB3  1  
ATOM   1324  H  HG   . LEU A 1 90 ? -14.857 20.251  9.424   1.00 0.00 ? 511 LEU A HG   1  
ATOM   1325  H  HD11 . LEU A 1 90 ? -13.867 21.289  11.115  1.00 0.00 ? 511 LEU A HD11 1  
ATOM   1326  H  HD12 . LEU A 1 90 ? -14.882 20.450  12.288  1.00 0.00 ? 511 LEU A HD12 1  
ATOM   1327  H  HD13 . LEU A 1 90 ? -15.435 21.960  11.564  1.00 0.00 ? 511 LEU A HD13 1  
ATOM   1328  H  HD21 . LEU A 1 90 ? -14.860 18.344  10.907  1.00 0.00 ? 511 LEU A HD21 1  
ATOM   1329  H  HD22 . LEU A 1 90 ? -16.298 18.301  9.887   1.00 0.00 ? 511 LEU A HD22 1  
ATOM   1330  H  HD23 . LEU A 1 90 ? -16.424 18.821  11.568  1.00 0.00 ? 511 LEU A HD23 1  
ATOM   1331  N  N    . LYS A 1 91 ? -19.362 21.932  8.279   1.00 0.00 ? 512 LYS A N    1  
ATOM   1332  C  CA   . LYS A 1 91 ? -20.792 22.213  8.233   1.00 0.00 ? 512 LYS A CA   1  
ATOM   1333  C  C    . LYS A 1 91 ? -21.049 23.653  7.800   1.00 0.00 ? 512 LYS A C    1  
ATOM   1334  O  O    . LYS A 1 91 ? -20.816 24.592  8.561   1.00 0.00 ? 512 LYS A O    1  
ATOM   1335  C  CB   . LYS A 1 91 ? -21.427 21.960  9.602   1.00 0.00 ? 512 LYS A CB   1  
ATOM   1336  C  CG   . LYS A 1 91 ? -22.938 21.809  9.553   1.00 0.00 ? 512 LYS A CG   1  
ATOM   1337  C  CD   . LYS A 1 91 ? -23.637 23.151  9.693   1.00 0.00 ? 512 LYS A CD   1  
ATOM   1338  C  CE   . LYS A 1 91 ? -25.139 23.021  9.488   1.00 0.00 ? 512 LYS A CE   1  
ATOM   1339  N  NZ   . LYS A 1 91 ? -25.805 22.382  10.657  1.00 0.00 ? 512 LYS A NZ   1  
ATOM   1340  H  H    . LYS A 1 91 ? -18.726 22.674  8.200   1.00 0.00 ? 512 LYS A H    1  
ATOM   1341  H  HA   . LYS A 1 91 ? -21.238 21.547  7.510   1.00 0.00 ? 512 LYS A HA   1  
ATOM   1342  H  HB2  . LYS A 1 91 ? -21.010 21.055  10.017  1.00 0.00 ? 512 LYS A HB2  1  
ATOM   1343  H  HB3  . LYS A 1 91 ? -21.191 22.788  10.254  1.00 0.00 ? 512 LYS A HB3  1  
ATOM   1344  H  HG2  . LYS A 1 91 ? -23.216 21.367  8.607   1.00 0.00 ? 512 LYS A HG2  1  
ATOM   1345  H  HG3  . LYS A 1 91 ? -23.253 21.163  10.360  1.00 0.00 ? 512 LYS A HG3  1  
ATOM   1346  H  HD2  . LYS A 1 91 ? -23.453 23.542  10.682  1.00 0.00 ? 512 LYS A HD2  1  
ATOM   1347  H  HD3  . LYS A 1 91 ? -23.240 23.833  8.954   1.00 0.00 ? 512 LYS A HD3  1  
ATOM   1348  H  HE2  . LYS A 1 91 ? -25.555 24.005  9.341   1.00 0.00 ? 512 LYS A HE2  1  
ATOM   1349  H  HE3  . LYS A 1 91 ? -25.318 22.419  8.609   1.00 0.00 ? 512 LYS A HE3  1  
ATOM   1350  H  HZ1  . LYS A 1 91 ? -25.729 22.999  11.491  1.00 0.00 ? 512 LYS A HZ1  1  
ATOM   1351  H  HZ2  . LYS A 1 91 ? -25.353 21.471  10.872  1.00 0.00 ? 512 LYS A HZ2  1  
ATOM   1352  H  HZ3  . LYS A 1 91 ? -26.810 22.218  10.450  1.00 0.00 ? 512 LYS A HZ3  1  
ATOM   1353  N  N    . LYS A 1 92 ? -21.533 23.820  6.574   1.00 0.00 ? 513 LYS A N    1  
ATOM   1354  C  CA   . LYS A 1 92 ? -21.826 25.145  6.040   1.00 0.00 ? 513 LYS A CA   1  
ATOM   1355  C  C    . LYS A 1 92 ? -23.194 25.630  6.507   1.00 0.00 ? 513 LYS A C    1  
ATOM   1356  O  O    . LYS A 1 92 ? -24.117 24.835  6.687   1.00 0.00 ? 513 LYS A O    1  
ATOM   1357  C  CB   . LYS A 1 92 ? -21.775 25.123  4.510   1.00 0.00 ? 513 LYS A CB   1  
ATOM   1358  C  CG   . LYS A 1 92 ? -21.573 26.494  3.889   1.00 0.00 ? 513 LYS A CG   1  
ATOM   1359  C  CD   . LYS A 1 92 ? -21.996 26.513  2.430   1.00 0.00 ? 513 LYS A CD   1  
ATOM   1360  C  CE   . LYS A 1 92 ? -22.103 27.935  1.899   1.00 0.00 ? 513 LYS A CE   1  
ATOM   1361  N  NZ   . LYS A 1 92 ? -22.750 27.979  0.558   1.00 0.00 ? 513 LYS A NZ   1  
ATOM   1362  H  H    . LYS A 1 92 ? -21.699 23.032  6.014   1.00 0.00 ? 513 LYS A H    1  
ATOM   1363  H  HA   . LYS A 1 92 ? -21.071 25.824  6.407   1.00 0.00 ? 513 LYS A HA   1  
ATOM   1364  H  HB2  . LYS A 1 92 ? -20.961 24.486  4.198   1.00 0.00 ? 513 LYS A HB2  1  
ATOM   1365  H  HB3  . LYS A 1 92 ? -22.704 24.715  4.137   1.00 0.00 ? 513 LYS A HB3  1  
ATOM   1366  H  HG2  . LYS A 1 92 ? -22.163 27.217  4.433   1.00 0.00 ? 513 LYS A HG2  1  
ATOM   1367  H  HG3  . LYS A 1 92 ? -20.527 26.759  3.955   1.00 0.00 ? 513 LYS A HG3  1  
ATOM   1368  H  HD2  . LYS A 1 92 ? -21.265 25.977  1.845   1.00 0.00 ? 513 LYS A HD2  1  
ATOM   1369  H  HD3  . LYS A 1 92 ? -22.959 26.030  2.337   1.00 0.00 ? 513 LYS A HD3  1  
ATOM   1370  H  HE2  . LYS A 1 92 ? -22.689 28.520  2.591   1.00 0.00 ? 513 LYS A HE2  1  
ATOM   1371  H  HE3  . LYS A 1 92 ? -21.110 28.353  1.825   1.00 0.00 ? 513 LYS A HE3  1  
ATOM   1372  H  HZ1  . LYS A 1 92 ? -22.064 27.716  -0.178  1.00 0.00 ? 513 LYS A HZ1  1  
ATOM   1373  H  HZ2  . LYS A 1 92 ? -23.101 28.938  0.362   1.00 0.00 ? 513 LYS A HZ2  1  
ATOM   1374  H  HZ3  . LYS A 1 92 ? -23.549 27.315  0.525   1.00 0.00 ? 513 LYS A HZ3  1  
ATOM   1375  N  N    . SER A 1 93 ? -23.319 26.939  6.700   1.00 0.00 ? 514 SER A N    1  
ATOM   1376  C  CA   . SER A 1 93 ? -24.574 27.529  7.149   1.00 0.00 ? 514 SER A CA   1  
ATOM   1377  C  C    . SER A 1 93 ? -25.722 27.130  6.227   1.00 0.00 ? 514 SER A C    1  
ATOM   1378  O  O    . SER A 1 93 ? -25.548 27.013  5.014   1.00 0.00 ? 514 SER A O    1  
ATOM   1379  C  CB   . SER A 1 93 ? -24.455 29.054  7.202   1.00 0.00 ? 514 SER A CB   1  
ATOM   1380  O  OG   . SER A 1 93 ? -24.324 29.601  5.902   1.00 0.00 ? 514 SER A OG   1  
ATOM   1381  H  H    . SER A 1 93 ? -22.547 27.521  6.540   1.00 0.00 ? 514 SER A H    1  
ATOM   1382  H  HA   . SER A 1 93 ? -24.780 27.158  8.141   1.00 0.00 ? 514 SER A HA   1  
ATOM   1383  H  HB2  . SER A 1 93 ? -25.339 29.465  7.665   1.00 0.00 ? 514 SER A HB2  1  
ATOM   1384  H  HB3  . SER A 1 93 ? -23.585 29.324  7.783   1.00 0.00 ? 514 SER A HB3  1  
ATOM   1385  H  HG   . SER A 1 93 ? -25.047 29.293  5.350   1.00 0.00 ? 514 SER A HG   1  
ATOM   1386  N  N    . GLY A 1 94 ? -26.898 26.921  6.812   1.00 0.00 ? 515 GLY A N    1  
ATOM   1387  C  CA   . GLY A 1 94 ? -28.058 26.537  6.029   1.00 0.00 ? 515 GLY A CA   1  
ATOM   1388  C  C    . GLY A 1 94 ? -29.273 27.389  6.337   1.00 0.00 ? 515 GLY A C    1  
ATOM   1389  O  O    . GLY A 1 94 ? -29.418 27.930  7.433   1.00 0.00 ? 515 GLY A O    1  
ATOM   1390  H  H    . GLY A 1 94 ? -26.978 27.029  7.783   1.00 0.00 ? 515 GLY A H    1  
ATOM   1391  H  HA2  . GLY A 1 94 ? -27.820 26.633  4.981   1.00 0.00 ? 515 GLY A HA2  1  
ATOM   1392  H  HA3  . GLY A 1 94 ? -28.295 25.504  6.241   1.00 0.00 ? 515 GLY A HA3  1  
ATOM   1393  N  N    . PRO A 1 95 ? -30.173 27.520  5.351   1.00 0.00 ? 516 PRO A N    1  
ATOM   1394  C  CA   . PRO A 1 95 ? -31.398 28.313  5.497   1.00 0.00 ? 516 PRO A CA   1  
ATOM   1395  C  C    . PRO A 1 95 ? -32.394 27.670  6.455   1.00 0.00 ? 516 PRO A C    1  
ATOM   1396  O  O    . PRO A 1 95 ? -32.091 26.666  7.100   1.00 0.00 ? 516 PRO A O    1  
ATOM   1397  C  CB   . PRO A 1 95 ? -31.968 28.351  4.077   1.00 0.00 ? 516 PRO A CB   1  
ATOM   1398  C  CG   . PRO A 1 95 ? -31.427 27.129  3.420   1.00 0.00 ? 516 PRO A CG   1  
ATOM   1399  C  CD   . PRO A 1 95 ? -30.066 26.904  4.018   1.00 0.00 ? 516 PRO A CD   1  
ATOM   1400  H  HA   . PRO A 1 95 ? -31.182 29.319  5.827   1.00 0.00 ? 516 PRO A HA   1  
ATOM   1401  H  HB2  . PRO A 1 95 ? -33.048 28.333  4.120   1.00 0.00 ? 516 PRO A HB2  1  
ATOM   1402  H  HB3  . PRO A 1 95 ? -31.637 29.248  3.576   1.00 0.00 ? 516 PRO A HB3  1  
ATOM   1403  H  HG2  . PRO A 1 95 ? -32.070 26.286  3.624   1.00 0.00 ? 516 PRO A HG2  1  
ATOM   1404  H  HG3  . PRO A 1 95 ? -31.346 27.291  2.355   1.00 0.00 ? 516 PRO A HG3  1  
ATOM   1405  H  HD2  . PRO A 1 95 ? -29.858 25.847  4.097   1.00 0.00 ? 516 PRO A HD2  1  
ATOM   1406  H  HD3  . PRO A 1 95 ? -29.308 27.396  3.426   1.00 0.00 ? 516 PRO A HD3  1  
ATOM   1407  N  N    . SER A 1 96 ? -33.586 28.253  6.542   1.00 0.00 ? 517 SER A N    1  
ATOM   1408  C  CA   . SER A 1 96 ? -34.626 27.737  7.424   1.00 0.00 ? 517 SER A CA   1  
ATOM   1409  C  C    . SER A 1 96 ? -35.839 27.276  6.621   1.00 0.00 ? 517 SER A C    1  
ATOM   1410  O  O    . SER A 1 96 ? -36.020 27.668  5.468   1.00 0.00 ? 517 SER A O    1  
ATOM   1411  C  CB   . SER A 1 96 ? -35.046 28.808  8.433   1.00 0.00 ? 517 SER A CB   1  
ATOM   1412  O  OG   . SER A 1 96 ? -35.491 28.221  9.644   1.00 0.00 ? 517 SER A OG   1  
ATOM   1413  H  H    . SER A 1 96 ? -33.768 29.050  6.002   1.00 0.00 ? 517 SER A H    1  
ATOM   1414  H  HA   . SER A 1 96 ? -34.220 26.891  7.958   1.00 0.00 ? 517 SER A HA   1  
ATOM   1415  H  HB2  . SER A 1 96 ? -34.204 29.448  8.646   1.00 0.00 ? 517 SER A HB2  1  
ATOM   1416  H  HB3  . SER A 1 96 ? -35.850 29.397  8.015   1.00 0.00 ? 517 SER A HB3  1  
ATOM   1417  H  HG   . SER A 1 96 ? -36.412 27.965  9.556   1.00 0.00 ? 517 SER A HG   1  
ATOM   1418  N  N    . SER A 1 97 ? -36.667 26.440  7.240   1.00 0.00 ? 518 SER A N    1  
ATOM   1419  C  CA   . SER A 1 97 ? -37.861 25.921  6.583   1.00 0.00 ? 518 SER A CA   1  
ATOM   1420  C  C    . SER A 1 97 ? -39.039 25.880  7.551   1.00 0.00 ? 518 SER A C    1  
ATOM   1421  O  O    . SER A 1 97 ? -38.910 25.417  8.684   1.00 0.00 ? 518 SER A O    1  
ATOM   1422  C  CB   . SER A 1 97 ? -37.595 24.522  6.026   1.00 0.00 ? 518 SER A CB   1  
ATOM   1423  O  OG   . SER A 1 97 ? -38.379 24.274  4.872   1.00 0.00 ? 518 SER A OG   1  
ATOM   1424  H  H    . SER A 1 97 ? -36.469 26.164  8.159   1.00 0.00 ? 518 SER A H    1  
ATOM   1425  H  HA   . SER A 1 97 ? -38.105 26.584  5.766   1.00 0.00 ? 518 SER A HA   1  
ATOM   1426  H  HB2  . SER A 1 97 ? -36.552 24.434  5.762   1.00 0.00 ? 518 SER A HB2  1  
ATOM   1427  H  HB3  . SER A 1 97 ? -37.839 23.785  6.778   1.00 0.00 ? 518 SER A HB3  1  
ATOM   1428  H  HG   . SER A 1 97 ? -38.602 25.108  4.451   1.00 0.00 ? 518 SER A HG   1  
ATOM   1429  N  N    . GLY A 1 98 ? -40.189 26.368  7.096   1.00 0.00 ? 519 GLY A N    1  
ATOM   1430  C  CA   . GLY A 1 98 ? -41.374 26.378  7.933   1.00 0.00 ? 519 GLY A CA   1  
ATOM   1431  C  C    . GLY A 1 98 ? -42.634 26.040  7.160   1.00 0.00 ? 519 GLY A C    1  
ATOM   1432  O  O    . GLY A 1 98 ? -42.534 25.620  6.008   1.00 0.00 ? 519 GLY A O    1  
ATOM   1433  H  H    . GLY A 1 98 ? -40.233 26.724  6.184   1.00 0.00 ? 519 GLY A H    1  
ATOM   1434  H  HA2  . GLY A 1 98 ? -41.247 25.657  8.727   1.00 0.00 ? 519 GLY A HA2  1  
ATOM   1435  H  HA3  . GLY A 1 98 ? -41.486 27.361  8.368   1.00 0.00 ? 519 GLY A HA3  1  
HETATM 1436  ZN ZN   . ZN  B 2 .  ? -0.623  -8.157  -11.012 1.00 0.00 ? 622 ZN  A ZN   1  
HETATM 1437  ZN ZN   . ZN  C 2 .  ? -0.575  -3.326  5.866   1.00 0.00 ? 822 ZN  A ZN   1  
ATOM   1438  N  N    . GLY A 1 1  ? 35.934  -21.088 -3.425  1.00 0.00 ? 422 GLY A N    2  
ATOM   1439  C  CA   . GLY A 1 1  ? 36.159  -19.817 -4.088  1.00 0.00 ? 422 GLY A CA   2  
ATOM   1440  C  C    . GLY A 1 1  ? 35.224  -19.602 -5.262  1.00 0.00 ? 422 GLY A C    2  
ATOM   1441  O  O    . GLY A 1 1  ? 34.540  -18.582 -5.341  1.00 0.00 ? 422 GLY A O    2  
ATOM   1442  H  H1   . GLY A 1 1  ? 35.038  -21.486 -3.423  1.00 0.00 ? 422 GLY A H1   2  
ATOM   1443  H  HA2  . GLY A 1 1  ? 36.013  -19.021 -3.374  1.00 0.00 ? 422 GLY A HA2  2  
ATOM   1444  H  HA3  . GLY A 1 1  ? 37.178  -19.786 -4.445  1.00 0.00 ? 422 GLY A HA3  2  
ATOM   1445  N  N    . SER A 1 2  ? 35.194  -20.565 -6.177  1.00 0.00 ? 423 SER A N    2  
ATOM   1446  C  CA   . SER A 1 2  ? 34.340  -20.474 -7.356  1.00 0.00 ? 423 SER A CA   2  
ATOM   1447  C  C    . SER A 1 2  ? 33.029  -19.768 -7.023  1.00 0.00 ? 423 SER A C    2  
ATOM   1448  O  O    . SER A 1 2  ? 32.418  -20.027 -5.986  1.00 0.00 ? 423 SER A O    2  
ATOM   1449  C  CB   . SER A 1 2  ? 34.054  -21.869 -7.914  1.00 0.00 ? 423 SER A CB   2  
ATOM   1450  O  OG   . SER A 1 2  ? 33.080  -21.818 -8.942  1.00 0.00 ? 423 SER A OG   2  
ATOM   1451  H  H    . SER A 1 2  ? 35.763  -21.355 -6.059  1.00 0.00 ? 423 SER A H    2  
ATOM   1452  H  HA   . SER A 1 2  ? 34.866  -19.898 -8.102  1.00 0.00 ? 423 SER A HA   2  
ATOM   1453  H  HB2  . SER A 1 2  ? 34.964  -22.286 -8.318  1.00 0.00 ? 423 SER A HB2  2  
ATOM   1454  H  HB3  . SER A 1 2  ? 33.689  -22.504 -7.119  1.00 0.00 ? 423 SER A HB3  2  
ATOM   1455  H  HG   . SER A 1 2  ? 32.290  -22.283 -8.658  1.00 0.00 ? 423 SER A HG   2  
ATOM   1456  N  N    . SER A 1 3  ? 32.603  -18.875 -7.910  1.00 0.00 ? 424 SER A N    2  
ATOM   1457  C  CA   . SER A 1 3  ? 31.367  -18.129 -7.711  1.00 0.00 ? 424 SER A CA   2  
ATOM   1458  C  C    . SER A 1 3  ? 30.282  -18.607 -8.670  1.00 0.00 ? 424 SER A C    2  
ATOM   1459  O  O    . SER A 1 3  ? 30.572  -19.070 -9.773  1.00 0.00 ? 424 SER A O    2  
ATOM   1460  C  CB   . SER A 1 3  ? 31.613  -16.631 -7.907  1.00 0.00 ? 424 SER A CB   2  
ATOM   1461  O  OG   . SER A 1 3  ? 30.645  -15.861 -7.216  1.00 0.00 ? 424 SER A OG   2  
ATOM   1462  H  H    . SER A 1 3  ? 33.135  -18.713 -8.718  1.00 0.00 ? 424 SER A H    2  
ATOM   1463  H  HA   . SER A 1 3  ? 31.036  -18.301 -6.697  1.00 0.00 ? 424 SER A HA   2  
ATOM   1464  H  HB2  . SER A 1 3  ? 32.592  -16.378 -7.531  1.00 0.00 ? 424 SER A HB2  2  
ATOM   1465  H  HB3  . SER A 1 3  ? 31.559  -16.396 -8.960  1.00 0.00 ? 424 SER A HB3  2  
ATOM   1466  H  HG   . SER A 1 3  ? 30.234  -15.242 -7.824  1.00 0.00 ? 424 SER A HG   2  
ATOM   1467  N  N    . GLY A 1 4  ? 29.028  -18.492 -8.242  1.00 0.00 ? 425 GLY A N    2  
ATOM   1468  C  CA   . GLY A 1 4  ? 27.918  -18.917 -9.074  1.00 0.00 ? 425 GLY A CA   2  
ATOM   1469  C  C    . GLY A 1 4  ? 27.506  -17.858 -10.077 1.00 0.00 ? 425 GLY A C    2  
ATOM   1470  O  O    . GLY A 1 4  ? 28.194  -16.851 -10.244 1.00 0.00 ? 425 GLY A O    2  
ATOM   1471  H  H    . GLY A 1 4  ? 28.856  -18.116 -7.353  1.00 0.00 ? 425 GLY A H    2  
ATOM   1472  H  HA2  . GLY A 1 4  ? 28.203  -19.812 -9.607  1.00 0.00 ? 425 GLY A HA2  2  
ATOM   1473  H  HA3  . GLY A 1 4  ? 27.073  -19.142 -8.439  1.00 0.00 ? 425 GLY A HA3  2  
ATOM   1474  N  N    . SER A 1 5  ? 26.382  -18.086 -10.749 1.00 0.00 ? 426 SER A N    2  
ATOM   1475  C  CA   . SER A 1 5  ? 25.884  -17.145 -11.746 1.00 0.00 ? 426 SER A CA   2  
ATOM   1476  C  C    . SER A 1 5  ? 24.362  -17.206 -11.836 1.00 0.00 ? 426 SER A C    2  
ATOM   1477  O  O    . SER A 1 5  ? 23.786  -18.264 -12.090 1.00 0.00 ? 426 SER A O    2  
ATOM   1478  C  CB   . SER A 1 5  ? 26.500  -17.445 -13.114 1.00 0.00 ? 426 SER A CB   2  
ATOM   1479  O  OG   . SER A 1 5  ? 27.910  -17.551 -13.025 1.00 0.00 ? 426 SER A OG   2  
ATOM   1480  H  H    . SER A 1 5  ? 25.878  -18.907 -10.571 1.00 0.00 ? 426 SER A H    2  
ATOM   1481  H  HA   . SER A 1 5  ? 26.175  -16.152 -11.439 1.00 0.00 ? 426 SER A HA   2  
ATOM   1482  H  HB2  . SER A 1 5  ? 26.103  -18.376 -13.488 1.00 0.00 ? 426 SER A HB2  2  
ATOM   1483  H  HB3  . SER A 1 5  ? 26.253  -16.647 -13.799 1.00 0.00 ? 426 SER A HB3  2  
ATOM   1484  H  HG   . SER A 1 5  ? 28.261  -17.859 -13.864 1.00 0.00 ? 426 SER A HG   2  
ATOM   1485  N  N    . SER A 1 6  ? 23.716  -16.063 -11.626 1.00 0.00 ? 427 SER A N    2  
ATOM   1486  C  CA   . SER A 1 6  ? 22.261  -15.986 -11.680 1.00 0.00 ? 427 SER A CA   2  
ATOM   1487  C  C    . SER A 1 6  ? 21.795  -15.454 -13.032 1.00 0.00 ? 427 SER A C    2  
ATOM   1488  O  O    . SER A 1 6  ? 20.791  -15.910 -13.578 1.00 0.00 ? 427 SER A O    2  
ATOM   1489  C  CB   . SER A 1 6  ? 21.735  -15.089 -10.558 1.00 0.00 ? 427 SER A CB   2  
ATOM   1490  O  OG   . SER A 1 6  ? 20.408  -15.439 -10.206 1.00 0.00 ? 427 SER A OG   2  
ATOM   1491  H  H    . SER A 1 6  ? 24.232  -15.253 -11.428 1.00 0.00 ? 427 SER A H    2  
ATOM   1492  H  HA   . SER A 1 6  ? 21.871  -16.984 -11.545 1.00 0.00 ? 427 SER A HA   2  
ATOM   1493  H  HB2  . SER A 1 6  ? 22.366  -15.197 -9.689  1.00 0.00 ? 427 SER A HB2  2  
ATOM   1494  H  HB3  . SER A 1 6  ? 21.749  -14.060 -10.887 1.00 0.00 ? 427 SER A HB3  2  
ATOM   1495  H  HG   . SER A 1 6  ? 20.240  -16.351 -10.454 1.00 0.00 ? 427 SER A HG   2  
ATOM   1496  N  N    . GLY A 1 7  ? 22.534  -14.487 -13.567 1.00 0.00 ? 428 GLY A N    2  
ATOM   1497  C  CA   . GLY A 1 7  ? 22.181  -13.908 -14.850 1.00 0.00 ? 428 GLY A CA   2  
ATOM   1498  C  C    . GLY A 1 7  ? 20.692  -13.656 -14.983 1.00 0.00 ? 428 GLY A C    2  
ATOM   1499  O  O    . GLY A 1 7  ? 20.140  -12.791 -14.304 1.00 0.00 ? 428 GLY A O    2  
ATOM   1500  H  H    . GLY A 1 7  ? 23.324  -14.163 -13.086 1.00 0.00 ? 428 GLY A H    2  
ATOM   1501  H  HA2  . GLY A 1 7  ? 22.706  -12.972 -14.967 1.00 0.00 ? 428 GLY A HA2  2  
ATOM   1502  H  HA3  . GLY A 1 7  ? 22.491  -14.583 -15.634 1.00 0.00 ? 428 GLY A HA3  2  
ATOM   1503  N  N    . GLU A 1 8  ? 20.042  -14.412 -15.862 1.00 0.00 ? 429 GLU A N    2  
ATOM   1504  C  CA   . GLU A 1 8  ? 18.608  -14.263 -16.083 1.00 0.00 ? 429 GLU A CA   2  
ATOM   1505  C  C    . GLU A 1 8  ? 17.851  -14.260 -14.758 1.00 0.00 ? 429 GLU A C    2  
ATOM   1506  O  O    . GLU A 1 8  ? 18.238  -14.940 -13.807 1.00 0.00 ? 429 GLU A O    2  
ATOM   1507  C  CB   . GLU A 1 8  ? 18.088  -15.391 -16.978 1.00 0.00 ? 429 GLU A CB   2  
ATOM   1508  C  CG   . GLU A 1 8  ? 16.581  -15.369 -17.170 1.00 0.00 ? 429 GLU A CG   2  
ATOM   1509  C  CD   . GLU A 1 8  ? 16.050  -16.658 -17.766 1.00 0.00 ? 429 GLU A CD   2  
ATOM   1510  O  OE1  . GLU A 1 8  ? 16.314  -17.732 -17.186 1.00 0.00 ? 429 GLU A OE1  2  
ATOM   1511  O  OE2  . GLU A 1 8  ? 15.371  -16.593 -18.812 1.00 0.00 ? 429 GLU A OE2  2  
ATOM   1512  H  H    . GLU A 1 8  ? 20.537  -15.085 -16.374 1.00 0.00 ? 429 GLU A H    2  
ATOM   1513  H  HA   . GLU A 1 8  ? 18.445  -13.319 -16.579 1.00 0.00 ? 429 GLU A HA   2  
ATOM   1514  H  HB2  . GLU A 1 8  ? 18.556  -15.309 -17.948 1.00 0.00 ? 429 GLU A HB2  2  
ATOM   1515  H  HB3  . GLU A 1 8  ? 18.359  -16.338 -16.536 1.00 0.00 ? 429 GLU A HB3  2  
ATOM   1516  H  HG2  . GLU A 1 8  ? 16.110  -15.213 -16.211 1.00 0.00 ? 429 GLU A HG2  2  
ATOM   1517  H  HG3  . GLU A 1 8  ? 16.327  -14.552 -17.831 1.00 0.00 ? 429 GLU A HG3  2  
ATOM   1518  N  N    . LEU A 1 9  ? 16.770  -13.489 -14.704 1.00 0.00 ? 430 LEU A N    2  
ATOM   1519  C  CA   . LEU A 1 9  ? 15.958  -13.396 -13.496 1.00 0.00 ? 430 LEU A CA   2  
ATOM   1520  C  C    . LEU A 1 9  ? 14.568  -13.981 -13.727 1.00 0.00 ? 430 LEU A C    2  
ATOM   1521  O  O    . LEU A 1 9  ? 13.990  -13.862 -14.808 1.00 0.00 ? 430 LEU A O    2  
ATOM   1522  C  CB   . LEU A 1 9  ? 15.841  -11.938 -13.047 1.00 0.00 ? 430 LEU A CB   2  
ATOM   1523  C  CG   . LEU A 1 9  ? 16.817  -11.491 -11.957 1.00 0.00 ? 430 LEU A CG   2  
ATOM   1524  C  CD1  . LEU A 1 9  ? 18.212  -11.308 -12.533 1.00 0.00 ? 430 LEU A CD1  2  
ATOM   1525  C  CD2  . LEU A 1 9  ? 16.334  -10.204 -11.305 1.00 0.00 ? 430 LEU A CD2  2  
ATOM   1526  H  H    . LEU A 1 9  ? 16.512  -12.971 -15.493 1.00 0.00 ? 430 LEU A H    2  
ATOM   1527  H  HA   . LEU A 1 9  ? 16.450  -13.964 -12.721 1.00 0.00 ? 430 LEU A HA   2  
ATOM   1528  H  HB2  . LEU A 1 9  ? 16.003  -11.312 -13.911 1.00 0.00 ? 430 LEU A HB2  2  
ATOM   1529  H  HB3  . LEU A 1 9  ? 14.837  -11.786 -12.677 1.00 0.00 ? 430 LEU A HB3  2  
ATOM   1530  H  HG   . LEU A 1 9  ? 16.868  -12.255 -11.194 1.00 0.00 ? 430 LEU A HG   2  
ATOM   1531  H  HD11 . LEU A 1 9  ? 18.921  -11.870 -11.943 1.00 0.00 ? 430 LEU A HD11 2  
ATOM   1532  H  HD12 . LEU A 1 9  ? 18.476  -10.261 -12.512 1.00 0.00 ? 430 LEU A HD12 2  
ATOM   1533  H  HD13 . LEU A 1 9  ? 18.231  -11.663 -13.553 1.00 0.00 ? 430 LEU A HD13 2  
ATOM   1534  H  HD21 . LEU A 1 9  ? 16.642  -9.360  -11.904 1.00 0.00 ? 430 LEU A HD21 2  
ATOM   1535  H  HD22 . LEU A 1 9  ? 16.762  -10.119 -10.317 1.00 0.00 ? 430 LEU A HD22 2  
ATOM   1536  H  HD23 . LEU A 1 9  ? 15.257  -10.220 -11.231 1.00 0.00 ? 430 LEU A HD23 2  
ATOM   1537  N  N    . PRO A 1 10 ? 14.016  -14.626 -12.689 1.00 0.00 ? 431 PRO A N    2  
ATOM   1538  C  CA   . PRO A 1 10 ? 12.687  -15.239 -12.754 1.00 0.00 ? 431 PRO A CA   2  
ATOM   1539  C  C    . PRO A 1 10 ? 11.572  -14.201 -12.827 1.00 0.00 ? 431 PRO A C    2  
ATOM   1540  O  O    . PRO A 1 10 ? 11.182  -13.769 -13.912 1.00 0.00 ? 431 PRO A O    2  
ATOM   1541  C  CB   . PRO A 1 10 ? 12.597  -16.030 -11.446 1.00 0.00 ? 431 PRO A CB   2  
ATOM   1542  C  CG   . PRO A 1 10 ? 13.528  -15.331 -10.517 1.00 0.00 ? 431 PRO A CG   2  
ATOM   1543  C  CD   . PRO A 1 10 ? 14.648  -14.805 -11.371 1.00 0.00 ? 431 PRO A CD   2  
ATOM   1544  H  HA   . PRO A 1 10 ? 12.603  -15.916 -13.592 1.00 0.00 ? 431 PRO A HA   2  
ATOM   1545  H  HB2  . PRO A 1 10 ? 11.580  -16.007 -11.078 1.00 0.00 ? 431 PRO A HB2  2  
ATOM   1546  H  HB3  . PRO A 1 10 ? 12.901  -17.051 -11.616 1.00 0.00 ? 431 PRO A HB3  2  
ATOM   1547  H  HG2  . PRO A 1 10 ? 13.017  -14.518 -10.026 1.00 0.00 ? 431 PRO A HG2  2  
ATOM   1548  H  HG3  . PRO A 1 10 ? 13.911  -16.030 -9.787  1.00 0.00 ? 431 PRO A HG3  2  
ATOM   1549  H  HD2  . PRO A 1 10 ? 15.007  -13.863 -10.984 1.00 0.00 ? 431 PRO A HD2  2  
ATOM   1550  H  HD3  . PRO A 1 10 ? 15.452  -15.524 -11.424 1.00 0.00 ? 431 PRO A HD3  2  
ATOM   1551  N  N    . LYS A 1 11 ? 11.063  -13.804 -11.666 1.00 0.00 ? 432 LYS A N    2  
ATOM   1552  C  CA   . LYS A 1 11 ? 9.994   -12.815 -11.597 1.00 0.00 ? 432 LYS A CA   2  
ATOM   1553  C  C    . LYS A 1 11 ? 10.536  -11.458 -11.162 1.00 0.00 ? 432 LYS A C    2  
ATOM   1554  O  O    . LYS A 1 11 ? 11.642  -11.360 -10.631 1.00 0.00 ? 432 LYS A O    2  
ATOM   1555  C  CB   . LYS A 1 11 ? 8.905   -13.277 -10.625 1.00 0.00 ? 432 LYS A CB   2  
ATOM   1556  C  CG   . LYS A 1 11 ? 8.208   -14.556 -11.056 1.00 0.00 ? 432 LYS A CG   2  
ATOM   1557  C  CD   . LYS A 1 11 ? 6.852   -14.704 -10.387 1.00 0.00 ? 432 LYS A CD   2  
ATOM   1558  C  CE   . LYS A 1 11 ? 6.394   -16.154 -10.370 1.00 0.00 ? 432 LYS A CE   2  
ATOM   1559  N  NZ   . LYS A 1 11 ? 4.981   -16.284 -9.918  1.00 0.00 ? 432 LYS A NZ   2  
ATOM   1560  H  H    . LYS A 1 11 ? 11.415  -14.186 -10.834 1.00 0.00 ? 432 LYS A H    2  
ATOM   1561  H  HA   . LYS A 1 11 ? 9.566   -12.720 -12.584 1.00 0.00 ? 432 LYS A HA   2  
ATOM   1562  H  HB2  . LYS A 1 11 ? 9.352   -13.444 -9.656  1.00 0.00 ? 432 LYS A HB2  2  
ATOM   1563  H  HB3  . LYS A 1 11 ? 8.162   -12.498 -10.540 1.00 0.00 ? 432 LYS A HB3  2  
ATOM   1564  H  HG2  . LYS A 1 11 ? 8.068   -14.536 -12.127 1.00 0.00 ? 432 LYS A HG2  2  
ATOM   1565  H  HG3  . LYS A 1 11 ? 8.826   -15.400 -10.787 1.00 0.00 ? 432 LYS A HG3  2  
ATOM   1566  H  HD2  . LYS A 1 11 ? 6.921   -14.348 -9.370  1.00 0.00 ? 432 LYS A HD2  2  
ATOM   1567  H  HD3  . LYS A 1 11 ? 6.126   -14.113 -10.928 1.00 0.00 ? 432 LYS A HD3  2  
ATOM   1568  H  HE2  . LYS A 1 11 ? 6.483   -16.558 -11.367 1.00 0.00 ? 432 LYS A HE2  2  
ATOM   1569  H  HE3  . LYS A 1 11 ? 7.031   -16.711 -9.698  1.00 0.00 ? 432 LYS A HE3  2  
ATOM   1570  H  HZ1  . LYS A 1 11 ? 4.455   -16.907 -10.565 1.00 0.00 ? 432 LYS A HZ1  2  
ATOM   1571  H  HZ2  . LYS A 1 11 ? 4.523   -15.351 -9.904  1.00 0.00 ? 432 LYS A HZ2  2  
ATOM   1572  H  HZ3  . LYS A 1 11 ? 4.947   -16.690 -8.961  1.00 0.00 ? 432 LYS A HZ3  2  
ATOM   1573  N  N    . LYS A 1 12 ? 9.749   -10.411 -11.390 1.00 0.00 ? 433 LYS A N    2  
ATOM   1574  C  CA   . LYS A 1 12 ? 10.148  -9.059  -11.019 1.00 0.00 ? 433 LYS A CA   2  
ATOM   1575  C  C    . LYS A 1 12 ? 10.100  -8.873  -9.506  1.00 0.00 ? 433 LYS A C    2  
ATOM   1576  O  O    . LYS A 1 12 ? 9.477   -9.660  -8.794  1.00 0.00 ? 433 LYS A O    2  
ATOM   1577  C  CB   . LYS A 1 12 ? 9.239   -8.032  -11.699 1.00 0.00 ? 433 LYS A CB   2  
ATOM   1578  C  CG   . LYS A 1 12 ? 9.692   -7.650  -13.097 1.00 0.00 ? 433 LYS A CG   2  
ATOM   1579  C  CD   . LYS A 1 12 ? 9.252   -6.241  -13.460 1.00 0.00 ? 433 LYS A CD   2  
ATOM   1580  C  CE   . LYS A 1 12 ? 9.988   -5.726  -14.687 1.00 0.00 ? 433 LYS A CE   2  
ATOM   1581  N  NZ   . LYS A 1 12 ? 11.401  -5.369  -14.377 1.00 0.00 ? 433 LYS A NZ   2  
ATOM   1582  H  H    . LYS A 1 12 ? 8.878   -10.552 -11.817 1.00 0.00 ? 433 LYS A H    2  
ATOM   1583  H  HA   . LYS A 1 12 ? 11.162  -8.908  -11.356 1.00 0.00 ? 433 LYS A HA   2  
ATOM   1584  H  HB2  . LYS A 1 12 ? 8.241   -8.441  -11.766 1.00 0.00 ? 433 LYS A HB2  2  
ATOM   1585  H  HB3  . LYS A 1 12 ? 9.212   -7.137  -11.094 1.00 0.00 ? 433 LYS A HB3  2  
ATOM   1586  H  HG2  . LYS A 1 12 ? 10.770  -7.701  -13.143 1.00 0.00 ? 433 LYS A HG2  2  
ATOM   1587  H  HG3  . LYS A 1 12 ? 9.266   -8.345  -13.807 1.00 0.00 ? 433 LYS A HG3  2  
ATOM   1588  H  HD2  . LYS A 1 12 ? 8.192   -6.247  -13.666 1.00 0.00 ? 433 LYS A HD2  2  
ATOM   1589  H  HD3  . LYS A 1 12 ? 9.455   -5.584  -12.627 1.00 0.00 ? 433 LYS A HD3  2  
ATOM   1590  H  HE2  . LYS A 1 12 ? 9.978   -6.494  -15.446 1.00 0.00 ? 433 LYS A HE2  2  
ATOM   1591  H  HE3  . LYS A 1 12 ? 9.477   -4.849  -15.056 1.00 0.00 ? 433 LYS A HE3  2  
ATOM   1592  H  HZ1  . LYS A 1 12 ? 12.049  -5.972  -14.923 1.00 0.00 ? 433 LYS A HZ1  2  
ATOM   1593  H  HZ2  . LYS A 1 12 ? 11.589  -5.506  -13.364 1.00 0.00 ? 433 LYS A HZ2  2  
ATOM   1594  H  HZ3  . LYS A 1 12 ? 11.580  -4.374  -14.622 1.00 0.00 ? 433 LYS A HZ3  2  
ATOM   1595  N  N    . ARG A 1 13 ? 10.760  -7.825  -9.022  1.00 0.00 ? 434 ARG A N    2  
ATOM   1596  C  CA   . ARG A 1 13 ? 10.792  -7.536  -7.593  1.00 0.00 ? 434 ARG A CA   2  
ATOM   1597  C  C    . ARG A 1 13 ? 10.207  -6.157  -7.304  1.00 0.00 ? 434 ARG A C    2  
ATOM   1598  O  O    . ARG A 1 13 ? 10.802  -5.360  -6.581  1.00 0.00 ? 434 ARG A O    2  
ATOM   1599  C  CB   . ARG A 1 13 ? 12.226  -7.614  -7.067  1.00 0.00 ? 434 ARG A CB   2  
ATOM   1600  C  CG   . ARG A 1 13 ? 12.614  -8.993  -6.558  1.00 0.00 ? 434 ARG A CG   2  
ATOM   1601  C  CD   . ARG A 1 13 ? 12.967  -9.930  -7.702  1.00 0.00 ? 434 ARG A CD   2  
ATOM   1602  N  NE   . ARG A 1 13 ? 13.910  -10.967 -7.290  1.00 0.00 ? 434 ARG A NE   2  
ATOM   1603  C  CZ   . ARG A 1 13 ? 15.213  -10.758 -7.141  1.00 0.00 ? 434 ARG A CZ   2  
ATOM   1604  N  NH1  . ARG A 1 13 ? 15.726  -9.557  -7.370  1.00 0.00 ? 434 ARG A NH1  2  
ATOM   1605  N  NH2  . ARG A 1 13 ? 16.007  -11.752 -6.763  1.00 0.00 ? 434 ARG A NH2  2  
ATOM   1606  H  H    . ARG A 1 13 ? 11.238  -7.234  -9.640  1.00 0.00 ? 434 ARG A H    2  
ATOM   1607  H  HA   . ARG A 1 13 ? 10.193  -8.281  -7.090  1.00 0.00 ? 434 ARG A HA   2  
ATOM   1608  H  HB2  . ARG A 1 13 ? 12.905  -7.345  -7.864  1.00 0.00 ? 434 ARG A HB2  2  
ATOM   1609  H  HB3  . ARG A 1 13 ? 12.338  -6.910  -6.256  1.00 0.00 ? 434 ARG A HB3  2  
ATOM   1610  H  HG2  . ARG A 1 13 ? 13.471  -8.898  -5.908  1.00 0.00 ? 434 ARG A HG2  2  
ATOM   1611  H  HG3  . ARG A 1 13 ? 11.785  -9.409  -6.006  1.00 0.00 ? 434 ARG A HG3  2  
ATOM   1612  H  HD2  . ARG A 1 13 ? 12.062  -10.401 -8.057  1.00 0.00 ? 434 ARG A HD2  2  
ATOM   1613  H  HD3  . ARG A 1 13 ? 13.408  -9.352  -8.500  1.00 0.00 ? 434 ARG A HD3  2  
ATOM   1614  H  HE   . ARG A 1 13 ? 13.552  -11.862 -7.115  1.00 0.00 ? 434 ARG A HE   2  
ATOM   1615  H  HH11 . ARG A 1 13 ? 15.130  -8.806  -7.654  1.00 0.00 ? 434 ARG A HH11 2  
ATOM   1616  H  HH12 . ARG A 1 13 ? 16.707  -9.402  -7.257  1.00 0.00 ? 434 ARG A HH12 2  
ATOM   1617  H  HH21 . ARG A 1 13 ? 15.624  -12.659 -6.589  1.00 0.00 ? 434 ARG A HH21 2  
ATOM   1618  H  HH22 . ARG A 1 13 ? 16.987  -11.594 -6.652  1.00 0.00 ? 434 ARG A HH22 2  
ATOM   1619  N  N    . GLU A 1 14 ? 9.038   -5.884  -7.876  1.00 0.00 ? 435 GLU A N    2  
ATOM   1620  C  CA   . GLU A 1 14 ? 8.375   -4.600  -7.681  1.00 0.00 ? 435 GLU A CA   2  
ATOM   1621  C  C    . GLU A 1 14 ? 6.870   -4.787  -7.504  1.00 0.00 ? 435 GLU A C    2  
ATOM   1622  O  O    . GLU A 1 14 ? 6.296   -5.770  -7.972  1.00 0.00 ? 435 GLU A O    2  
ATOM   1623  C  CB   . GLU A 1 14 ? 8.649   -3.673  -8.867  1.00 0.00 ? 435 GLU A CB   2  
ATOM   1624  C  CG   . GLU A 1 14 ? 8.513   -2.198  -8.530  1.00 0.00 ? 435 GLU A CG   2  
ATOM   1625  C  CD   . GLU A 1 14 ? 8.817   -1.299  -9.713  1.00 0.00 ? 435 GLU A CD   2  
ATOM   1626  O  OE1  . GLU A 1 14 ? 9.770   -1.605  -10.460 1.00 0.00 ? 435 GLU A OE1  2  
ATOM   1627  O  OE2  . GLU A 1 14 ? 8.103   -0.291  -9.892  1.00 0.00 ? 435 GLU A OE2  2  
ATOM   1628  H  H    . GLU A 1 14 ? 8.613   -6.561  -8.443  1.00 0.00 ? 435 GLU A H    2  
ATOM   1629  H  HA   . GLU A 1 14 ? 8.777   -4.152  -6.785  1.00 0.00 ? 435 GLU A HA   2  
ATOM   1630  H  HB2  . GLU A 1 14 ? 9.654   -3.850  -9.221  1.00 0.00 ? 435 GLU A HB2  2  
ATOM   1631  H  HB3  . GLU A 1 14 ? 7.952   -3.906  -9.658  1.00 0.00 ? 435 GLU A HB3  2  
ATOM   1632  H  HG2  . GLU A 1 14 ? 7.501   -2.008  -8.204  1.00 0.00 ? 435 GLU A HG2  2  
ATOM   1633  H  HG3  . GLU A 1 14 ? 9.198   -1.959  -7.730  1.00 0.00 ? 435 GLU A HG3  2  
ATOM   1634  N  N    . LEU A 1 15 ? 6.238   -3.836  -6.825  1.00 0.00 ? 436 LEU A N    2  
ATOM   1635  C  CA   . LEU A 1 15 ? 4.800   -3.895  -6.585  1.00 0.00 ? 436 LEU A CA   2  
ATOM   1636  C  C    . LEU A 1 15 ? 4.023   -3.666  -7.877  1.00 0.00 ? 436 LEU A C    2  
ATOM   1637  O  O    . LEU A 1 15 ? 4.422   -2.863  -8.721  1.00 0.00 ? 436 LEU A O    2  
ATOM   1638  C  CB   . LEU A 1 15 ? 4.395   -2.852  -5.541  1.00 0.00 ? 436 LEU A CB   2  
ATOM   1639  C  CG   . LEU A 1 15 ? 2.892   -2.643  -5.350  1.00 0.00 ? 436 LEU A CG   2  
ATOM   1640  C  CD1  . LEU A 1 15 ? 2.301   -3.762  -4.507  1.00 0.00 ? 436 LEU A CD1  2  
ATOM   1641  C  CD2  . LEU A 1 15 ? 2.619   -1.290  -4.711  1.00 0.00 ? 436 LEU A CD2  2  
ATOM   1642  H  H    . LEU A 1 15 ? 6.749   -3.077  -6.476  1.00 0.00 ? 436 LEU A H    2  
ATOM   1643  H  HA   . LEU A 1 15 ? 4.567   -4.879  -6.208  1.00 0.00 ? 436 LEU A HA   2  
ATOM   1644  H  HB2  . LEU A 1 15 ? 4.809   -3.156  -4.592  1.00 0.00 ? 436 LEU A HB2  2  
ATOM   1645  H  HB3  . LEU A 1 15 ? 4.827   -1.906  -5.834  1.00 0.00 ? 436 LEU A HB3  2  
ATOM   1646  H  HG   . LEU A 1 15 ? 2.407   -2.662  -6.316  1.00 0.00 ? 436 LEU A HG   2  
ATOM   1647  H  HD11 . LEU A 1 15 ? 1.615   -4.341  -5.107  1.00 0.00 ? 436 LEU A HD11 2  
ATOM   1648  H  HD12 . LEU A 1 15 ? 1.773   -3.338  -3.665  1.00 0.00 ? 436 LEU A HD12 2  
ATOM   1649  H  HD13 . LEU A 1 15 ? 3.095   -4.401  -4.148  1.00 0.00 ? 436 LEU A HD13 2  
ATOM   1650  H  HD21 . LEU A 1 15 ? 1.778   -1.373  -4.039  1.00 0.00 ? 436 LEU A HD21 2  
ATOM   1651  H  HD22 . LEU A 1 15 ? 2.394   -0.567  -5.481  1.00 0.00 ? 436 LEU A HD22 2  
ATOM   1652  H  HD23 . LEU A 1 15 ? 3.491   -0.970  -4.159  1.00 0.00 ? 436 LEU A HD23 2  
ATOM   1653  N  N    . CYS A 1 16 ? 2.909   -4.376  -8.025  1.00 0.00 ? 437 CYS A N    2  
ATOM   1654  C  CA   . CYS A 1 16 ? 2.074   -4.250  -9.213  1.00 0.00 ? 437 CYS A CA   2  
ATOM   1655  C  C    . CYS A 1 16 ? 1.292   -2.940  -9.192  1.00 0.00 ? 437 CYS A C    2  
ATOM   1656  O  O    . CYS A 1 16 ? 0.903   -2.452  -8.130  1.00 0.00 ? 437 CYS A O    2  
ATOM   1657  C  CB   . CYS A 1 16 ? 1.107   -5.432  -9.309  1.00 0.00 ? 437 CYS A CB   2  
ATOM   1658  S  SG   . CYS A 1 16 ? 0.237   -5.552  -10.905 1.00 0.00 ? 437 CYS A SG   2  
ATOM   1659  H  H    . CYS A 1 16 ? 2.643   -5.001  -7.317  1.00 0.00 ? 437 CYS A H    2  
ATOM   1660  H  HA   . CYS A 1 16 ? 2.722   -4.255  -10.076 1.00 0.00 ? 437 CYS A HA   2  
ATOM   1661  H  HB2  . CYS A 1 16 ? 1.658   -6.350  -9.166  1.00 0.00 ? 437 CYS A HB2  2  
ATOM   1662  H  HB3  . CYS A 1 16 ? 0.361   -5.341  -8.534  1.00 0.00 ? 437 CYS A HB3  2  
ATOM   1663  N  N    . LYS A 1 17 ? 1.067   -2.373  -10.372 1.00 0.00 ? 438 LYS A N    2  
ATOM   1664  C  CA   . LYS A 1 17 ? 0.331   -1.120  -10.492 1.00 0.00 ? 438 LYS A CA   2  
ATOM   1665  C  C    . LYS A 1 17 ? -1.169  -1.353  -10.341 1.00 0.00 ? 438 LYS A C    2  
ATOM   1666  O  O    . LYS A 1 17 ? -1.942  -0.408  -10.182 1.00 0.00 ? 438 LYS A O    2  
ATOM   1667  C  CB   . LYS A 1 17 ? 0.621   -0.461  -11.842 1.00 0.00 ? 438 LYS A CB   2  
ATOM   1668  C  CG   . LYS A 1 17 ? 1.900   0.360   -11.856 1.00 0.00 ? 438 LYS A CG   2  
ATOM   1669  C  CD   . LYS A 1 17 ? 3.128   -0.523  -12.003 1.00 0.00 ? 438 LYS A CD   2  
ATOM   1670  C  CE   . LYS A 1 17 ? 3.699   -0.914  -10.649 1.00 0.00 ? 438 LYS A CE   2  
ATOM   1671  N  NZ   . LYS A 1 17 ? 4.525   0.175   -10.060 1.00 0.00 ? 438 LYS A NZ   2  
ATOM   1672  H  H    . LYS A 1 17 ? 1.403   -2.809  -11.184 1.00 0.00 ? 438 LYS A H    2  
ATOM   1673  H  HA   . LYS A 1 17 ? 0.662   -0.464  -9.702  1.00 0.00 ? 438 LYS A HA   2  
ATOM   1674  H  HB2  . LYS A 1 17 ? 0.705   -1.231  -12.595 1.00 0.00 ? 438 LYS A HB2  2  
ATOM   1675  H  HB3  . LYS A 1 17 ? -0.202  0.191   -12.096 1.00 0.00 ? 438 LYS A HB3  2  
ATOM   1676  H  HG2  . LYS A 1 17 ? 1.865   1.051   -12.685 1.00 0.00 ? 438 LYS A HG2  2  
ATOM   1677  H  HG3  . LYS A 1 17 ? 1.973   0.911   -10.929 1.00 0.00 ? 438 LYS A HG3  2  
ATOM   1678  H  HD2  . LYS A 1 17 ? 2.853   -1.420  -12.538 1.00 0.00 ? 438 LYS A HD2  2  
ATOM   1679  H  HD3  . LYS A 1 17 ? 3.882   0.014   -12.561 1.00 0.00 ? 438 LYS A HD3  2  
ATOM   1680  H  HE2  . LYS A 1 17 ? 2.882   -1.137  -9.979  1.00 0.00 ? 438 LYS A HE2  2  
ATOM   1681  H  HE3  . LYS A 1 17 ? 4.313   -1.794  -10.772 1.00 0.00 ? 438 LYS A HE3  2  
ATOM   1682  H  HZ1  . LYS A 1 17 ? 5.070   0.653   -10.806 1.00 0.00 ? 438 LYS A HZ1  2  
ATOM   1683  H  HZ2  . LYS A 1 17 ? 5.187   -0.216  -9.360  1.00 0.00 ? 438 LYS A HZ2  2  
ATOM   1684  H  HZ3  . LYS A 1 17 ? 3.914   0.874   -9.590  1.00 0.00 ? 438 LYS A HZ3  2  
ATOM   1685  N  N    . PHE A 1 18 ? -1.575  -2.618  -10.391 1.00 0.00 ? 439 PHE A N    2  
ATOM   1686  C  CA   . PHE A 1 18 ? -2.982  -2.975  -10.259 1.00 0.00 ? 439 PHE A CA   2  
ATOM   1687  C  C    . PHE A 1 18 ? -3.269  -3.557  -8.877  1.00 0.00 ? 439 PHE A C    2  
ATOM   1688  O  O    . PHE A 1 18 ? -4.221  -3.155  -8.208  1.00 0.00 ? 439 PHE A O    2  
ATOM   1689  C  CB   . PHE A 1 18 ? -3.378  -3.982  -11.340 1.00 0.00 ? 439 PHE A CB   2  
ATOM   1690  C  CG   . PHE A 1 18 ? -3.409  -3.395  -12.723 1.00 0.00 ? 439 PHE A CG   2  
ATOM   1691  C  CD1  . PHE A 1 18 ? -2.283  -2.791  -13.258 1.00 0.00 ? 439 PHE A CD1  2  
ATOM   1692  C  CD2  . PHE A 1 18 ? -4.564  -3.448  -13.487 1.00 0.00 ? 439 PHE A CD2  2  
ATOM   1693  C  CE1  . PHE A 1 18 ? -2.309  -2.250  -14.530 1.00 0.00 ? 439 PHE A CE1  2  
ATOM   1694  C  CE2  . PHE A 1 18 ? -4.596  -2.909  -14.759 1.00 0.00 ? 439 PHE A CE2  2  
ATOM   1695  C  CZ   . PHE A 1 18 ? -3.466  -2.310  -15.282 1.00 0.00 ? 439 PHE A CZ   2  
ATOM   1696  H  H    . PHE A 1 18 ? -0.911  -3.328  -10.520 1.00 0.00 ? 439 PHE A H    2  
ATOM   1697  H  HA   . PHE A 1 18 ? -3.565  -2.076  -10.385 1.00 0.00 ? 439 PHE A HA   2  
ATOM   1698  H  HB2  . PHE A 1 18 ? -2.669  -4.796  -11.342 1.00 0.00 ? 439 PHE A HB2  2  
ATOM   1699  H  HB3  . PHE A 1 18 ? -4.362  -4.367  -11.120 1.00 0.00 ? 439 PHE A HB3  2  
ATOM   1700  H  HD1  . PHE A 1 18 ? -1.377  -2.744  -12.672 1.00 0.00 ? 439 PHE A HD1  2  
ATOM   1701  H  HD2  . PHE A 1 18 ? -5.448  -3.917  -13.079 1.00 0.00 ? 439 PHE A HD2  2  
ATOM   1702  H  HE1  . PHE A 1 18 ? -1.425  -1.782  -14.936 1.00 0.00 ? 439 PHE A HE1  2  
ATOM   1703  H  HE2  . PHE A 1 18 ? -5.502  -2.958  -15.344 1.00 0.00 ? 439 PHE A HE2  2  
ATOM   1704  H  HZ   . PHE A 1 18 ? -3.489  -1.888  -16.275 1.00 0.00 ? 439 PHE A HZ   2  
ATOM   1705  N  N    . TYR A 1 19 ? -2.438  -4.505  -8.458  1.00 0.00 ? 440 TYR A N    2  
ATOM   1706  C  CA   . TYR A 1 19 ? -2.603  -5.145  -7.158  1.00 0.00 ? 440 TYR A CA   2  
ATOM   1707  C  C    . TYR A 1 19 ? -2.936  -4.116  -6.082  1.00 0.00 ? 440 TYR A C    2  
ATOM   1708  O  O    . TYR A 1 19 ? -3.718  -4.385  -5.170  1.00 0.00 ? 440 TYR A O    2  
ATOM   1709  C  CB   . TYR A 1 19 ? -1.332  -5.905  -6.776  1.00 0.00 ? 440 TYR A CB   2  
ATOM   1710  C  CG   . TYR A 1 19 ? -1.518  -6.846  -5.607  1.00 0.00 ? 440 TYR A CG   2  
ATOM   1711  C  CD1  . TYR A 1 19 ? -2.300  -7.988  -5.726  1.00 0.00 ? 440 TYR A CD1  2  
ATOM   1712  C  CD2  . TYR A 1 19 ? -0.911  -6.593  -4.383  1.00 0.00 ? 440 TYR A CD2  2  
ATOM   1713  C  CE1  . TYR A 1 19 ? -2.474  -8.850  -4.661  1.00 0.00 ? 440 TYR A CE1  2  
ATOM   1714  C  CE2  . TYR A 1 19 ? -1.078  -7.450  -3.312  1.00 0.00 ? 440 TYR A CE2  2  
ATOM   1715  C  CZ   . TYR A 1 19 ? -1.860  -8.577  -3.456  1.00 0.00 ? 440 TYR A CZ   2  
ATOM   1716  O  OH   . TYR A 1 19 ? -2.029  -9.433  -2.392  1.00 0.00 ? 440 TYR A OH   2  
ATOM   1717  H  H    . TYR A 1 19 ? -1.698  -4.783  -9.036  1.00 0.00 ? 440 TYR A H    2  
ATOM   1718  H  HA   . TYR A 1 19 ? -3.421  -5.846  -7.235  1.00 0.00 ? 440 TYR A HA   2  
ATOM   1719  H  HB2  . TYR A 1 19 ? -1.002  -6.489  -7.621  1.00 0.00 ? 440 TYR A HB2  2  
ATOM   1720  H  HB3  . TYR A 1 19 ? -0.562  -5.196  -6.512  1.00 0.00 ? 440 TYR A HB3  2  
ATOM   1721  H  HD1  . TYR A 1 19 ? -2.780  -8.199  -6.671  1.00 0.00 ? 440 TYR A HD1  2  
ATOM   1722  H  HD2  . TYR A 1 19 ? -0.300  -5.709  -4.273  1.00 0.00 ? 440 TYR A HD2  2  
ATOM   1723  H  HE1  . TYR A 1 19 ? -3.085  -9.733  -4.773  1.00 0.00 ? 440 TYR A HE1  2  
ATOM   1724  H  HE2  . TYR A 1 19 ? -0.598  -7.236  -2.369  1.00 0.00 ? 440 TYR A HE2  2  
ATOM   1725  H  HH   . TYR A 1 19 ? -1.996  -8.934  -1.572  1.00 0.00 ? 440 TYR A HH   2  
ATOM   1726  N  N    . ILE A 1 20 ? -2.337  -2.935  -6.197  1.00 0.00 ? 441 ILE A N    2  
ATOM   1727  C  CA   . ILE A 1 20 ? -2.570  -1.864  -5.236  1.00 0.00 ? 441 ILE A CA   2  
ATOM   1728  C  C    . ILE A 1 20 ? -4.039  -1.799  -4.831  1.00 0.00 ? 441 ILE A C    2  
ATOM   1729  O  O    . ILE A 1 20 ? -4.365  -1.520  -3.677  1.00 0.00 ? 441 ILE A O    2  
ATOM   1730  C  CB   . ILE A 1 20 ? -2.145  -0.497  -5.802  1.00 0.00 ? 441 ILE A CB   2  
ATOM   1731  C  CG1  . ILE A 1 20 ? -0.660  -0.513  -6.172  1.00 0.00 ? 441 ILE A CG1  2  
ATOM   1732  C  CG2  . ILE A 1 20 ? -2.434  0.607   -4.796  1.00 0.00 ? 441 ILE A CG2  2  
ATOM   1733  C  CD1  . ILE A 1 20 ? -0.226  0.688   -6.982  1.00 0.00 ? 441 ILE A CD1  2  
ATOM   1734  H  H    . ILE A 1 20 ? -1.724  -2.781  -6.945  1.00 0.00 ? 441 ILE A H    2  
ATOM   1735  H  HA   . ILE A 1 20 ? -1.974  -2.069  -4.358  1.00 0.00 ? 441 ILE A HA   2  
ATOM   1736  H  HB   . ILE A 1 20 ? -2.727  -0.303  -6.690  1.00 0.00 ? 441 ILE A HB   2  
ATOM   1737  H  HG12 . ILE A 1 20 ? -0.071  -0.533  -5.268  1.00 0.00 ? 441 ILE A HG12 2  
ATOM   1738  H  HG13 . ILE A 1 20 ? -0.451  -1.400  -6.752  1.00 0.00 ? 441 ILE A HG13 2  
ATOM   1739  H  HG21 . ILE A 1 20 ? -1.543  0.813   -4.222  1.00 0.00 ? 441 ILE A HG21 2  
ATOM   1740  H  HG22 . ILE A 1 20 ? -2.738  1.501   -5.320  1.00 0.00 ? 441 ILE A HG22 2  
ATOM   1741  H  HG23 . ILE A 1 20 ? -3.225  0.291   -4.133  1.00 0.00 ? 441 ILE A HG23 2  
ATOM   1742  H  HD11 . ILE A 1 20 ? -1.087  1.298   -7.212  1.00 0.00 ? 441 ILE A HD11 2  
ATOM   1743  H  HD12 . ILE A 1 20 ? 0.487   1.267   -6.415  1.00 0.00 ? 441 ILE A HD12 2  
ATOM   1744  H  HD13 . ILE A 1 20 ? 0.233   0.354   -7.902  1.00 0.00 ? 441 ILE A HD13 2  
ATOM   1745  N  N    . THR A 1 21 ? -4.923  -2.062  -5.788  1.00 0.00 ? 442 THR A N    2  
ATOM   1746  C  CA   . THR A 1 21 ? -6.358  -2.034  -5.532  1.00 0.00 ? 442 THR A CA   2  
ATOM   1747  C  C    . THR A 1 21 ? -6.906  -3.442  -5.324  1.00 0.00 ? 442 THR A C    2  
ATOM   1748  O  O    . THR A 1 21 ? -7.823  -3.650  -4.531  1.00 0.00 ? 442 THR A O    2  
ATOM   1749  C  CB   . THR A 1 21 ? -7.122  -1.364  -6.689  1.00 0.00 ? 442 THR A CB   2  
ATOM   1750  O  OG1  . THR A 1 21 ? -6.889  -2.076  -7.909  1.00 0.00 ? 442 THR A OG1  2  
ATOM   1751  C  CG2  . THR A 1 21 ? -6.692  0.086   -6.853  1.00 0.00 ? 442 THR A CG2  2  
ATOM   1752  H  H    . THR A 1 21 ? -4.602  -2.279  -6.688  1.00 0.00 ? 442 THR A H    2  
ATOM   1753  H  HA   . THR A 1 21 ? -6.525  -1.457  -4.635  1.00 0.00 ? 442 THR A HA   2  
ATOM   1754  H  HB   . THR A 1 21 ? -8.179  -1.387  -6.464  1.00 0.00 ? 442 THR A HB   2  
ATOM   1755  H  HG1  . THR A 1 21 ? -7.726  -2.235  -8.352  1.00 0.00 ? 442 THR A HG1  2  
ATOM   1756  H  HG21 . THR A 1 21 ? -5.615  0.138   -6.908  1.00 0.00 ? 442 THR A HG21 2  
ATOM   1757  H  HG22 . THR A 1 21 ? -7.038  0.662   -6.008  1.00 0.00 ? 442 THR A HG22 2  
ATOM   1758  H  HG23 . THR A 1 21 ? -7.118  0.487   -7.761  1.00 0.00 ? 442 THR A HG23 2  
ATOM   1759  N  N    . GLY A 1 22 ? -6.338  -4.406  -6.043  1.00 0.00 ? 443 GLY A N    2  
ATOM   1760  C  CA   . GLY A 1 22 ? -6.784  -5.781  -5.922  1.00 0.00 ? 443 GLY A CA   2  
ATOM   1761  C  C    . GLY A 1 22 ? -7.407  -6.304  -7.201  1.00 0.00 ? 443 GLY A C    2  
ATOM   1762  O  O    . GLY A 1 22 ? -7.688  -7.496  -7.321  1.00 0.00 ? 443 GLY A O    2  
ATOM   1763  H  H    . GLY A 1 22 ? -5.611  -4.181  -6.660  1.00 0.00 ? 443 GLY A H    2  
ATOM   1764  H  HA2  . GLY A 1 22 ? -5.937  -6.401  -5.667  1.00 0.00 ? 443 GLY A HA2  2  
ATOM   1765  H  HA3  . GLY A 1 22 ? -7.514  -5.843  -5.128  1.00 0.00 ? 443 GLY A HA3  2  
ATOM   1766  N  N    . PHE A 1 23 ? -7.626  -5.409  -8.159  1.00 0.00 ? 444 PHE A N    2  
ATOM   1767  C  CA   . PHE A 1 23 ? -8.224  -5.786  -9.435  1.00 0.00 ? 444 PHE A CA   2  
ATOM   1768  C  C    . PHE A 1 23 ? -7.151  -5.968  -10.504 1.00 0.00 ? 444 PHE A C    2  
ATOM   1769  O  O    . PHE A 1 23 ? -6.897  -5.067  -11.305 1.00 0.00 ? 444 PHE A O    2  
ATOM   1770  C  CB   . PHE A 1 23 ? -9.232  -4.726  -9.882  1.00 0.00 ? 444 PHE A CB   2  
ATOM   1771  C  CG   . PHE A 1 23 ? -9.635  -4.853  -11.324 1.00 0.00 ? 444 PHE A CG   2  
ATOM   1772  C  CD1  . PHE A 1 23 ? -10.207 -6.023  -11.796 1.00 0.00 ? 444 PHE A CD1  2  
ATOM   1773  C  CD2  . PHE A 1 23 ? -9.441  -3.802  -12.206 1.00 0.00 ? 444 PHE A CD2  2  
ATOM   1774  C  CE1  . PHE A 1 23 ? -10.579 -6.143  -13.122 1.00 0.00 ? 444 PHE A CE1  2  
ATOM   1775  C  CE2  . PHE A 1 23 ? -9.812  -3.917  -13.533 1.00 0.00 ? 444 PHE A CE2  2  
ATOM   1776  C  CZ   . PHE A 1 23 ? -10.380 -5.089  -13.992 1.00 0.00 ? 444 PHE A CZ   2  
ATOM   1777  H  H    . PHE A 1 23 ? -7.381  -4.473  -8.003  1.00 0.00 ? 444 PHE A H    2  
ATOM   1778  H  HA   . PHE A 1 23 ? -8.738  -6.724  -9.294  1.00 0.00 ? 444 PHE A HA   2  
ATOM   1779  H  HB2  . PHE A 1 23 ? -10.124 -4.811  -9.280  1.00 0.00 ? 444 PHE A HB2  2  
ATOM   1780  H  HB3  . PHE A 1 23 ? -8.800  -3.747  -9.742  1.00 0.00 ? 444 PHE A HB3  2  
ATOM   1781  H  HD1  . PHE A 1 23 ? -10.363 -6.849  -11.117 1.00 0.00 ? 444 PHE A HD1  2  
ATOM   1782  H  HD2  . PHE A 1 23 ? -8.996  -2.885  -11.849 1.00 0.00 ? 444 PHE A HD2  2  
ATOM   1783  H  HE1  . PHE A 1 23 ? -11.023 -7.061  -13.477 1.00 0.00 ? 444 PHE A HE1  2  
ATOM   1784  H  HE2  . PHE A 1 23 ? -9.655  -3.091  -14.211 1.00 0.00 ? 444 PHE A HE2  2  
ATOM   1785  H  HZ   . PHE A 1 23 ? -10.671 -5.180  -15.028 1.00 0.00 ? 444 PHE A HZ   2  
ATOM   1786  N  N    . CYS A 1 24 ? -6.524  -7.139  -10.511 1.00 0.00 ? 445 CYS A N    2  
ATOM   1787  C  CA   . CYS A 1 24 ? -5.478  -7.441  -11.481 1.00 0.00 ? 445 CYS A CA   2  
ATOM   1788  C  C    . CYS A 1 24 ? -5.875  -8.624  -12.359 1.00 0.00 ? 445 CYS A C    2  
ATOM   1789  O  O    . CYS A 1 24 ? -5.761  -9.780  -11.950 1.00 0.00 ? 445 CYS A O    2  
ATOM   1790  C  CB   . CYS A 1 24 ? -4.160  -7.743  -10.764 1.00 0.00 ? 445 CYS A CB   2  
ATOM   1791  S  SG   . CYS A 1 24 ? -2.752  -8.027  -11.884 1.00 0.00 ? 445 CYS A SG   2  
ATOM   1792  H  H    . CYS A 1 24 ? -6.770  -7.818  -9.847  1.00 0.00 ? 445 CYS A H    2  
ATOM   1793  H  HA   . CYS A 1 24 ? -5.345  -6.572  -12.108 1.00 0.00 ? 445 CYS A HA   2  
ATOM   1794  H  HB2  . CYS A 1 24 ? -3.908  -6.910  -10.124 1.00 0.00 ? 445 CYS A HB2  2  
ATOM   1795  H  HB3  . CYS A 1 24 ? -4.284  -8.629  -10.159 1.00 0.00 ? 445 CYS A HB3  2  
ATOM   1796  N  N    . ALA A 1 25 ? -6.340  -8.327  -13.567 1.00 0.00 ? 446 ALA A N    2  
ATOM   1797  C  CA   . ALA A 1 25 ? -6.752  -9.366  -14.504 1.00 0.00 ? 446 ALA A CA   2  
ATOM   1798  C  C    . ALA A 1 25 ? -5.784  -10.544 -14.478 1.00 0.00 ? 446 ALA A C    2  
ATOM   1799  O  O    . ALA A 1 25 ? -6.174  -11.674 -14.184 1.00 0.00 ? 446 ALA A O    2  
ATOM   1800  C  CB   . ALA A 1 25 ? -6.856  -8.796  -15.911 1.00 0.00 ? 446 ALA A CB   2  
ATOM   1801  H  H    . ALA A 1 25 ? -6.407  -7.388  -13.836 1.00 0.00 ? 446 ALA A H    2  
ATOM   1802  H  HA   . ALA A 1 25 ? -7.732  -9.712  -14.209 1.00 0.00 ? 446 ALA A HA   2  
ATOM   1803  H  HB1  . ALA A 1 25 ? -6.040  -8.108  -16.081 1.00 0.00 ? 446 ALA A HB1  2  
ATOM   1804  H  HB2  . ALA A 1 25 ? -6.804  -9.601  -16.629 1.00 0.00 ? 446 ALA A HB2  2  
ATOM   1805  H  HB3  . ALA A 1 25 ? -7.795  -8.276  -16.020 1.00 0.00 ? 446 ALA A HB3  2  
ATOM   1806  N  N    . ARG A 1 26 ? -4.520  -10.272 -14.788 1.00 0.00 ? 447 ARG A N    2  
ATOM   1807  C  CA   . ARG A 1 26 ? -3.497  -11.310 -14.802 1.00 0.00 ? 447 ARG A CA   2  
ATOM   1808  C  C    . ARG A 1 26 ? -3.106  -11.707 -13.381 1.00 0.00 ? 447 ARG A C    2  
ATOM   1809  O  O    . ARG A 1 26 ? -2.271  -11.058 -12.752 1.00 0.00 ? 447 ARG A O    2  
ATOM   1810  C  CB   . ARG A 1 26 ? -2.262  -10.829 -15.566 1.00 0.00 ? 447 ARG A CB   2  
ATOM   1811  C  CG   . ARG A 1 26 ? -2.397  -10.947 -17.076 1.00 0.00 ? 447 ARG A CG   2  
ATOM   1812  C  CD   . ARG A 1 26 ? -1.070  -10.694 -17.775 1.00 0.00 ? 447 ARG A CD   2  
ATOM   1813  N  NE   . ARG A 1 26 ? -1.239  -10.488 -19.211 1.00 0.00 ? 447 ARG A NE   2  
ATOM   1814  C  CZ   . ARG A 1 26 ? -0.254  -10.115 -20.020 1.00 0.00 ? 447 ARG A CZ   2  
ATOM   1815  N  NH1  . ARG A 1 26 ? 0.963   -9.907  -19.537 1.00 0.00 ? 447 ARG A NH1  2  
ATOM   1816  N  NH2  . ARG A 1 26 ? -0.485  -9.948  -21.316 1.00 0.00 ? 447 ARG A NH2  2  
ATOM   1817  H  H    . ARG A 1 26 ? -4.270  -9.352  -15.013 1.00 0.00 ? 447 ARG A H    2  
ATOM   1818  H  HA   . ARG A 1 26 ? -3.907  -12.174 -15.304 1.00 0.00 ? 447 ARG A HA   2  
ATOM   1819  H  HB2  . ARG A 1 26 ? -2.084  -9.792  -15.323 1.00 0.00 ? 447 ARG A HB2  2  
ATOM   1820  H  HB3  . ARG A 1 26 ? -1.411  -11.415 -15.256 1.00 0.00 ? 447 ARG A HB3  2  
ATOM   1821  H  HG2  . ARG A 1 26 ? -2.736  -11.943 -17.321 1.00 0.00 ? 447 ARG A HG2  2  
ATOM   1822  H  HG3  . ARG A 1 26 ? -3.120  -10.224 -17.421 1.00 0.00 ? 447 ARG A HG3  2  
ATOM   1823  H  HD2  . ARG A 1 26 ? -0.615  -9.814  -17.346 1.00 0.00 ? 447 ARG A HD2  2  
ATOM   1824  H  HD3  . ARG A 1 26 ? -0.427  -11.546 -17.615 1.00 0.00 ? 447 ARG A HD3  2  
ATOM   1825  H  HE   . ARG A 1 26 ? -2.130  -10.636 -19.589 1.00 0.00 ? 447 ARG A HE   2  
ATOM   1826  H  HH11 . ARG A 1 26 ? 1.141   -10.033 -18.561 1.00 0.00 ? 447 ARG A HH11 2  
ATOM   1827  H  HH12 . ARG A 1 26 ? 1.703   -9.627  -20.148 1.00 0.00 ? 447 ARG A HH12 2  
ATOM   1828  H  HH21 . ARG A 1 26 ? -1.402  -10.104 -21.684 1.00 0.00 ? 447 ARG A HH21 2  
ATOM   1829  H  HH22 . ARG A 1 26 ? 0.256   -9.667  -21.924 1.00 0.00 ? 447 ARG A HH22 2  
ATOM   1830  N  N    . ALA A 1 27 ? -3.716  -12.777 -12.882 1.00 0.00 ? 448 ALA A N    2  
ATOM   1831  C  CA   . ALA A 1 27 ? -3.430  -13.262 -11.537 1.00 0.00 ? 448 ALA A CA   2  
ATOM   1832  C  C    . ALA A 1 27 ? -2.146  -14.083 -11.510 1.00 0.00 ? 448 ALA A C    2  
ATOM   1833  O  O    . ALA A 1 27 ? -1.104  -13.606 -11.061 1.00 0.00 ? 448 ALA A O    2  
ATOM   1834  C  CB   . ALA A 1 27 ? -4.597  -14.086 -11.014 1.00 0.00 ? 448 ALA A CB   2  
ATOM   1835  H  H    . ALA A 1 27 ? -4.372  -13.253 -13.432 1.00 0.00 ? 448 ALA A H    2  
ATOM   1836  H  HA   . ALA A 1 27 ? -3.311  -12.403 -10.892 1.00 0.00 ? 448 ALA A HA   2  
ATOM   1837  H  HB1  . ALA A 1 27 ? -4.904  -13.705 -10.051 1.00 0.00 ? 448 ALA A HB1  2  
ATOM   1838  H  HB2  . ALA A 1 27 ? -5.423  -14.021 -11.707 1.00 0.00 ? 448 ALA A HB2  2  
ATOM   1839  H  HB3  . ALA A 1 27 ? -4.292  -15.117 -10.913 1.00 0.00 ? 448 ALA A HB3  2  
ATOM   1840  N  N    . GLU A 1 28 ? -2.228  -15.319 -11.993 1.00 0.00 ? 449 GLU A N    2  
ATOM   1841  C  CA   . GLU A 1 28 ? -1.071  -16.206 -12.022 1.00 0.00 ? 449 GLU A CA   2  
ATOM   1842  C  C    . GLU A 1 28 ? -0.187  -15.907 -13.230 1.00 0.00 ? 449 GLU A C    2  
ATOM   1843  O  O    . GLU A 1 28 ? 0.609   -16.745 -13.651 1.00 0.00 ? 449 GLU A O    2  
ATOM   1844  C  CB   . GLU A 1 28 ? -1.522  -17.667 -12.055 1.00 0.00 ? 449 GLU A CB   2  
ATOM   1845  C  CG   . GLU A 1 28 ? -2.276  -18.044 -13.319 1.00 0.00 ? 449 GLU A CG   2  
ATOM   1846  C  CD   . GLU A 1 28 ? -3.139  -19.277 -13.139 1.00 0.00 ? 449 GLU A CD   2  
ATOM   1847  O  OE1  . GLU A 1 28 ? -2.798  -20.119 -12.281 1.00 0.00 ? 449 GLU A OE1  2  
ATOM   1848  O  OE2  . GLU A 1 28 ? -4.155  -19.401 -13.854 1.00 0.00 ? 449 GLU A OE2  2  
ATOM   1849  H  H    . GLU A 1 28 ? -3.087  -15.641 -12.337 1.00 0.00 ? 449 GLU A H    2  
ATOM   1850  H  HA   . GLU A 1 28 ? -0.500  -16.035 -11.122 1.00 0.00 ? 449 GLU A HA   2  
ATOM   1851  H  HB2  . GLU A 1 28 ? -0.652  -18.302 -11.976 1.00 0.00 ? 449 GLU A HB2  2  
ATOM   1852  H  HB3  . GLU A 1 28 ? -2.168  -17.851 -11.208 1.00 0.00 ? 449 GLU A HB3  2  
ATOM   1853  H  HG2  . GLU A 1 28 ? -2.910  -17.218 -13.604 1.00 0.00 ? 449 GLU A HG2  2  
ATOM   1854  H  HG3  . GLU A 1 28 ? -1.561  -18.235 -14.106 1.00 0.00 ? 449 GLU A HG3  2  
ATOM   1855  N  N    . ASN A 1 29 ? -0.336  -14.708 -13.782 1.00 0.00 ? 450 ASN A N    2  
ATOM   1856  C  CA   . ASN A 1 29 ? 0.448   -14.298 -14.942 1.00 0.00 ? 450 ASN A CA   2  
ATOM   1857  C  C    . ASN A 1 29 ? 1.187   -12.992 -14.666 1.00 0.00 ? 450 ASN A C    2  
ATOM   1858  O  O    . ASN A 1 29 ? 1.924   -12.492 -15.516 1.00 0.00 ? 450 ASN A O    2  
ATOM   1859  C  CB   . ASN A 1 29 ? -0.458  -14.136 -16.164 1.00 0.00 ? 450 ASN A CB   2  
ATOM   1860  C  CG   . ASN A 1 29 ? 0.322   -14.116 -17.464 1.00 0.00 ? 450 ASN A CG   2  
ATOM   1861  O  OD1  . ASN A 1 29 ? 1.196   -13.272 -17.663 1.00 0.00 ? 450 ASN A OD1  2  
ATOM   1862  N  ND2  . ASN A 1 29 ? 0.009   -15.047 -18.357 1.00 0.00 ? 450 ASN A ND2  2  
ATOM   1863  H  H    . ASN A 1 29 ? -0.988  -14.083 -13.401 1.00 0.00 ? 450 ASN A H    2  
ATOM   1864  H  HA   . ASN A 1 29 ? 1.172   -15.073 -15.143 1.00 0.00 ? 450 ASN A HA   2  
ATOM   1865  H  HB2  . ASN A 1 29 ? -1.156  -14.960 -16.199 1.00 0.00 ? 450 ASN A HB2  2  
ATOM   1866  H  HB3  . ASN A 1 29 ? -1.006  -13.210 -16.079 1.00 0.00 ? 450 ASN A HB3  2  
ATOM   1867  H  HD21 . ASN A 1 29 ? -0.698  -15.687 -18.131 1.00 0.00 ? 450 ASN A HD21 2  
ATOM   1868  H  HD22 . ASN A 1 29 ? 0.499   -15.057 -19.206 1.00 0.00 ? 450 ASN A HD22 2  
ATOM   1869  N  N    . CYS A 1 30 ? 0.984   -12.445 -13.472 1.00 0.00 ? 451 CYS A N    2  
ATOM   1870  C  CA   . CYS A 1 30 ? 1.631   -11.198 -13.083 1.00 0.00 ? 451 CYS A CA   2  
ATOM   1871  C  C    . CYS A 1 30 ? 3.069   -11.446 -12.638 1.00 0.00 ? 451 CYS A C    2  
ATOM   1872  O  O    . CYS A 1 30 ? 3.328   -12.051 -11.597 1.00 0.00 ? 451 CYS A O    2  
ATOM   1873  C  CB   . CYS A 1 30 ? 0.846   -10.523 -11.956 1.00 0.00 ? 451 CYS A CB   2  
ATOM   1874  S  SG   . CYS A 1 30 ? 1.184   -8.742  -11.778 1.00 0.00 ? 451 CYS A SG   2  
ATOM   1875  H  H    . CYS A 1 30 ? 0.385   -12.892 -12.837 1.00 0.00 ? 451 CYS A H    2  
ATOM   1876  H  HA   . CYS A 1 30 ? 1.640   -10.546 -13.943 1.00 0.00 ? 451 CYS A HA   2  
ATOM   1877  H  HB2  . CYS A 1 30 ? -0.211  -10.639 -12.144 1.00 0.00 ? 451 CYS A HB2  2  
ATOM   1878  H  HB3  . CYS A 1 30 ? 1.094   -11.001 -11.019 1.00 0.00 ? 451 CYS A HB3  2  
ATOM   1879  N  N    . PRO A 1 31 ? 4.028   -10.969 -13.445 1.00 0.00 ? 452 PRO A N    2  
ATOM   1880  C  CA   . PRO A 1 31 ? 5.457   -11.126 -13.155 1.00 0.00 ? 452 PRO A CA   2  
ATOM   1881  C  C    . PRO A 1 31 ? 5.903   -10.284 -11.964 1.00 0.00 ? 452 PRO A C    2  
ATOM   1882  O  O    . PRO A 1 31 ? 7.075   -10.296 -11.588 1.00 0.00 ? 452 PRO A O    2  
ATOM   1883  C  CB   . PRO A 1 31 ? 6.134   -10.639 -14.438 1.00 0.00 ? 452 PRO A CB   2  
ATOM   1884  C  CG   . PRO A 1 31 ? 5.152   -9.702  -15.053 1.00 0.00 ? 452 PRO A CG   2  
ATOM   1885  C  CD   . PRO A 1 31 ? 3.792   -10.238 -14.701 1.00 0.00 ? 452 PRO A CD   2  
ATOM   1886  H  HA   . PRO A 1 31 ? 5.715   -12.160 -12.981 1.00 0.00 ? 452 PRO A HA   2  
ATOM   1887  H  HB2  . PRO A 1 31 ? 7.059   -10.136 -14.192 1.00 0.00 ? 452 PRO A HB2  2  
ATOM   1888  H  HB3  . PRO A 1 31 ? 6.336   -11.479 -15.085 1.00 0.00 ? 452 PRO A HB3  2  
ATOM   1889  H  HG2  . PRO A 1 31 ? 5.283   -8.712  -14.643 1.00 0.00 ? 452 PRO A HG2  2  
ATOM   1890  H  HG3  . PRO A 1 31 ? 5.283   -9.686  -16.125 1.00 0.00 ? 452 PRO A HG3  2  
ATOM   1891  H  HD2  . PRO A 1 31 ? 3.094   -9.428  -14.551 1.00 0.00 ? 452 PRO A HD2  2  
ATOM   1892  H  HD3  . PRO A 1 31 ? 3.439   -10.906 -15.474 1.00 0.00 ? 452 PRO A HD3  2  
ATOM   1893  N  N    . TYR A 1 32 ? 4.961   -9.556  -11.375 1.00 0.00 ? 453 TYR A N    2  
ATOM   1894  C  CA   . TYR A 1 32 ? 5.258   -8.707  -10.228 1.00 0.00 ? 453 TYR A CA   2  
ATOM   1895  C  C    . TYR A 1 32 ? 4.847   -9.387  -8.926  1.00 0.00 ? 453 TYR A C    2  
ATOM   1896  O  O    . TYR A 1 32 ? 4.267   -10.472 -8.936  1.00 0.00 ? 453 TYR A O    2  
ATOM   1897  C  CB   . TYR A 1 32 ? 4.541   -7.362  -10.362 1.00 0.00 ? 453 TYR A CB   2  
ATOM   1898  C  CG   . TYR A 1 32 ? 5.110   -6.479  -11.450 1.00 0.00 ? 453 TYR A CG   2  
ATOM   1899  C  CD1  . TYR A 1 32 ? 4.722   -6.639  -12.775 1.00 0.00 ? 453 TYR A CD1  2  
ATOM   1900  C  CD2  . TYR A 1 32 ? 6.034   -5.486  -11.153 1.00 0.00 ? 453 TYR A CD2  2  
ATOM   1901  C  CE1  . TYR A 1 32 ? 5.239   -5.834  -13.772 1.00 0.00 ? 453 TYR A CE1  2  
ATOM   1902  C  CE2  . TYR A 1 32 ? 6.556   -4.676  -12.144 1.00 0.00 ? 453 TYR A CE2  2  
ATOM   1903  C  CZ   . TYR A 1 32 ? 6.155   -4.854  -13.451 1.00 0.00 ? 453 TYR A CZ   2  
ATOM   1904  O  OH   . TYR A 1 32 ? 6.673   -4.051  -14.441 1.00 0.00 ? 453 TYR A OH   2  
ATOM   1905  H  H    . TYR A 1 32 ? 4.045   -9.588  -11.721 1.00 0.00 ? 453 TYR A H    2  
ATOM   1906  H  HA   . TYR A 1 32 ? 6.325   -8.534  -10.210 1.00 0.00 ? 453 TYR A HA   2  
ATOM   1907  H  HB2  . TYR A 1 32 ? 3.501   -7.538  -10.589 1.00 0.00 ? 453 TYR A HB2  2  
ATOM   1908  H  HB3  . TYR A 1 32 ? 4.616   -6.827  -9.427  1.00 0.00 ? 453 TYR A HB3  2  
ATOM   1909  H  HD1  . TYR A 1 32 ? 4.004   -7.407  -13.023 1.00 0.00 ? 453 TYR A HD1  2  
ATOM   1910  H  HD2  . TYR A 1 32 ? 6.346   -5.349  -10.128 1.00 0.00 ? 453 TYR A HD2  2  
ATOM   1911  H  HE1  . TYR A 1 32 ? 4.926   -5.973  -14.796 1.00 0.00 ? 453 TYR A HE1  2  
ATOM   1912  H  HE2  . TYR A 1 32 ? 7.273   -3.909  -11.893 1.00 0.00 ? 453 TYR A HE2  2  
ATOM   1913  H  HH   . TYR A 1 32 ? 6.735   -4.550  -15.259 1.00 0.00 ? 453 TYR A HH   2  
ATOM   1914  N  N    . MET A 1 33 ? 5.153   -8.740  -7.806  1.00 0.00 ? 454 MET A N    2  
ATOM   1915  C  CA   . MET A 1 33 ? 4.814   -9.281  -6.495  1.00 0.00 ? 454 MET A CA   2  
ATOM   1916  C  C    . MET A 1 33 ? 3.433   -8.807  -6.051  1.00 0.00 ? 454 MET A C    2  
ATOM   1917  O  O    . MET A 1 33 ? 3.042   -7.669  -6.315  1.00 0.00 ? 454 MET A O    2  
ATOM   1918  C  CB   . MET A 1 33 ? 5.864   -8.867  -5.461  1.00 0.00 ? 454 MET A CB   2  
ATOM   1919  C  CG   . MET A 1 33 ? 7.224   -9.507  -5.688  1.00 0.00 ? 454 MET A CG   2  
ATOM   1920  S  SD   . MET A 1 33 ? 7.306   -11.200 -5.073  1.00 0.00 ? 454 MET A SD   2  
ATOM   1921  C  CE   . MET A 1 33 ? 7.922   -10.928 -3.413  1.00 0.00 ? 454 MET A CE   2  
ATOM   1922  H  H    . MET A 1 33 ? 5.616   -7.878  -7.862  1.00 0.00 ? 454 MET A H    2  
ATOM   1923  H  HA   . MET A 1 33 ? 4.804   -10.358 -6.573  1.00 0.00 ? 454 MET A HA   2  
ATOM   1924  H  HB2  . MET A 1 33 ? 5.984   -7.795  -5.497  1.00 0.00 ? 454 MET A HB2  2  
ATOM   1925  H  HB3  . MET A 1 33 ? 5.516   -9.150  -4.479  1.00 0.00 ? 454 MET A HB3  2  
ATOM   1926  H  HG2  . MET A 1 33 ? 7.432   -9.515  -6.747  1.00 0.00 ? 454 MET A HG2  2  
ATOM   1927  H  HG3  . MET A 1 33 ? 7.973   -8.917  -5.180  1.00 0.00 ? 454 MET A HG3  2  
ATOM   1928  H  HE1  . MET A 1 33 ? 8.935   -10.559 -3.461  1.00 0.00 ? 454 MET A HE1  2  
ATOM   1929  H  HE2  . MET A 1 33 ? 7.298   -10.203 -2.912  1.00 0.00 ? 454 MET A HE2  2  
ATOM   1930  H  HE3  . MET A 1 33 ? 7.903   -11.859 -2.865  1.00 0.00 ? 454 MET A HE3  2  
ATOM   1931  N  N    . HIS A 1 34 ? 2.699   -9.686  -5.377  1.00 0.00 ? 455 HIS A N    2  
ATOM   1932  C  CA   . HIS A 1 34 ? 1.361   -9.357  -4.897  1.00 0.00 ? 455 HIS A CA   2  
ATOM   1933  C  C    . HIS A 1 34 ? 1.284   -9.477  -3.378  1.00 0.00 ? 455 HIS A C    2  
ATOM   1934  O  O    . HIS A 1 34 ? 1.278   -8.475  -2.665  1.00 0.00 ? 455 HIS A O    2  
ATOM   1935  C  CB   . HIS A 1 34 ? 0.324   -10.273 -5.546  1.00 0.00 ? 455 HIS A CB   2  
ATOM   1936  C  CG   . HIS A 1 34 ? -0.061  -9.854  -6.932  1.00 0.00 ? 455 HIS A CG   2  
ATOM   1937  N  ND1  . HIS A 1 34 ? -1.148  -10.376 -7.601  1.00 0.00 ? 455 HIS A ND1  2  
ATOM   1938  C  CD2  . HIS A 1 34 ? 0.502   -8.957  -7.775  1.00 0.00 ? 455 HIS A CD2  2  
ATOM   1939  C  CE1  . HIS A 1 34 ? -1.236  -9.819  -8.796  1.00 0.00 ? 455 HIS A CE1  2  
ATOM   1940  N  NE2  . HIS A 1 34 ? -0.246  -8.954  -8.926  1.00 0.00 ? 455 HIS A NE2  2  
ATOM   1941  H  H    . HIS A 1 34 ? 3.065   -10.577 -5.198  1.00 0.00 ? 455 HIS A H    2  
ATOM   1942  H  HA   . HIS A 1 34 ? 1.151   -8.335  -5.176  1.00 0.00 ? 455 HIS A HA   2  
ATOM   1943  H  HB2  . HIS A 1 34 ? 0.722   -11.275 -5.602  1.00 0.00 ? 455 HIS A HB2  2  
ATOM   1944  H  HB3  . HIS A 1 34 ? -0.571  -10.279 -4.940  1.00 0.00 ? 455 HIS A HB3  2  
ATOM   1945  H  HD1  . HIS A 1 34 ? -1.763  -11.054 -7.252  1.00 0.00 ? 455 HIS A HD1  2  
ATOM   1946  H  HD2  . HIS A 1 34 ? 1.379   -8.355  -7.579  1.00 0.00 ? 455 HIS A HD2  2  
ATOM   1947  H  HE1  . HIS A 1 34 ? -1.989  -10.033 -9.539  1.00 0.00 ? 455 HIS A HE1  2  
ATOM   1948  N  N    . GLY A 1 35 ? 1.225   -10.712 -2.889  1.00 0.00 ? 456 GLY A N    2  
ATOM   1949  C  CA   . GLY A 1 35 ? 1.148   -10.941 -1.458  1.00 0.00 ? 456 GLY A CA   2  
ATOM   1950  C  C    . GLY A 1 35 ? 2.501   -10.838 -0.781  1.00 0.00 ? 456 GLY A C    2  
ATOM   1951  O  O    . GLY A 1 35 ? 2.745   -9.912  -0.006  1.00 0.00 ? 456 GLY A O    2  
ATOM   1952  H  H    . GLY A 1 35 ? 1.234   -11.475 -3.505  1.00 0.00 ? 456 GLY A H    2  
ATOM   1953  H  HA2  . GLY A 1 35 ? 0.483   -10.211 -1.023  1.00 0.00 ? 456 GLY A HA2  2  
ATOM   1954  H  HA3  . GLY A 1 35 ? 0.746   -11.928 -1.284  1.00 0.00 ? 456 GLY A HA3  2  
ATOM   1955  N  N    . ASP A 1 36 ? 3.380   -11.789 -1.072  1.00 0.00 ? 457 ASP A N    2  
ATOM   1956  C  CA   . ASP A 1 36 ? 4.715   -11.802 -0.485  1.00 0.00 ? 457 ASP A CA   2  
ATOM   1957  C  C    . ASP A 1 36 ? 5.236   -10.382 -0.289  1.00 0.00 ? 457 ASP A C    2  
ATOM   1958  O  O    . ASP A 1 36 ? 5.936   -10.095 0.682   1.00 0.00 ? 457 ASP A O    2  
ATOM   1959  C  CB   . ASP A 1 36 ? 5.678   -12.594 -1.371  1.00 0.00 ? 457 ASP A CB   2  
ATOM   1960  C  CG   . ASP A 1 36 ? 5.118   -13.945 -1.771  1.00 0.00 ? 457 ASP A CG   2  
ATOM   1961  O  OD1  . ASP A 1 36 ? 5.312   -14.917 -1.011  1.00 0.00 ? 457 ASP A OD1  2  
ATOM   1962  O  OD2  . ASP A 1 36 ? 4.485   -14.030 -2.844  1.00 0.00 ? 457 ASP A OD2  2  
ATOM   1963  H  H    . ASP A 1 36 ? 3.126   -12.500 -1.697  1.00 0.00 ? 457 ASP A H    2  
ATOM   1964  H  HA   . ASP A 1 36 ? 4.649   -12.284 0.479   1.00 0.00 ? 457 ASP A HA   2  
ATOM   1965  H  HB2  . ASP A 1 36 ? 5.878   -12.028 -2.270  1.00 0.00 ? 457 ASP A HB2  2  
ATOM   1966  H  HB3  . ASP A 1 36 ? 6.603   -12.751 -0.836  1.00 0.00 ? 457 ASP A HB3  2  
ATOM   1967  N  N    . PHE A 1 37 ? 4.891   -9.497  -1.218  1.00 0.00 ? 458 PHE A N    2  
ATOM   1968  C  CA   . PHE A 1 37 ? 5.325   -8.106  -1.149  1.00 0.00 ? 458 PHE A CA   2  
ATOM   1969  C  C    . PHE A 1 37 ? 4.998   -7.502  0.213   1.00 0.00 ? 458 PHE A C    2  
ATOM   1970  O  O    . PHE A 1 37 ? 3.851   -7.499  0.660   1.00 0.00 ? 458 PHE A O    2  
ATOM   1971  C  CB   . PHE A 1 37 ? 4.660   -7.286  -2.257  1.00 0.00 ? 458 PHE A CB   2  
ATOM   1972  C  CG   . PHE A 1 37 ? 5.378   -6.004  -2.566  1.00 0.00 ? 458 PHE A CG   2  
ATOM   1973  C  CD1  . PHE A 1 37 ? 6.525   -6.006  -3.342  1.00 0.00 ? 458 PHE A CD1  2  
ATOM   1974  C  CD2  . PHE A 1 37 ? 4.904   -4.795  -2.081  1.00 0.00 ? 458 PHE A CD2  2  
ATOM   1975  C  CE1  . PHE A 1 37 ? 7.188   -4.827  -3.628  1.00 0.00 ? 458 PHE A CE1  2  
ATOM   1976  C  CE2  . PHE A 1 37 ? 5.562   -3.613  -2.363  1.00 0.00 ? 458 PHE A CE2  2  
ATOM   1977  C  CZ   . PHE A 1 37 ? 6.705   -3.629  -3.138  1.00 0.00 ? 458 PHE A CZ   2  
ATOM   1978  H  H    . PHE A 1 37 ? 4.331   -9.786  -1.969  1.00 0.00 ? 458 PHE A H    2  
ATOM   1979  H  HA   . PHE A 1 37 ? 6.395   -8.087  -1.291  1.00 0.00 ? 458 PHE A HA   2  
ATOM   1980  H  HB2  . PHE A 1 37 ? 4.629   -7.875  -3.161  1.00 0.00 ? 458 PHE A HB2  2  
ATOM   1981  H  HB3  . PHE A 1 37 ? 3.653   -7.041  -1.957  1.00 0.00 ? 458 PHE A HB3  2  
ATOM   1982  H  HD1  . PHE A 1 37 ? 6.904   -6.942  -3.726  1.00 0.00 ? 458 PHE A HD1  2  
ATOM   1983  H  HD2  . PHE A 1 37 ? 4.010   -4.782  -1.474  1.00 0.00 ? 458 PHE A HD2  2  
ATOM   1984  H  HE1  . PHE A 1 37 ? 8.081   -4.842  -4.234  1.00 0.00 ? 458 PHE A HE1  2  
ATOM   1985  H  HE2  . PHE A 1 37 ? 5.182   -2.678  -1.979  1.00 0.00 ? 458 PHE A HE2  2  
ATOM   1986  H  HZ   . PHE A 1 37 ? 7.221   -2.707  -3.360  1.00 0.00 ? 458 PHE A HZ   2  
ATOM   1987  N  N    . PRO A 1 38 ? 6.030   -6.976  0.890   1.00 0.00 ? 459 PRO A N    2  
ATOM   1988  C  CA   . PRO A 1 38 ? 5.879   -6.359  2.211   1.00 0.00 ? 459 PRO A CA   2  
ATOM   1989  C  C    . PRO A 1 38 ? 5.120   -5.038  2.149   1.00 0.00 ? 459 PRO A C    2  
ATOM   1990  O  O    . PRO A 1 38 ? 5.304   -4.247  1.224   1.00 0.00 ? 459 PRO A O    2  
ATOM   1991  C  CB   . PRO A 1 38 ? 7.323   -6.125  2.661   1.00 0.00 ? 459 PRO A CB   2  
ATOM   1992  C  CG   . PRO A 1 38 ? 8.103   -6.025  1.395   1.00 0.00 ? 459 PRO A CG   2  
ATOM   1993  C  CD   . PRO A 1 38 ? 7.425   -6.944  0.417   1.00 0.00 ? 459 PRO A CD   2  
ATOM   1994  H  HA   . PRO A 1 38 ? 5.386   -7.024  2.905   1.00 0.00 ? 459 PRO A HA   2  
ATOM   1995  H  HB2  . PRO A 1 38 ? 7.380   -5.211  3.235   1.00 0.00 ? 459 PRO A HB2  2  
ATOM   1996  H  HB3  . PRO A 1 38 ? 7.655   -6.957  3.264   1.00 0.00 ? 459 PRO A HB3  2  
ATOM   1997  H  HG2  . PRO A 1 38 ? 8.083   -5.010  1.031   1.00 0.00 ? 459 PRO A HG2  2  
ATOM   1998  H  HG3  . PRO A 1 38 ? 9.120   -6.345  1.565   1.00 0.00 ? 459 PRO A HG3  2  
ATOM   1999  H  HD2  . PRO A 1 38 ? 7.484   -6.541  -0.583  1.00 0.00 ? 459 PRO A HD2  2  
ATOM   2000  H  HD3  . PRO A 1 38 ? 7.867   -7.929  0.456   1.00 0.00 ? 459 PRO A HD3  2  
ATOM   2001  N  N    . CYS A 1 39 ? 4.266   -4.804  3.141   1.00 0.00 ? 460 CYS A N    2  
ATOM   2002  C  CA   . CYS A 1 39 ? 3.479   -3.579  3.200   1.00 0.00 ? 460 CYS A CA   2  
ATOM   2003  C  C    . CYS A 1 39 ? 4.372   -2.371  3.467   1.00 0.00 ? 460 CYS A C    2  
ATOM   2004  O  O    . CYS A 1 39 ? 5.331   -2.451  4.236   1.00 0.00 ? 460 CYS A O    2  
ATOM   2005  C  CB   . CYS A 1 39 ? 2.410   -3.687  4.289   1.00 0.00 ? 460 CYS A CB   2  
ATOM   2006  S  SG   . CYS A 1 39 ? 1.039   -2.501  4.106   1.00 0.00 ? 460 CYS A SG   2  
ATOM   2007  H  H    . CYS A 1 39 ? 4.163   -5.473  3.850   1.00 0.00 ? 460 CYS A H    2  
ATOM   2008  H  HA   . CYS A 1 39 ? 2.995   -3.449  2.244   1.00 0.00 ? 460 CYS A HA   2  
ATOM   2009  H  HB2  . CYS A 1 39 ? 1.988   -4.681  4.271   1.00 0.00 ? 460 CYS A HB2  2  
ATOM   2010  H  HB3  . CYS A 1 39 ? 2.868   -3.514  5.251   1.00 0.00 ? 460 CYS A HB3  2  
ATOM   2011  N  N    . LYS A 1 40 ? 4.051   -1.252  2.827   1.00 0.00 ? 461 LYS A N    2  
ATOM   2012  C  CA   . LYS A 1 40 ? 4.822   -0.025  2.995   1.00 0.00 ? 461 LYS A CA   2  
ATOM   2013  C  C    . LYS A 1 40 ? 4.489   0.649   4.322   1.00 0.00 ? 461 LYS A C    2  
ATOM   2014  O  O    . LYS A 1 40 ? 5.336   0.747   5.210   1.00 0.00 ? 461 LYS A O    2  
ATOM   2015  C  CB   . LYS A 1 40 ? 4.546   0.937   1.838   1.00 0.00 ? 461 LYS A CB   2  
ATOM   2016  C  CG   . LYS A 1 40 ? 5.254   2.274   1.976   1.00 0.00 ? 461 LYS A CG   2  
ATOM   2017  C  CD   . LYS A 1 40 ? 4.872   3.226   0.856   1.00 0.00 ? 461 LYS A CD   2  
ATOM   2018  C  CE   . LYS A 1 40 ? 5.616   4.548   0.969   1.00 0.00 ? 461 LYS A CE   2  
ATOM   2019  N  NZ   . LYS A 1 40 ? 5.548   5.333   -0.294  1.00 0.00 ? 461 LYS A NZ   2  
ATOM   2020  H  H    . LYS A 1 40 ? 3.275   -1.250  2.226   1.00 0.00 ? 461 LYS A H    2  
ATOM   2021  H  HA   . LYS A 1 40 ? 5.869   -0.288  2.991   1.00 0.00 ? 461 LYS A HA   2  
ATOM   2022  H  HB2  . LYS A 1 40 ? 4.869   0.476   0.916   1.00 0.00 ? 461 LYS A HB2  2  
ATOM   2023  H  HB3  . LYS A 1 40 ? 3.482   1.121   1.784   1.00 0.00 ? 461 LYS A HB3  2  
ATOM   2024  H  HG2  . LYS A 1 40 ? 4.982   2.719   2.921   1.00 0.00 ? 461 LYS A HG2  2  
ATOM   2025  H  HG3  . LYS A 1 40 ? 6.322   2.109   1.948   1.00 0.00 ? 461 LYS A HG3  2  
ATOM   2026  H  HD2  . LYS A 1 40 ? 5.115   2.770   -0.092  1.00 0.00 ? 461 LYS A HD2  2  
ATOM   2027  H  HD3  . LYS A 1 40 ? 3.809   3.416   0.904   1.00 0.00 ? 461 LYS A HD3  2  
ATOM   2028  H  HE2  . LYS A 1 40 ? 5.175   5.127   1.767   1.00 0.00 ? 461 LYS A HE2  2  
ATOM   2029  H  HE3  . LYS A 1 40 ? 6.651   4.344   1.202   1.00 0.00 ? 461 LYS A HE3  2  
ATOM   2030  H  HZ1  . LYS A 1 40 ? 4.557   5.531   -0.539  1.00 0.00 ? 461 LYS A HZ1  2  
ATOM   2031  H  HZ2  . LYS A 1 40 ? 5.985   4.798   -1.071  1.00 0.00 ? 461 LYS A HZ2  2  
ATOM   2032  H  HZ3  . LYS A 1 40 ? 6.053   6.235   -0.182  1.00 0.00 ? 461 LYS A HZ3  2  
ATOM   2033  N  N    . LEU A 1 41 ? 3.250   1.111   4.450   1.00 0.00 ? 462 LEU A N    2  
ATOM   2034  C  CA   . LEU A 1 41 ? 2.804   1.776   5.671   1.00 0.00 ? 462 LEU A CA   2  
ATOM   2035  C  C    . LEU A 1 41 ? 3.260   1.007   6.907   1.00 0.00 ? 462 LEU A C    2  
ATOM   2036  O  O    . LEU A 1 41 ? 3.966   1.545   7.760   1.00 0.00 ? 462 LEU A O    2  
ATOM   2037  C  CB   . LEU A 1 41 ? 1.281   1.911   5.673   1.00 0.00 ? 462 LEU A CB   2  
ATOM   2038  C  CG   . LEU A 1 41 ? 0.708   3.060   4.842   1.00 0.00 ? 462 LEU A CG   2  
ATOM   2039  C  CD1  . LEU A 1 41 ? -0.810  2.978   4.795   1.00 0.00 ? 462 LEU A CD1  2  
ATOM   2040  C  CD2  . LEU A 1 41 ? 1.154   4.401   5.407   1.00 0.00 ? 462 LEU A CD2  2  
ATOM   2041  H  H    . LEU A 1 41 ? 2.620   1.004   3.708   1.00 0.00 ? 462 LEU A H    2  
ATOM   2042  H  HA   . LEU A 1 41 ? 3.245   2.761   5.691   1.00 0.00 ? 462 LEU A HA   2  
ATOM   2043  H  HB2  . LEU A 1 41 ? 0.866   0.990   5.294   1.00 0.00 ? 462 LEU A HB2  2  
ATOM   2044  H  HB3  . LEU A 1 41 ? 0.964   2.052   6.697   1.00 0.00 ? 462 LEU A HB3  2  
ATOM   2045  H  HG   . LEU A 1 41 ? 1.078   2.982   3.829   1.00 0.00 ? 462 LEU A HG   2  
ATOM   2046  H  HD11 . LEU A 1 41 ? -1.107  2.184   4.126   1.00 0.00 ? 462 LEU A HD11 2  
ATOM   2047  H  HD12 . LEU A 1 41 ? -1.210  3.916   4.439   1.00 0.00 ? 462 LEU A HD12 2  
ATOM   2048  H  HD13 . LEU A 1 41 ? -1.191  2.777   5.785   1.00 0.00 ? 462 LEU A HD13 2  
ATOM   2049  H  HD21 . LEU A 1 41 ? 1.556   4.257   6.399   1.00 0.00 ? 462 LEU A HD21 2  
ATOM   2050  H  HD22 . LEU A 1 41 ? 0.307   5.070   5.455   1.00 0.00 ? 462 LEU A HD22 2  
ATOM   2051  H  HD23 . LEU A 1 41 ? 1.914   4.825   4.768   1.00 0.00 ? 462 LEU A HD23 2  
ATOM   2052  N  N    . TYR A 1 42 ? 2.854   -0.255  6.995   1.00 0.00 ? 463 TYR A N    2  
ATOM   2053  C  CA   . TYR A 1 42 ? 3.221   -1.098  8.127   1.00 0.00 ? 463 TYR A CA   2  
ATOM   2054  C  C    . TYR A 1 42 ? 4.675   -0.870  8.528   1.00 0.00 ? 463 TYR A C    2  
ATOM   2055  O  O    . TYR A 1 42 ? 5.063   -1.119  9.670   1.00 0.00 ? 463 TYR A O    2  
ATOM   2056  C  CB   . TYR A 1 42 ? 3.000   -2.572  7.784   1.00 0.00 ? 463 TYR A CB   2  
ATOM   2057  C  CG   . TYR A 1 42 ? 3.281   -3.511  8.936   1.00 0.00 ? 463 TYR A CG   2  
ATOM   2058  C  CD1  . TYR A 1 42 ? 2.281   -3.859  9.834   1.00 0.00 ? 463 TYR A CD1  2  
ATOM   2059  C  CD2  . TYR A 1 42 ? 4.548   -4.050  9.124   1.00 0.00 ? 463 TYR A CD2  2  
ATOM   2060  C  CE1  . TYR A 1 42 ? 2.534   -4.715  10.889  1.00 0.00 ? 463 TYR A CE1  2  
ATOM   2061  C  CE2  . TYR A 1 42 ? 4.810   -4.908  10.175  1.00 0.00 ? 463 TYR A CE2  2  
ATOM   2062  C  CZ   . TYR A 1 42 ? 3.800   -5.237  11.054  1.00 0.00 ? 463 TYR A CZ   2  
ATOM   2063  O  OH   . TYR A 1 42 ? 4.056   -6.092  12.102  1.00 0.00 ? 463 TYR A OH   2  
ATOM   2064  H  H    . TYR A 1 42 ? 2.294   -0.628  6.283   1.00 0.00 ? 463 TYR A H    2  
ATOM   2065  H  HA   . TYR A 1 42 ? 2.584   -0.833  8.958   1.00 0.00 ? 463 TYR A HA   2  
ATOM   2066  H  HB2  . TYR A 1 42 ? 1.973   -2.715  7.484   1.00 0.00 ? 463 TYR A HB2  2  
ATOM   2067  H  HB3  . TYR A 1 42 ? 3.650   -2.846  6.966   1.00 0.00 ? 463 TYR A HB3  2  
ATOM   2068  H  HD1  . TYR A 1 42 ? 1.290   -3.448  9.701   1.00 0.00 ? 463 TYR A HD1  2  
ATOM   2069  H  HD2  . TYR A 1 42 ? 5.337   -3.790  8.434   1.00 0.00 ? 463 TYR A HD2  2  
ATOM   2070  H  HE1  . TYR A 1 42 ? 1.743   -4.973  11.577  1.00 0.00 ? 463 TYR A HE1  2  
ATOM   2071  H  HE2  . TYR A 1 42 ? 5.801   -5.317  10.305  1.00 0.00 ? 463 TYR A HE2  2  
ATOM   2072  H  HH   . TYR A 1 42 ? 4.722   -5.705  12.675  1.00 0.00 ? 463 TYR A HH   2  
ATOM   2073  N  N    . HIS A 1 43 ? 5.476   -0.394  7.579   1.00 0.00 ? 464 HIS A N    2  
ATOM   2074  C  CA   . HIS A 1 43 ? 6.888   -0.130  7.833   1.00 0.00 ? 464 HIS A CA   2  
ATOM   2075  C  C    . HIS A 1 43 ? 7.128   1.357   8.076   1.00 0.00 ? 464 HIS A C    2  
ATOM   2076  O  O    . HIS A 1 43 ? 7.745   1.743   9.069   1.00 0.00 ? 464 HIS A O    2  
ATOM   2077  C  CB   . HIS A 1 43 ? 7.737   -0.609  6.655   1.00 0.00 ? 464 HIS A CB   2  
ATOM   2078  C  CG   . HIS A 1 43 ? 7.988   -2.086  6.659   1.00 0.00 ? 464 HIS A CG   2  
ATOM   2079  N  ND1  . HIS A 1 43 ? 8.400   -2.776  7.779   1.00 0.00 ? 464 HIS A ND1  2  
ATOM   2080  C  CD2  . HIS A 1 43 ? 7.880   -3.005  5.671   1.00 0.00 ? 464 HIS A CD2  2  
ATOM   2081  C  CE1  . HIS A 1 43 ? 8.537   -4.056  7.479   1.00 0.00 ? 464 HIS A CE1  2  
ATOM   2082  N  NE2  . HIS A 1 43 ? 8.227   -4.221  6.206   1.00 0.00 ? 464 HIS A NE2  2  
ATOM   2083  H  H    . HIS A 1 43 ? 5.108   -0.215  6.689   1.00 0.00 ? 464 HIS A H    2  
ATOM   2084  H  HA   . HIS A 1 43 ? 7.174   -0.678  8.718   1.00 0.00 ? 464 HIS A HA   2  
ATOM   2085  H  HB2  . HIS A 1 43 ? 7.234   -0.361  5.732   1.00 0.00 ? 464 HIS A HB2  2  
ATOM   2086  H  HB3  . HIS A 1 43 ? 8.695   -0.109  6.683   1.00 0.00 ? 464 HIS A HB3  2  
ATOM   2087  H  HD2  . HIS A 1 43 ? 7.578   -2.817  4.650   1.00 0.00 ? 464 HIS A HD2  2  
ATOM   2088  H  HE1  . HIS A 1 43 ? 8.849   -4.834  8.159   1.00 0.00 ? 464 HIS A HE1  2  
ATOM   2089  H  HE2  . HIS A 1 43 ? 8.326   -5.057  5.705   1.00 0.00 ? 464 HIS A HE2  2  
ATOM   2090  N  N    . THR A 1 44 ? 6.636   2.188   7.162   1.00 0.00 ? 465 THR A N    2  
ATOM   2091  C  CA   . THR A 1 44 ? 6.798   3.632   7.277   1.00 0.00 ? 465 THR A CA   2  
ATOM   2092  C  C    . THR A 1 44 ? 6.835   4.067   8.737   1.00 0.00 ? 465 THR A C    2  
ATOM   2093  O  O    . THR A 1 44 ? 7.624   4.933   9.119   1.00 0.00 ? 465 THR A O    2  
ATOM   2094  C  CB   . THR A 1 44 ? 5.663   4.384   6.557   1.00 0.00 ? 465 THR A CB   2  
ATOM   2095  O  OG1  . THR A 1 44 ? 4.416   4.137   7.218   1.00 0.00 ? 465 THR A OG1  2  
ATOM   2096  C  CG2  . THR A 1 44 ? 5.565   3.952   5.102   1.00 0.00 ? 465 THR A CG2  2  
ATOM   2097  H  H    . THR A 1 44 ? 6.154   1.820   6.393   1.00 0.00 ? 465 THR A H    2  
ATOM   2098  H  HA   . THR A 1 44 ? 7.734   3.901   6.807   1.00 0.00 ? 465 THR A HA   2  
ATOM   2099  H  HB   . THR A 1 44 ? 5.875   5.443   6.590   1.00 0.00 ? 465 THR A HB   2  
ATOM   2100  H  HG1  . THR A 1 44 ? 4.429   3.259   7.608   1.00 0.00 ? 465 THR A HG1  2  
ATOM   2101  H  HG21 . THR A 1 44 ? 6.538   4.028   4.638   1.00 0.00 ? 465 THR A HG21 2  
ATOM   2102  H  HG22 . THR A 1 44 ? 4.868   4.593   4.582   1.00 0.00 ? 465 THR A HG22 2  
ATOM   2103  H  HG23 . THR A 1 44 ? 5.222   2.930   5.052   1.00 0.00 ? 465 THR A HG23 2  
ATOM   2104  N  N    . THR A 1 45 ? 5.977   3.462   9.552   1.00 0.00 ? 466 THR A N    2  
ATOM   2105  C  CA   . THR A 1 45 ? 5.911   3.787   10.971  1.00 0.00 ? 466 THR A CA   2  
ATOM   2106  C  C    . THR A 1 45 ? 5.888   2.524   11.825  1.00 0.00 ? 466 THR A C    2  
ATOM   2107  O  O    . THR A 1 45 ? 6.411   2.506   12.938  1.00 0.00 ? 466 THR A O    2  
ATOM   2108  C  CB   . THR A 1 45 ? 4.667   4.635   11.296  1.00 0.00 ? 466 THR A CB   2  
ATOM   2109  O  OG1  . THR A 1 45 ? 3.479   3.916   10.947  1.00 0.00 ? 466 THR A OG1  2  
ATOM   2110  C  CG2  . THR A 1 45 ? 4.703   5.959   10.546  1.00 0.00 ? 466 THR A CG2  2  
ATOM   2111  H  H    . THR A 1 45 ? 5.374   2.780   9.189   1.00 0.00 ? 466 THR A H    2  
ATOM   2112  H  HA   . THR A 1 45 ? 6.790   4.364   11.222  1.00 0.00 ? 466 THR A HA   2  
ATOM   2113  H  HB   . THR A 1 45 ? 4.656   4.840   12.357  1.00 0.00 ? 466 THR A HB   2  
ATOM   2114  H  HG1  . THR A 1 45 ? 3.194   4.176   10.067  1.00 0.00 ? 466 THR A HG1  2  
ATOM   2115  H  HG21 . THR A 1 45 ? 3.716   6.397   10.542  1.00 0.00 ? 466 THR A HG21 2  
ATOM   2116  H  HG22 . THR A 1 45 ? 5.027   5.788   9.530   1.00 0.00 ? 466 THR A HG22 2  
ATOM   2117  H  HG23 . THR A 1 45 ? 5.393   6.630   11.036  1.00 0.00 ? 466 THR A HG23 2  
ATOM   2118  N  N    . GLY A 1 46 ? 5.277   1.468   11.295  1.00 0.00 ? 467 GLY A N    2  
ATOM   2119  C  CA   . GLY A 1 46 ? 5.198   0.215   12.022  1.00 0.00 ? 467 GLY A CA   2  
ATOM   2120  C  C    . GLY A 1 46 ? 3.811   -0.396  11.975  1.00 0.00 ? 467 GLY A C    2  
ATOM   2121  O  O    . GLY A 1 46 ? 3.664   -1.616  11.939  1.00 0.00 ? 467 GLY A O    2  
ATOM   2122  H  H    . GLY A 1 46 ? 4.877   1.541   10.403  1.00 0.00 ? 467 GLY A H    2  
ATOM   2123  H  HA2  . GLY A 1 46 ? 5.902   -0.482  11.593  1.00 0.00 ? 467 GLY A HA2  2  
ATOM   2124  H  HA3  . GLY A 1 46 ? 5.466   0.393   13.053  1.00 0.00 ? 467 GLY A HA3  2  
ATOM   2125  N  N    . ASN A 1 47 ? 2.791   0.456   11.979  1.00 0.00 ? 468 ASN A N    2  
ATOM   2126  C  CA   . ASN A 1 47 ? 1.409   -0.007  11.939  1.00 0.00 ? 468 ASN A CA   2  
ATOM   2127  C  C    . ASN A 1 47 ? 0.764   0.320   10.595  1.00 0.00 ? 468 ASN A C    2  
ATOM   2128  O  O    . ASN A 1 47 ? 1.106   1.316   9.956   1.00 0.00 ? 468 ASN A O    2  
ATOM   2129  C  CB   . ASN A 1 47 ? 0.603   0.630   13.073  1.00 0.00 ? 468 ASN A CB   2  
ATOM   2130  C  CG   . ASN A 1 47 ? 0.277   2.087   12.803  1.00 0.00 ? 468 ASN A CG   2  
ATOM   2131  O  OD1  . ASN A 1 47 ? 1.174   2.912   12.628  1.00 0.00 ? 468 ASN A OD1  2  
ATOM   2132  N  ND2  . ASN A 1 47 ? -1.011  2.409   12.770  1.00 0.00 ? 468 ASN A ND2  2  
ATOM   2133  H  H    . ASN A 1 47 ? 2.972   1.419   12.009  1.00 0.00 ? 468 ASN A H    2  
ATOM   2134  H  HA   . ASN A 1 47 ? 1.414   -1.078  12.071  1.00 0.00 ? 468 ASN A HA   2  
ATOM   2135  H  HB2  . ASN A 1 47 ? -0.326  0.091   13.193  1.00 0.00 ? 468 ASN A HB2  2  
ATOM   2136  H  HB3  . ASN A 1 47 ? 1.171   0.570   13.989  1.00 0.00 ? 468 ASN A HB3  2  
ATOM   2137  H  HD21 . ASN A 1 47 ? -1.670  1.699   12.918  1.00 0.00 ? 468 ASN A HD21 2  
ATOM   2138  H  HD22 . ASN A 1 47 ? -1.249  3.343   12.597  1.00 0.00 ? 468 ASN A HD22 2  
ATOM   2139  N  N    . CYS A 1 48 ? -0.171  -0.524  10.173  1.00 0.00 ? 469 CYS A N    2  
ATOM   2140  C  CA   . CYS A 1 48 ? -0.865  -0.327  8.906   1.00 0.00 ? 469 CYS A CA   2  
ATOM   2141  C  C    . CYS A 1 48 ? -2.277  0.203   9.136   1.00 0.00 ? 469 CYS A C    2  
ATOM   2142  O  O    . CYS A 1 48 ? -2.891  -0.065  10.170  1.00 0.00 ? 469 CYS A O    2  
ATOM   2143  C  CB   . CYS A 1 48 ? -0.922  -1.639  8.121   1.00 0.00 ? 469 CYS A CB   2  
ATOM   2144  S  SG   . CYS A 1 48 ? -1.418  -1.443  6.380   1.00 0.00 ? 469 CYS A SG   2  
ATOM   2145  H  H    . CYS A 1 48 ? -0.400  -1.301  10.727  1.00 0.00 ? 469 CYS A H    2  
ATOM   2146  H  HA   . CYS A 1 48 ? -0.310  0.401   8.334   1.00 0.00 ? 469 CYS A HA   2  
ATOM   2147  H  HB2  . CYS A 1 48 ? 0.056   -2.099  8.134   1.00 0.00 ? 469 CYS A HB2  2  
ATOM   2148  H  HB3  . CYS A 1 48 ? -1.632  -2.301  8.594   1.00 0.00 ? 469 CYS A HB3  2  
ATOM   2149  N  N    . ILE A 1 49 ? -2.787  0.954   8.166   1.00 0.00 ? 470 ILE A N    2  
ATOM   2150  C  CA   . ILE A 1 49 ? -4.127  1.520   8.263   1.00 0.00 ? 470 ILE A CA   2  
ATOM   2151  C  C    . ILE A 1 49 ? -5.189  0.478   7.928   1.00 0.00 ? 470 ILE A C    2  
ATOM   2152  O  O    . ILE A 1 49 ? -6.257  0.448   8.537   1.00 0.00 ? 470 ILE A O    2  
ATOM   2153  C  CB   . ILE A 1 49 ? -4.297  2.729   7.324   1.00 0.00 ? 470 ILE A CB   2  
ATOM   2154  C  CG1  . ILE A 1 49 ? -5.654  3.396   7.556   1.00 0.00 ? 470 ILE A CG1  2  
ATOM   2155  C  CG2  . ILE A 1 49 ? -4.154  2.296   5.872   1.00 0.00 ? 470 ILE A CG2  2  
ATOM   2156  C  CD1  . ILE A 1 49 ? -5.763  4.095   8.893   1.00 0.00 ? 470 ILE A CD1  2  
ATOM   2157  H  H    . ILE A 1 49 ? -2.249  1.132   7.367   1.00 0.00 ? 470 ILE A H    2  
ATOM   2158  H  HA   . ILE A 1 49 ? -4.275  1.855   9.279   1.00 0.00 ? 470 ILE A HA   2  
ATOM   2159  H  HB   . ILE A 1 49 ? -3.513  3.438   7.541   1.00 0.00 ? 470 ILE A HB   2  
ATOM   2160  H  HG12 . ILE A 1 49 ? -5.824  4.129   6.784   1.00 0.00 ? 470 ILE A HG12 2  
ATOM   2161  H  HG13 . ILE A 1 49 ? -6.428  2.644   7.510   1.00 0.00 ? 470 ILE A HG13 2  
ATOM   2162  H  HG21 . ILE A 1 49 ? -4.959  1.623   5.617   1.00 0.00 ? 470 ILE A HG21 2  
ATOM   2163  H  HG22 . ILE A 1 49 ? -4.196  3.165   5.232   1.00 0.00 ? 470 ILE A HG22 2  
ATOM   2164  H  HG23 . ILE A 1 49 ? -3.208  1.794   5.737   1.00 0.00 ? 470 ILE A HG23 2  
ATOM   2165  H  HD11 . ILE A 1 49 ? -6.543  3.633   9.479   1.00 0.00 ? 470 ILE A HD11 2  
ATOM   2166  H  HD12 . ILE A 1 49 ? -4.823  4.018   9.418   1.00 0.00 ? 470 ILE A HD12 2  
ATOM   2167  H  HD13 . ILE A 1 49 ? -6.002  5.138   8.735   1.00 0.00 ? 470 ILE A HD13 2  
ATOM   2168  N  N    . ASN A 1 50 ? -4.885  -0.378  6.957   1.00 0.00 ? 471 ASN A N    2  
ATOM   2169  C  CA   . ASN A 1 50 ? -5.813  -1.423  6.542   1.00 0.00 ? 471 ASN A CA   2  
ATOM   2170  C  C    . ASN A 1 50 ? -6.330  -2.202  7.748   1.00 0.00 ? 471 ASN A C    2  
ATOM   2171  O  O    . ASN A 1 50 ? -7.516  -2.151  8.071   1.00 0.00 ? 471 ASN A O    2  
ATOM   2172  C  CB   . ASN A 1 50 ? -5.132  -2.377  5.559   1.00 0.00 ? 471 ASN A CB   2  
ATOM   2173  C  CG   . ASN A 1 50 ? -4.703  -1.682  4.281   1.00 0.00 ? 471 ASN A CG   2  
ATOM   2174  O  OD1  . ASN A 1 50 ? -4.259  -0.534  4.305   1.00 0.00 ? 471 ASN A OD1  2  
ATOM   2175  N  ND2  . ASN A 1 50 ? -4.835  -2.376  3.157   1.00 0.00 ? 471 ASN A ND2  2  
ATOM   2176  H  H    . ASN A 1 50 ? -4.017  -0.304  6.509   1.00 0.00 ? 471 ASN A H    2  
ATOM   2177  H  HA   . ASN A 1 50 ? -6.648  -0.949  6.049   1.00 0.00 ? 471 ASN A HA   2  
ATOM   2178  H  HB2  . ASN A 1 50 ? -4.256  -2.801  6.027   1.00 0.00 ? 471 ASN A HB2  2  
ATOM   2179  H  HB3  . ASN A 1 50 ? -5.818  -3.171  5.303   1.00 0.00 ? 471 ASN A HB3  2  
ATOM   2180  H  HD21 . ASN A 1 50 ? -5.197  -3.285  3.214   1.00 0.00 ? 471 ASN A HD21 2  
ATOM   2181  H  HD22 . ASN A 1 50 ? -4.565  -1.951  2.317   1.00 0.00 ? 471 ASN A HD22 2  
ATOM   2182  N  N    . GLY A 1 51 ? -5.431  -2.922  8.411   1.00 0.00 ? 472 GLY A N    2  
ATOM   2183  C  CA   . GLY A 1 51 ? -5.814  -3.700  9.574   1.00 0.00 ? 472 GLY A CA   2  
ATOM   2184  C  C    . GLY A 1 51 ? -5.135  -5.054  9.616   1.00 0.00 ? 472 GLY A C    2  
ATOM   2185  O  O    . GLY A 1 51 ? -4.214  -5.318  8.842   1.00 0.00 ? 472 GLY A O    2  
ATOM   2186  H  H    . GLY A 1 51 ? -4.498  -2.924  8.108   1.00 0.00 ? 472 GLY A H    2  
ATOM   2187  H  HA2  . GLY A 1 51 ? -5.551  -3.150  10.465  1.00 0.00 ? 472 GLY A HA2  2  
ATOM   2188  H  HA3  . GLY A 1 51 ? -6.884  -3.848  9.557   1.00 0.00 ? 472 GLY A HA3  2  
ATOM   2189  N  N    . ASP A 1 52 ? -5.588  -5.915  10.521  1.00 0.00 ? 473 ASP A N    2  
ATOM   2190  C  CA   . ASP A 1 52 ? -5.017  -7.249  10.661  1.00 0.00 ? 473 ASP A CA   2  
ATOM   2191  C  C    . ASP A 1 52 ? -5.230  -8.067  9.391   1.00 0.00 ? 473 ASP A C    2  
ATOM   2192  O  O    . ASP A 1 52 ? -4.482  -9.004  9.111   1.00 0.00 ? 473 ASP A O    2  
ATOM   2193  C  CB   . ASP A 1 52 ? -5.639  -7.970  11.857  1.00 0.00 ? 473 ASP A CB   2  
ATOM   2194  C  CG   . ASP A 1 52 ? -7.139  -7.767  11.940  1.00 0.00 ? 473 ASP A CG   2  
ATOM   2195  O  OD1  . ASP A 1 52 ? -7.568  -6.711  12.453  1.00 0.00 ? 473 ASP A OD1  2  
ATOM   2196  O  OD2  . ASP A 1 52 ? -7.885  -8.662  11.491  1.00 0.00 ? 473 ASP A OD2  2  
ATOM   2197  H  H    . ASP A 1 52 ? -6.325  -5.646  11.109  1.00 0.00 ? 473 ASP A H    2  
ATOM   2198  H  HA   . ASP A 1 52 ? -3.956  -7.140  10.830  1.00 0.00 ? 473 ASP A HA   2  
ATOM   2199  H  HB2  . ASP A 1 52 ? -5.443  -9.030  11.773  1.00 0.00 ? 473 ASP A HB2  2  
ATOM   2200  H  HB3  . ASP A 1 52 ? -5.192  -7.597  12.767  1.00 0.00 ? 473 ASP A HB3  2  
ATOM   2201  N  N    . ASP A 1 53 ? -6.255  -7.707  8.626   1.00 0.00 ? 474 ASP A N    2  
ATOM   2202  C  CA   . ASP A 1 53 ? -6.567  -8.408  7.386   1.00 0.00 ? 474 ASP A CA   2  
ATOM   2203  C  C    . ASP A 1 53 ? -6.146  -7.581  6.175   1.00 0.00 ? 474 ASP A C    2  
ATOM   2204  O  O    . ASP A 1 53 ? -6.910  -7.424  5.221   1.00 0.00 ? 474 ASP A O    2  
ATOM   2205  C  CB   . ASP A 1 53 ? -8.063  -8.718  7.313   1.00 0.00 ? 474 ASP A CB   2  
ATOM   2206  C  CG   . ASP A 1 53 ? -8.607  -9.257  8.621   1.00 0.00 ? 474 ASP A CG   2  
ATOM   2207  O  OD1  . ASP A 1 53 ? -7.934  -10.110 9.237   1.00 0.00 ? 474 ASP A OD1  2  
ATOM   2208  O  OD2  . ASP A 1 53 ? -9.705  -8.825  9.029   1.00 0.00 ? 474 ASP A OD2  2  
ATOM   2209  H  H    . ASP A 1 53 ? -6.815  -6.952  8.903   1.00 0.00 ? 474 ASP A H    2  
ATOM   2210  H  HA   . ASP A 1 53 ? -6.016  -9.336  7.381   1.00 0.00 ? 474 ASP A HA   2  
ATOM   2211  H  HB2  . ASP A 1 53 ? -8.600  -7.813  7.067   1.00 0.00 ? 474 ASP A HB2  2  
ATOM   2212  H  HB3  . ASP A 1 53 ? -8.234  -9.454  6.541   1.00 0.00 ? 474 ASP A HB3  2  
ATOM   2213  N  N    . CYS A 1 54 ? -4.928  -7.053  6.219   1.00 0.00 ? 475 CYS A N    2  
ATOM   2214  C  CA   . CYS A 1 54 ? -4.405  -6.241  5.127   1.00 0.00 ? 475 CYS A CA   2  
ATOM   2215  C  C    . CYS A 1 54 ? -4.089  -7.105  3.910   1.00 0.00 ? 475 CYS A C    2  
ATOM   2216  O  O    . CYS A 1 54 ? -3.703  -8.266  4.044   1.00 0.00 ? 475 CYS A O    2  
ATOM   2217  C  CB   . CYS A 1 54 ? -3.148  -5.493  5.576   1.00 0.00 ? 475 CYS A CB   2  
ATOM   2218  S  SG   . CYS A 1 54 ? -2.442  -4.396  4.305   1.00 0.00 ? 475 CYS A SG   2  
ATOM   2219  H  H    . CYS A 1 54 ? -4.365  -7.213  7.007   1.00 0.00 ? 475 CYS A H    2  
ATOM   2220  H  HA   . CYS A 1 54 ? -5.163  -5.522  4.856   1.00 0.00 ? 475 CYS A HA   2  
ATOM   2221  H  HB2  . CYS A 1 54 ? -3.388  -4.885  6.437   1.00 0.00 ? 475 CYS A HB2  2  
ATOM   2222  H  HB3  . CYS A 1 54 ? -2.390  -6.211  5.850   1.00 0.00 ? 475 CYS A HB3  2  
ATOM   2223  N  N    . MET A 1 55 ? -4.254  -6.530  2.724   1.00 0.00 ? 476 MET A N    2  
ATOM   2224  C  CA   . MET A 1 55 ? -3.985  -7.247  1.483   1.00 0.00 ? 476 MET A CA   2  
ATOM   2225  C  C    . MET A 1 55 ? -2.489  -7.276  1.186   1.00 0.00 ? 476 MET A C    2  
ATOM   2226  O  O    . MET A 1 55 ? -2.071  -7.641  0.086   1.00 0.00 ? 476 MET A O    2  
ATOM   2227  C  CB   . MET A 1 55 ? -4.735  -6.596  0.319   1.00 0.00 ? 476 MET A CB   2  
ATOM   2228  C  CG   . MET A 1 55 ? -4.357  -5.141  0.090   1.00 0.00 ? 476 MET A CG   2  
ATOM   2229  S  SD   . MET A 1 55 ? -2.789  -4.961  -0.783  1.00 0.00 ? 476 MET A SD   2  
ATOM   2230  C  CE   . MET A 1 55 ? -3.264  -5.454  -2.438  1.00 0.00 ? 476 MET A CE   2  
ATOM   2231  H  H    . MET A 1 55 ? -4.565  -5.601  2.681   1.00 0.00 ? 476 MET A H    2  
ATOM   2232  H  HA   . MET A 1 55 ? -4.336  -8.260  1.603   1.00 0.00 ? 476 MET A HA   2  
ATOM   2233  H  HB2  . MET A 1 55 ? -4.523  -7.147  -0.584  1.00 0.00 ? 476 MET A HB2  2  
ATOM   2234  H  HB3  . MET A 1 55 ? -5.795  -6.641  0.519   1.00 0.00 ? 476 MET A HB3  2  
ATOM   2235  H  HG2  . MET A 1 55 ? -5.133  -4.668  -0.493  1.00 0.00 ? 476 MET A HG2  2  
ATOM   2236  H  HG3  . MET A 1 55 ? -4.279  -4.649  1.048   1.00 0.00 ? 476 MET A HG3  2  
ATOM   2237  H  HE1  . MET A 1 55 ? -3.461  -6.516  -2.455  1.00 0.00 ? 476 MET A HE1  2  
ATOM   2238  H  HE2  . MET A 1 55 ? -4.155  -4.918  -2.731  1.00 0.00 ? 476 MET A HE2  2  
ATOM   2239  H  HE3  . MET A 1 55 ? -2.463  -5.225  -3.125  1.00 0.00 ? 476 MET A HE3  2  
ATOM   2240  N  N    . PHE A 1 56 ? -1.687  -6.889  2.172   1.00 0.00 ? 477 PHE A N    2  
ATOM   2241  C  CA   . PHE A 1 56 ? -0.237  -6.870  2.015   1.00 0.00 ? 477 PHE A CA   2  
ATOM   2242  C  C    . PHE A 1 56 ? 0.437   -7.729  3.081   1.00 0.00 ? 477 PHE A C    2  
ATOM   2243  O  O    . PHE A 1 56 ? -0.124  -7.961  4.153   1.00 0.00 ? 477 PHE A O    2  
ATOM   2244  C  CB   . PHE A 1 56 ? 0.287   -5.435  2.095   1.00 0.00 ? 477 PHE A CB   2  
ATOM   2245  C  CG   . PHE A 1 56 ? 0.036   -4.635  0.848   1.00 0.00 ? 477 PHE A CG   2  
ATOM   2246  C  CD1  . PHE A 1 56 ? 0.314   -5.168  -0.400  1.00 0.00 ? 477 PHE A CD1  2  
ATOM   2247  C  CD2  . PHE A 1 56 ? -0.477  -3.350  0.925   1.00 0.00 ? 477 PHE A CD2  2  
ATOM   2248  C  CE1  . PHE A 1 56 ? 0.084   -4.435  -1.549  1.00 0.00 ? 477 PHE A CE1  2  
ATOM   2249  C  CE2  . PHE A 1 56 ? -0.709  -2.613  -0.221  1.00 0.00 ? 477 PHE A CE2  2  
ATOM   2250  C  CZ   . PHE A 1 56 ? -0.427  -3.155  -1.459  1.00 0.00 ? 477 PHE A CZ   2  
ATOM   2251  H  H    . PHE A 1 56 ? -2.079  -6.609  3.025   1.00 0.00 ? 477 PHE A H    2  
ATOM   2252  H  HA   . PHE A 1 56 ? -0.004  -7.276  1.043   1.00 0.00 ? 477 PHE A HA   2  
ATOM   2253  H  HB2  . PHE A 1 56 ? -0.196  -4.928  2.916   1.00 0.00 ? 477 PHE A HB2  2  
ATOM   2254  H  HB3  . PHE A 1 56 ? 1.352   -5.457  2.268   1.00 0.00 ? 477 PHE A HB3  2  
ATOM   2255  H  HD1  . PHE A 1 56 ? 0.715   -6.169  -0.472  1.00 0.00 ? 477 PHE A HD1  2  
ATOM   2256  H  HD2  . PHE A 1 56 ? -0.697  -2.924  1.893   1.00 0.00 ? 477 PHE A HD2  2  
ATOM   2257  H  HE1  . PHE A 1 56 ? 0.306   -4.862  -2.516  1.00 0.00 ? 477 PHE A HE1  2  
ATOM   2258  H  HE2  . PHE A 1 56 ? -1.109  -1.612  -0.147  1.00 0.00 ? 477 PHE A HE2  2  
ATOM   2259  H  HZ   . PHE A 1 56 ? -0.608  -2.581  -2.355  1.00 0.00 ? 477 PHE A HZ   2  
ATOM   2260  N  N    . SER A 1 57 ? 1.642   -8.200  2.779   1.00 0.00 ? 478 SER A N    2  
ATOM   2261  C  CA   . SER A 1 57 ? 2.392   -9.037  3.708   1.00 0.00 ? 478 SER A CA   2  
ATOM   2262  C  C    . SER A 1 57 ? 2.979   -8.200  4.840   1.00 0.00 ? 478 SER A C    2  
ATOM   2263  O  O    . SER A 1 57 ? 3.666   -7.206  4.601   1.00 0.00 ? 478 SER A O    2  
ATOM   2264  C  CB   . SER A 1 57 ? 3.510   -9.778  2.973   1.00 0.00 ? 478 SER A CB   2  
ATOM   2265  O  OG   . SER A 1 57 ? 3.003   -10.903 2.275   1.00 0.00 ? 478 SER A OG   2  
ATOM   2266  H  H    . SER A 1 57 ? 2.036   -7.980  1.908   1.00 0.00 ? 478 SER A H    2  
ATOM   2267  H  HA   . SER A 1 57 ? 1.708   -9.760  4.128   1.00 0.00 ? 478 SER A HA   2  
ATOM   2268  H  HB2  . SER A 1 57 ? 3.975   -9.110  2.264   1.00 0.00 ? 478 SER A HB2  2  
ATOM   2269  H  HB3  . SER A 1 57 ? 4.246   -10.114 3.688   1.00 0.00 ? 478 SER A HB3  2  
ATOM   2270  H  HG   . SER A 1 57 ? 2.579   -11.500 2.896   1.00 0.00 ? 478 SER A HG   2  
ATOM   2271  N  N    . HIS A 1 58 ? 2.705   -8.610  6.075   1.00 0.00 ? 479 HIS A N    2  
ATOM   2272  C  CA   . HIS A 1 58 ? 3.207   -7.899  7.245   1.00 0.00 ? 479 HIS A CA   2  
ATOM   2273  C  C    . HIS A 1 58 ? 4.390   -8.637  7.864   1.00 0.00 ? 479 HIS A C    2  
ATOM   2274  O  O    . HIS A 1 58 ? 4.769   -8.377  9.006   1.00 0.00 ? 479 HIS A O    2  
ATOM   2275  C  CB   . HIS A 1 58 ? 2.096   -7.733  8.283   1.00 0.00 ? 479 HIS A CB   2  
ATOM   2276  C  CG   . HIS A 1 58 ? 1.153   -6.610  7.977   1.00 0.00 ? 479 HIS A CG   2  
ATOM   2277  N  ND1  . HIS A 1 58 ? 0.089   -6.279  8.788   1.00 0.00 ? 479 HIS A ND1  2  
ATOM   2278  C  CD2  . HIS A 1 58 ? 1.121   -5.739  6.941   1.00 0.00 ? 479 HIS A CD2  2  
ATOM   2279  C  CE1  . HIS A 1 58 ? -0.559  -5.253  8.264   1.00 0.00 ? 479 HIS A CE1  2  
ATOM   2280  N  NE2  . HIS A 1 58 ? 0.048   -4.906  7.143   1.00 0.00 ? 479 HIS A NE2  2  
ATOM   2281  H  H    . HIS A 1 58 ? 2.153   -9.409  6.201   1.00 0.00 ? 479 HIS A H    2  
ATOM   2282  H  HA   . HIS A 1 58 ? 3.536   -6.922  6.925   1.00 0.00 ? 479 HIS A HA   2  
ATOM   2283  H  HB2  . HIS A 1 58 ? 1.520   -8.645  8.332   1.00 0.00 ? 479 HIS A HB2  2  
ATOM   2284  H  HB3  . HIS A 1 58 ? 2.540   -7.541  9.249   1.00 0.00 ? 479 HIS A HB3  2  
ATOM   2285  H  HD1  . HIS A 1 58 ? -0.156  -6.729  9.623   1.00 0.00 ? 479 HIS A HD1  2  
ATOM   2286  H  HD2  . HIS A 1 58 ? 1.810   -5.704  6.110   1.00 0.00 ? 479 HIS A HD2  2  
ATOM   2287  H  HE1  . HIS A 1 58 ? -1.434  -4.779  8.681   1.00 0.00 ? 479 HIS A HE1  2  
ATOM   2288  N  N    . ASP A 1 59 ? 4.969   -9.559  7.102   1.00 0.00 ? 480 ASP A N    2  
ATOM   2289  C  CA   . ASP A 1 59 ? 6.110   -10.335 7.575   1.00 0.00 ? 480 ASP A CA   2  
ATOM   2290  C  C    . ASP A 1 59 ? 7.313   -9.433  7.828   1.00 0.00 ? 480 ASP A C    2  
ATOM   2291  O  O    . ASP A 1 59 ? 7.433   -8.344  7.267   1.00 0.00 ? 480 ASP A O    2  
ATOM   2292  C  CB   . ASP A 1 59 ? 6.473   -11.418 6.558   1.00 0.00 ? 480 ASP A CB   2  
ATOM   2293  C  CG   . ASP A 1 59 ? 5.485   -12.568 6.558   1.00 0.00 ? 480 ASP A CG   2  
ATOM   2294  O  OD1  . ASP A 1 59 ? 5.620   -13.466 7.416   1.00 0.00 ? 480 ASP A OD1  2  
ATOM   2295  O  OD2  . ASP A 1 59 ? 4.577   -12.570 5.701   1.00 0.00 ? 480 ASP A OD2  2  
ATOM   2296  H  H    . ASP A 1 59 ? 4.622   -9.721  6.200   1.00 0.00 ? 480 ASP A H    2  
ATOM   2297  H  HA   . ASP A 1 59 ? 5.828   -10.807 8.504   1.00 0.00 ? 480 ASP A HA   2  
ATOM   2298  H  HB2  . ASP A 1 59 ? 6.491   -10.984 5.569   1.00 0.00 ? 480 ASP A HB2  2  
ATOM   2299  H  HB3  . ASP A 1 59 ? 7.453   -11.809 6.793   1.00 0.00 ? 480 ASP A HB3  2  
ATOM   2300  N  N    . PRO A 1 60 ? 8.228   -9.895  8.694   1.00 0.00 ? 481 PRO A N    2  
ATOM   2301  C  CA   . PRO A 1 60 ? 9.438   -9.145  9.042   1.00 0.00 ? 481 PRO A CA   2  
ATOM   2302  C  C    . PRO A 1 60 ? 10.428  -9.073  7.885   1.00 0.00 ? 481 PRO A C    2  
ATOM   2303  O  O    . PRO A 1 60 ? 10.885  -10.099 7.380   1.00 0.00 ? 481 PRO A O    2  
ATOM   2304  C  CB   . PRO A 1 60 ? 10.031  -9.947  10.203  1.00 0.00 ? 481 PRO A CB   2  
ATOM   2305  C  CG   . PRO A 1 60 ? 9.518   -11.332 10.008  1.00 0.00 ? 481 PRO A CG   2  
ATOM   2306  C  CD   . PRO A 1 60 ? 8.150   -11.185 9.400   1.00 0.00 ? 481 PRO A CD   2  
ATOM   2307  H  HA   . PRO A 1 60 ? 9.203   -8.145  9.376   1.00 0.00 ? 481 PRO A HA   2  
ATOM   2308  H  HB2  . PRO A 1 60 ? 11.110  -9.914  10.153  1.00 0.00 ? 481 PRO A HB2  2  
ATOM   2309  H  HB3  . PRO A 1 60 ? 9.696   -9.531  11.141  1.00 0.00 ? 481 PRO A HB3  2  
ATOM   2310  H  HG2  . PRO A 1 60 ? 10.169  -11.874 9.339   1.00 0.00 ? 481 PRO A HG2  2  
ATOM   2311  H  HG3  . PRO A 1 60 ? 9.452   -11.836 10.961  1.00 0.00 ? 481 PRO A HG3  2  
ATOM   2312  H  HD2  . PRO A 1 60 ? 7.956   -11.992 8.709   1.00 0.00 ? 481 PRO A HD2  2  
ATOM   2313  H  HD3  . PRO A 1 60 ? 7.395   -11.156 10.172  1.00 0.00 ? 481 PRO A HD3  2  
ATOM   2314  N  N    . LEU A 1 61 ? 10.756  -7.855  7.468   1.00 0.00 ? 482 LEU A N    2  
ATOM   2315  C  CA   . LEU A 1 61 ? 11.693  -7.649  6.369   1.00 0.00 ? 482 LEU A CA   2  
ATOM   2316  C  C    . LEU A 1 61 ? 12.872  -8.611  6.471   1.00 0.00 ? 482 LEU A C    2  
ATOM   2317  O  O    . LEU A 1 61 ? 13.325  -8.943  7.567   1.00 0.00 ? 482 LEU A O    2  
ATOM   2318  C  CB   . LEU A 1 61 ? 12.198  -6.205  6.368   1.00 0.00 ? 482 LEU A CB   2  
ATOM   2319  C  CG   . LEU A 1 61 ? 11.211  -5.149  5.870   1.00 0.00 ? 482 LEU A CG   2  
ATOM   2320  C  CD1  . LEU A 1 61 ? 11.786  -3.753  6.051   1.00 0.00 ? 482 LEU A CD1  2  
ATOM   2321  C  CD2  . LEU A 1 61 ? 10.856  -5.396  4.411   1.00 0.00 ? 482 LEU A CD2  2  
ATOM   2322  H  H    . LEU A 1 61 ? 10.359  -7.075  7.909   1.00 0.00 ? 482 LEU A H    2  
ATOM   2323  H  HA   . LEU A 1 61 ? 11.167  -7.838  5.445   1.00 0.00 ? 482 LEU A HA   2  
ATOM   2324  H  HB2  . LEU A 1 61 ? 12.473  -5.949  7.380   1.00 0.00 ? 482 LEU A HB2  2  
ATOM   2325  H  HB3  . LEU A 1 61 ? 13.075  -6.163  5.737   1.00 0.00 ? 482 LEU A HB3  2  
ATOM   2326  H  HG   . LEU A 1 61 ? 10.301  -5.213  6.451   1.00 0.00 ? 482 LEU A HG   2  
ATOM   2327  H  HD11 . LEU A 1 61 ? 12.682  -3.653  5.458   1.00 0.00 ? 482 LEU A HD11 2  
ATOM   2328  H  HD12 . LEU A 1 61 ? 12.023  -3.593  7.092   1.00 0.00 ? 482 LEU A HD12 2  
ATOM   2329  H  HD13 . LEU A 1 61 ? 11.059  -3.020  5.731   1.00 0.00 ? 482 LEU A HD13 2  
ATOM   2330  H  HD21 . LEU A 1 61 ? 10.395  -6.368  4.313   1.00 0.00 ? 482 LEU A HD21 2  
ATOM   2331  H  HD22 . LEU A 1 61 ? 11.754  -5.362  3.811   1.00 0.00 ? 482 LEU A HD22 2  
ATOM   2332  H  HD23 . LEU A 1 61 ? 10.168  -4.635  4.073   1.00 0.00 ? 482 LEU A HD23 2  
ATOM   2333  N  N    . THR A 1 62 ? 13.367  -9.057  5.320   1.00 0.00 ? 483 THR A N    2  
ATOM   2334  C  CA   . THR A 1 62 ? 14.493  -9.980  5.279   1.00 0.00 ? 483 THR A CA   2  
ATOM   2335  C  C    . THR A 1 62 ? 15.478  -9.598  4.180   1.00 0.00 ? 483 THR A C    2  
ATOM   2336  O  O    . THR A 1 62 ? 15.121  -8.905  3.228   1.00 0.00 ? 483 THR A O    2  
ATOM   2337  C  CB   . THR A 1 62 ? 14.024  -11.429 5.049   1.00 0.00 ? 483 THR A CB   2  
ATOM   2338  O  OG1  . THR A 1 62 ? 12.979  -11.456 4.070   1.00 0.00 ? 483 THR A OG1  2  
ATOM   2339  C  CG2  . THR A 1 62 ? 13.527  -12.049 6.346   1.00 0.00 ? 483 THR A CG2  2  
ATOM   2340  H  H    . THR A 1 62 ? 12.963  -8.756  4.479   1.00 0.00 ? 483 THR A H    2  
ATOM   2341  H  HA   . THR A 1 62 ? 14.997  -9.934  6.233   1.00 0.00 ? 483 THR A HA   2  
ATOM   2342  H  HB   . THR A 1 62 ? 14.860  -12.010 4.687   1.00 0.00 ? 483 THR A HB   2  
ATOM   2343  H  HG1  . THR A 1 62 ? 13.023  -10.662 3.532   1.00 0.00 ? 483 THR A HG1  2  
ATOM   2344  H  HG21 . THR A 1 62 ? 14.319  -12.034 7.080   1.00 0.00 ? 483 THR A HG21 2  
ATOM   2345  H  HG22 . THR A 1 62 ? 13.223  -13.069 6.165   1.00 0.00 ? 483 THR A HG22 2  
ATOM   2346  H  HG23 . THR A 1 62 ? 12.685  -11.483 6.716   1.00 0.00 ? 483 THR A HG23 2  
ATOM   2347  N  N    . GLU A 1 63 ? 16.719  -10.053 4.319   1.00 0.00 ? 484 GLU A N    2  
ATOM   2348  C  CA   . GLU A 1 63 ? 17.756  -9.757  3.337   1.00 0.00 ? 484 GLU A CA   2  
ATOM   2349  C  C    . GLU A 1 63 ? 17.190  -9.796  1.920   1.00 0.00 ? 484 GLU A C    2  
ATOM   2350  O  O    . GLU A 1 63 ? 17.672  -9.097  1.030   1.00 0.00 ? 484 GLU A O    2  
ATOM   2351  C  CB   . GLU A 1 63 ? 18.910  -10.754 3.464   1.00 0.00 ? 484 GLU A CB   2  
ATOM   2352  C  CG   . GLU A 1 63 ? 18.505  -12.192 3.190   1.00 0.00 ? 484 GLU A CG   2  
ATOM   2353  C  CD   . GLU A 1 63 ? 19.661  -13.162 3.334   1.00 0.00 ? 484 GLU A CD   2  
ATOM   2354  O  OE1  . GLU A 1 63 ? 20.010  -13.501 4.484   1.00 0.00 ? 484 GLU A OE1  2  
ATOM   2355  O  OE2  . GLU A 1 63 ? 20.218  -13.581 2.298   1.00 0.00 ? 484 GLU A OE2  2  
ATOM   2356  H  H    . GLU A 1 63 ? 16.943  -10.601 5.100   1.00 0.00 ? 484 GLU A H    2  
ATOM   2357  H  HA   . GLU A 1 63 ? 18.127  -8.764  3.536   1.00 0.00 ? 484 GLU A HA   2  
ATOM   2358  H  HB2  . GLU A 1 63 ? 19.685  -10.480 2.764   1.00 0.00 ? 484 GLU A HB2  2  
ATOM   2359  H  HB3  . GLU A 1 63 ? 19.307  -10.699 4.467   1.00 0.00 ? 484 GLU A HB3  2  
ATOM   2360  H  HG2  . GLU A 1 63 ? 17.730  -12.474 3.887   1.00 0.00 ? 484 GLU A HG2  2  
ATOM   2361  H  HG3  . GLU A 1 63 ? 18.122  -12.259 2.182   1.00 0.00 ? 484 GLU A HG3  2  
ATOM   2362  N  N    . GLU A 1 64 ? 16.164  -10.618 1.721   1.00 0.00 ? 485 GLU A N    2  
ATOM   2363  C  CA   . GLU A 1 64 ? 15.534  -10.749 0.413   1.00 0.00 ? 485 GLU A CA   2  
ATOM   2364  C  C    . GLU A 1 64 ? 14.543  -9.614  0.171   1.00 0.00 ? 485 GLU A C    2  
ATOM   2365  O  O    . GLU A 1 64 ? 14.822  -8.679  -0.581  1.00 0.00 ? 485 GLU A O    2  
ATOM   2366  C  CB   . GLU A 1 64 ? 14.819  -12.097 0.299   1.00 0.00 ? 485 GLU A CB   2  
ATOM   2367  C  CG   . GLU A 1 64 ? 15.766  -13.276 0.145   1.00 0.00 ? 485 GLU A CG   2  
ATOM   2368  C  CD   . GLU A 1 64 ? 15.074  -14.610 0.347   1.00 0.00 ? 485 GLU A CD   2  
ATOM   2369  O  OE1  . GLU A 1 64 ? 14.942  -15.039 1.513   1.00 0.00 ? 485 GLU A OE1  2  
ATOM   2370  O  OE2  . GLU A 1 64 ? 14.664  -15.225 -0.659  1.00 0.00 ? 485 GLU A OE2  2  
ATOM   2371  H  H    . GLU A 1 64 ? 15.824  -11.149 2.471   1.00 0.00 ? 485 GLU A H    2  
ATOM   2372  H  HA   . GLU A 1 64 ? 16.310  -10.699 -0.336  1.00 0.00 ? 485 GLU A HA   2  
ATOM   2373  H  HB2  . GLU A 1 64 ? 14.225  -12.252 1.187   1.00 0.00 ? 485 GLU A HB2  2  
ATOM   2374  H  HB3  . GLU A 1 64 ? 14.166  -12.073 -0.561  1.00 0.00 ? 485 GLU A HB3  2  
ATOM   2375  H  HG2  . GLU A 1 64 ? 16.189  -13.255 -0.848  1.00 0.00 ? 485 GLU A HG2  2  
ATOM   2376  H  HG3  . GLU A 1 64 ? 16.557  -13.183 0.874   1.00 0.00 ? 485 GLU A HG3  2  
ATOM   2377  N  N    . THR A 1 65 ? 13.382  -9.703  0.812   1.00 0.00 ? 486 THR A N    2  
ATOM   2378  C  CA   . THR A 1 65 ? 12.348  -8.686  0.666   1.00 0.00 ? 486 THR A CA   2  
ATOM   2379  C  C    . THR A 1 65 ? 12.918  -7.288  0.878   1.00 0.00 ? 486 THR A C    2  
ATOM   2380  O  O    . THR A 1 65 ? 12.666  -6.379  0.087   1.00 0.00 ? 486 THR A O    2  
ATOM   2381  C  CB   . THR A 1 65 ? 11.193  -8.912  1.660   1.00 0.00 ? 486 THR A CB   2  
ATOM   2382  O  OG1  . THR A 1 65 ? 11.671  -8.787  3.004   1.00 0.00 ? 486 THR A OG1  2  
ATOM   2383  C  CG2  . THR A 1 65 ? 10.571  -10.287 1.463   1.00 0.00 ? 486 THR A CG2  2  
ATOM   2384  H  H    . THR A 1 65 ? 13.218  -10.472 1.397   1.00 0.00 ? 486 THR A H    2  
ATOM   2385  H  HA   . THR A 1 65 ? 11.951  -8.755  -0.336  1.00 0.00 ? 486 THR A HA   2  
ATOM   2386  H  HB   . THR A 1 65 ? 10.435  -8.162  1.484   1.00 0.00 ? 486 THR A HB   2  
ATOM   2387  H  HG1  . THR A 1 65 ? 10.961  -8.471  3.568   1.00 0.00 ? 486 THR A HG1  2  
ATOM   2388  H  HG21 . THR A 1 65 ? 10.184  -10.366 0.458   1.00 0.00 ? 486 THR A HG21 2  
ATOM   2389  H  HG22 . THR A 1 65 ? 9.767   -10.423 2.171   1.00 0.00 ? 486 THR A HG22 2  
ATOM   2390  H  HG23 . THR A 1 65 ? 11.322  -11.047 1.620   1.00 0.00 ? 486 THR A HG23 2  
ATOM   2391  N  N    . ARG A 1 66 ? 13.688  -7.124  1.948   1.00 0.00 ? 487 ARG A N    2  
ATOM   2392  C  CA   . ARG A 1 66 ? 14.293  -5.835  2.263   1.00 0.00 ? 487 ARG A CA   2  
ATOM   2393  C  C    . ARG A 1 66 ? 14.771  -5.134  0.995   1.00 0.00 ? 487 ARG A C    2  
ATOM   2394  O  O    . ARG A 1 66 ? 14.682  -3.912  0.879   1.00 0.00 ? 487 ARG A O    2  
ATOM   2395  C  CB   . ARG A 1 66 ? 15.466  -6.021  3.228   1.00 0.00 ? 487 ARG A CB   2  
ATOM   2396  C  CG   . ARG A 1 66 ? 15.798  -4.774  4.031   1.00 0.00 ? 487 ARG A CG   2  
ATOM   2397  C  CD   . ARG A 1 66 ? 16.323  -3.660  3.139   1.00 0.00 ? 487 ARG A CD   2  
ATOM   2398  N  NE   . ARG A 1 66 ? 17.249  -2.782  3.849   1.00 0.00 ? 487 ARG A NE   2  
ATOM   2399  C  CZ   . ARG A 1 66 ? 16.860  -1.765  4.610   1.00 0.00 ? 487 ARG A CZ   2  
ATOM   2400  N  NH1  . ARG A 1 66 ? 15.570  -1.500  4.759   1.00 0.00 ? 487 ARG A NH1  2  
ATOM   2401  N  NH2  . ARG A 1 66 ? 17.763  -1.011  5.223   1.00 0.00 ? 487 ARG A NH2  2  
ATOM   2402  H  H    . ARG A 1 66 ? 13.852  -7.886  2.541   1.00 0.00 ? 487 ARG A H    2  
ATOM   2403  H  HA   . ARG A 1 66 ? 13.542  -5.223  2.738   1.00 0.00 ? 487 ARG A HA   2  
ATOM   2404  H  HB2  . ARG A 1 66 ? 15.226  -6.815  3.920   1.00 0.00 ? 487 ARG A HB2  2  
ATOM   2405  H  HB3  . ARG A 1 66 ? 16.341  -6.301  2.662   1.00 0.00 ? 487 ARG A HB3  2  
ATOM   2406  H  HG2  . ARG A 1 66 ? 14.903  -4.429  4.529   1.00 0.00 ? 487 ARG A HG2  2  
ATOM   2407  H  HG3  . ARG A 1 66 ? 16.549  -5.020  4.766   1.00 0.00 ? 487 ARG A HG3  2  
ATOM   2408  H  HD2  . ARG A 1 66 ? 16.835  -4.103  2.297   1.00 0.00 ? 487 ARG A HD2  2  
ATOM   2409  H  HD3  . ARG A 1 66 ? 15.487  -3.076  2.785   1.00 0.00 ? 487 ARG A HD3  2  
ATOM   2410  H  HE   . ARG A 1 66 ? 18.208  -2.959  3.752   1.00 0.00 ? 487 ARG A HE   2  
ATOM   2411  H  HH11 . ARG A 1 66 ? 14.887  -2.067  4.299   1.00 0.00 ? 487 ARG A HH11 2  
ATOM   2412  H  HH12 . ARG A 1 66 ? 15.280  -0.735  5.334   1.00 0.00 ? 487 ARG A HH12 2  
ATOM   2413  H  HH21 . ARG A 1 66 ? 18.737  -1.207  5.113   1.00 0.00 ? 487 ARG A HH21 2  
ATOM   2414  H  HH22 . ARG A 1 66 ? 17.470  -0.246  5.796   1.00 0.00 ? 487 ARG A HH22 2  
ATOM   2415  N  N    . GLU A 1 67 ? 15.277  -5.917  0.047   1.00 0.00 ? 488 GLU A N    2  
ATOM   2416  C  CA   . GLU A 1 67 ? 15.769  -5.370  -1.212  1.00 0.00 ? 488 GLU A CA   2  
ATOM   2417  C  C    . GLU A 1 67 ? 14.632  -4.749  -2.017  1.00 0.00 ? 488 GLU A C    2  
ATOM   2418  O  O    . GLU A 1 67 ? 14.786  -3.680  -2.609  1.00 0.00 ? 488 GLU A O    2  
ATOM   2419  C  CB   . GLU A 1 67 ? 16.454  -6.463  -2.035  1.00 0.00 ? 488 GLU A CB   2  
ATOM   2420  C  CG   . GLU A 1 67 ? 17.713  -7.015  -1.387  1.00 0.00 ? 488 GLU A CG   2  
ATOM   2421  C  CD   . GLU A 1 67 ? 18.945  -6.192  -1.710  1.00 0.00 ? 488 GLU A CD   2  
ATOM   2422  O  OE1  . GLU A 1 67 ? 18.795  -4.986  -1.993  1.00 0.00 ? 488 GLU A OE1  2  
ATOM   2423  O  OE2  . GLU A 1 67 ? 20.059  -6.756  -1.679  1.00 0.00 ? 488 GLU A OE2  2  
ATOM   2424  H  H    . GLU A 1 67 ? 15.321  -6.884  0.198   1.00 0.00 ? 488 GLU A H    2  
ATOM   2425  H  HA   . GLU A 1 67 ? 16.491  -4.602  -0.980  1.00 0.00 ? 488 GLU A HA   2  
ATOM   2426  H  HB2  . GLU A 1 67 ? 15.760  -7.278  -2.178  1.00 0.00 ? 488 GLU A HB2  2  
ATOM   2427  H  HB3  . GLU A 1 67 ? 16.721  -6.056  -2.999  1.00 0.00 ? 488 GLU A HB3  2  
ATOM   2428  H  HG2  . GLU A 1 67 ? 17.576  -7.024  -0.316  1.00 0.00 ? 488 GLU A HG2  2  
ATOM   2429  H  HG3  . GLU A 1 67 ? 17.869  -8.025  -1.737  1.00 0.00 ? 488 GLU A HG3  2  
ATOM   2430  N  N    . LEU A 1 68 ? 13.489  -5.427  -2.035  1.00 0.00 ? 489 LEU A N    2  
ATOM   2431  C  CA   . LEU A 1 68 ? 12.324  -4.943  -2.768  1.00 0.00 ? 489 LEU A CA   2  
ATOM   2432  C  C    . LEU A 1 68 ? 12.075  -3.465  -2.481  1.00 0.00 ? 489 LEU A C    2  
ATOM   2433  O  O    . LEU A 1 68 ? 12.141  -2.628  -3.382  1.00 0.00 ? 489 LEU A O    2  
ATOM   2434  C  CB   . LEU A 1 68 ? 11.087  -5.762  -2.396  1.00 0.00 ? 489 LEU A CB   2  
ATOM   2435  C  CG   . LEU A 1 68 ? 11.173  -7.265  -2.660  1.00 0.00 ? 489 LEU A CG   2  
ATOM   2436  C  CD1  . LEU A 1 68 ? 9.913   -7.965  -2.174  1.00 0.00 ? 489 LEU A CD1  2  
ATOM   2437  C  CD2  . LEU A 1 68 ? 11.397  -7.535  -4.141  1.00 0.00 ? 489 LEU A CD2  2  
ATOM   2438  H  H    . LEU A 1 68 ? 13.426  -6.272  -1.544  1.00 0.00 ? 489 LEU A H    2  
ATOM   2439  H  HA   . LEU A 1 68 ? 12.522  -5.064  -3.823  1.00 0.00 ? 489 LEU A HA   2  
ATOM   2440  H  HB2  . LEU A 1 68 ? 10.902  -5.621  -1.342  1.00 0.00 ? 489 LEU A HB2  2  
ATOM   2441  H  HB3  . LEU A 1 68 ? 10.252  -5.372  -2.961  1.00 0.00 ? 489 LEU A HB3  2  
ATOM   2442  H  HG   . LEU A 1 68 ? 12.012  -7.673  -2.114  1.00 0.00 ? 489 LEU A HG   2  
ATOM   2443  H  HD11 . LEU A 1 68 ? 9.046   -7.477  -2.591  1.00 0.00 ? 489 LEU A HD11 2  
ATOM   2444  H  HD12 . LEU A 1 68 ? 9.869   -7.918  -1.096  1.00 0.00 ? 489 LEU A HD12 2  
ATOM   2445  H  HD13 . LEU A 1 68 ? 9.932   -8.999  -2.488  1.00 0.00 ? 489 LEU A HD13 2  
ATOM   2446  H  HD21 . LEU A 1 68 ? 11.022  -6.702  -4.718  1.00 0.00 ? 489 LEU A HD21 2  
ATOM   2447  H  HD22 . LEU A 1 68 ? 10.873  -8.435  -4.426  1.00 0.00 ? 489 LEU A HD22 2  
ATOM   2448  H  HD23 . LEU A 1 68 ? 12.453  -7.657  -4.329  1.00 0.00 ? 489 LEU A HD23 2  
ATOM   2449  N  N    . LEU A 1 69 ? 11.792  -3.152  -1.222  1.00 0.00 ? 490 LEU A N    2  
ATOM   2450  C  CA   . LEU A 1 69 ? 11.536  -1.775  -0.815  1.00 0.00 ? 490 LEU A CA   2  
ATOM   2451  C  C    . LEU A 1 69 ? 12.493  -0.814  -1.513  1.00 0.00 ? 490 LEU A C    2  
ATOM   2452  O  O    . LEU A 1 69 ? 12.066  0.115   -2.199  1.00 0.00 ? 490 LEU A O    2  
ATOM   2453  C  CB   . LEU A 1 69 ? 11.672  -1.637  0.702   1.00 0.00 ? 490 LEU A CB   2  
ATOM   2454  C  CG   . LEU A 1 69 ? 10.535  -2.229  1.535   1.00 0.00 ? 490 LEU A CG   2  
ATOM   2455  C  CD1  . LEU A 1 69 ? 10.918  -2.275  3.006   1.00 0.00 ? 490 LEU A CD1  2  
ATOM   2456  C  CD2  . LEU A 1 69 ? 9.257   -1.425  1.340   1.00 0.00 ? 490 LEU A CD2  2  
ATOM   2457  H  H    . LEU A 1 69 ? 11.754  -3.863  -0.549  1.00 0.00 ? 490 LEU A H    2  
ATOM   2458  H  HA   . LEU A 1 69 ? 10.524  -1.528  -1.102  1.00 0.00 ? 490 LEU A HA   2  
ATOM   2459  H  HB2  . LEU A 1 69 ? 12.587  -2.126  0.998   1.00 0.00 ? 490 LEU A HB2  2  
ATOM   2460  H  HB3  . LEU A 1 69 ? 11.739  -0.583  0.933   1.00 0.00 ? 490 LEU A HB3  2  
ATOM   2461  H  HG   . LEU A 1 69 ? 10.347  -3.242  1.208   1.00 0.00 ? 490 LEU A HG   2  
ATOM   2462  H  HD11 . LEU A 1 69 ? 11.451  -3.191  3.210   1.00 0.00 ? 490 LEU A HD11 2  
ATOM   2463  H  HD12 . LEU A 1 69 ? 10.025  -2.234  3.612   1.00 0.00 ? 490 LEU A HD12 2  
ATOM   2464  H  HD13 . LEU A 1 69 ? 11.550  -1.430  3.240   1.00 0.00 ? 490 LEU A HD13 2  
ATOM   2465  H  HD21 . LEU A 1 69 ? 9.110   -1.233  0.287   1.00 0.00 ? 490 LEU A HD21 2  
ATOM   2466  H  HD22 . LEU A 1 69 ? 9.337   -0.487  1.869   1.00 0.00 ? 490 LEU A HD22 2  
ATOM   2467  H  HD23 . LEU A 1 69 ? 8.418   -1.986  1.724   1.00 0.00 ? 490 LEU A HD23 2  
ATOM   2468  N  N    . ASP A 1 70 ? 13.789  -1.045  -1.334  1.00 0.00 ? 491 ASP A N    2  
ATOM   2469  C  CA   . ASP A 1 70 ? 14.808  -0.202  -1.949  1.00 0.00 ? 491 ASP A CA   2  
ATOM   2470  C  C    . ASP A 1 70 ? 14.441  0.128   -3.393  1.00 0.00 ? 491 ASP A C    2  
ATOM   2471  O  O    . ASP A 1 70 ? 14.668  1.243   -3.863  1.00 0.00 ? 491 ASP A O    2  
ATOM   2472  C  CB   . ASP A 1 70 ? 16.171  -0.894  -1.901  1.00 0.00 ? 491 ASP A CB   2  
ATOM   2473  C  CG   . ASP A 1 70 ? 16.724  -0.988  -0.493  1.00 0.00 ? 491 ASP A CG   2  
ATOM   2474  O  OD1  . ASP A 1 70 ? 16.374  -0.126  0.341   1.00 0.00 ? 491 ASP A OD1  2  
ATOM   2475  O  OD2  . ASP A 1 70 ? 17.505  -1.923  -0.224  1.00 0.00 ? 491 ASP A OD2  2  
ATOM   2476  H  H    . ASP A 1 70 ? 14.068  -1.801  -0.776  1.00 0.00 ? 491 ASP A H    2  
ATOM   2477  H  HA   . ASP A 1 70 ? 14.862  0.718   -1.386  1.00 0.00 ? 491 ASP A HA   2  
ATOM   2478  H  HB2  . ASP A 1 70 ? 16.073  -1.895  -2.297  1.00 0.00 ? 491 ASP A HB2  2  
ATOM   2479  H  HB3  . ASP A 1 70 ? 16.871  -0.339  -2.508  1.00 0.00 ? 491 ASP A HB3  2  
ATOM   2480  N  N    . LYS A 1 71 ? 13.874  -0.849  -4.092  1.00 0.00 ? 492 LYS A N    2  
ATOM   2481  C  CA   . LYS A 1 71 ? 13.476  -0.665  -5.482  1.00 0.00 ? 492 LYS A CA   2  
ATOM   2482  C  C    . LYS A 1 71 ? 12.155  0.094   -5.573  1.00 0.00 ? 492 LYS A C    2  
ATOM   2483  O  O    . LYS A 1 71 ? 12.053  1.097   -6.279  1.00 0.00 ? 492 LYS A O    2  
ATOM   2484  C  CB   . LYS A 1 71 ? 13.347  -2.020  -6.182  1.00 0.00 ? 492 LYS A CB   2  
ATOM   2485  C  CG   . LYS A 1 71 ? 13.130  -1.912  -7.681  1.00 0.00 ? 492 LYS A CG   2  
ATOM   2486  C  CD   . LYS A 1 71 ? 14.448  -1.912  -8.437  1.00 0.00 ? 492 LYS A CD   2  
ATOM   2487  C  CE   . LYS A 1 71 ? 14.959  -0.498  -8.666  1.00 0.00 ? 492 LYS A CE   2  
ATOM   2488  N  NZ   . LYS A 1 71 ? 16.155  -0.478  -9.553  1.00 0.00 ? 492 LYS A NZ   2  
ATOM   2489  H  H    . LYS A 1 71 ? 13.719  -1.717  -3.661  1.00 0.00 ? 492 LYS A H    2  
ATOM   2490  H  HA   . LYS A 1 71 ? 14.244  -0.087  -5.974  1.00 0.00 ? 492 LYS A HA   2  
ATOM   2491  H  HB2  . LYS A 1 71 ? 14.250  -2.587  -6.010  1.00 0.00 ? 492 LYS A HB2  2  
ATOM   2492  H  HB3  . LYS A 1 71 ? 12.510  -2.553  -5.755  1.00 0.00 ? 492 LYS A HB3  2  
ATOM   2493  H  HG2  . LYS A 1 71 ? 12.538  -2.752  -8.011  1.00 0.00 ? 492 LYS A HG2  2  
ATOM   2494  H  HG3  . LYS A 1 71 ? 12.603  -0.992  -7.894  1.00 0.00 ? 492 LYS A HG3  2  
ATOM   2495  H  HD2  . LYS A 1 71 ? 15.181  -2.460  -7.864  1.00 0.00 ? 492 LYS A HD2  2  
ATOM   2496  H  HD3  . LYS A 1 71 ? 14.304  -2.393  -9.394  1.00 0.00 ? 492 LYS A HD3  2  
ATOM   2497  H  HE2  . LYS A 1 71 ? 14.174  0.085   -9.122  1.00 0.00 ? 492 LYS A HE2  2  
ATOM   2498  H  HE3  . LYS A 1 71 ? 15.222  -0.065  -7.712  1.00 0.00 ? 492 LYS A HE3  2  
ATOM   2499  H  HZ1  . LYS A 1 71 ? 15.928  -0.915  -10.469 1.00 0.00 ? 492 LYS A HZ1  2  
ATOM   2500  H  HZ2  . LYS A 1 71 ? 16.935  -1.008  -9.114  1.00 0.00 ? 492 LYS A HZ2  2  
ATOM   2501  H  HZ3  . LYS A 1 71 ? 16.464  0.502   -9.715  1.00 0.00 ? 492 LYS A HZ3  2  
ATOM   2502  N  N    . MET A 1 72 ? 11.148  -0.392  -4.855  1.00 0.00 ? 493 MET A N    2  
ATOM   2503  C  CA   . MET A 1 72 ? 9.835   0.243   -4.853  1.00 0.00 ? 493 MET A CA   2  
ATOM   2504  C  C    . MET A 1 72 ? 9.939   1.705   -4.431  1.00 0.00 ? 493 MET A C    2  
ATOM   2505  O  O    . MET A 1 72 ? 9.588   2.608   -5.193  1.00 0.00 ? 493 MET A O    2  
ATOM   2506  C  CB   . MET A 1 72 ? 8.885   -0.504  -3.916  1.00 0.00 ? 493 MET A CB   2  
ATOM   2507  C  CG   . MET A 1 72 ? 7.450   -0.008  -3.983  1.00 0.00 ? 493 MET A CG   2  
ATOM   2508  S  SD   . MET A 1 72 ? 7.207   1.539   -3.090  1.00 0.00 ? 493 MET A SD   2  
ATOM   2509  C  CE   . MET A 1 72 ? 6.633   0.930   -1.507  1.00 0.00 ? 493 MET A CE   2  
ATOM   2510  H  H    . MET A 1 72 ? 11.291  -1.195  -4.312  1.00 0.00 ? 493 MET A H    2  
ATOM   2511  H  HA   . MET A 1 72 ? 9.445   0.197   -5.858  1.00 0.00 ? 493 MET A HA   2  
ATOM   2512  H  HB2  . MET A 1 72 ? 8.894   -1.552  -4.175  1.00 0.00 ? 493 MET A HB2  2  
ATOM   2513  H  HB3  . MET A 1 72 ? 9.235   -0.389  -2.901  1.00 0.00 ? 493 MET A HB3  2  
ATOM   2514  H  HG2  . MET A 1 72 ? 7.184   0.145   -5.019  1.00 0.00 ? 493 MET A HG2  2  
ATOM   2515  H  HG3  . MET A 1 72 ? 6.803   -0.760  -3.556  1.00 0.00 ? 493 MET A HG3  2  
ATOM   2516  H  HE1  . MET A 1 72 ? 7.145   0.009   -1.268  1.00 0.00 ? 493 MET A HE1  2  
ATOM   2517  H  HE2  . MET A 1 72 ? 6.839   1.664   -0.743  1.00 0.00 ? 493 MET A HE2  2  
ATOM   2518  H  HE3  . MET A 1 72 ? 5.569   0.748   -1.556  1.00 0.00 ? 493 MET A HE3  2  
ATOM   2519  N  N    . LEU A 1 73 ? 10.421  1.933   -3.214  1.00 0.00 ? 494 LEU A N    2  
ATOM   2520  C  CA   . LEU A 1 73 ? 10.571  3.286   -2.691  1.00 0.00 ? 494 LEU A CA   2  
ATOM   2521  C  C    . LEU A 1 73 ? 11.302  4.178   -3.689  1.00 0.00 ? 494 LEU A C    2  
ATOM   2522  O  O    . LEU A 1 73 ? 10.870  5.296   -3.970  1.00 0.00 ? 494 LEU A O    2  
ATOM   2523  C  CB   . LEU A 1 73 ? 11.329  3.260   -1.363  1.00 0.00 ? 494 LEU A CB   2  
ATOM   2524  C  CG   . LEU A 1 73 ? 10.517  2.847   -0.135  1.00 0.00 ? 494 LEU A CG   2  
ATOM   2525  C  CD1  . LEU A 1 73 ? 9.835   1.508   -0.371  1.00 0.00 ? 494 LEU A CD1  2  
ATOM   2526  C  CD2  . LEU A 1 73 ? 11.408  2.783   1.097   1.00 0.00 ? 494 LEU A CD2  2  
ATOM   2527  H  H    . LEU A 1 73 ? 10.684  1.173   -2.654  1.00 0.00 ? 494 LEU A H    2  
ATOM   2528  H  HA   . LEU A 1 73 ? 9.582   3.688   -2.524  1.00 0.00 ? 494 LEU A HA   2  
ATOM   2529  H  HB2  . LEU A 1 73 ? 12.150  2.566   -1.465  1.00 0.00 ? 494 LEU A HB2  2  
ATOM   2530  H  HB3  . LEU A 1 73 ? 11.718  4.252   -1.185  1.00 0.00 ? 494 LEU A HB3  2  
ATOM   2531  H  HG   . LEU A 1 73 ? 9.748   3.585   0.046   1.00 0.00 ? 494 LEU A HG   2  
ATOM   2532  H  HD11 . LEU A 1 73 ? 9.181   1.584   -1.226  1.00 0.00 ? 494 LEU A HD11 2  
ATOM   2533  H  HD12 . LEU A 1 73 ? 9.258   1.240   0.501   1.00 0.00 ? 494 LEU A HD12 2  
ATOM   2534  H  HD13 . LEU A 1 73 ? 10.583  0.751   -0.554  1.00 0.00 ? 494 LEU A HD13 2  
ATOM   2535  H  HD21 . LEU A 1 73 ? 10.793  2.720   1.983   1.00 0.00 ? 494 LEU A HD21 2  
ATOM   2536  H  HD22 . LEU A 1 73 ? 12.019  3.673   1.146   1.00 0.00 ? 494 LEU A HD22 2  
ATOM   2537  H  HD23 . LEU A 1 73 ? 12.044  1.912   1.037   1.00 0.00 ? 494 LEU A HD23 2  
ATOM   2538  N  N    . ALA A 1 74 ? 12.410  3.676   -4.223  1.00 0.00 ? 495 ALA A N    2  
ATOM   2539  C  CA   . ALA A 1 74 ? 13.198  4.425   -5.193  1.00 0.00 ? 495 ALA A CA   2  
ATOM   2540  C  C    . ALA A 1 74 ? 12.311  5.011   -6.287  1.00 0.00 ? 495 ALA A C    2  
ATOM   2541  O  O    . ALA A 1 74 ? 12.455  6.176   -6.658  1.00 0.00 ? 495 ALA A O    2  
ATOM   2542  C  CB   . ALA A 1 74 ? 14.271  3.535   -5.803  1.00 0.00 ? 495 ALA A CB   2  
ATOM   2543  H  H    . ALA A 1 74 ? 12.703  2.779   -3.960  1.00 0.00 ? 495 ALA A H    2  
ATOM   2544  H  HA   . ALA A 1 74 ? 13.690  5.233   -4.671  1.00 0.00 ? 495 ALA A HA   2  
ATOM   2545  H  HB1  . ALA A 1 74 ? 13.804  2.689   -6.287  1.00 0.00 ? 495 ALA A HB1  2  
ATOM   2546  H  HB2  . ALA A 1 74 ? 14.837  4.098   -6.529  1.00 0.00 ? 495 ALA A HB2  2  
ATOM   2547  H  HB3  . ALA A 1 74 ? 14.932  3.184   -5.024  1.00 0.00 ? 495 ALA A HB3  2  
ATOM   2548  N  N    . ASP A 1 75 ? 11.395  4.197   -6.799  1.00 0.00 ? 496 ASP A N    2  
ATOM   2549  C  CA   . ASP A 1 75 ? 10.484  4.635   -7.849  1.00 0.00 ? 496 ASP A CA   2  
ATOM   2550  C  C    . ASP A 1 75 ? 9.752   5.908   -7.438  1.00 0.00 ? 496 ASP A C    2  
ATOM   2551  O  O    . ASP A 1 75 ? 9.673   6.867   -8.207  1.00 0.00 ? 496 ASP A O    2  
ATOM   2552  C  CB   . ASP A 1 75 ? 9.474   3.532   -8.171  1.00 0.00 ? 496 ASP A CB   2  
ATOM   2553  C  CG   . ASP A 1 75 ? 8.823   3.721   -9.527  1.00 0.00 ? 496 ASP A CG   2  
ATOM   2554  O  OD1  . ASP A 1 75 ? 9.557   3.953   -10.510 1.00 0.00 ? 496 ASP A OD1  2  
ATOM   2555  O  OD2  . ASP A 1 75 ? 7.580   3.635   -9.605  1.00 0.00 ? 496 ASP A OD2  2  
ATOM   2556  H  H    . ASP A 1 75 ? 11.330  3.279   -6.461  1.00 0.00 ? 496 ASP A H    2  
ATOM   2557  H  HA   . ASP A 1 75 ? 11.071  4.841   -8.732  1.00 0.00 ? 496 ASP A HA   2  
ATOM   2558  H  HB2  . ASP A 1 75 ? 9.979   2.577   -8.164  1.00 0.00 ? 496 ASP A HB2  2  
ATOM   2559  H  HB3  . ASP A 1 75 ? 8.701   3.531   -7.417  1.00 0.00 ? 496 ASP A HB3  2  
ATOM   2560  N  N    . ASP A 1 76 ? 9.218   5.911   -6.221  1.00 0.00 ? 497 ASP A N    2  
ATOM   2561  C  CA   . ASP A 1 76 ? 8.493   7.067   -5.707  1.00 0.00 ? 497 ASP A CA   2  
ATOM   2562  C  C    . ASP A 1 76 ? 9.452   8.202   -5.364  1.00 0.00 ? 497 ASP A C    2  
ATOM   2563  O  O    . ASP A 1 76 ? 9.455   9.244   -6.017  1.00 0.00 ? 497 ASP A O    2  
ATOM   2564  C  CB   . ASP A 1 76 ? 7.680   6.677   -4.471  1.00 0.00 ? 497 ASP A CB   2  
ATOM   2565  C  CG   . ASP A 1 76 ? 6.560   7.657   -4.183  1.00 0.00 ? 497 ASP A CG   2  
ATOM   2566  O  OD1  . ASP A 1 76 ? 6.098   8.326   -5.130  1.00 0.00 ? 497 ASP A OD1  2  
ATOM   2567  O  OD2  . ASP A 1 76 ? 6.145   7.755   -3.008  1.00 0.00 ? 497 ASP A OD2  2  
ATOM   2568  H  H    . ASP A 1 76 ? 9.316   5.117   -5.655  1.00 0.00 ? 497 ASP A H    2  
ATOM   2569  H  HA   . ASP A 1 76 ? 7.817   7.404   -6.479  1.00 0.00 ? 497 ASP A HA   2  
ATOM   2570  H  HB2  . ASP A 1 76 ? 7.247   5.699   -4.627  1.00 0.00 ? 497 ASP A HB2  2  
ATOM   2571  H  HB3  . ASP A 1 76 ? 8.336   6.643   -3.614  1.00 0.00 ? 497 ASP A HB3  2  
ATOM   2572  N  N    . ALA A 1 77 ? 10.264  7.992   -4.333  1.00 0.00 ? 498 ALA A N    2  
ATOM   2573  C  CA   . ALA A 1 77 ? 11.228  8.997   -3.903  1.00 0.00 ? 498 ALA A CA   2  
ATOM   2574  C  C    . ALA A 1 77 ? 11.833  9.724   -5.099  1.00 0.00 ? 498 ALA A C    2  
ATOM   2575  O  O    . ALA A 1 77 ? 12.008  10.942  -5.072  1.00 0.00 ? 498 ALA A O    2  
ATOM   2576  C  CB   . ALA A 1 77 ? 12.323  8.353   -3.065  1.00 0.00 ? 498 ALA A CB   2  
ATOM   2577  H  H    . ALA A 1 77 ? 10.214  7.140   -3.851  1.00 0.00 ? 498 ALA A H    2  
ATOM   2578  H  HA   . ALA A 1 77 ? 10.709  9.714   -3.283  1.00 0.00 ? 498 ALA A HA   2  
ATOM   2579  H  HB1  . ALA A 1 77 ? 13.244  8.335   -3.630  1.00 0.00 ? 498 ALA A HB1  2  
ATOM   2580  H  HB2  . ALA A 1 77 ? 12.467  8.925   -2.160  1.00 0.00 ? 498 ALA A HB2  2  
ATOM   2581  H  HB3  . ALA A 1 77 ? 12.035  7.344   -2.811  1.00 0.00 ? 498 ALA A HB3  2  
ATOM   2582  N  N    . GLU A 1 78 ? 12.152  8.969   -6.146  1.00 0.00 ? 499 GLU A N    2  
ATOM   2583  C  CA   . GLU A 1 78 ? 12.739  9.543   -7.350  1.00 0.00 ? 499 GLU A CA   2  
ATOM   2584  C  C    . GLU A 1 78 ? 11.897  10.708  -7.864  1.00 0.00 ? 499 GLU A C    2  
ATOM   2585  O  O    . GLU A 1 78 ? 12.372  11.839  -7.952  1.00 0.00 ? 499 GLU A O    2  
ATOM   2586  C  CB   . GLU A 1 78 ? 12.872  8.476   -8.439  1.00 0.00 ? 499 GLU A CB   2  
ATOM   2587  C  CG   . GLU A 1 78 ? 13.457  9.001   -9.739  1.00 0.00 ? 499 GLU A CG   2  
ATOM   2588  C  CD   . GLU A 1 78 ? 13.110  8.129   -10.929 1.00 0.00 ? 499 GLU A CD   2  
ATOM   2589  O  OE1  . GLU A 1 78 ? 13.147  6.889   -10.788 1.00 0.00 ? 499 GLU A OE1  2  
ATOM   2590  O  OE2  . GLU A 1 78 ? 12.800  8.687   -12.003 1.00 0.00 ? 499 GLU A OE2  2  
ATOM   2591  H  H    . GLU A 1 78 ? 11.988  8.004   -6.107  1.00 0.00 ? 499 GLU A H    2  
ATOM   2592  H  HA   . GLU A 1 78 ? 13.722  9.910   -7.098  1.00 0.00 ? 499 GLU A HA   2  
ATOM   2593  H  HB2  . GLU A 1 78 ? 13.510  7.685   -8.074  1.00 0.00 ? 499 GLU A HB2  2  
ATOM   2594  H  HB3  . GLU A 1 78 ? 11.893  8.069   -8.647  1.00 0.00 ? 499 GLU A HB3  2  
ATOM   2595  H  HG2  . GLU A 1 78 ? 13.072  9.995   -9.916  1.00 0.00 ? 499 GLU A HG2  2  
ATOM   2596  H  HG3  . GLU A 1 78 ? 14.532  9.044   -9.644  1.00 0.00 ? 499 GLU A HG3  2  
ATOM   2597  N  N    . ALA A 1 79 ? 10.645  10.420  -8.204  1.00 0.00 ? 500 ALA A N    2  
ATOM   2598  C  CA   . ALA A 1 79 ? 9.736   11.442  -8.708  1.00 0.00 ? 500 ALA A CA   2  
ATOM   2599  C  C    . ALA A 1 79 ? 9.860   12.731  -7.903  1.00 0.00 ? 500 ALA A C    2  
ATOM   2600  O  O    . ALA A 1 79 ? 9.985   13.817  -8.468  1.00 0.00 ? 500 ALA A O    2  
ATOM   2601  C  CB   . ALA A 1 79 ? 8.302   10.934  -8.678  1.00 0.00 ? 500 ALA A CB   2  
ATOM   2602  H  H    . ALA A 1 79 ? 10.324  9.499   -8.111  1.00 0.00 ? 500 ALA A H    2  
ATOM   2603  H  HA   . ALA A 1 79 ? 9.999   11.645  -9.736  1.00 0.00 ? 500 ALA A HA   2  
ATOM   2604  H  HB1  . ALA A 1 79 ? 8.231   10.098  -7.997  1.00 0.00 ? 500 ALA A HB1  2  
ATOM   2605  H  HB2  . ALA A 1 79 ? 7.647   11.726  -8.345  1.00 0.00 ? 500 ALA A HB2  2  
ATOM   2606  H  HB3  . ALA A 1 79 ? 8.012   10.618  -9.668  1.00 0.00 ? 500 ALA A HB3  2  
ATOM   2607  N  N    . GLY A 1 80 ? 9.822   12.604  -6.580  1.00 0.00 ? 501 GLY A N    2  
ATOM   2608  C  CA   . GLY A 1 80 ? 9.930   13.768  -5.720  1.00 0.00 ? 501 GLY A CA   2  
ATOM   2609  C  C    . GLY A 1 80 ? 8.753   13.901  -4.774  1.00 0.00 ? 501 GLY A C    2  
ATOM   2610  O  O    . GLY A 1 80 ? 7.605   13.982  -5.209  1.00 0.00 ? 501 GLY A O    2  
ATOM   2611  H  H    . GLY A 1 80 ? 9.720   11.713  -6.185  1.00 0.00 ? 501 GLY A H    2  
ATOM   2612  H  HA2  . GLY A 1 80 ? 10.838  13.690  -5.139  1.00 0.00 ? 501 GLY A HA2  2  
ATOM   2613  H  HA3  . GLY A 1 80 ? 9.984   14.653  -6.336  1.00 0.00 ? 501 GLY A HA3  2  
ATOM   2614  N  N    . ALA A 1 81 ? 9.038   13.921  -3.476  1.00 0.00 ? 502 ALA A N    2  
ATOM   2615  C  CA   . ALA A 1 81 ? 7.994   14.046  -2.466  1.00 0.00 ? 502 ALA A CA   2  
ATOM   2616  C  C    . ALA A 1 81 ? 8.427   14.980  -1.341  1.00 0.00 ? 502 ALA A C    2  
ATOM   2617  O  O    . ALA A 1 81 ? 9.397   14.708  -0.636  1.00 0.00 ? 502 ALA A O    2  
ATOM   2618  C  CB   . ALA A 1 81 ? 7.633   12.677  -1.909  1.00 0.00 ? 502 ALA A CB   2  
ATOM   2619  H  H    . ALA A 1 81 ? 9.973   13.853  -3.191  1.00 0.00 ? 502 ALA A H    2  
ATOM   2620  H  HA   . ALA A 1 81 ? 7.116   14.456  -2.944  1.00 0.00 ? 502 ALA A HA   2  
ATOM   2621  H  HB1  . ALA A 1 81 ? 6.593   12.469  -2.112  1.00 0.00 ? 502 ALA A HB1  2  
ATOM   2622  H  HB2  . ALA A 1 81 ? 8.249   11.924  -2.378  1.00 0.00 ? 502 ALA A HB2  2  
ATOM   2623  H  HB3  . ALA A 1 81 ? 7.801   12.667  -0.842  1.00 0.00 ? 502 ALA A HB3  2  
ATOM   2624  N  N    . GLU A 1 82 ? 7.700   16.082  -1.181  1.00 0.00 ? 503 GLU A N    2  
ATOM   2625  C  CA   . GLU A 1 82 ? 8.012   17.057  -0.142  1.00 0.00 ? 503 GLU A CA   2  
ATOM   2626  C  C    . GLU A 1 82 ? 7.025   16.949  1.017   1.00 0.00 ? 503 GLU A C    2  
ATOM   2627  O  O    . GLU A 1 82 ? 6.016   17.653  1.055   1.00 0.00 ? 503 GLU A O    2  
ATOM   2628  C  CB   . GLU A 1 82 ? 7.987   18.474  -0.718  1.00 0.00 ? 503 GLU A CB   2  
ATOM   2629  C  CG   . GLU A 1 82 ? 8.654   19.506  0.176   1.00 0.00 ? 503 GLU A CG   2  
ATOM   2630  C  CD   . GLU A 1 82 ? 10.122  19.210  0.413   1.00 0.00 ? 503 GLU A CD   2  
ATOM   2631  O  OE1  . GLU A 1 82 ? 10.766  18.636  -0.490  1.00 0.00 ? 503 GLU A OE1  2  
ATOM   2632  O  OE2  . GLU A 1 82 ? 10.627  19.553  1.502   1.00 0.00 ? 503 GLU A OE2  2  
ATOM   2633  H  H    . GLU A 1 82 ? 6.938   16.243  -1.776  1.00 0.00 ? 503 GLU A H    2  
ATOM   2634  H  HA   . GLU A 1 82 ? 9.004   16.845  0.225   1.00 0.00 ? 503 GLU A HA   2  
ATOM   2635  H  HB2  . GLU A 1 82 ? 8.494   18.471  -1.672  1.00 0.00 ? 503 GLU A HB2  2  
ATOM   2636  H  HB3  . GLU A 1 82 ? 6.959   18.770  -0.868  1.00 0.00 ? 503 GLU A HB3  2  
ATOM   2637  H  HG2  . GLU A 1 82 ? 8.569   20.476  -0.290  1.00 0.00 ? 503 GLU A HG2  2  
ATOM   2638  H  HG3  . GLU A 1 82 ? 8.146   19.520  1.129   1.00 0.00 ? 503 GLU A HG3  2  
ATOM   2639  N  N    . ASP A 1 83 ? 7.325   16.064  1.961   1.00 0.00 ? 504 ASP A N    2  
ATOM   2640  C  CA   . ASP A 1 83 ? 6.466   15.864  3.122   1.00 0.00 ? 504 ASP A CA   2  
ATOM   2641  C  C    . ASP A 1 83 ? 7.268   15.968  4.416   1.00 0.00 ? 504 ASP A C    2  
ATOM   2642  O  O    . ASP A 1 83 ? 7.833   14.981  4.887   1.00 0.00 ? 504 ASP A O    2  
ATOM   2643  C  CB   . ASP A 1 83 ? 5.775   14.501  3.044   1.00 0.00 ? 504 ASP A CB   2  
ATOM   2644  C  CG   . ASP A 1 83 ? 5.150   14.247  1.687   1.00 0.00 ? 504 ASP A CG   2  
ATOM   2645  O  OD1  . ASP A 1 83 ? 4.172   14.944  1.344   1.00 0.00 ? 504 ASP A OD1  2  
ATOM   2646  O  OD2  . ASP A 1 83 ? 5.637   13.350  0.967   1.00 0.00 ? 504 ASP A OD2  2  
ATOM   2647  H  H    . ASP A 1 83 ? 8.144   15.532  1.875   1.00 0.00 ? 504 ASP A H    2  
ATOM   2648  H  HA   . ASP A 1 83 ? 5.715   16.639  3.116   1.00 0.00 ? 504 ASP A HA   2  
ATOM   2649  H  HB2  . ASP A 1 83 ? 6.502   13.725  3.236   1.00 0.00 ? 504 ASP A HB2  2  
ATOM   2650  H  HB3  . ASP A 1 83 ? 4.999   14.455  3.793   1.00 0.00 ? 504 ASP A HB3  2  
ATOM   2651  N  N    . GLU A 1 84 ? 7.314   17.169  4.983   1.00 0.00 ? 505 GLU A N    2  
ATOM   2652  C  CA   . GLU A 1 84 ? 8.049   17.401  6.221   1.00 0.00 ? 505 GLU A CA   2  
ATOM   2653  C  C    . GLU A 1 84 ? 7.092   17.637  7.386   1.00 0.00 ? 505 GLU A C    2  
ATOM   2654  O  O    . GLU A 1 84 ? 6.009   18.196  7.211   1.00 0.00 ? 505 GLU A O    2  
ATOM   2655  C  CB   . GLU A 1 84 ? 8.987   18.600  6.066   1.00 0.00 ? 505 GLU A CB   2  
ATOM   2656  C  CG   . GLU A 1 84 ? 10.249  18.498  6.907   1.00 0.00 ? 505 GLU A CG   2  
ATOM   2657  C  CD   . GLU A 1 84 ? 10.978  17.184  6.708   1.00 0.00 ? 505 GLU A CD   2  
ATOM   2658  O  OE1  . GLU A 1 84 ? 11.529  16.971  5.608   1.00 0.00 ? 505 GLU A OE1  2  
ATOM   2659  O  OE2  . GLU A 1 84 ? 10.999  16.369  7.654   1.00 0.00 ? 505 GLU A OE2  2  
ATOM   2660  H  H    . GLU A 1 84 ? 6.843   17.917  4.559   1.00 0.00 ? 505 GLU A H    2  
ATOM   2661  H  HA   . GLU A 1 84 ? 8.638   16.520  6.427   1.00 0.00 ? 505 GLU A HA   2  
ATOM   2662  H  HB2  . GLU A 1 84 ? 9.277   18.684  5.029   1.00 0.00 ? 505 GLU A HB2  2  
ATOM   2663  H  HB3  . GLU A 1 84 ? 8.458   19.495  6.356   1.00 0.00 ? 505 GLU A HB3  2  
ATOM   2664  H  HG2  . GLU A 1 84 ? 10.913  19.306  6.636   1.00 0.00 ? 505 GLU A HG2  2  
ATOM   2665  H  HG3  . GLU A 1 84 ? 9.979   18.590  7.949   1.00 0.00 ? 505 GLU A HG3  2  
ATOM   2666  N  N    . LYS A 1 85 ? 7.500   17.208  8.575   1.00 0.00 ? 506 LYS A N    2  
ATOM   2667  C  CA   . LYS A 1 85 ? 6.681   17.372  9.770   1.00 0.00 ? 506 LYS A CA   2  
ATOM   2668  C  C    . LYS A 1 85 ? 7.286   18.415  10.705  1.00 0.00 ? 506 LYS A C    2  
ATOM   2669  O  O    . LYS A 1 85 ? 8.381   18.920  10.460  1.00 0.00 ? 506 LYS A O    2  
ATOM   2670  C  CB   . LYS A 1 85 ? 6.539   16.036  10.503  1.00 0.00 ? 506 LYS A CB   2  
ATOM   2671  C  CG   . LYS A 1 85 ? 5.665   15.032  9.772   1.00 0.00 ? 506 LYS A CG   2  
ATOM   2672  C  CD   . LYS A 1 85 ? 4.191   15.263  10.057  1.00 0.00 ? 506 LYS A CD   2  
ATOM   2673  C  CE   . LYS A 1 85 ? 3.347   14.071  9.632   1.00 0.00 ? 506 LYS A CE   2  
ATOM   2674  N  NZ   . LYS A 1 85 ? 3.427   13.830  8.164   1.00 0.00 ? 506 LYS A NZ   2  
ATOM   2675  H  H    . LYS A 1 85 ? 8.374   16.770  8.651   1.00 0.00 ? 506 LYS A H    2  
ATOM   2676  H  HA   . LYS A 1 85 ? 5.704   17.709  9.459   1.00 0.00 ? 506 LYS A HA   2  
ATOM   2677  H  HB2  . LYS A 1 85 ? 7.520   15.603  10.632  1.00 0.00 ? 506 LYS A HB2  2  
ATOM   2678  H  HB3  . LYS A 1 85 ? 6.105   16.218  11.476  1.00 0.00 ? 506 LYS A HB3  2  
ATOM   2679  H  HG2  . LYS A 1 85 ? 5.835   15.127  8.710   1.00 0.00 ? 506 LYS A HG2  2  
ATOM   2680  H  HG3  . LYS A 1 85 ? 5.933   14.035  10.093  1.00 0.00 ? 506 LYS A HG3  2  
ATOM   2681  H  HD2  . LYS A 1 85 ? 4.059   15.423  11.117  1.00 0.00 ? 506 LYS A HD2  2  
ATOM   2682  H  HD3  . LYS A 1 85 ? 3.861   16.138  9.515   1.00 0.00 ? 506 LYS A HD3  2  
ATOM   2683  H  HE2  . LYS A 1 85 ? 3.700   13.193  10.151  1.00 0.00 ? 506 LYS A HE2  2  
ATOM   2684  H  HE3  . LYS A 1 85 ? 2.319   14.260  9.902   1.00 0.00 ? 506 LYS A HE3  2  
ATOM   2685  H  HZ1  . LYS A 1 85 ? 2.638   14.306  7.682   1.00 0.00 ? 506 LYS A HZ1  2  
ATOM   2686  H  HZ2  . LYS A 1 85 ? 3.376   12.811  7.966   1.00 0.00 ? 506 LYS A HZ2  2  
ATOM   2687  H  HZ3  . LYS A 1 85 ? 4.323   14.201  7.789   1.00 0.00 ? 506 LYS A HZ3  2  
ATOM   2688  N  N    . GLU A 1 86 ? 6.566   18.731  11.777  1.00 0.00 ? 507 GLU A N    2  
ATOM   2689  C  CA   . GLU A 1 86 ? 7.034   19.713  12.748  1.00 0.00 ? 507 GLU A CA   2  
ATOM   2690  C  C    . GLU A 1 86 ? 7.122   19.100  14.143  1.00 0.00 ? 507 GLU A C    2  
ATOM   2691  O  O    . GLU A 1 86 ? 6.304   18.259  14.516  1.00 0.00 ? 507 GLU A O    2  
ATOM   2692  C  CB   . GLU A 1 86 ? 6.101   20.925  12.770  1.00 0.00 ? 507 GLU A CB   2  
ATOM   2693  C  CG   . GLU A 1 86 ? 6.558   22.029  13.710  1.00 0.00 ? 507 GLU A CG   2  
ATOM   2694  C  CD   . GLU A 1 86 ? 7.764   22.782  13.182  1.00 0.00 ? 507 GLU A CD   2  
ATOM   2695  O  OE1  . GLU A 1 86 ? 8.809   22.139  12.948  1.00 0.00 ? 507 GLU A OE1  2  
ATOM   2696  O  OE2  . GLU A 1 86 ? 7.663   24.013  13.003  1.00 0.00 ? 507 GLU A OE2  2  
ATOM   2697  H  H    . GLU A 1 86 ? 5.701   18.293  11.918  1.00 0.00 ? 507 GLU A H    2  
ATOM   2698  H  HA   . GLU A 1 86 ? 8.019   20.034  12.447  1.00 0.00 ? 507 GLU A HA   2  
ATOM   2699  H  HB2  . GLU A 1 86 ? 6.037   21.334  11.772  1.00 0.00 ? 507 GLU A HB2  2  
ATOM   2700  H  HB3  . GLU A 1 86 ? 5.118   20.602  13.080  1.00 0.00 ? 507 GLU A HB3  2  
ATOM   2701  H  HG2  . GLU A 1 86 ? 5.747   22.728  13.845  1.00 0.00 ? 507 GLU A HG2  2  
ATOM   2702  H  HG3  . GLU A 1 86 ? 6.815   21.589  14.662  1.00 0.00 ? 507 GLU A HG3  2  
ATOM   2703  N  N    . VAL A 1 87 ? 8.121   19.527  14.909  1.00 0.00 ? 508 VAL A N    2  
ATOM   2704  C  CA   . VAL A 1 87 ? 8.317   19.022  16.262  1.00 0.00 ? 508 VAL A CA   2  
ATOM   2705  C  C    . VAL A 1 87 ? 7.752   19.988  17.297  1.00 0.00 ? 508 VAL A C    2  
ATOM   2706  O  O    . VAL A 1 87 ? 8.236   21.110  17.441  1.00 0.00 ? 508 VAL A O    2  
ATOM   2707  C  CB   . VAL A 1 87 ? 9.808   18.781  16.561  1.00 0.00 ? 508 VAL A CB   2  
ATOM   2708  C  CG1  . VAL A 1 87 ? 9.994   18.290  17.989  1.00 0.00 ? 508 VAL A CG1  2  
ATOM   2709  C  CG2  . VAL A 1 87 ? 10.398  17.791  15.567  1.00 0.00 ? 508 VAL A CG2  2  
ATOM   2710  H  H    . VAL A 1 87 ? 8.741   20.199  14.555  1.00 0.00 ? 508 VAL A H    2  
ATOM   2711  H  HA   . VAL A 1 87 ? 7.798   18.078  16.344  1.00 0.00 ? 508 VAL A HA   2  
ATOM   2712  H  HB   . VAL A 1 87 ? 10.332  19.720  16.456  1.00 0.00 ? 508 VAL A HB   2  
ATOM   2713  H  HG11 . VAL A 1 87 ? 10.947  17.788  18.075  1.00 0.00 ? 508 VAL A HG11 2  
ATOM   2714  H  HG12 . VAL A 1 87 ? 9.967   19.131  18.666  1.00 0.00 ? 508 VAL A HG12 2  
ATOM   2715  H  HG13 . VAL A 1 87 ? 9.201   17.600  18.238  1.00 0.00 ? 508 VAL A HG13 2  
ATOM   2716  H  HG21 . VAL A 1 87 ? 10.491  18.265  14.601  1.00 0.00 ? 508 VAL A HG21 2  
ATOM   2717  H  HG22 . VAL A 1 87 ? 11.373  17.475  15.908  1.00 0.00 ? 508 VAL A HG22 2  
ATOM   2718  H  HG23 . VAL A 1 87 ? 9.749   16.932  15.486  1.00 0.00 ? 508 VAL A HG23 2  
ATOM   2719  N  N    . GLU A 1 88 ? 6.725   19.545  18.014  1.00 0.00 ? 509 GLU A N    2  
ATOM   2720  C  CA   . GLU A 1 88 ? 6.094   20.372  19.036  1.00 0.00 ? 509 GLU A CA   2  
ATOM   2721  C  C    . GLU A 1 88 ? 6.658   20.054  20.418  1.00 0.00 ? 509 GLU A C    2  
ATOM   2722  O  O    . GLU A 1 88 ? 6.452   18.963  20.947  1.00 0.00 ? 509 GLU A O    2  
ATOM   2723  C  CB   . GLU A 1 88 ? 4.578   20.161  19.031  1.00 0.00 ? 509 GLU A CB   2  
ATOM   2724  C  CG   . GLU A 1 88 ? 4.164   18.718  19.269  1.00 0.00 ? 509 GLU A CG   2  
ATOM   2725  C  CD   . GLU A 1 88 ? 2.685   18.489  19.027  1.00 0.00 ? 509 GLU A CD   2  
ATOM   2726  O  OE1  . GLU A 1 88 ? 2.305   18.240  17.864  1.00 0.00 ? 509 GLU A OE1  2  
ATOM   2727  O  OE2  . GLU A 1 88 ? 1.907   18.557  20.002  1.00 0.00 ? 509 GLU A OE2  2  
ATOM   2728  H  H    . GLU A 1 88 ? 6.383   18.641  17.853  1.00 0.00 ? 509 GLU A H    2  
ATOM   2729  H  HA   . GLU A 1 88 ? 6.304   21.405  18.804  1.00 0.00 ? 509 GLU A HA   2  
ATOM   2730  H  HB2  . GLU A 1 88 ? 4.139   20.773  19.805  1.00 0.00 ? 509 GLU A HB2  2  
ATOM   2731  H  HB3  . GLU A 1 88 ? 4.187   20.472  18.073  1.00 0.00 ? 509 GLU A HB3  2  
ATOM   2732  H  HG2  . GLU A 1 88 ? 4.725   18.081  18.603  1.00 0.00 ? 509 GLU A HG2  2  
ATOM   2733  H  HG3  . GLU A 1 88 ? 4.391   18.456  20.292  1.00 0.00 ? 509 GLU A HG3  2  
ATOM   2734  N  N    . GLU A 1 89 ? 7.370   21.017  20.996  1.00 0.00 ? 510 GLU A N    2  
ATOM   2735  C  CA   . GLU A 1 89 ? 7.965   20.839  22.315  1.00 0.00 ? 510 GLU A CA   2  
ATOM   2736  C  C    . GLU A 1 89 ? 6.907   20.441  23.340  1.00 0.00 ? 510 GLU A C    2  
ATOM   2737  O  O    . GLU A 1 89 ? 5.749   20.849  23.244  1.00 0.00 ? 510 GLU A O    2  
ATOM   2738  C  CB   . GLU A 1 89 ? 8.665   22.124  22.761  1.00 0.00 ? 510 GLU A CB   2  
ATOM   2739  C  CG   . GLU A 1 89 ? 7.728   23.314  22.887  1.00 0.00 ? 510 GLU A CG   2  
ATOM   2740  C  CD   . GLU A 1 89 ? 8.460   24.641  22.827  1.00 0.00 ? 510 GLU A CD   2  
ATOM   2741  O  OE1  . GLU A 1 89 ? 9.517   24.707  22.166  1.00 0.00 ? 510 GLU A OE1  2  
ATOM   2742  O  OE2  . GLU A 1 89 ? 7.974   25.614  23.440  1.00 0.00 ? 510 GLU A OE2  2  
ATOM   2743  H  H    . GLU A 1 89 ? 7.499   21.865  20.523  1.00 0.00 ? 510 GLU A H    2  
ATOM   2744  H  HA   . GLU A 1 89 ? 8.696   20.048  22.245  1.00 0.00 ? 510 GLU A HA   2  
ATOM   2745  H  HB2  . GLU A 1 89 ? 9.128   21.953  23.721  1.00 0.00 ? 510 GLU A HB2  2  
ATOM   2746  H  HB3  . GLU A 1 89 ? 9.431   22.371  22.041  1.00 0.00 ? 510 GLU A HB3  2  
ATOM   2747  H  HG2  . GLU A 1 89 ? 7.011   23.279  22.081  1.00 0.00 ? 510 GLU A HG2  2  
ATOM   2748  H  HG3  . GLU A 1 89 ? 7.209   23.249  23.832  1.00 0.00 ? 510 GLU A HG3  2  
ATOM   2749  N  N    . LEU A 1 90 ? 7.312   19.640  24.319  1.00 0.00 ? 511 LEU A N    2  
ATOM   2750  C  CA   . LEU A 1 90 ? 6.400   19.185  25.363  1.00 0.00 ? 511 LEU A CA   2  
ATOM   2751  C  C    . LEU A 1 90 ? 6.536   20.042  26.617  1.00 0.00 ? 511 LEU A C    2  
ATOM   2752  O  O    . LEU A 1 90 ? 7.170   19.639  27.592  1.00 0.00 ? 511 LEU A O    2  
ATOM   2753  C  CB   . LEU A 1 90 ? 6.671   17.719  25.701  1.00 0.00 ? 511 LEU A CB   2  
ATOM   2754  C  CG   . LEU A 1 90 ? 6.046   16.686  24.763  1.00 0.00 ? 511 LEU A CG   2  
ATOM   2755  C  CD1  . LEU A 1 90 ? 6.791   15.363  24.852  1.00 0.00 ? 511 LEU A CD1  2  
ATOM   2756  C  CD2  . LEU A 1 90 ? 4.572   16.493  25.090  1.00 0.00 ? 511 LEU A CD2  2  
ATOM   2757  H  H    . LEU A 1 90 ? 8.247   19.348  24.343  1.00 0.00 ? 511 LEU A H    2  
ATOM   2758  H  HA   . LEU A 1 90 ? 5.392   19.279  24.985  1.00 0.00 ? 511 LEU A HA   2  
ATOM   2759  H  HB2  . LEU A 1 90 ? 7.740   17.569  25.691  1.00 0.00 ? 511 LEU A HB2  2  
ATOM   2760  H  HB3  . LEU A 1 90 ? 6.293   17.535  26.697  1.00 0.00 ? 511 LEU A HB3  2  
ATOM   2761  H  HG   . LEU A 1 90 ? 6.120   17.043  23.745  1.00 0.00 ? 511 LEU A HG   2  
ATOM   2762  H  HD11 . LEU A 1 90 ? 7.380   15.342  25.756  1.00 0.00 ? 511 LEU A HD11 2  
ATOM   2763  H  HD12 . LEU A 1 90 ? 7.441   15.259  23.996  1.00 0.00 ? 511 LEU A HD12 2  
ATOM   2764  H  HD13 . LEU A 1 90 ? 6.081   14.550  24.865  1.00 0.00 ? 511 LEU A HD13 2  
ATOM   2765  H  HD21 . LEU A 1 90 ? 4.477   15.862  25.961  1.00 0.00 ? 511 LEU A HD21 2  
ATOM   2766  H  HD22 . LEU A 1 90 ? 4.076   16.025  24.251  1.00 0.00 ? 511 LEU A HD22 2  
ATOM   2767  H  HD23 . LEU A 1 90 ? 4.118   17.452  25.287  1.00 0.00 ? 511 LEU A HD23 2  
ATOM   2768  N  N    . LYS A 1 91 ? 5.936   21.227  26.586  1.00 0.00 ? 512 LYS A N    2  
ATOM   2769  C  CA   . LYS A 1 91 ? 5.986   22.141  27.721  1.00 0.00 ? 512 LYS A CA   2  
ATOM   2770  C  C    . LYS A 1 91 ? 7.330   22.046  28.437  1.00 0.00 ? 512 LYS A C    2  
ATOM   2771  O  O    . LYS A 1 91 ? 7.391   22.047  29.667  1.00 0.00 ? 512 LYS A O    2  
ATOM   2772  C  CB   . LYS A 1 91 ? 4.851   21.835  28.700  1.00 0.00 ? 512 LYS A CB   2  
ATOM   2773  C  CG   . LYS A 1 91 ? 3.532   22.488  28.326  1.00 0.00 ? 512 LYS A CG   2  
ATOM   2774  C  CD   . LYS A 1 91 ? 2.389   21.964  29.179  1.00 0.00 ? 512 LYS A CD   2  
ATOM   2775  C  CE   . LYS A 1 91 ? 1.041   22.222  28.523  1.00 0.00 ? 512 LYS A CE   2  
ATOM   2776  N  NZ   . LYS A 1 91 ? -0.090  21.789  29.390  1.00 0.00 ? 512 LYS A NZ   2  
ATOM   2777  H  H    . LYS A 1 91 ? 5.445   21.493  25.779  1.00 0.00 ? 512 LYS A H    2  
ATOM   2778  H  HA   . LYS A 1 91 ? 5.864   23.145  27.344  1.00 0.00 ? 512 LYS A HA   2  
ATOM   2779  H  HB2  . LYS A 1 91 ? 4.702   20.766  28.736  1.00 0.00 ? 512 LYS A HB2  2  
ATOM   2780  H  HB3  . LYS A 1 91 ? 5.136   22.183  29.683  1.00 0.00 ? 512 LYS A HB3  2  
ATOM   2781  H  HG2  . LYS A 1 91 ? 3.615   23.555  28.472  1.00 0.00 ? 512 LYS A HG2  2  
ATOM   2782  H  HG3  . LYS A 1 91 ? 3.319   22.280  27.287  1.00 0.00 ? 512 LYS A HG3  2  
ATOM   2783  H  HD2  . LYS A 1 91 ? 2.512   20.900  29.316  1.00 0.00 ? 512 LYS A HD2  2  
ATOM   2784  H  HD3  . LYS A 1 91 ? 2.412   22.458  30.140  1.00 0.00 ? 512 LYS A HD3  2  
ATOM   2785  H  HE2  . LYS A 1 91 ? 0.947   23.279  28.326  1.00 0.00 ? 512 LYS A HE2  2  
ATOM   2786  H  HE3  . LYS A 1 91 ? 0.999   21.678  27.591  1.00 0.00 ? 512 LYS A HE3  2  
ATOM   2787  H  HZ1  . LYS A 1 91 ? 0.204   21.793  30.388  1.00 0.00 ? 512 LYS A HZ1  2  
ATOM   2788  H  HZ2  . LYS A 1 91 ? -0.389  20.826  29.132  1.00 0.00 ? 512 LYS A HZ2  2  
ATOM   2789  H  HZ3  . LYS A 1 91 ? -0.897  22.434  29.274  1.00 0.00 ? 512 LYS A HZ3  2  
ATOM   2790  N  N    . LYS A 1 92 ? 8.405   21.964  27.660  1.00 0.00 ? 513 LYS A N    2  
ATOM   2791  C  CA   . LYS A 1 92 ? 9.748   21.871  28.220  1.00 0.00 ? 513 LYS A CA   2  
ATOM   2792  C  C    . LYS A 1 92 ? 9.931   22.861  29.365  1.00 0.00 ? 513 LYS A C    2  
ATOM   2793  O  O    . LYS A 1 92 ? 9.351   23.947  29.358  1.00 0.00 ? 513 LYS A O    2  
ATOM   2794  C  CB   . LYS A 1 92 ? 10.794  22.132  27.134  1.00 0.00 ? 513 LYS A CB   2  
ATOM   2795  C  CG   . LYS A 1 92 ? 10.898  23.592  26.728  1.00 0.00 ? 513 LYS A CG   2  
ATOM   2796  C  CD   . LYS A 1 92 ? 11.928  24.332  27.567  1.00 0.00 ? 513 LYS A CD   2  
ATOM   2797  C  CE   . LYS A 1 92 ? 12.218  25.713  27.001  1.00 0.00 ? 513 LYS A CE   2  
ATOM   2798  N  NZ   . LYS A 1 92 ? 13.012  25.642  25.744  1.00 0.00 ? 513 LYS A NZ   2  
ATOM   2799  H  H    . LYS A 1 92 ? 8.292   21.968  26.686  1.00 0.00 ? 513 LYS A H    2  
ATOM   2800  H  HA   . LYS A 1 92 ? 9.880   20.869  28.601  1.00 0.00 ? 513 LYS A HA   2  
ATOM   2801  H  HB2  . LYS A 1 92 ? 11.760  21.811  27.496  1.00 0.00 ? 513 LYS A HB2  2  
ATOM   2802  H  HB3  . LYS A 1 92 ? 10.538  21.554  26.257  1.00 0.00 ? 513 LYS A HB3  2  
ATOM   2803  H  HG2  . LYS A 1 92 ? 11.188  23.648  25.690  1.00 0.00 ? 513 LYS A HG2  2  
ATOM   2804  H  HG3  . LYS A 1 92 ? 9.934   24.063  26.861  1.00 0.00 ? 513 LYS A HG3  2  
ATOM   2805  H  HD2  . LYS A 1 92 ? 11.550  24.439  28.573  1.00 0.00 ? 513 LYS A HD2  2  
ATOM   2806  H  HD3  . LYS A 1 92 ? 12.844  23.759  27.583  1.00 0.00 ? 513 LYS A HD3  2  
ATOM   2807  H  HE2  . LYS A 1 92 ? 11.281  26.209  26.798  1.00 0.00 ? 513 LYS A HE2  2  
ATOM   2808  H  HE3  . LYS A 1 92 ? 12.772  26.279  27.736  1.00 0.00 ? 513 LYS A HE3  2  
ATOM   2809  H  HZ1  . LYS A 1 92 ? 14.017  25.489  25.964  1.00 0.00 ? 513 LYS A HZ1  2  
ATOM   2810  H  HZ2  . LYS A 1 92 ? 12.918  26.530  25.211  1.00 0.00 ? 513 LYS A HZ2  2  
ATOM   2811  H  HZ3  . LYS A 1 92 ? 12.674  24.857  25.151  1.00 0.00 ? 513 LYS A HZ3  2  
ATOM   2812  N  N    . SER A 1 93 ? 10.741  22.480  30.348  1.00 0.00 ? 514 SER A N    2  
ATOM   2813  C  CA   . SER A 1 93 ? 10.998  23.334  31.501  1.00 0.00 ? 514 SER A CA   2  
ATOM   2814  C  C    . SER A 1 93 ? 12.092  22.741  32.383  1.00 0.00 ? 514 SER A C    2  
ATOM   2815  O  O    . SER A 1 93 ? 12.369  21.543  32.327  1.00 0.00 ? 514 SER A O    2  
ATOM   2816  C  CB   . SER A 1 93 ? 9.717   23.525  32.316  1.00 0.00 ? 514 SER A CB   2  
ATOM   2817  O  OG   . SER A 1 93 ? 8.971   24.632  31.841  1.00 0.00 ? 514 SER A OG   2  
ATOM   2818  H  H    . SER A 1 93 ? 11.174  21.602  30.296  1.00 0.00 ? 514 SER A H    2  
ATOM   2819  H  HA   . SER A 1 93 ? 11.329  24.295  31.135  1.00 0.00 ? 514 SER A HA   2  
ATOM   2820  H  HB2  . SER A 1 93 ? 9.109   22.637  32.240  1.00 0.00 ? 514 SER A HB2  2  
ATOM   2821  H  HB3  . SER A 1 93 ? 9.975   23.698  33.351  1.00 0.00 ? 514 SER A HB3  2  
ATOM   2822  H  HG   . SER A 1 93 ? 9.243   24.841  30.944  1.00 0.00 ? 514 SER A HG   2  
ATOM   2823  N  N    . GLY A 1 94 ? 12.711  23.589  33.199  1.00 0.00 ? 515 GLY A N    2  
ATOM   2824  C  CA   . GLY A 1 94 ? 13.768  23.132  34.082  1.00 0.00 ? 515 GLY A CA   2  
ATOM   2825  C  C    . GLY A 1 94 ? 13.414  23.300  35.546  1.00 0.00 ? 515 GLY A C    2  
ATOM   2826  O  O    . GLY A 1 94 ? 14.050  24.058  36.278  1.00 0.00 ? 515 GLY A O    2  
ATOM   2827  H  H    . GLY A 1 94 ? 12.448  24.533  33.201  1.00 0.00 ? 515 GLY A H    2  
ATOM   2828  H  HA2  . GLY A 1 94 ? 13.959  22.087  33.886  1.00 0.00 ? 515 GLY A HA2  2  
ATOM   2829  H  HA3  . GLY A 1 94 ? 14.665  23.696  33.874  1.00 0.00 ? 515 GLY A HA3  2  
ATOM   2830  N  N    . PRO A 1 95 ? 12.374  22.580  35.994  1.00 0.00 ? 516 PRO A N    2  
ATOM   2831  C  CA   . PRO A 1 95 ? 11.912  22.637  37.383  1.00 0.00 ? 516 PRO A CA   2  
ATOM   2832  C  C    . PRO A 1 95 ? 12.899  21.992  38.350  1.00 0.00 ? 516 PRO A C    2  
ATOM   2833  O  O    . PRO A 1 95 ? 13.888  21.389  37.932  1.00 0.00 ? 516 PRO A O    2  
ATOM   2834  C  CB   . PRO A 1 95 ? 10.600  21.849  37.354  1.00 0.00 ? 516 PRO A CB   2  
ATOM   2835  C  CG   . PRO A 1 95 ? 10.741  20.922  36.196  1.00 0.00 ? 516 PRO A CG   2  
ATOM   2836  C  CD   . PRO A 1 95 ? 11.570  21.656  35.177  1.00 0.00 ? 516 PRO A CD   2  
ATOM   2837  H  HA   . PRO A 1 95 ? 11.716  23.653  37.695  1.00 0.00 ? 516 PRO A HA   2  
ATOM   2838  H  HB2  . PRO A 1 95 ? 10.482  21.307  38.282  1.00 0.00 ? 516 PRO A HB2  2  
ATOM   2839  H  HB3  . PRO A 1 95 ? 9.771   22.527  37.218  1.00 0.00 ? 516 PRO A HB3  2  
ATOM   2840  H  HG2  . PRO A 1 95 ? 11.243  20.019  36.507  1.00 0.00 ? 516 PRO A HG2  2  
ATOM   2841  H  HG3  . PRO A 1 95 ? 9.768   20.691  35.790  1.00 0.00 ? 516 PRO A HG3  2  
ATOM   2842  H  HD2  . PRO A 1 95 ? 12.203  20.966  34.638  1.00 0.00 ? 516 PRO A HD2  2  
ATOM   2843  H  HD3  . PRO A 1 95 ? 10.933  22.199  34.494  1.00 0.00 ? 516 PRO A HD3  2  
ATOM   2844  N  N    . SER A 1 96 ? 12.625  22.123  39.644  1.00 0.00 ? 517 SER A N    2  
ATOM   2845  C  CA   . SER A 1 96 ? 13.492  21.555  40.670  1.00 0.00 ? 517 SER A CA   2  
ATOM   2846  C  C    . SER A 1 96 ? 12.824  21.617  42.040  1.00 0.00 ? 517 SER A C    2  
ATOM   2847  O  O    . SER A 1 96 ? 12.352  22.671  42.466  1.00 0.00 ? 517 SER A O    2  
ATOM   2848  C  CB   . SER A 1 96 ? 14.828  22.299  40.707  1.00 0.00 ? 517 SER A CB   2  
ATOM   2849  O  OG   . SER A 1 96 ? 15.728  21.781  39.743  1.00 0.00 ? 517 SER A OG   2  
ATOM   2850  H  H    . SER A 1 96 ? 11.822  22.615  39.915  1.00 0.00 ? 517 SER A H    2  
ATOM   2851  H  HA   . SER A 1 96 ? 13.672  20.521  40.417  1.00 0.00 ? 517 SER A HA   2  
ATOM   2852  H  HB2  . SER A 1 96 ? 14.661  23.345  40.500  1.00 0.00 ? 517 SER A HB2  2  
ATOM   2853  H  HB3  . SER A 1 96 ? 15.269  22.193  41.688  1.00 0.00 ? 517 SER A HB3  2  
ATOM   2854  H  HG   . SER A 1 96 ? 16.285  21.114  40.151  1.00 0.00 ? 517 SER A HG   2  
ATOM   2855  N  N    . SER A 1 97 ? 12.788  20.479  42.726  1.00 0.00 ? 518 SER A N    2  
ATOM   2856  C  CA   . SER A 1 97 ? 12.175  20.401  44.047  1.00 0.00 ? 518 SER A CA   2  
ATOM   2857  C  C    . SER A 1 97 ? 13.100  19.696  45.034  1.00 0.00 ? 518 SER A C    2  
ATOM   2858  O  O    . SER A 1 97 ? 14.049  19.021  44.640  1.00 0.00 ? 518 SER A O    2  
ATOM   2859  C  CB   . SER A 1 97 ? 10.837  19.663  43.968  1.00 0.00 ? 518 SER A CB   2  
ATOM   2860  O  OG   . SER A 1 97 ? 9.992   20.243  42.990  1.00 0.00 ? 518 SER A OG   2  
ATOM   2861  H  H    . SER A 1 97 ? 13.181  19.672  42.333  1.00 0.00 ? 518 SER A H    2  
ATOM   2862  H  HA   . SER A 1 97 ? 12.001  21.409  44.391  1.00 0.00 ? 518 SER A HA   2  
ATOM   2863  H  HB2  . SER A 1 97 ? 11.013  18.631  43.709  1.00 0.00 ? 518 SER A HB2  2  
ATOM   2864  H  HB3  . SER A 1 97 ? 10.344  19.715  44.928  1.00 0.00 ? 518 SER A HB3  2  
ATOM   2865  H  HG   . SER A 1 97 ? 9.898   19.639  42.249  1.00 0.00 ? 518 SER A HG   2  
ATOM   2866  N  N    . GLY A 1 98 ? 12.814  19.860  46.323  1.00 0.00 ? 519 GLY A N    2  
ATOM   2867  C  CA   . GLY A 1 98 ? 13.629  19.234  47.348  1.00 0.00 ? 519 GLY A CA   2  
ATOM   2868  C  C    . GLY A 1 98 ? 14.297  20.247  48.256  1.00 0.00 ? 519 GLY A C    2  
ATOM   2869  O  O    . GLY A 1 98 ? 13.852  21.393  48.305  1.00 0.00 ? 519 GLY A O    2  
ATOM   2870  H  H    . GLY A 1 98 ? 12.045  20.409  46.579  1.00 0.00 ? 519 GLY A H    2  
ATOM   2871  H  HA2  . GLY A 1 98 ? 13.003  18.588  47.945  1.00 0.00 ? 519 GLY A HA2  2  
ATOM   2872  H  HA3  . GLY A 1 98 ? 14.393  18.637  46.871  1.00 0.00 ? 519 GLY A HA3  2  
HETATM 2873  ZN ZN   . ZN  B 2 .  ? -0.672  -7.696  -10.835 1.00 0.00 ? 622 ZN  A ZN   2  
HETATM 2874  ZN ZN   . ZN  C 2 .  ? -0.628  -3.444  5.430   1.00 0.00 ? 822 ZN  A ZN   2  
ATOM   2875  N  N    . GLY A 1 1  ? 37.553  0.151   -5.825  1.00 0.00 ? 422 GLY A N    3  
ATOM   2876  C  CA   . GLY A 1 1  ? 37.286  -1.261  -6.025  1.00 0.00 ? 422 GLY A CA   3  
ATOM   2877  C  C    . GLY A 1 1  ? 35.913  -1.514  -6.614  1.00 0.00 ? 422 GLY A C    3  
ATOM   2878  O  O    . GLY A 1 1  ? 35.085  -2.192  -6.006  1.00 0.00 ? 422 GLY A O    3  
ATOM   2879  H  H1   . GLY A 1 1  ? 37.922  0.687   -6.558  1.00 0.00 ? 422 GLY A H1   3  
ATOM   2880  H  HA2  . GLY A 1 1  ? 38.033  -1.666  -6.692  1.00 0.00 ? 422 GLY A HA2  3  
ATOM   2881  H  HA3  . GLY A 1 1  ? 37.356  -1.767  -5.073  1.00 0.00 ? 422 GLY A HA3  3  
ATOM   2882  N  N    . SER A 1 2  ? 35.669  -0.967  -7.801  1.00 0.00 ? 423 SER A N    3  
ATOM   2883  C  CA   . SER A 1 2  ? 34.384  -1.132  -8.470  1.00 0.00 ? 423 SER A CA   3  
ATOM   2884  C  C    . SER A 1 2  ? 33.855  -2.551  -8.286  1.00 0.00 ? 423 SER A C    3  
ATOM   2885  O  O    . SER A 1 2  ? 34.474  -3.519  -8.729  1.00 0.00 ? 423 SER A O    3  
ATOM   2886  C  CB   . SER A 1 2  ? 34.517  -0.814  -9.960  1.00 0.00 ? 423 SER A CB   3  
ATOM   2887  O  OG   . SER A 1 2  ? 34.594  0.584   -10.178 1.00 0.00 ? 423 SER A OG   3  
ATOM   2888  H  H    . SER A 1 2  ? 36.370  -0.437  -8.235  1.00 0.00 ? 423 SER A H    3  
ATOM   2889  H  HA   . SER A 1 2  ? 33.686  -0.440  -8.023  1.00 0.00 ? 423 SER A HA   3  
ATOM   2890  H  HB2  . SER A 1 2  ? 35.412  -1.276  -10.346 1.00 0.00 ? 423 SER A HB2  3  
ATOM   2891  H  HB3  . SER A 1 2  ? 33.656  -1.202  -10.486 1.00 0.00 ? 423 SER A HB3  3  
ATOM   2892  H  HG   . SER A 1 2  ? 35.354  0.781   -10.730 1.00 0.00 ? 423 SER A HG   3  
ATOM   2893  N  N    . SER A 1 3  ? 32.705  -2.667  -7.630  1.00 0.00 ? 424 SER A N    3  
ATOM   2894  C  CA   . SER A 1 3  ? 32.093  -3.968  -7.383  1.00 0.00 ? 424 SER A CA   3  
ATOM   2895  C  C    . SER A 1 3  ? 30.574  -3.848  -7.312  1.00 0.00 ? 424 SER A C    3  
ATOM   2896  O  O    . SER A 1 3  ? 30.031  -2.750  -7.200  1.00 0.00 ? 424 SER A O    3  
ATOM   2897  C  CB   . SER A 1 3  ? 32.630  -4.570  -6.083  1.00 0.00 ? 424 SER A CB   3  
ATOM   2898  O  OG   . SER A 1 3  ? 32.509  -3.654  -5.009  1.00 0.00 ? 424 SER A OG   3  
ATOM   2899  H  H    . SER A 1 3  ? 32.259  -1.858  -7.301  1.00 0.00 ? 424 SER A H    3  
ATOM   2900  H  HA   . SER A 1 3  ? 32.353  -4.618  -8.205  1.00 0.00 ? 424 SER A HA   3  
ATOM   2901  H  HB2  . SER A 1 3  ? 32.071  -5.462  -5.845  1.00 0.00 ? 424 SER A HB2  3  
ATOM   2902  H  HB3  . SER A 1 3  ? 33.673  -4.821  -6.210  1.00 0.00 ? 424 SER A HB3  3  
ATOM   2903  H  HG   . SER A 1 3  ? 32.746  -4.090  -4.187  1.00 0.00 ? 424 SER A HG   3  
ATOM   2904  N  N    . GLY A 1 4  ? 29.893  -4.988  -7.378  1.00 0.00 ? 425 GLY A N    3  
ATOM   2905  C  CA   . GLY A 1 4  ? 28.443  -4.991  -7.319  1.00 0.00 ? 425 GLY A CA   3  
ATOM   2906  C  C    . GLY A 1 4  ? 27.825  -5.974  -8.294  1.00 0.00 ? 425 GLY A C    3  
ATOM   2907  O  O    . GLY A 1 4  ? 27.648  -5.663  -9.472  1.00 0.00 ? 425 GLY A O    3  
ATOM   2908  H  H    . GLY A 1 4  ? 30.379  -5.835  -7.466  1.00 0.00 ? 425 GLY A H    3  
ATOM   2909  H  HA2  . GLY A 1 4  ? 28.134  -5.251  -6.318  1.00 0.00 ? 425 GLY A HA2  3  
ATOM   2910  H  HA3  . GLY A 1 4  ? 28.083  -3.999  -7.550  1.00 0.00 ? 425 GLY A HA3  3  
ATOM   2911  N  N    . SER A 1 5  ? 27.498  -7.165  -7.803  1.00 0.00 ? 426 SER A N    3  
ATOM   2912  C  CA   . SER A 1 5  ? 26.902  -8.200  -8.641  1.00 0.00 ? 426 SER A CA   3  
ATOM   2913  C  C    . SER A 1 5  ? 25.597  -7.710  -9.262  1.00 0.00 ? 426 SER A C    3  
ATOM   2914  O  O    . SER A 1 5  ? 24.936  -6.822  -8.725  1.00 0.00 ? 426 SER A O    3  
ATOM   2915  C  CB   . SER A 1 5  ? 26.646  -9.465  -7.820  1.00 0.00 ? 426 SER A CB   3  
ATOM   2916  O  OG   . SER A 1 5  ? 26.029  -10.468 -8.608  1.00 0.00 ? 426 SER A OG   3  
ATOM   2917  H  H    . SER A 1 5  ? 27.665  -7.354  -6.856  1.00 0.00 ? 426 SER A H    3  
ATOM   2918  H  HA   . SER A 1 5  ? 27.600  -8.429  -9.432  1.00 0.00 ? 426 SER A HA   3  
ATOM   2919  H  HB2  . SER A 1 5  ? 27.585  -9.845  -7.447  1.00 0.00 ? 426 SER A HB2  3  
ATOM   2920  H  HB3  . SER A 1 5  ? 25.998  -9.227  -6.989  1.00 0.00 ? 426 SER A HB3  3  
ATOM   2921  H  HG   . SER A 1 5  ? 25.712  -11.173 -8.039  1.00 0.00 ? 426 SER A HG   3  
ATOM   2922  N  N    . SER A 1 6  ? 25.233  -8.298  -10.398 1.00 0.00 ? 427 SER A N    3  
ATOM   2923  C  CA   . SER A 1 6  ? 24.010  -7.920  -11.096 1.00 0.00 ? 427 SER A CA   3  
ATOM   2924  C  C    . SER A 1 6  ? 23.525  -9.053  -11.994 1.00 0.00 ? 427 SER A C    3  
ATOM   2925  O  O    . SER A 1 6  ? 24.324  -9.808  -12.546 1.00 0.00 ? 427 SER A O    3  
ATOM   2926  C  CB   . SER A 1 6  ? 24.242  -6.657  -11.928 1.00 0.00 ? 427 SER A CB   3  
ATOM   2927  O  OG   . SER A 1 6  ? 24.286  -5.505  -11.105 1.00 0.00 ? 427 SER A OG   3  
ATOM   2928  H  H    . SER A 1 6  ? 25.803  -9.000  -10.776 1.00 0.00 ? 427 SER A H    3  
ATOM   2929  H  HA   . SER A 1 6  ? 23.254  -7.717  -10.352 1.00 0.00 ? 427 SER A HA   3  
ATOM   2930  H  HB2  . SER A 1 6  ? 25.180  -6.744  -12.455 1.00 0.00 ? 427 SER A HB2  3  
ATOM   2931  H  HB3  . SER A 1 6  ? 23.437  -6.547  -12.640 1.00 0.00 ? 427 SER A HB3  3  
ATOM   2932  H  HG   . SER A 1 6  ? 24.880  -5.660  -10.368 1.00 0.00 ? 427 SER A HG   3  
ATOM   2933  N  N    . GLY A 1 7  ? 22.208  -9.166  -12.136 1.00 0.00 ? 428 GLY A N    3  
ATOM   2934  C  CA   . GLY A 1 7  ? 21.638  -10.209 -12.968 1.00 0.00 ? 428 GLY A CA   3  
ATOM   2935  C  C    . GLY A 1 7  ? 20.175  -9.965  -13.283 1.00 0.00 ? 428 GLY A C    3  
ATOM   2936  O  O    . GLY A 1 7  ? 19.373  -9.718  -12.383 1.00 0.00 ? 428 GLY A O    3  
ATOM   2937  H  H    . GLY A 1 7  ? 21.618  -8.535  -11.671 1.00 0.00 ? 428 GLY A H    3  
ATOM   2938  H  HA2  . GLY A 1 7  ? 22.191  -10.260 -13.893 1.00 0.00 ? 428 GLY A HA2  3  
ATOM   2939  H  HA3  . GLY A 1 7  ? 21.730  -11.155 -12.453 1.00 0.00 ? 428 GLY A HA3  3  
ATOM   2940  N  N    . GLU A 1 8  ? 19.829  -10.032 -14.565 1.00 0.00 ? 429 GLU A N    3  
ATOM   2941  C  CA   . GLU A 1 8  ? 18.453  -9.814  -14.996 1.00 0.00 ? 429 GLU A CA   3  
ATOM   2942  C  C    . GLU A 1 8  ? 17.659  -11.116 -14.962 1.00 0.00 ? 429 GLU A C    3  
ATOM   2943  O  O    . GLU A 1 8  ? 18.197  -12.192 -15.230 1.00 0.00 ? 429 GLU A O    3  
ATOM   2944  C  CB   . GLU A 1 8  ? 18.425  -9.222  -16.407 1.00 0.00 ? 429 GLU A CB   3  
ATOM   2945  C  CG   . GLU A 1 8  ? 18.625  -7.717  -16.440 1.00 0.00 ? 429 GLU A CG   3  
ATOM   2946  C  CD   . GLU A 1 8  ? 17.918  -7.059  -17.609 1.00 0.00 ? 429 GLU A CD   3  
ATOM   2947  O  OE1  . GLU A 1 8  ? 16.669  -7.060  -17.623 1.00 0.00 ? 429 GLU A OE1  3  
ATOM   2948  O  OE2  . GLU A 1 8  ? 18.613  -6.545  -18.510 1.00 0.00 ? 429 GLU A OE2  3  
ATOM   2949  H  H    . GLU A 1 8  ? 20.514  -10.233 -15.236 1.00 0.00 ? 429 GLU A H    3  
ATOM   2950  H  HA   . GLU A 1 8  ? 17.999  -9.112  -14.312 1.00 0.00 ? 429 GLU A HA   3  
ATOM   2951  H  HB2  . GLU A 1 8  ? 19.207  -9.682  -16.992 1.00 0.00 ? 429 GLU A HB2  3  
ATOM   2952  H  HB3  . GLU A 1 8  ? 17.470  -9.447  -16.858 1.00 0.00 ? 429 GLU A HB3  3  
ATOM   2953  H  HG2  . GLU A 1 8  ? 18.241  -7.295  -15.523 1.00 0.00 ? 429 GLU A HG2  3  
ATOM   2954  H  HG3  . GLU A 1 8  ? 19.683  -7.509  -16.514 1.00 0.00 ? 429 GLU A HG3  3  
ATOM   2955  N  N    . LEU A 1 9  ? 16.376  -11.012 -14.632 1.00 0.00 ? 430 LEU A N    3  
ATOM   2956  C  CA   . LEU A 1 9  ? 15.507  -12.181 -14.562 1.00 0.00 ? 430 LEU A CA   3  
ATOM   2957  C  C    . LEU A 1 9  ? 14.150  -11.889 -15.195 1.00 0.00 ? 430 LEU A C    3  
ATOM   2958  O  O    . LEU A 1 9  ? 13.677  -10.752 -15.212 1.00 0.00 ? 430 LEU A O    3  
ATOM   2959  C  CB   . LEU A 1 9  ? 15.320  -12.617 -13.108 1.00 0.00 ? 430 LEU A CB   3  
ATOM   2960  C  CG   . LEU A 1 9  ? 16.578  -13.099 -12.385 1.00 0.00 ? 430 LEU A CG   3  
ATOM   2961  C  CD1  . LEU A 1 9  ? 16.490  -12.794 -10.898 1.00 0.00 ? 430 LEU A CD1  3  
ATOM   2962  C  CD2  . LEU A 1 9  ? 16.786  -14.589 -12.614 1.00 0.00 ? 430 LEU A CD2  3  
ATOM   2963  H  H    . LEU A 1 9  ? 16.005  -10.129 -14.429 1.00 0.00 ? 430 LEU A H    3  
ATOM   2964  H  HA   . LEU A 1 9  ? 15.982  -12.981 -15.111 1.00 0.00 ? 430 LEU A HA   3  
ATOM   2965  H  HB2  . LEU A 1 9  ? 14.926  -11.776 -12.559 1.00 0.00 ? 430 LEU A HB2  3  
ATOM   2966  H  HB3  . LEU A 1 9  ? 14.600  -13.423 -13.095 1.00 0.00 ? 430 LEU A HB3  3  
ATOM   2967  H  HG   . LEU A 1 9  ? 17.437  -12.576 -12.782 1.00 0.00 ? 430 LEU A HG   3  
ATOM   2968  H  HD11 . LEU A 1 9  ? 17.433  -13.025 -10.426 1.00 0.00 ? 430 LEU A HD11 3  
ATOM   2969  H  HD12 . LEU A 1 9  ? 15.708  -13.392 -10.453 1.00 0.00 ? 430 LEU A HD12 3  
ATOM   2970  H  HD13 . LEU A 1 9  ? 16.265  -11.746 -10.759 1.00 0.00 ? 430 LEU A HD13 3  
ATOM   2971  H  HD21 . LEU A 1 9  ? 16.266  -15.146 -11.848 1.00 0.00 ? 430 LEU A HD21 3  
ATOM   2972  H  HD22 . LEU A 1 9  ? 17.842  -14.816 -12.569 1.00 0.00 ? 430 LEU A HD22 3  
ATOM   2973  H  HD23 . LEU A 1 9  ? 16.399  -14.862 -13.584 1.00 0.00 ? 430 LEU A HD23 3  
ATOM   2974  N  N    . PRO A 1 10 ? 13.507  -12.939 -15.728 1.00 0.00 ? 431 PRO A N    3  
ATOM   2975  C  CA   . PRO A 1 10 ? 12.194  -12.820 -16.370 1.00 0.00 ? 431 PRO A CA   3  
ATOM   2976  C  C    . PRO A 1 10 ? 11.084  -12.524 -15.367 1.00 0.00 ? 431 PRO A C    3  
ATOM   2977  O  O    . PRO A 1 10 ? 9.925   -12.347 -15.743 1.00 0.00 ? 431 PRO A O    3  
ATOM   2978  C  CB   . PRO A 1 10 ? 11.986  -14.196 -17.007 1.00 0.00 ? 431 PRO A CB   3  
ATOM   2979  C  CG   . PRO A 1 10 ? 12.819  -15.122 -16.190 1.00 0.00 ? 431 PRO A CG   3  
ATOM   2980  C  CD   . PRO A 1 10 ? 14.011  -14.322 -15.744 1.00 0.00 ? 431 PRO A CD   3  
ATOM   2981  H  HA   . PRO A 1 10 ? 12.195  -12.062 -17.139 1.00 0.00 ? 431 PRO A HA   3  
ATOM   2982  H  HB2  . PRO A 1 10 ? 10.939  -14.462 -16.962 1.00 0.00 ? 431 PRO A HB2  3  
ATOM   2983  H  HB3  . PRO A 1 10 ? 12.313  -14.174 -18.035 1.00 0.00 ? 431 PRO A HB3  3  
ATOM   2984  H  HG2  . PRO A 1 10 ? 12.257  -15.466 -15.335 1.00 0.00 ? 431 PRO A HG2  3  
ATOM   2985  H  HG3  . PRO A 1 10 ? 13.135  -15.960 -16.794 1.00 0.00 ? 431 PRO A HG3  3  
ATOM   2986  H  HD2  . PRO A 1 10 ? 14.325  -14.630 -14.757 1.00 0.00 ? 431 PRO A HD2  3  
ATOM   2987  H  HD3  . PRO A 1 10 ? 14.822  -14.428 -16.450 1.00 0.00 ? 431 PRO A HD3  3  
ATOM   2988  N  N    . LYS A 1 11 ? 11.445  -12.469 -14.090 1.00 0.00 ? 432 LYS A N    3  
ATOM   2989  C  CA   . LYS A 1 11 ? 10.480  -12.192 -13.033 1.00 0.00 ? 432 LYS A CA   3  
ATOM   2990  C  C    . LYS A 1 11 ? 10.732  -10.821 -12.412 1.00 0.00 ? 432 LYS A C    3  
ATOM   2991  O  O    . LYS A 1 11 ? 11.834  -10.281 -12.501 1.00 0.00 ? 432 LYS A O    3  
ATOM   2992  C  CB   . LYS A 1 11 ? 10.551  -13.274 -11.952 1.00 0.00 ? 432 LYS A CB   3  
ATOM   2993  C  CG   . LYS A 1 11 ? 9.746   -14.518 -12.283 1.00 0.00 ? 432 LYS A CG   3  
ATOM   2994  C  CD   . LYS A 1 11 ? 8.261   -14.300 -12.048 1.00 0.00 ? 432 LYS A CD   3  
ATOM   2995  C  CE   . LYS A 1 11 ? 7.430   -15.417 -12.659 1.00 0.00 ? 432 LYS A CE   3  
ATOM   2996  N  NZ   . LYS A 1 11 ? 7.373   -15.317 -14.144 1.00 0.00 ? 432 LYS A NZ   3  
ATOM   2997  H  H    . LYS A 1 11 ? 12.385  -12.619 -13.852 1.00 0.00 ? 432 LYS A H    3  
ATOM   2998  H  HA   . LYS A 1 11 ? 9.494   -12.199 -13.473 1.00 0.00 ? 432 LYS A HA   3  
ATOM   2999  H  HB2  . LYS A 1 11 ? 11.583  -13.563 -11.817 1.00 0.00 ? 432 LYS A HB2  3  
ATOM   3000  H  HB3  . LYS A 1 11 ? 10.177  -12.864 -11.025 1.00 0.00 ? 432 LYS A HB3  3  
ATOM   3001  H  HG2  . LYS A 1 11 ? 9.902   -14.771 -13.321 1.00 0.00 ? 432 LYS A HG2  3  
ATOM   3002  H  HG3  . LYS A 1 11 ? 10.085  -15.332 -11.657 1.00 0.00 ? 432 LYS A HG3  3  
ATOM   3003  H  HD2  . LYS A 1 11 ? 8.074   -14.268 -10.985 1.00 0.00 ? 432 LYS A HD2  3  
ATOM   3004  H  HD3  . LYS A 1 11 ? 7.969   -13.360 -12.495 1.00 0.00 ? 432 LYS A HD3  3  
ATOM   3005  H  HE2  . LYS A 1 11 ? 7.869   -16.365 -12.388 1.00 0.00 ? 432 LYS A HE2  3  
ATOM   3006  H  HE3  . LYS A 1 11 ? 6.426   -15.359 -12.264 1.00 0.00 ? 432 LYS A HE3  3  
ATOM   3007  H  HZ1  . LYS A 1 11 ? 7.425   -14.321 -14.437 1.00 0.00 ? 432 LYS A HZ1  3  
ATOM   3008  H  HZ2  . LYS A 1 11 ? 6.483   -15.724 -14.496 1.00 0.00 ? 432 LYS A HZ2  3  
ATOM   3009  H  HZ3  . LYS A 1 11 ? 8.169   -15.835 -14.568 1.00 0.00 ? 432 LYS A HZ3  3  
ATOM   3010  N  N    . LYS A 1 12 ? 9.703   -10.264 -11.782 1.00 0.00 ? 433 LYS A N    3  
ATOM   3011  C  CA   . LYS A 1 12 ? 9.812   -8.958  -11.144 1.00 0.00 ? 433 LYS A CA   3  
ATOM   3012  C  C    . LYS A 1 12 ? 9.262   -8.999  -9.722  1.00 0.00 ? 433 LYS A C    3  
ATOM   3013  O  O    . LYS A 1 12 ? 8.163   -9.502  -9.486  1.00 0.00 ? 433 LYS A O    3  
ATOM   3014  C  CB   . LYS A 1 12 ? 9.063   -7.904  -11.962 1.00 0.00 ? 433 LYS A CB   3  
ATOM   3015  C  CG   . LYS A 1 12 ? 9.721   -7.587  -13.294 1.00 0.00 ? 433 LYS A CG   3  
ATOM   3016  C  CD   . LYS A 1 12 ? 9.401   -6.173  -13.751 1.00 0.00 ? 433 LYS A CD   3  
ATOM   3017  C  CE   . LYS A 1 12 ? 9.493   -6.043  -15.264 1.00 0.00 ? 433 LYS A CE   3  
ATOM   3018  N  NZ   . LYS A 1 12 ? 10.902  -5.897  -15.723 1.00 0.00 ? 433 LYS A NZ   3  
ATOM   3019  H  H    . LYS A 1 12 ? 8.849   -10.745 -11.745 1.00 0.00 ? 433 LYS A H    3  
ATOM   3020  H  HA   . LYS A 1 12 ? 10.858  -8.694  -11.105 1.00 0.00 ? 433 LYS A HA   3  
ATOM   3021  H  HB2  . LYS A 1 12 ? 8.061   -8.259  -12.154 1.00 0.00 ? 433 LYS A HB2  3  
ATOM   3022  H  HB3  . LYS A 1 12 ? 9.007   -6.991  -11.385 1.00 0.00 ? 433 LYS A HB3  3  
ATOM   3023  H  HG2  . LYS A 1 12 ? 10.791  -7.686  -13.189 1.00 0.00 ? 433 LYS A HG2  3  
ATOM   3024  H  HG3  . LYS A 1 12 ? 9.363   -8.285  -14.037 1.00 0.00 ? 433 LYS A HG3  3  
ATOM   3025  H  HD2  . LYS A 1 12 ? 8.397   -5.922  -13.441 1.00 0.00 ? 433 LYS A HD2  3  
ATOM   3026  H  HD3  . LYS A 1 12 ? 10.102  -5.489  -13.296 1.00 0.00 ? 433 LYS A HD3  3  
ATOM   3027  H  HE2  . LYS A 1 12 ? 9.066   -6.925  -15.715 1.00 0.00 ? 433 LYS A HE2  3  
ATOM   3028  H  HE3  . LYS A 1 12 ? 8.932   -5.173  -15.572 1.00 0.00 ? 433 LYS A HE3  3  
ATOM   3029  H  HZ1  . LYS A 1 12 ? 11.324  -5.038  -15.315 1.00 0.00 ? 433 LYS A HZ1  3  
ATOM   3030  H  HZ2  . LYS A 1 12 ? 10.935  -5.827  -16.759 1.00 0.00 ? 433 LYS A HZ2  3  
ATOM   3031  H  HZ3  . LYS A 1 12 ? 11.463  -6.721  -15.424 1.00 0.00 ? 433 LYS A HZ3  3  
ATOM   3032  N  N    . ARG A 1 13 ? 10.032  -8.467  -8.779  1.00 0.00 ? 434 ARG A N    3  
ATOM   3033  C  CA   . ARG A 1 13 ? 9.620   -8.443  -7.380  1.00 0.00 ? 434 ARG A CA   3  
ATOM   3034  C  C    . ARG A 1 13 ? 9.192   -7.039  -6.963  1.00 0.00 ? 434 ARG A C    3  
ATOM   3035  O  O    . ARG A 1 13 ? 9.568   -6.557  -5.895  1.00 0.00 ? 434 ARG A O    3  
ATOM   3036  C  CB   . ARG A 1 13 ? 10.760  -8.928  -6.483  1.00 0.00 ? 434 ARG A CB   3  
ATOM   3037  C  CG   . ARG A 1 13 ? 10.756  -10.430 -6.250  1.00 0.00 ? 434 ARG A CG   3  
ATOM   3038  C  CD   . ARG A 1 13 ? 11.500  -11.166 -7.353  1.00 0.00 ? 434 ARG A CD   3  
ATOM   3039  N  NE   . ARG A 1 13 ? 11.766  -12.558 -6.999  1.00 0.00 ? 434 ARG A NE   3  
ATOM   3040  C  CZ   . ARG A 1 13 ? 12.768  -13.267 -7.508  1.00 0.00 ? 434 ARG A CZ   3  
ATOM   3041  N  NH1  . ARG A 1 13 ? 13.593  -12.718 -8.388  1.00 0.00 ? 434 ARG A NH1  3  
ATOM   3042  N  NH2  . ARG A 1 13 ? 12.945  -14.528 -7.136  1.00 0.00 ? 434 ARG A NH2  3  
ATOM   3043  H  H    . ARG A 1 13 ? 10.897  -8.081  -9.029  1.00 0.00 ? 434 ARG A H    3  
ATOM   3044  H  HA   . ARG A 1 13 ? 8.779   -9.110  -7.270  1.00 0.00 ? 434 ARG A HA   3  
ATOM   3045  H  HB2  . ARG A 1 13 ? 11.702  -8.659  -6.939  1.00 0.00 ? 434 ARG A HB2  3  
ATOM   3046  H  HB3  . ARG A 1 13 ? 10.681  -8.437  -5.524  1.00 0.00 ? 434 ARG A HB3  3  
ATOM   3047  H  HG2  . ARG A 1 13 ? 11.235  -10.640 -5.306  1.00 0.00 ? 434 ARG A HG2  3  
ATOM   3048  H  HG3  . ARG A 1 13 ? 9.734   -10.777 -6.223  1.00 0.00 ? 434 ARG A HG3  3  
ATOM   3049  H  HD2  . ARG A 1 13 ? 10.902  -11.142 -8.252  1.00 0.00 ? 434 ARG A HD2  3  
ATOM   3050  H  HD3  . ARG A 1 13 ? 12.439  -10.664 -7.532  1.00 0.00 ? 434 ARG A HD3  3  
ATOM   3051  H  HE   . ARG A 1 13 ? 11.168  -12.983 -6.350  1.00 0.00 ? 434 ARG A HE   3  
ATOM   3052  H  HH11 . ARG A 1 13 ? 13.463  -11.767 -8.669  1.00 0.00 ? 434 ARG A HH11 3  
ATOM   3053  H  HH12 . ARG A 1 13 ? 14.347  -13.254 -8.769  1.00 0.00 ? 434 ARG A HH12 3  
ATOM   3054  H  HH21 . ARG A 1 13 ? 12.325  -14.946 -6.473  1.00 0.00 ? 434 ARG A HH21 3  
ATOM   3055  H  HH22 . ARG A 1 13 ? 13.698  -15.061 -7.520  1.00 0.00 ? 434 ARG A HH22 3  
ATOM   3056  N  N    . GLU A 1 14 ? 8.405   -6.388  -7.814  1.00 0.00 ? 435 GLU A N    3  
ATOM   3057  C  CA   . GLU A 1 14 ? 7.927   -5.039  -7.534  1.00 0.00 ? 435 GLU A CA   3  
ATOM   3058  C  C    . GLU A 1 14 ? 6.415   -5.028  -7.335  1.00 0.00 ? 435 GLU A C    3  
ATOM   3059  O  O    . GLU A 1 14 ? 5.699   -5.869  -7.880  1.00 0.00 ? 435 GLU A O    3  
ATOM   3060  C  CB   . GLU A 1 14 ? 8.310   -4.092  -8.673  1.00 0.00 ? 435 GLU A CB   3  
ATOM   3061  C  CG   . GLU A 1 14 ? 9.803   -4.046  -8.951  1.00 0.00 ? 435 GLU A CG   3  
ATOM   3062  C  CD   . GLU A 1 14 ? 10.243  -2.729  -9.560  1.00 0.00 ? 435 GLU A CD   3  
ATOM   3063  O  OE1  . GLU A 1 14 ? 9.562   -1.709  -9.325  1.00 0.00 ? 435 GLU A OE1  3  
ATOM   3064  O  OE2  . GLU A 1 14 ? 11.269  -2.719  -10.272 1.00 0.00 ? 435 GLU A OE2  3  
ATOM   3065  H  H    . GLU A 1 14 ? 8.139   -6.826  -8.650  1.00 0.00 ? 435 GLU A H    3  
ATOM   3066  H  HA   . GLU A 1 14 ? 8.401   -4.703  -6.624  1.00 0.00 ? 435 GLU A HA   3  
ATOM   3067  H  HB2  . GLU A 1 14 ? 7.806   -4.410  -9.574  1.00 0.00 ? 435 GLU A HB2  3  
ATOM   3068  H  HB3  . GLU A 1 14 ? 7.981   -3.095  -8.421  1.00 0.00 ? 435 GLU A HB3  3  
ATOM   3069  H  HG2  . GLU A 1 14 ? 10.334  -4.190  -8.022  1.00 0.00 ? 435 GLU A HG2  3  
ATOM   3070  H  HG3  . GLU A 1 14 ? 10.054  -4.844  -9.634  1.00 0.00 ? 435 GLU A HG3  3  
ATOM   3071  N  N    . LEU A 1 15 ? 5.935   -4.070  -6.549  1.00 0.00 ? 436 LEU A N    3  
ATOM   3072  C  CA   . LEU A 1 15 ? 4.507   -3.948  -6.277  1.00 0.00 ? 436 LEU A CA   3  
ATOM   3073  C  C    . LEU A 1 15 ? 3.731   -3.651  -7.556  1.00 0.00 ? 436 LEU A C    3  
ATOM   3074  O  O    . LEU A 1 15 ? 3.895   -2.591  -8.162  1.00 0.00 ? 436 LEU A O    3  
ATOM   3075  C  CB   . LEU A 1 15 ? 4.256   -2.845  -5.247  1.00 0.00 ? 436 LEU A CB   3  
ATOM   3076  C  CG   . LEU A 1 15 ? 2.814   -2.694  -4.762  1.00 0.00 ? 436 LEU A CG   3  
ATOM   3077  C  CD1  . LEU A 1 15 ? 2.398   -3.905  -3.941  1.00 0.00 ? 436 LEU A CD1  3  
ATOM   3078  C  CD2  . LEU A 1 15 ? 2.655   -1.417  -3.951  1.00 0.00 ? 436 LEU A CD2  3  
ATOM   3079  H  H    . LEU A 1 15 ? 6.554   -3.429  -6.143  1.00 0.00 ? 436 LEU A H    3  
ATOM   3080  H  HA   . LEU A 1 15 ? 4.165   -4.890  -5.874  1.00 0.00 ? 436 LEU A HA   3  
ATOM   3081  H  HB2  . LEU A 1 15 ? 4.875   -3.050  -4.386  1.00 0.00 ? 436 LEU A HB2  3  
ATOM   3082  H  HB3  . LEU A 1 15 ? 4.558   -1.906  -5.689  1.00 0.00 ? 436 LEU A HB3  3  
ATOM   3083  H  HG   . LEU A 1 15 ? 2.158   -2.631  -5.619  1.00 0.00 ? 436 LEU A HG   3  
ATOM   3084  H  HD11 . LEU A 1 15 ? 3.115   -4.068  -3.151  1.00 0.00 ? 436 LEU A HD11 3  
ATOM   3085  H  HD12 . LEU A 1 15 ? 2.359   -4.776  -4.578  1.00 0.00 ? 436 LEU A HD12 3  
ATOM   3086  H  HD13 . LEU A 1 15 ? 1.422   -3.729  -3.511  1.00 0.00 ? 436 LEU A HD13 3  
ATOM   3087  H  HD21 . LEU A 1 15 ? 2.011   -1.606  -3.105  1.00 0.00 ? 436 LEU A HD21 3  
ATOM   3088  H  HD22 . LEU A 1 15 ? 2.218   -0.648  -4.572  1.00 0.00 ? 436 LEU A HD22 3  
ATOM   3089  H  HD23 . LEU A 1 15 ? 3.623   -1.090  -3.600  1.00 0.00 ? 436 LEU A HD23 3  
ATOM   3090  N  N    . CYS A 1 16 ? 2.885   -4.592  -7.961  1.00 0.00 ? 437 CYS A N    3  
ATOM   3091  C  CA   . CYS A 1 16 ? 2.082   -4.431  -9.167  1.00 0.00 ? 437 CYS A CA   3  
ATOM   3092  C  C    . CYS A 1 16 ? 1.162   -3.219  -9.051  1.00 0.00 ? 437 CYS A C    3  
ATOM   3093  O  O    . CYS A 1 16 ? 0.476   -3.040  -8.044  1.00 0.00 ? 437 CYS A O    3  
ATOM   3094  C  CB   . CYS A 1 16 ? 1.254   -5.691  -9.426  1.00 0.00 ? 437 CYS A CB   3  
ATOM   3095  S  SG   . CYS A 1 16 ? 0.611   -5.822  -11.125 1.00 0.00 ? 437 CYS A SG   3  
ATOM   3096  H  H    . CYS A 1 16 ? 2.798   -5.415  -7.436  1.00 0.00 ? 437 CYS A H    3  
ATOM   3097  H  HA   . CYS A 1 16 ? 2.756   -4.277  -9.997  1.00 0.00 ? 437 CYS A HA   3  
ATOM   3098  H  HB2  . CYS A 1 16 ? 1.867   -6.560  -9.239  1.00 0.00 ? 437 CYS A HB2  3  
ATOM   3099  H  HB3  . CYS A 1 16 ? 0.409   -5.701  -8.753  1.00 0.00 ? 437 CYS A HB3  3  
ATOM   3100  N  N    . LYS A 1 17 ? 1.153   -2.388  -10.088 1.00 0.00 ? 438 LYS A N    3  
ATOM   3101  C  CA   . LYS A 1 17 ? 0.317   -1.194  -10.105 1.00 0.00 ? 438 LYS A CA   3  
ATOM   3102  C  C    . LYS A 1 17 ? -1.118  -1.539  -10.488 1.00 0.00 ? 438 LYS A C    3  
ATOM   3103  O  O    . LYS A 1 17 ? -1.908  -0.660  -10.833 1.00 0.00 ? 438 LYS A O    3  
ATOM   3104  C  CB   . LYS A 1 17 ? 0.884   -0.163  -11.084 1.00 0.00 ? 438 LYS A CB   3  
ATOM   3105  C  CG   . LYS A 1 17 ? 0.882   -0.632  -12.529 1.00 0.00 ? 438 LYS A CG   3  
ATOM   3106  C  CD   . LYS A 1 17 ? 2.253   -1.131  -12.954 1.00 0.00 ? 438 LYS A CD   3  
ATOM   3107  C  CE   . LYS A 1 17 ? 2.159   -2.071  -14.146 1.00 0.00 ? 438 LYS A CE   3  
ATOM   3108  N  NZ   . LYS A 1 17 ? 3.363   -2.939  -14.264 1.00 0.00 ? 438 LYS A NZ   3  
ATOM   3109  H  H    . LYS A 1 17 ? 1.722   -2.584  -10.862 1.00 0.00 ? 438 LYS A H    3  
ATOM   3110  H  HA   . LYS A 1 17 ? 0.320   -0.773  -9.111  1.00 0.00 ? 438 LYS A HA   3  
ATOM   3111  H  HB2  . LYS A 1 17 ? 0.294   0.739   -11.019 1.00 0.00 ? 438 LYS A HB2  3  
ATOM   3112  H  HB3  . LYS A 1 17 ? 1.902   0.062   -10.801 1.00 0.00 ? 438 LYS A HB3  3  
ATOM   3113  H  HG2  . LYS A 1 17 ? 0.170   -1.436  -12.636 1.00 0.00 ? 438 LYS A HG2  3  
ATOM   3114  H  HG3  . LYS A 1 17 ? 0.596   0.193   -13.165 1.00 0.00 ? 438 LYS A HG3  3  
ATOM   3115  H  HD2  . LYS A 1 17 ? 2.867   -0.284  -13.226 1.00 0.00 ? 438 LYS A HD2  3  
ATOM   3116  H  HD3  . LYS A 1 17 ? 2.708   -1.656  -12.126 1.00 0.00 ? 438 LYS A HD3  3  
ATOM   3117  H  HE2  . LYS A 1 17 ? 1.286   -2.695  -14.028 1.00 0.00 ? 438 LYS A HE2  3  
ATOM   3118  H  HE3  . LYS A 1 17 ? 2.061   -1.482  -15.046 1.00 0.00 ? 438 LYS A HE3  3  
ATOM   3119  H  HZ1  . LYS A 1 17 ? 4.128   -2.573  -13.661 1.00 0.00 ? 438 LYS A HZ1  3  
ATOM   3120  H  HZ2  . LYS A 1 17 ? 3.694   -2.960  -15.249 1.00 0.00 ? 438 LYS A HZ2  3  
ATOM   3121  H  HZ3  . LYS A 1 17 ? 3.135   -3.909  -13.966 1.00 0.00 ? 438 LYS A HZ3  3  
ATOM   3122  N  N    . PHE A 1 18 ? -1.450  -2.825  -10.425 1.00 0.00 ? 439 PHE A N    3  
ATOM   3123  C  CA   . PHE A 1 18 ? -2.791  -3.286  -10.765 1.00 0.00 ? 439 PHE A CA   3  
ATOM   3124  C  C    . PHE A 1 18 ? -3.441  -3.990  -9.578  1.00 0.00 ? 439 PHE A C    3  
ATOM   3125  O  O    . PHE A 1 18 ? -4.645  -3.862  -9.350  1.00 0.00 ? 439 PHE A O    3  
ATOM   3126  C  CB   . PHE A 1 18 ? -2.738  -4.232  -11.967 1.00 0.00 ? 439 PHE A CB   3  
ATOM   3127  C  CG   . PHE A 1 18 ? -2.614  -3.521  -13.284 1.00 0.00 ? 439 PHE A CG   3  
ATOM   3128  C  CD1  . PHE A 1 18 ? -3.622  -2.680  -13.730 1.00 0.00 ? 439 PHE A CD1  3  
ATOM   3129  C  CD2  . PHE A 1 18 ? -1.491  -3.693  -14.077 1.00 0.00 ? 439 PHE A CD2  3  
ATOM   3130  C  CE1  . PHE A 1 18 ? -3.511  -2.024  -14.942 1.00 0.00 ? 439 PHE A CE1  3  
ATOM   3131  C  CE2  . PHE A 1 18 ? -1.374  -3.039  -15.289 1.00 0.00 ? 439 PHE A CE2  3  
ATOM   3132  C  CZ   . PHE A 1 18 ? -2.386  -2.205  -15.722 1.00 0.00 ? 439 PHE A CZ   3  
ATOM   3133  H  H    . PHE A 1 18 ? -0.776  -3.479  -10.143 1.00 0.00 ? 439 PHE A H    3  
ATOM   3134  H  HA   . PHE A 1 18 ? -3.382  -2.421  -11.024 1.00 0.00 ? 439 PHE A HA   3  
ATOM   3135  H  HB2  . PHE A 1 18 ? -1.886  -4.887  -11.863 1.00 0.00 ? 439 PHE A HB2  3  
ATOM   3136  H  HB3  . PHE A 1 18 ? -3.641  -4.822  -11.991 1.00 0.00 ? 439 PHE A HB3  3  
ATOM   3137  H  HD1  . PHE A 1 18 ? -4.503  -2.539  -13.120 1.00 0.00 ? 439 PHE A HD1  3  
ATOM   3138  H  HD2  . PHE A 1 18 ? -0.699  -4.346  -13.740 1.00 0.00 ? 439 PHE A HD2  3  
ATOM   3139  H  HE1  . PHE A 1 18 ? -4.304  -1.373  -15.278 1.00 0.00 ? 439 PHE A HE1  3  
ATOM   3140  H  HE2  . PHE A 1 18 ? -0.494  -3.182  -15.898 1.00 0.00 ? 439 PHE A HE2  3  
ATOM   3141  H  HZ   . PHE A 1 18 ? -2.297  -1.693  -16.669 1.00 0.00 ? 439 PHE A HZ   3  
ATOM   3142  N  N    . TYR A 1 19 ? -2.638  -4.733  -8.826  1.00 0.00 ? 440 TYR A N    3  
ATOM   3143  C  CA   . TYR A 1 19 ? -3.134  -5.461  -7.664  1.00 0.00 ? 440 TYR A CA   3  
ATOM   3144  C  C    . TYR A 1 19 ? -3.555  -4.498  -6.558  1.00 0.00 ? 440 TYR A C    3  
ATOM   3145  O  O    . TYR A 1 19 ? -4.525  -4.745  -5.841  1.00 0.00 ? 440 TYR A O    3  
ATOM   3146  C  CB   . TYR A 1 19 ? -2.064  -6.420  -7.140  1.00 0.00 ? 440 TYR A CB   3  
ATOM   3147  C  CG   . TYR A 1 19 ? -2.457  -7.127  -5.863  1.00 0.00 ? 440 TYR A CG   3  
ATOM   3148  C  CD1  . TYR A 1 19 ? -3.620  -7.884  -5.796  1.00 0.00 ? 440 TYR A CD1  3  
ATOM   3149  C  CD2  . TYR A 1 19 ? -1.667  -7.038  -4.725  1.00 0.00 ? 440 TYR A CD2  3  
ATOM   3150  C  CE1  . TYR A 1 19 ? -3.984  -8.532  -4.631  1.00 0.00 ? 440 TYR A CE1  3  
ATOM   3151  C  CE2  . TYR A 1 19 ? -2.022  -7.684  -3.556  1.00 0.00 ? 440 TYR A CE2  3  
ATOM   3152  C  CZ   . TYR A 1 19 ? -3.181  -8.429  -3.514  1.00 0.00 ? 440 TYR A CZ   3  
ATOM   3153  O  OH   . TYR A 1 19 ? -3.540  -9.072  -2.352  1.00 0.00 ? 440 TYR A OH   3  
ATOM   3154  H  H    . TYR A 1 19 ? -1.688  -4.796  -9.058  1.00 0.00 ? 440 TYR A H    3  
ATOM   3155  H  HA   . TYR A 1 19 ? -3.996  -6.033  -7.974  1.00 0.00 ? 440 TYR A HA   3  
ATOM   3156  H  HB2  . TYR A 1 19 ? -1.867  -7.172  -7.889  1.00 0.00 ? 440 TYR A HB2  3  
ATOM   3157  H  HB3  . TYR A 1 19 ? -1.157  -5.865  -6.947  1.00 0.00 ? 440 TYR A HB3  3  
ATOM   3158  H  HD1  . TYR A 1 19 ? -4.247  -7.963  -6.672  1.00 0.00 ? 440 TYR A HD1  3  
ATOM   3159  H  HD2  . TYR A 1 19 ? -0.759  -6.453  -4.761  1.00 0.00 ? 440 TYR A HD2  3  
ATOM   3160  H  HE1  . TYR A 1 19 ? -4.892  -9.116  -4.598  1.00 0.00 ? 440 TYR A HE1  3  
ATOM   3161  H  HE2  . TYR A 1 19 ? -1.394  -7.603  -2.681  1.00 0.00 ? 440 TYR A HE2  3  
ATOM   3162  H  HH   . TYR A 1 19 ? -2.777  -9.531  -1.992  1.00 0.00 ? 440 TYR A HH   3  
ATOM   3163  N  N    . ILE A 1 20 ? -2.819  -3.400  -6.427  1.00 0.00 ? 441 ILE A N    3  
ATOM   3164  C  CA   . ILE A 1 20 ? -3.117  -2.398  -5.410  1.00 0.00 ? 441 ILE A CA   3  
ATOM   3165  C  C    . ILE A 1 20 ? -4.615  -2.124  -5.330  1.00 0.00 ? 441 ILE A C    3  
ATOM   3166  O  O    . ILE A 1 20 ? -5.149  -1.837  -4.258  1.00 0.00 ? 441 ILE A O    3  
ATOM   3167  C  CB   . ILE A 1 20 ? -2.378  -1.076  -5.689  1.00 0.00 ? 441 ILE A CB   3  
ATOM   3168  C  CG1  . ILE A 1 20 ? -0.867  -1.311  -5.736  1.00 0.00 ? 441 ILE A CG1  3  
ATOM   3169  C  CG2  . ILE A 1 20 ? -2.726  -0.041  -4.630  1.00 0.00 ? 441 ILE A CG2  3  
ATOM   3170  C  CD1  . ILE A 1 20 ? -0.090  -0.135  -6.286  1.00 0.00 ? 441 ILE A CD1  3  
ATOM   3171  H  H    . ILE A 1 20 ? -2.059  -3.259  -7.028  1.00 0.00 ? 441 ILE A H    3  
ATOM   3172  H  HA   . ILE A 1 20 ? -2.780  -2.781  -4.457  1.00 0.00 ? 441 ILE A HA   3  
ATOM   3173  H  HB   . ILE A 1 20 ? -2.707  -0.701  -6.647  1.00 0.00 ? 441 ILE A HB   3  
ATOM   3174  H  HG12 . ILE A 1 20 ? -0.508  -1.507  -4.738  1.00 0.00 ? 441 ILE A HG12 3  
ATOM   3175  H  HG13 . ILE A 1 20 ? -0.663  -2.167  -6.362  1.00 0.00 ? 441 ILE A HG13 3  
ATOM   3176  H  HG21 . ILE A 1 20 ? -3.479  -0.443  -3.968  1.00 0.00 ? 441 ILE A HG21 3  
ATOM   3177  H  HG22 . ILE A 1 20 ? -1.842  0.203   -4.061  1.00 0.00 ? 441 ILE A HG22 3  
ATOM   3178  H  HG23 . ILE A 1 20 ? -3.105  0.850   -5.108  1.00 0.00 ? 441 ILE A HG23 3  
ATOM   3179  H  HD11 . ILE A 1 20 ? -0.773  0.573   -6.730  1.00 0.00 ? 441 ILE A HD11 3  
ATOM   3180  H  HD12 . ILE A 1 20 ? 0.456   0.342   -5.486  1.00 0.00 ? 441 ILE A HD12 3  
ATOM   3181  H  HD13 . ILE A 1 20 ? 0.605   -0.483  -7.038  1.00 0.00 ? 441 ILE A HD13 3  
ATOM   3182  N  N    . THR A 1 21 ? -5.289  -2.215  -6.472  1.00 0.00 ? 442 THR A N    3  
ATOM   3183  C  CA   . THR A 1 21 ? -6.726  -1.977  -6.532  1.00 0.00 ? 442 THR A CA   3  
ATOM   3184  C  C    . THR A 1 21 ? -7.498  -3.290  -6.602  1.00 0.00 ? 442 THR A C    3  
ATOM   3185  O  O    . THR A 1 21 ? -8.577  -3.418  -6.026  1.00 0.00 ? 442 THR A O    3  
ATOM   3186  C  CB   . THR A 1 21 ? -7.101  -1.109  -7.748  1.00 0.00 ? 442 THR A CB   3  
ATOM   3187  O  OG1  . THR A 1 21 ? -6.552  -1.675  -8.943  1.00 0.00 ? 442 THR A OG1  3  
ATOM   3188  C  CG2  . THR A 1 21 ? -6.592  0.314   -7.574  1.00 0.00 ? 442 THR A CG2  3  
ATOM   3189  H  H    . THR A 1 21 ? -4.807  -2.447  -7.293  1.00 0.00 ? 442 THR A H    3  
ATOM   3190  H  HA   . THR A 1 21 ? -7.014  -1.449  -5.635  1.00 0.00 ? 442 THR A HA   3  
ATOM   3191  H  HB   . THR A 1 21 ? -8.178  -1.082  -7.833  1.00 0.00 ? 442 THR A HB   3  
ATOM   3192  H  HG1  . THR A 1 21 ? -5.724  -1.235  -9.154  1.00 0.00 ? 442 THR A HG1  3  
ATOM   3193  H  HG21 . THR A 1 21 ? -6.592  0.571   -6.525  1.00 0.00 ? 442 THR A HG21 3  
ATOM   3194  H  HG22 . THR A 1 21 ? -7.236  0.995   -8.111  1.00 0.00 ? 442 THR A HG22 3  
ATOM   3195  H  HG23 . THR A 1 21 ? -5.588  0.387   -7.962  1.00 0.00 ? 442 THR A HG23 3  
ATOM   3196  N  N    . GLY A 1 22 ? -6.936  -4.264  -7.312  1.00 0.00 ? 443 GLY A N    3  
ATOM   3197  C  CA   . GLY A 1 22 ? -7.586  -5.555  -7.443  1.00 0.00 ? 443 GLY A CA   3  
ATOM   3198  C  C    . GLY A 1 22 ? -7.890  -5.907  -8.886  1.00 0.00 ? 443 GLY A C    3  
ATOM   3199  O  O    . GLY A 1 22 ? -8.270  -7.038  -9.190  1.00 0.00 ? 443 GLY A O    3  
ATOM   3200  H  H    . GLY A 1 22 ? -6.074  -4.105  -7.749  1.00 0.00 ? 443 GLY A H    3  
ATOM   3201  H  HA2  . GLY A 1 22 ? -6.942  -6.315  -7.026  1.00 0.00 ? 443 GLY A HA2  3  
ATOM   3202  H  HA3  . GLY A 1 22 ? -8.512  -5.538  -6.886  1.00 0.00 ? 443 GLY A HA3  3  
ATOM   3203  N  N    . PHE A 1 23 ? -7.725  -4.936  -9.777  1.00 0.00 ? 444 PHE A N    3  
ATOM   3204  C  CA   . PHE A 1 23 ? -7.987  -5.148  -11.196 1.00 0.00 ? 444 PHE A CA   3  
ATOM   3205  C  C    . PHE A 1 23 ? -6.689  -5.399  -11.958 1.00 0.00 ? 444 PHE A C    3  
ATOM   3206  O  O    . PHE A 1 23 ? -6.091  -4.474  -12.510 1.00 0.00 ? 444 PHE A O    3  
ATOM   3207  C  CB   . PHE A 1 23 ? -8.714  -3.938  -11.789 1.00 0.00 ? 444 PHE A CB   3  
ATOM   3208  C  CG   . PHE A 1 23 ? -8.633  -3.865  -13.287 1.00 0.00 ? 444 PHE A CG   3  
ATOM   3209  C  CD1  . PHE A 1 23 ? -9.059  -4.926  -14.069 1.00 0.00 ? 444 PHE A CD1  3  
ATOM   3210  C  CD2  . PHE A 1 23 ? -8.131  -2.736  -13.912 1.00 0.00 ? 444 PHE A CD2  3  
ATOM   3211  C  CE1  . PHE A 1 23 ? -8.987  -4.862  -15.448 1.00 0.00 ? 444 PHE A CE1  3  
ATOM   3212  C  CE2  . PHE A 1 23 ? -8.057  -2.666  -15.291 1.00 0.00 ? 444 PHE A CE2  3  
ATOM   3213  C  CZ   . PHE A 1 23 ? -8.484  -3.731  -16.059 1.00 0.00 ? 444 PHE A CZ   3  
ATOM   3214  H  H    . PHE A 1 23 ? -7.420  -4.055  -9.474  1.00 0.00 ? 444 PHE A H    3  
ATOM   3215  H  HA   . PHE A 1 23 ? -8.619  -6.018  -11.289 1.00 0.00 ? 444 PHE A HA   3  
ATOM   3216  H  HB2  . PHE A 1 23 ? -9.757  -3.985  -11.515 1.00 0.00 ? 444 PHE A HB2  3  
ATOM   3217  H  HB3  . PHE A 1 23 ? -8.280  -3.035  -11.387 1.00 0.00 ? 444 PHE A HB3  3  
ATOM   3218  H  HD1  . PHE A 1 23 ? -9.453  -5.813  -13.591 1.00 0.00 ? 444 PHE A HD1  3  
ATOM   3219  H  HD2  . PHE A 1 23 ? -7.795  -1.903  -13.313 1.00 0.00 ? 444 PHE A HD2  3  
ATOM   3220  H  HE1  . PHE A 1 23 ? -9.322  -5.697  -16.046 1.00 0.00 ? 444 PHE A HE1  3  
ATOM   3221  H  HE2  . PHE A 1 23 ? -7.663  -1.780  -15.766 1.00 0.00 ? 444 PHE A HE2  3  
ATOM   3222  H  HZ   . PHE A 1 23 ? -8.427  -3.679  -17.136 1.00 0.00 ? 444 PHE A HZ   3  
ATOM   3223  N  N    . CYS A 1 24 ? -6.258  -6.655  -11.982 1.00 0.00 ? 445 CYS A N    3  
ATOM   3224  C  CA   . CYS A 1 24 ? -5.030  -7.030  -12.674 1.00 0.00 ? 445 CYS A CA   3  
ATOM   3225  C  C    . CYS A 1 24 ? -5.310  -8.071  -13.753 1.00 0.00 ? 445 CYS A C    3  
ATOM   3226  O  O    . CYS A 1 24 ? -5.635  -9.220  -13.452 1.00 0.00 ? 445 CYS A O    3  
ATOM   3227  C  CB   . CYS A 1 24 ? -4.005  -7.574  -11.678 1.00 0.00 ? 445 CYS A CB   3  
ATOM   3228  S  SG   . CYS A 1 24 ? -2.426  -8.076  -12.436 1.00 0.00 ? 445 CYS A SG   3  
ATOM   3229  H  H    . CYS A 1 24 ? -6.778  -7.349  -11.523 1.00 0.00 ? 445 CYS A H    3  
ATOM   3230  H  HA   . CYS A 1 24 ? -4.629  -6.143  -13.142 1.00 0.00 ? 445 CYS A HA   3  
ATOM   3231  H  HB2  . CYS A 1 24 ? -3.788  -6.812  -10.943 1.00 0.00 ? 445 CYS A HB2  3  
ATOM   3232  H  HB3  . CYS A 1 24 ? -4.420  -8.438  -11.181 1.00 0.00 ? 445 CYS A HB3  3  
ATOM   3233  N  N    . ALA A 1 25 ? -5.182  -7.661  -15.011 1.00 0.00 ? 446 ALA A N    3  
ATOM   3234  C  CA   . ALA A 1 25 ? -5.419  -8.559  -16.135 1.00 0.00 ? 446 ALA A CA   3  
ATOM   3235  C  C    . ALA A 1 25 ? -4.826  -9.938  -15.870 1.00 0.00 ? 446 ALA A C    3  
ATOM   3236  O  O    . ALA A 1 25 ? -5.555  -10.910 -15.669 1.00 0.00 ? 446 ALA A O    3  
ATOM   3237  C  CB   . ALA A 1 25 ? -4.840  -7.969  -17.412 1.00 0.00 ? 446 ALA A CB   3  
ATOM   3238  H  H    . ALA A 1 25 ? -4.921  -6.734  -15.187 1.00 0.00 ? 446 ALA A H    3  
ATOM   3239  H  HA   . ALA A 1 25 ? -6.487  -8.656  -16.265 1.00 0.00 ? 446 ALA A HA   3  
ATOM   3240  H  HB1  . ALA A 1 25 ? -4.771  -8.741  -18.165 1.00 0.00 ? 446 ALA A HB1  3  
ATOM   3241  H  HB2  . ALA A 1 25 ? -5.482  -7.176  -17.766 1.00 0.00 ? 446 ALA A HB2  3  
ATOM   3242  H  HB3  . ALA A 1 25 ? -3.855  -7.574  -17.211 1.00 0.00 ? 446 ALA A HB3  3  
ATOM   3243  N  N    . ARG A 1 26 ? -3.499  -10.017 -15.872 1.00 0.00 ? 447 ARG A N    3  
ATOM   3244  C  CA   . ARG A 1 26 ? -2.808  -11.279 -15.634 1.00 0.00 ? 447 ARG A CA   3  
ATOM   3245  C  C    . ARG A 1 26 ? -2.781  -11.611 -14.144 1.00 0.00 ? 447 ARG A C    3  
ATOM   3246  O  O    . ARG A 1 26 ? -2.060  -10.982 -13.371 1.00 0.00 ? 447 ARG A O    3  
ATOM   3247  C  CB   . ARG A 1 26 ? -1.381  -11.214 -16.178 1.00 0.00 ? 447 ARG A CB   3  
ATOM   3248  C  CG   . ARG A 1 26 ? -1.304  -11.285 -17.695 1.00 0.00 ? 447 ARG A CG   3  
ATOM   3249  C  CD   . ARG A 1 26 ? 0.132   -11.177 -18.185 1.00 0.00 ? 447 ARG A CD   3  
ATOM   3250  N  NE   . ARG A 1 26 ? 0.203   -10.769 -19.586 1.00 0.00 ? 447 ARG A NE   3  
ATOM   3251  C  CZ   . ARG A 1 26 ? 1.169   -11.149 -20.414 1.00 0.00 ? 447 ARG A CZ   3  
ATOM   3252  N  NH1  . ARG A 1 26 ? 2.141   -11.942 -19.985 1.00 0.00 ? 447 ARG A NH1  3  
ATOM   3253  N  NH2  . ARG A 1 26 ? 1.164   -10.736 -21.675 1.00 0.00 ? 447 ARG A NH2  3  
ATOM   3254  H  H    . ARG A 1 26 ? -2.972  -9.208  -16.038 1.00 0.00 ? 447 ARG A H    3  
ATOM   3255  H  HA   . ARG A 1 26 ? -3.348  -12.056 -16.154 1.00 0.00 ? 447 ARG A HA   3  
ATOM   3256  H  HB2  . ARG A 1 26 ? -0.928  -10.286 -15.860 1.00 0.00 ? 447 ARG A HB2  3  
ATOM   3257  H  HB3  . ARG A 1 26 ? -0.815  -12.039 -15.772 1.00 0.00 ? 447 ARG A HB3  3  
ATOM   3258  H  HG2  . ARG A 1 26 ? -1.714  -12.228 -18.023 1.00 0.00 ? 447 ARG A HG2  3  
ATOM   3259  H  HG3  . ARG A 1 26 ? -1.880  -10.474 -18.114 1.00 0.00 ? 447 ARG A HG3  3  
ATOM   3260  H  HD2  . ARG A 1 26 ? 0.651   -10.448 -17.581 1.00 0.00 ? 447 ARG A HD2  3  
ATOM   3261  H  HD3  . ARG A 1 26 ? 0.609   -12.140 -18.076 1.00 0.00 ? 447 ARG A HD3  3  
ATOM   3262  H  HE   . ARG A 1 26 ? -0.506  -10.183 -19.924 1.00 0.00 ? 447 ARG A HE   3  
ATOM   3263  H  HH11 . ARG A 1 26 ? 2.147   -12.255 -19.035 1.00 0.00 ? 447 ARG A HH11 3  
ATOM   3264  H  HH12 . ARG A 1 26 ? 2.867   -12.227 -20.611 1.00 0.00 ? 447 ARG A HH12 3  
ATOM   3265  H  HH21 . ARG A 1 26 ? 0.433   -10.138 -22.002 1.00 0.00 ? 447 ARG A HH21 3  
ATOM   3266  H  HH22 . ARG A 1 26 ? 1.892   -11.022 -22.297 1.00 0.00 ? 447 ARG A HH22 3  
ATOM   3267  N  N    . ALA A 1 27 ? -3.573  -12.604 -13.750 1.00 0.00 ? 448 ALA A N    3  
ATOM   3268  C  CA   . ALA A 1 27 ? -3.639  -13.020 -12.355 1.00 0.00 ? 448 ALA A CA   3  
ATOM   3269  C  C    . ALA A 1 27 ? -2.460  -13.918 -11.994 1.00 0.00 ? 448 ALA A C    3  
ATOM   3270  O  O    . ALA A 1 27 ? -1.523  -13.486 -11.324 1.00 0.00 ? 448 ALA A O    3  
ATOM   3271  C  CB   . ALA A 1 27 ? -4.953  -13.736 -12.079 1.00 0.00 ? 448 ALA A CB   3  
ATOM   3272  H  H    . ALA A 1 27 ? -4.125  -13.067 -14.414 1.00 0.00 ? 448 ALA A H    3  
ATOM   3273  H  HA   . ALA A 1 27 ? -3.604  -12.133 -11.740 1.00 0.00 ? 448 ALA A HA   3  
ATOM   3274  H  HB1  . ALA A 1 27 ? -5.373  -13.370 -11.154 1.00 0.00 ? 448 ALA A HB1  3  
ATOM   3275  H  HB2  . ALA A 1 27 ? -5.642  -13.546 -12.889 1.00 0.00 ? 448 ALA A HB2  3  
ATOM   3276  H  HB3  . ALA A 1 27 ? -4.774  -14.798 -11.999 1.00 0.00 ? 448 ALA A HB3  3  
ATOM   3277  N  N    . GLU A 1 28 ? -2.514  -15.168 -12.443 1.00 0.00 ? 449 GLU A N    3  
ATOM   3278  C  CA   . GLU A 1 28 ? -1.451  -16.126 -12.165 1.00 0.00 ? 449 GLU A CA   3  
ATOM   3279  C  C    . GLU A 1 28 ? -0.277  -15.928 -13.120 1.00 0.00 ? 449 GLU A C    3  
ATOM   3280  O  O    . GLU A 1 28 ? 0.698   -16.677 -13.085 1.00 0.00 ? 449 GLU A O    3  
ATOM   3281  C  CB   . GLU A 1 28 ? -1.980  -17.557 -12.280 1.00 0.00 ? 449 GLU A CB   3  
ATOM   3282  C  CG   . GLU A 1 28 ? -3.262  -17.796 -11.499 1.00 0.00 ? 449 GLU A CG   3  
ATOM   3283  C  CD   . GLU A 1 28 ? -3.020  -17.934 -10.009 1.00 0.00 ? 449 GLU A CD   3  
ATOM   3284  O  OE1  . GLU A 1 28 ? -2.102  -18.688 -9.624  1.00 0.00 ? 449 GLU A OE1  3  
ATOM   3285  O  OE2  . GLU A 1 28 ? -3.749  -17.288 -9.227  1.00 0.00 ? 449 GLU A OE2  3  
ATOM   3286  H  H    . GLU A 1 28 ? -3.288  -15.453 -12.973 1.00 0.00 ? 449 GLU A H    3  
ATOM   3287  H  HA   . GLU A 1 28 ? -1.109  -15.958 -11.155 1.00 0.00 ? 449 GLU A HA   3  
ATOM   3288  H  HB2  . GLU A 1 28 ? -2.170  -17.776 -13.320 1.00 0.00 ? 449 GLU A HB2  3  
ATOM   3289  H  HB3  . GLU A 1 28 ? -1.227  -18.237 -11.910 1.00 0.00 ? 449 GLU A HB3  3  
ATOM   3290  H  HG2  . GLU A 1 28 ? -3.929  -16.964 -11.665 1.00 0.00 ? 449 GLU A HG2  3  
ATOM   3291  H  HG3  . GLU A 1 28 ? -3.724  -18.703 -11.860 1.00 0.00 ? 449 GLU A HG3  3  
ATOM   3292  N  N    . ASN A 1 29 ? -0.381  -14.915 -13.974 1.00 0.00 ? 450 ASN A N    3  
ATOM   3293  C  CA   . ASN A 1 29 ? 0.671   -14.618 -14.940 1.00 0.00 ? 450 ASN A CA   3  
ATOM   3294  C  C    . ASN A 1 29 ? 1.319   -13.269 -14.642 1.00 0.00 ? 450 ASN A C    3  
ATOM   3295  O  O    . ASN A 1 29 ? 2.015   -12.703 -15.486 1.00 0.00 ? 450 ASN A O    3  
ATOM   3296  C  CB   . ASN A 1 29 ? 0.103   -14.622 -16.360 1.00 0.00 ? 450 ASN A CB   3  
ATOM   3297  C  CG   . ASN A 1 29 ? -0.246  -16.017 -16.840 1.00 0.00 ? 450 ASN A CG   3  
ATOM   3298  O  OD1  . ASN A 1 29 ? -1.352  -16.507 -16.609 1.00 0.00 ? 450 ASN A OD1  3  
ATOM   3299  N  ND2  . ASN A 1 29 ? 0.698   -16.665 -17.512 1.00 0.00 ? 450 ASN A ND2  3  
ATOM   3300  H  H    . ASN A 1 29 ? -1.183  -14.353 -13.954 1.00 0.00 ? 450 ASN A H    3  
ATOM   3301  H  HA   . ASN A 1 29 ? 1.421   -15.390 -14.860 1.00 0.00 ? 450 ASN A HA   3  
ATOM   3302  H  HB2  . ASN A 1 29 ? -0.794  -14.019 -16.385 1.00 0.00 ? 450 ASN A HB2  3  
ATOM   3303  H  HB3  . ASN A 1 29 ? 0.833   -14.201 -17.035 1.00 0.00 ? 450 ASN A HB3  3  
ATOM   3304  H  HD21 . ASN A 1 29 ? 1.555   -16.213 -17.659 1.00 0.00 ? 450 ASN A HD21 3  
ATOM   3305  H  HD22 . ASN A 1 29 ? 0.499   -17.569 -17.834 1.00 0.00 ? 450 ASN A HD22 3  
ATOM   3306  N  N    . CYS A 1 30 ? 1.085   -12.760 -13.437 1.00 0.00 ? 451 CYS A N    3  
ATOM   3307  C  CA   . CYS A 1 30 ? 1.645   -11.478 -13.027 1.00 0.00 ? 451 CYS A CA   3  
ATOM   3308  C  C    . CYS A 1 30 ? 3.097   -11.636 -12.583 1.00 0.00 ? 451 CYS A C    3  
ATOM   3309  O  O    . CYS A 1 30 ? 3.395   -12.237 -11.551 1.00 0.00 ? 451 CYS A O    3  
ATOM   3310  C  CB   . CYS A 1 30 ? 0.816   -10.876 -11.891 1.00 0.00 ? 451 CYS A CB   3  
ATOM   3311  S  SG   . CYS A 1 30 ? 1.279   -9.169  -11.457 1.00 0.00 ? 451 CYS A SG   3  
ATOM   3312  H  H    . CYS A 1 30 ? 0.522   -13.259 -12.808 1.00 0.00 ? 451 CYS A H    3  
ATOM   3313  H  HA   . CYS A 1 30 ? 1.612   -10.814 -13.877 1.00 0.00 ? 451 CYS A HA   3  
ATOM   3314  H  HB2  . CYS A 1 30 ? -0.225  -10.870 -12.180 1.00 0.00 ? 451 CYS A HB2  3  
ATOM   3315  H  HB3  . CYS A 1 30 ? 0.935   -11.485 -11.007 1.00 0.00 ? 451 CYS A HB3  3  
ATOM   3316  N  N    . PRO A 1 31 ? 4.023   -11.083 -13.381 1.00 0.00 ? 452 PRO A N    3  
ATOM   3317  C  CA   . PRO A 1 31 ? 5.458   -11.147 -13.091 1.00 0.00 ? 452 PRO A CA   3  
ATOM   3318  C  C    . PRO A 1 31 ? 5.845   -10.296 -11.887 1.00 0.00 ? 452 PRO A C    3  
ATOM   3319  O  O    . PRO A 1 31 ? 7.012   -10.249 -11.497 1.00 0.00 ? 452 PRO A O    3  
ATOM   3320  C  CB   . PRO A 1 31 ? 6.102   -10.596 -14.366 1.00 0.00 ? 452 PRO A CB   3  
ATOM   3321  C  CG   . PRO A 1 31 ? 5.060   -9.718  -14.968 1.00 0.00 ? 452 PRO A CG   3  
ATOM   3322  C  CD   . PRO A 1 31 ? 3.739   -10.351 -14.627 1.00 0.00 ? 452 PRO A CD   3  
ATOM   3323  H  HA   . PRO A 1 31 ? 5.785   -12.164 -12.932 1.00 0.00 ? 452 PRO A HA   3  
ATOM   3324  H  HB2  . PRO A 1 31 ? 6.991   -10.036 -14.109 1.00 0.00 ? 452 PRO A HB2  3  
ATOM   3325  H  HB3  . PRO A 1 31 ? 6.361   -11.411 -15.024 1.00 0.00 ? 452 PRO A HB3  3  
ATOM   3326  H  HG2  . PRO A 1 31 ? 5.123   -8.728  -14.543 1.00 0.00 ? 452 PRO A HG2  3  
ATOM   3327  H  HG3  . PRO A 1 31 ? 5.190   -9.677  -16.039 1.00 0.00 ? 452 PRO A HG3  3  
ATOM   3328  H  HD2  . PRO A 1 31 ? 2.988   -9.592  -14.466 1.00 0.00 ? 452 PRO A HD2  3  
ATOM   3329  H  HD3  . PRO A 1 31 ? 3.432   -11.028 -15.410 1.00 0.00 ? 452 PRO A HD3  3  
ATOM   3330  N  N    . TYR A 1 32 ? 4.860   -9.624  -11.302 1.00 0.00 ? 453 TYR A N    3  
ATOM   3331  C  CA   . TYR A 1 32 ? 5.099   -8.772  -10.143 1.00 0.00 ? 453 TYR A CA   3  
ATOM   3332  C  C    . TYR A 1 32 ? 4.666   -9.469  -8.857  1.00 0.00 ? 453 TYR A C    3  
ATOM   3333  O  O    . TYR A 1 32 ? 4.182   -10.601 -8.883  1.00 0.00 ? 453 TYR A O    3  
ATOM   3334  C  CB   . TYR A 1 32 ? 4.350   -7.447  -10.295 1.00 0.00 ? 453 TYR A CB   3  
ATOM   3335  C  CG   . TYR A 1 32 ? 4.872   -6.582  -11.420 1.00 0.00 ? 453 TYR A CG   3  
ATOM   3336  C  CD1  . TYR A 1 32 ? 4.535   -6.850  -12.741 1.00 0.00 ? 453 TYR A CD1  3  
ATOM   3337  C  CD2  . TYR A 1 32 ? 5.703   -5.499  -11.163 1.00 0.00 ? 453 TYR A CD2  3  
ATOM   3338  C  CE1  . TYR A 1 32 ? 5.010   -6.063  -13.773 1.00 0.00 ? 453 TYR A CE1  3  
ATOM   3339  C  CE2  . TYR A 1 32 ? 6.181   -4.706  -12.188 1.00 0.00 ? 453 TYR A CE2  3  
ATOM   3340  C  CZ   . TYR A 1 32 ? 5.832   -4.992  -13.491 1.00 0.00 ? 453 TYR A CZ   3  
ATOM   3341  O  OH   . TYR A 1 32 ? 6.308   -4.206  -14.515 1.00 0.00 ? 453 TYR A OH   3  
ATOM   3342  H  H    . TYR A 1 32 ? 3.951   -9.701  -11.659 1.00 0.00 ? 453 TYR A H    3  
ATOM   3343  H  HA   . TYR A 1 32 ? 6.159   -8.572  -10.091 1.00 0.00 ? 453 TYR A HA   3  
ATOM   3344  H  HB2  . TYR A 1 32 ? 3.308   -7.650  -10.489 1.00 0.00 ? 453 TYR A HB2  3  
ATOM   3345  H  HB3  . TYR A 1 32 ? 4.437   -6.885  -9.377  1.00 0.00 ? 453 TYR A HB3  3  
ATOM   3346  H  HD1  . TYR A 1 32 ? 3.890   -7.689  -12.959 1.00 0.00 ? 453 TYR A HD1  3  
ATOM   3347  H  HD2  . TYR A 1 32 ? 5.975   -5.278  -10.140 1.00 0.00 ? 453 TYR A HD2  3  
ATOM   3348  H  HE1  . TYR A 1 32 ? 4.737   -6.286  -14.794 1.00 0.00 ? 453 TYR A HE1  3  
ATOM   3349  H  HE2  . TYR A 1 32 ? 6.826   -3.868  -11.967 1.00 0.00 ? 453 TYR A HE2  3  
ATOM   3350  H  HH   . TYR A 1 32 ? 6.621   -3.371  -14.158 1.00 0.00 ? 453 TYR A HH   3  
ATOM   3351  N  N    . MET A 1 33 ? 4.843   -8.784  -7.732  1.00 0.00 ? 454 MET A N    3  
ATOM   3352  C  CA   . MET A 1 33 ? 4.469   -9.335  -6.434  1.00 0.00 ? 454 MET A CA   3  
ATOM   3353  C  C    . MET A 1 33 ? 3.124   -8.780  -5.975  1.00 0.00 ? 454 MET A C    3  
ATOM   3354  O  O    . MET A 1 33 ? 2.842   -7.593  -6.141  1.00 0.00 ? 454 MET A O    3  
ATOM   3355  C  CB   . MET A 1 33 ? 5.546   -9.022  -5.394  1.00 0.00 ? 454 MET A CB   3  
ATOM   3356  C  CG   . MET A 1 33 ? 6.829   -9.812  -5.591  1.00 0.00 ? 454 MET A CG   3  
ATOM   3357  S  SD   . MET A 1 33 ? 6.729   -11.479 -4.911  1.00 0.00 ? 454 MET A SD   3  
ATOM   3358  C  CE   . MET A 1 33 ? 7.496   -11.238 -3.310  1.00 0.00 ? 454 MET A CE   3  
ATOM   3359  H  H    . MET A 1 33 ? 5.233   -7.885  -7.774  1.00 0.00 ? 454 MET A H    3  
ATOM   3360  H  HA   . MET A 1 33 ? 4.385   -10.406 -6.542  1.00 0.00 ? 454 MET A HA   3  
ATOM   3361  H  HB2  . MET A 1 33 ? 5.784   -7.970  -5.446  1.00 0.00 ? 454 MET A HB2  3  
ATOM   3362  H  HB3  . MET A 1 33 ? 5.157   -9.247  -4.412  1.00 0.00 ? 454 MET A HB3  3  
ATOM   3363  H  HG2  . MET A 1 33 ? 7.035   -9.883  -6.649  1.00 0.00 ? 454 MET A HG2  3  
ATOM   3364  H  HG3  . MET A 1 33 ? 7.637   -9.287  -5.104  1.00 0.00 ? 454 MET A HG3  3  
ATOM   3365  H  HE1  . MET A 1 33 ? 8.436   -10.722 -3.435  1.00 0.00 ? 454 MET A HE1  3  
ATOM   3366  H  HE2  . MET A 1 33 ? 6.842   -10.650 -2.683  1.00 0.00 ? 454 MET A HE2  3  
ATOM   3367  H  HE3  . MET A 1 33 ? 7.671   -12.199 -2.847  1.00 0.00 ? 454 MET A HE3  3  
ATOM   3368  N  N    . HIS A 1 34 ? 2.298   -9.646  -5.396  1.00 0.00 ? 455 HIS A N    3  
ATOM   3369  C  CA   . HIS A 1 34 ? 0.983   -9.241  -4.912  1.00 0.00 ? 455 HIS A CA   3  
ATOM   3370  C  C    . HIS A 1 34 ? 0.914   -9.328  -3.391  1.00 0.00 ? 455 HIS A C    3  
ATOM   3371  O  O    . HIS A 1 34 ? 1.009   -8.317  -2.696  1.00 0.00 ? 455 HIS A O    3  
ATOM   3372  C  CB   . HIS A 1 34 ? -0.105  -10.117 -5.535  1.00 0.00 ? 455 HIS A CB   3  
ATOM   3373  C  CG   . HIS A 1 34 ? -0.475  -9.712  -6.928  1.00 0.00 ? 455 HIS A CG   3  
ATOM   3374  N  ND1  . HIS A 1 34 ? -1.540  -10.259 -7.613  1.00 0.00 ? 455 HIS A ND1  3  
ATOM   3375  C  CD2  . HIS A 1 34 ? 0.083   -8.806  -7.765  1.00 0.00 ? 455 HIS A CD2  3  
ATOM   3376  C  CE1  . HIS A 1 34 ? -1.620  -9.708  -8.811  1.00 0.00 ? 455 HIS A CE1  3  
ATOM   3377  N  NE2  . HIS A 1 34 ? -0.647  -8.823  -8.929  1.00 0.00 ? 455 HIS A NE2  3  
ATOM   3378  H  H    . HIS A 1 34 ? 2.580   -10.578 -5.292  1.00 0.00 ? 455 HIS A H    3  
ATOM   3379  H  HA   . HIS A 1 34 ? 0.821   -8.216  -5.210  1.00 0.00 ? 455 HIS A HA   3  
ATOM   3380  H  HB2  . HIS A 1 34 ? 0.242   -11.140 -5.568  1.00 0.00 ? 455 HIS A HB2  3  
ATOM   3381  H  HB3  . HIS A 1 34 ? -0.995  -10.063 -4.925  1.00 0.00 ? 455 HIS A HB3  3  
ATOM   3382  H  HD1  . HIS A 1 34 ? -2.146  -10.949 -7.272  1.00 0.00 ? 455 HIS A HD1  3  
ATOM   3383  H  HD2  . HIS A 1 34 ? 0.943   -8.185  -7.557  1.00 0.00 ? 455 HIS A HD2  3  
ATOM   3384  H  HE1  . HIS A 1 34 ? -2.355  -9.941  -9.567  1.00 0.00 ? 455 HIS A HE1  3  
ATOM   3385  N  N    . GLY A 1 35 ? 0.746   -10.544 -2.879  1.00 0.00 ? 456 GLY A N    3  
ATOM   3386  C  CA   . GLY A 1 35 ? 0.666   -10.740 -1.443  1.00 0.00 ? 456 GLY A CA   3  
ATOM   3387  C  C    . GLY A 1 35 ? 2.031   -10.773 -0.785  1.00 0.00 ? 456 GLY A C    3  
ATOM   3388  O  O    . GLY A 1 35 ? 2.351   -9.917  0.040   1.00 0.00 ? 456 GLY A O    3  
ATOM   3389  H  H    . GLY A 1 35 ? 0.677   -11.314 -3.481  1.00 0.00 ? 456 GLY A H    3  
ATOM   3390  H  HA2  . GLY A 1 35 ? 0.090   -9.935  -1.013  1.00 0.00 ? 456 GLY A HA2  3  
ATOM   3391  H  HA3  . GLY A 1 35 ? 0.162   -11.675 -1.247  1.00 0.00 ? 456 GLY A HA3  3  
ATOM   3392  N  N    . ASP A 1 36 ? 2.838   -11.764 -1.150  1.00 0.00 ? 457 ASP A N    3  
ATOM   3393  C  CA   . ASP A 1 36 ? 4.176   -11.905 -0.588  1.00 0.00 ? 457 ASP A CA   3  
ATOM   3394  C  C    . ASP A 1 36 ? 4.781   -10.541 -0.273  1.00 0.00 ? 457 ASP A C    3  
ATOM   3395  O  O    . ASP A 1 36 ? 5.348   -10.335 0.800   1.00 0.00 ? 457 ASP A O    3  
ATOM   3396  C  CB   . ASP A 1 36 ? 5.082   -12.666 -1.559  1.00 0.00 ? 457 ASP A CB   3  
ATOM   3397  C  CG   . ASP A 1 36 ? 6.387   -13.095 -0.918  1.00 0.00 ? 457 ASP A CG   3  
ATOM   3398  O  OD1  . ASP A 1 36 ? 6.838   -12.411 0.024   1.00 0.00 ? 457 ASP A OD1  3  
ATOM   3399  O  OD2  . ASP A 1 36 ? 6.956   -14.115 -1.359  1.00 0.00 ? 457 ASP A OD2  3  
ATOM   3400  H  H    . ASP A 1 36 ? 2.526   -12.415 -1.812  1.00 0.00 ? 457 ASP A H    3  
ATOM   3401  H  HA   . ASP A 1 36 ? 4.094   -12.469 0.328   1.00 0.00 ? 457 ASP A HA   3  
ATOM   3402  H  HB2  . ASP A 1 36 ? 4.565   -13.549 -1.906  1.00 0.00 ? 457 ASP A HB2  3  
ATOM   3403  H  HB3  . ASP A 1 36 ? 5.307   -12.030 -2.403  1.00 0.00 ? 457 ASP A HB3  3  
ATOM   3404  N  N    . PHE A 1 37 ? 4.655   -9.612  -1.215  1.00 0.00 ? 458 PHE A N    3  
ATOM   3405  C  CA   . PHE A 1 37 ? 5.191   -8.267  -1.038  1.00 0.00 ? 458 PHE A CA   3  
ATOM   3406  C  C    . PHE A 1 37 ? 4.817   -7.708  0.332   1.00 0.00 ? 458 PHE A C    3  
ATOM   3407  O  O    . PHE A 1 37 ? 3.645   -7.644  0.705   1.00 0.00 ? 458 PHE A O    3  
ATOM   3408  C  CB   . PHE A 1 37 ? 4.672   -7.340  -2.139  1.00 0.00 ? 458 PHE A CB   3  
ATOM   3409  C  CG   . PHE A 1 37 ? 5.521   -6.118  -2.343  1.00 0.00 ? 458 PHE A CG   3  
ATOM   3410  C  CD1  . PHE A 1 37 ? 6.737   -6.205  -3.002  1.00 0.00 ? 458 PHE A CD1  3  
ATOM   3411  C  CD2  . PHE A 1 37 ? 5.104   -4.882  -1.876  1.00 0.00 ? 458 PHE A CD2  3  
ATOM   3412  C  CE1  . PHE A 1 37 ? 7.520   -5.082  -3.191  1.00 0.00 ? 458 PHE A CE1  3  
ATOM   3413  C  CE2  . PHE A 1 37 ? 5.883   -3.755  -2.062  1.00 0.00 ? 458 PHE A CE2  3  
ATOM   3414  C  CZ   . PHE A 1 37 ? 7.092   -3.856  -2.722  1.00 0.00 ? 458 PHE A CZ   3  
ATOM   3415  H  H    . PHE A 1 37 ? 4.192   -9.836  -2.049  1.00 0.00 ? 458 PHE A H    3  
ATOM   3416  H  HA   . PHE A 1 37 ? 6.266   -8.327  -1.107  1.00 0.00 ? 458 PHE A HA   3  
ATOM   3417  H  HB2  . PHE A 1 37 ? 4.642   -7.882  -3.072  1.00 0.00 ? 458 PHE A HB2  3  
ATOM   3418  H  HB3  . PHE A 1 37 ? 3.675   -7.014  -1.884  1.00 0.00 ? 458 PHE A HB3  3  
ATOM   3419  H  HD1  . PHE A 1 37 ? 7.072   -7.163  -3.371  1.00 0.00 ? 458 PHE A HD1  3  
ATOM   3420  H  HD2  . PHE A 1 37 ? 4.157   -4.802  -1.360  1.00 0.00 ? 458 PHE A HD2  3  
ATOM   3421  H  HE1  . PHE A 1 37 ? 8.465   -5.163  -3.707  1.00 0.00 ? 458 PHE A HE1  3  
ATOM   3422  H  HE2  . PHE A 1 37 ? 5.545   -2.798  -1.694  1.00 0.00 ? 458 PHE A HE2  3  
ATOM   3423  H  HZ   . PHE A 1 37 ? 7.703   -2.977  -2.867  1.00 0.00 ? 458 PHE A HZ   3  
ATOM   3424  N  N    . PRO A 1 38 ? 5.835   -7.294  1.100   1.00 0.00 ? 459 PRO A N    3  
ATOM   3425  C  CA   . PRO A 1 38 ? 5.639   -6.733  2.440   1.00 0.00 ? 459 PRO A CA   3  
ATOM   3426  C  C    . PRO A 1 38 ? 4.980   -5.359  2.402   1.00 0.00 ? 459 PRO A C    3  
ATOM   3427  O  O    . PRO A 1 38 ? 5.211   -4.572  1.484   1.00 0.00 ? 459 PRO A O    3  
ATOM   3428  C  CB   . PRO A 1 38 ? 7.063   -6.628  2.992   1.00 0.00 ? 459 PRO A CB   3  
ATOM   3429  C  CG   . PRO A 1 38 ? 7.931   -6.522  1.785   1.00 0.00 ? 459 PRO A CG   3  
ATOM   3430  C  CD   . PRO A 1 38 ? 7.257   -7.340  0.718   1.00 0.00 ? 459 PRO A CD   3  
ATOM   3431  H  HA   . PRO A 1 38 ? 5.057   -7.394  3.065   1.00 0.00 ? 459 PRO A HA   3  
ATOM   3432  H  HB2  . PRO A 1 38 ? 7.146   -5.750  3.617   1.00 0.00 ? 459 PRO A HB2  3  
ATOM   3433  H  HB3  . PRO A 1 38 ? 7.295   -7.510  3.569   1.00 0.00 ? 459 PRO A HB3  3  
ATOM   3434  H  HG2  . PRO A 1 38 ? 8.006   -5.491  1.476   1.00 0.00 ? 459 PRO A HG2  3  
ATOM   3435  H  HG3  . PRO A 1 38 ? 8.910   -6.923  2.002   1.00 0.00 ? 459 PRO A HG3  3  
ATOM   3436  H  HD2  . PRO A 1 38 ? 7.411   -6.893  -0.253  1.00 0.00 ? 459 PRO A HD2  3  
ATOM   3437  H  HD3  . PRO A 1 38 ? 7.626   -8.355  0.731   1.00 0.00 ? 459 PRO A HD3  3  
ATOM   3438  N  N    . CYS A 1 39 ? 4.157   -5.075  3.407   1.00 0.00 ? 460 CYS A N    3  
ATOM   3439  C  CA   . CYS A 1 39 ? 3.463   -3.795  3.489   1.00 0.00 ? 460 CYS A CA   3  
ATOM   3440  C  C    . CYS A 1 39 ? 4.456   -2.649  3.663   1.00 0.00 ? 460 CYS A C    3  
ATOM   3441  O  O    . CYS A 1 39 ? 5.479   -2.794  4.332   1.00 0.00 ? 460 CYS A O    3  
ATOM   3442  C  CB   . CYS A 1 39 ? 2.469   -3.804  4.652   1.00 0.00 ? 460 CYS A CB   3  
ATOM   3443  S  SG   . CYS A 1 39 ? 1.167   -2.537  4.527   1.00 0.00 ? 460 CYS A SG   3  
ATOM   3444  H  H    . CYS A 1 39 ? 4.013   -5.743  4.110   1.00 0.00 ? 460 CYS A H    3  
ATOM   3445  H  HA   . CYS A 1 39 ? 2.923   -3.650  2.566   1.00 0.00 ? 460 CYS A HA   3  
ATOM   3446  H  HB2  . CYS A 1 39 ? 1.984   -4.769  4.693   1.00 0.00 ? 460 CYS A HB2  3  
ATOM   3447  H  HB3  . CYS A 1 39 ? 3.005   -3.637  5.575   1.00 0.00 ? 460 CYS A HB3  3  
ATOM   3448  N  N    . LYS A 1 40 ? 4.145   -1.508  3.056   1.00 0.00 ? 461 LYS A N    3  
ATOM   3449  C  CA   . LYS A 1 40 ? 5.007   -0.335  3.144   1.00 0.00 ? 461 LYS A CA   3  
ATOM   3450  C  C    . LYS A 1 40 ? 4.808   0.388   4.472   1.00 0.00 ? 461 LYS A C    3  
ATOM   3451  O  O    . LYS A 1 40 ? 5.706   0.421   5.314   1.00 0.00 ? 461 LYS A O    3  
ATOM   3452  C  CB   . LYS A 1 40 ? 4.723   0.620   1.983   1.00 0.00 ? 461 LYS A CB   3  
ATOM   3453  C  CG   . LYS A 1 40 ? 5.454   1.946   2.093   1.00 0.00 ? 461 LYS A CG   3  
ATOM   3454  C  CD   . LYS A 1 40 ? 5.687   2.570   0.727   1.00 0.00 ? 461 LYS A CD   3  
ATOM   3455  C  CE   . LYS A 1 40 ? 4.454   3.316   0.238   1.00 0.00 ? 461 LYS A CE   3  
ATOM   3456  N  NZ   . LYS A 1 40 ? 4.579   3.716   -1.191  1.00 0.00 ? 461 LYS A NZ   3  
ATOM   3457  H  H    . LYS A 1 40 ? 3.315   -1.454  2.537   1.00 0.00 ? 461 LYS A H    3  
ATOM   3458  H  HA   . LYS A 1 40 ? 6.031   -0.671  3.081   1.00 0.00 ? 461 LYS A HA   3  
ATOM   3459  H  HB2  . LYS A 1 40 ? 5.020   0.144   1.060   1.00 0.00 ? 461 LYS A HB2  3  
ATOM   3460  H  HB3  . LYS A 1 40 ? 3.661   0.820   1.948   1.00 0.00 ? 461 LYS A HB3  3  
ATOM   3461  H  HG2  . LYS A 1 40 ? 4.864   2.624   2.691   1.00 0.00 ? 461 LYS A HG2  3  
ATOM   3462  H  HG3  . LYS A 1 40 ? 6.410   1.781   2.571   1.00 0.00 ? 461 LYS A HG3  3  
ATOM   3463  H  HD2  . LYS A 1 40 ? 6.511   3.265   0.794   1.00 0.00 ? 461 LYS A HD2  3  
ATOM   3464  H  HD3  . LYS A 1 40 ? 5.928   1.789   0.020   1.00 0.00 ? 461 LYS A HD3  3  
ATOM   3465  H  HE2  . LYS A 1 40 ? 3.594   2.675   0.350   1.00 0.00 ? 461 LYS A HE2  3  
ATOM   3466  H  HE3  . LYS A 1 40 ? 4.323   4.202   0.841   1.00 0.00 ? 461 LYS A HE3  3  
ATOM   3467  H  HZ1  . LYS A 1 40 ? 5.545   4.049   -1.385  1.00 0.00 ? 461 LYS A HZ1  3  
ATOM   3468  H  HZ2  . LYS A 1 40 ? 3.910   4.482   -1.407  1.00 0.00 ? 461 LYS A HZ2  3  
ATOM   3469  H  HZ3  . LYS A 1 40 ? 4.372   2.905   -1.808  1.00 0.00 ? 461 LYS A HZ3  3  
ATOM   3470  N  N    . LEU A 1 41 ? 3.625   0.966   4.654   1.00 0.00 ? 462 LEU A N    3  
ATOM   3471  C  CA   . LEU A 1 41 ? 3.307   1.688   5.880   1.00 0.00 ? 462 LEU A CA   3  
ATOM   3472  C  C    . LEU A 1 41 ? 3.762   0.904   7.107   1.00 0.00 ? 462 LEU A C    3  
ATOM   3473  O  O    . LEU A 1 41 ? 4.569   1.387   7.901   1.00 0.00 ? 462 LEU A O    3  
ATOM   3474  C  CB   . LEU A 1 41 ? 1.804   1.958   5.962   1.00 0.00 ? 462 LEU A CB   3  
ATOM   3475  C  CG   . LEU A 1 41 ? 1.285   3.128   5.125   1.00 0.00 ? 462 LEU A CG   3  
ATOM   3476  C  CD1  . LEU A 1 41 ? -0.229  3.224   5.222   1.00 0.00 ? 462 LEU A CD1  3  
ATOM   3477  C  CD2  . LEU A 1 41 ? 1.933   4.431   5.571   1.00 0.00 ? 462 LEU A CD2  3  
ATOM   3478  H  H    . LEU A 1 41 ? 2.950   0.906   3.947   1.00 0.00 ? 462 LEU A H    3  
ATOM   3479  H  HA   . LEU A 1 41 ? 3.833   2.631   5.856   1.00 0.00 ? 462 LEU A HA   3  
ATOM   3480  H  HB2  . LEU A 1 41 ? 1.290   1.066   5.636   1.00 0.00 ? 462 LEU A HB2  3  
ATOM   3481  H  HB3  . LEU A 1 41 ? 1.559   2.155   6.996   1.00 0.00 ? 462 LEU A HB3  3  
ATOM   3482  H  HG   . LEU A 1 41 ? 1.543   2.963   4.088   1.00 0.00 ? 462 LEU A HG   3  
ATOM   3483  H  HD11 . LEU A 1 41 ? -0.568  4.104   4.697   1.00 0.00 ? 462 LEU A HD11 3  
ATOM   3484  H  HD12 . LEU A 1 41 ? -0.520  3.288   6.259   1.00 0.00 ? 462 LEU A HD12 3  
ATOM   3485  H  HD13 . LEU A 1 41 ? -0.674  2.346   4.777   1.00 0.00 ? 462 LEU A HD13 3  
ATOM   3486  H  HD21 . LEU A 1 41 ? 1.782   4.562   6.632   1.00 0.00 ? 462 LEU A HD21 3  
ATOM   3487  H  HD22 . LEU A 1 41 ? 1.485   5.257   5.038   1.00 0.00 ? 462 LEU A HD22 3  
ATOM   3488  H  HD23 . LEU A 1 41 ? 2.992   4.397   5.359   1.00 0.00 ? 462 LEU A HD23 3  
ATOM   3489  N  N    . TYR A 1 42 ? 3.239   -0.308  7.255   1.00 0.00 ? 463 TYR A N    3  
ATOM   3490  C  CA   . TYR A 1 42 ? 3.591   -1.160  8.385   1.00 0.00 ? 463 TYR A CA   3  
ATOM   3491  C  C    . TYR A 1 42 ? 5.079   -1.052  8.706   1.00 0.00 ? 463 TYR A C    3  
ATOM   3492  O  O    . TYR A 1 42 ? 5.501   -1.294  9.838   1.00 0.00 ? 463 TYR A O    3  
ATOM   3493  C  CB   . TYR A 1 42 ? 3.227   -2.615  8.087   1.00 0.00 ? 463 TYR A CB   3  
ATOM   3494  C  CG   . TYR A 1 42 ? 3.465   -3.550  9.251   1.00 0.00 ? 463 TYR A CG   3  
ATOM   3495  C  CD1  . TYR A 1 42 ? 4.700   -4.159  9.437   1.00 0.00 ? 463 TYR A CD1  3  
ATOM   3496  C  CD2  . TYR A 1 42 ? 2.455   -3.824  10.166  1.00 0.00 ? 463 TYR A CD2  3  
ATOM   3497  C  CE1  . TYR A 1 42 ? 4.922   -5.014  10.499  1.00 0.00 ? 463 TYR A CE1  3  
ATOM   3498  C  CE2  . TYR A 1 42 ? 2.669   -4.676  11.231  1.00 0.00 ? 463 TYR A CE2  3  
ATOM   3499  C  CZ   . TYR A 1 42 ? 3.904   -5.269  11.394  1.00 0.00 ? 463 TYR A CZ   3  
ATOM   3500  O  OH   . TYR A 1 42 ? 4.120   -6.120  12.453  1.00 0.00 ? 463 TYR A OH   3  
ATOM   3501  H  H    . TYR A 1 42 ? 2.601   -0.638  6.589   1.00 0.00 ? 463 TYR A H    3  
ATOM   3502  H  HA   . TYR A 1 42 ? 3.024   -0.825  9.241   1.00 0.00 ? 463 TYR A HA   3  
ATOM   3503  H  HB2  . TYR A 1 42 ? 2.181   -2.671  7.826   1.00 0.00 ? 463 TYR A HB2  3  
ATOM   3504  H  HB3  . TYR A 1 42 ? 3.820   -2.964  7.254   1.00 0.00 ? 463 TYR A HB3  3  
ATOM   3505  H  HD1  . TYR A 1 42 ? 5.496   -3.957  8.734   1.00 0.00 ? 463 TYR A HD1  3  
ATOM   3506  H  HD2  . TYR A 1 42 ? 1.489   -3.358  10.035  1.00 0.00 ? 463 TYR A HD2  3  
ATOM   3507  H  HE1  . TYR A 1 42 ? 5.889   -5.479  10.627  1.00 0.00 ? 463 TYR A HE1  3  
ATOM   3508  H  HE2  . TYR A 1 42 ? 1.872   -4.877  11.932  1.00 0.00 ? 463 TYR A HE2  3  
ATOM   3509  H  HH   . TYR A 1 42 ? 3.432   -5.994  13.110  1.00 0.00 ? 463 TYR A HH   3  
ATOM   3510  N  N    . HIS A 1 43 ? 5.869   -0.686  7.702   1.00 0.00 ? 464 HIS A N    3  
ATOM   3511  C  CA   . HIS A 1 43 ? 7.310   -0.544  7.876   1.00 0.00 ? 464 HIS A CA   3  
ATOM   3512  C  C    . HIS A 1 43 ? 7.694   0.922   8.059   1.00 0.00 ? 464 HIS A C    3  
ATOM   3513  O  O    . HIS A 1 43 ? 8.391   1.279   9.009   1.00 0.00 ? 464 HIS A O    3  
ATOM   3514  C  CB   . HIS A 1 43 ? 8.051   -1.131  6.675   1.00 0.00 ? 464 HIS A CB   3  
ATOM   3515  C  CG   . HIS A 1 43 ? 7.970   -2.624  6.592   1.00 0.00 ? 464 HIS A CG   3  
ATOM   3516  N  ND1  . HIS A 1 43 ? 8.091   -3.446  7.692   1.00 0.00 ? 464 HIS A ND1  3  
ATOM   3517  C  CD2  . HIS A 1 43 ? 7.776   -3.443  5.531   1.00 0.00 ? 464 HIS A CD2  3  
ATOM   3518  C  CE1  . HIS A 1 43 ? 7.978   -4.706  7.312   1.00 0.00 ? 464 HIS A CE1  3  
ATOM   3519  N  NE2  . HIS A 1 43 ? 7.785   -4.732  6.005   1.00 0.00 ? 464 HIS A NE2  3  
ATOM   3520  H  H    . HIS A 1 43 ? 5.474   -0.507  6.824   1.00 0.00 ? 464 HIS A H    3  
ATOM   3521  H  HA   . HIS A 1 43 ? 7.592   -1.090  8.764   1.00 0.00 ? 464 HIS A HA   3  
ATOM   3522  H  HB2  . HIS A 1 43 ? 7.629   -0.725  5.767   1.00 0.00 ? 464 HIS A HB2  3  
ATOM   3523  H  HB3  . HIS A 1 43 ? 9.095   -0.857  6.734   1.00 0.00 ? 464 HIS A HB3  3  
ATOM   3524  H  HD2  . HIS A 1 43 ? 7.639   -3.139  4.503   1.00 0.00 ? 464 HIS A HD2  3  
ATOM   3525  H  HE1  . HIS A 1 43 ? 8.032   -5.569  7.958   1.00 0.00 ? 464 HIS A HE1  3  
ATOM   3526  H  HE2  . HIS A 1 43 ? 7.754   -5.542  5.455   1.00 0.00 ? 464 HIS A HE2  3  
ATOM   3527  N  N    . THR A 1 44 ? 7.234   1.768   7.142   1.00 0.00 ? 465 THR A N    3  
ATOM   3528  C  CA   . THR A 1 44 ? 7.530   3.193   7.201   1.00 0.00 ? 465 THR A CA   3  
ATOM   3529  C  C    . THR A 1 44 ? 7.576   3.687   8.642   1.00 0.00 ? 465 THR A C    3  
ATOM   3530  O  O    . THR A 1 44 ? 8.474   4.437   9.025   1.00 0.00 ? 465 THR A O    3  
ATOM   3531  C  CB   . THR A 1 44 ? 6.486   4.016   6.422   1.00 0.00 ? 465 THR A CB   3  
ATOM   3532  O  OG1  . THR A 1 44 ? 5.212   3.930   7.069   1.00 0.00 ? 465 THR A OG1  3  
ATOM   3533  C  CG2  . THR A 1 44 ? 6.367   3.521   4.988   1.00 0.00 ? 465 THR A CG2  3  
ATOM   3534  H  H    . THR A 1 44 ? 6.683   1.423   6.409   1.00 0.00 ? 465 THR A H    3  
ATOM   3535  H  HA   . THR A 1 44 ? 8.496   3.352   6.745   1.00 0.00 ? 465 THR A HA   3  
ATOM   3536  H  HB   . THR A 1 44 ? 6.804   5.049   6.405   1.00 0.00 ? 465 THR A HB   3  
ATOM   3537  H  HG1  . THR A 1 44 ? 5.316   4.109   8.006   1.00 0.00 ? 465 THR A HG1  3  
ATOM   3538  H  HG21 . THR A 1 44 ? 6.912   2.595   4.881   1.00 0.00 ? 465 THR A HG21 3  
ATOM   3539  H  HG22 . THR A 1 44 ? 6.779   4.261   4.317   1.00 0.00 ? 465 THR A HG22 3  
ATOM   3540  H  HG23 . THR A 1 44 ? 5.328   3.357   4.749   1.00 0.00 ? 465 THR A HG23 3  
ATOM   3541  N  N    . THR A 1 45 ? 6.601   3.260   9.440   1.00 0.00 ? 466 THR A N    3  
ATOM   3542  C  CA   . THR A 1 45 ? 6.531   3.659   10.840  1.00 0.00 ? 466 THR A CA   3  
ATOM   3543  C  C    . THR A 1 45 ? 6.514   2.442   11.758  1.00 0.00 ? 466 THR A C    3  
ATOM   3544  O  O    . THR A 1 45 ? 7.071   2.472   12.855  1.00 0.00 ? 466 THR A O    3  
ATOM   3545  C  CB   . THR A 1 45 ? 5.281   4.515   11.118  1.00 0.00 ? 466 THR A CB   3  
ATOM   3546  O  OG1  . THR A 1 45 ? 4.099   3.777   10.790  1.00 0.00 ? 466 THR A OG1  3  
ATOM   3547  C  CG2  . THR A 1 45 ? 5.319   5.806   10.313  1.00 0.00 ? 466 THR A CG2  3  
ATOM   3548  H  H    . THR A 1 45 ? 5.914   2.664   9.077   1.00 0.00 ? 466 THR A H    3  
ATOM   3549  H  HA   . THR A 1 45 ? 7.405   4.254   11.062  1.00 0.00 ? 466 THR A HA   3  
ATOM   3550  H  HB   . THR A 1 45 ? 5.260   4.765   12.169  1.00 0.00 ? 466 THR A HB   3  
ATOM   3551  H  HG1  . THR A 1 45 ? 4.175   2.882   11.130  1.00 0.00 ? 466 THR A HG1  3  
ATOM   3552  H  HG21 . THR A 1 45 ? 4.314   6.179   10.184  1.00 0.00 ? 466 THR A HG21 3  
ATOM   3553  H  HG22 . THR A 1 45 ? 5.759   5.614   9.346   1.00 0.00 ? 466 THR A HG22 3  
ATOM   3554  H  HG23 . THR A 1 45 ? 5.910   6.540   10.839  1.00 0.00 ? 466 THR A HG23 3  
ATOM   3555  N  N    . GLY A 1 46 ? 5.870   1.372   11.303  1.00 0.00 ? 467 GLY A N    3  
ATOM   3556  C  CA   . GLY A 1 46 ? 5.793   0.159   12.096  1.00 0.00 ? 467 GLY A CA   3  
ATOM   3557  C  C    . GLY A 1 46 ? 4.390   -0.413  12.146  1.00 0.00 ? 467 GLY A C    3  
ATOM   3558  O  O    . GLY A 1 46 ? 4.208   -1.629  12.126  1.00 0.00 ? 467 GLY A O    3  
ATOM   3559  H  H    . GLY A 1 46 ? 5.444   1.406   10.421  1.00 0.00 ? 467 GLY A H    3  
ATOM   3560  H  HA2  . GLY A 1 46 ? 6.457   -0.579  11.671  1.00 0.00 ? 467 GLY A HA2  3  
ATOM   3561  H  HA3  . GLY A 1 46 ? 6.115   0.380   13.103  1.00 0.00 ? 467 GLY A HA3  3  
ATOM   3562  N  N    . ASN A 1 47 ? 3.396   0.467   12.214  1.00 0.00 ? 468 ASN A N    3  
ATOM   3563  C  CA   . ASN A 1 47 ? 2.002   0.042   12.270  1.00 0.00 ? 468 ASN A CA   3  
ATOM   3564  C  C    . ASN A 1 47 ? 1.278   0.381   10.970  1.00 0.00 ? 468 ASN A C    3  
ATOM   3565  O  O    . ASN A 1 47 ? 1.585   1.379   10.318  1.00 0.00 ? 468 ASN A O    3  
ATOM   3566  C  CB   . ASN A 1 47 ? 1.292   0.707   13.451  1.00 0.00 ? 468 ASN A CB   3  
ATOM   3567  C  CG   . ASN A 1 47 ? 1.522   -0.034  14.754  1.00 0.00 ? 468 ASN A CG   3  
ATOM   3568  O  OD1  . ASN A 1 47 ? 2.456   0.269   15.496  1.00 0.00 ? 468 ASN A OD1  3  
ATOM   3569  N  ND2  . ASN A 1 47 ? 0.668   -1.010  15.038  1.00 0.00 ? 468 ASN A ND2  3  
ATOM   3570  H  H    . ASN A 1 47 ? 3.605   1.424   12.226  1.00 0.00 ? 468 ASN A H    3  
ATOM   3571  H  HA   . ASN A 1 47 ? 1.987   -1.028  12.408  1.00 0.00 ? 468 ASN A HA   3  
ATOM   3572  H  HB2  . ASN A 1 47 ? 1.660   1.716   13.563  1.00 0.00 ? 468 ASN A HB2  3  
ATOM   3573  H  HB3  . ASN A 1 47 ? 0.230   0.735   13.256  1.00 0.00 ? 468 ASN A HB3  3  
ATOM   3574  H  HD21 . ASN A 1 47 ? -0.052  -1.196  14.400  1.00 0.00 ? 468 ASN A HD21 3  
ATOM   3575  H  HD22 . ASN A 1 47 ? 0.793   -1.505  15.875  1.00 0.00 ? 468 ASN A HD22 3  
ATOM   3576  N  N    . CYS A 1 48 ? 0.314   -0.456  10.601  1.00 0.00 ? 469 CYS A N    3  
ATOM   3577  C  CA   . CYS A 1 48 ? -0.455  -0.246  9.380   1.00 0.00 ? 469 CYS A CA   3  
ATOM   3578  C  C    . CYS A 1 48 ? -1.838  0.314   9.698   1.00 0.00 ? 469 CYS A C    3  
ATOM   3579  O  O    . CYS A 1 48 ? -2.420  0.005   10.739  1.00 0.00 ? 469 CYS A O    3  
ATOM   3580  C  CB   . CYS A 1 48 ? -0.590  -1.559  8.606   1.00 0.00 ? 469 CYS A CB   3  
ATOM   3581  S  SG   . CYS A 1 48 ? -1.338  -1.375  6.955   1.00 0.00 ? 469 CYS A SG   3  
ATOM   3582  H  H    . CYS A 1 48 ? 0.115   -1.235  11.163  1.00 0.00 ? 469 CYS A H    3  
ATOM   3583  H  HA   . CYS A 1 48 ? 0.077   0.468   8.771   1.00 0.00 ? 469 CYS A HA   3  
ATOM   3584  H  HB2  . CYS A 1 48 ? 0.391   -1.993  8.475   1.00 0.00 ? 469 CYS A HB2  3  
ATOM   3585  H  HB3  . CYS A 1 48 ? -1.207  -2.241  9.173   1.00 0.00 ? 469 CYS A HB3  3  
ATOM   3586  N  N    . ILE A 1 49 ? -2.359  1.138   8.796   1.00 0.00 ? 470 ILE A N    3  
ATOM   3587  C  CA   . ILE A 1 49 ? -3.673  1.740   8.979   1.00 0.00 ? 470 ILE A CA   3  
ATOM   3588  C  C    . ILE A 1 49 ? -4.779  0.700   8.835   1.00 0.00 ? 470 ILE A C    3  
ATOM   3589  O  O    . ILE A 1 49 ? -5.737  0.685   9.607   1.00 0.00 ? 470 ILE A O    3  
ATOM   3590  C  CB   . ILE A 1 49 ? -3.918  2.877   7.970   1.00 0.00 ? 470 ILE A CB   3  
ATOM   3591  C  CG1  . ILE A 1 49 ? -5.284  3.521   8.215   1.00 0.00 ? 470 ILE A CG1  3  
ATOM   3592  C  CG2  . ILE A 1 49 ? -3.823  2.350   6.545   1.00 0.00 ? 470 ILE A CG2  3  
ATOM   3593  C  CD1  . ILE A 1 49 ? -5.291  4.505   9.363   1.00 0.00 ? 470 ILE A CD1  3  
ATOM   3594  H  H    . ILE A 1 49 ? -1.847  1.346   7.987   1.00 0.00 ? 470 ILE A H    3  
ATOM   3595  H  HA   . ILE A 1 49 ? -3.713  2.156   9.976   1.00 0.00 ? 470 ILE A HA   3  
ATOM   3596  H  HB   . ILE A 1 49 ? -3.148  3.620   8.105   1.00 0.00 ? 470 ILE A HB   3  
ATOM   3597  H  HG12 . ILE A 1 49 ? -5.592  4.047   7.325   1.00 0.00 ? 470 ILE A HG12 3  
ATOM   3598  H  HG13 . ILE A 1 49 ? -6.004  2.746   8.437   1.00 0.00 ? 470 ILE A HG13 3  
ATOM   3599  H  HG21 . ILE A 1 49 ? -3.917  3.172   5.851   1.00 0.00 ? 470 ILE A HG21 3  
ATOM   3600  H  HG22 . ILE A 1 49 ? -2.867  1.868   6.404   1.00 0.00 ? 470 ILE A HG22 3  
ATOM   3601  H  HG23 . ILE A 1 49 ? -4.615  1.638   6.371   1.00 0.00 ? 470 ILE A HG23 3  
ATOM   3602  H  HD11 . ILE A 1 49 ? -5.826  5.397   9.071   1.00 0.00 ? 470 ILE A HD11 3  
ATOM   3603  H  HD12 . ILE A 1 49 ? -5.774  4.058   10.219  1.00 0.00 ? 470 ILE A HD12 3  
ATOM   3604  H  HD13 . ILE A 1 49 ? -4.274  4.765   9.620   1.00 0.00 ? 470 ILE A HD13 3  
ATOM   3605  N  N    . ASN A 1 50 ? -4.639  -0.171  7.840   1.00 0.00 ? 471 ASN A N    3  
ATOM   3606  C  CA   . ASN A 1 50 ? -5.625  -1.217  7.595   1.00 0.00 ? 471 ASN A CA   3  
ATOM   3607  C  C    . ASN A 1 50 ? -5.906  -2.009  8.867   1.00 0.00 ? 471 ASN A C    3  
ATOM   3608  O  O    . ASN A 1 50 ? -7.054  -2.135  9.292   1.00 0.00 ? 471 ASN A O    3  
ATOM   3609  C  CB   . ASN A 1 50 ? -5.138  -2.158  6.491   1.00 0.00 ? 471 ASN A CB   3  
ATOM   3610  C  CG   . ASN A 1 50 ? -6.275  -2.911  5.829   1.00 0.00 ? 471 ASN A CG   3  
ATOM   3611  O  OD1  . ASN A 1 50 ? -6.831  -3.848  6.402   1.00 0.00 ? 471 ASN A OD1  3  
ATOM   3612  N  ND2  . ASN A 1 50 ? -6.627  -2.503  4.616   1.00 0.00 ? 471 ASN A ND2  3  
ATOM   3613  H  H    . ASN A 1 50 ? -3.853  -0.109  7.257   1.00 0.00 ? 471 ASN A H    3  
ATOM   3614  H  HA   . ASN A 1 50 ? -6.539  -0.741  7.272   1.00 0.00 ? 471 ASN A HA   3  
ATOM   3615  H  HB2  . ASN A 1 50 ? -4.625  -1.581  5.735   1.00 0.00 ? 471 ASN A HB2  3  
ATOM   3616  H  HB3  . ASN A 1 50 ? -4.453  -2.877  6.916   1.00 0.00 ? 471 ASN A HB3  3  
ATOM   3617  H  HD21 . ASN A 1 50 ? -6.140  -1.749  4.221   1.00 0.00 ? 471 ASN A HD21 3  
ATOM   3618  H  HD22 . ASN A 1 50 ? -7.361  -2.972  4.165   1.00 0.00 ? 471 ASN A HD22 3  
ATOM   3619  N  N    . GLY A 1 51 ? -4.848  -2.542  9.472   1.00 0.00 ? 472 GLY A N    3  
ATOM   3620  C  CA   . GLY A 1 51 ? -5.002  -3.315  10.691  1.00 0.00 ? 472 GLY A CA   3  
ATOM   3621  C  C    . GLY A 1 51 ? -4.468  -4.727  10.552  1.00 0.00 ? 472 GLY A C    3  
ATOM   3622  O  O    . GLY A 1 51 ? -3.571  -4.983  9.749   1.00 0.00 ? 472 GLY A O    3  
ATOM   3623  H  H    . GLY A 1 51 ? -3.957  -2.409  9.088   1.00 0.00 ? 472 GLY A H    3  
ATOM   3624  H  HA2  . GLY A 1 51 ? -4.472  -2.817  11.489  1.00 0.00 ? 472 GLY A HA2  3  
ATOM   3625  H  HA3  . GLY A 1 51 ? -6.051  -3.363  10.943  1.00 0.00 ? 472 GLY A HA3  3  
ATOM   3626  N  N    . ASP A 1 52 ? -5.019  -5.646  11.338  1.00 0.00 ? 473 ASP A N    3  
ATOM   3627  C  CA   . ASP A 1 52 ? -4.592  -7.040  11.300  1.00 0.00 ? 473 ASP A CA   3  
ATOM   3628  C  C    . ASP A 1 52 ? -5.139  -7.742  10.061  1.00 0.00 ? 473 ASP A C    3  
ATOM   3629  O  O    . ASP A 1 52 ? -4.631  -8.786  9.653   1.00 0.00 ? 473 ASP A O    3  
ATOM   3630  C  CB   . ASP A 1 52 ? -5.055  -7.771  12.561  1.00 0.00 ? 473 ASP A CB   3  
ATOM   3631  C  CG   . ASP A 1 52 ? -4.218  -7.419  13.775  1.00 0.00 ? 473 ASP A CG   3  
ATOM   3632  O  OD1  . ASP A 1 52 ? -2.974  -7.423  13.660  1.00 0.00 ? 473 ASP A OD1  3  
ATOM   3633  O  OD2  . ASP A 1 52 ? -4.806  -7.138  14.840  1.00 0.00 ? 473 ASP A OD2  3  
ATOM   3634  H  H    . ASP A 1 52 ? -5.730  -5.380  11.958  1.00 0.00 ? 473 ASP A H    3  
ATOM   3635  H  HA   . ASP A 1 52 ? -3.514  -7.055  11.261  1.00 0.00 ? 473 ASP A HA   3  
ATOM   3636  H  HB2  . ASP A 1 52 ? -6.082  -7.507  12.767  1.00 0.00 ? 473 ASP A HB2  3  
ATOM   3637  H  HB3  . ASP A 1 52 ? -4.988  -8.836  12.396  1.00 0.00 ? 473 ASP A HB3  3  
ATOM   3638  N  N    . ASP A 1 53 ? -6.176  -7.161  9.467   1.00 0.00 ? 474 ASP A N    3  
ATOM   3639  C  CA   . ASP A 1 53 ? -6.791  -7.731  8.274   1.00 0.00 ? 474 ASP A CA   3  
ATOM   3640  C  C    . ASP A 1 53 ? -6.332  -6.993  7.021   1.00 0.00 ? 474 ASP A C    3  
ATOM   3641  O  O    . ASP A 1 53 ? -7.132  -6.700  6.131   1.00 0.00 ? 474 ASP A O    3  
ATOM   3642  C  CB   . ASP A 1 53 ? -8.316  -7.675  8.384   1.00 0.00 ? 474 ASP A CB   3  
ATOM   3643  C  CG   . ASP A 1 53 ? -8.813  -6.318  8.842   1.00 0.00 ? 474 ASP A CG   3  
ATOM   3644  O  OD1  . ASP A 1 53 ? -8.934  -6.113  10.068  1.00 0.00 ? 474 ASP A OD1  3  
ATOM   3645  O  OD2  . ASP A 1 53 ? -9.081  -5.461  7.974   1.00 0.00 ? 474 ASP A OD2  3  
ATOM   3646  H  H    . ASP A 1 53 ? -6.536  -6.329  9.840   1.00 0.00 ? 474 ASP A H    3  
ATOM   3647  H  HA   . ASP A 1 53 ? -6.483  -8.763  8.202   1.00 0.00 ? 474 ASP A HA   3  
ATOM   3648  H  HB2  . ASP A 1 53 ? -8.748  -7.888  7.418   1.00 0.00 ? 474 ASP A HB2  3  
ATOM   3649  H  HB3  . ASP A 1 53 ? -8.646  -8.418  9.094   1.00 0.00 ? 474 ASP A HB3  3  
ATOM   3650  N  N    . CYS A 1 54 ? -5.039  -6.694  6.957   1.00 0.00 ? 475 CYS A N    3  
ATOM   3651  C  CA   . CYS A 1 54 ? -4.472  -5.989  5.814   1.00 0.00 ? 475 CYS A CA   3  
ATOM   3652  C  C    . CYS A 1 54 ? -4.278  -6.935  4.632   1.00 0.00 ? 475 CYS A C    3  
ATOM   3653  O  O    . CYS A 1 54 ? -3.932  -8.103  4.810   1.00 0.00 ? 475 CYS A O    3  
ATOM   3654  C  CB   . CYS A 1 54 ? -3.135  -5.349  6.194   1.00 0.00 ? 475 CYS A CB   3  
ATOM   3655  S  SG   . CYS A 1 54 ? -2.378  -4.362  4.863   1.00 0.00 ? 475 CYS A SG   3  
ATOM   3656  H  H    . CYS A 1 54 ? -4.450  -6.954  7.697   1.00 0.00 ? 475 CYS A H    3  
ATOM   3657  H  HA   . CYS A 1 54 ? -5.164  -5.212  5.526   1.00 0.00 ? 475 CYS A HA   3  
ATOM   3658  H  HB2  . CYS A 1 54 ? -3.285  -4.696  7.041   1.00 0.00 ? 475 CYS A HB2  3  
ATOM   3659  H  HB3  . CYS A 1 54 ? -2.437  -6.127  6.465   1.00 0.00 ? 475 CYS A HB3  3  
ATOM   3660  N  N    . MET A 1 55 ? -4.502  -6.422  3.427   1.00 0.00 ? 476 MET A N    3  
ATOM   3661  C  CA   . MET A 1 55 ? -4.351  -7.221  2.217   1.00 0.00 ? 476 MET A CA   3  
ATOM   3662  C  C    . MET A 1 55 ? -2.885  -7.310  1.804   1.00 0.00 ? 476 MET A C    3  
ATOM   3663  O  O    . MET A 1 55 ? -2.570  -7.623  0.656   1.00 0.00 ? 476 MET A O    3  
ATOM   3664  C  CB   . MET A 1 55 ? -5.177  -6.621  1.077   1.00 0.00 ? 476 MET A CB   3  
ATOM   3665  C  CG   . MET A 1 55 ? -4.795  -5.190  0.738   1.00 0.00 ? 476 MET A CG   3  
ATOM   3666  S  SD   . MET A 1 55 ? -3.315  -5.090  -0.287  1.00 0.00 ? 476 MET A SD   3  
ATOM   3667  C  CE   . MET A 1 55 ? -3.909  -5.817  -1.812  1.00 0.00 ? 476 MET A CE   3  
ATOM   3668  H  H    . MET A 1 55 ? -4.776  -5.484  3.349   1.00 0.00 ? 476 MET A H    3  
ATOM   3669  H  HA   . MET A 1 55 ? -4.714  -8.215  2.428   1.00 0.00 ? 476 MET A HA   3  
ATOM   3670  H  HB2  . MET A 1 55 ? -5.042  -7.226  0.193   1.00 0.00 ? 476 MET A HB2  3  
ATOM   3671  H  HB3  . MET A 1 55 ? -6.220  -6.636  1.358   1.00 0.00 ? 476 MET A HB3  3  
ATOM   3672  H  HG2  . MET A 1 55 ? -5.615  -4.729  0.207   1.00 0.00 ? 476 MET A HG2  3  
ATOM   3673  H  HG3  . MET A 1 55 ? -4.618  -4.652  1.657   1.00 0.00 ? 476 MET A HG3  3  
ATOM   3674  H  HE1  . MET A 1 55 ? -3.345  -5.422  -2.643  1.00 0.00 ? 476 MET A HE1  3  
ATOM   3675  H  HE2  . MET A 1 55 ? -3.786  -6.890  -1.770  1.00 0.00 ? 476 MET A HE2  3  
ATOM   3676  H  HE3  . MET A 1 55 ? -4.955  -5.579  -1.940  1.00 0.00 ? 476 MET A HE3  3  
ATOM   3677  N  N    . PHE A 1 56 ? -1.991  -7.034  2.749   1.00 0.00 ? 477 PHE A N    3  
ATOM   3678  C  CA   . PHE A 1 56 ? -0.558  -7.082  2.483   1.00 0.00 ? 477 PHE A CA   3  
ATOM   3679  C  C    . PHE A 1 56 ? 0.152   -7.983  3.489   1.00 0.00 ? 477 PHE A C    3  
ATOM   3680  O  O    . PHE A 1 56 ? -0.362  -8.241  4.578   1.00 0.00 ? 477 PHE A O    3  
ATOM   3681  C  CB   . PHE A 1 56 ? 0.039   -5.674  2.532   1.00 0.00 ? 477 PHE A CB   3  
ATOM   3682  C  CG   . PHE A 1 56 ? -0.205  -4.876  1.283   1.00 0.00 ? 477 PHE A CG   3  
ATOM   3683  C  CD1  . PHE A 1 56 ? 0.237   -5.336  0.053   1.00 0.00 ? 477 PHE A CD1  3  
ATOM   3684  C  CD2  . PHE A 1 56 ? -0.876  -3.665  1.339   1.00 0.00 ? 477 PHE A CD2  3  
ATOM   3685  C  CE1  . PHE A 1 56 ? 0.014   -4.604  -1.098  1.00 0.00 ? 477 PHE A CE1  3  
ATOM   3686  C  CE2  . PHE A 1 56 ? -1.103  -2.929  0.191   1.00 0.00 ? 477 PHE A CE2  3  
ATOM   3687  C  CZ   . PHE A 1 56 ? -0.656  -3.399  -1.028  1.00 0.00 ? 477 PHE A CZ   3  
ATOM   3688  H  H    . PHE A 1 56 ? -2.303  -6.791  3.646   1.00 0.00 ? 477 PHE A H    3  
ATOM   3689  H  HA   . PHE A 1 56 ? -0.419  -7.489  1.493   1.00 0.00 ? 477 PHE A HA   3  
ATOM   3690  H  HB2  . PHE A 1 56 ? -0.396  -5.135  3.360   1.00 0.00 ? 477 PHE A HB2  3  
ATOM   3691  H  HB3  . PHE A 1 56 ? 1.106   -5.749  2.676   1.00 0.00 ? 477 PHE A HB3  3  
ATOM   3692  H  HD1  . PHE A 1 56 ? 0.762   -6.280  -0.002  1.00 0.00 ? 477 PHE A HD1  3  
ATOM   3693  H  HD2  . PHE A 1 56 ? -1.225  -3.296  2.292   1.00 0.00 ? 477 PHE A HD2  3  
ATOM   3694  H  HE1  . PHE A 1 56 ? 0.364   -4.975  -2.050  1.00 0.00 ? 477 PHE A HE1  3  
ATOM   3695  H  HE2  . PHE A 1 56 ? -1.626  -1.986  0.249   1.00 0.00 ? 477 PHE A HE2  3  
ATOM   3696  H  HZ   . PHE A 1 56 ? -0.832  -2.826  -1.926  1.00 0.00 ? 477 PHE A HZ   3  
ATOM   3697  N  N    . SER A 1 57 ? 1.335   -8.459  3.116   1.00 0.00 ? 478 SER A N    3  
ATOM   3698  C  CA   . SER A 1 57 ? 2.115   -9.335  3.983   1.00 0.00 ? 478 SER A CA   3  
ATOM   3699  C  C    . SER A 1 57 ? 2.788   -8.538  5.097   1.00 0.00 ? 478 SER A C    3  
ATOM   3700  O  O    . SER A 1 57 ? 3.582   -7.634  4.836   1.00 0.00 ? 478 SER A O    3  
ATOM   3701  C  CB   . SER A 1 57 ? 3.170   -10.087 3.169   1.00 0.00 ? 478 SER A CB   3  
ATOM   3702  O  OG   . SER A 1 57 ? 2.589   -11.164 2.454   1.00 0.00 ? 478 SER A OG   3  
ATOM   3703  H  H    . SER A 1 57 ? 1.691   -8.218  2.235   1.00 0.00 ? 478 SER A H    3  
ATOM   3704  H  HA   . SER A 1 57 ? 1.438   -10.050 4.427   1.00 0.00 ? 478 SER A HA   3  
ATOM   3705  H  HB2  . SER A 1 57 ? 3.628   -9.409  2.466   1.00 0.00 ? 478 SER A HB2  3  
ATOM   3706  H  HB3  . SER A 1 57 ? 3.924   -10.478 3.837   1.00 0.00 ? 478 SER A HB3  3  
ATOM   3707  H  HG   . SER A 1 57 ? 2.052   -11.691 3.049   1.00 0.00 ? 478 SER A HG   3  
ATOM   3708  N  N    . HIS A 1 58 ? 2.464   -8.880  6.340   1.00 0.00 ? 479 HIS A N    3  
ATOM   3709  C  CA   . HIS A 1 58 ? 3.037   -8.197  7.494   1.00 0.00 ? 479 HIS A CA   3  
ATOM   3710  C  C    . HIS A 1 58 ? 4.164   -9.023  8.109   1.00 0.00 ? 479 HIS A C    3  
ATOM   3711  O  O    . HIS A 1 58 ? 4.376   -8.995  9.322   1.00 0.00 ? 479 HIS A O    3  
ATOM   3712  C  CB   . HIS A 1 58 ? 1.957   -7.927  8.542   1.00 0.00 ? 479 HIS A CB   3  
ATOM   3713  C  CG   . HIS A 1 58 ? 1.110   -6.731  8.234   1.00 0.00 ? 479 HIS A CG   3  
ATOM   3714  N  ND1  . HIS A 1 58 ? 0.318   -6.107  9.175   1.00 0.00 ? 479 HIS A ND1  3  
ATOM   3715  C  CD2  . HIS A 1 58 ? 0.935   -6.043  7.082   1.00 0.00 ? 479 HIS A CD2  3  
ATOM   3716  C  CE1  . HIS A 1 58 ? -0.308  -5.088  8.614   1.00 0.00 ? 479 HIS A CE1  3  
ATOM   3717  N  NE2  . HIS A 1 58 ? 0.049   -5.027  7.344   1.00 0.00 ? 479 HIS A NE2  3  
ATOM   3718  H  H    . HIS A 1 58 ? 1.825   -9.609  6.484   1.00 0.00 ? 479 HIS A H    3  
ATOM   3719  H  HA   . HIS A 1 58 ? 3.441   -7.256  7.156   1.00 0.00 ? 479 HIS A HA   3  
ATOM   3720  H  HB2  . HIS A 1 58 ? 1.305   -8.786  8.607   1.00 0.00 ? 479 HIS A HB2  3  
ATOM   3721  H  HB3  . HIS A 1 58 ? 2.427   -7.764  9.501   1.00 0.00 ? 479 HIS A HB3  3  
ATOM   3722  H  HD1  . HIS A 1 58 ? 0.228   -6.373  10.113  1.00 0.00 ? 479 HIS A HD1  3  
ATOM   3723  H  HD2  . HIS A 1 58 ? 1.405   -6.253  6.131   1.00 0.00 ? 479 HIS A HD2  3  
ATOM   3724  H  HE1  . HIS A 1 58 ? -0.995  -4.418  9.109   1.00 0.00 ? 479 HIS A HE1  3  
ATOM   3725  N  N    . ASP A 1 59 ? 4.881   -9.756  7.266   1.00 0.00 ? 480 ASP A N    3  
ATOM   3726  C  CA   . ASP A 1 59 ? 5.986   -10.589 7.726   1.00 0.00 ? 480 ASP A CA   3  
ATOM   3727  C  C    . ASP A 1 59 ? 7.225   -9.744  8.003   1.00 0.00 ? 480 ASP A C    3  
ATOM   3728  O  O    . ASP A 1 59 ? 7.350   -8.611  7.538   1.00 0.00 ? 480 ASP A O    3  
ATOM   3729  C  CB   . ASP A 1 59 ? 6.309   -11.665 6.688   1.00 0.00 ? 480 ASP A CB   3  
ATOM   3730  C  CG   . ASP A 1 59 ? 5.520   -12.940 6.912   1.00 0.00 ? 480 ASP A CG   3  
ATOM   3731  O  OD1  . ASP A 1 59 ? 5.342   -13.329 8.085   1.00 0.00 ? 480 ASP A OD1  3  
ATOM   3732  O  OD2  . ASP A 1 59 ? 5.081   -13.550 5.914   1.00 0.00 ? 480 ASP A OD2  3  
ATOM   3733  H  H    . ASP A 1 59 ? 4.663   -9.736  6.310   1.00 0.00 ? 480 ASP A H    3  
ATOM   3734  H  HA   . ASP A 1 59 ? 5.680   -11.068 8.644   1.00 0.00 ? 480 ASP A HA   3  
ATOM   3735  H  HB2  . ASP A 1 59 ? 6.075   -11.288 5.703   1.00 0.00 ? 480 ASP A HB2  3  
ATOM   3736  H  HB3  . ASP A 1 59 ? 7.361   -11.901 6.739   1.00 0.00 ? 480 ASP A HB3  3  
ATOM   3737  N  N    . PRO A 1 60 ? 8.165   -10.306 8.778   1.00 0.00 ? 481 PRO A N    3  
ATOM   3738  C  CA   . PRO A 1 60 ? 9.411   -9.621  9.135   1.00 0.00 ? 481 PRO A CA   3  
ATOM   3739  C  C    . PRO A 1 60 ? 10.349  -9.466  7.942   1.00 0.00 ? 481 PRO A C    3  
ATOM   3740  O  O    . PRO A 1 60 ? 10.815  -10.455 7.374   1.00 0.00 ? 481 PRO A O    3  
ATOM   3741  C  CB   . PRO A 1 60 ? 10.032  -10.541 10.188  1.00 0.00 ? 481 PRO A CB   3  
ATOM   3742  C  CG   . PRO A 1 60 ? 9.471   -11.889 9.892   1.00 0.00 ? 481 PRO A CG   3  
ATOM   3743  C  CD   . PRO A 1 60 ? 8.082   -11.653 9.366   1.00 0.00 ? 481 PRO A CD   3  
ATOM   3744  H  HA   . PRO A 1 60 ? 9.220   -8.651  9.569   1.00 0.00 ? 481 PRO A HA   3  
ATOM   3745  H  HB2  . PRO A 1 60 ? 11.109  -10.530 10.089  1.00 0.00 ? 481 PRO A HB2  3  
ATOM   3746  H  HB3  . PRO A 1 60 ? 9.752   -10.205 11.175  1.00 0.00 ? 481 PRO A HB3  3  
ATOM   3747  H  HG2  . PRO A 1 60 ? 10.076  -12.383 9.147   1.00 0.00 ? 481 PRO A HG2  3  
ATOM   3748  H  HG3  . PRO A 1 60 ? 9.434   -12.478 10.797  1.00 0.00 ? 481 PRO A HG3  3  
ATOM   3749  H  HD2  . PRO A 1 60 ? 7.834   -12.388 8.615   1.00 0.00 ? 481 PRO A HD2  3  
ATOM   3750  H  HD3  . PRO A 1 60 ? 7.364   -11.678 10.173  1.00 0.00 ? 481 PRO A HD3  3  
ATOM   3751  N  N    . LEU A 1 61 ? 10.621  -8.221  7.568   1.00 0.00 ? 482 LEU A N    3  
ATOM   3752  C  CA   . LEU A 1 61 ? 11.505  -7.937  6.442   1.00 0.00 ? 482 LEU A CA   3  
ATOM   3753  C  C    . LEU A 1 61 ? 12.710  -8.872  6.446   1.00 0.00 ? 482 LEU A C    3  
ATOM   3754  O  O    . LEU A 1 61 ? 13.150  -9.333  7.500   1.00 0.00 ? 482 LEU A O    3  
ATOM   3755  C  CB   . LEU A 1 61 ? 11.974  -6.482  6.492   1.00 0.00 ? 482 LEU A CB   3  
ATOM   3756  C  CG   . LEU A 1 61 ? 10.981  -5.438  5.980   1.00 0.00 ? 482 LEU A CG   3  
ATOM   3757  C  CD1  . LEU A 1 61 ? 11.543  -4.036  6.155   1.00 0.00 ? 482 LEU A CD1  3  
ATOM   3758  C  CD2  . LEU A 1 61 ? 10.637  -5.699  4.521   1.00 0.00 ? 482 LEU A CD2  3  
ATOM   3759  H  H    . LEU A 1 61 ? 10.220  -7.475  8.059   1.00 0.00 ? 482 LEU A H    3  
ATOM   3760  H  HA   . LEU A 1 61 ? 10.944  -8.095  5.533   1.00 0.00 ? 482 LEU A HA   3  
ATOM   3761  H  HB2  . LEU A 1 61 ? 12.204  -6.244  7.519   1.00 0.00 ? 482 LEU A HB2  3  
ATOM   3762  H  HB3  . LEU A 1 61 ? 12.873  -6.405  5.896   1.00 0.00 ? 482 LEU A HB3  3  
ATOM   3763  H  HG   . LEU A 1 61 ? 10.068  -5.506  6.557   1.00 0.00 ? 482 LEU A HG   3  
ATOM   3764  H  HD11 . LEU A 1 61 ? 12.203  -4.016  7.008   1.00 0.00 ? 482 LEU A HD11 3  
ATOM   3765  H  HD12 . LEU A 1 61 ? 10.731  -3.340  6.311   1.00 0.00 ? 482 LEU A HD12 3  
ATOM   3766  H  HD13 . LEU A 1 61 ? 12.091  -3.755  5.268   1.00 0.00 ? 482 LEU A HD13 3  
ATOM   3767  H  HD21 . LEU A 1 61 ? 11.320  -6.432  4.117   1.00 0.00 ? 482 LEU A HD21 3  
ATOM   3768  H  HD22 . LEU A 1 61 ? 10.723  -4.780  3.961   1.00 0.00 ? 482 LEU A HD22 3  
ATOM   3769  H  HD23 . LEU A 1 61 ? 9.626   -6.072  4.450   1.00 0.00 ? 482 LEU A HD23 3  
ATOM   3770  N  N    . THR A 1 62 ? 13.241  -9.149  5.259   1.00 0.00 ? 483 THR A N    3  
ATOM   3771  C  CA   . THR A 1 62 ? 14.396  -10.028 5.125   1.00 0.00 ? 483 THR A CA   3  
ATOM   3772  C  C    . THR A 1 62 ? 15.445  -9.421  4.200   1.00 0.00 ? 483 THR A C    3  
ATOM   3773  O  O    . THR A 1 62 ? 15.125  -8.605  3.337   1.00 0.00 ? 483 THR A O    3  
ATOM   3774  C  CB   . THR A 1 62 ? 13.989  -11.411 4.584   1.00 0.00 ? 483 THR A CB   3  
ATOM   3775  O  OG1  . THR A 1 62 ? 13.413  -11.277 3.280   1.00 0.00 ? 483 THR A OG1  3  
ATOM   3776  C  CG2  . THR A 1 62 ? 12.994  -12.086 5.516   1.00 0.00 ? 483 THR A CG2  3  
ATOM   3777  H  H    . THR A 1 62 ? 12.846  -8.752  4.455   1.00 0.00 ? 483 THR A H    3  
ATOM   3778  H  HA   . THR A 1 62 ? 14.829  -10.162 6.106   1.00 0.00 ? 483 THR A HA   3  
ATOM   3779  H  HB   . THR A 1 62 ? 14.873  -12.029 4.516   1.00 0.00 ? 483 THR A HB   3  
ATOM   3780  H  HG1  . THR A 1 62 ? 12.796  -11.997 3.126   1.00 0.00 ? 483 THR A HG1  3  
ATOM   3781  H  HG21 . THR A 1 62 ? 13.472  -12.295 6.462   1.00 0.00 ? 483 THR A HG21 3  
ATOM   3782  H  HG22 . THR A 1 62 ? 12.655  -13.010 5.072   1.00 0.00 ? 483 THR A HG22 3  
ATOM   3783  H  HG23 . THR A 1 62 ? 12.151  -11.432 5.676   1.00 0.00 ? 483 THR A HG23 3  
ATOM   3784  N  N    . GLU A 1 63 ? 16.697  -9.826  4.387   1.00 0.00 ? 484 GLU A N    3  
ATOM   3785  C  CA   . GLU A 1 63 ? 17.793  -9.321  3.568   1.00 0.00 ? 484 GLU A CA   3  
ATOM   3786  C  C    . GLU A 1 63 ? 17.370  -9.204  2.107   1.00 0.00 ? 484 GLU A C    3  
ATOM   3787  O  O    . GLU A 1 63 ? 17.821  -8.312  1.389   1.00 0.00 ? 484 GLU A O    3  
ATOM   3788  C  CB   . GLU A 1 63 ? 19.012  -10.237 3.686   1.00 0.00 ? 484 GLU A CB   3  
ATOM   3789  C  CG   . GLU A 1 63 ? 18.856  -11.556 2.948   1.00 0.00 ? 484 GLU A CG   3  
ATOM   3790  C  CD   . GLU A 1 63 ? 19.968  -12.537 3.265   1.00 0.00 ? 484 GLU A CD   3  
ATOM   3791  O  OE1  . GLU A 1 63 ? 21.144  -12.203 3.014   1.00 0.00 ? 484 GLU A OE1  3  
ATOM   3792  O  OE2  . GLU A 1 63 ? 19.661  -13.640 3.764   1.00 0.00 ? 484 GLU A OE2  3  
ATOM   3793  H  H    . GLU A 1 63 ? 16.889  -10.479 5.092   1.00 0.00 ? 484 GLU A H    3  
ATOM   3794  H  HA   . GLU A 1 63 ? 18.055  -8.340  3.934   1.00 0.00 ? 484 GLU A HA   3  
ATOM   3795  H  HB2  . GLU A 1 63 ? 19.874  -9.724  3.286   1.00 0.00 ? 484 GLU A HB2  3  
ATOM   3796  H  HB3  . GLU A 1 63 ? 19.186  -10.452 4.730   1.00 0.00 ? 484 GLU A HB3  3  
ATOM   3797  H  HG2  . GLU A 1 63 ? 17.913  -12.002 3.229   1.00 0.00 ? 484 GLU A HG2  3  
ATOM   3798  H  HG3  . GLU A 1 63 ? 18.858  -11.362 1.886   1.00 0.00 ? 484 GLU A HG3  3  
ATOM   3799  N  N    . GLU A 1 64 ? 16.502  -10.112 1.673   1.00 0.00 ? 485 GLU A N    3  
ATOM   3800  C  CA   . GLU A 1 64 ? 16.020  -10.112 0.297   1.00 0.00 ? 485 GLU A CA   3  
ATOM   3801  C  C    . GLU A 1 64 ? 14.913  -9.077  0.108   1.00 0.00 ? 485 GLU A C    3  
ATOM   3802  O  O    . GLU A 1 64 ? 15.131  -8.019  -0.482  1.00 0.00 ? 485 GLU A O    3  
ATOM   3803  C  CB   . GLU A 1 64 ? 15.505  -11.500 -0.087  1.00 0.00 ? 485 GLU A CB   3  
ATOM   3804  C  CG   . GLU A 1 64 ? 16.577  -12.407 -0.668  1.00 0.00 ? 485 GLU A CG   3  
ATOM   3805  C  CD   . GLU A 1 64 ? 15.996  -13.614 -1.381  1.00 0.00 ? 485 GLU A CD   3  
ATOM   3806  O  OE1  . GLU A 1 64 ? 14.840  -13.530 -1.844  1.00 0.00 ? 485 GLU A OE1  3  
ATOM   3807  O  OE2  . GLU A 1 64 ? 16.700  -14.642 -1.474  1.00 0.00 ? 485 GLU A OE2  3  
ATOM   3808  H  H    . GLU A 1 64 ? 16.178  -10.799 2.293   1.00 0.00 ? 485 GLU A H    3  
ATOM   3809  H  HA   . GLU A 1 64 ? 16.849  -9.855  -0.345  1.00 0.00 ? 485 GLU A HA   3  
ATOM   3810  H  HB2  . GLU A 1 64 ? 15.097  -11.976 0.793   1.00 0.00 ? 485 GLU A HB2  3  
ATOM   3811  H  HB3  . GLU A 1 64 ? 14.720  -11.390 -0.821  1.00 0.00 ? 485 GLU A HB3  3  
ATOM   3812  H  HG2  . GLU A 1 64 ? 17.165  -11.841 -1.374  1.00 0.00 ? 485 GLU A HG2  3  
ATOM   3813  H  HG3  . GLU A 1 64 ? 17.212  -12.752 0.134   1.00 0.00 ? 485 GLU A HG3  3  
ATOM   3814  N  N    . THR A 1 65 ? 13.725  -9.391  0.615   1.00 0.00 ? 486 THR A N    3  
ATOM   3815  C  CA   . THR A 1 65 ? 12.584  -8.492  0.501   1.00 0.00 ? 486 THR A CA   3  
ATOM   3816  C  C    . THR A 1 65 ? 12.969  -7.065  0.875   1.00 0.00 ? 486 THR A C    3  
ATOM   3817  O  O    . THR A 1 65 ? 12.736  -6.128  0.112   1.00 0.00 ? 486 THR A O    3  
ATOM   3818  C  CB   . THR A 1 65 ? 11.417  -8.948  1.398   1.00 0.00 ? 486 THR A CB   3  
ATOM   3819  O  OG1  . THR A 1 65 ? 11.882  -9.160  2.735   1.00 0.00 ? 486 THR A OG1  3  
ATOM   3820  C  CG2  . THR A 1 65 ? 10.793  -10.228 0.863   1.00 0.00 ? 486 THR A CG2  3  
ATOM   3821  H  H    . THR A 1 65 ? 13.614  -10.250 1.074   1.00 0.00 ? 486 THR A H    3  
ATOM   3822  H  HA   . THR A 1 65 ? 12.248  -8.506  -0.526  1.00 0.00 ? 486 THR A HA   3  
ATOM   3823  H  HB   . THR A 1 65 ? 10.664  -8.173  1.405   1.00 0.00 ? 486 THR A HB   3  
ATOM   3824  H  HG1  . THR A 1 65 ? 12.688  -9.682  2.716   1.00 0.00 ? 486 THR A HG1  3  
ATOM   3825  H  HG21 . THR A 1 65 ? 10.752  -10.186 -0.215  1.00 0.00 ? 486 THR A HG21 3  
ATOM   3826  H  HG22 . THR A 1 65 ? 9.793   -10.333 1.258   1.00 0.00 ? 486 THR A HG22 3  
ATOM   3827  H  HG23 . THR A 1 65 ? 11.391  -11.074 1.167   1.00 0.00 ? 486 THR A HG23 3  
ATOM   3828  N  N    . ARG A 1 66 ? 13.561  -6.907  2.055   1.00 0.00 ? 487 ARG A N    3  
ATOM   3829  C  CA   . ARG A 1 66 ? 13.979  -5.594  2.530   1.00 0.00 ? 487 ARG A CA   3  
ATOM   3830  C  C    . ARG A 1 66 ? 14.597  -4.777  1.399   1.00 0.00 ? 487 ARG A C    3  
ATOM   3831  O  O    . ARG A 1 66 ? 14.299  -3.594  1.240   1.00 0.00 ? 487 ARG A O    3  
ATOM   3832  C  CB   . ARG A 1 66 ? 14.981  -5.737  3.677   1.00 0.00 ? 487 ARG A CB   3  
ATOM   3833  C  CG   . ARG A 1 66 ? 15.019  -4.536  4.607   1.00 0.00 ? 487 ARG A CG   3  
ATOM   3834  C  CD   . ARG A 1 66 ? 15.601  -3.313  3.914   1.00 0.00 ? 487 ARG A CD   3  
ATOM   3835  N  NE   . ARG A 1 66 ? 16.025  -2.293  4.869   1.00 0.00 ? 487 ARG A NE   3  
ATOM   3836  C  CZ   . ARG A 1 66 ? 17.159  -2.358  5.558   1.00 0.00 ? 487 ARG A CZ   3  
ATOM   3837  N  NH1  . ARG A 1 66 ? 17.978  -3.389  5.399   1.00 0.00 ? 487 ARG A NH1  3  
ATOM   3838  N  NH2  . ARG A 1 66 ? 17.476  -1.391  6.409   1.00 0.00 ? 487 ARG A NH2  3  
ATOM   3839  H  H    . ARG A 1 66 ? 13.721  -7.692  2.619   1.00 0.00 ? 487 ARG A H    3  
ATOM   3840  H  HA   . ARG A 1 66 ? 13.102  -5.078  2.893   1.00 0.00 ? 487 ARG A HA   3  
ATOM   3841  H  HB2  . ARG A 1 66 ? 14.721  -6.608  4.260   1.00 0.00 ? 487 ARG A HB2  3  
ATOM   3842  H  HB3  . ARG A 1 66 ? 15.968  -5.875  3.261   1.00 0.00 ? 487 ARG A HB3  3  
ATOM   3843  H  HG2  . ARG A 1 66 ? 14.013  -4.309  4.928   1.00 0.00 ? 487 ARG A HG2  3  
ATOM   3844  H  HG3  . ARG A 1 66 ? 15.628  -4.777  5.465   1.00 0.00 ? 487 ARG A HG3  3  
ATOM   3845  H  HD2  . ARG A 1 66 ? 16.454  -3.620  3.327   1.00 0.00 ? 487 ARG A HD2  3  
ATOM   3846  H  HD3  . ARG A 1 66 ? 14.849  -2.893  3.263   1.00 0.00 ? 487 ARG A HD3  3  
ATOM   3847  H  HE   . ARG A 1 66 ? 15.435  -1.523  5.003   1.00 0.00 ? 487 ARG A HE   3  
ATOM   3848  H  HH11 . ARG A 1 66 ? 17.742  -4.119  4.758   1.00 0.00 ? 487 ARG A HH11 3  
ATOM   3849  H  HH12 . ARG A 1 66 ? 18.831  -3.435  5.918   1.00 0.00 ? 487 ARG A HH12 3  
ATOM   3850  H  HH21 . ARG A 1 66 ? 16.862  -0.612  6.532   1.00 0.00 ? 487 ARG A HH21 3  
ATOM   3851  H  HH22 . ARG A 1 66 ? 18.329  -1.441  6.927   1.00 0.00 ? 487 ARG A HH22 3  
ATOM   3852  N  N    . GLU A 1 67 ? 15.460  -5.418  0.616   1.00 0.00 ? 488 GLU A N    3  
ATOM   3853  C  CA   . GLU A 1 67 ? 16.121  -4.751  -0.499  1.00 0.00 ? 488 GLU A CA   3  
ATOM   3854  C  C    . GLU A 1 67 ? 15.098  -4.223  -1.500  1.00 0.00 ? 488 GLU A C    3  
ATOM   3855  O  O    . GLU A 1 67 ? 15.265  -3.140  -2.063  1.00 0.00 ? 488 GLU A O    3  
ATOM   3856  C  CB   . GLU A 1 67 ? 17.086  -5.711  -1.197  1.00 0.00 ? 488 GLU A CB   3  
ATOM   3857  C  CG   . GLU A 1 67 ? 17.855  -5.075  -2.343  1.00 0.00 ? 488 GLU A CG   3  
ATOM   3858  C  CD   . GLU A 1 67 ? 17.010  -4.911  -3.592  1.00 0.00 ? 488 GLU A CD   3  
ATOM   3859  O  OE1  . GLU A 1 67 ? 16.611  -5.940  -4.176  1.00 0.00 ? 488 GLU A OE1  3  
ATOM   3860  O  OE2  . GLU A 1 67 ? 16.749  -3.755  -3.985  1.00 0.00 ? 488 GLU A OE2  3  
ATOM   3861  H  H    . GLU A 1 67 ? 15.657  -6.362  0.794   1.00 0.00 ? 488 GLU A H    3  
ATOM   3862  H  HA   . GLU A 1 67 ? 16.681  -3.918  -0.102  1.00 0.00 ? 488 GLU A HA   3  
ATOM   3863  H  HB2  . GLU A 1 67 ? 17.799  -6.077  -0.472  1.00 0.00 ? 488 GLU A HB2  3  
ATOM   3864  H  HB3  . GLU A 1 67 ? 16.524  -6.546  -1.588  1.00 0.00 ? 488 GLU A HB3  3  
ATOM   3865  H  HG2  . GLU A 1 67 ? 18.200  -4.100  -2.031  1.00 0.00 ? 488 GLU A HG2  3  
ATOM   3866  H  HG3  . GLU A 1 67 ? 18.705  -5.698  -2.580  1.00 0.00 ? 488 GLU A HG3  3  
ATOM   3867  N  N    . LEU A 1 68 ? 14.040  -4.996  -1.719  1.00 0.00 ? 489 LEU A N    3  
ATOM   3868  C  CA   . LEU A 1 68 ? 12.989  -4.607  -2.653  1.00 0.00 ? 489 LEU A CA   3  
ATOM   3869  C  C    . LEU A 1 68 ? 12.475  -3.205  -2.342  1.00 0.00 ? 489 LEU A C    3  
ATOM   3870  O  O    . LEU A 1 68 ? 12.644  -2.280  -3.138  1.00 0.00 ? 489 LEU A O    3  
ATOM   3871  C  CB   . LEU A 1 68 ? 11.835  -5.610  -2.599  1.00 0.00 ? 489 LEU A CB   3  
ATOM   3872  C  CG   . LEU A 1 68 ? 12.186  -7.056  -2.950  1.00 0.00 ? 489 LEU A CG   3  
ATOM   3873  C  CD1  . LEU A 1 68 ? 11.048  -7.990  -2.564  1.00 0.00 ? 489 LEU A CD1  3  
ATOM   3874  C  CD2  . LEU A 1 68 ? 12.503  -7.184  -4.432  1.00 0.00 ? 489 LEU A CD2  3  
ATOM   3875  H  H    . LEU A 1 68 ? 13.962  -5.847  -1.242  1.00 0.00 ? 489 LEU A H    3  
ATOM   3876  H  HA   . LEU A 1 68 ? 13.411  -4.610  -3.647  1.00 0.00 ? 489 LEU A HA   3  
ATOM   3877  H  HB2  . LEU A 1 68 ? 11.436  -5.600  -1.597  1.00 0.00 ? 489 LEU A HB2  3  
ATOM   3878  H  HB3  . LEU A 1 68 ? 11.075  -5.276  -3.291  1.00 0.00 ? 489 LEU A HB3  3  
ATOM   3879  H  HG   . LEU A 1 68 ? 13.063  -7.353  -2.392  1.00 0.00 ? 489 LEU A HG   3  
ATOM   3880  H  HD11 . LEU A 1 68 ? 10.318  -8.014  -3.359  1.00 0.00 ? 489 LEU A HD11 3  
ATOM   3881  H  HD12 . LEU A 1 68 ? 10.582  -7.634  -1.657  1.00 0.00 ? 489 LEU A HD12 3  
ATOM   3882  H  HD13 . LEU A 1 68 ? 11.438  -8.984  -2.402  1.00 0.00 ? 489 LEU A HD13 3  
ATOM   3883  H  HD21 . LEU A 1 68 ? 11.687  -6.777  -5.011  1.00 0.00 ? 489 LEU A HD21 3  
ATOM   3884  H  HD22 . LEU A 1 68 ? 12.639  -8.226  -4.683  1.00 0.00 ? 489 LEU A HD22 3  
ATOM   3885  H  HD23 . LEU A 1 68 ? 13.409  -6.639  -4.654  1.00 0.00 ? 489 LEU A HD23 3  
ATOM   3886  N  N    . LEU A 1 69 ? 11.848  -3.055  -1.181  1.00 0.00 ? 490 LEU A N    3  
ATOM   3887  C  CA   . LEU A 1 69 ? 11.311  -1.765  -0.762  1.00 0.00 ? 490 LEU A CA   3  
ATOM   3888  C  C    . LEU A 1 69 ? 12.290  -0.639  -1.079  1.00 0.00 ? 490 LEU A C    3  
ATOM   3889  O  O    . LEU A 1 69 ? 11.955  0.306   -1.794  1.00 0.00 ? 490 LEU A O    3  
ATOM   3890  C  CB   . LEU A 1 69 ? 11.001  -1.780  0.735   1.00 0.00 ? 490 LEU A CB   3  
ATOM   3891  C  CG   . LEU A 1 69 ? 9.877   -2.717  1.179   1.00 0.00 ? 490 LEU A CG   3  
ATOM   3892  C  CD1  . LEU A 1 69 ? 9.880   -2.877  2.691   1.00 0.00 ? 490 LEU A CD1  3  
ATOM   3893  C  CD2  . LEU A 1 69 ? 8.530   -2.198  0.698   1.00 0.00 ? 490 LEU A CD2  3  
ATOM   3894  H  H    . LEU A 1 69 ? 11.745  -3.829  -0.589  1.00 0.00 ? 490 LEU A H    3  
ATOM   3895  H  HA   . LEU A 1 69 ? 10.396  -1.594  -1.309  1.00 0.00 ? 490 LEU A HA   3  
ATOM   3896  H  HB2  . LEU A 1 69 ? 11.900  -2.073  1.256   1.00 0.00 ? 490 LEU A HB2  3  
ATOM   3897  H  HB3  . LEU A 1 69 ? 10.730  -0.775  1.027   1.00 0.00 ? 490 LEU A HB3  3  
ATOM   3898  H  HG   . LEU A 1 69 ? 10.037  -3.693  0.740   1.00 0.00 ? 490 LEU A HG   3  
ATOM   3899  H  HD11 . LEU A 1 69 ? 9.299   -3.744  2.963   1.00 0.00 ? 490 LEU A HD11 3  
ATOM   3900  H  HD12 . LEU A 1 69 ? 9.450   -1.997  3.147   1.00 0.00 ? 490 LEU A HD12 3  
ATOM   3901  H  HD13 . LEU A 1 69 ? 10.896  -3.000  3.038   1.00 0.00 ? 490 LEU A HD13 3  
ATOM   3902  H  HD21 . LEU A 1 69 ? 8.595   -1.944  -0.350  1.00 0.00 ? 490 LEU A HD21 3  
ATOM   3903  H  HD22 . LEU A 1 69 ? 8.260   -1.319  1.265   1.00 0.00 ? 490 LEU A HD22 3  
ATOM   3904  H  HD23 . LEU A 1 69 ? 7.779   -2.962  0.838   1.00 0.00 ? 490 LEU A HD23 3  
ATOM   3905  N  N    . ASP A 1 70 ? 13.501  -0.747  -0.544  1.00 0.00 ? 491 ASP A N    3  
ATOM   3906  C  CA   . ASP A 1 70 ? 14.531  0.261   -0.772  1.00 0.00 ? 491 ASP A CA   3  
ATOM   3907  C  C    . ASP A 1 70 ? 14.504  0.748   -2.218  1.00 0.00 ? 491 ASP A C    3  
ATOM   3908  O  O    . ASP A 1 70 ? 14.628  1.943   -2.484  1.00 0.00 ? 491 ASP A O    3  
ATOM   3909  C  CB   . ASP A 1 70 ? 15.912  -0.306  -0.438  1.00 0.00 ? 491 ASP A CB   3  
ATOM   3910  C  CG   . ASP A 1 70 ? 16.009  -0.783  0.998   1.00 0.00 ? 491 ASP A CG   3  
ATOM   3911  O  OD1  . ASP A 1 70 ? 15.211  -0.312  1.836   1.00 0.00 ? 491 ASP A OD1  3  
ATOM   3912  O  OD2  . ASP A 1 70 ? 16.883  -1.628  1.284   1.00 0.00 ? 491 ASP A OD2  3  
ATOM   3913  H  H    . ASP A 1 70 ? 13.708  -1.523  0.017   1.00 0.00 ? 491 ASP A H    3  
ATOM   3914  H  HA   . ASP A 1 70 ? 14.327  1.097   -0.120  1.00 0.00 ? 491 ASP A HA   3  
ATOM   3915  H  HB2  . ASP A 1 70 ? 16.119  -1.142  -1.090  1.00 0.00 ? 491 ASP A HB2  3  
ATOM   3916  H  HB3  . ASP A 1 70 ? 16.656  0.461   -0.595  1.00 0.00 ? 491 ASP A HB3  3  
ATOM   3917  N  N    . LYS A 1 71 ? 14.341  -0.187  -3.149  1.00 0.00 ? 492 LYS A N    3  
ATOM   3918  C  CA   . LYS A 1 71 ? 14.297  0.146   -4.568  1.00 0.00 ? 492 LYS A CA   3  
ATOM   3919  C  C    . LYS A 1 71 ? 12.924  0.682   -4.959  1.00 0.00 ? 492 LYS A C    3  
ATOM   3920  O  O    . LYS A 1 71 ? 12.816  1.716   -5.617  1.00 0.00 ? 492 LYS A O    3  
ATOM   3921  C  CB   . LYS A 1 71 ? 14.635  -1.086  -5.411  1.00 0.00 ? 492 LYS A CB   3  
ATOM   3922  C  CG   . LYS A 1 71 ? 14.951  -0.761  -6.861  1.00 0.00 ? 492 LYS A CG   3  
ATOM   3923  C  CD   . LYS A 1 71 ? 15.789  -1.852  -7.507  1.00 0.00 ? 492 LYS A CD   3  
ATOM   3924  C  CE   . LYS A 1 71 ? 15.993  -1.593  -8.992  1.00 0.00 ? 492 LYS A CE   3  
ATOM   3925  N  NZ   . LYS A 1 71 ? 17.076  -2.443  -9.560  1.00 0.00 ? 492 LYS A NZ   3  
ATOM   3926  H  H    . LYS A 1 71 ? 14.247  -1.123  -2.874  1.00 0.00 ? 492 LYS A H    3  
ATOM   3927  H  HA   . LYS A 1 71 ? 15.036  0.911   -4.752  1.00 0.00 ? 492 LYS A HA   3  
ATOM   3928  H  HB2  . LYS A 1 71 ? 15.493  -1.579  -4.980  1.00 0.00 ? 492 LYS A HB2  3  
ATOM   3929  H  HB3  . LYS A 1 71 ? 13.793  -1.763  -5.391  1.00 0.00 ? 492 LYS A HB3  3  
ATOM   3930  H  HG2  . LYS A 1 71 ? 14.025  -0.663  -7.409  1.00 0.00 ? 492 LYS A HG2  3  
ATOM   3931  H  HG3  . LYS A 1 71 ? 15.496  0.171   -6.902  1.00 0.00 ? 492 LYS A HG3  3  
ATOM   3932  H  HD2  . LYS A 1 71 ? 16.754  -1.886  -7.024  1.00 0.00 ? 492 LYS A HD2  3  
ATOM   3933  H  HD3  . LYS A 1 71 ? 15.288  -2.801  -7.381  1.00 0.00 ? 492 LYS A HD3  3  
ATOM   3934  H  HE2  . LYS A 1 71 ? 15.071  -1.806  -9.511  1.00 0.00 ? 492 LYS A HE2  3  
ATOM   3935  H  HE3  . LYS A 1 71 ? 16.252  -0.554  -9.130  1.00 0.00 ? 492 LYS A HE3  3  
ATOM   3936  H  HZ1  . LYS A 1 71 ? 17.548  -1.944  -10.341 1.00 0.00 ? 492 LYS A HZ1  3  
ATOM   3937  H  HZ2  . LYS A 1 71 ? 16.679  -3.333  -9.921  1.00 0.00 ? 492 LYS A HZ2  3  
ATOM   3938  H  HZ3  . LYS A 1 71 ? 17.780  -2.661  -8.826  1.00 0.00 ? 492 LYS A HZ3  3  
ATOM   3939  N  N    . MET A 1 72 ? 11.878  -0.027  -4.547  1.00 0.00 ? 493 MET A N    3  
ATOM   3940  C  CA   . MET A 1 72 ? 10.512  0.381   -4.853  1.00 0.00 ? 493 MET A CA   3  
ATOM   3941  C  C    . MET A 1 72 ? 10.278  1.837   -4.462  1.00 0.00 ? 493 MET A C    3  
ATOM   3942  O  O    . MET A 1 72 ? 9.927   2.667   -5.302  1.00 0.00 ? 493 MET A O    3  
ATOM   3943  C  CB   . MET A 1 72 ? 9.513   -0.521  -4.125  1.00 0.00 ? 493 MET A CB   3  
ATOM   3944  C  CG   . MET A 1 72 ? 8.074   -0.321  -4.575  1.00 0.00 ? 493 MET A CG   3  
ATOM   3945  S  SD   . MET A 1 72 ? 7.316   1.143   -3.845  1.00 0.00 ? 493 MET A SD   3  
ATOM   3946  C  CE   . MET A 1 72 ? 7.124   0.612   -2.145  1.00 0.00 ? 493 MET A CE   3  
ATOM   3947  H  H    . MET A 1 72 ? 12.027  -0.843  -4.025  1.00 0.00 ? 493 MET A H    3  
ATOM   3948  H  HA   . MET A 1 72 ? 10.366  0.279   -5.918  1.00 0.00 ? 493 MET A HA   3  
ATOM   3949  H  HB2  . MET A 1 72 ? 9.782   -1.552  -4.301  1.00 0.00 ? 493 MET A HB2  3  
ATOM   3950  H  HB3  . MET A 1 72 ? 9.567   -0.318  -3.066  1.00 0.00 ? 493 MET A HB3  3  
ATOM   3951  H  HG2  . MET A 1 72 ? 8.057   -0.219  -5.649  1.00 0.00 ? 493 MET A HG2  3  
ATOM   3952  H  HG3  . MET A 1 72 ? 7.499   -1.189  -4.289  1.00 0.00 ? 493 MET A HG3  3  
ATOM   3953  H  HE1  . MET A 1 72 ? 6.112   0.804   -1.820  1.00 0.00 ? 493 MET A HE1  3  
ATOM   3954  H  HE2  . MET A 1 72 ? 7.331   -0.445  -2.072  1.00 0.00 ? 493 MET A HE2  3  
ATOM   3955  H  HE3  . MET A 1 72 ? 7.813   1.159   -1.517  1.00 0.00 ? 493 MET A HE3  3  
ATOM   3956  N  N    . LEU A 1 73 ? 10.475  2.140   -3.184  1.00 0.00 ? 494 LEU A N    3  
ATOM   3957  C  CA   . LEU A 1 73 ? 10.285  3.497   -2.682  1.00 0.00 ? 494 LEU A CA   3  
ATOM   3958  C  C    . LEU A 1 73 ? 10.836  4.524   -3.666  1.00 0.00 ? 494 LEU A C    3  
ATOM   3959  O  O    . LEU A 1 73 ? 10.168  5.504   -3.995  1.00 0.00 ? 494 LEU A O    3  
ATOM   3960  C  CB   . LEU A 1 73 ? 10.968  3.659   -1.323  1.00 0.00 ? 494 LEU A CB   3  
ATOM   3961  C  CG   . LEU A 1 73 ? 10.351  2.875   -0.164  1.00 0.00 ? 494 LEU A CG   3  
ATOM   3962  C  CD1  . LEU A 1 73 ? 11.223  2.983   1.078   1.00 0.00 ? 494 LEU A CD1  3  
ATOM   3963  C  CD2  . LEU A 1 73 ? 8.942   3.372   0.126   1.00 0.00 ? 494 LEU A CD2  3  
ATOM   3964  H  H    . LEU A 1 73 ? 10.753  1.436   -2.563  1.00 0.00 ? 494 LEU A H    3  
ATOM   3965  H  HA   . LEU A 1 73 ? 9.224   3.662   -2.565  1.00 0.00 ? 494 LEU A HA   3  
ATOM   3966  H  HB2  . LEU A 1 73 ? 11.994  3.340   -1.428  1.00 0.00 ? 494 LEU A HB2  3  
ATOM   3967  H  HB3  . LEU A 1 73 ? 10.944  4.708   -1.064  1.00 0.00 ? 494 LEU A HB3  3  
ATOM   3968  H  HG   . LEU A 1 73 ? 10.288  1.830   -0.437  1.00 0.00 ? 494 LEU A HG   3  
ATOM   3969  H  HD11 . LEU A 1 73 ? 11.087  3.954   1.529   1.00 0.00 ? 494 LEU A HD11 3  
ATOM   3970  H  HD12 . LEU A 1 73 ? 12.259  2.855   0.802   1.00 0.00 ? 494 LEU A HD12 3  
ATOM   3971  H  HD13 . LEU A 1 73 ? 10.941  2.215   1.783   1.00 0.00 ? 494 LEU A HD13 3  
ATOM   3972  H  HD21 . LEU A 1 73 ? 8.276   2.528   0.222   1.00 0.00 ? 494 LEU A HD21 3  
ATOM   3973  H  HD22 . LEU A 1 73 ? 8.610   4.004   -0.685  1.00 0.00 ? 494 LEU A HD22 3  
ATOM   3974  H  HD23 . LEU A 1 73 ? 8.943   3.938   1.046   1.00 0.00 ? 494 LEU A HD23 3  
ATOM   3975  N  N    . ALA A 1 74 ? 12.058  4.291   -4.134  1.00 0.00 ? 495 ALA A N    3  
ATOM   3976  C  CA   . ALA A 1 74 ? 12.697  5.193   -5.084  1.00 0.00 ? 495 ALA A CA   3  
ATOM   3977  C  C    . ALA A 1 74 ? 11.943  5.218   -6.410  1.00 0.00 ? 495 ALA A C    3  
ATOM   3978  O  O    . ALA A 1 74 ? 11.728  6.282   -6.992  1.00 0.00 ? 495 ALA A O    3  
ATOM   3979  C  CB   . ALA A 1 74 ? 14.145  4.785   -5.307  1.00 0.00 ? 495 ALA A CB   3  
ATOM   3980  H  H    . ALA A 1 74 ? 12.540  3.492   -3.835  1.00 0.00 ? 495 ALA A H    3  
ATOM   3981  H  HA   . ALA A 1 74 ? 12.689  6.186   -4.658  1.00 0.00 ? 495 ALA A HA   3  
ATOM   3982  H  HB1  . ALA A 1 74 ? 14.177  3.811   -5.774  1.00 0.00 ? 495 ALA A HB1  3  
ATOM   3983  H  HB2  . ALA A 1 74 ? 14.628  5.507   -5.948  1.00 0.00 ? 495 ALA A HB2  3  
ATOM   3984  H  HB3  . ALA A 1 74 ? 14.658  4.746   -4.358  1.00 0.00 ? 495 ALA A HB3  3  
ATOM   3985  N  N    . ASP A 1 75 ? 11.543  4.042   -6.880  1.00 0.00 ? 496 ASP A N    3  
ATOM   3986  C  CA   . ASP A 1 75 ? 10.812  3.930   -8.137  1.00 0.00 ? 496 ASP A CA   3  
ATOM   3987  C  C    . ASP A 1 75 ? 9.502   4.709   -8.076  1.00 0.00 ? 496 ASP A C    3  
ATOM   3988  O  O    . ASP A 1 75 ? 9.143   5.414   -9.019  1.00 0.00 ? 496 ASP A O    3  
ATOM   3989  C  CB   . ASP A 1 75 ? 10.532  2.461   -8.460  1.00 0.00 ? 496 ASP A CB   3  
ATOM   3990  C  CG   . ASP A 1 75 ? 10.225  2.239   -9.927  1.00 0.00 ? 496 ASP A CG   3  
ATOM   3991  O  OD1  . ASP A 1 75 ? 9.219   2.796   -10.414 1.00 0.00 ? 496 ASP A OD1  3  
ATOM   3992  O  OD2  . ASP A 1 75 ? 10.991  1.508   -10.590 1.00 0.00 ? 496 ASP A OD2  3  
ATOM   3993  H  H    . ASP A 1 75 ? 11.744  3.230   -6.370  1.00 0.00 ? 496 ASP A H    3  
ATOM   3994  H  HA   . ASP A 1 75 ? 11.429  4.349   -8.918  1.00 0.00 ? 496 ASP A HA   3  
ATOM   3995  H  HB2  . ASP A 1 75 ? 11.398  1.871   -8.199  1.00 0.00 ? 496 ASP A HB2  3  
ATOM   3996  H  HB3  . ASP A 1 75 ? 9.685   2.127   -7.878  1.00 0.00 ? 496 ASP A HB3  3  
ATOM   3997  N  N    . ASP A 1 76 ? 8.793   4.576   -6.960  1.00 0.00 ? 497 ASP A N    3  
ATOM   3998  C  CA   . ASP A 1 76 ? 7.522   5.267   -6.775  1.00 0.00 ? 497 ASP A CA   3  
ATOM   3999  C  C    . ASP A 1 76 ? 7.721   6.780   -6.779  1.00 0.00 ? 497 ASP A C    3  
ATOM   4000  O  O    . ASP A 1 76 ? 7.218   7.480   -7.658  1.00 0.00 ? 497 ASP A O    3  
ATOM   4001  C  CB   . ASP A 1 76 ? 6.865   4.830   -5.465  1.00 0.00 ? 497 ASP A CB   3  
ATOM   4002  C  CG   . ASP A 1 76 ? 5.415   5.260   -5.373  1.00 0.00 ? 497 ASP A CG   3  
ATOM   4003  O  OD1  . ASP A 1 76 ? 4.724   5.244   -6.413  1.00 0.00 ? 497 ASP A OD1  3  
ATOM   4004  O  OD2  . ASP A 1 76 ? 4.970   5.614   -4.261  1.00 0.00 ? 497 ASP A OD2  3  
ATOM   4005  H  H    . ASP A 1 76 ? 9.132   3.999   -6.244  1.00 0.00 ? 497 ASP A H    3  
ATOM   4006  H  HA   . ASP A 1 76 ? 6.876   5.000   -7.598  1.00 0.00 ? 497 ASP A HA   3  
ATOM   4007  H  HB2  . ASP A 1 76 ? 6.907   3.753   -5.391  1.00 0.00 ? 497 ASP A HB2  3  
ATOM   4008  H  HB3  . ASP A 1 76 ? 7.405   5.266   -4.637  1.00 0.00 ? 497 ASP A HB3  3  
ATOM   4009  N  N    . ALA A 1 77 ? 8.457   7.277   -5.791  1.00 0.00 ? 498 ALA A N    3  
ATOM   4010  C  CA   . ALA A 1 77 ? 8.723   8.706   -5.681  1.00 0.00 ? 498 ALA A CA   3  
ATOM   4011  C  C    . ALA A 1 77 ? 9.232   9.273   -7.002  1.00 0.00 ? 498 ALA A C    3  
ATOM   4012  O  O    . ALA A 1 77 ? 8.654   10.213  -7.547  1.00 0.00 ? 498 ALA A O    3  
ATOM   4013  C  CB   . ALA A 1 77 ? 9.727   8.972   -4.569  1.00 0.00 ? 498 ALA A CB   3  
ATOM   4014  H  H    . ALA A 1 77 ? 8.831   6.669   -5.121  1.00 0.00 ? 498 ALA A H    3  
ATOM   4015  H  HA   . ALA A 1 77 ? 7.797   9.199   -5.422  1.00 0.00 ? 498 ALA A HA   3  
ATOM   4016  H  HB1  . ALA A 1 77 ? 10.729  8.851   -4.953  1.00 0.00 ? 498 ALA A HB1  3  
ATOM   4017  H  HB2  . ALA A 1 77 ? 9.600   9.981   -4.204  1.00 0.00 ? 498 ALA A HB2  3  
ATOM   4018  H  HB3  . ALA A 1 77 ? 9.563   8.274   -3.762  1.00 0.00 ? 498 ALA A HB3  3  
ATOM   4019  N  N    . GLU A 1 78 ? 10.316  8.696   -7.510  1.00 0.00 ? 499 GLU A N    3  
ATOM   4020  C  CA   . GLU A 1 78 ? 10.902  9.146   -8.767  1.00 0.00 ? 499 GLU A CA   3  
ATOM   4021  C  C    . GLU A 1 78 ? 9.835   9.274   -9.850  1.00 0.00 ? 499 GLU A C    3  
ATOM   4022  O  O    . GLU A 1 78 ? 9.645   10.345  -10.425 1.00 0.00 ? 499 GLU A O    3  
ATOM   4023  C  CB   . GLU A 1 78 ? 11.994  8.176   -9.223  1.00 0.00 ? 499 GLU A CB   3  
ATOM   4024  C  CG   . GLU A 1 78 ? 12.650  8.571   -10.535 1.00 0.00 ? 499 GLU A CG   3  
ATOM   4025  C  CD   . GLU A 1 78 ? 14.016  7.939   -10.718 1.00 0.00 ? 499 GLU A CD   3  
ATOM   4026  O  OE1  . GLU A 1 78 ? 14.256  6.865   -10.126 1.00 0.00 ? 499 GLU A OE1  3  
ATOM   4027  O  OE2  . GLU A 1 78 ? 14.845  8.517   -11.451 1.00 0.00 ? 499 GLU A OE2  3  
ATOM   4028  H  H    . GLU A 1 78 ? 10.731  7.951   -7.028  1.00 0.00 ? 499 GLU A H    3  
ATOM   4029  H  HA   . GLU A 1 78 ? 11.344  10.117  -8.598  1.00 0.00 ? 499 GLU A HA   3  
ATOM   4030  H  HB2  . GLU A 1 78 ? 12.758  8.129   -8.461  1.00 0.00 ? 499 GLU A HB2  3  
ATOM   4031  H  HB3  . GLU A 1 78 ? 11.558  7.195   -9.343  1.00 0.00 ? 499 GLU A HB3  3  
ATOM   4032  H  HG2  . GLU A 1 78 ? 12.014  8.257   -11.350 1.00 0.00 ? 499 GLU A HG2  3  
ATOM   4033  H  HG3  . GLU A 1 78 ? 12.760  9.645   -10.559 1.00 0.00 ? 499 GLU A HG3  3  
ATOM   4034  N  N    . ALA A 1 79 ? 9.143   8.173   -10.123 1.00 0.00 ? 500 ALA A N    3  
ATOM   4035  C  CA   . ALA A 1 79 ? 8.094   8.161   -11.136 1.00 0.00 ? 500 ALA A CA   3  
ATOM   4036  C  C    . ALA A 1 79 ? 7.128   9.325   -10.939 1.00 0.00 ? 500 ALA A C    3  
ATOM   4037  O  O    . ALA A 1 79 ? 6.863   10.088  -11.867 1.00 0.00 ? 500 ALA A O    3  
ATOM   4038  C  CB   . ALA A 1 79 ? 7.343   6.838   -11.103 1.00 0.00 ? 500 ALA A CB   3  
ATOM   4039  H  H    . ALA A 1 79 ? 9.341   7.350   -9.631  1.00 0.00 ? 500 ALA A H    3  
ATOM   4040  H  HA   . ALA A 1 79 ? 8.564   8.256   -12.104 1.00 0.00 ? 500 ALA A HA   3  
ATOM   4041  H  HB1  . ALA A 1 79 ? 6.414   6.939   -11.644 1.00 0.00 ? 500 ALA A HB1  3  
ATOM   4042  H  HB2  . ALA A 1 79 ? 7.947   6.071   -11.563 1.00 0.00 ? 500 ALA A HB2  3  
ATOM   4043  H  HB3  . ALA A 1 79 ? 7.136   6.568   -10.078 1.00 0.00 ? 500 ALA A HB3  3  
ATOM   4044  N  N    . GLY A 1 80 ? 6.604   9.455   -9.724  1.00 0.00 ? 501 GLY A N    3  
ATOM   4045  C  CA   . GLY A 1 80 ? 5.673   10.528  -9.428  1.00 0.00 ? 501 GLY A CA   3  
ATOM   4046  C  C    . GLY A 1 80 ? 4.229   10.069  -9.471  1.00 0.00 ? 501 GLY A C    3  
ATOM   4047  O  O    . GLY A 1 80 ? 3.641   9.751   -8.437  1.00 0.00 ? 501 GLY A O    3  
ATOM   4048  H  H    . GLY A 1 80 ? 6.853   8.817   -9.022  1.00 0.00 ? 501 GLY A H    3  
ATOM   4049  H  HA2  . GLY A 1 80 ? 5.888   10.916  -8.444  1.00 0.00 ? 501 GLY A HA2  3  
ATOM   4050  H  HA3  . GLY A 1 80 ? 5.809   11.317  -10.153 1.00 0.00 ? 501 GLY A HA3  3  
ATOM   4051  N  N    . ALA A 1 81 ? 3.654   10.037  -10.669 1.00 0.00 ? 502 ALA A N    3  
ATOM   4052  C  CA   . ALA A 1 81 ? 2.270   9.614   -10.841 1.00 0.00 ? 502 ALA A CA   3  
ATOM   4053  C  C    . ALA A 1 81 ? 2.129   8.668   -12.029 1.00 0.00 ? 502 ALA A C    3  
ATOM   4054  O  O    . ALA A 1 81 ? 3.092   8.420   -12.754 1.00 0.00 ? 502 ALA A O    3  
ATOM   4055  C  CB   . ALA A 1 81 ? 1.367   10.826  -11.019 1.00 0.00 ? 502 ALA A CB   3  
ATOM   4056  H  H    . ALA A 1 81 ? 4.175   10.302  -11.455 1.00 0.00 ? 502 ALA A H    3  
ATOM   4057  H  HA   . ALA A 1 81 ? 1.965   9.097   -9.943  1.00 0.00 ? 502 ALA A HA   3  
ATOM   4058  H  HB1  . ALA A 1 81 ? 0.339   10.500  -11.089 1.00 0.00 ? 502 ALA A HB1  3  
ATOM   4059  H  HB2  . ALA A 1 81 ? 1.479   11.485  -10.171 1.00 0.00 ? 502 ALA A HB2  3  
ATOM   4060  H  HB3  . ALA A 1 81 ? 1.641   11.350  -11.922 1.00 0.00 ? 502 ALA A HB3  3  
ATOM   4061  N  N    . GLU A 1 82 ? 0.923   8.143   -12.221 1.00 0.00 ? 503 GLU A N    3  
ATOM   4062  C  CA   . GLU A 1 82 ? 0.658   7.223   -13.321 1.00 0.00 ? 503 GLU A CA   3  
ATOM   4063  C  C    . GLU A 1 82 ? 1.023   7.856   -14.660 1.00 0.00 ? 503 GLU A C    3  
ATOM   4064  O  O    . GLU A 1 82 ? 0.884   9.065   -14.846 1.00 0.00 ? 503 GLU A O    3  
ATOM   4065  C  CB   . GLU A 1 82 ? -0.815  6.809   -13.325 1.00 0.00 ? 503 GLU A CB   3  
ATOM   4066  C  CG   . GLU A 1 82 ? -1.194  5.897   -12.170 1.00 0.00 ? 503 GLU A CG   3  
ATOM   4067  C  CD   . GLU A 1 82 ? -1.498  6.664   -10.897 1.00 0.00 ? 503 GLU A CD   3  
ATOM   4068  O  OE1  . GLU A 1 82 ? -0.559  6.898   -10.108 1.00 0.00 ? 503 GLU A OE1  3  
ATOM   4069  O  OE2  . GLU A 1 82 ? -2.674  7.028   -10.690 1.00 0.00 ? 503 GLU A OE2  3  
ATOM   4070  H  H    . GLU A 1 82 ? 0.195   8.379   -11.609 1.00 0.00 ? 503 GLU A H    3  
ATOM   4071  H  HA   . GLU A 1 82 ? 1.269   6.345   -13.173 1.00 0.00 ? 503 GLU A HA   3  
ATOM   4072  H  HB2  . GLU A 1 82 ? -1.426  7.697   -13.271 1.00 0.00 ? 503 GLU A HB2  3  
ATOM   4073  H  HB3  . GLU A 1 82 ? -1.028  6.291   -14.249 1.00 0.00 ? 503 GLU A HB3  3  
ATOM   4074  H  HG2  . GLU A 1 82 ? -2.070  5.330   -12.448 1.00 0.00 ? 503 GLU A HG2  3  
ATOM   4075  H  HG3  . GLU A 1 82 ? -0.374  5.220   -11.978 1.00 0.00 ? 503 GLU A HG3  3  
ATOM   4076  N  N    . ASP A 1 83 ? 1.492   7.031   -15.590 1.00 0.00 ? 504 ASP A N    3  
ATOM   4077  C  CA   . ASP A 1 83 ? 1.878   7.509   -16.912 1.00 0.00 ? 504 ASP A CA   3  
ATOM   4078  C  C    . ASP A 1 83 ? 1.458   6.516   -17.992 1.00 0.00 ? 504 ASP A C    3  
ATOM   4079  O  O    . ASP A 1 83 ? 1.293   5.327   -17.724 1.00 0.00 ? 504 ASP A O    3  
ATOM   4080  C  CB   . ASP A 1 83 ? 3.388   7.740   -16.974 1.00 0.00 ? 504 ASP A CB   3  
ATOM   4081  C  CG   . ASP A 1 83 ? 3.808   9.016   -16.271 1.00 0.00 ? 504 ASP A CG   3  
ATOM   4082  O  OD1  . ASP A 1 83 ? 3.224   10.078  -16.571 1.00 0.00 ? 504 ASP A OD1  3  
ATOM   4083  O  OD2  . ASP A 1 83 ? 4.721   8.953   -15.421 1.00 0.00 ? 504 ASP A OD2  3  
ATOM   4084  H  H    . ASP A 1 83 ? 1.581   6.077   -15.381 1.00 0.00 ? 504 ASP A H    3  
ATOM   4085  H  HA   . ASP A 1 83 ? 1.372   8.446   -17.087 1.00 0.00 ? 504 ASP A HA   3  
ATOM   4086  H  HB2  . ASP A 1 83 ? 3.893   6.909   -16.503 1.00 0.00 ? 504 ASP A HB2  3  
ATOM   4087  H  HB3  . ASP A 1 83 ? 3.694   7.803   -18.008 1.00 0.00 ? 504 ASP A HB3  3  
ATOM   4088  N  N    . GLU A 1 84 ? 1.286   7.015   -19.213 1.00 0.00 ? 505 GLU A N    3  
ATOM   4089  C  CA   . GLU A 1 84 ? 0.884   6.171   -20.332 1.00 0.00 ? 505 GLU A CA   3  
ATOM   4090  C  C    . GLU A 1 84 ? 1.954   5.128   -20.639 1.00 0.00 ? 505 GLU A C    3  
ATOM   4091  O  O    . GLU A 1 84 ? 3.132   5.455   -20.787 1.00 0.00 ? 505 GLU A O    3  
ATOM   4092  C  CB   . GLU A 1 84 ? 0.617   7.025   -21.573 1.00 0.00 ? 505 GLU A CB   3  
ATOM   4093  C  CG   . GLU A 1 84 ? 1.819   7.841   -22.021 1.00 0.00 ? 505 GLU A CG   3  
ATOM   4094  C  CD   . GLU A 1 84 ? 1.425   9.089   -22.785 1.00 0.00 ? 505 GLU A CD   3  
ATOM   4095  O  OE1  . GLU A 1 84 ? 0.816   8.954   -23.868 1.00 0.00 ? 505 GLU A OE1  3  
ATOM   4096  O  OE2  . GLU A 1 84 ? 1.724   10.201  -22.302 1.00 0.00 ? 505 GLU A OE2  3  
ATOM   4097  H  H    . GLU A 1 84 ? 1.433   7.972   -19.364 1.00 0.00 ? 505 GLU A H    3  
ATOM   4098  H  HA   . GLU A 1 84 ? -0.027  5.663   -20.054 1.00 0.00 ? 505 GLU A HA   3  
ATOM   4099  H  HB2  . GLU A 1 84 ? 0.325   6.377   -22.386 1.00 0.00 ? 505 GLU A HB2  3  
ATOM   4100  H  HB3  . GLU A 1 84 ? -0.194  7.706   -21.359 1.00 0.00 ? 505 GLU A HB3  3  
ATOM   4101  H  HG2  . GLU A 1 84 ? 2.383   8.135   -21.148 1.00 0.00 ? 505 GLU A HG2  3  
ATOM   4102  H  HG3  . GLU A 1 84 ? 2.437   7.226   -22.658 1.00 0.00 ? 505 GLU A HG3  3  
ATOM   4103  N  N    . LYS A 1 85 ? 1.536   3.870   -20.734 1.00 0.00 ? 506 LYS A N    3  
ATOM   4104  C  CA   . LYS A 1 85 ? 2.456   2.777   -21.024 1.00 0.00 ? 506 LYS A CA   3  
ATOM   4105  C  C    . LYS A 1 85 ? 2.063   2.063   -22.313 1.00 0.00 ? 506 LYS A C    3  
ATOM   4106  O  O    . LYS A 1 85 ? 2.910   1.783   -23.161 1.00 0.00 ? 506 LYS A O    3  
ATOM   4107  C  CB   . LYS A 1 85 ? 2.480   1.781   -19.863 1.00 0.00 ? 506 LYS A CB   3  
ATOM   4108  C  CG   . LYS A 1 85 ? 1.124   1.164   -19.564 1.00 0.00 ? 506 LYS A CG   3  
ATOM   4109  C  CD   . LYS A 1 85 ? 1.110   0.482   -18.206 1.00 0.00 ? 506 LYS A CD   3  
ATOM   4110  C  CE   . LYS A 1 85 ? 0.986   1.493   -17.076 1.00 0.00 ? 506 LYS A CE   3  
ATOM   4111  N  NZ   . LYS A 1 85 ? 2.316   2.001   -16.638 1.00 0.00 ? 506 LYS A NZ   3  
ATOM   4112  H  H    . LYS A 1 85 ? 0.584   3.672   -20.606 1.00 0.00 ? 506 LYS A H    3  
ATOM   4113  H  HA   . LYS A 1 85 ? 3.443   3.198   -21.147 1.00 0.00 ? 506 LYS A HA   3  
ATOM   4114  H  HB2  . LYS A 1 85 ? 3.169   0.985   -20.102 1.00 0.00 ? 506 LYS A HB2  3  
ATOM   4115  H  HB3  . LYS A 1 85 ? 2.824   2.290   -18.975 1.00 0.00 ? 506 LYS A HB3  3  
ATOM   4116  H  HG2  . LYS A 1 85 ? 0.375   1.942   -19.572 1.00 0.00 ? 506 LYS A HG2  3  
ATOM   4117  H  HG3  . LYS A 1 85 ? 0.895   0.433   -20.326 1.00 0.00 ? 506 LYS A HG3  3  
ATOM   4118  H  HD2  . LYS A 1 85 ? 0.270   -0.195  -18.161 1.00 0.00 ? 506 LYS A HD2  3  
ATOM   4119  H  HD3  . LYS A 1 85 ? 2.029   -0.073  -18.082 1.00 0.00 ? 506 LYS A HD3  3  
ATOM   4120  H  HE2  . LYS A 1 85 ? 0.388   2.323   -17.417 1.00 0.00 ? 506 LYS A HE2  3  
ATOM   4121  H  HE3  . LYS A 1 85 ? 0.498   1.018   -16.238 1.00 0.00 ? 506 LYS A HE3  3  
ATOM   4122  H  HZ1  . LYS A 1 85 ? 2.506   2.925   -17.074 1.00 0.00 ? 506 LYS A HZ1  3  
ATOM   4123  H  HZ2  . LYS A 1 85 ? 3.063   1.336   -16.922 1.00 0.00 ? 506 LYS A HZ2  3  
ATOM   4124  H  HZ3  . LYS A 1 85 ? 2.335   2.107   -15.604 1.00 0.00 ? 506 LYS A HZ3  3  
ATOM   4125  N  N    . GLU A 1 86 ? 0.773   1.772   -22.454 1.00 0.00 ? 507 GLU A N    3  
ATOM   4126  C  CA   . GLU A 1 86 ? 0.270   1.091   -23.641 1.00 0.00 ? 507 GLU A CA   3  
ATOM   4127  C  C    . GLU A 1 86 ? -0.923  1.838   -24.232 1.00 0.00 ? 507 GLU A C    3  
ATOM   4128  O  O    . GLU A 1 86 ? -2.069  1.606   -23.845 1.00 0.00 ? 507 GLU A O    3  
ATOM   4129  C  CB   . GLU A 1 86 ? -0.132  -0.345  -23.300 1.00 0.00 ? 507 GLU A CB   3  
ATOM   4130  C  CG   . GLU A 1 86 ? -0.822  -1.072  -24.442 1.00 0.00 ? 507 GLU A CG   3  
ATOM   4131  C  CD   . GLU A 1 86 ? -1.816  -2.109  -23.958 1.00 0.00 ? 507 GLU A CD   3  
ATOM   4132  O  OE1  . GLU A 1 86 ? -2.857  -1.715  -23.393 1.00 0.00 ? 507 GLU A OE1  3  
ATOM   4133  O  OE2  . GLU A 1 86 ? -1.553  -3.315  -24.145 1.00 0.00 ? 507 GLU A OE2  3  
ATOM   4134  H  H    . GLU A 1 86 ? 0.147   2.022   -21.743 1.00 0.00 ? 507 GLU A H    3  
ATOM   4135  H  HA   . GLU A 1 86 ? 1.063   1.069   -24.373 1.00 0.00 ? 507 GLU A HA   3  
ATOM   4136  H  HB2  . GLU A 1 86 ? 0.755   -0.900  -23.030 1.00 0.00 ? 507 GLU A HB2  3  
ATOM   4137  H  HB3  . GLU A 1 86 ? -0.804  -0.327  -22.455 1.00 0.00 ? 507 GLU A HB3  3  
ATOM   4138  H  HG2  . GLU A 1 86 ? -1.346  -0.348  -25.048 1.00 0.00 ? 507 GLU A HG2  3  
ATOM   4139  H  HG3  . GLU A 1 86 ? -0.072  -1.566  -25.042 1.00 0.00 ? 507 GLU A HG3  3  
ATOM   4140  N  N    . VAL A 1 87 ? -0.645  2.736   -25.171 1.00 0.00 ? 508 VAL A N    3  
ATOM   4141  C  CA   . VAL A 1 87 ? -1.694  3.517   -25.816 1.00 0.00 ? 508 VAL A CA   3  
ATOM   4142  C  C    . VAL A 1 87 ? -2.279  2.771   -27.010 1.00 0.00 ? 508 VAL A C    3  
ATOM   4143  O  O    . VAL A 1 87 ? -2.987  3.353   -27.831 1.00 0.00 ? 508 VAL A O    3  
ATOM   4144  C  CB   . VAL A 1 87 ? -1.166  4.885   -26.288 1.00 0.00 ? 508 VAL A CB   3  
ATOM   4145  C  CG1  . VAL A 1 87 ? -1.382  5.940   -25.215 1.00 0.00 ? 508 VAL A CG1  3  
ATOM   4146  C  CG2  . VAL A 1 87 ? 0.306   4.787   -26.662 1.00 0.00 ? 508 VAL A CG2  3  
ATOM   4147  H  H    . VAL A 1 87 ? 0.287   2.877   -25.437 1.00 0.00 ? 508 VAL A H    3  
ATOM   4148  H  HA   . VAL A 1 87 ? -2.477  3.688   -25.092 1.00 0.00 ? 508 VAL A HA   3  
ATOM   4149  H  HB   . VAL A 1 87 ? -1.720  5.178   -27.167 1.00 0.00 ? 508 VAL A HB   3  
ATOM   4150  H  HG11 . VAL A 1 87 ? -2.438  6.143   -25.117 1.00 0.00 ? 508 VAL A HG11 3  
ATOM   4151  H  HG12 . VAL A 1 87 ? -0.994  5.581   -24.273 1.00 0.00 ? 508 VAL A HG12 3  
ATOM   4152  H  HG13 . VAL A 1 87 ? -0.867  6.848   -25.494 1.00 0.00 ? 508 VAL A HG13 3  
ATOM   4153  H  HG21 . VAL A 1 87 ? 0.568   5.612   -27.308 1.00 0.00 ? 508 VAL A HG21 3  
ATOM   4154  H  HG22 . VAL A 1 87 ? 0.909   4.825   -25.767 1.00 0.00 ? 508 VAL A HG22 3  
ATOM   4155  H  HG23 . VAL A 1 87 ? 0.485   3.855   -27.177 1.00 0.00 ? 508 VAL A HG23 3  
ATOM   4156  N  N    . GLU A 1 88 ? -1.979  1.479   -27.099 1.00 0.00 ? 509 GLU A N    3  
ATOM   4157  C  CA   . GLU A 1 88 ? -2.475  0.654   -28.193 1.00 0.00 ? 509 GLU A CA   3  
ATOM   4158  C  C    . GLU A 1 88 ? -2.883  -0.728  -27.691 1.00 0.00 ? 509 GLU A C    3  
ATOM   4159  O  O    . GLU A 1 88 ? -2.154  -1.362  -26.928 1.00 0.00 ? 509 GLU A O    3  
ATOM   4160  C  CB   . GLU A 1 88 ? -1.410  0.518   -29.284 1.00 0.00 ? 509 GLU A CB   3  
ATOM   4161  C  CG   . GLU A 1 88 ? -1.528  1.562   -30.382 1.00 0.00 ? 509 GLU A CG   3  
ATOM   4162  C  CD   . GLU A 1 88 ? -2.509  1.160   -31.466 1.00 0.00 ? 509 GLU A CD   3  
ATOM   4163  O  OE1  . GLU A 1 88 ? -2.277  0.122   -32.121 1.00 0.00 ? 509 GLU A OE1  3  
ATOM   4164  O  OE2  . GLU A 1 88 ? -3.509  1.883   -31.659 1.00 0.00 ? 509 GLU A OE2  3  
ATOM   4165  H  H    . GLU A 1 88 ? -1.409  1.072   -26.413 1.00 0.00 ? 509 GLU A H    3  
ATOM   4166  H  HA   . GLU A 1 88 ? -3.343  1.142   -28.610 1.00 0.00 ? 509 GLU A HA   3  
ATOM   4167  H  HB2  . GLU A 1 88 ? -0.434  0.611   -28.830 1.00 0.00 ? 509 GLU A HB2  3  
ATOM   4168  H  HB3  . GLU A 1 88 ? -1.497  -0.459  -29.734 1.00 0.00 ? 509 GLU A HB3  3  
ATOM   4169  H  HG2  . GLU A 1 88 ? -1.859  2.491   -29.944 1.00 0.00 ? 509 GLU A HG2  3  
ATOM   4170  H  HG3  . GLU A 1 88 ? -0.556  1.704   -30.831 1.00 0.00 ? 509 GLU A HG3  3  
ATOM   4171  N  N    . GLU A 1 89 ? -4.052  -1.189  -28.125 1.00 0.00 ? 510 GLU A N    3  
ATOM   4172  C  CA   . GLU A 1 89 ? -4.557  -2.495  -27.718 1.00 0.00 ? 510 GLU A CA   3  
ATOM   4173  C  C    . GLU A 1 89 ? -4.239  -3.553  -28.770 1.00 0.00 ? 510 GLU A C    3  
ATOM   4174  O  O    . GLU A 1 89 ? -3.856  -3.230  -29.896 1.00 0.00 ? 510 GLU A O    3  
ATOM   4175  C  CB   . GLU A 1 89 ? -6.067  -2.431  -27.482 1.00 0.00 ? 510 GLU A CB   3  
ATOM   4176  C  CG   . GLU A 1 89 ? -6.446  -2.070  -26.056 1.00 0.00 ? 510 GLU A CG   3  
ATOM   4177  C  CD   . GLU A 1 89 ? -7.903  -1.671  -25.922 1.00 0.00 ? 510 GLU A CD   3  
ATOM   4178  O  OE1  . GLU A 1 89 ? -8.338  -0.759  -26.656 1.00 0.00 ? 510 GLU A OE1  3  
ATOM   4179  O  OE2  . GLU A 1 89 ? -8.608  -2.271  -25.084 1.00 0.00 ? 510 GLU A OE2  3  
ATOM   4180  H  H    . GLU A 1 89 ? -4.587  -0.637  -28.732 1.00 0.00 ? 510 GLU A H    3  
ATOM   4181  H  HA   . GLU A 1 89 ? -4.069  -2.766  -26.794 1.00 0.00 ? 510 GLU A HA   3  
ATOM   4182  H  HB2  . GLU A 1 89 ? -6.492  -1.692  -28.144 1.00 0.00 ? 510 GLU A HB2  3  
ATOM   4183  H  HB3  . GLU A 1 89 ? -6.495  -3.396  -27.712 1.00 0.00 ? 510 GLU A HB3  3  
ATOM   4184  H  HG2  . GLU A 1 89 ? -6.263  -2.923  -25.420 1.00 0.00 ? 510 GLU A HG2  3  
ATOM   4185  H  HG3  . GLU A 1 89 ? -5.831  -1.243  -25.732 1.00 0.00 ? 510 GLU A HG3  3  
ATOM   4186  N  N    . LEU A 1 90 ? -4.400  -4.817  -28.396 1.00 0.00 ? 511 LEU A N    3  
ATOM   4187  C  CA   . LEU A 1 90 ? -4.130  -5.925  -29.307 1.00 0.00 ? 511 LEU A CA   3  
ATOM   4188  C  C    . LEU A 1 90 ? -5.362  -6.809  -29.469 1.00 0.00 ? 511 LEU A C    3  
ATOM   4189  O  O    . LEU A 1 90 ? -5.691  -7.239  -30.575 1.00 0.00 ? 511 LEU A O    3  
ATOM   4190  C  CB   . LEU A 1 90 ? -2.954  -6.758  -28.794 1.00 0.00 ? 511 LEU A CB   3  
ATOM   4191  C  CG   . LEU A 1 90 ? -3.191  -7.523  -27.491 1.00 0.00 ? 511 LEU A CG   3  
ATOM   4192  C  CD1  . LEU A 1 90 ? -3.779  -8.896  -27.778 1.00 0.00 ? 511 LEU A CD1  3  
ATOM   4193  C  CD2  . LEU A 1 90 ? -1.895  -7.649  -26.703 1.00 0.00 ? 511 LEU A CD2  3  
ATOM   4194  H  H    . LEU A 1 90 ? -4.707  -5.012  -27.487 1.00 0.00 ? 511 LEU A H    3  
ATOM   4195  H  HA   . LEU A 1 90 ? -3.873  -5.507  -30.269 1.00 0.00 ? 511 LEU A HA   3  
ATOM   4196  H  HB2  . LEU A 1 90 ? -2.700  -7.477  -29.558 1.00 0.00 ? 511 LEU A HB2  3  
ATOM   4197  H  HB3  . LEU A 1 90 ? -2.119  -6.089  -28.639 1.00 0.00 ? 511 LEU A HB3  3  
ATOM   4198  H  HG   . LEU A 1 90 ? -3.901  -6.977  -26.885 1.00 0.00 ? 511 LEU A HG   3  
ATOM   4199  H  HD11 . LEU A 1 90 ? -2.997  -9.558  -28.117 1.00 0.00 ? 511 LEU A HD11 3  
ATOM   4200  H  HD12 . LEU A 1 90 ? -4.536  -8.811  -28.543 1.00 0.00 ? 511 LEU A HD12 3  
ATOM   4201  H  HD13 . LEU A 1 90 ? -4.222  -9.293  -26.876 1.00 0.00 ? 511 LEU A HD13 3  
ATOM   4202  H  HD21 . LEU A 1 90 ? -1.120  -8.039  -27.347 1.00 0.00 ? 511 LEU A HD21 3  
ATOM   4203  H  HD22 . LEU A 1 90 ? -2.044  -8.321  -25.871 1.00 0.00 ? 511 LEU A HD22 3  
ATOM   4204  H  HD23 . LEU A 1 90 ? -1.602  -6.677  -26.335 1.00 0.00 ? 511 LEU A HD23 3  
ATOM   4205  N  N    . LYS A 1 91 ? -6.043  -7.076  -28.359 1.00 0.00 ? 512 LYS A N    3  
ATOM   4206  C  CA   . LYS A 1 91 ? -7.241  -7.906  -28.377 1.00 0.00 ? 512 LYS A CA   3  
ATOM   4207  C  C    . LYS A 1 91 ? -8.474  -7.074  -28.717 1.00 0.00 ? 512 LYS A C    3  
ATOM   4208  O  O    . LYS A 1 91 ? -9.528  -7.225  -28.098 1.00 0.00 ? 512 LYS A O    3  
ATOM   4209  C  CB   . LYS A 1 91 ? -7.433  -8.590  -27.021 1.00 0.00 ? 512 LYS A CB   3  
ATOM   4210  C  CG   . LYS A 1 91 ? -7.725  -7.622  -25.887 1.00 0.00 ? 512 LYS A CG   3  
ATOM   4211  C  CD   . LYS A 1 91 ? -8.410  -8.317  -24.723 1.00 0.00 ? 512 LYS A CD   3  
ATOM   4212  C  CE   . LYS A 1 91 ? -8.954  -7.315  -23.717 1.00 0.00 ? 512 LYS A CE   3  
ATOM   4213  N  NZ   . LYS A 1 91 ? -9.874  -7.956  -22.737 1.00 0.00 ? 512 LYS A NZ   3  
ATOM   4214  H  H    . LYS A 1 91 ? -5.731  -6.704  -27.507 1.00 0.00 ? 512 LYS A H    3  
ATOM   4215  H  HA   . LYS A 1 91 ? -7.111  -8.661  -29.136 1.00 0.00 ? 512 LYS A HA   3  
ATOM   4216  H  HB2  . LYS A 1 91 ? -8.257  -9.284  -27.095 1.00 0.00 ? 512 LYS A HB2  3  
ATOM   4217  H  HB3  . LYS A 1 91 ? -6.534  -9.137  -26.777 1.00 0.00 ? 512 LYS A HB3  3  
ATOM   4218  H  HG2  . LYS A 1 91 ? -6.794  -7.197  -25.541 1.00 0.00 ? 512 LYS A HG2  3  
ATOM   4219  H  HG3  . LYS A 1 91 ? -8.368  -6.835  -26.254 1.00 0.00 ? 512 LYS A HG3  3  
ATOM   4220  H  HD2  . LYS A 1 91 ? -9.229  -8.911  -25.101 1.00 0.00 ? 512 LYS A HD2  3  
ATOM   4221  H  HD3  . LYS A 1 91 ? -7.696  -8.960  -24.228 1.00 0.00 ? 512 LYS A HD3  3  
ATOM   4222  H  HE2  . LYS A 1 91 ? -8.125  -6.874  -23.184 1.00 0.00 ? 512 LYS A HE2  3  
ATOM   4223  H  HE3  . LYS A 1 91 ? -9.490  -6.544  -24.251 1.00 0.00 ? 512 LYS A HE3  3  
ATOM   4224  H  HZ1  . LYS A 1 91 ? -9.456  -8.838  -22.379 1.00 0.00 ? 512 LYS A HZ1  3  
ATOM   4225  H  HZ2  . LYS A 1 91 ? -10.783 -8.176  -23.191 1.00 0.00 ? 512 LYS A HZ2  3  
ATOM   4226  H  HZ3  . LYS A 1 91 ? -10.045 -7.316  -21.935 1.00 0.00 ? 512 LYS A HZ3  3  
ATOM   4227  N  N    . LYS A 1 92 ? -8.336  -6.197  -29.706 1.00 0.00 ? 513 LYS A N    3  
ATOM   4228  C  CA   . LYS A 1 92 ? -9.439  -5.344  -30.131 1.00 0.00 ? 513 LYS A CA   3  
ATOM   4229  C  C    . LYS A 1 92 ? -10.719 -6.154  -30.306 1.00 0.00 ? 513 LYS A C    3  
ATOM   4230  O  O    . LYS A 1 92 ? -10.871 -6.889  -31.281 1.00 0.00 ? 513 LYS A O    3  
ATOM   4231  C  CB   . LYS A 1 92 ? -9.087  -4.637  -31.443 1.00 0.00 ? 513 LYS A CB   3  
ATOM   4232  C  CG   . LYS A 1 92 ? -9.894  -3.374  -31.688 1.00 0.00 ? 513 LYS A CG   3  
ATOM   4233  C  CD   . LYS A 1 92 ? -11.310 -3.695  -32.136 1.00 0.00 ? 513 LYS A CD   3  
ATOM   4234  C  CE   . LYS A 1 92 ? -11.866 -2.609  -33.044 1.00 0.00 ? 513 LYS A CE   3  
ATOM   4235  N  NZ   . LYS A 1 92 ? -11.340 -2.723  -34.433 1.00 0.00 ? 513 LYS A NZ   3  
ATOM   4236  H  H    . LYS A 1 92 ? -7.471  -6.124  -30.161 1.00 0.00 ? 513 LYS A H    3  
ATOM   4237  H  HA   . LYS A 1 92 ? -9.598  -4.601  -29.364 1.00 0.00 ? 513 LYS A HA   3  
ATOM   4238  H  HB2  . LYS A 1 92 ? -8.040  -4.373  -31.426 1.00 0.00 ? 513 LYS A HB2  3  
ATOM   4239  H  HB3  . LYS A 1 92 ? -9.265  -5.318  -32.263 1.00 0.00 ? 513 LYS A HB3  3  
ATOM   4240  H  HG2  . LYS A 1 92 ? -9.938  -2.802  -30.773 1.00 0.00 ? 513 LYS A HG2  3  
ATOM   4241  H  HG3  . LYS A 1 92 ? -9.406  -2.790  -32.456 1.00 0.00 ? 513 LYS A HG3  3  
ATOM   4242  H  HD2  . LYS A 1 92 ? -11.304 -4.631  -32.675 1.00 0.00 ? 513 LYS A HD2  3  
ATOM   4243  H  HD3  . LYS A 1 92 ? -11.943 -3.783  -31.265 1.00 0.00 ? 513 LYS A HD3  3  
ATOM   4244  H  HE2  . LYS A 1 92 ? -12.942 -2.694  -33.068 1.00 0.00 ? 513 LYS A HE2  3  
ATOM   4245  H  HE3  . LYS A 1 92 ? -11.591 -1.645  -32.642 1.00 0.00 ? 513 LYS A HE3  3  
ATOM   4246  H  HZ1  . LYS A 1 92 ? -11.940 -2.181  -35.088 1.00 0.00 ? 513 LYS A HZ1  3  
ATOM   4247  H  HZ2  . LYS A 1 92 ? -11.333 -3.719  -34.731 1.00 0.00 ? 513 LYS A HZ2  3  
ATOM   4248  H  HZ3  . LYS A 1 92 ? -10.370 -2.351  -34.479 1.00 0.00 ? 513 LYS A HZ3  3  
ATOM   4249  N  N    . SER A 1 93 ? -11.637 -6.014  -29.355 1.00 0.00 ? 514 SER A N    3  
ATOM   4250  C  CA   . SER A 1 93 ? -12.903 -6.736  -29.403 1.00 0.00 ? 514 SER A CA   3  
ATOM   4251  C  C    . SER A 1 93 ? -13.855 -6.096  -30.409 1.00 0.00 ? 514 SER A C    3  
ATOM   4252  O  O    . SER A 1 93 ? -14.083 -4.888  -30.383 1.00 0.00 ? 514 SER A O    3  
ATOM   4253  C  CB   . SER A 1 93 ? -13.551 -6.764  -28.017 1.00 0.00 ? 514 SER A CB   3  
ATOM   4254  O  OG   . SER A 1 93 ? -14.785 -7.460  -28.045 1.00 0.00 ? 514 SER A OG   3  
ATOM   4255  H  H    . SER A 1 93 ? -11.457 -5.413  -28.602 1.00 0.00 ? 514 SER A H    3  
ATOM   4256  H  HA   . SER A 1 93 ? -12.696 -7.749  -29.714 1.00 0.00 ? 514 SER A HA   3  
ATOM   4257  H  HB2  . SER A 1 93 ? -12.889 -7.258  -27.323 1.00 0.00 ? 514 SER A HB2  3  
ATOM   4258  H  HB3  . SER A 1 93 ? -13.729 -5.751  -27.686 1.00 0.00 ? 514 SER A HB3  3  
ATOM   4259  H  HG   . SER A 1 93 ? -14.827 -8.005  -28.834 1.00 0.00 ? 514 SER A HG   3  
ATOM   4260  N  N    . GLY A 1 94 ? -14.408 -6.918  -31.296 1.00 0.00 ? 515 GLY A N    3  
ATOM   4261  C  CA   . GLY A 1 94 ? -15.329 -6.416  -32.299 1.00 0.00 ? 515 GLY A CA   3  
ATOM   4262  C  C    . GLY A 1 94 ? -16.574 -7.271  -32.423 1.00 0.00 ? 515 GLY A C    3  
ATOM   4263  O  O    . GLY A 1 94 ? -16.892 -8.074  -31.545 1.00 0.00 ? 515 GLY A O    3  
ATOM   4264  H  H    . GLY A 1 94 ? -14.189 -7.873  -31.269 1.00 0.00 ? 515 GLY A H    3  
ATOM   4265  H  HA2  . GLY A 1 94 ? -15.620 -5.410  -32.033 1.00 0.00 ? 515 GLY A HA2  3  
ATOM   4266  H  HA3  . GLY A 1 94 ? -14.825 -6.393  -33.254 1.00 0.00 ? 515 GLY A HA3  3  
ATOM   4267  N  N    . PRO A 1 95 ? -17.305 -7.102  -33.535 1.00 0.00 ? 516 PRO A N    3  
ATOM   4268  C  CA   . PRO A 1 95 ? -18.535 -7.855  -33.796 1.00 0.00 ? 516 PRO A CA   3  
ATOM   4269  C  C    . PRO A 1 95 ? -18.263 -9.328  -34.082 1.00 0.00 ? 516 PRO A C    3  
ATOM   4270  O  O    . PRO A 1 95 ? -17.130 -9.716  -34.368 1.00 0.00 ? 516 PRO A O    3  
ATOM   4271  C  CB   . PRO A 1 95 ? -19.115 -7.169  -35.036 1.00 0.00 ? 516 PRO A CB   3  
ATOM   4272  C  CG   . PRO A 1 95 ? -17.938 -6.560  -35.717 1.00 0.00 ? 516 PRO A CG   3  
ATOM   4273  C  CD   . PRO A 1 95 ? -16.986 -6.162  -34.623 1.00 0.00 ? 516 PRO A CD   3  
ATOM   4274  H  HA   . PRO A 1 95 ? -19.233 -7.772  -32.977 1.00 0.00 ? 516 PRO A HA   3  
ATOM   4275  H  HB2  . PRO A 1 95 ? -19.599 -7.903  -35.663 1.00 0.00 ? 516 PRO A HB2  3  
ATOM   4276  H  HB3  . PRO A 1 95 ? -19.829 -6.417  -34.734 1.00 0.00 ? 516 PRO A HB3  3  
ATOM   4277  H  HG2  . PRO A 1 95 ? -17.476 -7.285  -36.370 1.00 0.00 ? 516 PRO A HG2  3  
ATOM   4278  H  HG3  . PRO A 1 95 ? -18.248 -5.691  -36.278 1.00 0.00 ? 516 PRO A HG3  3  
ATOM   4279  H  HD2  . PRO A 1 95 ? -15.964 -6.283  -34.950 1.00 0.00 ? 516 PRO A HD2  3  
ATOM   4280  H  HD3  . PRO A 1 95 ? -17.168 -5.142  -34.317 1.00 0.00 ? 516 PRO A HD3  3  
ATOM   4281  N  N    . SER A 1 96 ? -19.308 -10.145 -34.002 1.00 0.00 ? 517 SER A N    3  
ATOM   4282  C  CA   . SER A 1 96 ? -19.181 -11.576 -34.249 1.00 0.00 ? 517 SER A CA   3  
ATOM   4283  C  C    . SER A 1 96 ? -20.187 -12.038 -35.299 1.00 0.00 ? 517 SER A C    3  
ATOM   4284  O  O    . SER A 1 96 ? -20.752 -13.128 -35.196 1.00 0.00 ? 517 SER A O    3  
ATOM   4285  C  CB   . SER A 1 96 ? -19.385 -12.359 -32.951 1.00 0.00 ? 517 SER A CB   3  
ATOM   4286  O  OG   . SER A 1 96 ? -20.628 -12.036 -32.350 1.00 0.00 ? 517 SER A OG   3  
ATOM   4287  H  H    . SER A 1 96 ? -20.186 -9.775  -33.770 1.00 0.00 ? 517 SER A H    3  
ATOM   4288  H  HA   . SER A 1 96 ? -18.183 -11.762 -34.618 1.00 0.00 ? 517 SER A HA   3  
ATOM   4289  H  HB2  . SER A 1 96 ? -19.367 -13.417 -33.164 1.00 0.00 ? 517 SER A HB2  3  
ATOM   4290  H  HB3  . SER A 1 96 ? -18.591 -12.117 -32.259 1.00 0.00 ? 517 SER A HB3  3  
ATOM   4291  H  HG   . SER A 1 96 ? -20.503 -11.903 -31.408 1.00 0.00 ? 517 SER A HG   3  
ATOM   4292  N  N    . SER A 1 97 ? -20.407 -11.202 -36.308 1.00 0.00 ? 518 SER A N    3  
ATOM   4293  C  CA   . SER A 1 97 ? -21.348 -11.521 -37.375 1.00 0.00 ? 518 SER A CA   3  
ATOM   4294  C  C    . SER A 1 97 ? -20.955 -12.819 -38.075 1.00 0.00 ? 518 SER A C    3  
ATOM   4295  O  O    . SER A 1 97 ? -19.875 -13.361 -37.842 1.00 0.00 ? 518 SER A O    3  
ATOM   4296  C  CB   . SER A 1 97 ? -21.407 -10.378 -38.390 1.00 0.00 ? 518 SER A CB   3  
ATOM   4297  O  OG   . SER A 1 97 ? -20.144 -10.171 -38.999 1.00 0.00 ? 518 SER A OG   3  
ATOM   4298  H  H    . SER A 1 97 ? -19.926 -10.348 -36.333 1.00 0.00 ? 518 SER A H    3  
ATOM   4299  H  HA   . SER A 1 97 ? -22.323 -11.647 -36.930 1.00 0.00 ? 518 SER A HA   3  
ATOM   4300  H  HB2  . SER A 1 97 ? -22.128 -10.618 -39.157 1.00 0.00 ? 518 SER A HB2  3  
ATOM   4301  H  HB3  . SER A 1 97 ? -21.705 -9.469  -37.888 1.00 0.00 ? 518 SER A HB3  3  
ATOM   4302  H  HG   . SER A 1 97 ? -19.465 -10.127 -38.322 1.00 0.00 ? 518 SER A HG   3  
ATOM   4303  N  N    . GLY A 1 98 ? -21.841 -13.312 -38.935 1.00 0.00 ? 519 GLY A N    3  
ATOM   4304  C  CA   . GLY A 1 98 ? -21.570 -14.541 -39.656 1.00 0.00 ? 519 GLY A CA   3  
ATOM   4305  C  C    . GLY A 1 98 ? -21.841 -14.414 -41.142 1.00 0.00 ? 519 GLY A C    3  
ATOM   4306  O  O    . GLY A 1 98 ? -22.166 -13.319 -41.600 1.00 0.00 ? 519 GLY A O    3  
ATOM   4307  H  H    . GLY A 1 98 ? -22.686 -12.836 -39.081 1.00 0.00 ? 519 GLY A H    3  
ATOM   4308  H  HA2  . GLY A 1 98 ? -20.534 -14.810 -39.512 1.00 0.00 ? 519 GLY A HA2  3  
ATOM   4309  H  HA3  . GLY A 1 98 ? -22.194 -15.326 -39.254 1.00 0.00 ? 519 GLY A HA3  3  
HETATM 4310  ZN ZN   . ZN  B 2 .  ? -0.580  -7.833  -11.038 1.00 0.00 ? 622 ZN  A ZN   3  
HETATM 4311  ZN ZN   . ZN  C 2 .  ? -0.556  -3.324  5.880   1.00 0.00 ? 822 ZN  A ZN   3  
ATOM   4312  N  N    . GLY A 1 1  ? 39.842  -13.638 -2.969  1.00 0.00 ? 422 GLY A N    4  
ATOM   4313  C  CA   . GLY A 1 1  ? 38.699  -13.053 -3.644  1.00 0.00 ? 422 GLY A CA   4  
ATOM   4314  C  C    . GLY A 1 1  ? 37.811  -14.097 -4.291  1.00 0.00 ? 422 GLY A C    4  
ATOM   4315  O  O    . GLY A 1 1  ? 38.297  -15.003 -4.967  1.00 0.00 ? 422 GLY A O    4  
ATOM   4316  H  H1   . GLY A 1 1  ? 40.622  -13.925 -3.489  1.00 0.00 ? 422 GLY A H1   4  
ATOM   4317  H  HA2  . GLY A 1 1  ? 38.117  -12.495 -2.926  1.00 0.00 ? 422 GLY A HA2  4  
ATOM   4318  H  HA3  . GLY A 1 1  ? 39.054  -12.376 -4.408  1.00 0.00 ? 422 GLY A HA3  4  
ATOM   4319  N  N    . SER A 1 2  ? 36.504  -13.972 -4.083  1.00 0.00 ? 423 SER A N    4  
ATOM   4320  C  CA   . SER A 1 2  ? 35.546  -14.915 -4.646  1.00 0.00 ? 423 SER A CA   4  
ATOM   4321  C  C    . SER A 1 2  ? 34.684  -14.244 -5.711  1.00 0.00 ? 423 SER A C    4  
ATOM   4322  O  O    . SER A 1 2  ? 34.138  -13.163 -5.493  1.00 0.00 ? 423 SER A O    4  
ATOM   4323  C  CB   . SER A 1 2  ? 34.656  -15.492 -3.543  1.00 0.00 ? 423 SER A CB   4  
ATOM   4324  O  OG   . SER A 1 2  ? 35.240  -16.649 -2.970  1.00 0.00 ? 423 SER A OG   4  
ATOM   4325  H  H    . SER A 1 2  ? 36.177  -13.228 -3.534  1.00 0.00 ? 423 SER A H    4  
ATOM   4326  H  HA   . SER A 1 2  ? 36.103  -15.719 -5.105  1.00 0.00 ? 423 SER A HA   4  
ATOM   4327  H  HB2  . SER A 1 2  ? 34.520  -14.751 -2.770  1.00 0.00 ? 423 SER A HB2  4  
ATOM   4328  H  HB3  . SER A 1 2  ? 33.695  -15.756 -3.961  1.00 0.00 ? 423 SER A HB3  4  
ATOM   4329  H  HG   . SER A 1 2  ? 35.750  -16.400 -2.195  1.00 0.00 ? 423 SER A HG   4  
ATOM   4330  N  N    . SER A 1 3  ? 34.567  -14.894 -6.865  1.00 0.00 ? 424 SER A N    4  
ATOM   4331  C  CA   . SER A 1 3  ? 33.776  -14.359 -7.967  1.00 0.00 ? 424 SER A CA   4  
ATOM   4332  C  C    . SER A 1 3  ? 32.329  -14.136 -7.538  1.00 0.00 ? 424 SER A C    4  
ATOM   4333  O  O    . SER A 1 3  ? 31.940  -14.478 -6.421  1.00 0.00 ? 424 SER A O    4  
ATOM   4334  C  CB   . SER A 1 3  ? 33.824  -15.309 -9.165  1.00 0.00 ? 424 SER A CB   4  
ATOM   4335  O  OG   . SER A 1 3  ? 33.458  -16.625 -8.788  1.00 0.00 ? 424 SER A OG   4  
ATOM   4336  H  H    . SER A 1 3  ? 35.027  -15.752 -6.979  1.00 0.00 ? 424 SER A H    4  
ATOM   4337  H  HA   . SER A 1 3  ? 34.204  -13.410 -8.253  1.00 0.00 ? 424 SER A HA   4  
ATOM   4338  H  HB2  . SER A 1 3  ? 33.140  -14.961 -9.924  1.00 0.00 ? 424 SER A HB2  4  
ATOM   4339  H  HB3  . SER A 1 3  ? 34.827  -15.327 -9.566  1.00 0.00 ? 424 SER A HB3  4  
ATOM   4340  H  HG   . SER A 1 3  ? 33.789  -17.248 -9.439  1.00 0.00 ? 424 SER A HG   4  
ATOM   4341  N  N    . GLY A 1 4  ? 31.534  -13.559 -8.434  1.00 0.00 ? 425 GLY A N    4  
ATOM   4342  C  CA   . GLY A 1 4  ? 30.139  -13.300 -8.131  1.00 0.00 ? 425 GLY A CA   4  
ATOM   4343  C  C    . GLY A 1 4  ? 29.204  -13.836 -9.198  1.00 0.00 ? 425 GLY A C    4  
ATOM   4344  O  O    . GLY A 1 4  ? 29.641  -14.194 -10.292 1.00 0.00 ? 425 GLY A O    4  
ATOM   4345  H  H    . GLY A 1 4  ? 31.898  -13.308 -9.309  1.00 0.00 ? 425 GLY A H    4  
ATOM   4346  H  HA2  . GLY A 1 4  ? 29.894  -13.764 -7.187  1.00 0.00 ? 425 GLY A HA2  4  
ATOM   4347  H  HA3  . GLY A 1 4  ? 29.993  -12.233 -8.045  1.00 0.00 ? 425 GLY A HA3  4  
ATOM   4348  N  N    . SER A 1 5  ? 27.915  -13.892 -8.879  1.00 0.00 ? 426 SER A N    4  
ATOM   4349  C  CA   . SER A 1 5  ? 26.917  -14.393 -9.817  1.00 0.00 ? 426 SER A CA   4  
ATOM   4350  C  C    . SER A 1 5  ? 25.721  -13.449 -9.893  1.00 0.00 ? 426 SER A C    4  
ATOM   4351  O  O    . SER A 1 5  ? 25.427  -12.724 -8.942  1.00 0.00 ? 426 SER A O    4  
ATOM   4352  C  CB   . SER A 1 5  ? 26.453  -15.790 -9.401  1.00 0.00 ? 426 SER A CB   4  
ATOM   4353  O  OG   . SER A 1 5  ? 25.624  -15.732 -8.254  1.00 0.00 ? 426 SER A OG   4  
ATOM   4354  H  H    . SER A 1 5  ? 27.629  -13.591 -7.991  1.00 0.00 ? 426 SER A H    4  
ATOM   4355  H  HA   . SER A 1 5  ? 27.378  -14.451 -10.792 1.00 0.00 ? 426 SER A HA   4  
ATOM   4356  H  HB2  . SER A 1 5  ? 25.896  -16.237 -10.211 1.00 0.00 ? 426 SER A HB2  4  
ATOM   4357  H  HB3  . SER A 1 5  ? 27.315  -16.401 -9.178  1.00 0.00 ? 426 SER A HB3  4  
ATOM   4358  H  HG   . SER A 1 5  ? 24.713  -15.593 -8.523  1.00 0.00 ? 426 SER A HG   4  
ATOM   4359  N  N    . SER A 1 6  ? 25.034  -13.464 -11.031 1.00 0.00 ? 427 SER A N    4  
ATOM   4360  C  CA   . SER A 1 6  ? 23.872  -12.607 -11.234 1.00 0.00 ? 427 SER A CA   4  
ATOM   4361  C  C    . SER A 1 6  ? 22.580  -13.370 -10.958 1.00 0.00 ? 427 SER A C    4  
ATOM   4362  O  O    . SER A 1 6  ? 21.784  -12.977 -10.107 1.00 0.00 ? 427 SER A O    4  
ATOM   4363  C  CB   . SER A 1 6  ? 23.859  -12.060 -12.663 1.00 0.00 ? 427 SER A CB   4  
ATOM   4364  O  OG   . SER A 1 6  ? 24.975  -11.218 -12.896 1.00 0.00 ? 427 SER A OG   4  
ATOM   4365  H  H    . SER A 1 6  ? 25.319  -14.064 -11.752 1.00 0.00 ? 427 SER A H    4  
ATOM   4366  H  HA   . SER A 1 6  ? 23.944  -11.782 -10.542 1.00 0.00 ? 427 SER A HA   4  
ATOM   4367  H  HB2  . SER A 1 6  ? 23.892  -12.882 -13.361 1.00 0.00 ? 427 SER A HB2  4  
ATOM   4368  H  HB3  . SER A 1 6  ? 22.954  -11.491 -12.819 1.00 0.00 ? 427 SER A HB3  4  
ATOM   4369  H  HG   . SER A 1 6  ? 24.684  -10.415 -13.335 1.00 0.00 ? 427 SER A HG   4  
ATOM   4370  N  N    . GLY A 1 7  ? 22.379  -14.465 -11.686 1.00 0.00 ? 428 GLY A N    4  
ATOM   4371  C  CA   . GLY A 1 7  ? 21.183  -15.266 -11.505 1.00 0.00 ? 428 GLY A CA   4  
ATOM   4372  C  C    . GLY A 1 7  ? 19.919  -14.430 -11.511 1.00 0.00 ? 428 GLY A C    4  
ATOM   4373  O  O    . GLY A 1 7  ? 19.263  -14.279 -10.481 1.00 0.00 ? 428 GLY A O    4  
ATOM   4374  H  H    . GLY A 1 7  ? 23.049  -14.730 -12.350 1.00 0.00 ? 428 GLY A H    4  
ATOM   4375  H  HA2  . GLY A 1 7  ? 21.126  -15.992 -12.302 1.00 0.00 ? 428 GLY A HA2  4  
ATOM   4376  H  HA3  . GLY A 1 7  ? 21.251  -15.787 -10.562 1.00 0.00 ? 428 GLY A HA3  4  
ATOM   4377  N  N    . GLU A 1 8  ? 19.577  -13.884 -12.674 1.00 0.00 ? 429 GLU A N    4  
ATOM   4378  C  CA   . GLU A 1 8  ? 18.384  -13.057 -12.808 1.00 0.00 ? 429 GLU A CA   4  
ATOM   4379  C  C    . GLU A 1 8  ? 17.303  -13.785 -13.603 1.00 0.00 ? 429 GLU A C    4  
ATOM   4380  O  O    . GLU A 1 8  ? 17.591  -14.448 -14.600 1.00 0.00 ? 429 GLU A O    4  
ATOM   4381  C  CB   . GLU A 1 8  ? 18.729  -11.732 -13.492 1.00 0.00 ? 429 GLU A CB   4  
ATOM   4382  C  CG   . GLU A 1 8  ? 19.545  -10.792 -12.620 1.00 0.00 ? 429 GLU A CG   4  
ATOM   4383  C  CD   . GLU A 1 8  ? 19.667  -9.403  -13.215 1.00 0.00 ? 429 GLU A CD   4  
ATOM   4384  O  OE1  . GLU A 1 8  ? 18.694  -8.942  -13.849 1.00 0.00 ? 429 GLU A OE1  4  
ATOM   4385  O  OE2  . GLU A 1 8  ? 20.734  -8.776  -13.047 1.00 0.00 ? 429 GLU A OE2  4  
ATOM   4386  H  H    . GLU A 1 8  ? 20.141  -14.041 -13.460 1.00 0.00 ? 429 GLU A H    4  
ATOM   4387  H  HA   . GLU A 1 8  ? 18.009  -12.853 -11.817 1.00 0.00 ? 429 GLU A HA   4  
ATOM   4388  H  HB2  . GLU A 1 8  ? 19.294  -11.939 -14.388 1.00 0.00 ? 429 GLU A HB2  4  
ATOM   4389  H  HB3  . GLU A 1 8  ? 17.812  -11.231 -13.763 1.00 0.00 ? 429 GLU A HB3  4  
ATOM   4390  H  HG2  . GLU A 1 8  ? 19.068  -10.712 -11.654 1.00 0.00 ? 429 GLU A HG2  4  
ATOM   4391  H  HG3  . GLU A 1 8  ? 20.536  -11.203 -12.498 1.00 0.00 ? 429 GLU A HG3  4  
ATOM   4392  N  N    . LEU A 1 9  ? 16.060  -13.656 -13.153 1.00 0.00 ? 430 LEU A N    4  
ATOM   4393  C  CA   . LEU A 1 9  ? 14.935  -14.301 -13.821 1.00 0.00 ? 430 LEU A CA   4  
ATOM   4394  C  C    . LEU A 1 9  ? 14.025  -13.268 -14.477 1.00 0.00 ? 430 LEU A C    4  
ATOM   4395  O  O    . LEU A 1 9  ? 13.995  -12.098 -14.093 1.00 0.00 ? 430 LEU A O    4  
ATOM   4396  C  CB   . LEU A 1 9  ? 14.135  -15.139 -12.821 1.00 0.00 ? 430 LEU A CB   4  
ATOM   4397  C  CG   . LEU A 1 9  ? 14.763  -16.470 -12.407 1.00 0.00 ? 430 LEU A CG   4  
ATOM   4398  C  CD1  . LEU A 1 9  ? 15.613  -16.295 -11.158 1.00 0.00 ? 430 LEU A CD1  4  
ATOM   4399  C  CD2  . LEU A 1 9  ? 13.685  -17.520 -12.178 1.00 0.00 ? 430 LEU A CD2  4  
ATOM   4400  H  H    . LEU A 1 9  ? 15.893  -13.114 -12.354 1.00 0.00 ? 430 LEU A H    4  
ATOM   4401  H  HA   . LEU A 1 9  ? 15.332  -14.951 -14.586 1.00 0.00 ? 430 LEU A HA   4  
ATOM   4402  H  HB2  . LEU A 1 9  ? 13.998  -14.547 -11.929 1.00 0.00 ? 430 LEU A HB2  4  
ATOM   4403  H  HB3  . LEU A 1 9  ? 13.172  -15.349 -13.263 1.00 0.00 ? 430 LEU A HB3  4  
ATOM   4404  H  HG   . LEU A 1 9  ? 15.408  -16.819 -13.202 1.00 0.00 ? 430 LEU A HG   4  
ATOM   4405  H  HD11 . LEU A 1 9  ? 16.589  -15.928 -11.436 1.00 0.00 ? 430 LEU A HD11 4  
ATOM   4406  H  HD12 . LEU A 1 9  ? 15.714  -17.245 -10.655 1.00 0.00 ? 430 LEU A HD12 4  
ATOM   4407  H  HD13 . LEU A 1 9  ? 15.136  -15.587 -10.496 1.00 0.00 ? 430 LEU A HD13 4  
ATOM   4408  H  HD21 . LEU A 1 9  ? 14.149  -18.465 -11.940 1.00 0.00 ? 430 LEU A HD21 4  
ATOM   4409  H  HD22 . LEU A 1 9  ? 13.091  -17.626 -13.074 1.00 0.00 ? 430 LEU A HD22 4  
ATOM   4410  H  HD23 . LEU A 1 9  ? 13.052  -17.212 -11.359 1.00 0.00 ? 430 LEU A HD23 4  
ATOM   4411  N  N    . PRO A 1 10 ? 13.265  -13.707 -15.491 1.00 0.00 ? 431 PRO A N    4  
ATOM   4412  C  CA   . PRO A 1 10 ? 12.338  -12.837 -16.221 1.00 0.00 ? 431 PRO A CA   4  
ATOM   4413  C  C    . PRO A 1 10 ? 11.141  -12.423 -15.372 1.00 0.00 ? 431 PRO A C    4  
ATOM   4414  O  O    . PRO A 1 10 ? 10.240  -11.731 -15.846 1.00 0.00 ? 431 PRO A O    4  
ATOM   4415  C  CB   . PRO A 1 10 ? 11.886  -13.706 -17.396 1.00 0.00 ? 431 PRO A CB   4  
ATOM   4416  C  CG   . PRO A 1 10 ? 12.059  -15.107 -16.920 1.00 0.00 ? 431 PRO A CG   4  
ATOM   4417  C  CD   . PRO A 1 10 ? 13.250  -15.088 -16.002 1.00 0.00 ? 431 PRO A CD   4  
ATOM   4418  H  HA   . PRO A 1 10 ? 12.835  -11.953 -16.595 1.00 0.00 ? 431 PRO A HA   4  
ATOM   4419  H  HB2  . PRO A 1 10 ? 10.852  -13.492 -17.629 1.00 0.00 ? 431 PRO A HB2  4  
ATOM   4420  H  HB3  . PRO A 1 10 ? 12.504  -13.503 -18.258 1.00 0.00 ? 431 PRO A HB3  4  
ATOM   4421  H  HG2  . PRO A 1 10 ? 11.177  -15.425 -16.384 1.00 0.00 ? 431 PRO A HG2  4  
ATOM   4422  H  HG3  . PRO A 1 10 ? 12.244  -15.760 -17.760 1.00 0.00 ? 431 PRO A HG3  4  
ATOM   4423  H  HD2  . PRO A 1 10 ? 13.118  -15.796 -15.197 1.00 0.00 ? 431 PRO A HD2  4  
ATOM   4424  H  HD3  . PRO A 1 10 ? 14.154  -15.304 -16.552 1.00 0.00 ? 431 PRO A HD3  4  
ATOM   4425  N  N    . LYS A 1 11 ? 11.137  -12.852 -14.114 1.00 0.00 ? 432 LYS A N    4  
ATOM   4426  C  CA   . LYS A 1 11 ? 10.051  -12.526 -13.198 1.00 0.00 ? 432 LYS A CA   4  
ATOM   4427  C  C    . LYS A 1 11 ? 10.383  -11.281 -12.381 1.00 0.00 ? 432 LYS A C    4  
ATOM   4428  O  O    . LYS A 1 11 ? 11.450  -11.191 -11.772 1.00 0.00 ? 432 LYS A O    4  
ATOM   4429  C  CB   . LYS A 1 11 ? 9.775   -13.704 -12.261 1.00 0.00 ? 432 LYS A CB   4  
ATOM   4430  C  CG   . LYS A 1 11 ? 9.296   -14.953 -12.979 1.00 0.00 ? 432 LYS A CG   4  
ATOM   4431  C  CD   . LYS A 1 11 ? 7.828   -14.851 -13.356 1.00 0.00 ? 432 LYS A CD   4  
ATOM   4432  C  CE   . LYS A 1 11 ? 7.321   -16.143 -13.979 1.00 0.00 ? 432 LYS A CE   4  
ATOM   4433  N  NZ   . LYS A 1 11 ? 6.136   -15.911 -14.851 1.00 0.00 ? 432 LYS A NZ   4  
ATOM   4434  H  H    . LYS A 1 11 ? 11.883  -13.402 -13.794 1.00 0.00 ? 432 LYS A H    4  
ATOM   4435  H  HA   . LYS A 1 11 ? 9.167   -12.330 -13.786 1.00 0.00 ? 432 LYS A HA   4  
ATOM   4436  H  HB2  . LYS A 1 11 ? 10.684  -13.946 -11.729 1.00 0.00 ? 432 LYS A HB2  4  
ATOM   4437  H  HB3  . LYS A 1 11 ? 9.018   -13.412 -11.547 1.00 0.00 ? 432 LYS A HB3  4  
ATOM   4438  H  HG2  . LYS A 1 11 ? 9.879   -15.087 -13.878 1.00 0.00 ? 432 LYS A HG2  4  
ATOM   4439  H  HG3  . LYS A 1 11 ? 9.433   -15.806 -12.329 1.00 0.00 ? 432 LYS A HG3  4  
ATOM   4440  H  HD2  . LYS A 1 11 ? 7.250   -14.643 -12.468 1.00 0.00 ? 432 LYS A HD2  4  
ATOM   4441  H  HD3  . LYS A 1 11 ? 7.702   -14.046 -14.066 1.00 0.00 ? 432 LYS A HD3  4  
ATOM   4442  H  HE2  . LYS A 1 11 ? 8.112   -16.577 -14.571 1.00 0.00 ? 432 LYS A HE2  4  
ATOM   4443  H  HE3  . LYS A 1 11 ? 7.047   -16.825 -13.188 1.00 0.00 ? 432 LYS A HE3  4  
ATOM   4444  H  HZ1  . LYS A 1 11 ? 5.585   -16.788 -14.946 1.00 0.00 ? 432 LYS A HZ1  4  
ATOM   4445  H  HZ2  . LYS A 1 11 ? 6.443   -15.604 -15.796 1.00 0.00 ? 432 LYS A HZ2  4  
ATOM   4446  H  HZ3  . LYS A 1 11 ? 5.528   -15.175 -14.439 1.00 0.00 ? 432 LYS A HZ3  4  
ATOM   4447  N  N    . LYS A 1 12 ? 9.464   -10.322 -12.372 1.00 0.00 ? 433 LYS A N    4  
ATOM   4448  C  CA   . LYS A 1 12 ? 9.658   -9.082  -11.629 1.00 0.00 ? 433 LYS A CA   4  
ATOM   4449  C  C    . LYS A 1 12 ? 9.215   -9.243  -10.178 1.00 0.00 ? 433 LYS A C    4  
ATOM   4450  O  O    . LYS A 1 12 ? 8.337   -10.051 -9.873  1.00 0.00 ? 433 LYS A O    4  
ATOM   4451  C  CB   . LYS A 1 12 ? 8.879   -7.942  -12.288 1.00 0.00 ? 433 LYS A CB   4  
ATOM   4452  C  CG   . LYS A 1 12 ? 9.681   -7.178  -13.327 1.00 0.00 ? 433 LYS A CG   4  
ATOM   4453  C  CD   . LYS A 1 12 ? 9.251   -5.722  -13.404 1.00 0.00 ? 433 LYS A CD   4  
ATOM   4454  C  CE   . LYS A 1 12 ? 10.047  -4.854  -12.443 1.00 0.00 ? 433 LYS A CE   4  
ATOM   4455  N  NZ   . LYS A 1 12 ? 11.459  -4.687  -12.886 1.00 0.00 ? 433 LYS A NZ   4  
ATOM   4456  H  H    . LYS A 1 12 ? 8.634   -10.451 -12.878 1.00 0.00 ? 433 LYS A H    4  
ATOM   4457  H  HA   . LYS A 1 12 ? 10.711  -8.846  -11.647 1.00 0.00 ? 433 LYS A HA   4  
ATOM   4458  H  HB2  . LYS A 1 12 ? 8.002   -8.351  -12.769 1.00 0.00 ? 433 LYS A HB2  4  
ATOM   4459  H  HB3  . LYS A 1 12 ? 8.566   -7.246  -11.522 1.00 0.00 ? 433 LYS A HB3  4  
ATOM   4460  H  HG2  . LYS A 1 12 ? 10.727  -7.219  -13.063 1.00 0.00 ? 433 LYS A HG2  4  
ATOM   4461  H  HG3  . LYS A 1 12 ? 9.533   -7.639  -14.293 1.00 0.00 ? 433 LYS A HG3  4  
ATOM   4462  H  HD2  . LYS A 1 12 ? 9.407   -5.363  -14.410 1.00 0.00 ? 433 LYS A HD2  4  
ATOM   4463  H  HD3  . LYS A 1 12 ? 8.202   -5.653  -13.154 1.00 0.00 ? 433 LYS A HD3  4  
ATOM   4464  H  HE2  . LYS A 1 12 ? 9.580   -3.883  -12.384 1.00 0.00 ? 433 LYS A HE2  4  
ATOM   4465  H  HE3  . LYS A 1 12 ? 10.037  -5.317  -11.467 1.00 0.00 ? 433 LYS A HE3  4  
ATOM   4466  H  HZ1  . LYS A 1 12 ? 11.788  -3.722  -12.676 1.00 0.00 ? 433 LYS A HZ1  4  
ATOM   4467  H  HZ2  . LYS A 1 12 ? 11.534  -4.850  -13.910 1.00 0.00 ? 433 LYS A HZ2  4  
ATOM   4468  H  HZ3  . LYS A 1 12 ? 12.072  -5.366  -12.392 1.00 0.00 ? 433 LYS A HZ3  4  
ATOM   4469  N  N    . ARG A 1 13 ? 9.827   -8.469  -9.288  1.00 0.00 ? 434 ARG A N    4  
ATOM   4470  C  CA   . ARG A 1 13 ? 9.495   -8.526  -7.870  1.00 0.00 ? 434 ARG A CA   4  
ATOM   4471  C  C    . ARG A 1 13 ? 9.082   -7.151  -7.352  1.00 0.00 ? 434 ARG A C    4  
ATOM   4472  O  O    . ARG A 1 13 ? 9.535   -6.714  -6.296  1.00 0.00 ? 434 ARG A O    4  
ATOM   4473  C  CB   . ARG A 1 13 ? 10.687  -9.048  -7.066  1.00 0.00 ? 434 ARG A CB   4  
ATOM   4474  C  CG   . ARG A 1 13 ? 10.734  -10.564 -6.959  1.00 0.00 ? 434 ARG A CG   4  
ATOM   4475  C  CD   . ARG A 1 13 ? 11.140  -11.203 -8.278  1.00 0.00 ? 434 ARG A CD   4  
ATOM   4476  N  NE   . ARG A 1 13 ? 11.329  -12.645 -8.152  1.00 0.00 ? 434 ARG A NE   4  
ATOM   4477  C  CZ   . ARG A 1 13 ? 10.332  -13.504 -7.969  1.00 0.00 ? 434 ARG A CZ   4  
ATOM   4478  N  NH1  . ARG A 1 13 ? 9.083   -13.067 -7.892  1.00 0.00 ? 434 ARG A NH1  4  
ATOM   4479  N  NH2  . ARG A 1 13 ? 10.584  -14.802 -7.864  1.00 0.00 ? 434 ARG A NH2  4  
ATOM   4480  H  H    . ARG A 1 13 ? 10.519  -7.845  -9.592  1.00 0.00 ? 434 ARG A H    4  
ATOM   4481  H  HA   . ARG A 1 13 ? 8.666   -9.207  -7.750  1.00 0.00 ? 434 ARG A HA   4  
ATOM   4482  H  HB2  . ARG A 1 13 ? 11.599  -8.715  -7.539  1.00 0.00 ? 434 ARG A HB2  4  
ATOM   4483  H  HB3  . ARG A 1 13 ? 10.639  -8.640  -6.068  1.00 0.00 ? 434 ARG A HB3  4  
ATOM   4484  H  HG2  . ARG A 1 13 ? 11.452  -10.840 -6.202  1.00 0.00 ? 434 ARG A HG2  4  
ATOM   4485  H  HG3  . ARG A 1 13 ? 9.755   -10.925 -6.680  1.00 0.00 ? 434 ARG A HG3  4  
ATOM   4486  H  HD2  . ARG A 1 13 ? 10.367  -11.013 -9.008  1.00 0.00 ? 434 ARG A HD2  4  
ATOM   4487  H  HD3  . ARG A 1 13 ? 12.065  -10.755 -8.610  1.00 0.00 ? 434 ARG A HD3  4  
ATOM   4488  H  HE   . ARG A 1 13 ? 12.245  -12.989 -8.206  1.00 0.00 ? 434 ARG A HE   4  
ATOM   4489  H  HH11 . ARG A 1 13 ? 8.890   -12.090 -7.972  1.00 0.00 ? 434 ARG A HH11 4  
ATOM   4490  H  HH12 . ARG A 1 13 ? 8.334   -13.716 -7.756  1.00 0.00 ? 434 ARG A HH12 4  
ATOM   4491  H  HH21 . ARG A 1 13 ? 11.525  -15.135 -7.922  1.00 0.00 ? 434 ARG A HH21 4  
ATOM   4492  H  HH22 . ARG A 1 13 ? 9.834   -15.448 -7.726  1.00 0.00 ? 434 ARG A HH22 4  
ATOM   4493  N  N    . GLU A 1 14 ? 8.219   -6.476  -8.105  1.00 0.00 ? 435 GLU A N    4  
ATOM   4494  C  CA   . GLU A 1 14 ? 7.746   -5.151  -7.723  1.00 0.00 ? 435 GLU A CA   4  
ATOM   4495  C  C    . GLU A 1 14 ? 6.251   -5.173  -7.420  1.00 0.00 ? 435 GLU A C    4  
ATOM   4496  O  O    . GLU A 1 14 ? 5.552   -6.131  -7.754  1.00 0.00 ? 435 GLU A O    4  
ATOM   4497  C  CB   . GLU A 1 14 ? 8.038   -4.141  -8.834  1.00 0.00 ? 435 GLU A CB   4  
ATOM   4498  C  CG   . GLU A 1 14 ? 9.503   -3.747  -8.930  1.00 0.00 ? 435 GLU A CG   4  
ATOM   4499  C  CD   . GLU A 1 14 ? 9.848   -2.565  -8.046  1.00 0.00 ? 435 GLU A CD   4  
ATOM   4500  O  OE1  . GLU A 1 14 ? 9.092   -2.298  -7.089  1.00 0.00 ? 435 GLU A OE1  4  
ATOM   4501  O  OE2  . GLU A 1 14 ? 10.875  -1.906  -8.311  1.00 0.00 ? 435 GLU A OE2  4  
ATOM   4502  H  H    . GLU A 1 14 ? 7.893   -6.878  -8.937  1.00 0.00 ? 435 GLU A H    4  
ATOM   4503  H  HA   . GLU A 1 14 ? 8.277   -4.854  -6.831  1.00 0.00 ? 435 GLU A HA   4  
ATOM   4504  H  HB2  . GLU A 1 14 ? 7.738   -4.567  -9.780  1.00 0.00 ? 435 GLU A HB2  4  
ATOM   4505  H  HB3  . GLU A 1 14 ? 7.459   -3.247  -8.653  1.00 0.00 ? 435 GLU A HB3  4  
ATOM   4506  H  HG2  . GLU A 1 14 ? 10.109  -4.589  -8.631  1.00 0.00 ? 435 GLU A HG2  4  
ATOM   4507  H  HG3  . GLU A 1 14 ? 9.727   -3.489  -9.955  1.00 0.00 ? 435 GLU A HG3  4  
ATOM   4508  N  N    . LEU A 1 15 ? 5.766   -4.111  -6.785  1.00 0.00 ? 436 LEU A N    4  
ATOM   4509  C  CA   . LEU A 1 15 ? 4.353   -4.008  -6.437  1.00 0.00 ? 436 LEU A CA   4  
ATOM   4510  C  C    . LEU A 1 15 ? 3.501   -3.773  -7.680  1.00 0.00 ? 436 LEU A C    4  
ATOM   4511  O  O    . LEU A 1 15 ? 3.623   -2.744  -8.344  1.00 0.00 ? 436 LEU A O    4  
ATOM   4512  C  CB   . LEU A 1 15 ? 4.137   -2.872  -5.434  1.00 0.00 ? 436 LEU A CB   4  
ATOM   4513  C  CG   . LEU A 1 15 ? 2.685   -2.581  -5.054  1.00 0.00 ? 436 LEU A CG   4  
ATOM   4514  C  CD1  . LEU A 1 15 ? 2.144   -3.670  -4.141  1.00 0.00 ? 436 LEU A CD1  4  
ATOM   4515  C  CD2  . LEU A 1 15 ? 2.573   -1.218  -4.386  1.00 0.00 ? 436 LEU A CD2  4  
ATOM   4516  H  H    . LEU A 1 15 ? 6.371   -3.380  -6.545  1.00 0.00 ? 436 LEU A H    4  
ATOM   4517  H  HA   . LEU A 1 15 ? 4.055   -4.940  -5.981  1.00 0.00 ? 436 LEU A HA   4  
ATOM   4518  H  HB2  . LEU A 1 15 ? 4.672   -3.123  -4.531  1.00 0.00 ? 436 LEU A HB2  4  
ATOM   4519  H  HB3  . LEU A 1 15 ? 4.556   -1.972  -5.861  1.00 0.00 ? 436 LEU A HB3  4  
ATOM   4520  H  HG   . LEU A 1 15 ? 2.081   -2.566  -5.950  1.00 0.00 ? 436 LEU A HG   4  
ATOM   4521  H  HD11 . LEU A 1 15 ? 1.066   -3.623  -4.124  1.00 0.00 ? 436 LEU A HD11 4  
ATOM   4522  H  HD12 . LEU A 1 15 ? 2.526   -3.524  -3.141  1.00 0.00 ? 436 LEU A HD12 4  
ATOM   4523  H  HD13 . LEU A 1 15 ? 2.458   -4.636  -4.508  1.00 0.00 ? 436 LEU A HD13 4  
ATOM   4524  H  HD21 . LEU A 1 15 ? 2.583   -1.341  -3.313  1.00 0.00 ? 436 LEU A HD21 4  
ATOM   4525  H  HD22 . LEU A 1 15 ? 1.648   -0.746  -4.685  1.00 0.00 ? 436 LEU A HD22 4  
ATOM   4526  H  HD23 . LEU A 1 15 ? 3.406   -0.600  -4.686  1.00 0.00 ? 436 LEU A HD23 4  
ATOM   4527  N  N    . CYS A 1 16 ? 2.636   -4.734  -7.988  1.00 0.00 ? 437 CYS A N    4  
ATOM   4528  C  CA   . CYS A 1 16 ? 1.762   -4.632  -9.150  1.00 0.00 ? 437 CYS A CA   4  
ATOM   4529  C  C    . CYS A 1 16 ? 0.849   -3.415  -9.039  1.00 0.00 ? 437 CYS A C    4  
ATOM   4530  O  O    . CYS A 1 16 ? 0.130   -3.251  -8.052  1.00 0.00 ? 437 CYS A O    4  
ATOM   4531  C  CB   . CYS A 1 16 ? 0.921   -5.902  -9.294  1.00 0.00 ? 437 CYS A CB   4  
ATOM   4532  S  SG   . CYS A 1 16 ? 0.160   -6.108  -10.936 1.00 0.00 ? 437 CYS A SG   4  
ATOM   4533  H  H    . CYS A 1 16 ? 2.585   -5.532  -7.419  1.00 0.00 ? 437 CYS A H    4  
ATOM   4534  H  HA   . CYS A 1 16 ? 2.384   -4.522  -10.025 1.00 0.00 ? 437 CYS A HA   4  
ATOM   4535  H  HB2  . CYS A 1 16 ? 1.549   -6.763  -9.114  1.00 0.00 ? 437 CYS A HB2  4  
ATOM   4536  H  HB3  . CYS A 1 16 ? 0.127   -5.884  -8.563  1.00 0.00 ? 437 CYS A HB3  4  
ATOM   4537  N  N    . LYS A 1 17 ? 0.882   -2.562  -10.057 1.00 0.00 ? 438 LYS A N    4  
ATOM   4538  C  CA   . LYS A 1 17 ? 0.057   -1.360  -10.077 1.00 0.00 ? 438 LYS A CA   4  
ATOM   4539  C  C    . LYS A 1 17 ? -1.423  -1.717  -10.161 1.00 0.00 ? 438 LYS A C    4  
ATOM   4540  O  O    . LYS A 1 17 ? -2.287  -0.840  -10.118 1.00 0.00 ? 438 LYS A O    4  
ATOM   4541  C  CB   . LYS A 1 17 ? 0.446   -0.469  -11.259 1.00 0.00 ? 438 LYS A CB   4  
ATOM   4542  C  CG   . LYS A 1 17 ? 0.353   -1.169  -12.604 1.00 0.00 ? 438 LYS A CG   4  
ATOM   4543  C  CD   . LYS A 1 17 ? 1.055   -0.377  -13.694 1.00 0.00 ? 438 LYS A CD   4  
ATOM   4544  C  CE   . LYS A 1 17 ? 0.685   -0.886  -15.079 1.00 0.00 ? 438 LYS A CE   4  
ATOM   4545  N  NZ   . LYS A 1 17 ? 1.152   -2.283  -15.299 1.00 0.00 ? 438 LYS A NZ   4  
ATOM   4546  H  H    . LYS A 1 17 ? 1.475   -2.747  -10.816 1.00 0.00 ? 438 LYS A H    4  
ATOM   4547  H  HA   . LYS A 1 17 ? 0.234   -0.822  -9.158  1.00 0.00 ? 438 LYS A HA   4  
ATOM   4548  H  HB2  . LYS A 1 17 ? -0.208  0.390   -11.278 1.00 0.00 ? 438 LYS A HB2  4  
ATOM   4549  H  HB3  . LYS A 1 17 ? 1.464   -0.133  -11.122 1.00 0.00 ? 438 LYS A HB3  4  
ATOM   4550  H  HG2  . LYS A 1 17 ? 0.816   -2.142  -12.527 1.00 0.00 ? 438 LYS A HG2  4  
ATOM   4551  H  HG3  . LYS A 1 17 ? -0.689  -1.283  -12.869 1.00 0.00 ? 438 LYS A HG3  4  
ATOM   4552  H  HD2  . LYS A 1 17 ? 0.766   0.661   -13.616 1.00 0.00 ? 438 LYS A HD2  4  
ATOM   4553  H  HD3  . LYS A 1 17 ? 2.124   -0.466  -13.561 1.00 0.00 ? 438 LYS A HD3  4  
ATOM   4554  H  HE2  . LYS A 1 17 ? -0.388  -0.854  -15.186 1.00 0.00 ? 438 LYS A HE2  4  
ATOM   4555  H  HE3  . LYS A 1 17 ? 1.140   -0.243  -15.818 1.00 0.00 ? 438 LYS A HE3  4  
ATOM   4556  H  HZ1  . LYS A 1 17 ? 0.915   -2.873  -14.476 1.00 0.00 ? 438 LYS A HZ1  4  
ATOM   4557  H  HZ2  . LYS A 1 17 ? 2.183   -2.298  -15.436 1.00 0.00 ? 438 LYS A HZ2  4  
ATOM   4558  H  HZ3  . LYS A 1 17 ? 0.696   -2.684  -16.143 1.00 0.00 ? 438 LYS A HZ3  4  
ATOM   4559  N  N    . PHE A 1 18 ? -1.710  -3.009  -10.279 1.00 0.00 ? 439 PHE A N    4  
ATOM   4560  C  CA   . PHE A 1 18 ? -3.087  -3.482  -10.368 1.00 0.00 ? 439 PHE A CA   4  
ATOM   4561  C  C    . PHE A 1 18 ? -3.569  -4.010  -9.020  1.00 0.00 ? 439 PHE A C    4  
ATOM   4562  O  O    . PHE A 1 18 ? -4.590  -3.565  -8.496  1.00 0.00 ? 439 PHE A O    4  
ATOM   4563  C  CB   . PHE A 1 18 ? -3.204  -4.577  -11.430 1.00 0.00 ? 439 PHE A CB   4  
ATOM   4564  C  CG   . PHE A 1 18 ? -3.138  -4.057  -12.838 1.00 0.00 ? 439 PHE A CG   4  
ATOM   4565  C  CD1  . PHE A 1 18 ? -4.175  -3.302  -13.361 1.00 0.00 ? 439 PHE A CD1  4  
ATOM   4566  C  CD2  . PHE A 1 18 ? -2.039  -4.324  -13.638 1.00 0.00 ? 439 PHE A CD2  4  
ATOM   4567  C  CE1  . PHE A 1 18 ? -4.118  -2.821  -14.655 1.00 0.00 ? 439 PHE A CE1  4  
ATOM   4568  C  CE2  . PHE A 1 18 ? -1.976  -3.846  -14.933 1.00 0.00 ? 439 PHE A CE2  4  
ATOM   4569  C  CZ   . PHE A 1 18 ? -3.017  -3.095  -15.443 1.00 0.00 ? 439 PHE A CZ   4  
ATOM   4570  H  H    . PHE A 1 18 ? -0.978  -3.660  -10.307 1.00 0.00 ? 439 PHE A H    4  
ATOM   4571  H  HA   . PHE A 1 18 ? -3.705  -2.646  -10.656 1.00 0.00 ? 439 PHE A HA   4  
ATOM   4572  H  HB2  . PHE A 1 18 ? -2.398  -5.283  -11.300 1.00 0.00 ? 439 PHE A HB2  4  
ATOM   4573  H  HB3  . PHE A 1 18 ? -4.148  -5.087  -11.307 1.00 0.00 ? 439 PHE A HB3  4  
ATOM   4574  H  HD1  . PHE A 1 18 ? -5.038  -3.087  -12.745 1.00 0.00 ? 439 PHE A HD1  4  
ATOM   4575  H  HD2  . PHE A 1 18 ? -1.225  -4.912  -13.241 1.00 0.00 ? 439 PHE A HD2  4  
ATOM   4576  H  HE1  . PHE A 1 18 ? -4.933  -2.234  -15.051 1.00 0.00 ? 439 PHE A HE1  4  
ATOM   4577  H  HE2  . PHE A 1 18 ? -1.114  -4.062  -15.547 1.00 0.00 ? 439 PHE A HE2  4  
ATOM   4578  H  HZ   . PHE A 1 18 ? -2.969  -2.720  -16.454 1.00 0.00 ? 439 PHE A HZ   4  
ATOM   4579  N  N    . TYR A 1 19 ? -2.827  -4.963  -8.466  1.00 0.00 ? 440 TYR A N    4  
ATOM   4580  C  CA   . TYR A 1 19 ? -3.179  -5.555  -7.181  1.00 0.00 ? 440 TYR A CA   4  
ATOM   4581  C  C    . TYR A 1 19 ? -3.599  -4.480  -6.183  1.00 0.00 ? 440 TYR A C    4  
ATOM   4582  O  O    . TYR A 1 19 ? -4.498  -4.692  -5.368  1.00 0.00 ? 440 TYR A O    4  
ATOM   4583  C  CB   . TYR A 1 19 ? -2.000  -6.353  -6.623  1.00 0.00 ? 440 TYR A CB   4  
ATOM   4584  C  CG   . TYR A 1 19 ? -2.380  -7.287  -5.496  1.00 0.00 ? 440 TYR A CG   4  
ATOM   4585  C  CD1  . TYR A 1 19 ? -3.455  -8.158  -5.622  1.00 0.00 ? 440 TYR A CD1  4  
ATOM   4586  C  CD2  . TYR A 1 19 ? -1.664  -7.299  -4.306  1.00 0.00 ? 440 TYR A CD2  4  
ATOM   4587  C  CE1  . TYR A 1 19 ? -3.807  -9.012  -4.595  1.00 0.00 ? 440 TYR A CE1  4  
ATOM   4588  C  CE2  . TYR A 1 19 ? -2.007  -8.151  -3.274  1.00 0.00 ? 440 TYR A CE2  4  
ATOM   4589  C  CZ   . TYR A 1 19 ? -3.079  -9.006  -3.424  1.00 0.00 ? 440 TYR A CZ   4  
ATOM   4590  O  OH   . TYR A 1 19 ? -3.425  -9.855  -2.398  1.00 0.00 ? 440 TYR A OH   4  
ATOM   4591  H  H    . TYR A 1 19 ? -2.024  -5.277  -8.933  1.00 0.00 ? 440 TYR A H    4  
ATOM   4592  H  HA   . TYR A 1 19 ? -4.011  -6.226  -7.342  1.00 0.00 ? 440 TYR A HA   4  
ATOM   4593  H  HB2  . TYR A 1 19 ? -1.569  -6.947  -7.414  1.00 0.00 ? 440 TYR A HB2  4  
ATOM   4594  H  HB3  . TYR A 1 19 ? -1.255  -5.666  -6.248  1.00 0.00 ? 440 TYR A HB3  4  
ATOM   4595  H  HD1  . TYR A 1 19 ? -4.023  -8.161  -6.541  1.00 0.00 ? 440 TYR A HD1  4  
ATOM   4596  H  HD2  . TYR A 1 19 ? -0.825  -6.627  -4.192  1.00 0.00 ? 440 TYR A HD2  4  
ATOM   4597  H  HE1  . TYR A 1 19 ? -4.646  -9.682  -4.712  1.00 0.00 ? 440 TYR A HE1  4  
ATOM   4598  H  HE2  . TYR A 1 19 ? -1.438  -8.145  -2.356  1.00 0.00 ? 440 TYR A HE2  4  
ATOM   4599  H  HH   . TYR A 1 19 ? -4.203  -10.358 -2.648  1.00 0.00 ? 440 TYR A HH   4  
ATOM   4600  N  N    . ILE A 1 20 ? -2.942  -3.328  -6.253  1.00 0.00 ? 441 ILE A N    4  
ATOM   4601  C  CA   . ILE A 1 20 ? -3.246  -2.219  -5.357  1.00 0.00 ? 441 ILE A CA   4  
ATOM   4602  C  C    . ILE A 1 20 ? -4.752  -2.029  -5.211  1.00 0.00 ? 441 ILE A C    4  
ATOM   4603  O  O    . ILE A 1 20 ? -5.249  -1.730  -4.124  1.00 0.00 ? 441 ILE A O    4  
ATOM   4604  C  CB   . ILE A 1 20 ? -2.620  -0.904  -5.856  1.00 0.00 ? 441 ILE A CB   4  
ATOM   4605  C  CG1  . ILE A 1 20 ? -1.105  -1.058  -6.002  1.00 0.00 ? 441 ILE A CG1  4  
ATOM   4606  C  CG2  . ILE A 1 20 ? -2.953  0.236   -4.905  1.00 0.00 ? 441 ILE A CG2  4  
ATOM   4607  C  CD1  . ILE A 1 20 ? -0.401  0.226   -6.383  1.00 0.00 ? 441 ILE A CD1  4  
ATOM   4608  H  H    . ILE A 1 20 ? -2.235  -3.221  -6.923  1.00 0.00 ? 441 ILE A H    4  
ATOM   4609  H  HA   . ILE A 1 20 ? -2.827  -2.449  -4.388  1.00 0.00 ? 441 ILE A HA   4  
ATOM   4610  H  HB   . ILE A 1 20 ? -3.046  -0.672  -6.821  1.00 0.00 ? 441 ILE A HB   4  
ATOM   4611  H  HG12 . ILE A 1 20 ? -0.692  -1.397  -5.065  1.00 0.00 ? 441 ILE A HG12 4  
ATOM   4612  H  HG13 . ILE A 1 20 ? -0.898  -1.791  -6.769  1.00 0.00 ? 441 ILE A HG13 4  
ATOM   4613  H  HG21 . ILE A 1 20 ? -2.040  0.637   -4.491  1.00 0.00 ? 441 ILE A HG21 4  
ATOM   4614  H  HG22 . ILE A 1 20 ? -3.475  1.013   -5.443  1.00 0.00 ? 441 ILE A HG22 4  
ATOM   4615  H  HG23 . ILE A 1 20 ? -3.580  -0.133  -4.107  1.00 0.00 ? 441 ILE A HG23 4  
ATOM   4616  H  HD11 . ILE A 1 20 ? -1.131  0.961   -6.687  1.00 0.00 ? 441 ILE A HD11 4  
ATOM   4617  H  HD12 . ILE A 1 20 ? 0.154   0.598   -5.535  1.00 0.00 ? 441 ILE A HD12 4  
ATOM   4618  H  HD13 . ILE A 1 20 ? 0.278   0.035   -7.201  1.00 0.00 ? 441 ILE A HD13 4  
ATOM   4619  N  N    . THR A 1 21 ? -5.476  -2.206  -6.312  1.00 0.00 ? 442 THR A N    4  
ATOM   4620  C  CA   . THR A 1 21 ? -6.925  -2.055  -6.307  1.00 0.00 ? 442 THR A CA   4  
ATOM   4621  C  C    . THR A 1 21 ? -7.619  -3.410  -6.231  1.00 0.00 ? 442 THR A C    4  
ATOM   4622  O  O    . THR A 1 21 ? -8.671  -3.546  -5.607  1.00 0.00 ? 442 THR A O    4  
ATOM   4623  C  CB   . THR A 1 21 ? -7.417  -1.310  -7.562  1.00 0.00 ? 442 THR A CB   4  
ATOM   4624  O  OG1  . THR A 1 21 ? -8.807  -1.576  -7.777  1.00 0.00 ? 442 THR A OG1  4  
ATOM   4625  C  CG2  . THR A 1 21 ? -6.619  -1.729  -8.788  1.00 0.00 ? 442 THR A CG2  4  
ATOM   4626  H  H    . THR A 1 21 ? -5.022  -2.444  -7.148  1.00 0.00 ? 442 THR A H    4  
ATOM   4627  H  HA   . THR A 1 21 ? -7.197  -1.473  -5.438  1.00 0.00 ? 442 THR A HA   4  
ATOM   4628  H  HB   . THR A 1 21 ? -7.280  -0.249  -7.408  1.00 0.00 ? 442 THR A HB   4  
ATOM   4629  H  HG1  . THR A 1 21 ? -9.331  -1.059  -7.160  1.00 0.00 ? 442 THR A HG1  4  
ATOM   4630  H  HG21 . THR A 1 21 ? -7.056  -1.286  -9.671  1.00 0.00 ? 442 THR A HG21 4  
ATOM   4631  H  HG22 . THR A 1 21 ? -6.638  -2.805  -8.878  1.00 0.00 ? 442 THR A HG22 4  
ATOM   4632  H  HG23 . THR A 1 21 ? -5.598  -1.394  -8.685  1.00 0.00 ? 442 THR A HG23 4  
ATOM   4633  N  N    . GLY A 1 22 ? -7.023  -4.412  -6.870  1.00 0.00 ? 443 GLY A N    4  
ATOM   4634  C  CA   . GLY A 1 22 ? -7.598  -5.745  -6.861  1.00 0.00 ? 443 GLY A CA   4  
ATOM   4635  C  C    . GLY A 1 22 ? -7.937  -6.239  -8.253  1.00 0.00 ? 443 GLY A C    4  
ATOM   4636  O  O    . GLY A 1 22 ? -8.264  -7.411  -8.442  1.00 0.00 ? 443 GLY A O    4  
ATOM   4637  H  H    . GLY A 1 22 ? -6.185  -4.246  -7.351  1.00 0.00 ? 443 GLY A H    4  
ATOM   4638  H  HA2  . GLY A 1 22 ? -6.893  -6.427  -6.410  1.00 0.00 ? 443 GLY A HA2  4  
ATOM   4639  H  HA3  . GLY A 1 22 ? -8.500  -5.731  -6.267  1.00 0.00 ? 443 GLY A HA3  4  
ATOM   4640  N  N    . PHE A 1 23 ? -7.860  -5.344  -9.233  1.00 0.00 ? 444 PHE A N    4  
ATOM   4641  C  CA   . PHE A 1 23 ? -8.164  -5.695  -10.615 1.00 0.00 ? 444 PHE A CA   4  
ATOM   4642  C  C    . PHE A 1 23 ? -6.884  -5.944  -11.407 1.00 0.00 ? 444 PHE A C    4  
ATOM   4643  O  O    . PHE A 1 23 ? -6.258  -5.009  -11.907 1.00 0.00 ? 444 PHE A O    4  
ATOM   4644  C  CB   . PHE A 1 23 ? -8.979  -4.583  -11.278 1.00 0.00 ? 444 PHE A CB   4  
ATOM   4645  C  CG   . PHE A 1 23 ? -9.594  -4.990  -12.587 1.00 0.00 ? 444 PHE A CG   4  
ATOM   4646  C  CD1  . PHE A 1 23 ? -8.797  -5.273  -13.684 1.00 0.00 ? 444 PHE A CD1  4  
ATOM   4647  C  CD2  . PHE A 1 23 ? -10.970 -5.089  -12.720 1.00 0.00 ? 444 PHE A CD2  4  
ATOM   4648  C  CE1  . PHE A 1 23 ? -9.361  -5.647  -14.889 1.00 0.00 ? 444 PHE A CE1  4  
ATOM   4649  C  CE2  . PHE A 1 23 ? -11.539 -5.462  -13.923 1.00 0.00 ? 444 PHE A CE2  4  
ATOM   4650  C  CZ   . PHE A 1 23 ? -10.733 -5.743  -15.008 1.00 0.00 ? 444 PHE A CZ   4  
ATOM   4651  H  H    . PHE A 1 23 ? -7.594  -4.425  -9.020  1.00 0.00 ? 444 PHE A H    4  
ATOM   4652  H  HA   . PHE A 1 23 ? -8.749  -6.601  -10.605 1.00 0.00 ? 444 PHE A HA   4  
ATOM   4653  H  HB2  . PHE A 1 23 ? -9.778  -4.287  -10.615 1.00 0.00 ? 444 PHE A HB2  4  
ATOM   4654  H  HB3  . PHE A 1 23 ? -8.336  -3.735  -11.462 1.00 0.00 ? 444 PHE A HB3  4  
ATOM   4655  H  HD1  . PHE A 1 23 ? -7.723  -5.200  -13.592 1.00 0.00 ? 444 PHE A HD1  4  
ATOM   4656  H  HD2  . PHE A 1 23 ? -11.602 -4.870  -11.870 1.00 0.00 ? 444 PHE A HD2  4  
ATOM   4657  H  HE1  . PHE A 1 23 ? -8.728  -5.866  -15.736 1.00 0.00 ? 444 PHE A HE1  4  
ATOM   4658  H  HE2  . PHE A 1 23 ? -12.613 -5.536  -14.012 1.00 0.00 ? 444 PHE A HE2  4  
ATOM   4659  H  HZ   . PHE A 1 23 ? -11.176 -6.034  -15.949 1.00 0.00 ? 444 PHE A HZ   4  
ATOM   4660  N  N    . CYS A 1 24 ? -6.500  -7.211  -11.516 1.00 0.00 ? 445 CYS A N    4  
ATOM   4661  C  CA   . CYS A 1 24 ? -5.294  -7.585  -12.245 1.00 0.00 ? 445 CYS A CA   4  
ATOM   4662  C  C    . CYS A 1 24 ? -5.582  -8.716  -13.229 1.00 0.00 ? 445 CYS A C    4  
ATOM   4663  O  O    . CYS A 1 24 ? -5.688  -9.879  -12.840 1.00 0.00 ? 445 CYS A O    4  
ATOM   4664  C  CB   . CYS A 1 24 ? -4.194  -8.011  -11.270 1.00 0.00 ? 445 CYS A CB   4  
ATOM   4665  S  SG   . CYS A 1 24 ? -2.694  -8.656  -12.077 1.00 0.00 ? 445 CYS A SG   4  
ATOM   4666  H  H    . CYS A 1 24 ? -7.041  -7.913  -11.095 1.00 0.00 ? 445 CYS A H    4  
ATOM   4667  H  HA   . CYS A 1 24 ? -4.959  -6.721  -12.798 1.00 0.00 ? 445 CYS A HA   4  
ATOM   4668  H  HB2  . CYS A 1 24 ? -3.904  -7.158  -10.673 1.00 0.00 ? 445 CYS A HB2  4  
ATOM   4669  H  HB3  . CYS A 1 24 ? -4.578  -8.784  -10.622 1.00 0.00 ? 445 CYS A HB3  4  
ATOM   4670  N  N    . ALA A 1 25 ? -5.708  -8.365  -14.504 1.00 0.00 ? 446 ALA A N    4  
ATOM   4671  C  CA   . ALA A 1 25 ? -5.981  -9.350  -15.544 1.00 0.00 ? 446 ALA A CA   4  
ATOM   4672  C  C    . ALA A 1 25 ? -5.191  -10.633 -15.306 1.00 0.00 ? 446 ALA A C    4  
ATOM   4673  O  O    . ALA A 1 25 ? -5.745  -11.642 -14.869 1.00 0.00 ? 446 ALA A O    4  
ATOM   4674  C  CB   . ALA A 1 25 ? -5.657  -8.774  -16.914 1.00 0.00 ? 446 ALA A CB   4  
ATOM   4675  H  H    . ALA A 1 25 ? -5.613  -7.422  -14.752 1.00 0.00 ? 446 ALA A H    4  
ATOM   4676  H  HA   . ALA A 1 25 ? -7.037  -9.579  -15.517 1.00 0.00 ? 446 ALA A HA   4  
ATOM   4677  H  HB1  . ALA A 1 25 ? -5.006  -7.920  -16.800 1.00 0.00 ? 446 ALA A HB1  4  
ATOM   4678  H  HB2  . ALA A 1 25 ? -5.165  -9.526  -17.513 1.00 0.00 ? 446 ALA A HB2  4  
ATOM   4679  H  HB3  . ALA A 1 25 ? -6.571  -8.468  -17.401 1.00 0.00 ? 446 ALA A HB3  4  
ATOM   4680  N  N    . ARG A 1 26 ? -3.896  -10.587 -15.598 1.00 0.00 ? 447 ARG A N    4  
ATOM   4681  C  CA   . ARG A 1 26 ? -3.030  -11.746 -15.418 1.00 0.00 ? 447 ARG A CA   4  
ATOM   4682  C  C    . ARG A 1 26 ? -2.865  -12.076 -13.937 1.00 0.00 ? 447 ARG A C    4  
ATOM   4683  O  O    . ARG A 1 26 ? -1.882  -11.684 -13.309 1.00 0.00 ? 447 ARG A O    4  
ATOM   4684  C  CB   . ARG A 1 26 ? -1.661  -11.490 -16.050 1.00 0.00 ? 447 ARG A CB   4  
ATOM   4685  C  CG   . ARG A 1 26 ? -1.605  -11.815 -17.534 1.00 0.00 ? 447 ARG A CG   4  
ATOM   4686  C  CD   . ARG A 1 26 ? -0.195  -11.665 -18.084 1.00 0.00 ? 447 ARG A CD   4  
ATOM   4687  N  NE   . ARG A 1 26 ? -0.148  -11.864 -19.530 1.00 0.00 ? 447 ARG A NE   4  
ATOM   4688  C  CZ   . ARG A 1 26 ? 0.926   -11.616 -20.271 1.00 0.00 ? 447 ARG A CZ   4  
ATOM   4689  N  NH1  . ARG A 1 26 ? 2.036   -11.163 -19.705 1.00 0.00 ? 447 ARG A NH1  4  
ATOM   4690  N  NH2  . ARG A 1 26 ? 0.891   -11.822 -21.582 1.00 0.00 ? 447 ARG A NH2  4  
ATOM   4691  H  H    . ARG A 1 26 ? -3.512  -9.753  -15.943 1.00 0.00 ? 447 ARG A H    4  
ATOM   4692  H  HA   . ARG A 1 26 ? -3.494  -12.586 -15.912 1.00 0.00 ? 447 ARG A HA   4  
ATOM   4693  H  HB2  . ARG A 1 26 ? -1.407  -10.448 -15.922 1.00 0.00 ? 447 ARG A HB2  4  
ATOM   4694  H  HB3  . ARG A 1 26 ? -0.925  -12.096 -15.543 1.00 0.00 ? 447 ARG A HB3  4  
ATOM   4695  H  HG2  . ARG A 1 26 ? -1.931  -12.834 -17.682 1.00 0.00 ? 447 ARG A HG2  4  
ATOM   4696  H  HG3  . ARG A 1 26 ? -2.263  -11.143 -18.064 1.00 0.00 ? 447 ARG A HG3  4  
ATOM   4697  H  HD2  . ARG A 1 26 ? 0.163   -10.673 -17.855 1.00 0.00 ? 447 ARG A HD2  4  
ATOM   4698  H  HD3  . ARG A 1 26 ? 0.442   -12.396 -17.608 1.00 0.00 ? 447 ARG A HD3  4  
ATOM   4699  H  HE   . ARG A 1 26 ? -0.958  -12.199 -19.969 1.00 0.00 ? 447 ARG A HE   4  
ATOM   4700  H  HH11 . ARG A 1 26 ? 2.065   -11.007 -18.718 1.00 0.00 ? 447 ARG A HH11 4  
ATOM   4701  H  HH12 . ARG A 1 26 ? 2.843   -10.978 -20.266 1.00 0.00 ? 447 ARG A HH12 4  
ATOM   4702  H  HH21 . ARG A 1 26 ? 0.056   -12.164 -22.012 1.00 0.00 ? 447 ARG A HH21 4  
ATOM   4703  H  HH22 . ARG A 1 26 ? 1.699   -11.635 -22.139 1.00 0.00 ? 447 ARG A HH22 4  
ATOM   4704  N  N    . ALA A 1 27 ? -3.834  -12.799 -13.386 1.00 0.00 ? 448 ALA A N    4  
ATOM   4705  C  CA   . ALA A 1 27 ? -3.796  -13.183 -11.980 1.00 0.00 ? 448 ALA A CA   4  
ATOM   4706  C  C    . ALA A 1 27 ? -2.858  -14.365 -11.760 1.00 0.00 ? 448 ALA A C    4  
ATOM   4707  O  O    . ALA A 1 27 ? -1.912  -14.281 -10.976 1.00 0.00 ? 448 ALA A O    4  
ATOM   4708  C  CB   . ALA A 1 27 ? -5.195  -13.518 -11.486 1.00 0.00 ? 448 ALA A CB   4  
ATOM   4709  H  H    . ALA A 1 27 ? -4.593  -13.082 -13.938 1.00 0.00 ? 448 ALA A H    4  
ATOM   4710  H  HA   . ALA A 1 27 ? -3.433  -12.338 -11.413 1.00 0.00 ? 448 ALA A HA   4  
ATOM   4711  H  HB1  . ALA A 1 27 ? -5.520  -12.761 -10.788 1.00 0.00 ? 448 ALA A HB1  4  
ATOM   4712  H  HB2  . ALA A 1 27 ? -5.875  -13.551 -12.324 1.00 0.00 ? 448 ALA A HB2  4  
ATOM   4713  H  HB3  . ALA A 1 27 ? -5.183  -14.480 -10.994 1.00 0.00 ? 448 ALA A HB3  4  
ATOM   4714  N  N    . GLU A 1 28 ? -3.127  -15.466 -12.455 1.00 0.00 ? 449 GLU A N    4  
ATOM   4715  C  CA   . GLU A 1 28 ? -2.306  -16.665 -12.333 1.00 0.00 ? 449 GLU A CA   4  
ATOM   4716  C  C    . GLU A 1 28 ? -0.998  -16.511 -13.102 1.00 0.00 ? 449 GLU A C    4  
ATOM   4717  O  O    . GLU A 1 28 ? -0.151  -17.402 -13.093 1.00 0.00 ? 449 GLU A O    4  
ATOM   4718  C  CB   . GLU A 1 28 ? -3.071  -17.888 -12.845 1.00 0.00 ? 449 GLU A CB   4  
ATOM   4719  C  CG   . GLU A 1 28 ? -2.404  -19.210 -12.505 1.00 0.00 ? 449 GLU A CG   4  
ATOM   4720  C  CD   . GLU A 1 28 ? -3.093  -20.395 -13.154 1.00 0.00 ? 449 GLU A CD   4  
ATOM   4721  O  OE1  . GLU A 1 28 ? -2.878  -20.617 -14.363 1.00 0.00 ? 449 GLU A OE1  4  
ATOM   4722  O  OE2  . GLU A 1 28 ? -3.847  -21.100 -12.450 1.00 0.00 ? 449 GLU A OE2  4  
ATOM   4723  H  H    . GLU A 1 28 ? -3.895  -15.472 -13.064 1.00 0.00 ? 449 GLU A H    4  
ATOM   4724  H  HA   . GLU A 1 28 ? -2.080  -16.807 -11.287 1.00 0.00 ? 449 GLU A HA   4  
ATOM   4725  H  HB2  . GLU A 1 28 ? -4.061  -17.885 -12.414 1.00 0.00 ? 449 GLU A HB2  4  
ATOM   4726  H  HB3  . GLU A 1 28 ? -3.157  -17.818 -13.920 1.00 0.00 ? 449 GLU A HB3  4  
ATOM   4727  H  HG2  . GLU A 1 28 ? -1.379  -19.179 -12.844 1.00 0.00 ? 449 GLU A HG2  4  
ATOM   4728  H  HG3  . GLU A 1 28 ? -2.424  -19.343 -11.433 1.00 0.00 ? 449 GLU A HG3  4  
ATOM   4729  N  N    . ASN A 1 29 ? -0.842  -15.371 -13.769 1.00 0.00 ? 450 ASN A N    4  
ATOM   4730  C  CA   . ASN A 1 29 ? 0.362   -15.099 -14.545 1.00 0.00 ? 450 ASN A CA   4  
ATOM   4731  C  C    . ASN A 1 29 ? 0.870   -13.684 -14.284 1.00 0.00 ? 450 ASN A C    4  
ATOM   4732  O  O    . ASN A 1 29 ? 1.353   -13.008 -15.193 1.00 0.00 ? 450 ASN A O    4  
ATOM   4733  C  CB   . ASN A 1 29 ? 0.085   -15.286 -16.038 1.00 0.00 ? 450 ASN A CB   4  
ATOM   4734  C  CG   . ASN A 1 29 ? 0.315   -16.714 -16.495 1.00 0.00 ? 450 ASN A CG   4  
ATOM   4735  O  OD1  . ASN A 1 29 ? 1.147   -17.429 -15.936 1.00 0.00 ? 450 ASN A OD1  4  
ATOM   4736  N  ND2  . ASN A 1 29 ? -0.423  -17.135 -17.515 1.00 0.00 ? 450 ASN A ND2  4  
ATOM   4737  H  H    . ASN A 1 29 ? -1.553  -14.698 -13.738 1.00 0.00 ? 450 ASN A H    4  
ATOM   4738  H  HA   . ASN A 1 29 ? 1.121   -15.803 -14.238 1.00 0.00 ? 450 ASN A HA   4  
ATOM   4739  H  HB2  . ASN A 1 29 ? -0.943  -15.025 -16.242 1.00 0.00 ? 450 ASN A HB2  4  
ATOM   4740  H  HB3  . ASN A 1 29 ? 0.736   -14.637 -16.604 1.00 0.00 ? 450 ASN A HB3  4  
ATOM   4741  H  HD21 . ASN A 1 29 ? -1.066  -16.510 -17.911 1.00 0.00 ? 450 ASN A HD21 4  
ATOM   4742  H  HD22 . ASN A 1 29 ? -0.295  -18.054 -17.830 1.00 0.00 ? 450 ASN A HD22 4  
ATOM   4743  N  N    . CYS A 1 30 ? 0.757   -13.242 -13.036 1.00 0.00 ? 451 CYS A N    4  
ATOM   4744  C  CA   . CYS A 1 30 ? 1.203   -11.908 -12.654 1.00 0.00 ? 451 CYS A CA   4  
ATOM   4745  C  C    . CYS A 1 30 ? 2.713   -11.882 -12.430 1.00 0.00 ? 451 CYS A C    4  
ATOM   4746  O  O    . CYS A 1 30 ? 3.234   -12.463 -11.478 1.00 0.00 ? 451 CYS A O    4  
ATOM   4747  C  CB   . CYS A 1 30 ? 0.481   -11.449 -11.385 1.00 0.00 ? 451 CYS A CB   4  
ATOM   4748  S  SG   . CYS A 1 30 ? 0.942   -9.776  -10.831 1.00 0.00 ? 451 CYS A SG   4  
ATOM   4749  H  H    . CYS A 1 30 ? 0.363   -13.827 -12.355 1.00 0.00 ? 451 CYS A H    4  
ATOM   4750  H  HA   . CYS A 1 30 ? 0.960   -11.232 -13.460 1.00 0.00 ? 451 CYS A HA   4  
ATOM   4751  H  HB2  . CYS A 1 30 ? -0.584  -11.453 -11.566 1.00 0.00 ? 451 CYS A HB2  4  
ATOM   4752  H  HB3  . CYS A 1 30 ? 0.707   -12.136 -10.583 1.00 0.00 ? 451 CYS A HB3  4  
ATOM   4753  N  N    . PRO A 1 31 ? 3.433   -11.194 -13.328 1.00 0.00 ? 452 PRO A N    4  
ATOM   4754  C  CA   . PRO A 1 31 ? 4.892   -11.075 -13.250 1.00 0.00 ? 452 PRO A CA   4  
ATOM   4755  C  C    . PRO A 1 31 ? 5.341   -10.208 -12.079 1.00 0.00 ? 452 PRO A C    4  
ATOM   4756  O  O    . PRO A 1 31 ? 6.537   -10.042 -11.841 1.00 0.00 ? 452 PRO A O    4  
ATOM   4757  C  CB   . PRO A 1 31 ? 5.265   -10.415 -14.580 1.00 0.00 ? 452 PRO A CB   4  
ATOM   4758  C  CG   . PRO A 1 31 ? 4.043   -9.669  -14.989 1.00 0.00 ? 452 PRO A CG   4  
ATOM   4759  C  CD   . PRO A 1 31 ? 2.877   -10.477 -14.489 1.00 0.00 ? 452 PRO A CD   4  
ATOM   4760  H  HA   . PRO A 1 31 ? 5.365   -12.044 -13.182 1.00 0.00 ? 452 PRO A HA   4  
ATOM   4761  H  HB2  . PRO A 1 31 ? 6.104   -9.749  -14.430 1.00 0.00 ? 452 PRO A HB2  4  
ATOM   4762  H  HB3  . PRO A 1 31 ? 5.525   -11.173 -15.302 1.00 0.00 ? 452 PRO A HB3  4  
ATOM   4763  H  HG2  . PRO A 1 31 ? 4.041   -8.689  -14.536 1.00 0.00 ? 452 PRO A HG2  4  
ATOM   4764  H  HG3  . PRO A 1 31 ? 4.006   -9.586  -16.065 1.00 0.00 ? 452 PRO A HG3  4  
ATOM   4765  H  HD2  . PRO A 1 31 ? 2.068   -9.828  -14.190 1.00 0.00 ? 452 PRO A HD2  4  
ATOM   4766  H  HD3  . PRO A 1 31 ? 2.547   -11.171 -15.247 1.00 0.00 ? 452 PRO A HD3  4  
ATOM   4767  N  N    . TYR A 1 32 ? 4.375   -9.659  -11.352 1.00 0.00 ? 453 TYR A N    4  
ATOM   4768  C  CA   . TYR A 1 32 ? 4.672   -8.806  -10.206 1.00 0.00 ? 453 TYR A CA   4  
ATOM   4769  C  C    . TYR A 1 32 ? 4.337   -9.516  -8.898  1.00 0.00 ? 453 TYR A C    4  
ATOM   4770  O  O    . TYR A 1 32 ? 3.927   -10.676 -8.896  1.00 0.00 ? 453 TYR A O    4  
ATOM   4771  C  CB   . TYR A 1 32 ? 3.890   -7.495  -10.303 1.00 0.00 ? 453 TYR A CB   4  
ATOM   4772  C  CG   . TYR A 1 32 ? 4.419   -6.552  -11.359 1.00 0.00 ? 453 TYR A CG   4  
ATOM   4773  C  CD1  . TYR A 1 32 ? 4.075   -6.711  -12.696 1.00 0.00 ? 453 TYR A CD1  4  
ATOM   4774  C  CD2  . TYR A 1 32 ? 5.262   -5.501  -11.021 1.00 0.00 ? 453 TYR A CD2  4  
ATOM   4775  C  CE1  . TYR A 1 32 ? 4.555   -5.852  -13.665 1.00 0.00 ? 453 TYR A CE1  4  
ATOM   4776  C  CE2  . TYR A 1 32 ? 5.747   -4.636  -11.983 1.00 0.00 ? 453 TYR A CE2  4  
ATOM   4777  C  CZ   . TYR A 1 32 ? 5.391   -4.816  -13.304 1.00 0.00 ? 453 TYR A CZ   4  
ATOM   4778  O  OH   . TYR A 1 32 ? 5.872   -3.957  -14.265 1.00 0.00 ? 453 TYR A OH   4  
ATOM   4779  H  H    . TYR A 1 32 ? 3.440   -9.828  -11.591 1.00 0.00 ? 453 TYR A H    4  
ATOM   4780  H  HA   . TYR A 1 32 ? 5.729   -8.586  -10.222 1.00 0.00 ? 453 TYR A HA   4  
ATOM   4781  H  HB2  . TYR A 1 32 ? 2.861   -7.715  -10.540 1.00 0.00 ? 453 TYR A HB2  4  
ATOM   4782  H  HB3  . TYR A 1 32 ? 3.934   -6.987  -9.351  1.00 0.00 ? 453 TYR A HB3  4  
ATOM   4783  H  HD1  . TYR A 1 32 ? 3.420   -7.524  -12.976 1.00 0.00 ? 453 TYR A HD1  4  
ATOM   4784  H  HD2  . TYR A 1 32 ? 5.540   -5.363  -9.986  1.00 0.00 ? 453 TYR A HD2  4  
ATOM   4785  H  HE1  . TYR A 1 32 ? 4.277   -5.992  -14.699 1.00 0.00 ? 453 TYR A HE1  4  
ATOM   4786  H  HE2  . TYR A 1 32 ? 6.401   -3.825  -11.700 1.00 0.00 ? 453 TYR A HE2  4  
ATOM   4787  H  HH   . TYR A 1 32 ? 5.826   -4.381  -15.125 1.00 0.00 ? 453 TYR A HH   4  
ATOM   4788  N  N    . MET A 1 33 ? 4.515   -8.809  -7.787  1.00 0.00 ? 454 MET A N    4  
ATOM   4789  C  CA   . MET A 1 33 ? 4.230   -9.370  -6.471  1.00 0.00 ? 454 MET A CA   4  
ATOM   4790  C  C    . MET A 1 33 ? 2.875   -8.893  -5.958  1.00 0.00 ? 454 MET A C    4  
ATOM   4791  O  O    . MET A 1 33 ? 2.446   -7.776  -6.253  1.00 0.00 ? 454 MET A O    4  
ATOM   4792  C  CB   . MET A 1 33 ? 5.328   -8.983  -5.479  1.00 0.00 ? 454 MET A CB   4  
ATOM   4793  C  CG   . MET A 1 33 ? 6.670   -9.635  -5.773  1.00 0.00 ? 454 MET A CG   4  
ATOM   4794  S  SD   . MET A 1 33 ? 6.769   -11.327 -5.158  1.00 0.00 ? 454 MET A SD   4  
ATOM   4795  C  CE   . MET A 1 33 ? 7.582   -11.067 -3.583  1.00 0.00 ? 454 MET A CE   4  
ATOM   4796  H  H    . MET A 1 33 ? 4.844   -7.888  -7.852  1.00 0.00 ? 454 MET A H    4  
ATOM   4797  H  HA   . MET A 1 33 ? 4.207   -10.445 -6.567  1.00 0.00 ? 454 MET A HA   4  
ATOM   4798  H  HB2  . MET A 1 33 ? 5.460   -7.911  -5.506  1.00 0.00 ? 454 MET A HB2  4  
ATOM   4799  H  HB3  . MET A 1 33 ? 5.021   -9.275  -4.486  1.00 0.00 ? 454 MET A HB3  4  
ATOM   4800  H  HG2  . MET A 1 33 ? 6.823   -9.647  -6.842  1.00 0.00 ? 454 MET A HG2  4  
ATOM   4801  H  HG3  . MET A 1 33 ? 7.448   -9.050  -5.306  1.00 0.00 ? 454 MET A HG3  4  
ATOM   4802  H  HE1  . MET A 1 33 ? 8.387   -11.778 -3.471  1.00 0.00 ? 454 MET A HE1  4  
ATOM   4803  H  HE2  . MET A 1 33 ? 7.979   -10.063 -3.544  1.00 0.00 ? 454 MET A HE2  4  
ATOM   4804  H  HE3  . MET A 1 33 ? 6.868   -11.203 -2.783  1.00 0.00 ? 454 MET A HE3  4  
ATOM   4805  N  N    . HIS A 1 34 ? 2.204   -9.745  -5.190  1.00 0.00 ? 455 HIS A N    4  
ATOM   4806  C  CA   . HIS A 1 34 ? 0.897   -9.410  -4.637  1.00 0.00 ? 455 HIS A CA   4  
ATOM   4807  C  C    . HIS A 1 34 ? 0.909   -9.511  -3.114  1.00 0.00 ? 455 HIS A C    4  
ATOM   4808  O  O    . HIS A 1 34 ? 0.978   -8.501  -2.415  1.00 0.00 ? 455 HIS A O    4  
ATOM   4809  C  CB   . HIS A 1 34 ? -0.177  -10.333 -5.212  1.00 0.00 ? 455 HIS A CB   4  
ATOM   4810  C  CG   . HIS A 1 34 ? -0.676  -9.906  -6.558  1.00 0.00 ? 455 HIS A CG   4  
ATOM   4811  N  ND1  . HIS A 1 34 ? -1.717  -10.534 -7.209  1.00 0.00 ? 455 HIS A ND1  4  
ATOM   4812  C  CD2  . HIS A 1 34 ? -0.272  -8.905  -7.375  1.00 0.00 ? 455 HIS A CD2  4  
ATOM   4813  C  CE1  . HIS A 1 34 ? -1.931  -9.939  -8.369  1.00 0.00 ? 455 HIS A CE1  4  
ATOM   4814  N  NE2  . HIS A 1 34 ? -1.068  -8.947  -8.494  1.00 0.00 ? 455 HIS A NE2  4  
ATOM   4815  H  H    . HIS A 1 34 ? 2.597   -10.620 -4.991  1.00 0.00 ? 455 HIS A H    4  
ATOM   4816  H  HA   . HIS A 1 34 ? 0.670   -8.392  -4.915  1.00 0.00 ? 455 HIS A HA   4  
ATOM   4817  H  HB2  . HIS A 1 34 ? 0.230   -11.329 -5.311  1.00 0.00 ? 455 HIS A HB2  4  
ATOM   4818  H  HB3  . HIS A 1 34 ? -1.020  -10.359 -4.537  1.00 0.00 ? 455 HIS A HB3  4  
ATOM   4819  H  HD1  . HIS A 1 34 ? -2.223  -11.302 -6.872  1.00 0.00 ? 455 HIS A HD1  4  
ATOM   4820  H  HD2  . HIS A 1 34 ? 0.527   -8.204  -7.184  1.00 0.00 ? 455 HIS A HD2  4  
ATOM   4821  H  HE1  . HIS A 1 34 ? -2.683  -10.216 -9.092  1.00 0.00 ? 455 HIS A HE1  4  
ATOM   4822  N  N    . GLY A 1 35 ? 0.841   -10.739 -2.607  1.00 0.00 ? 456 GLY A N    4  
ATOM   4823  C  CA   . GLY A 1 35 ? 0.845   -10.949 -1.171  1.00 0.00 ? 456 GLY A CA   4  
ATOM   4824  C  C    . GLY A 1 35 ? 2.239   -10.892 -0.581  1.00 0.00 ? 456 GLY A C    4  
ATOM   4825  O  O    . GLY A 1 35 ? 2.554   -9.994  0.201   1.00 0.00 ? 456 GLY A O    4  
ATOM   4826  H  H    . GLY A 1 35 ? 0.787   -11.507 -3.213  1.00 0.00 ? 456 GLY A H    4  
ATOM   4827  H  HA2  . GLY A 1 35 ? 0.236   -10.188 -0.705  1.00 0.00 ? 456 GLY A HA2  4  
ATOM   4828  H  HA3  . GLY A 1 35 ? 0.416   -11.918 -0.960  1.00 0.00 ? 456 GLY A HA3  4  
ATOM   4829  N  N    . ASP A 1 36 ? 3.077   -11.854 -0.953  1.00 0.00 ? 457 ASP A N    4  
ATOM   4830  C  CA   . ASP A 1 36 ? 4.446   -11.910 -0.454  1.00 0.00 ? 457 ASP A CA   4  
ATOM   4831  C  C    . ASP A 1 36 ? 5.013   -10.507 -0.261  1.00 0.00 ? 457 ASP A C    4  
ATOM   4832  O  O    . ASP A 1 36 ? 5.722   -10.241 0.709   1.00 0.00 ? 457 ASP A O    4  
ATOM   4833  C  CB   . ASP A 1 36 ? 5.331   -12.702 -1.419  1.00 0.00 ? 457 ASP A CB   4  
ATOM   4834  C  CG   . ASP A 1 36 ? 5.128   -14.199 -1.294  1.00 0.00 ? 457 ASP A CG   4  
ATOM   4835  O  OD1  . ASP A 1 36 ? 5.531   -14.769 -0.258  1.00 0.00 ? 457 ASP A OD1  4  
ATOM   4836  O  OD2  . ASP A 1 36 ? 4.564   -14.801 -2.231  1.00 0.00 ? 457 ASP A OD2  4  
ATOM   4837  H  H    . ASP A 1 36 ? 2.767   -12.542 -1.579  1.00 0.00 ? 457 ASP A H    4  
ATOM   4838  H  HA   . ASP A 1 36 ? 4.431   -12.413 0.501   1.00 0.00 ? 457 ASP A HA   4  
ATOM   4839  H  HB2  . ASP A 1 36 ? 5.099   -12.410 -2.432  1.00 0.00 ? 457 ASP A HB2  4  
ATOM   4840  H  HB3  . ASP A 1 36 ? 6.367   -12.479 -1.212  1.00 0.00 ? 457 ASP A HB3  4  
ATOM   4841  N  N    . PHE A 1 37 ? 4.695   -9.613  -1.191  1.00 0.00 ? 458 PHE A N    4  
ATOM   4842  C  CA   . PHE A 1 37 ? 5.174   -8.237  -1.125  1.00 0.00 ? 458 PHE A CA   4  
ATOM   4843  C  C    . PHE A 1 37 ? 4.899   -7.632  0.249   1.00 0.00 ? 458 PHE A C    4  
ATOM   4844  O  O    . PHE A 1 37 ? 3.765   -7.605  0.728   1.00 0.00 ? 458 PHE A O    4  
ATOM   4845  C  CB   . PHE A 1 37 ? 4.507   -7.390  -2.211  1.00 0.00 ? 458 PHE A CB   4  
ATOM   4846  C  CG   . PHE A 1 37 ? 5.260   -6.131  -2.536  1.00 0.00 ? 458 PHE A CG   4  
ATOM   4847  C  CD1  . PHE A 1 37 ? 6.431   -6.181  -3.275  1.00 0.00 ? 458 PHE A CD1  4  
ATOM   4848  C  CD2  . PHE A 1 37 ? 4.797   -4.900  -2.103  1.00 0.00 ? 458 PHE A CD2  4  
ATOM   4849  C  CE1  . PHE A 1 37 ? 7.127   -5.025  -3.575  1.00 0.00 ? 458 PHE A CE1  4  
ATOM   4850  C  CE2  . PHE A 1 37 ? 5.488   -3.740  -2.400  1.00 0.00 ? 458 PHE A CE2  4  
ATOM   4851  C  CZ   . PHE A 1 37 ? 6.654   -3.803  -3.138  1.00 0.00 ? 458 PHE A CZ   4  
ATOM   4852  H  H    . PHE A 1 37 ? 4.125   -9.885  -1.941  1.00 0.00 ? 458 PHE A H    4  
ATOM   4853  H  HA   . PHE A 1 37 ? 6.239   -8.249  -1.293  1.00 0.00 ? 458 PHE A HA   4  
ATOM   4854  H  HB2  . PHE A 1 37 ? 4.430   -7.973  -3.116  1.00 0.00 ? 458 PHE A HB2  4  
ATOM   4855  H  HB3  . PHE A 1 37 ? 3.518   -7.110  -1.882  1.00 0.00 ? 458 PHE A HB3  4  
ATOM   4856  H  HD1  . PHE A 1 37 ? 6.802   -7.136  -3.618  1.00 0.00 ? 458 PHE A HD1  4  
ATOM   4857  H  HD2  . PHE A 1 37 ? 3.885   -4.849  -1.525  1.00 0.00 ? 458 PHE A HD2  4  
ATOM   4858  H  HE1  . PHE A 1 37 ? 8.038   -5.076  -4.152  1.00 0.00 ? 458 PHE A HE1  4  
ATOM   4859  H  HE2  . PHE A 1 37 ? 5.116   -2.786  -2.057  1.00 0.00 ? 458 PHE A HE2  4  
ATOM   4860  H  HZ   . PHE A 1 37 ? 7.196   -2.898  -3.370  1.00 0.00 ? 458 PHE A HZ   4  
ATOM   4861  N  N    . PRO A 1 38 ? 5.962   -7.133  0.898   1.00 0.00 ? 459 PRO A N    4  
ATOM   4862  C  CA   . PRO A 1 38 ? 5.862   -6.519  2.225   1.00 0.00 ? 459 PRO A CA   4  
ATOM   4863  C  C    . PRO A 1 38 ? 5.131   -5.181  2.191   1.00 0.00 ? 459 PRO A C    4  
ATOM   4864  O  O    . PRO A 1 38 ? 5.306   -4.390  1.263   1.00 0.00 ? 459 PRO A O    4  
ATOM   4865  C  CB   . PRO A 1 38 ? 7.323   -6.320  2.635   1.00 0.00 ? 459 PRO A CB   4  
ATOM   4866  C  CG   . PRO A 1 38 ? 8.069   -6.232  1.349   1.00 0.00 ? 459 PRO A CG   4  
ATOM   4867  C  CD   . PRO A 1 38 ? 7.342   -7.130  0.386   1.00 0.00 ? 459 PRO A CD   4  
ATOM   4868  H  HA   . PRO A 1 38 ? 5.374   -7.176  2.931   1.00 0.00 ? 459 PRO A HA   4  
ATOM   4869  H  HB2  . PRO A 1 38 ? 7.417   -5.410  3.211   1.00 0.00 ? 459 PRO A HB2  4  
ATOM   4870  H  HB3  . PRO A 1 38 ? 7.653   -7.162  3.225   1.00 0.00 ? 459 PRO A HB3  4  
ATOM   4871  H  HG2  . PRO A 1 38 ? 8.062   -5.214  0.990   1.00 0.00 ? 459 PRO A HG2  4  
ATOM   4872  H  HG3  . PRO A 1 38 ? 9.083   -6.575  1.489   1.00 0.00 ? 459 PRO A HG3  4  
ATOM   4873  H  HD2  . PRO A 1 38 ? 7.382   -6.724  -0.613  1.00 0.00 ? 459 PRO A HD2  4  
ATOM   4874  H  HD3  . PRO A 1 38 ? 7.763   -8.125  0.408   1.00 0.00 ? 459 PRO A HD3  4  
ATOM   4875  N  N    . CYS A 1 39 ? 4.313   -4.932  3.208   1.00 0.00 ? 460 CYS A N    4  
ATOM   4876  C  CA   . CYS A 1 39 ? 3.556   -3.689  3.295   1.00 0.00 ? 460 CYS A CA   4  
ATOM   4877  C  C    . CYS A 1 39 ? 4.489   -2.496  3.479   1.00 0.00 ? 460 CYS A C    4  
ATOM   4878  O  O    . CYS A 1 39 ? 5.484   -2.576  4.200   1.00 0.00 ? 460 CYS A O    4  
ATOM   4879  C  CB   . CYS A 1 39 ? 2.559   -3.755  4.454   1.00 0.00 ? 460 CYS A CB   4  
ATOM   4880  S  SG   . CYS A 1 39 ? 1.186   -2.565  4.322   1.00 0.00 ? 460 CYS A SG   4  
ATOM   4881  H  H    . CYS A 1 39 ? 4.215   -5.602  3.918   1.00 0.00 ? 460 CYS A H    4  
ATOM   4882  H  HA   . CYS A 1 39 ? 3.012   -3.566  2.370   1.00 0.00 ? 460 CYS A HA   4  
ATOM   4883  H  HB2  . CYS A 1 39 ? 2.131   -4.746  4.494   1.00 0.00 ? 460 CYS A HB2  4  
ATOM   4884  H  HB3  . CYS A 1 39 ? 3.080   -3.556  5.378   1.00 0.00 ? 460 CYS A HB3  4  
ATOM   4885  N  N    . LYS A 1 40 ? 4.160   -1.388  2.822   1.00 0.00 ? 461 LYS A N    4  
ATOM   4886  C  CA   . LYS A 1 40 ? 4.966   -0.177  2.913   1.00 0.00 ? 461 LYS A CA   4  
ATOM   4887  C  C    . LYS A 1 40 ? 4.696   0.559   4.222   1.00 0.00 ? 461 LYS A C    4  
ATOM   4888  O  O    . LYS A 1 40 ? 5.569   0.652   5.085   1.00 0.00 ? 461 LYS A O    4  
ATOM   4889  C  CB   . LYS A 1 40 ? 4.673   0.745   1.727   1.00 0.00 ? 461 LYS A CB   4  
ATOM   4890  C  CG   . LYS A 1 40 ? 5.376   2.089   1.814   1.00 0.00 ? 461 LYS A CG   4  
ATOM   4891  C  CD   . LYS A 1 40 ? 4.897   3.040   0.729   1.00 0.00 ? 461 LYS A CD   4  
ATOM   4892  C  CE   . LYS A 1 40 ? 5.303   4.475   1.026   1.00 0.00 ? 461 LYS A CE   4  
ATOM   4893  N  NZ   . LYS A 1 40 ? 6.775   4.671   0.909   1.00 0.00 ? 461 LYS A NZ   4  
ATOM   4894  H  H    . LYS A 1 40 ? 3.355   -1.386  2.263   1.00 0.00 ? 461 LYS A H    4  
ATOM   4895  H  HA   . LYS A 1 40 ? 6.005   -0.466  2.885   1.00 0.00 ? 461 LYS A HA   4  
ATOM   4896  H  HB2  . LYS A 1 40 ? 4.990   0.255   0.819   1.00 0.00 ? 461 LYS A HB2  4  
ATOM   4897  H  HB3  . LYS A 1 40 ? 3.608   0.922   1.678   1.00 0.00 ? 461 LYS A HB3  4  
ATOM   4898  H  HG2  . LYS A 1 40 ? 5.172   2.530   2.779   1.00 0.00 ? 461 LYS A HG2  4  
ATOM   4899  H  HG3  . LYS A 1 40 ? 6.440   1.937   1.703   1.00 0.00 ? 461 LYS A HG3  4  
ATOM   4900  H  HD2  . LYS A 1 40 ? 5.331   2.743   -0.214  1.00 0.00 ? 461 LYS A HD2  4  
ATOM   4901  H  HD3  . LYS A 1 40 ? 3.820   2.985   0.665   1.00 0.00 ? 461 LYS A HD3  4  
ATOM   4902  H  HE2  . LYS A 1 40 ? 4.805   5.128   0.327   1.00 0.00 ? 461 LYS A HE2  4  
ATOM   4903  H  HE3  . LYS A 1 40 ? 4.995   4.721   2.032   1.00 0.00 ? 461 LYS A HE3  4  
ATOM   4904  H  HZ1  . LYS A 1 40 ? 7.254   4.284   1.747   1.00 0.00 ? 461 LYS A HZ1  4  
ATOM   4905  H  HZ2  . LYS A 1 40 ? 6.996   5.684   0.834   1.00 0.00 ? 461 LYS A HZ2  4  
ATOM   4906  H  HZ3  . LYS A 1 40 ? 7.134   4.185   0.062   1.00 0.00 ? 461 LYS A HZ3  4  
ATOM   4907  N  N    . LEU A 1 41 ? 3.482   1.080   4.362   1.00 0.00 ? 462 LEU A N    4  
ATOM   4908  C  CA   . LEU A 1 41 ? 3.096   1.807   5.567   1.00 0.00 ? 462 LEU A CA   4  
ATOM   4909  C  C    . LEU A 1 41 ? 3.540   1.059   6.820   1.00 0.00 ? 462 LEU A C    4  
ATOM   4910  O  O    . LEU A 1 41 ? 4.266   1.600   7.654   1.00 0.00 ? 462 LEU A O    4  
ATOM   4911  C  CB   . LEU A 1 41 ? 1.581   2.018   5.596   1.00 0.00 ? 462 LEU A CB   4  
ATOM   4912  C  CG   . LEU A 1 41 ? 1.047   3.164   4.735   1.00 0.00 ? 462 LEU A CG   4  
ATOM   4913  C  CD1  . LEU A 1 41 ? -0.466  3.073   4.605   1.00 0.00 ? 462 LEU A CD1  4  
ATOM   4914  C  CD2  . LEU A 1 41 ? 1.454   4.507   5.323   1.00 0.00 ? 462 LEU A CD2  4  
ATOM   4915  H  H    . LEU A 1 41 ? 2.829   0.973   3.640   1.00 0.00 ? 462 LEU A H    4  
ATOM   4916  H  HA   . LEU A 1 41 ? 3.585   2.769   5.544   1.00 0.00 ? 462 LEU A HA   4  
ATOM   4917  H  HB2  . LEU A 1 41 ? 1.114   1.106   5.258   1.00 0.00 ? 462 LEU A HB2  4  
ATOM   4918  H  HB3  . LEU A 1 41 ? 1.294   2.210   6.620   1.00 0.00 ? 462 LEU A HB3  4  
ATOM   4919  H  HG   . LEU A 1 41 ? 1.472   3.089   3.743   1.00 0.00 ? 462 LEU A HG   4  
ATOM   4920  H  HD11 . LEU A 1 41 ? -0.825  2.226   5.168   1.00 0.00 ? 462 LEU A HD11 4  
ATOM   4921  H  HD12 . LEU A 1 41 ? -0.731  2.954   3.565   1.00 0.00 ? 462 LEU A HD12 4  
ATOM   4922  H  HD13 . LEU A 1 41 ? -0.914  3.978   4.989   1.00 0.00 ? 462 LEU A HD13 4  
ATOM   4923  H  HD21 . LEU A 1 41 ? 0.611   4.945   5.836   1.00 0.00 ? 462 LEU A HD21 4  
ATOM   4924  H  HD22 . LEU A 1 41 ? 1.774   5.166   4.528   1.00 0.00 ? 462 LEU A HD22 4  
ATOM   4925  H  HD23 . LEU A 1 41 ? 2.266   4.363   6.020   1.00 0.00 ? 462 LEU A HD23 4  
ATOM   4926  N  N    . TYR A 1 42 ? 3.101   -0.189  6.945   1.00 0.00 ? 463 TYR A N    4  
ATOM   4927  C  CA   . TYR A 1 42 ? 3.453   -1.011  8.096   1.00 0.00 ? 463 TYR A CA   4  
ATOM   4928  C  C    . TYR A 1 42 ? 4.916   -0.814  8.480   1.00 0.00 ? 463 TYR A C    4  
ATOM   4929  O  O    . TYR A 1 42 ? 5.304   -1.028  9.629   1.00 0.00 ? 463 TYR A O    4  
ATOM   4930  C  CB   . TYR A 1 42 ? 3.188   -2.487  7.795   1.00 0.00 ? 463 TYR A CB   4  
ATOM   4931  C  CG   . TYR A 1 42 ? 3.318   -3.385  9.005   1.00 0.00 ? 463 TYR A CG   4  
ATOM   4932  C  CD1  . TYR A 1 42 ? 2.314   -3.444  9.962   1.00 0.00 ? 463 TYR A CD1  4  
ATOM   4933  C  CD2  . TYR A 1 42 ? 4.447   -4.175  9.189   1.00 0.00 ? 463 TYR A CD2  4  
ATOM   4934  C  CE1  . TYR A 1 42 ? 2.429   -4.263  11.069  1.00 0.00 ? 463 TYR A CE1  4  
ATOM   4935  C  CE2  . TYR A 1 42 ? 4.570   -4.997  10.292  1.00 0.00 ? 463 TYR A CE2  4  
ATOM   4936  C  CZ   . TYR A 1 42 ? 3.559   -5.037  11.230  1.00 0.00 ? 463 TYR A CZ   4  
ATOM   4937  O  OH   . TYR A 1 42 ? 3.677   -5.855  12.330  1.00 0.00 ? 463 TYR A OH   4  
ATOM   4938  H  H    . TYR A 1 42 ? 2.525   -0.565  6.247   1.00 0.00 ? 463 TYR A H    4  
ATOM   4939  H  HA   . TYR A 1 42 ? 2.831   -0.706  8.925   1.00 0.00 ? 463 TYR A HA   4  
ATOM   4940  H  HB2  . TYR A 1 42 ? 2.186   -2.595  7.410   1.00 0.00 ? 463 TYR A HB2  4  
ATOM   4941  H  HB3  . TYR A 1 42 ? 3.893   -2.828  7.051   1.00 0.00 ? 463 TYR A HB3  4  
ATOM   4942  H  HD1  . TYR A 1 42 ? 1.430   -2.837  9.833   1.00 0.00 ? 463 TYR A HD1  4  
ATOM   4943  H  HD2  . TYR A 1 42 ? 5.237   -4.141  8.453   1.00 0.00 ? 463 TYR A HD2  4  
ATOM   4944  H  HE1  . TYR A 1 42 ? 1.637   -4.294  11.803  1.00 0.00 ? 463 TYR A HE1  4  
ATOM   4945  H  HE2  . TYR A 1 42 ? 5.455   -5.604  10.419  1.00 0.00 ? 463 TYR A HE2  4  
ATOM   4946  H  HH   . TYR A 1 42 ? 3.936   -5.330  13.092  1.00 0.00 ? 463 TYR A HH   4  
ATOM   4947  N  N    . HIS A 1 43 ? 5.726   -0.403  7.508   1.00 0.00 ? 464 HIS A N    4  
ATOM   4948  C  CA   . HIS A 1 43 ? 7.147   -0.175  7.743   1.00 0.00 ? 464 HIS A CA   4  
ATOM   4949  C  C    . HIS A 1 43 ? 7.437   1.313   7.918   1.00 0.00 ? 464 HIS A C    4  
ATOM   4950  O  O    . HIS A 1 43 ? 8.038   1.727   8.910   1.00 0.00 ? 464 HIS A O    4  
ATOM   4951  C  CB   . HIS A 1 43 ? 7.973   -0.734  6.584   1.00 0.00 ? 464 HIS A CB   4  
ATOM   4952  C  CG   . HIS A 1 43 ? 8.071   -2.228  6.585   1.00 0.00 ? 464 HIS A CG   4  
ATOM   4953  N  ND1  . HIS A 1 43 ? 8.370   -2.962  7.713   1.00 0.00 ? 464 HIS A ND1  4  
ATOM   4954  C  CD2  . HIS A 1 43 ? 7.907   -3.127  5.586   1.00 0.00 ? 464 HIS A CD2  4  
ATOM   4955  C  CE1  . HIS A 1 43 ? 8.387   -4.247  7.408   1.00 0.00 ? 464 HIS A CE1  4  
ATOM   4956  N  NE2  . HIS A 1 43 ? 8.108   -4.374  6.123   1.00 0.00 ? 464 HIS A NE2  4  
ATOM   4957  H  H    . HIS A 1 43 ? 5.358   -0.249  6.613   1.00 0.00 ? 464 HIS A H    4  
ATOM   4958  H  HA   . HIS A 1 43 ? 7.421   -0.691  8.650   1.00 0.00 ? 464 HIS A HA   4  
ATOM   4959  H  HB2  . HIS A 1 43 ? 7.521   -0.432  5.650   1.00 0.00 ? 464 HIS A HB2  4  
ATOM   4960  H  HB3  . HIS A 1 43 ? 8.976   -0.334  6.639   1.00 0.00 ? 464 HIS A HB3  4  
ATOM   4961  H  HD2  . HIS A 1 43 ? 7.663   -2.904  4.556   1.00 0.00 ? 464 HIS A HD2  4  
ATOM   4962  H  HE1  . HIS A 1 43 ? 8.592   -5.057  8.092   1.00 0.00 ? 464 HIS A HE1  4  
ATOM   4963  H  HE2  . HIS A 1 43 ? 8.140   -5.214  5.619   1.00 0.00 ? 464 HIS A HE2  4  
ATOM   4964  N  N    . THR A 1 44 ? 7.006   2.114   6.948   1.00 0.00 ? 465 THR A N    4  
ATOM   4965  C  CA   . THR A 1 44 ? 7.220   3.554   6.994   1.00 0.00 ? 465 THR A CA   4  
ATOM   4966  C  C    . THR A 1 44 ? 7.236   4.062   8.431   1.00 0.00 ? 465 THR A C    4  
ATOM   4967  O  O    . THR A 1 44 ? 8.054   4.908   8.794   1.00 0.00 ? 465 THR A O    4  
ATOM   4968  C  CB   . THR A 1 44 ? 6.134   4.310   6.206   1.00 0.00 ? 465 THR A CB   4  
ATOM   4969  O  OG1  . THR A 1 44 ? 4.855   4.109   6.820   1.00 0.00 ? 465 THR A OG1  4  
ATOM   4970  C  CG2  . THR A 1 44 ? 6.087   3.839   4.761   1.00 0.00 ? 465 THR A CG2  4  
ATOM   4971  H  H    . THR A 1 44 ? 6.533   1.724   6.183   1.00 0.00 ? 465 THR A H    4  
ATOM   4972  H  HA   . THR A 1 44 ? 8.177   3.764   6.538   1.00 0.00 ? 465 THR A HA   4  
ATOM   4973  H  HB   . THR A 1 44 ? 6.369   5.364   6.219   1.00 0.00 ? 465 THR A HB   4  
ATOM   4974  H  HG1  . THR A 1 44 ? 4.819   3.230   7.204   1.00 0.00 ? 465 THR A HG1  4  
ATOM   4975  H  HG21 . THR A 1 44 ? 6.577   2.880   4.679   1.00 0.00 ? 465 THR A HG21 4  
ATOM   4976  H  HG22 . THR A 1 44 ? 6.593   4.556   4.132   1.00 0.00 ? 465 THR A HG22 4  
ATOM   4977  H  HG23 . THR A 1 44 ? 5.059   3.745   4.446   1.00 0.00 ? 465 THR A HG23 4  
ATOM   4978  N  N    . THR A 1 45 ? 6.326   3.540   9.248   1.00 0.00 ? 466 THR A N    4  
ATOM   4979  C  CA   . THR A 1 45 ? 6.235   3.941   10.647  1.00 0.00 ? 466 THR A CA   4  
ATOM   4980  C  C    . THR A 1 45 ? 6.204   2.726   11.566  1.00 0.00 ? 466 THR A C    4  
ATOM   4981  O  O    . THR A 1 45 ? 6.772   2.747   12.657  1.00 0.00 ? 466 THR A O    4  
ATOM   4982  C  CB   . THR A 1 45 ? 4.981   4.798   10.905  1.00 0.00 ? 466 THR A CB   4  
ATOM   4983  O  OG1  . THR A 1 45 ? 3.815   4.115   10.431  1.00 0.00 ? 466 THR A OG1  4  
ATOM   4984  C  CG2  . THR A 1 45 ? 5.098   6.150   10.217  1.00 0.00 ? 466 THR A CG2  4  
ATOM   4985  H  H    . THR A 1 45 ? 5.701   2.870   8.901   1.00 0.00 ? 466 THR A H    4  
ATOM   4986  H  HA   . THR A 1 45 ? 7.106   4.536   10.881  1.00 0.00 ? 466 THR A HA   4  
ATOM   4987  H  HB   . THR A 1 45 ? 4.886   4.959   11.969  1.00 0.00 ? 466 THR A HB   4  
ATOM   4988  H  HG1  . THR A 1 45 ? 3.670   4.333   9.507   1.00 0.00 ? 466 THR A HG1  4  
ATOM   4989  H  HG21 . THR A 1 45 ? 6.039   6.205   9.690   1.00 0.00 ? 466 THR A HG21 4  
ATOM   4990  H  HG22 . THR A 1 45 ? 5.052   6.935   10.956  1.00 0.00 ? 466 THR A HG22 4  
ATOM   4991  H  HG23 . THR A 1 45 ? 4.286   6.267   9.515   1.00 0.00 ? 466 THR A HG23 4  
ATOM   4992  N  N    . GLY A 1 46 ? 5.537   1.667   11.118  1.00 0.00 ? 467 GLY A N    4  
ATOM   4993  C  CA   . GLY A 1 46 ? 5.446   0.456   11.914  1.00 0.00 ? 467 GLY A CA   4  
ATOM   4994  C  C    . GLY A 1 46 ? 4.048   -0.129  11.921  1.00 0.00 ? 467 GLY A C    4  
ATOM   4995  O  O    . GLY A 1 46 ? 3.877   -1.347  11.895  1.00 0.00 ? 467 GLY A O    4  
ATOM   4996  H  H    . GLY A 1 46 ? 5.104   1.707   10.240  1.00 0.00 ? 467 GLY A H    4  
ATOM   4997  H  HA2  . GLY A 1 46 ? 6.130   -0.277  11.513  1.00 0.00 ? 467 GLY A HA2  4  
ATOM   4998  H  HA3  . GLY A 1 46 ? 5.733   0.685   12.930  1.00 0.00 ? 467 GLY A HA3  4  
ATOM   4999  N  N    . ASN A 1 47 ? 3.044   0.742   11.957  1.00 0.00 ? 468 ASN A N    4  
ATOM   5000  C  CA   . ASN A 1 47 ? 1.653   0.304   11.970  1.00 0.00 ? 468 ASN A CA   4  
ATOM   5001  C  C    . ASN A 1 47 ? 0.989   0.561   10.620  1.00 0.00 ? 468 ASN A C    4  
ATOM   5002  O  O    . ASN A 1 47 ? 1.252   1.573   9.970   1.00 0.00 ? 468 ASN A O    4  
ATOM   5003  C  CB   . ASN A 1 47 ? 0.880   1.024   13.076  1.00 0.00 ? 468 ASN A CB   4  
ATOM   5004  C  CG   . ASN A 1 47 ? -0.519  0.469   13.259  1.00 0.00 ? 468 ASN A CG   4  
ATOM   5005  O  OD1  . ASN A 1 47 ? -0.826  -0.633  12.805  1.00 0.00 ? 468 ASN A OD1  4  
ATOM   5006  N  ND2  . ASN A 1 47 ? -1.376  1.234   13.927  1.00 0.00 ? 468 ASN A ND2  4  
ATOM   5007  H  H    . ASN A 1 47 ? 3.243   1.701   11.976  1.00 0.00 ? 468 ASN A H    4  
ATOM   5008  H  HA   . ASN A 1 47 ? 1.641   -0.757  12.167  1.00 0.00 ? 468 ASN A HA   4  
ATOM   5009  H  HB2  . ASN A 1 47 ? 1.414   0.915   14.009  1.00 0.00 ? 468 ASN A HB2  4  
ATOM   5010  H  HB3  . ASN A 1 47 ? 0.803   2.072   12.831  1.00 0.00 ? 468 ASN A HB3  4  
ATOM   5011  H  HD21 . ASN A 1 47 ? -1.062  2.100   14.260  1.00 0.00 ? 468 ASN A HD21 4  
ATOM   5012  H  HD22 . ASN A 1 47 ? -2.287  0.899   14.060  1.00 0.00 ? 468 ASN A HD22 4  
ATOM   5013  N  N    . CYS A 1 48 ? 0.127   -0.361  10.206  1.00 0.00 ? 469 CYS A N    4  
ATOM   5014  C  CA   . CYS A 1 48 ? -0.575  -0.235  8.934   1.00 0.00 ? 469 CYS A CA   4  
ATOM   5015  C  C    . CYS A 1 48 ? -1.999  0.271   9.147   1.00 0.00 ? 469 CYS A C    4  
ATOM   5016  O  O    . CYS A 1 48 ? -2.648  -0.070  10.136  1.00 0.00 ? 469 CYS A O    4  
ATOM   5017  C  CB   . CYS A 1 48 ? -0.604  -1.582  8.208   1.00 0.00 ? 469 CYS A CB   4  
ATOM   5018  S  SG   . CYS A 1 48 ? -1.363  -1.518  6.553   1.00 0.00 ? 469 CYS A SG   4  
ATOM   5019  H  H    . CYS A 1 48 ? -0.041  -1.147  10.769  1.00 0.00 ? 469 CYS A H    4  
ATOM   5020  H  HA   . CYS A 1 48 ? -0.039  0.479   8.328   1.00 0.00 ? 469 CYS A HA   4  
ATOM   5021  H  HB2  . CYS A 1 48 ? 0.408   -1.941  8.091   1.00 0.00 ? 469 CYS A HB2  4  
ATOM   5022  H  HB3  . CYS A 1 48 ? -1.165  -2.290  8.801   1.00 0.00 ? 469 CYS A HB3  4  
ATOM   5023  N  N    . ILE A 1 49 ? -2.477  1.086   8.213   1.00 0.00 ? 470 ILE A N    4  
ATOM   5024  C  CA   . ILE A 1 49 ? -3.823  1.638   8.297   1.00 0.00 ? 470 ILE A CA   4  
ATOM   5025  C  C    . ILE A 1 49 ? -4.875  0.567   8.026   1.00 0.00 ? 470 ILE A C    4  
ATOM   5026  O  O    . ILE A 1 49 ? -5.941  0.560   8.639   1.00 0.00 ? 470 ILE A O    4  
ATOM   5027  C  CB   . ILE A 1 49 ? -4.020  2.798   7.304   1.00 0.00 ? 470 ILE A CB   4  
ATOM   5028  C  CG1  . ILE A 1 49 ? -5.416  3.404   7.463   1.00 0.00 ? 470 ILE A CG1  4  
ATOM   5029  C  CG2  . ILE A 1 49 ? -3.806  2.315   5.877   1.00 0.00 ? 470 ILE A CG2  4  
ATOM   5030  C  CD1  . ILE A 1 49 ? -5.575  4.232   8.719   1.00 0.00 ? 470 ILE A CD1  4  
ATOM   5031  H  H    . ILE A 1 49 ? -1.911  1.321   7.448   1.00 0.00 ? 470 ILE A H    4  
ATOM   5032  H  HA   . ILE A 1 49 ? -3.965  2.020   9.298   1.00 0.00 ? 470 ILE A HA   4  
ATOM   5033  H  HB   . ILE A 1 49 ? -3.280  3.554   7.517   1.00 0.00 ? 470 ILE A HB   4  
ATOM   5034  H  HG12 . ILE A 1 49 ? -5.624  4.041   6.618   1.00 0.00 ? 470 ILE A HG12 4  
ATOM   5035  H  HG13 . ILE A 1 49 ? -6.144  2.607   7.496   1.00 0.00 ? 470 ILE A HG13 4  
ATOM   5036  H  HG21 . ILE A 1 49 ? -2.793  1.956   5.767   1.00 0.00 ? 470 ILE A HG21 4  
ATOM   5037  H  HG22 . ILE A 1 49 ? -4.497  1.514   5.661   1.00 0.00 ? 470 ILE A HG22 4  
ATOM   5038  H  HG23 . ILE A 1 49 ? -3.975  3.131   5.191   1.00 0.00 ? 470 ILE A HG23 4  
ATOM   5039  H  HD11 . ILE A 1 49 ? -4.936  3.838   9.494   1.00 0.00 ? 470 ILE A HD11 4  
ATOM   5040  H  HD12 . ILE A 1 49 ? -5.303  5.256   8.512   1.00 0.00 ? 470 ILE A HD12 4  
ATOM   5041  H  HD13 . ILE A 1 49 ? -6.604  4.193   9.048   1.00 0.00 ? 470 ILE A HD13 4  
ATOM   5042  N  N    . ASN A 1 50 ? -4.564  -0.338  7.103   1.00 0.00 ? 471 ASN A N    4  
ATOM   5043  C  CA   . ASN A 1 50 ? -5.482  -1.416  6.751   1.00 0.00 ? 471 ASN A CA   4  
ATOM   5044  C  C    . ASN A 1 50 ? -5.941  -2.169  7.996   1.00 0.00 ? 471 ASN A C    4  
ATOM   5045  O  O    . ASN A 1 50 ? -7.133  -2.223  8.297   1.00 0.00 ? 471 ASN A O    4  
ATOM   5046  C  CB   . ASN A 1 50 ? -4.813  -2.384  5.773   1.00 0.00 ? 471 ASN A CB   4  
ATOM   5047  C  CG   . ASN A 1 50 ? -4.976  -1.952  4.329   1.00 0.00 ? 471 ASN A CG   4  
ATOM   5048  O  OD1  . ASN A 1 50 ? -5.864  -2.430  3.623   1.00 0.00 ? 471 ASN A OD1  4  
ATOM   5049  N  ND2  . ASN A 1 50 ? -4.116  -1.044  3.883   1.00 0.00 ? 471 ASN A ND2  4  
ATOM   5050  H  H    . ASN A 1 50 ? -3.698  -0.280  6.648   1.00 0.00 ? 471 ASN A H    4  
ATOM   5051  H  HA   . ASN A 1 50 ? -6.344  -0.974  6.273   1.00 0.00 ? 471 ASN A HA   4  
ATOM   5052  H  HB2  . ASN A 1 50 ? -3.757  -2.438  5.996   1.00 0.00 ? 471 ASN A HB2  4  
ATOM   5053  H  HB3  . ASN A 1 50 ? -5.251  -3.364  5.889   1.00 0.00 ? 471 ASN A HB3  4  
ATOM   5054  H  HD21 . ASN A 1 50 ? -3.434  -0.708  4.502   1.00 0.00 ? 471 ASN A HD21 4  
ATOM   5055  H  HD22 . ASN A 1 50 ? -4.199  -0.746  2.953   1.00 0.00 ? 471 ASN A HD22 4  
ATOM   5056  N  N    . GLY A 1 51 ? -4.986  -2.748  8.717   1.00 0.00 ? 472 GLY A N    4  
ATOM   5057  C  CA   . GLY A 1 51 ? -5.311  -3.489  9.921   1.00 0.00 ? 472 GLY A CA   4  
ATOM   5058  C  C    . GLY A 1 51 ? -4.760  -4.901  9.900   1.00 0.00 ? 472 GLY A C    4  
ATOM   5059  O  O    . GLY A 1 51 ? -3.786  -5.184  9.201   1.00 0.00 ? 472 GLY A O    4  
ATOM   5060  H  H    . GLY A 1 51 ? -4.052  -2.671  8.428   1.00 0.00 ? 472 GLY A H    4  
ATOM   5061  H  HA2  . GLY A 1 51 ? -4.903  -2.967  10.773  1.00 0.00 ? 472 GLY A HA2  4  
ATOM   5062  H  HA3  . GLY A 1 51 ? -6.386  -3.537  10.021  1.00 0.00 ? 472 GLY A HA3  4  
ATOM   5063  N  N    . ASP A 1 52 ? -5.381  -5.789  10.668  1.00 0.00 ? 473 ASP A N    4  
ATOM   5064  C  CA   . ASP A 1 52 ? -4.946  -7.179  10.735  1.00 0.00 ? 473 ASP A CA   4  
ATOM   5065  C  C    . ASP A 1 52 ? -5.289  -7.919  9.446   1.00 0.00 ? 473 ASP A C    4  
ATOM   5066  O  O    . ASP A 1 52 ? -4.618  -8.881  9.074   1.00 0.00 ? 473 ASP A O    4  
ATOM   5067  C  CB   . ASP A 1 52 ? -5.595  -7.881  11.929  1.00 0.00 ? 473 ASP A CB   4  
ATOM   5068  C  CG   . ASP A 1 52 ? -4.989  -7.453  13.252  1.00 0.00 ? 473 ASP A CG   4  
ATOM   5069  O  OD1  . ASP A 1 52 ? -3.951  -8.028  13.643  1.00 0.00 ? 473 ASP A OD1  4  
ATOM   5070  O  OD2  . ASP A 1 52 ? -5.552  -6.543  13.894  1.00 0.00 ? 473 ASP A OD2  4  
ATOM   5071  H  H    . ASP A 1 52 ? -6.152  -5.502  11.202  1.00 0.00 ? 473 ASP A H    4  
ATOM   5072  H  HA   . ASP A 1 52 ? -3.874  -7.185  10.864  1.00 0.00 ? 473 ASP A HA   4  
ATOM   5073  H  HB2  . ASP A 1 52 ? -6.649  -7.649  11.946  1.00 0.00 ? 473 ASP A HB2  4  
ATOM   5074  H  HB3  . ASP A 1 52 ? -5.467  -8.948  11.824  1.00 0.00 ? 473 ASP A HB3  4  
ATOM   5075  N  N    . ASP A 1 53 ? -6.339  -7.463  8.770   1.00 0.00 ? 474 ASP A N    4  
ATOM   5076  C  CA   . ASP A 1 53 ? -6.771  -8.082  7.523   1.00 0.00 ? 474 ASP A CA   4  
ATOM   5077  C  C    . ASP A 1 53 ? -6.308  -7.264  6.321   1.00 0.00 ? 474 ASP A C    4  
ATOM   5078  O  O    . ASP A 1 53 ? -7.072  -7.031  5.384   1.00 0.00 ? 474 ASP A O    4  
ATOM   5079  C  CB   . ASP A 1 53 ? -8.294  -8.226  7.501   1.00 0.00 ? 474 ASP A CB   4  
ATOM   5080  C  CG   . ASP A 1 53 ? -8.821  -8.982  8.705   1.00 0.00 ? 474 ASP A CG   4  
ATOM   5081  O  OD1  . ASP A 1 53 ? -8.497  -10.180 8.842   1.00 0.00 ? 474 ASP A OD1  4  
ATOM   5082  O  OD2  . ASP A 1 53 ? -9.558  -8.375  9.510   1.00 0.00 ? 474 ASP A OD2  4  
ATOM   5083  H  H    . ASP A 1 53 ? -6.833  -6.692  9.119   1.00 0.00 ? 474 ASP A H    4  
ATOM   5084  H  HA   . ASP A 1 53 ? -6.326  -9.064  7.467   1.00 0.00 ? 474 ASP A HA   4  
ATOM   5085  H  HB2  . ASP A 1 53 ? -8.742  -7.242  7.493   1.00 0.00 ? 474 ASP A HB2  4  
ATOM   5086  H  HB3  . ASP A 1 53 ? -8.586  -8.757  6.608   1.00 0.00 ? 474 ASP A HB3  4  
ATOM   5087  N  N    . CYS A 1 54 ? -5.053  -6.830  6.356   1.00 0.00 ? 475 CYS A N    4  
ATOM   5088  C  CA   . CYS A 1 54 ? -4.487  -6.036  5.272   1.00 0.00 ? 475 CYS A CA   4  
ATOM   5089  C  C    . CYS A 1 54 ? -4.206  -6.907  4.050   1.00 0.00 ? 475 CYS A C    4  
ATOM   5090  O  O    . CYS A 1 54 ? -3.857  -8.080  4.178   1.00 0.00 ? 475 CYS A O    4  
ATOM   5091  C  CB   . CYS A 1 54 ? -3.198  -5.352  5.731   1.00 0.00 ? 475 CYS A CB   4  
ATOM   5092  S  SG   . CYS A 1 54 ? -2.410  -4.317  4.456   1.00 0.00 ? 475 CYS A SG   4  
ATOM   5093  H  H    . CYS A 1 54 ? -4.492  -7.048  7.131   1.00 0.00 ? 475 CYS A H    4  
ATOM   5094  H  HA   . CYS A 1 54 ? -5.209  -5.281  5.002   1.00 0.00 ? 475 CYS A HA   4  
ATOM   5095  H  HB2  . CYS A 1 54 ? -3.419  -4.718  6.578   1.00 0.00 ? 475 CYS A HB2  4  
ATOM   5096  H  HB3  . CYS A 1 54 ? -2.485  -6.107  6.029   1.00 0.00 ? 475 CYS A HB3  4  
ATOM   5097  N  N    . MET A 1 55 ? -4.361  -6.323  2.866   1.00 0.00 ? 476 MET A N    4  
ATOM   5098  C  CA   . MET A 1 55 ? -4.122  -7.044  1.622   1.00 0.00 ? 476 MET A CA   4  
ATOM   5099  C  C    . MET A 1 55 ? -2.632  -7.099  1.302   1.00 0.00 ? 476 MET A C    4  
ATOM   5100  O  O    . MET A 1 55 ? -2.240  -7.368  0.166   1.00 0.00 ? 476 MET A O    4  
ATOM   5101  C  CB   . MET A 1 55 ? -4.879  -6.381  0.470   1.00 0.00 ? 476 MET A CB   4  
ATOM   5102  C  CG   . MET A 1 55 ? -4.504  -4.924  0.255   1.00 0.00 ? 476 MET A CG   4  
ATOM   5103  S  SD   . MET A 1 55 ? -2.913  -4.731  -0.571  1.00 0.00 ? 476 MET A SD   4  
ATOM   5104  C  CE   . MET A 1 55 ? -3.318  -5.293  -2.222  1.00 0.00 ? 476 MET A CE   4  
ATOM   5105  H  H    . MET A 1 55 ? -4.641  -5.384  2.828   1.00 0.00 ? 476 MET A H    4  
ATOM   5106  H  HA   . MET A 1 55 ? -4.488  -8.052  1.748   1.00 0.00 ? 476 MET A HA   4  
ATOM   5107  H  HB2  . MET A 1 55 ? -4.671  -6.922  -0.441  1.00 0.00 ? 476 MET A HB2  4  
ATOM   5108  H  HB3  . MET A 1 55 ? -5.938  -6.431  0.674   1.00 0.00 ? 476 MET A HB3  4  
ATOM   5109  H  HG2  . MET A 1 55 ? -5.266  -4.455  -0.349  1.00 0.00 ? 476 MET A HG2  4  
ATOM   5110  H  HG3  . MET A 1 55 ? -4.458  -4.434  1.216   1.00 0.00 ? 476 MET A HG3  4  
ATOM   5111  H  HE1  . MET A 1 55 ? -4.203  -5.911  -2.185  1.00 0.00 ? 476 MET A HE1  4  
ATOM   5112  H  HE2  . MET A 1 55 ? -3.501  -4.440  -2.858  1.00 0.00 ? 476 MET A HE2  4  
ATOM   5113  H  HE3  . MET A 1 55 ? -2.494  -5.869  -2.618  1.00 0.00 ? 476 MET A HE3  4  
ATOM   5114  N  N    . PHE A 1 56 ? -1.805  -6.841  2.310   1.00 0.00 ? 477 PHE A N    4  
ATOM   5115  C  CA   . PHE A 1 56 ? -0.357  -6.859  2.135   1.00 0.00 ? 477 PHE A CA   4  
ATOM   5116  C  C    . PHE A 1 56 ? 0.306   -7.746  3.184   1.00 0.00 ? 477 PHE A C    4  
ATOM   5117  O  O    . PHE A 1 56 ? -0.239  -7.959  4.267   1.00 0.00 ? 477 PHE A O    4  
ATOM   5118  C  CB   . PHE A 1 56 ? 0.206   -5.439  2.221   1.00 0.00 ? 477 PHE A CB   4  
ATOM   5119  C  CG   . PHE A 1 56 ? -0.060  -4.613  0.995   1.00 0.00 ? 477 PHE A CG   4  
ATOM   5120  C  CD1  . PHE A 1 56 ? 0.304   -5.074  -0.259  1.00 0.00 ? 477 PHE A CD1  4  
ATOM   5121  C  CD2  . PHE A 1 56 ? -0.674  -3.375  1.098   1.00 0.00 ? 477 PHE A CD2  4  
ATOM   5122  C  CE1  . PHE A 1 56 ? 0.060   -4.317  -1.390  1.00 0.00 ? 477 PHE A CE1  4  
ATOM   5123  C  CE2  . PHE A 1 56 ? -0.921  -2.614  -0.029  1.00 0.00 ? 477 PHE A CE2  4  
ATOM   5124  C  CZ   . PHE A 1 56 ? -0.552  -3.084  -1.274  1.00 0.00 ? 477 PHE A CZ   4  
ATOM   5125  H  H    . PHE A 1 56 ? -2.177  -6.633  3.192   1.00 0.00 ? 477 PHE A H    4  
ATOM   5126  H  HA   . PHE A 1 56 ? -0.148  -7.262  1.156   1.00 0.00 ? 477 PHE A HA   4  
ATOM   5127  H  HB2  . PHE A 1 56 ? -0.239  -4.933  3.064   1.00 0.00 ? 477 PHE A HB2  4  
ATOM   5128  H  HB3  . PHE A 1 56 ? 1.275   -5.492  2.362   1.00 0.00 ? 477 PHE A HB3  4  
ATOM   5129  H  HD1  . PHE A 1 56 ? 0.783   -6.039  -0.351  1.00 0.00 ? 477 PHE A HD1  4  
ATOM   5130  H  HD2  . PHE A 1 56 ? -0.961  -3.005  2.071   1.00 0.00 ? 477 PHE A HD2  4  
ATOM   5131  H  HE1  . PHE A 1 56 ? 0.349   -4.688  -2.362  1.00 0.00 ? 477 PHE A HE1  4  
ATOM   5132  H  HE2  . PHE A 1 56 ? -1.399  -1.650  0.065   1.00 0.00 ? 477 PHE A HE2  4  
ATOM   5133  H  HZ   . PHE A 1 56 ? -0.744  -2.491  -2.155  1.00 0.00 ? 477 PHE A HZ   4  
ATOM   5134  N  N    . SER A 1 57 ? 1.486   -8.261  2.855   1.00 0.00 ? 478 SER A N    4  
ATOM   5135  C  CA   . SER A 1 57 ? 2.223   -9.129  3.766   1.00 0.00 ? 478 SER A CA   4  
ATOM   5136  C  C    . SER A 1 57 ? 2.930   -8.311  4.843   1.00 0.00 ? 478 SER A C    4  
ATOM   5137  O  O    . SER A 1 57 ? 3.675   -7.378  4.541   1.00 0.00 ? 478 SER A O    4  
ATOM   5138  C  CB   . SER A 1 57 ? 3.244   -9.967  2.993   1.00 0.00 ? 478 SER A CB   4  
ATOM   5139  O  OG   . SER A 1 57 ? 2.628   -11.090 2.388   1.00 0.00 ? 478 SER A OG   4  
ATOM   5140  H  H    . SER A 1 57 ? 1.869   -8.055  1.976   1.00 0.00 ? 478 SER A H    4  
ATOM   5141  H  HA   . SER A 1 57 ? 1.514   -9.790  4.240   1.00 0.00 ? 478 SER A HA   4  
ATOM   5142  H  HB2  . SER A 1 57 ? 3.694   -9.359  2.222   1.00 0.00 ? 478 SER A HB2  4  
ATOM   5143  H  HB3  . SER A 1 57 ? 4.010   -10.312 3.672   1.00 0.00 ? 478 SER A HB3  4  
ATOM   5144  H  HG   . SER A 1 57 ? 1.684   -10.936 2.312   1.00 0.00 ? 478 SER A HG   4  
ATOM   5145  N  N    . HIS A 1 58 ? 2.691   -8.669  6.100   1.00 0.00 ? 479 HIS A N    4  
ATOM   5146  C  CA   . HIS A 1 58 ? 3.305   -7.969  7.224   1.00 0.00 ? 479 HIS A CA   4  
ATOM   5147  C  C    . HIS A 1 58 ? 4.505   -8.745  7.757   1.00 0.00 ? 479 HIS A C    4  
ATOM   5148  O  O    . HIS A 1 58 ? 4.942   -8.531  8.888   1.00 0.00 ? 479 HIS A O    4  
ATOM   5149  C  CB   . HIS A 1 58 ? 2.282   -7.758  8.340   1.00 0.00 ? 479 HIS A CB   4  
ATOM   5150  C  CG   . HIS A 1 58 ? 1.305   -6.659  8.057   1.00 0.00 ? 479 HIS A CG   4  
ATOM   5151  N  ND1  . HIS A 1 58 ? 0.425   -6.172  9.002   1.00 0.00 ? 479 HIS A ND1  4  
ATOM   5152  C  CD2  . HIS A 1 58 ? 1.072   -5.950  6.928   1.00 0.00 ? 479 HIS A CD2  4  
ATOM   5153  C  CE1  . HIS A 1 58 ? -0.307  -5.212  8.465   1.00 0.00 ? 479 HIS A CE1  4  
ATOM   5154  N  NE2  . HIS A 1 58 ? 0.066   -5.058  7.207   1.00 0.00 ? 479 HIS A NE2  4  
ATOM   5155  H  H    . HIS A 1 58 ? 2.089   -9.421  6.277   1.00 0.00 ? 479 HIS A H    4  
ATOM   5156  H  HA   . HIS A 1 58 ? 3.642   -7.007  6.870   1.00 0.00 ? 479 HIS A HA   4  
ATOM   5157  H  HB2  . HIS A 1 58 ? 1.722   -8.670  8.484   1.00 0.00 ? 479 HIS A HB2  4  
ATOM   5158  H  HB3  . HIS A 1 58 ? 2.803   -7.513  9.255   1.00 0.00 ? 479 HIS A HB3  4  
ATOM   5159  H  HD1  . HIS A 1 58 ? 0.348   -6.485  9.927   1.00 0.00 ? 479 HIS A HD1  4  
ATOM   5160  H  HD2  . HIS A 1 58 ? 1.583   -6.064  5.982   1.00 0.00 ? 479 HIS A HD2  4  
ATOM   5161  H  HE1  . HIS A 1 58 ? -1.079  -4.650  8.968   1.00 0.00 ? 479 HIS A HE1  4  
ATOM   5162  N  N    . ASP A 1 59 ? 5.032   -9.647  6.936   1.00 0.00 ? 480 ASP A N    4  
ATOM   5163  C  CA   . ASP A 1 59 ? 6.182   -10.455 7.325   1.00 0.00 ? 480 ASP A CA   4  
ATOM   5164  C  C    . ASP A 1 59 ? 7.392   -9.574  7.616   1.00 0.00 ? 480 ASP A C    4  
ATOM   5165  O  O    . ASP A 1 59 ? 7.511   -8.455  7.115   1.00 0.00 ? 480 ASP A O    4  
ATOM   5166  C  CB   . ASP A 1 59 ? 6.521   -11.462 6.225   1.00 0.00 ? 480 ASP A CB   4  
ATOM   5167  C  CG   . ASP A 1 59 ? 5.454   -12.527 6.066   1.00 0.00 ? 480 ASP A CG   4  
ATOM   5168  O  OD1  . ASP A 1 59 ? 4.653   -12.709 7.007   1.00 0.00 ? 480 ASP A OD1  4  
ATOM   5169  O  OD2  . ASP A 1 59 ? 5.421   -13.181 5.002   1.00 0.00 ? 480 ASP A OD2  4  
ATOM   5170  H  H    . ASP A 1 59 ? 4.639   -9.772  6.047   1.00 0.00 ? 480 ASP A H    4  
ATOM   5171  H  HA   . ASP A 1 59 ? 5.920   -10.993 8.224   1.00 0.00 ? 480 ASP A HA   4  
ATOM   5172  H  HB2  . ASP A 1 59 ? 6.622   -10.938 5.285   1.00 0.00 ? 480 ASP A HB2  4  
ATOM   5173  H  HB3  . ASP A 1 59 ? 7.456   -11.946 6.464   1.00 0.00 ? 480 ASP A HB3  4  
ATOM   5174  N  N    . PRO A 1 60 ? 8.313   -10.086 8.446   1.00 0.00 ? 481 PRO A N    4  
ATOM   5175  C  CA   . PRO A 1 60 ? 9.530   -9.362  8.823   1.00 0.00 ? 481 PRO A CA   4  
ATOM   5176  C  C    . PRO A 1 60 ? 10.509  -9.230  7.661   1.00 0.00 ? 481 PRO A C    4  
ATOM   5177  O  O    . PRO A 1 60 ? 11.028  -10.227 7.157   1.00 0.00 ? 481 PRO A O    4  
ATOM   5178  C  CB   . PRO A 1 60 ? 10.130  -10.229 9.932   1.00 0.00 ? 481 PRO A CB   4  
ATOM   5179  C  CG   . PRO A 1 60 ? 9.608   -11.599 9.666   1.00 0.00 ? 481 PRO A CG   4  
ATOM   5180  C  CD   . PRO A 1 60 ? 8.236   -11.413 9.081   1.00 0.00 ? 481 PRO A CD   4  
ATOM   5181  H  HA   . PRO A 1 60 ? 9.303   -8.381  9.214   1.00 0.00 ? 481 PRO A HA   4  
ATOM   5182  H  HB2  . PRO A 1 60 ? 11.209  -10.198 9.873   1.00 0.00 ? 481 PRO A HB2  4  
ATOM   5183  H  HB3  . PRO A 1 60 ? 9.806   -9.864  10.895  1.00 0.00 ? 481 PRO A HB3  4  
ATOM   5184  H  HG2  . PRO A 1 60 ? 10.251  -12.106 8.962   1.00 0.00 ? 481 PRO A HG2  4  
ATOM   5185  H  HG3  . PRO A 1 60 ? 9.549   -12.155 10.590  1.00 0.00 ? 481 PRO A HG3  4  
ATOM   5186  H  HD2  . PRO A 1 60 ? 8.031   -12.179 8.348   1.00 0.00 ? 481 PRO A HD2  4  
ATOM   5187  H  HD3  . PRO A 1 60 ? 7.489   -11.424 9.860   1.00 0.00 ? 481 PRO A HD3  4  
ATOM   5188  N  N    . LEU A 1 61 ? 10.758  -7.995  7.241   1.00 0.00 ? 482 LEU A N    4  
ATOM   5189  C  CA   . LEU A 1 61 ? 11.676  -7.733  6.138   1.00 0.00 ? 482 LEU A CA   4  
ATOM   5190  C  C    . LEU A 1 61 ? 12.903  -8.634  6.225   1.00 0.00 ? 482 LEU A C    4  
ATOM   5191  O  O    . LEU A 1 61 ? 13.517  -8.767  7.284   1.00 0.00 ? 482 LEU A O    4  
ATOM   5192  C  CB   . LEU A 1 61 ? 12.107  -6.265  6.145   1.00 0.00 ? 482 LEU A CB   4  
ATOM   5193  C  CG   . LEU A 1 61 ? 11.119  -5.273  5.529   1.00 0.00 ? 482 LEU A CG   4  
ATOM   5194  C  CD1  . LEU A 1 61 ? 11.772  -3.911  5.349   1.00 0.00 ? 482 LEU A CD1  4  
ATOM   5195  C  CD2  . LEU A 1 61 ? 10.598  -5.796  4.198   1.00 0.00 ? 482 LEU A CD2  4  
ATOM   5196  H  H    . LEU A 1 61 ? 10.315  -7.241  7.682   1.00 0.00 ? 482 LEU A H    4  
ATOM   5197  H  HA   . LEU A 1 61 ? 11.155  -7.942  5.216   1.00 0.00 ? 482 LEU A HA   4  
ATOM   5198  H  HB2  . LEU A 1 61 ? 12.271  -5.973  7.170   1.00 0.00 ? 482 LEU A HB2  4  
ATOM   5199  H  HB3  . LEU A 1 61 ? 13.036  -6.191  5.598   1.00 0.00 ? 482 LEU A HB3  4  
ATOM   5200  H  HG   . LEU A 1 61 ? 10.276  -5.153  6.195   1.00 0.00 ? 482 LEU A HG   4  
ATOM   5201  H  HD11 . LEU A 1 61 ? 12.488  -3.959  4.543   1.00 0.00 ? 482 LEU A HD11 4  
ATOM   5202  H  HD12 . LEU A 1 61 ? 12.276  -3.631  6.262   1.00 0.00 ? 482 LEU A HD12 4  
ATOM   5203  H  HD13 . LEU A 1 61 ? 11.015  -3.177  5.116   1.00 0.00 ? 482 LEU A HD13 4  
ATOM   5204  H  HD21 . LEU A 1 61 ? 11.302  -6.506  3.790   1.00 0.00 ? 482 LEU A HD21 4  
ATOM   5205  H  HD22 . LEU A 1 61 ? 10.478  -4.972  3.509   1.00 0.00 ? 482 LEU A HD22 4  
ATOM   5206  H  HD23 . LEU A 1 61 ? 9.645   -6.281  4.351   1.00 0.00 ? 482 LEU A HD23 4  
ATOM   5207  N  N    . THR A 1 62 ? 13.258  -9.252  5.102   1.00 0.00 ? 483 THR A N    4  
ATOM   5208  C  CA   . THR A 1 62 ? 14.413  -10.140 5.051   1.00 0.00 ? 483 THR A CA   4  
ATOM   5209  C  C    . THR A 1 62 ? 15.520  -9.553  4.183   1.00 0.00 ? 483 THR A C    4  
ATOM   5210  O  O    . THR A 1 62 ? 15.300  -8.592  3.446   1.00 0.00 ? 483 THR A O    4  
ATOM   5211  C  CB   . THR A 1 62 ? 14.029  -11.528 4.504   1.00 0.00 ? 483 THR A CB   4  
ATOM   5212  O  OG1  . THR A 1 62 ? 13.493  -11.404 3.182   1.00 0.00 ? 483 THR A OG1  4  
ATOM   5213  C  CG2  . THR A 1 62 ? 13.009  -12.203 5.409   1.00 0.00 ? 483 THR A CG2  4  
ATOM   5214  H  H    . THR A 1 62 ? 12.730  -9.106  4.290   1.00 0.00 ? 483 THR A H    4  
ATOM   5215  H  HA   . THR A 1 62 ? 14.784  -10.263 6.057   1.00 0.00 ? 483 THR A HA   4  
ATOM   5216  H  HB   . THR A 1 62 ? 14.918  -12.142 4.468   1.00 0.00 ? 483 THR A HB   4  
ATOM   5217  H  HG1  . THR A 1 62 ? 13.259  -10.487 3.017   1.00 0.00 ? 483 THR A HG1  4  
ATOM   5218  H  HG21 . THR A 1 62 ? 12.444  -12.925 4.838   1.00 0.00 ? 483 THR A HG21 4  
ATOM   5219  H  HG22 . THR A 1 62 ? 12.340  -11.459 5.814   1.00 0.00 ? 483 THR A HG22 4  
ATOM   5220  H  HG23 . THR A 1 62 ? 13.521  -12.705 6.216   1.00 0.00 ? 483 THR A HG23 4  
ATOM   5221  N  N    . GLU A 1 63 ? 16.710  -10.138 4.274   1.00 0.00 ? 484 GLU A N    4  
ATOM   5222  C  CA   . GLU A 1 63 ? 17.852  -9.671  3.496   1.00 0.00 ? 484 GLU A CA   4  
ATOM   5223  C  C    . GLU A 1 63 ? 17.480  -9.515  2.025   1.00 0.00 ? 484 GLU A C    4  
ATOM   5224  O  O    . GLU A 1 63 ? 18.010  -8.649  1.329   1.00 0.00 ? 484 GLU A O    4  
ATOM   5225  C  CB   . GLU A 1 63 ? 19.025  -10.644 3.636   1.00 0.00 ? 484 GLU A CB   4  
ATOM   5226  C  CG   . GLU A 1 63 ? 18.709  -12.051 3.160   1.00 0.00 ? 484 GLU A CG   4  
ATOM   5227  C  CD   . GLU A 1 63 ? 19.939  -12.936 3.096   1.00 0.00 ? 484 GLU A CD   4  
ATOM   5228  O  OE1  . GLU A 1 63 ? 20.679  -12.852 2.094   1.00 0.00 ? 484 GLU A OE1  4  
ATOM   5229  O  OE2  . GLU A 1 63 ? 20.161  -13.712 4.049   1.00 0.00 ? 484 GLU A OE2  4  
ATOM   5230  H  H    . GLU A 1 63 ? 16.823  -10.901 4.879   1.00 0.00 ? 484 GLU A H    4  
ATOM   5231  H  HA   . GLU A 1 63 ? 18.147  -8.708  3.885   1.00 0.00 ? 484 GLU A HA   4  
ATOM   5232  H  HB2  . GLU A 1 63 ? 19.858  -10.269 3.061   1.00 0.00 ? 484 GLU A HB2  4  
ATOM   5233  H  HB3  . GLU A 1 63 ? 19.312  -10.695 4.676   1.00 0.00 ? 484 GLU A HB3  4  
ATOM   5234  H  HG2  . GLU A 1 63 ? 17.999  -12.497 3.840   1.00 0.00 ? 484 GLU A HG2  4  
ATOM   5235  H  HG3  . GLU A 1 63 ? 18.273  -11.994 2.173   1.00 0.00 ? 484 GLU A HG3  4  
ATOM   5236  N  N    . GLU A 1 64 ? 16.565  -10.359 1.558   1.00 0.00 ? 485 GLU A N    4  
ATOM   5237  C  CA   . GLU A 1 64 ? 16.123  -10.315 0.169   1.00 0.00 ? 485 GLU A CA   4  
ATOM   5238  C  C    . GLU A 1 64 ? 15.075  -9.225  -0.034  1.00 0.00 ? 485 GLU A C    4  
ATOM   5239  O  O    . GLU A 1 64 ? 15.370  -8.154  -0.565  1.00 0.00 ? 485 GLU A O    4  
ATOM   5240  C  CB   . GLU A 1 64 ? 15.553  -11.671 -0.251  1.00 0.00 ? 485 GLU A CB   4  
ATOM   5241  C  CG   . GLU A 1 64 ? 16.603  -12.764 -0.365  1.00 0.00 ? 485 GLU A CG   4  
ATOM   5242  C  CD   . GLU A 1 64 ? 17.526  -12.564 -1.551  1.00 0.00 ? 485 GLU A CD   4  
ATOM   5243  O  OE1  . GLU A 1 64 ? 18.493  -11.783 -1.426  1.00 0.00 ? 485 GLU A OE1  4  
ATOM   5244  O  OE2  . GLU A 1 64 ? 17.282  -13.189 -2.605  1.00 0.00 ? 485 GLU A OE2  4  
ATOM   5245  H  H    . GLU A 1 64 ? 16.179  -11.027 2.162   1.00 0.00 ? 485 GLU A H    4  
ATOM   5246  H  HA   . GLU A 1 64 ? 16.982  -10.090 -0.445  1.00 0.00 ? 485 GLU A HA   4  
ATOM   5247  H  HB2  . GLU A 1 64 ? 14.818  -11.981 0.478   1.00 0.00 ? 485 GLU A HB2  4  
ATOM   5248  H  HB3  . GLU A 1 64 ? 15.071  -11.563 -1.211  1.00 0.00 ? 485 GLU A HB3  4  
ATOM   5249  H  HG2  . GLU A 1 64 ? 17.197  -12.771 0.536   1.00 0.00 ? 485 GLU A HG2  4  
ATOM   5250  H  HG3  . GLU A 1 64 ? 16.103  -13.715 -0.473  1.00 0.00 ? 485 GLU A HG3  4  
ATOM   5251  N  N    . THR A 1 65 ? 13.847  -9.506  0.392   1.00 0.00 ? 486 THR A N    4  
ATOM   5252  C  CA   . THR A 1 65 ? 12.754  -8.552  0.256   1.00 0.00 ? 486 THR A CA   4  
ATOM   5253  C  C    . THR A 1 65 ? 13.187  -7.155  0.684   1.00 0.00 ? 486 THR A C    4  
ATOM   5254  O  O    . THR A 1 65 ? 12.777  -6.158  0.089   1.00 0.00 ? 486 THR A O    4  
ATOM   5255  C  CB   . THR A 1 65 ? 11.531  -8.977  1.090   1.00 0.00 ? 486 THR A CB   4  
ATOM   5256  O  OG1  . THR A 1 65 ? 11.848  -8.924  2.486   1.00 0.00 ? 486 THR A OG1  4  
ATOM   5257  C  CG2  . THR A 1 65 ? 11.084  -10.383 0.719   1.00 0.00 ? 486 THR A CG2  4  
ATOM   5258  H  H    . THR A 1 65 ? 13.674  -10.377 0.807   1.00 0.00 ? 486 THR A H    4  
ATOM   5259  H  HA   . THR A 1 65 ? 12.462  -8.526  -0.784  1.00 0.00 ? 486 THR A HA   4  
ATOM   5260  H  HB   . THR A 1 65 ? 10.720  -8.292  0.887   1.00 0.00 ? 486 THR A HB   4  
ATOM   5261  H  HG1  . THR A 1 65 ? 12.438  -8.186  2.652   1.00 0.00 ? 486 THR A HG1  4  
ATOM   5262  H  HG21 . THR A 1 65 ? 10.304  -10.328 -0.026  1.00 0.00 ? 486 THR A HG21 4  
ATOM   5263  H  HG22 . THR A 1 65 ? 10.707  -10.884 1.598   1.00 0.00 ? 486 THR A HG22 4  
ATOM   5264  H  HG23 . THR A 1 65 ? 11.923  -10.933 0.322   1.00 0.00 ? 486 THR A HG23 4  
ATOM   5265  N  N    . ARG A 1 66 ? 14.018  -7.089  1.719   1.00 0.00 ? 487 ARG A N    4  
ATOM   5266  C  CA   . ARG A 1 66 ? 14.506  -5.813  2.227   1.00 0.00 ? 487 ARG A CA   4  
ATOM   5267  C  C    . ARG A 1 66 ? 15.027  -4.939  1.090   1.00 0.00 ? 487 ARG A C    4  
ATOM   5268  O  O    . ARG A 1 66 ? 14.793  -3.731  1.066   1.00 0.00 ? 487 ARG A O    4  
ATOM   5269  C  CB   . ARG A 1 66 ? 15.613  -6.040  3.258   1.00 0.00 ? 487 ARG A CB   4  
ATOM   5270  C  CG   . ARG A 1 66 ? 16.325  -4.764  3.678   1.00 0.00 ? 487 ARG A CG   4  
ATOM   5271  C  CD   . ARG A 1 66 ? 15.337  -3.674  4.059   1.00 0.00 ? 487 ARG A CD   4  
ATOM   5272  N  NE   . ARG A 1 66 ? 15.904  -2.733  5.022   1.00 0.00 ? 487 ARG A NE   4  
ATOM   5273  C  CZ   . ARG A 1 66 ? 15.436  -1.504  5.211   1.00 0.00 ? 487 ARG A CZ   4  
ATOM   5274  N  NH1  . ARG A 1 66 ? 14.399  -1.070  4.509   1.00 0.00 ? 487 ARG A NH1  4  
ATOM   5275  N  NH2  . ARG A 1 66 ? 16.007  -0.707  6.106   1.00 0.00 ? 487 ARG A NH2  4  
ATOM   5276  H  H    . ARG A 1 66 ? 14.309  -7.919  2.152   1.00 0.00 ? 487 ARG A H    4  
ATOM   5277  H  HA   . ARG A 1 66 ? 13.680  -5.307  2.704   1.00 0.00 ? 487 ARG A HA   4  
ATOM   5278  H  HB2  . ARG A 1 66 ? 15.181  -6.491  4.139   1.00 0.00 ? 487 ARG A HB2  4  
ATOM   5279  H  HB3  . ARG A 1 66 ? 16.345  -6.714  2.840   1.00 0.00 ? 487 ARG A HB3  4  
ATOM   5280  H  HG2  . ARG A 1 66 ? 16.955  -4.978  4.529   1.00 0.00 ? 487 ARG A HG2  4  
ATOM   5281  H  HG3  . ARG A 1 66 ? 16.933  -4.416  2.856   1.00 0.00 ? 487 ARG A HG3  4  
ATOM   5282  H  HD2  . ARG A 1 66 ? 15.053  -3.135  3.168   1.00 0.00 ? 487 ARG A HD2  4  
ATOM   5283  H  HD3  . ARG A 1 66 ? 14.462  -4.135  4.494   1.00 0.00 ? 487 ARG A HD3  4  
ATOM   5284  H  HE   . ARG A 1 66 ? 16.671  -3.033  5.552   1.00 0.00 ? 487 ARG A HE   4  
ATOM   5285  H  HH11 . ARG A 1 66 ? 13.967  -1.669  3.835   1.00 0.00 ? 487 ARG A HH11 4  
ATOM   5286  H  HH12 . ARG A 1 66 ? 14.048  -0.145  4.655   1.00 0.00 ? 487 ARG A HH12 4  
ATOM   5287  H  HH21 . ARG A 1 66 ? 16.789  -1.031  6.637   1.00 0.00 ? 487 ARG A HH21 4  
ATOM   5288  H  HH22 . ARG A 1 66 ? 15.654  0.218   6.248   1.00 0.00 ? 487 ARG A HH22 4  
ATOM   5289  N  N    . GLU A 1 67 ? 15.734  -5.558  0.150   1.00 0.00 ? 488 GLU A N    4  
ATOM   5290  C  CA   . GLU A 1 67 ? 16.289  -4.836  -0.989  1.00 0.00 ? 488 GLU A CA   4  
ATOM   5291  C  C    . GLU A 1 67 ? 15.180  -4.202  -1.823  1.00 0.00 ? 488 GLU A C    4  
ATOM   5292  O  O    . GLU A 1 67 ? 15.270  -3.036  -2.213  1.00 0.00 ? 488 GLU A O    4  
ATOM   5293  C  CB   . GLU A 1 67 ? 17.124  -5.776  -1.860  1.00 0.00 ? 488 GLU A CB   4  
ATOM   5294  C  CG   . GLU A 1 67 ? 17.894  -5.064  -2.960  1.00 0.00 ? 488 GLU A CG   4  
ATOM   5295  C  CD   . GLU A 1 67 ? 19.239  -4.546  -2.488  1.00 0.00 ? 488 GLU A CD   4  
ATOM   5296  O  OE1  . GLU A 1 67 ? 19.266  -3.769  -1.511  1.00 0.00 ? 488 GLU A OE1  4  
ATOM   5297  O  OE2  . GLU A 1 67 ? 20.265  -4.918  -3.097  1.00 0.00 ? 488 GLU A OE2  4  
ATOM   5298  H  H    . GLU A 1 67 ? 15.887  -6.523  0.224   1.00 0.00 ? 488 GLU A H    4  
ATOM   5299  H  HA   . GLU A 1 67 ? 16.927  -4.054  -0.606  1.00 0.00 ? 488 GLU A HA   4  
ATOM   5300  H  HB2  . GLU A 1 67 ? 17.832  -6.296  -1.232  1.00 0.00 ? 488 GLU A HB2  4  
ATOM   5301  H  HB3  . GLU A 1 67 ? 16.467  -6.499  -2.320  1.00 0.00 ? 488 GLU A HB3  4  
ATOM   5302  H  HG2  . GLU A 1 67 ? 18.057  -5.755  -3.773  1.00 0.00 ? 488 GLU A HG2  4  
ATOM   5303  H  HG3  . GLU A 1 67 ? 17.306  -4.229  -3.310  1.00 0.00 ? 488 GLU A HG3  4  
ATOM   5304  N  N    . LEU A 1 68 ? 14.136  -4.976  -2.095  1.00 0.00 ? 489 LEU A N    4  
ATOM   5305  C  CA   . LEU A 1 68 ? 13.009  -4.492  -2.884  1.00 0.00 ? 489 LEU A CA   4  
ATOM   5306  C  C    . LEU A 1 68 ? 12.642  -3.065  -2.490  1.00 0.00 ? 489 LEU A C    4  
ATOM   5307  O  O    . LEU A 1 68 ? 12.804  -2.131  -3.277  1.00 0.00 ? 489 LEU A O    4  
ATOM   5308  C  CB   . LEU A 1 68 ? 11.800  -5.411  -2.700  1.00 0.00 ? 489 LEU A CB   4  
ATOM   5309  C  CG   . LEU A 1 68 ? 11.924  -6.811  -3.302  1.00 0.00 ? 489 LEU A CG   4  
ATOM   5310  C  CD1  . LEU A 1 68 ? 10.614  -7.570  -3.160  1.00 0.00 ? 489 LEU A CD1  4  
ATOM   5311  C  CD2  . LEU A 1 68 ? 12.339  -6.729  -4.763  1.00 0.00 ? 489 LEU A CD2  4  
ATOM   5312  H  H    . LEU A 1 68 ? 14.122  -5.896  -1.757  1.00 0.00 ? 489 LEU A H    4  
ATOM   5313  H  HA   . LEU A 1 68 ? 13.303  -4.501  -3.923  1.00 0.00 ? 489 LEU A HA   4  
ATOM   5314  H  HB2  . LEU A 1 68 ? 11.626  -5.520  -1.641  1.00 0.00 ? 489 LEU A HB2  4  
ATOM   5315  H  HB3  . LEU A 1 68 ? 10.946  -4.928  -3.155  1.00 0.00 ? 489 LEU A HB3  4  
ATOM   5316  H  HG   . LEU A 1 68 ? 12.686  -7.360  -2.767  1.00 0.00 ? 489 LEU A HG   4  
ATOM   5317  H  HD11 . LEU A 1 68 ? 10.746  -8.391  -2.472  1.00 0.00 ? 489 LEU A HD11 4  
ATOM   5318  H  HD12 . LEU A 1 68 ? 10.314  -7.954  -4.124  1.00 0.00 ? 489 LEU A HD12 4  
ATOM   5319  H  HD13 . LEU A 1 68 ? 9.850   -6.904  -2.785  1.00 0.00 ? 489 LEU A HD13 4  
ATOM   5320  H  HD21 . LEU A 1 68 ? 11.742  -5.982  -5.265  1.00 0.00 ? 489 LEU A HD21 4  
ATOM   5321  H  HD22 . LEU A 1 68 ? 12.186  -7.689  -5.236  1.00 0.00 ? 489 LEU A HD22 4  
ATOM   5322  H  HD23 . LEU A 1 68 ? 13.383  -6.458  -4.826  1.00 0.00 ? 489 LEU A HD23 4  
ATOM   5323  N  N    . LEU A 1 69 ? 12.148  -2.902  -1.268  1.00 0.00 ? 490 LEU A N    4  
ATOM   5324  C  CA   . LEU A 1 69 ? 11.760  -1.588  -0.767  1.00 0.00 ? 490 LEU A CA   4  
ATOM   5325  C  C    . LEU A 1 69 ? 12.770  -0.525  -1.187  1.00 0.00 ? 490 LEU A C    4  
ATOM   5326  O  O    . LEU A 1 69 ? 12.425  0.439   -1.870  1.00 0.00 ? 490 LEU A O    4  
ATOM   5327  C  CB   . LEU A 1 69 ? 11.637  -1.617  0.757   1.00 0.00 ? 490 LEU A CB   4  
ATOM   5328  C  CG   . LEU A 1 69 ? 10.438  -2.383  1.319   1.00 0.00 ? 490 LEU A CG   4  
ATOM   5329  C  CD1  . LEU A 1 69 ? 10.587  -2.579  2.820   1.00 0.00 ? 490 LEU A CD1  4  
ATOM   5330  C  CD2  . LEU A 1 69 ? 9.142   -1.652  1.001   1.00 0.00 ? 490 LEU A CD2  4  
ATOM   5331  H  H    . LEU A 1 69 ? 12.042  -3.684  -0.687  1.00 0.00 ? 490 LEU A H    4  
ATOM   5332  H  HA   . LEU A 1 69 ? 10.799  -1.342  -1.194  1.00 0.00 ? 490 LEU A HA   4  
ATOM   5333  H  HB2  . LEU A 1 69 ? 12.533  -2.069  1.153   1.00 0.00 ? 490 LEU A HB2  4  
ATOM   5334  H  HB3  . LEU A 1 69 ? 11.569  -0.595  1.102   1.00 0.00 ? 490 LEU A HB3  4  
ATOM   5335  H  HG   . LEU A 1 69 ? 10.395  -3.360  0.858   1.00 0.00 ? 490 LEU A HG   4  
ATOM   5336  H  HD11 . LEU A 1 69 ? 9.723   -3.102  3.202   1.00 0.00 ? 490 LEU A HD11 4  
ATOM   5337  H  HD12 . LEU A 1 69 ? 10.668  -1.617  3.303   1.00 0.00 ? 490 LEU A HD12 4  
ATOM   5338  H  HD13 . LEU A 1 69 ? 11.477  -3.158  3.020   1.00 0.00 ? 490 LEU A HD13 4  
ATOM   5339  H  HD21 . LEU A 1 69 ? 9.197   -1.240  0.004   1.00 0.00 ? 490 LEU A HD21 4  
ATOM   5340  H  HD22 . LEU A 1 69 ? 8.995   -0.853  1.713   1.00 0.00 ? 490 LEU A HD22 4  
ATOM   5341  H  HD23 . LEU A 1 69 ? 8.315   -2.345  1.060   1.00 0.00 ? 490 LEU A HD23 4  
ATOM   5342  N  N    . ASP A 1 70 ? 14.020  -0.710  -0.776  1.00 0.00 ? 491 ASP A N    4  
ATOM   5343  C  CA   . ASP A 1 70 ? 15.082  0.231   -1.112  1.00 0.00 ? 491 ASP A CA   4  
ATOM   5344  C  C    . ASP A 1 70 ? 14.937  0.724   -2.549  1.00 0.00 ? 491 ASP A C    4  
ATOM   5345  O  O    . ASP A 1 70 ? 15.130  1.906   -2.834  1.00 0.00 ? 491 ASP A O    4  
ATOM   5346  C  CB   . ASP A 1 70 ? 16.452  -0.422  -0.920  1.00 0.00 ? 491 ASP A CB   4  
ATOM   5347  C  CG   . ASP A 1 70 ? 16.782  -0.654  0.541   1.00 0.00 ? 491 ASP A CG   4  
ATOM   5348  O  OD1  . ASP A 1 70 ? 16.377  0.177   1.381   1.00 0.00 ? 491 ASP A OD1  4  
ATOM   5349  O  OD2  . ASP A 1 70 ? 17.445  -1.668  0.845   1.00 0.00 ? 491 ASP A OD2  4  
ATOM   5350  H  H    . ASP A 1 70 ? 14.234  -1.498  -0.234  1.00 0.00 ? 491 ASP A H    4  
ATOM   5351  H  HA   . ASP A 1 70 ? 15.000  1.076   -0.445  1.00 0.00 ? 491 ASP A HA   4  
ATOM   5352  H  HB2  . ASP A 1 70 ? 16.463  -1.375  -1.428  1.00 0.00 ? 491 ASP A HB2  4  
ATOM   5353  H  HB3  . ASP A 1 70 ? 17.211  0.217   -1.345  1.00 0.00 ? 491 ASP A HB3  4  
ATOM   5354  N  N    . LYS A 1 71 ? 14.597  -0.190  -3.451  1.00 0.00 ? 492 LYS A N    4  
ATOM   5355  C  CA   . LYS A 1 71 ? 14.426  0.150   -4.858  1.00 0.00 ? 492 LYS A CA   4  
ATOM   5356  C  C    . LYS A 1 71 ? 13.066  0.797   -5.100  1.00 0.00 ? 492 LYS A C    4  
ATOM   5357  O  O    . LYS A 1 71 ? 12.975  1.860   -5.713  1.00 0.00 ? 492 LYS A O    4  
ATOM   5358  C  CB   . LYS A 1 71 ? 14.568  -1.102  -5.727  1.00 0.00 ? 492 LYS A CB   4  
ATOM   5359  C  CG   . LYS A 1 71 ? 14.876  -0.799  -7.184  1.00 0.00 ? 492 LYS A CG   4  
ATOM   5360  C  CD   . LYS A 1 71 ? 16.323  -0.375  -7.372  1.00 0.00 ? 492 LYS A CD   4  
ATOM   5361  C  CE   . LYS A 1 71 ? 17.262  -1.571  -7.347  1.00 0.00 ? 492 LYS A CE   4  
ATOM   5362  N  NZ   . LYS A 1 71 ? 17.193  -2.356  -8.610  1.00 0.00 ? 492 LYS A NZ   4  
ATOM   5363  H  H    . LYS A 1 71 ? 14.457  -1.117  -3.163  1.00 0.00 ? 492 LYS A H    4  
ATOM   5364  H  HA   . LYS A 1 71 ? 15.199  0.854   -5.126  1.00 0.00 ? 492 LYS A HA   4  
ATOM   5365  H  HB2  . LYS A 1 71 ? 15.367  -1.711  -5.332  1.00 0.00 ? 492 LYS A HB2  4  
ATOM   5366  H  HB3  . LYS A 1 71 ? 13.645  -1.662  -5.685  1.00 0.00 ? 492 LYS A HB3  4  
ATOM   5367  H  HG2  . LYS A 1 71 ? 14.693  -1.686  -7.773  1.00 0.00 ? 492 LYS A HG2  4  
ATOM   5368  H  HG3  . LYS A 1 71 ? 14.229  -0.001  -7.520  1.00 0.00 ? 492 LYS A HG3  4  
ATOM   5369  H  HD2  . LYS A 1 71 ? 16.421  0.126   -8.323  1.00 0.00 ? 492 LYS A HD2  4  
ATOM   5370  H  HD3  . LYS A 1 71 ? 16.596  0.303   -6.576  1.00 0.00 ? 492 LYS A HD3  4  
ATOM   5371  H  HE2  . LYS A 1 71 ? 18.272  -1.216  -7.209  1.00 0.00 ? 492 LYS A HE2  4  
ATOM   5372  H  HE3  . LYS A 1 71 ? 16.988  -2.209  -6.520  1.00 0.00 ? 492 LYS A HE3  4  
ATOM   5373  H  HZ1  . LYS A 1 71 ? 16.201  -2.546  -8.859  1.00 0.00 ? 492 LYS A HZ1  4  
ATOM   5374  H  HZ2  . LYS A 1 71 ? 17.689  -3.263  -8.495  1.00 0.00 ? 492 LYS A HZ2  4  
ATOM   5375  H  HZ3  . LYS A 1 71 ? 17.638  -1.826  -9.386  1.00 0.00 ? 492 LYS A HZ3  4  
ATOM   5376  N  N    . MET A 1 72 ? 12.012  0.150   -4.613  1.00 0.00 ? 493 MET A N    4  
ATOM   5377  C  CA   . MET A 1 72 ? 10.658  0.665   -4.775  1.00 0.00 ? 493 MET A CA   4  
ATOM   5378  C  C    . MET A 1 72 ? 10.532  2.062   -4.174  1.00 0.00 ? 493 MET A C    4  
ATOM   5379  O  O    . MET A 1 72 ? 10.256  3.031   -4.883  1.00 0.00 ? 493 MET A O    4  
ATOM   5380  C  CB   . MET A 1 72 ? 9.649   -0.278  -4.117  1.00 0.00 ? 493 MET A CB   4  
ATOM   5381  C  CG   . MET A 1 72 ? 8.224   -0.085  -4.612  1.00 0.00 ? 493 MET A CG   4  
ATOM   5382  S  SD   . MET A 1 72 ? 7.433   1.370   -3.900  1.00 0.00 ? 493 MET A SD   4  
ATOM   5383  C  CE   . MET A 1 72 ? 6.855   0.710   -2.338  1.00 0.00 ? 493 MET A CE   4  
ATOM   5384  H  H    . MET A 1 72 ? 12.148  -0.694  -4.133  1.00 0.00 ? 493 MET A H    4  
ATOM   5385  H  HA   . MET A 1 72 ? 10.449  0.720   -5.832  1.00 0.00 ? 493 MET A HA   4  
ATOM   5386  H  HB2  . MET A 1 72 ? 9.942   -1.297  -4.318  1.00 0.00 ? 493 MET A HB2  4  
ATOM   5387  H  HB3  . MET A 1 72 ? 9.661   -0.113  -3.050  1.00 0.00 ? 493 MET A HB3  4  
ATOM   5388  H  HG2  . MET A 1 72 ? 8.242   0.022   -5.686  1.00 0.00 ? 493 MET A HG2  4  
ATOM   5389  H  HG3  . MET A 1 72 ? 7.646   -0.958  -4.349  1.00 0.00 ? 493 MET A HG3  4  
ATOM   5390  H  HE1  . MET A 1 72 ? 7.567   -0.010  -1.965  1.00 0.00 ? 493 MET A HE1  4  
ATOM   5391  H  HE2  . MET A 1 72 ? 6.749   1.515   -1.625  1.00 0.00 ? 493 MET A HE2  4  
ATOM   5392  H  HE3  . MET A 1 72 ? 5.898   0.229   -2.483  1.00 0.00 ? 493 MET A HE3  4  
ATOM   5393  N  N    . LEU A 1 73 ? 10.736  2.159   -2.865  1.00 0.00 ? 494 LEU A N    4  
ATOM   5394  C  CA   . LEU A 1 73 ? 10.646  3.437   -2.169  1.00 0.00 ? 494 LEU A CA   4  
ATOM   5395  C  C    . LEU A 1 73 ? 11.379  4.530   -2.940  1.00 0.00 ? 494 LEU A C    4  
ATOM   5396  O  O    . LEU A 1 73 ? 10.756  5.391   -3.560  1.00 0.00 ? 494 LEU A O    4  
ATOM   5397  C  CB   . LEU A 1 73 ? 11.226  3.315   -0.759  1.00 0.00 ? 494 LEU A CB   4  
ATOM   5398  C  CG   . LEU A 1 73 ? 10.563  2.282   0.152   1.00 0.00 ? 494 LEU A CG   4  
ATOM   5399  C  CD1  . LEU A 1 73 ? 11.327  2.156   1.461   1.00 0.00 ? 494 LEU A CD1  4  
ATOM   5400  C  CD2  . LEU A 1 73 ? 9.111   2.654   0.413   1.00 0.00 ? 494 LEU A CD2  4  
ATOM   5401  H  H    . LEU A 1 73 ? 10.953  1.352   -2.354  1.00 0.00 ? 494 LEU A H    4  
ATOM   5402  H  HA   . LEU A 1 73 ? 9.601   3.703   -2.098  1.00 0.00 ? 494 LEU A HA   4  
ATOM   5403  H  HB2  . LEU A 1 73 ? 12.268  3.054   -0.852  1.00 0.00 ? 494 LEU A HB2  4  
ATOM   5404  H  HB3  . LEU A 1 73 ? 11.140  4.282   -0.282  1.00 0.00 ? 494 LEU A HB3  4  
ATOM   5405  H  HG   . LEU A 1 73 ? 10.579  1.317   -0.337  1.00 0.00 ? 494 LEU A HG   4  
ATOM   5406  H  HD11 . LEU A 1 73 ? 11.013  1.262   1.977   1.00 0.00 ? 494 LEU A HD11 4  
ATOM   5407  H  HD12 . LEU A 1 73 ? 11.125  3.018   2.080   1.00 0.00 ? 494 LEU A HD12 4  
ATOM   5408  H  HD13 . LEU A 1 73 ? 12.386  2.101   1.256   1.00 0.00 ? 494 LEU A HD13 4  
ATOM   5409  H  HD21 . LEU A 1 73 ? 8.469   2.072   -0.231  1.00 0.00 ? 494 LEU A HD21 4  
ATOM   5410  H  HD22 . LEU A 1 73 ? 8.967   3.706   0.211   1.00 0.00 ? 494 LEU A HD22 4  
ATOM   5411  H  HD23 . LEU A 1 73 ? 8.867   2.449   1.445   1.00 0.00 ? 494 LEU A HD23 4  
ATOM   5412  N  N    . ALA A 1 74 ? 12.707  4.487   -2.899  1.00 0.00 ? 495 ALA A N    4  
ATOM   5413  C  CA   . ALA A 1 74 ? 13.525  5.471   -3.597  1.00 0.00 ? 495 ALA A CA   4  
ATOM   5414  C  C    . ALA A 1 74 ? 12.890  5.870   -4.925  1.00 0.00 ? 495 ALA A C    4  
ATOM   5415  O  O    . ALA A 1 74 ? 12.795  7.055   -5.247  1.00 0.00 ? 495 ALA A O    4  
ATOM   5416  C  CB   . ALA A 1 74 ? 14.927  4.926   -3.823  1.00 0.00 ? 495 ALA A CB   4  
ATOM   5417  H  H    . ALA A 1 74 ? 13.146  3.776   -2.387  1.00 0.00 ? 495 ALA A H    4  
ATOM   5418  H  HA   . ALA A 1 74 ? 13.603  6.347   -2.969  1.00 0.00 ? 495 ALA A HA   4  
ATOM   5419  H  HB1  . ALA A 1 74 ? 15.524  5.669   -4.332  1.00 0.00 ? 495 ALA A HB1  4  
ATOM   5420  H  HB2  . ALA A 1 74 ? 15.380  4.691   -2.871  1.00 0.00 ? 495 ALA A HB2  4  
ATOM   5421  H  HB3  . ALA A 1 74 ? 14.873  4.032   -4.427  1.00 0.00 ? 495 ALA A HB3  4  
ATOM   5422  N  N    . ASP A 1 75 ? 12.458  4.875   -5.691  1.00 0.00 ? 496 ASP A N    4  
ATOM   5423  C  CA   . ASP A 1 75 ? 11.831  5.123   -6.984  1.00 0.00 ? 496 ASP A CA   4  
ATOM   5424  C  C    . ASP A 1 75 ? 10.594  6.002   -6.830  1.00 0.00 ? 496 ASP A C    4  
ATOM   5425  O  O    . ASP A 1 75 ? 10.464  7.030   -7.493  1.00 0.00 ? 496 ASP A O    4  
ATOM   5426  C  CB   . ASP A 1 75 ? 11.452  3.801   -7.653  1.00 0.00 ? 496 ASP A CB   4  
ATOM   5427  C  CG   . ASP A 1 75 ? 12.605  3.193   -8.429  1.00 0.00 ? 496 ASP A CG   4  
ATOM   5428  O  OD1  . ASP A 1 75 ? 13.425  3.963   -8.972  1.00 0.00 ? 496 ASP A OD1  4  
ATOM   5429  O  OD2  . ASP A 1 75 ? 12.686  1.949   -8.494  1.00 0.00 ? 496 ASP A OD2  4  
ATOM   5430  H  H    . ASP A 1 75 ? 12.562  3.952   -5.379  1.00 0.00 ? 496 ASP A H    4  
ATOM   5431  H  HA   . ASP A 1 75 ? 12.547  5.638   -7.607  1.00 0.00 ? 496 ASP A HA   4  
ATOM   5432  H  HB2  . ASP A 1 75 ? 11.143  3.097   -6.895  1.00 0.00 ? 496 ASP A HB2  4  
ATOM   5433  H  HB3  . ASP A 1 75 ? 10.633  3.972   -8.336  1.00 0.00 ? 496 ASP A HB3  4  
ATOM   5434  N  N    . ASP A 1 76 ? 9.688   5.589   -5.950  1.00 0.00 ? 497 ASP A N    4  
ATOM   5435  C  CA   . ASP A 1 76 ? 8.461   6.339   -5.708  1.00 0.00 ? 497 ASP A CA   4  
ATOM   5436  C  C    . ASP A 1 76 ? 8.770   7.711   -5.117  1.00 0.00 ? 497 ASP A C    4  
ATOM   5437  O  O    . ASP A 1 76 ? 8.526   8.738   -5.749  1.00 0.00 ? 497 ASP A O    4  
ATOM   5438  C  CB   . ASP A 1 76 ? 7.540   5.560   -4.767  1.00 0.00 ? 497 ASP A CB   4  
ATOM   5439  C  CG   . ASP A 1 76 ? 6.436   6.425   -4.191  1.00 0.00 ? 497 ASP A CG   4  
ATOM   5440  O  OD1  . ASP A 1 76 ? 5.864   7.238   -4.947  1.00 0.00 ? 497 ASP A OD1  4  
ATOM   5441  O  OD2  . ASP A 1 76 ? 6.143   6.289   -2.984  1.00 0.00 ? 497 ASP A OD2  4  
ATOM   5442  H  H    . ASP A 1 76 ? 9.849   4.761   -5.451  1.00 0.00 ? 497 ASP A H    4  
ATOM   5443  H  HA   . ASP A 1 76 ? 7.961   6.472   -6.655  1.00 0.00 ? 497 ASP A HA   4  
ATOM   5444  H  HB2  . ASP A 1 76 ? 7.086   4.744   -5.311  1.00 0.00 ? 497 ASP A HB2  4  
ATOM   5445  H  HB3  . ASP A 1 76 ? 8.124   5.162   -3.950  1.00 0.00 ? 497 ASP A HB3  4  
ATOM   5446  N  N    . ALA A 1 77 ? 9.307   7.719   -3.902  1.00 0.00 ? 498 ALA A N    4  
ATOM   5447  C  CA   . ALA A 1 77 ? 9.650   8.965   -3.227  1.00 0.00 ? 498 ALA A CA   4  
ATOM   5448  C  C    . ALA A 1 77 ? 10.198  9.991   -4.213  1.00 0.00 ? 498 ALA A C    4  
ATOM   5449  O  O    . ALA A 1 77 ? 9.588   11.035  -4.439  1.00 0.00 ? 498 ALA A O    4  
ATOM   5450  C  CB   . ALA A 1 77 ? 10.658  8.704   -2.118  1.00 0.00 ? 498 ALA A CB   4  
ATOM   5451  H  H    . ALA A 1 77 ? 9.478   6.867   -3.449  1.00 0.00 ? 498 ALA A H    4  
ATOM   5452  H  HA   . ALA A 1 77 ? 8.750   9.359   -2.776  1.00 0.00 ? 498 ALA A HA   4  
ATOM   5453  H  HB1  . ALA A 1 77 ? 10.158  8.241   -1.279  1.00 0.00 ? 498 ALA A HB1  4  
ATOM   5454  H  HB2  . ALA A 1 77 ? 11.432  8.046   -2.483  1.00 0.00 ? 498 ALA A HB2  4  
ATOM   5455  H  HB3  . ALA A 1 77 ? 11.098  9.638   -1.804  1.00 0.00 ? 498 ALA A HB3  4  
ATOM   5456  N  N    . GLU A 1 78 ? 11.353  9.685   -4.796  1.00 0.00 ? 499 GLU A N    4  
ATOM   5457  C  CA   . GLU A 1 78 ? 11.984  10.583  -5.757  1.00 0.00 ? 499 GLU A CA   4  
ATOM   5458  C  C    . GLU A 1 78 ? 10.935  11.287  -6.613  1.00 0.00 ? 499 GLU A C    4  
ATOM   5459  O  O    . GLU A 1 78 ? 10.920  12.513  -6.711  1.00 0.00 ? 499 GLU A O    4  
ATOM   5460  C  CB   . GLU A 1 78 ? 12.953  9.808   -6.652  1.00 0.00 ? 499 GLU A CB   4  
ATOM   5461  C  CG   . GLU A 1 78 ? 13.986  10.689  -7.335  1.00 0.00 ? 499 GLU A CG   4  
ATOM   5462  C  CD   . GLU A 1 78 ? 13.417  11.441  -8.522  1.00 0.00 ? 499 GLU A CD   4  
ATOM   5463  O  OE1  . GLU A 1 78 ? 12.657  10.831  -9.303  1.00 0.00 ? 499 GLU A OE1  4  
ATOM   5464  O  OE2  . GLU A 1 78 ? 13.732  12.641  -8.670  1.00 0.00 ? 499 GLU A OE2  4  
ATOM   5465  H  H    . GLU A 1 78 ? 11.792  8.837   -4.575  1.00 0.00 ? 499 GLU A H    4  
ATOM   5466  H  HA   . GLU A 1 78 ? 12.536  11.327  -5.202  1.00 0.00 ? 499 GLU A HA   4  
ATOM   5467  H  HB2  . GLU A 1 78 ? 13.474  9.078   -6.050  1.00 0.00 ? 499 GLU A HB2  4  
ATOM   5468  H  HB3  . GLU A 1 78 ? 12.387  9.295   -7.415  1.00 0.00 ? 499 GLU A HB3  4  
ATOM   5469  H  HG2  . GLU A 1 78 ? 14.360  11.406  -6.620  1.00 0.00 ? 499 GLU A HG2  4  
ATOM   5470  H  HG3  . GLU A 1 78 ? 14.800  10.067  -7.678  1.00 0.00 ? 499 GLU A HG3  4  
ATOM   5471  N  N    . ALA A 1 79 ? 10.061  10.500  -7.232  1.00 0.00 ? 500 ALA A N    4  
ATOM   5472  C  CA   . ALA A 1 79 ? 9.008   11.047  -8.080  1.00 0.00 ? 500 ALA A CA   4  
ATOM   5473  C  C    . ALA A 1 79 ? 7.796   11.460  -7.251  1.00 0.00 ? 500 ALA A C    4  
ATOM   5474  O  O    . ALA A 1 79 ? 6.654   11.240  -7.652  1.00 0.00 ? 500 ALA A O    4  
ATOM   5475  C  CB   . ALA A 1 79 ? 8.604   10.033  -9.140  1.00 0.00 ? 500 ALA A CB   4  
ATOM   5476  H  H    . ALA A 1 79 ? 10.125  9.530   -7.116  1.00 0.00 ? 500 ALA A H    4  
ATOM   5477  H  HA   . ALA A 1 79 ? 9.403   11.918  -8.582  1.00 0.00 ? 500 ALA A HA   4  
ATOM   5478  H  HB1  . ALA A 1 79 ? 9.308   10.070  -9.959  1.00 0.00 ? 500 ALA A HB1  4  
ATOM   5479  H  HB2  . ALA A 1 79 ? 8.604   9.043   -8.709  1.00 0.00 ? 500 ALA A HB2  4  
ATOM   5480  H  HB3  . ALA A 1 79 ? 7.615   10.268  -9.503  1.00 0.00 ? 500 ALA A HB3  4  
ATOM   5481  N  N    . GLY A 1 80 ? 8.054   12.061  -6.093  1.00 0.00 ? 501 GLY A N    4  
ATOM   5482  C  CA   . GLY A 1 80 ? 6.974   12.495  -5.227  1.00 0.00 ? 501 GLY A CA   4  
ATOM   5483  C  C    . GLY A 1 80 ? 7.268   12.241  -3.761  1.00 0.00 ? 501 GLY A C    4  
ATOM   5484  O  O    . GLY A 1 80 ? 7.132   11.117  -3.279  1.00 0.00 ? 501 GLY A O    4  
ATOM   5485  H  H    . GLY A 1 80 ? 8.985   12.210  -5.825  1.00 0.00 ? 501 GLY A H    4  
ATOM   5486  H  HA2  . GLY A 1 80 ? 6.812   13.552  -5.373  1.00 0.00 ? 501 GLY A HA2  4  
ATOM   5487  H  HA3  . GLY A 1 80 ? 6.074   11.962  -5.498  1.00 0.00 ? 501 GLY A HA3  4  
ATOM   5488  N  N    . ALA A 1 81 ? 7.675   13.289  -3.052  1.00 0.00 ? 502 ALA A N    4  
ATOM   5489  C  CA   . ALA A 1 81 ? 7.990   13.175  -1.633  1.00 0.00 ? 502 ALA A CA   4  
ATOM   5490  C  C    . ALA A 1 81 ? 7.978   14.541  -0.956  1.00 0.00 ? 502 ALA A C    4  
ATOM   5491  O  O    . ALA A 1 81 ? 8.656   15.468  -1.398  1.00 0.00 ? 502 ALA A O    4  
ATOM   5492  C  CB   . ALA A 1 81 ? 9.342   12.503  -1.445  1.00 0.00 ? 502 ALA A CB   4  
ATOM   5493  H  H    . ALA A 1 81 ? 7.764   14.159  -3.493  1.00 0.00 ? 502 ALA A H    4  
ATOM   5494  H  HA   . ALA A 1 81 ? 7.238   12.550  -1.173  1.00 0.00 ? 502 ALA A HA   4  
ATOM   5495  H  HB1  . ALA A 1 81 ? 10.126  13.184  -1.741  1.00 0.00 ? 502 ALA A HB1  4  
ATOM   5496  H  HB2  . ALA A 1 81 ? 9.469   12.236  -0.406  1.00 0.00 ? 502 ALA A HB2  4  
ATOM   5497  H  HB3  . ALA A 1 81 ? 9.389   11.613  -2.054  1.00 0.00 ? 502 ALA A HB3  4  
ATOM   5498  N  N    . GLU A 1 82 ? 7.201   14.658  0.116   1.00 0.00 ? 503 GLU A N    4  
ATOM   5499  C  CA   . GLU A 1 82 ? 7.101   15.913  0.852   1.00 0.00 ? 503 GLU A CA   4  
ATOM   5500  C  C    . GLU A 1 82 ? 7.363   15.695  2.340   1.00 0.00 ? 503 GLU A C    4  
ATOM   5501  O  O    . GLU A 1 82 ? 6.435   15.480  3.120   1.00 0.00 ? 503 GLU A O    4  
ATOM   5502  C  CB   . GLU A 1 82 ? 5.718   16.537  0.653   1.00 0.00 ? 503 GLU A CB   4  
ATOM   5503  C  CG   . GLU A 1 82 ? 5.477   17.048  -0.757  1.00 0.00 ? 503 GLU A CG   4  
ATOM   5504  C  CD   . GLU A 1 82 ? 6.078   18.420  -0.991  1.00 0.00 ? 503 GLU A CD   4  
ATOM   5505  O  OE1  . GLU A 1 82 ? 7.256   18.622  -0.632  1.00 0.00 ? 503 GLU A OE1  4  
ATOM   5506  O  OE2  . GLU A 1 82 ? 5.368   19.293  -1.535  1.00 0.00 ? 503 GLU A OE2  4  
ATOM   5507  H  H    . GLU A 1 82 ? 6.684   13.883  0.420   1.00 0.00 ? 503 GLU A H    4  
ATOM   5508  H  HA   . GLU A 1 82 ? 7.849   16.587  0.463   1.00 0.00 ? 503 GLU A HA   4  
ATOM   5509  H  HB2  . GLU A 1 82 ? 4.965   15.796  0.879   1.00 0.00 ? 503 GLU A HB2  4  
ATOM   5510  H  HB3  . GLU A 1 82 ? 5.609   17.366  1.337   1.00 0.00 ? 503 GLU A HB3  4  
ATOM   5511  H  HG2  . GLU A 1 82 ? 5.919   16.355  -1.457  1.00 0.00 ? 503 GLU A HG2  4  
ATOM   5512  H  HG3  . GLU A 1 82 ? 4.413   17.102  -0.930  1.00 0.00 ? 503 GLU A HG3  4  
ATOM   5513  N  N    . ASP A 1 83 ? 8.633   15.750  2.724   1.00 0.00 ? 504 ASP A N    4  
ATOM   5514  C  CA   . ASP A 1 83 ? 9.019   15.558  4.118   1.00 0.00 ? 504 ASP A CA   4  
ATOM   5515  C  C    . ASP A 1 83 ? 8.964   16.877  4.883   1.00 0.00 ? 504 ASP A C    4  
ATOM   5516  O  O    . ASP A 1 83 ? 8.785   17.941  4.292   1.00 0.00 ? 504 ASP A O    4  
ATOM   5517  C  CB   . ASP A 1 83 ? 10.425  14.963  4.203   1.00 0.00 ? 504 ASP A CB   4  
ATOM   5518  C  CG   . ASP A 1 83 ? 10.828  14.631  5.626   1.00 0.00 ? 504 ASP A CG   4  
ATOM   5519  O  OD1  . ASP A 1 83 ? 10.098  13.863  6.286   1.00 0.00 ? 504 ASP A OD1  4  
ATOM   5520  O  OD2  . ASP A 1 83 ? 11.875  15.138  6.079   1.00 0.00 ? 504 ASP A OD2  4  
ATOM   5521  H  H    . ASP A 1 83 ? 9.328   15.924  2.055   1.00 0.00 ? 504 ASP A H    4  
ATOM   5522  H  HA   . ASP A 1 83 ? 8.319   14.868  4.564   1.00 0.00 ? 504 ASP A HA   4  
ATOM   5523  H  HB2  . ASP A 1 83 ? 10.461  14.056  3.617   1.00 0.00 ? 504 ASP A HB2  4  
ATOM   5524  H  HB3  . ASP A 1 83 ? 11.134  15.673  3.803   1.00 0.00 ? 504 ASP A HB3  4  
ATOM   5525  N  N    . GLU A 1 84 ? 9.118   16.797  6.201   1.00 0.00 ? 505 GLU A N    4  
ATOM   5526  C  CA   . GLU A 1 84 ? 9.084   17.985  7.046   1.00 0.00 ? 505 GLU A CA   4  
ATOM   5527  C  C    . GLU A 1 84 ? 10.295  18.027  7.974   1.00 0.00 ? 505 GLU A C    4  
ATOM   5528  O  O    . GLU A 1 84 ? 10.752  16.995  8.466   1.00 0.00 ? 505 GLU A O    4  
ATOM   5529  C  CB   . GLU A 1 84 ? 7.795   18.015  7.870   1.00 0.00 ? 505 GLU A CB   4  
ATOM   5530  C  CG   . GLU A 1 84 ? 7.327   19.418  8.218   1.00 0.00 ? 505 GLU A CG   4  
ATOM   5531  C  CD   . GLU A 1 84 ? 7.194   20.307  6.997   1.00 0.00 ? 505 GLU A CD   4  
ATOM   5532  O  OE1  . GLU A 1 84 ? 6.837   19.788  5.920   1.00 0.00 ? 505 GLU A OE1  4  
ATOM   5533  O  OE2  . GLU A 1 84 ? 7.448   21.524  7.120   1.00 0.00 ? 505 GLU A OE2  4  
ATOM   5534  H  H    . GLU A 1 84 ? 9.258   15.920  6.614   1.00 0.00 ? 505 GLU A H    4  
ATOM   5535  H  HA   . GLU A 1 84 ? 9.109   18.851  6.403   1.00 0.00 ? 505 GLU A HA   4  
ATOM   5536  H  HB2  . GLU A 1 84 ? 7.013   17.524  7.310   1.00 0.00 ? 505 GLU A HB2  4  
ATOM   5537  H  HB3  . GLU A 1 84 ? 7.959   17.474  8.791   1.00 0.00 ? 505 GLU A HB3  4  
ATOM   5538  H  HG2  . GLU A 1 84 ? 6.365   19.353  8.703   1.00 0.00 ? 505 GLU A HG2  4  
ATOM   5539  H  HG3  . GLU A 1 84 ? 8.041   19.864  8.895   1.00 0.00 ? 505 GLU A HG3  4  
ATOM   5540  N  N    . LYS A 1 85 ? 10.811  19.229  8.209   1.00 0.00 ? 506 LYS A N    4  
ATOM   5541  C  CA   . LYS A 1 85 ? 11.968  19.409  9.078   1.00 0.00 ? 506 LYS A CA   4  
ATOM   5542  C  C    . LYS A 1 85 ? 11.943  18.410  10.231  1.00 0.00 ? 506 LYS A C    4  
ATOM   5543  O  O    . LYS A 1 85 ? 10.876  18.022  10.704  1.00 0.00 ? 506 LYS A O    4  
ATOM   5544  C  CB   . LYS A 1 85 ? 12.003  20.837  9.627   1.00 0.00 ? 506 LYS A CB   4  
ATOM   5545  C  CG   . LYS A 1 85 ? 10.795  21.191  10.477  1.00 0.00 ? 506 LYS A CG   4  
ATOM   5546  C  CD   . LYS A 1 85 ? 11.138  22.238  11.524  1.00 0.00 ? 506 LYS A CD   4  
ATOM   5547  C  CE   . LYS A 1 85 ? 11.330  23.610  10.897  1.00 0.00 ? 506 LYS A CE   4  
ATOM   5548  N  NZ   . LYS A 1 85 ? 10.046  24.178  10.400  1.00 0.00 ? 506 LYS A NZ   4  
ATOM   5549  H  H    . LYS A 1 85 ? 10.403  20.015  7.788   1.00 0.00 ? 506 LYS A H    4  
ATOM   5550  H  HA   . LYS A 1 85 ? 12.856  19.237  8.488   1.00 0.00 ? 506 LYS A HA   4  
ATOM   5551  H  HB2  . LYS A 1 85 ? 12.890  20.956  10.230  1.00 0.00 ? 506 LYS A HB2  4  
ATOM   5552  H  HB3  . LYS A 1 85 ? 12.047  21.527  8.797   1.00 0.00 ? 506 LYS A HB3  4  
ATOM   5553  H  HG2  . LYS A 1 85 ? 10.017  21.578  9.838   1.00 0.00 ? 506 LYS A HG2  4  
ATOM   5554  H  HG3  . LYS A 1 85 ? 10.444  20.299  10.976  1.00 0.00 ? 506 LYS A HG3  4  
ATOM   5555  H  HD2  . LYS A 1 85 ? 10.335  22.293  12.243  1.00 0.00 ? 506 LYS A HD2  4  
ATOM   5556  H  HD3  . LYS A 1 85 ? 12.052  21.949  12.023  1.00 0.00 ? 506 LYS A HD3  4  
ATOM   5557  H  HE2  . LYS A 1 85 ? 11.745  24.276  11.638  1.00 0.00 ? 506 LYS A HE2  4  
ATOM   5558  H  HE3  . LYS A 1 85 ? 12.018  23.520  10.069  1.00 0.00 ? 506 LYS A HE3  4  
ATOM   5559  H  HZ1  . LYS A 1 85 ? 9.792   23.744  9.490   1.00 0.00 ? 506 LYS A HZ1  4  
ATOM   5560  H  HZ2  . LYS A 1 85 ? 10.137  25.206  10.268  1.00 0.00 ? 506 LYS A HZ2  4  
ATOM   5561  H  HZ3  . LYS A 1 85 ? 9.285   23.993  11.085  1.00 0.00 ? 506 LYS A HZ3  4  
ATOM   5562  N  N    . GLU A 1 86 ? 13.126  18.000  10.678  1.00 0.00 ? 507 GLU A N    4  
ATOM   5563  C  CA   . GLU A 1 86 ? 13.238  17.048  11.777  1.00 0.00 ? 507 GLU A CA   4  
ATOM   5564  C  C    . GLU A 1 86 ? 13.190  17.763  13.124  1.00 0.00 ? 507 GLU A C    4  
ATOM   5565  O  O    . GLU A 1 86 ? 13.442  18.965  13.211  1.00 0.00 ? 507 GLU A O    4  
ATOM   5566  C  CB   . GLU A 1 86 ? 14.537  16.248  11.657  1.00 0.00 ? 507 GLU A CB   4  
ATOM   5567  C  CG   . GLU A 1 86 ? 14.686  15.167  12.714  1.00 0.00 ? 507 GLU A CG   4  
ATOM   5568  C  CD   . GLU A 1 86 ? 15.752  14.148  12.361  1.00 0.00 ? 507 GLU A CD   4  
ATOM   5569  O  OE1  . GLU A 1 86 ? 16.066  14.011  11.159  1.00 0.00 ? 507 GLU A OE1  4  
ATOM   5570  O  OE2  . GLU A 1 86 ? 16.273  13.489  13.284  1.00 0.00 ? 507 GLU A OE2  4  
ATOM   5571  H  H    . GLU A 1 86 ? 13.942  18.346  10.260  1.00 0.00 ? 507 GLU A H    4  
ATOM   5572  H  HA   . GLU A 1 86 ? 12.402  16.369  11.713  1.00 0.00 ? 507 GLU A HA   4  
ATOM   5573  H  HB2  . GLU A 1 86 ? 14.570  15.780  10.685  1.00 0.00 ? 507 GLU A HB2  4  
ATOM   5574  H  HB3  . GLU A 1 86 ? 15.373  16.927  11.748  1.00 0.00 ? 507 GLU A HB3  4  
ATOM   5575  H  HG2  . GLU A 1 86 ? 14.950  15.631  13.652  1.00 0.00 ? 507 GLU A HG2  4  
ATOM   5576  H  HG3  . GLU A 1 86 ? 13.741  14.654  12.821  1.00 0.00 ? 507 GLU A HG3  4  
ATOM   5577  N  N    . VAL A 1 87 ? 12.864  17.014  14.173  1.00 0.00 ? 508 VAL A N    4  
ATOM   5578  C  CA   . VAL A 1 87 ? 12.783  17.575  15.517  1.00 0.00 ? 508 VAL A CA   4  
ATOM   5579  C  C    . VAL A 1 87 ? 13.798  16.921  16.447  1.00 0.00 ? 508 VAL A C    4  
ATOM   5580  O  O    . VAL A 1 87 ? 13.699  15.733  16.753  1.00 0.00 ? 508 VAL A O    4  
ATOM   5581  C  CB   . VAL A 1 87 ? 11.372  17.404  16.112  1.00 0.00 ? 508 VAL A CB   4  
ATOM   5582  C  CG1  . VAL A 1 87 ? 11.006  15.930  16.203  1.00 0.00 ? 508 VAL A CG1  4  
ATOM   5583  C  CG2  . VAL A 1 87 ? 11.287  18.069  17.477  1.00 0.00 ? 508 VAL A CG2  4  
ATOM   5584  H  H    . VAL A 1 87 ? 12.674  16.062  14.040  1.00 0.00 ? 508 VAL A H    4  
ATOM   5585  H  HA   . VAL A 1 87 ? 12.997  18.632  15.451  1.00 0.00 ? 508 VAL A HA   4  
ATOM   5586  H  HB   . VAL A 1 87 ? 10.665  17.887  15.454  1.00 0.00 ? 508 VAL A HB   4  
ATOM   5587  H  HG11 . VAL A 1 87 ? 11.365  15.528  17.140  1.00 0.00 ? 508 VAL A HG11 4  
ATOM   5588  H  HG12 . VAL A 1 87 ? 9.933   15.821  16.151  1.00 0.00 ? 508 VAL A HG12 4  
ATOM   5589  H  HG13 . VAL A 1 87 ? 11.463  15.394  15.384  1.00 0.00 ? 508 VAL A HG13 4  
ATOM   5590  H  HG21 . VAL A 1 87 ? 11.492  19.124  17.376  1.00 0.00 ? 508 VAL A HG21 4  
ATOM   5591  H  HG22 . VAL A 1 87 ? 10.294  17.933  17.883  1.00 0.00 ? 508 VAL A HG22 4  
ATOM   5592  H  HG23 . VAL A 1 87 ? 12.011  17.622  18.142  1.00 0.00 ? 508 VAL A HG23 4  
ATOM   5593  N  N    . GLU A 1 88 ? 14.774  17.705  16.894  1.00 0.00 ? 509 GLU A N    4  
ATOM   5594  C  CA   . GLU A 1 88 ? 15.808  17.202  17.790  1.00 0.00 ? 509 GLU A CA   4  
ATOM   5595  C  C    . GLU A 1 88 ? 15.529  17.618  19.232  1.00 0.00 ? 509 GLU A C    4  
ATOM   5596  O  O    . GLU A 1 88 ? 14.562  18.327  19.507  1.00 0.00 ? 509 GLU A O    4  
ATOM   5597  C  CB   . GLU A 1 88 ? 17.183  17.713  17.357  1.00 0.00 ? 509 GLU A CB   4  
ATOM   5598  C  CG   . GLU A 1 88 ? 17.796  16.919  16.216  1.00 0.00 ? 509 GLU A CG   4  
ATOM   5599  C  CD   . GLU A 1 88 ? 17.354  17.418  14.854  1.00 0.00 ? 509 GLU A CD   4  
ATOM   5600  O  OE1  . GLU A 1 88 ? 16.134  17.598  14.656  1.00 0.00 ? 509 GLU A OE1  4  
ATOM   5601  O  OE2  . GLU A 1 88 ? 18.227  17.627  13.986  1.00 0.00 ? 509 GLU A OE2  4  
ATOM   5602  H  H    . GLU A 1 88 ? 14.799  18.644  16.615  1.00 0.00 ? 509 GLU A H    4  
ATOM   5603  H  HA   . GLU A 1 88 ? 15.800  16.124  17.732  1.00 0.00 ? 509 GLU A HA   4  
ATOM   5604  H  HB2  . GLU A 1 88 ? 17.088  18.742  17.042  1.00 0.00 ? 509 GLU A HB2  4  
ATOM   5605  H  HB3  . GLU A 1 88 ? 17.854  17.665  18.202  1.00 0.00 ? 509 GLU A HB3  4  
ATOM   5606  H  HG2  . GLU A 1 88 ? 18.871  16.995  16.278  1.00 0.00 ? 509 GLU A HG2  4  
ATOM   5607  H  HG3  . GLU A 1 88 ? 17.503  15.884  16.316  1.00 0.00 ? 509 GLU A HG3  4  
ATOM   5608  N  N    . GLU A 1 89 ? 16.384  17.172  20.146  1.00 0.00 ? 510 GLU A N    4  
ATOM   5609  C  CA   . GLU A 1 89 ? 16.229  17.498  21.559  1.00 0.00 ? 510 GLU A CA   4  
ATOM   5610  C  C    . GLU A 1 89 ? 16.866  18.847  21.880  1.00 0.00 ? 510 GLU A C    4  
ATOM   5611  O  O    . GLU A 1 89 ? 16.170  19.847  22.061  1.00 0.00 ? 510 GLU A O    4  
ATOM   5612  C  CB   . GLU A 1 89 ? 16.856  16.406  22.429  1.00 0.00 ? 510 GLU A CB   4  
ATOM   5613  C  CG   . GLU A 1 89 ? 15.893  15.289  22.792  1.00 0.00 ? 510 GLU A CG   4  
ATOM   5614  C  CD   . GLU A 1 89 ? 16.439  14.375  23.872  1.00 0.00 ? 510 GLU A CD   4  
ATOM   5615  O  OE1  . GLU A 1 89 ? 17.678  14.251  23.972  1.00 0.00 ? 510 GLU A OE1  4  
ATOM   5616  O  OE2  . GLU A 1 89 ? 15.629  13.784  24.616  1.00 0.00 ? 510 GLU A OE2  4  
ATOM   5617  H  H    . GLU A 1 89 ? 17.136  16.611  19.865  1.00 0.00 ? 510 GLU A H    4  
ATOM   5618  H  HA   . GLU A 1 89 ? 15.172  17.552  21.773  1.00 0.00 ? 510 GLU A HA   4  
ATOM   5619  H  HB2  . GLU A 1 89 ? 17.692  15.975  21.898  1.00 0.00 ? 510 GLU A HB2  4  
ATOM   5620  H  HB3  . GLU A 1 89 ? 17.215  16.854  23.344  1.00 0.00 ? 510 GLU A HB3  4  
ATOM   5621  H  HG2  . GLU A 1 89 ? 14.971  15.726  23.145  1.00 0.00 ? 510 GLU A HG2  4  
ATOM   5622  H  HG3  . GLU A 1 89 ? 15.696  14.699  21.908  1.00 0.00 ? 510 GLU A HG3  4  
ATOM   5623  N  N    . LEU A 1 90 ? 18.192  18.867  21.949  1.00 0.00 ? 511 LEU A N    4  
ATOM   5624  C  CA   . LEU A 1 90 ? 18.924  20.093  22.248  1.00 0.00 ? 511 LEU A CA   4  
ATOM   5625  C  C    . LEU A 1 90 ? 18.299  20.826  23.430  1.00 0.00 ? 511 LEU A C    4  
ATOM   5626  O  O    . LEU A 1 90 ? 18.299  22.056  23.482  1.00 0.00 ? 511 LEU A O    4  
ATOM   5627  C  CB   . LEU A 1 90 ? 18.950  21.007  21.022  1.00 0.00 ? 511 LEU A CB   4  
ATOM   5628  C  CG   . LEU A 1 90 ? 19.968  20.649  19.938  1.00 0.00 ? 511 LEU A CG   4  
ATOM   5629  C  CD1  . LEU A 1 90 ? 19.376  19.645  18.961  1.00 0.00 ? 511 LEU A CD1  4  
ATOM   5630  C  CD2  . LEU A 1 90 ? 20.431  21.900  19.206  1.00 0.00 ? 511 LEU A CD2  4  
ATOM   5631  H  H    . LEU A 1 90 ? 18.692  18.039  21.795  1.00 0.00 ? 511 LEU A H    4  
ATOM   5632  H  HA   . LEU A 1 90 ? 19.937  19.820  22.504  1.00 0.00 ? 511 LEU A HA   4  
ATOM   5633  H  HB2  . LEU A 1 90 ? 17.969  20.986  20.573  1.00 0.00 ? 511 LEU A HB2  4  
ATOM   5634  H  HB3  . LEU A 1 90 ? 19.167  22.010  21.362  1.00 0.00 ? 511 LEU A HB3  4  
ATOM   5635  H  HG   . LEU A 1 90 ? 20.832  20.192  20.402  1.00 0.00 ? 511 LEU A HG   4  
ATOM   5636  H  HD11 . LEU A 1 90 ? 20.141  18.950  18.651  1.00 0.00 ? 511 LEU A HD11 4  
ATOM   5637  H  HD12 . LEU A 1 90 ? 18.993  20.168  18.097  1.00 0.00 ? 511 LEU A HD12 4  
ATOM   5638  H  HD13 . LEU A 1 90 ? 18.572  19.106  19.441  1.00 0.00 ? 511 LEU A HD13 4  
ATOM   5639  H  HD21 . LEU A 1 90 ? 20.297  21.764  18.143  1.00 0.00 ? 511 LEU A HD21 4  
ATOM   5640  H  HD22 . LEU A 1 90 ? 21.476  22.075  19.418  1.00 0.00 ? 511 LEU A HD22 4  
ATOM   5641  H  HD23 . LEU A 1 90 ? 19.849  22.747  19.537  1.00 0.00 ? 511 LEU A HD23 4  
ATOM   5642  N  N    . LYS A 1 91 ? 17.767  20.063  24.378  1.00 0.00 ? 512 LYS A N    4  
ATOM   5643  C  CA   . LYS A 1 91 ? 17.140  20.638  25.563  1.00 0.00 ? 512 LYS A CA   4  
ATOM   5644  C  C    . LYS A 1 91 ? 17.642  19.955  26.830  1.00 0.00 ? 512 LYS A C    4  
ATOM   5645  O  O    . LYS A 1 91 ? 17.097  20.158  27.916  1.00 0.00 ? 512 LYS A O    4  
ATOM   5646  C  CB   . LYS A 1 91 ? 15.618  20.513  25.472  1.00 0.00 ? 512 LYS A CB   4  
ATOM   5647  C  CG   . LYS A 1 91 ? 15.002  21.367  24.377  1.00 0.00 ? 512 LYS A CG   4  
ATOM   5648  C  CD   . LYS A 1 91 ? 14.660  22.759  24.881  1.00 0.00 ? 512 LYS A CD   4  
ATOM   5649  C  CE   . LYS A 1 91 ? 13.755  23.498  23.908  1.00 0.00 ? 512 LYS A CE   4  
ATOM   5650  N  NZ   . LYS A 1 91 ? 13.568  24.924  24.297  1.00 0.00 ? 512 LYS A NZ   4  
ATOM   5651  H  H    . LYS A 1 91 ? 17.797  19.088  24.280  1.00 0.00 ? 512 LYS A H    4  
ATOM   5652  H  HA   . LYS A 1 91 ? 17.405  21.684  25.603  1.00 0.00 ? 512 LYS A HA   4  
ATOM   5653  H  HB2  . LYS A 1 91 ? 15.364  19.481  25.280  1.00 0.00 ? 512 LYS A HB2  4  
ATOM   5654  H  HB3  . LYS A 1 91 ? 15.187  20.811  26.417  1.00 0.00 ? 512 LYS A HB3  4  
ATOM   5655  H  HG2  . LYS A 1 91 ? 15.704  21.454  23.562  1.00 0.00 ? 512 LYS A HG2  4  
ATOM   5656  H  HG3  . LYS A 1 91 ? 14.098  20.889  24.026  1.00 0.00 ? 512 LYS A HG3  4  
ATOM   5657  H  HD2  . LYS A 1 91 ? 14.155  22.675  25.832  1.00 0.00 ? 512 LYS A HD2  4  
ATOM   5658  H  HD3  . LYS A 1 91 ? 15.575  23.321  25.007  1.00 0.00 ? 512 LYS A HD3  4  
ATOM   5659  H  HE2  . LYS A 1 91 ? 14.197  23.458  22.924  1.00 0.00 ? 512 LYS A HE2  4  
ATOM   5660  H  HE3  . LYS A 1 91 ? 12.792  23.009  23.890  1.00 0.00 ? 512 LYS A HE3  4  
ATOM   5661  H  HZ1  . LYS A 1 91 ? 14.056  25.115  25.195  1.00 0.00 ? 512 LYS A HZ1  4  
ATOM   5662  H  HZ2  . LYS A 1 91 ? 12.557  25.132  24.414  1.00 0.00 ? 512 LYS A HZ2  4  
ATOM   5663  H  HZ3  . LYS A 1 91 ? 13.958  25.549  23.563  1.00 0.00 ? 512 LYS A HZ3  4  
ATOM   5664  N  N    . LYS A 1 92 ? 18.685  19.144  26.686  1.00 0.00 ? 513 LYS A N    4  
ATOM   5665  C  CA   . LYS A 1 92 ? 19.263  18.432  27.820  1.00 0.00 ? 513 LYS A CA   4  
ATOM   5666  C  C    . LYS A 1 92 ? 19.687  19.405  28.915  1.00 0.00 ? 513 LYS A C    4  
ATOM   5667  O  O    . LYS A 1 92 ? 20.347  20.409  28.645  1.00 0.00 ? 513 LYS A O    4  
ATOM   5668  C  CB   . LYS A 1 92 ? 20.466  17.602  27.367  1.00 0.00 ? 513 LYS A CB   4  
ATOM   5669  C  CG   . LYS A 1 92 ? 20.901  16.557  28.380  1.00 0.00 ? 513 LYS A CG   4  
ATOM   5670  C  CD   . LYS A 1 92 ? 22.383  16.245  28.260  1.00 0.00 ? 513 LYS A CD   4  
ATOM   5671  C  CE   . LYS A 1 92 ? 22.823  15.220  29.293  1.00 0.00 ? 513 LYS A CE   4  
ATOM   5672  N  NZ   . LYS A 1 92 ? 24.295  14.999  29.263  1.00 0.00 ? 513 LYS A NZ   4  
ATOM   5673  H  H    . LYS A 1 92 ? 19.076  19.022  25.796  1.00 0.00 ? 513 LYS A H    4  
ATOM   5674  H  HA   . LYS A 1 92 ? 18.508  17.770  28.216  1.00 0.00 ? 513 LYS A HA   4  
ATOM   5675  H  HB2  . LYS A 1 92 ? 20.214  17.097  26.446  1.00 0.00 ? 513 LYS A HB2  4  
ATOM   5676  H  HB3  . LYS A 1 92 ? 21.300  18.266  27.187  1.00 0.00 ? 513 LYS A HB3  4  
ATOM   5677  H  HG2  . LYS A 1 92 ? 20.702  16.928  29.375  1.00 0.00 ? 513 LYS A HG2  4  
ATOM   5678  H  HG3  . LYS A 1 92 ? 20.337  15.650  28.213  1.00 0.00 ? 513 LYS A HG3  4  
ATOM   5679  H  HD2  . LYS A 1 92 ? 22.581  15.853  27.273  1.00 0.00 ? 513 LYS A HD2  4  
ATOM   5680  H  HD3  . LYS A 1 92 ? 22.947  17.156  28.406  1.00 0.00 ? 513 LYS A HD3  4  
ATOM   5681  H  HE2  . LYS A 1 92 ? 22.541  15.572  30.274  1.00 0.00 ? 513 LYS A HE2  4  
ATOM   5682  H  HE3  . LYS A 1 92 ? 22.323  14.285  29.089  1.00 0.00 ? 513 LYS A HE3  4  
ATOM   5683  H  HZ1  . LYS A 1 92 ? 24.585  14.413  30.073  1.00 0.00 ? 513 LYS A HZ1  4  
ATOM   5684  H  HZ2  . LYS A 1 92 ? 24.795  15.909  29.313  1.00 0.00 ? 513 LYS A HZ2  4  
ATOM   5685  H  HZ3  . LYS A 1 92 ? 24.566  14.514  28.384  1.00 0.00 ? 513 LYS A HZ3  4  
ATOM   5686  N  N    . SER A 1 93 ? 19.305  19.101  30.151  1.00 0.00 ? 514 SER A N    4  
ATOM   5687  C  CA   . SER A 1 93 ? 19.644  19.950  31.287  1.00 0.00 ? 514 SER A CA   4  
ATOM   5688  C  C    . SER A 1 93 ? 19.762  19.126  32.566  1.00 0.00 ? 514 SER A C    4  
ATOM   5689  O  O    . SER A 1 93 ? 19.525  17.919  32.564  1.00 0.00 ? 514 SER A O    4  
ATOM   5690  C  CB   . SER A 1 93 ? 18.589  21.043  31.466  1.00 0.00 ? 514 SER A CB   4  
ATOM   5691  O  OG   . SER A 1 93 ? 18.427  21.796  30.277  1.00 0.00 ? 514 SER A OG   4  
ATOM   5692  H  H    . SER A 1 93 ? 18.781  18.286  30.302  1.00 0.00 ? 514 SER A H    4  
ATOM   5693  H  HA   . SER A 1 93 ? 20.598  20.413  31.082  1.00 0.00 ? 514 SER A HA   4  
ATOM   5694  H  HB2  . SER A 1 93 ? 17.643  20.589  31.721  1.00 0.00 ? 514 SER A HB2  4  
ATOM   5695  H  HB3  . SER A 1 93 ? 18.895  21.708  32.261  1.00 0.00 ? 514 SER A HB3  4  
ATOM   5696  H  HG   . SER A 1 93 ? 18.505  22.732  30.477  1.00 0.00 ? 514 SER A HG   4  
ATOM   5697  N  N    . GLY A 1 94 ? 20.130  19.789  33.658  1.00 0.00 ? 515 GLY A N    4  
ATOM   5698  C  CA   . GLY A 1 94 ? 20.273  19.103  34.929  1.00 0.00 ? 515 GLY A CA   4  
ATOM   5699  C  C    . GLY A 1 94 ? 20.640  20.046  36.058  1.00 0.00 ? 515 GLY A C    4  
ATOM   5700  O  O    . GLY A 1 94 ? 21.809  20.199  36.413  1.00 0.00 ? 515 GLY A O    4  
ATOM   5701  H  H    . GLY A 1 94 ? 20.306  20.752  33.600  1.00 0.00 ? 515 GLY A H    4  
ATOM   5702  H  HA2  . GLY A 1 94 ? 19.341  18.615  35.169  1.00 0.00 ? 515 GLY A HA2  4  
ATOM   5703  H  HA3  . GLY A 1 94 ? 21.046  18.355  34.836  1.00 0.00 ? 515 GLY A HA3  4  
ATOM   5704  N  N    . PRO A 1 95 ? 19.624  20.699  36.642  1.00 0.00 ? 516 PRO A N    4  
ATOM   5705  C  CA   . PRO A 1 95 ? 19.820  21.644  37.745  1.00 0.00 ? 516 PRO A CA   4  
ATOM   5706  C  C    . PRO A 1 95 ? 20.244  20.949  39.035  1.00 0.00 ? 516 PRO A C    4  
ATOM   5707  O  O    . PRO A 1 95 ? 20.402  19.729  39.071  1.00 0.00 ? 516 PRO A O    4  
ATOM   5708  C  CB   . PRO A 1 95 ? 18.441  22.287  37.912  1.00 0.00 ? 516 PRO A CB   4  
ATOM   5709  C  CG   . PRO A 1 95 ? 17.485  21.274  37.384  1.00 0.00 ? 516 PRO A CG   4  
ATOM   5710  C  CD   . PRO A 1 95 ? 18.205  20.566  36.270  1.00 0.00 ? 516 PRO A CD   4  
ATOM   5711  H  HA   . PRO A 1 95 ? 20.545  22.404  37.492  1.00 0.00 ? 516 PRO A HA   4  
ATOM   5712  H  HB2  . PRO A 1 95 ? 18.262  22.494  38.958  1.00 0.00 ? 516 PRO A HB2  4  
ATOM   5713  H  HB3  . PRO A 1 95 ? 18.397  23.205  37.345  1.00 0.00 ? 516 PRO A HB3  4  
ATOM   5714  H  HG2  . PRO A 1 95 ? 17.222  20.576  38.164  1.00 0.00 ? 516 PRO A HG2  4  
ATOM   5715  H  HG3  . PRO A 1 95 ? 16.602  21.766  37.005  1.00 0.00 ? 516 PRO A HG3  4  
ATOM   5716  H  HD2  . PRO A 1 95 ? 17.913  19.527  36.232  1.00 0.00 ? 516 PRO A HD2  4  
ATOM   5717  H  HD3  . PRO A 1 95 ? 18.008  21.050  35.325  1.00 0.00 ? 516 PRO A HD3  4  
ATOM   5718  N  N    . SER A 1 96 ? 20.425  21.734  40.092  1.00 0.00 ? 517 SER A N    4  
ATOM   5719  C  CA   . SER A 1 96 ? 20.834  21.194  41.384  1.00 0.00 ? 517 SER A CA   4  
ATOM   5720  C  C    . SER A 1 96 ? 19.869  21.628  42.484  1.00 0.00 ? 517 SER A C    4  
ATOM   5721  O  O    . SER A 1 96 ? 18.945  22.404  42.243  1.00 0.00 ? 517 SER A O    4  
ATOM   5722  C  CB   . SER A 1 96 ? 22.253  21.651  41.726  1.00 0.00 ? 517 SER A CB   4  
ATOM   5723  O  OG   . SER A 1 96 ? 22.332  23.064  41.793  1.00 0.00 ? 517 SER A OG   4  
ATOM   5724  H  H    . SER A 1 96 ? 20.284  22.700  40.001  1.00 0.00 ? 517 SER A H    4  
ATOM   5725  H  HA   . SER A 1 96 ? 20.819  20.117  41.312  1.00 0.00 ? 517 SER A HA   4  
ATOM   5726  H  HB2  . SER A 1 96 ? 22.540  21.241  42.682  1.00 0.00 ? 517 SER A HB2  4  
ATOM   5727  H  HB3  . SER A 1 96 ? 22.934  21.300  40.964  1.00 0.00 ? 517 SER A HB3  4  
ATOM   5728  H  HG   . SER A 1 96 ? 21.923  23.370  42.606  1.00 0.00 ? 517 SER A HG   4  
ATOM   5729  N  N    . SER A 1 97 ? 20.091  21.119  43.691  1.00 0.00 ? 518 SER A N    4  
ATOM   5730  C  CA   . SER A 1 97 ? 19.240  21.450  44.828  1.00 0.00 ? 518 SER A CA   4  
ATOM   5731  C  C    . SER A 1 97 ? 20.036  22.175  45.910  1.00 0.00 ? 518 SER A C    4  
ATOM   5732  O  O    . SER A 1 97 ? 19.696  23.289  46.305  1.00 0.00 ? 518 SER A O    4  
ATOM   5733  C  CB   . SER A 1 97 ? 18.610  20.181  45.407  1.00 0.00 ? 518 SER A CB   4  
ATOM   5734  O  OG   . SER A 1 97 ? 17.873  19.482  44.419  1.00 0.00 ? 518 SER A OG   4  
ATOM   5735  H  H    . SER A 1 97 ? 20.844  20.505  43.820  1.00 0.00 ? 518 SER A H    4  
ATOM   5736  H  HA   . SER A 1 97 ? 18.456  22.103  44.476  1.00 0.00 ? 518 SER A HA   4  
ATOM   5737  H  HB2  . SER A 1 97 ? 19.388  19.535  45.783  1.00 0.00 ? 518 SER A HB2  4  
ATOM   5738  H  HB3  . SER A 1 97 ? 17.944  20.450  46.214  1.00 0.00 ? 518 SER A HB3  4  
ATOM   5739  H  HG   . SER A 1 97 ? 17.974  18.537  44.553  1.00 0.00 ? 518 SER A HG   4  
ATOM   5740  N  N    . GLY A 1 98 ? 21.098  21.532  46.385  1.00 0.00 ? 519 GLY A N    4  
ATOM   5741  C  CA   . GLY A 1 98 ? 21.926  22.129  47.417  1.00 0.00 ? 519 GLY A CA   4  
ATOM   5742  C  C    . GLY A 1 98 ? 21.789  21.423  48.751  1.00 0.00 ? 519 GLY A C    4  
ATOM   5743  O  O    . GLY A 1 98 ? 21.399  20.257  48.775  1.00 0.00 ? 519 GLY A O    4  
ATOM   5744  H  H    . GLY A 1 98 ? 21.321  20.645  46.033  1.00 0.00 ? 519 GLY A H    4  
ATOM   5745  H  HA2  . GLY A 1 98 ? 22.959  22.087  47.103  1.00 0.00 ? 519 GLY A HA2  4  
ATOM   5746  H  HA3  . GLY A 1 98 ? 21.639  23.163  47.539  1.00 0.00 ? 519 GLY A HA3  4  
HETATM 5747  ZN ZN   . ZN  B 2 .  ? -0.817  -8.255  -10.715 1.00 0.00 ? 622 ZN  A ZN   4  
HETATM 5748  ZN ZN   . ZN  C 2 .  ? -0.548  -3.480  5.573   1.00 0.00 ? 822 ZN  A ZN   4  
ATOM   5749  N  N    . GLY A 1 1  ? 29.264  -11.462 3.994   1.00 0.00 ? 422 GLY A N    5  
ATOM   5750  C  CA   . GLY A 1 1  ? 29.197  -12.180 2.735   1.00 0.00 ? 422 GLY A CA   5  
ATOM   5751  C  C    . GLY A 1 1  ? 28.042  -13.161 2.688   1.00 0.00 ? 422 GLY A C    5  
ATOM   5752  O  O    . GLY A 1 1  ? 27.721  -13.801 3.690   1.00 0.00 ? 422 GLY A O    5  
ATOM   5753  H  H1   . GLY A 1 1  ? 28.960  -10.531 4.041   1.00 0.00 ? 422 GLY A H1   5  
ATOM   5754  H  HA2  . GLY A 1 1  ? 29.083  -11.468 1.932   1.00 0.00 ? 422 GLY A HA2  5  
ATOM   5755  H  HA3  . GLY A 1 1  ? 30.120  -12.723 2.594   1.00 0.00 ? 422 GLY A HA3  5  
ATOM   5756  N  N    . SER A 1 2  ? 27.415  -13.280 1.522   1.00 0.00 ? 423 SER A N    5  
ATOM   5757  C  CA   . SER A 1 2  ? 26.285  -14.186 1.351   1.00 0.00 ? 423 SER A CA   5  
ATOM   5758  C  C    . SER A 1 2  ? 26.374  -14.918 0.015   1.00 0.00 ? 423 SER A C    5  
ATOM   5759  O  O    . SER A 1 2  ? 26.798  -14.348 -0.991  1.00 0.00 ? 423 SER A O    5  
ATOM   5760  C  CB   . SER A 1 2  ? 24.967  -13.413 1.435   1.00 0.00 ? 423 SER A CB   5  
ATOM   5761  O  OG   . SER A 1 2  ? 24.648  -13.094 2.778   1.00 0.00 ? 423 SER A OG   5  
ATOM   5762  H  H    . SER A 1 2  ? 27.718  -12.743 0.760   1.00 0.00 ? 423 SER A H    5  
ATOM   5763  H  HA   . SER A 1 2  ? 26.318  -14.912 2.149   1.00 0.00 ? 423 SER A HA   5  
ATOM   5764  H  HB2  . SER A 1 2  ? 25.053  -12.497 0.870   1.00 0.00 ? 423 SER A HB2  5  
ATOM   5765  H  HB3  . SER A 1 2  ? 24.172  -14.017 1.022   1.00 0.00 ? 423 SER A HB3  5  
ATOM   5766  H  HG   . SER A 1 2  ? 23.865  -13.581 3.045   1.00 0.00 ? 423 SER A HG   5  
ATOM   5767  N  N    . SER A 1 3  ? 25.972  -16.185 0.014   1.00 0.00 ? 424 SER A N    5  
ATOM   5768  C  CA   . SER A 1 3  ? 26.010  -16.998 -1.196  1.00 0.00 ? 424 SER A CA   5  
ATOM   5769  C  C    . SER A 1 3  ? 25.204  -18.280 -1.014  1.00 0.00 ? 424 SER A C    5  
ATOM   5770  O  O    . SER A 1 3  ? 25.597  -19.173 -0.265  1.00 0.00 ? 424 SER A O    5  
ATOM   5771  C  CB   . SER A 1 3  ? 27.456  -17.339 -1.562  1.00 0.00 ? 424 SER A CB   5  
ATOM   5772  O  OG   . SER A 1 3  ? 27.550  -17.790 -2.902  1.00 0.00 ? 424 SER A OG   5  
ATOM   5773  H  H    . SER A 1 3  ? 25.645  -16.583 0.848   1.00 0.00 ? 424 SER A H    5  
ATOM   5774  H  HA   . SER A 1 3  ? 25.571  -16.421 -1.996  1.00 0.00 ? 424 SER A HA   5  
ATOM   5775  H  HB2  . SER A 1 3  ? 28.071  -16.459 -1.447  1.00 0.00 ? 424 SER A HB2  5  
ATOM   5776  H  HB3  . SER A 1 3  ? 27.816  -18.118 -0.906  1.00 0.00 ? 424 SER A HB3  5  
ATOM   5777  H  HG   . SER A 1 3  ? 27.778  -17.053 -3.473  1.00 0.00 ? 424 SER A HG   5  
ATOM   5778  N  N    . GLY A 1 4  ? 24.072  -18.363 -1.706  1.00 0.00 ? 425 GLY A N    5  
ATOM   5779  C  CA   . GLY A 1 4  ? 23.227  -19.539 -1.608  1.00 0.00 ? 425 GLY A CA   5  
ATOM   5780  C  C    . GLY A 1 4  ? 21.805  -19.270 -2.059  1.00 0.00 ? 425 GLY A C    5  
ATOM   5781  O  O    . GLY A 1 4  ? 20.851  -19.577 -1.343  1.00 0.00 ? 425 GLY A O    5  
ATOM   5782  H  H    . GLY A 1 4  ? 23.808  -17.620 -2.288  1.00 0.00 ? 425 GLY A H    5  
ATOM   5783  H  HA2  . GLY A 1 4  ? 23.646  -20.323 -2.222  1.00 0.00 ? 425 GLY A HA2  5  
ATOM   5784  H  HA3  . GLY A 1 4  ? 23.210  -19.871 -0.581  1.00 0.00 ? 425 GLY A HA3  5  
ATOM   5785  N  N    . SER A 1 5  ? 21.661  -18.694 -3.248  1.00 0.00 ? 426 SER A N    5  
ATOM   5786  C  CA   . SER A 1 5  ? 20.345  -18.379 -3.790  1.00 0.00 ? 426 SER A CA   5  
ATOM   5787  C  C    . SER A 1 5  ? 19.745  -19.589 -4.499  1.00 0.00 ? 426 SER A C    5  
ATOM   5788  O  O    . SER A 1 5  ? 20.433  -20.295 -5.235  1.00 0.00 ? 426 SER A O    5  
ATOM   5789  C  CB   . SER A 1 5  ? 20.439  -17.200 -4.761  1.00 0.00 ? 426 SER A CB   5  
ATOM   5790  O  OG   . SER A 1 5  ? 21.120  -17.570 -5.947  1.00 0.00 ? 426 SER A OG   5  
ATOM   5791  H  H    . SER A 1 5  ? 22.460  -18.473 -3.771  1.00 0.00 ? 426 SER A H    5  
ATOM   5792  H  HA   . SER A 1 5  ? 19.703  -18.104 -2.966  1.00 0.00 ? 426 SER A HA   5  
ATOM   5793  H  HB2  . SER A 1 5  ? 19.444  -16.870 -5.020  1.00 0.00 ? 426 SER A HB2  5  
ATOM   5794  H  HB3  . SER A 1 5  ? 20.976  -16.390 -4.289  1.00 0.00 ? 426 SER A HB3  5  
ATOM   5795  H  HG   . SER A 1 5  ? 20.802  -18.425 -6.246  1.00 0.00 ? 426 SER A HG   5  
ATOM   5796  N  N    . SER A 1 6  ? 18.456  -19.823 -4.269  1.00 0.00 ? 427 SER A N    5  
ATOM   5797  C  CA   . SER A 1 6  ? 17.763  -20.950 -4.882  1.00 0.00 ? 427 SER A CA   5  
ATOM   5798  C  C    . SER A 1 6  ? 17.851  -20.880 -6.403  1.00 0.00 ? 427 SER A C    5  
ATOM   5799  O  O    . SER A 1 6  ? 18.132  -21.878 -7.066  1.00 0.00 ? 427 SER A O    5  
ATOM   5800  C  CB   . SER A 1 6  ? 16.297  -20.973 -4.445  1.00 0.00 ? 427 SER A CB   5  
ATOM   5801  O  OG   . SER A 1 6  ? 15.576  -19.897 -5.021  1.00 0.00 ? 427 SER A OG   5  
ATOM   5802  H  H    . SER A 1 6  ? 17.961  -19.224 -3.672  1.00 0.00 ? 427 SER A H    5  
ATOM   5803  H  HA   . SER A 1 6  ? 18.244  -21.857 -4.546  1.00 0.00 ? 427 SER A HA   5  
ATOM   5804  H  HB2  . SER A 1 6  ? 15.845  -21.902 -4.758  1.00 0.00 ? 427 SER A HB2  5  
ATOM   5805  H  HB3  . SER A 1 6  ? 16.244  -20.891 -3.369  1.00 0.00 ? 427 SER A HB3  5  
ATOM   5806  H  HG   . SER A 1 6  ? 14.820  -20.240 -5.502  1.00 0.00 ? 427 SER A HG   5  
ATOM   5807  N  N    . GLY A 1 7  ? 17.608  -19.693 -6.950  1.00 0.00 ? 428 GLY A N    5  
ATOM   5808  C  CA   . GLY A 1 7  ? 17.664  -19.513 -8.389  1.00 0.00 ? 428 GLY A CA   5  
ATOM   5809  C  C    . GLY A 1 7  ? 17.188  -18.141 -8.821  1.00 0.00 ? 428 GLY A C    5  
ATOM   5810  O  O    . GLY A 1 7  ? 16.790  -17.325 -7.990  1.00 0.00 ? 428 GLY A O    5  
ATOM   5811  H  H    . GLY A 1 7  ? 17.388  -18.933 -6.372  1.00 0.00 ? 428 GLY A H    5  
ATOM   5812  H  HA2  . GLY A 1 7  ? 18.683  -19.650 -8.718  1.00 0.00 ? 428 GLY A HA2  5  
ATOM   5813  H  HA3  . GLY A 1 7  ? 17.042  -20.262 -8.858  1.00 0.00 ? 428 GLY A HA3  5  
ATOM   5814  N  N    . GLU A 1 8  ? 17.229  -17.885 -10.125 1.00 0.00 ? 429 GLU A N    5  
ATOM   5815  C  CA   . GLU A 1 8  ? 16.800  -16.600 -10.665 1.00 0.00 ? 429 GLU A CA   5  
ATOM   5816  C  C    . GLU A 1 8  ? 15.738  -16.790 -11.743 1.00 0.00 ? 429 GLU A C    5  
ATOM   5817  O  O    . GLU A 1 8  ? 16.055  -17.054 -12.904 1.00 0.00 ? 429 GLU A O    5  
ATOM   5818  C  CB   . GLU A 1 8  ? 17.996  -15.839 -11.240 1.00 0.00 ? 429 GLU A CB   5  
ATOM   5819  C  CG   . GLU A 1 8  ? 19.065  -15.516 -10.210 1.00 0.00 ? 429 GLU A CG   5  
ATOM   5820  C  CD   . GLU A 1 8  ? 19.850  -14.265 -10.556 1.00 0.00 ? 429 GLU A CD   5  
ATOM   5821  O  OE1  . GLU A 1 8  ? 20.115  -14.043 -11.756 1.00 0.00 ? 429 GLU A OE1  5  
ATOM   5822  O  OE2  . GLU A 1 8  ? 20.200  -13.509 -9.626  1.00 0.00 ? 429 GLU A OE2  5  
ATOM   5823  H  H    . GLU A 1 8  ? 17.556  -18.576 -10.738 1.00 0.00 ? 429 GLU A H    5  
ATOM   5824  H  HA   . GLU A 1 8  ? 16.376  -16.026 -9.855  1.00 0.00 ? 429 GLU A HA   5  
ATOM   5825  H  HB2  . GLU A 1 8  ? 18.446  -16.435 -12.020 1.00 0.00 ? 429 GLU A HB2  5  
ATOM   5826  H  HB3  . GLU A 1 8  ? 17.645  -14.911 -11.666 1.00 0.00 ? 429 GLU A HB3  5  
ATOM   5827  H  HG2  . GLU A 1 8  ? 18.591  -15.370 -9.251  1.00 0.00 ? 429 GLU A HG2  5  
ATOM   5828  H  HG3  . GLU A 1 8  ? 19.751  -16.348 -10.148 1.00 0.00 ? 429 GLU A HG3  5  
ATOM   5829  N  N    . LEU A 1 9  ? 14.476  -16.654 -11.352 1.00 0.00 ? 430 LEU A N    5  
ATOM   5830  C  CA   . LEU A 1 9  ? 13.364  -16.811 -12.284 1.00 0.00 ? 430 LEU A CA   5  
ATOM   5831  C  C    . LEU A 1 9  ? 13.021  -15.483 -12.951 1.00 0.00 ? 430 LEU A C    5  
ATOM   5832  O  O    . LEU A 1 9  ? 13.263  -14.406 -12.406 1.00 0.00 ? 430 LEU A O    5  
ATOM   5833  C  CB   . LEU A 1 9  ? 12.137  -17.362 -11.557 1.00 0.00 ? 430 LEU A CB   5  
ATOM   5834  C  CG   . LEU A 1 9  ? 12.073  -18.882 -11.404 1.00 0.00 ? 430 LEU A CG   5  
ATOM   5835  C  CD1  . LEU A 1 9  ? 11.923  -19.549 -12.763 1.00 0.00 ? 430 LEU A CD1  5  
ATOM   5836  C  CD2  . LEU A 1 9  ? 13.312  -19.399 -10.688 1.00 0.00 ? 430 LEU A CD2  5  
ATOM   5837  H  H    . LEU A 1 9  ? 14.285  -16.444 -10.414 1.00 0.00 ? 430 LEU A H    5  
ATOM   5838  H  HA   . LEU A 1 9  ? 13.668  -17.515 -13.045 1.00 0.00 ? 430 LEU A HA   5  
ATOM   5839  H  HB2  . LEU A 1 9  ? 12.116  -16.930 -10.568 1.00 0.00 ? 430 LEU A HB2  5  
ATOM   5840  H  HB3  . LEU A 1 9  ? 11.260  -17.046 -12.104 1.00 0.00 ? 430 LEU A HB3  5  
ATOM   5841  H  HG   . LEU A 1 9  ? 11.208  -19.142 -10.809 1.00 0.00 ? 430 LEU A HG   5  
ATOM   5842  H  HD11 . LEU A 1 9  ? 12.764  -19.288 -13.387 1.00 0.00 ? 430 LEU A HD11 5  
ATOM   5843  H  HD12 . LEU A 1 9  ? 11.009  -19.213 -13.230 1.00 0.00 ? 430 LEU A HD12 5  
ATOM   5844  H  HD13 . LEU A 1 9  ? 11.888  -20.621 -12.636 1.00 0.00 ? 430 LEU A HD13 5  
ATOM   5845  H  HD21 . LEU A 1 9  ? 13.059  -20.287 -10.128 1.00 0.00 ? 430 LEU A HD21 5  
ATOM   5846  H  HD22 . LEU A 1 9  ? 13.680  -18.640 -10.013 1.00 0.00 ? 430 LEU A HD22 5  
ATOM   5847  H  HD23 . LEU A 1 9  ? 14.075  -19.637 -11.415 1.00 0.00 ? 430 LEU A HD23 5  
ATOM   5848  N  N    . PRO A 1 10 ? 12.442  -15.559 -14.158 1.00 0.00 ? 431 PRO A N    5  
ATOM   5849  C  CA   . PRO A 1 10 ? 12.050  -14.372 -14.924 1.00 0.00 ? 431 PRO A CA   5  
ATOM   5850  C  C    . PRO A 1 10 ? 10.870  -13.640 -14.296 1.00 0.00 ? 431 PRO A C    5  
ATOM   5851  O  O    . PRO A 1 10 ? 9.723   -13.826 -14.701 1.00 0.00 ? 431 PRO A O    5  
ATOM   5852  C  CB   . PRO A 1 10 ? 11.659  -14.944 -16.289 1.00 0.00 ? 431 PRO A CB   5  
ATOM   5853  C  CG   . PRO A 1 10 ? 11.258  -16.352 -16.009 1.00 0.00 ? 431 PRO A CG   5  
ATOM   5854  C  CD   . PRO A 1 10 ? 12.124  -16.809 -14.868 1.00 0.00 ? 431 PRO A CD   5  
ATOM   5855  H  HA   . PRO A 1 10 ? 12.876  -13.686 -15.043 1.00 0.00 ? 431 PRO A HA   5  
ATOM   5856  H  HB2  . PRO A 1 10 ? 10.838  -14.373 -16.700 1.00 0.00 ? 431 PRO A HB2  5  
ATOM   5857  H  HB3  . PRO A 1 10 ? 12.505  -14.901 -16.958 1.00 0.00 ? 431 PRO A HB3  5  
ATOM   5858  H  HG2  . PRO A 1 10 ? 10.217  -16.388 -15.728 1.00 0.00 ? 431 PRO A HG2  5  
ATOM   5859  H  HG3  . PRO A 1 10 ? 11.435  -16.964 -16.882 1.00 0.00 ? 431 PRO A HG3  5  
ATOM   5860  H  HD2  . PRO A 1 10 ? 11.578  -17.488 -14.229 1.00 0.00 ? 431 PRO A HD2  5  
ATOM   5861  H  HD3  . PRO A 1 10 ? 13.022  -17.279 -15.241 1.00 0.00 ? 431 PRO A HD3  5  
ATOM   5862  N  N    . LYS A 1 11 ? 11.158  -12.806 -13.303 1.00 0.00 ? 432 LYS A N    5  
ATOM   5863  C  CA   . LYS A 1 11 ? 10.121  -12.043 -12.618 1.00 0.00 ? 432 LYS A CA   5  
ATOM   5864  C  C    . LYS A 1 11 ? 10.636  -10.664 -12.216 1.00 0.00 ? 432 LYS A C    5  
ATOM   5865  O  O    . LYS A 1 11 ? 11.843  -10.422 -12.197 1.00 0.00 ? 432 LYS A O    5  
ATOM   5866  C  CB   . LYS A 1 11 ? 9.637   -12.799 -11.379 1.00 0.00 ? 432 LYS A CB   5  
ATOM   5867  C  CG   . LYS A 1 11 ? 8.948   -14.114 -11.700 1.00 0.00 ? 432 LYS A CG   5  
ATOM   5868  C  CD   . LYS A 1 11 ? 7.464   -13.918 -11.959 1.00 0.00 ? 432 LYS A CD   5  
ATOM   5869  C  CE   . LYS A 1 11 ? 6.703   -13.653 -10.669 1.00 0.00 ? 432 LYS A CE   5  
ATOM   5870  N  NZ   . LYS A 1 11 ? 6.398   -14.913 -9.936  1.00 0.00 ? 432 LYS A NZ   5  
ATOM   5871  H  H    . LYS A 1 11 ? 12.093  -12.699 -13.024 1.00 0.00 ? 432 LYS A H    5  
ATOM   5872  H  HA   . LYS A 1 11 ? 9.294   -11.920 -13.300 1.00 0.00 ? 432 LYS A HA   5  
ATOM   5873  H  HB2  . LYS A 1 11 ? 10.486  -13.007 -10.744 1.00 0.00 ? 432 LYS A HB2  5  
ATOM   5874  H  HB3  . LYS A 1 11 ? 8.940   -12.174 -10.840 1.00 0.00 ? 432 LYS A HB3  5  
ATOM   5875  H  HG2  . LYS A 1 11 ? 9.403   -14.543 -12.581 1.00 0.00 ? 432 LYS A HG2  5  
ATOM   5876  H  HG3  . LYS A 1 11 ? 9.072   -14.788 -10.864 1.00 0.00 ? 432 LYS A HG3  5  
ATOM   5877  H  HD2  . LYS A 1 11 ? 7.331   -13.075 -12.621 1.00 0.00 ? 432 LYS A HD2  5  
ATOM   5878  H  HD3  . LYS A 1 11 ? 7.067   -14.809 -12.424 1.00 0.00 ? 432 LYS A HD3  5  
ATOM   5879  H  HE2  . LYS A 1 11 ? 7.303   -13.016 -10.037 1.00 0.00 ? 432 LYS A HE2  5  
ATOM   5880  H  HE3  . LYS A 1 11 ? 5.777   -13.153 -10.909 1.00 0.00 ? 432 LYS A HE3  5  
ATOM   5881  H  HZ1  . LYS A 1 11 ? 6.845   -14.897 -8.997  1.00 0.00 ? 432 LYS A HZ1  5  
ATOM   5882  H  HZ2  . LYS A 1 11 ? 6.761   -15.731 -10.466 1.00 0.00 ? 432 LYS A HZ2  5  
ATOM   5883  H  HZ3  . LYS A 1 11 ? 5.370   -15.018 -9.818  1.00 0.00 ? 432 LYS A HZ3  5  
ATOM   5884  N  N    . LYS A 1 12 ? 9.713   -9.764  -11.893 1.00 0.00 ? 433 LYS A N    5  
ATOM   5885  C  CA   . LYS A 1 12 ? 10.073  -8.410  -11.488 1.00 0.00 ? 433 LYS A CA   5  
ATOM   5886  C  C    . LYS A 1 12 ? 10.305  -8.336  -9.983  1.00 0.00 ? 433 LYS A C    5  
ATOM   5887  O  O    . LYS A 1 12 ? 11.188  -7.616  -9.516  1.00 0.00 ? 433 LYS A O    5  
ATOM   5888  C  CB   . LYS A 1 12 ? 8.974   -7.426  -11.895 1.00 0.00 ? 433 LYS A CB   5  
ATOM   5889  C  CG   . LYS A 1 12 ? 8.926   -7.151  -13.388 1.00 0.00 ? 433 LYS A CG   5  
ATOM   5890  C  CD   . LYS A 1 12 ? 10.093  -6.286  -13.834 1.00 0.00 ? 433 LYS A CD   5  
ATOM   5891  C  CE   . LYS A 1 12 ? 9.775   -4.805  -13.696 1.00 0.00 ? 433 LYS A CE   5  
ATOM   5892  N  NZ   . LYS A 1 12 ? 9.942   -4.330  -12.295 1.00 0.00 ? 433 LYS A NZ   5  
ATOM   5893  H  H    . LYS A 1 12 ? 8.766   -10.017 -11.927 1.00 0.00 ? 433 LYS A H    5  
ATOM   5894  H  HA   . LYS A 1 12 ? 10.988  -8.145  -11.995 1.00 0.00 ? 433 LYS A HA   5  
ATOM   5895  H  HB2  . LYS A 1 12 ? 8.018   -7.827  -11.593 1.00 0.00 ? 433 LYS A HB2  5  
ATOM   5896  H  HB3  . LYS A 1 12 ? 9.140   -6.489  -11.383 1.00 0.00 ? 433 LYS A HB3  5  
ATOM   5897  H  HG2  . LYS A 1 12 ? 8.964   -8.090  -13.919 1.00 0.00 ? 433 LYS A HG2  5  
ATOM   5898  H  HG3  . LYS A 1 12 ? 8.002   -6.640  -13.621 1.00 0.00 ? 433 LYS A HG3  5  
ATOM   5899  H  HD2  . LYS A 1 12 ? 10.954  -6.516  -13.223 1.00 0.00 ? 433 LYS A HD2  5  
ATOM   5900  H  HD3  . LYS A 1 12 ? 10.316  -6.503  -14.869 1.00 0.00 ? 433 LYS A HD3  5  
ATOM   5901  H  HE2  . LYS A 1 12 ? 10.438  -4.247  -14.338 1.00 0.00 ? 433 LYS A HE2  5  
ATOM   5902  H  HE3  . LYS A 1 12 ? 8.753   -4.640  -14.004 1.00 0.00 ? 433 LYS A HE3  5  
ATOM   5903  H  HZ1  . LYS A 1 12 ? 10.619  -4.938  -11.790 1.00 0.00 ? 433 LYS A HZ1  5  
ATOM   5904  H  HZ2  . LYS A 1 12 ? 9.030   -4.358  -11.797 1.00 0.00 ? 433 LYS A HZ2  5  
ATOM   5905  H  HZ3  . LYS A 1 12 ? 10.298  -3.353  -12.289 1.00 0.00 ? 433 LYS A HZ3  5  
ATOM   5906  N  N    . ARG A 1 13 ? 9.508   -9.086  -9.228  1.00 0.00 ? 434 ARG A N    5  
ATOM   5907  C  CA   . ARG A 1 13 ? 9.627   -9.105  -7.775  1.00 0.00 ? 434 ARG A CA   5  
ATOM   5908  C  C    . ARG A 1 13 ? 9.380   -7.717  -7.191  1.00 0.00 ? 434 ARG A C    5  
ATOM   5909  O  O    . ARG A 1 13 ? 10.074  -7.289  -6.270  1.00 0.00 ? 434 ARG A O    5  
ATOM   5910  C  CB   . ARG A 1 13 ? 11.013  -9.604  -7.363  1.00 0.00 ? 434 ARG A CB   5  
ATOM   5911  C  CG   . ARG A 1 13 ? 11.037  -10.282 -6.003  1.00 0.00 ? 434 ARG A CG   5  
ATOM   5912  C  CD   . ARG A 1 13 ? 10.408  -11.665 -6.059  1.00 0.00 ? 434 ARG A CD   5  
ATOM   5913  N  NE   . ARG A 1 13 ? 10.474  -12.350 -4.771  1.00 0.00 ? 434 ARG A NE   5  
ATOM   5914  C  CZ   . ARG A 1 13 ? 11.605  -12.784 -4.227  1.00 0.00 ? 434 ARG A CZ   5  
ATOM   5915  N  NH1  . ARG A 1 13 ? 12.759  -12.605 -4.856  1.00 0.00 ? 434 ARG A NH1  5  
ATOM   5916  N  NH2  . ARG A 1 13 ? 11.584  -13.398 -3.051  1.00 0.00 ? 434 ARG A NH2  5  
ATOM   5917  H  H    . ARG A 1 13 ? 8.823   -9.639  -9.658  1.00 0.00 ? 434 ARG A H    5  
ATOM   5918  H  HA   . ARG A 1 13 ? 8.881   -9.783  -7.390  1.00 0.00 ? 434 ARG A HA   5  
ATOM   5919  H  HB2  . ARG A 1 13 ? 11.362  -10.312 -8.099  1.00 0.00 ? 434 ARG A HB2  5  
ATOM   5920  H  HB3  . ARG A 1 13 ? 11.691  -8.764  -7.334  1.00 0.00 ? 434 ARG A HB3  5  
ATOM   5921  H  HG2  . ARG A 1 13 ? 12.061  -10.378 -5.676  1.00 0.00 ? 434 ARG A HG2  5  
ATOM   5922  H  HG3  . ARG A 1 13 ? 10.488  -9.674  -5.299  1.00 0.00 ? 434 ARG A HG3  5  
ATOM   5923  H  HD2  . ARG A 1 13 ? 9.372   -11.564 -6.349  1.00 0.00 ? 434 ARG A HD2  5  
ATOM   5924  H  HD3  . ARG A 1 13 ? 10.932  -12.254 -6.797  1.00 0.00 ? 434 ARG A HD3  5  
ATOM   5925  H  HE   . ARG A 1 13 ? 9.633   -12.492 -4.289  1.00 0.00 ? 434 ARG A HE   5  
ATOM   5926  H  HH11 . ARG A 1 13 ? 12.777  -12.142 -5.742  1.00 0.00 ? 434 ARG A HH11 5  
ATOM   5927  H  HH12 . ARG A 1 13 ? 13.609  -12.932 -4.443  1.00 0.00 ? 434 ARG A HH12 5  
ATOM   5928  H  HH21 . ARG A 1 13 ? 10.717  -13.534 -2.573  1.00 0.00 ? 434 ARG A HH21 5  
ATOM   5929  H  HH22 . ARG A 1 13 ? 12.436  -13.724 -2.642  1.00 0.00 ? 434 ARG A HH22 5  
ATOM   5930  N  N    . GLU A 1 14 ? 8.388   -7.020  -7.735  1.00 0.00 ? 435 GLU A N    5  
ATOM   5931  C  CA   . GLU A 1 14 ? 8.051   -5.680  -7.269  1.00 0.00 ? 435 GLU A CA   5  
ATOM   5932  C  C    . GLU A 1 14 ? 6.541   -5.522  -7.112  1.00 0.00 ? 435 GLU A C    5  
ATOM   5933  O  O    . GLU A 1 14 ? 5.763   -6.292  -7.676  1.00 0.00 ? 435 GLU A O    5  
ATOM   5934  C  CB   . GLU A 1 14 ? 8.586   -4.627  -8.241  1.00 0.00 ? 435 GLU A CB   5  
ATOM   5935  C  CG   . GLU A 1 14 ? 8.874   -3.286  -7.589  1.00 0.00 ? 435 GLU A CG   5  
ATOM   5936  C  CD   . GLU A 1 14 ? 10.065  -3.336  -6.652  1.00 0.00 ? 435 GLU A CD   5  
ATOM   5937  O  OE1  . GLU A 1 14 ? 9.916   -3.867  -5.531  1.00 0.00 ? 435 GLU A OE1  5  
ATOM   5938  O  OE2  . GLU A 1 14 ? 11.146  -2.845  -7.039  1.00 0.00 ? 435 GLU A OE2  5  
ATOM   5939  H  H    . GLU A 1 14 ? 7.870   -7.415  -8.467  1.00 0.00 ? 435 GLU A H    5  
ATOM   5940  H  HA   . GLU A 1 14 ? 8.517   -5.537  -6.306  1.00 0.00 ? 435 GLU A HA   5  
ATOM   5941  H  HB2  . GLU A 1 14 ? 9.501   -4.994  -8.682  1.00 0.00 ? 435 GLU A HB2  5  
ATOM   5942  H  HB3  . GLU A 1 14 ? 7.857   -4.474  -9.023  1.00 0.00 ? 435 GLU A HB3  5  
ATOM   5943  H  HG2  . GLU A 1 14 ? 9.074   -2.559  -8.362  1.00 0.00 ? 435 GLU A HG2  5  
ATOM   5944  H  HG3  . GLU A 1 14 ? 8.004   -2.980  -7.025  1.00 0.00 ? 435 GLU A HG3  5  
ATOM   5945  N  N    . LEU A 1 15 ? 6.134   -4.520  -6.340  1.00 0.00 ? 436 LEU A N    5  
ATOM   5946  C  CA   . LEU A 1 15 ? 4.717   -4.260  -6.107  1.00 0.00 ? 436 LEU A CA   5  
ATOM   5947  C  C    . LEU A 1 15 ? 3.998   -3.951  -7.417  1.00 0.00 ? 436 LEU A C    5  
ATOM   5948  O  O    . LEU A 1 15 ? 4.246   -2.922  -8.046  1.00 0.00 ? 436 LEU A O    5  
ATOM   5949  C  CB   . LEU A 1 15 ? 4.546   -3.095  -5.131  1.00 0.00 ? 436 LEU A CB   5  
ATOM   5950  C  CG   . LEU A 1 15 ? 3.114   -2.799  -4.684  1.00 0.00 ? 436 LEU A CG   5  
ATOM   5951  C  CD1  . LEU A 1 15 ? 2.540   -3.980  -3.917  1.00 0.00 ? 436 LEU A CD1  5  
ATOM   5952  C  CD2  . LEU A 1 15 ? 3.071   -1.537  -3.835  1.00 0.00 ? 436 LEU A CD2  5  
ATOM   5953  H  H    . LEU A 1 15 ? 6.801   -3.941  -5.917  1.00 0.00 ? 436 LEU A H    5  
ATOM   5954  H  HA   . LEU A 1 15 ? 4.284   -5.149  -5.674  1.00 0.00 ? 436 LEU A HA   5  
ATOM   5955  H  HB2  . LEU A 1 15 ? 5.129   -3.314  -4.250  1.00 0.00 ? 436 LEU A HB2  5  
ATOM   5956  H  HB3  . LEU A 1 15 ? 4.936   -2.206  -5.607  1.00 0.00 ? 436 LEU A HB3  5  
ATOM   5957  H  HG   . LEU A 1 15 ? 2.497   -2.637  -5.557  1.00 0.00 ? 436 LEU A HG   5  
ATOM   5958  H  HD11 . LEU A 1 15 ? 1.930   -3.618  -3.103  1.00 0.00 ? 436 LEU A HD11 5  
ATOM   5959  H  HD12 . LEU A 1 15 ? 3.347   -4.580  -3.523  1.00 0.00 ? 436 LEU A HD12 5  
ATOM   5960  H  HD13 . LEU A 1 15 ? 1.936   -4.581  -4.581  1.00 0.00 ? 436 LEU A HD13 5  
ATOM   5961  H  HD21 . LEU A 1 15 ? 4.078   -1.206  -3.631  1.00 0.00 ? 436 LEU A HD21 5  
ATOM   5962  H  HD22 . LEU A 1 15 ? 2.566   -1.748  -2.903  1.00 0.00 ? 436 LEU A HD22 5  
ATOM   5963  H  HD23 . LEU A 1 15 ? 2.538   -0.764  -4.367  1.00 0.00 ? 436 LEU A HD23 5  
ATOM   5964  N  N    . CYS A 1 16 ? 3.105   -4.848  -7.821  1.00 0.00 ? 437 CYS A N    5  
ATOM   5965  C  CA   . CYS A 1 16 ? 2.347   -4.672  -9.054  1.00 0.00 ? 437 CYS A CA   5  
ATOM   5966  C  C    . CYS A 1 16 ? 1.649   -3.315  -9.074  1.00 0.00 ? 437 CYS A C    5  
ATOM   5967  O  O    . CYS A 1 16 ? 0.768   -3.045  -8.257  1.00 0.00 ? 437 CYS A O    5  
ATOM   5968  C  CB   . CYS A 1 16 ? 1.315   -5.791  -9.207  1.00 0.00 ? 437 CYS A CB   5  
ATOM   5969  S  SG   . CYS A 1 16 ? 0.731   -6.034  -10.916 1.00 0.00 ? 437 CYS A SG   5  
ATOM   5970  H  H    . CYS A 1 16 ? 2.951   -5.649  -7.276  1.00 0.00 ? 437 CYS A H    5  
ATOM   5971  H  HA   . CYS A 1 16 ? 3.041   -4.718  -9.879  1.00 0.00 ? 437 CYS A HA   5  
ATOM   5972  H  HB2  . CYS A 1 16 ? 1.753   -6.722  -8.876  1.00 0.00 ? 437 CYS A HB2  5  
ATOM   5973  H  HB3  . CYS A 1 16 ? 0.456   -5.565  -8.594  1.00 0.00 ? 437 CYS A HB3  5  
ATOM   5974  N  N    . LYS A 1 17 ? 2.049   -2.464  -10.012 1.00 0.00 ? 438 LYS A N    5  
ATOM   5975  C  CA   . LYS A 1 17 ? 1.462   -1.136  -10.142 1.00 0.00 ? 438 LYS A CA   5  
ATOM   5976  C  C    . LYS A 1 17 ? -0.051  -1.224  -10.313 1.00 0.00 ? 438 LYS A C    5  
ATOM   5977  O  O    . LYS A 1 17 ? -0.756  -0.219  -10.216 1.00 0.00 ? 438 LYS A O    5  
ATOM   5978  C  CB   . LYS A 1 17 ? 2.079   -0.397  -11.332 1.00 0.00 ? 438 LYS A CB   5  
ATOM   5979  C  CG   . LYS A 1 17 ? 3.455   0.177   -11.044 1.00 0.00 ? 438 LYS A CG   5  
ATOM   5980  C  CD   . LYS A 1 17 ? 4.106   0.722   -12.304 1.00 0.00 ? 438 LYS A CD   5  
ATOM   5981  C  CE   . LYS A 1 17 ? 5.129   1.801   -11.981 1.00 0.00 ? 438 LYS A CE   5  
ATOM   5982  N  NZ   . LYS A 1 17 ? 4.491   3.134   -11.798 1.00 0.00 ? 438 LYS A NZ   5  
ATOM   5983  H  H    . LYS A 1 17 ? 2.756   -2.737  -10.635 1.00 0.00 ? 438 LYS A H    5  
ATOM   5984  H  HA   . LYS A 1 17 ? 1.679   -0.588  -9.237  1.00 0.00 ? 438 LYS A HA   5  
ATOM   5985  H  HB2  . LYS A 1 17 ? 2.164   -1.083  -12.161 1.00 0.00 ? 438 LYS A HB2  5  
ATOM   5986  H  HB3  . LYS A 1 17 ? 1.424   0.416   -11.614 1.00 0.00 ? 438 LYS A HB3  5  
ATOM   5987  H  HG2  . LYS A 1 17 ? 3.359   0.978   -10.327 1.00 0.00 ? 438 LYS A HG2  5  
ATOM   5988  H  HG3  . LYS A 1 17 ? 4.082   -0.602  -10.635 1.00 0.00 ? 438 LYS A HG3  5  
ATOM   5989  H  HD2  . LYS A 1 17 ? 4.603   -0.085  -12.821 1.00 0.00 ? 438 LYS A HD2  5  
ATOM   5990  H  HD3  . LYS A 1 17 ? 3.341   1.143   -12.941 1.00 0.00 ? 438 LYS A HD3  5  
ATOM   5991  H  HE2  . LYS A 1 17 ? 5.644   1.530   -11.073 1.00 0.00 ? 438 LYS A HE2  5  
ATOM   5992  H  HE3  . LYS A 1 17 ? 5.839   1.860   -12.793 1.00 0.00 ? 438 LYS A HE3  5  
ATOM   5993  H  HZ1  . LYS A 1 17 ? 5.217   3.878   -11.785 1.00 0.00 ? 438 LYS A HZ1  5  
ATOM   5994  H  HZ2  . LYS A 1 17 ? 3.969   3.159   -10.899 1.00 0.00 ? 438 LYS A HZ2  5  
ATOM   5995  H  HZ3  . LYS A 1 17 ? 3.829   3.323   -12.577 1.00 0.00 ? 438 LYS A HZ3  5  
ATOM   5996  N  N    . PHE A 1 18 ? -0.544  -2.431  -10.567 1.00 0.00 ? 439 PHE A N    5  
ATOM   5997  C  CA   . PHE A 1 18 ? -1.974  -2.650  -10.751 1.00 0.00 ? 439 PHE A CA   5  
ATOM   5998  C  C    . PHE A 1 18 ? -2.603  -3.228  -9.487  1.00 0.00 ? 439 PHE A C    5  
ATOM   5999  O  O    . PHE A 1 18 ? -3.635  -2.746  -9.018  1.00 0.00 ? 439 PHE A O    5  
ATOM   6000  C  CB   . PHE A 1 18 ? -2.220  -3.591  -11.932 1.00 0.00 ? 439 PHE A CB   5  
ATOM   6001  C  CG   . PHE A 1 18 ? -2.018  -2.939  -13.270 1.00 0.00 ? 439 PHE A CG   5  
ATOM   6002  C  CD1  . PHE A 1 18 ? -0.793  -2.386  -13.608 1.00 0.00 ? 439 PHE A CD1  5  
ATOM   6003  C  CD2  . PHE A 1 18 ? -3.052  -2.881  -14.190 1.00 0.00 ? 439 PHE A CD2  5  
ATOM   6004  C  CE1  . PHE A 1 18 ? -0.605  -1.785  -14.838 1.00 0.00 ? 439 PHE A CE1  5  
ATOM   6005  C  CE2  . PHE A 1 18 ? -2.870  -2.281  -15.422 1.00 0.00 ? 439 PHE A CE2  5  
ATOM   6006  C  CZ   . PHE A 1 18 ? -1.644  -1.733  -15.747 1.00 0.00 ? 439 PHE A CZ   5  
ATOM   6007  H  H    . PHE A 1 18 ? 0.069   -3.194  -10.632 1.00 0.00 ? 439 PHE A H    5  
ATOM   6008  H  HA   . PHE A 1 18 ? -2.430  -1.695  -10.962 1.00 0.00 ? 439 PHE A HA   5  
ATOM   6009  H  HB2  . PHE A 1 18 ? -1.539  -4.427  -11.865 1.00 0.00 ? 439 PHE A HB2  5  
ATOM   6010  H  HB3  . PHE A 1 18 ? -3.235  -3.955  -11.888 1.00 0.00 ? 439 PHE A HB3  5  
ATOM   6011  H  HD1  . PHE A 1 18 ? 0.021   -2.426  -12.899 1.00 0.00 ? 439 PHE A HD1  5  
ATOM   6012  H  HD2  . PHE A 1 18 ? -4.012  -3.309  -13.937 1.00 0.00 ? 439 PHE A HD2  5  
ATOM   6013  H  HE1  . PHE A 1 18 ? 0.354   -1.357  -15.090 1.00 0.00 ? 439 PHE A HE1  5  
ATOM   6014  H  HE2  . PHE A 1 18 ? -3.684  -2.243  -16.130 1.00 0.00 ? 439 PHE A HE2  5  
ATOM   6015  H  HZ   . PHE A 1 18 ? -1.500  -1.264  -16.708 1.00 0.00 ? 439 PHE A HZ   5  
ATOM   6016  N  N    . TYR A 1 19 ? -1.975  -4.263  -8.940  1.00 0.00 ? 440 TYR A N    5  
ATOM   6017  C  CA   . TYR A 1 19 ? -2.473  -4.909  -7.732  1.00 0.00 ? 440 TYR A CA   5  
ATOM   6018  C  C    . TYR A 1 19 ? -2.874  -3.873  -6.686  1.00 0.00 ? 440 TYR A C    5  
ATOM   6019  O  O    . TYR A 1 19 ? -3.893  -4.020  -6.010  1.00 0.00 ? 440 TYR A O    5  
ATOM   6020  C  CB   . TYR A 1 19 ? -1.413  -5.848  -7.156  1.00 0.00 ? 440 TYR A CB   5  
ATOM   6021  C  CG   . TYR A 1 19 ? -1.873  -6.601  -5.928  1.00 0.00 ? 440 TYR A CG   5  
ATOM   6022  C  CD1  . TYR A 1 19 ? -3.085  -7.280  -5.920  1.00 0.00 ? 440 TYR A CD1  5  
ATOM   6023  C  CD2  . TYR A 1 19 ? -1.097  -6.632  -4.776  1.00 0.00 ? 440 TYR A CD2  5  
ATOM   6024  C  CE1  . TYR A 1 19 ? -3.511  -7.969  -4.800  1.00 0.00 ? 440 TYR A CE1  5  
ATOM   6025  C  CE2  . TYR A 1 19 ? -1.513  -7.319  -3.653  1.00 0.00 ? 440 TYR A CE2  5  
ATOM   6026  C  CZ   . TYR A 1 19 ? -2.721  -7.986  -3.669  1.00 0.00 ? 440 TYR A CZ   5  
ATOM   6027  O  OH   . TYR A 1 19 ? -3.140  -8.670  -2.551  1.00 0.00 ? 440 TYR A OH   5  
ATOM   6028  H  H    . TYR A 1 19 ? -1.157  -4.601  -9.360  1.00 0.00 ? 440 TYR A H    5  
ATOM   6029  H  HA   . TYR A 1 19 ? -3.345  -5.488  -8.001  1.00 0.00 ? 440 TYR A HA   5  
ATOM   6030  H  HB2  . TYR A 1 19 ? -1.139  -6.574  -7.906  1.00 0.00 ? 440 TYR A HB2  5  
ATOM   6031  H  HB3  . TYR A 1 19 ? -0.541  -5.272  -6.884  1.00 0.00 ? 440 TYR A HB3  5  
ATOM   6032  H  HD1  . TYR A 1 19 ? -3.702  -7.265  -6.807  1.00 0.00 ? 440 TYR A HD1  5  
ATOM   6033  H  HD2  . TYR A 1 19 ? -0.152  -6.109  -4.766  1.00 0.00 ? 440 TYR A HD2  5  
ATOM   6034  H  HE1  . TYR A 1 19 ? -4.456  -8.491  -4.813  1.00 0.00 ? 440 TYR A HE1  5  
ATOM   6035  H  HE2  . TYR A 1 19 ? -0.896  -7.332  -2.767  1.00 0.00 ? 440 TYR A HE2  5  
ATOM   6036  H  HH   . TYR A 1 19 ? -2.720  -8.298  -1.772  1.00 0.00 ? 440 TYR A HH   5  
ATOM   6037  N  N    . ILE A 1 20 ? -2.065  -2.826  -6.560  1.00 0.00 ? 441 ILE A N    5  
ATOM   6038  C  CA   . ILE A 1 20 ? -2.335  -1.765  -5.598  1.00 0.00 ? 441 ILE A CA   5  
ATOM   6039  C  C    . ILE A 1 20 ? -3.824  -1.436  -5.546  1.00 0.00 ? 441 ILE A C    5  
ATOM   6040  O  O    . ILE A 1 20 ? -4.351  -1.056  -4.500  1.00 0.00 ? 441 ILE A O    5  
ATOM   6041  C  CB   . ILE A 1 20 ? -1.550  -0.484  -5.938  1.00 0.00 ? 441 ILE A CB   5  
ATOM   6042  C  CG1  . ILE A 1 20 ? -0.047  -0.771  -5.953  1.00 0.00 ? 441 ILE A CG1  5  
ATOM   6043  C  CG2  . ILE A 1 20 ? -1.875  0.617   -4.940  1.00 0.00 ? 441 ILE A CG2  5  
ATOM   6044  C  CD1  . ILE A 1 20 ? 0.759   0.269   -6.700  1.00 0.00 ? 441 ILE A CD1  5  
ATOM   6045  H  H    . ILE A 1 20 ? -1.269  -2.766  -7.127  1.00 0.00 ? 441 ILE A H    5  
ATOM   6046  H  HA   . ILE A 1 20 ? -2.019  -2.109  -4.624  1.00 0.00 ? 441 ILE A HA   5  
ATOM   6047  H  HB   . ILE A 1 20 ? -1.855  -0.150  -6.918  1.00 0.00 ? 441 ILE A HB   5  
ATOM   6048  H  HG12 . ILE A 1 20 ? 0.317   -0.805  -4.938  1.00 0.00 ? 441 ILE A HG12 5  
ATOM   6049  H  HG13 . ILE A 1 20 ? 0.125   -1.727  -6.425  1.00 0.00 ? 441 ILE A HG13 5  
ATOM   6050  H  HG21 . ILE A 1 20 ? -1.065  1.332   -4.916  1.00 0.00 ? 441 ILE A HG21 5  
ATOM   6051  H  HG22 . ILE A 1 20 ? -2.785  1.115   -5.237  1.00 0.00 ? 441 ILE A HG22 5  
ATOM   6052  H  HG23 . ILE A 1 20 ? -2.004  0.187   -3.958  1.00 0.00 ? 441 ILE A HG23 5  
ATOM   6053  H  HD11 . ILE A 1 20 ? 0.363   0.382   -7.699  1.00 0.00 ? 441 ILE A HD11 5  
ATOM   6054  H  HD12 . ILE A 1 20 ? 0.701   1.213   -6.180  1.00 0.00 ? 441 ILE A HD12 5  
ATOM   6055  H  HD13 . ILE A 1 20 ? 1.790   -0.048  -6.757  1.00 0.00 ? 441 ILE A HD13 5  
ATOM   6056  N  N    . THR A 1 21 ? -4.498  -1.586  -6.682  1.00 0.00 ? 442 THR A N    5  
ATOM   6057  C  CA   . THR A 1 21 ? -5.925  -1.306  -6.766  1.00 0.00 ? 442 THR A CA   5  
ATOM   6058  C  C    . THR A 1 21 ? -6.740  -2.594  -6.748  1.00 0.00 ? 442 THR A C    5  
ATOM   6059  O  O    . THR A 1 21 ? -7.824  -2.646  -6.167  1.00 0.00 ? 442 THR A O    5  
ATOM   6060  C  CB   . THR A 1 21 ? -6.268  -0.513  -8.041  1.00 0.00 ? 442 THR A CB   5  
ATOM   6061  O  OG1  . THR A 1 21 ? -5.910  -1.272  -9.201  1.00 0.00 ? 442 THR A OG1  5  
ATOM   6062  C  CG2  . THR A 1 21 ? -5.541  0.823   -8.059  1.00 0.00 ? 442 THR A CG2  5  
ATOM   6063  H  H    . THR A 1 21 ? -4.022  -1.892  -7.482  1.00 0.00 ? 442 THR A H    5  
ATOM   6064  H  HA   . THR A 1 21 ? -6.199  -0.706  -5.910  1.00 0.00 ? 442 THR A HA   5  
ATOM   6065  H  HB   . THR A 1 21 ? -7.333  -0.327  -8.056  1.00 0.00 ? 442 THR A HB   5  
ATOM   6066  H  HG1  . THR A 1 21 ? -6.274  -0.852  -9.984  1.00 0.00 ? 442 THR A HG1  5  
ATOM   6067  H  HG21 . THR A 1 21 ? -4.713  0.792   -7.367  1.00 0.00 ? 442 THR A HG21 5  
ATOM   6068  H  HG22 . THR A 1 21 ? -6.224  1.608   -7.770  1.00 0.00 ? 442 THR A HG22 5  
ATOM   6069  H  HG23 . THR A 1 21 ? -5.171  1.017   -9.055  1.00 0.00 ? 442 THR A HG23 5  
ATOM   6070  N  N    . GLY A 1 22 ? -6.211  -3.633  -7.387  1.00 0.00 ? 443 GLY A N    5  
ATOM   6071  C  CA   . GLY A 1 22 ? -6.903  -4.908  -7.431  1.00 0.00 ? 443 GLY A CA   5  
ATOM   6072  C  C    . GLY A 1 22 ? -7.228  -5.343  -8.847  1.00 0.00 ? 443 GLY A C    5  
ATOM   6073  O  O    . GLY A 1 22 ? -7.657  -6.474  -9.073  1.00 0.00 ? 443 GLY A O    5  
ATOM   6074  H  H    . GLY A 1 22 ? -5.344  -3.533  -7.832  1.00 0.00 ? 443 GLY A H    5  
ATOM   6075  H  HA2  . GLY A 1 22 ? -6.281  -5.659  -6.968  1.00 0.00 ? 443 GLY A HA2  5  
ATOM   6076  H  HA3  . GLY A 1 22 ? -7.825  -4.824  -6.873  1.00 0.00 ? 443 GLY A HA3  5  
ATOM   6077  N  N    . PHE A 1 23 ? -7.024  -4.442  -9.802  1.00 0.00 ? 444 PHE A N    5  
ATOM   6078  C  CA   . PHE A 1 23 ? -7.301  -4.737  -11.203 1.00 0.00 ? 444 PHE A CA   5  
ATOM   6079  C  C    . PHE A 1 23 ? -6.028  -5.160  -11.931 1.00 0.00 ? 444 PHE A C    5  
ATOM   6080  O  O    . PHE A 1 23 ? -5.322  -4.330  -12.505 1.00 0.00 ? 444 PHE A O    5  
ATOM   6081  C  CB   . PHE A 1 23 ? -7.914  -3.517  -11.892 1.00 0.00 ? 444 PHE A CB   5  
ATOM   6082  C  CG   . PHE A 1 23 ? -7.853  -3.582  -13.392 1.00 0.00 ? 444 PHE A CG   5  
ATOM   6083  C  CD1  . PHE A 1 23 ? -8.326  -4.693  -14.070 1.00 0.00 ? 444 PHE A CD1  5  
ATOM   6084  C  CD2  . PHE A 1 23 ? -7.323  -2.531  -14.123 1.00 0.00 ? 444 PHE A CD2  5  
ATOM   6085  C  CE1  . PHE A 1 23 ? -8.272  -4.756  -15.450 1.00 0.00 ? 444 PHE A CE1  5  
ATOM   6086  C  CE2  . PHE A 1 23 ? -7.267  -2.587  -15.502 1.00 0.00 ? 444 PHE A CE2  5  
ATOM   6087  C  CZ   . PHE A 1 23 ? -7.741  -3.702  -16.167 1.00 0.00 ? 444 PHE A CZ   5  
ATOM   6088  H  H    . PHE A 1 23 ? -6.681  -3.556  -9.559  1.00 0.00 ? 444 PHE A H    5  
ATOM   6089  H  HA   . PHE A 1 23 ? -8.008  -5.552  -11.236 1.00 0.00 ? 444 PHE A HA   5  
ATOM   6090  H  HB2  . PHE A 1 23 ? -8.952  -3.434  -11.606 1.00 0.00 ? 444 PHE A HB2  5  
ATOM   6091  H  HB3  . PHE A 1 23 ? -7.386  -2.630  -11.575 1.00 0.00 ? 444 PHE A HB3  5  
ATOM   6092  H  HD1  . PHE A 1 23 ? -8.742  -5.519  -13.509 1.00 0.00 ? 444 PHE A HD1  5  
ATOM   6093  H  HD2  . PHE A 1 23 ? -6.951  -1.659  -13.605 1.00 0.00 ? 444 PHE A HD2  5  
ATOM   6094  H  HE1  . PHE A 1 23 ? -8.643  -5.629  -15.966 1.00 0.00 ? 444 PHE A HE1  5  
ATOM   6095  H  HE2  . PHE A 1 23 ? -6.851  -1.762  -16.061 1.00 0.00 ? 444 PHE A HE2  5  
ATOM   6096  H  HZ   . PHE A 1 23 ? -7.698  -3.749  -17.245 1.00 0.00 ? 444 PHE A HZ   5  
ATOM   6097  N  N    . CYS A 1 24 ? -5.740  -6.457  -11.902 1.00 0.00 ? 445 CYS A N    5  
ATOM   6098  C  CA   . CYS A 1 24 ? -4.553  -6.992  -12.557 1.00 0.00 ? 445 CYS A CA   5  
ATOM   6099  C  C    . CYS A 1 24 ? -4.922  -8.125  -13.510 1.00 0.00 ? 445 CYS A C    5  
ATOM   6100  O  O    . CYS A 1 24 ? -5.320  -9.207  -13.081 1.00 0.00 ? 445 CYS A O    5  
ATOM   6101  C  CB   . CYS A 1 24 ? -3.552  -7.494  -11.514 1.00 0.00 ? 445 CYS A CB   5  
ATOM   6102  S  SG   . CYS A 1 24 ? -2.177  -8.465  -12.210 1.00 0.00 ? 445 CYS A SG   5  
ATOM   6103  H  H    . CYS A 1 24 ? -6.341  -7.070  -11.427 1.00 0.00 ? 445 CYS A H    5  
ATOM   6104  H  HA   . CYS A 1 24 ? -4.099  -6.194  -13.124 1.00 0.00 ? 445 CYS A HA   5  
ATOM   6105  H  HB2  . CYS A 1 24 ? -3.126  -6.646  -10.998 1.00 0.00 ? 445 CYS A HB2  5  
ATOM   6106  H  HB3  . CYS A 1 24 ? -4.069  -8.120  -10.802 1.00 0.00 ? 445 CYS A HB3  5  
ATOM   6107  N  N    . ALA A 1 25 ? -4.786  -7.867  -14.807 1.00 0.00 ? 446 ALA A N    5  
ATOM   6108  C  CA   . ALA A 1 25 ? -5.103  -8.865  -15.822 1.00 0.00 ? 446 ALA A CA   5  
ATOM   6109  C  C    . ALA A 1 25 ? -4.642  -10.253 -15.389 1.00 0.00 ? 446 ALA A C    5  
ATOM   6110  O  O    . ALA A 1 25 ? -5.458  -11.111 -15.054 1.00 0.00 ? 446 ALA A O    5  
ATOM   6111  C  CB   . ALA A 1 25 ? -4.467  -8.486  -17.151 1.00 0.00 ? 446 ALA A CB   5  
ATOM   6112  H  H    . ALA A 1 25 ? -4.465  -6.985  -15.088 1.00 0.00 ? 446 ALA A H    5  
ATOM   6113  H  HA   . ALA A 1 25 ? -6.175  -8.877  -15.954 1.00 0.00 ? 446 ALA A HA   5  
ATOM   6114  H  HB1  . ALA A 1 25 ? -4.628  -9.280  -17.865 1.00 0.00 ? 446 ALA A HB1  5  
ATOM   6115  H  HB2  . ALA A 1 25 ? -4.916  -7.575  -17.518 1.00 0.00 ? 446 ALA A HB2  5  
ATOM   6116  H  HB3  . ALA A 1 25 ? -3.407  -8.335  -17.013 1.00 0.00 ? 446 ALA A HB3  5  
ATOM   6117  N  N    . ARG A 1 26 ? -3.330  -10.466 -15.400 1.00 0.00 ? 447 ARG A N    5  
ATOM   6118  C  CA   . ARG A 1 26 ? -2.762  -11.750 -15.010 1.00 0.00 ? 447 ARG A CA   5  
ATOM   6119  C  C    . ARG A 1 26 ? -2.838  -11.943 -13.499 1.00 0.00 ? 447 ARG A C    5  
ATOM   6120  O  O    . ARG A 1 26 ? -2.042  -11.377 -12.750 1.00 0.00 ? 447 ARG A O    5  
ATOM   6121  C  CB   . ARG A 1 26 ? -1.308  -11.850 -15.475 1.00 0.00 ? 447 ARG A CB   5  
ATOM   6122  C  CG   . ARG A 1 26 ? -1.150  -11.853 -16.987 1.00 0.00 ? 447 ARG A CG   5  
ATOM   6123  C  CD   . ARG A 1 26 ? 0.174   -12.470 -17.408 1.00 0.00 ? 447 ARG A CD   5  
ATOM   6124  N  NE   . ARG A 1 26 ? 0.417   -12.320 -18.840 1.00 0.00 ? 447 ARG A NE   5  
ATOM   6125  C  CZ   . ARG A 1 26 ? 1.225   -13.112 -19.536 1.00 0.00 ? 447 ARG A CZ   5  
ATOM   6126  N  NH1  . ARG A 1 26 ? 1.865   -14.105 -18.934 1.00 0.00 ? 447 ARG A NH1  5  
ATOM   6127  N  NH2  . ARG A 1 26 ? 1.394   -12.912 -20.837 1.00 0.00 ? 447 ARG A NH2  5  
ATOM   6128  H  H    . ARG A 1 26 ? -2.730  -9.742  -15.677 1.00 0.00 ? 447 ARG A H    5  
ATOM   6129  H  HA   . ARG A 1 26 ? -3.338  -12.527 -15.490 1.00 0.00 ? 447 ARG A HA   5  
ATOM   6130  H  HB2  . ARG A 1 26 ? -0.757  -11.010 -15.079 1.00 0.00 ? 447 ARG A HB2  5  
ATOM   6131  H  HB3  . ARG A 1 26 ? -0.881  -12.764 -15.089 1.00 0.00 ? 447 ARG A HB3  5  
ATOM   6132  H  HG2  . ARG A 1 26 ? -1.956  -12.425 -17.423 1.00 0.00 ? 447 ARG A HG2  5  
ATOM   6133  H  HG3  . ARG A 1 26 ? -1.194  -10.835 -17.345 1.00 0.00 ? 447 ARG A HG3  5  
ATOM   6134  H  HD2  . ARG A 1 26 ? 0.971   -11.984 -16.865 1.00 0.00 ? 447 ARG A HD2  5  
ATOM   6135  H  HD3  . ARG A 1 26 ? 0.160   -13.521 -17.163 1.00 0.00 ? 447 ARG A HD3  5  
ATOM   6136  H  HE   . ARG A 1 26 ? -0.046  -11.592 -19.305 1.00 0.00 ? 447 ARG A HE   5  
ATOM   6137  H  HH11 . ARG A 1 26 ? 1.738   -14.259 -17.954 1.00 0.00 ? 447 ARG A HH11 5  
ATOM   6138  H  HH12 . ARG A 1 26 ? 2.472   -14.701 -19.460 1.00 0.00 ? 447 ARG A HH12 5  
ATOM   6139  H  HH21 . ARG A 1 26 ? 0.914   -12.165 -21.294 1.00 0.00 ? 447 ARG A HH21 5  
ATOM   6140  H  HH22 . ARG A 1 26 ? 2.003   -13.509 -21.359 1.00 0.00 ? 447 ARG A HH22 5  
ATOM   6141  N  N    . ALA A 1 27 ? -3.802  -12.745 -13.058 1.00 0.00 ? 448 ALA A N    5  
ATOM   6142  C  CA   . ALA A 1 27 ? -3.981  -13.013 -11.636 1.00 0.00 ? 448 ALA A CA   5  
ATOM   6143  C  C    . ALA A 1 27 ? -3.008  -14.082 -11.152 1.00 0.00 ? 448 ALA A C    5  
ATOM   6144  O  O    . ALA A 1 27 ? -2.054  -13.785 -10.433 1.00 0.00 ? 448 ALA A O    5  
ATOM   6145  C  CB   . ALA A 1 27 ? -5.416  -13.437 -11.356 1.00 0.00 ? 448 ALA A CB   5  
ATOM   6146  H  H    . ALA A 1 27 ? -4.406  -13.167 -13.704 1.00 0.00 ? 448 ALA A H    5  
ATOM   6147  H  HA   . ALA A 1 27 ? -3.792  -12.096 -11.097 1.00 0.00 ? 448 ALA A HA   5  
ATOM   6148  H  HB1  . ALA A 1 27 ? -5.463  -14.514 -11.282 1.00 0.00 ? 448 ALA A HB1  5  
ATOM   6149  H  HB2  . ALA A 1 27 ? -5.746  -12.997 -10.428 1.00 0.00 ? 448 ALA A HB2  5  
ATOM   6150  H  HB3  . ALA A 1 27 ? -6.053  -13.103 -12.161 1.00 0.00 ? 448 ALA A HB3  5  
ATOM   6151  N  N    . GLU A 1 28 ? -3.255  -15.326 -11.550 1.00 0.00 ? 449 GLU A N    5  
ATOM   6152  C  CA   . GLU A 1 28 ? -2.400  -16.438 -11.154 1.00 0.00 ? 449 GLU A CA   5  
ATOM   6153  C  C    . GLU A 1 28 ? -1.101  -16.439 -11.957 1.00 0.00 ? 449 GLU A C    5  
ATOM   6154  O  O    . GLU A 1 28 ? -0.189  -17.216 -11.680 1.00 0.00 ? 449 GLU A O    5  
ATOM   6155  C  CB   . GLU A 1 28 ? -3.132  -17.768 -11.348 1.00 0.00 ? 449 GLU A CB   5  
ATOM   6156  C  CG   . GLU A 1 28 ? -3.226  -18.205 -12.800 1.00 0.00 ? 449 GLU A CG   5  
ATOM   6157  C  CD   . GLU A 1 28 ? -3.969  -19.517 -12.967 1.00 0.00 ? 449 GLU A CD   5  
ATOM   6158  O  OE1  . GLU A 1 28 ? -3.334  -20.581 -12.811 1.00 0.00 ? 449 GLU A OE1  5  
ATOM   6159  O  OE2  . GLU A 1 28 ? -5.183  -19.479 -13.255 1.00 0.00 ? 449 GLU A OE2  5  
ATOM   6160  H  H    . GLU A 1 28 ? -4.031  -15.499 -12.123 1.00 0.00 ? 449 GLU A H    5  
ATOM   6161  H  HA   . GLU A 1 28 ? -2.162  -16.318 -10.108 1.00 0.00 ? 449 GLU A HA   5  
ATOM   6162  H  HB2  . GLU A 1 28 ? -2.611  -18.536 -10.795 1.00 0.00 ? 449 GLU A HB2  5  
ATOM   6163  H  HB3  . GLU A 1 28 ? -4.134  -17.673 -10.957 1.00 0.00 ? 449 GLU A HB3  5  
ATOM   6164  H  HG2  . GLU A 1 28 ? -3.746  -17.441 -13.359 1.00 0.00 ? 449 GLU A HG2  5  
ATOM   6165  H  HG3  . GLU A 1 28 ? -2.227  -18.321 -13.194 1.00 0.00 ? 449 GLU A HG3  5  
ATOM   6166  N  N    . ASN A 1 29 ? -1.028  -15.561 -12.952 1.00 0.00 ? 450 ASN A N    5  
ATOM   6167  C  CA   . ASN A 1 29 ? 0.157   -15.460 -13.796 1.00 0.00 ? 450 ASN A CA   5  
ATOM   6168  C  C    . ASN A 1 29 ? 0.783   -14.073 -13.691 1.00 0.00 ? 450 ASN A C    5  
ATOM   6169  O  O    . ASN A 1 29 ? 1.392   -13.581 -14.642 1.00 0.00 ? 450 ASN A O    5  
ATOM   6170  C  CB   . ASN A 1 29 ? -0.201  -15.762 -15.252 1.00 0.00 ? 450 ASN A CB   5  
ATOM   6171  C  CG   . ASN A 1 29 ? -1.630  -15.379 -15.588 1.00 0.00 ? 450 ASN A CG   5  
ATOM   6172  O  OD1  . ASN A 1 29 ? -2.230  -14.534 -14.922 1.00 0.00 ? 450 ASN A OD1  5  
ATOM   6173  N  ND2  . ASN A 1 29 ? -2.181  -16.000 -16.624 1.00 0.00 ? 450 ASN A ND2  5  
ATOM   6174  H  H    . ASN A 1 29 ? -1.788  -14.967 -13.124 1.00 0.00 ? 450 ASN A H    5  
ATOM   6175  H  HA   . ASN A 1 29 ? 0.873   -16.192 -13.452 1.00 0.00 ? 450 ASN A HA   5  
ATOM   6176  H  HB2  . ASN A 1 29 ? 0.461   -15.208 -15.902 1.00 0.00 ? 450 ASN A HB2  5  
ATOM   6177  H  HB3  . ASN A 1 29 ? -0.078  -16.818 -15.436 1.00 0.00 ? 450 ASN A HB3  5  
ATOM   6178  H  HD21 . ASN A 1 29 ? -1.643  -16.661 -17.107 1.00 0.00 ? 450 ASN A HD21 5  
ATOM   6179  H  HD22 . ASN A 1 29 ? -3.103  -15.771 -16.863 1.00 0.00 ? 450 ASN A HD22 5  
ATOM   6180  N  N    . CYS A 1 30 ? 0.631   -13.447 -12.529 1.00 0.00 ? 451 CYS A N    5  
ATOM   6181  C  CA   . CYS A 1 30 ? 1.180   -12.117 -12.298 1.00 0.00 ? 451 CYS A CA   5  
ATOM   6182  C  C    . CYS A 1 30 ? 2.695   -12.177 -12.124 1.00 0.00 ? 451 CYS A C    5  
ATOM   6183  O  O    . CYS A 1 30 ? 3.212   -12.732 -11.154 1.00 0.00 ? 451 CYS A O    5  
ATOM   6184  C  CB   . CYS A 1 30 ? 0.538   -11.484 -11.062 1.00 0.00 ? 451 CYS A CB   5  
ATOM   6185  S  SG   . CYS A 1 30 ? 1.224   -9.856  -10.618 1.00 0.00 ? 451 CYS A SG   5  
ATOM   6186  H  H    . CYS A 1 30 ? 0.135   -13.891 -11.808 1.00 0.00 ? 451 CYS A H    5  
ATOM   6187  H  HA   . CYS A 1 30 ? 0.953   -11.509 -13.161 1.00 0.00 ? 451 CYS A HA   5  
ATOM   6188  H  HB2  . CYS A 1 30 ? -0.520  -11.356 -11.240 1.00 0.00 ? 451 CYS A HB2  5  
ATOM   6189  H  HB3  . CYS A 1 30 ? 0.678   -12.142 -10.217 1.00 0.00 ? 451 CYS A HB3  5  
ATOM   6190  N  N    . PRO A 1 31 ? 3.425   -11.591 -13.085 1.00 0.00 ? 452 PRO A N    5  
ATOM   6191  C  CA   . PRO A 1 31 ? 4.890   -11.563 -13.060 1.00 0.00 ? 452 PRO A CA   5  
ATOM   6192  C  C    . PRO A 1 31 ? 5.434   -10.659 -11.960 1.00 0.00 ? 452 PRO A C    5  
ATOM   6193  O  O    . PRO A 1 31 ? 6.639   -10.419 -11.879 1.00 0.00 ? 452 PRO A O    5  
ATOM   6194  C  CB   . PRO A 1 31 ? 5.258   -11.009 -14.439 1.00 0.00 ? 452 PRO A CB   5  
ATOM   6195  C  CG   . PRO A 1 31 ? 4.071   -10.210 -14.855 1.00 0.00 ? 452 PRO A CG   5  
ATOM   6196  C  CD   . PRO A 1 31 ? 2.875   -10.910 -14.269 1.00 0.00 ? 452 PRO A CD   5  
ATOM   6197  H  HA   . PRO A 1 31 ? 5.304   -12.555 -12.947 1.00 0.00 ? 452 PRO A HA   5  
ATOM   6198  H  HB2  . PRO A 1 31 ? 6.141   -10.391 -14.357 1.00 0.00 ? 452 PRO A HB2  5  
ATOM   6199  H  HB3  . PRO A 1 31 ? 5.443   -11.824 -15.121 1.00 0.00 ? 452 PRO A HB3  5  
ATOM   6200  H  HG2  . PRO A 1 31 ? 4.147   -9.207  -14.463 1.00 0.00 ? 452 PRO A HG2  5  
ATOM   6201  H  HG3  . PRO A 1 31 ? 4.002   -10.190 -15.932 1.00 0.00 ? 452 PRO A HG3  5  
ATOM   6202  H  HD2  . PRO A 1 31 ? 2.119   -10.193 -13.986 1.00 0.00 ? 452 PRO A HD2  5  
ATOM   6203  H  HD3  . PRO A 1 31 ? 2.475   -11.625 -14.973 1.00 0.00 ? 452 PRO A HD3  5  
ATOM   6204  N  N    . TYR A 1 32 ? 4.540   -10.161 -11.114 1.00 0.00 ? 453 TYR A N    5  
ATOM   6205  C  CA   . TYR A 1 32 ? 4.931   -9.281  -10.019 1.00 0.00 ? 453 TYR A CA   5  
ATOM   6206  C  C    . TYR A 1 32 ? 4.581   -9.902  -8.670  1.00 0.00 ? 453 TYR A C    5  
ATOM   6207  O  O    . TYR A 1 32 ? 4.120   -11.041 -8.599  1.00 0.00 ? 453 TYR A O    5  
ATOM   6208  C  CB   . TYR A 1 32 ? 4.245   -7.921  -10.160 1.00 0.00 ? 453 TYR A CB   5  
ATOM   6209  C  CG   . TYR A 1 32 ? 4.848   -7.048  -11.238 1.00 0.00 ? 453 TYR A CG   5  
ATOM   6210  C  CD1  . TYR A 1 32 ? 4.560   -7.269  -12.579 1.00 0.00 ? 453 TYR A CD1  5  
ATOM   6211  C  CD2  . TYR A 1 32 ? 5.705   -6.004  -10.916 1.00 0.00 ? 453 TYR A CD2  5  
ATOM   6212  C  CE1  . TYR A 1 32 ? 5.108   -6.475  -13.568 1.00 0.00 ? 453 TYR A CE1  5  
ATOM   6213  C  CE2  . TYR A 1 32 ? 6.257   -5.204  -11.897 1.00 0.00 ? 453 TYR A CE2  5  
ATOM   6214  C  CZ   . TYR A 1 32 ? 5.955   -5.444  -13.222 1.00 0.00 ? 453 TYR A CZ   5  
ATOM   6215  O  OH   . TYR A 1 32 ? 6.504   -4.650  -14.203 1.00 0.00 ? 453 TYR A OH   5  
ATOM   6216  H  H    . TYR A 1 32 ? 3.594   -10.388 -11.229 1.00 0.00 ? 453 TYR A H    5  
ATOM   6217  H  HA   . TYR A 1 32 ? 6.001   -9.141  -10.071 1.00 0.00 ? 453 TYR A HA   5  
ATOM   6218  H  HB2  . TYR A 1 32 ? 3.205   -8.073  -10.400 1.00 0.00 ? 453 TYR A HB2  5  
ATOM   6219  H  HB3  . TYR A 1 32 ? 4.320   -7.389  -9.222  1.00 0.00 ? 453 TYR A HB3  5  
ATOM   6220  H  HD1  . TYR A 1 32 ? 3.895   -8.078  -12.847 1.00 0.00 ? 453 TYR A HD1  5  
ATOM   6221  H  HD2  . TYR A 1 32 ? 5.940   -5.819  -9.877  1.00 0.00 ? 453 TYR A HD2  5  
ATOM   6222  H  HE1  . TYR A 1 32 ? 4.872   -6.663  -14.605 1.00 0.00 ? 453 TYR A HE1  5  
ATOM   6223  H  HE2  . TYR A 1 32 ? 6.921   -4.396  -11.627 1.00 0.00 ? 453 TYR A HE2  5  
ATOM   6224  H  HH   . TYR A 1 32 ? 5.804   -4.298  -14.758 1.00 0.00 ? 453 TYR A HH   5  
ATOM   6225  N  N    . MET A 1 33 ? 4.803   -9.144  -7.601  1.00 0.00 ? 454 MET A N    5  
ATOM   6226  C  CA   . MET A 1 33 ? 4.510   -9.618  -6.254  1.00 0.00 ? 454 MET A CA   5  
ATOM   6227  C  C    . MET A 1 33 ? 3.194   -9.036  -5.747  1.00 0.00 ? 454 MET A C    5  
ATOM   6228  O  O    . MET A 1 33 ? 2.934   -7.842  -5.895  1.00 0.00 ? 454 MET A O    5  
ATOM   6229  C  CB   . MET A 1 33 ? 5.647   -9.244  -5.300  1.00 0.00 ? 454 MET A CB   5  
ATOM   6230  C  CG   . MET A 1 33 ? 6.904   -10.076 -5.497  1.00 0.00 ? 454 MET A CG   5  
ATOM   6231  S  SD   . MET A 1 33 ? 6.813   -11.677 -4.675  1.00 0.00 ? 454 MET A SD   5  
ATOM   6232  C  CE   . MET A 1 33 ? 7.759   -11.349 -3.189  1.00 0.00 ? 454 MET A CE   5  
ATOM   6233  H  H    . MET A 1 33 ? 5.173   -8.244  -7.721  1.00 0.00 ? 454 MET A H    5  
ATOM   6234  H  HA   . MET A 1 33 ? 4.424   -10.693 -6.293  1.00 0.00 ? 454 MET A HA   5  
ATOM   6235  H  HB2  . MET A 1 33 ? 5.901   -8.206  -5.451  1.00 0.00 ? 454 MET A HB2  5  
ATOM   6236  H  HB3  . MET A 1 33 ? 5.308   -9.380  -4.284  1.00 0.00 ? 454 MET A HB3  5  
ATOM   6237  H  HG2  . MET A 1 33 ? 7.050   -10.238 -6.555  1.00 0.00 ? 454 MET A HG2  5  
ATOM   6238  H  HG3  . MET A 1 33 ? 7.746   -9.529  -5.100  1.00 0.00 ? 454 MET A HG3  5  
ATOM   6239  H  HE1  . MET A 1 33 ? 7.136   -10.836 -2.472  1.00 0.00 ? 454 MET A HE1  5  
ATOM   6240  H  HE2  . MET A 1 33 ? 8.100   -12.283 -2.767  1.00 0.00 ? 454 MET A HE2  5  
ATOM   6241  H  HE3  . MET A 1 33 ? 8.611   -10.731 -3.435  1.00 0.00 ? 454 MET A HE3  5  
ATOM   6242  N  N    . HIS A 1 34 ? 2.367   -9.888  -5.150  1.00 0.00 ? 455 HIS A N    5  
ATOM   6243  C  CA   . HIS A 1 34 ? 1.077   -9.458  -4.622  1.00 0.00 ? 455 HIS A CA   5  
ATOM   6244  C  C    . HIS A 1 34 ? 1.050   -9.567  -3.100  1.00 0.00 ? 455 HIS A C    5  
ATOM   6245  O  O    . HIS A 1 34 ? 1.160   -8.566  -2.394  1.00 0.00 ? 455 HIS A O    5  
ATOM   6246  C  CB   . HIS A 1 34 ? -0.050  -10.296 -5.225  1.00 0.00 ? 455 HIS A CB   5  
ATOM   6247  C  CG   . HIS A 1 34 ? -0.514  -9.804  -6.561  1.00 0.00 ? 455 HIS A CG   5  
ATOM   6248  N  ND1  . HIS A 1 34 ? -1.568  -10.368 -7.247  1.00 0.00 ? 455 HIS A ND1  5  
ATOM   6249  C  CD2  . HIS A 1 34 ? -0.061  -8.792  -7.338  1.00 0.00 ? 455 HIS A CD2  5  
ATOM   6250  C  CE1  . HIS A 1 34 ? -1.743  -9.726  -8.389  1.00 0.00 ? 455 HIS A CE1  5  
ATOM   6251  N  NE2  . HIS A 1 34 ? -0.841  -8.764  -8.467  1.00 0.00 ? 455 HIS A NE2  5  
ATOM   6252  H  H    . HIS A 1 34 ? 2.630   -10.828 -5.063  1.00 0.00 ? 455 HIS A H    5  
ATOM   6253  H  HA   . HIS A 1 34 ? 0.933   -8.425  -4.898  1.00 0.00 ? 455 HIS A HA   5  
ATOM   6254  H  HB2  . HIS A 1 34 ? 0.292   -11.313 -5.348  1.00 0.00 ? 455 HIS A HB2  5  
ATOM   6255  H  HB3  . HIS A 1 34 ? -0.898  -10.285 -4.554  1.00 0.00 ? 455 HIS A HB3  5  
ATOM   6256  H  HD1  . HIS A 1 34 ? -2.108  -11.128 -6.944  1.00 0.00 ? 455 HIS A HD1  5  
ATOM   6257  H  HD2  . HIS A 1 34 ? 0.762   -8.128  -7.111  1.00 0.00 ? 455 HIS A HD2  5  
ATOM   6258  H  HE1  . HIS A 1 34 ? -2.495  -9.948  -9.131  1.00 0.00 ? 455 HIS A HE1  5  
ATOM   6259  N  N    . GLY A 1 35 ? 0.901   -10.791 -2.602  1.00 0.00 ? 456 GLY A N    5  
ATOM   6260  C  CA   . GLY A 1 35 ? 0.861   -11.008 -1.167  1.00 0.00 ? 456 GLY A CA   5  
ATOM   6261  C  C    . GLY A 1 35 ? 2.238   -10.968 -0.536  1.00 0.00 ? 456 GLY A C    5  
ATOM   6262  O  O    . GLY A 1 35 ? 2.569   -10.028 0.187   1.00 0.00 ? 456 GLY A O    5  
ATOM   6263  H  H    . GLY A 1 35 ? 0.818   -11.553 -3.213  1.00 0.00 ? 456 GLY A H    5  
ATOM   6264  H  HA2  . GLY A 1 35 ? 0.246   -10.244 -0.716  1.00 0.00 ? 456 GLY A HA2  5  
ATOM   6265  H  HA3  . GLY A 1 35 ? 0.417   -11.974 -0.973  1.00 0.00 ? 456 GLY A HA3  5  
ATOM   6266  N  N    . ASP A 1 36 ? 3.042   -11.989 -0.808  1.00 0.00 ? 457 ASP A N    5  
ATOM   6267  C  CA   . ASP A 1 36 ? 4.392   -12.067 -0.261  1.00 0.00 ? 457 ASP A CA   5  
ATOM   6268  C  C    . ASP A 1 36 ? 4.967   -10.673 -0.033  1.00 0.00 ? 457 ASP A C    5  
ATOM   6269  O  O    . ASP A 1 36 ? 5.592   -10.408 0.994   1.00 0.00 ? 457 ASP A O    5  
ATOM   6270  C  CB   . ASP A 1 36 ? 5.301   -12.860 -1.201  1.00 0.00 ? 457 ASP A CB   5  
ATOM   6271  C  CG   . ASP A 1 36 ? 4.601   -14.059 -1.809  1.00 0.00 ? 457 ASP A CG   5  
ATOM   6272  O  OD1  . ASP A 1 36 ? 3.725   -14.641 -1.134  1.00 0.00 ? 457 ASP A OD1  5  
ATOM   6273  O  OD2  . ASP A 1 36 ? 4.927   -14.416 -2.960  1.00 0.00 ? 457 ASP A OD2  5  
ATOM   6274  H  H    . ASP A 1 36 ? 2.721   -12.708 -1.392  1.00 0.00 ? 457 ASP A H    5  
ATOM   6275  H  HA   . ASP A 1 36 ? 4.336   -12.579 0.688   1.00 0.00 ? 457 ASP A HA   5  
ATOM   6276  H  HB2  . ASP A 1 36 ? 5.631   -12.215 -2.002  1.00 0.00 ? 457 ASP A HB2  5  
ATOM   6277  H  HB3  . ASP A 1 36 ? 6.161   -13.210 -0.649  1.00 0.00 ? 457 ASP A HB3  5  
ATOM   6278  N  N    . PHE A 1 37 ? 4.752   -9.785  -0.998  1.00 0.00 ? 458 PHE A N    5  
ATOM   6279  C  CA   . PHE A 1 37 ? 5.250   -8.417  -0.904  1.00 0.00 ? 458 PHE A CA   5  
ATOM   6280  C  C    . PHE A 1 37 ? 4.913   -7.808  0.454   1.00 0.00 ? 458 PHE A C    5  
ATOM   6281  O  O    . PHE A 1 37 ? 3.760   -7.784  0.883   1.00 0.00 ? 458 PHE A O    5  
ATOM   6282  C  CB   . PHE A 1 37 ? 4.658   -7.558  -2.022  1.00 0.00 ? 458 PHE A CB   5  
ATOM   6283  C  CG   . PHE A 1 37 ? 5.459   -6.321  -2.316  1.00 0.00 ? 458 PHE A CG   5  
ATOM   6284  C  CD1  . PHE A 1 37 ? 6.608   -6.391  -3.088  1.00 0.00 ? 458 PHE A CD1  5  
ATOM   6285  C  CD2  . PHE A 1 37 ? 5.063   -5.089  -1.821  1.00 0.00 ? 458 PHE A CD2  5  
ATOM   6286  C  CE1  . PHE A 1 37 ? 7.347   -5.256  -3.359  1.00 0.00 ? 458 PHE A CE1  5  
ATOM   6287  C  CE2  . PHE A 1 37 ? 5.798   -3.950  -2.089  1.00 0.00 ? 458 PHE A CE2  5  
ATOM   6288  C  CZ   . PHE A 1 37 ? 6.941   -4.033  -2.860  1.00 0.00 ? 458 PHE A CZ   5  
ATOM   6289  H  H    . PHE A 1 37 ? 4.246   -10.055 -1.793  1.00 0.00 ? 458 PHE A H    5  
ATOM   6290  H  HA   . PHE A 1 37 ? 6.323   -8.449  -1.015  1.00 0.00 ? 458 PHE A HA   5  
ATOM   6291  H  HB2  . PHE A 1 37 ? 4.608   -8.143  -2.928  1.00 0.00 ? 458 PHE A HB2  5  
ATOM   6292  H  HB3  . PHE A 1 37 ? 3.662   -7.250  -1.741  1.00 0.00 ? 458 PHE A HB3  5  
ATOM   6293  H  HD1  . PHE A 1 37 ? 6.926   -7.346  -3.479  1.00 0.00 ? 458 PHE A HD1  5  
ATOM   6294  H  HD2  . PHE A 1 37 ? 4.168   -5.023  -1.218  1.00 0.00 ? 458 PHE A HD2  5  
ATOM   6295  H  HE1  . PHE A 1 37 ? 8.240   -5.323  -3.962  1.00 0.00 ? 458 PHE A HE1  5  
ATOM   6296  H  HE2  . PHE A 1 37 ? 5.478   -2.996  -1.697  1.00 0.00 ? 458 PHE A HE2  5  
ATOM   6297  H  HZ   . PHE A 1 37 ? 7.517   -3.144  -3.070  1.00 0.00 ? 458 PHE A HZ   5  
ATOM   6298  N  N    . PRO A 1 38 ? 5.945   -7.304  1.148   1.00 0.00 ? 459 PRO A N    5  
ATOM   6299  C  CA   . PRO A 1 38 ? 5.784   -6.685  2.467   1.00 0.00 ? 459 PRO A CA   5  
ATOM   6300  C  C    . PRO A 1 38 ? 5.052   -5.349  2.396   1.00 0.00 ? 459 PRO A C    5  
ATOM   6301  O  O    . PRO A 1 38 ? 5.437   -4.459  1.638   1.00 0.00 ? 459 PRO A O    5  
ATOM   6302  C  CB   . PRO A 1 38 ? 7.225   -6.481  2.941   1.00 0.00 ? 459 PRO A CB   5  
ATOM   6303  C  CG   . PRO A 1 38 ? 8.027   -6.394  1.688   1.00 0.00 ? 459 PRO A CG   5  
ATOM   6304  C  CD   . PRO A 1 38 ? 7.347   -7.298  0.698   1.00 0.00 ? 459 PRO A CD   5  
ATOM   6305  H  HA   . PRO A 1 38 ? 5.268   -7.341  3.153   1.00 0.00 ? 459 PRO A HA   5  
ATOM   6306  H  HB2  . PRO A 1 38 ? 7.291   -5.568  3.517   1.00 0.00 ? 459 PRO A HB2  5  
ATOM   6307  H  HB3  . PRO A 1 38 ? 7.531   -7.319  3.548   1.00 0.00 ? 459 PRO A HB3  5  
ATOM   6308  H  HG2  . PRO A 1 38 ? 8.033   -5.378  1.325   1.00 0.00 ? 459 PRO A HG2  5  
ATOM   6309  H  HG3  . PRO A 1 38 ? 9.035   -6.733  1.874   1.00 0.00 ? 459 PRO A HG3  5  
ATOM   6310  H  HD2  . PRO A 1 38 ? 7.430   -6.895  -0.300  1.00 0.00 ? 459 PRO A HD2  5  
ATOM   6311  H  HD3  . PRO A 1 38 ? 7.769   -8.292  0.742   1.00 0.00 ? 459 PRO A HD3  5  
ATOM   6312  N  N    . CYS A 1 39 ? 3.995   -5.216  3.190   1.00 0.00 ? 460 CYS A N    5  
ATOM   6313  C  CA   . CYS A 1 39 ? 3.208   -3.989  3.217   1.00 0.00 ? 460 CYS A CA   5  
ATOM   6314  C  C    . CYS A 1 39 ? 4.110   -2.769  3.381   1.00 0.00 ? 460 CYS A C    5  
ATOM   6315  O  O    . CYS A 1 39 ? 5.169   -2.845  4.003   1.00 0.00 ? 460 CYS A O    5  
ATOM   6316  C  CB   . CYS A 1 39 ? 2.186   -4.039  4.355   1.00 0.00 ? 460 CYS A CB   5  
ATOM   6317  S  SG   . CYS A 1 39 ? 0.802   -2.871  4.162   1.00 0.00 ? 460 CYS A SG   5  
ATOM   6318  H  H    . CYS A 1 39 ? 3.737   -5.962  3.772   1.00 0.00 ? 460 CYS A H    5  
ATOM   6319  H  HA   . CYS A 1 39 ? 2.684   -3.910  2.277   1.00 0.00 ? 460 CYS A HA   5  
ATOM   6320  H  HB2  . CYS A 1 39 ? 1.770   -5.034  4.411   1.00 0.00 ? 460 CYS A HB2  5  
ATOM   6321  H  HB3  . CYS A 1 39 ? 2.684   -3.809  5.286   1.00 0.00 ? 460 CYS A HB3  5  
ATOM   6322  N  N    . LYS A 1 40 ? 3.681   -1.644  2.819   1.00 0.00 ? 461 LYS A N    5  
ATOM   6323  C  CA   . LYS A 1 40 ? 4.446   -0.406  2.903   1.00 0.00 ? 461 LYS A CA   5  
ATOM   6324  C  C    . LYS A 1 40 ? 4.231   0.277   4.250   1.00 0.00 ? 461 LYS A C    5  
ATOM   6325  O  O    . LYS A 1 40 ? 5.146   0.358   5.071   1.00 0.00 ? 461 LYS A O    5  
ATOM   6326  C  CB   . LYS A 1 40 ? 4.049   0.542   1.769   1.00 0.00 ? 461 LYS A CB   5  
ATOM   6327  C  CG   . LYS A 1 40 ? 4.792   1.866   1.794   1.00 0.00 ? 461 LYS A CG   5  
ATOM   6328  C  CD   . LYS A 1 40 ? 4.238   2.836   0.765   1.00 0.00 ? 461 LYS A CD   5  
ATOM   6329  C  CE   . LYS A 1 40 ? 4.834   4.226   0.931   1.00 0.00 ? 461 LYS A CE   5  
ATOM   6330  N  NZ   . LYS A 1 40 ? 4.716   5.033   -0.315  1.00 0.00 ? 461 LYS A NZ   5  
ATOM   6331  H  H    . LYS A 1 40 ? 2.827   -1.646  2.336   1.00 0.00 ? 461 LYS A H    5  
ATOM   6332  H  HA   . LYS A 1 40 ? 5.492   -0.655  2.803   1.00 0.00 ? 461 LYS A HA   5  
ATOM   6333  H  HB2  . LYS A 1 40 ? 4.249   0.058   0.825   1.00 0.00 ? 461 LYS A HB2  5  
ATOM   6334  H  HB3  . LYS A 1 40 ? 2.990   0.746   1.842   1.00 0.00 ? 461 LYS A HB3  5  
ATOM   6335  H  HG2  . LYS A 1 40 ? 4.694   2.305   2.776   1.00 0.00 ? 461 LYS A HG2  5  
ATOM   6336  H  HG3  . LYS A 1 40 ? 5.836   1.686   1.581   1.00 0.00 ? 461 LYS A HG3  5  
ATOM   6337  H  HD2  . LYS A 1 40 ? 4.474   2.472   -0.224  1.00 0.00 ? 461 LYS A HD2  5  
ATOM   6338  H  HD3  . LYS A 1 40 ? 3.165   2.898   0.881   1.00 0.00 ? 461 LYS A HD3  5  
ATOM   6339  H  HE2  . LYS A 1 40 ? 4.313   4.733   1.729   1.00 0.00 ? 461 LYS A HE2  5  
ATOM   6340  H  HE3  . LYS A 1 40 ? 5.878   4.127   1.188   1.00 0.00 ? 461 LYS A HE3  5  
ATOM   6341  H  HZ1  . LYS A 1 40 ? 4.783   6.047   -0.092  1.00 0.00 ? 461 LYS A HZ1  5  
ATOM   6342  H  HZ2  . LYS A 1 40 ? 3.801   4.850   -0.774  1.00 0.00 ? 461 LYS A HZ2  5  
ATOM   6343  H  HZ3  . LYS A 1 40 ? 5.479   4.784   -0.976  1.00 0.00 ? 461 LYS A HZ3  5  
ATOM   6344  N  N    . LEU A 1 41 ? 3.016   0.766   4.472   1.00 0.00 ? 462 LEU A N    5  
ATOM   6345  C  CA   . LEU A 1 41 ? 2.679   1.441   5.721   1.00 0.00 ? 462 LEU A CA   5  
ATOM   6346  C  C    . LEU A 1 41 ? 3.237   0.679   6.919   1.00 0.00 ? 462 LEU A C    5  
ATOM   6347  O  O    . LEU A 1 41 ? 4.046   1.208   7.682   1.00 0.00 ? 462 LEU A O    5  
ATOM   6348  C  CB   . LEU A 1 41 ? 1.162   1.583   5.854   1.00 0.00 ? 462 LEU A CB   5  
ATOM   6349  C  CG   . LEU A 1 41 ? 0.514   2.680   5.010   1.00 0.00 ? 462 LEU A CG   5  
ATOM   6350  C  CD1  . LEU A 1 41 ? -1.002  2.598   5.099   1.00 0.00 ? 462 LEU A CD1  5  
ATOM   6351  C  CD2  . LEU A 1 41 ? 1.002   4.052   5.452   1.00 0.00 ? 462 LEU A CD2  5  
ATOM   6352  H  H    . LEU A 1 41 ? 2.328   0.672   3.781   1.00 0.00 ? 462 LEU A H    5  
ATOM   6353  H  HA   . LEU A 1 41 ? 3.124   2.425   5.696   1.00 0.00 ? 462 LEU A HA   5  
ATOM   6354  H  HB2  . LEU A 1 41 ? 0.716   0.642   5.572   1.00 0.00 ? 462 LEU A HB2  5  
ATOM   6355  H  HB3  . LEU A 1 41 ? 0.939   1.787   6.892   1.00 0.00 ? 462 LEU A HB3  5  
ATOM   6356  H  HG   . LEU A 1 41 ? 0.794   2.542   3.974   1.00 0.00 ? 462 LEU A HG   5  
ATOM   6357  H  HD11 . LEU A 1 41 ? -1.356  1.792   4.475   1.00 0.00 ? 462 LEU A HD11 5  
ATOM   6358  H  HD12 . LEU A 1 41 ? -1.434  3.529   4.765   1.00 0.00 ? 462 LEU A HD12 5  
ATOM   6359  H  HD13 . LEU A 1 41 ? -1.293  2.414   6.124   1.00 0.00 ? 462 LEU A HD13 5  
ATOM   6360  H  HD21 . LEU A 1 41 ? 2.038   4.173   5.170   1.00 0.00 ? 462 LEU A HD21 5  
ATOM   6361  H  HD22 . LEU A 1 41 ? 0.908   4.139   6.525   1.00 0.00 ? 462 LEU A HD22 5  
ATOM   6362  H  HD23 . LEU A 1 41 ? 0.407   4.817   4.975   1.00 0.00 ? 462 LEU A HD23 5  
ATOM   6363  N  N    . TYR A 1 42 ? 2.802   -0.566  7.077   1.00 0.00 ? 463 TYR A N    5  
ATOM   6364  C  CA   . TYR A 1 42 ? 3.258   -1.401  8.182   1.00 0.00 ? 463 TYR A CA   5  
ATOM   6365  C  C    . TYR A 1 42 ? 4.745   -1.189  8.447   1.00 0.00 ? 463 TYR A C    5  
ATOM   6366  O  O    . TYR A 1 42 ? 5.227   -1.405  9.560   1.00 0.00 ? 463 TYR A O    5  
ATOM   6367  C  CB   . TYR A 1 42 ? 2.987   -2.876  7.880   1.00 0.00 ? 463 TYR A CB   5  
ATOM   6368  C  CG   . TYR A 1 42 ? 3.494   -3.816  8.950   1.00 0.00 ? 463 TYR A CG   5  
ATOM   6369  C  CD1  . TYR A 1 42 ? 2.781   -4.010  10.126  1.00 0.00 ? 463 TYR A CD1  5  
ATOM   6370  C  CD2  . TYR A 1 42 ? 4.686   -4.510  8.785   1.00 0.00 ? 463 TYR A CD2  5  
ATOM   6371  C  CE1  . TYR A 1 42 ? 3.240   -4.868  11.107  1.00 0.00 ? 463 TYR A CE1  5  
ATOM   6372  C  CE2  . TYR A 1 42 ? 5.153   -5.371  9.760   1.00 0.00 ? 463 TYR A CE2  5  
ATOM   6373  C  CZ   . TYR A 1 42 ? 4.426   -5.546  10.919  1.00 0.00 ? 463 TYR A CZ   5  
ATOM   6374  O  OH   . TYR A 1 42 ? 4.887   -6.402  11.893  1.00 0.00 ? 463 TYR A OH   5  
ATOM   6375  H  H    . TYR A 1 42 ? 2.158   -0.932  6.436   1.00 0.00 ? 463 TYR A H    5  
ATOM   6376  H  HA   . TYR A 1 42 ? 2.703   -1.116  9.063   1.00 0.00 ? 463 TYR A HA   5  
ATOM   6377  H  HB2  . TYR A 1 42 ? 1.924   -3.027  7.783   1.00 0.00 ? 463 TYR A HB2  5  
ATOM   6378  H  HB3  . TYR A 1 42 ? 3.470   -3.140  6.950   1.00 0.00 ? 463 TYR A HB3  5  
ATOM   6379  H  HD1  . TYR A 1 42 ? 1.851   -3.478  10.270  1.00 0.00 ? 463 TYR A HD1  5  
ATOM   6380  H  HD2  . TYR A 1 42 ? 5.253   -4.371  7.875   1.00 0.00 ? 463 TYR A HD2  5  
ATOM   6381  H  HE1  . TYR A 1 42 ? 2.671   -5.005  12.015  1.00 0.00 ? 463 TYR A HE1  5  
ATOM   6382  H  HE2  . TYR A 1 42 ? 6.082   -5.902  9.613   1.00 0.00 ? 463 TYR A HE2  5  
ATOM   6383  H  HH   . TYR A 1 42 ? 5.646   -6.886  11.560  1.00 0.00 ? 463 TYR A HH   5  
ATOM   6384  N  N    . HIS A 1 43 ? 5.469   -0.763  7.416   1.00 0.00 ? 464 HIS A N    5  
ATOM   6385  C  CA   . HIS A 1 43 ? 6.902   -0.520  7.537   1.00 0.00 ? 464 HIS A CA   5  
ATOM   6386  C  C    . HIS A 1 43 ? 7.186   0.965   7.738   1.00 0.00 ? 464 HIS A C    5  
ATOM   6387  O  O    . HIS A 1 43 ? 7.872   1.355   8.684   1.00 0.00 ? 464 HIS A O    5  
ATOM   6388  C  CB   . HIS A 1 43 ? 7.633   -1.027  6.293   1.00 0.00 ? 464 HIS A CB   5  
ATOM   6389  C  CG   . HIS A 1 43 ? 7.833   -2.511  6.280   1.00 0.00 ? 464 HIS A CG   5  
ATOM   6390  N  ND1  . HIS A 1 43 ? 8.281   -3.220  7.374   1.00 0.00 ? 464 HIS A ND1  5  
ATOM   6391  C  CD2  . HIS A 1 43 ? 7.643   -3.422  5.296   1.00 0.00 ? 464 HIS A CD2  5  
ATOM   6392  C  CE1  . HIS A 1 43 ? 8.359   -4.502  7.064   1.00 0.00 ? 464 HIS A CE1  5  
ATOM   6393  N  NE2  . HIS A 1 43 ? 7.977   -4.651  5.809   1.00 0.00 ? 464 HIS A NE2  5  
ATOM   6394  H  H    . HIS A 1 43 ? 5.029   -0.609  6.555   1.00 0.00 ? 464 HIS A H    5  
ATOM   6395  H  HA   . HIS A 1 43 ? 7.259   -1.062  8.399   1.00 0.00 ? 464 HIS A HA   5  
ATOM   6396  H  HB2  . HIS A 1 43 ? 7.063   -0.762  5.415   1.00 0.00 ? 464 HIS A HB2  5  
ATOM   6397  H  HB3  . HIS A 1 43 ? 8.606   -0.560  6.239   1.00 0.00 ? 464 HIS A HB3  5  
ATOM   6398  H  HD2  . HIS A 1 43 ? 7.294   -3.219  4.293   1.00 0.00 ? 464 HIS A HD2  5  
ATOM   6399  H  HE1  . HIS A 1 43 ? 8.679   -5.294  7.724   1.00 0.00 ? 464 HIS A HE1  5  
ATOM   6400  H  HE2  . HIS A 1 43 ? 8.021   -5.488  5.301   1.00 0.00 ? 464 HIS A HE2  5  
ATOM   6401  N  N    . THR A 1 44 ? 6.655   1.791   6.841   1.00 0.00 ? 465 THR A N    5  
ATOM   6402  C  CA   . THR A 1 44 ? 6.853   3.233   6.919   1.00 0.00 ? 465 THR A CA   5  
ATOM   6403  C  C    . THR A 1 44 ? 6.959   3.696   8.368   1.00 0.00 ? 465 THR A C    5  
ATOM   6404  O  O    . THR A 1 44 ? 7.812   4.517   8.708   1.00 0.00 ? 465 THR A O    5  
ATOM   6405  C  CB   . THR A 1 44 ? 5.705   3.996   6.231   1.00 0.00 ? 465 THR A CB   5  
ATOM   6406  O  OG1  . THR A 1 44 ? 4.472   3.744   6.913   1.00 0.00 ? 465 THR A OG1  5  
ATOM   6407  C  CG2  . THR A 1 44 ? 5.579   3.581   4.773   1.00 0.00 ? 465 THR A CG2  5  
ATOM   6408  H  H    . THR A 1 44 ? 6.119   1.420   6.110   1.00 0.00 ? 465 THR A H    5  
ATOM   6409  H  HA   . THR A 1 44 ? 7.774   3.472   6.407   1.00 0.00 ? 465 THR A HA   5  
ATOM   6410  H  HB   . THR A 1 44 ? 5.921   5.054   6.272   1.00 0.00 ? 465 THR A HB   5  
ATOM   6411  H  HG1  . THR A 1 44 ? 3.757   4.199   6.461   1.00 0.00 ? 465 THR A HG1  5  
ATOM   6412  H  HG21 . THR A 1 44 ? 6.002   4.350   4.142   1.00 0.00 ? 465 THR A HG21 5  
ATOM   6413  H  HG22 . THR A 1 44 ? 4.536   3.447   4.526   1.00 0.00 ? 465 THR A HG22 5  
ATOM   6414  H  HG23 . THR A 1 44 ? 6.109   2.654   4.615   1.00 0.00 ? 465 THR A HG23 5  
ATOM   6415  N  N    . THR A 1 45 ? 6.087   3.165   9.219   1.00 0.00 ? 466 THR A N    5  
ATOM   6416  C  CA   . THR A 1 45 ? 6.082   3.524   10.632  1.00 0.00 ? 466 THR A CA   5  
ATOM   6417  C  C    . THR A 1 45 ? 6.140   2.283   11.515  1.00 0.00 ? 466 THR A C    5  
ATOM   6418  O  O    . THR A 1 45 ? 6.767   2.290   12.573  1.00 0.00 ? 466 THR A O    5  
ATOM   6419  C  CB   . THR A 1 45 ? 4.831   4.344   10.999  1.00 0.00 ? 466 THR A CB   5  
ATOM   6420  O  OG1  . THR A 1 45 ? 3.650   3.578   10.738  1.00 0.00 ? 466 THR A OG1  5  
ATOM   6421  C  CG2  . THR A 1 45 ? 4.784   5.642   10.208  1.00 0.00 ? 466 THR A CG2  5  
ATOM   6422  H  H    . THR A 1 45 ? 5.432   2.516   8.888   1.00 0.00 ? 466 THR A H    5  
ATOM   6423  H  HA   . THR A 1 45 ? 6.955   4.132   10.824  1.00 0.00 ? 466 THR A HA   5  
ATOM   6424  H  HB   . THR A 1 45 ? 4.872   4.582   12.052  1.00 0.00 ? 466 THR A HB   5  
ATOM   6425  H  HG1  . THR A 1 45 ? 3.385   3.115   11.537  1.00 0.00 ? 466 THR A HG1  5  
ATOM   6426  H  HG21 . THR A 1 45 ? 4.078   6.318   10.667  1.00 0.00 ? 466 THR A HG21 5  
ATOM   6427  H  HG22 . THR A 1 45 ? 4.477   5.435   9.193   1.00 0.00 ? 466 THR A HG22 5  
ATOM   6428  H  HG23 . THR A 1 45 ? 5.764   6.096   10.202  1.00 0.00 ? 466 THR A HG23 5  
ATOM   6429  N  N    . GLY A 1 46 ? 5.481   1.216   11.073  1.00 0.00 ? 467 GLY A N    5  
ATOM   6430  C  CA   . GLY A 1 46 ? 5.470   -0.019  11.835  1.00 0.00 ? 467 GLY A CA   5  
ATOM   6431  C  C    . GLY A 1 46 ? 4.108   -0.683  11.844  1.00 0.00 ? 467 GLY A C    5  
ATOM   6432  O  O    . GLY A 1 46 ? 4.005   -1.905  11.738  1.00 0.00 ? 467 GLY A O    5  
ATOM   6433  H  H    . GLY A 1 46 ? 4.997   1.268   10.221  1.00 0.00 ? 467 GLY A H    5  
ATOM   6434  H  HA2  . GLY A 1 46 ? 6.189   -0.700  11.406  1.00 0.00 ? 467 GLY A HA2  5  
ATOM   6435  H  HA3  . GLY A 1 46 ? 5.758   0.199   12.854  1.00 0.00 ? 467 GLY A HA3  5  
ATOM   6436  N  N    . ASN A 1 47 ? 3.059   0.123   11.971  1.00 0.00 ? 468 ASN A N    5  
ATOM   6437  C  CA   . ASN A 1 47 ? 1.696   -0.396  11.995  1.00 0.00 ? 468 ASN A CA   5  
ATOM   6438  C  C    . ASN A 1 47 ? 0.986   -0.122  10.672  1.00 0.00 ? 468 ASN A C    5  
ATOM   6439  O  O    . ASN A 1 47 ? 1.511   0.580   9.807   1.00 0.00 ? 468 ASN A O    5  
ATOM   6440  C  CB   . ASN A 1 47 ? 0.909   0.233   13.147  1.00 0.00 ? 468 ASN A CB   5  
ATOM   6441  C  CG   . ASN A 1 47 ? 1.763   0.444   14.383  1.00 0.00 ? 468 ASN A CG   5  
ATOM   6442  O  OD1  . ASN A 1 47 ? 2.496   1.428   14.483  1.00 0.00 ? 468 ASN A OD1  5  
ATOM   6443  N  ND2  . ASN A 1 47 ? 1.673   -0.482  15.330  1.00 0.00 ? 468 ASN A ND2  5  
ATOM   6444  H  H    . ASN A 1 47 ? 3.204   1.088   12.051  1.00 0.00 ? 468 ASN A H    5  
ATOM   6445  H  HA   . ASN A 1 47 ? 1.749   -1.463  12.148  1.00 0.00 ? 468 ASN A HA   5  
ATOM   6446  H  HB2  . ASN A 1 47 ? 0.524   1.192   12.832  1.00 0.00 ? 468 ASN A HB2  5  
ATOM   6447  H  HB3  . ASN A 1 47 ? 0.085   -0.413  13.408  1.00 0.00 ? 468 ASN A HB3  5  
ATOM   6448  H  HD21 . ASN A 1 47 ? 1.068   -1.239  15.181  1.00 0.00 ? 468 ASN A HD21 5  
ATOM   6449  H  HD22 . ASN A 1 47 ? 2.213   -0.370  16.140  1.00 0.00 ? 468 ASN A HD22 5  
ATOM   6450  N  N    . CYS A 1 48 ? -0.210  -0.682  10.522  1.00 0.00 ? 469 CYS A N    5  
ATOM   6451  C  CA   . CYS A 1 48 ? -0.992  -0.500  9.306   1.00 0.00 ? 469 CYS A CA   5  
ATOM   6452  C  C    . CYS A 1 48 ? -2.416  -0.060  9.635   1.00 0.00 ? 469 CYS A C    5  
ATOM   6453  O  O    . CYS A 1 48 ? -3.156  -0.774  10.313  1.00 0.00 ? 469 CYS A O    5  
ATOM   6454  C  CB   . CYS A 1 48 ? -1.023  -1.797  8.495   1.00 0.00 ? 469 CYS A CB   5  
ATOM   6455  S  SG   . CYS A 1 48 ? -1.480  -1.569  6.746   1.00 0.00 ? 469 CYS A SG   5  
ATOM   6456  H  H    . CYS A 1 48 ? -0.575  -1.231  11.248  1.00 0.00 ? 469 CYS A H    5  
ATOM   6457  H  HA   . CYS A 1 48 ? -0.518  0.271   8.718   1.00 0.00 ? 469 CYS A HA   5  
ATOM   6458  H  HB2  . CYS A 1 48 ? -0.043  -2.251  8.521   1.00 0.00 ? 469 CYS A HB2  5  
ATOM   6459  H  HB3  . CYS A 1 48 ? -1.739  -2.472  8.937   1.00 0.00 ? 469 CYS A HB3  5  
ATOM   6460  N  N    . ILE A 1 49 ? -2.792  1.119   9.152   1.00 0.00 ? 470 ILE A N    5  
ATOM   6461  C  CA   . ILE A 1 49 ? -4.126  1.654   9.394   1.00 0.00 ? 470 ILE A CA   5  
ATOM   6462  C  C    . ILE A 1 49 ? -5.201  0.639   9.017   1.00 0.00 ? 470 ILE A C    5  
ATOM   6463  O  O    . ILE A 1 49 ? -6.281  0.616   9.606   1.00 0.00 ? 470 ILE A O    5  
ATOM   6464  C  CB   . ILE A 1 49 ? -4.364  2.954   8.604   1.00 0.00 ? 470 ILE A CB   5  
ATOM   6465  C  CG1  . ILE A 1 49 ? -5.743  3.530   8.931   1.00 0.00 ? 470 ILE A CG1  5  
ATOM   6466  C  CG2  . ILE A 1 49 ? -4.231  2.698   7.110   1.00 0.00 ? 470 ILE A CG2  5  
ATOM   6467  C  CD1  . ILE A 1 49 ? -5.857  4.061   10.343  1.00 0.00 ? 470 ILE A CD1  5  
ATOM   6468  H  H    . ILE A 1 49 ? -2.157  1.642   8.619   1.00 0.00 ? 470 ILE A H    5  
ATOM   6469  H  HA   . ILE A 1 49 ? -4.210  1.876   10.448  1.00 0.00 ? 470 ILE A HA   5  
ATOM   6470  H  HB   . ILE A 1 49 ? -3.606  3.667   8.891   1.00 0.00 ? 470 ILE A HB   5  
ATOM   6471  H  HG12 . ILE A 1 49 ? -5.957  4.342   8.254   1.00 0.00 ? 470 ILE A HG12 5  
ATOM   6472  H  HG13 . ILE A 1 49 ? -6.487  2.757   8.805   1.00 0.00 ? 470 ILE A HG13 5  
ATOM   6473  H  HG21 . ILE A 1 49 ? -3.240  2.328   6.895   1.00 0.00 ? 470 ILE A HG21 5  
ATOM   6474  H  HG22 . ILE A 1 49 ? -4.962  1.965   6.804   1.00 0.00 ? 470 ILE A HG22 5  
ATOM   6475  H  HG23 . ILE A 1 49 ? -4.396  3.619   6.571   1.00 0.00 ? 470 ILE A HG23 5  
ATOM   6476  H  HD11 . ILE A 1 49 ? -5.118  3.583   10.968  1.00 0.00 ? 470 ILE A HD11 5  
ATOM   6477  H  HD12 . ILE A 1 49 ? -5.694  5.128   10.341  1.00 0.00 ? 470 ILE A HD12 5  
ATOM   6478  H  HD13 . ILE A 1 49 ? -6.844  3.849   10.728  1.00 0.00 ? 470 ILE A HD13 5  
ATOM   6479  N  N    . ASN A 1 50 ? -4.896  -0.199  8.032   1.00 0.00 ? 471 ASN A N    5  
ATOM   6480  C  CA   . ASN A 1 50 ? -5.836  -1.217  7.577   1.00 0.00 ? 471 ASN A CA   5  
ATOM   6481  C  C    . ASN A 1 50 ? -6.377  -2.023  8.754   1.00 0.00 ? 471 ASN A C    5  
ATOM   6482  O  O    . ASN A 1 50 ? -7.574  -1.999  9.037   1.00 0.00 ? 471 ASN A O    5  
ATOM   6483  C  CB   . ASN A 1 50 ? -5.159  -2.153  6.572   1.00 0.00 ? 471 ASN A CB   5  
ATOM   6484  C  CG   . ASN A 1 50 ? -4.829  -1.457  5.266   1.00 0.00 ? 471 ASN A CG   5  
ATOM   6485  O  OD1  . ASN A 1 50 ? -3.666  -1.177  4.976   1.00 0.00 ? 471 ASN A OD1  5  
ATOM   6486  N  ND2  . ASN A 1 50 ? -5.854  -1.174  4.471   1.00 0.00 ? 471 ASN A ND2  5  
ATOM   6487  H  H    . ASN A 1 50 ? -4.019  -0.132  7.600   1.00 0.00 ? 471 ASN A H    5  
ATOM   6488  H  HA   . ASN A 1 50 ? -6.658  -0.715  7.090   1.00 0.00 ? 471 ASN A HA   5  
ATOM   6489  H  HB2  . ASN A 1 50 ? -4.241  -2.527  7.001   1.00 0.00 ? 471 ASN A HB2  5  
ATOM   6490  H  HB3  . ASN A 1 50 ? -5.818  -2.982  6.361   1.00 0.00 ? 471 ASN A HB3  5  
ATOM   6491  H  HD21 . ASN A 1 50 ? -6.754  -1.427  4.767   1.00 0.00 ? 471 ASN A HD21 5  
ATOM   6492  H  HD22 . ASN A 1 50 ? -5.669  -0.725  3.620   1.00 0.00 ? 471 ASN A HD22 5  
ATOM   6493  N  N    . GLY A 1 51 ? -5.486  -2.735  9.437   1.00 0.00 ? 472 GLY A N    5  
ATOM   6494  C  CA   . GLY A 1 51 ? -5.893  -3.538  10.575  1.00 0.00 ? 472 GLY A CA   5  
ATOM   6495  C  C    . GLY A 1 51 ? -5.121  -4.838  10.674  1.00 0.00 ? 472 GLY A C    5  
ATOM   6496  O  O    . GLY A 1 51 ? -4.060  -4.986  10.066  1.00 0.00 ? 472 GLY A O    5  
ATOM   6497  H  H    . GLY A 1 51 ? -4.545  -2.716  9.165   1.00 0.00 ? 472 GLY A H    5  
ATOM   6498  H  HA2  . GLY A 1 51 ? -5.735  -2.967  11.478  1.00 0.00 ? 472 GLY A HA2  5  
ATOM   6499  H  HA3  . GLY A 1 51 ? -6.946  -3.763  10.484  1.00 0.00 ? 472 GLY A HA3  5  
ATOM   6500  N  N    . ASP A 1 52 ? -5.652  -5.783  11.442  1.00 0.00 ? 473 ASP A N    5  
ATOM   6501  C  CA   . ASP A 1 52 ? -5.006  -7.078  11.619  1.00 0.00 ? 473 ASP A CA   5  
ATOM   6502  C  C    . ASP A 1 52 ? -5.077  -7.901  10.337  1.00 0.00 ? 473 ASP A C    5  
ATOM   6503  O  O    . ASP A 1 52 ? -4.134  -8.612  9.990   1.00 0.00 ? 473 ASP A O    5  
ATOM   6504  C  CB   . ASP A 1 52 ? -5.659  -7.845  12.769  1.00 0.00 ? 473 ASP A CB   5  
ATOM   6505  C  CG   . ASP A 1 52 ? -6.124  -6.930  13.885  1.00 0.00 ? 473 ASP A CG   5  
ATOM   6506  O  OD1  . ASP A 1 52 ? -5.289  -6.168  14.416  1.00 0.00 ? 473 ASP A OD1  5  
ATOM   6507  O  OD2  . ASP A 1 52 ? -7.324  -6.976  14.227  1.00 0.00 ? 473 ASP A OD2  5  
ATOM   6508  H  H    . ASP A 1 52 ? -6.500  -5.605  11.901  1.00 0.00 ? 473 ASP A H    5  
ATOM   6509  H  HA   . ASP A 1 52 ? -3.968  -6.900  11.860  1.00 0.00 ? 473 ASP A HA   5  
ATOM   6510  H  HB2  . ASP A 1 52 ? -6.515  -8.387  12.393  1.00 0.00 ? 473 ASP A HB2  5  
ATOM   6511  H  HB3  . ASP A 1 52 ? -4.945  -8.546  13.177  1.00 0.00 ? 473 ASP A HB3  5  
ATOM   6512  N  N    . ASP A 1 53 ? -6.202  -7.799  9.637   1.00 0.00 ? 474 ASP A N    5  
ATOM   6513  C  CA   . ASP A 1 53 ? -6.397  -8.534  8.393   1.00 0.00 ? 474 ASP A CA   5  
ATOM   6514  C  C    . ASP A 1 53 ? -6.147  -7.636  7.186   1.00 0.00 ? 474 ASP A C    5  
ATOM   6515  O  O    . ASP A 1 53 ? -7.060  -7.350  6.410   1.00 0.00 ? 474 ASP A O    5  
ATOM   6516  C  CB   . ASP A 1 53 ? -7.814  -9.108  8.331   1.00 0.00 ? 474 ASP A CB   5  
ATOM   6517  C  CG   . ASP A 1 53 ? -8.074  -10.125 9.425   1.00 0.00 ? 474 ASP A CG   5  
ATOM   6518  O  OD1  . ASP A 1 53 ? -7.509  -9.968  10.527  1.00 0.00 ? 474 ASP A OD1  5  
ATOM   6519  O  OD2  . ASP A 1 53 ? -8.843  -11.078 9.179   1.00 0.00 ? 474 ASP A OD2  5  
ATOM   6520  H  H    . ASP A 1 53 ? -6.918  -7.216  9.965   1.00 0.00 ? 474 ASP A H    5  
ATOM   6521  H  HA   . ASP A 1 53 ? -5.688  -9.348  8.373   1.00 0.00 ? 474 ASP A HA   5  
ATOM   6522  H  HB2  . ASP A 1 53 ? -8.526  -8.303  8.437   1.00 0.00 ? 474 ASP A HB2  5  
ATOM   6523  H  HB3  . ASP A 1 53 ? -7.959  -9.589  7.375   1.00 0.00 ? 474 ASP A HB3  5  
ATOM   6524  N  N    . CYS A 1 54 ? -4.903  -7.192  7.033   1.00 0.00 ? 475 CYS A N    5  
ATOM   6525  C  CA   . CYS A 1 54 ? -4.532  -6.324  5.922   1.00 0.00 ? 475 CYS A CA   5  
ATOM   6526  C  C    . CYS A 1 54 ? -4.364  -7.129  4.636   1.00 0.00 ? 475 CYS A C    5  
ATOM   6527  O  O    . CYS A 1 54 ? -4.028  -8.312  4.672   1.00 0.00 ? 475 CYS A O    5  
ATOM   6528  C  CB   . CYS A 1 54 ? -3.235  -5.578  6.242   1.00 0.00 ? 475 CYS A CB   5  
ATOM   6529  S  SG   . CYS A 1 54 ? -2.847  -4.230  5.080   1.00 0.00 ? 475 CYS A SG   5  
ATOM   6530  H  H    . CYS A 1 54 ? -4.218  -7.454  7.684   1.00 0.00 ? 475 CYS A H    5  
ATOM   6531  H  HA   . CYS A 1 54 ? -5.325  -5.606  5.782   1.00 0.00 ? 475 CYS A HA   5  
ATOM   6532  H  HB2  . CYS A 1 54 ? -3.312  -5.147  7.230   1.00 0.00 ? 475 CYS A HB2  5  
ATOM   6533  H  HB3  . CYS A 1 54 ? -2.412  -6.277  6.223   1.00 0.00 ? 475 CYS A HB3  5  
ATOM   6534  N  N    . MET A 1 55 ? -4.601  -6.477  3.502   1.00 0.00 ? 476 MET A N    5  
ATOM   6535  C  CA   . MET A 1 55 ? -4.475  -7.132  2.205   1.00 0.00 ? 476 MET A CA   5  
ATOM   6536  C  C    . MET A 1 55 ? -3.013  -7.429  1.886   1.00 0.00 ? 476 MET A C    5  
ATOM   6537  O  O    . MET A 1 55 ? -2.711  -8.271  1.040   1.00 0.00 ? 476 MET A O    5  
ATOM   6538  C  CB   . MET A 1 55 ? -5.080  -6.255  1.107   1.00 0.00 ? 476 MET A CB   5  
ATOM   6539  C  CG   . MET A 1 55 ? -4.299  -4.977  0.850   1.00 0.00 ? 476 MET A CG   5  
ATOM   6540  S  SD   . MET A 1 55 ? -2.855  -5.244  -0.197  1.00 0.00 ? 476 MET A SD   5  
ATOM   6541  C  CE   . MET A 1 55 ? -3.617  -5.305  -1.816  1.00 0.00 ? 476 MET A CE   5  
ATOM   6542  H  H    . MET A 1 55 ? -4.866  -5.535  3.538   1.00 0.00 ? 476 MET A H    5  
ATOM   6543  H  HA   . MET A 1 55 ? -5.018  -8.063  2.250   1.00 0.00 ? 476 MET A HA   5  
ATOM   6544  H  HB2  . MET A 1 55 ? -5.114  -6.822  0.188   1.00 0.00 ? 476 MET A HB2  5  
ATOM   6545  H  HB3  . MET A 1 55 ? -6.086  -5.985  1.391   1.00 0.00 ? 476 MET A HB3  5  
ATOM   6546  H  HG2  . MET A 1 55 ? -4.949  -4.264  0.365   1.00 0.00 ? 476 MET A HG2  5  
ATOM   6547  H  HG3  . MET A 1 55 ? -3.971  -4.575  1.797   1.00 0.00 ? 476 MET A HG3  5  
ATOM   6548  H  HE1  . MET A 1 55 ? -4.247  -6.180  -1.885  1.00 0.00 ? 476 MET A HE1  5  
ATOM   6549  H  HE2  . MET A 1 55 ? -4.214  -4.418  -1.966  1.00 0.00 ? 476 MET A HE2  5  
ATOM   6550  H  HE3  . MET A 1 55 ? -2.848  -5.355  -2.574  1.00 0.00 ? 476 MET A HE3  5  
ATOM   6551  N  N    . PHE A 1 56 ? -2.110  -6.733  2.568   1.00 0.00 ? 477 PHE A N    5  
ATOM   6552  C  CA   . PHE A 1 56 ? -0.679  -6.922  2.356   1.00 0.00 ? 477 PHE A CA   5  
ATOM   6553  C  C    . PHE A 1 56 ? -0.075  -7.784  3.461   1.00 0.00 ? 477 PHE A C    5  
ATOM   6554  O  O    . PHE A 1 56 ? -0.612  -7.862  4.566   1.00 0.00 ? 477 PHE A O    5  
ATOM   6555  C  CB   . PHE A 1 56 ? 0.033   -5.569  2.302   1.00 0.00 ? 477 PHE A CB   5  
ATOM   6556  C  CG   . PHE A 1 56 ? -0.149  -4.848  0.997   1.00 0.00 ? 477 PHE A CG   5  
ATOM   6557  C  CD1  . PHE A 1 56 ? 0.140   -5.476  -0.203  1.00 0.00 ? 477 PHE A CD1  5  
ATOM   6558  C  CD2  . PHE A 1 56 ? -0.608  -3.541  0.971   1.00 0.00 ? 477 PHE A CD2  5  
ATOM   6559  C  CE1  . PHE A 1 56 ? -0.026  -4.816  -1.406  1.00 0.00 ? 477 PHE A CE1  5  
ATOM   6560  C  CE2  . PHE A 1 56 ? -0.777  -2.875  -0.229  1.00 0.00 ? 477 PHE A CE2  5  
ATOM   6561  C  CZ   . PHE A 1 56 ? -0.484  -3.513  -1.418  1.00 0.00 ? 477 PHE A CZ   5  
ATOM   6562  H  H    . PHE A 1 56 ? -2.413  -6.075  3.229   1.00 0.00 ? 477 PHE A H    5  
ATOM   6563  H  HA   . PHE A 1 56 ? -0.549  -7.426  1.411   1.00 0.00 ? 477 PHE A HA   5  
ATOM   6564  H  HB2  . PHE A 1 56 ? -0.352  -4.936  3.087   1.00 0.00 ? 477 PHE A HB2  5  
ATOM   6565  H  HB3  . PHE A 1 56 ? 1.091   -5.721  2.454   1.00 0.00 ? 477 PHE A HB3  5  
ATOM   6566  H  HD1  . PHE A 1 56 ? 0.499   -6.496  -0.195  1.00 0.00 ? 477 PHE A HD1  5  
ATOM   6567  H  HD2  . PHE A 1 56 ? -0.836  -3.040  1.900   1.00 0.00 ? 477 PHE A HD2  5  
ATOM   6568  H  HE1  . PHE A 1 56 ? 0.204   -5.317  -2.334  1.00 0.00 ? 477 PHE A HE1  5  
ATOM   6569  H  HE2  . PHE A 1 56 ? -1.134  -1.856  -0.236  1.00 0.00 ? 477 PHE A HE2  5  
ATOM   6570  H  HZ   . PHE A 1 56 ? -0.615  -2.995  -2.357  1.00 0.00 ? 477 PHE A HZ   5  
ATOM   6571  N  N    . SER A 1 57 ? 1.045   -8.430  3.153   1.00 0.00 ? 478 SER A N    5  
ATOM   6572  C  CA   . SER A 1 57 ? 1.721   -9.290  4.118   1.00 0.00 ? 478 SER A CA   5  
ATOM   6573  C  C    . SER A 1 57 ? 2.527   -8.461  5.113   1.00 0.00 ? 478 SER A C    5  
ATOM   6574  O  O    . SER A 1 57 ? 3.120   -7.443  4.755   1.00 0.00 ? 478 SER A O    5  
ATOM   6575  C  CB   . SER A 1 57 ? 2.640   -10.277 3.396   1.00 0.00 ? 478 SER A CB   5  
ATOM   6576  O  OG   . SER A 1 57 ? 1.891   -11.282 2.735   1.00 0.00 ? 478 SER A OG   5  
ATOM   6577  H  H    . SER A 1 57 ? 1.425   -8.327  2.255   1.00 0.00 ? 478 SER A H    5  
ATOM   6578  H  HA   . SER A 1 57 ? 0.965   -9.842  4.656   1.00 0.00 ? 478 SER A HA   5  
ATOM   6579  H  HB2  . SER A 1 57 ? 3.231   -9.746  2.665   1.00 0.00 ? 478 SER A HB2  5  
ATOM   6580  H  HB3  . SER A 1 57 ? 3.295   -10.747 4.116   1.00 0.00 ? 478 SER A HB3  5  
ATOM   6581  H  HG   . SER A 1 57 ? 2.008   -11.196 1.786   1.00 0.00 ? 478 SER A HG   5  
ATOM   6582  N  N    . HIS A 1 58 ? 2.544   -8.904  6.366   1.00 0.00 ? 479 HIS A N    5  
ATOM   6583  C  CA   . HIS A 1 58 ? 3.277   -8.205  7.415   1.00 0.00 ? 479 HIS A CA   5  
ATOM   6584  C  C    . HIS A 1 58 ? 4.420   -9.065  7.946   1.00 0.00 ? 479 HIS A C    5  
ATOM   6585  O  O    . HIS A 1 58 ? 4.736   -9.030  9.135   1.00 0.00 ? 479 HIS A O    5  
ATOM   6586  C  CB   . HIS A 1 58 ? 2.336   -7.825  8.559   1.00 0.00 ? 479 HIS A CB   5  
ATOM   6587  C  CG   . HIS A 1 58 ? 1.405   -6.701  8.220   1.00 0.00 ? 479 HIS A CG   5  
ATOM   6588  N  ND1  . HIS A 1 58 ? 0.668   -6.023  9.168   1.00 0.00 ? 479 HIS A ND1  5  
ATOM   6589  C  CD2  . HIS A 1 58 ? 1.094   -6.137  7.029   1.00 0.00 ? 479 HIS A CD2  5  
ATOM   6590  C  CE1  . HIS A 1 58 ? -0.057  -5.091  8.574   1.00 0.00 ? 479 HIS A CE1  5  
ATOM   6591  N  NE2  . HIS A 1 58 ? 0.184   -5.139  7.277   1.00 0.00 ? 479 HIS A NE2  5  
ATOM   6592  H  H    . HIS A 1 58 ? 2.051   -9.721  6.590   1.00 0.00 ? 479 HIS A H    5  
ATOM   6593  H  HA   . HIS A 1 58 ? 3.690   -7.304  6.987   1.00 0.00 ? 479 HIS A HA   5  
ATOM   6594  H  HB2  . HIS A 1 58 ? 1.736   -8.683  8.823   1.00 0.00 ? 479 HIS A HB2  5  
ATOM   6595  H  HB3  . HIS A 1 58 ? 2.922   -7.524  9.415   1.00 0.00 ? 479 HIS A HB3  5  
ATOM   6596  H  HD1  . HIS A 1 58 ? 0.674   -6.199  10.131  1.00 0.00 ? 479 HIS A HD1  5  
ATOM   6597  H  HD2  . HIS A 1 58 ? 1.488   -6.420  6.063   1.00 0.00 ? 479 HIS A HD2  5  
ATOM   6598  H  HE1  . HIS A 1 58 ? -0.731  -4.406  9.066   1.00 0.00 ? 479 HIS A HE1  5  
ATOM   6599  N  N    . ASP A 1 59 ? 5.034   -9.838  7.057   1.00 0.00 ? 480 ASP A N    5  
ATOM   6600  C  CA   . ASP A 1 59 ? 6.142   -10.707 7.435   1.00 0.00 ? 480 ASP A CA   5  
ATOM   6601  C  C    . ASP A 1 59 ? 7.406   -9.894  7.698   1.00 0.00 ? 480 ASP A C    5  
ATOM   6602  O  O    . ASP A 1 59 ? 7.534   -8.746  7.274   1.00 0.00 ? 480 ASP A O    5  
ATOM   6603  C  CB   . ASP A 1 59 ? 6.404   -11.741 6.339   1.00 0.00 ? 480 ASP A CB   5  
ATOM   6604  C  CG   . ASP A 1 59 ? 5.602   -13.012 6.538   1.00 0.00 ? 480 ASP A CG   5  
ATOM   6605  O  OD1  . ASP A 1 59 ? 5.215   -13.294 7.691   1.00 0.00 ? 480 ASP A OD1  5  
ATOM   6606  O  OD2  . ASP A 1 59 ? 5.362   -13.725 5.541   1.00 0.00 ? 480 ASP A OD2  5  
ATOM   6607  H  H    . ASP A 1 59 ? 4.736   -9.822  6.123   1.00 0.00 ? 480 ASP A H    5  
ATOM   6608  H  HA   . ASP A 1 59 ? 5.865   -11.221 8.343   1.00 0.00 ? 480 ASP A HA   5  
ATOM   6609  H  HB2  . ASP A 1 59 ? 6.139   -11.317 5.382   1.00 0.00 ? 480 ASP A HB2  5  
ATOM   6610  H  HB3  . ASP A 1 59 ? 7.454   -11.996 6.337   1.00 0.00 ? 480 ASP A HB3  5  
ATOM   6611  N  N    . PRO A 1 60 ? 8.362   -10.503 8.415   1.00 0.00 ? 481 PRO A N    5  
ATOM   6612  C  CA   . PRO A 1 60 ? 9.633   -9.854  8.751   1.00 0.00 ? 481 PRO A CA   5  
ATOM   6613  C  C    . PRO A 1 60 ? 10.529  -9.667  7.531   1.00 0.00 ? 481 PRO A C    5  
ATOM   6614  O  O    . PRO A 1 60 ? 10.963  -10.639 6.912   1.00 0.00 ? 481 PRO A O    5  
ATOM   6615  C  CB   . PRO A 1 60 ? 10.277  -10.825 9.743   1.00 0.00 ? 481 PRO A CB   5  
ATOM   6616  C  CG   . PRO A 1 60 ? 9.680   -12.151 9.416   1.00 0.00 ? 481 PRO A CG   5  
ATOM   6617  C  CD   . PRO A 1 60 ? 8.278   -11.871 8.952   1.00 0.00 ? 481 PRO A CD   5  
ATOM   6618  H  HA   . PRO A 1 60 ? 9.476   -8.898  9.231   1.00 0.00 ? 481 PRO A HA   5  
ATOM   6619  H  HB2  . PRO A 1 60 ? 11.349  -10.828 9.605   1.00 0.00 ? 481 PRO A HB2  5  
ATOM   6620  H  HB3  . PRO A 1 60 ? 10.039  -10.525 10.753  1.00 0.00 ? 481 PRO A HB3  5  
ATOM   6621  H  HG2  . PRO A 1 60 ? 10.248  -12.624 8.629   1.00 0.00 ? 481 PRO A HG2  5  
ATOM   6622  H  HG3  . PRO A 1 60 ? 9.666   -12.774 10.297  1.00 0.00 ? 481 PRO A HG3  5  
ATOM   6623  H  HD2  . PRO A 1 60 ? 7.988   -12.570 8.182   1.00 0.00 ? 481 PRO A HD2  5  
ATOM   6624  H  HD3  . PRO A 1 60 ? 7.590   -11.916 9.784   1.00 0.00 ? 481 PRO A HD3  5  
ATOM   6625  N  N    . LEU A 1 61 ? 10.803  -8.412  7.191   1.00 0.00 ? 482 LEU A N    5  
ATOM   6626  C  CA   . LEU A 1 61 ? 11.648  -8.098  6.044   1.00 0.00 ? 482 LEU A CA   5  
ATOM   6627  C  C    . LEU A 1 61 ? 12.834  -9.053  5.964   1.00 0.00 ? 482 LEU A C    5  
ATOM   6628  O  O    . LEU A 1 61 ? 13.359  -9.497  6.986   1.00 0.00 ? 482 LEU A O    5  
ATOM   6629  C  CB   . LEU A 1 61 ? 12.147  -6.654  6.134   1.00 0.00 ? 482 LEU A CB   5  
ATOM   6630  C  CG   . LEU A 1 61 ? 11.154  -5.573  5.704   1.00 0.00 ? 482 LEU A CG   5  
ATOM   6631  C  CD1  . LEU A 1 61 ? 11.739  -4.189  5.938   1.00 0.00 ? 482 LEU A CD1  5  
ATOM   6632  C  CD2  . LEU A 1 61 ? 10.771  -5.753  4.243   1.00 0.00 ? 482 LEU A CD2  5  
ATOM   6633  H  H    . LEU A 1 61 ? 10.428  -7.679  7.722   1.00 0.00 ? 482 LEU A H    5  
ATOM   6634  H  HA   . LEU A 1 61 ? 11.051  -8.209  5.152   1.00 0.00 ? 482 LEU A HA   5  
ATOM   6635  H  HB2  . LEU A 1 61 ? 12.421  -6.462  7.160   1.00 0.00 ? 482 LEU A HB2  5  
ATOM   6636  H  HB3  . LEU A 1 61 ? 13.023  -6.568  5.507   1.00 0.00 ? 482 LEU A HB3  5  
ATOM   6637  H  HG   . LEU A 1 61 ? 10.256  -5.661  6.300   1.00 0.00 ? 482 LEU A HG   5  
ATOM   6638  H  HD11 . LEU A 1 61 ? 12.029  -4.091  6.973   1.00 0.00 ? 482 LEU A HD11 5  
ATOM   6639  H  HD12 . LEU A 1 61 ? 10.997  -3.441  5.700   1.00 0.00 ? 482 LEU A HD12 5  
ATOM   6640  H  HD13 . LEU A 1 61 ? 12.604  -4.052  5.306   1.00 0.00 ? 482 LEU A HD13 5  
ATOM   6641  H  HD21 . LEU A 1 61 ? 10.558  -4.788  3.806   1.00 0.00 ? 482 LEU A HD21 5  
ATOM   6642  H  HD22 . LEU A 1 61 ? 9.893   -6.379  4.175   1.00 0.00 ? 482 LEU A HD22 5  
ATOM   6643  H  HD23 . LEU A 1 61 ? 11.587  -6.217  3.711   1.00 0.00 ? 482 LEU A HD23 5  
ATOM   6644  N  N    . THR A 1 62 ? 13.254  -9.366  4.742   1.00 0.00 ? 483 THR A N    5  
ATOM   6645  C  CA   . THR A 1 62 ? 14.379  -10.268 4.528   1.00 0.00 ? 483 THR A CA   5  
ATOM   6646  C  C    . THR A 1 62 ? 15.446  -9.618  3.654   1.00 0.00 ? 483 THR A C    5  
ATOM   6647  O  O    . THR A 1 62 ? 15.157  -8.704  2.883   1.00 0.00 ? 483 THR A O    5  
ATOM   6648  C  CB   . THR A 1 62 ? 13.925  -11.585 3.870   1.00 0.00 ? 483 THR A CB   5  
ATOM   6649  O  OG1  . THR A 1 62 ? 13.323  -11.316 2.600   1.00 0.00 ? 483 THR A OG1  5  
ATOM   6650  C  CG2  . THR A 1 62 ? 12.936  -12.322 4.761   1.00 0.00 ? 483 THR A CG2  5  
ATOM   6651  H  H    . THR A 1 62 ? 12.795  -8.981  3.967   1.00 0.00 ? 483 THR A H    5  
ATOM   6652  H  HA   . THR A 1 62 ? 14.808  -10.500 5.491   1.00 0.00 ? 483 THR A HA   5  
ATOM   6653  H  HB   . THR A 1 62 ? 14.792  -12.214 3.724   1.00 0.00 ? 483 THR A HB   5  
ATOM   6654  H  HG1  . THR A 1 62 ? 14.005  -11.267 1.926   1.00 0.00 ? 483 THR A HG1  5  
ATOM   6655  H  HG21 . THR A 1 62 ? 12.344  -11.605 5.312   1.00 0.00 ? 483 THR A HG21 5  
ATOM   6656  H  HG22 . THR A 1 62 ? 13.474  -12.952 5.453   1.00 0.00 ? 483 THR A HG22 5  
ATOM   6657  H  HG23 . THR A 1 62 ? 12.286  -12.930 4.150   1.00 0.00 ? 483 THR A HG23 5  
ATOM   6658  N  N    . GLU A 1 63 ? 16.680  -10.097 3.780   1.00 0.00 ? 484 GLU A N    5  
ATOM   6659  C  CA   . GLU A 1 63 ? 17.789  -9.561  3.001   1.00 0.00 ? 484 GLU A CA   5  
ATOM   6660  C  C    . GLU A 1 63 ? 17.358  -9.273  1.566   1.00 0.00 ? 484 GLU A C    5  
ATOM   6661  O  O    . GLU A 1 63 ? 17.839  -8.329  0.940   1.00 0.00 ? 484 GLU A O    5  
ATOM   6662  C  CB   . GLU A 1 63 ? 18.964  -10.541 3.005   1.00 0.00 ? 484 GLU A CB   5  
ATOM   6663  C  CG   . GLU A 1 63 ? 20.098  -10.137 2.077   1.00 0.00 ? 484 GLU A CG   5  
ATOM   6664  C  CD   . GLU A 1 63 ? 20.775  -8.851  2.510   1.00 0.00 ? 484 GLU A CD   5  
ATOM   6665  O  OE1  . GLU A 1 63 ? 21.469  -8.866  3.548   1.00 0.00 ? 484 GLU A OE1  5  
ATOM   6666  O  OE2  . GLU A 1 63 ? 20.610  -7.829  1.812   1.00 0.00 ? 484 GLU A OE2  5  
ATOM   6667  H  H    . GLU A 1 63 ? 16.847  -10.827 4.412   1.00 0.00 ? 484 GLU A H    5  
ATOM   6668  H  HA   . GLU A 1 63 ? 18.103  -8.637  3.462   1.00 0.00 ? 484 GLU A HA   5  
ATOM   6669  H  HB2  . GLU A 1 63 ? 19.356  -10.612 4.009   1.00 0.00 ? 484 GLU A HB2  5  
ATOM   6670  H  HB3  . GLU A 1 63 ? 18.607  -11.514 2.698   1.00 0.00 ? 484 GLU A HB3  5  
ATOM   6671  H  HG2  . GLU A 1 63 ? 20.834  -10.926 2.064   1.00 0.00 ? 484 GLU A HG2  5  
ATOM   6672  H  HG3  . GLU A 1 63 ? 19.700  -10.000 1.082   1.00 0.00 ? 484 GLU A HG3  5  
ATOM   6673  N  N    . GLU A 1 64 ? 16.448  -10.095 1.052   1.00 0.00 ? 485 GLU A N    5  
ATOM   6674  C  CA   . GLU A 1 64 ? 15.952  -9.929  -0.310  1.00 0.00 ? 485 GLU A CA   5  
ATOM   6675  C  C    . GLU A 1 64 ? 14.883  -8.842  -0.371  1.00 0.00 ? 485 GLU A C    5  
ATOM   6676  O  O    . GLU A 1 64 ? 15.136  -7.731  -0.840  1.00 0.00 ? 485 GLU A O    5  
ATOM   6677  C  CB   . GLU A 1 64 ? 15.383  -11.249 -0.833  1.00 0.00 ? 485 GLU A CB   5  
ATOM   6678  C  CG   . GLU A 1 64 ? 16.449  -12.263 -1.214  1.00 0.00 ? 485 GLU A CG   5  
ATOM   6679  C  CD   . GLU A 1 64 ? 17.279  -11.818 -2.404  1.00 0.00 ? 485 GLU A CD   5  
ATOM   6680  O  OE1  . GLU A 1 64 ? 16.722  -11.745 -3.519  1.00 0.00 ? 485 GLU A OE1  5  
ATOM   6681  O  OE2  . GLU A 1 64 ? 18.483  -11.544 -2.219  1.00 0.00 ? 485 GLU A OE2  5  
ATOM   6682  H  H    . GLU A 1 64 ? 16.102  -10.829 1.600   1.00 0.00 ? 485 GLU A H    5  
ATOM   6683  H  HA   . GLU A 1 64 ? 16.784  -9.634  -0.932  1.00 0.00 ? 485 GLU A HA   5  
ATOM   6684  H  HB2  . GLU A 1 64 ? 14.757  -11.686 -0.069  1.00 0.00 ? 485 GLU A HB2  5  
ATOM   6685  H  HB3  . GLU A 1 64 ? 14.781  -11.046 -1.707  1.00 0.00 ? 485 GLU A HB3  5  
ATOM   6686  H  HG2  . GLU A 1 64 ? 17.107  -12.409 -0.371  1.00 0.00 ? 485 GLU A HG2  5  
ATOM   6687  H  HG3  . GLU A 1 64 ? 15.968  -13.198 -1.459  1.00 0.00 ? 485 GLU A HG3  5  
ATOM   6688  N  N    . THR A 1 65 ? 13.686  -9.170  0.106   1.00 0.00 ? 486 THR A N    5  
ATOM   6689  C  CA   . THR A 1 65 ? 12.578  -8.224  0.104   1.00 0.00 ? 486 THR A CA   5  
ATOM   6690  C  C    . THR A 1 65 ? 13.045  -6.828  0.500   1.00 0.00 ? 486 THR A C    5  
ATOM   6691  O  O    . THR A 1 65 ? 12.744  -5.846  -0.179  1.00 0.00 ? 486 THR A O    5  
ATOM   6692  C  CB   . THR A 1 65 ? 11.458  -8.669  1.063   1.00 0.00 ? 486 THR A CB   5  
ATOM   6693  O  OG1  . THR A 1 65 ? 12.013  -9.022  2.335   1.00 0.00 ? 486 THR A OG1  5  
ATOM   6694  C  CG2  . THR A 1 65 ? 10.695  -9.854  0.491   1.00 0.00 ? 486 THR A CG2  5  
ATOM   6695  H  H    . THR A 1 65 ? 13.547  -10.070 0.466   1.00 0.00 ? 486 THR A H    5  
ATOM   6696  H  HA   . THR A 1 65 ? 12.172  -8.186  -0.897  1.00 0.00 ? 486 THR A HA   5  
ATOM   6697  H  HB   . THR A 1 65 ? 10.769  -7.846  1.195   1.00 0.00 ? 486 THR A HB   5  
ATOM   6698  H  HG1  . THR A 1 65 ? 12.095  -9.977  2.395   1.00 0.00 ? 486 THR A HG1  5  
ATOM   6699  H  HG21 . THR A 1 65 ? 10.684  -9.789  -0.587  1.00 0.00 ? 486 THR A HG21 5  
ATOM   6700  H  HG22 . THR A 1 65 ? 9.681   -9.843  0.863   1.00 0.00 ? 486 THR A HG22 5  
ATOM   6701  H  HG23 . THR A 1 65 ? 11.178  -10.771 0.791   1.00 0.00 ? 486 THR A HG23 5  
ATOM   6702  N  N    . ARG A 1 66 ? 13.783  -6.747  1.603   1.00 0.00 ? 487 ARG A N    5  
ATOM   6703  C  CA   . ARG A 1 66 ? 14.292  -5.470  2.090   1.00 0.00 ? 487 ARG A CA   5  
ATOM   6704  C  C    . ARG A 1 66 ? 14.773  -4.600  0.932   1.00 0.00 ? 487 ARG A C    5  
ATOM   6705  O  O    . ARG A 1 66 ? 14.448  -3.415  0.858   1.00 0.00 ? 487 ARG A O    5  
ATOM   6706  C  CB   . ARG A 1 66 ? 15.435  -5.697  3.080   1.00 0.00 ? 487 ARG A CB   5  
ATOM   6707  C  CG   . ARG A 1 66 ? 15.578  -4.588  4.110   1.00 0.00 ? 487 ARG A CG   5  
ATOM   6708  C  CD   . ARG A 1 66 ? 16.291  -3.377  3.528   1.00 0.00 ? 487 ARG A CD   5  
ATOM   6709  N  NE   . ARG A 1 66 ? 16.293  -2.247  4.453   1.00 0.00 ? 487 ARG A NE   5  
ATOM   6710  C  CZ   . ARG A 1 66 ? 15.286  -1.388  4.566   1.00 0.00 ? 487 ARG A CZ   5  
ATOM   6711  N  NH1  . ARG A 1 66 ? 14.202  -1.530  3.816   1.00 0.00 ? 487 ARG A NH1  5  
ATOM   6712  N  NH2  . ARG A 1 66 ? 15.362  -0.384  5.431   1.00 0.00 ? 487 ARG A NH2  5  
ATOM   6713  H  H    . ARG A 1 66 ? 13.989  -7.565  2.102   1.00 0.00 ? 487 ARG A H    5  
ATOM   6714  H  HA   . ARG A 1 66 ? 13.484  -4.962  2.595   1.00 0.00 ? 487 ARG A HA   5  
ATOM   6715  H  HB2  . ARG A 1 66 ? 15.262  -6.625  3.606   1.00 0.00 ? 487 ARG A HB2  5  
ATOM   6716  H  HB3  . ARG A 1 66 ? 16.362  -5.771  2.531   1.00 0.00 ? 487 ARG A HB3  5  
ATOM   6717  H  HG2  . ARG A 1 66 ? 14.595  -4.288  4.441   1.00 0.00 ? 487 ARG A HG2  5  
ATOM   6718  H  HG3  . ARG A 1 66 ? 16.146  -4.960  4.949   1.00 0.00 ? 487 ARG A HG3  5  
ATOM   6719  H  HD2  . ARG A 1 66 ? 17.312  -3.649  3.305   1.00 0.00 ? 487 ARG A HD2  5  
ATOM   6720  H  HD3  . ARG A 1 66 ? 15.789  -3.084  2.618   1.00 0.00 ? 487 ARG A HD3  5  
ATOM   6721  H  HE   . ARG A 1 66 ? 17.084  -2.123  5.017   1.00 0.00 ? 487 ARG A HE   5  
ATOM   6722  H  HH11 . ARG A 1 66 ? 14.141  -2.285  3.165   1.00 0.00 ? 487 ARG A HH11 5  
ATOM   6723  H  HH12 . ARG A 1 66 ? 13.444  -0.882  3.904   1.00 0.00 ? 487 ARG A HH12 5  
ATOM   6724  H  HH21 . ARG A 1 66 ? 16.178  -0.274  5.998   1.00 0.00 ? 487 ARG A HH21 5  
ATOM   6725  H  HH22 . ARG A 1 66 ? 14.604  0.262   5.515   1.00 0.00 ? 487 ARG A HH22 5  
ATOM   6726  N  N    . GLU A 1 67 ? 15.548  -5.196  0.032   1.00 0.00 ? 488 GLU A N    5  
ATOM   6727  C  CA   . GLU A 1 67 ? 16.074  -4.474  -1.120  1.00 0.00 ? 488 GLU A CA   5  
ATOM   6728  C  C    . GLU A 1 67 ? 14.942  -3.968  -2.008  1.00 0.00 ? 488 GLU A C    5  
ATOM   6729  O  O    . GLU A 1 67 ? 14.943  -2.814  -2.439  1.00 0.00 ? 488 GLU A O    5  
ATOM   6730  C  CB   . GLU A 1 67 ? 17.009  -5.374  -1.931  1.00 0.00 ? 488 GLU A CB   5  
ATOM   6731  C  CG   . GLU A 1 67 ? 18.399  -5.506  -1.331  1.00 0.00 ? 488 GLU A CG   5  
ATOM   6732  C  CD   . GLU A 1 67 ? 19.471  -5.718  -2.382  1.00 0.00 ? 488 GLU A CD   5  
ATOM   6733  O  OE1  . GLU A 1 67 ? 19.180  -6.384  -3.398  1.00 0.00 ? 488 GLU A OE1  5  
ATOM   6734  O  OE2  . GLU A 1 67 ? 20.599  -5.220  -2.189  1.00 0.00 ? 488 GLU A OE2  5  
ATOM   6735  H  H    . GLU A 1 67 ? 15.772  -6.143  0.146   1.00 0.00 ? 488 GLU A H    5  
ATOM   6736  H  HA   . GLU A 1 67 ? 16.634  -3.627  -0.754  1.00 0.00 ? 488 GLU A HA   5  
ATOM   6737  H  HB2  . GLU A 1 67 ? 16.573  -6.360  -1.996  1.00 0.00 ? 488 GLU A HB2  5  
ATOM   6738  H  HB3  . GLU A 1 67 ? 17.107  -4.967  -2.926  1.00 0.00 ? 488 GLU A HB3  5  
ATOM   6739  H  HG2  . GLU A 1 67 ? 18.628  -4.603  -0.783  1.00 0.00 ? 488 GLU A HG2  5  
ATOM   6740  H  HG3  . GLU A 1 67 ? 18.407  -6.347  -0.654  1.00 0.00 ? 488 GLU A HG3  5  
ATOM   6741  N  N    . LEU A 1 68 ? 13.976  -4.839  -2.280  1.00 0.00 ? 489 LEU A N    5  
ATOM   6742  C  CA   . LEU A 1 68 ? 12.836  -4.482  -3.117  1.00 0.00 ? 489 LEU A CA   5  
ATOM   6743  C  C    . LEU A 1 68 ? 12.274  -3.121  -2.721  1.00 0.00 ? 489 LEU A C    5  
ATOM   6744  O  O    . LEU A 1 68 ? 12.278  -2.180  -3.516  1.00 0.00 ? 489 LEU A O    5  
ATOM   6745  C  CB   . LEU A 1 68 ? 11.745  -5.548  -3.009  1.00 0.00 ? 489 LEU A CB   5  
ATOM   6746  C  CG   . LEU A 1 68 ? 12.131  -6.953  -3.474  1.00 0.00 ? 489 LEU A CG   5  
ATOM   6747  C  CD1  . LEU A 1 68 ? 11.047  -7.954  -3.104  1.00 0.00 ? 489 LEU A CD1  5  
ATOM   6748  C  CD2  . LEU A 1 68 ? 12.384  -6.968  -4.974  1.00 0.00 ? 489 LEU A CD2  5  
ATOM   6749  H  H    . LEU A 1 68 ? 14.030  -5.744  -1.908  1.00 0.00 ? 489 LEU A H    5  
ATOM   6750  H  HA   . LEU A 1 68 ? 13.180  -4.432  -4.140  1.00 0.00 ? 489 LEU A HA   5  
ATOM   6751  H  HB2  . LEU A 1 68 ? 11.447  -5.613  -1.974  1.00 0.00 ? 489 LEU A HB2  5  
ATOM   6752  H  HB3  . LEU A 1 68 ? 10.904  -5.221  -3.605  1.00 0.00 ? 489 LEU A HB3  5  
ATOM   6753  H  HG   . LEU A 1 68 ? 13.044  -7.252  -2.976  1.00 0.00 ? 489 LEU A HG   5  
ATOM   6754  H  HD11 . LEU A 1 68 ? 11.503  -8.895  -2.834  1.00 0.00 ? 489 LEU A HD11 5  
ATOM   6755  H  HD12 . LEU A 1 68 ? 10.390  -8.101  -3.948  1.00 0.00 ? 489 LEU A HD12 5  
ATOM   6756  H  HD13 . LEU A 1 68 ? 10.478  -7.576  -2.267  1.00 0.00 ? 489 LEU A HD13 5  
ATOM   6757  H  HD21 . LEU A 1 68 ? 11.877  -6.133  -5.433  1.00 0.00 ? 489 LEU A HD21 5  
ATOM   6758  H  HD22 . LEU A 1 68 ? 12.009  -7.891  -5.393  1.00 0.00 ? 489 LEU A HD22 5  
ATOM   6759  H  HD23 . LEU A 1 68 ? 13.445  -6.893  -5.161  1.00 0.00 ? 489 LEU A HD23 5  
ATOM   6760  N  N    . LEU A 1 69 ? 11.794  -3.022  -1.486  1.00 0.00 ? 490 LEU A N    5  
ATOM   6761  C  CA   . LEU A 1 69 ? 11.230  -1.775  -0.982  1.00 0.00 ? 490 LEU A CA   5  
ATOM   6762  C  C    . LEU A 1 69 ? 12.076  -0.581  -1.414  1.00 0.00 ? 490 LEU A C    5  
ATOM   6763  O  O    . LEU A 1 69 ? 11.600  0.306   -2.122  1.00 0.00 ? 490 LEU A O    5  
ATOM   6764  C  CB   . LEU A 1 69 ? 11.130  -1.817  0.544   1.00 0.00 ? 490 LEU A CB   5  
ATOM   6765  C  CG   . LEU A 1 69 ? 9.967   -2.627  1.118   1.00 0.00 ? 490 LEU A CG   5  
ATOM   6766  C  CD1  . LEU A 1 69 ? 10.065  -2.702  2.634   1.00 0.00 ? 490 LEU A CD1  5  
ATOM   6767  C  CD2  . LEU A 1 69 ? 8.636   -2.020  0.697   1.00 0.00 ? 490 LEU A CD2  5  
ATOM   6768  H  H    . LEU A 1 69 ? 11.819  -3.806  -0.899  1.00 0.00 ? 490 LEU A H    5  
ATOM   6769  H  HA   . LEU A 1 69 ? 10.239  -1.667  -1.397  1.00 0.00 ? 490 LEU A HA   5  
ATOM   6770  H  HB2  . LEU A 1 69 ? 12.047  -2.241  0.924   1.00 0.00 ? 490 LEU A HB2  5  
ATOM   6771  H  HB3  . LEU A 1 69 ? 11.033  -0.800  0.897   1.00 0.00 ? 490 LEU A HB3  5  
ATOM   6772  H  HG   . LEU A 1 69 ? 10.013  -3.636  0.731   1.00 0.00 ? 490 LEU A HG   5  
ATOM   6773  H  HD11 . LEU A 1 69 ? 9.863   -1.729  3.056   1.00 0.00 ? 490 LEU A HD11 5  
ATOM   6774  H  HD12 . LEU A 1 69 ? 11.058  -3.017  2.915   1.00 0.00 ? 490 LEU A HD12 5  
ATOM   6775  H  HD13 . LEU A 1 69 ? 9.342   -3.413  3.006   1.00 0.00 ? 490 LEU A HD13 5  
ATOM   6776  H  HD21 . LEU A 1 69 ? 8.816   -1.153  0.079   1.00 0.00 ? 490 LEU A HD21 5  
ATOM   6777  H  HD22 . LEU A 1 69 ? 8.080   -1.727  1.576   1.00 0.00 ? 490 LEU A HD22 5  
ATOM   6778  H  HD23 . LEU A 1 69 ? 8.069   -2.750  0.138   1.00 0.00 ? 490 LEU A HD23 5  
ATOM   6779  N  N    . ASP A 1 70 ? 13.333  -0.567  -0.984  1.00 0.00 ? 491 ASP A N    5  
ATOM   6780  C  CA   . ASP A 1 70 ? 14.247  0.516   -1.329  1.00 0.00 ? 491 ASP A CA   5  
ATOM   6781  C  C    . ASP A 1 70 ? 14.053  0.949   -2.779  1.00 0.00 ? 491 ASP A C    5  
ATOM   6782  O  O    . ASP A 1 70 ? 13.953  2.140   -3.075  1.00 0.00 ? 491 ASP A O    5  
ATOM   6783  C  CB   . ASP A 1 70 ? 15.696  0.081   -1.103  1.00 0.00 ? 491 ASP A CB   5  
ATOM   6784  C  CG   . ASP A 1 70 ? 15.973  -0.278  0.344   1.00 0.00 ? 491 ASP A CG   5  
ATOM   6785  O  OD1  . ASP A 1 70 ? 15.072  -0.843  0.998   1.00 0.00 ? 491 ASP A OD1  5  
ATOM   6786  O  OD2  . ASP A 1 70 ? 17.091  0.007   0.822   1.00 0.00 ? 491 ASP A OD2  5  
ATOM   6787  H  H    . ASP A 1 70 ? 13.654  -1.303  -0.422  1.00 0.00 ? 491 ASP A H    5  
ATOM   6788  H  HA   . ASP A 1 70 ? 14.027  1.354   -0.685  1.00 0.00 ? 491 ASP A HA   5  
ATOM   6789  H  HB2  . ASP A 1 70 ? 15.905  -0.784  -1.715  1.00 0.00 ? 491 ASP A HB2  5  
ATOM   6790  H  HB3  . ASP A 1 70 ? 16.355  0.887   -1.389  1.00 0.00 ? 491 ASP A HB3  5  
ATOM   6791  N  N    . LYS A 1 71 ? 14.002  -0.026  -3.681  1.00 0.00 ? 492 LYS A N    5  
ATOM   6792  C  CA   . LYS A 1 71 ? 13.821  0.253   -5.100  1.00 0.00 ? 492 LYS A CA   5  
ATOM   6793  C  C    . LYS A 1 71 ? 12.423  0.798   -5.373  1.00 0.00 ? 492 LYS A C    5  
ATOM   6794  O  O    . LYS A 1 71 ? 12.256  1.754   -6.130  1.00 0.00 ? 492 LYS A O    5  
ATOM   6795  C  CB   . LYS A 1 71 ? 14.056  -1.015  -5.924  1.00 0.00 ? 492 LYS A CB   5  
ATOM   6796  C  CG   . LYS A 1 71 ? 14.310  -0.745  -7.397  1.00 0.00 ? 492 LYS A CG   5  
ATOM   6797  C  CD   . LYS A 1 71 ? 15.689  -0.148  -7.624  1.00 0.00 ? 492 LYS A CD   5  
ATOM   6798  C  CE   . LYS A 1 71 ? 16.215  -0.472  -9.014  1.00 0.00 ? 492 LYS A CE   5  
ATOM   6799  N  NZ   . LYS A 1 71 ? 16.591  -1.907  -9.144  1.00 0.00 ? 492 LYS A NZ   5  
ATOM   6800  H  H    . LYS A 1 71 ? 14.089  -0.956  -3.384  1.00 0.00 ? 492 LYS A H    5  
ATOM   6801  H  HA   . LYS A 1 71 ? 14.547  0.999   -5.388  1.00 0.00 ? 492 LYS A HA   5  
ATOM   6802  H  HB2  . LYS A 1 71 ? 14.911  -1.538  -5.522  1.00 0.00 ? 492 LYS A HB2  5  
ATOM   6803  H  HB3  . LYS A 1 71 ? 13.185  -1.650  -5.842  1.00 0.00 ? 492 LYS A HB3  5  
ATOM   6804  H  HG2  . LYS A 1 71 ? 14.238  -1.674  -7.942  1.00 0.00 ? 492 LYS A HG2  5  
ATOM   6805  H  HG3  . LYS A 1 71 ? 13.564  -0.053  -7.761  1.00 0.00 ? 492 LYS A HG3  5  
ATOM   6806  H  HD2  . LYS A 1 71 ? 15.630  0.925   -7.516  1.00 0.00 ? 492 LYS A HD2  5  
ATOM   6807  H  HD3  . LYS A 1 71 ? 16.371  -0.549  -6.888  1.00 0.00 ? 492 LYS A HD3  5  
ATOM   6808  H  HE2  . LYS A 1 71 ? 15.447  -0.243  -9.738  1.00 0.00 ? 492 LYS A HE2  5  
ATOM   6809  H  HE3  . LYS A 1 71 ? 17.085  0.138   -9.207  1.00 0.00 ? 492 LYS A HE3  5  
ATOM   6810  H  HZ1  . LYS A 1 71 ? 17.609  -2.026  -8.969  1.00 0.00 ? 492 LYS A HZ1  5  
ATOM   6811  H  HZ2  . LYS A 1 71 ? 16.373  -2.248  -10.102 1.00 0.00 ? 492 LYS A HZ2  5  
ATOM   6812  H  HZ3  . LYS A 1 71 ? 16.062  -2.479  -8.455  1.00 0.00 ? 492 LYS A HZ3  5  
ATOM   6813  N  N    . MET A 1 72 ? 11.421  0.185   -4.751  1.00 0.00 ? 493 MET A N    5  
ATOM   6814  C  CA   . MET A 1 72 ? 10.038  0.611   -4.925  1.00 0.00 ? 493 MET A CA   5  
ATOM   6815  C  C    . MET A 1 72 ? 9.870   2.080   -4.552  1.00 0.00 ? 493 MET A C    5  
ATOM   6816  O  O    . MET A 1 72 ? 9.475   2.901   -5.382  1.00 0.00 ? 493 MET A O    5  
ATOM   6817  C  CB   . MET A 1 72 ? 9.105   -0.253  -4.074  1.00 0.00 ? 493 MET A CB   5  
ATOM   6818  C  CG   . MET A 1 72 ? 7.639   -0.123  -4.457  1.00 0.00 ? 493 MET A CG   5  
ATOM   6819  S  SD   . MET A 1 72 ? 6.871   1.358   -3.771  1.00 0.00 ? 493 MET A SD   5  
ATOM   6820  C  CE   . MET A 1 72 ? 6.659   0.868   -2.061  1.00 0.00 ? 493 MET A CE   5  
ATOM   6821  H  H    . MET A 1 72 ? 11.617  -0.572  -4.159  1.00 0.00 ? 493 MET A H    5  
ATOM   6822  H  HA   . MET A 1 72 ? 9.781   0.484   -5.966  1.00 0.00 ? 493 MET A HA   5  
ATOM   6823  H  HB2  . MET A 1 72 ? 9.392   -1.288  -4.183  1.00 0.00 ? 493 MET A HB2  5  
ATOM   6824  H  HB3  . MET A 1 72 ? 9.211   0.035   -3.039  1.00 0.00 ? 493 MET A HB3  5  
ATOM   6825  H  HG2  . MET A 1 72 ? 7.563   -0.084  -5.533  1.00 0.00 ? 493 MET A HG2  5  
ATOM   6826  H  HG3  . MET A 1 72 ? 7.108   -0.989  -4.092  1.00 0.00 ? 493 MET A HG3  5  
ATOM   6827  H  HE1  . MET A 1 72 ? 7.350   0.072   -1.826  1.00 0.00 ? 493 MET A HE1  5  
ATOM   6828  H  HE2  . MET A 1 72 ? 6.851   1.714   -1.418  1.00 0.00 ? 493 MET A HE2  5  
ATOM   6829  H  HE3  . MET A 1 72 ? 5.647   0.522   -1.909  1.00 0.00 ? 493 MET A HE3  5  
ATOM   6830  N  N    . LEU A 1 73 ? 10.173  2.406   -3.300  1.00 0.00 ? 494 LEU A N    5  
ATOM   6831  C  CA   . LEU A 1 73 ? 10.056  3.778   -2.817  1.00 0.00 ? 494 LEU A CA   5  
ATOM   6832  C  C    . LEU A 1 73 ? 10.844  4.737   -3.704  1.00 0.00 ? 494 LEU A C    5  
ATOM   6833  O  O    . LEU A 1 73 ? 10.416  5.864   -3.950  1.00 0.00 ? 494 LEU A O    5  
ATOM   6834  C  CB   . LEU A 1 73 ? 10.552  3.875   -1.374  1.00 0.00 ? 494 LEU A CB   5  
ATOM   6835  C  CG   . LEU A 1 73 ? 9.600   3.348   -0.300  1.00 0.00 ? 494 LEU A CG   5  
ATOM   6836  C  CD1  . LEU A 1 73 ? 8.309   4.151   -0.290  1.00 0.00 ? 494 LEU A CD1  5  
ATOM   6837  C  CD2  . LEU A 1 73 ? 9.310   1.871   -0.523  1.00 0.00 ? 494 LEU A CD2  5  
ATOM   6838  H  H    . LEU A 1 73 ? 10.483  1.709   -2.686  1.00 0.00 ? 494 LEU A H    5  
ATOM   6839  H  HA   . LEU A 1 73 ? 9.012   4.053   -2.850  1.00 0.00 ? 494 LEU A HA   5  
ATOM   6840  H  HB2  . LEU A 1 73 ? 11.473  3.317   -1.303  1.00 0.00 ? 494 LEU A HB2  5  
ATOM   6841  H  HB3  . LEU A 1 73 ? 10.748  4.917   -1.162  1.00 0.00 ? 494 LEU A HB3  5  
ATOM   6842  H  HG   . LEU A 1 73 ? 10.067  3.456   0.670   1.00 0.00 ? 494 LEU A HG   5  
ATOM   6843  H  HD11 . LEU A 1 73 ? 7.576   3.662   -0.913  1.00 0.00 ? 494 LEU A HD11 5  
ATOM   6844  H  HD12 . LEU A 1 73 ? 8.500   5.144   -0.670  1.00 0.00 ? 494 LEU A HD12 5  
ATOM   6845  H  HD13 . LEU A 1 73 ? 7.935   4.219   0.721   1.00 0.00 ? 494 LEU A HD13 5  
ATOM   6846  H  HD21 . LEU A 1 73 ? 8.605   1.527   0.219   1.00 0.00 ? 494 LEU A HD21 5  
ATOM   6847  H  HD22 . LEU A 1 73 ? 10.228  1.307   -0.435  1.00 0.00 ? 494 LEU A HD22 5  
ATOM   6848  H  HD23 . LEU A 1 73 ? 8.893   1.731   -1.509  1.00 0.00 ? 494 LEU A HD23 5  
ATOM   6849  N  N    . ALA A 1 74 ? 11.996  4.280   -4.183  1.00 0.00 ? 495 ALA A N    5  
ATOM   6850  C  CA   . ALA A 1 74 ? 12.842  5.095   -5.046  1.00 0.00 ? 495 ALA A CA   5  
ATOM   6851  C  C    . ALA A 1 74 ? 12.081  5.554   -6.285  1.00 0.00 ? 495 ALA A C    5  
ATOM   6852  O  O    . ALA A 1 74 ? 12.202  6.703   -6.709  1.00 0.00 ? 495 ALA A O    5  
ATOM   6853  C  CB   . ALA A 1 74 ? 14.089  4.321   -5.446  1.00 0.00 ? 495 ALA A CB   5  
ATOM   6854  H  H    . ALA A 1 74 ? 12.284  3.372   -3.951  1.00 0.00 ? 495 ALA A H    5  
ATOM   6855  H  HA   . ALA A 1 74 ? 13.152  5.965   -4.484  1.00 0.00 ? 495 ALA A HA   5  
ATOM   6856  H  HB1  . ALA A 1 74 ? 13.801  3.387   -5.906  1.00 0.00 ? 495 ALA A HB1  5  
ATOM   6857  H  HB2  . ALA A 1 74 ? 14.666  4.906   -6.148  1.00 0.00 ? 495 ALA A HB2  5  
ATOM   6858  H  HB3  . ALA A 1 74 ? 14.686  4.121   -4.568  1.00 0.00 ? 495 ALA A HB3  5  
ATOM   6859  N  N    . ASP A 1 75 ? 11.299  4.648   -6.862  1.00 0.00 ? 496 ASP A N    5  
ATOM   6860  C  CA   . ASP A 1 75 ? 10.518  4.960   -8.054  1.00 0.00 ? 496 ASP A CA   5  
ATOM   6861  C  C    . ASP A 1 75 ? 9.708   6.237   -7.853  1.00 0.00 ? 496 ASP A C    5  
ATOM   6862  O  O    . ASP A 1 75 ? 9.681   7.110   -8.722  1.00 0.00 ? 496 ASP A O    5  
ATOM   6863  C  CB   . ASP A 1 75 ? 9.585   3.798   -8.396  1.00 0.00 ? 496 ASP A CB   5  
ATOM   6864  C  CG   . ASP A 1 75 ? 8.483   4.204   -9.356  1.00 0.00 ? 496 ASP A CG   5  
ATOM   6865  O  OD1  . ASP A 1 75 ? 8.790   4.452   -10.541 1.00 0.00 ? 496 ASP A OD1  5  
ATOM   6866  O  OD2  . ASP A 1 75 ? 7.315   4.272   -8.922  1.00 0.00 ? 496 ASP A OD2  5  
ATOM   6867  H  H    . ASP A 1 75 ? 11.245  3.749   -6.477  1.00 0.00 ? 496 ASP A H    5  
ATOM   6868  H  HA   . ASP A 1 75 ? 11.207  5.110   -8.871  1.00 0.00 ? 496 ASP A HA   5  
ATOM   6869  H  HB2  . ASP A 1 75 ? 10.160  3.005   -8.853  1.00 0.00 ? 496 ASP A HB2  5  
ATOM   6870  H  HB3  . ASP A 1 75 ? 9.130   3.431   -7.489  1.00 0.00 ? 496 ASP A HB3  5  
ATOM   6871  N  N    . ASP A 1 76 ? 9.049   6.339   -6.705  1.00 0.00 ? 497 ASP A N    5  
ATOM   6872  C  CA   . ASP A 1 76 ? 8.237   7.510   -6.390  1.00 0.00 ? 497 ASP A CA   5  
ATOM   6873  C  C    . ASP A 1 76 ? 9.117   8.685   -5.974  1.00 0.00 ? 497 ASP A C    5  
ATOM   6874  O  O    . ASP A 1 76 ? 9.048   9.764   -6.562  1.00 0.00 ? 497 ASP A O    5  
ATOM   6875  C  CB   . ASP A 1 76 ? 7.242   7.182   -5.276  1.00 0.00 ? 497 ASP A CB   5  
ATOM   6876  C  CG   . ASP A 1 76 ? 6.631   8.426   -4.662  1.00 0.00 ? 497 ASP A CG   5  
ATOM   6877  O  OD1  . ASP A 1 76 ? 6.174   9.302   -5.426  1.00 0.00 ? 497 ASP A OD1  5  
ATOM   6878  O  OD2  . ASP A 1 76 ? 6.610   8.525   -3.417  1.00 0.00 ? 497 ASP A OD2  5  
ATOM   6879  H  H    . ASP A 1 76 ? 9.109   5.610   -6.052  1.00 0.00 ? 497 ASP A H    5  
ATOM   6880  H  HA   . ASP A 1 76 ? 7.691   7.783   -7.280  1.00 0.00 ? 497 ASP A HA   5  
ATOM   6881  H  HB2  . ASP A 1 76 ? 6.445   6.575   -5.682  1.00 0.00 ? 497 ASP A HB2  5  
ATOM   6882  H  HB3  . ASP A 1 76 ? 7.750   6.631   -4.499  1.00 0.00 ? 497 ASP A HB3  5  
ATOM   6883  N  N    . ALA A 1 77 ? 9.943   8.467   -4.956  1.00 0.00 ? 498 ALA A N    5  
ATOM   6884  C  CA   . ALA A 1 77 ? 10.837  9.507   -4.461  1.00 0.00 ? 498 ALA A CA   5  
ATOM   6885  C  C    . ALA A 1 77 ? 11.533  10.226  -5.612  1.00 0.00 ? 498 ALA A C    5  
ATOM   6886  O  O    . ALA A 1 77 ? 11.511  11.453  -5.693  1.00 0.00 ? 498 ALA A O    5  
ATOM   6887  C  CB   . ALA A 1 77 ? 11.864  8.912   -3.510  1.00 0.00 ? 498 ALA A CB   5  
ATOM   6888  H  H    . ALA A 1 77 ? 9.952   7.586   -4.528  1.00 0.00 ? 498 ALA A H    5  
ATOM   6889  H  HA   . ALA A 1 77 ? 10.243  10.223  -3.910  1.00 0.00 ? 498 ALA A HA   5  
ATOM   6890  H  HB1  . ALA A 1 77 ? 12.285  8.020   -3.949  1.00 0.00 ? 498 ALA A HB1  5  
ATOM   6891  H  HB2  . ALA A 1 77 ? 12.649  9.632   -3.332  1.00 0.00 ? 498 ALA A HB2  5  
ATOM   6892  H  HB3  . ALA A 1 77 ? 11.385  8.662   -2.575  1.00 0.00 ? 498 ALA A HB3  5  
ATOM   6893  N  N    . GLU A 1 78 ? 12.150  9.452   -6.500  1.00 0.00 ? 499 GLU A N    5  
ATOM   6894  C  CA   . GLU A 1 78 ? 12.854  10.016  -7.646  1.00 0.00 ? 499 GLU A CA   5  
ATOM   6895  C  C    . GLU A 1 78 ? 11.932  10.920  -8.460  1.00 0.00 ? 499 GLU A C    5  
ATOM   6896  O  O    . GLU A 1 78 ? 12.258  12.075  -8.730  1.00 0.00 ? 499 GLU A O    5  
ATOM   6897  C  CB   . GLU A 1 78 ? 13.406  8.899   -8.534  1.00 0.00 ? 499 GLU A CB   5  
ATOM   6898  C  CG   . GLU A 1 78 ? 14.324  9.397   -9.637  1.00 0.00 ? 499 GLU A CG   5  
ATOM   6899  C  CD   . GLU A 1 78 ? 15.657  9.891   -9.108  1.00 0.00 ? 499 GLU A CD   5  
ATOM   6900  O  OE1  . GLU A 1 78 ? 16.518  9.044   -8.789  1.00 0.00 ? 499 GLU A OE1  5  
ATOM   6901  O  OE2  . GLU A 1 78 ? 15.839  11.123  -9.012  1.00 0.00 ? 499 GLU A OE2  5  
ATOM   6902  H  H    . GLU A 1 78 ? 12.131  8.479   -6.381  1.00 0.00 ? 499 GLU A H    5  
ATOM   6903  H  HA   . GLU A 1 78 ? 13.677  10.606  -7.271  1.00 0.00 ? 499 GLU A HA   5  
ATOM   6904  H  HB2  . GLU A 1 78 ? 13.959  8.206   -7.918  1.00 0.00 ? 499 GLU A HB2  5  
ATOM   6905  H  HB3  . GLU A 1 78 ? 12.578  8.378   -8.992  1.00 0.00 ? 499 GLU A HB3  5  
ATOM   6906  H  HG2  . GLU A 1 78 ? 14.507  8.588   -10.329 1.00 0.00 ? 499 GLU A HG2  5  
ATOM   6907  H  HG3  . GLU A 1 78 ? 13.836  10.209  -10.155 1.00 0.00 ? 499 GLU A HG3  5  
ATOM   6908  N  N    . ALA A 1 79 ? 10.779  10.384  -8.847  1.00 0.00 ? 500 ALA A N    5  
ATOM   6909  C  CA   . ALA A 1 79 ? 9.809   11.141  -9.629  1.00 0.00 ? 500 ALA A CA   5  
ATOM   6910  C  C    . ALA A 1 79 ? 9.729   12.587  -9.153  1.00 0.00 ? 500 ALA A C    5  
ATOM   6911  O  O    . ALA A 1 79 ? 9.759   13.518  -9.956  1.00 0.00 ? 500 ALA A O    5  
ATOM   6912  C  CB   . ALA A 1 79 ? 8.440   10.482  -9.552  1.00 0.00 ? 500 ALA A CB   5  
ATOM   6913  H  H    . ALA A 1 79 ? 10.576  9.458   -8.601  1.00 0.00 ? 500 ALA A H    5  
ATOM   6914  H  HA   . ALA A 1 79 ? 10.130  11.129  -10.661 1.00 0.00 ? 500 ALA A HA   5  
ATOM   6915  H  HB1  . ALA A 1 79 ? 8.190   10.291  -8.518  1.00 0.00 ? 500 ALA A HB1  5  
ATOM   6916  H  HB2  . ALA A 1 79 ? 7.700   11.137  -9.987  1.00 0.00 ? 500 ALA A HB2  5  
ATOM   6917  H  HB3  . ALA A 1 79 ? 8.459   9.549   -10.096 1.00 0.00 ? 500 ALA A HB3  5  
ATOM   6918  N  N    . GLY A 1 80 ? 9.627   12.768  -7.839  1.00 0.00 ? 501 GLY A N    5  
ATOM   6919  C  CA   . GLY A 1 80 ? 9.543   14.105  -7.279  1.00 0.00 ? 501 GLY A CA   5  
ATOM   6920  C  C    . GLY A 1 80 ? 10.813  14.904  -7.496  1.00 0.00 ? 501 GLY A C    5  
ATOM   6921  O  O    . GLY A 1 80 ? 10.955  15.595  -8.505  1.00 0.00 ? 501 GLY A O    5  
ATOM   6922  H  H    . GLY A 1 80 ? 9.608   11.988  -7.246  1.00 0.00 ? 501 GLY A H    5  
ATOM   6923  H  HA2  . GLY A 1 80 ? 8.718   14.626  -7.741  1.00 0.00 ? 501 GLY A HA2  5  
ATOM   6924  H  HA3  . GLY A 1 80 ? 9.358   14.027  -6.218  1.00 0.00 ? 501 GLY A HA3  5  
ATOM   6925  N  N    . ALA A 1 81 ? 11.737  14.813  -6.546  1.00 0.00 ? 502 ALA A N    5  
ATOM   6926  C  CA   . ALA A 1 81 ? 13.001  15.534  -6.638  1.00 0.00 ? 502 ALA A CA   5  
ATOM   6927  C  C    . ALA A 1 81 ? 14.144  14.593  -7.006  1.00 0.00 ? 502 ALA A C    5  
ATOM   6928  O  O    . ALA A 1 81 ? 13.954  13.382  -7.108  1.00 0.00 ? 502 ALA A O    5  
ATOM   6929  C  CB   . ALA A 1 81 ? 13.301  16.243  -5.326  1.00 0.00 ? 502 ALA A CB   5  
ATOM   6930  H  H    . ALA A 1 81 ? 11.566  14.246  -5.765  1.00 0.00 ? 502 ALA A H    5  
ATOM   6931  H  HA   . ALA A 1 81 ? 12.902  16.284  -7.410  1.00 0.00 ? 502 ALA A HA   5  
ATOM   6932  H  HB1  . ALA A 1 81 ? 12.373  16.481  -4.826  1.00 0.00 ? 502 ALA A HB1  5  
ATOM   6933  H  HB2  . ALA A 1 81 ? 13.894  15.598  -4.695  1.00 0.00 ? 502 ALA A HB2  5  
ATOM   6934  H  HB3  . ALA A 1 81 ? 13.847  17.153  -5.525  1.00 0.00 ? 502 ALA A HB3  5  
ATOM   6935  N  N    . GLU A 1 82 ? 15.330  15.160  -7.206  1.00 0.00 ? 503 GLU A N    5  
ATOM   6936  C  CA   . GLU A 1 82 ? 16.502  14.371  -7.564  1.00 0.00 ? 503 GLU A CA   5  
ATOM   6937  C  C    . GLU A 1 82 ? 17.499  14.322  -6.410  1.00 0.00 ? 503 GLU A C    5  
ATOM   6938  O  O    . GLU A 1 82 ? 17.616  15.272  -5.636  1.00 0.00 ? 503 GLU A O    5  
ATOM   6939  C  CB   . GLU A 1 82 ? 17.175  14.953  -8.809  1.00 0.00 ? 503 GLU A CB   5  
ATOM   6940  C  CG   . GLU A 1 82 ? 16.647  14.377  -10.112 1.00 0.00 ? 503 GLU A CG   5  
ATOM   6941  C  CD   . GLU A 1 82 ? 16.981  15.243  -11.311 1.00 0.00 ? 503 GLU A CD   5  
ATOM   6942  O  OE1  . GLU A 1 82 ? 18.141  15.197  -11.772 1.00 0.00 ? 503 GLU A OE1  5  
ATOM   6943  O  OE2  . GLU A 1 82 ? 16.082  15.966  -11.789 1.00 0.00 ? 503 GLU A OE2  5  
ATOM   6944  H  H    . GLU A 1 82 ? 15.418  16.131  -7.109  1.00 0.00 ? 503 GLU A H    5  
ATOM   6945  H  HA   . GLU A 1 82 ? 16.172  13.367  -7.782  1.00 0.00 ? 503 GLU A HA   5  
ATOM   6946  H  HB2  . GLU A 1 82 ? 17.018  16.022  -8.822  1.00 0.00 ? 503 GLU A HB2  5  
ATOM   6947  H  HB3  . GLU A 1 82 ? 18.235  14.755  -8.756  1.00 0.00 ? 503 GLU A HB3  5  
ATOM   6948  H  HG2  . GLU A 1 82 ? 17.082  13.400  -10.261 1.00 0.00 ? 503 GLU A HG2  5  
ATOM   6949  H  HG3  . GLU A 1 82 ? 15.573  14.284  -10.042 1.00 0.00 ? 503 GLU A HG3  5  
ATOM   6950  N  N    . ASP A 1 83 ? 18.215  13.208  -6.302  1.00 0.00 ? 504 ASP A N    5  
ATOM   6951  C  CA   . ASP A 1 83 ? 19.202  13.034  -5.243  1.00 0.00 ? 504 ASP A CA   5  
ATOM   6952  C  C    . ASP A 1 83 ? 20.235  11.981  -5.632  1.00 0.00 ? 504 ASP A C    5  
ATOM   6953  O  O    . ASP A 1 83 ? 20.034  11.220  -6.577  1.00 0.00 ? 504 ASP A O    5  
ATOM   6954  C  CB   . ASP A 1 83 ? 18.515  12.634  -3.936  1.00 0.00 ? 504 ASP A CB   5  
ATOM   6955  C  CG   . ASP A 1 83 ? 17.924  11.239  -3.996  1.00 0.00 ? 504 ASP A CG   5  
ATOM   6956  O  OD1  . ASP A 1 83 ? 17.006  11.019  -4.814  1.00 0.00 ? 504 ASP A OD1  5  
ATOM   6957  O  OD2  . ASP A 1 83 ? 18.378  10.368  -3.225  1.00 0.00 ? 504 ASP A OD2  5  
ATOM   6958  H  H    . ASP A 1 83 ? 18.076  12.486  -6.950  1.00 0.00 ? 504 ASP A H    5  
ATOM   6959  H  HA   . ASP A 1 83 ? 19.705  13.978  -5.100  1.00 0.00 ? 504 ASP A HA   5  
ATOM   6960  H  HB2  . ASP A 1 83 ? 19.238  12.664  -3.133  1.00 0.00 ? 504 ASP A HB2  5  
ATOM   6961  H  HB3  . ASP A 1 83 ? 17.720  13.334  -3.726  1.00 0.00 ? 504 ASP A HB3  5  
ATOM   6962  N  N    . GLU A 1 84 ? 21.342  11.945  -4.896  1.00 0.00 ? 505 GLU A N    5  
ATOM   6963  C  CA   . GLU A 1 84 ? 22.407  10.987  -5.166  1.00 0.00 ? 505 GLU A CA   5  
ATOM   6964  C  C    . GLU A 1 84 ? 22.622  10.061  -3.971  1.00 0.00 ? 505 GLU A C    5  
ATOM   6965  O  O    . GLU A 1 84 ? 22.802  10.517  -2.842  1.00 0.00 ? 505 GLU A O    5  
ATOM   6966  C  CB   . GLU A 1 84 ? 23.709  11.718  -5.499  1.00 0.00 ? 505 GLU A CB   5  
ATOM   6967  C  CG   . GLU A 1 84 ? 23.854  12.064  -6.971  1.00 0.00 ? 505 GLU A CG   5  
ATOM   6968  C  CD   . GLU A 1 84 ? 23.760  10.845  -7.868  1.00 0.00 ? 505 GLU A CD   5  
ATOM   6969  O  OE1  . GLU A 1 84 ? 24.762  10.107  -7.972  1.00 0.00 ? 505 GLU A OE1  5  
ATOM   6970  O  OE2  . GLU A 1 84 ? 22.686  10.630  -8.467  1.00 0.00 ? 505 GLU A OE2  5  
ATOM   6971  H  H    . GLU A 1 84 ? 21.445  12.578  -4.155  1.00 0.00 ? 505 GLU A H    5  
ATOM   6972  H  HA   . GLU A 1 84 ? 22.111  10.393  -6.017  1.00 0.00 ? 505 GLU A HA   5  
ATOM   6973  H  HB2  . GLU A 1 84 ? 23.749  12.635  -4.929  1.00 0.00 ? 505 GLU A HB2  5  
ATOM   6974  H  HB3  . GLU A 1 84 ? 24.542  11.092  -5.214  1.00 0.00 ? 505 GLU A HB3  5  
ATOM   6975  H  HG2  . GLU A 1 84 ? 23.070  12.754  -7.244  1.00 0.00 ? 505 GLU A HG2  5  
ATOM   6976  H  HG3  . GLU A 1 84 ? 24.815  12.533  -7.125  1.00 0.00 ? 505 GLU A HG3  5  
ATOM   6977  N  N    . LYS A 1 85 ? 22.601  8.758   -4.229  1.00 0.00 ? 506 LYS A N    5  
ATOM   6978  C  CA   . LYS A 1 85 ? 22.793  7.766   -3.178  1.00 0.00 ? 506 LYS A CA   5  
ATOM   6979  C  C    . LYS A 1 85 ? 24.157  7.094   -3.307  1.00 0.00 ? 506 LYS A C    5  
ATOM   6980  O  O    . LYS A 1 85 ? 24.770  7.115   -4.374  1.00 0.00 ? 506 LYS A O    5  
ATOM   6981  C  CB   . LYS A 1 85 ? 21.686  6.712   -3.234  1.00 0.00 ? 506 LYS A CB   5  
ATOM   6982  C  CG   . LYS A 1 85 ? 21.310  6.152   -1.873  1.00 0.00 ? 506 LYS A CG   5  
ATOM   6983  C  CD   . LYS A 1 85 ? 20.567  4.832   -1.998  1.00 0.00 ? 506 LYS A CD   5  
ATOM   6984  C  CE   . LYS A 1 85 ? 19.077  5.050   -2.215  1.00 0.00 ? 506 LYS A CE   5  
ATOM   6985  N  NZ   . LYS A 1 85 ? 18.407  3.825   -2.734  1.00 0.00 ? 506 LYS A NZ   5  
ATOM   6986  H  H    . LYS A 1 85 ? 22.453  8.455   -5.150  1.00 0.00 ? 506 LYS A H    5  
ATOM   6987  H  HA   . LYS A 1 85 ? 22.746  8.276   -2.228  1.00 0.00 ? 506 LYS A HA   5  
ATOM   6988  H  HB2  . LYS A 1 85 ? 20.805  7.156   -3.673  1.00 0.00 ? 506 LYS A HB2  5  
ATOM   6989  H  HB3  . LYS A 1 85 ? 22.015  5.893   -3.857  1.00 0.00 ? 506 LYS A HB3  5  
ATOM   6990  H  HG2  . LYS A 1 85 ? 22.210  5.992   -1.298  1.00 0.00 ? 506 LYS A HG2  5  
ATOM   6991  H  HG3  . LYS A 1 85 ? 20.677  6.864   -1.363  1.00 0.00 ? 506 LYS A HG3  5  
ATOM   6992  H  HD2  . LYS A 1 85 ? 20.965  4.284   -2.839  1.00 0.00 ? 506 LYS A HD2  5  
ATOM   6993  H  HD3  . LYS A 1 85 ? 20.710  4.261   -1.092  1.00 0.00 ? 506 LYS A HD3  5  
ATOM   6994  H  HE2  . LYS A 1 85 ? 18.626  5.325   -1.274  1.00 0.00 ? 506 LYS A HE2  5  
ATOM   6995  H  HE3  . LYS A 1 85 ? 18.944  5.852   -2.926  1.00 0.00 ? 506 LYS A HE3  5  
ATOM   6996  H  HZ1  . LYS A 1 85 ? 18.502  3.778   -3.768  1.00 0.00 ? 506 LYS A HZ1  5  
ATOM   6997  H  HZ2  . LYS A 1 85 ? 17.397  3.840   -2.489  1.00 0.00 ? 506 LYS A HZ2  5  
ATOM   6998  H  HZ3  . LYS A 1 85 ? 18.841  2.977   -2.317  1.00 0.00 ? 506 LYS A HZ3  5  
ATOM   6999  N  N    . GLU A 1 86 ? 24.624  6.498   -2.214  1.00 0.00 ? 507 GLU A N    5  
ATOM   7000  C  CA   . GLU A 1 86 ? 25.914  5.819   -2.208  1.00 0.00 ? 507 GLU A CA   5  
ATOM   7001  C  C    . GLU A 1 86 ? 25.975  4.777   -1.095  1.00 0.00 ? 507 GLU A C    5  
ATOM   7002  O  O    . GLU A 1 86 ? 25.462  4.993   0.003   1.00 0.00 ? 507 GLU A O    5  
ATOM   7003  C  CB   . GLU A 1 86 ? 27.047  6.833   -2.034  1.00 0.00 ? 507 GLU A CB   5  
ATOM   7004  C  CG   . GLU A 1 86 ? 28.411  6.296   -2.437  1.00 0.00 ? 507 GLU A CG   5  
ATOM   7005  C  CD   . GLU A 1 86 ? 29.509  7.333   -2.303  1.00 0.00 ? 507 GLU A CD   5  
ATOM   7006  O  OE1  . GLU A 1 86 ? 30.018  7.517   -1.177  1.00 0.00 ? 507 GLU A OE1  5  
ATOM   7007  O  OE2  . GLU A 1 86 ? 29.859  7.961   -3.324  1.00 0.00 ? 507 GLU A OE2  5  
ATOM   7008  H  H    . GLU A 1 86 ? 24.088  6.516   -1.394  1.00 0.00 ? 507 GLU A H    5  
ATOM   7009  H  HA   . GLU A 1 86 ? 26.032  5.321   -3.158  1.00 0.00 ? 507 GLU A HA   5  
ATOM   7010  H  HB2  . GLU A 1 86 ? 26.832  7.702   -2.638  1.00 0.00 ? 507 GLU A HB2  5  
ATOM   7011  H  HB3  . GLU A 1 86 ? 27.093  7.129   -0.996  1.00 0.00 ? 507 GLU A HB3  5  
ATOM   7012  H  HG2  . GLU A 1 86 ? 28.653  5.454   -1.805  1.00 0.00 ? 507 GLU A HG2  5  
ATOM   7013  H  HG3  . GLU A 1 86 ? 28.366  5.971   -3.466  1.00 0.00 ? 507 GLU A HG3  5  
ATOM   7014  N  N    . VAL A 1 87 ? 26.605  3.643   -1.388  1.00 0.00 ? 508 VAL A N    5  
ATOM   7015  C  CA   . VAL A 1 87 ? 26.733  2.566   -0.413  1.00 0.00 ? 508 VAL A CA   5  
ATOM   7016  C  C    . VAL A 1 87 ? 28.190  2.147   -0.246  1.00 0.00 ? 508 VAL A C    5  
ATOM   7017  O  O    . VAL A 1 87 ? 28.638  1.174   -0.850  1.00 0.00 ? 508 VAL A O    5  
ATOM   7018  C  CB   . VAL A 1 87 ? 25.900  1.337   -0.822  1.00 0.00 ? 508 VAL A CB   5  
ATOM   7019  C  CG1  . VAL A 1 87 ? 26.228  0.920   -2.248  1.00 0.00 ? 508 VAL A CG1  5  
ATOM   7020  C  CG2  . VAL A 1 87 ? 26.138  0.188   0.146   1.00 0.00 ? 508 VAL A CG2  5  
ATOM   7021  H  H    . VAL A 1 87 ? 26.993  3.529   -2.280  1.00 0.00 ? 508 VAL A H    5  
ATOM   7022  H  HA   . VAL A 1 87 ? 26.362  2.928   0.535   1.00 0.00 ? 508 VAL A HA   5  
ATOM   7023  H  HB   . VAL A 1 87 ? 24.855  1.605   -0.780  1.00 0.00 ? 508 VAL A HB   5  
ATOM   7024  H  HG11 . VAL A 1 87 ? 26.198  1.787   -2.892  1.00 0.00 ? 508 VAL A HG11 5  
ATOM   7025  H  HG12 . VAL A 1 87 ? 27.214  0.482   -2.278  1.00 0.00 ? 508 VAL A HG12 5  
ATOM   7026  H  HG13 . VAL A 1 87 ? 25.501  0.197   -2.587  1.00 0.00 ? 508 VAL A HG13 5  
ATOM   7027  H  HG21 . VAL A 1 87 ? 25.788  0.467   1.128   1.00 0.00 ? 508 VAL A HG21 5  
ATOM   7028  H  HG22 . VAL A 1 87 ? 25.599  -0.686  -0.193  1.00 0.00 ? 508 VAL A HG22 5  
ATOM   7029  H  HG23 . VAL A 1 87 ? 27.193  -0.035  0.189   1.00 0.00 ? 508 VAL A HG23 5  
ATOM   7030  N  N    . GLU A 1 88 ? 28.923  2.890   0.578   1.00 0.00 ? 509 GLU A N    5  
ATOM   7031  C  CA   . GLU A 1 88 ? 30.329  2.595   0.823   1.00 0.00 ? 509 GLU A CA   5  
ATOM   7032  C  C    . GLU A 1 88 ? 30.484  1.296   1.609   1.00 0.00 ? 509 GLU A C    5  
ATOM   7033  O  O    . GLU A 1 88 ? 29.603  0.918   2.381   1.00 0.00 ? 509 GLU A O    5  
ATOM   7034  C  CB   . GLU A 1 88 ? 30.990  3.746   1.585   1.00 0.00 ? 509 GLU A CB   5  
ATOM   7035  C  CG   . GLU A 1 88 ? 32.476  3.887   1.305   1.00 0.00 ? 509 GLU A CG   5  
ATOM   7036  C  CD   . GLU A 1 88 ? 32.759  4.625   0.011   1.00 0.00 ? 509 GLU A CD   5  
ATOM   7037  O  OE1  . GLU A 1 88 ? 32.314  4.146   -1.054  1.00 0.00 ? 509 GLU A OE1  5  
ATOM   7038  O  OE2  . GLU A 1 88 ? 33.424  5.680   0.062   1.00 0.00 ? 509 GLU A OE2  5  
ATOM   7039  H  H    . GLU A 1 88 ? 28.508  3.654   1.030   1.00 0.00 ? 509 GLU A H    5  
ATOM   7040  H  HA   . GLU A 1 88 ? 30.817  2.482   -0.133  1.00 0.00 ? 509 GLU A HA   5  
ATOM   7041  H  HB2  . GLU A 1 88 ? 30.503  4.670   1.310   1.00 0.00 ? 509 GLU A HB2  5  
ATOM   7042  H  HB3  . GLU A 1 88 ? 30.858  3.582   2.644   1.00 0.00 ? 509 GLU A HB3  5  
ATOM   7043  H  HG2  . GLU A 1 88 ? 32.933  4.432   2.118   1.00 0.00 ? 509 GLU A HG2  5  
ATOM   7044  H  HG3  . GLU A 1 88 ? 32.913  2.902   1.243   1.00 0.00 ? 509 GLU A HG3  5  
ATOM   7045  N  N    . GLU A 1 89 ? 31.609  0.618   1.407   1.00 0.00 ? 510 GLU A N    5  
ATOM   7046  C  CA   . GLU A 1 89 ? 31.878  -0.639  2.095   1.00 0.00 ? 510 GLU A CA   5  
ATOM   7047  C  C    . GLU A 1 89 ? 32.770  -0.412  3.313   1.00 0.00 ? 510 GLU A C    5  
ATOM   7048  O  O    . GLU A 1 89 ? 33.359  0.657   3.474   1.00 0.00 ? 510 GLU A O    5  
ATOM   7049  C  CB   . GLU A 1 89 ? 32.540  -1.637  1.143   1.00 0.00 ? 510 GLU A CB   5  
ATOM   7050  C  CG   . GLU A 1 89 ? 33.702  -1.051  0.359   1.00 0.00 ? 510 GLU A CG   5  
ATOM   7051  C  CD   . GLU A 1 89 ? 33.249  -0.252  -0.847  1.00 0.00 ? 510 GLU A CD   5  
ATOM   7052  O  OE1  . GLU A 1 89 ? 32.734  -0.866  -1.805  1.00 0.00 ? 510 GLU A OE1  5  
ATOM   7053  O  OE2  . GLU A 1 89 ? 33.410  0.987   -0.834  1.00 0.00 ? 510 GLU A OE2  5  
ATOM   7054  H  H    . GLU A 1 89 ? 32.274  0.971   0.779   1.00 0.00 ? 510 GLU A H    5  
ATOM   7055  H  HA   . GLU A 1 89 ? 30.934  -1.044  2.427   1.00 0.00 ? 510 GLU A HA   5  
ATOM   7056  H  HB2  . GLU A 1 89 ? 32.905  -2.476  1.717   1.00 0.00 ? 510 GLU A HB2  5  
ATOM   7057  H  HB3  . GLU A 1 89 ? 31.800  -1.988  0.439   1.00 0.00 ? 510 GLU A HB3  5  
ATOM   7058  H  HG2  . GLU A 1 89 ? 34.267  -0.401  1.011   1.00 0.00 ? 510 GLU A HG2  5  
ATOM   7059  H  HG3  . GLU A 1 89 ? 34.335  -1.858  0.021   1.00 0.00 ? 510 GLU A HG3  5  
ATOM   7060  N  N    . LEU A 1 90 ? 32.863  -1.426  4.167   1.00 0.00 ? 511 LEU A N    5  
ATOM   7061  C  CA   . LEU A 1 90 ? 33.683  -1.338  5.370   1.00 0.00 ? 511 LEU A CA   5  
ATOM   7062  C  C    . LEU A 1 90 ? 35.037  -2.008  5.157   1.00 0.00 ? 511 LEU A C    5  
ATOM   7063  O  O    . LEU A 1 90 ? 36.073  -1.343  5.131   1.00 0.00 ? 511 LEU A O    5  
ATOM   7064  C  CB   . LEU A 1 90 ? 32.960  -1.989  6.551   1.00 0.00 ? 511 LEU A CB   5  
ATOM   7065  C  CG   . LEU A 1 90 ? 31.547  -1.478  6.837   1.00 0.00 ? 511 LEU A CG   5  
ATOM   7066  C  CD1  . LEU A 1 90 ? 30.527  -2.235  6.002   1.00 0.00 ? 511 LEU A CD1  5  
ATOM   7067  C  CD2  . LEU A 1 90 ? 31.225  -1.603  8.319   1.00 0.00 ? 511 LEU A CD2  5  
ATOM   7068  H  H    . LEU A 1 90 ? 32.371  -2.252  3.984   1.00 0.00 ? 511 LEU A H    5  
ATOM   7069  H  HA   . LEU A 1 90 ? 33.842  -0.293  5.588   1.00 0.00 ? 511 LEU A HA   5  
ATOM   7070  H  HB2  . LEU A 1 90 ? 32.895  -3.048  6.357   1.00 0.00 ? 511 LEU A HB2  5  
ATOM   7071  H  HB3  . LEU A 1 90 ? 33.558  -1.823  7.436   1.00 0.00 ? 511 LEU A HB3  5  
ATOM   7072  H  HG   . LEU A 1 90 ? 31.488  -0.432  6.568   1.00 0.00 ? 511 LEU A HG   5  
ATOM   7073  H  HD11 . LEU A 1 90 ? 29.562  -2.187  6.483   1.00 0.00 ? 511 LEU A HD11 5  
ATOM   7074  H  HD12 . LEU A 1 90 ? 30.832  -3.267  5.909   1.00 0.00 ? 511 LEU A HD12 5  
ATOM   7075  H  HD13 . LEU A 1 90 ? 30.463  -1.789  5.020   1.00 0.00 ? 511 LEU A HD13 5  
ATOM   7076  H  HD21 . LEU A 1 90 ? 31.044  -2.640  8.562   1.00 0.00 ? 511 LEU A HD21 5  
ATOM   7077  H  HD22 . LEU A 1 90 ? 30.343  -1.021  8.546   1.00 0.00 ? 511 LEU A HD22 5  
ATOM   7078  H  HD23 . LEU A 1 90 ? 32.058  -1.236  8.901   1.00 0.00 ? 511 LEU A HD23 5  
ATOM   7079  N  N    . LYS A 1 91 ? 35.021  -3.327  5.003   1.00 0.00 ? 512 LYS A N    5  
ATOM   7080  C  CA   . LYS A 1 91 ? 36.246  -4.088  4.789   1.00 0.00 ? 512 LYS A CA   5  
ATOM   7081  C  C    . LYS A 1 91 ? 36.111  -5.006  3.578   1.00 0.00 ? 512 LYS A C    5  
ATOM   7082  O  O    . LYS A 1 91 ? 35.861  -6.204  3.719   1.00 0.00 ? 512 LYS A O    5  
ATOM   7083  C  CB   . LYS A 1 91 ? 36.584  -4.913  6.033   1.00 0.00 ? 512 LYS A CB   5  
ATOM   7084  C  CG   . LYS A 1 91 ? 35.408  -5.711  6.571   1.00 0.00 ? 512 LYS A CG   5  
ATOM   7085  C  CD   . LYS A 1 91 ? 35.804  -6.537  7.783   1.00 0.00 ? 512 LYS A CD   5  
ATOM   7086  C  CE   . LYS A 1 91 ? 34.879  -7.730  7.970   1.00 0.00 ? 512 LYS A CE   5  
ATOM   7087  N  NZ   . LYS A 1 91 ? 35.164  -8.813  6.988   1.00 0.00 ? 512 LYS A NZ   5  
ATOM   7088  H  H    . LYS A 1 91 ? 34.163  -3.802  5.034   1.00 0.00 ? 512 LYS A H    5  
ATOM   7089  H  HA   . LYS A 1 91 ? 37.045  -3.386  4.605   1.00 0.00 ? 512 LYS A HA   5  
ATOM   7090  H  HB2  . LYS A 1 91 ? 37.378  -5.602  5.789   1.00 0.00 ? 512 LYS A HB2  5  
ATOM   7091  H  HB3  . LYS A 1 91 ? 36.924  -4.245  6.811   1.00 0.00 ? 512 LYS A HB3  5  
ATOM   7092  H  HG2  . LYS A 1 91 ? 34.621  -5.028  6.855   1.00 0.00 ? 512 LYS A HG2  5  
ATOM   7093  H  HG3  . LYS A 1 91 ? 35.050  -6.374  5.796   1.00 0.00 ? 512 LYS A HG3  5  
ATOM   7094  H  HD2  . LYS A 1 91 ? 36.813  -6.897  7.649   1.00 0.00 ? 512 LYS A HD2  5  
ATOM   7095  H  HD3  . LYS A 1 91 ? 35.755  -5.913  8.664   1.00 0.00 ? 512 LYS A HD3  5  
ATOM   7096  H  HE2  . LYS A 1 91 ? 35.010  -8.117  8.969   1.00 0.00 ? 512 LYS A HE2  5  
ATOM   7097  H  HE3  . LYS A 1 91 ? 33.858  -7.400  7.843   1.00 0.00 ? 512 LYS A HE3  5  
ATOM   7098  H  HZ1  . LYS A 1 91 ? 35.140  -9.739  7.461   1.00 0.00 ? 512 LYS A HZ1  5  
ATOM   7099  H  HZ2  . LYS A 1 91 ? 36.105  -8.675  6.569   1.00 0.00 ? 512 LYS A HZ2  5  
ATOM   7100  H  HZ3  . LYS A 1 91 ? 34.453  -8.804  6.230   1.00 0.00 ? 512 LYS A HZ3  5  
ATOM   7101  N  N    . LYS A 1 92 ? 36.281  -4.439  2.389   1.00 0.00 ? 513 LYS A N    5  
ATOM   7102  C  CA   . LYS A 1 92 ? 36.181  -5.206  1.153   1.00 0.00 ? 513 LYS A CA   5  
ATOM   7103  C  C    . LYS A 1 92 ? 37.561  -5.642  0.671   1.00 0.00 ? 513 LYS A C    5  
ATOM   7104  O  O    . LYS A 1 92 ? 38.146  -5.016  -0.212  1.00 0.00 ? 513 LYS A O    5  
ATOM   7105  C  CB   . LYS A 1 92 ? 35.488  -4.378  0.069   1.00 0.00 ? 513 LYS A CB   5  
ATOM   7106  C  CG   . LYS A 1 92 ? 33.973  -4.480  0.101   1.00 0.00 ? 513 LYS A CG   5  
ATOM   7107  C  CD   . LYS A 1 92 ? 33.495  -5.842  -0.375  1.00 0.00 ? 513 LYS A CD   5  
ATOM   7108  C  CE   . LYS A 1 92 ? 33.537  -5.948  -1.892  1.00 0.00 ? 513 LYS A CE   5  
ATOM   7109  N  NZ   . LYS A 1 92 ? 32.483  -5.117  -2.536  1.00 0.00 ? 513 LYS A NZ   5  
ATOM   7110  H  H    . LYS A 1 92 ? 36.479  -3.479  2.341   1.00 0.00 ? 513 LYS A H    5  
ATOM   7111  H  HA   . LYS A 1 92 ? 35.589  -6.086  1.356   1.00 0.00 ? 513 LYS A HA   5  
ATOM   7112  H  HB2  . LYS A 1 92 ? 35.761  -3.340  0.196   1.00 0.00 ? 513 LYS A HB2  5  
ATOM   7113  H  HB3  . LYS A 1 92 ? 35.830  -4.715  -0.899  1.00 0.00 ? 513 LYS A HB3  5  
ATOM   7114  H  HG2  . LYS A 1 92 ? 33.632  -4.325  1.113   1.00 0.00 ? 513 LYS A HG2  5  
ATOM   7115  H  HG3  . LYS A 1 92 ? 33.556  -3.717  -0.542  1.00 0.00 ? 513 LYS A HG3  5  
ATOM   7116  H  HD2  . LYS A 1 92 ? 34.133  -6.605  0.045   1.00 0.00 ? 513 LYS A HD2  5  
ATOM   7117  H  HD3  . LYS A 1 92 ? 32.479  -5.995  -0.040  1.00 0.00 ? 513 LYS A HD3  5  
ATOM   7118  H  HE2  . LYS A 1 92 ? 34.505  -5.616  -2.237  1.00 0.00 ? 513 LYS A HE2  5  
ATOM   7119  H  HE3  . LYS A 1 92 ? 33.391  -6.981  -2.172  1.00 0.00 ? 513 LYS A HE3  5  
ATOM   7120  H  HZ1  . LYS A 1 92 ? 32.816  -4.137  -2.643  1.00 0.00 ? 513 LYS A HZ1  5  
ATOM   7121  H  HZ2  . LYS A 1 92 ? 31.622  -5.116  -1.952  1.00 0.00 ? 513 LYS A HZ2  5  
ATOM   7122  H  HZ3  . LYS A 1 92 ? 32.251  -5.498  -3.475  1.00 0.00 ? 513 LYS A HZ3  5  
ATOM   7123  N  N    . SER A 1 93 ? 38.073  -6.720  1.255   1.00 0.00 ? 514 SER A N    5  
ATOM   7124  C  CA   . SER A 1 93 ? 39.385  -7.239  0.885   1.00 0.00 ? 514 SER A CA   5  
ATOM   7125  C  C    . SER A 1 93 ? 39.656  -8.573  1.574   1.00 0.00 ? 514 SER A C    5  
ATOM   7126  O  O    . SER A 1 93 ? 38.919  -8.982  2.470   1.00 0.00 ? 514 SER A O    5  
ATOM   7127  C  CB   . SER A 1 93 ? 40.477  -6.232  1.253   1.00 0.00 ? 514 SER A CB   5  
ATOM   7128  O  OG   . SER A 1 93 ? 40.453  -5.937  2.639   1.00 0.00 ? 514 SER A OG   5  
ATOM   7129  H  H    . SER A 1 93 ? 37.558  -7.176  1.952   1.00 0.00 ? 514 SER A H    5  
ATOM   7130  H  HA   . SER A 1 93 ? 39.393  -7.391  -0.184  1.00 0.00 ? 514 SER A HA   5  
ATOM   7131  H  HB2  . SER A 1 93 ? 41.442  -6.643  1.001   1.00 0.00 ? 514 SER A HB2  5  
ATOM   7132  H  HB3  . SER A 1 93 ? 40.320  -5.317  0.699   1.00 0.00 ? 514 SER A HB3  5  
ATOM   7133  H  HG   . SER A 1 93 ? 39.864  -5.196  2.799   1.00 0.00 ? 514 SER A HG   5  
ATOM   7134  N  N    . GLY A 1 94 ? 40.720  -9.247  1.148   1.00 0.00 ? 515 GLY A N    5  
ATOM   7135  C  CA   . GLY A 1 94 ? 41.070  -10.528 1.733   1.00 0.00 ? 515 GLY A CA   5  
ATOM   7136  C  C    . GLY A 1 94 ? 42.418  -11.033 1.259   1.00 0.00 ? 515 GLY A C    5  
ATOM   7137  O  O    . GLY A 1 94 ? 42.539  -11.638 0.194   1.00 0.00 ? 515 GLY A O    5  
ATOM   7138  H  H    . GLY A 1 94 ? 41.271  -8.872  0.430   1.00 0.00 ? 515 GLY A H    5  
ATOM   7139  H  HA2  . GLY A 1 94 ? 41.092  -10.426 2.808   1.00 0.00 ? 515 GLY A HA2  5  
ATOM   7140  H  HA3  . GLY A 1 94 ? 40.314  -11.252 1.466   1.00 0.00 ? 515 GLY A HA3  5  
ATOM   7141  N  N    . PRO A 1 95 ? 43.464  -10.782 2.061   1.00 0.00 ? 516 PRO A N    5  
ATOM   7142  C  CA   . PRO A 1 95 ? 44.829  -11.205 1.738   1.00 0.00 ? 516 PRO A CA   5  
ATOM   7143  C  C    . PRO A 1 95 ? 45.002  -12.718 1.823   1.00 0.00 ? 516 PRO A C    5  
ATOM   7144  O  O    . PRO A 1 95 ? 44.063  -13.442 2.153   1.00 0.00 ? 516 PRO A O    5  
ATOM   7145  C  CB   . PRO A 1 95 ? 45.679  -10.509 2.804   1.00 0.00 ? 516 PRO A CB   5  
ATOM   7146  C  CG   . PRO A 1 95 ? 44.750  -10.298 3.950   1.00 0.00 ? 516 PRO A CG   5  
ATOM   7147  C  CD   . PRO A 1 95 ? 43.393  -10.065 3.346   1.00 0.00 ? 516 PRO A CD   5  
ATOM   7148  H  HA   . PRO A 1 95 ? 45.129  -10.865 0.758   1.00 0.00 ? 516 PRO A HA   5  
ATOM   7149  H  HB2  . PRO A 1 95 ? 46.508  -11.145 3.079   1.00 0.00 ? 516 PRO A HB2  5  
ATOM   7150  H  HB3  . PRO A 1 95 ? 46.049  -9.571  2.419   1.00 0.00 ? 516 PRO A HB3  5  
ATOM   7151  H  HG2  . PRO A 1 95 ? 44.735  -11.176 4.577   1.00 0.00 ? 516 PRO A HG2  5  
ATOM   7152  H  HG3  . PRO A 1 95 ? 45.060  -9.434  4.519   1.00 0.00 ? 516 PRO A HG3  5  
ATOM   7153  H  HD2  . PRO A 1 95 ? 42.622  -10.480 3.977   1.00 0.00 ? 516 PRO A HD2  5  
ATOM   7154  H  HD3  . PRO A 1 95 ? 43.226  -9.009  3.189   1.00 0.00 ? 516 PRO A HD3  5  
ATOM   7155  N  N    . SER A 1 96 ? 46.209  -13.189 1.525   1.00 0.00 ? 517 SER A N    5  
ATOM   7156  C  CA   . SER A 1 96 ? 46.504  -14.616 1.565   1.00 0.00 ? 517 SER A CA   5  
ATOM   7157  C  C    . SER A 1 96 ? 47.998  -14.857 1.757   1.00 0.00 ? 517 SER A C    5  
ATOM   7158  O  O    . SER A 1 96 ? 48.794  -13.918 1.764   1.00 0.00 ? 517 SER A O    5  
ATOM   7159  C  CB   . SER A 1 96 ? 46.028  -15.293 0.278   1.00 0.00 ? 517 SER A CB   5  
ATOM   7160  O  OG   . SER A 1 96 ? 46.933  -15.058 -0.787  1.00 0.00 ? 517 SER A OG   5  
ATOM   7161  H  H    . SER A 1 96 ? 46.917  -12.561 1.270   1.00 0.00 ? 517 SER A H    5  
ATOM   7162  H  HA   . SER A 1 96 ? 45.972  -15.041 2.403   1.00 0.00 ? 517 SER A HA   5  
ATOM   7163  H  HB2  . SER A 1 96 ? 45.951  -16.357 0.441   1.00 0.00 ? 517 SER A HB2  5  
ATOM   7164  H  HB3  . SER A 1 96 ? 45.059  -14.900 0.005   1.00 0.00 ? 517 SER A HB3  5  
ATOM   7165  H  HG   . SER A 1 96 ? 47.293  -14.171 -0.712  1.00 0.00 ? 517 SER A HG   5  
ATOM   7166  N  N    . SER A 1 97 ? 48.372  -16.123 1.913   1.00 0.00 ? 518 SER A N    5  
ATOM   7167  C  CA   . SER A 1 97 ? 49.770  -16.489 2.109   1.00 0.00 ? 518 SER A CA   5  
ATOM   7168  C  C    . SER A 1 97 ? 49.970  -17.990 1.921   1.00 0.00 ? 518 SER A C    5  
ATOM   7169  O  O    . SER A 1 97 ? 49.010  -18.738 1.742   1.00 0.00 ? 518 SER A O    5  
ATOM   7170  C  CB   . SER A 1 97 ? 50.237  -16.072 3.505   1.00 0.00 ? 518 SER A CB   5  
ATOM   7171  O  OG   . SER A 1 97 ? 49.640  -16.879 4.505   1.00 0.00 ? 518 SER A OG   5  
ATOM   7172  H  H    . SER A 1 97 ? 47.690  -16.828 1.898   1.00 0.00 ? 518 SER A H    5  
ATOM   7173  H  HA   . SER A 1 97 ? 50.357  -15.964 1.370   1.00 0.00 ? 518 SER A HA   5  
ATOM   7174  H  HB2  . SER A 1 97 ? 51.309  -16.175 3.568   1.00 0.00 ? 518 SER A HB2  5  
ATOM   7175  H  HB3  . SER A 1 97 ? 49.963  -15.041 3.680   1.00 0.00 ? 518 SER A HB3  5  
ATOM   7176  H  HG   . SER A 1 97 ? 50.249  -16.980 5.240   1.00 0.00 ? 518 SER A HG   5  
ATOM   7177  N  N    . GLY A 1 98 ? 51.227  -18.423 1.962   1.00 0.00 ? 519 GLY A N    5  
ATOM   7178  C  CA   . GLY A 1 98 ? 51.532  -19.831 1.795   1.00 0.00 ? 519 GLY A CA   5  
ATOM   7179  C  C    . GLY A 1 98 ? 52.786  -20.059 0.974   1.00 0.00 ? 519 GLY A C    5  
ATOM   7180  O  O    . GLY A 1 98 ? 53.132  -19.205 0.159   1.00 0.00 ? 519 GLY A O    5  
ATOM   7181  H  H    . GLY A 1 98 ? 51.952  -17.780 2.108   1.00 0.00 ? 519 GLY A H    5  
ATOM   7182  H  HA2  . GLY A 1 98 ? 51.665  -20.278 2.769   1.00 0.00 ? 519 GLY A HA2  5  
ATOM   7183  H  HA3  . GLY A 1 98 ? 50.700  -20.312 1.301   1.00 0.00 ? 519 GLY A HA3  5  
HETATM 7184  ZN ZN   . ZN  B 2 .  ? -0.384  -8.119  -10.702 1.00 0.00 ? 622 ZN  A ZN   5  
HETATM 7185  ZN ZN   . ZN  C 2 .  ? -0.718  -3.566  5.784   1.00 0.00 ? 822 ZN  A ZN   5  
ATOM   7186  N  N    . GLY A 1 1  ? 31.771  -11.946 -4.206  1.00 0.00 ? 422 GLY A N    6  
ATOM   7187  C  CA   . GLY A 1 1  ? 31.211  -11.576 -5.493  1.00 0.00 ? 422 GLY A CA   6  
ATOM   7188  C  C    . GLY A 1 1  ? 30.131  -12.535 -5.952  1.00 0.00 ? 422 GLY A C    6  
ATOM   7189  O  O    . GLY A 1 1  ? 30.422  -13.662 -6.355  1.00 0.00 ? 422 GLY A O    6  
ATOM   7190  H  H1   . GLY A 1 1  ? 32.005  -12.880 -4.026  1.00 0.00 ? 422 GLY A H1   6  
ATOM   7191  H  HA2  . GLY A 1 1  ? 30.790  -10.585 -5.419  1.00 0.00 ? 422 GLY A HA2  6  
ATOM   7192  H  HA3  . GLY A 1 1  ? 32.003  -11.566 -6.228  1.00 0.00 ? 422 GLY A HA3  6  
ATOM   7193  N  N    . SER A 1 2  ? 28.880  -12.089 -5.891  1.00 0.00 ? 423 SER A N    6  
ATOM   7194  C  CA   . SER A 1 2  ? 27.752  -12.918 -6.299  1.00 0.00 ? 423 SER A CA   6  
ATOM   7195  C  C    . SER A 1 2  ? 26.696  -12.083 -7.016  1.00 0.00 ? 423 SER A C    6  
ATOM   7196  O  O    . SER A 1 2  ? 26.118  -11.163 -6.438  1.00 0.00 ? 423 SER A O    6  
ATOM   7197  C  CB   . SER A 1 2  ? 27.133  -13.608 -5.082  1.00 0.00 ? 423 SER A CB   6  
ATOM   7198  O  OG   . SER A 1 2  ? 27.924  -14.706 -4.661  1.00 0.00 ? 423 SER A OG   6  
ATOM   7199  H  H    . SER A 1 2  ? 28.712  -11.181 -5.561  1.00 0.00 ? 423 SER A H    6  
ATOM   7200  H  HA   . SER A 1 2  ? 28.123  -13.670 -6.979  1.00 0.00 ? 423 SER A HA   6  
ATOM   7201  H  HB2  . SER A 1 2  ? 27.058  -12.902 -4.270  1.00 0.00 ? 423 SER A HB2  6  
ATOM   7202  H  HB3  . SER A 1 2  ? 26.147  -13.968 -5.339  1.00 0.00 ? 423 SER A HB3  6  
ATOM   7203  H  HG   . SER A 1 2  ? 28.526  -14.956 -5.366  1.00 0.00 ? 423 SER A HG   6  
ATOM   7204  N  N    . SER A 1 3  ? 26.449  -12.412 -8.280  1.00 0.00 ? 424 SER A N    6  
ATOM   7205  C  CA   . SER A 1 3  ? 25.465  -11.691 -9.080  1.00 0.00 ? 424 SER A CA   6  
ATOM   7206  C  C    . SER A 1 3  ? 25.290  -12.346 -10.446 1.00 0.00 ? 424 SER A C    6  
ATOM   7207  O  O    . SER A 1 3  ? 26.246  -12.855 -11.030 1.00 0.00 ? 424 SER A O    6  
ATOM   7208  C  CB   . SER A 1 3  ? 25.888  -10.230 -9.252  1.00 0.00 ? 424 SER A CB   6  
ATOM   7209  O  OG   . SER A 1 3  ? 24.918  -9.501  -9.983  1.00 0.00 ? 424 SER A OG   6  
ATOM   7210  H  H    . SER A 1 3  ? 26.942  -13.156 -8.686  1.00 0.00 ? 424 SER A H    6  
ATOM   7211  H  HA   . SER A 1 3  ? 24.522  -11.724 -8.554  1.00 0.00 ? 424 SER A HA   6  
ATOM   7212  H  HB2  . SER A 1 3  ? 26.006  -9.776  -8.280  1.00 0.00 ? 424 SER A HB2  6  
ATOM   7213  H  HB3  . SER A 1 3  ? 26.828  -10.191 -9.784  1.00 0.00 ? 424 SER A HB3  6  
ATOM   7214  H  HG   . SER A 1 3  ? 24.423  -10.101 -10.545 1.00 0.00 ? 424 SER A HG   6  
ATOM   7215  N  N    . GLY A 1 4  ? 24.060  -12.328 -10.951 1.00 0.00 ? 425 GLY A N    6  
ATOM   7216  C  CA   . GLY A 1 4  ? 23.781  -12.922 -12.245 1.00 0.00 ? 425 GLY A CA   6  
ATOM   7217  C  C    . GLY A 1 4  ? 22.498  -12.398 -12.860 1.00 0.00 ? 425 GLY A C    6  
ATOM   7218  O  O    . GLY A 1 4  ? 21.742  -13.151 -13.473 1.00 0.00 ? 425 GLY A O    6  
ATOM   7219  H  H    . GLY A 1 4  ? 23.337  -11.907 -10.441 1.00 0.00 ? 425 GLY A H    6  
ATOM   7220  H  HA2  . GLY A 1 4  ? 24.602  -12.708 -12.913 1.00 0.00 ? 425 GLY A HA2  6  
ATOM   7221  H  HA3  . GLY A 1 4  ? 23.697  -13.993 -12.126 1.00 0.00 ? 425 GLY A HA3  6  
ATOM   7222  N  N    . SER A 1 5  ? 22.251  -11.103 -12.694 1.00 0.00 ? 426 SER A N    6  
ATOM   7223  C  CA   . SER A 1 5  ? 21.048  -10.479 -13.232 1.00 0.00 ? 426 SER A CA   6  
ATOM   7224  C  C    . SER A 1 5  ? 21.366  -9.687  -14.497 1.00 0.00 ? 426 SER A C    6  
ATOM   7225  O  O    . SER A 1 5  ? 20.847  -8.590  -14.702 1.00 0.00 ? 426 SER A O    6  
ATOM   7226  C  CB   . SER A 1 5  ? 20.413  -9.559  -12.187 1.00 0.00 ? 426 SER A CB   6  
ATOM   7227  O  OG   . SER A 1 5  ? 19.654  -10.301 -11.248 1.00 0.00 ? 426 SER A OG   6  
ATOM   7228  H  H    . SER A 1 5  ? 22.892  -10.554 -12.195 1.00 0.00 ? 426 SER A H    6  
ATOM   7229  H  HA   . SER A 1 5  ? 20.349  -11.264 -13.479 1.00 0.00 ? 426 SER A HA   6  
ATOM   7230  H  HB2  . SER A 1 5  ? 21.190  -9.025  -11.661 1.00 0.00 ? 426 SER A HB2  6  
ATOM   7231  H  HB3  . SER A 1 5  ? 19.762  -8.853  -12.681 1.00 0.00 ? 426 SER A HB3  6  
ATOM   7232  H  HG   . SER A 1 5  ? 18.928  -10.739 -11.698 1.00 0.00 ? 426 SER A HG   6  
ATOM   7233  N  N    . SER A 1 6  ? 22.222  -10.252 -15.341 1.00 0.00 ? 427 SER A N    6  
ATOM   7234  C  CA   . SER A 1 6  ? 22.613  -9.599  -16.585 1.00 0.00 ? 427 SER A CA   6  
ATOM   7235  C  C    . SER A 1 6  ? 21.546  -9.789  -17.658 1.00 0.00 ? 427 SER A C    6  
ATOM   7236  O  O    . SER A 1 6  ? 21.175  -10.914 -17.989 1.00 0.00 ? 427 SER A O    6  
ATOM   7237  C  CB   . SER A 1 6  ? 23.952  -10.152 -17.078 1.00 0.00 ? 427 SER A CB   6  
ATOM   7238  O  OG   . SER A 1 6  ? 24.995  -9.848  -16.168 1.00 0.00 ? 427 SER A OG   6  
ATOM   7239  H  H    . SER A 1 6  ? 22.602  -11.129 -15.122 1.00 0.00 ? 427 SER A H    6  
ATOM   7240  H  HA   . SER A 1 6  ? 22.722  -8.543  -16.385 1.00 0.00 ? 427 SER A HA   6  
ATOM   7241  H  HB2  . SER A 1 6  ? 23.880  -11.225 -17.178 1.00 0.00 ? 427 SER A HB2  6  
ATOM   7242  H  HB3  . SER A 1 6  ? 24.187  -9.715  -18.037 1.00 0.00 ? 427 SER A HB3  6  
ATOM   7243  H  HG   . SER A 1 6  ? 25.562  -10.616 -16.062 1.00 0.00 ? 427 SER A HG   6  
ATOM   7244  N  N    . GLY A 1 7  ? 21.054  -8.678  -18.198 1.00 0.00 ? 428 GLY A N    6  
ATOM   7245  C  CA   . GLY A 1 7  ? 20.034  -8.743  -19.228 1.00 0.00 ? 428 GLY A CA   6  
ATOM   7246  C  C    . GLY A 1 7  ? 18.631  -8.765  -18.654 1.00 0.00 ? 428 GLY A C    6  
ATOM   7247  O  O    . GLY A 1 7  ? 18.431  -9.156  -17.505 1.00 0.00 ? 428 GLY A O    6  
ATOM   7248  H  H    . GLY A 1 7  ? 21.387  -7.807  -17.895 1.00 0.00 ? 428 GLY A H    6  
ATOM   7249  H  HA2  . GLY A 1 7  ? 20.134  -7.883  -19.873 1.00 0.00 ? 428 GLY A HA2  6  
ATOM   7250  H  HA3  . GLY A 1 7  ? 20.185  -9.638  -19.813 1.00 0.00 ? 428 GLY A HA3  6  
ATOM   7251  N  N    . GLU A 1 8  ? 17.658  -8.343  -19.455 1.00 0.00 ? 429 GLU A N    6  
ATOM   7252  C  CA   . GLU A 1 8  ? 16.267  -8.314  -19.018 1.00 0.00 ? 429 GLU A CA   6  
ATOM   7253  C  C    . GLU A 1 8  ? 15.871  -9.641  -18.377 1.00 0.00 ? 429 GLU A C    6  
ATOM   7254  O  O    . GLU A 1 8  ? 16.304  -10.708 -18.814 1.00 0.00 ? 429 GLU A O    6  
ATOM   7255  C  CB   . GLU A 1 8  ? 15.344  -8.009  -20.199 1.00 0.00 ? 429 GLU A CB   6  
ATOM   7256  C  CG   . GLU A 1 8  ? 13.897  -7.780  -19.798 1.00 0.00 ? 429 GLU A CG   6  
ATOM   7257  C  CD   . GLU A 1 8  ? 13.652  -6.378  -19.275 1.00 0.00 ? 429 GLU A CD   6  
ATOM   7258  O  OE1  . GLU A 1 8  ? 13.702  -5.427  -20.082 1.00 0.00 ? 429 GLU A OE1  6  
ATOM   7259  O  OE2  . GLU A 1 8  ? 13.410  -6.232  -18.058 1.00 0.00 ? 429 GLU A OE2  6  
ATOM   7260  H  H    . GLU A 1 8  ? 17.881  -8.043  -20.361 1.00 0.00 ? 429 GLU A H    6  
ATOM   7261  H  HA   . GLU A 1 8  ? 16.167  -7.529  -18.283 1.00 0.00 ? 429 GLU A HA   6  
ATOM   7262  H  HB2  . GLU A 1 8  ? 15.702  -7.122  -20.702 1.00 0.00 ? 429 GLU A HB2  6  
ATOM   7263  H  HB3  . GLU A 1 8  ? 15.377  -8.840  -20.889 1.00 0.00 ? 429 GLU A HB3  6  
ATOM   7264  H  HG2  . GLU A 1 8  ? 13.267  -7.941  -20.660 1.00 0.00 ? 429 GLU A HG2  6  
ATOM   7265  H  HG3  . GLU A 1 8  ? 13.635  -8.488  -19.025 1.00 0.00 ? 429 GLU A HG3  6  
ATOM   7266  N  N    . LEU A 1 9  ? 15.045  -9.566  -17.339 1.00 0.00 ? 430 LEU A N    6  
ATOM   7267  C  CA   . LEU A 1 9  ? 14.590  -10.761 -16.637 1.00 0.00 ? 430 LEU A CA   6  
ATOM   7268  C  C    . LEU A 1 9  ? 13.069  -10.775 -16.515 1.00 0.00 ? 430 LEU A C    6  
ATOM   7269  O  O    . LEU A 1 9  ? 12.409  -9.737  -16.566 1.00 0.00 ? 430 LEU A O    6  
ATOM   7270  C  CB   . LEU A 1 9  ? 15.224  -10.832 -15.247 1.00 0.00 ? 430 LEU A CB   6  
ATOM   7271  C  CG   . LEU A 1 9  ? 15.233  -9.530  -14.445 1.00 0.00 ? 430 LEU A CG   6  
ATOM   7272  C  CD1  . LEU A 1 9  ? 16.240  -8.551  -15.029 1.00 0.00 ? 430 LEU A CD1  6  
ATOM   7273  C  CD2  . LEU A 1 9  ? 13.843  -8.913  -14.415 1.00 0.00 ? 430 LEU A CD2  6  
ATOM   7274  H  H    . LEU A 1 9  ? 14.734  -8.688  -17.037 1.00 0.00 ? 430 LEU A H    6  
ATOM   7275  H  HA   . LEU A 1 9  ? 14.901  -11.621 -17.210 1.00 0.00 ? 430 LEU A HA   6  
ATOM   7276  H  HB2  . LEU A 1 9  ? 14.683  -11.569 -14.674 1.00 0.00 ? 430 LEU A HB2  6  
ATOM   7277  H  HB3  . LEU A 1 9  ? 16.249  -11.154 -15.368 1.00 0.00 ? 430 LEU A HB3  6  
ATOM   7278  H  HG   . LEU A 1 9  ? 15.528  -9.743  -13.427 1.00 0.00 ? 430 LEU A HG   6  
ATOM   7279  H  HD11 . LEU A 1 9  ? 16.823  -8.115  -14.231 1.00 0.00 ? 430 LEU A HD11 6  
ATOM   7280  H  HD12 . LEU A 1 9  ? 15.717  -7.770  -15.560 1.00 0.00 ? 430 LEU A HD12 6  
ATOM   7281  H  HD13 . LEU A 1 9  ? 16.896  -9.073  -15.711 1.00 0.00 ? 430 LEU A HD13 6  
ATOM   7282  H  HD21 . LEU A 1 9  ? 13.101  -9.698  -14.398 1.00 0.00 ? 430 LEU A HD21 6  
ATOM   7283  H  HD22 . LEU A 1 9  ? 13.701  -8.302  -15.295 1.00 0.00 ? 430 LEU A HD22 6  
ATOM   7284  H  HD23 . LEU A 1 9  ? 13.740  -8.301  -13.531 1.00 0.00 ? 430 LEU A HD23 6  
ATOM   7285  N  N    . PRO A 1 10 ? 12.500  -11.977 -16.349 1.00 0.00 ? 431 PRO A N    6  
ATOM   7286  C  CA   . PRO A 1 10 ? 11.051  -12.155 -16.214 1.00 0.00 ? 431 PRO A CA   6  
ATOM   7287  C  C    . PRO A 1 10 ? 10.521  -11.613 -14.891 1.00 0.00 ? 431 PRO A C    6  
ATOM   7288  O  O    . PRO A 1 10 ? 10.164  -10.439 -14.788 1.00 0.00 ? 431 PRO A O    6  
ATOM   7289  C  CB   . PRO A 1 10 ? 10.872  -13.674 -16.279 1.00 0.00 ? 431 PRO A CB   6  
ATOM   7290  C  CG   . PRO A 1 10 ? 12.176  -14.229 -15.818 1.00 0.00 ? 431 PRO A CG   6  
ATOM   7291  C  CD   . PRO A 1 10 ? 13.226  -13.256 -16.280 1.00 0.00 ? 431 PRO A CD   6  
ATOM   7292  H  HA   . PRO A 1 10 ? 10.517  -11.693 -17.031 1.00 0.00 ? 431 PRO A HA   6  
ATOM   7293  H  HB2  . PRO A 1 10 ? 10.063  -13.972 -15.627 1.00 0.00 ? 431 PRO A HB2  6  
ATOM   7294  H  HB3  . PRO A 1 10 ? 10.654  -13.972 -17.293 1.00 0.00 ? 431 PRO A HB3  6  
ATOM   7295  H  HG2  . PRO A 1 10 ? 12.183  -14.305 -14.741 1.00 0.00 ? 431 PRO A HG2  6  
ATOM   7296  H  HG3  . PRO A 1 10 ? 12.341  -15.198 -16.265 1.00 0.00 ? 431 PRO A HG3  6  
ATOM   7297  H  HD2  . PRO A 1 10 ? 14.032  -13.204 -15.563 1.00 0.00 ? 431 PRO A HD2  6  
ATOM   7298  H  HD3  . PRO A 1 10 ? 13.601  -13.539 -17.252 1.00 0.00 ? 431 PRO A HD3  6  
ATOM   7299  N  N    . LYS A 1 11 ? 10.473  -12.474 -13.880 1.00 0.00 ? 432 LYS A N    6  
ATOM   7300  C  CA   . LYS A 1 11 ? 9.989   -12.081 -12.562 1.00 0.00 ? 432 LYS A CA   6  
ATOM   7301  C  C    . LYS A 1 11 ? 10.586  -10.743 -12.139 1.00 0.00 ? 432 LYS A C    6  
ATOM   7302  O  O    . LYS A 1 11 ? 11.804  -10.600 -12.034 1.00 0.00 ? 432 LYS A O    6  
ATOM   7303  C  CB   . LYS A 1 11 ? 10.334  -13.156 -11.529 1.00 0.00 ? 432 LYS A CB   6  
ATOM   7304  C  CG   . LYS A 1 11 ? 9.654   -14.489 -11.786 1.00 0.00 ? 432 LYS A CG   6  
ATOM   7305  C  CD   . LYS A 1 11 ? 8.165   -14.422 -11.486 1.00 0.00 ? 432 LYS A CD   6  
ATOM   7306  C  CE   . LYS A 1 11 ? 7.582   -15.806 -11.249 1.00 0.00 ? 432 LYS A CE   6  
ATOM   7307  N  NZ   . LYS A 1 11 ? 7.978   -16.355 -9.922  1.00 0.00 ? 432 LYS A NZ   6  
ATOM   7308  H  H    . LYS A 1 11 ? 10.772  -13.397 -14.024 1.00 0.00 ? 432 LYS A H    6  
ATOM   7309  H  HA   . LYS A 1 11 ? 8.916   -11.981 -12.620 1.00 0.00 ? 432 LYS A HA   6  
ATOM   7310  H  HB2  . LYS A 1 11 ? 11.403  -13.313 -11.535 1.00 0.00 ? 432 LYS A HB2  6  
ATOM   7311  H  HB3  . LYS A 1 11 ? 10.036  -12.806 -10.551 1.00 0.00 ? 432 LYS A HB3  6  
ATOM   7312  H  HG2  . LYS A 1 11 ? 9.789   -14.758 -12.823 1.00 0.00 ? 432 LYS A HG2  6  
ATOM   7313  H  HG3  . LYS A 1 11 ? 10.105  -15.241 -11.155 1.00 0.00 ? 432 LYS A HG3  6  
ATOM   7314  H  HD2  . LYS A 1 11 ? 8.012   -13.822 -10.601 1.00 0.00 ? 432 LYS A HD2  6  
ATOM   7315  H  HD3  . LYS A 1 11 ? 7.658   -13.966 -12.325 1.00 0.00 ? 432 LYS A HD3  6  
ATOM   7316  H  HE2  . LYS A 1 11 ? 6.506   -15.742 -11.295 1.00 0.00 ? 432 LYS A HE2  6  
ATOM   7317  H  HE3  . LYS A 1 11 ? 7.936   -16.470 -12.024 1.00 0.00 ? 432 LYS A HE3  6  
ATOM   7318  H  HZ1  . LYS A 1 11 ? 8.137   -17.381 -9.994  1.00 0.00 ? 432 LYS A HZ1  6  
ATOM   7319  H  HZ2  . LYS A 1 11 ? 7.228   -16.180 -9.224  1.00 0.00 ? 432 LYS A HZ2  6  
ATOM   7320  H  HZ3  . LYS A 1 11 ? 8.855   -15.901 -9.595  1.00 0.00 ? 432 LYS A HZ3  6  
ATOM   7321  N  N    . LYS A 1 12 ? 9.721   -9.764  -11.897 1.00 0.00 ? 433 LYS A N    6  
ATOM   7322  C  CA   . LYS A 1 12 ? 10.162  -8.438  -11.482 1.00 0.00 ? 433 LYS A CA   6  
ATOM   7323  C  C    . LYS A 1 12 ? 10.407  -8.392  -9.978  1.00 0.00 ? 433 LYS A C    6  
ATOM   7324  O  O    . LYS A 1 12 ? 11.285  -7.669  -9.504  1.00 0.00 ? 433 LYS A O    6  
ATOM   7325  C  CB   . LYS A 1 12 ? 9.120   -7.387  -11.872 1.00 0.00 ? 433 LYS A CB   6  
ATOM   7326  C  CG   . LYS A 1 12 ? 9.069   -7.106  -13.364 1.00 0.00 ? 433 LYS A CG   6  
ATOM   7327  C  CD   . LYS A 1 12 ? 10.316  -6.379  -13.838 1.00 0.00 ? 433 LYS A CD   6  
ATOM   7328  C  CE   . LYS A 1 12 ? 10.438  -5.005  -13.196 1.00 0.00 ? 433 LYS A CE   6  
ATOM   7329  N  NZ   . LYS A 1 12 ? 11.372  -4.122  -13.949 1.00 0.00 ? 433 LYS A NZ   6  
ATOM   7330  H  H    . LYS A 1 12 ? 8.761   -9.939  -11.998 1.00 0.00 ? 433 LYS A H    6  
ATOM   7331  H  HA   . LYS A 1 12 ? 11.088  -8.222  -11.993 1.00 0.00 ? 433 LYS A HA   6  
ATOM   7332  H  HB2  . LYS A 1 12 ? 8.145   -7.729  -11.558 1.00 0.00 ? 433 LYS A HB2  6  
ATOM   7333  H  HB3  . LYS A 1 12 ? 9.349   -6.463  -11.361 1.00 0.00 ? 433 LYS A HB3  6  
ATOM   7334  H  HG2  . LYS A 1 12 ? 8.988   -8.042  -13.896 1.00 0.00 ? 433 LYS A HG2  6  
ATOM   7335  H  HG3  . LYS A 1 12 ? 8.204   -6.493  -13.576 1.00 0.00 ? 433 LYS A HG3  6  
ATOM   7336  H  HD2  . LYS A 1 12 ? 11.185  -6.964  -13.576 1.00 0.00 ? 433 LYS A HD2  6  
ATOM   7337  H  HD3  . LYS A 1 12 ? 10.269  -6.262  -14.911 1.00 0.00 ? 433 LYS A HD3  6  
ATOM   7338  H  HE2  . LYS A 1 12 ? 9.462   -4.545  -13.172 1.00 0.00 ? 433 LYS A HE2  6  
ATOM   7339  H  HE3  . LYS A 1 12 ? 10.804  -5.125  -12.187 1.00 0.00 ? 433 LYS A HE3  6  
ATOM   7340  H  HZ1  . LYS A 1 12 ? 11.199  -3.127  -13.701 1.00 0.00 ? 433 LYS A HZ1  6  
ATOM   7341  H  HZ2  . LYS A 1 12 ? 11.230  -4.243  -14.972 1.00 0.00 ? 433 LYS A HZ2  6  
ATOM   7342  H  HZ3  . LYS A 1 12 ? 12.356  -4.361  -13.715 1.00 0.00 ? 433 LYS A HZ3  6  
ATOM   7343  N  N    . ARG A 1 13 ? 9.627   -9.167  -9.231  1.00 0.00 ? 434 ARG A N    6  
ATOM   7344  C  CA   . ARG A 1 13 ? 9.761   -9.214  -7.780  1.00 0.00 ? 434 ARG A CA   6  
ATOM   7345  C  C    . ARG A 1 13 ? 9.512   -7.839  -7.166  1.00 0.00 ? 434 ARG A C    6  
ATOM   7346  O  O    . ARG A 1 13 ? 10.150  -7.465  -6.183  1.00 0.00 ? 434 ARG A O    6  
ATOM   7347  C  CB   . ARG A 1 13 ? 11.153  -9.714  -7.391  1.00 0.00 ? 434 ARG A CB   6  
ATOM   7348  C  CG   . ARG A 1 13 ? 11.261  -10.147 -5.938  1.00 0.00 ? 434 ARG A CG   6  
ATOM   7349  C  CD   . ARG A 1 13 ? 10.822  -11.591 -5.752  1.00 0.00 ? 434 ARG A CD   6  
ATOM   7350  N  NE   . ARG A 1 13 ? 11.739  -12.528 -6.396  1.00 0.00 ? 434 ARG A NE   6  
ATOM   7351  C  CZ   . ARG A 1 13 ? 11.641  -13.848 -6.280  1.00 0.00 ? 434 ARG A CZ   6  
ATOM   7352  N  NH1  . ARG A 1 13 ? 10.673  -14.383 -5.549  1.00 0.00 ? 434 ARG A NH1  6  
ATOM   7353  N  NH2  . ARG A 1 13 ? 12.513  -14.635 -6.896  1.00 0.00 ? 434 ARG A NH2  6  
ATOM   7354  H  H    . ARG A 1 13 ? 8.946   -9.720  -9.666  1.00 0.00 ? 434 ARG A H    6  
ATOM   7355  H  HA   . ARG A 1 13 ? 9.022   -9.904  -7.401  1.00 0.00 ? 434 ARG A HA   6  
ATOM   7356  H  HB2  . ARG A 1 13 ? 11.407  -10.559 -8.014  1.00 0.00 ? 434 ARG A HB2  6  
ATOM   7357  H  HB3  . ARG A 1 13 ? 11.867  -8.923  -7.562  1.00 0.00 ? 434 ARG A HB3  6  
ATOM   7358  H  HG2  . ARG A 1 13 ? 12.288  -10.050 -5.618  1.00 0.00 ? 434 ARG A HG2  6  
ATOM   7359  H  HG3  . ARG A 1 13 ? 10.633  -9.508  -5.335  1.00 0.00 ? 434 ARG A HG3  6  
ATOM   7360  H  HD2  . ARG A 1 13 ? 10.784  -11.808 -4.695  1.00 0.00 ? 434 ARG A HD2  6  
ATOM   7361  H  HD3  . ARG A 1 13 ? 9.838   -11.711 -6.180  1.00 0.00 ? 434 ARG A HD3  6  
ATOM   7362  H  HE   . ARG A 1 13 ? 12.461  -12.154 -6.941  1.00 0.00 ? 434 ARG A HE   6  
ATOM   7363  H  HH11 . ARG A 1 13 ? 10.014  -13.792 -5.084  1.00 0.00 ? 434 ARG A HH11 6  
ATOM   7364  H  HH12 . ARG A 1 13 ? 10.601  -15.377 -5.464  1.00 0.00 ? 434 ARG A HH12 6  
ATOM   7365  H  HH21 . ARG A 1 13 ? 13.245  -14.236 -7.449  1.00 0.00 ? 434 ARG A HH21 6  
ATOM   7366  H  HH22 . ARG A 1 13 ? 12.439  -15.628 -6.808  1.00 0.00 ? 434 ARG A HH22 6  
ATOM   7367  N  N    . GLU A 1 14 ? 8.583   -7.094  -7.755  1.00 0.00 ? 435 GLU A N    6  
ATOM   7368  C  CA   . GLU A 1 14 ? 8.252   -5.760  -7.266  1.00 0.00 ? 435 GLU A CA   6  
ATOM   7369  C  C    . GLU A 1 14 ? 6.748   -5.619  -7.046  1.00 0.00 ? 435 GLU A C    6  
ATOM   7370  O  O    . GLU A 1 14 ? 5.977   -6.534  -7.340  1.00 0.00 ? 435 GLU A O    6  
ATOM   7371  C  CB   . GLU A 1 14 ? 8.736   -4.696  -8.253  1.00 0.00 ? 435 GLU A CB   6  
ATOM   7372  C  CG   . GLU A 1 14 ? 10.240  -4.480  -8.226  1.00 0.00 ? 435 GLU A CG   6  
ATOM   7373  C  CD   . GLU A 1 14 ? 10.684  -3.354  -9.138  1.00 0.00 ? 435 GLU A CD   6  
ATOM   7374  O  OE1  . GLU A 1 14 ? 9.841   -2.500  -9.482  1.00 0.00 ? 435 GLU A OE1  6  
ATOM   7375  O  OE2  . GLU A 1 14 ? 11.876  -3.327  -9.509  1.00 0.00 ? 435 GLU A OE2  6  
ATOM   7376  H  H    . GLU A 1 14 ? 8.109   -7.448  -8.536  1.00 0.00 ? 435 GLU A H    6  
ATOM   7377  H  HA   . GLU A 1 14 ? 8.756   -5.618  -6.322  1.00 0.00 ? 435 GLU A HA   6  
ATOM   7378  H  HB2  . GLU A 1 14 ? 8.454   -4.994  -9.252  1.00 0.00 ? 435 GLU A HB2  6  
ATOM   7379  H  HB3  . GLU A 1 14 ? 8.255   -3.759  -8.017  1.00 0.00 ? 435 GLU A HB3  6  
ATOM   7380  H  HG2  . GLU A 1 14 ? 10.538  -4.243  -7.215  1.00 0.00 ? 435 GLU A HG2  6  
ATOM   7381  H  HG3  . GLU A 1 14 ? 10.728  -5.391  -8.539  1.00 0.00 ? 435 GLU A HG3  6  
ATOM   7382  N  N    . LEU A 1 15 ? 6.338   -4.467  -6.528  1.00 0.00 ? 436 LEU A N    6  
ATOM   7383  C  CA   . LEU A 1 15 ? 4.927   -4.204  -6.268  1.00 0.00 ? 436 LEU A CA   6  
ATOM   7384  C  C    . LEU A 1 15 ? 4.179   -3.910  -7.564  1.00 0.00 ? 436 LEU A C    6  
ATOM   7385  O  O    . LEU A 1 15 ? 4.523   -2.979  -8.294  1.00 0.00 ? 436 LEU A O    6  
ATOM   7386  C  CB   . LEU A 1 15 ? 4.776   -3.029  -5.301  1.00 0.00 ? 436 LEU A CB   6  
ATOM   7387  C  CG   . LEU A 1 15 ? 3.345   -2.668  -4.900  1.00 0.00 ? 436 LEU A CG   6  
ATOM   7388  C  CD1  . LEU A 1 15 ? 2.765   -3.730  -3.980  1.00 0.00 ? 436 LEU A CD1  6  
ATOM   7389  C  CD2  . LEU A 1 15 ? 3.307   -1.301  -4.232  1.00 0.00 ? 436 LEU A CD2  6  
ATOM   7390  H  H    . LEU A 1 15 ? 6.999   -3.776  -6.315  1.00 0.00 ? 436 LEU A H    6  
ATOM   7391  H  HA   . LEU A 1 15 ? 4.503   -5.089  -5.815  1.00 0.00 ? 436 LEU A HA   6  
ATOM   7392  H  HB2  . LEU A 1 15 ? 5.320   -3.269  -4.401  1.00 0.00 ? 436 LEU A HB2  6  
ATOM   7393  H  HB3  . LEU A 1 15 ? 5.220   -2.160  -5.766  1.00 0.00 ? 436 LEU A HB3  6  
ATOM   7394  H  HG   . LEU A 1 15 ? 2.730   -2.624  -5.788  1.00 0.00 ? 436 LEU A HG   6  
ATOM   7395  H  HD11 . LEU A 1 15 ? 2.673   -4.661  -4.518  1.00 0.00 ? 436 LEU A HD11 6  
ATOM   7396  H  HD12 . LEU A 1 15 ? 1.790   -3.415  -3.636  1.00 0.00 ? 436 LEU A HD12 6  
ATOM   7397  H  HD13 . LEU A 1 15 ? 3.418   -3.867  -3.131  1.00 0.00 ? 436 LEU A HD13 6  
ATOM   7398  H  HD21 . LEU A 1 15 ? 4.114   -0.692  -4.612  1.00 0.00 ? 436 LEU A HD21 6  
ATOM   7399  H  HD22 . LEU A 1 15 ? 3.419   -1.420  -3.164  1.00 0.00 ? 436 LEU A HD22 6  
ATOM   7400  H  HD23 . LEU A 1 15 ? 2.363   -0.823  -4.445  1.00 0.00 ? 436 LEU A HD23 6  
ATOM   7401  N  N    . CYS A 1 16 ? 3.154   -4.707  -7.845  1.00 0.00 ? 437 CYS A N    6  
ATOM   7402  C  CA   . CYS A 1 16 ? 2.356   -4.532  -9.052  1.00 0.00 ? 437 CYS A CA   6  
ATOM   7403  C  C    . CYS A 1 16 ? 1.709   -3.150  -9.081  1.00 0.00 ? 437 CYS A C    6  
ATOM   7404  O  O    . CYS A 1 16 ? 1.104   -2.715  -8.101  1.00 0.00 ? 437 CYS A O    6  
ATOM   7405  C  CB   . CYS A 1 16 ? 1.278   -5.614  -9.137  1.00 0.00 ? 437 CYS A CB   6  
ATOM   7406  S  SG   . CYS A 1 16 ? 0.513   -5.774  -10.783 1.00 0.00 ? 437 CYS A SG   6  
ATOM   7407  H  H    . CYS A 1 16 ? 2.928   -5.432  -7.224  1.00 0.00 ? 437 CYS A H    6  
ATOM   7408  H  HA   . CYS A 1 16 ? 3.015   -4.625  -9.902  1.00 0.00 ? 437 CYS A HA   6  
ATOM   7409  H  HB2  . CYS A 1 16 ? 1.716   -6.569  -8.885  1.00 0.00 ? 437 CYS A HB2  6  
ATOM   7410  H  HB3  . CYS A 1 16 ? 0.493   -5.386  -8.431  1.00 0.00 ? 437 CYS A HB3  6  
ATOM   7411  N  N    . LYS A 1 17 ? 1.842   -2.464  -10.211 1.00 0.00 ? 438 LYS A N    6  
ATOM   7412  C  CA   . LYS A 1 17 ? 1.270   -1.133  -10.370 1.00 0.00 ? 438 LYS A CA   6  
ATOM   7413  C  C    . LYS A 1 17 ? -0.248  -1.205  -10.507 1.00 0.00 ? 438 LYS A C    6  
ATOM   7414  O  O    . LYS A 1 17 ? -0.914  -0.186  -10.689 1.00 0.00 ? 438 LYS A O    6  
ATOM   7415  C  CB   . LYS A 1 17 ? 1.871   -0.440  -11.595 1.00 0.00 ? 438 LYS A CB   6  
ATOM   7416  C  CG   . LYS A 1 17 ? 3.368   -0.207  -11.489 1.00 0.00 ? 438 LYS A CG   6  
ATOM   7417  C  CD   . LYS A 1 17 ? 4.156   -1.380  -12.047 1.00 0.00 ? 438 LYS A CD   6  
ATOM   7418  C  CE   . LYS A 1 17 ? 5.495   -0.934  -12.613 1.00 0.00 ? 438 LYS A CE   6  
ATOM   7419  N  NZ   . LYS A 1 17 ? 6.571   -0.968  -11.584 1.00 0.00 ? 438 LYS A NZ   6  
ATOM   7420  H  H    . LYS A 1 17 ? 2.336   -2.865  -10.958 1.00 0.00 ? 438 LYS A H    6  
ATOM   7421  H  HA   . LYS A 1 17 ? 1.512   -0.560  -9.488  1.00 0.00 ? 438 LYS A HA   6  
ATOM   7422  H  HB2  . LYS A 1 17 ? 1.683   -1.050  -12.467 1.00 0.00 ? 438 LYS A HB2  6  
ATOM   7423  H  HB3  . LYS A 1 17 ? 1.387   0.518   -11.726 1.00 0.00 ? 438 LYS A HB3  6  
ATOM   7424  H  HG2  . LYS A 1 17 ? 3.625   0.682   -12.044 1.00 0.00 ? 438 LYS A HG2  6  
ATOM   7425  H  HG3  . LYS A 1 17 ? 3.629   -0.073  -10.449 1.00 0.00 ? 438 LYS A HG3  6  
ATOM   7426  H  HD2  . LYS A 1 17 ? 4.332   -2.094  -11.256 1.00 0.00 ? 438 LYS A HD2  6  
ATOM   7427  H  HD3  . LYS A 1 17 ? 3.580   -1.847  -12.834 1.00 0.00 ? 438 LYS A HD3  6  
ATOM   7428  H  HE2  . LYS A 1 17 ? 5.765   -1.590  -13.426 1.00 0.00 ? 438 LYS A HE2  6  
ATOM   7429  H  HE3  . LYS A 1 17 ? 5.395   0.076   -12.984 1.00 0.00 ? 438 LYS A HE3  6  
ATOM   7430  H  HZ1  . LYS A 1 17 ? 7.406   -1.462  -11.958 1.00 0.00 ? 438 LYS A HZ1  6  
ATOM   7431  H  HZ2  . LYS A 1 17 ? 6.238   -1.467  -10.735 1.00 0.00 ? 438 LYS A HZ2  6  
ATOM   7432  H  HZ3  . LYS A 1 17 ? 6.843   0.000   -11.320 1.00 0.00 ? 438 LYS A HZ3  6  
ATOM   7433  N  N    . PHE A 1 18 ? -0.788  -2.416  -10.419 1.00 0.00 ? 439 PHE A N    6  
ATOM   7434  C  CA   . PHE A 1 18 ? -2.228  -2.621  -10.533 1.00 0.00 ? 439 PHE A CA   6  
ATOM   7435  C  C    . PHE A 1 18 ? -2.792  -3.235  -9.255  1.00 0.00 ? 439 PHE A C    6  
ATOM   7436  O  O    . PHE A 1 18 ? -3.871  -2.858  -8.796  1.00 0.00 ? 439 PHE A O    6  
ATOM   7437  C  CB   . PHE A 1 18 ? -2.543  -3.522  -11.728 1.00 0.00 ? 439 PHE A CB   6  
ATOM   7438  C  CG   . PHE A 1 18 ? -2.376  -2.839  -13.055 1.00 0.00 ? 439 PHE A CG   6  
ATOM   7439  C  CD1  . PHE A 1 18 ? -3.425  -2.137  -13.625 1.00 0.00 ? 439 PHE A CD1  6  
ATOM   7440  C  CD2  . PHE A 1 18 ? -1.169  -2.899  -13.733 1.00 0.00 ? 439 PHE A CD2  6  
ATOM   7441  C  CE1  . PHE A 1 18 ? -3.275  -1.506  -14.845 1.00 0.00 ? 439 PHE A CE1  6  
ATOM   7442  C  CE2  . PHE A 1 18 ? -1.013  -2.271  -14.954 1.00 0.00 ? 439 PHE A CE2  6  
ATOM   7443  C  CZ   . PHE A 1 18 ? -2.067  -1.574  -15.512 1.00 0.00 ? 439 PHE A CZ   6  
ATOM   7444  H  H    . PHE A 1 18 ? -0.205  -3.190  -10.274 1.00 0.00 ? 439 PHE A H    6  
ATOM   7445  H  HA   . PHE A 1 18 ? -2.687  -1.657  -10.689 1.00 0.00 ? 439 PHE A HA   6  
ATOM   7446  H  HB2  . PHE A 1 18 ? -1.882  -4.376  -11.710 1.00 0.00 ? 439 PHE A HB2  6  
ATOM   7447  H  HB3  . PHE A 1 18 ? -3.565  -3.861  -11.654 1.00 0.00 ? 439 PHE A HB3  6  
ATOM   7448  H  HD1  . PHE A 1 18 ? -4.372  -2.083  -13.104 1.00 0.00 ? 439 PHE A HD1  6  
ATOM   7449  H  HD2  . PHE A 1 18 ? -0.344  -3.445  -13.300 1.00 0.00 ? 439 PHE A HD2  6  
ATOM   7450  H  HE1  . PHE A 1 18 ? -4.102  -0.963  -15.278 1.00 0.00 ? 439 PHE A HE1  6  
ATOM   7451  H  HE2  . PHE A 1 18 ? -0.067  -2.326  -15.473 1.00 0.00 ? 439 PHE A HE2  6  
ATOM   7452  H  HZ   . PHE A 1 18 ? -1.947  -1.082  -16.465 1.00 0.00 ? 439 PHE A HZ   6  
ATOM   7453  N  N    . TYR A 1 19 ? -2.056  -4.183  -8.686  1.00 0.00 ? 440 TYR A N    6  
ATOM   7454  C  CA   . TYR A 1 19 ? -2.484  -4.852  -7.463  1.00 0.00 ? 440 TYR A CA   6  
ATOM   7455  C  C    . TYR A 1 19 ? -2.785  -3.838  -6.364  1.00 0.00 ? 440 TYR A C    6  
ATOM   7456  O  O    . TYR A 1 19 ? -3.610  -4.086  -5.484  1.00 0.00 ? 440 TYR A O    6  
ATOM   7457  C  CB   . TYR A 1 19 ? -1.408  -5.830  -6.989  1.00 0.00 ? 440 TYR A CB   6  
ATOM   7458  C  CG   . TYR A 1 19 ? -1.856  -6.719  -5.851  1.00 0.00 ? 440 TYR A CG   6  
ATOM   7459  C  CD1  . TYR A 1 19 ? -2.951  -7.563  -5.993  1.00 0.00 ? 440 TYR A CD1  6  
ATOM   7460  C  CD2  . TYR A 1 19 ? -1.186  -6.714  -4.634  1.00 0.00 ? 440 TYR A CD2  6  
ATOM   7461  C  CE1  . TYR A 1 19 ? -3.365  -8.376  -4.956  1.00 0.00 ? 440 TYR A CE1  6  
ATOM   7462  C  CE2  . TYR A 1 19 ? -1.592  -7.525  -3.592  1.00 0.00 ? 440 TYR A CE2  6  
ATOM   7463  C  CZ   . TYR A 1 19 ? -2.682  -8.354  -3.758  1.00 0.00 ? 440 TYR A CZ   6  
ATOM   7464  O  OH   . TYR A 1 19 ? -3.090  -9.162  -2.721  1.00 0.00 ? 440 TYR A OH   6  
ATOM   7465  H  H    . TYR A 1 19 ? -1.205  -4.440  -9.099  1.00 0.00 ? 440 TYR A H    6  
ATOM   7466  H  HA   . TYR A 1 19 ? -3.385  -5.404  -7.685  1.00 0.00 ? 440 TYR A HA   6  
ATOM   7467  H  HB2  . TYR A 1 19 ? -1.121  -6.466  -7.812  1.00 0.00 ? 440 TYR A HB2  6  
ATOM   7468  H  HB3  . TYR A 1 19 ? -0.546  -5.272  -6.655  1.00 0.00 ? 440 TYR A HB3  6  
ATOM   7469  H  HD1  . TYR A 1 19 ? -3.484  -7.578  -6.933  1.00 0.00 ? 440 TYR A HD1  6  
ATOM   7470  H  HD2  . TYR A 1 19 ? -0.333  -6.063  -4.508  1.00 0.00 ? 440 TYR A HD2  6  
ATOM   7471  H  HE1  . TYR A 1 19 ? -4.218  -9.025  -5.085  1.00 0.00 ? 440 TYR A HE1  6  
ATOM   7472  H  HE2  . TYR A 1 19 ? -1.058  -7.507  -2.654  1.00 0.00 ? 440 TYR A HE2  6  
ATOM   7473  H  HH   . TYR A 1 19 ? -3.116  -10.075 -3.019  1.00 0.00 ? 440 TYR A HH   6  
ATOM   7474  N  N    . ILE A 1 20 ? -2.111  -2.694  -6.422  1.00 0.00 ? 441 ILE A N    6  
ATOM   7475  C  CA   . ILE A 1 20 ? -2.306  -1.641  -5.434  1.00 0.00 ? 441 ILE A CA   6  
ATOM   7476  C  C    . ILE A 1 20 ? -3.789  -1.404  -5.169  1.00 0.00 ? 441 ILE A C    6  
ATOM   7477  O  O    . ILE A 1 20 ? -4.186  -1.056  -4.056  1.00 0.00 ? 441 ILE A O    6  
ATOM   7478  C  CB   . ILE A 1 20 ? -1.659  -0.319  -5.884  1.00 0.00 ? 441 ILE A CB   6  
ATOM   7479  C  CG1  . ILE A 1 20 ? -0.160  -0.514  -6.120  1.00 0.00 ? 441 ILE A CG1  6  
ATOM   7480  C  CG2  . ILE A 1 20 ? -1.901  0.769   -4.848  1.00 0.00 ? 441 ILE A CG2  6  
ATOM   7481  C  CD1  . ILE A 1 20 ? 0.504   0.667   -6.793  1.00 0.00 ? 441 ILE A CD1  6  
ATOM   7482  H  H    . ILE A 1 20 ? -1.467  -2.555  -7.147  1.00 0.00 ? 441 ILE A H    6  
ATOM   7483  H  HA   . ILE A 1 20 ? -1.834  -1.956  -4.514  1.00 0.00 ? 441 ILE A HA   6  
ATOM   7484  H  HB   . ILE A 1 20 ? -2.125  -0.012  -6.808  1.00 0.00 ? 441 ILE A HB   6  
ATOM   7485  H  HG12 . ILE A 1 20 ? 0.330   -0.673  -5.173  1.00 0.00 ? 441 ILE A HG12 6  
ATOM   7486  H  HG13 . ILE A 1 20 ? -0.012  -1.381  -6.748  1.00 0.00 ? 441 ILE A HG13 6  
ATOM   7487  H  HG21 . ILE A 1 20 ? -0.993  1.336   -4.704  1.00 0.00 ? 441 ILE A HG21 6  
ATOM   7488  H  HG22 . ILE A 1 20 ? -2.684  1.427   -5.194  1.00 0.00 ? 441 ILE A HG22 6  
ATOM   7489  H  HG23 . ILE A 1 20 ? -2.196  0.317   -3.913  1.00 0.00 ? 441 ILE A HG23 6  
ATOM   7490  H  HD11 . ILE A 1 20 ? 0.418   0.567   -7.865  1.00 0.00 ? 441 ILE A HD11 6  
ATOM   7491  H  HD12 . ILE A 1 20 ? 0.024   1.580   -6.476  1.00 0.00 ? 441 ILE A HD12 6  
ATOM   7492  H  HD13 . ILE A 1 20 ? 1.549   0.697   -6.518  1.00 0.00 ? 441 ILE A HD13 6  
ATOM   7493  N  N    . THR A 1 21 ? -4.607  -1.597  -6.200  1.00 0.00 ? 442 THR A N    6  
ATOM   7494  C  CA   . THR A 1 21 ? -6.047  -1.405  -6.080  1.00 0.00 ? 442 THR A CA   6  
ATOM   7495  C  C    . THR A 1 21 ? -6.771  -2.741  -5.960  1.00 0.00 ? 442 THR A C    6  
ATOM   7496  O  O    . THR A 1 21 ? -7.827  -2.832  -5.336  1.00 0.00 ? 442 THR A O    6  
ATOM   7497  C  CB   . THR A 1 21 ? -6.613  -0.633  -7.286  1.00 0.00 ? 442 THR A CB   6  
ATOM   7498  O  OG1  . THR A 1 21 ? -6.116  -1.197  -8.506  1.00 0.00 ? 442 THR A OG1  6  
ATOM   7499  C  CG2  . THR A 1 21 ? -6.237  0.839   -7.212  1.00 0.00 ? 442 THR A CG2  6  
ATOM   7500  H  H    . THR A 1 21 ? -4.231  -1.874  -7.061  1.00 0.00 ? 442 THR A H    6  
ATOM   7501  H  HA   . THR A 1 21 ? -6.232  -0.825  -5.188  1.00 0.00 ? 442 THR A HA   6  
ATOM   7502  H  HB   . THR A 1 21 ? -7.691  -0.716  -7.273  1.00 0.00 ? 442 THR A HB   6  
ATOM   7503  H  HG1  . THR A 1 21 ? -6.804  -1.166  -9.176  1.00 0.00 ? 442 THR A HG1  6  
ATOM   7504  H  HG21 . THR A 1 21 ? -5.162  0.935   -7.188  1.00 0.00 ? 442 THR A HG21 6  
ATOM   7505  H  HG22 . THR A 1 21 ? -6.658  1.273   -6.317  1.00 0.00 ? 442 THR A HG22 6  
ATOM   7506  H  HG23 . THR A 1 21 ? -6.625  1.353   -8.078  1.00 0.00 ? 442 THR A HG23 6  
ATOM   7507  N  N    . GLY A 1 22 ? -6.195  -3.778  -6.562  1.00 0.00 ? 443 GLY A N    6  
ATOM   7508  C  CA   . GLY A 1 22 ? -6.801  -5.096  -6.510  1.00 0.00 ? 443 GLY A CA   6  
ATOM   7509  C  C    . GLY A 1 22 ? -7.220  -5.596  -7.878  1.00 0.00 ? 443 GLY A C    6  
ATOM   7510  O  O    . GLY A 1 22 ? -7.575  -6.764  -8.038  1.00 0.00 ? 443 GLY A O    6  
ATOM   7511  H  H    . GLY A 1 22 ? -5.353  -3.646  -7.045  1.00 0.00 ? 443 GLY A H    6  
ATOM   7512  H  HA2  . GLY A 1 22 ? -6.090  -5.790  -6.086  1.00 0.00 ? 443 GLY A HA2  6  
ATOM   7513  H  HA3  . GLY A 1 22 ? -7.672  -5.054  -5.872  1.00 0.00 ? 443 GLY A HA3  6  
ATOM   7514  N  N    . PHE A 1 23 ? -7.180  -4.710  -8.868  1.00 0.00 ? 444 PHE A N    6  
ATOM   7515  C  CA   . PHE A 1 23 ? -7.561  -5.067  -10.229 1.00 0.00 ? 444 PHE A CA   6  
ATOM   7516  C  C    . PHE A 1 23 ? -6.327  -5.337  -11.086 1.00 0.00 ? 444 PHE A C    6  
ATOM   7517  O  O    . PHE A 1 23 ? -5.700  -4.410  -11.600 1.00 0.00 ? 444 PHE A O    6  
ATOM   7518  C  CB   . PHE A 1 23 ? -8.398  -3.951  -10.857 1.00 0.00 ? 444 PHE A CB   6  
ATOM   7519  C  CG   . PHE A 1 23 ? -9.016  -4.331  -12.171 1.00 0.00 ? 444 PHE A CG   6  
ATOM   7520  C  CD1  . PHE A 1 23 ? -8.235  -4.459  -13.308 1.00 0.00 ? 444 PHE A CD1  6  
ATOM   7521  C  CD2  . PHE A 1 23 ? -10.379 -4.562  -12.270 1.00 0.00 ? 444 PHE A CD2  6  
ATOM   7522  C  CE1  . PHE A 1 23 ? -8.801  -4.809  -14.520 1.00 0.00 ? 444 PHE A CE1  6  
ATOM   7523  C  CE2  . PHE A 1 23 ? -10.951 -4.913  -13.479 1.00 0.00 ? 444 PHE A CE2  6  
ATOM   7524  C  CZ   . PHE A 1 23 ? -10.161 -5.037  -14.604 1.00 0.00 ? 444 PHE A CZ   6  
ATOM   7525  H  H    . PHE A 1 23 ? -6.887  -3.794  -8.678  1.00 0.00 ? 444 PHE A H    6  
ATOM   7526  H  HA   . PHE A 1 23 ? -8.155  -5.967  -10.181 1.00 0.00 ? 444 PHE A HA   6  
ATOM   7527  H  HB2  . PHE A 1 23 ? -9.196  -3.685  -10.180 1.00 0.00 ? 444 PHE A HB2  6  
ATOM   7528  H  HB3  . PHE A 1 23 ? -7.769  -3.089  -11.021 1.00 0.00 ? 444 PHE A HB3  6  
ATOM   7529  H  HD1  . PHE A 1 23 ? -7.171  -4.282  -13.244 1.00 0.00 ? 444 PHE A HD1  6  
ATOM   7530  H  HD2  . PHE A 1 23 ? -10.998 -4.465  -11.389 1.00 0.00 ? 444 PHE A HD2  6  
ATOM   7531  H  HE1  . PHE A 1 23 ? -8.181  -4.906  -15.398 1.00 0.00 ? 444 PHE A HE1  6  
ATOM   7532  H  HE2  . PHE A 1 23 ? -12.014 -5.090  -13.541 1.00 0.00 ? 444 PHE A HE2  6  
ATOM   7533  H  HZ   . PHE A 1 23 ? -10.606 -5.310  -15.550 1.00 0.00 ? 444 PHE A HZ   6  
ATOM   7534  N  N    . CYS A 1 24 ? -5.985  -6.612  -11.236 1.00 0.00 ? 445 CYS A N    6  
ATOM   7535  C  CA   . CYS A 1 24 ? -4.827  -7.006  -12.029 1.00 0.00 ? 445 CYS A CA   6  
ATOM   7536  C  C    . CYS A 1 24 ? -5.188  -8.126  -13.000 1.00 0.00 ? 445 CYS A C    6  
ATOM   7537  O  O    . CYS A 1 24 ? -5.401  -9.268  -12.594 1.00 0.00 ? 445 CYS A O    6  
ATOM   7538  C  CB   . CYS A 1 24 ? -3.686  -7.456  -11.115 1.00 0.00 ? 445 CYS A CB   6  
ATOM   7539  S  SG   . CYS A 1 24 ? -2.314  -8.277  -11.988 1.00 0.00 ? 445 CYS A SG   6  
ATOM   7540  H  H    . CYS A 1 24 ? -6.525  -7.306  -10.802 1.00 0.00 ? 445 CYS A H    6  
ATOM   7541  H  HA   . CYS A 1 24 ? -4.505  -6.145  -12.595 1.00 0.00 ? 445 CYS A HA   6  
ATOM   7542  H  HB2  . CYS A 1 24 ? -3.282  -6.594  -10.605 1.00 0.00 ? 445 CYS A HB2  6  
ATOM   7543  H  HB3  . CYS A 1 24 ? -4.073  -8.151  -10.384 1.00 0.00 ? 445 CYS A HB3  6  
ATOM   7544  N  N    . ALA A 1 25 ? -5.256  -7.790  -14.284 1.00 0.00 ? 446 ALA A N    6  
ATOM   7545  C  CA   . ALA A 1 25 ? -5.589  -8.767  -15.313 1.00 0.00 ? 446 ALA A CA   6  
ATOM   7546  C  C    . ALA A 1 25 ? -4.922  -10.109 -15.032 1.00 0.00 ? 446 ALA A C    6  
ATOM   7547  O  O    . ALA A 1 25 ? -5.596  -11.102 -14.756 1.00 0.00 ? 446 ALA A O    6  
ATOM   7548  C  CB   . ALA A 1 25 ? -5.180  -8.250  -16.684 1.00 0.00 ? 446 ALA A CB   6  
ATOM   7549  H  H    . ALA A 1 25 ? -5.076  -6.863  -14.545 1.00 0.00 ? 446 ALA A H    6  
ATOM   7550  H  HA   . ALA A 1 25 ? -6.661  -8.902  -15.311 1.00 0.00 ? 446 ALA A HA   6  
ATOM   7551  H  HB1  . ALA A 1 25 ? -4.149  -7.927  -16.653 1.00 0.00 ? 446 ALA A HB1  6  
ATOM   7552  H  HB2  . ALA A 1 25 ? -5.289  -9.038  -17.414 1.00 0.00 ? 446 ALA A HB2  6  
ATOM   7553  H  HB3  . ALA A 1 25 ? -5.810  -7.417  -16.957 1.00 0.00 ? 446 ALA A HB3  6  
ATOM   7554  N  N    . ARG A 1 26 ? -3.595  -10.133 -15.103 1.00 0.00 ? 447 ARG A N    6  
ATOM   7555  C  CA   . ARG A 1 26 ? -2.838  -11.354 -14.858 1.00 0.00 ? 447 ARG A CA   6  
ATOM   7556  C  C    . ARG A 1 26 ? -2.872  -11.727 -13.378 1.00 0.00 ? 447 ARG A C    6  
ATOM   7557  O  O    . ARG A 1 26 ? -2.197  -11.108 -12.557 1.00 0.00 ? 447 ARG A O    6  
ATOM   7558  C  CB   . ARG A 1 26 ? -1.389  -11.183 -15.318 1.00 0.00 ? 447 ARG A CB   6  
ATOM   7559  C  CG   . ARG A 1 26 ? -1.152  -11.617 -16.755 1.00 0.00 ? 447 ARG A CG   6  
ATOM   7560  C  CD   . ARG A 1 26 ? 0.275   -11.329 -17.196 1.00 0.00 ? 447 ARG A CD   6  
ATOM   7561  N  NE   . ARG A 1 26 ? 0.400   -10.016 -17.822 1.00 0.00 ? 447 ARG A NE   6  
ATOM   7562  C  CZ   . ARG A 1 26 ? -0.093  -9.724  -19.021 1.00 0.00 ? 447 ARG A CZ   6  
ATOM   7563  N  NH1  . ARG A 1 26 ? -0.740  -10.647 -19.718 1.00 0.00 ? 447 ARG A NH1  6  
ATOM   7564  N  NH2  . ARG A 1 26 ? 0.062   -8.506  -19.524 1.00 0.00 ? 447 ARG A NH2  6  
ATOM   7565  H  H    . ARG A 1 26 ? -3.114  -9.309  -15.327 1.00 0.00 ? 447 ARG A H    6  
ATOM   7566  H  HA   . ARG A 1 26 ? -3.296  -12.149 -15.427 1.00 0.00 ? 447 ARG A HA   6  
ATOM   7567  H  HB2  . ARG A 1 26 ? -1.117  -10.141 -15.231 1.00 0.00 ? 447 ARG A HB2  6  
ATOM   7568  H  HB3  . ARG A 1 26 ? -0.749  -11.769 -14.677 1.00 0.00 ? 447 ARG A HB3  6  
ATOM   7569  H  HG2  . ARG A 1 26 ? -1.334  -12.679 -16.835 1.00 0.00 ? 447 ARG A HG2  6  
ATOM   7570  H  HG3  . ARG A 1 26 ? -1.833  -11.083 -17.400 1.00 0.00 ? 447 ARG A HG3  6  
ATOM   7571  H  HD2  . ARG A 1 26 ? 0.920   -11.367 -16.330 1.00 0.00 ? 447 ARG A HD2  6  
ATOM   7572  H  HD3  . ARG A 1 26 ? 0.579   -12.086 -17.903 1.00 0.00 ? 447 ARG A HD3  6  
ATOM   7573  H  HE   . ARG A 1 26 ? 0.875   -9.319  -17.325 1.00 0.00 ? 447 ARG A HE   6  
ATOM   7574  H  HH11 . ARG A 1 26 ? -0.859  -11.566 -19.341 1.00 0.00 ? 447 ARG A HH11 6  
ATOM   7575  H  HH12 . ARG A 1 26 ? -1.111  -10.425 -20.620 1.00 0.00 ? 447 ARG A HH12 6  
ATOM   7576  H  HH21 . ARG A 1 26 ? 0.549   -7.807  -19.001 1.00 0.00 ? 447 ARG A HH21 6  
ATOM   7577  H  HH22 . ARG A 1 26 ? -0.309  -8.287  -20.426 1.00 0.00 ? 447 ARG A HH22 6  
ATOM   7578  N  N    . ALA A 1 27 ? -3.663  -12.742 -13.047 1.00 0.00 ? 448 ALA A N    6  
ATOM   7579  C  CA   . ALA A 1 27 ? -3.784  -13.198 -11.668 1.00 0.00 ? 448 ALA A CA   6  
ATOM   7580  C  C    . ALA A 1 27 ? -2.636  -14.130 -11.296 1.00 0.00 ? 448 ALA A C    6  
ATOM   7581  O  O    . ALA A 1 27 ? -1.696  -13.729 -10.611 1.00 0.00 ? 448 ALA A O    6  
ATOM   7582  C  CB   . ALA A 1 27 ? -5.121  -13.893 -11.457 1.00 0.00 ? 448 ALA A CB   6  
ATOM   7583  H  H    . ALA A 1 27 ? -4.177  -13.196 -13.747 1.00 0.00 ? 448 ALA A H    6  
ATOM   7584  H  HA   . ALA A 1 27 ? -3.752  -12.330 -11.025 1.00 0.00 ? 448 ALA A HA   6  
ATOM   7585  H  HB1  . ALA A 1 27 ? -5.632  -13.442 -10.619 1.00 0.00 ? 448 ALA A HB1  6  
ATOM   7586  H  HB2  . ALA A 1 27 ? -5.725  -13.788 -12.346 1.00 0.00 ? 448 ALA A HB2  6  
ATOM   7587  H  HB3  . ALA A 1 27 ? -4.954  -14.941 -11.257 1.00 0.00 ? 448 ALA A HB3  6  
ATOM   7588  N  N    . GLU A 1 28 ? -2.721  -15.377 -11.750 1.00 0.00 ? 449 GLU A N    6  
ATOM   7589  C  CA   . GLU A 1 28 ? -1.689  -16.366 -11.462 1.00 0.00 ? 449 GLU A CA   6  
ATOM   7590  C  C    . GLU A 1 28 ? -0.509  -16.215 -12.418 1.00 0.00 ? 449 GLU A C    6  
ATOM   7591  O  O    . GLU A 1 28 ? 0.489   -16.925 -12.305 1.00 0.00 ? 449 GLU A O    6  
ATOM   7592  C  CB   . GLU A 1 28 ? -2.265  -17.780 -11.564 1.00 0.00 ? 449 GLU A CB   6  
ATOM   7593  C  CG   . GLU A 1 28 ? -1.250  -18.873 -11.272 1.00 0.00 ? 449 GLU A CG   6  
ATOM   7594  C  CD   . GLU A 1 28 ? -1.882  -20.248 -11.183 1.00 0.00 ? 449 GLU A CD   6  
ATOM   7595  O  OE1  . GLU A 1 28 ? -2.457  -20.704 -12.194 1.00 0.00 ? 449 GLU A OE1  6  
ATOM   7596  O  OE2  . GLU A 1 28 ? -1.802  -20.868 -10.102 1.00 0.00 ? 449 GLU A OE2  6  
ATOM   7597  H  H    . GLU A 1 28 ? -3.496  -15.637 -12.291 1.00 0.00 ? 449 GLU A H    6  
ATOM   7598  H  HA   . GLU A 1 28 ? -1.343  -16.200 -10.453 1.00 0.00 ? 449 GLU A HA   6  
ATOM   7599  H  HB2  . GLU A 1 28 ? -3.079  -17.876 -10.862 1.00 0.00 ? 449 GLU A HB2  6  
ATOM   7600  H  HB3  . GLU A 1 28 ? -2.644  -17.930 -12.565 1.00 0.00 ? 449 GLU A HB3  6  
ATOM   7601  H  HG2  . GLU A 1 28 ? -0.513  -18.883 -12.061 1.00 0.00 ? 449 GLU A HG2  6  
ATOM   7602  H  HG3  . GLU A 1 28 ? -0.765  -18.654 -10.332 1.00 0.00 ? 449 GLU A HG3  6  
ATOM   7603  N  N    . ASN A 1 29 ? -0.632  -15.284 -13.359 1.00 0.00 ? 450 ASN A N    6  
ATOM   7604  C  CA   . ASN A 1 29 ? 0.423   -15.040 -14.335 1.00 0.00 ? 450 ASN A CA   6  
ATOM   7605  C  C    . ASN A 1 29 ? 1.029   -13.653 -14.145 1.00 0.00 ? 450 ASN A C    6  
ATOM   7606  O  O    . ASN A 1 29 ? 1.584   -13.072 -15.079 1.00 0.00 ? 450 ASN A O    6  
ATOM   7607  C  CB   . ASN A 1 29 ? -0.126  -15.178 -15.756 1.00 0.00 ? 450 ASN A CB   6  
ATOM   7608  C  CG   . ASN A 1 29 ? -0.485  -16.611 -16.101 1.00 0.00 ? 450 ASN A CG   6  
ATOM   7609  O  OD1  . ASN A 1 29 ? -1.578  -17.082 -15.784 1.00 0.00 ? 450 ASN A OD1  6  
ATOM   7610  N  ND2  . ASN A 1 29 ? 0.436   -17.311 -16.752 1.00 0.00 ? 450 ASN A ND2  6  
ATOM   7611  H  H    . ASN A 1 29 ? -1.453  -14.749 -13.398 1.00 0.00 ? 450 ASN A H    6  
ATOM   7612  H  HA   . ASN A 1 29 ? 1.193   -15.781 -14.183 1.00 0.00 ? 450 ASN A HA   6  
ATOM   7613  H  HB2  . ASN A 1 29 ? -1.016  -14.572 -15.852 1.00 0.00 ? 450 ASN A HB2  6  
ATOM   7614  H  HB3  . ASN A 1 29 ? 0.617   -14.834 -16.459 1.00 0.00 ? 450 ASN A HB3  6  
ATOM   7615  H  HD21 . ASN A 1 29 ? 1.284   -16.871 -16.971 1.00 0.00 ? 450 ASN A HD21 6  
ATOM   7616  H  HD22 . ASN A 1 29 ? 0.230   -18.240 -16.988 1.00 0.00 ? 450 ASN A HD22 6  
ATOM   7617  N  N    . CYS A 1 30 ? 0.921   -13.127 -12.929 1.00 0.00 ? 451 CYS A N    6  
ATOM   7618  C  CA   . CYS A 1 30 ? 1.458   -11.809 -12.615 1.00 0.00 ? 451 CYS A CA   6  
ATOM   7619  C  C    . CYS A 1 30 ? 2.962   -11.880 -12.365 1.00 0.00 ? 451 CYS A C    6  
ATOM   7620  O  O    . CYS A 1 30 ? 3.428   -12.493 -11.405 1.00 0.00 ? 451 CYS A O    6  
ATOM   7621  C  CB   . CYS A 1 30 ? 0.752   -11.227 -11.388 1.00 0.00 ? 451 CYS A CB   6  
ATOM   7622  S  SG   . CYS A 1 30 ? 1.327   -9.563  -10.921 1.00 0.00 ? 451 CYS A SG   6  
ATOM   7623  H  H    . CYS A 1 30 ? 0.468   -13.639 -12.226 1.00 0.00 ? 451 CYS A H    6  
ATOM   7624  H  HA   . CYS A 1 30 ? 1.276   -11.166 -13.463 1.00 0.00 ? 451 CYS A HA   6  
ATOM   7625  H  HB2  . CYS A 1 30 ? -0.307  -11.164 -11.589 1.00 0.00 ? 451 CYS A HB2  6  
ATOM   7626  H  HB3  . CYS A 1 30 ? 0.916   -11.881 -10.545 1.00 0.00 ? 451 CYS A HB3  6  
ATOM   7627  N  N    . PRO A 1 31 ? 3.739   -11.237 -13.248 1.00 0.00 ? 452 PRO A N    6  
ATOM   7628  C  CA   . PRO A 1 31 ? 5.201   -11.211 -13.144 1.00 0.00 ? 452 PRO A CA   6  
ATOM   7629  C  C    . PRO A 1 31 ? 5.684   -10.375 -11.964 1.00 0.00 ? 452 PRO A C    6  
ATOM   7630  O  O    . PRO A 1 31 ? 6.886   -10.209 -11.759 1.00 0.00 ? 452 PRO A O    6  
ATOM   7631  C  CB   . PRO A 1 31 ? 5.639   -10.573 -14.465 1.00 0.00 ? 452 PRO A CB   6  
ATOM   7632  C  CG   . PRO A 1 31 ? 4.474   -9.751  -14.894 1.00 0.00 ? 452 PRO A CG   6  
ATOM   7633  C  CD   . PRO A 1 31 ? 3.251   -10.485 -14.417 1.00 0.00 ? 452 PRO A CD   6  
ATOM   7634  H  HA   . PRO A 1 31 ? 5.611   -12.207 -13.070 1.00 0.00 ? 452 PRO A HA   6  
ATOM   7635  H  HB2  . PRO A 1 31 ? 6.516   -9.962  -14.300 1.00 0.00 ? 452 PRO A HB2  6  
ATOM   7636  H  HB3  . PRO A 1 31 ? 5.864   -11.346 -15.185 1.00 0.00 ? 452 PRO A HB3  6  
ATOM   7637  H  HG2  . PRO A 1 31 ? 4.526   -8.773  -14.439 1.00 0.00 ? 452 PRO A HG2  6  
ATOM   7638  H  HG3  . PRO A 1 31 ? 4.462   -9.664  -15.971 1.00 0.00 ? 452 PRO A HG3  6  
ATOM   7639  H  HD2  . PRO A 1 31 ? 2.479   -9.786  -14.131 1.00 0.00 ? 452 PRO A HD2  6  
ATOM   7640  H  HD3  . PRO A 1 31 ? 2.891   -11.155 -15.183 1.00 0.00 ? 452 PRO A HD3  6  
ATOM   7641  N  N    . TYR A 1 32 ? 4.739   -9.853  -11.190 1.00 0.00 ? 453 TYR A N    6  
ATOM   7642  C  CA   . TYR A 1 32 ? 5.069   -9.033  -10.030 1.00 0.00 ? 453 TYR A CA   6  
ATOM   7643  C  C    . TYR A 1 32 ? 4.617   -9.708  -8.739  1.00 0.00 ? 453 TYR A C    6  
ATOM   7644  O  O    . TYR A 1 32 ? 4.147   -10.846 -8.752  1.00 0.00 ? 453 TYR A O    6  
ATOM   7645  C  CB   . TYR A 1 32 ? 4.417   -7.654  -10.152 1.00 0.00 ? 453 TYR A CB   6  
ATOM   7646  C  CG   . TYR A 1 32 ? 5.027   -6.790  -11.232 1.00 0.00 ? 453 TYR A CG   6  
ATOM   7647  C  CD1  . TYR A 1 32 ? 4.654   -6.940  -12.562 1.00 0.00 ? 453 TYR A CD1  6  
ATOM   7648  C  CD2  . TYR A 1 32 ? 5.977   -5.824  -10.923 1.00 0.00 ? 453 TYR A CD2  6  
ATOM   7649  C  CE1  . TYR A 1 32 ? 5.209   -6.153  -13.553 1.00 0.00 ? 453 TYR A CE1  6  
ATOM   7650  C  CE2  . TYR A 1 32 ? 6.537   -5.032  -11.907 1.00 0.00 ? 453 TYR A CE2  6  
ATOM   7651  C  CZ   . TYR A 1 32 ? 6.149   -5.200  -13.220 1.00 0.00 ? 453 TYR A CZ   6  
ATOM   7652  O  OH   . TYR A 1 32 ? 6.705   -4.414  -14.203 1.00 0.00 ? 453 TYR A OH   6  
ATOM   7653  H  H    . TYR A 1 32 ? 3.798   -10.021 -11.404 1.00 0.00 ? 453 TYR A H    6  
ATOM   7654  H  HA   . TYR A 1 32 ? 6.142   -8.912  -10.003 1.00 0.00 ? 453 TYR A HA   6  
ATOM   7655  H  HB2  . TYR A 1 32 ? 3.370   -7.777  -10.379 1.00 0.00 ? 453 TYR A HB2  6  
ATOM   7656  H  HB3  . TYR A 1 32 ? 4.518   -7.131  -9.212  1.00 0.00 ? 453 TYR A HB3  6  
ATOM   7657  H  HD1  . TYR A 1 32 ? 3.917   -7.687  -12.820 1.00 0.00 ? 453 TYR A HD1  6  
ATOM   7658  H  HD2  . TYR A 1 32 ? 6.279   -5.696  -9.894  1.00 0.00 ? 453 TYR A HD2  6  
ATOM   7659  H  HE1  . TYR A 1 32 ? 4.906   -6.284  -14.582 1.00 0.00 ? 453 TYR A HE1  6  
ATOM   7660  H  HE2  . TYR A 1 32 ? 7.273   -4.286  -11.647 1.00 0.00 ? 453 TYR A HE2  6  
ATOM   7661  H  HH   . TYR A 1 32 ? 7.636   -4.629  -14.297 1.00 0.00 ? 453 TYR A HH   6  
ATOM   7662  N  N    . MET A 1 33 ? 4.762   -8.998  -7.625  1.00 0.00 ? 454 MET A N    6  
ATOM   7663  C  CA   . MET A 1 33 ? 4.367   -9.528  -6.325  1.00 0.00 ? 454 MET A CA   6  
ATOM   7664  C  C    . MET A 1 33 ? 3.006   -8.980  -5.905  1.00 0.00 ? 454 MET A C    6  
ATOM   7665  O  O    . MET A 1 33 ? 2.633   -7.866  -6.274  1.00 0.00 ? 454 MET A O    6  
ATOM   7666  C  CB   . MET A 1 33 ? 5.417   -9.180  -5.268  1.00 0.00 ? 454 MET A CB   6  
ATOM   7667  C  CG   . MET A 1 33 ? 6.745   -9.890  -5.474  1.00 0.00 ? 454 MET A CG   6  
ATOM   7668  S  SD   . MET A 1 33 ? 6.731   -11.583 -4.853  1.00 0.00 ? 454 MET A SD   6  
ATOM   7669  C  CE   . MET A 1 33 ? 7.545   -11.370 -3.272  1.00 0.00 ? 454 MET A CE   6  
ATOM   7670  H  H    . MET A 1 33 ? 5.142   -8.097  -7.678  1.00 0.00 ? 454 MET A H    6  
ATOM   7671  H  HA   . MET A 1 33 ? 4.299   -10.602 -6.411  1.00 0.00 ? 454 MET A HA   6  
ATOM   7672  H  HB2  . MET A 1 33 ? 5.596   -8.115  -5.292  1.00 0.00 ? 454 MET A HB2  6  
ATOM   7673  H  HB3  . MET A 1 33 ? 5.036   -9.451  -4.295  1.00 0.00 ? 454 MET A HB3  6  
ATOM   7674  H  HG2  . MET A 1 33 ? 6.967   -9.912  -6.531  1.00 0.00 ? 454 MET A HG2  6  
ATOM   7675  H  HG3  . MET A 1 33 ? 7.517   -9.338  -4.958  1.00 0.00 ? 454 MET A HG3  6  
ATOM   7676  H  HE1  . MET A 1 33 ? 8.599   -11.199 -3.429  1.00 0.00 ? 454 MET A HE1  6  
ATOM   7677  H  HE2  . MET A 1 33 ? 7.115   -10.523 -2.758  1.00 0.00 ? 454 MET A HE2  6  
ATOM   7678  H  HE3  . MET A 1 33 ? 7.410   -12.261 -2.675  1.00 0.00 ? 454 MET A HE3  6  
ATOM   7679  N  N    . HIS A 1 34 ? 2.268   -9.771  -5.132  1.00 0.00 ? 455 HIS A N    6  
ATOM   7680  C  CA   . HIS A 1 34 ? 0.948   -9.365  -4.662  1.00 0.00 ? 455 HIS A CA   6  
ATOM   7681  C  C    . HIS A 1 34 ? 0.858   -9.464  -3.143  1.00 0.00 ? 455 HIS A C    6  
ATOM   7682  O  O    . HIS A 1 34 ? 0.928   -8.457  -2.439  1.00 0.00 ? 455 HIS A O    6  
ATOM   7683  C  CB   . HIS A 1 34 ? -0.134  -10.231 -5.307  1.00 0.00 ? 455 HIS A CB   6  
ATOM   7684  C  CG   . HIS A 1 34 ? -0.500  -9.799  -6.693  1.00 0.00 ? 455 HIS A CG   6  
ATOM   7685  N  ND1  . HIS A 1 34 ? -1.329  -10.533 -7.516  1.00 0.00 ? 455 HIS A ND1  6  
ATOM   7686  C  CD2  . HIS A 1 34 ? -0.146  -8.701  -7.401  1.00 0.00 ? 455 HIS A CD2  6  
ATOM   7687  C  CE1  . HIS A 1 34 ? -1.467  -9.905  -8.670  1.00 0.00 ? 455 HIS A CE1  6  
ATOM   7688  N  NE2  . HIS A 1 34 ? -0.760  -8.790  -8.626  1.00 0.00 ? 455 HIS A NE2  6  
ATOM   7689  H  H    . HIS A 1 34 ? 2.620   -10.647 -4.871  1.00 0.00 ? 455 HIS A H    6  
ATOM   7690  H  HA   . HIS A 1 34 ? 0.795   -8.336  -4.953  1.00 0.00 ? 455 HIS A HA   6  
ATOM   7691  H  HB2  . HIS A 1 34 ? 0.214   -11.252 -5.359  1.00 0.00 ? 455 HIS A HB2  6  
ATOM   7692  H  HB3  . HIS A 1 34 ? -1.027  -10.191 -4.699  1.00 0.00 ? 455 HIS A HB3  6  
ATOM   7693  H  HD1  . HIS A 1 34 ? -1.751  -11.387 -7.288  1.00 0.00 ? 455 HIS A HD1  6  
ATOM   7694  H  HD2  . HIS A 1 34 ? 0.500   -7.902  -7.065  1.00 0.00 ? 455 HIS A HD2  6  
ATOM   7695  H  HE1  . HIS A 1 34 ? -2.059  -10.245 -9.508  1.00 0.00 ? 455 HIS A HE1  6  
ATOM   7696  N  N    . GLY A 1 35 ? 0.702   -10.686 -2.642  1.00 0.00 ? 456 GLY A N    6  
ATOM   7697  C  CA   . GLY A 1 35 ? 0.604   -10.894 -1.209  1.00 0.00 ? 456 GLY A CA   6  
ATOM   7698  C  C    . GLY A 1 35 ? 1.960   -10.910 -0.532  1.00 0.00 ? 456 GLY A C    6  
ATOM   7699  O  O    . GLY A 1 35 ? 2.233   -10.089 0.345   1.00 0.00 ? 456 GLY A O    6  
ATOM   7700  H  H    . GLY A 1 35 ? 0.653   -11.452 -3.251  1.00 0.00 ? 456 GLY A H    6  
ATOM   7701  H  HA2  . GLY A 1 35 ? 0.008   -10.101 -0.781  1.00 0.00 ? 456 GLY A HA2  6  
ATOM   7702  H  HA3  . GLY A 1 35 ? 0.112   -11.838 -1.027  1.00 0.00 ? 456 GLY A HA3  6  
ATOM   7703  N  N    . ASP A 1 36 ? 2.811   -11.846 -0.936  1.00 0.00 ? 457 ASP A N    6  
ATOM   7704  C  CA   . ASP A 1 36 ? 4.146   -11.966 -0.362  1.00 0.00 ? 457 ASP A CA   6  
ATOM   7705  C  C    . ASP A 1 36 ? 4.757   -10.590 -0.115  1.00 0.00 ? 457 ASP A C    6  
ATOM   7706  O  O    . ASP A 1 36 ? 5.358   -10.345 0.931   1.00 0.00 ? 457 ASP A O    6  
ATOM   7707  C  CB   . ASP A 1 36 ? 5.051   -12.781 -1.287  1.00 0.00 ? 457 ASP A CB   6  
ATOM   7708  C  CG   . ASP A 1 36 ? 4.886   -14.275 -1.089  1.00 0.00 ? 457 ASP A CG   6  
ATOM   7709  O  OD1  . ASP A 1 36 ? 3.743   -14.719 -0.849  1.00 0.00 ? 457 ASP A OD1  6  
ATOM   7710  O  OD2  . ASP A 1 36 ? 5.899   -15.000 -1.172  1.00 0.00 ? 457 ASP A OD2  6  
ATOM   7711  H  H    . ASP A 1 36 ? 2.535   -12.471 -1.639  1.00 0.00 ? 457 ASP A H    6  
ATOM   7712  H  HA   . ASP A 1 36 ? 4.055   -12.480 0.583   1.00 0.00 ? 457 ASP A HA   6  
ATOM   7713  H  HB2  . ASP A 1 36 ? 4.812   -12.544 -2.313  1.00 0.00 ? 457 ASP A HB2  6  
ATOM   7714  H  HB3  . ASP A 1 36 ? 6.081   -12.521 -1.092  1.00 0.00 ? 457 ASP A HB3  6  
ATOM   7715  N  N    . PHE A 1 37 ? 4.599   -9.696  -1.085  1.00 0.00 ? 458 PHE A N    6  
ATOM   7716  C  CA   . PHE A 1 37 ? 5.137   -8.345  -0.974  1.00 0.00 ? 458 PHE A CA   6  
ATOM   7717  C  C    . PHE A 1 37 ? 4.812   -7.740  0.388   1.00 0.00 ? 458 PHE A C    6  
ATOM   7718  O  O    . PHE A 1 37 ? 3.661   -7.716  0.827   1.00 0.00 ? 458 PHE A O    6  
ATOM   7719  C  CB   . PHE A 1 37 ? 4.576   -7.456  -2.086  1.00 0.00 ? 458 PHE A CB   6  
ATOM   7720  C  CG   . PHE A 1 37 ? 5.403   -6.231  -2.350  1.00 0.00 ? 458 PHE A CG   6  
ATOM   7721  C  CD1  . PHE A 1 37 ? 6.563   -6.310  -3.103  1.00 0.00 ? 458 PHE A CD1  6  
ATOM   7722  C  CD2  . PHE A 1 37 ? 5.020   -4.999  -1.845  1.00 0.00 ? 458 PHE A CD2  6  
ATOM   7723  C  CE1  . PHE A 1 37 ? 7.326   -5.184  -3.346  1.00 0.00 ? 458 PHE A CE1  6  
ATOM   7724  C  CE2  . PHE A 1 37 ? 5.779   -3.869  -2.085  1.00 0.00 ? 458 PHE A CE2  6  
ATOM   7725  C  CZ   . PHE A 1 37 ? 6.933   -3.962  -2.837  1.00 0.00 ? 458 PHE A CZ   6  
ATOM   7726  H  H    . PHE A 1 37 ? 4.110   -9.951  -1.895  1.00 0.00 ? 458 PHE A H    6  
ATOM   7727  H  HA   . PHE A 1 37 ? 6.209   -8.406  -1.081  1.00 0.00 ? 458 PHE A HA   6  
ATOM   7728  H  HB2  . PHE A 1 37 ? 4.527   -8.026  -3.002  1.00 0.00 ? 458 PHE A HB2  6  
ATOM   7729  H  HB3  . PHE A 1 37 ? 3.582   -7.135  -1.813  1.00 0.00 ? 458 PHE A HB3  6  
ATOM   7730  H  HD1  . PHE A 1 37 ? 6.872   -7.266  -3.502  1.00 0.00 ? 458 PHE A HD1  6  
ATOM   7731  H  HD2  . PHE A 1 37 ? 4.116   -4.925  -1.256  1.00 0.00 ? 458 PHE A HD2  6  
ATOM   7732  H  HE1  . PHE A 1 37 ? 8.228   -5.259  -3.934  1.00 0.00 ? 458 PHE A HE1  6  
ATOM   7733  H  HE2  . PHE A 1 37 ? 5.468   -2.914  -1.686  1.00 0.00 ? 458 PHE A HE2  6  
ATOM   7734  H  HZ   . PHE A 1 37 ? 7.528   -3.080  -3.025  1.00 0.00 ? 458 PHE A HZ   6  
ATOM   7735  N  N    . PRO A 1 38 ? 5.849   -7.239  1.076   1.00 0.00 ? 459 PRO A N    6  
ATOM   7736  C  CA   . PRO A 1 38 ? 5.699   -6.625  2.399   1.00 0.00 ? 459 PRO A CA   6  
ATOM   7737  C  C    . PRO A 1 38 ? 4.968   -5.288  2.338   1.00 0.00 ? 459 PRO A C    6  
ATOM   7738  O  O    . PRO A 1 38 ? 5.186   -4.491  1.425   1.00 0.00 ? 459 PRO A O    6  
ATOM   7739  C  CB   . PRO A 1 38 ? 7.144   -6.424  2.862   1.00 0.00 ? 459 PRO A CB   6  
ATOM   7740  C  CG   . PRO A 1 38 ? 7.936   -6.334  1.603   1.00 0.00 ? 459 PRO A CG   6  
ATOM   7741  C  CD   . PRO A 1 38 ? 7.247   -7.234  0.615   1.00 0.00 ? 459 PRO A CD   6  
ATOM   7742  H  HA   . PRO A 1 38 ? 5.188   -7.283  3.086   1.00 0.00 ? 459 PRO A HA   6  
ATOM   7743  H  HB2  . PRO A 1 38 ? 7.216   -5.514  3.441   1.00 0.00 ? 459 PRO A HB2  6  
ATOM   7744  H  HB3  . PRO A 1 38 ? 7.454   -7.265  3.463   1.00 0.00 ? 459 PRO A HB3  6  
ATOM   7745  H  HG2  . PRO A 1 38 ? 7.940   -5.316  1.244   1.00 0.00 ? 459 PRO A HG2  6  
ATOM   7746  H  HG3  . PRO A 1 38 ? 8.946   -6.675  1.780   1.00 0.00 ? 459 PRO A HG3  6  
ATOM   7747  H  HD2  . PRO A 1 38 ? 7.323   -6.827  -0.382  1.00 0.00 ? 459 PRO A HD2  6  
ATOM   7748  H  HD3  . PRO A 1 38 ? 7.669   -8.228  0.652   1.00 0.00 ? 459 PRO A HD3  6  
ATOM   7749  N  N    . CYS A 1 39 ? 4.101   -5.049  3.315   1.00 0.00 ? 460 CYS A N    6  
ATOM   7750  C  CA   . CYS A 1 39 ? 3.337   -3.808  3.374   1.00 0.00 ? 460 CYS A CA   6  
ATOM   7751  C  C    . CYS A 1 39 ? 4.265   -2.604  3.509   1.00 0.00 ? 460 CYS A C    6  
ATOM   7752  O  O    . CYS A 1 39 ? 5.318   -2.686  4.141   1.00 0.00 ? 460 CYS A O    6  
ATOM   7753  C  CB   . CYS A 1 39 ? 2.355   -3.844  4.546   1.00 0.00 ? 460 CYS A CB   6  
ATOM   7754  S  SG   . CYS A 1 39 ? 0.977   -2.662  4.398   1.00 0.00 ? 460 CYS A SG   6  
ATOM   7755  H  H    . CYS A 1 39 ? 3.970   -5.723  4.016   1.00 0.00 ? 460 CYS A H    6  
ATOM   7756  H  HA   . CYS A 1 39 ? 2.781   -3.717  2.453   1.00 0.00 ? 460 CYS A HA   6  
ATOM   7757  H  HB2  . CYS A 1 39 ? 1.931   -4.835  4.620   1.00 0.00 ? 460 CYS A HB2  6  
ATOM   7758  H  HB3  . CYS A 1 39 ? 2.887   -3.617  5.458   1.00 0.00 ? 460 CYS A HB3  6  
ATOM   7759  N  N    . LYS A 1 40 ? 3.865   -1.487  2.912   1.00 0.00 ? 461 LYS A N    6  
ATOM   7760  C  CA   . LYS A 1 40 ? 4.658   -0.264  2.966   1.00 0.00 ? 461 LYS A CA   6  
ATOM   7761  C  C    . LYS A 1 40 ? 4.449   0.462   4.291   1.00 0.00 ? 461 LYS A C    6  
ATOM   7762  O  O    . LYS A 1 40 ? 5.356   0.532   5.122   1.00 0.00 ? 461 LYS A O    6  
ATOM   7763  C  CB   . LYS A 1 40 ? 4.289   0.659   1.802   1.00 0.00 ? 461 LYS A CB   6  
ATOM   7764  C  CG   . LYS A 1 40 ? 5.058   1.969   1.799   1.00 0.00 ? 461 LYS A CG   6  
ATOM   7765  C  CD   . LYS A 1 40 ? 4.576   2.895   0.694   1.00 0.00 ? 461 LYS A CD   6  
ATOM   7766  C  CE   . LYS A 1 40 ? 5.440   4.143   0.597   1.00 0.00 ? 461 LYS A CE   6  
ATOM   7767  N  NZ   . LYS A 1 40 ? 6.611   3.938   -0.300  1.00 0.00 ? 461 LYS A NZ   6  
ATOM   7768  H  H    . LYS A 1 40 ? 3.015   -1.484  2.423   1.00 0.00 ? 461 LYS A H    6  
ATOM   7769  H  HA   . LYS A 1 40 ? 5.698   -0.539  2.880   1.00 0.00 ? 461 LYS A HA   6  
ATOM   7770  H  HB2  . LYS A 1 40 ? 4.489   0.146   0.874   1.00 0.00 ? 461 LYS A HB2  6  
ATOM   7771  H  HB3  . LYS A 1 40 ? 3.234   0.885   1.859   1.00 0.00 ? 461 LYS A HB3  6  
ATOM   7772  H  HG2  . LYS A 1 40 ? 4.920   2.460   2.751   1.00 0.00 ? 461 LYS A HG2  6  
ATOM   7773  H  HG3  . LYS A 1 40 ? 6.107   1.760   1.648   1.00 0.00 ? 461 LYS A HG3  6  
ATOM   7774  H  HD2  . LYS A 1 40 ? 4.616   2.369   -0.248  1.00 0.00 ? 461 LYS A HD2  6  
ATOM   7775  H  HD3  . LYS A 1 40 ? 3.557   3.189   0.902   1.00 0.00 ? 461 LYS A HD3  6  
ATOM   7776  H  HE2  . LYS A 1 40 ? 4.839   4.952   0.211   1.00 0.00 ? 461 LYS A HE2  6  
ATOM   7777  H  HE3  . LYS A 1 40 ? 5.795   4.398   1.585   1.00 0.00 ? 461 LYS A HE3  6  
ATOM   7778  H  HZ1  . LYS A 1 40 ? 7.403   4.541   0.003   1.00 0.00 ? 461 LYS A HZ1  6  
ATOM   7779  H  HZ2  . LYS A 1 40 ? 6.359   4.184   -1.279  1.00 0.00 ? 461 LYS A HZ2  6  
ATOM   7780  H  HZ3  . LYS A 1 40 ? 6.915   2.944   -0.271  1.00 0.00 ? 461 LYS A HZ3  6  
ATOM   7781  N  N    . LEU A 1 41 ? 3.250   0.999   4.483   1.00 0.00 ? 462 LEU A N    6  
ATOM   7782  C  CA   . LEU A 1 41 ? 2.921   1.718   5.709   1.00 0.00 ? 462 LEU A CA   6  
ATOM   7783  C  C    . LEU A 1 41 ? 3.411   0.956   6.936   1.00 0.00 ? 462 LEU A C    6  
ATOM   7784  O  O    . LEU A 1 41 ? 4.178   1.483   7.742   1.00 0.00 ? 462 LEU A O    6  
ATOM   7785  C  CB   . LEU A 1 41 ? 1.411   1.942   5.803   1.00 0.00 ? 462 LEU A CB   6  
ATOM   7786  C  CG   . LEU A 1 41 ? 0.851   3.101   4.977   1.00 0.00 ? 462 LEU A CG   6  
ATOM   7787  C  CD1  . LEU A 1 41 ? -0.669  3.088   5.000   1.00 0.00 ? 462 LEU A CD1  6  
ATOM   7788  C  CD2  . LEU A 1 41 ? 1.383   4.430   5.495   1.00 0.00 ? 462 LEU A CD2  6  
ATOM   7789  H  H    . LEU A 1 41 ? 2.568   0.910   3.785   1.00 0.00 ? 462 LEU A H    6  
ATOM   7790  H  HA   . LEU A 1 41 ? 3.417   2.676   5.674   1.00 0.00 ? 462 LEU A HA   6  
ATOM   7791  H  HB2  . LEU A 1 41 ? 0.921   1.038   5.476   1.00 0.00 ? 462 LEU A HB2  6  
ATOM   7792  H  HB3  . LEU A 1 41 ? 1.168   2.126   6.840   1.00 0.00 ? 462 LEU A HB3  6  
ATOM   7793  H  HG   . LEU A 1 41 ? 1.170   2.990   3.950   1.00 0.00 ? 462 LEU A HG   6  
ATOM   7794  H  HD11 . LEU A 1 41 ? -1.013  2.993   6.018   1.00 0.00 ? 462 LEU A HD11 6  
ATOM   7795  H  HD12 . LEU A 1 41 ? -1.030  2.252   4.419   1.00 0.00 ? 462 LEU A HD12 6  
ATOM   7796  H  HD13 . LEU A 1 41 ? -1.043  4.008   4.576   1.00 0.00 ? 462 LEU A HD13 6  
ATOM   7797  H  HD21 . LEU A 1 41 ? 0.893   5.240   4.975   1.00 0.00 ? 462 LEU A HD21 6  
ATOM   7798  H  HD22 . LEU A 1 41 ? 2.448   4.483   5.323   1.00 0.00 ? 462 LEU A HD22 6  
ATOM   7799  H  HD23 . LEU A 1 41 ? 1.184   4.509   6.553   1.00 0.00 ? 462 LEU A HD23 6  
ATOM   7800  N  N    . TYR A 1 42 ? 2.964   -0.288  7.070   1.00 0.00 ? 463 TYR A N    6  
ATOM   7801  C  CA   . TYR A 1 42 ? 3.357   -1.124  8.199   1.00 0.00 ? 463 TYR A CA   6  
ATOM   7802  C  C    . TYR A 1 42 ? 4.833   -0.930  8.532   1.00 0.00 ? 463 TYR A C    6  
ATOM   7803  O  O    . TYR A 1 42 ? 5.252   -1.114  9.675   1.00 0.00 ? 463 TYR A O    6  
ATOM   7804  C  CB   . TYR A 1 42 ? 3.081   -2.596  7.890   1.00 0.00 ? 463 TYR A CB   6  
ATOM   7805  C  CG   . TYR A 1 42 ? 3.190   -3.499  9.099   1.00 0.00 ? 463 TYR A CG   6  
ATOM   7806  C  CD1  . TYR A 1 42 ? 2.104   -3.698  9.942   1.00 0.00 ? 463 TYR A CD1  6  
ATOM   7807  C  CD2  . TYR A 1 42 ? 4.379   -4.152  9.397   1.00 0.00 ? 463 TYR A CD2  6  
ATOM   7808  C  CE1  . TYR A 1 42 ? 2.199   -4.521  11.047  1.00 0.00 ? 463 TYR A CE1  6  
ATOM   7809  C  CE2  . TYR A 1 42 ? 4.483   -4.978  10.499  1.00 0.00 ? 463 TYR A CE2  6  
ATOM   7810  C  CZ   . TYR A 1 42 ? 3.391   -5.159  11.322  1.00 0.00 ? 463 TYR A CZ   6  
ATOM   7811  O  OH   . TYR A 1 42 ? 3.490   -5.981  12.421  1.00 0.00 ? 463 TYR A OH   6  
ATOM   7812  H  H    . TYR A 1 42 ? 2.355   -0.653  6.395   1.00 0.00 ? 463 TYR A H    6  
ATOM   7813  H  HA   . TYR A 1 42 ? 2.765   -0.828  9.052   1.00 0.00 ? 463 TYR A HA   6  
ATOM   7814  H  HB2  . TYR A 1 42 ? 2.082   -2.693  7.494   1.00 0.00 ? 463 TYR A HB2  6  
ATOM   7815  H  HB3  . TYR A 1 42 ? 3.790   -2.942  7.153   1.00 0.00 ? 463 TYR A HB3  6  
ATOM   7816  H  HD1  . TYR A 1 42 ? 1.171   -3.197  9.723   1.00 0.00 ? 463 TYR A HD1  6  
ATOM   7817  H  HD2  . TYR A 1 42 ? 5.233   -4.009  8.751   1.00 0.00 ? 463 TYR A HD2  6  
ATOM   7818  H  HE1  . TYR A 1 42 ? 1.344   -4.663  11.691  1.00 0.00 ? 463 TYR A HE1  6  
ATOM   7819  H  HE2  . TYR A 1 42 ? 5.417   -5.478  10.715  1.00 0.00 ? 463 TYR A HE2  6  
ATOM   7820  H  HH   . TYR A 1 42 ? 2.660   -5.970  12.904  1.00 0.00 ? 463 TYR A HH   6  
ATOM   7821  N  N    . HIS A 1 43 ? 5.617   -0.558  7.525   1.00 0.00 ? 464 HIS A N    6  
ATOM   7822  C  CA   . HIS A 1 43 ? 7.047   -0.337  7.710   1.00 0.00 ? 464 HIS A CA   6  
ATOM   7823  C  C    . HIS A 1 43 ? 7.350   1.148   7.878   1.00 0.00 ? 464 HIS A C    6  
ATOM   7824  O  O    . HIS A 1 43 ? 8.004   1.555   8.839   1.00 0.00 ? 464 HIS A O    6  
ATOM   7825  C  CB   . HIS A 1 43 ? 7.828   -0.898  6.522   1.00 0.00 ? 464 HIS A CB   6  
ATOM   7826  C  CG   . HIS A 1 43 ? 7.933   -2.392  6.526   1.00 0.00 ? 464 HIS A CG   6  
ATOM   7827  N  ND1  . HIS A 1 43 ? 8.231   -3.123  7.656   1.00 0.00 ? 464 HIS A ND1  6  
ATOM   7828  C  CD2  . HIS A 1 43 ? 7.775   -3.293  5.528   1.00 0.00 ? 464 HIS A CD2  6  
ATOM   7829  C  CE1  . HIS A 1 43 ? 8.254   -4.409  7.353   1.00 0.00 ? 464 HIS A CE1  6  
ATOM   7830  N  NE2  . HIS A 1 43 ? 7.980   -4.539  6.068   1.00 0.00 ? 464 HIS A NE2  6  
ATOM   7831  H  H    . HIS A 1 43 ? 5.224   -0.427  6.637   1.00 0.00 ? 464 HIS A H    6  
ATOM   7832  H  HA   . HIS A 1 43 ? 7.349   -0.857  8.607   1.00 0.00 ? 464 HIS A HA   6  
ATOM   7833  H  HB2  . HIS A 1 43 ? 7.339   -0.603  5.606   1.00 0.00 ? 464 HIS A HB2  6  
ATOM   7834  H  HB3  . HIS A 1 43 ? 8.831   -0.495  6.536   1.00 0.00 ? 464 HIS A HB3  6  
ATOM   7835  H  HD2  . HIS A 1 43 ? 7.533   -3.074  4.497   1.00 0.00 ? 464 HIS A HD2  6  
ATOM   7836  H  HE1  . HIS A 1 43 ? 8.461   -5.217  8.039   1.00 0.00 ? 464 HIS A HE1  6  
ATOM   7837  H  HE2  . HIS A 1 43 ? 8.016   -5.379  5.566   1.00 0.00 ? 464 HIS A HE2  6  
ATOM   7838  N  N    . THR A 1 44 ? 6.872   1.956   6.937   1.00 0.00 ? 465 THR A N    6  
ATOM   7839  C  CA   . THR A 1 44 ? 7.093   3.395   6.979   1.00 0.00 ? 465 THR A CA   6  
ATOM   7840  C  C    . THR A 1 44 ? 7.110   3.907   8.415   1.00 0.00 ? 465 THR A C    6  
ATOM   7841  O  O    . THR A 1 44 ? 7.863   4.821   8.751   1.00 0.00 ? 465 THR A O    6  
ATOM   7842  C  CB   . THR A 1 44 ? 6.011   4.154   6.188   1.00 0.00 ? 465 THR A CB   6  
ATOM   7843  O  OG1  . THR A 1 44 ? 4.753   4.060   6.866   1.00 0.00 ? 465 THR A OG1  6  
ATOM   7844  C  CG2  . THR A 1 44 ? 5.877   3.594   4.780   1.00 0.00 ? 465 THR A CG2  6  
ATOM   7845  H  H    . THR A 1 44 ? 6.358   1.572   6.196   1.00 0.00 ? 465 THR A H    6  
ATOM   7846  H  HA   . THR A 1 44 ? 8.051   3.599   6.523   1.00 0.00 ? 465 THR A HA   6  
ATOM   7847  H  HB   . THR A 1 44 ? 6.298   5.194   6.121   1.00 0.00 ? 465 THR A HB   6  
ATOM   7848  H  HG1  . THR A 1 44 ? 4.753   3.288   7.437   1.00 0.00 ? 465 THR A HG1  6  
ATOM   7849  H  HG21 . THR A 1 44 ? 6.853   3.324   4.406   1.00 0.00 ? 465 THR A HG21 6  
ATOM   7850  H  HG22 . THR A 1 44 ? 5.438   4.342   4.136   1.00 0.00 ? 465 THR A HG22 6  
ATOM   7851  H  HG23 . THR A 1 44 ? 5.245   2.719   4.800   1.00 0.00 ? 465 THR A HG23 6  
ATOM   7852  N  N    . THR A 1 45 ? 6.275   3.311   9.261   1.00 0.00 ? 466 THR A N    6  
ATOM   7853  C  CA   . THR A 1 45 ? 6.193   3.707   10.661  1.00 0.00 ? 466 THR A CA   6  
ATOM   7854  C  C    . THR A 1 45 ? 6.224   2.490   11.579  1.00 0.00 ? 466 THR A C    6  
ATOM   7855  O  O    . THR A 1 45 ? 6.850   2.515   12.637  1.00 0.00 ? 466 THR A O    6  
ATOM   7856  C  CB   . THR A 1 45 ? 4.913   4.516   10.942  1.00 0.00 ? 466 THR A CB   6  
ATOM   7857  O  OG1  . THR A 1 45 ? 3.758   3.717   10.668  1.00 0.00 ? 466 THR A OG1  6  
ATOM   7858  C  CG2  . THR A 1 45 ? 4.875   5.780   10.096  1.00 0.00 ? 466 THR A CG2  6  
ATOM   7859  H  H    . THR A 1 45 ? 5.700   2.588   8.933   1.00 0.00 ? 466 THR A H    6  
ATOM   7860  H  HA   . THR A 1 45 ? 7.046   4.333   10.880  1.00 0.00 ? 466 THR A HA   6  
ATOM   7861  H  HB   . THR A 1 45 ? 4.907   4.799   11.985  1.00 0.00 ? 466 THR A HB   6  
ATOM   7862  H  HG1  . THR A 1 45 ? 3.511   3.816   9.745   1.00 0.00 ? 466 THR A HG1  6  
ATOM   7863  H  HG21 . THR A 1 45 ? 5.776   5.844   9.504   1.00 0.00 ? 466 THR A HG21 6  
ATOM   7864  H  HG22 . THR A 1 45 ? 4.805   6.643   10.741  1.00 0.00 ? 466 THR A HG22 6  
ATOM   7865  H  HG23 . THR A 1 45 ? 4.017   5.748   9.442   1.00 0.00 ? 466 THR A HG23 6  
ATOM   7866  N  N    . GLY A 1 46 ? 5.543   1.425   11.165  1.00 0.00 ? 467 GLY A N    6  
ATOM   7867  C  CA   . GLY A 1 46 ? 5.506   0.213   11.962  1.00 0.00 ? 467 GLY A CA   6  
ATOM   7868  C  C    . GLY A 1 46 ? 4.135   -0.433  11.972  1.00 0.00 ? 467 GLY A C    6  
ATOM   7869  O  O    . GLY A 1 46 ? 4.018   -1.656  11.929  1.00 0.00 ? 467 GLY A O    6  
ATOM   7870  H  H    . GLY A 1 46 ? 5.063   1.463   10.312  1.00 0.00 ? 467 GLY A H    6  
ATOM   7871  H  HA2  . GLY A 1 46 ? 6.221   -0.490  11.562  1.00 0.00 ? 467 GLY A HA2  6  
ATOM   7872  H  HA3  . GLY A 1 46 ? 5.785   0.455   12.978  1.00 0.00 ? 467 GLY A HA3  6  
ATOM   7873  N  N    . ASN A 1 47 ? 3.095   0.392   12.032  1.00 0.00 ? 468 ASN A N    6  
ATOM   7874  C  CA   . ASN A 1 47 ? 1.724   -0.106  12.050  1.00 0.00 ? 468 ASN A CA   6  
ATOM   7875  C  C    . ASN A 1 47 ? 1.017   0.199   10.733  1.00 0.00 ? 468 ASN A C    6  
ATOM   7876  O  O    . ASN A 1 47 ? 1.345   1.170   10.050  1.00 0.00 ? 468 ASN A O    6  
ATOM   7877  C  CB   . ASN A 1 47 ? 0.949   0.515   13.214  1.00 0.00 ? 468 ASN A CB   6  
ATOM   7878  C  CG   . ASN A 1 47 ? 1.282   -0.135  14.543  1.00 0.00 ? 468 ASN A CG   6  
ATOM   7879  O  OD1  . ASN A 1 47 ? 2.450   -0.248  14.916  1.00 0.00 ? 468 ASN A OD1  6  
ATOM   7880  N  ND2  . ASN A 1 47 ? 0.254   -0.566  15.264  1.00 0.00 ? 468 ASN A ND2  6  
ATOM   7881  H  H    . ASN A 1 47 ? 3.252   1.359   12.065  1.00 0.00 ? 468 ASN A H    6  
ATOM   7882  H  HA   . ASN A 1 47 ? 1.763   -1.176  12.185  1.00 0.00 ? 468 ASN A HA   6  
ATOM   7883  H  HB2  . ASN A 1 47 ? 1.190   1.566   13.279  1.00 0.00 ? 468 ASN A HB2  6  
ATOM   7884  H  HB3  . ASN A 1 47 ? -0.110  0.404   13.034  1.00 0.00 ? 468 ASN A HB3  6  
ATOM   7885  H  HD21 . ASN A 1 47 ? -0.649  -0.442  14.904  1.00 0.00 ? 468 ASN A HD21 6  
ATOM   7886  H  HD22 . ASN A 1 47 ? 0.440   -0.989  16.128  1.00 0.00 ? 468 ASN A HD22 6  
ATOM   7887  N  N    . CYS A 1 48 ? 0.045   -0.637  10.382  1.00 0.00 ? 469 CYS A N    6  
ATOM   7888  C  CA   . CYS A 1 48 ? -0.709  -0.458  9.148   1.00 0.00 ? 469 CYS A CA   6  
ATOM   7889  C  C    . CYS A 1 48 ? -2.107  0.081   9.438   1.00 0.00 ? 469 CYS A C    6  
ATOM   7890  O  O    . CYS A 1 48 ? -2.744  -0.310  10.416  1.00 0.00 ? 469 CYS A O    6  
ATOM   7891  C  CB   . CYS A 1 48 ? -0.809  -1.784  8.390   1.00 0.00 ? 469 CYS A CB   6  
ATOM   7892  S  SG   . CYS A 1 48 ? -1.533  -1.636  6.725   1.00 0.00 ? 469 CYS A SG   6  
ATOM   7893  H  H    . CYS A 1 48 ? -0.170  -1.393  10.969  1.00 0.00 ? 469 CYS A H    6  
ATOM   7894  H  HA   . CYS A 1 48 ? -0.181  0.257   8.536   1.00 0.00 ? 469 CYS A HA   6  
ATOM   7895  H  HB2  . CYS A 1 48 ? 0.181   -2.202  8.281   1.00 0.00 ? 469 CYS A HB2  6  
ATOM   7896  H  HB3  . CYS A 1 48 ? -1.423  -2.468  8.956   1.00 0.00 ? 469 CYS A HB3  6  
ATOM   7897  N  N    . ILE A 1 49 ? -2.578  0.981   8.580   1.00 0.00 ? 470 ILE A N    6  
ATOM   7898  C  CA   . ILE A 1 49 ? -3.900  1.572   8.744   1.00 0.00 ? 470 ILE A CA   6  
ATOM   7899  C  C    . ILE A 1 49 ? -4.997  0.570   8.401   1.00 0.00 ? 470 ILE A C    6  
ATOM   7900  O  O    . ILE A 1 49 ? -6.083  0.601   8.978   1.00 0.00 ? 470 ILE A O    6  
ATOM   7901  C  CB   . ILE A 1 49 ? -4.069  2.823   7.862   1.00 0.00 ? 470 ILE A CB   6  
ATOM   7902  C  CG1  . ILE A 1 49 ? -5.446  3.451   8.089   1.00 0.00 ? 470 ILE A CG1  6  
ATOM   7903  C  CG2  . ILE A 1 49 ? -3.879  2.468   6.395   1.00 0.00 ? 470 ILE A CG2  6  
ATOM   7904  C  CD1  . ILE A 1 49 ? -5.594  4.110   9.442   1.00 0.00 ? 470 ILE A CD1  6  
ATOM   7905  H  H    . ILE A 1 49 ? -2.023  1.252   7.820   1.00 0.00 ? 470 ILE A H    6  
ATOM   7906  H  HA   . ILE A 1 49 ? -4.007  1.867   9.778   1.00 0.00 ? 470 ILE A HA   6  
ATOM   7907  H  HB   . ILE A 1 49 ? -3.307  3.536   8.137   1.00 0.00 ? 470 ILE A HB   6  
ATOM   7908  H  HG12 . ILE A 1 49 ? -5.622  4.201   7.334   1.00 0.00 ? 470 ILE A HG12 6  
ATOM   7909  H  HG13 . ILE A 1 49 ? -6.201  2.683   8.009   1.00 0.00 ? 470 ILE A HG13 6  
ATOM   7910  H  HG21 . ILE A 1 49 ? -2.937  1.954   6.269   1.00 0.00 ? 470 ILE A HG21 6  
ATOM   7911  H  HG22 . ILE A 1 49 ? -4.684  1.824   6.074   1.00 0.00 ? 470 ILE A HG22 6  
ATOM   7912  H  HG23 . ILE A 1 49 ? -3.879  3.370   5.802   1.00 0.00 ? 470 ILE A HG23 6  
ATOM   7913  H  HD11 . ILE A 1 49 ? -4.992  5.007   9.474   1.00 0.00 ? 470 ILE A HD11 6  
ATOM   7914  H  HD12 . ILE A 1 49 ? -6.630  4.365   9.608   1.00 0.00 ? 470 ILE A HD12 6  
ATOM   7915  H  HD13 . ILE A 1 49 ? -5.263  3.428   10.213  1.00 0.00 ? 470 ILE A HD13 6  
ATOM   7916  N  N    . ASN A 1 50 ? -4.704  -0.320  7.458   1.00 0.00 ? 471 ASN A N    6  
ATOM   7917  C  CA   . ASN A 1 50 ? -5.665  -1.334  7.039   1.00 0.00 ? 471 ASN A CA   6  
ATOM   7918  C  C    . ASN A 1 50 ? -6.231  -2.078  8.244   1.00 0.00 ? 471 ASN A C    6  
ATOM   7919  O  O    . ASN A 1 50 ? -7.409  -1.946  8.571   1.00 0.00 ? 471 ASN A O    6  
ATOM   7920  C  CB   . ASN A 1 50 ? -5.006  -2.324  6.076   1.00 0.00 ? 471 ASN A CB   6  
ATOM   7921  C  CG   . ASN A 1 50 ? -4.605  -1.677  4.765   1.00 0.00 ? 471 ASN A CG   6  
ATOM   7922  O  OD1  . ASN A 1 50 ? -3.525  -1.098  4.650   1.00 0.00 ? 471 ASN A OD1  6  
ATOM   7923  N  ND2  . ASN A 1 50 ? -5.477  -1.772  3.768   1.00 0.00 ? 471 ASN A ND2  6  
ATOM   7924  H  H    . ASN A 1 50 ? -3.821  -0.295  7.034   1.00 0.00 ? 471 ASN A H    6  
ATOM   7925  H  HA   . ASN A 1 50 ? -6.473  -0.832  6.528   1.00 0.00 ? 471 ASN A HA   6  
ATOM   7926  H  HB2  . ASN A 1 50 ? -4.119  -2.731  6.540   1.00 0.00 ? 471 ASN A HB2  6  
ATOM   7927  H  HB3  . ASN A 1 50 ? -5.697  -3.126  5.865   1.00 0.00 ? 471 ASN A HB3  6  
ATOM   7928  H  HD21 . ASN A 1 50 ? -6.318  -2.247  3.931   1.00 0.00 ? 471 ASN A HD21 6  
ATOM   7929  H  HD22 . ASN A 1 50 ? -5.243  -1.362  2.909   1.00 0.00 ? 471 ASN A HD22 6  
ATOM   7930  N  N    . GLY A 1 51 ? -5.381  -2.862  8.901   1.00 0.00 ? 472 GLY A N    6  
ATOM   7931  C  CA   . GLY A 1 51 ? -5.814  -3.615  10.063  1.00 0.00 ? 472 GLY A CA   6  
ATOM   7932  C  C    . GLY A 1 51 ? -5.142  -4.971  10.159  1.00 0.00 ? 472 GLY A C    6  
ATOM   7933  O  O    . GLY A 1 51 ? -4.065  -5.177  9.600   1.00 0.00 ? 472 GLY A O    6  
ATOM   7934  H  H    . GLY A 1 51 ? -4.453  -2.928  8.595   1.00 0.00 ? 472 GLY A H    6  
ATOM   7935  H  HA2  . GLY A 1 51 ? -5.586  -3.048  10.953  1.00 0.00 ? 472 GLY A HA2  6  
ATOM   7936  H  HA3  . GLY A 1 51 ? -6.883  -3.760  10.006  1.00 0.00 ? 472 GLY A HA3  6  
ATOM   7937  N  N    . ASP A 1 52 ? -5.777  -5.895  10.870  1.00 0.00 ? 473 ASP A N    6  
ATOM   7938  C  CA   . ASP A 1 52 ? -5.234  -7.238  11.038  1.00 0.00 ? 473 ASP A CA   6  
ATOM   7939  C  C    . ASP A 1 52 ? -5.397  -8.054  9.759   1.00 0.00 ? 473 ASP A C    6  
ATOM   7940  O  O    . ASP A 1 52 ? -4.600  -8.950  9.477   1.00 0.00 ? 473 ASP A O    6  
ATOM   7941  C  CB   . ASP A 1 52 ? -5.924  -7.949  12.203  1.00 0.00 ? 473 ASP A CB   6  
ATOM   7942  C  CG   . ASP A 1 52 ? -5.389  -7.507  13.550  1.00 0.00 ? 473 ASP A CG   6  
ATOM   7943  O  OD1  . ASP A 1 52 ? -4.292  -7.965  13.933  1.00 0.00 ? 473 ASP A OD1  6  
ATOM   7944  O  OD2  . ASP A 1 52 ? -6.067  -6.701  14.222  1.00 0.00 ? 473 ASP A OD2  6  
ATOM   7945  H  H    . ASP A 1 52 ? -6.633  -5.670  11.292  1.00 0.00 ? 473 ASP A H    6  
ATOM   7946  H  HA   . ASP A 1 52 ? -4.181  -7.145  11.259  1.00 0.00 ? 473 ASP A HA   6  
ATOM   7947  H  HB2  . ASP A 1 52 ? -6.983  -7.736  12.170  1.00 0.00 ? 473 ASP A HB2  6  
ATOM   7948  H  HB3  . ASP A 1 52 ? -5.772  -9.014  12.107  1.00 0.00 ? 473 ASP A HB3  6  
ATOM   7949  N  N    . ASP A 1 53 ? -6.433  -7.739  8.991   1.00 0.00 ? 474 ASP A N    6  
ATOM   7950  C  CA   . ASP A 1 53 ? -6.701  -8.443  7.742   1.00 0.00 ? 474 ASP A CA   6  
ATOM   7951  C  C    . ASP A 1 53 ? -6.306  -7.589  6.541   1.00 0.00 ? 474 ASP A C    6  
ATOM   7952  O  O    . ASP A 1 53 ? -7.112  -7.354  5.641   1.00 0.00 ? 474 ASP A O    6  
ATOM   7953  C  CB   . ASP A 1 53 ? -8.181  -8.819  7.651   1.00 0.00 ? 474 ASP A CB   6  
ATOM   7954  C  CG   . ASP A 1 53 ? -8.728  -9.339  8.966   1.00 0.00 ? 474 ASP A CG   6  
ATOM   7955  O  OD1  . ASP A 1 53 ? -8.769  -8.559  9.940   1.00 0.00 ? 474 ASP A OD1  6  
ATOM   7956  O  OD2  . ASP A 1 53 ? -9.115  -10.525 9.021   1.00 0.00 ? 474 ASP A OD2  6  
ATOM   7957  H  H    . ASP A 1 53 ? -7.033  -7.015  9.270   1.00 0.00 ? 474 ASP A H    6  
ATOM   7958  H  HA   . ASP A 1 53 ? -6.109  -9.345  7.736   1.00 0.00 ? 474 ASP A HA   6  
ATOM   7959  H  HB2  . ASP A 1 53 ? -8.750  -7.947  7.365   1.00 0.00 ? 474 ASP A HB2  6  
ATOM   7960  H  HB3  . ASP A 1 53 ? -8.305  -9.587  6.901   1.00 0.00 ? 474 ASP A HB3  6  
ATOM   7961  N  N    . CYS A 1 54 ? -5.060  -7.126  6.536   1.00 0.00 ? 475 CYS A N    6  
ATOM   7962  C  CA   . CYS A 1 54 ? -4.557  -6.296  5.447   1.00 0.00 ? 475 CYS A CA   6  
ATOM   7963  C  C    . CYS A 1 54 ? -4.313  -7.132  4.195   1.00 0.00 ? 475 CYS A C    6  
ATOM   7964  O  O    . CYS A 1 54 ? -3.970  -8.311  4.280   1.00 0.00 ? 475 CYS A O    6  
ATOM   7965  C  CB   . CYS A 1 54 ? -3.263  -5.596  5.868   1.00 0.00 ? 475 CYS A CB   6  
ATOM   7966  S  SG   . CYS A 1 54 ? -2.592  -4.459  4.613   1.00 0.00 ? 475 CYS A SG   6  
ATOM   7967  H  H    . CYS A 1 54 ? -4.464  -7.347  7.282   1.00 0.00 ? 475 CYS A H    6  
ATOM   7968  H  HA   . CYS A 1 54 ? -5.305  -5.549  5.226   1.00 0.00 ? 475 CYS A HA   6  
ATOM   7969  H  HB2  . CYS A 1 54 ? -3.449  -5.023  6.764   1.00 0.00 ? 475 CYS A HB2  6  
ATOM   7970  H  HB3  . CYS A 1 54 ? -2.510  -6.342  6.073   1.00 0.00 ? 475 CYS A HB3  6  
ATOM   7971  N  N    . MET A 1 55 ? -4.491  -6.513  3.032   1.00 0.00 ? 476 MET A N    6  
ATOM   7972  C  CA   . MET A 1 55 ? -4.288  -7.199  1.762   1.00 0.00 ? 476 MET A CA   6  
ATOM   7973  C  C    . MET A 1 55 ? -2.803  -7.284  1.421   1.00 0.00 ? 476 MET A C    6  
ATOM   7974  O  O    . MET A 1 55 ? -2.433  -7.642  0.303   1.00 0.00 ? 476 MET A O    6  
ATOM   7975  C  CB   . MET A 1 55 ? -5.040  -6.478  0.642   1.00 0.00 ? 476 MET A CB   6  
ATOM   7976  C  CG   . MET A 1 55 ? -4.598  -5.037  0.443   1.00 0.00 ? 476 MET A CG   6  
ATOM   7977  S  SD   . MET A 1 55 ? -3.047  -4.906  -0.468  1.00 0.00 ? 476 MET A SD   6  
ATOM   7978  C  CE   . MET A 1 55 ? -3.630  -5.076  -2.153  1.00 0.00 ? 476 MET A CE   6  
ATOM   7979  H  H    . MET A 1 55 ? -4.765  -5.572  3.028   1.00 0.00 ? 476 MET A H    6  
ATOM   7980  H  HA   . MET A 1 55 ? -4.680  -8.200  1.860   1.00 0.00 ? 476 MET A HA   6  
ATOM   7981  H  HB2  . MET A 1 55 ? -4.882  -7.011  -0.284  1.00 0.00 ? 476 MET A HB2  6  
ATOM   7982  H  HB3  . MET A 1 55 ? -6.095  -6.479  0.873   1.00 0.00 ? 476 MET A HB3  6  
ATOM   7983  H  HG2  . MET A 1 55 ? -5.366  -4.511  -0.104  1.00 0.00 ? 476 MET A HG2  6  
ATOM   7984  H  HG3  . MET A 1 55 ? -4.470  -4.578  1.412   1.00 0.00 ? 476 MET A HG3  6  
ATOM   7985  H  HE1  . MET A 1 55 ? -2.870  -5.559  -2.750  1.00 0.00 ? 476 MET A HE1  6  
ATOM   7986  H  HE2  . MET A 1 55 ? -4.530  -5.673  -2.164  1.00 0.00 ? 476 MET A HE2  6  
ATOM   7987  H  HE3  . MET A 1 55 ? -3.841  -4.098  -2.562  1.00 0.00 ? 476 MET A HE3  6  
ATOM   7988  N  N    . PHE A 1 56 ? -1.958  -6.952  2.391   1.00 0.00 ? 477 PHE A N    6  
ATOM   7989  C  CA   . PHE A 1 56 ? -0.514  -6.990  2.193   1.00 0.00 ? 477 PHE A CA   6  
ATOM   7990  C  C    . PHE A 1 56 ? 0.157   -7.869  3.244   1.00 0.00 ? 477 PHE A C    6  
ATOM   7991  O  O    . PHE A 1 56 ? -0.400  -8.108  4.316   1.00 0.00 ? 477 PHE A O    6  
ATOM   7992  C  CB   . PHE A 1 56 ? 0.067   -5.575  2.249   1.00 0.00 ? 477 PHE A CB   6  
ATOM   7993  C  CG   . PHE A 1 56 ? -0.159  -4.785  0.992   1.00 0.00 ? 477 PHE A CG   6  
ATOM   7994  C  CD1  . PHE A 1 56 ? 0.096   -5.345  -0.250  1.00 0.00 ? 477 PHE A CD1  6  
ATOM   7995  C  CD2  . PHE A 1 56 ? -0.625  -3.481  1.052   1.00 0.00 ? 477 PHE A CD2  6  
ATOM   7996  C  CE1  . PHE A 1 56 ? -0.111  -4.620  -1.409  1.00 0.00 ? 477 PHE A CE1  6  
ATOM   7997  C  CE2  . PHE A 1 56 ? -0.835  -2.752  -0.104  1.00 0.00 ? 477 PHE A CE2  6  
ATOM   7998  C  CZ   . PHE A 1 56 ? -0.576  -3.322  -1.335  1.00 0.00 ? 477 PHE A CZ   6  
ATOM   7999  H  H    . PHE A 1 56 ? -2.314  -6.675  3.261   1.00 0.00 ? 477 PHE A H    6  
ATOM   8000  H  HA   . PHE A 1 56 ? -0.325  -7.409  1.217   1.00 0.00 ? 477 PHE A HA   6  
ATOM   8001  H  HB2  . PHE A 1 56 ? -0.391  -5.038  3.065   1.00 0.00 ? 477 PHE A HB2  6  
ATOM   8002  H  HB3  . PHE A 1 56 ? 1.131   -5.638  2.416   1.00 0.00 ? 477 PHE A HB3  6  
ATOM   8003  H  HD1  . PHE A 1 56 ? 0.460   -6.361  -0.309  1.00 0.00 ? 477 PHE A HD1  6  
ATOM   8004  H  HD2  . PHE A 1 56 ? -0.827  -3.034  2.014   1.00 0.00 ? 477 PHE A HD2  6  
ATOM   8005  H  HE1  . PHE A 1 56 ? 0.092   -5.068  -2.370  1.00 0.00 ? 477 PHE A HE1  6  
ATOM   8006  H  HE2  . PHE A 1 56 ? -1.198  -1.737  -0.043  1.00 0.00 ? 477 PHE A HE2  6  
ATOM   8007  H  HZ   . PHE A 1 56 ? -0.739  -2.754  -2.239  1.00 0.00 ? 477 PHE A HZ   6  
ATOM   8008  N  N    . SER A 1 57 ? 1.356   -8.347  2.929   1.00 0.00 ? 478 SER A N    6  
ATOM   8009  C  CA   . SER A 1 57 ? 2.102   -9.204  3.844   1.00 0.00 ? 478 SER A CA   6  
ATOM   8010  C  C    . SER A 1 57 ? 2.732   -8.383  4.965   1.00 0.00 ? 478 SER A C    6  
ATOM   8011  O  O    . SER A 1 57 ? 3.331   -7.335  4.722   1.00 0.00 ? 478 SER A O    6  
ATOM   8012  C  CB   . SER A 1 57 ? 3.187   -9.972  3.087   1.00 0.00 ? 478 SER A CB   6  
ATOM   8013  O  OG   . SER A 1 57 ? 2.678   -11.182 2.554   1.00 0.00 ? 478 SER A OG   6  
ATOM   8014  H  H    . SER A 1 57 ? 1.747   -8.121  2.060   1.00 0.00 ? 478 SER A H    6  
ATOM   8015  H  HA   . SER A 1 57 ? 1.409   -9.910  4.277   1.00 0.00 ? 478 SER A HA   6  
ATOM   8016  H  HB2  . SER A 1 57 ? 3.556   -9.363  2.276   1.00 0.00 ? 478 SER A HB2  6  
ATOM   8017  H  HB3  . SER A 1 57 ? 3.999   -10.202 3.763   1.00 0.00 ? 478 SER A HB3  6  
ATOM   8018  H  HG   . SER A 1 57 ? 1.908   -11.455 3.058   1.00 0.00 ? 478 SER A HG   6  
ATOM   8019  N  N    . HIS A 1 58 ? 2.591   -8.866  6.195   1.00 0.00 ? 479 HIS A N    6  
ATOM   8020  C  CA   . HIS A 1 58 ? 3.146   -8.178  7.356   1.00 0.00 ? 479 HIS A CA   6  
ATOM   8021  C  C    . HIS A 1 58 ? 4.330   -8.951  7.930   1.00 0.00 ? 479 HIS A C    6  
ATOM   8022  O  O    . HIS A 1 58 ? 4.701   -8.765  9.089   1.00 0.00 ? 479 HIS A O    6  
ATOM   8023  C  CB   . HIS A 1 58 ? 2.072   -7.995  8.428   1.00 0.00 ? 479 HIS A CB   6  
ATOM   8024  C  CG   . HIS A 1 58 ? 1.152   -6.843  8.164   1.00 0.00 ? 479 HIS A CG   6  
ATOM   8025  N  ND1  . HIS A 1 58 ? 0.273   -6.351  9.105   1.00 0.00 ? 479 HIS A ND1  6  
ATOM   8026  C  CD2  . HIS A 1 58 ? 0.980   -6.084  7.057   1.00 0.00 ? 479 HIS A CD2  6  
ATOM   8027  C  CE1  . HIS A 1 58 ? -0.403  -5.341  8.588   1.00 0.00 ? 479 HIS A CE1  6  
ATOM   8028  N  NE2  . HIS A 1 58 ? 0.008   -5.157  7.346   1.00 0.00 ? 479 HIS A NE2  6  
ATOM   8029  H  H    . HIS A 1 58 ? 2.103   -9.706  6.326   1.00 0.00 ? 479 HIS A H    6  
ATOM   8030  H  HA   . HIS A 1 58 ? 3.489   -7.207  7.032   1.00 0.00 ? 479 HIS A HA   6  
ATOM   8031  H  HB2  . HIS A 1 58 ? 1.473   -8.892  8.485   1.00 0.00 ? 479 HIS A HB2  6  
ATOM   8032  H  HB3  . HIS A 1 58 ? 2.551   -7.827  9.383   1.00 0.00 ? 479 HIS A HB3  6  
ATOM   8033  H  HD1  . HIS A 1 58 ? 0.159   -6.694  10.016  1.00 0.00 ? 479 HIS A HD1  6  
ATOM   8034  H  HD2  . HIS A 1 58 ? 1.508   -6.187  6.120   1.00 0.00 ? 479 HIS A HD2  6  
ATOM   8035  H  HE1  . HIS A 1 58 ? -1.161  -4.762  9.094   1.00 0.00 ? 479 HIS A HE1  6  
ATOM   8036  N  N    . ASP A 1 59 ? 4.917   -9.818  7.113   1.00 0.00 ? 480 ASP A N    6  
ATOM   8037  C  CA   . ASP A 1 59 ? 6.058   -10.619 7.540   1.00 0.00 ? 480 ASP A CA   6  
ATOM   8038  C  C    . ASP A 1 59 ? 7.283   -9.740  7.770   1.00 0.00 ? 480 ASP A C    6  
ATOM   8039  O  O    . ASP A 1 59 ? 7.382   -8.624  7.258   1.00 0.00 ? 480 ASP A O    6  
ATOM   8040  C  CB   . ASP A 1 59 ? 6.374   -11.692 6.497   1.00 0.00 ? 480 ASP A CB   6  
ATOM   8041  C  CG   . ASP A 1 59 ? 5.171   -12.041 5.643   1.00 0.00 ? 480 ASP A CG   6  
ATOM   8042  O  OD1  . ASP A 1 59 ? 4.046   -12.057 6.182   1.00 0.00 ? 480 ASP A OD1  6  
ATOM   8043  O  OD2  . ASP A 1 59 ? 5.356   -12.299 4.435   1.00 0.00 ? 480 ASP A OD2  6  
ATOM   8044  H  H    . ASP A 1 59 ? 4.575   -9.922  6.200   1.00 0.00 ? 480 ASP A H    6  
ATOM   8045  H  HA   . ASP A 1 59 ? 5.797   -11.100 8.470   1.00 0.00 ? 480 ASP A HA   6  
ATOM   8046  H  HB2  . ASP A 1 59 ? 7.161   -11.335 5.849   1.00 0.00 ? 480 ASP A HB2  6  
ATOM   8047  H  HB3  . ASP A 1 59 ? 6.707   -12.587 7.001   1.00 0.00 ? 480 ASP A HB3  6  
ATOM   8048  N  N    . PRO A 1 60 ? 8.239   -10.251 8.560   1.00 0.00 ? 481 PRO A N    6  
ATOM   8049  C  CA   . PRO A 1 60 ? 9.475   -9.528  8.876   1.00 0.00 ? 481 PRO A CA   6  
ATOM   8050  C  C    . PRO A 1 60 ? 10.400  -9.405  7.670   1.00 0.00 ? 481 PRO A C    6  
ATOM   8051  O  O    . PRO A 1 60 ? 10.868  -10.408 7.129   1.00 0.00 ? 481 PRO A O    6  
ATOM   8052  C  CB   . PRO A 1 60 ? 10.123  -10.392 9.961   1.00 0.00 ? 481 PRO A CB   6  
ATOM   8053  C  CG   . PRO A 1 60 ? 9.586   -11.762 9.726   1.00 0.00 ? 481 PRO A CG   6  
ATOM   8054  C  CD   . PRO A 1 60 ? 8.188   -11.574 9.204   1.00 0.00 ? 481 PRO A CD   6  
ATOM   8055  H  HA   . PRO A 1 60 ? 9.269   -8.545  9.272   1.00 0.00 ? 481 PRO A HA   6  
ATOM   8056  H  HB2  . PRO A 1 60 ? 11.198  -10.365 9.852   1.00 0.00 ? 481 PRO A HB2  6  
ATOM   8057  H  HB3  . PRO A 1 60 ? 9.845   -10.021 10.936  1.00 0.00 ? 481 PRO A HB3  6  
ATOM   8058  H  HG2  . PRO A 1 60 ? 10.193  -12.274 8.996   1.00 0.00 ? 481 PRO A HG2  6  
ATOM   8059  H  HG3  . PRO A 1 60 ? 9.568   -12.313 10.655  1.00 0.00 ? 481 PRO A HG3  6  
ATOM   8060  H  HD2  . PRO A 1 60 ? 7.948   -12.344 8.485   1.00 0.00 ? 481 PRO A HD2  6  
ATOM   8061  H  HD3  . PRO A 1 60 ? 7.478   -11.579 10.017  1.00 0.00 ? 481 PRO A HD3  6  
ATOM   8062  N  N    . LEU A 1 61 ? 10.660  -8.171  7.254   1.00 0.00 ? 482 LEU A N    6  
ATOM   8063  C  CA   . LEU A 1 61 ? 11.531  -7.917  6.111   1.00 0.00 ? 482 LEU A CA   6  
ATOM   8064  C  C    . LEU A 1 61 ? 12.720  -8.871  6.110   1.00 0.00 ? 482 LEU A C    6  
ATOM   8065  O  O    . LEU A 1 61 ? 13.294  -9.168  7.158   1.00 0.00 ? 482 LEU A O    6  
ATOM   8066  C  CB   . LEU A 1 61 ? 12.024  -6.469  6.133   1.00 0.00 ? 482 LEU A CB   6  
ATOM   8067  C  CG   . LEU A 1 61 ? 10.974  -5.397  5.839   1.00 0.00 ? 482 LEU A CG   6  
ATOM   8068  C  CD1  . LEU A 1 61 ? 11.551  -4.008  6.061   1.00 0.00 ? 482 LEU A CD1  6  
ATOM   8069  C  CD2  . LEU A 1 61 ? 10.451  -5.539  4.416   1.00 0.00 ? 482 LEU A CD2  6  
ATOM   8070  H  H    . LEU A 1 61 ? 10.259  -7.412  7.726   1.00 0.00 ? 482 LEU A H    6  
ATOM   8071  H  HA   . LEU A 1 61 ? 10.954  -8.078  5.213   1.00 0.00 ? 482 LEU A HA   6  
ATOM   8072  H  HB2  . LEU A 1 61 ? 12.430  -6.273  7.113   1.00 0.00 ? 482 LEU A HB2  6  
ATOM   8073  H  HB3  . LEU A 1 61 ? 12.808  -6.377  5.395   1.00 0.00 ? 482 LEU A HB3  6  
ATOM   8074  H  HG   . LEU A 1 61 ? 10.140  -5.524  6.516   1.00 0.00 ? 482 LEU A HG   6  
ATOM   8075  H  HD11 . LEU A 1 61 ? 10.799  -3.266  5.841   1.00 0.00 ? 482 LEU A HD11 6  
ATOM   8076  H  HD12 . LEU A 1 61 ? 12.401  -3.864  5.409   1.00 0.00 ? 482 LEU A HD12 6  
ATOM   8077  H  HD13 . LEU A 1 61 ? 11.866  -3.910  7.089   1.00 0.00 ? 482 LEU A HD13 6  
ATOM   8078  H  HD21 . LEU A 1 61 ? 9.635   -4.848  4.263   1.00 0.00 ? 482 LEU A HD21 6  
ATOM   8079  H  HD22 . LEU A 1 61 ? 10.101  -6.549  4.260   1.00 0.00 ? 482 LEU A HD22 6  
ATOM   8080  H  HD23 . LEU A 1 61 ? 11.245  -5.320  3.718   1.00 0.00 ? 482 LEU A HD23 6  
ATOM   8081  N  N    . THR A 1 62 ? 13.088  -9.349  4.925   1.00 0.00 ? 483 THR A N    6  
ATOM   8082  C  CA   . THR A 1 62 ? 14.210  -10.269 4.786   1.00 0.00 ? 483 THR A CA   6  
ATOM   8083  C  C    . THR A 1 62 ? 15.286  -9.690  3.875   1.00 0.00 ? 483 THR A C    6  
ATOM   8084  O  O    . THR A 1 62 ? 15.002  -8.856  3.016   1.00 0.00 ? 483 THR A O    6  
ATOM   8085  C  CB   . THR A 1 62 ? 13.755  -11.629 4.224   1.00 0.00 ? 483 THR A CB   6  
ATOM   8086  O  OG1  . THR A 1 62 ? 12.865  -11.430 3.120   1.00 0.00 ? 483 THR A OG1  6  
ATOM   8087  C  CG2  . THR A 1 62 ? 13.062  -12.453 5.298   1.00 0.00 ? 483 THR A CG2  6  
ATOM   8088  H  H    . THR A 1 62 ? 12.592  -9.075  4.125   1.00 0.00 ? 483 THR A H    6  
ATOM   8089  H  HA   . THR A 1 62 ? 14.632  -10.431 5.767   1.00 0.00 ? 483 THR A HA   6  
ATOM   8090  H  HB   . THR A 1 62 ? 14.626  -12.169 3.882   1.00 0.00 ? 483 THR A HB   6  
ATOM   8091  H  HG1  . THR A 1 62 ? 11.959  -11.423 3.436   1.00 0.00 ? 483 THR A HG1  6  
ATOM   8092  H  HG21 . THR A 1 62 ? 12.149  -11.960 5.598   1.00 0.00 ? 483 THR A HG21 6  
ATOM   8093  H  HG22 . THR A 1 62 ? 13.715  -12.553 6.152   1.00 0.00 ? 483 THR A HG22 6  
ATOM   8094  H  HG23 . THR A 1 62 ? 12.830  -13.432 4.906   1.00 0.00 ? 483 THR A HG23 6  
ATOM   8095  N  N    . GLU A 1 63 ? 16.523  -10.138 4.068   1.00 0.00 ? 484 GLU A N    6  
ATOM   8096  C  CA   . GLU A 1 63 ? 17.642  -9.663  3.262   1.00 0.00 ? 484 GLU A CA   6  
ATOM   8097  C  C    . GLU A 1 63 ? 17.240  -9.534  1.796   1.00 0.00 ? 484 GLU A C    6  
ATOM   8098  O  O    . GLU A 1 63 ? 17.779  -8.703  1.066   1.00 0.00 ? 484 GLU A O    6  
ATOM   8099  C  CB   . GLU A 1 63 ? 18.834  -10.613 3.394   1.00 0.00 ? 484 GLU A CB   6  
ATOM   8100  C  CG   . GLU A 1 63 ? 18.534  -12.032 2.940   1.00 0.00 ? 484 GLU A CG   6  
ATOM   8101  C  CD   . GLU A 1 63 ? 19.670  -12.992 3.236   1.00 0.00 ? 484 GLU A CD   6  
ATOM   8102  O  OE1  . GLU A 1 63 ? 20.837  -12.546 3.243   1.00 0.00 ? 484 GLU A OE1  6  
ATOM   8103  O  OE2  . GLU A 1 63 ? 19.392  -14.188 3.462   1.00 0.00 ? 484 GLU A OE2  6  
ATOM   8104  H  H    . GLU A 1 63 ? 16.686  -10.803 4.769   1.00 0.00 ? 484 GLU A H    6  
ATOM   8105  H  HA   . GLU A 1 63 ? 17.927  -8.690  3.632   1.00 0.00 ? 484 GLU A HA   6  
ATOM   8106  H  HB2  . GLU A 1 63 ? 19.651  -10.232 2.799   1.00 0.00 ? 484 GLU A HB2  6  
ATOM   8107  H  HB3  . GLU A 1 63 ? 19.139  -10.646 4.430   1.00 0.00 ? 484 GLU A HB3  6  
ATOM   8108  H  HG2  . GLU A 1 63 ? 17.648  -12.380 3.450   1.00 0.00 ? 484 GLU A HG2  6  
ATOM   8109  H  HG3  . GLU A 1 63 ? 18.356  -12.026 1.875   1.00 0.00 ? 484 GLU A HG3  6  
ATOM   8110  N  N    . GLU A 1 64 ? 16.290  -10.363 1.373   1.00 0.00 ? 485 GLU A N    6  
ATOM   8111  C  CA   . GLU A 1 64 ? 15.818  -10.342 -0.006  1.00 0.00 ? 485 GLU A CA   6  
ATOM   8112  C  C    . GLU A 1 64 ? 14.821  -9.206  -0.223  1.00 0.00 ? 485 GLU A C    6  
ATOM   8113  O  O    . GLU A 1 64 ? 15.151  -8.180  -0.819  1.00 0.00 ? 485 GLU A O    6  
ATOM   8114  C  CB   . GLU A 1 64 ? 15.169  -11.680 -0.366  1.00 0.00 ? 485 GLU A CB   6  
ATOM   8115  C  CG   . GLU A 1 64 ? 14.679  -11.751 -1.803  1.00 0.00 ? 485 GLU A CG   6  
ATOM   8116  C  CD   . GLU A 1 64 ? 13.468  -12.649 -1.962  1.00 0.00 ? 485 GLU A CD   6  
ATOM   8117  O  OE1  . GLU A 1 64 ? 12.366  -12.242 -1.539  1.00 0.00 ? 485 GLU A OE1  6  
ATOM   8118  O  OE2  . GLU A 1 64 ? 13.622  -13.761 -2.511  1.00 0.00 ? 485 GLU A OE2  6  
ATOM   8119  H  H    . GLU A 1 64 ? 15.899  -11.003 2.003   1.00 0.00 ? 485 GLU A H    6  
ATOM   8120  H  HA   . GLU A 1 64 ? 16.672  -10.182 -0.647  1.00 0.00 ? 485 GLU A HA   6  
ATOM   8121  H  HB2  . GLU A 1 64 ? 15.890  -12.469 -0.213  1.00 0.00 ? 485 GLU A HB2  6  
ATOM   8122  H  HB3  . GLU A 1 64 ? 14.325  -11.844 0.288   1.00 0.00 ? 485 GLU A HB3  6  
ATOM   8123  H  HG2  . GLU A 1 64 ? 14.416  -10.757 -2.130  1.00 0.00 ? 485 GLU A HG2  6  
ATOM   8124  H  HG3  . GLU A 1 64 ? 15.477  -12.134 -2.423  1.00 0.00 ? 485 GLU A HG3  6  
ATOM   8125  N  N    . THR A 1 65 ? 13.600  -9.397  0.265   1.00 0.00 ? 486 THR A N    6  
ATOM   8126  C  CA   . THR A 1 65 ? 12.554  -8.392  0.125   1.00 0.00 ? 486 THR A CA   6  
ATOM   8127  C  C    . THR A 1 65 ? 13.075  -7.004  0.479   1.00 0.00 ? 486 THR A C    6  
ATOM   8128  O  O    . THR A 1 65 ? 12.860  -6.042  -0.259  1.00 0.00 ? 486 THR A O    6  
ATOM   8129  C  CB   . THR A 1 65 ? 11.340  -8.715  1.015   1.00 0.00 ? 486 THR A CB   6  
ATOM   8130  O  OG1  . THR A 1 65 ? 11.779  -9.074  2.330   1.00 0.00 ? 486 THR A OG1  6  
ATOM   8131  C  CG2  . THR A 1 65 ? 10.520  -9.850  0.421   1.00 0.00 ? 486 THR A CG2  6  
ATOM   8132  H  H    . THR A 1 65 ? 13.398  -10.236 0.731   1.00 0.00 ? 486 THR A H    6  
ATOM   8133  H  HA   . THR A 1 65 ? 12.229  -8.391  -0.906  1.00 0.00 ? 486 THR A HA   6  
ATOM   8134  H  HB   . THR A 1 65 ? 10.716  -7.835  1.080   1.00 0.00 ? 486 THR A HB   6  
ATOM   8135  H  HG1  . THR A 1 65 ? 12.662  -9.447  2.282   1.00 0.00 ? 486 THR A HG1  6  
ATOM   8136  H  HG21 . THR A 1 65 ? 9.648   -10.024 1.035   1.00 0.00 ? 486 THR A HG21 6  
ATOM   8137  H  HG22 . THR A 1 65 ? 11.120  -10.747 0.386   1.00 0.00 ? 486 THR A HG22 6  
ATOM   8138  H  HG23 . THR A 1 65 ? 10.210  -9.585  -0.578  1.00 0.00 ? 486 THR A HG23 6  
ATOM   8139  N  N    . ARG A 1 66 ? 13.762  -6.906  1.613   1.00 0.00 ? 487 ARG A N    6  
ATOM   8140  C  CA   . ARG A 1 66 ? 14.314  -5.635  2.065   1.00 0.00 ? 487 ARG A CA   6  
ATOM   8141  C  C    . ARG A 1 66 ? 14.881  -4.840  0.892   1.00 0.00 ? 487 ARG A C    6  
ATOM   8142  O  O    . ARG A 1 66 ? 14.735  -3.620  0.829   1.00 0.00 ? 487 ARG A O    6  
ATOM   8143  C  CB   . ARG A 1 66 ? 15.406  -5.871  3.110   1.00 0.00 ? 487 ARG A CB   6  
ATOM   8144  C  CG   . ARG A 1 66 ? 15.558  -4.728  4.100   1.00 0.00 ? 487 ARG A CG   6  
ATOM   8145  C  CD   . ARG A 1 66 ? 15.887  -3.421  3.396   1.00 0.00 ? 487 ARG A CD   6  
ATOM   8146  N  NE   . ARG A 1 66 ? 16.686  -2.533  4.235   1.00 0.00 ? 487 ARG A NE   6  
ATOM   8147  C  CZ   . ARG A 1 66 ? 16.789  -1.224  4.031   1.00 0.00 ? 487 ARG A CZ   6  
ATOM   8148  N  NH1  . ARG A 1 66 ? 16.146  -0.655  3.021   1.00 0.00 ? 487 ARG A NH1  6  
ATOM   8149  N  NH2  . ARG A 1 66 ? 17.536  -0.482  4.839   1.00 0.00 ? 487 ARG A NH2  6  
ATOM   8150  H  H    . ARG A 1 66 ? 13.901  -7.709  2.158   1.00 0.00 ? 487 ARG A H    6  
ATOM   8151  H  HA   . ARG A 1 66 ? 13.513  -5.067  2.515   1.00 0.00 ? 487 ARG A HA   6  
ATOM   8152  H  HB2  . ARG A 1 66 ? 15.170  -6.768  3.664   1.00 0.00 ? 487 ARG A HB2  6  
ATOM   8153  H  HB3  . ARG A 1 66 ? 16.349  -6.008  2.603   1.00 0.00 ? 487 ARG A HB3  6  
ATOM   8154  H  HG2  . ARG A 1 66 ? 14.633  -4.608  4.644   1.00 0.00 ? 487 ARG A HG2  6  
ATOM   8155  H  HG3  . ARG A 1 66 ? 16.355  -4.966  4.790   1.00 0.00 ? 487 ARG A HG3  6  
ATOM   8156  H  HD2  . ARG A 1 66 ? 16.439  -3.642  2.495   1.00 0.00 ? 487 ARG A HD2  6  
ATOM   8157  H  HD3  . ARG A 1 66 ? 14.963  -2.924  3.139   1.00 0.00 ? 487 ARG A HD3  6  
ATOM   8158  H  HE   . ARG A 1 66 ? 17.170  -2.932  4.988   1.00 0.00 ? 487 ARG A HE   6  
ATOM   8159  H  HH11 . ARG A 1 66 ? 15.582  -1.211  2.411   1.00 0.00 ? 487 ARG A HH11 6  
ATOM   8160  H  HH12 . ARG A 1 66 ? 16.224  0.331   2.870   1.00 0.00 ? 487 ARG A HH12 6  
ATOM   8161  H  HH21 . ARG A 1 66 ? 18.022  -0.908  5.602   1.00 0.00 ? 487 ARG A HH21 6  
ATOM   8162  H  HH22 . ARG A 1 66 ? 17.613  0.502   4.684   1.00 0.00 ? 487 ARG A HH22 6  
ATOM   8163  N  N    . GLU A 1 67 ? 15.528  -5.541  -0.033  1.00 0.00 ? 488 GLU A N    6  
ATOM   8164  C  CA   . GLU A 1 67 ? 16.118  -4.900  -1.203  1.00 0.00 ? 488 GLU A CA   6  
ATOM   8165  C  C    . GLU A 1 67 ? 15.038  -4.296  -2.095  1.00 0.00 ? 488 GLU A C    6  
ATOM   8166  O  O    . GLU A 1 67 ? 15.212  -3.211  -2.652  1.00 0.00 ? 488 GLU A O    6  
ATOM   8167  C  CB   . GLU A 1 67 ? 16.948  -5.908  -2.000  1.00 0.00 ? 488 GLU A CB   6  
ATOM   8168  C  CG   . GLU A 1 67 ? 18.358  -6.095  -1.465  1.00 0.00 ? 488 GLU A CG   6  
ATOM   8169  C  CD   . GLU A 1 67 ? 19.297  -4.984  -1.893  1.00 0.00 ? 488 GLU A CD   6  
ATOM   8170  O  OE1  . GLU A 1 67 ? 18.819  -3.849  -2.099  1.00 0.00 ? 488 GLU A OE1  6  
ATOM   8171  O  OE2  . GLU A 1 67 ? 20.510  -5.250  -2.021  1.00 0.00 ? 488 GLU A OE2  6  
ATOM   8172  H  H    . GLU A 1 67 ? 15.612  -6.512  0.073   1.00 0.00 ? 488 GLU A H    6  
ATOM   8173  H  HA   . GLU A 1 67 ? 16.766  -4.109  -0.856  1.00 0.00 ? 488 GLU A HA   6  
ATOM   8174  H  HB2  . GLU A 1 67 ? 16.447  -6.865  -1.980  1.00 0.00 ? 488 GLU A HB2  6  
ATOM   8175  H  HB3  . GLU A 1 67 ? 17.017  -5.570  -3.023  1.00 0.00 ? 488 GLU A HB3  6  
ATOM   8176  H  HG2  . GLU A 1 67 ? 18.320  -6.117  -0.386  1.00 0.00 ? 488 GLU A HG2  6  
ATOM   8177  H  HG3  . GLU A 1 67 ? 18.746  -7.035  -1.829  1.00 0.00 ? 488 GLU A HG3  6  
ATOM   8178  N  N    . LEU A 1 68 ? 13.922  -5.005  -2.226  1.00 0.00 ? 489 LEU A N    6  
ATOM   8179  C  CA   . LEU A 1 68 ? 12.813  -4.540  -3.051  1.00 0.00 ? 489 LEU A CA   6  
ATOM   8180  C  C    . LEU A 1 68 ? 12.439  -3.103  -2.701  1.00 0.00 ? 489 LEU A C    6  
ATOM   8181  O  O    . LEU A 1 68 ? 12.529  -2.205  -3.539  1.00 0.00 ? 489 LEU A O    6  
ATOM   8182  C  CB   . LEU A 1 68 ? 11.599  -5.452  -2.869  1.00 0.00 ? 489 LEU A CB   6  
ATOM   8183  C  CG   . LEU A 1 68 ? 11.812  -6.928  -3.207  1.00 0.00 ? 489 LEU A CG   6  
ATOM   8184  C  CD1  . LEU A 1 68 ? 10.535  -7.720  -2.972  1.00 0.00 ? 489 LEU A CD1  6  
ATOM   8185  C  CD2  . LEU A 1 68 ? 12.279  -7.083  -4.647  1.00 0.00 ? 489 LEU A CD2  6  
ATOM   8186  H  H    . LEU A 1 68 ? 13.842  -5.862  -1.758  1.00 0.00 ? 489 LEU A H    6  
ATOM   8187  H  HA   . LEU A 1 68 ? 13.129  -4.576  -4.082  1.00 0.00 ? 489 LEU A HA   6  
ATOM   8188  H  HB2  . LEU A 1 68 ? 11.291  -5.392  -1.836  1.00 0.00 ? 489 LEU A HB2  6  
ATOM   8189  H  HB3  . LEU A 1 68 ? 10.806  -5.078  -3.501  1.00 0.00 ? 489 LEU A HB3  6  
ATOM   8190  H  HG   . LEU A 1 68 ? 12.579  -7.332  -2.561  1.00 0.00 ? 489 LEU A HG   6  
ATOM   8191  H  HD11 . LEU A 1 68 ? 10.777  -8.661  -2.501  1.00 0.00 ? 489 LEU A HD11 6  
ATOM   8192  H  HD12 . LEU A 1 68 ? 10.047  -7.905  -3.917  1.00 0.00 ? 489 LEU A HD12 6  
ATOM   8193  H  HD13 . LEU A 1 68 ? 9.875   -7.155  -2.330  1.00 0.00 ? 489 LEU A HD13 6  
ATOM   8194  H  HD21 . LEU A 1 68 ? 11.801  -6.336  -5.263  1.00 0.00 ? 489 LEU A HD21 6  
ATOM   8195  H  HD22 . LEU A 1 68 ? 12.017  -8.067  -5.007  1.00 0.00 ? 489 LEU A HD22 6  
ATOM   8196  H  HD23 . LEU A 1 68 ? 13.351  -6.956  -4.694  1.00 0.00 ? 489 LEU A HD23 6  
ATOM   8197  N  N    . LEU A 1 69 ? 12.022  -2.891  -1.457  1.00 0.00 ? 490 LEU A N    6  
ATOM   8198  C  CA   . LEU A 1 69 ? 11.638  -1.562  -0.995  1.00 0.00 ? 490 LEU A CA   6  
ATOM   8199  C  C    . LEU A 1 69 ? 12.603  -0.503  -1.518  1.00 0.00 ? 490 LEU A C    6  
ATOM   8200  O  O    . LEU A 1 69 ? 12.192  0.460   -2.166  1.00 0.00 ? 490 LEU A O    6  
ATOM   8201  C  CB   . LEU A 1 69 ? 11.599  -1.524  0.534   1.00 0.00 ? 490 LEU A CB   6  
ATOM   8202  C  CG   . LEU A 1 69 ? 10.511  -2.367  1.199   1.00 0.00 ? 490 LEU A CG   6  
ATOM   8203  C  CD1  . LEU A 1 69 ? 10.816  -2.563  2.676   1.00 0.00 ? 490 LEU A CD1  6  
ATOM   8204  C  CD2  . LEU A 1 69 ? 9.147   -1.719  1.016   1.00 0.00 ? 490 LEU A CD2  6  
ATOM   8205  H  H    . LEU A 1 69 ? 11.972  -3.646  -0.835  1.00 0.00 ? 490 LEU A H    6  
ATOM   8206  H  HA   . LEU A 1 69 ? 10.650  -1.352  -1.377  1.00 0.00 ? 490 LEU A HA   6  
ATOM   8207  H  HB2  . LEU A 1 69 ? 12.554  -1.870  0.897   1.00 0.00 ? 490 LEU A HB2  6  
ATOM   8208  H  HB3  . LEU A 1 69 ? 11.453  -0.496  0.834   1.00 0.00 ? 490 LEU A HB3  6  
ATOM   8209  H  HG   . LEU A 1 69 ? 10.485  -3.342  0.733   1.00 0.00 ? 490 LEU A HG   6  
ATOM   8210  H  HD11 . LEU A 1 69 ? 10.424  -3.514  3.002   1.00 0.00 ? 490 LEU A HD11 6  
ATOM   8211  H  HD12 . LEU A 1 69 ? 10.356  -1.770  3.247   1.00 0.00 ? 490 LEU A HD12 6  
ATOM   8212  H  HD13 . LEU A 1 69 ? 11.885  -2.542  2.829   1.00 0.00 ? 490 LEU A HD13 6  
ATOM   8213  H  HD21 . LEU A 1 69 ? 8.375   -2.465  1.136   1.00 0.00 ? 490 LEU A HD21 6  
ATOM   8214  H  HD22 . LEU A 1 69 ? 9.082   -1.291  0.026   1.00 0.00 ? 490 LEU A HD22 6  
ATOM   8215  H  HD23 . LEU A 1 69 ? 9.015   -0.942  1.754   1.00 0.00 ? 490 LEU A HD23 6  
ATOM   8216  N  N    . ASP A 1 70 ? 13.887  -0.689  -1.234  1.00 0.00 ? 491 ASP A N    6  
ATOM   8217  C  CA   . ASP A 1 70 ? 14.912  0.248   -1.678  1.00 0.00 ? 491 ASP A CA   6  
ATOM   8218  C  C    . ASP A 1 70 ? 14.625  0.736   -3.095  1.00 0.00 ? 491 ASP A C    6  
ATOM   8219  O  O    . ASP A 1 70 ? 14.718  1.929   -3.383  1.00 0.00 ? 491 ASP A O    6  
ATOM   8220  C  CB   . ASP A 1 70 ? 16.293  -0.407  -1.620  1.00 0.00 ? 491 ASP A CB   6  
ATOM   8221  C  CG   . ASP A 1 70 ? 16.741  -0.688  -0.200  1.00 0.00 ? 491 ASP A CG   6  
ATOM   8222  O  OD1  . ASP A 1 70 ? 16.971  0.281   0.553   1.00 0.00 ? 491 ASP A OD1  6  
ATOM   8223  O  OD2  . ASP A 1 70 ? 16.861  -1.878  0.159   1.00 0.00 ? 491 ASP A OD2  6  
ATOM   8224  H  H    . ASP A 1 70 ? 14.152  -1.476  -0.713  1.00 0.00 ? 491 ASP A H    6  
ATOM   8225  H  HA   . ASP A 1 70 ? 14.898  1.096   -1.010  1.00 0.00 ? 491 ASP A HA   6  
ATOM   8226  H  HB2  . ASP A 1 70 ? 16.263  -1.342  -2.160  1.00 0.00 ? 491 ASP A HB2  6  
ATOM   8227  H  HB3  . ASP A 1 70 ? 17.015  0.249   -2.084  1.00 0.00 ? 491 ASP A HB3  6  
ATOM   8228  N  N    . LYS A 1 71 ? 14.278  -0.196  -3.976  1.00 0.00 ? 492 LYS A N    6  
ATOM   8229  C  CA   . LYS A 1 71 ? 13.978  0.137   -5.364  1.00 0.00 ? 492 LYS A CA   6  
ATOM   8230  C  C    . LYS A 1 71 ? 12.567  0.704   -5.494  1.00 0.00 ? 492 LYS A C    6  
ATOM   8231  O  O    . LYS A 1 71 ? 12.324  1.611   -6.289  1.00 0.00 ? 492 LYS A O    6  
ATOM   8232  C  CB   . LYS A 1 71 ? 14.125  -1.101  -6.251  1.00 0.00 ? 492 LYS A CB   6  
ATOM   8233  C  CG   . LYS A 1 71 ? 14.287  -0.777  -7.726  1.00 0.00 ? 492 LYS A CG   6  
ATOM   8234  C  CD   . LYS A 1 71 ? 15.684  -0.266  -8.035  1.00 0.00 ? 492 LYS A CD   6  
ATOM   8235  C  CE   . LYS A 1 71 ? 16.630  -1.406  -8.382  1.00 0.00 ? 492 LYS A CE   6  
ATOM   8236  N  NZ   . LYS A 1 71 ? 17.228  -2.021  -7.165  1.00 0.00 ? 492 LYS A NZ   6  
ATOM   8237  H  H    . LYS A 1 71 ? 14.222  -1.131  -3.686  1.00 0.00 ? 492 LYS A H    6  
ATOM   8238  H  HA   . LYS A 1 71 ? 14.685  0.887   -5.686  1.00 0.00 ? 492 LYS A HA   6  
ATOM   8239  H  HB2  . LYS A 1 71 ? 14.993  -1.658  -5.929  1.00 0.00 ? 492 LYS A HB2  6  
ATOM   8240  H  HB3  . LYS A 1 71 ? 13.247  -1.720  -6.134  1.00 0.00 ? 492 LYS A HB3  6  
ATOM   8241  H  HG2  . LYS A 1 71 ? 14.106  -1.671  -8.303  1.00 0.00 ? 492 LYS A HG2  6  
ATOM   8242  H  HG3  . LYS A 1 71 ? 13.567  -0.018  -7.999  1.00 0.00 ? 492 LYS A HG3  6  
ATOM   8243  H  HD2  . LYS A 1 71 ? 15.633  0.412   -8.873  1.00 0.00 ? 492 LYS A HD2  6  
ATOM   8244  H  HD3  . LYS A 1 71 ? 16.067  0.256   -7.169  1.00 0.00 ? 492 LYS A HD3  6  
ATOM   8245  H  HE2  . LYS A 1 71 ? 16.080  -2.160  -8.924  1.00 0.00 ? 492 LYS A HE2  6  
ATOM   8246  H  HE3  . LYS A 1 71 ? 17.422  -1.020  -9.007  1.00 0.00 ? 492 LYS A HE3  6  
ATOM   8247  H  HZ1  . LYS A 1 71 ? 18.217  -2.286  -7.348  1.00 0.00 ? 492 LYS A HZ1  6  
ATOM   8248  H  HZ2  . LYS A 1 71 ? 16.697  -2.875  -6.899  1.00 0.00 ? 492 LYS A HZ2  6  
ATOM   8249  H  HZ3  . LYS A 1 71 ? 17.201  -1.348  -6.374  1.00 0.00 ? 492 LYS A HZ3  6  
ATOM   8250  N  N    . MET A 1 72 ? 11.643  0.164   -4.707  1.00 0.00 ? 493 MET A N    6  
ATOM   8251  C  CA   . MET A 1 72 ? 10.257  0.618   -4.733  1.00 0.00 ? 493 MET A CA   6  
ATOM   8252  C  C    . MET A 1 72 ? 10.148  2.060   -4.248  1.00 0.00 ? 493 MET A C    6  
ATOM   8253  O  O    . MET A 1 72 ? 9.808   2.961   -5.017  1.00 0.00 ? 493 MET A O    6  
ATOM   8254  C  CB   . MET A 1 72 ? 9.383   -0.291  -3.867  1.00 0.00 ? 493 MET A CB   6  
ATOM   8255  C  CG   . MET A 1 72 ? 7.902   -0.208  -4.200  1.00 0.00 ? 493 MET A CG   6  
ATOM   8256  S  SD   . MET A 1 72 ? 7.109   1.242   -3.481  1.00 0.00 ? 493 MET A SD   6  
ATOM   8257  C  CE   . MET A 1 72 ? 6.960   0.733   -1.770  1.00 0.00 ? 493 MET A CE   6  
ATOM   8258  H  H    . MET A 1 72 ? 11.897  -0.557  -4.093  1.00 0.00 ? 493 MET A H    6  
ATOM   8259  H  HA   . MET A 1 72 ? 9.911   0.567   -5.755  1.00 0.00 ? 493 MET A HA   6  
ATOM   8260  H  HB2  . MET A 1 72 ? 9.704   -1.313  -4.001  1.00 0.00 ? 493 MET A HB2  6  
ATOM   8261  H  HB3  . MET A 1 72 ? 9.512   -0.015  -2.831  1.00 0.00 ? 493 MET A HB3  6  
ATOM   8262  H  HG2  . MET A 1 72 ? 7.790   -0.167  -5.274  1.00 0.00 ? 493 MET A HG2  6  
ATOM   8263  H  HG3  . MET A 1 72 ? 7.413   -1.094  -3.824  1.00 0.00 ? 493 MET A HG3  6  
ATOM   8264  H  HE1  . MET A 1 72 ? 7.921   0.816   -1.285  1.00 0.00 ? 493 MET A HE1  6  
ATOM   8265  H  HE2  . MET A 1 72 ? 6.246   1.368   -1.267  1.00 0.00 ? 493 MET A HE2  6  
ATOM   8266  H  HE3  . MET A 1 72 ? 6.623   -0.292  -1.728  1.00 0.00 ? 493 MET A HE3  6  
ATOM   8267  N  N    . LEU A 1 73 ? 10.439  2.272   -2.969  1.00 0.00 ? 494 LEU A N    6  
ATOM   8268  C  CA   . LEU A 1 73 ? 10.373  3.606   -2.381  1.00 0.00 ? 494 LEU A CA   6  
ATOM   8269  C  C    . LEU A 1 73 ? 10.916  4.654   -3.347  1.00 0.00 ? 494 LEU A C    6  
ATOM   8270  O  O    . LEU A 1 73 ? 10.280  5.681   -3.586  1.00 0.00 ? 494 LEU A O    6  
ATOM   8271  C  CB   . LEU A 1 73 ? 11.162  3.646   -1.071  1.00 0.00 ? 494 LEU A CB   6  
ATOM   8272  C  CG   . LEU A 1 73 ? 10.578  2.840   0.089   1.00 0.00 ? 494 LEU A CG   6  
ATOM   8273  C  CD1  . LEU A 1 73 ? 11.676  2.425   1.057   1.00 0.00 ? 494 LEU A CD1  6  
ATOM   8274  C  CD2  . LEU A 1 73 ? 9.505   3.643   0.810   1.00 0.00 ? 494 LEU A CD2  6  
ATOM   8275  H  H    . LEU A 1 73 ? 10.703  1.516   -2.406  1.00 0.00 ? 494 LEU A H    6  
ATOM   8276  H  HA   . LEU A 1 73 ? 9.337   3.826   -2.175  1.00 0.00 ? 494 LEU A HA   6  
ATOM   8277  H  HB2  . LEU A 1 73 ? 12.153  3.268   -1.270  1.00 0.00 ? 494 LEU A HB2  6  
ATOM   8278  H  HB3  . LEU A 1 73 ? 11.229  4.679   -0.758  1.00 0.00 ? 494 LEU A HB3  6  
ATOM   8279  H  HG   . LEU A 1 73 ? 10.120  1.941   -0.300  1.00 0.00 ? 494 LEU A HG   6  
ATOM   8280  H  HD11 . LEU A 1 73 ? 11.330  1.600   1.661   1.00 0.00 ? 494 LEU A HD11 6  
ATOM   8281  H  HD12 . LEU A 1 73 ? 11.926  3.259   1.696   1.00 0.00 ? 494 LEU A HD12 6  
ATOM   8282  H  HD13 . LEU A 1 73 ? 12.551  2.123   0.500   1.00 0.00 ? 494 LEU A HD13 6  
ATOM   8283  H  HD21 . LEU A 1 73 ? 8.551   3.151   0.697   1.00 0.00 ? 494 LEU A HD21 6  
ATOM   8284  H  HD22 . LEU A 1 73 ? 9.450   4.635   0.383   1.00 0.00 ? 494 LEU A HD22 6  
ATOM   8285  H  HD23 . LEU A 1 73 ? 9.752   3.715   1.858   1.00 0.00 ? 494 LEU A HD23 6  
ATOM   8286  N  N    . ALA A 1 74 ? 12.094  4.387   -3.902  1.00 0.00 ? 495 ALA A N    6  
ATOM   8287  C  CA   . ALA A 1 74 ? 12.719  5.305   -4.845  1.00 0.00 ? 495 ALA A CA   6  
ATOM   8288  C  C    . ALA A 1 74 ? 11.872  5.461   -6.104  1.00 0.00 ? 495 ALA A C    6  
ATOM   8289  O  O    . ALA A 1 74 ? 11.683  6.571   -6.602  1.00 0.00 ? 495 ALA A O    6  
ATOM   8290  C  CB   . ALA A 1 74 ? 14.117  4.822   -5.204  1.00 0.00 ? 495 ALA A CB   6  
ATOM   8291  H  H    . ALA A 1 74 ? 12.552  3.552   -3.672  1.00 0.00 ? 495 ALA A H    6  
ATOM   8292  H  HA   . ALA A 1 74 ? 12.811  6.268   -4.363  1.00 0.00 ? 495 ALA A HA   6  
ATOM   8293  H  HB1  . ALA A 1 74 ? 14.604  4.444   -4.318  1.00 0.00 ? 495 ALA A HB1  6  
ATOM   8294  H  HB2  . ALA A 1 74 ? 14.047  4.036   -5.941  1.00 0.00 ? 495 ALA A HB2  6  
ATOM   8295  H  HB3  . ALA A 1 74 ? 14.689  5.644   -5.607  1.00 0.00 ? 495 ALA A HB3  6  
ATOM   8296  N  N    . ASP A 1 75 ? 11.365  4.344   -6.612  1.00 0.00 ? 496 ASP A N    6  
ATOM   8297  C  CA   . ASP A 1 75 ? 10.538  4.357   -7.813  1.00 0.00 ? 496 ASP A CA   6  
ATOM   8298  C  C    . ASP A 1 75 ? 9.325   5.263   -7.627  1.00 0.00 ? 496 ASP A C    6  
ATOM   8299  O  O    . ASP A 1 75 ? 9.022   6.095   -8.482  1.00 0.00 ? 496 ASP A O    6  
ATOM   8300  C  CB   . ASP A 1 75 ? 10.082  2.938   -8.159  1.00 0.00 ? 496 ASP A CB   6  
ATOM   8301  C  CG   . ASP A 1 75 ? 9.709   2.791   -9.621  1.00 0.00 ? 496 ASP A CG   6  
ATOM   8302  O  OD1  . ASP A 1 75 ? 10.551  3.116   -10.484 1.00 0.00 ? 496 ASP A OD1  6  
ATOM   8303  O  OD2  . ASP A 1 75 ? 8.575   2.349   -9.902  1.00 0.00 ? 496 ASP A OD2  6  
ATOM   8304  H  H    . ASP A 1 75 ? 11.552  3.489   -6.169  1.00 0.00 ? 496 ASP A H    6  
ATOM   8305  H  HA   . ASP A 1 75 ? 11.137  4.740   -8.624  1.00 0.00 ? 496 ASP A HA   6  
ATOM   8306  H  HB2  . ASP A 1 75 ? 10.882  2.246   -7.939  1.00 0.00 ? 496 ASP A HB2  6  
ATOM   8307  H  HB3  . ASP A 1 75 ? 9.219   2.688   -7.559  1.00 0.00 ? 496 ASP A HB3  6  
ATOM   8308  N  N    . ASP A 1 76 ? 8.633   5.094   -6.505  1.00 0.00 ? 497 ASP A N    6  
ATOM   8309  C  CA   . ASP A 1 76 ? 7.453   5.897   -6.207  1.00 0.00 ? 497 ASP A CA   6  
ATOM   8310  C  C    . ASP A 1 76 ? 7.825   7.366   -6.028  1.00 0.00 ? 497 ASP A C    6  
ATOM   8311  O  O    . ASP A 1 76 ? 7.476   8.209   -6.853  1.00 0.00 ? 497 ASP A O    6  
ATOM   8312  C  CB   . ASP A 1 76 ? 6.761   5.377   -4.946  1.00 0.00 ? 497 ASP A CB   6  
ATOM   8313  C  CG   . ASP A 1 76 ? 5.265   5.622   -4.962  1.00 0.00 ? 497 ASP A CG   6  
ATOM   8314  O  OD1  . ASP A 1 76 ? 4.624   5.302   -5.984  1.00 0.00 ? 497 ASP A OD1  6  
ATOM   8315  O  OD2  . ASP A 1 76 ? 4.736   6.135   -3.954  1.00 0.00 ? 497 ASP A OD2  6  
ATOM   8316  H  H    . ASP A 1 76 ? 8.924   4.414   -5.862  1.00 0.00 ? 497 ASP A H    6  
ATOM   8317  H  HA   . ASP A 1 76 ? 6.773   5.810   -7.041  1.00 0.00 ? 497 ASP A HA   6  
ATOM   8318  H  HB2  . ASP A 1 76 ? 6.932   4.313   -4.862  1.00 0.00 ? 497 ASP A HB2  6  
ATOM   8319  H  HB3  . ASP A 1 76 ? 7.180   5.873   -4.082  1.00 0.00 ? 497 ASP A HB3  6  
ATOM   8320  N  N    . ALA A 1 77 ? 8.535   7.663   -4.945  1.00 0.00 ? 498 ALA A N    6  
ATOM   8321  C  CA   . ALA A 1 77 ? 8.955   9.029   -4.658  1.00 0.00 ? 498 ALA A CA   6  
ATOM   8322  C  C    . ALA A 1 77 ? 9.474   9.719   -5.915  1.00 0.00 ? 498 ALA A C    6  
ATOM   8323  O  O    . ALA A 1 77 ? 9.074   10.839  -6.229  1.00 0.00 ? 498 ALA A O    6  
ATOM   8324  C  CB   . ALA A 1 77 ? 10.021  9.037   -3.572  1.00 0.00 ? 498 ALA A CB   6  
ATOM   8325  H  H    . ALA A 1 77 ? 8.783   6.947   -4.324  1.00 0.00 ? 498 ALA A H    6  
ATOM   8326  H  HA   . ALA A 1 77 ? 8.097   9.573   -4.290  1.00 0.00 ? 498 ALA A HA   6  
ATOM   8327  H  HB1  . ALA A 1 77 ? 9.802   9.820   -2.861  1.00 0.00 ? 498 ALA A HB1  6  
ATOM   8328  H  HB2  . ALA A 1 77 ? 10.026  8.083   -3.067  1.00 0.00 ? 498 ALA A HB2  6  
ATOM   8329  H  HB3  . ALA A 1 77 ? 10.988  9.215   -4.018  1.00 0.00 ? 498 ALA A HB3  6  
ATOM   8330  N  N    . GLU A 1 78 ? 10.368  9.042   -6.630  1.00 0.00 ? 499 GLU A N    6  
ATOM   8331  C  CA   . GLU A 1 78 ? 10.942  9.592   -7.852  1.00 0.00 ? 499 GLU A CA   6  
ATOM   8332  C  C    . GLU A 1 78 ? 9.866   9.796   -8.915  1.00 0.00 ? 499 GLU A C    6  
ATOM   8333  O  O    . GLU A 1 78 ? 9.659   10.908  -9.399  1.00 0.00 ? 499 GLU A O    6  
ATOM   8334  C  CB   . GLU A 1 78 ? 12.036  8.667   -8.389  1.00 0.00 ? 499 GLU A CB   6  
ATOM   8335  C  CG   . GLU A 1 78 ? 12.905  9.308   -9.458  1.00 0.00 ? 499 GLU A CG   6  
ATOM   8336  C  CD   . GLU A 1 78 ? 14.130  8.479   -9.789  1.00 0.00 ? 499 GLU A CD   6  
ATOM   8337  O  OE1  . GLU A 1 78 ? 13.964  7.298   -10.159 1.00 0.00 ? 499 GLU A OE1  6  
ATOM   8338  O  OE2  . GLU A 1 78 ? 15.255  9.010   -9.679  1.00 0.00 ? 499 GLU A OE2  6  
ATOM   8339  H  H    . GLU A 1 78 ? 10.648  8.153   -6.328  1.00 0.00 ? 499 GLU A H    6  
ATOM   8340  H  HA   . GLU A 1 78 ? 11.379  10.549  -7.612  1.00 0.00 ? 499 GLU A HA   6  
ATOM   8341  H  HB2  . GLU A 1 78 ? 12.672  8.368   -7.569  1.00 0.00 ? 499 GLU A HB2  6  
ATOM   8342  H  HB3  . GLU A 1 78 ? 11.572  7.788   -8.812  1.00 0.00 ? 499 GLU A HB3  6  
ATOM   8343  H  HG2  . GLU A 1 78 ? 12.318  9.429   -10.356 1.00 0.00 ? 499 GLU A HG2  6  
ATOM   8344  H  HG3  . GLU A 1 78 ? 13.228  10.278  -9.108  1.00 0.00 ? 499 GLU A HG3  6  
ATOM   8345  N  N    . ALA A 1 79 ? 9.185   8.713   -9.274  1.00 0.00 ? 500 ALA A N    6  
ATOM   8346  C  CA   . ALA A 1 79 ? 8.130   8.772   -10.278 1.00 0.00 ? 500 ALA A CA   6  
ATOM   8347  C  C    . ALA A 1 79 ? 6.800   9.178   -9.653  1.00 0.00 ? 500 ALA A C    6  
ATOM   8348  O  O    . ALA A 1 79 ? 6.078   8.344   -9.108  1.00 0.00 ? 500 ALA A O    6  
ATOM   8349  C  CB   . ALA A 1 79 ? 7.996   7.430   -10.983 1.00 0.00 ? 500 ALA A CB   6  
ATOM   8350  H  H    . ALA A 1 79 ? 9.396   7.854   -8.853  1.00 0.00 ? 500 ALA A H    6  
ATOM   8351  H  HA   . ALA A 1 79 ? 8.411   9.511   -11.015 1.00 0.00 ? 500 ALA A HA   6  
ATOM   8352  H  HB1  . ALA A 1 79 ? 7.431   6.752   -10.359 1.00 0.00 ? 500 ALA A HB1  6  
ATOM   8353  H  HB2  . ALA A 1 79 ? 7.483   7.567   -11.923 1.00 0.00 ? 500 ALA A HB2  6  
ATOM   8354  H  HB3  . ALA A 1 79 ? 8.978   7.019   -11.164 1.00 0.00 ? 500 ALA A HB3  6  
ATOM   8355  N  N    . GLY A 1 80 ? 6.482   10.467  -9.735  1.00 0.00 ? 501 GLY A N    6  
ATOM   8356  C  CA   . GLY A 1 80 ? 5.239   10.961  -9.173  1.00 0.00 ? 501 GLY A CA   6  
ATOM   8357  C  C    . GLY A 1 80 ? 4.166   11.162  -10.225 1.00 0.00 ? 501 GLY A C    6  
ATOM   8358  O  O    . GLY A 1 80 ? 3.430   12.148  -10.190 1.00 0.00 ? 501 GLY A O    6  
ATOM   8359  H  H    . GLY A 1 80 ? 7.096   11.086  -10.182 1.00 0.00 ? 501 GLY A H    6  
ATOM   8360  H  HA2  . GLY A 1 80 ? 4.881   10.254  -8.440  1.00 0.00 ? 501 GLY A HA2  6  
ATOM   8361  H  HA3  . GLY A 1 80 ? 5.429   11.906  -8.684  1.00 0.00 ? 501 GLY A HA3  6  
ATOM   8362  N  N    . ALA A 1 81 ? 4.077   10.226  -11.164 1.00 0.00 ? 502 ALA A N    6  
ATOM   8363  C  CA   . ALA A 1 81 ? 3.086   10.305  -12.230 1.00 0.00 ? 502 ALA A CA   6  
ATOM   8364  C  C    . ALA A 1 81 ? 2.687   8.915   -12.712 1.00 0.00 ? 502 ALA A C    6  
ATOM   8365  O  O    . ALA A 1 81 ? 3.535   8.123   -13.120 1.00 0.00 ? 502 ALA A O    6  
ATOM   8366  C  CB   . ALA A 1 81 ? 3.622   11.134  -13.388 1.00 0.00 ? 502 ALA A CB   6  
ATOM   8367  H  H    . ALA A 1 81 ? 4.692   9.464   -11.138 1.00 0.00 ? 502 ALA A H    6  
ATOM   8368  H  HA   . ALA A 1 81 ? 2.212   10.804  -11.837 1.00 0.00 ? 502 ALA A HA   6  
ATOM   8369  H  HB1  . ALA A 1 81 ? 4.698   11.198  -13.316 1.00 0.00 ? 502 ALA A HB1  6  
ATOM   8370  H  HB2  . ALA A 1 81 ? 3.351   10.665  -14.322 1.00 0.00 ? 502 ALA A HB2  6  
ATOM   8371  H  HB3  . ALA A 1 81 ? 3.199   12.126  -13.346 1.00 0.00 ? 502 ALA A HB3  6  
ATOM   8372  N  N    . GLU A 1 82 ? 1.390   8.626   -12.661 1.00 0.00 ? 503 GLU A N    6  
ATOM   8373  C  CA   . GLU A 1 82 ? 0.880   7.330   -13.092 1.00 0.00 ? 503 GLU A CA   6  
ATOM   8374  C  C    . GLU A 1 82 ? -0.435  7.488   -13.851 1.00 0.00 ? 503 GLU A C    6  
ATOM   8375  O  O    . GLU A 1 82 ? -1.475  7.778   -13.260 1.00 0.00 ? 503 GLU A O    6  
ATOM   8376  C  CB   . GLU A 1 82 ? 0.678   6.410   -11.886 1.00 0.00 ? 503 GLU A CB   6  
ATOM   8377  C  CG   . GLU A 1 82 ? 0.808   4.933   -12.218 1.00 0.00 ? 503 GLU A CG   6  
ATOM   8378  C  CD   . GLU A 1 82 ? 0.067   4.552   -13.485 1.00 0.00 ? 503 GLU A CD   6  
ATOM   8379  O  OE1  . GLU A 1 82 ? 0.573   4.861   -14.584 1.00 0.00 ? 503 GLU A OE1  6  
ATOM   8380  O  OE2  . GLU A 1 82 ? -1.019  3.946   -13.377 1.00 0.00 ? 503 GLU A OE2  6  
ATOM   8381  H  H    . GLU A 1 82 ? 0.763   9.300   -12.326 1.00 0.00 ? 503 GLU A H    6  
ATOM   8382  H  HA   . GLU A 1 82 ? 1.611   6.888   -13.751 1.00 0.00 ? 503 GLU A HA   6  
ATOM   8383  H  HB2  . GLU A 1 82 ? 1.413   6.656   -11.134 1.00 0.00 ? 503 GLU A HB2  6  
ATOM   8384  H  HB3  . GLU A 1 82 ? -0.309  6.580   -11.481 1.00 0.00 ? 503 GLU A HB3  6  
ATOM   8385  H  HG2  . GLU A 1 82 ? 1.854   4.697   -12.347 1.00 0.00 ? 503 GLU A HG2  6  
ATOM   8386  H  HG3  . GLU A 1 82 ? 0.409   4.356   -11.398 1.00 0.00 ? 503 GLU A HG3  6  
ATOM   8387  N  N    . ASP A 1 83 ? -0.379  7.295   -15.164 1.00 0.00 ? 504 ASP A N    6  
ATOM   8388  C  CA   . ASP A 1 83 ? -1.564  7.415   -16.005 1.00 0.00 ? 504 ASP A CA   6  
ATOM   8389  C  C    . ASP A 1 83 ? -2.758  6.712   -15.366 1.00 0.00 ? 504 ASP A C    6  
ATOM   8390  O  O    . ASP A 1 83 ? -2.599  5.919   -14.439 1.00 0.00 ? 504 ASP A O    6  
ATOM   8391  C  CB   . ASP A 1 83 ? -1.294  6.829   -17.392 1.00 0.00 ? 504 ASP A CB   6  
ATOM   8392  C  CG   . ASP A 1 83 ? -1.585  5.342   -17.459 1.00 0.00 ? 504 ASP A CG   6  
ATOM   8393  O  OD1  . ASP A 1 83 ? -1.094  4.602   -16.581 1.00 0.00 ? 504 ASP A OD1  6  
ATOM   8394  O  OD2  . ASP A 1 83 ? -2.303  4.919   -18.389 1.00 0.00 ? 504 ASP A OD2  6  
ATOM   8395  H  H    . ASP A 1 83 ? 0.480   7.066   -15.578 1.00 0.00 ? 504 ASP A H    6  
ATOM   8396  H  HA   . ASP A 1 83 ? -1.794  8.465   -16.108 1.00 0.00 ? 504 ASP A HA   6  
ATOM   8397  H  HB2  . ASP A 1 83 ? -1.917  7.331   -18.117 1.00 0.00 ? 504 ASP A HB2  6  
ATOM   8398  H  HB3  . ASP A 1 83 ? -0.256  6.986   -17.646 1.00 0.00 ? 504 ASP A HB3  6  
ATOM   8399  N  N    . GLU A 1 84 ? -3.952  7.009   -15.869 1.00 0.00 ? 505 GLU A N    6  
ATOM   8400  C  CA   . GLU A 1 84 ? -5.172  6.406   -15.345 1.00 0.00 ? 505 GLU A CA   6  
ATOM   8401  C  C    . GLU A 1 84 ? -5.903  5.624   -16.432 1.00 0.00 ? 505 GLU A C    6  
ATOM   8402  O  O    . GLU A 1 84 ? -5.492  5.620   -17.593 1.00 0.00 ? 505 GLU A O    6  
ATOM   8403  C  CB   . GLU A 1 84 ? -6.094  7.484   -14.770 1.00 0.00 ? 505 GLU A CB   6  
ATOM   8404  C  CG   . GLU A 1 84 ? -5.483  8.252   -13.609 1.00 0.00 ? 505 GLU A CG   6  
ATOM   8405  C  CD   . GLU A 1 84 ? -6.526  8.766   -12.637 1.00 0.00 ? 505 GLU A CD   6  
ATOM   8406  O  OE1  . GLU A 1 84 ? -7.597  8.134   -12.525 1.00 0.00 ? 505 GLU A OE1  6  
ATOM   8407  O  OE2  . GLU A 1 84 ? -6.270  9.802   -11.987 1.00 0.00 ? 505 GLU A OE2  6  
ATOM   8408  H  H    . GLU A 1 84 ? -4.014  7.649   -16.608 1.00 0.00 ? 505 GLU A H    6  
ATOM   8409  H  HA   . GLU A 1 84 ? -4.893  5.726   -14.555 1.00 0.00 ? 505 GLU A HA   6  
ATOM   8410  H  HB2  . GLU A 1 84 ? -6.337  8.188   -15.552 1.00 0.00 ? 505 GLU A HB2  6  
ATOM   8411  H  HB3  . GLU A 1 84 ? -7.003  7.015   -14.424 1.00 0.00 ? 505 GLU A HB3  6  
ATOM   8412  H  HG2  . GLU A 1 84 ? -4.808  7.598   -13.077 1.00 0.00 ? 505 GLU A HG2  6  
ATOM   8413  H  HG3  . GLU A 1 84 ? -4.931  9.093   -14.002 1.00 0.00 ? 505 GLU A HG3  6  
ATOM   8414  N  N    . LYS A 1 85 ? -6.989  4.962   -16.048 1.00 0.00 ? 506 LYS A N    6  
ATOM   8415  C  CA   . LYS A 1 85 ? -7.779  4.176   -16.988 1.00 0.00 ? 506 LYS A CA   6  
ATOM   8416  C  C    . LYS A 1 85 ? -9.205  4.711   -17.081 1.00 0.00 ? 506 LYS A C    6  
ATOM   8417  O  O    . LYS A 1 85 ? -9.665  5.432   -16.196 1.00 0.00 ? 506 LYS A O    6  
ATOM   8418  C  CB   . LYS A 1 85 ? -7.802  2.706   -16.563 1.00 0.00 ? 506 LYS A CB   6  
ATOM   8419  C  CG   . LYS A 1 85 ? -8.476  1.792   -17.571 1.00 0.00 ? 506 LYS A CG   6  
ATOM   8420  C  CD   . LYS A 1 85 ? -8.103  0.337   -17.340 1.00 0.00 ? 506 LYS A CD   6  
ATOM   8421  C  CE   . LYS A 1 85 ? -8.985  -0.600  -18.153 1.00 0.00 ? 506 LYS A CE   6  
ATOM   8422  N  NZ   . LYS A 1 85 ? -8.269  -1.852  -18.524 1.00 0.00 ? 506 LYS A NZ   6  
ATOM   8423  H  H    . LYS A 1 85 ? -7.267  5.004   -15.108 1.00 0.00 ? 506 LYS A H    6  
ATOM   8424  H  HA   . LYS A 1 85 ? -7.314  4.254   -17.959 1.00 0.00 ? 506 LYS A HA   6  
ATOM   8425  H  HB2  . LYS A 1 85 ? -6.785  2.368   -16.424 1.00 0.00 ? 506 LYS A HB2  6  
ATOM   8426  H  HB3  . LYS A 1 85 ? -8.331  2.624   -15.624 1.00 0.00 ? 506 LYS A HB3  6  
ATOM   8427  H  HG2  . LYS A 1 85 ? -9.546  1.897   -17.480 1.00 0.00 ? 506 LYS A HG2  6  
ATOM   8428  H  HG3  . LYS A 1 85 ? -8.167  2.079   -18.566 1.00 0.00 ? 506 LYS A HG3  6  
ATOM   8429  H  HD2  . LYS A 1 85 ? -7.074  0.187   -17.631 1.00 0.00 ? 506 LYS A HD2  6  
ATOM   8430  H  HD3  . LYS A 1 85 ? -8.220  0.107   -16.291 1.00 0.00 ? 506 LYS A HD3  6  
ATOM   8431  H  HE2  . LYS A 1 85 ? -9.855  -0.853  -17.567 1.00 0.00 ? 506 LYS A HE2  6  
ATOM   8432  H  HE3  . LYS A 1 85 ? -9.293  -0.091  -19.054 1.00 0.00 ? 506 LYS A HE3  6  
ATOM   8433  H  HZ1  . LYS A 1 85 ? -7.920  -2.330  -17.669 1.00 0.00 ? 506 LYS A HZ1  6  
ATOM   8434  H  HZ2  . LYS A 1 85 ? -7.459  -1.632  -19.139 1.00 0.00 ? 506 LYS A HZ2  6  
ATOM   8435  H  HZ3  . LYS A 1 85 ? -8.911  -2.494  -19.031 1.00 0.00 ? 506 LYS A HZ3  6  
ATOM   8436  N  N    . GLU A 1 86 ? -9.898  4.352   -18.157 1.00 0.00 ? 507 GLU A N    6  
ATOM   8437  C  CA   . GLU A 1 86 ? -11.271 4.797   -18.364 1.00 0.00 ? 507 GLU A CA   6  
ATOM   8438  C  C    . GLU A 1 86 ? -12.191 3.611   -18.643 1.00 0.00 ? 507 GLU A C    6  
ATOM   8439  O  O    . GLU A 1 86 ? -11.766 2.599   -19.201 1.00 0.00 ? 507 GLU A O    6  
ATOM   8440  C  CB   . GLU A 1 86 ? -11.339 5.793   -19.523 1.00 0.00 ? 507 GLU A CB   6  
ATOM   8441  C  CG   . GLU A 1 86 ? -12.757 6.134   -19.951 1.00 0.00 ? 507 GLU A CG   6  
ATOM   8442  C  CD   . GLU A 1 86 ? -12.817 6.746   -21.336 1.00 0.00 ? 507 GLU A CD   6  
ATOM   8443  O  OE1  . GLU A 1 86 ? -12.114 6.245   -22.238 1.00 0.00 ? 507 GLU A OE1  6  
ATOM   8444  O  OE2  . GLU A 1 86 ? -13.569 7.727   -21.519 1.00 0.00 ? 507 GLU A OE2  6  
ATOM   8445  H  H    . GLU A 1 86 ? -9.476  3.776   -18.828 1.00 0.00 ? 507 GLU A H    6  
ATOM   8446  H  HA   . GLU A 1 86 ? -11.600 5.287   -17.460 1.00 0.00 ? 507 GLU A HA   6  
ATOM   8447  H  HB2  . GLU A 1 86 ? -10.845 6.707   -19.227 1.00 0.00 ? 507 GLU A HB2  6  
ATOM   8448  H  HB3  . GLU A 1 86 ? -10.821 5.374   -20.373 1.00 0.00 ? 507 GLU A HB3  6  
ATOM   8449  H  HG2  . GLU A 1 86 ? -13.347 5.230   -19.948 1.00 0.00 ? 507 GLU A HG2  6  
ATOM   8450  H  HG3  . GLU A 1 86 ? -13.173 6.837   -19.244 1.00 0.00 ? 507 GLU A HG3  6  
ATOM   8451  N  N    . VAL A 1 87 ? -13.454 3.744   -18.250 1.00 0.00 ? 508 VAL A N    6  
ATOM   8452  C  CA   . VAL A 1 87 ? -14.434 2.686   -18.458 1.00 0.00 ? 508 VAL A CA   6  
ATOM   8453  C  C    . VAL A 1 87 ? -15.179 2.877   -19.774 1.00 0.00 ? 508 VAL A C    6  
ATOM   8454  O  O    . VAL A 1 87 ? -15.815 3.907   -19.994 1.00 0.00 ? 508 VAL A O    6  
ATOM   8455  C  CB   . VAL A 1 87 ? -15.455 2.632   -17.306 1.00 0.00 ? 508 VAL A CB   6  
ATOM   8456  C  CG1  . VAL A 1 87 ? -16.026 4.016   -17.034 1.00 0.00 ? 508 VAL A CG1  6  
ATOM   8457  C  CG2  . VAL A 1 87 ? -16.565 1.641   -17.623 1.00 0.00 ? 508 VAL A CG2  6  
ATOM   8458  H  H    . VAL A 1 87 ? -13.733 4.575   -17.811 1.00 0.00 ? 508 VAL A H    6  
ATOM   8459  H  HA   . VAL A 1 87 ? -13.907 1.743   -18.487 1.00 0.00 ? 508 VAL A HA   6  
ATOM   8460  H  HB   . VAL A 1 87 ? -14.945 2.296   -16.415 1.00 0.00 ? 508 VAL A HB   6  
ATOM   8461  H  HG11 . VAL A 1 87 ? -17.105 3.973   -17.070 1.00 0.00 ? 508 VAL A HG11 6  
ATOM   8462  H  HG12 . VAL A 1 87 ? -15.710 4.350   -16.057 1.00 0.00 ? 508 VAL A HG12 6  
ATOM   8463  H  HG13 . VAL A 1 87 ? -15.670 4.706   -17.785 1.00 0.00 ? 508 VAL A HG13 6  
ATOM   8464  H  HG21 . VAL A 1 87 ? -17.416 2.171   -18.025 1.00 0.00 ? 508 VAL A HG21 6  
ATOM   8465  H  HG22 . VAL A 1 87 ? -16.211 0.925   -18.351 1.00 0.00 ? 508 VAL A HG22 6  
ATOM   8466  H  HG23 . VAL A 1 87 ? -16.855 1.124   -16.721 1.00 0.00 ? 508 VAL A HG23 6  
ATOM   8467  N  N    . GLU A 1 88 ? -15.096 1.876   -20.646 1.00 0.00 ? 509 GLU A N    6  
ATOM   8468  C  CA   . GLU A 1 88 ? -15.762 1.936   -21.942 1.00 0.00 ? 509 GLU A CA   6  
ATOM   8469  C  C    . GLU A 1 88 ? -17.151 1.307   -21.868 1.00 0.00 ? 509 GLU A C    6  
ATOM   8470  O  O    . GLU A 1 88 ? -17.347 0.288   -21.208 1.00 0.00 ? 509 GLU A O    6  
ATOM   8471  C  CB   . GLU A 1 88 ? -14.924 1.223   -23.005 1.00 0.00 ? 509 GLU A CB   6  
ATOM   8472  C  CG   . GLU A 1 88 ? -14.824 -0.279  -22.796 1.00 0.00 ? 509 GLU A CG   6  
ATOM   8473  C  CD   . GLU A 1 88 ? -15.946 -1.038  -23.477 1.00 0.00 ? 509 GLU A CD   6  
ATOM   8474  O  OE1  . GLU A 1 88 ? -16.360 -0.623  -24.580 1.00 0.00 ? 509 GLU A OE1  6  
ATOM   8475  O  OE2  . GLU A 1 88 ? -16.410 -2.048  -22.908 1.00 0.00 ? 509 GLU A OE2  6  
ATOM   8476  H  H    . GLU A 1 88 ? -14.573 1.081   -20.413 1.00 0.00 ? 509 GLU A H    6  
ATOM   8477  H  HA   . GLU A 1 88 ? -15.865 2.975   -22.215 1.00 0.00 ? 509 GLU A HA   6  
ATOM   8478  H  HB2  . GLU A 1 88 ? -15.364 1.403   -23.974 1.00 0.00 ? 509 GLU A HB2  6  
ATOM   8479  H  HB3  . GLU A 1 88 ? -13.925 1.633   -22.992 1.00 0.00 ? 509 GLU A HB3  6  
ATOM   8480  H  HG2  . GLU A 1 88 ? -13.883 -0.624  -23.195 1.00 0.00 ? 509 GLU A HG2  6  
ATOM   8481  H  HG3  . GLU A 1 88 ? -14.862 -0.485  -21.736 1.00 0.00 ? 509 GLU A HG3  6  
ATOM   8482  N  N    . GLU A 1 89 ? -18.110 1.924   -22.551 1.00 0.00 ? 510 GLU A N    6  
ATOM   8483  C  CA   . GLU A 1 89 ? -19.481 1.426   -22.562 1.00 0.00 ? 510 GLU A CA   6  
ATOM   8484  C  C    . GLU A 1 89 ? -19.510 -0.082  -22.795 1.00 0.00 ? 510 GLU A C    6  
ATOM   8485  O  O    . GLU A 1 89 ? -18.591 -0.647  -23.389 1.00 0.00 ? 510 GLU A O    6  
ATOM   8486  C  CB   . GLU A 1 89 ? -20.297 2.137   -23.643 1.00 0.00 ? 510 GLU A CB   6  
ATOM   8487  C  CG   . GLU A 1 89 ? -19.806 1.862   -25.055 1.00 0.00 ? 510 GLU A CG   6  
ATOM   8488  C  CD   . GLU A 1 89 ? -20.294 2.894   -26.053 1.00 0.00 ? 510 GLU A CD   6  
ATOM   8489  O  OE1  . GLU A 1 89 ? -21.469 2.808   -26.467 1.00 0.00 ? 510 GLU A OE1  6  
ATOM   8490  O  OE2  . GLU A 1 89 ? -19.501 3.786   -26.421 1.00 0.00 ? 510 GLU A OE2  6  
ATOM   8491  H  H    . GLU A 1 89 ? -17.891 2.733   -23.058 1.00 0.00 ? 510 GLU A H    6  
ATOM   8492  H  HA   . GLU A 1 89 ? -19.918 1.637   -21.597 1.00 0.00 ? 510 GLU A HA   6  
ATOM   8493  H  HB2  . GLU A 1 89 ? -21.325 1.814   -23.572 1.00 0.00 ? 510 GLU A HB2  6  
ATOM   8494  H  HB3  . GLU A 1 89 ? -20.251 3.202   -23.470 1.00 0.00 ? 510 GLU A HB3  6  
ATOM   8495  H  HG2  . GLU A 1 89 ? -18.726 1.867   -25.054 1.00 0.00 ? 510 GLU A HG2  6  
ATOM   8496  H  HG3  . GLU A 1 89 ? -20.160 0.889   -25.363 1.00 0.00 ? 510 GLU A HG3  6  
ATOM   8497  N  N    . LEU A 1 90 ? -20.570 -0.727  -22.323 1.00 0.00 ? 511 LEU A N    6  
ATOM   8498  C  CA   . LEU A 1 90 ? -20.720 -2.170  -22.479 1.00 0.00 ? 511 LEU A CA   6  
ATOM   8499  C  C    . LEU A 1 90 ? -21.462 -2.503  -23.770 1.00 0.00 ? 511 LEU A C    6  
ATOM   8500  O  O    . LEU A 1 90 ? -22.397 -3.304  -23.772 1.00 0.00 ? 511 LEU A O    6  
ATOM   8501  C  CB   . LEU A 1 90 ? -21.468 -2.757  -21.281 1.00 0.00 ? 511 LEU A CB   6  
ATOM   8502  C  CG   . LEU A 1 90 ? -20.670 -2.871  -19.982 1.00 0.00 ? 511 LEU A CG   6  
ATOM   8503  C  CD1  . LEU A 1 90 ? -21.599 -3.137  -18.807 1.00 0.00 ? 511 LEU A CD1  6  
ATOM   8504  C  CD2  . LEU A 1 90 ? -19.622 -3.969  -20.095 1.00 0.00 ? 511 LEU A CD2  6  
ATOM   8505  H  H    . LEU A 1 90 ? -21.270 -0.222  -21.858 1.00 0.00 ? 511 LEU A H    6  
ATOM   8506  H  HA   . LEU A 1 90 ? -19.732 -2.602  -22.524 1.00 0.00 ? 511 LEU A HA   6  
ATOM   8507  H  HB2  . LEU A 1 90 ? -22.326 -2.132  -21.088 1.00 0.00 ? 511 LEU A HB2  6  
ATOM   8508  H  HB3  . LEU A 1 90 ? -21.802 -3.748  -21.554 1.00 0.00 ? 511 LEU A HB3  6  
ATOM   8509  H  HG   . LEU A 1 90 ? -20.159 -1.937  -19.798 1.00 0.00 ? 511 LEU A HG   6  
ATOM   8510  H  HD11 . LEU A 1 90 ? -21.869 -2.201  -18.343 1.00 0.00 ? 511 LEU A HD11 6  
ATOM   8511  H  HD12 . LEU A 1 90 ? -21.096 -3.765  -18.086 1.00 0.00 ? 511 LEU A HD12 6  
ATOM   8512  H  HD13 . LEU A 1 90 ? -22.490 -3.636  -19.158 1.00 0.00 ? 511 LEU A HD13 6  
ATOM   8513  H  HD21 . LEU A 1 90 ? -18.979 -3.766  -20.938 1.00 0.00 ? 511 LEU A HD21 6  
ATOM   8514  H  HD22 . LEU A 1 90 ? -20.112 -4.921  -20.237 1.00 0.00 ? 511 LEU A HD22 6  
ATOM   8515  H  HD23 . LEU A 1 90 ? -19.033 -3.998  -19.190 1.00 0.00 ? 511 LEU A HD23 6  
ATOM   8516  N  N    . LYS A 1 91 ? -21.037 -1.886  -24.867 1.00 0.00 ? 512 LYS A N    6  
ATOM   8517  C  CA   . LYS A 1 91 ? -21.657 -2.119  -26.165 1.00 0.00 ? 512 LYS A CA   6  
ATOM   8518  C  C    . LYS A 1 91 ? -23.161 -2.331  -26.020 1.00 0.00 ? 512 LYS A C    6  
ATOM   8519  O  O    . LYS A 1 91 ? -23.747 -3.180  -26.693 1.00 0.00 ? 512 LYS A O    6  
ATOM   8520  C  CB   . LYS A 1 91 ? -21.023 -3.334  -26.846 1.00 0.00 ? 512 LYS A CB   6  
ATOM   8521  C  CG   . LYS A 1 91 ? -21.240 -4.635  -26.092 1.00 0.00 ? 512 LYS A CG   6  
ATOM   8522  C  CD   . LYS A 1 91 ? -20.127 -4.890  -25.089 1.00 0.00 ? 512 LYS A CD   6  
ATOM   8523  C  CE   . LYS A 1 91 ? -18.948 -5.603  -25.734 1.00 0.00 ? 512 LYS A CE   6  
ATOM   8524  N  NZ   . LYS A 1 91 ? -18.106 -4.671  -26.533 1.00 0.00 ? 512 LYS A NZ   6  
ATOM   8525  H  H    . LYS A 1 91 ? -20.287 -1.258  -24.801 1.00 0.00 ? 512 LYS A H    6  
ATOM   8526  H  HA   . LYS A 1 91 ? -21.487 -1.245  -26.776 1.00 0.00 ? 512 LYS A HA   6  
ATOM   8527  H  HB2  . LYS A 1 91 ? -21.447 -3.440  -27.834 1.00 0.00 ? 512 LYS A HB2  6  
ATOM   8528  H  HB3  . LYS A 1 91 ? -19.960 -3.167  -26.935 1.00 0.00 ? 512 LYS A HB3  6  
ATOM   8529  H  HG2  . LYS A 1 91 ? -22.180 -4.582  -25.564 1.00 0.00 ? 512 LYS A HG2  6  
ATOM   8530  H  HG3  . LYS A 1 91 ? -21.268 -5.451  -26.800 1.00 0.00 ? 512 LYS A HG3  6  
ATOM   8531  H  HD2  . LYS A 1 91 ? -19.788 -3.945  -24.692 1.00 0.00 ? 512 LYS A HD2  6  
ATOM   8532  H  HD3  . LYS A 1 91 ? -20.512 -5.502  -24.286 1.00 0.00 ? 512 LYS A HD3  6  
ATOM   8533  H  HE2  . LYS A 1 91 ? -18.343 -6.045  -24.957 1.00 0.00 ? 512 LYS A HE2  6  
ATOM   8534  H  HE3  . LYS A 1 91 ? -19.326 -6.380  -26.382 1.00 0.00 ? 512 LYS A HE3  6  
ATOM   8535  H  HZ1  . LYS A 1 91 ? -18.144 -3.715  -26.124 1.00 0.00 ? 512 LYS A HZ1  6  
ATOM   8536  H  HZ2  . LYS A 1 91 ? -18.450 -4.630  -27.513 1.00 0.00 ? 512 LYS A HZ2  6  
ATOM   8537  H  HZ3  . LYS A 1 91 ? -17.118 -4.996  -26.537 1.00 0.00 ? 512 LYS A HZ3  6  
ATOM   8538  N  N    . LYS A 1 92 ? -23.781 -1.554  -25.139 1.00 0.00 ? 513 LYS A N    6  
ATOM   8539  C  CA   . LYS A 1 92 ? -25.217 -1.655  -24.906 1.00 0.00 ? 513 LYS A CA   6  
ATOM   8540  C  C    . LYS A 1 92 ? -25.979 -1.718  -26.226 1.00 0.00 ? 513 LYS A C    6  
ATOM   8541  O  O    . LYS A 1 92 ? -25.860 -0.825  -27.066 1.00 0.00 ? 513 LYS A O    6  
ATOM   8542  C  CB   . LYS A 1 92 ? -25.705 -0.463  -24.080 1.00 0.00 ? 513 LYS A CB   6  
ATOM   8543  C  CG   . LYS A 1 92 ? -27.153 -0.583  -23.635 1.00 0.00 ? 513 LYS A CG   6  
ATOM   8544  C  CD   . LYS A 1 92 ? -27.276 -1.387  -22.351 1.00 0.00 ? 513 LYS A CD   6  
ATOM   8545  C  CE   . LYS A 1 92 ? -27.551 -2.855  -22.638 1.00 0.00 ? 513 LYS A CE   6  
ATOM   8546  N  NZ   . LYS A 1 92 ? -29.010 -3.155  -22.650 1.00 0.00 ? 513 LYS A NZ   6  
ATOM   8547  H  H    . LYS A 1 92 ? -23.260 -0.896  -24.632 1.00 0.00 ? 513 LYS A H    6  
ATOM   8548  H  HA   . LYS A 1 92 ? -25.401 -2.564  -24.354 1.00 0.00 ? 513 LYS A HA   6  
ATOM   8549  H  HB2  . LYS A 1 92 ? -25.086 -0.372  -23.200 1.00 0.00 ? 513 LYS A HB2  6  
ATOM   8550  H  HB3  . LYS A 1 92 ? -25.607 0.436   -24.673 1.00 0.00 ? 513 LYS A HB3  6  
ATOM   8551  H  HG2  . LYS A 1 92 ? -27.552 0.406   -23.467 1.00 0.00 ? 513 LYS A HG2  6  
ATOM   8552  H  HG3  . LYS A 1 92 ? -27.719 -1.075  -24.413 1.00 0.00 ? 513 LYS A HG3  6  
ATOM   8553  H  HD2  . LYS A 1 92 ? -26.353 -1.307  -21.796 1.00 0.00 ? 513 LYS A HD2  6  
ATOM   8554  H  HD3  . LYS A 1 92 ? -28.088 -0.986  -21.762 1.00 0.00 ? 513 LYS A HD3  6  
ATOM   8555  H  HE2  . LYS A 1 92 ? -27.133 -3.105  -23.601 1.00 0.00 ? 513 LYS A HE2  6  
ATOM   8556  H  HE3  . LYS A 1 92 ? -27.076 -3.453  -21.874 1.00 0.00 ? 513 LYS A HE3  6  
ATOM   8557  H  HZ1  . LYS A 1 92 ? -29.554 -2.284  -22.480 1.00 0.00 ? 513 LYS A HZ1  6  
ATOM   8558  H  HZ2  . LYS A 1 92 ? -29.239 -3.844  -21.906 1.00 0.00 ? 513 LYS A HZ2  6  
ATOM   8559  H  HZ3  . LYS A 1 92 ? -29.286 -3.550  -23.571 1.00 0.00 ? 513 LYS A HZ3  6  
ATOM   8560  N  N    . SER A 1 93 ? -26.761 -2.777  -26.403 1.00 0.00 ? 514 SER A N    6  
ATOM   8561  C  CA   . SER A 1 93 ? -27.541 -2.958  -27.622 1.00 0.00 ? 514 SER A CA   6  
ATOM   8562  C  C    . SER A 1 93 ? -28.604 -4.035  -27.432 1.00 0.00 ? 514 SER A C    6  
ATOM   8563  O  O    . SER A 1 93 ? -28.623 -4.734  -26.420 1.00 0.00 ? 514 SER A O    6  
ATOM   8564  C  CB   . SER A 1 93 ? -26.623 -3.330  -28.788 1.00 0.00 ? 514 SER A CB   6  
ATOM   8565  O  OG   . SER A 1 93 ? -25.963 -4.560  -28.545 1.00 0.00 ? 514 SER A OG   6  
ATOM   8566  H  H    . SER A 1 93 ? -26.814 -3.455  -25.697 1.00 0.00 ? 514 SER A H    6  
ATOM   8567  H  HA   . SER A 1 93 ? -28.030 -2.021  -27.844 1.00 0.00 ? 514 SER A HA   6  
ATOM   8568  H  HB2  . SER A 1 93 ? -27.211 -3.423  -29.689 1.00 0.00 ? 514 SER A HB2  6  
ATOM   8569  H  HB3  . SER A 1 93 ? -25.881 -2.556  -28.920 1.00 0.00 ? 514 SER A HB3  6  
ATOM   8570  H  HG   . SER A 1 93 ? -25.089 -4.538  -28.942 1.00 0.00 ? 514 SER A HG   6  
ATOM   8571  N  N    . GLY A 1 94 ? -29.490 -4.163  -28.416 1.00 0.00 ? 515 GLY A N    6  
ATOM   8572  C  CA   . GLY A 1 94 ? -30.546 -5.156  -28.339 1.00 0.00 ? 515 GLY A CA   6  
ATOM   8573  C  C    . GLY A 1 94 ? -31.836 -4.682  -28.978 1.00 0.00 ? 515 GLY A C    6  
ATOM   8574  O  O    . GLY A 1 94 ? -32.693 -4.084  -28.327 1.00 0.00 ? 515 GLY A O    6  
ATOM   8575  H  H    . GLY A 1 94 ? -29.427 -3.577  -29.199 1.00 0.00 ? 515 GLY A H    6  
ATOM   8576  H  HA2  . GLY A 1 94 ? -30.217 -6.054  -28.840 1.00 0.00 ? 515 GLY A HA2  6  
ATOM   8577  H  HA3  . GLY A 1 94 ? -30.735 -5.384  -27.300 1.00 0.00 ? 515 GLY A HA3  6  
ATOM   8578  N  N    . PRO A 1 95 ? -31.986 -4.948  -30.284 1.00 0.00 ? 516 PRO A N    6  
ATOM   8579  C  CA   . PRO A 1 95 ? -33.178 -4.552  -31.040 1.00 0.00 ? 516 PRO A CA   6  
ATOM   8580  C  C    . PRO A 1 95 ? -34.413 -5.349  -30.635 1.00 0.00 ? 516 PRO A C    6  
ATOM   8581  O  O    . PRO A 1 95 ? -34.361 -6.170  -29.719 1.00 0.00 ? 516 PRO A O    6  
ATOM   8582  C  CB   . PRO A 1 95 ? -32.796 -4.859  -32.490 1.00 0.00 ? 516 PRO A CB   6  
ATOM   8583  C  CG   . PRO A 1 95 ? -31.764 -5.929  -32.392 1.00 0.00 ? 516 PRO A CG   6  
ATOM   8584  C  CD   . PRO A 1 95 ? -31.005 -5.657  -31.123 1.00 0.00 ? 516 PRO A CD   6  
ATOM   8585  H  HA   . PRO A 1 95 ? -33.382 -3.497  -30.935 1.00 0.00 ? 516 PRO A HA   6  
ATOM   8586  H  HB2  . PRO A 1 95 ? -33.669 -5.198  -33.031 1.00 0.00 ? 516 PRO A HB2  6  
ATOM   8587  H  HB3  . PRO A 1 95 ? -32.400 -3.970  -32.958 1.00 0.00 ? 516 PRO A HB3  6  
ATOM   8588  H  HG2  . PRO A 1 95 ? -32.241 -6.896  -32.344 1.00 0.00 ? 516 PRO A HG2  6  
ATOM   8589  H  HG3  . PRO A 1 95 ? -31.101 -5.878  -33.243 1.00 0.00 ? 516 PRO A HG3  6  
ATOM   8590  H  HD2  . PRO A 1 95 ? -30.700 -6.584  -30.660 1.00 0.00 ? 516 PRO A HD2  6  
ATOM   8591  H  HD3  . PRO A 1 95 ? -30.147 -5.032  -31.323 1.00 0.00 ? 516 PRO A HD3  6  
ATOM   8592  N  N    . SER A 1 96 ? -35.524 -5.102  -31.323 1.00 0.00 ? 517 SER A N    6  
ATOM   8593  C  CA   . SER A 1 96 ? -36.773 -5.795  -31.032 1.00 0.00 ? 517 SER A CA   6  
ATOM   8594  C  C    . SER A 1 96 ? -37.096 -6.813  -32.121 1.00 0.00 ? 517 SER A C    6  
ATOM   8595  O  O    . SER A 1 96 ? -36.473 -6.823  -33.182 1.00 0.00 ? 517 SER A O    6  
ATOM   8596  C  CB   . SER A 1 96 ? -37.920 -4.790  -30.901 1.00 0.00 ? 517 SER A CB   6  
ATOM   8597  O  OG   . SER A 1 96 ? -37.653 -3.841  -29.883 1.00 0.00 ? 517 SER A OG   6  
ATOM   8598  H  H    . SER A 1 96 ? -35.502 -4.436  -32.042 1.00 0.00 ? 517 SER A H    6  
ATOM   8599  H  HA   . SER A 1 96 ? -36.653 -6.315  -30.093 1.00 0.00 ? 517 SER A HA   6  
ATOM   8600  H  HB2  . SER A 1 96 ? -38.046 -4.269  -31.838 1.00 0.00 ? 517 SER A HB2  6  
ATOM   8601  H  HB3  . SER A 1 96 ? -38.830 -5.317  -30.656 1.00 0.00 ? 517 SER A HB3  6  
ATOM   8602  H  HG   . SER A 1 96 ? -38.194 -3.061  -30.022 1.00 0.00 ? 517 SER A HG   6  
ATOM   8603  N  N    . SER A 1 97 ? -38.076 -7.670  -31.849 1.00 0.00 ? 518 SER A N    6  
ATOM   8604  C  CA   . SER A 1 97 ? -38.480 -8.696  -32.803 1.00 0.00 ? 518 SER A CA   6  
ATOM   8605  C  C    . SER A 1 97 ? -40.000 -8.768  -32.912 1.00 0.00 ? 518 SER A C    6  
ATOM   8606  O  O    . SER A 1 97 ? -40.720 -8.275  -32.044 1.00 0.00 ? 518 SER A O    6  
ATOM   8607  C  CB   . SER A 1 97 ? -37.923 -10.058 -32.387 1.00 0.00 ? 518 SER A CB   6  
ATOM   8608  O  OG   . SER A 1 97 ? -38.386 -11.084 -33.248 1.00 0.00 ? 518 SER A OG   6  
ATOM   8609  H  H    . SER A 1 97 ? -38.535 -7.612  -30.985 1.00 0.00 ? 518 SER A H    6  
ATOM   8610  H  HA   . SER A 1 97 ? -38.074 -8.430  -33.768 1.00 0.00 ? 518 SER A HA   6  
ATOM   8611  H  HB2  . SER A 1 97 ? -36.844 -10.031 -32.427 1.00 0.00 ? 518 SER A HB2  6  
ATOM   8612  H  HB3  . SER A 1 97 ? -38.240 -10.281 -31.378 1.00 0.00 ? 518 SER A HB3  6  
ATOM   8613  H  HG   . SER A 1 97 ? -39.080 -11.581 -32.809 1.00 0.00 ? 518 SER A HG   6  
ATOM   8614  N  N    . GLY A 1 98 ? -40.482 -9.385  -33.986 1.00 0.00 ? 519 GLY A N    6  
ATOM   8615  C  CA   . GLY A 1 98 ? -41.914 -9.511  -34.190 1.00 0.00 ? 519 GLY A CA   6  
ATOM   8616  C  C    . GLY A 1 98 ? -42.280 -10.751 -34.980 1.00 0.00 ? 519 GLY A C    6  
ATOM   8617  O  O    . GLY A 1 98 ? -41.470 -11.674 -35.056 1.00 0.00 ? 519 GLY A O    6  
ATOM   8618  H  H    . GLY A 1 98 ? -39.861 -9.759  -34.646 1.00 0.00 ? 519 GLY A H    6  
ATOM   8619  H  HA2  . GLY A 1 98 ? -42.401 -9.552  -33.228 1.00 0.00 ? 519 GLY A HA2  6  
ATOM   8620  H  HA3  . GLY A 1 98 ? -42.267 -8.641  -34.724 1.00 0.00 ? 519 GLY A HA3  6  
HETATM 8621  ZN ZN   . ZN  B 2 .  ? -0.355  -7.958  -10.768 1.00 0.00 ? 622 ZN  A ZN   6  
HETATM 8622  ZN ZN   . ZN  C 2 .  ? -0.702  -3.606  5.702   1.00 0.00 ? 822 ZN  A ZN   6  
ATOM   8623  N  N    . GLY A 1 1  ? 32.318  -17.127 -3.385  1.00 0.00 ? 422 GLY A N    7  
ATOM   8624  C  CA   . GLY A 1 1  ? 32.647  -18.540 -3.348  1.00 0.00 ? 422 GLY A CA   7  
ATOM   8625  C  C    . GLY A 1 1  ? 31.423  -19.424 -3.483  1.00 0.00 ? 422 GLY A C    7  
ATOM   8626  O  O    . GLY A 1 1  ? 30.904  -19.614 -4.583  1.00 0.00 ? 422 GLY A O    7  
ATOM   8627  H  H1   . GLY A 1 1  ? 31.574  -16.814 -3.942  1.00 0.00 ? 422 GLY A H1   7  
ATOM   8628  H  HA2  . GLY A 1 1  ? 33.329  -18.761 -4.156  1.00 0.00 ? 422 GLY A HA2  7  
ATOM   8629  H  HA3  . GLY A 1 1  ? 33.134  -18.760 -2.409  1.00 0.00 ? 422 GLY A HA3  7  
ATOM   8630  N  N    . SER A 1 2  ? 30.962  -19.969 -2.361  1.00 0.00 ? 423 SER A N    7  
ATOM   8631  C  CA   . SER A 1 2  ? 29.795  -20.843 -2.359  1.00 0.00 ? 423 SER A CA   7  
ATOM   8632  C  C    . SER A 1 2  ? 28.638  -20.206 -3.124  1.00 0.00 ? 423 SER A C    7  
ATOM   8633  O  O    . SER A 1 2  ? 27.954  -20.870 -3.902  1.00 0.00 ? 423 SER A O    7  
ATOM   8634  C  CB   . SER A 1 2  ? 29.364  -21.151 -0.924  1.00 0.00 ? 423 SER A CB   7  
ATOM   8635  O  OG   . SER A 1 2  ? 28.204  -21.965 -0.903  1.00 0.00 ? 423 SER A OG   7  
ATOM   8636  H  H    . SER A 1 2  ? 31.420  -19.780 -1.515  1.00 0.00 ? 423 SER A H    7  
ATOM   8637  H  HA   . SER A 1 2  ? 30.070  -21.765 -2.850  1.00 0.00 ? 423 SER A HA   7  
ATOM   8638  H  HB2  . SER A 1 2  ? 30.162  -21.670 -0.415  1.00 0.00 ? 423 SER A HB2  7  
ATOM   8639  H  HB3  . SER A 1 2  ? 29.150  -20.226 -0.409  1.00 0.00 ? 423 SER A HB3  7  
ATOM   8640  H  HG   . SER A 1 2  ? 28.028  -22.294 -1.787  1.00 0.00 ? 423 SER A HG   7  
ATOM   8641  N  N    . SER A 1 3  ? 28.426  -18.914 -2.895  1.00 0.00 ? 424 SER A N    7  
ATOM   8642  C  CA   . SER A 1 3  ? 27.350  -18.187 -3.558  1.00 0.00 ? 424 SER A CA   7  
ATOM   8643  C  C    . SER A 1 3  ? 27.727  -17.852 -4.998  1.00 0.00 ? 424 SER A C    7  
ATOM   8644  O  O    . SER A 1 3  ? 28.906  -17.753 -5.335  1.00 0.00 ? 424 SER A O    7  
ATOM   8645  C  CB   . SER A 1 3  ? 27.027  -16.902 -2.792  1.00 0.00 ? 424 SER A CB   7  
ATOM   8646  O  OG   . SER A 1 3  ? 26.545  -17.192 -1.491  1.00 0.00 ? 424 SER A OG   7  
ATOM   8647  H  H    . SER A 1 3  ? 29.006  -18.439 -2.263  1.00 0.00 ? 424 SER A H    7  
ATOM   8648  H  HA   . SER A 1 3  ? 26.477  -18.821 -3.565  1.00 0.00 ? 424 SER A HA   7  
ATOM   8649  H  HB2  . SER A 1 3  ? 27.920  -16.303 -2.706  1.00 0.00 ? 424 SER A HB2  7  
ATOM   8650  H  HB3  . SER A 1 3  ? 26.271  -16.347 -3.329  1.00 0.00 ? 424 SER A HB3  7  
ATOM   8651  H  HG   . SER A 1 3  ? 26.093  -16.421 -1.138  1.00 0.00 ? 424 SER A HG   7  
ATOM   8652  N  N    . GLY A 1 4  ? 26.716  -17.680 -5.843  1.00 0.00 ? 425 GLY A N    7  
ATOM   8653  C  CA   . GLY A 1 4  ? 26.961  -17.359 -7.237  1.00 0.00 ? 425 GLY A CA   7  
ATOM   8654  C  C    . GLY A 1 4  ? 26.361  -18.382 -8.182  1.00 0.00 ? 425 GLY A C    7  
ATOM   8655  O  O    . GLY A 1 4  ? 27.052  -19.291 -8.643  1.00 0.00 ? 425 GLY A O    7  
ATOM   8656  H  H    . GLY A 1 4  ? 25.796  -17.772 -5.518  1.00 0.00 ? 425 GLY A H    7  
ATOM   8657  H  HA2  . GLY A 1 4  ? 26.533  -16.392 -7.453  1.00 0.00 ? 425 GLY A HA2  7  
ATOM   8658  H  HA3  . GLY A 1 4  ? 28.027  -17.316 -7.403  1.00 0.00 ? 425 GLY A HA3  7  
ATOM   8659  N  N    . SER A 1 5  ? 25.072  -18.236 -8.470  1.00 0.00 ? 426 SER A N    7  
ATOM   8660  C  CA   . SER A 1 5  ? 24.378  -19.158 -9.361  1.00 0.00 ? 426 SER A CA   7  
ATOM   8661  C  C    . SER A 1 5  ? 23.538  -18.398 -10.382 1.00 0.00 ? 426 SER A C    7  
ATOM   8662  O  O    . SER A 1 5  ? 22.930  -17.375 -10.065 1.00 0.00 ? 426 SER A O    7  
ATOM   8663  C  CB   . SER A 1 5  ? 23.488  -20.106 -8.556  1.00 0.00 ? 426 SER A CB   7  
ATOM   8664  O  OG   . SER A 1 5  ? 24.249  -21.149 -7.972  1.00 0.00 ? 426 SER A OG   7  
ATOM   8665  H  H    . SER A 1 5  ? 24.575  -17.491 -8.071  1.00 0.00 ? 426 SER A H    7  
ATOM   8666  H  HA   . SER A 1 5  ? 25.124  -19.737 -9.885  1.00 0.00 ? 426 SER A HA   7  
ATOM   8667  H  HB2  . SER A 1 5  ? 22.995  -19.553 -7.770  1.00 0.00 ? 426 SER A HB2  7  
ATOM   8668  H  HB3  . SER A 1 5  ? 22.746  -20.541 -9.210  1.00 0.00 ? 426 SER A HB3  7  
ATOM   8669  H  HG   . SER A 1 5  ? 24.059  -21.197 -7.032  1.00 0.00 ? 426 SER A HG   7  
ATOM   8670  N  N    . SER A 1 6  ? 23.509  -18.905 -11.611 1.00 0.00 ? 427 SER A N    7  
ATOM   8671  C  CA   . SER A 1 6  ? 22.746  -18.272 -12.681 1.00 0.00 ? 427 SER A CA   7  
ATOM   8672  C  C    . SER A 1 6  ? 21.365  -18.906 -12.812 1.00 0.00 ? 427 SER A C    7  
ATOM   8673  O  O    . SER A 1 6  ? 21.224  -20.128 -12.774 1.00 0.00 ? 427 SER A O    7  
ATOM   8674  C  CB   . SER A 1 6  ? 23.500  -18.385 -14.008 1.00 0.00 ? 427 SER A CB   7  
ATOM   8675  O  OG   . SER A 1 6  ? 23.887  -19.724 -14.262 1.00 0.00 ? 427 SER A OG   7  
ATOM   8676  H  H    . SER A 1 6  ? 24.014  -19.723 -11.802 1.00 0.00 ? 427 SER A H    7  
ATOM   8677  H  HA   . SER A 1 6  ? 22.628  -17.228 -12.431 1.00 0.00 ? 427 SER A HA   7  
ATOM   8678  H  HB2  . SER A 1 6  ? 22.862  -18.049 -14.811 1.00 0.00 ? 427 SER A HB2  7  
ATOM   8679  H  HB3  . SER A 1 6  ? 24.385  -17.767 -13.969 1.00 0.00 ? 427 SER A HB3  7  
ATOM   8680  H  HG   . SER A 1 6  ? 23.228  -20.149 -14.815 1.00 0.00 ? 427 SER A HG   7  
ATOM   8681  N  N    . GLY A 1 7  ? 20.347  -18.065 -12.966 1.00 0.00 ? 428 GLY A N    7  
ATOM   8682  C  CA   . GLY A 1 7  ? 18.989  -18.561 -13.100 1.00 0.00 ? 428 GLY A CA   7  
ATOM   8683  C  C    . GLY A 1 7  ? 17.955  -17.459 -12.979 1.00 0.00 ? 428 GLY A C    7  
ATOM   8684  O  O    . GLY A 1 7  ? 17.228  -17.388 -11.990 1.00 0.00 ? 428 GLY A O    7  
ATOM   8685  H  H    . GLY A 1 7  ? 20.519  -17.101 -12.989 1.00 0.00 ? 428 GLY A H    7  
ATOM   8686  H  HA2  . GLY A 1 7  ? 18.884  -19.034 -14.065 1.00 0.00 ? 428 GLY A HA2  7  
ATOM   8687  H  HA3  . GLY A 1 7  ? 18.808  -19.294 -12.329 1.00 0.00 ? 428 GLY A HA3  7  
ATOM   8688  N  N    . GLU A 1 8  ? 17.892  -16.596 -13.989 1.00 0.00 ? 429 GLU A N    7  
ATOM   8689  C  CA   . GLU A 1 8  ? 16.940  -15.491 -13.989 1.00 0.00 ? 429 GLU A CA   7  
ATOM   8690  C  C    . GLU A 1 8  ? 15.588  -15.936 -14.539 1.00 0.00 ? 429 GLU A C    7  
ATOM   8691  O  O    . GLU A 1 8  ? 15.473  -16.311 -15.706 1.00 0.00 ? 429 GLU A O    7  
ATOM   8692  C  CB   . GLU A 1 8  ? 17.481  -14.323 -14.818 1.00 0.00 ? 429 GLU A CB   7  
ATOM   8693  C  CG   . GLU A 1 8  ? 18.605  -13.562 -14.136 1.00 0.00 ? 429 GLU A CG   7  
ATOM   8694  C  CD   . GLU A 1 8  ? 19.831  -14.422 -13.896 1.00 0.00 ? 429 GLU A CD   7  
ATOM   8695  O  OE1  . GLU A 1 8  ? 20.161  -15.242 -14.778 1.00 0.00 ? 429 GLU A OE1  7  
ATOM   8696  O  OE2  . GLU A 1 8  ? 20.459  -14.276 -12.827 1.00 0.00 ? 429 GLU A OE2  7  
ATOM   8697  H  H    . GLU A 1 8  ? 18.498  -16.705 -14.750 1.00 0.00 ? 429 GLU A H    7  
ATOM   8698  H  HA   . GLU A 1 8  ? 16.810  -15.165 -12.968 1.00 0.00 ? 429 GLU A HA   7  
ATOM   8699  H  HB2  . GLU A 1 8  ? 17.851  -14.706 -15.758 1.00 0.00 ? 429 GLU A HB2  7  
ATOM   8700  H  HB3  . GLU A 1 8  ? 16.674  -13.633 -15.013 1.00 0.00 ? 429 GLU A HB3  7  
ATOM   8701  H  HG2  . GLU A 1 8  ? 18.887  -12.727 -14.759 1.00 0.00 ? 429 GLU A HG2  7  
ATOM   8702  H  HG3  . GLU A 1 8  ? 18.249  -13.195 -13.184 1.00 0.00 ? 429 GLU A HG3  7  
ATOM   8703  N  N    . LEU A 1 9  ? 14.568  -15.893 -13.690 1.00 0.00 ? 430 LEU A N    7  
ATOM   8704  C  CA   . LEU A 1 9  ? 13.223  -16.292 -14.089 1.00 0.00 ? 430 LEU A CA   7  
ATOM   8705  C  C    . LEU A 1 9  ? 12.523  -15.168 -14.846 1.00 0.00 ? 430 LEU A C    7  
ATOM   8706  O  O    . LEU A 1 9  ? 12.846  -13.989 -14.694 1.00 0.00 ? 430 LEU A O    7  
ATOM   8707  C  CB   . LEU A 1 9  ? 12.400  -16.685 -12.861 1.00 0.00 ? 430 LEU A CB   7  
ATOM   8708  C  CG   . LEU A 1 9  ? 12.678  -18.073 -12.283 1.00 0.00 ? 430 LEU A CG   7  
ATOM   8709  C  CD1  . LEU A 1 9  ? 12.207  -19.155 -13.243 1.00 0.00 ? 430 LEU A CD1  7  
ATOM   8710  C  CD2  . LEU A 1 9  ? 14.159  -18.237 -11.977 1.00 0.00 ? 430 LEU A CD2  7  
ATOM   8711  H  H    . LEU A 1 9  ? 14.721  -15.585 -12.772 1.00 0.00 ? 430 LEU A H    7  
ATOM   8712  H  HA   . LEU A 1 9  ? 13.311  -17.148 -14.742 1.00 0.00 ? 430 LEU A HA   7  
ATOM   8713  H  HB2  . LEU A 1 9  ? 12.596  -15.960 -12.086 1.00 0.00 ? 430 LEU A HB2  7  
ATOM   8714  H  HB3  . LEU A 1 9  ? 11.356  -16.643 -13.136 1.00 0.00 ? 430 LEU A HB3  7  
ATOM   8715  H  HG   . LEU A 1 9  ? 12.129  -18.188 -11.358 1.00 0.00 ? 430 LEU A HG   7  
ATOM   8716  H  HD11 . LEU A 1 9  ? 11.187  -19.421 -13.014 1.00 0.00 ? 430 LEU A HD11 7  
ATOM   8717  H  HD12 . LEU A 1 9  ? 12.838  -20.026 -13.141 1.00 0.00 ? 430 LEU A HD12 7  
ATOM   8718  H  HD13 . LEU A 1 9  ? 12.265  -18.786 -14.257 1.00 0.00 ? 430 LEU A HD13 7  
ATOM   8719  H  HD21 . LEU A 1 9  ? 14.737  -17.991 -12.855 1.00 0.00 ? 430 LEU A HD21 7  
ATOM   8720  H  HD22 . LEU A 1 9  ? 14.357  -19.260 -11.692 1.00 0.00 ? 430 LEU A HD22 7  
ATOM   8721  H  HD23 . LEU A 1 9  ? 14.435  -17.578 -11.167 1.00 0.00 ? 430 LEU A HD23 7  
ATOM   8722  N  N    . PRO A 1 10 ? 11.538  -15.538 -15.678 1.00 0.00 ? 431 PRO A N    7  
ATOM   8723  C  CA   . PRO A 1 10 ? 10.770  -14.575 -16.473 1.00 0.00 ? 431 PRO A CA   7  
ATOM   8724  C  C    . PRO A 1 10 ? 9.851   -13.714 -15.611 1.00 0.00 ? 431 PRO A C    7  
ATOM   8725  O  O    . PRO A 1 10 ? 9.085   -12.899 -16.125 1.00 0.00 ? 431 PRO A O    7  
ATOM   8726  C  CB   . PRO A 1 10 ? 9.947   -15.463 -17.409 1.00 0.00 ? 431 PRO A CB   7  
ATOM   8727  C  CG   . PRO A 1 10 ? 9.824   -16.761 -16.688 1.00 0.00 ? 431 PRO A CG   7  
ATOM   8728  C  CD   . PRO A 1 10 ? 11.099  -16.924 -15.907 1.00 0.00 ? 431 PRO A CD   7  
ATOM   8729  H  HA   . PRO A 1 10 ? 11.417  -13.936 -17.056 1.00 0.00 ? 431 PRO A HA   7  
ATOM   8730  H  HB2  . PRO A 1 10 ? 8.980   -15.012 -17.580 1.00 0.00 ? 431 PRO A HB2  7  
ATOM   8731  H  HB3  . PRO A 1 10 ? 10.467  -15.581 -18.348 1.00 0.00 ? 431 PRO A HB3  7  
ATOM   8732  H  HG2  . PRO A 1 10 ? 8.977   -16.731 -16.020 1.00 0.00 ? 431 PRO A HG2  7  
ATOM   8733  H  HG3  . PRO A 1 10 ? 9.715   -17.567 -17.399 1.00 0.00 ? 431 PRO A HG3  7  
ATOM   8734  H  HD2  . PRO A 1 10 ? 10.907  -17.428 -14.972 1.00 0.00 ? 431 PRO A HD2  7  
ATOM   8735  H  HD3  . PRO A 1 10 ? 11.830  -17.468 -16.488 1.00 0.00 ? 431 PRO A HD3  7  
ATOM   8736  N  N    . LYS A 1 11 ? 9.934   -13.901 -14.298 1.00 0.00 ? 432 LYS A N    7  
ATOM   8737  C  CA   . LYS A 1 11 ? 9.112   -13.141 -13.364 1.00 0.00 ? 432 LYS A CA   7  
ATOM   8738  C  C    . LYS A 1 11 ? 9.773   -11.812 -13.013 1.00 0.00 ? 432 LYS A C    7  
ATOM   8739  O  O    . LYS A 1 11 ? 10.831  -11.473 -13.545 1.00 0.00 ? 432 LYS A O    7  
ATOM   8740  C  CB   . LYS A 1 11 ? 8.867   -13.953 -12.090 1.00 0.00 ? 432 LYS A CB   7  
ATOM   8741  C  CG   . LYS A 1 11 ? 7.848   -15.066 -12.264 1.00 0.00 ? 432 LYS A CG   7  
ATOM   8742  C  CD   . LYS A 1 11 ? 7.149   -15.392 -10.955 1.00 0.00 ? 432 LYS A CD   7  
ATOM   8743  C  CE   . LYS A 1 11 ? 6.105   -16.482 -11.138 1.00 0.00 ? 432 LYS A CE   7  
ATOM   8744  N  NZ   . LYS A 1 11 ? 4.859   -15.958 -11.762 1.00 0.00 ? 432 LYS A NZ   7  
ATOM   8745  H  H    . LYS A 1 11 ? 10.564  -14.565 -13.948 1.00 0.00 ? 432 LYS A H    7  
ATOM   8746  H  HA   . LYS A 1 11 ? 8.164   -12.942 -13.842 1.00 0.00 ? 432 LYS A HA   7  
ATOM   8747  H  HB2  . LYS A 1 11 ? 9.801   -14.394 -11.775 1.00 0.00 ? 432 LYS A HB2  7  
ATOM   8748  H  HB3  . LYS A 1 11 ? 8.514   -13.288 -11.316 1.00 0.00 ? 432 LYS A HB3  7  
ATOM   8749  H  HG2  . LYS A 1 11 ? 7.109   -14.755 -12.987 1.00 0.00 ? 432 LYS A HG2  7  
ATOM   8750  H  HG3  . LYS A 1 11 ? 8.354   -15.951 -12.623 1.00 0.00 ? 432 LYS A HG3  7  
ATOM   8751  H  HD2  . LYS A 1 11 ? 7.884   -15.729 -10.239 1.00 0.00 ? 432 LYS A HD2  7  
ATOM   8752  H  HD3  . LYS A 1 11 ? 6.665   -14.500 -10.584 1.00 0.00 ? 432 LYS A HD3  7  
ATOM   8753  H  HE2  . LYS A 1 11 ? 6.516   -17.254 -11.769 1.00 0.00 ? 432 LYS A HE2  7  
ATOM   8754  H  HE3  . LYS A 1 11 ? 5.865   -16.898 -10.170 1.00 0.00 ? 432 LYS A HE3  7  
ATOM   8755  H  HZ1  . LYS A 1 11 ? 4.541   -15.103 -11.261 1.00 0.00 ? 432 LYS A HZ1  7  
ATOM   8756  H  HZ2  . LYS A 1 11 ? 4.106   -16.673 -11.713 1.00 0.00 ? 432 LYS A HZ2  7  
ATOM   8757  H  HZ3  . LYS A 1 11 ? 5.031   -15.719 -12.759 1.00 0.00 ? 432 LYS A HZ3  7  
ATOM   8758  N  N    . LYS A 1 12 ? 9.145   -11.063 -12.114 1.00 0.00 ? 433 LYS A N    7  
ATOM   8759  C  CA   . LYS A 1 12 ? 9.673   -9.772  -11.689 1.00 0.00 ? 433 LYS A CA   7  
ATOM   8760  C  C    . LYS A 1 12 ? 9.398   -9.532  -10.208 1.00 0.00 ? 433 LYS A C    7  
ATOM   8761  O  O    . LYS A 1 12 ? 8.297   -9.789  -9.722  1.00 0.00 ? 433 LYS A O    7  
ATOM   8762  C  CB   . LYS A 1 12 ? 9.057   -8.646  -12.522 1.00 0.00 ? 433 LYS A CB   7  
ATOM   8763  C  CG   . LYS A 1 12 ? 9.628   -8.545  -13.926 1.00 0.00 ? 433 LYS A CG   7  
ATOM   8764  C  CD   . LYS A 1 12 ? 9.101   -7.320  -14.655 1.00 0.00 ? 433 LYS A CD   7  
ATOM   8765  C  CE   . LYS A 1 12 ? 9.431   -7.370  -16.139 1.00 0.00 ? 433 LYS A CE   7  
ATOM   8766  N  NZ   . LYS A 1 12 ? 8.638   -8.412  -16.848 1.00 0.00 ? 433 LYS A NZ   7  
ATOM   8767  H  H    . LYS A 1 12 ? 8.305   -11.387 -11.725 1.00 0.00 ? 433 LYS A H    7  
ATOM   8768  H  HA   . LYS A 1 12 ? 10.741  -9.782  -11.847 1.00 0.00 ? 433 LYS A HA   7  
ATOM   8769  H  HB2  . LYS A 1 12 ? 7.992   -8.814  -12.600 1.00 0.00 ? 433 LYS A HB2  7  
ATOM   8770  H  HB3  . LYS A 1 12 ? 9.228   -7.706  -12.017 1.00 0.00 ? 433 LYS A HB3  7  
ATOM   8771  H  HG2  . LYS A 1 12 ? 10.704  -8.478  -13.863 1.00 0.00 ? 433 LYS A HG2  7  
ATOM   8772  H  HG3  . LYS A 1 12 ? 9.352   -9.430  -14.481 1.00 0.00 ? 433 LYS A HG3  7  
ATOM   8773  H  HD2  . LYS A 1 12 ? 8.029   -7.275  -14.537 1.00 0.00 ? 433 LYS A HD2  7  
ATOM   8774  H  HD3  . LYS A 1 12 ? 9.550   -6.435  -14.225 1.00 0.00 ? 433 LYS A HD3  7  
ATOM   8775  H  HE2  . LYS A 1 12 ? 9.216   -6.407  -16.575 1.00 0.00 ? 433 LYS A HE2  7  
ATOM   8776  H  HE3  . LYS A 1 12 ? 10.482  -7.590  -16.253 1.00 0.00 ? 433 LYS A HE3  7  
ATOM   8777  H  HZ1  . LYS A 1 12 ? 7.764   -8.615  -16.322 1.00 0.00 ? 433 LYS A HZ1  7  
ATOM   8778  H  HZ2  . LYS A 1 12 ? 9.191   -9.289  -16.929 1.00 0.00 ? 433 LYS A HZ2  7  
ATOM   8779  H  HZ3  . LYS A 1 12 ? 8.388   -8.083  -17.802 1.00 0.00 ? 433 LYS A HZ3  7  
ATOM   8780  N  N    . ARG A 1 13 ? 10.406  -9.037  -9.496  1.00 0.00 ? 434 ARG A N    7  
ATOM   8781  C  CA   . ARG A 1 13 ? 10.271  -8.762  -8.071  1.00 0.00 ? 434 ARG A CA   7  
ATOM   8782  C  C    . ARG A 1 13 ? 9.811   -7.327  -7.835  1.00 0.00 ? 434 ARG A C    7  
ATOM   8783  O  O    . ARG A 1 13 ? 10.193  -6.697  -6.849  1.00 0.00 ? 434 ARG A O    7  
ATOM   8784  C  CB   . ARG A 1 13 ? 11.601  -9.007  -7.355  1.00 0.00 ? 434 ARG A CB   7  
ATOM   8785  C  CG   . ARG A 1 13 ? 12.809  -8.493  -8.122  1.00 0.00 ? 434 ARG A CG   7  
ATOM   8786  C  CD   . ARG A 1 13 ? 12.577  -7.086  -8.649  1.00 0.00 ? 434 ARG A CD   7  
ATOM   8787  N  NE   . ARG A 1 13 ? 13.823  -6.441  -9.055  1.00 0.00 ? 434 ARG A NE   7  
ATOM   8788  C  CZ   . ARG A 1 13 ? 14.643  -5.828  -8.208  1.00 0.00 ? 434 ARG A CZ   7  
ATOM   8789  N  NH1  . ARG A 1 13 ? 14.350  -5.778  -6.916  1.00 0.00 ? 434 ARG A NH1  7  
ATOM   8790  N  NH2  . ARG A 1 13 ? 15.758  -5.264  -8.653  1.00 0.00 ? 434 ARG A NH2  7  
ATOM   8791  H  H    . ARG A 1 13 ? 11.260  -8.852  -9.940  1.00 0.00 ? 434 ARG A H    7  
ATOM   8792  H  HA   . ARG A 1 13 ? 9.529   -9.436  -7.671  1.00 0.00 ? 434 ARG A HA   7  
ATOM   8793  H  HB2  . ARG A 1 13 ? 11.576  -8.513  -6.395  1.00 0.00 ? 434 ARG A HB2  7  
ATOM   8794  H  HB3  . ARG A 1 13 ? 11.724  -10.068 -7.202  1.00 0.00 ? 434 ARG A HB3  7  
ATOM   8795  H  HG2  . ARG A 1 13 ? 13.664  -8.482  -7.463  1.00 0.00 ? 434 ARG A HG2  7  
ATOM   8796  H  HG3  . ARG A 1 13 ? 13.002  -9.153  -8.955  1.00 0.00 ? 434 ARG A HG3  7  
ATOM   8797  H  HD2  . ARG A 1 13 ? 11.917  -7.139  -9.502  1.00 0.00 ? 434 ARG A HD2  7  
ATOM   8798  H  HD3  . ARG A 1 13 ? 12.113  -6.497  -7.872  1.00 0.00 ? 434 ARG A HD3  7  
ATOM   8799  H  HE   . ARG A 1 13 ? 14.059  -6.466  -10.005 1.00 0.00 ? 434 ARG A HE   7  
ATOM   8800  H  HH11 . ARG A 1 13 ? 13.510  -6.202  -6.577  1.00 0.00 ? 434 ARG A HH11 7  
ATOM   8801  H  HH12 . ARG A 1 13 ? 14.969  -5.316  -6.280  1.00 0.00 ? 434 ARG A HH12 7  
ATOM   8802  H  HH21 . ARG A 1 13 ? 15.982  -5.301  -9.627  1.00 0.00 ? 434 ARG A HH21 7  
ATOM   8803  H  HH22 . ARG A 1 13 ? 16.374  -4.803  -8.016  1.00 0.00 ? 434 ARG A HH22 7  
ATOM   8804  N  N    . GLU A 1 14 ? 8.988   -6.817  -8.746  1.00 0.00 ? 435 GLU A N    7  
ATOM   8805  C  CA   . GLU A 1 14 ? 8.477   -5.456  -8.637  1.00 0.00 ? 435 GLU A CA   7  
ATOM   8806  C  C    . GLU A 1 14 ? 6.998   -5.458  -8.265  1.00 0.00 ? 435 GLU A C    7  
ATOM   8807  O  O    . GLU A 1 14 ? 6.237   -6.322  -8.703  1.00 0.00 ? 435 GLU A O    7  
ATOM   8808  C  CB   . GLU A 1 14 ? 8.682   -4.703  -9.953  1.00 0.00 ? 435 GLU A CB   7  
ATOM   8809  C  CG   . GLU A 1 14 ? 8.439   -3.207  -9.844  1.00 0.00 ? 435 GLU A CG   7  
ATOM   8810  C  CD   . GLU A 1 14 ? 9.607   -2.470  -9.217  1.00 0.00 ? 435 GLU A CD   7  
ATOM   8811  O  OE1  . GLU A 1 14 ? 10.357  -3.099  -8.442  1.00 0.00 ? 435 GLU A OE1  7  
ATOM   8812  O  OE2  . GLU A 1 14 ? 9.770   -1.266  -9.502  1.00 0.00 ? 435 GLU A OE2  7  
ATOM   8813  H  H    . GLU A 1 14 ? 8.719   -7.369  -9.510  1.00 0.00 ? 435 GLU A H    7  
ATOM   8814  H  HA   . GLU A 1 14 ? 9.031   -4.955  -7.857  1.00 0.00 ? 435 GLU A HA   7  
ATOM   8815  H  HB2  . GLU A 1 14 ? 9.697   -4.858  -10.289 1.00 0.00 ? 435 GLU A HB2  7  
ATOM   8816  H  HB3  . GLU A 1 14 ? 8.004   -5.104  -10.692 1.00 0.00 ? 435 GLU A HB3  7  
ATOM   8817  H  HG2  . GLU A 1 14 ? 8.271   -2.809  -10.833 1.00 0.00 ? 435 GLU A HG2  7  
ATOM   8818  H  HG3  . GLU A 1 14 ? 7.561   -3.042  -9.237  1.00 0.00 ? 435 GLU A HG3  7  
ATOM   8819  N  N    . LEU A 1 15 ? 6.596   -4.485  -7.454  1.00 0.00 ? 436 LEU A N    7  
ATOM   8820  C  CA   . LEU A 1 15 ? 5.207   -4.374  -7.021  1.00 0.00 ? 436 LEU A CA   7  
ATOM   8821  C  C    . LEU A 1 15 ? 4.297   -4.029  -8.196  1.00 0.00 ? 436 LEU A C    7  
ATOM   8822  O  O    . LEU A 1 15 ? 4.468   -2.997  -8.845  1.00 0.00 ? 436 LEU A O    7  
ATOM   8823  C  CB   . LEU A 1 15 ? 5.076   -3.311  -5.930  1.00 0.00 ? 436 LEU A CB   7  
ATOM   8824  C  CG   . LEU A 1 15 ? 3.650   -2.946  -5.516  1.00 0.00 ? 436 LEU A CG   7  
ATOM   8825  C  CD1  . LEU A 1 15 ? 3.012   -4.088  -4.739  1.00 0.00 ? 436 LEU A CD1  7  
ATOM   8826  C  CD2  . LEU A 1 15 ? 3.644   -1.668  -4.690  1.00 0.00 ? 436 LEU A CD2  7  
ATOM   8827  H  H    . LEU A 1 15 ? 7.248   -3.826  -7.138  1.00 0.00 ? 436 LEU A H    7  
ATOM   8828  H  HA   . LEU A 1 15 ? 4.908   -5.331  -6.619  1.00 0.00 ? 436 LEU A HA   7  
ATOM   8829  H  HB2  . LEU A 1 15 ? 5.593   -3.671  -5.054  1.00 0.00 ? 436 LEU A HB2  7  
ATOM   8830  H  HB3  . LEU A 1 15 ? 5.558   -2.411  -6.286  1.00 0.00 ? 436 LEU A HB3  7  
ATOM   8831  H  HG   . LEU A 1 15 ? 3.056   -2.775  -6.403  1.00 0.00 ? 436 LEU A HG   7  
ATOM   8832  H  HD11 . LEU A 1 15 ? 1.961   -4.144  -4.980  1.00 0.00 ? 436 LEU A HD11 7  
ATOM   8833  H  HD12 . LEU A 1 15 ? 3.129   -3.912  -3.680  1.00 0.00 ? 436 LEU A HD12 7  
ATOM   8834  H  HD13 . LEU A 1 15 ? 3.493   -5.017  -5.005  1.00 0.00 ? 436 LEU A HD13 7  
ATOM   8835  H  HD21 . LEU A 1 15 ? 3.755   -1.915  -3.644  1.00 0.00 ? 436 LEU A HD21 7  
ATOM   8836  H  HD22 . LEU A 1 15 ? 2.709   -1.147  -4.839  1.00 0.00 ? 436 LEU A HD22 7  
ATOM   8837  H  HD23 . LEU A 1 15 ? 4.463   -1.036  -5.000  1.00 0.00 ? 436 LEU A HD23 7  
ATOM   8838  N  N    . CYS A 1 16 ? 3.328   -4.899  -8.462  1.00 0.00 ? 437 CYS A N    7  
ATOM   8839  C  CA   . CYS A 1 16 ? 2.389   -4.686  -9.557  1.00 0.00 ? 437 CYS A CA   7  
ATOM   8840  C  C    . CYS A 1 16 ? 1.627   -3.377  -9.373  1.00 0.00 ? 437 CYS A C    7  
ATOM   8841  O  O    . CYS A 1 16 ? 1.139   -3.077  -8.284  1.00 0.00 ? 437 CYS A O    7  
ATOM   8842  C  CB   . CYS A 1 16 ? 1.405   -5.854  -9.646  1.00 0.00 ? 437 CYS A CB   7  
ATOM   8843  S  SG   . CYS A 1 16 ? 0.361   -5.835  -11.139 1.00 0.00 ? 437 CYS A SG   7  
ATOM   8844  H  H    . CYS A 1 16 ? 3.243   -5.704  -7.909  1.00 0.00 ? 437 CYS A H    7  
ATOM   8845  H  HA   . CYS A 1 16 ? 2.955   -4.633  -10.474 1.00 0.00 ? 437 CYS A HA   7  
ATOM   8846  H  HB2  . CYS A 1 16 ? 1.958   -6.782  -9.645  1.00 0.00 ? 437 CYS A HB2  7  
ATOM   8847  H  HB3  . CYS A 1 16 ? 0.751   -5.830  -8.787  1.00 0.00 ? 437 CYS A HB3  7  
ATOM   8848  N  N    . LYS A 1 17 ? 1.529   -2.601  -10.447 1.00 0.00 ? 438 LYS A N    7  
ATOM   8849  C  CA   . LYS A 1 17 ? 0.826   -1.324  -10.407 1.00 0.00 ? 438 LYS A CA   7  
ATOM   8850  C  C    . LYS A 1 17 ? -0.683  -1.531  -10.495 1.00 0.00 ? 438 LYS A C    7  
ATOM   8851  O  O    . LYS A 1 17 ? -1.439  -0.581  -10.699 1.00 0.00 ? 438 LYS A O    7  
ATOM   8852  C  CB   . LYS A 1 17 ? 1.295   -0.424  -11.552 1.00 0.00 ? 438 LYS A CB   7  
ATOM   8853  C  CG   . LYS A 1 17 ? 2.763   -0.044  -11.464 1.00 0.00 ? 438 LYS A CG   7  
ATOM   8854  C  CD   . LYS A 1 17 ? 3.261   0.562   -12.766 1.00 0.00 ? 438 LYS A CD   7  
ATOM   8855  C  CE   . LYS A 1 17 ? 2.803   2.004   -12.920 1.00 0.00 ? 438 LYS A CE   7  
ATOM   8856  N  NZ   . LYS A 1 17 ? 3.430   2.897   -11.907 1.00 0.00 ? 438 LYS A NZ   7  
ATOM   8857  H  H    . LYS A 1 17 ? 1.939   -2.894  -11.288 1.00 0.00 ? 438 LYS A H    7  
ATOM   8858  H  HA   . LYS A 1 17 ? 1.057   -0.847  -9.467  1.00 0.00 ? 438 LYS A HA   7  
ATOM   8859  H  HB2  . LYS A 1 17 ? 1.133   -0.938  -12.488 1.00 0.00 ? 438 LYS A HB2  7  
ATOM   8860  H  HB3  . LYS A 1 17 ? 0.709   0.484   -11.544 1.00 0.00 ? 438 LYS A HB3  7  
ATOM   8861  H  HG2  . LYS A 1 17 ? 2.892   0.678   -10.671 1.00 0.00 ? 438 LYS A HG2  7  
ATOM   8862  H  HG3  . LYS A 1 17 ? 3.342   -0.930  -11.246 1.00 0.00 ? 438 LYS A HG3  7  
ATOM   8863  H  HD2  . LYS A 1 17 ? 4.340   0.537   -12.775 1.00 0.00 ? 438 LYS A HD2  7  
ATOM   8864  H  HD3  . LYS A 1 17 ? 2.878   -0.019  -13.593 1.00 0.00 ? 438 LYS A HD3  7  
ATOM   8865  H  HE2  . LYS A 1 17 ? 3.071   2.350   -13.907 1.00 0.00 ? 438 LYS A HE2  7  
ATOM   8866  H  HE3  . LYS A 1 17 ? 1.730   2.041   -12.805 1.00 0.00 ? 438 LYS A HE3  7  
ATOM   8867  H  HZ1  . LYS A 1 17 ? 2.724   3.187   -11.200 1.00 0.00 ? 438 LYS A HZ1  7  
ATOM   8868  H  HZ2  . LYS A 1 17 ? 3.811   3.748   -12.368 1.00 0.00 ? 438 LYS A HZ2  7  
ATOM   8869  H  HZ3  . LYS A 1 17 ? 4.206   2.401   -11.424 1.00 0.00 ? 438 LYS A HZ3  7  
ATOM   8870  N  N    . PHE A 1 18 ? -1.115  -2.778  -10.340 1.00 0.00 ? 439 PHE A N    7  
ATOM   8871  C  CA   . PHE A 1 18 ? -2.534  -3.110  -10.401 1.00 0.00 ? 439 PHE A CA   7  
ATOM   8872  C  C    . PHE A 1 18 ? -3.016  -3.683  -9.072  1.00 0.00 ? 439 PHE A C    7  
ATOM   8873  O  O    . PHE A 1 18 ? -4.102  -3.348  -8.597  1.00 0.00 ? 439 PHE A O    7  
ATOM   8874  C  CB   . PHE A 1 18 ? -2.797  -4.112  -11.527 1.00 0.00 ? 439 PHE A CB   7  
ATOM   8875  C  CG   . PHE A 1 18 ? -2.636  -3.525  -12.901 1.00 0.00 ? 439 PHE A CG   7  
ATOM   8876  C  CD1  . PHE A 1 18 ? -3.488  -2.527  -13.346 1.00 0.00 ? 439 PHE A CD1  7  
ATOM   8877  C  CD2  . PHE A 1 18 ? -1.635  -3.973  -13.747 1.00 0.00 ? 439 PHE A CD2  7  
ATOM   8878  C  CE1  . PHE A 1 18 ? -3.343  -1.986  -14.610 1.00 0.00 ? 439 PHE A CE1  7  
ATOM   8879  C  CE2  . PHE A 1 18 ? -1.484  -3.435  -15.011 1.00 0.00 ? 439 PHE A CE2  7  
ATOM   8880  C  CZ   . PHE A 1 18 ? -2.340  -2.441  -15.443 1.00 0.00 ? 439 PHE A CZ   7  
ATOM   8881  H  H    . PHE A 1 18 ? -0.463  -3.493  -10.180 1.00 0.00 ? 439 PHE A H    7  
ATOM   8882  H  HA   . PHE A 1 18 ? -3.077  -2.200  -10.606 1.00 0.00 ? 439 PHE A HA   7  
ATOM   8883  H  HB2  . PHE A 1 18 ? -2.105  -4.935  -11.436 1.00 0.00 ? 439 PHE A HB2  7  
ATOM   8884  H  HB3  . PHE A 1 18 ? -3.806  -4.484  -11.439 1.00 0.00 ? 439 PHE A HB3  7  
ATOM   8885  H  HD1  . PHE A 1 18 ? -4.273  -2.171  -12.695 1.00 0.00 ? 439 PHE A HD1  7  
ATOM   8886  H  HD2  . PHE A 1 18 ? -0.965  -4.751  -13.410 1.00 0.00 ? 439 PHE A HD2  7  
ATOM   8887  H  HE1  . PHE A 1 18 ? -4.014  -1.209  -14.944 1.00 0.00 ? 439 PHE A HE1  7  
ATOM   8888  H  HE2  . PHE A 1 18 ? -0.700  -3.793  -15.661 1.00 0.00 ? 439 PHE A HE2  7  
ATOM   8889  H  HZ   . PHE A 1 18 ? -2.225  -2.019  -16.430 1.00 0.00 ? 439 PHE A HZ   7  
ATOM   8890  N  N    . TYR A 1 19 ? -2.203  -4.548  -8.477  1.00 0.00 ? 440 TYR A N    7  
ATOM   8891  C  CA   . TYR A 1 19 ? -2.547  -5.171  -7.205  1.00 0.00 ? 440 TYR A CA   7  
ATOM   8892  C  C    . TYR A 1 19 ? -2.766  -4.116  -6.124  1.00 0.00 ? 440 TYR A C    7  
ATOM   8893  O  O    . TYR A 1 19 ? -3.595  -4.290  -5.230  1.00 0.00 ? 440 TYR A O    7  
ATOM   8894  C  CB   . TYR A 1 19 ? -1.445  -6.139  -6.772  1.00 0.00 ? 440 TYR A CB   7  
ATOM   8895  C  CG   . TYR A 1 19 ? -1.838  -7.025  -5.611  1.00 0.00 ? 440 TYR A CG   7  
ATOM   8896  C  CD1  . TYR A 1 19 ? -2.971  -7.827  -5.677  1.00 0.00 ? 440 TYR A CD1  7  
ATOM   8897  C  CD2  . TYR A 1 19 ? -1.078  -7.058  -4.449  1.00 0.00 ? 440 TYR A CD2  7  
ATOM   8898  C  CE1  . TYR A 1 19 ? -3.334  -8.637  -4.618  1.00 0.00 ? 440 TYR A CE1  7  
ATOM   8899  C  CE2  . TYR A 1 19 ? -1.433  -7.866  -3.386  1.00 0.00 ? 440 TYR A CE2  7  
ATOM   8900  C  CZ   . TYR A 1 19 ? -2.562  -8.653  -3.476  1.00 0.00 ? 440 TYR A CZ   7  
ATOM   8901  O  OH   . TYR A 1 19 ? -2.920  -9.458  -2.419  1.00 0.00 ? 440 TYR A OH   7  
ATOM   8902  H  H    . TYR A 1 19 ? -1.351  -4.775  -8.905  1.00 0.00 ? 440 TYR A H    7  
ATOM   8903  H  HA   . TYR A 1 19 ? -3.464  -5.724  -7.343  1.00 0.00 ? 440 TYR A HA   7  
ATOM   8904  H  HB2  . TYR A 1 19 ? -1.190  -6.778  -7.604  1.00 0.00 ? 440 TYR A HB2  7  
ATOM   8905  H  HB3  . TYR A 1 19 ? -0.573  -5.574  -6.478  1.00 0.00 ? 440 TYR A HB3  7  
ATOM   8906  H  HD1  . TYR A 1 19 ? -3.573  -7.812  -6.573  1.00 0.00 ? 440 TYR A HD1  7  
ATOM   8907  H  HD2  . TYR A 1 19 ? -0.194  -6.440  -4.382  1.00 0.00 ? 440 TYR A HD2  7  
ATOM   8908  H  HE1  . TYR A 1 19 ? -4.218  -9.254  -4.688  1.00 0.00 ? 440 TYR A HE1  7  
ATOM   8909  H  HE2  . TYR A 1 19 ? -0.829  -7.879  -2.491  1.00 0.00 ? 440 TYR A HE2  7  
ATOM   8910  H  HH   . TYR A 1 19 ? -3.660  -10.013 -2.676  1.00 0.00 ? 440 TYR A HH   7  
ATOM   8911  N  N    . ILE A 1 20 ? -2.016  -3.023  -6.213  1.00 0.00 ? 441 ILE A N    7  
ATOM   8912  C  CA   . ILE A 1 20 ? -2.129  -1.939  -5.245  1.00 0.00 ? 441 ILE A CA   7  
ATOM   8913  C  C    . ILE A 1 20 ? -3.588  -1.641  -4.921  1.00 0.00 ? 441 ILE A C    7  
ATOM   8914  O  O    . ILE A 1 20 ? -3.922  -1.260  -3.798  1.00 0.00 ? 441 ILE A O    7  
ATOM   8915  C  CB   . ILE A 1 20 ? -1.455  -0.653  -5.759  1.00 0.00 ? 441 ILE A CB   7  
ATOM   8916  C  CG1  . ILE A 1 20 ? 0.018   -0.915  -6.079  1.00 0.00 ? 441 ILE A CG1  7  
ATOM   8917  C  CG2  . ILE A 1 20 ? -1.590  0.462   -4.732  1.00 0.00 ? 441 ILE A CG2  7  
ATOM   8918  C  CD1  . ILE A 1 20 ? 0.724   0.275   -6.690  1.00 0.00 ? 441 ILE A CD1  7  
ATOM   8919  H  H    . ILE A 1 20 ? -1.373  -2.942  -6.948  1.00 0.00 ? 441 ILE A H    7  
ATOM   8920  H  HA   . ILE A 1 20 ? -1.626  -2.248  -4.340  1.00 0.00 ? 441 ILE A HA   7  
ATOM   8921  H  HB   . ILE A 1 20 ? -1.963  -0.343  -6.660  1.00 0.00 ? 441 ILE A HB   7  
ATOM   8922  H  HG12 . ILE A 1 20 ? 0.536   -1.177  -5.170  1.00 0.00 ? 441 ILE A HG12 7  
ATOM   8923  H  HG13 . ILE A 1 20 ? 0.086   -1.737  -6.777  1.00 0.00 ? 441 ILE A HG13 7  
ATOM   8924  H  HG21 . ILE A 1 20 ? -2.225  1.241   -5.128  1.00 0.00 ? 441 ILE A HG21 7  
ATOM   8925  H  HG22 . ILE A 1 20 ? -2.027  0.067   -3.828  1.00 0.00 ? 441 ILE A HG22 7  
ATOM   8926  H  HG23 . ILE A 1 20 ? -0.614  0.869   -4.513  1.00 0.00 ? 441 ILE A HG23 7  
ATOM   8927  H  HD11 . ILE A 1 20 ? 0.700   0.195   -7.767  1.00 0.00 ? 441 ILE A HD11 7  
ATOM   8928  H  HD12 . ILE A 1 20 ? 0.230   1.184   -6.384  1.00 0.00 ? 441 ILE A HD12 7  
ATOM   8929  H  HD13 . ILE A 1 20 ? 1.752   0.294   -6.355  1.00 0.00 ? 441 ILE A HD13 7  
ATOM   8930  N  N    . THR A 1 21 ? -4.457  -1.817  -5.912  1.00 0.00 ? 442 THR A N    7  
ATOM   8931  C  CA   . THR A 1 21 ? -5.882  -1.568  -5.733  1.00 0.00 ? 442 THR A CA   7  
ATOM   8932  C  C    . THR A 1 21 ? -6.648  -2.872  -5.540  1.00 0.00 ? 442 THR A C    7  
ATOM   8933  O  O    . THR A 1 21 ? -7.598  -2.936  -4.760  1.00 0.00 ? 442 THR A O    7  
ATOM   8934  C  CB   . THR A 1 21 ? -6.475  -0.810  -6.935  1.00 0.00 ? 442 THR A CB   7  
ATOM   8935  O  OG1  . THR A 1 21 ? -6.148  -1.490  -8.152  1.00 0.00 ? 442 THR A OG1  7  
ATOM   8936  C  CG2  . THR A 1 21 ? -5.950  0.617   -6.988  1.00 0.00 ? 442 THR A CG2  7  
ATOM   8937  H  H    . THR A 1 21 ? -4.130  -2.122  -6.784  1.00 0.00 ? 442 THR A H    7  
ATOM   8938  H  HA   . THR A 1 21 ? -6.005  -0.956  -4.851  1.00 0.00 ? 442 THR A HA   7  
ATOM   8939  H  HB   . THR A 1 21 ? -7.550  -0.779  -6.827  1.00 0.00 ? 442 THR A HB   7  
ATOM   8940  H  HG1  . THR A 1 21 ? -6.109  -0.855  -8.873  1.00 0.00 ? 442 THR A HG1  7  
ATOM   8941  H  HG21 . THR A 1 21 ? -6.657  1.241   -7.513  1.00 0.00 ? 442 THR A HG21 7  
ATOM   8942  H  HG22 . THR A 1 21 ? -5.002  0.632   -7.505  1.00 0.00 ? 442 THR A HG22 7  
ATOM   8943  H  HG23 . THR A 1 21 ? -5.819  0.989   -5.983  1.00 0.00 ? 442 THR A HG23 7  
ATOM   8944  N  N    . GLY A 1 22 ? -6.229  -3.911  -6.256  1.00 0.00 ? 443 GLY A N    7  
ATOM   8945  C  CA   . GLY A 1 22 ? -6.887  -5.200  -6.149  1.00 0.00 ? 443 GLY A CA   7  
ATOM   8946  C  C    . GLY A 1 22 ? -7.534  -5.631  -7.450  1.00 0.00 ? 443 GLY A C    7  
ATOM   8947  O  O    . GLY A 1 22 ? -8.000  -6.764  -7.575  1.00 0.00 ? 443 GLY A O    7  
ATOM   8948  H  H    . GLY A 1 22 ? -5.467  -3.801  -6.862  1.00 0.00 ? 443 GLY A H    7  
ATOM   8949  H  HA2  . GLY A 1 22 ? -6.158  -5.941  -5.858  1.00 0.00 ? 443 GLY A HA2  7  
ATOM   8950  H  HA3  . GLY A 1 22 ? -7.649  -5.140  -5.385  1.00 0.00 ? 443 GLY A HA3  7  
ATOM   8951  N  N    . PHE A 1 23 ? -7.564  -4.725  -8.423  1.00 0.00 ? 444 PHE A N    7  
ATOM   8952  C  CA   . PHE A 1 23 ? -8.161  -5.017  -9.721  1.00 0.00 ? 444 PHE A CA   7  
ATOM   8953  C  C    . PHE A 1 23 ? -7.086  -5.355  -10.750 1.00 0.00 ? 444 PHE A C    7  
ATOM   8954  O  O    . PHE A 1 23 ? -6.688  -4.508  -11.550 1.00 0.00 ? 444 PHE A O    7  
ATOM   8955  C  CB   . PHE A 1 23 ? -8.989  -3.825  -10.205 1.00 0.00 ? 444 PHE A CB   7  
ATOM   8956  C  CG   . PHE A 1 23 ? -9.382  -3.916  -11.651 1.00 0.00 ? 444 PHE A CG   7  
ATOM   8957  C  CD1  . PHE A 1 23 ? -10.010 -5.049  -12.143 1.00 0.00 ? 444 PHE A CD1  7  
ATOM   8958  C  CD2  . PHE A 1 23 ? -9.123  -2.868  -12.520 1.00 0.00 ? 444 PHE A CD2  7  
ATOM   8959  C  CE1  . PHE A 1 23 ? -10.373 -5.135  -13.474 1.00 0.00 ? 444 PHE A CE1  7  
ATOM   8960  C  CE2  . PHE A 1 23 ? -9.484  -2.949  -13.852 1.00 0.00 ? 444 PHE A CE2  7  
ATOM   8961  C  CZ   . PHE A 1 23 ? -10.109 -4.084  -14.329 1.00 0.00 ? 444 PHE A CZ   7  
ATOM   8962  H  H    . PHE A 1 23 ? -7.176  -3.839  -8.263  1.00 0.00 ? 444 PHE A H    7  
ATOM   8963  H  HA   . PHE A 1 23 ? -8.809  -5.871  -9.602  1.00 0.00 ? 444 PHE A HA   7  
ATOM   8964  H  HB2  . PHE A 1 23 ? -9.894  -3.763  -9.619  1.00 0.00 ? 444 PHE A HB2  7  
ATOM   8965  H  HB3  . PHE A 1 23 ? -8.416  -2.920  -10.071 1.00 0.00 ? 444 PHE A HB3  7  
ATOM   8966  H  HD1  . PHE A 1 23 ? -10.217 -5.872  -11.474 1.00 0.00 ? 444 PHE A HD1  7  
ATOM   8967  H  HD2  . PHE A 1 23 ? -8.633  -1.980  -12.149 1.00 0.00 ? 444 PHE A HD2  7  
ATOM   8968  H  HE1  . PHE A 1 23 ? -10.862 -6.024  -13.843 1.00 0.00 ? 444 PHE A HE1  7  
ATOM   8969  H  HE2  . PHE A 1 23 ? -9.276  -2.125  -14.519 1.00 0.00 ? 444 PHE A HE2  7  
ATOM   8970  H  HZ   . PHE A 1 23 ? -10.392 -4.149  -15.369 1.00 0.00 ? 444 PHE A HZ   7  
ATOM   8971  N  N    . CYS A 1 24 ? -6.619  -6.599  -10.723 1.00 0.00 ? 445 CYS A N    7  
ATOM   8972  C  CA   . CYS A 1 24 ? -5.590  -7.051  -11.651 1.00 0.00 ? 445 CYS A CA   7  
ATOM   8973  C  C    . CYS A 1 24 ? -6.108  -8.189  -12.525 1.00 0.00 ? 445 CYS A C    7  
ATOM   8974  O  O    . CYS A 1 24 ? -6.232  -9.327  -12.072 1.00 0.00 ? 445 CYS A O    7  
ATOM   8975  C  CB   . CYS A 1 24 ? -4.347  -7.506  -10.885 1.00 0.00 ? 445 CYS A CB   7  
ATOM   8976  S  SG   . CYS A 1 24 ? -2.938  -7.951  -11.951 1.00 0.00 ? 445 CYS A SG   7  
ATOM   8977  H  H    . CYS A 1 24 ? -6.976  -7.229  -10.062 1.00 0.00 ? 445 CYS A H    7  
ATOM   8978  H  HA   . CYS A 1 24 ? -5.327  -6.218  -12.286 1.00 0.00 ? 445 CYS A HA   7  
ATOM   8979  H  HB2  . CYS A 1 24 ? -4.024  -6.709  -10.231 1.00 0.00 ? 445 CYS A HB2  7  
ATOM   8980  H  HB3  . CYS A 1 24 ? -4.597  -8.372  -10.291 1.00 0.00 ? 445 CYS A HB3  7  
ATOM   8981  N  N    . ALA A 1 25 ? -6.408  -7.875  -13.781 1.00 0.00 ? 446 ALA A N    7  
ATOM   8982  C  CA   . ALA A 1 25 ? -6.910  -8.871  -14.719 1.00 0.00 ? 446 ALA A CA   7  
ATOM   8983  C  C    . ALA A 1 25 ? -6.185  -10.201 -14.547 1.00 0.00 ? 446 ALA A C    7  
ATOM   8984  O  O    . ALA A 1 25 ? -6.793  -11.207 -14.177 1.00 0.00 ? 446 ALA A O    7  
ATOM   8985  C  CB   . ALA A 1 25 ? -6.765  -8.370  -16.149 1.00 0.00 ? 446 ALA A CB   7  
ATOM   8986  H  H    . ALA A 1 25 ? -6.288  -6.951  -14.084 1.00 0.00 ? 446 ALA A H    7  
ATOM   8987  H  HA   . ALA A 1 25 ? -7.962  -9.017  -14.520 1.00 0.00 ? 446 ALA A HA   7  
ATOM   8988  H  HB1  . ALA A 1 25 ? -5.719  -8.208  -16.368 1.00 0.00 ? 446 ALA A HB1  7  
ATOM   8989  H  HB2  . ALA A 1 25 ? -7.166  -9.105  -16.830 1.00 0.00 ? 446 ALA A HB2  7  
ATOM   8990  H  HB3  . ALA A 1 25 ? -7.305  -7.442  -16.261 1.00 0.00 ? 446 ALA A HB3  7  
ATOM   8991  N  N    . ARG A 1 26 ? -4.884  -10.201 -14.817 1.00 0.00 ? 447 ARG A N    7  
ATOM   8992  C  CA   . ARG A 1 26 ? -4.077  -11.409 -14.694 1.00 0.00 ? 447 ARG A CA   7  
ATOM   8993  C  C    . ARG A 1 26 ? -3.736  -11.688 -13.233 1.00 0.00 ? 447 ARG A C    7  
ATOM   8994  O  O    . ARG A 1 26 ? -2.892  -11.014 -12.642 1.00 0.00 ? 447 ARG A O    7  
ATOM   8995  C  CB   . ARG A 1 26 ? -2.792  -11.275 -15.512 1.00 0.00 ? 447 ARG A CB   7  
ATOM   8996  C  CG   . ARG A 1 26 ? -2.996  -11.475 -17.005 1.00 0.00 ? 447 ARG A CG   7  
ATOM   8997  C  CD   . ARG A 1 26 ? -1.768  -11.053 -17.796 1.00 0.00 ? 447 ARG A CD   7  
ATOM   8998  N  NE   . ARG A 1 26 ? -2.072  -10.851 -19.211 1.00 0.00 ? 447 ARG A NE   7  
ATOM   8999  C  CZ   . ARG A 1 26 ? -1.242  -10.260 -20.063 1.00 0.00 ? 447 ARG A CZ   7  
ATOM   9000  N  NH1  . ARG A 1 26 ? -0.064  -9.816  -19.647 1.00 0.00 ? 447 ARG A NH1  7  
ATOM   9001  N  NH2  . ARG A 1 26 ? -1.589  -10.112 -21.335 1.00 0.00 ? 447 ARG A NH2  7  
ATOM   9002  H  H    . ARG A 1 26 ? -4.456  -9.368  -15.108 1.00 0.00 ? 447 ARG A H    7  
ATOM   9003  H  HA   . ARG A 1 26 ? -4.655  -12.235 -15.080 1.00 0.00 ? 447 ARG A HA   7  
ATOM   9004  H  HB2  . ARG A 1 26 ? -2.380  -10.288 -15.356 1.00 0.00 ? 447 ARG A HB2  7  
ATOM   9005  H  HB3  . ARG A 1 26 ? -2.081  -12.011 -15.166 1.00 0.00 ? 447 ARG A HB3  7  
ATOM   9006  H  HG2  . ARG A 1 26 ? -3.192  -12.520 -17.195 1.00 0.00 ? 447 ARG A HG2  7  
ATOM   9007  H  HG3  . ARG A 1 26 ? -3.841  -10.883 -17.325 1.00 0.00 ? 447 ARG A HG3  7  
ATOM   9008  H  HD2  . ARG A 1 26 ? -1.389  -10.130 -17.384 1.00 0.00 ? 447 ARG A HD2  7  
ATOM   9009  H  HD3  . ARG A 1 26 ? -1.017  -11.824 -17.706 1.00 0.00 ? 447 ARG A HD3  7  
ATOM   9010  H  HE   . ARG A 1 26 ? -2.937  -11.171 -19.539 1.00 0.00 ? 447 ARG A HE   7  
ATOM   9011  H  HH11 . ARG A 1 26 ? 0.202   -9.927  -18.689 1.00 0.00 ? 447 ARG A HH11 7  
ATOM   9012  H  HH12 . ARG A 1 26 ? 0.560   -9.373  -20.291 1.00 0.00 ? 447 ARG A HH12 7  
ATOM   9013  H  HH21 . ARG A 1 26 ? -2.477  -10.445 -21.652 1.00 0.00 ? 447 ARG A HH21 7  
ATOM   9014  H  HH22 . ARG A 1 26 ? -0.964  -9.667  -21.976 1.00 0.00 ? 447 ARG A HH22 7  
ATOM   9015  N  N    . ALA A 1 27 ? -4.399  -12.685 -12.656 1.00 0.00 ? 448 ALA A N    7  
ATOM   9016  C  CA   . ALA A 1 27 ? -4.166  -13.054 -11.265 1.00 0.00 ? 448 ALA A CA   7  
ATOM   9017  C  C    . ALA A 1 27 ? -2.932  -13.940 -11.132 1.00 0.00 ? 448 ALA A C    7  
ATOM   9018  O  O    . ALA A 1 27 ? -1.864  -13.476 -10.734 1.00 0.00 ? 448 ALA A O    7  
ATOM   9019  C  CB   . ALA A 1 27 ? -5.387  -13.758 -10.694 1.00 0.00 ? 448 ALA A CB   7  
ATOM   9020  H  H    . ALA A 1 27 ? -5.060  -13.185 -13.179 1.00 0.00 ? 448 ALA A H    7  
ATOM   9021  H  HA   . ALA A 1 27 ? -4.007  -12.146 -10.701 1.00 0.00 ? 448 ALA A HA   7  
ATOM   9022  H  HB1  . ALA A 1 27 ? -5.679  -13.278 -9.771  1.00 0.00 ? 448 ALA A HB1  7  
ATOM   9023  H  HB2  . ALA A 1 27 ? -6.200  -13.700 -11.402 1.00 0.00 ? 448 ALA A HB2  7  
ATOM   9024  H  HB3  . ALA A 1 27 ? -5.149  -14.793 -10.502 1.00 0.00 ? 448 ALA A HB3  7  
ATOM   9025  N  N    . GLU A 1 28 ? -3.087  -15.217 -11.468 1.00 0.00 ? 449 GLU A N    7  
ATOM   9026  C  CA   . GLU A 1 28 ? -1.985  -16.168 -11.383 1.00 0.00 ? 449 GLU A CA   7  
ATOM   9027  C  C    . GLU A 1 28 ? -1.088  -16.071 -12.614 1.00 0.00 ? 449 GLU A C    7  
ATOM   9028  O  O    . GLU A 1 28 ? -0.264  -16.950 -12.866 1.00 0.00 ? 449 GLU A O    7  
ATOM   9029  C  CB   . GLU A 1 28 ? -2.521  -17.593 -11.241 1.00 0.00 ? 449 GLU A CB   7  
ATOM   9030  C  CG   . GLU A 1 28 ? -3.604  -17.733 -10.183 1.00 0.00 ? 449 GLU A CG   7  
ATOM   9031  C  CD   . GLU A 1 28 ? -4.085  -19.163 -10.027 1.00 0.00 ? 449 GLU A CD   7  
ATOM   9032  O  OE1  . GLU A 1 28 ? -3.445  -19.926 -9.275  1.00 0.00 ? 449 GLU A OE1  7  
ATOM   9033  O  OE2  . GLU A 1 28 ? -5.104  -19.517 -10.658 1.00 0.00 ? 449 GLU A OE2  7  
ATOM   9034  H  H    . GLU A 1 28 ? -3.963  -15.527 -11.778 1.00 0.00 ? 449 GLU A H    7  
ATOM   9035  H  HA   . GLU A 1 28 ? -1.402  -15.923 -10.508 1.00 0.00 ? 449 GLU A HA   7  
ATOM   9036  H  HB2  . GLU A 1 28 ? -2.930  -17.908 -12.189 1.00 0.00 ? 449 GLU A HB2  7  
ATOM   9037  H  HB3  . GLU A 1 28 ? -1.703  -18.248 -10.976 1.00 0.00 ? 449 GLU A HB3  7  
ATOM   9038  H  HG2  . GLU A 1 28 ? -3.210  -17.397 -9.236  1.00 0.00 ? 449 GLU A HG2  7  
ATOM   9039  H  HG3  . GLU A 1 28 ? -4.444  -17.114 -10.463 1.00 0.00 ? 449 GLU A HG3  7  
ATOM   9040  N  N    . ASN A 1 29 ? -1.255  -14.996 -13.378 1.00 0.00 ? 450 ASN A N    7  
ATOM   9041  C  CA   . ASN A 1 29 ? -0.462  -14.785 -14.584 1.00 0.00 ? 450 ASN A CA   7  
ATOM   9042  C  C    . ASN A 1 29 ? 0.462   -13.581 -14.423 1.00 0.00 ? 450 ASN A C    7  
ATOM   9043  O  O    . ASN A 1 29 ? 1.424   -13.418 -15.174 1.00 0.00 ? 450 ASN A O    7  
ATOM   9044  C  CB   . ASN A 1 29 ? -1.378  -14.580 -15.792 1.00 0.00 ? 450 ASN A CB   7  
ATOM   9045  C  CG   . ASN A 1 29 ? -1.928  -15.887 -16.329 1.00 0.00 ? 450 ASN A CG   7  
ATOM   9046  O  OD1  . ASN A 1 29 ? -1.500  -16.369 -17.378 1.00 0.00 ? 450 ASN A OD1  7  
ATOM   9047  N  ND2  . ASN A 1 29 ? -2.881  -16.468 -15.610 1.00 0.00 ? 450 ASN A ND2  7  
ATOM   9048  H  H    . ASN A 1 29 ? -1.928  -14.330 -13.126 1.00 0.00 ? 450 ASN A H    7  
ATOM   9049  H  HA   . ASN A 1 29 ? 0.139   -15.667 -14.744 1.00 0.00 ? 450 ASN A HA   7  
ATOM   9050  H  HB2  . ASN A 1 29 ? -2.210  -13.954 -15.504 1.00 0.00 ? 450 ASN A HB2  7  
ATOM   9051  H  HB3  . ASN A 1 29 ? -0.822  -14.094 -16.580 1.00 0.00 ? 450 ASN A HB3  7  
ATOM   9052  H  HD21 . ASN A 1 29 ? -3.173  -16.026 -14.785 1.00 0.00 ? 450 ASN A HD21 7  
ATOM   9053  H  HD22 . ASN A 1 29 ? -3.254  -17.314 -15.933 1.00 0.00 ? 450 ASN A HD22 7  
ATOM   9054  N  N    . CYS A 1 30 ? 0.164   -12.742 -13.437 1.00 0.00 ? 451 CYS A N    7  
ATOM   9055  C  CA   . CYS A 1 30 ? 0.967   -11.553 -13.175 1.00 0.00 ? 451 CYS A CA   7  
ATOM   9056  C  C    . CYS A 1 30 ? 2.369   -11.935 -12.708 1.00 0.00 ? 451 CYS A C    7  
ATOM   9057  O  O    . CYS A 1 30 ? 2.562   -12.461 -11.611 1.00 0.00 ? 451 CYS A O    7  
ATOM   9058  C  CB   . CYS A 1 30 ? 0.288   -10.675 -12.123 1.00 0.00 ? 451 CYS A CB   7  
ATOM   9059  S  SG   . CYS A 1 30 ? 0.894   -8.957  -12.085 1.00 0.00 ? 451 CYS A SG   7  
ATOM   9060  H  H    . CYS A 1 30 ? -0.616  -12.925 -12.871 1.00 0.00 ? 451 CYS A H    7  
ATOM   9061  H  HA   . CYS A 1 30 ? 1.048   -10.998 -14.097 1.00 0.00 ? 451 CYS A HA   7  
ATOM   9062  H  HB2  . CYS A 1 30 ? -0.773  -10.643 -12.322 1.00 0.00 ? 451 CYS A HB2  7  
ATOM   9063  H  HB3  . CYS A 1 30 ? 0.454   -11.104 -11.146 1.00 0.00 ? 451 CYS A HB3  7  
ATOM   9064  N  N    . PRO A 1 31 ? 3.370   -11.666 -13.558 1.00 0.00 ? 452 PRO A N    7  
ATOM   9065  C  CA   . PRO A 1 31 ? 4.771   -11.972 -13.254 1.00 0.00 ? 452 PRO A CA   7  
ATOM   9066  C  C    . PRO A 1 31 ? 5.334   -11.079 -12.153 1.00 0.00 ? 452 PRO A C    7  
ATOM   9067  O  O    . PRO A 1 31 ? 6.517   -11.158 -11.820 1.00 0.00 ? 452 PRO A O    7  
ATOM   9068  C  CB   . PRO A 1 31 ? 5.489   -11.704 -14.579 1.00 0.00 ? 452 PRO A CB   7  
ATOM   9069  C  CG   . PRO A 1 31 ? 4.625   -10.717 -15.285 1.00 0.00 ? 452 PRO A CG   7  
ATOM   9070  C  CD   . PRO A 1 31 ? 3.212   -11.040 -14.882 1.00 0.00 ? 452 PRO A CD   7  
ATOM   9071  H  HA   . PRO A 1 31 ? 4.899   -13.008 -12.976 1.00 0.00 ? 452 PRO A HA   7  
ATOM   9072  H  HB2  . PRO A 1 31 ? 6.472   -11.301 -14.383 1.00 0.00 ? 452 PRO A HB2  7  
ATOM   9073  H  HB3  . PRO A 1 31 ? 5.575   -12.623 -15.138 1.00 0.00 ? 452 PRO A HB3  7  
ATOM   9074  H  HG2  . PRO A 1 31 ? 4.883   -9.715  -14.976 1.00 0.00 ? 452 PRO A HG2  7  
ATOM   9075  H  HG3  . PRO A 1 31 ? 4.743   -10.824 -16.353 1.00 0.00 ? 452 PRO A HG3  7  
ATOM   9076  H  HD2  . PRO A 1 31 ? 2.624   -10.137 -14.814 1.00 0.00 ? 452 PRO A HD2  7  
ATOM   9077  H  HD3  . PRO A 1 31 ? 2.768   -11.730 -15.583 1.00 0.00 ? 452 PRO A HD3  7  
ATOM   9078  N  N    . TYR A 1 32 ? 4.480   -10.231 -11.591 1.00 0.00 ? 453 TYR A N    7  
ATOM   9079  C  CA   . TYR A 1 32 ? 4.893   -9.322  -10.529 1.00 0.00 ? 453 TYR A CA   7  
ATOM   9080  C  C    . TYR A 1 32 ? 4.482   -9.859  -9.161  1.00 0.00 ? 453 TYR A C    7  
ATOM   9081  O  O    . TYR A 1 32 ? 3.738   -10.835 -9.063  1.00 0.00 ? 453 TYR A O    7  
ATOM   9082  C  CB   . TYR A 1 32 ? 4.283   -7.936  -10.749 1.00 0.00 ? 453 TYR A CB   7  
ATOM   9083  C  CG   . TYR A 1 32 ? 4.799   -7.238  -11.987 1.00 0.00 ? 453 TYR A CG   7  
ATOM   9084  C  CD1  . TYR A 1 32 ? 4.313   -7.566  -13.247 1.00 0.00 ? 453 TYR A CD1  7  
ATOM   9085  C  CD2  . TYR A 1 32 ? 5.772   -6.250  -11.897 1.00 0.00 ? 453 TYR A CD2  7  
ATOM   9086  C  CE1  . TYR A 1 32 ? 4.781   -6.931  -14.381 1.00 0.00 ? 453 TYR A CE1  7  
ATOM   9087  C  CE2  . TYR A 1 32 ? 6.245   -5.609  -13.026 1.00 0.00 ? 453 TYR A CE2  7  
ATOM   9088  C  CZ   . TYR A 1 32 ? 5.747   -5.953  -14.265 1.00 0.00 ? 453 TYR A CZ   7  
ATOM   9089  O  OH   . TYR A 1 32 ? 6.216   -5.318  -15.391 1.00 0.00 ? 453 TYR A OH   7  
ATOM   9090  H  H    . TYR A 1 32 ? 3.550   -10.215 -11.899 1.00 0.00 ? 453 TYR A H    7  
ATOM   9091  H  HA   . TYR A 1 32 ? 5.969   -9.240  -10.562 1.00 0.00 ? 453 TYR A HA   7  
ATOM   9092  H  HB2  . TYR A 1 32 ? 3.213   -8.033  -10.845 1.00 0.00 ? 453 TYR A HB2  7  
ATOM   9093  H  HB3  . TYR A 1 32 ? 4.509   -7.312  -9.897  1.00 0.00 ? 453 TYR A HB3  7  
ATOM   9094  H  HD1  . TYR A 1 32 ? 3.556   -8.333  -13.334 1.00 0.00 ? 453 TYR A HD1  7  
ATOM   9095  H  HD2  . TYR A 1 32 ? 6.160   -5.984  -10.925 1.00 0.00 ? 453 TYR A HD2  7  
ATOM   9096  H  HE1  . TYR A 1 32 ? 4.391   -7.200  -15.351 1.00 0.00 ? 453 TYR A HE1  7  
ATOM   9097  H  HE2  . TYR A 1 32 ? 7.001   -4.844  -12.935 1.00 0.00 ? 453 TYR A HE2  7  
ATOM   9098  H  HH   . TYR A 1 32 ? 5.658   -4.562  -15.589 1.00 0.00 ? 453 TYR A HH   7  
ATOM   9099  N  N    . MET A 1 33 ? 4.971   -9.214  -8.108  1.00 0.00 ? 454 MET A N    7  
ATOM   9100  C  CA   . MET A 1 33 ? 4.654   -9.625  -6.745  1.00 0.00 ? 454 MET A CA   7  
ATOM   9101  C  C    . MET A 1 33 ? 3.300   -9.071  -6.311  1.00 0.00 ? 454 MET A C    7  
ATOM   9102  O  O    . MET A 1 33 ? 2.950   -7.936  -6.636  1.00 0.00 ? 454 MET A O    7  
ATOM   9103  C  CB   . MET A 1 33 ? 5.743   -9.153  -5.780  1.00 0.00 ? 454 MET A CB   7  
ATOM   9104  C  CG   . MET A 1 33 ? 7.029   -9.959  -5.873  1.00 0.00 ? 454 MET A CG   7  
ATOM   9105  S  SD   . MET A 1 33 ? 6.940   -11.515 -4.966  1.00 0.00 ? 454 MET A SD   7  
ATOM   9106  C  CE   . MET A 1 33 ? 7.944   -11.129 -3.534  1.00 0.00 ? 454 MET A CE   7  
ATOM   9107  H  H    . MET A 1 33 ? 5.559   -8.442  -8.249  1.00 0.00 ? 454 MET A H    7  
ATOM   9108  H  HA   . MET A 1 33 ? 4.611   -10.703 -6.726  1.00 0.00 ? 454 MET A HA   7  
ATOM   9109  H  HB2  . MET A 1 33 ? 5.975   -8.120  -5.995  1.00 0.00 ? 454 MET A HB2  7  
ATOM   9110  H  HB3  . MET A 1 33 ? 5.370   -9.227  -4.770  1.00 0.00 ? 454 MET A HB3  7  
ATOM   9111  H  HG2  . MET A 1 33 ? 7.227   -10.176 -6.912  1.00 0.00 ? 454 MET A HG2  7  
ATOM   9112  H  HG3  . MET A 1 33 ? 7.838   -9.368  -5.470  1.00 0.00 ? 454 MET A HG3  7  
ATOM   9113  H  HE1  . MET A 1 33 ? 7.636   -10.179 -3.123  1.00 0.00 ? 454 MET A HE1  7  
ATOM   9114  H  HE2  . MET A 1 33 ? 7.819   -11.901 -2.789  1.00 0.00 ? 454 MET A HE2  7  
ATOM   9115  H  HE3  . MET A 1 33 ? 8.982   -11.075 -3.827  1.00 0.00 ? 454 MET A HE3  7  
ATOM   9116  N  N    . HIS A 1 34 ? 2.543   -9.880  -5.577  1.00 0.00 ? 455 HIS A N    7  
ATOM   9117  C  CA   . HIS A 1 34 ? 1.227   -9.470  -5.099  1.00 0.00 ? 455 HIS A CA   7  
ATOM   9118  C  C    . HIS A 1 34 ? 1.163   -9.520  -3.576  1.00 0.00 ? 455 HIS A C    7  
ATOM   9119  O  O    . HIS A 1 34 ? 1.241   -8.490  -2.907  1.00 0.00 ? 455 HIS A O    7  
ATOM   9120  C  CB   . HIS A 1 34 ? 0.142   -10.367 -5.697  1.00 0.00 ? 455 HIS A CB   7  
ATOM   9121  C  CG   . HIS A 1 34 ? -0.240  -9.993  -7.096  1.00 0.00 ? 455 HIS A CG   7  
ATOM   9122  N  ND1  . HIS A 1 34 ? -1.428  -10.380 -7.680  1.00 0.00 ? 455 HIS A ND1  7  
ATOM   9123  C  CD2  . HIS A 1 34 ? 0.416   -9.263  -8.028  1.00 0.00 ? 455 HIS A CD2  7  
ATOM   9124  C  CE1  . HIS A 1 34 ? -1.486  -9.904  -8.911  1.00 0.00 ? 455 HIS A CE1  7  
ATOM   9125  N  NE2  . HIS A 1 34 ? -0.379  -9.222  -9.147  1.00 0.00 ? 455 HIS A NE2  7  
ATOM   9126  H  H    . HIS A 1 34 ? 2.877   -10.773 -5.351  1.00 0.00 ? 455 HIS A H    7  
ATOM   9127  H  HA   . HIS A 1 34 ? 1.059   -8.454  -5.421  1.00 0.00 ? 455 HIS A HA   7  
ATOM   9128  H  HB2  . HIS A 1 34 ? 0.495   -11.387 -5.711  1.00 0.00 ? 455 HIS A HB2  7  
ATOM   9129  H  HB3  . HIS A 1 34 ? -0.745  -10.306 -5.082  1.00 0.00 ? 455 HIS A HB3  7  
ATOM   9130  H  HD1  . HIS A 1 34 ? -2.124  -10.923 -7.256  1.00 0.00 ? 455 HIS A HD1  7  
ATOM   9131  H  HD2  . HIS A 1 34 ? 1.385   -8.798  -7.913  1.00 0.00 ? 455 HIS A HD2  7  
ATOM   9132  H  HE1  . HIS A 1 34 ? -2.299  -10.048 -9.607  1.00 0.00 ? 455 HIS A HE1  7  
ATOM   9133  N  N    . GLY A 1 35 ? 1.018   -10.725 -3.033  1.00 0.00 ? 456 GLY A N    7  
ATOM   9134  C  CA   . GLY A 1 35 ? 0.944   -10.887 -1.593  1.00 0.00 ? 456 GLY A CA   7  
ATOM   9135  C  C    . GLY A 1 35 ? 2.311   -10.871 -0.937  1.00 0.00 ? 456 GLY A C    7  
ATOM   9136  O  O    . GLY A 1 35 ? 2.593   -10.021 -0.093  1.00 0.00 ? 456 GLY A O    7  
ATOM   9137  H  H    . GLY A 1 35 ? 0.960   -11.512 -3.616  1.00 0.00 ? 456 GLY A H    7  
ATOM   9138  H  HA2  . GLY A 1 35 ? 0.350   -10.084 -1.182  1.00 0.00 ? 456 GLY A HA2  7  
ATOM   9139  H  HA3  . GLY A 1 35 ? 0.462   -11.828 -1.372  1.00 0.00 ? 456 GLY A HA3  7  
ATOM   9140  N  N    . ASP A 1 36 ? 3.161   -11.815 -1.324  1.00 0.00 ? 457 ASP A N    7  
ATOM   9141  C  CA   . ASP A 1 36 ? 4.506   -11.908 -0.768  1.00 0.00 ? 457 ASP A CA   7  
ATOM   9142  C  C    . ASP A 1 36 ? 5.065   -10.521 -0.465  1.00 0.00 ? 457 ASP A C    7  
ATOM   9143  O  O    . ASP A 1 36 ? 5.617   -10.285 0.611   1.00 0.00 ? 457 ASP A O    7  
ATOM   9144  C  CB   . ASP A 1 36 ? 5.433   -12.644 -1.737  1.00 0.00 ? 457 ASP A CB   7  
ATOM   9145  C  CG   . ASP A 1 36 ? 4.940   -14.041 -2.061  1.00 0.00 ? 457 ASP A CG   7  
ATOM   9146  O  OD1  . ASP A 1 36 ? 5.232   -14.970 -1.279  1.00 0.00 ? 457 ASP A OD1  7  
ATOM   9147  O  OD2  . ASP A 1 36 ? 4.260   -14.204 -3.096  1.00 0.00 ? 457 ASP A OD2  7  
ATOM   9148  H  H    . ASP A 1 36 ? 2.878   -12.466 -2.001  1.00 0.00 ? 457 ASP A H    7  
ATOM   9149  H  HA   . ASP A 1 36 ? 4.446   -12.468 0.153   1.00 0.00 ? 457 ASP A HA   7  
ATOM   9150  H  HB2  . ASP A 1 36 ? 5.499   -12.083 -2.658  1.00 0.00 ? 457 ASP A HB2  7  
ATOM   9151  H  HB3  . ASP A 1 36 ? 6.416   -12.722 -1.296  1.00 0.00 ? 457 ASP A HB3  7  
ATOM   9152  N  N    . PHE A 1 37 ? 4.920   -9.609  -1.419  1.00 0.00 ? 458 PHE A N    7  
ATOM   9153  C  CA   . PHE A 1 37 ? 5.413   -8.246  -1.255  1.00 0.00 ? 458 PHE A CA   7  
ATOM   9154  C  C    . PHE A 1 37 ? 5.014   -7.684  0.107   1.00 0.00 ? 458 PHE A C    7  
ATOM   9155  O  O    . PHE A 1 37 ? 3.843   -7.679  0.486   1.00 0.00 ? 458 PHE A O    7  
ATOM   9156  C  CB   . PHE A 1 37 ? 4.870   -7.347  -2.369  1.00 0.00 ? 458 PHE A CB   7  
ATOM   9157  C  CG   . PHE A 1 37 ? 5.662   -6.086  -2.560  1.00 0.00 ? 458 PHE A CG   7  
ATOM   9158  C  CD1  . PHE A 1 37 ? 6.927   -6.125  -3.124  1.00 0.00 ? 458 PHE A CD1  7  
ATOM   9159  C  CD2  . PHE A 1 37 ? 5.141   -4.860  -2.177  1.00 0.00 ? 458 PHE A CD2  7  
ATOM   9160  C  CE1  . PHE A 1 37 ? 7.658   -4.965  -3.300  1.00 0.00 ? 458 PHE A CE1  7  
ATOM   9161  C  CE2  . PHE A 1 37 ? 5.867   -3.697  -2.351  1.00 0.00 ? 458 PHE A CE2  7  
ATOM   9162  C  CZ   . PHE A 1 37 ? 7.127   -3.750  -2.915  1.00 0.00 ? 458 PHE A CZ   7  
ATOM   9163  H  H    . PHE A 1 37 ? 4.472   -9.858  -2.255  1.00 0.00 ? 458 PHE A H    7  
ATOM   9164  H  HA   . PHE A 1 37 ? 6.489   -8.273  -1.319  1.00 0.00 ? 458 PHE A HA   7  
ATOM   9165  H  HB2  . PHE A 1 37 ? 4.885   -7.892  -3.300  1.00 0.00 ? 458 PHE A HB2  7  
ATOM   9166  H  HB3  . PHE A 1 37 ? 3.853   -7.070  -2.134  1.00 0.00 ? 458 PHE A HB3  7  
ATOM   9167  H  HD1  . PHE A 1 37 ? 7.343   -7.074  -3.427  1.00 0.00 ? 458 PHE A HD1  7  
ATOM   9168  H  HD2  . PHE A 1 37 ? 4.155   -4.818  -1.736  1.00 0.00 ? 458 PHE A HD2  7  
ATOM   9169  H  HE1  . PHE A 1 37 ? 8.643   -5.009  -3.741  1.00 0.00 ? 458 PHE A HE1  7  
ATOM   9170  H  HE2  . PHE A 1 37 ? 5.449   -2.749  -2.049  1.00 0.00 ? 458 PHE A HE2  7  
ATOM   9171  H  HZ   . PHE A 1 37 ? 7.696   -2.843  -3.051  1.00 0.00 ? 458 PHE A HZ   7  
ATOM   9172  N  N    . PRO A 1 38 ? 6.012   -7.199  0.861   1.00 0.00 ? 459 PRO A N    7  
ATOM   9173  C  CA   . PRO A 1 38 ? 5.792   -6.626  2.192   1.00 0.00 ? 459 PRO A CA   7  
ATOM   9174  C  C    . PRO A 1 38 ? 5.056   -5.292  2.134   1.00 0.00 ? 459 PRO A C    7  
ATOM   9175  O  O    . PRO A 1 38 ? 5.386   -4.424  1.325   1.00 0.00 ? 459 PRO A O    7  
ATOM   9176  C  CB   . PRO A 1 38 ? 7.210   -6.431  2.733   1.00 0.00 ? 459 PRO A CB   7  
ATOM   9177  C  CG   . PRO A 1 38 ? 8.064   -6.299  1.520   1.00 0.00 ? 459 PRO A CG   7  
ATOM   9178  C  CD   . PRO A 1 38 ? 7.432   -7.173  0.472   1.00 0.00 ? 459 PRO A CD   7  
ATOM   9179  H  HA   . PRO A 1 38 ? 5.250   -7.307  2.832   1.00 0.00 ? 459 PRO A HA   7  
ATOM   9180  H  HB2  . PRO A 1 38 ? 7.246   -5.539  3.342   1.00 0.00 ? 459 PRO A HB2  7  
ATOM   9181  H  HB3  . PRO A 1 38 ? 7.494   -7.289  3.325   1.00 0.00 ? 459 PRO A HB3  7  
ATOM   9182  H  HG2  . PRO A 1 38 ? 8.080   -5.271  1.192   1.00 0.00 ? 459 PRO A HG2  7  
ATOM   9183  H  HG3  . PRO A 1 38 ? 9.065   -6.641  1.737   1.00 0.00 ? 459 PRO A HG3  7  
ATOM   9184  H  HD2  . PRO A 1 38 ? 7.555   -6.736  -0.508  1.00 0.00 ? 459 PRO A HD2  7  
ATOM   9185  H  HD3  . PRO A 1 38 ? 7.858   -8.165  0.500   1.00 0.00 ? 459 PRO A HD3  7  
ATOM   9186  N  N    . CYS A 1 39 ? 4.058   -5.134  2.996   1.00 0.00 ? 460 CYS A N    7  
ATOM   9187  C  CA   . CYS A 1 39 ? 3.275   -3.905  3.044   1.00 0.00 ? 460 CYS A CA   7  
ATOM   9188  C  C    . CYS A 1 39 ? 4.182   -2.687  3.191   1.00 0.00 ? 460 CYS A C    7  
ATOM   9189  O  O    . CYS A 1 39 ? 5.218   -2.746  3.853   1.00 0.00 ? 460 CYS A O    7  
ATOM   9190  C  CB   . CYS A 1 39 ? 2.278   -3.955  4.204   1.00 0.00 ? 460 CYS A CB   7  
ATOM   9191  S  SG   . CYS A 1 39 ? 0.924   -2.743  4.074   1.00 0.00 ? 460 CYS A SG   7  
ATOM   9192  H  H    . CYS A 1 39 ? 3.842   -5.862  3.617   1.00 0.00 ? 460 CYS A H    7  
ATOM   9193  H  HA   . CYS A 1 39 ? 2.729   -3.823  2.116   1.00 0.00 ? 460 CYS A HA   7  
ATOM   9194  H  HB2  . CYS A 1 39 ? 1.834   -4.939  4.245   1.00 0.00 ? 460 CYS A HB2  7  
ATOM   9195  H  HB3  . CYS A 1 39 ? 2.803   -3.764  5.128   1.00 0.00 ? 460 CYS A HB3  7  
ATOM   9196  N  N    . LYS A 1 40 ? 3.785   -1.582  2.568   1.00 0.00 ? 461 LYS A N    7  
ATOM   9197  C  CA   . LYS A 1 40 ? 4.560   -0.348  2.630   1.00 0.00 ? 461 LYS A CA   7  
ATOM   9198  C  C    . LYS A 1 40 ? 4.303   0.391   3.939   1.00 0.00 ? 461 LYS A C    7  
ATOM   9199  O  O    . LYS A 1 40 ? 5.190   0.501   4.786   1.00 0.00 ? 461 LYS A O    7  
ATOM   9200  C  CB   . LYS A 1 40 ? 4.213   0.555   1.444   1.00 0.00 ? 461 LYS A CB   7  
ATOM   9201  C  CG   . LYS A 1 40 ? 5.063   1.811   1.368   1.00 0.00 ? 461 LYS A CG   7  
ATOM   9202  C  CD   . LYS A 1 40 ? 4.504   2.803   0.362   1.00 0.00 ? 461 LYS A CD   7  
ATOM   9203  C  CE   . LYS A 1 40 ? 4.939   4.226   0.680   1.00 0.00 ? 461 LYS A CE   7  
ATOM   9204  N  NZ   . LYS A 1 40 ? 3.974   4.912   1.584   1.00 0.00 ? 461 LYS A NZ   7  
ATOM   9205  H  H    . LYS A 1 40 ? 2.949   -1.597  2.055   1.00 0.00 ? 461 LYS A H    7  
ATOM   9206  H  HA   . LYS A 1 40 ? 5.606   -0.611  2.577   1.00 0.00 ? 461 LYS A HA   7  
ATOM   9207  H  HB2  . LYS A 1 40 ? 4.349   -0.003  0.530   1.00 0.00 ? 461 LYS A HB2  7  
ATOM   9208  H  HB3  . LYS A 1 40 ? 3.177   0.852   1.524   1.00 0.00 ? 461 LYS A HB3  7  
ATOM   9209  H  HG2  . LYS A 1 40 ? 5.089   2.278   2.341   1.00 0.00 ? 461 LYS A HG2  7  
ATOM   9210  H  HG3  . LYS A 1 40 ? 6.066   1.539   1.071   1.00 0.00 ? 461 LYS A HG3  7  
ATOM   9211  H  HD2  . LYS A 1 40 ? 4.859   2.543   -0.624  1.00 0.00 ? 461 LYS A HD2  7  
ATOM   9212  H  HD3  . LYS A 1 40 ? 3.424   2.753   0.383   1.00 0.00 ? 461 LYS A HD3  7  
ATOM   9213  H  HE2  . LYS A 1 40 ? 5.906   4.194   1.159   1.00 0.00 ? 461 LYS A HE2  7  
ATOM   9214  H  HE3  . LYS A 1 40 ? 5.012   4.781   -0.243  1.00 0.00 ? 461 LYS A HE3  7  
ATOM   9215  H  HZ1  . LYS A 1 40 ? 3.128   5.199   1.050   1.00 0.00 ? 461 LYS A HZ1  7  
ATOM   9216  H  HZ2  . LYS A 1 40 ? 4.412   5.759   1.997   1.00 0.00 ? 461 LYS A HZ2  7  
ATOM   9217  H  HZ3  . LYS A 1 40 ? 3.686   4.273   2.352   1.00 0.00 ? 461 LYS A HZ3  7  
ATOM   9218  N  N    . LEU A 1 41 ? 3.084   0.895   4.098   1.00 0.00 ? 462 LEU A N    7  
ATOM   9219  C  CA   . LEU A 1 41 ? 2.709   1.623   5.306   1.00 0.00 ? 462 LEU A CA   7  
ATOM   9220  C  C    . LEU A 1 41 ? 3.199   0.897   6.554   1.00 0.00 ? 462 LEU A C    7  
ATOM   9221  O  O    . LEU A 1 41 ? 3.963   1.448   7.346   1.00 0.00 ? 462 LEU A O    7  
ATOM   9222  C  CB   . LEU A 1 41 ? 1.191   1.801   5.367   1.00 0.00 ? 462 LEU A CB   7  
ATOM   9223  C  CG   . LEU A 1 41 ? 0.612   2.932   4.516   1.00 0.00 ? 462 LEU A CG   7  
ATOM   9224  C  CD1  . LEU A 1 41 ? -0.908  2.912   4.565   1.00 0.00 ? 462 LEU A CD1  7  
ATOM   9225  C  CD2  . LEU A 1 41 ? 1.145   4.278   4.984   1.00 0.00 ? 462 LEU A CD2  7  
ATOM   9226  H  H    . LEU A 1 41 ? 2.420   0.776   3.388   1.00 0.00 ? 462 LEU A H    7  
ATOM   9227  H  HA   . LEU A 1 41 ? 3.176   2.596   5.264   1.00 0.00 ? 462 LEU A HA   7  
ATOM   9228  H  HB2  . LEU A 1 41 ? 0.737   0.877   5.043   1.00 0.00 ? 462 LEU A HB2  7  
ATOM   9229  H  HB3  . LEU A 1 41 ? 0.923   1.990   6.397   1.00 0.00 ? 462 LEU A HB3  7  
ATOM   9230  H  HG   . LEU A 1 41 ? 0.915   2.790   3.488   1.00 0.00 ? 462 LEU A HG   7  
ATOM   9231  H  HD11 . LEU A 1 41 ? -1.255  3.654   5.267   1.00 0.00 ? 462 LEU A HD11 7  
ATOM   9232  H  HD12 . LEU A 1 41 ? -1.245  1.935   4.878   1.00 0.00 ? 462 LEU A HD12 7  
ATOM   9233  H  HD13 . LEU A 1 41 ? -1.302  3.131   3.583   1.00 0.00 ? 462 LEU A HD13 7  
ATOM   9234  H  HD21 . LEU A 1 41 ? 2.157   4.407   4.629   1.00 0.00 ? 462 LEU A HD21 7  
ATOM   9235  H  HD22 . LEU A 1 41 ? 1.136   4.313   6.064   1.00 0.00 ? 462 LEU A HD22 7  
ATOM   9236  H  HD23 . LEU A 1 41 ? 0.522   5.068   4.593   1.00 0.00 ? 462 LEU A HD23 7  
ATOM   9237  N  N    . TYR A 1 42 ? 2.756   -0.345  6.721   1.00 0.00 ? 463 TYR A N    7  
ATOM   9238  C  CA   . TYR A 1 42 ? 3.150   -1.147  7.873   1.00 0.00 ? 463 TYR A CA   7  
ATOM   9239  C  C    . TYR A 1 42 ? 4.621   -0.928  8.213   1.00 0.00 ? 463 TYR A C    7  
ATOM   9240  O  O    . TYR A 1 42 ? 5.040   -1.114  9.356   1.00 0.00 ? 463 TYR A O    7  
ATOM   9241  C  CB   . TYR A 1 42 ? 2.893   -2.630  7.599   1.00 0.00 ? 463 TYR A CB   7  
ATOM   9242  C  CG   . TYR A 1 42 ? 3.145   -3.520  8.796   1.00 0.00 ? 463 TYR A CG   7  
ATOM   9243  C  CD1  . TYR A 1 42 ? 4.438   -3.853  9.178   1.00 0.00 ? 463 TYR A CD1  7  
ATOM   9244  C  CD2  . TYR A 1 42 ? 2.090   -4.027  9.543   1.00 0.00 ? 463 TYR A CD2  7  
ATOM   9245  C  CE1  . TYR A 1 42 ? 4.673   -4.666  10.270  1.00 0.00 ? 463 TYR A CE1  7  
ATOM   9246  C  CE2  . TYR A 1 42 ? 2.315   -4.839  10.638  1.00 0.00 ? 463 TYR A CE2  7  
ATOM   9247  C  CZ   . TYR A 1 42 ? 3.609   -5.156  10.997  1.00 0.00 ? 463 TYR A CZ   7  
ATOM   9248  O  OH   . TYR A 1 42 ? 3.837   -5.966  12.086  1.00 0.00 ? 463 TYR A OH   7  
ATOM   9249  H  H    . TYR A 1 42 ? 2.149   -0.730  6.055   1.00 0.00 ? 463 TYR A H    7  
ATOM   9250  H  HA   . TYR A 1 42 ? 2.547   -0.838  8.714   1.00 0.00 ? 463 TYR A HA   7  
ATOM   9251  H  HB2  . TYR A 1 42 ? 1.865   -2.762  7.300   1.00 0.00 ? 463 TYR A HB2  7  
ATOM   9252  H  HB3  . TYR A 1 42 ? 3.541   -2.959  6.799   1.00 0.00 ? 463 TYR A HB3  7  
ATOM   9253  H  HD1  . TYR A 1 42 ? 5.271   -3.468  8.607   1.00 0.00 ? 463 TYR A HD1  7  
ATOM   9254  H  HD2  . TYR A 1 42 ? 1.078   -3.777  9.259   1.00 0.00 ? 463 TYR A HD2  7  
ATOM   9255  H  HE1  . TYR A 1 42 ? 5.686   -4.914  10.552  1.00 0.00 ? 463 TYR A HE1  7  
ATOM   9256  H  HE2  . TYR A 1 42 ? 1.481   -5.223  11.207  1.00 0.00 ? 463 TYR A HE2  7  
ATOM   9257  H  HH   . TYR A 1 42 ? 3.098   -6.568  12.198  1.00 0.00 ? 463 TYR A HH   7  
ATOM   9258  N  N    . HIS A 1 43 ? 5.400   -0.531  7.212   1.00 0.00 ? 464 HIS A N    7  
ATOM   9259  C  CA   . HIS A 1 43 ? 6.825   -0.285  7.404   1.00 0.00 ? 464 HIS A CA   7  
ATOM   9260  C  C    . HIS A 1 43 ? 7.103   1.208   7.555   1.00 0.00 ? 464 HIS A C    7  
ATOM   9261  O  O    . HIS A 1 43 ? 7.719   1.640   8.529   1.00 0.00 ? 464 HIS A O    7  
ATOM   9262  C  CB   . HIS A 1 43 ? 7.624   -0.848  6.229   1.00 0.00 ? 464 HIS A CB   7  
ATOM   9263  C  CG   . HIS A 1 43 ? 7.852   -2.326  6.313   1.00 0.00 ? 464 HIS A CG   7  
ATOM   9264  N  ND1  . HIS A 1 43 ? 8.315   -2.953  7.450   1.00 0.00 ? 464 HIS A ND1  7  
ATOM   9265  C  CD2  . HIS A 1 43 ? 7.675   -3.303  5.392   1.00 0.00 ? 464 HIS A CD2  7  
ATOM   9266  C  CE1  . HIS A 1 43 ? 8.415   -4.251  7.225   1.00 0.00 ? 464 HIS A CE1  7  
ATOM   9267  N  NE2  . HIS A 1 43 ? 8.032   -4.489  5.984   1.00 0.00 ? 464 HIS A NE2  7  
ATOM   9268  H  H    . HIS A 1 43 ? 5.007   -0.400  6.324   1.00 0.00 ? 464 HIS A H    7  
ATOM   9269  H  HA   . HIS A 1 43 ? 7.129   -0.788  8.309   1.00 0.00 ? 464 HIS A HA   7  
ATOM   9270  H  HB2  . HIS A 1 43 ? 7.092   -0.647  5.311   1.00 0.00 ? 464 HIS A HB2  7  
ATOM   9271  H  HB3  . HIS A 1 43 ? 8.590   -0.365  6.194   1.00 0.00 ? 464 HIS A HB3  7  
ATOM   9272  H  HD2  . HIS A 1 43 ? 7.319   -3.174  4.380   1.00 0.00 ? 464 HIS A HD2  7  
ATOM   9273  H  HE1  . HIS A 1 43 ? 8.752   -4.991  7.935   1.00 0.00 ? 464 HIS A HE1  7  
ATOM   9274  H  HE2  . HIS A 1 43 ? 8.090   -5.357  5.533   1.00 0.00 ? 464 HIS A HE2  7  
ATOM   9275  N  N    . THR A 1 44 ? 6.644   1.991   6.584   1.00 0.00 ? 465 THR A N    7  
ATOM   9276  C  CA   . THR A 1 44 ? 6.845   3.434   6.607   1.00 0.00 ? 465 THR A CA   7  
ATOM   9277  C  C    . THR A 1 44 ? 6.820   3.970   8.034   1.00 0.00 ? 465 THR A C    7  
ATOM   9278  O  O    . THR A 1 44 ? 7.609   4.843   8.395   1.00 0.00 ? 465 THR A O    7  
ATOM   9279  C  CB   . THR A 1 44 ? 5.772   4.164   5.778   1.00 0.00 ? 465 THR A CB   7  
ATOM   9280  O  OG1  . THR A 1 44 ? 4.497   4.055   6.421   1.00 0.00 ? 465 THR A OG1  7  
ATOM   9281  C  CG2  . THR A 1 44 ? 5.688   3.587   4.373   1.00 0.00 ? 465 THR A CG2  7  
ATOM   9282  H  H    . THR A 1 44 ? 6.160   1.587   5.833   1.00 0.00 ? 465 THR A H    7  
ATOM   9283  H  HA   . THR A 1 44 ? 7.811   3.644   6.171   1.00 0.00 ? 465 THR A HA   7  
ATOM   9284  H  HB   . THR A 1 44 ? 6.042   5.208   5.706   1.00 0.00 ? 465 THR A HB   7  
ATOM   9285  H  HG1  . THR A 1 44 ? 4.435   3.207   6.867   1.00 0.00 ? 465 THR A HG1  7  
ATOM   9286  H  HG21 . THR A 1 44 ? 5.428   4.371   3.676   1.00 0.00 ? 465 THR A HG21 7  
ATOM   9287  H  HG22 . THR A 1 44 ? 4.933   2.816   4.345   1.00 0.00 ? 465 THR A HG22 7  
ATOM   9288  H  HG23 . THR A 1 44 ? 6.644   3.166   4.100   1.00 0.00 ? 465 THR A HG23 7  
ATOM   9289  N  N    . THR A 1 45 ? 5.908   3.441   8.844   1.00 0.00 ? 466 THR A N    7  
ATOM   9290  C  CA   . THR A 1 45 ? 5.779   3.866   10.232  1.00 0.00 ? 466 THR A CA   7  
ATOM   9291  C  C    . THR A 1 45 ? 5.832   2.673   11.179  1.00 0.00 ? 466 THR A C    7  
ATOM   9292  O  O    . THR A 1 45 ? 6.332   2.778   12.298  1.00 0.00 ? 466 THR A O    7  
ATOM   9293  C  CB   . THR A 1 45 ? 4.465   4.635   10.465  1.00 0.00 ? 466 THR A CB   7  
ATOM   9294  O  OG1  . THR A 1 45 ? 3.345   3.789   10.177  1.00 0.00 ? 466 THR A OG1  7  
ATOM   9295  C  CG2  . THR A 1 45 ? 4.404   5.880   9.592   1.00 0.00 ? 466 THR A CG2  7  
ATOM   9296  H  H    . THR A 1 45 ? 5.307   2.748   8.498   1.00 0.00 ? 466 THR A H    7  
ATOM   9297  H  HA   . THR A 1 45 ? 6.603   4.528   10.456  1.00 0.00 ? 466 THR A HA   7  
ATOM   9298  H  HB   . THR A 1 45 ? 4.421   4.937   11.501  1.00 0.00 ? 466 THR A HB   7  
ATOM   9299  H  HG1  . THR A 1 45 ? 3.493   2.921   10.560  1.00 0.00 ? 466 THR A HG1  7  
ATOM   9300  H  HG21 . THR A 1 45 ? 5.171   6.574   9.902   1.00 0.00 ? 466 THR A HG21 7  
ATOM   9301  H  HG22 . THR A 1 45 ? 3.434   6.344   9.695   1.00 0.00 ? 466 THR A HG22 7  
ATOM   9302  H  HG23 . THR A 1 45 ? 4.564   5.604   8.561   1.00 0.00 ? 466 THR A HG23 7  
ATOM   9303  N  N    . GLY A 1 46 ? 5.312   1.537   10.723  1.00 0.00 ? 467 GLY A N    7  
ATOM   9304  C  CA   . GLY A 1 46 ? 5.310   0.340   11.544  1.00 0.00 ? 467 GLY A CA   7  
ATOM   9305  C  C    . GLY A 1 46 ? 3.956   -0.339  11.576  1.00 0.00 ? 467 GLY A C    7  
ATOM   9306  O  O    . GLY A 1 46 ? 3.868   -1.565  11.533  1.00 0.00 ? 467 GLY A O    7  
ATOM   9307  H  H    . GLY A 1 46 ? 4.926   1.512   9.823   1.00 0.00 ? 467 GLY A H    7  
ATOM   9308  H  HA2  . GLY A 1 46 ? 6.040   -0.352  11.152  1.00 0.00 ? 467 GLY A HA2  7  
ATOM   9309  H  HA3  . GLY A 1 46 ? 5.589   0.609   12.552  1.00 0.00 ? 467 GLY A HA3  7  
ATOM   9310  N  N    . ASN A 1 47 ? 2.896   0.460   11.653  1.00 0.00 ? 468 ASN A N    7  
ATOM   9311  C  CA   . ASN A 1 47 ? 1.539   -0.072  11.693  1.00 0.00 ? 468 ASN A CA   7  
ATOM   9312  C  C    . ASN A 1 47 ? 0.798   0.229   10.394  1.00 0.00 ? 468 ASN A C    7  
ATOM   9313  O  O    . ASN A 1 47 ? 1.059   1.238   9.737   1.00 0.00 ? 468 ASN A O    7  
ATOM   9314  C  CB   . ASN A 1 47 ? 0.773   0.517   12.879  1.00 0.00 ? 468 ASN A CB   7  
ATOM   9315  C  CG   . ASN A 1 47 ? -0.440  -0.313  13.252  1.00 0.00 ? 468 ASN A CG   7  
ATOM   9316  O  OD1  . ASN A 1 47 ? -0.470  -1.524  13.033  1.00 0.00 ? 468 ASN A OD1  7  
ATOM   9317  N  ND2  . ASN A 1 47 ? -1.449  0.338   13.820  1.00 0.00 ? 468 ASN A ND2  7  
ATOM   9318  H  H    . ASN A 1 47 ? 3.030   1.430   11.684  1.00 0.00 ? 468 ASN A H    7  
ATOM   9319  H  HA   . ASN A 1 47 ? 1.606   -1.143  11.815  1.00 0.00 ? 468 ASN A HA   7  
ATOM   9320  H  HB2  . ASN A 1 47 ? 1.429   0.565   13.735  1.00 0.00 ? 468 ASN A HB2  7  
ATOM   9321  H  HB3  . ASN A 1 47 ? 0.442   1.513   12.627  1.00 0.00 ? 468 ASN A HB3  7  
ATOM   9322  H  HD21 . ASN A 1 47 ? -1.356  1.303   13.964  1.00 0.00 ? 468 ASN A HD21 7  
ATOM   9323  H  HD22 . ASN A 1 47 ? -2.246  -0.174  14.073  1.00 0.00 ? 468 ASN A HD22 7  
ATOM   9324  N  N    . CYS A 1 48 ? -0.128  -0.651  10.029  1.00 0.00 ? 469 CYS A N    7  
ATOM   9325  C  CA   . CYS A 1 48 ? -0.908  -0.481  8.809   1.00 0.00 ? 469 CYS A CA   7  
ATOM   9326  C  C    . CYS A 1 48 ? -2.301  0.054   9.125   1.00 0.00 ? 469 CYS A C    7  
ATOM   9327  O  O    . CYS A 1 48 ? -2.899  -0.302  10.141  1.00 0.00 ? 469 CYS A O    7  
ATOM   9328  C  CB   . CYS A 1 48 ? -1.018  -1.810  8.059   1.00 0.00 ? 469 CYS A CB   7  
ATOM   9329  S  SG   . CYS A 1 48 ? -1.534  -1.642  6.320   1.00 0.00 ? 469 CYS A SG   7  
ATOM   9330  H  H    . CYS A 1 48 ? -0.291  -1.436  10.594  1.00 0.00 ? 469 CYS A H    7  
ATOM   9331  H  HA   . CYS A 1 48 ? -0.394  0.234   8.184   1.00 0.00 ? 469 CYS A HA   7  
ATOM   9332  H  HB2  . CYS A 1 48 ? -0.055  -2.300  8.069   1.00 0.00 ? 469 CYS A HB2  7  
ATOM   9333  H  HB3  . CYS A 1 48 ? -1.741  -2.437  8.558   1.00 0.00 ? 469 CYS A HB3  7  
ATOM   9334  N  N    . ILE A 1 49 ? -2.813  0.911   8.247   1.00 0.00 ? 470 ILE A N    7  
ATOM   9335  C  CA   . ILE A 1 49 ? -4.136  1.494   8.432   1.00 0.00 ? 470 ILE A CA   7  
ATOM   9336  C  C    . ILE A 1 49 ? -5.230  0.455   8.208   1.00 0.00 ? 470 ILE A C    7  
ATOM   9337  O  O    . ILE A 1 49 ? -6.233  0.432   8.921   1.00 0.00 ? 470 ILE A O    7  
ATOM   9338  C  CB   . ILE A 1 49 ? -4.367  2.680   7.477   1.00 0.00 ? 470 ILE A CB   7  
ATOM   9339  C  CG1  . ILE A 1 49 ? -5.736  3.313   7.736   1.00 0.00 ? 470 ILE A CG1  7  
ATOM   9340  C  CG2  . ILE A 1 49 ? -4.254  2.224   6.030   1.00 0.00 ? 470 ILE A CG2  7  
ATOM   9341  C  CD1  . ILE A 1 49 ? -5.805  4.094   9.030   1.00 0.00 ? 470 ILE A CD1  7  
ATOM   9342  H  H    . ILE A 1 49 ? -2.289  1.156   7.457   1.00 0.00 ? 470 ILE A H    7  
ATOM   9343  H  HA   . ILE A 1 49 ? -4.201  1.857   9.447   1.00 0.00 ? 470 ILE A HA   7  
ATOM   9344  H  HB   . ILE A 1 49 ? -3.598  3.415   7.659   1.00 0.00 ? 470 ILE A HB   7  
ATOM   9345  H  HG12 . ILE A 1 49 ? -5.972  3.988   6.929   1.00 0.00 ? 470 ILE A HG12 7  
ATOM   9346  H  HG13 . ILE A 1 49 ? -6.482  2.533   7.778   1.00 0.00 ? 470 ILE A HG13 7  
ATOM   9347  H  HG21 . ILE A 1 49 ? -4.079  3.081   5.395   1.00 0.00 ? 470 ILE A HG21 7  
ATOM   9348  H  HG22 . ILE A 1 49 ? -3.430  1.533   5.934   1.00 0.00 ? 470 ILE A HG22 7  
ATOM   9349  H  HG23 . ILE A 1 49 ? -5.170  1.737   5.732   1.00 0.00 ? 470 ILE A HG23 7  
ATOM   9350  H  HD11 . ILE A 1 49 ? -5.188  4.976   8.952   1.00 0.00 ? 470 ILE A HD11 7  
ATOM   9351  H  HD12 . ILE A 1 49 ? -6.827  4.383   9.222   1.00 0.00 ? 470 ILE A HD12 7  
ATOM   9352  H  HD13 . ILE A 1 49 ? -5.447  3.477   9.842   1.00 0.00 ? 470 ILE A HD13 7  
ATOM   9353  N  N    . ASN A 1 50 ? -5.029  -0.404  7.214   1.00 0.00 ? 471 ASN A N    7  
ATOM   9354  C  CA   . ASN A 1 50 ? -5.998  -1.446  6.897   1.00 0.00 ? 471 ASN A CA   7  
ATOM   9355  C  C    . ASN A 1 50 ? -6.397  -2.218  8.151   1.00 0.00 ? 471 ASN A C    7  
ATOM   9356  O  O    . ASN A 1 50 ? -7.534  -2.130  8.613   1.00 0.00 ? 471 ASN A O    7  
ATOM   9357  C  CB   . ASN A 1 50 ? -5.422  -2.407  5.855   1.00 0.00 ? 471 ASN A CB   7  
ATOM   9358  C  CG   . ASN A 1 50 ? -6.499  -3.211  5.152   1.00 0.00 ? 471 ASN A CG   7  
ATOM   9359  O  OD1  . ASN A 1 50 ? -7.039  -4.167  5.709   1.00 0.00 ? 471 ASN A OD1  7  
ATOM   9360  N  ND2  . ASN A 1 50 ? -6.816  -2.825  3.921   1.00 0.00 ? 471 ASN A ND2  7  
ATOM   9361  H  H    . ASN A 1 50 ? -4.210  -0.335  6.681   1.00 0.00 ? 471 ASN A H    7  
ATOM   9362  H  HA   . ASN A 1 50 ? -6.876  -0.970  6.488   1.00 0.00 ? 471 ASN A HA   7  
ATOM   9363  H  HB2  . ASN A 1 50 ? -4.881  -1.840  5.112   1.00 0.00 ? 471 ASN A HB2  7  
ATOM   9364  H  HB3  . ASN A 1 50 ? -4.746  -3.094  6.341   1.00 0.00 ? 471 ASN A HB3  7  
ATOM   9365  H  HD21 . ASN A 1 50 ? -6.344  -2.055  3.541   1.00 0.00 ? 471 ASN A HD21 7  
ATOM   9366  H  HD22 . ASN A 1 50 ? -7.510  -3.327  3.444   1.00 0.00 ? 471 ASN A HD22 7  
ATOM   9367  N  N    . GLY A 1 51 ? -5.451  -2.976  8.699   1.00 0.00 ? 472 GLY A N    7  
ATOM   9368  C  CA   . GLY A 1 51 ? -5.722  -3.752  9.895   1.00 0.00 ? 472 GLY A CA   7  
ATOM   9369  C  C    . GLY A 1 51 ? -5.053  -5.112  9.868   1.00 0.00 ? 472 GLY A C    7  
ATOM   9370  O  O    . GLY A 1 51 ? -4.041  -5.300  9.192   1.00 0.00 ? 472 GLY A O    7  
ATOM   9371  H  H    . GLY A 1 51 ? -4.562  -3.008  8.288   1.00 0.00 ? 472 GLY A H    7  
ATOM   9372  H  HA2  . GLY A 1 51 ? -5.366  -3.204  10.755  1.00 0.00 ? 472 GLY A HA2  7  
ATOM   9373  H  HA3  . GLY A 1 51 ? -6.790  -3.890  9.986   1.00 0.00 ? 472 GLY A HA3  7  
ATOM   9374  N  N    . ASP A 1 52 ? -5.618  -6.062  10.605  1.00 0.00 ? 473 ASP A N    7  
ATOM   9375  C  CA   . ASP A 1 52 ? -5.070  -7.412  10.663  1.00 0.00 ? 473 ASP A CA   7  
ATOM   9376  C  C    . ASP A 1 52 ? -5.367  -8.175  9.377   1.00 0.00 ? 473 ASP A C    7  
ATOM   9377  O  O    . ASP A 1 52 ? -4.656  -9.116  9.023   1.00 0.00 ? 473 ASP A O    7  
ATOM   9378  C  CB   . ASP A 1 52 ? -5.643  -8.167  11.863  1.00 0.00 ? 473 ASP A CB   7  
ATOM   9379  C  CG   . ASP A 1 52 ? -7.134  -7.945  12.029  1.00 0.00 ? 473 ASP A CG   7  
ATOM   9380  O  OD1  . ASP A 1 52 ? -7.804  -7.644  11.019  1.00 0.00 ? 473 ASP A OD1  7  
ATOM   9381  O  OD2  . ASP A 1 52 ? -7.630  -8.070  13.168  1.00 0.00 ? 473 ASP A OD2  7  
ATOM   9382  H  H    . ASP A 1 52 ? -6.424  -5.850  11.122  1.00 0.00 ? 473 ASP A H    7  
ATOM   9383  H  HA   . ASP A 1 52 ? -4.000  -7.330  10.779  1.00 0.00 ? 473 ASP A HA   7  
ATOM   9384  H  HB2  . ASP A 1 52 ? -5.468  -9.225  11.732  1.00 0.00 ? 473 ASP A HB2  7  
ATOM   9385  H  HB3  . ASP A 1 52 ? -5.146  -7.833  12.762  1.00 0.00 ? 473 ASP A HB3  7  
ATOM   9386  N  N    . ASP A 1 53 ? -6.422  -7.764  8.682   1.00 0.00 ? 474 ASP A N    7  
ATOM   9387  C  CA   . ASP A 1 53 ? -6.814  -8.410  7.434   1.00 0.00 ? 474 ASP A CA   7  
ATOM   9388  C  C    . ASP A 1 53 ? -6.368  -7.584  6.232   1.00 0.00 ? 474 ASP A C    7  
ATOM   9389  O  O    . ASP A 1 53 ? -7.155  -7.314  5.323   1.00 0.00 ? 474 ASP A O    7  
ATOM   9390  C  CB   . ASP A 1 53 ? -8.330  -8.613  7.395   1.00 0.00 ? 474 ASP A CB   7  
ATOM   9391  C  CG   . ASP A 1 53 ? -8.793  -9.702  8.342   1.00 0.00 ? 474 ASP A CG   7  
ATOM   9392  O  OD1  . ASP A 1 53 ? -8.383  -10.867 8.154   1.00 0.00 ? 474 ASP A OD1  7  
ATOM   9393  O  OD2  . ASP A 1 53 ? -9.564  -9.389  9.273   1.00 0.00 ? 474 ASP A OD2  7  
ATOM   9394  H  H    . ASP A 1 53 ? -6.950  -7.009  9.016   1.00 0.00 ? 474 ASP A H    7  
ATOM   9395  H  HA   . ASP A 1 53 ? -6.330  -9.373  7.393   1.00 0.00 ? 474 ASP A HA   7  
ATOM   9396  H  HB2  . ASP A 1 53 ? -8.818  -7.690  7.671   1.00 0.00 ? 474 ASP A HB2  7  
ATOM   9397  H  HB3  . ASP A 1 53 ? -8.624  -8.885  6.391   1.00 0.00 ? 474 ASP A HB3  7  
ATOM   9398  N  N    . CYS A 1 54 ? -5.101  -7.184  6.233   1.00 0.00 ? 475 CYS A N    7  
ATOM   9399  C  CA   . CYS A 1 54 ? -4.549  -6.387  5.143   1.00 0.00 ? 475 CYS A CA   7  
ATOM   9400  C  C    . CYS A 1 54 ? -4.208  -7.267  3.944   1.00 0.00 ? 475 CYS A C    7  
ATOM   9401  O  O    . CYS A 1 54 ? -3.839  -8.431  4.101   1.00 0.00 ? 475 CYS A O    7  
ATOM   9402  C  CB   . CYS A 1 54 ? -3.300  -5.639  5.613   1.00 0.00 ? 475 CYS A CB   7  
ATOM   9403  S  SG   . CYS A 1 54 ? -2.721  -4.358  4.454   1.00 0.00 ? 475 CYS A SG   7  
ATOM   9404  H  H    . CYS A 1 54 ? -4.522  -7.430  6.985   1.00 0.00 ? 475 CYS A H    7  
ATOM   9405  H  HA   . CYS A 1 54 ? -5.298  -5.668  4.845   1.00 0.00 ? 475 CYS A HA   7  
ATOM   9406  H  HB2  . CYS A 1 54 ? -3.512  -5.156  6.556   1.00 0.00 ? 475 CYS A HB2  7  
ATOM   9407  H  HB3  . CYS A 1 54 ? -2.496  -6.347  5.750   1.00 0.00 ? 475 CYS A HB3  7  
ATOM   9408  N  N    . MET A 1 55 ? -4.334  -6.702  2.748   1.00 0.00 ? 476 MET A N    7  
ATOM   9409  C  CA   . MET A 1 55 ? -4.038  -7.435  1.523   1.00 0.00 ? 476 MET A CA   7  
ATOM   9410  C  C    . MET A 1 55 ? -2.536  -7.464  1.256   1.00 0.00 ? 476 MET A C    7  
ATOM   9411  O  O    . MET A 1 55 ? -2.099  -7.742  0.139   1.00 0.00 ? 476 MET A O    7  
ATOM   9412  C  CB   . MET A 1 55 ? -4.766  -6.802  0.335   1.00 0.00 ? 476 MET A CB   7  
ATOM   9413  C  CG   . MET A 1 55 ? -4.412  -5.341  0.114   1.00 0.00 ? 476 MET A CG   7  
ATOM   9414  S  SD   . MET A 1 55 ? -2.764  -5.125  -0.587  1.00 0.00 ? 476 MET A SD   7  
ATOM   9415  C  CE   . MET A 1 55 ? -3.108  -5.344  -2.332  1.00 0.00 ? 476 MET A CE   7  
ATOM   9416  H  H    . MET A 1 55 ? -4.633  -5.771  2.687   1.00 0.00 ? 476 MET A H    7  
ATOM   9417  H  HA   . MET A 1 55 ? -4.388  -8.448  1.650   1.00 0.00 ? 476 MET A HA   7  
ATOM   9418  H  HB2  . MET A 1 55 ? -4.516  -7.351  -0.560  1.00 0.00 ? 476 MET A HB2  7  
ATOM   9419  H  HB3  . MET A 1 55 ? -5.831  -6.870  0.504   1.00 0.00 ? 476 MET A HB3  7  
ATOM   9420  H  HG2  . MET A 1 55 ? -5.134  -4.907  -0.561  1.00 0.00 ? 476 MET A HG2  7  
ATOM   9421  H  HG3  . MET A 1 55 ? -4.455  -4.827  1.063   1.00 0.00 ? 476 MET A HG3  7  
ATOM   9422  H  HE1  . MET A 1 55 ? -3.378  -4.394  -2.768  1.00 0.00 ? 476 MET A HE1  7  
ATOM   9423  H  HE2  . MET A 1 55 ? -2.228  -5.729  -2.825  1.00 0.00 ? 476 MET A HE2  7  
ATOM   9424  H  HE3  . MET A 1 55 ? -3.924  -6.041  -2.453  1.00 0.00 ? 476 MET A HE3  7  
ATOM   9425  N  N    . PHE A 1 56 ? -1.751  -7.174  2.288   1.00 0.00 ? 477 PHE A N    7  
ATOM   9426  C  CA   . PHE A 1 56 ? -0.298  -7.165  2.164   1.00 0.00 ? 477 PHE A CA   7  
ATOM   9427  C  C    . PHE A 1 56 ? 0.347   -7.999  3.268   1.00 0.00 ? 477 PHE A C    7  
ATOM   9428  O  O    . PHE A 1 56 ? -0.251  -8.224  4.320   1.00 0.00 ? 477 PHE A O    7  
ATOM   9429  C  CB   . PHE A 1 56 ? 0.231   -5.731  2.218   1.00 0.00 ? 477 PHE A CB   7  
ATOM   9430  C  CG   . PHE A 1 56 ? 0.095   -4.992  0.917   1.00 0.00 ? 477 PHE A CG   7  
ATOM   9431  C  CD1  . PHE A 1 56 ? 0.519   -5.568  -0.269  1.00 0.00 ? 477 PHE A CD1  7  
ATOM   9432  C  CD2  . PHE A 1 56 ? -0.458  -3.722  0.881   1.00 0.00 ? 477 PHE A CD2  7  
ATOM   9433  C  CE1  . PHE A 1 56 ? 0.395   -4.892  -1.468  1.00 0.00 ? 477 PHE A CE1  7  
ATOM   9434  C  CE2  . PHE A 1 56 ? -0.586  -3.041  -0.315  1.00 0.00 ? 477 PHE A CE2  7  
ATOM   9435  C  CZ   . PHE A 1 56 ? -0.158  -3.626  -1.491  1.00 0.00 ? 477 PHE A CZ   7  
ATOM   9436  H  H    . PHE A 1 56 ? -2.159  -6.960  3.154   1.00 0.00 ? 477 PHE A H    7  
ATOM   9437  H  HA   . PHE A 1 56 ? -0.045  -7.598  1.209   1.00 0.00 ? 477 PHE A HA   7  
ATOM   9438  H  HB2  . PHE A 1 56 ? -0.315  -5.181  2.970   1.00 0.00 ? 477 PHE A HB2  7  
ATOM   9439  H  HB3  . PHE A 1 56 ? 1.278   -5.750  2.482   1.00 0.00 ? 477 PHE A HB3  7  
ATOM   9440  H  HD1  . PHE A 1 56 ? 0.952   -6.559  -0.253  1.00 0.00 ? 477 PHE A HD1  7  
ATOM   9441  H  HD2  . PHE A 1 56 ? -0.792  -3.263  1.800   1.00 0.00 ? 477 PHE A HD2  7  
ATOM   9442  H  HE1  . PHE A 1 56 ? 0.731   -5.352  -2.386  1.00 0.00 ? 477 PHE A HE1  7  
ATOM   9443  H  HE2  . PHE A 1 56 ? -1.018  -2.052  -0.330  1.00 0.00 ? 477 PHE A HE2  7  
ATOM   9444  H  HZ   . PHE A 1 56 ? -0.257  -3.096  -2.426  1.00 0.00 ? 477 PHE A HZ   7  
ATOM   9445  N  N    . SER A 1 57 ? 1.571   -8.454  3.019   1.00 0.00 ? 478 SER A N    7  
ATOM   9446  C  CA   . SER A 1 57 ? 2.296   -9.266  3.989   1.00 0.00 ? 478 SER A CA   7  
ATOM   9447  C  C    . SER A 1 57 ? 2.923   -8.391  5.070   1.00 0.00 ? 478 SER A C    7  
ATOM   9448  O  O    . SER A 1 57 ? 3.620   -7.420  4.772   1.00 0.00 ? 478 SER A O    7  
ATOM   9449  C  CB   . SER A 1 57 ? 3.380   -10.087 3.289   1.00 0.00 ? 478 SER A CB   7  
ATOM   9450  O  OG   . SER A 1 57 ? 4.035   -9.323  2.292   1.00 0.00 ? 478 SER A OG   7  
ATOM   9451  H  H    . SER A 1 57 ? 1.995   -8.241  2.162   1.00 0.00 ? 478 SER A H    7  
ATOM   9452  H  HA   . SER A 1 57 ? 1.589   -9.939  4.452   1.00 0.00 ? 478 SER A HA   7  
ATOM   9453  H  HB2  . SER A 1 57 ? 4.110   -10.409 4.016   1.00 0.00 ? 478 SER A HB2  7  
ATOM   9454  H  HB3  . SER A 1 57 ? 2.929   -10.952 2.825   1.00 0.00 ? 478 SER A HB3  7  
ATOM   9455  H  HG   . SER A 1 57 ? 3.468   -9.249  1.521   1.00 0.00 ? 478 SER A HG   7  
ATOM   9456  N  N    . HIS A 1 58 ? 2.670   -8.741  6.327   1.00 0.00 ? 479 HIS A N    7  
ATOM   9457  C  CA   . HIS A 1 58 ? 3.210   -7.989  7.454   1.00 0.00 ? 479 HIS A CA   7  
ATOM   9458  C  C    . HIS A 1 58 ? 4.380   -8.731  8.092   1.00 0.00 ? 479 HIS A C    7  
ATOM   9459  O  O    . HIS A 1 58 ? 4.714   -8.500  9.255   1.00 0.00 ? 479 HIS A O    7  
ATOM   9460  C  CB   . HIS A 1 58 ? 2.120   -7.739  8.496   1.00 0.00 ? 479 HIS A CB   7  
ATOM   9461  C  CG   . HIS A 1 58 ? 1.165   -6.649  8.116   1.00 0.00 ? 479 HIS A CG   7  
ATOM   9462  N  ND1  . HIS A 1 58 ? 0.054   -6.326  8.865   1.00 0.00 ? 479 HIS A ND1  7  
ATOM   9463  C  CD2  . HIS A 1 58 ? 1.162   -5.805  7.057   1.00 0.00 ? 479 HIS A CD2  7  
ATOM   9464  C  CE1  . HIS A 1 58 ? -0.592  -5.331  8.284   1.00 0.00 ? 479 HIS A CE1  7  
ATOM   9465  N  NE2  . HIS A 1 58 ? 0.060   -4.996  7.185   1.00 0.00 ? 479 HIS A NE2  7  
ATOM   9466  H  H    . HIS A 1 58 ? 2.108   -9.525  6.501   1.00 0.00 ? 479 HIS A H    7  
ATOM   9467  H  HA   . HIS A 1 58 ? 3.563   -7.040  7.080   1.00 0.00 ? 479 HIS A HA   7  
ATOM   9468  H  HB2  . HIS A 1 58 ? 1.549   -8.645  8.635   1.00 0.00 ? 479 HIS A HB2  7  
ATOM   9469  H  HB3  . HIS A 1 58 ? 2.583   -7.463  9.433   1.00 0.00 ? 479 HIS A HB3  7  
ATOM   9470  H  HD1  . HIS A 1 58 ? -0.220  -6.761  9.698   1.00 0.00 ? 479 HIS A HD1  7  
ATOM   9471  H  HD2  . HIS A 1 58 ? 1.891   -5.773  6.260   1.00 0.00 ? 479 HIS A HD2  7  
ATOM   9472  H  HE1  . HIS A 1 58 ? -1.499  -4.869  8.645   1.00 0.00 ? 479 HIS A HE1  7  
ATOM   9473  N  N    . ASP A 1 59 ? 4.998   -9.623  7.326   1.00 0.00 ? 480 ASP A N    7  
ATOM   9474  C  CA   . ASP A 1 59 ? 6.131   -10.399 7.816   1.00 0.00 ? 480 ASP A CA   7  
ATOM   9475  C  C    . ASP A 1 59 ? 7.355   -9.509  8.011   1.00 0.00 ? 480 ASP A C    7  
ATOM   9476  O  O    . ASP A 1 59 ? 7.466   -8.429  7.432   1.00 0.00 ? 480 ASP A O    7  
ATOM   9477  C  CB   . ASP A 1 59 ? 6.459   -11.533 6.844   1.00 0.00 ? 480 ASP A CB   7  
ATOM   9478  C  CG   . ASP A 1 59 ? 5.613   -12.767 7.087   1.00 0.00 ? 480 ASP A CG   7  
ATOM   9479  O  OD1  . ASP A 1 59 ? 4.383   -12.621 7.249   1.00 0.00 ? 480 ASP A OD1  7  
ATOM   9480  O  OD2  . ASP A 1 59 ? 6.180   -13.879 7.115   1.00 0.00 ? 480 ASP A OD2  7  
ATOM   9481  H  H    . ASP A 1 59 ? 4.685   -9.762  6.407   1.00 0.00 ? 480 ASP A H    7  
ATOM   9482  H  HA   . ASP A 1 59 ? 5.854   -10.823 8.769   1.00 0.00 ? 480 ASP A HA   7  
ATOM   9483  H  HB2  . ASP A 1 59 ? 6.284   -11.194 5.833   1.00 0.00 ? 480 ASP A HB2  7  
ATOM   9484  H  HB3  . ASP A 1 59 ? 7.499   -11.803 6.954   1.00 0.00 ? 480 ASP A HB3  7  
ATOM   9485  N  N    . PRO A 1 60 ? 8.296   -9.972  8.848   1.00 0.00 ? 481 PRO A N    7  
ATOM   9486  C  CA   . PRO A 1 60 ? 9.528   -9.234  9.139   1.00 0.00 ? 481 PRO A CA   7  
ATOM   9487  C  C    . PRO A 1 60 ? 10.474  -9.189  7.944   1.00 0.00 ? 481 PRO A C    7  
ATOM   9488  O  O    . PRO A 1 60 ? 10.926  -10.227 7.457   1.00 0.00 ? 481 PRO A O    7  
ATOM   9489  C  CB   . PRO A 1 60 ? 10.155  -10.029 10.287  1.00 0.00 ? 481 PRO A CB   7  
ATOM   9490  C  CG   . PRO A 1 60 ? 9.617   -11.410 10.130  1.00 0.00 ? 481 PRO A CG   7  
ATOM   9491  C  CD   . PRO A 1 60 ? 8.229   -11.252 9.573   1.00 0.00 ? 481 PRO A CD   7  
ATOM   9492  H  HA   . PRO A 1 60 ? 9.319   -8.227  9.469   1.00 0.00 ? 481 PRO A HA   7  
ATOM   9493  H  HB2  . PRO A 1 60 ? 11.232  -10.011 10.195  1.00 0.00 ? 481 PRO A HB2  7  
ATOM   9494  H  HB3  . PRO A 1 60 ? 9.861   -9.597  11.232  1.00 0.00 ? 481 PRO A HB3  7  
ATOM   9495  H  HG2  . PRO A 1 60 ? 10.235  -11.969 9.444   1.00 0.00 ? 481 PRO A HG2  7  
ATOM   9496  H  HG3  . PRO A 1 60 ? 9.581   -11.901 11.091  1.00 0.00 ? 481 PRO A HG3  7  
ATOM   9497  H  HD2  . PRO A 1 60 ? 7.998   -12.065 8.900   1.00 0.00 ? 481 PRO A HD2  7  
ATOM   9498  H  HD3  . PRO A 1 60 ? 7.505   -11.204 10.373  1.00 0.00 ? 481 PRO A HD3  7  
ATOM   9499  N  N    . LEU A 1 61 ? 10.769  -7.983  7.474   1.00 0.00 ? 482 LEU A N    7  
ATOM   9500  C  CA   . LEU A 1 61 ? 11.663  -7.803  6.335   1.00 0.00 ? 482 LEU A CA   7  
ATOM   9501  C  C    . LEU A 1 61 ? 12.871  -8.727  6.439   1.00 0.00 ? 482 LEU A C    7  
ATOM   9502  O  O    . LEU A 1 61 ? 13.311  -9.071  7.536   1.00 0.00 ? 482 LEU A O    7  
ATOM   9503  C  CB   . LEU A 1 61 ? 12.125  -6.347  6.249   1.00 0.00 ? 482 LEU A CB   7  
ATOM   9504  C  CG   . LEU A 1 61 ? 11.110  -5.352  5.685   1.00 0.00 ? 482 LEU A CG   7  
ATOM   9505  C  CD1  . LEU A 1 61 ? 11.542  -3.924  5.981   1.00 0.00 ? 482 LEU A CD1  7  
ATOM   9506  C  CD2  . LEU A 1 61 ? 10.935  -5.560  4.188   1.00 0.00 ? 482 LEU A CD2  7  
ATOM   9507  H  H    . LEU A 1 61 ? 10.379  -7.193  7.903   1.00 0.00 ? 482 LEU A H    7  
ATOM   9508  H  HA   . LEU A 1 61 ? 11.111  -8.050  5.439   1.00 0.00 ? 482 LEU A HA   7  
ATOM   9509  H  HB2  . LEU A 1 61 ? 12.386  -6.024  7.245   1.00 0.00 ? 482 LEU A HB2  7  
ATOM   9510  H  HB3  . LEU A 1 61 ? 13.004  -6.317  5.620   1.00 0.00 ? 482 LEU A HB3  7  
ATOM   9511  H  HG   . LEU A 1 61 ? 10.153  -5.516  6.161   1.00 0.00 ? 482 LEU A HG   7  
ATOM   9512  H  HD11 . LEU A 1 61 ? 12.456  -3.708  5.449   1.00 0.00 ? 482 LEU A HD11 7  
ATOM   9513  H  HD12 . LEU A 1 61 ? 11.706  -3.810  7.042   1.00 0.00 ? 482 LEU A HD12 7  
ATOM   9514  H  HD13 . LEU A 1 61 ? 10.768  -3.241  5.661   1.00 0.00 ? 482 LEU A HD13 7  
ATOM   9515  H  HD21 . LEU A 1 61 ? 9.894   -5.438  3.928   1.00 0.00 ? 482 LEU A HD21 7  
ATOM   9516  H  HD22 . LEU A 1 61 ? 11.258  -6.556  3.923   1.00 0.00 ? 482 LEU A HD22 7  
ATOM   9517  H  HD23 . LEU A 1 61 ? 11.528  -4.833  3.652   1.00 0.00 ? 482 LEU A HD23 7  
ATOM   9518  N  N    . THR A 1 62 ? 13.406  -9.125  5.289   1.00 0.00 ? 483 THR A N    7  
ATOM   9519  C  CA   . THR A 1 62 ? 14.565  -10.009 5.250   1.00 0.00 ? 483 THR A CA   7  
ATOM   9520  C  C    . THR A 1 62 ? 15.659  -9.442  4.353   1.00 0.00 ? 483 THR A C    7  
ATOM   9521  O  O    . THR A 1 62 ? 15.384  -8.664  3.440   1.00 0.00 ? 483 THR A O    7  
ATOM   9522  C  CB   . THR A 1 62 ? 14.183  -11.415 4.749   1.00 0.00 ? 483 THR A CB   7  
ATOM   9523  O  OG1  . THR A 1 62 ? 13.673  -11.337 3.414   1.00 0.00 ? 483 THR A OG1  7  
ATOM   9524  C  CG2  . THR A 1 62 ? 13.142  -12.049 5.659   1.00 0.00 ? 483 THR A CG2  7  
ATOM   9525  H  H    . THR A 1 62 ? 13.011  -8.817  4.447   1.00 0.00 ? 483 THR A H    7  
ATOM   9526  H  HA   . THR A 1 62 ? 14.949  -10.100 6.256   1.00 0.00 ? 483 THR A HA   7  
ATOM   9527  H  HB   . THR A 1 62 ? 15.068  -12.034 4.753   1.00 0.00 ? 483 THR A HB   7  
ATOM   9528  H  HG1  . THR A 1 62 ? 13.088  -12.081 3.251   1.00 0.00 ? 483 THR A HG1  7  
ATOM   9529  H  HG21 . THR A 1 62 ? 12.329  -11.355 5.815   1.00 0.00 ? 483 THR A HG21 7  
ATOM   9530  H  HG22 . THR A 1 62 ? 13.594  -12.293 6.609   1.00 0.00 ? 483 THR A HG22 7  
ATOM   9531  H  HG23 . THR A 1 62 ? 12.762  -12.949 5.199   1.00 0.00 ? 483 THR A HG23 7  
ATOM   9532  N  N    . GLU A 1 63 ? 16.900  -9.837  4.618   1.00 0.00 ? 484 GLU A N    7  
ATOM   9533  C  CA   . GLU A 1 63 ? 18.035  -9.367  3.833   1.00 0.00 ? 484 GLU A CA   7  
ATOM   9534  C  C    . GLU A 1 63 ? 17.681  -9.300  2.351   1.00 0.00 ? 484 GLU A C    7  
ATOM   9535  O  O    . GLU A 1 63 ? 18.212  -8.471  1.613   1.00 0.00 ? 484 GLU A O    7  
ATOM   9536  C  CB   . GLU A 1 63 ? 19.242  -10.286 4.040   1.00 0.00 ? 484 GLU A CB   7  
ATOM   9537  C  CG   . GLU A 1 63 ? 18.999  -11.718 3.596   1.00 0.00 ? 484 GLU A CG   7  
ATOM   9538  C  CD   . GLU A 1 63 ? 20.283  -12.445 3.245   1.00 0.00 ? 484 GLU A CD   7  
ATOM   9539  O  OE1  . GLU A 1 63 ? 21.214  -12.439 4.077   1.00 0.00 ? 484 GLU A OE1  7  
ATOM   9540  O  OE2  . GLU A 1 63 ? 20.356  -13.021 2.139   1.00 0.00 ? 484 GLU A OE2  7  
ATOM   9541  H  H    . GLU A 1 63 ? 17.056  -10.459 5.360   1.00 0.00 ? 484 GLU A H    7  
ATOM   9542  H  HA   . GLU A 1 63 ? 18.287  -8.375  4.176   1.00 0.00 ? 484 GLU A HA   7  
ATOM   9543  H  HB2  . GLU A 1 63 ? 20.078  -9.893  3.480   1.00 0.00 ? 484 GLU A HB2  7  
ATOM   9544  H  HB3  . GLU A 1 63 ? 19.496  -10.295 5.089   1.00 0.00 ? 484 GLU A HB3  7  
ATOM   9545  H  HG2  . GLU A 1 63 ? 18.509  -12.252 4.396   1.00 0.00 ? 484 GLU A HG2  7  
ATOM   9546  H  HG3  . GLU A 1 63 ? 18.359  -11.708 2.726   1.00 0.00 ? 484 GLU A HG3  7  
ATOM   9547  N  N    . GLU A 1 64 ? 16.781  -10.180 1.923   1.00 0.00 ? 485 GLU A N    7  
ATOM   9548  C  CA   . GLU A 1 64 ? 16.357  -10.221 0.528   1.00 0.00 ? 485 GLU A CA   7  
ATOM   9549  C  C    . GLU A 1 64 ? 15.311  -9.146  0.245   1.00 0.00 ? 485 GLU A C    7  
ATOM   9550  O  O    . GLU A 1 64 ? 15.609  -8.118  -0.365  1.00 0.00 ? 485 GLU A O    7  
ATOM   9551  C  CB   . GLU A 1 64 ? 15.791  -11.600 0.185   1.00 0.00 ? 485 GLU A CB   7  
ATOM   9552  C  CG   . GLU A 1 64 ? 15.363  -11.739 -1.266  1.00 0.00 ? 485 GLU A CG   7  
ATOM   9553  C  CD   . GLU A 1 64 ? 16.541  -11.849 -2.214  1.00 0.00 ? 485 GLU A CD   7  
ATOM   9554  O  OE1  . GLU A 1 64 ? 17.477  -11.031 -2.094  1.00 0.00 ? 485 GLU A OE1  7  
ATOM   9555  O  OE2  . GLU A 1 64 ? 16.528  -12.753 -3.076  1.00 0.00 ? 485 GLU A OE2  7  
ATOM   9556  H  H    . GLU A 1 64 ? 16.393  -10.815 2.560   1.00 0.00 ? 485 GLU A H    7  
ATOM   9557  H  HA   . GLU A 1 64 ? 17.223  -10.034 -0.087  1.00 0.00 ? 485 GLU A HA   7  
ATOM   9558  H  HB2  . GLU A 1 64 ? 16.545  -12.346 0.389   1.00 0.00 ? 485 GLU A HB2  7  
ATOM   9559  H  HB3  . GLU A 1 64 ? 14.932  -11.790 0.811   1.00 0.00 ? 485 GLU A HB3  7  
ATOM   9560  H  HG2  . GLU A 1 64 ? 14.756  -12.626 -1.367  1.00 0.00 ? 485 GLU A HG2  7  
ATOM   9561  H  HG3  . GLU A 1 64 ? 14.779  -10.872 -1.540  1.00 0.00 ? 485 GLU A HG3  7  
ATOM   9562  N  N    . THR A 1 65 ? 14.083  -9.390  0.693   1.00 0.00 ? 486 THR A N    7  
ATOM   9563  C  CA   . THR A 1 65 ? 12.993  -8.445  0.487   1.00 0.00 ? 486 THR A CA   7  
ATOM   9564  C  C    . THR A 1 65 ? 13.422  -7.025  0.840   1.00 0.00 ? 486 THR A C    7  
ATOM   9565  O  O    . THR A 1 65 ? 13.174  -6.086  0.083   1.00 0.00 ? 486 THR A O    7  
ATOM   9566  C  CB   . THR A 1 65 ? 11.758  -8.820  1.329   1.00 0.00 ? 486 THR A CB   7  
ATOM   9567  O  OG1  . THR A 1 65 ? 12.148  -9.079  2.682   1.00 0.00 ? 486 THR A OG1  7  
ATOM   9568  C  CG2  . THR A 1 65 ? 11.063  -10.044 0.753   1.00 0.00 ? 486 THR A CG2  7  
ATOM   9569  H  H    . THR A 1 65 ? 13.908  -10.226 1.172   1.00 0.00 ? 486 THR A H    7  
ATOM   9570  H  HA   . THR A 1 65 ? 12.715  -8.478  -0.556  1.00 0.00 ? 486 THR A HA   7  
ATOM   9571  H  HB   . THR A 1 65 ? 11.066  -7.990  1.314   1.00 0.00 ? 486 THR A HB   7  
ATOM   9572  H  HG1  . THR A 1 65 ? 12.286  -10.022 2.800   1.00 0.00 ? 486 THR A HG1  7  
ATOM   9573  H  HG21 . THR A 1 65 ? 11.794  -10.690 0.291   1.00 0.00 ? 486 THR A HG21 7  
ATOM   9574  H  HG22 . THR A 1 65 ? 10.340  -9.733  0.013   1.00 0.00 ? 486 THR A HG22 7  
ATOM   9575  H  HG23 . THR A 1 65 ? 10.560  -10.578 1.545   1.00 0.00 ? 486 THR A HG23 7  
ATOM   9576  N  N    . ARG A 1 66 ? 14.067  -6.876  1.992   1.00 0.00 ? 487 ARG A N    7  
ATOM   9577  C  CA   . ARG A 1 66 ? 14.530  -5.569  2.445   1.00 0.00 ? 487 ARG A CA   7  
ATOM   9578  C  C    . ARG A 1 66 ? 15.079  -4.753  1.278   1.00 0.00 ? 487 ARG A C    7  
ATOM   9579  O  O    . ARG A 1 66 ? 14.798  -3.562  1.156   1.00 0.00 ? 487 ARG A O    7  
ATOM   9580  C  CB   . ARG A 1 66 ? 15.606  -5.730  3.520   1.00 0.00 ? 487 ARG A CB   7  
ATOM   9581  C  CG   . ARG A 1 66 ? 15.822  -4.480  4.357   1.00 0.00 ? 487 ARG A CG   7  
ATOM   9582  C  CD   . ARG A 1 66 ? 16.398  -3.345  3.524   1.00 0.00 ? 487 ARG A CD   7  
ATOM   9583  N  NE   . ARG A 1 66 ? 17.241  -2.456  4.319   1.00 0.00 ? 487 ARG A NE   7  
ATOM   9584  C  CZ   . ARG A 1 66 ? 18.528  -2.683  4.558   1.00 0.00 ? 487 ARG A CZ   7  
ATOM   9585  N  NH1  . ARG A 1 66 ? 19.116  -3.764  4.066   1.00 0.00 ? 487 ARG A NH1  7  
ATOM   9586  N  NH2  . ARG A 1 66 ? 19.228  -1.827  5.291   1.00 0.00 ? 487 ARG A NH2  7  
ATOM   9587  H  H    . ARG A 1 66 ? 14.235  -7.662  2.552   1.00 0.00 ? 487 ARG A H    7  
ATOM   9588  H  HA   . ARG A 1 66 ? 13.685  -5.046  2.868   1.00 0.00 ? 487 ARG A HA   7  
ATOM   9589  H  HB2  . ARG A 1 66 ? 15.319  -6.534  4.182   1.00 0.00 ? 487 ARG A HB2  7  
ATOM   9590  H  HB3  . ARG A 1 66 ? 16.540  -5.984  3.042   1.00 0.00 ? 487 ARG A HB3  7  
ATOM   9591  H  HG2  . ARG A 1 66 ? 14.875  -4.165  4.768   1.00 0.00 ? 487 ARG A HG2  7  
ATOM   9592  H  HG3  . ARG A 1 66 ? 16.507  -4.710  5.159   1.00 0.00 ? 487 ARG A HG3  7  
ATOM   9593  H  HD2  . ARG A 1 66 ? 16.989  -3.767  2.725   1.00 0.00 ? 487 ARG A HD2  7  
ATOM   9594  H  HD3  . ARG A 1 66 ? 15.583  -2.775  3.105   1.00 0.00 ? 487 ARG A HD3  7  
ATOM   9595  H  HE   . ARG A 1 66 ? 16.826  -1.651  4.692   1.00 0.00 ? 487 ARG A HE   7  
ATOM   9596  H  HH11 . ARG A 1 66 ? 18.591  -4.410  3.513   1.00 0.00 ? 487 ARG A HH11 7  
ATOM   9597  H  HH12 . ARG A 1 66 ? 20.086  -3.932  4.247   1.00 0.00 ? 487 ARG A HH12 7  
ATOM   9598  H  HH21 . ARG A 1 66 ? 18.788  -1.010  5.663   1.00 0.00 ? 487 ARG A HH21 7  
ATOM   9599  H  HH22 . ARG A 1 66 ? 20.196  -1.998  5.471   1.00 0.00 ? 487 ARG A HH22 7  
ATOM   9600  N  N    . GLU A 1 67 ? 15.864  -5.404  0.425   1.00 0.00 ? 488 GLU A N    7  
ATOM   9601  C  CA   . GLU A 1 67 ? 16.453  -4.738  -0.730  1.00 0.00 ? 488 GLU A CA   7  
ATOM   9602  C  C    . GLU A 1 67 ? 15.371  -4.145  -1.628  1.00 0.00 ? 488 GLU A C    7  
ATOM   9603  O  O    . GLU A 1 67 ? 15.516  -3.037  -2.147  1.00 0.00 ? 488 GLU A O    7  
ATOM   9604  C  CB   . GLU A 1 67 ? 17.313  -5.719  -1.530  1.00 0.00 ? 488 GLU A CB   7  
ATOM   9605  C  CG   . GLU A 1 67 ? 17.900  -5.122  -2.798  1.00 0.00 ? 488 GLU A CG   7  
ATOM   9606  C  CD   . GLU A 1 67 ? 16.955  -5.218  -3.980  1.00 0.00 ? 488 GLU A CD   7  
ATOM   9607  O  OE1  . GLU A 1 67 ? 16.205  -6.214  -4.059  1.00 0.00 ? 488 GLU A OE1  7  
ATOM   9608  O  OE2  . GLU A 1 67 ? 16.965  -4.299  -4.825  1.00 0.00 ? 488 GLU A OE2  7  
ATOM   9609  H  H    . GLU A 1 67 ? 16.051  -6.354  0.576   1.00 0.00 ? 488 GLU A H    7  
ATOM   9610  H  HA   . GLU A 1 67 ? 17.081  -3.938  -0.367  1.00 0.00 ? 488 GLU A HA   7  
ATOM   9611  H  HB2  . GLU A 1 67 ? 18.126  -6.058  -0.905  1.00 0.00 ? 488 GLU A HB2  7  
ATOM   9612  H  HB3  . GLU A 1 67 ? 16.705  -6.568  -1.805  1.00 0.00 ? 488 GLU A HB3  7  
ATOM   9613  H  HG2  . GLU A 1 67 ? 18.123  -4.080  -2.620  1.00 0.00 ? 488 GLU A HG2  7  
ATOM   9614  H  HG3  . GLU A 1 67 ? 18.811  -5.648  -3.040  1.00 0.00 ? 488 GLU A HG3  7  
ATOM   9615  N  N    . LEU A 1 68 ? 14.285  -4.890  -1.806  1.00 0.00 ? 489 LEU A N    7  
ATOM   9616  C  CA   . LEU A 1 68 ? 13.177  -4.440  -2.641  1.00 0.00 ? 489 LEU A CA   7  
ATOM   9617  C  C    . LEU A 1 68 ? 12.752  -3.024  -2.264  1.00 0.00 ? 489 LEU A C    7  
ATOM   9618  O  O    . LEU A 1 68 ? 12.872  -2.095  -3.064  1.00 0.00 ? 489 LEU A O    7  
ATOM   9619  C  CB   . LEU A 1 68 ? 11.990  -5.395  -2.506  1.00 0.00 ? 489 LEU A CB   7  
ATOM   9620  C  CG   . LEU A 1 68 ? 12.214  -6.820  -3.010  1.00 0.00 ? 489 LEU A CG   7  
ATOM   9621  C  CD1  . LEU A 1 68 ? 10.916  -7.612  -2.969  1.00 0.00 ? 489 LEU A CD1  7  
ATOM   9622  C  CD2  . LEU A 1 68 ? 12.786  -6.804  -4.420  1.00 0.00 ? 489 LEU A CD2  7  
ATOM   9623  H  H    . LEU A 1 68 ? 14.227  -5.763  -1.367  1.00 0.00 ? 489 LEU A H    7  
ATOM   9624  H  HA   . LEU A 1 68 ? 13.514  -4.440  -3.667  1.00 0.00 ? 489 LEU A HA   7  
ATOM   9625  H  HB2  . LEU A 1 68 ? 11.729  -5.451  -1.460  1.00 0.00 ? 489 LEU A HB2  7  
ATOM   9626  H  HB3  . LEU A 1 68 ? 11.163  -4.973  -3.059  1.00 0.00 ? 489 LEU A HB3  7  
ATOM   9627  H  HG   . LEU A 1 68 ? 12.927  -7.316  -2.365  1.00 0.00 ? 489 LEU A HG   7  
ATOM   9628  H  HD11 . LEU A 1 68 ? 11.069  -8.524  -2.412  1.00 0.00 ? 489 LEU A HD11 7  
ATOM   9629  H  HD12 . LEU A 1 68 ? 10.609  -7.851  -3.976  1.00 0.00 ? 489 LEU A HD12 7  
ATOM   9630  H  HD13 . LEU A 1 68 ? 10.150  -7.020  -2.489  1.00 0.00 ? 489 LEU A HD13 7  
ATOM   9631  H  HD21 . LEU A 1 68 ? 12.651  -7.774  -4.874  1.00 0.00 ? 489 LEU A HD21 7  
ATOM   9632  H  HD22 . LEU A 1 68 ? 13.840  -6.569  -4.378  1.00 0.00 ? 489 LEU A HD22 7  
ATOM   9633  H  HD23 . LEU A 1 68 ? 12.273  -6.056  -5.007  1.00 0.00 ? 489 LEU A HD23 7  
ATOM   9634  N  N    . LEU A 1 69 ? 12.256  -2.867  -1.042  1.00 0.00 ? 490 LEU A N    7  
ATOM   9635  C  CA   . LEU A 1 69 ? 11.814  -1.564  -0.558  1.00 0.00 ? 490 LEU A CA   7  
ATOM   9636  C  C    . LEU A 1 69 ? 12.805  -0.472  -0.951  1.00 0.00 ? 490 LEU A C    7  
ATOM   9637  O  O    . LEU A 1 69 ? 12.430  0.528   -1.563  1.00 0.00 ? 490 LEU A O    7  
ATOM   9638  C  CB   . LEU A 1 69 ? 11.647  -1.593  0.963   1.00 0.00 ? 490 LEU A CB   7  
ATOM   9639  C  CG   . LEU A 1 69 ? 10.463  -2.401  1.492   1.00 0.00 ? 490 LEU A CG   7  
ATOM   9640  C  CD1  . LEU A 1 69 ? 10.521  -2.503  3.009   1.00 0.00 ? 490 LEU A CD1  7  
ATOM   9641  C  CD2  . LEU A 1 69 ? 9.148   -1.776  1.048   1.00 0.00 ? 490 LEU A CD2  7  
ATOM   9642  H  H    . LEU A 1 69 ? 12.184  -3.644  -0.451  1.00 0.00 ? 490 LEU A H    7  
ATOM   9643  H  HA   . LEU A 1 69 ? 10.859  -1.347  -1.013  1.00 0.00 ? 490 LEU A HA   7  
ATOM   9644  H  HB2  . LEU A 1 69 ? 12.548  -2.010  1.386   1.00 0.00 ? 490 LEU A HB2  7  
ATOM   9645  H  HB3  . LEU A 1 69 ? 11.531  -0.573  1.301   1.00 0.00 ? 490 LEU A HB3  7  
ATOM   9646  H  HG   . LEU A 1 69 ? 10.510  -3.404  1.089   1.00 0.00 ? 490 LEU A HG   7  
ATOM   9647  H  HD11 . LEU A 1 69 ? 10.190  -1.573  3.445   1.00 0.00 ? 490 LEU A HD11 7  
ATOM   9648  H  HD12 . LEU A 1 69 ? 11.536  -2.705  3.317   1.00 0.00 ? 490 LEU A HD12 7  
ATOM   9649  H  HD13 . LEU A 1 69 ? 9.879   -3.306  3.340   1.00 0.00 ? 490 LEU A HD13 7  
ATOM   9650  H  HD21 . LEU A 1 69 ? 8.523   -2.533  0.599   1.00 0.00 ? 490 LEU A HD21 7  
ATOM   9651  H  HD22 . LEU A 1 69 ? 9.346   -0.997  0.326   1.00 0.00 ? 490 LEU A HD22 7  
ATOM   9652  H  HD23 . LEU A 1 69 ? 8.643   -1.354  1.904   1.00 0.00 ? 490 LEU A HD23 7  
ATOM   9653  N  N    . ASP A 1 70 ? 14.069  -0.673  -0.597  1.00 0.00 ? 491 ASP A N    7  
ATOM   9654  C  CA   . ASP A 1 70 ? 15.115  0.293   -0.916  1.00 0.00 ? 491 ASP A CA   7  
ATOM   9655  C  C    . ASP A 1 70 ? 14.939  0.836   -2.330  1.00 0.00 ? 491 ASP A C    7  
ATOM   9656  O  O    . ASP A 1 70 ? 15.047  2.041   -2.562  1.00 0.00 ? 491 ASP A O    7  
ATOM   9657  C  CB   . ASP A 1 70 ? 16.494  -0.351  -0.771  1.00 0.00 ? 491 ASP A CB   7  
ATOM   9658  C  CG   . ASP A 1 70 ? 16.809  -0.730  0.663   1.00 0.00 ? 491 ASP A CG   7  
ATOM   9659  O  OD1  . ASP A 1 70 ? 15.857  -0.967  1.436   1.00 0.00 ? 491 ASP A OD1  7  
ATOM   9660  O  OD2  . ASP A 1 70 ? 18.007  -0.789  1.012   1.00 0.00 ? 491 ASP A OD2  7  
ATOM   9661  H  H    . ASP A 1 70 ? 14.305  -1.490  -0.110  1.00 0.00 ? 491 ASP A H    7  
ATOM   9662  H  HA   . ASP A 1 70 ? 15.035  1.111   -0.217  1.00 0.00 ? 491 ASP A HA   7  
ATOM   9663  H  HB2  . ASP A 1 70 ? 16.533  -1.245  -1.376  1.00 0.00 ? 491 ASP A HB2  7  
ATOM   9664  H  HB3  . ASP A 1 70 ? 17.247  0.344   -1.114  1.00 0.00 ? 491 ASP A HB3  7  
ATOM   9665  N  N    . LYS A 1 71 ? 14.669  -0.060  -3.274  1.00 0.00 ? 492 LYS A N    7  
ATOM   9666  C  CA   . LYS A 1 71 ? 14.479  0.329   -4.666  1.00 0.00 ? 492 LYS A CA   7  
ATOM   9667  C  C    . LYS A 1 71 ? 13.090  0.922   -4.880  1.00 0.00 ? 492 LYS A C    7  
ATOM   9668  O  O    . LYS A 1 71 ? 12.954  2.070   -5.304  1.00 0.00 ? 492 LYS A O    7  
ATOM   9669  C  CB   . LYS A 1 71 ? 14.675  -0.879  -5.585  1.00 0.00 ? 492 LYS A CB   7  
ATOM   9670  C  CG   . LYS A 1 71 ? 14.942  -0.505  -7.033  1.00 0.00 ? 492 LYS A CG   7  
ATOM   9671  C  CD   . LYS A 1 71 ? 15.546  -1.664  -7.807  1.00 0.00 ? 492 LYS A CD   7  
ATOM   9672  C  CE   . LYS A 1 71 ? 15.396  -1.471  -9.308  1.00 0.00 ? 492 LYS A CE   7  
ATOM   9673  N  NZ   . LYS A 1 71 ? 15.480  -2.762  -10.045 1.00 0.00 ? 492 LYS A NZ   7  
ATOM   9674  H  H    . LYS A 1 71 ? 14.595  -1.006  -3.027  1.00 0.00 ? 492 LYS A H    7  
ATOM   9675  H  HA   . LYS A 1 71 ? 15.218  1.077   -4.906  1.00 0.00 ? 492 LYS A HA   7  
ATOM   9676  H  HB2  . LYS A 1 71 ? 15.513  -1.458  -5.225  1.00 0.00 ? 492 LYS A HB2  7  
ATOM   9677  H  HB3  . LYS A 1 71 ? 13.785  -1.491  -5.552  1.00 0.00 ? 492 LYS A HB3  7  
ATOM   9678  H  HG2  . LYS A 1 71 ? 14.010  -0.221  -7.500  1.00 0.00 ? 492 LYS A HG2  7  
ATOM   9679  H  HG3  . LYS A 1 71 ? 15.628  0.330   -7.059  1.00 0.00 ? 492 LYS A HG3  7  
ATOM   9680  H  HD2  . LYS A 1 71 ? 16.597  -1.737  -7.568  1.00 0.00 ? 492 LYS A HD2  7  
ATOM   9681  H  HD3  . LYS A 1 71 ? 15.045  -2.578  -7.518  1.00 0.00 ? 492 LYS A HD3  7  
ATOM   9682  H  HE2  . LYS A 1 71 ? 14.438  -1.016  -9.505  1.00 0.00 ? 492 LYS A HE2  7  
ATOM   9683  H  HE3  . LYS A 1 71 ? 16.183  -0.817  -9.654  1.00 0.00 ? 492 LYS A HE3  7  
ATOM   9684  H  HZ1  . LYS A 1 71 ? 15.590  -2.585  -11.064 1.00 0.00 ? 492 LYS A HZ1  7  
ATOM   9685  H  HZ2  . LYS A 1 71 ? 14.614  -3.317  -9.893  1.00 0.00 ? 492 LYS A HZ2  7  
ATOM   9686  H  HZ3  . LYS A 1 71 ? 16.296  -3.313  -9.709  1.00 0.00 ? 492 LYS A HZ3  7  
ATOM   9687  N  N    . MET A 1 72 ? 12.062  0.135   -4.582  1.00 0.00 ? 493 MET A N    7  
ATOM   9688  C  CA   . MET A 1 72 ? 10.684  0.585   -4.740  1.00 0.00 ? 493 MET A CA   7  
ATOM   9689  C  C    . MET A 1 72 ? 10.510  2.002   -4.205  1.00 0.00 ? 493 MET A C    7  
ATOM   9690  O  O    . MET A 1 72 ? 10.134  2.914   -4.943  1.00 0.00 ? 493 MET A O    7  
ATOM   9691  C  CB   . MET A 1 72 ? 9.728   -0.367  -4.017  1.00 0.00 ? 493 MET A CB   7  
ATOM   9692  C  CG   . MET A 1 72 ? 8.280   -0.221  -4.454  1.00 0.00 ? 493 MET A CG   7  
ATOM   9693  S  SD   . MET A 1 72 ? 7.522   1.301   -3.853  1.00 0.00 ? 493 MET A SD   7  
ATOM   9694  C  CE   . MET A 1 72 ? 7.152   0.849   -2.160  1.00 0.00 ? 493 MET A CE   7  
ATOM   9695  H  H    . MET A 1 72 ? 12.233  -0.771  -4.248  1.00 0.00 ? 493 MET A H    7  
ATOM   9696  H  HA   . MET A 1 72 ? 10.453  0.580   -5.794  1.00 0.00 ? 493 MET A HA   7  
ATOM   9697  H  HB2  . MET A 1 72 ? 10.039  -1.383  -4.207  1.00 0.00 ? 493 MET A HB2  7  
ATOM   9698  H  HB3  . MET A 1 72 ? 9.782   -0.174  -2.956  1.00 0.00 ? 493 MET A HB3  7  
ATOM   9699  H  HG2  . MET A 1 72 ? 8.241   -0.224  -5.533  1.00 0.00 ? 493 MET A HG2  7  
ATOM   9700  H  HG3  . MET A 1 72 ? 7.718   -1.061  -4.074  1.00 0.00 ? 493 MET A HG3  7  
ATOM   9701  H  HE1  . MET A 1 72 ? 6.260   0.240   -2.137  1.00 0.00 ? 493 MET A HE1  7  
ATOM   9702  H  HE2  . MET A 1 72 ? 7.979   0.292   -1.747  1.00 0.00 ? 493 MET A HE2  7  
ATOM   9703  H  HE3  . MET A 1 72 ? 6.992   1.744   -1.576  1.00 0.00 ? 493 MET A HE3  7  
ATOM   9704  N  N    . LEU A 1 73 ? 10.786  2.182   -2.918  1.00 0.00 ? 494 LEU A N    7  
ATOM   9705  C  CA   . LEU A 1 73 ? 10.660  3.489   -2.283  1.00 0.00 ? 494 LEU A CA   7  
ATOM   9706  C  C    . LEU A 1 73 ? 11.191  4.591   -3.195  1.00 0.00 ? 494 LEU A C    7  
ATOM   9707  O  O    . LEU A 1 73 ? 10.459  5.505   -3.572  1.00 0.00 ? 494 LEU A O    7  
ATOM   9708  C  CB   . LEU A 1 73 ? 11.413  3.507   -0.952  1.00 0.00 ? 494 LEU A CB   7  
ATOM   9709  C  CG   . LEU A 1 73 ? 10.759  2.744   0.200   1.00 0.00 ? 494 LEU A CG   7  
ATOM   9710  C  CD1  . LEU A 1 73 ? 11.751  2.533   1.333   1.00 0.00 ? 494 LEU A CD1  7  
ATOM   9711  C  CD2  . LEU A 1 73 ? 9.527   3.485   0.698   1.00 0.00 ? 494 LEU A CD2  7  
ATOM   9712  H  H    . LEU A 1 73 ? 11.081  1.418   -2.380  1.00 0.00 ? 494 LEU A H    7  
ATOM   9713  H  HA   . LEU A 1 73 ? 9.612   3.667   -2.097  1.00 0.00 ? 494 LEU A HA   7  
ATOM   9714  H  HB2  . LEU A 1 73 ? 12.390  3.079   -1.119  1.00 0.00 ? 494 LEU A HB2  7  
ATOM   9715  H  HB3  . LEU A 1 73 ? 11.522  4.538   -0.648  1.00 0.00 ? 494 LEU A HB3  7  
ATOM   9716  H  HG   . LEU A 1 73 ? 10.445  1.771   -0.153  1.00 0.00 ? 494 LEU A HG   7  
ATOM   9717  H  HD11 . LEU A 1 73 ? 11.281  1.965   2.122   1.00 0.00 ? 494 LEU A HD11 7  
ATOM   9718  H  HD12 . LEU A 1 73 ? 12.066  3.491   1.718   1.00 0.00 ? 494 LEU A HD12 7  
ATOM   9719  H  HD13 . LEU A 1 73 ? 12.610  1.993   0.963   1.00 0.00 ? 494 LEU A HD13 7  
ATOM   9720  H  HD21 . LEU A 1 73 ? 8.645   3.075   0.228   1.00 0.00 ? 494 LEU A HD21 7  
ATOM   9721  H  HD22 . LEU A 1 73 ? 9.612   4.533   0.450   1.00 0.00 ? 494 LEU A HD22 7  
ATOM   9722  H  HD23 . LEU A 1 73 ? 9.448   3.373   1.769   1.00 0.00 ? 494 LEU A HD23 7  
ATOM   9723  N  N    . ALA A 1 74 ? 12.469  4.495   -3.548  1.00 0.00 ? 495 ALA A N    7  
ATOM   9724  C  CA   . ALA A 1 74 ? 13.097  5.480   -4.420  1.00 0.00 ? 495 ALA A CA   7  
ATOM   9725  C  C    . ALA A 1 74 ? 12.251  5.731   -5.664  1.00 0.00 ? 495 ALA A C    7  
ATOM   9726  O  O    . ALA A 1 74 ? 11.932  6.875   -5.989  1.00 0.00 ? 495 ALA A O    7  
ATOM   9727  C  CB   . ALA A 1 74 ? 14.494  5.023   -4.813  1.00 0.00 ? 495 ALA A CB   7  
ATOM   9728  H  H    . ALA A 1 74 ? 13.002  3.743   -3.215  1.00 0.00 ? 495 ALA A H    7  
ATOM   9729  H  HA   . ALA A 1 74 ? 13.189  6.404   -3.867  1.00 0.00 ? 495 ALA A HA   7  
ATOM   9730  H  HB1  . ALA A 1 74 ? 14.967  5.788   -5.411  1.00 0.00 ? 495 ALA A HB1  7  
ATOM   9731  H  HB2  . ALA A 1 74 ? 15.079  4.849   -3.922  1.00 0.00 ? 495 ALA A HB2  7  
ATOM   9732  H  HB3  . ALA A 1 74 ? 14.426  4.110   -5.384  1.00 0.00 ? 495 ALA A HB3  7  
ATOM   9733  N  N    . ASP A 1 75 ? 11.891  4.656   -6.355  1.00 0.00 ? 496 ASP A N    7  
ATOM   9734  C  CA   . ASP A 1 75 ? 11.082  4.759   -7.564  1.00 0.00 ? 496 ASP A CA   7  
ATOM   9735  C  C    . ASP A 1 75 ? 9.956   5.772   -7.379  1.00 0.00 ? 496 ASP A C    7  
ATOM   9736  O  O    . ASP A 1 75 ? 9.835   6.728   -8.145  1.00 0.00 ? 496 ASP A O    7  
ATOM   9737  C  CB   . ASP A 1 75 ? 10.501  3.393   -7.933  1.00 0.00 ? 496 ASP A CB   7  
ATOM   9738  C  CG   . ASP A 1 75 ? 10.124  3.301   -9.399  1.00 0.00 ? 496 ASP A CG   7  
ATOM   9739  O  OD1  . ASP A 1 75 ? 10.754  4.003   -10.218 1.00 0.00 ? 496 ASP A OD1  7  
ATOM   9740  O  OD2  . ASP A 1 75 ? 9.202   2.527   -9.726  1.00 0.00 ? 496 ASP A OD2  7  
ATOM   9741  H  H    . ASP A 1 75 ? 12.177  3.770   -6.045  1.00 0.00 ? 496 ASP A H    7  
ATOM   9742  H  HA   . ASP A 1 75 ? 11.723  5.096   -8.365  1.00 0.00 ? 496 ASP A HA   7  
ATOM   9743  H  HB2  . ASP A 1 75 ? 11.233  2.628   -7.720  1.00 0.00 ? 496 ASP A HB2  7  
ATOM   9744  H  HB3  . ASP A 1 75 ? 9.616   3.214   -7.340  1.00 0.00 ? 496 ASP A HB3  7  
ATOM   9745  N  N    . ASP A 1 76 ? 9.134   5.554   -6.358  1.00 0.00 ? 497 ASP A N    7  
ATOM   9746  C  CA   . ASP A 1 76 ? 8.017   6.448   -6.072  1.00 0.00 ? 497 ASP A CA   7  
ATOM   9747  C  C    . ASP A 1 76 ? 8.511   7.758   -5.467  1.00 0.00 ? 497 ASP A C    7  
ATOM   9748  O  O    . ASP A 1 76 ? 8.348   8.826   -6.057  1.00 0.00 ? 497 ASP A O    7  
ATOM   9749  C  CB   . ASP A 1 76 ? 7.028   5.773   -5.120  1.00 0.00 ? 497 ASP A CB   7  
ATOM   9750  C  CG   . ASP A 1 76 ? 5.615   6.298   -5.286  1.00 0.00 ? 497 ASP A CG   7  
ATOM   9751  O  OD1  . ASP A 1 76 ? 5.457   7.417   -5.818  1.00 0.00 ? 497 ASP A OD1  7  
ATOM   9752  O  OD2  . ASP A 1 76 ? 4.669   5.590   -4.884  1.00 0.00 ? 497 ASP A OD2  7  
ATOM   9753  H  H    . ASP A 1 76 ? 9.282   4.774   -5.783  1.00 0.00 ? 497 ASP A H    7  
ATOM   9754  H  HA   . ASP A 1 76 ? 7.517   6.662   -7.004  1.00 0.00 ? 497 ASP A HA   7  
ATOM   9755  H  HB2  . ASP A 1 76 ? 7.021   4.710   -5.312  1.00 0.00 ? 497 ASP A HB2  7  
ATOM   9756  H  HB3  . ASP A 1 76 ? 7.341   5.950   -4.102  1.00 0.00 ? 497 ASP A HB3  7  
ATOM   9757  N  N    . ALA A 1 77 ? 9.114   7.669   -4.286  1.00 0.00 ? 498 ALA A N    7  
ATOM   9758  C  CA   . ALA A 1 77 ? 9.633   8.847   -3.603  1.00 0.00 ? 498 ALA A CA   7  
ATOM   9759  C  C    . ALA A 1 77 ? 10.150  9.878   -4.600  1.00 0.00 ? 498 ALA A C    7  
ATOM   9760  O  O    . ALA A 1 77 ? 9.967   11.080  -4.414  1.00 0.00 ? 498 ALA A O    7  
ATOM   9761  C  CB   . ALA A 1 77 ? 10.734  8.452   -2.631  1.00 0.00 ? 498 ALA A CB   7  
ATOM   9762  H  H    . ALA A 1 77 ? 9.214   6.790   -3.866  1.00 0.00 ? 498 ALA A H    7  
ATOM   9763  H  HA   . ALA A 1 77 ? 8.825   9.285   -3.034  1.00 0.00 ? 498 ALA A HA   7  
ATOM   9764  H  HB1  . ALA A 1 77 ? 10.519  7.474   -2.223  1.00 0.00 ? 498 ALA A HB1  7  
ATOM   9765  H  HB2  . ALA A 1 77 ? 11.680  8.425   -3.150  1.00 0.00 ? 498 ALA A HB2  7  
ATOM   9766  H  HB3  . ALA A 1 77 ? 10.783  9.173   -1.829  1.00 0.00 ? 498 ALA A HB3  7  
ATOM   9767  N  N    . GLU A 1 78 ? 10.797  9.398   -5.658  1.00 0.00 ? 499 GLU A N    7  
ATOM   9768  C  CA   . GLU A 1 78 ? 11.342  10.280  -6.684  1.00 0.00 ? 499 GLU A CA   7  
ATOM   9769  C  C    . GLU A 1 78 ? 10.242  10.769  -7.621  1.00 0.00 ? 499 GLU A C    7  
ATOM   9770  O  O    . GLU A 1 78 ? 9.986   11.968  -7.723  1.00 0.00 ? 499 GLU A O    7  
ATOM   9771  C  CB   . GLU A 1 78 ? 12.427  9.557   -7.485  1.00 0.00 ? 499 GLU A CB   7  
ATOM   9772  C  CG   . GLU A 1 78 ? 13.372  10.497  -8.215  1.00 0.00 ? 499 GLU A CG   7  
ATOM   9773  C  CD   . GLU A 1 78 ? 14.149  11.392  -7.270  1.00 0.00 ? 499 GLU A CD   7  
ATOM   9774  O  OE1  . GLU A 1 78 ? 13.616  12.454  -6.885  1.00 0.00 ? 499 GLU A OE1  7  
ATOM   9775  O  OE2  . GLU A 1 78 ? 15.291  11.031  -6.915  1.00 0.00 ? 499 GLU A OE2  7  
ATOM   9776  H  H    . GLU A 1 78 ? 10.911  8.429   -5.750  1.00 0.00 ? 499 GLU A H    7  
ATOM   9777  H  HA   . GLU A 1 78 ? 11.781  11.133  -6.189  1.00 0.00 ? 499 GLU A HA   7  
ATOM   9778  H  HB2  . GLU A 1 78 ? 13.008  8.946   -6.811  1.00 0.00 ? 499 GLU A HB2  7  
ATOM   9779  H  HB3  . GLU A 1 78 ? 11.952  8.919   -8.216  1.00 0.00 ? 499 GLU A HB3  7  
ATOM   9780  H  HG2  . GLU A 1 78 ? 14.074  9.908   -8.787  1.00 0.00 ? 499 GLU A HG2  7  
ATOM   9781  H  HG3  . GLU A 1 78 ? 12.796  11.118  -8.884  1.00 0.00 ? 499 GLU A HG3  7  
ATOM   9782  N  N    . ALA A 1 79 ? 9.595   9.830   -8.305  1.00 0.00 ? 500 ALA A N    7  
ATOM   9783  C  CA   . ALA A 1 79 ? 8.522   10.164  -9.233  1.00 0.00 ? 500 ALA A CA   7  
ATOM   9784  C  C    . ALA A 1 79 ? 8.859   11.417  -10.035 1.00 0.00 ? 500 ALA A C    7  
ATOM   9785  O  O    . ALA A 1 79 ? 7.997   12.260  -10.279 1.00 0.00 ? 500 ALA A O    7  
ATOM   9786  C  CB   . ALA A 1 79 ? 7.213   10.353  -8.481  1.00 0.00 ? 500 ALA A CB   7  
ATOM   9787  H  H    . ALA A 1 79 ? 9.845   8.891   -8.181  1.00 0.00 ? 500 ALA A H    7  
ATOM   9788  H  HA   . ALA A 1 79 ? 8.400   9.335   -9.915  1.00 0.00 ? 500 ALA A HA   7  
ATOM   9789  H  HB1  . ALA A 1 79 ? 7.014   9.477   -7.881  1.00 0.00 ? 500 ALA A HB1  7  
ATOM   9790  H  HB2  . ALA A 1 79 ? 7.288   11.219  -7.840  1.00 0.00 ? 500 ALA A HB2  7  
ATOM   9791  H  HB3  . ALA A 1 79 ? 6.409   10.496  -9.187  1.00 0.00 ? 500 ALA A HB3  7  
ATOM   9792  N  N    . GLY A 1 80 ? 10.120  11.532  -10.441 1.00 0.00 ? 501 GLY A N    7  
ATOM   9793  C  CA   . GLY A 1 80 ? 10.549  12.686  -11.210 1.00 0.00 ? 501 GLY A CA   7  
ATOM   9794  C  C    . GLY A 1 80 ? 9.677   12.928  -12.427 1.00 0.00 ? 501 GLY A C    7  
ATOM   9795  O  O    . GLY A 1 80 ? 9.304   14.065  -12.715 1.00 0.00 ? 501 GLY A O    7  
ATOM   9796  H  H    . GLY A 1 80 ? 10.764  10.828  -10.217 1.00 0.00 ? 501 GLY A H    7  
ATOM   9797  H  HA2  . GLY A 1 80 ? 10.516  13.560  -10.577 1.00 0.00 ? 501 GLY A HA2  7  
ATOM   9798  H  HA3  . GLY A 1 80 ? 11.566  12.528  -11.537 1.00 0.00 ? 501 GLY A HA3  7  
ATOM   9799  N  N    . ALA A 1 81 ? 9.353   11.857  -13.143 1.00 0.00 ? 502 ALA A N    7  
ATOM   9800  C  CA   . ALA A 1 81 ? 8.521   11.958  -14.335 1.00 0.00 ? 502 ALA A CA   7  
ATOM   9801  C  C    . ALA A 1 81 ? 7.264   11.105  -14.201 1.00 0.00 ? 502 ALA A C    7  
ATOM   9802  O  O    . ALA A 1 81 ? 7.229   9.960   -14.651 1.00 0.00 ? 502 ALA A O    7  
ATOM   9803  C  CB   . ALA A 1 81 ? 9.311   11.546  -15.568 1.00 0.00 ? 502 ALA A CB   7  
ATOM   9804  H  H    . ALA A 1 81 ? 9.681   10.977  -12.863 1.00 0.00 ? 502 ALA A H    7  
ATOM   9805  H  HA   . ALA A 1 81 ? 8.231   12.993  -14.453 1.00 0.00 ? 502 ALA A HA   7  
ATOM   9806  H  HB1  . ALA A 1 81 ? 9.120   12.247  -16.368 1.00 0.00 ? 502 ALA A HB1  7  
ATOM   9807  H  HB2  . ALA A 1 81 ? 10.365  11.544  -15.336 1.00 0.00 ? 502 ALA A HB2  7  
ATOM   9808  H  HB3  . ALA A 1 81 ? 9.008   10.557  -15.876 1.00 0.00 ? 502 ALA A HB3  7  
ATOM   9809  N  N    . GLU A 1 82 ? 6.234   11.671  -13.579 1.00 0.00 ? 503 GLU A N    7  
ATOM   9810  C  CA   . GLU A 1 82 ? 4.975   10.960  -13.385 1.00 0.00 ? 503 GLU A CA   7  
ATOM   9811  C  C    . GLU A 1 82 ? 3.889   11.518  -14.300 1.00 0.00 ? 503 GLU A C    7  
ATOM   9812  O  O    . GLU A 1 82 ? 3.431   12.646  -14.122 1.00 0.00 ? 503 GLU A O    7  
ATOM   9813  C  CB   . GLU A 1 82 ? 4.528   11.059  -11.925 1.00 0.00 ? 503 GLU A CB   7  
ATOM   9814  C  CG   . GLU A 1 82 ? 3.587   9.944   -11.500 1.00 0.00 ? 503 GLU A CG   7  
ATOM   9815  C  CD   . GLU A 1 82 ? 2.925   10.217  -10.164 1.00 0.00 ? 503 GLU A CD   7  
ATOM   9816  O  OE1  . GLU A 1 82 ? 2.115   11.164  -10.084 1.00 0.00 ? 503 GLU A OE1  7  
ATOM   9817  O  OE2  . GLU A 1 82 ? 3.218   9.483   -9.196  1.00 0.00 ? 503 GLU A OE2  7  
ATOM   9818  H  H    . GLU A 1 82 ? 6.322   12.587  -13.243 1.00 0.00 ? 503 GLU A H    7  
ATOM   9819  H  HA   . GLU A 1 82 ? 5.139   9.922   -13.632 1.00 0.00 ? 503 GLU A HA   7  
ATOM   9820  H  HB2  . GLU A 1 82 ? 5.402   11.027  -11.291 1.00 0.00 ? 503 GLU A HB2  7  
ATOM   9821  H  HB3  . GLU A 1 82 ? 4.023   12.002  -11.780 1.00 0.00 ? 503 GLU A HB3  7  
ATOM   9822  H  HG2  . GLU A 1 82 ? 2.817   9.835   -12.250 1.00 0.00 ? 503 GLU A HG2  7  
ATOM   9823  H  HG3  . GLU A 1 82 ? 4.149   9.025   -11.426 1.00 0.00 ? 503 GLU A HG3  7  
ATOM   9824  N  N    . ASP A 1 83 ? 3.482   10.718  -15.280 1.00 0.00 ? 504 ASP A N    7  
ATOM   9825  C  CA   . ASP A 1 83 ? 2.449   11.130  -16.223 1.00 0.00 ? 504 ASP A CA   7  
ATOM   9826  C  C    . ASP A 1 83 ? 1.058   10.911  -15.636 1.00 0.00 ? 504 ASP A C    7  
ATOM   9827  O  O    . ASP A 1 83 ? 0.446   9.863   -15.841 1.00 0.00 ? 504 ASP A O    7  
ATOM   9828  C  CB   . ASP A 1 83 ? 2.589   10.358  -17.536 1.00 0.00 ? 504 ASP A CB   7  
ATOM   9829  C  CG   . ASP A 1 83 ? 2.902   8.891   -17.314 1.00 0.00 ? 504 ASP A CG   7  
ATOM   9830  O  OD1  . ASP A 1 83 ? 2.482   8.346   -16.272 1.00 0.00 ? 504 ASP A OD1  7  
ATOM   9831  O  OD2  . ASP A 1 83 ? 3.566   8.289   -18.183 1.00 0.00 ? 504 ASP A OD2  7  
ATOM   9832  H  H    . ASP A 1 83 ? 3.885   9.829   -15.371 1.00 0.00 ? 504 ASP A H    7  
ATOM   9833  H  HA   . ASP A 1 83 ? 2.580   12.183  -16.420 1.00 0.00 ? 504 ASP A HA   7  
ATOM   9834  H  HB2  . ASP A 1 83 ? 1.664   10.430  -18.090 1.00 0.00 ? 504 ASP A HB2  7  
ATOM   9835  H  HB3  . ASP A 1 83 ? 3.387   10.794  -18.119 1.00 0.00 ? 504 ASP A HB3  7  
ATOM   9836  N  N    . GLU A 1 84 ? 0.565   11.906  -14.906 1.00 0.00 ? 505 GLU A N    7  
ATOM   9837  C  CA   . GLU A 1 84 ? -0.752  11.820  -14.288 1.00 0.00 ? 505 GLU A CA   7  
ATOM   9838  C  C    . GLU A 1 84 ? -1.791  11.323  -15.289 1.00 0.00 ? 505 GLU A C    7  
ATOM   9839  O  O    . GLU A 1 84 ? -1.643  11.504  -16.497 1.00 0.00 ? 505 GLU A O    7  
ATOM   9840  C  CB   . GLU A 1 84 ? -1.172  13.184  -13.736 1.00 0.00 ? 505 GLU A CB   7  
ATOM   9841  C  CG   . GLU A 1 84 ? -0.678  13.448  -12.323 1.00 0.00 ? 505 GLU A CG   7  
ATOM   9842  C  CD   . GLU A 1 84 ? -1.534  12.771  -11.270 1.00 0.00 ? 505 GLU A CD   7  
ATOM   9843  O  OE1  . GLU A 1 84 ? -1.943  11.613  -11.492 1.00 0.00 ? 505 GLU A OE1  7  
ATOM   9844  O  OE2  . GLU A 1 84 ? -1.794  13.402  -10.224 1.00 0.00 ? 505 GLU A OE2  7  
ATOM   9845  H  H    . GLU A 1 84 ? 1.101   12.717  -14.779 1.00 0.00 ? 505 GLU A H    7  
ATOM   9846  H  HA   . GLU A 1 84 ? -0.691  11.116  -13.472 1.00 0.00 ? 505 GLU A HA   7  
ATOM   9847  H  HB2  . GLU A 1 84 ? -0.781  13.956  -14.382 1.00 0.00 ? 505 GLU A HB2  7  
ATOM   9848  H  HB3  . GLU A 1 84 ? -2.250  13.242  -13.734 1.00 0.00 ? 505 GLU A HB3  7  
ATOM   9849  H  HG2  . GLU A 1 84 ? 0.333   13.079  -12.235 1.00 0.00 ? 505 GLU A HG2  7  
ATOM   9850  H  HG3  . GLU A 1 84 ? -0.688  14.513  -12.145 1.00 0.00 ? 505 GLU A HG3  7  
ATOM   9851  N  N    . LYS A 1 85 ? -2.844  10.694  -14.777 1.00 0.00 ? 506 LYS A N    7  
ATOM   9852  C  CA   . LYS A 1 85 ? -3.909  10.170  -15.624 1.00 0.00 ? 506 LYS A CA   7  
ATOM   9853  C  C    . LYS A 1 85 ? -5.199  9.994   -14.829 1.00 0.00 ? 506 LYS A C    7  
ATOM   9854  O  O    . LYS A 1 85 ? -5.328  9.062   -14.037 1.00 0.00 ? 506 LYS A O    7  
ATOM   9855  C  CB   . LYS A 1 85 ? -3.490  8.833   -16.238 1.00 0.00 ? 506 LYS A CB   7  
ATOM   9856  C  CG   . LYS A 1 85 ? -4.181  8.525   -17.555 1.00 0.00 ? 506 LYS A CG   7  
ATOM   9857  C  CD   . LYS A 1 85 ? -5.576  7.964   -17.335 1.00 0.00 ? 506 LYS A CD   7  
ATOM   9858  C  CE   . LYS A 1 85 ? -6.155  7.391   -18.619 1.00 0.00 ? 506 LYS A CE   7  
ATOM   9859  N  NZ   . LYS A 1 85 ? -6.614  8.462   -19.547 1.00 0.00 ? 506 LYS A NZ   7  
ATOM   9860  H  H    . LYS A 1 85 ? -2.906  10.580  -13.805 1.00 0.00 ? 506 LYS A H    7  
ATOM   9861  H  HA   . LYS A 1 85 ? -4.083  10.882  -16.416 1.00 0.00 ? 506 LYS A HA   7  
ATOM   9862  H  HB2  . LYS A 1 85 ? -2.423  8.848   -16.410 1.00 0.00 ? 506 LYS A HB2  7  
ATOM   9863  H  HB3  . LYS A 1 85 ? -3.722  8.041   -15.540 1.00 0.00 ? 506 LYS A HB3  7  
ATOM   9864  H  HG2  . LYS A 1 85 ? -4.257  9.434   -18.132 1.00 0.00 ? 506 LYS A HG2  7  
ATOM   9865  H  HG3  . LYS A 1 85 ? -3.593  7.799   -18.098 1.00 0.00 ? 506 LYS A HG3  7  
ATOM   9866  H  HD2  . LYS A 1 85 ? -5.527  7.180   -16.594 1.00 0.00 ? 506 LYS A HD2  7  
ATOM   9867  H  HD3  . LYS A 1 85 ? -6.221  8.756   -16.981 1.00 0.00 ? 506 LYS A HD3  7  
ATOM   9868  H  HE2  . LYS A 1 85 ? -5.396  6.802   -19.110 1.00 0.00 ? 506 LYS A HE2  7  
ATOM   9869  H  HE3  . LYS A 1 85 ? -6.995  6.759   -18.369 1.00 0.00 ? 506 LYS A HE3  7  
ATOM   9870  H  HZ1  . LYS A 1 85 ? -5.795  8.918   -19.998 1.00 0.00 ? 506 LYS A HZ1  7  
ATOM   9871  H  HZ2  . LYS A 1 85 ? -7.152  9.182   -19.024 1.00 0.00 ? 506 LYS A HZ2  7  
ATOM   9872  H  HZ3  . LYS A 1 85 ? -7.223  8.058   -20.286 1.00 0.00 ? 506 LYS A HZ3  7  
ATOM   9873  N  N    . GLU A 1 86 ? -6.151  10.896  -15.047 1.00 0.00 ? 507 GLU A N    7  
ATOM   9874  C  CA   . GLU A 1 86 ? -7.431  10.838  -14.351 1.00 0.00 ? 507 GLU A CA   7  
ATOM   9875  C  C    . GLU A 1 86 ? -8.470  10.090  -15.182 1.00 0.00 ? 507 GLU A C    7  
ATOM   9876  O  O    . GLU A 1 86 ? -8.958  10.599  -16.190 1.00 0.00 ? 507 GLU A O    7  
ATOM   9877  C  CB   . GLU A 1 86 ? -7.932  12.250  -14.040 1.00 0.00 ? 507 GLU A CB   7  
ATOM   9878  C  CG   . GLU A 1 86 ? -9.084  12.283  -13.049 1.00 0.00 ? 507 GLU A CG   7  
ATOM   9879  C  CD   . GLU A 1 86 ? -9.393  13.685  -12.561 1.00 0.00 ? 507 GLU A CD   7  
ATOM   9880  O  OE1  . GLU A 1 86 ? -8.673  14.173  -11.665 1.00 0.00 ? 507 GLU A OE1  7  
ATOM   9881  O  OE2  . GLU A 1 86 ? -10.355 14.294  -13.075 1.00 0.00 ? 507 GLU A OE2  7  
ATOM   9882  H  H    . GLU A 1 86 ? -5.989  11.617  -15.691 1.00 0.00 ? 507 GLU A H    7  
ATOM   9883  H  HA   . GLU A 1 86 ? -7.280  10.308  -13.423 1.00 0.00 ? 507 GLU A HA   7  
ATOM   9884  H  HB2  . GLU A 1 86 ? -7.116  12.827  -13.632 1.00 0.00 ? 507 GLU A HB2  7  
ATOM   9885  H  HB3  . GLU A 1 86 ? -8.262  12.712  -14.959 1.00 0.00 ? 507 GLU A HB3  7  
ATOM   9886  H  HG2  . GLU A 1 86 ? -9.965  11.883  -13.528 1.00 0.00 ? 507 GLU A HG2  7  
ATOM   9887  H  HG3  . GLU A 1 86 ? -8.827  11.670  -12.198 1.00 0.00 ? 507 GLU A HG3  7  
ATOM   9888  N  N    . VAL A 1 87 ? -8.802  8.877   -14.750 1.00 0.00 ? 508 VAL A N    7  
ATOM   9889  C  CA   . VAL A 1 87 ? -9.782  8.058   -15.453 1.00 0.00 ? 508 VAL A CA   7  
ATOM   9890  C  C    . VAL A 1 87 ? -11.199 8.559   -15.201 1.00 0.00 ? 508 VAL A C    7  
ATOM   9891  O  O    . VAL A 1 87 ? -11.891 8.071   -14.308 1.00 0.00 ? 508 VAL A O    7  
ATOM   9892  C  CB   . VAL A 1 87 ? -9.688  6.581   -15.026 1.00 0.00 ? 508 VAL A CB   7  
ATOM   9893  C  CG1  . VAL A 1 87 ? -8.727  5.823   -15.930 1.00 0.00 ? 508 VAL A CG1  7  
ATOM   9894  C  CG2  . VAL A 1 87 ? -9.260  6.473   -13.570 1.00 0.00 ? 508 VAL A CG2  7  
ATOM   9895  H  H    . VAL A 1 87 ? -8.378  8.525   -13.940 1.00 0.00 ? 508 VAL A H    7  
ATOM   9896  H  HA   . VAL A 1 87 ? -9.571  8.119   -16.511 1.00 0.00 ? 508 VAL A HA   7  
ATOM   9897  H  HB   . VAL A 1 87 ? -10.667 6.135   -15.125 1.00 0.00 ? 508 VAL A HB   7  
ATOM   9898  H  HG11 . VAL A 1 87 ? -8.439  6.455   -16.758 1.00 0.00 ? 508 VAL A HG11 7  
ATOM   9899  H  HG12 . VAL A 1 87 ? -7.849  5.542   -15.367 1.00 0.00 ? 508 VAL A HG12 7  
ATOM   9900  H  HG13 . VAL A 1 87 ? -9.213  4.935   -16.308 1.00 0.00 ? 508 VAL A HG13 7  
ATOM   9901  H  HG21 . VAL A 1 87 ? -9.653  7.313   -13.017 1.00 0.00 ? 508 VAL A HG21 7  
ATOM   9902  H  HG22 . VAL A 1 87 ? -9.642  5.555   -13.149 1.00 0.00 ? 508 VAL A HG22 7  
ATOM   9903  H  HG23 . VAL A 1 87 ? -8.182  6.475   -13.510 1.00 0.00 ? 508 VAL A HG23 7  
ATOM   9904  N  N    . GLU A 1 88 ? -11.625 9.536   -15.995 1.00 0.00 ? 509 GLU A N    7  
ATOM   9905  C  CA   . GLU A 1 88 ? -12.961 10.104  -15.857 1.00 0.00 ? 509 GLU A CA   7  
ATOM   9906  C  C    . GLU A 1 88 ? -14.020 9.005   -15.837 1.00 0.00 ? 509 GLU A C    7  
ATOM   9907  O  O    . GLU A 1 88 ? -13.919 8.019   -16.565 1.00 0.00 ? 509 GLU A O    7  
ATOM   9908  C  CB   . GLU A 1 88 ? -13.245 11.080  -17.000 1.00 0.00 ? 509 GLU A CB   7  
ATOM   9909  C  CG   . GLU A 1 88 ? -14.365 12.062  -16.698 1.00 0.00 ? 509 GLU A CG   7  
ATOM   9910  C  CD   . GLU A 1 88 ? -14.683 12.965  -17.875 1.00 0.00 ? 509 GLU A CD   7  
ATOM   9911  O  OE1  . GLU A 1 88 ? -14.358 12.585  -19.019 1.00 0.00 ? 509 GLU A OE1  7  
ATOM   9912  O  OE2  . GLU A 1 88 ? -15.256 14.051  -17.650 1.00 0.00 ? 509 GLU A OE2  7  
ATOM   9913  H  H    . GLU A 1 88 ? -11.027 9.884   -16.689 1.00 0.00 ? 509 GLU A H    7  
ATOM   9914  H  HA   . GLU A 1 88 ? -12.999 10.640  -14.921 1.00 0.00 ? 509 GLU A HA   7  
ATOM   9915  H  HB2  . GLU A 1 88 ? -12.347 11.643  -17.209 1.00 0.00 ? 509 GLU A HB2  7  
ATOM   9916  H  HB3  . GLU A 1 88 ? -13.518 10.516  -17.880 1.00 0.00 ? 509 GLU A HB3  7  
ATOM   9917  H  HG2  . GLU A 1 88 ? -15.254 11.507  -16.441 1.00 0.00 ? 509 GLU A HG2  7  
ATOM   9918  H  HG3  . GLU A 1 88 ? -14.071 12.677  -15.861 1.00 0.00 ? 509 GLU A HG3  7  
ATOM   9919  N  N    . GLU A 1 89 ? -15.035 9.184   -14.997 1.00 0.00 ? 510 GLU A N    7  
ATOM   9920  C  CA   . GLU A 1 89 ? -16.111 8.208   -14.881 1.00 0.00 ? 510 GLU A CA   7  
ATOM   9921  C  C    . GLU A 1 89 ? -16.632 7.806   -16.258 1.00 0.00 ? 510 GLU A C    7  
ATOM   9922  O  O    . GLU A 1 89 ? -16.600 8.597   -17.201 1.00 0.00 ? 510 GLU A O    7  
ATOM   9923  C  CB   . GLU A 1 89 ? -17.254 8.773   -14.036 1.00 0.00 ? 510 GLU A CB   7  
ATOM   9924  C  CG   . GLU A 1 89 ? -17.919 9.993   -14.650 1.00 0.00 ? 510 GLU A CG   7  
ATOM   9925  C  CD   . GLU A 1 89 ? -19.074 10.511  -13.815 1.00 0.00 ? 510 GLU A CD   7  
ATOM   9926  O  OE1  . GLU A 1 89 ? -19.821 9.680   -13.256 1.00 0.00 ? 510 GLU A OE1  7  
ATOM   9927  O  OE2  . GLU A 1 89 ? -19.232 11.746  -13.719 1.00 0.00 ? 510 GLU A OE2  7  
ATOM   9928  H  H    . GLU A 1 89 ? -15.060 9.992   -14.442 1.00 0.00 ? 510 GLU A H    7  
ATOM   9929  H  HA   . GLU A 1 89 ? -15.713 7.332   -14.391 1.00 0.00 ? 510 GLU A HA   7  
ATOM   9930  H  HB2  . GLU A 1 89 ? -18.004 8.007   -13.906 1.00 0.00 ? 510 GLU A HB2  7  
ATOM   9931  H  HB3  . GLU A 1 89 ? -16.866 9.051   -13.067 1.00 0.00 ? 510 GLU A HB3  7  
ATOM   9932  H  HG2  . GLU A 1 89 ? -17.184 10.779  -14.745 1.00 0.00 ? 510 GLU A HG2  7  
ATOM   9933  H  HG3  . GLU A 1 89 ? -18.292 9.730   -15.629 1.00 0.00 ? 510 GLU A HG3  7  
ATOM   9934  N  N    . LEU A 1 90 ? -17.112 6.572   -16.366 1.00 0.00 ? 511 LEU A N    7  
ATOM   9935  C  CA   . LEU A 1 90 ? -17.640 6.064   -17.627 1.00 0.00 ? 511 LEU A CA   7  
ATOM   9936  C  C    . LEU A 1 90 ? -19.071 6.543   -17.850 1.00 0.00 ? 511 LEU A C    7  
ATOM   9937  O  O    . LEU A 1 90 ? -19.904 5.814   -18.389 1.00 0.00 ? 511 LEU A O    7  
ATOM   9938  C  CB   . LEU A 1 90 ? -17.593 4.535   -17.643 1.00 0.00 ? 511 LEU A CB   7  
ATOM   9939  C  CG   . LEU A 1 90 ? -18.033 3.836   -16.356 1.00 0.00 ? 511 LEU A CG   7  
ATOM   9940  C  CD1  . LEU A 1 90 ? -16.878 3.756   -15.370 1.00 0.00 ? 511 LEU A CD1  7  
ATOM   9941  C  CD2  . LEU A 1 90 ? -19.218 4.561   -15.733 1.00 0.00 ? 511 LEU A CD2  7  
ATOM   9942  H  H    . LEU A 1 90 ? -17.111 5.988   -15.579 1.00 0.00 ? 511 LEU A H    7  
ATOM   9943  H  HA   . LEU A 1 90 ? -17.017 6.443   -18.423 1.00 0.00 ? 511 LEU A HA   7  
ATOM   9944  H  HB2  . LEU A 1 90 ? -18.235 4.193   -18.440 1.00 0.00 ? 511 LEU A HB2  7  
ATOM   9945  H  HB3  . LEU A 1 90 ? -16.575 4.238   -17.850 1.00 0.00 ? 511 LEU A HB3  7  
ATOM   9946  H  HG   . LEU A 1 90 ? -18.343 2.827   -16.589 1.00 0.00 ? 511 LEU A HG   7  
ATOM   9947  H  HD11 . LEU A 1 90 ? -15.965 4.058   -15.861 1.00 0.00 ? 511 LEU A HD11 7  
ATOM   9948  H  HD12 . LEU A 1 90 ? -16.777 2.741   -15.015 1.00 0.00 ? 511 LEU A HD12 7  
ATOM   9949  H  HD13 . LEU A 1 90 ? -17.072 4.412   -14.534 1.00 0.00 ? 511 LEU A HD13 7  
ATOM   9950  H  HD21 . LEU A 1 90 ? -18.887 5.504   -15.323 1.00 0.00 ? 511 LEU A HD21 7  
ATOM   9951  H  HD22 . LEU A 1 90 ? -19.638 3.954   -14.945 1.00 0.00 ? 511 LEU A HD22 7  
ATOM   9952  H  HD23 . LEU A 1 90 ? -19.967 4.741   -16.490 1.00 0.00 ? 511 LEU A HD23 7  
ATOM   9953  N  N    . LYS A 1 91 ? -19.348 7.774   -17.435 1.00 0.00 ? 512 LYS A N    7  
ATOM   9954  C  CA   . LYS A 1 91 ? -20.677 8.353   -17.593 1.00 0.00 ? 512 LYS A CA   7  
ATOM   9955  C  C    . LYS A 1 91 ? -21.756 7.370   -17.148 1.00 0.00 ? 512 LYS A C    7  
ATOM   9956  O  O    . LYS A 1 91 ? -22.800 7.248   -17.788 1.00 0.00 ? 512 LYS A O    7  
ATOM   9957  C  CB   . LYS A 1 91 ? -20.910 8.758   -19.050 1.00 0.00 ? 512 LYS A CB   7  
ATOM   9958  C  CG   . LYS A 1 91 ? -20.396 10.147  -19.386 1.00 0.00 ? 512 LYS A CG   7  
ATOM   9959  C  CD   . LYS A 1 91 ? -21.241 10.810  -20.460 1.00 0.00 ? 512 LYS A CD   7  
ATOM   9960  C  CE   . LYS A 1 91 ? -22.378 11.620  -19.855 1.00 0.00 ? 512 LYS A CE   7  
ATOM   9961  N  NZ   . LYS A 1 91 ? -23.511 10.753  -19.429 1.00 0.00 ? 512 LYS A NZ   7  
ATOM   9962  H  H    . LYS A 1 91 ? -18.642 8.307   -17.013 1.00 0.00 ? 512 LYS A H    7  
ATOM   9963  H  HA   . LYS A 1 91 ? -20.731 9.234   -16.971 1.00 0.00 ? 512 LYS A HA   7  
ATOM   9964  H  HB2  . LYS A 1 91 ? -20.412 8.047   -19.693 1.00 0.00 ? 512 LYS A HB2  7  
ATOM   9965  H  HB3  . LYS A 1 91 ? -21.971 8.731   -19.254 1.00 0.00 ? 512 LYS A HB3  7  
ATOM   9966  H  HG2  . LYS A 1 91 ? -20.423 10.756  -18.495 1.00 0.00 ? 512 LYS A HG2  7  
ATOM   9967  H  HG3  . LYS A 1 91 ? -19.378 10.068  -19.739 1.00 0.00 ? 512 LYS A HG3  7  
ATOM   9968  H  HD2  . LYS A 1 91 ? -20.615 11.469  -21.043 1.00 0.00 ? 512 LYS A HD2  7  
ATOM   9969  H  HD3  . LYS A 1 91 ? -21.657 10.046  -21.102 1.00 0.00 ? 512 LYS A HD3  7  
ATOM   9970  H  HE2  . LYS A 1 91 ? -22.003 12.155  -18.996 1.00 0.00 ? 512 LYS A HE2  7  
ATOM   9971  H  HE3  . LYS A 1 91 ? -22.732 12.325  -20.592 1.00 0.00 ? 512 LYS A HE3  7  
ATOM   9972  H  HZ1  . LYS A 1 91 ? -23.234 10.182  -18.605 1.00 0.00 ? 512 LYS A HZ1  7  
ATOM   9973  H  HZ2  . LYS A 1 91 ? -23.783 10.114  -20.203 1.00 0.00 ? 512 LYS A HZ2  7  
ATOM   9974  H  HZ3  . LYS A 1 91 ? -24.332 11.338  -19.172 1.00 0.00 ? 512 LYS A HZ3  7  
ATOM   9975  N  N    . LYS A 1 92 ? -21.496 6.673   -16.048 1.00 0.00 ? 513 LYS A N    7  
ATOM   9976  C  CA   . LYS A 1 92 ? -22.445 5.702   -15.515 1.00 0.00 ? 513 LYS A CA   7  
ATOM   9977  C  C    . LYS A 1 92 ? -23.875 6.224   -15.623 1.00 0.00 ? 513 LYS A C    7  
ATOM   9978  O  O    . LYS A 1 92 ? -24.111 7.431   -15.571 1.00 0.00 ? 513 LYS A O    7  
ATOM   9979  C  CB   . LYS A 1 92 ? -22.116 5.385   -14.055 1.00 0.00 ? 513 LYS A CB   7  
ATOM   9980  C  CG   . LYS A 1 92 ? -22.426 6.524   -13.099 1.00 0.00 ? 513 LYS A CG   7  
ATOM   9981  C  CD   . LYS A 1 92 ? -22.107 6.149   -11.662 1.00 0.00 ? 513 LYS A CD   7  
ATOM   9982  C  CE   . LYS A 1 92 ? -22.766 7.103   -10.678 1.00 0.00 ? 513 LYS A CE   7  
ATOM   9983  N  NZ   . LYS A 1 92 ? -22.006 7.195   -9.400  1.00 0.00 ? 513 LYS A NZ   7  
ATOM   9984  H  H    . LYS A 1 92 ? -20.645 6.815   -15.581 1.00 0.00 ? 513 LYS A H    7  
ATOM   9985  H  HA   . LYS A 1 92 ? -22.359 4.799   -16.099 1.00 0.00 ? 513 LYS A HA   7  
ATOM   9986  H  HB2  . LYS A 1 92 ? -22.687 4.521   -13.749 1.00 0.00 ? 513 LYS A HB2  7  
ATOM   9987  H  HB3  . LYS A 1 92 ? -21.063 5.155   -13.978 1.00 0.00 ? 513 LYS A HB3  7  
ATOM   9988  H  HG2  . LYS A 1 92 ? -21.833 7.384   -13.375 1.00 0.00 ? 513 LYS A HG2  7  
ATOM   9989  H  HG3  . LYS A 1 92 ? -23.476 6.769   -13.174 1.00 0.00 ? 513 LYS A HG3  7  
ATOM   9990  H  HD2  . LYS A 1 92 ? -22.467 5.149   -11.472 1.00 0.00 ? 513 LYS A HD2  7  
ATOM   9991  H  HD3  . LYS A 1 92 ? -21.036 6.181   -11.519 1.00 0.00 ? 513 LYS A HD3  7  
ATOM   9992  H  HE2  . LYS A 1 92 ? -22.818 8.083   -11.127 1.00 0.00 ? 513 LYS A HE2  7  
ATOM   9993  H  HE3  . LYS A 1 92 ? -23.765 6.750   -10.468 1.00 0.00 ? 513 LYS A HE3  7  
ATOM   9994  H  HZ1  . LYS A 1 92 ? -22.469 6.620   -8.667  1.00 0.00 ? 513 LYS A HZ1  7  
ATOM   9995  H  HZ2  . LYS A 1 92 ? -21.967 8.183   -9.078  1.00 0.00 ? 513 LYS A HZ2  7  
ATOM   9996  H  HZ3  . LYS A 1 92 ? -21.035 6.848   -9.536  1.00 0.00 ? 513 LYS A HZ3  7  
ATOM   9997  N  N    . SER A 1 93 ? -24.825 5.306   -15.772 1.00 0.00 ? 514 SER A N    7  
ATOM   9998  C  CA   . SER A 1 93 ? -26.231 5.674   -15.889 1.00 0.00 ? 514 SER A CA   7  
ATOM   9999  C  C    . SER A 1 93 ? -27.122 4.635   -15.215 1.00 0.00 ? 514 SER A C    7  
ATOM   10000 O  O    . SER A 1 93 ? -26.642 3.617   -14.717 1.00 0.00 ? 514 SER A O    7  
ATOM   10001 C  CB   . SER A 1 93 ? -26.621 5.819   -17.361 1.00 0.00 ? 514 SER A CB   7  
ATOM   10002 O  OG   . SER A 1 93 ? -26.265 4.663   -18.099 1.00 0.00 ? 514 SER A OG   7  
ATOM   10003 H  H    . SER A 1 93 ? -24.573 4.359   -15.806 1.00 0.00 ? 514 SER A H    7  
ATOM   10004 H  HA   . SER A 1 93 ? -26.368 6.624   -15.394 1.00 0.00 ? 514 SER A HA   7  
ATOM   10005 H  HB2  . SER A 1 93 ? -27.688 5.964   -17.436 1.00 0.00 ? 514 SER A HB2  7  
ATOM   10006 H  HB3  . SER A 1 93 ? -26.111 6.672   -17.783 1.00 0.00 ? 514 SER A HB3  7  
ATOM   10007 H  HG   . SER A 1 93 ? -26.863 3.945   -17.879 1.00 0.00 ? 514 SER A HG   7  
ATOM   10008 N  N    . GLY A 1 94 ? -28.425 4.900   -15.203 1.00 0.00 ? 515 GLY A N    7  
ATOM   10009 C  CA   . GLY A 1 94 ? -29.364 3.980   -14.588 1.00 0.00 ? 515 GLY A CA   7  
ATOM   10010 C  C    . GLY A 1 94 ? -30.804 4.417   -14.766 1.00 0.00 ? 515 GLY A C    7  
ATOM   10011 O  O    . GLY A 1 94 ? -31.280 5.343   -14.110 1.00 0.00 ? 515 GLY A O    7  
ATOM   10012 H  H    . GLY A 1 94 ? -28.751 5.727   -15.616 1.00 0.00 ? 515 GLY A H    7  
ATOM   10013 H  HA2  . GLY A 1 94 ? -29.237 3.004   -15.031 1.00 0.00 ? 515 GLY A HA2  7  
ATOM   10014 H  HA3  . GLY A 1 94 ? -29.147 3.916   -13.532 1.00 0.00 ? 515 GLY A HA3  7  
ATOM   10015 N  N    . PRO A 1 95 ? -31.524 3.740   -15.674 1.00 0.00 ? 516 PRO A N    7  
ATOM   10016 C  CA   . PRO A 1 95 ? -32.929 4.047   -15.958 1.00 0.00 ? 516 PRO A CA   7  
ATOM   10017 C  C    . PRO A 1 95 ? -33.850 3.670   -14.803 1.00 0.00 ? 516 PRO A C    7  
ATOM   10018 O  O    . PRO A 1 95 ? -33.391 3.233   -13.747 1.00 0.00 ? 516 PRO A O    7  
ATOM   10019 C  CB   . PRO A 1 95 ? -33.237 3.191   -17.189 1.00 0.00 ? 516 PRO A CB   7  
ATOM   10020 C  CG   . PRO A 1 95 ? -32.269 2.061   -17.116 1.00 0.00 ? 516 PRO A CG   7  
ATOM   10021 C  CD   . PRO A 1 95 ? -31.022 2.624   -16.492 1.00 0.00 ? 516 PRO A CD   7  
ATOM   10022 H  HA   . PRO A 1 95 ? -33.066 5.091   -16.200 1.00 0.00 ? 516 PRO A HA   7  
ATOM   10023 H  HB2  . PRO A 1 95 ? -34.259 2.840   -17.140 1.00 0.00 ? 516 PRO A HB2  7  
ATOM   10024 H  HB3  . PRO A 1 95 ? -33.094 3.777   -18.084 1.00 0.00 ? 516 PRO A HB3  7  
ATOM   10025 H  HG2  . PRO A 1 95 ? -32.672 1.271   -16.502 1.00 0.00 ? 516 PRO A HG2  7  
ATOM   10026 H  HG3  . PRO A 1 95 ? -32.057 1.695   -18.110 1.00 0.00 ? 516 PRO A HG3  7  
ATOM   10027 H  HD2  . PRO A 1 95 ? -30.539 1.880   -15.876 1.00 0.00 ? 516 PRO A HD2  7  
ATOM   10028 H  HD3  . PRO A 1 95 ? -30.345 2.981   -17.255 1.00 0.00 ? 516 PRO A HD3  7  
ATOM   10029 N  N    . SER A 1 96 ? -35.152 3.841   -15.009 1.00 0.00 ? 517 SER A N    7  
ATOM   10030 C  CA   . SER A 1 96 ? -36.137 3.521   -13.983 1.00 0.00 ? 517 SER A CA   7  
ATOM   10031 C  C    . SER A 1 96 ? -37.501 3.242   -14.608 1.00 0.00 ? 517 SER A C    7  
ATOM   10032 O  O    . SER A 1 96 ? -37.673 3.348   -15.822 1.00 0.00 ? 517 SER A O    7  
ATOM   10033 C  CB   . SER A 1 96 ? -36.249 4.669   -12.978 1.00 0.00 ? 517 SER A CB   7  
ATOM   10034 O  OG   . SER A 1 96 ? -36.948 5.769   -13.535 1.00 0.00 ? 517 SER A OG   7  
ATOM   10035 H  H    . SER A 1 96 ? -35.456 4.193   -15.872 1.00 0.00 ? 517 SER A H    7  
ATOM   10036 H  HA   . SER A 1 96 ? -35.802 2.634   -13.467 1.00 0.00 ? 517 SER A HA   7  
ATOM   10037 H  HB2  . SER A 1 96 ? -36.780 4.327   -12.102 1.00 0.00 ? 517 SER A HB2  7  
ATOM   10038 H  HB3  . SER A 1 96 ? -35.258 4.994   -12.695 1.00 0.00 ? 517 SER A HB3  7  
ATOM   10039 H  HG   . SER A 1 96 ? -36.524 6.037   -14.353 1.00 0.00 ? 517 SER A HG   7  
ATOM   10040 N  N    . SER A 1 97 ? -38.467 2.885   -13.768 1.00 0.00 ? 518 SER A N    7  
ATOM   10041 C  CA   . SER A 1 97 ? -39.816 2.587   -14.236 1.00 0.00 ? 518 SER A CA   7  
ATOM   10042 C  C    . SER A 1 97 ? -40.831 2.747   -13.109 1.00 0.00 ? 518 SER A C    7  
ATOM   10043 O  O    . SER A 1 97 ? -40.464 2.962   -11.954 1.00 0.00 ? 518 SER A O    7  
ATOM   10044 C  CB   . SER A 1 97 ? -39.880 1.165   -14.798 1.00 0.00 ? 518 SER A CB   7  
ATOM   10045 O  OG   . SER A 1 97 ? -39.528 0.211   -13.812 1.00 0.00 ? 518 SER A OG   7  
ATOM   10046 H  H    . SER A 1 97 ? -38.268 2.818   -12.810 1.00 0.00 ? 518 SER A H    7  
ATOM   10047 H  HA   . SER A 1 97 ? -40.056 3.287   -15.023 1.00 0.00 ? 518 SER A HA   7  
ATOM   10048 H  HB2  . SER A 1 97 ? -40.884 0.960   -15.138 1.00 0.00 ? 518 SER A HB2  7  
ATOM   10049 H  HB3  . SER A 1 97 ? -39.194 1.077   -15.628 1.00 0.00 ? 518 SER A HB3  7  
ATOM   10050 H  HG   . SER A 1 97 ? -39.184 -0.578  -14.237 1.00 0.00 ? 518 SER A HG   7  
ATOM   10051 N  N    . GLY A 1 98 ? -42.111 2.640   -13.453 1.00 0.00 ? 519 GLY A N    7  
ATOM   10052 C  CA   . GLY A 1 98 ? -43.160 2.776   -12.460 1.00 0.00 ? 519 GLY A CA   7  
ATOM   10053 C  C    . GLY A 1 98 ? -44.439 3.344   -13.042 1.00 0.00 ? 519 GLY A C    7  
ATOM   10054 O  O    . GLY A 1 98 ? -44.369 4.155   -13.964 1.00 0.00 ? 519 GLY A O    7  
ATOM   10055 H  H    . GLY A 1 98 ? -42.344 2.468   -14.390 1.00 0.00 ? 519 GLY A H    7  
ATOM   10056 H  HA2  . GLY A 1 98 ? -43.369 1.804   -12.038 1.00 0.00 ? 519 GLY A HA2  7  
ATOM   10057 H  HA3  . GLY A 1 98 ? -42.813 3.431   -11.674 1.00 0.00 ? 519 GLY A HA3  7  
HETATM 10058 ZN ZN   . ZN  B 2 .  ? -0.846  -7.816  -10.942 1.00 0.00 ? 622 ZN  A ZN   7  
HETATM 10059 ZN ZN   . ZN  C 2 .  ? -0.718  -3.682  5.427   1.00 0.00 ? 822 ZN  A ZN   7  
ATOM   10060 N  N    . GLY A 1 1  ? 36.879  -13.721 -11.854 1.00 0.00 ? 422 GLY A N    8  
ATOM   10061 C  CA   . GLY A 1 1  ? 35.682  -14.273 -12.460 1.00 0.00 ? 422 GLY A CA   8  
ATOM   10062 C  C    . GLY A 1 1  ? 34.471  -14.163 -11.555 1.00 0.00 ? 422 GLY A C    8  
ATOM   10063 O  O    . GLY A 1 1  ? 34.102  -15.125 -10.881 1.00 0.00 ? 422 GLY A O    8  
ATOM   10064 H  H1   . GLY A 1 1  ? 36.862  -12.818 -11.473 1.00 0.00 ? 422 GLY A H1   8  
ATOM   10065 H  HA2  . GLY A 1 1  ? 35.480  -13.743 -13.379 1.00 0.00 ? 422 GLY A HA2  8  
ATOM   10066 H  HA3  . GLY A 1 1  ? 35.854  -15.314 -12.687 1.00 0.00 ? 422 GLY A HA3  8  
ATOM   10067 N  N    . SER A 1 2  ? 33.851  -12.988 -11.537 1.00 0.00 ? 423 SER A N    8  
ATOM   10068 C  CA   . SER A 1 2  ? 32.678  -12.754 -10.703 1.00 0.00 ? 423 SER A CA   8  
ATOM   10069 C  C    . SER A 1 2  ? 31.483  -12.330 -11.553 1.00 0.00 ? 423 SER A C    8  
ATOM   10070 O  O    . SER A 1 2  ? 31.456  -11.226 -12.097 1.00 0.00 ? 423 SER A O    8  
ATOM   10071 C  CB   . SER A 1 2  ? 32.977  -11.683 -9.653  1.00 0.00 ? 423 SER A CB   8  
ATOM   10072 O  OG   . SER A 1 2  ? 33.337  -10.456 -10.263 1.00 0.00 ? 423 SER A OG   8  
ATOM   10073 H  H    . SER A 1 2  ? 34.193  -12.259 -12.097 1.00 0.00 ? 423 SER A H    8  
ATOM   10074 H  HA   . SER A 1 2  ? 32.437  -13.680 -10.203 1.00 0.00 ? 423 SER A HA   8  
ATOM   10075 H  HB2  . SER A 1 2  ? 32.100  -11.525 -9.044  1.00 0.00 ? 423 SER A HB2  8  
ATOM   10076 H  HB3  . SER A 1 2  ? 33.794  -12.015 -9.028  1.00 0.00 ? 423 SER A HB3  8  
ATOM   10077 H  HG   . SER A 1 2  ? 34.055  -10.606 -10.884 1.00 0.00 ? 423 SER A HG   8  
ATOM   10078 N  N    . SER A 1 3  ? 30.498  -13.215 -11.661 1.00 0.00 ? 424 SER A N    8  
ATOM   10079 C  CA   . SER A 1 3  ? 29.302  -12.935 -12.446 1.00 0.00 ? 424 SER A CA   8  
ATOM   10080 C  C    . SER A 1 3  ? 28.057  -12.943 -11.564 1.00 0.00 ? 424 SER A C    8  
ATOM   10081 O  O    . SER A 1 3  ? 27.601  -13.998 -11.125 1.00 0.00 ? 424 SER A O    8  
ATOM   10082 C  CB   . SER A 1 3  ? 29.151  -13.963 -13.570 1.00 0.00 ? 424 SER A CB   8  
ATOM   10083 O  OG   . SER A 1 3  ? 30.048  -13.691 -14.633 1.00 0.00 ? 424 SER A OG   8  
ATOM   10084 H  H    . SER A 1 3  ? 30.578  -14.078 -11.203 1.00 0.00 ? 424 SER A H    8  
ATOM   10085 H  HA   . SER A 1 3  ? 29.413  -11.953 -12.881 1.00 0.00 ? 424 SER A HA   8  
ATOM   10086 H  HB2  . SER A 1 3  ? 29.359  -14.948 -13.182 1.00 0.00 ? 424 SER A HB2  8  
ATOM   10087 H  HB3  . SER A 1 3  ? 28.140  -13.931 -13.949 1.00 0.00 ? 424 SER A HB3  8  
ATOM   10088 H  HG   . SER A 1 3  ? 30.817  -14.260 -14.557 1.00 0.00 ? 424 SER A HG   8  
ATOM   10089 N  N    . GLY A 1 4  ? 27.513  -11.758 -11.307 1.00 0.00 ? 425 GLY A N    8  
ATOM   10090 C  CA   . GLY A 1 4  ? 26.327  -11.650 -10.478 1.00 0.00 ? 425 GLY A CA   8  
ATOM   10091 C  C    . GLY A 1 4  ? 25.076  -11.374 -11.288 1.00 0.00 ? 425 GLY A C    8  
ATOM   10092 O  O    . GLY A 1 4  ? 25.045  -10.449 -12.100 1.00 0.00 ? 425 GLY A O    8  
ATOM   10093 H  H    . GLY A 1 4  ? 27.920  -10.950 -11.684 1.00 0.00 ? 425 GLY A H    8  
ATOM   10094 H  HA2  . GLY A 1 4  ? 26.195  -12.574 -9.935  1.00 0.00 ? 425 GLY A HA2  8  
ATOM   10095 H  HA3  . GLY A 1 4  ? 26.468  -10.845 -9.771  1.00 0.00 ? 425 GLY A HA3  8  
ATOM   10096 N  N    . SER A 1 5  ? 24.042  -12.180 -11.071 1.00 0.00 ? 426 SER A N    8  
ATOM   10097 C  CA   . SER A 1 5  ? 22.784  -12.022 -11.791 1.00 0.00 ? 426 SER A CA   8  
ATOM   10098 C  C    . SER A 1 5  ? 21.611  -11.921 -10.821 1.00 0.00 ? 426 SER A C    8  
ATOM   10099 O  O    . SER A 1 5  ? 21.717  -12.313 -9.659  1.00 0.00 ? 426 SER A O    8  
ATOM   10100 C  CB   . SER A 1 5  ? 22.569  -13.196 -12.748 1.00 0.00 ? 426 SER A CB   8  
ATOM   10101 O  OG   . SER A 1 5  ? 21.657  -12.855 -13.778 1.00 0.00 ? 426 SER A OG   8  
ATOM   10102 H  H    . SER A 1 5  ? 24.128  -12.900 -10.411 1.00 0.00 ? 426 SER A H    8  
ATOM   10103 H  HA   . SER A 1 5  ? 22.843  -11.108 -12.364 1.00 0.00 ? 426 SER A HA   8  
ATOM   10104 H  HB2  . SER A 1 5  ? 23.512  -13.470 -13.196 1.00 0.00 ? 426 SER A HB2  8  
ATOM   10105 H  HB3  . SER A 1 5  ? 22.174  -14.038 -12.198 1.00 0.00 ? 426 SER A HB3  8  
ATOM   10106 H  HG   . SER A 1 5  ? 21.242  -13.652 -14.115 1.00 0.00 ? 426 SER A HG   8  
ATOM   10107 N  N    . SER A 1 6  ? 20.493  -11.391 -11.307 1.00 0.00 ? 427 SER A N    8  
ATOM   10108 C  CA   . SER A 1 6  ? 19.300  -11.234 -10.483 1.00 0.00 ? 427 SER A CA   8  
ATOM   10109 C  C    . SER A 1 6  ? 18.266  -12.305 -10.815 1.00 0.00 ? 427 SER A C    8  
ATOM   10110 O  O    . SER A 1 6  ? 17.341  -12.072 -11.592 1.00 0.00 ? 427 SER A O    8  
ATOM   10111 C  CB   . SER A 1 6  ? 18.695  -9.844  -10.686 1.00 0.00 ? 427 SER A CB   8  
ATOM   10112 O  OG   . SER A 1 6  ? 18.437  -9.594  -12.057 1.00 0.00 ? 427 SER A OG   8  
ATOM   10113 H  H    . SER A 1 6  ? 20.471  -11.097 -12.242 1.00 0.00 ? 427 SER A H    8  
ATOM   10114 H  HA   . SER A 1 6  ? 19.595  -11.342 -9.450  1.00 0.00 ? 427 SER A HA   8  
ATOM   10115 H  HB2  . SER A 1 6  ? 17.766  -9.775  -10.140 1.00 0.00 ? 427 SER A HB2  8  
ATOM   10116 H  HB3  . SER A 1 6  ? 19.384  -9.097  -10.319 1.00 0.00 ? 427 SER A HB3  8  
ATOM   10117 H  HG   . SER A 1 6  ? 18.155  -10.407 -12.483 1.00 0.00 ? 427 SER A HG   8  
ATOM   10118 N  N    . GLY A 1 7  ? 18.430  -13.482 -10.218 1.00 0.00 ? 428 GLY A N    8  
ATOM   10119 C  CA   . GLY A 1 7  ? 17.504  -14.573 -10.462 1.00 0.00 ? 428 GLY A CA   8  
ATOM   10120 C  C    . GLY A 1 7  ? 17.551  -15.064 -11.895 1.00 0.00 ? 428 GLY A C    8  
ATOM   10121 O  O    . GLY A 1 7  ? 17.211  -14.328 -12.821 1.00 0.00 ? 428 GLY A O    8  
ATOM   10122 H  H    . GLY A 1 7  ? 19.186  -13.611 -9.608  1.00 0.00 ? 428 GLY A H    8  
ATOM   10123 H  HA2  . GLY A 1 7  ? 17.748  -15.392 -9.803  1.00 0.00 ? 428 GLY A HA2  8  
ATOM   10124 H  HA3  . GLY A 1 7  ? 16.502  -14.234 -10.243 1.00 0.00 ? 428 GLY A HA3  8  
ATOM   10125 N  N    . GLU A 1 8  ? 17.976  -16.310 -12.078 1.00 0.00 ? 429 GLU A N    8  
ATOM   10126 C  CA   . GLU A 1 8  ? 18.069  -16.897 -13.410 1.00 0.00 ? 429 GLU A CA   8  
ATOM   10127 C  C    . GLU A 1 8  ? 16.698  -17.357 -13.899 1.00 0.00 ? 429 GLU A C    8  
ATOM   10128 O  O    . GLU A 1 8  ? 16.555  -18.455 -14.437 1.00 0.00 ? 429 GLU A O    8  
ATOM   10129 C  CB   . GLU A 1 8  ? 19.043  -18.077 -13.404 1.00 0.00 ? 429 GLU A CB   8  
ATOM   10130 C  CG   . GLU A 1 8  ? 20.503  -17.662 -13.470 1.00 0.00 ? 429 GLU A CG   8  
ATOM   10131 C  CD   . GLU A 1 8  ? 21.411  -18.791 -13.916 1.00 0.00 ? 429 GLU A CD   8  
ATOM   10132 O  OE1  . GLU A 1 8  ? 21.051  -19.495 -14.883 1.00 0.00 ? 429 GLU A OE1  8  
ATOM   10133 O  OE2  . GLU A 1 8  ? 22.481  -18.972 -13.298 1.00 0.00 ? 429 GLU A OE2  8  
ATOM   10134 H  H    . GLU A 1 8  ? 18.233  -16.847 -11.300 1.00 0.00 ? 429 GLU A H    8  
ATOM   10135 H  HA   . GLU A 1 8  ? 18.441  -16.138 -14.081 1.00 0.00 ? 429 GLU A HA   8  
ATOM   10136 H  HB2  . GLU A 1 8  ? 18.892  -18.649 -12.500 1.00 0.00 ? 429 GLU A HB2  8  
ATOM   10137 H  HB3  . GLU A 1 8  ? 18.831  -18.707 -14.256 1.00 0.00 ? 429 GLU A HB3  8  
ATOM   10138 H  HG2  . GLU A 1 8  ? 20.601  -16.845 -14.169 1.00 0.00 ? 429 GLU A HG2  8  
ATOM   10139 H  HG3  . GLU A 1 8  ? 20.815  -17.334 -12.489 1.00 0.00 ? 429 GLU A HG3  8  
ATOM   10140 N  N    . LEU A 1 9  ? 15.694  -16.509 -13.707 1.00 0.00 ? 430 LEU A N    8  
ATOM   10141 C  CA   . LEU A 1 9  ? 14.334  -16.827 -14.128 1.00 0.00 ? 430 LEU A CA   8  
ATOM   10142 C  C    . LEU A 1 9  ? 13.506  -15.557 -14.301 1.00 0.00 ? 430 LEU A C    8  
ATOM   10143 O  O    . LEU A 1 9  ? 13.825  -14.500 -13.756 1.00 0.00 ? 430 LEU A O    8  
ATOM   10144 C  CB   . LEU A 1 9  ? 13.666  -17.750 -13.107 1.00 0.00 ? 430 LEU A CB   8  
ATOM   10145 C  CG   . LEU A 1 9  ? 12.784  -17.067 -12.061 1.00 0.00 ? 430 LEU A CG   8  
ATOM   10146 C  CD1  . LEU A 1 9  ? 12.139  -18.099 -11.150 1.00 0.00 ? 430 LEU A CD1  8  
ATOM   10147 C  CD2  . LEU A 1 9  ? 13.596  -16.069 -11.248 1.00 0.00 ? 430 LEU A CD2  8  
ATOM   10148 H  H    . LEU A 1 9  ? 15.870  -15.649 -13.273 1.00 0.00 ? 430 LEU A H    8  
ATOM   10149 H  HA   . LEU A 1 9  ? 14.391  -17.337 -15.078 1.00 0.00 ? 430 LEU A HA   8  
ATOM   10150 H  HB2  . LEU A 1 9  ? 13.051  -18.452 -13.649 1.00 0.00 ? 430 LEU A HB2  8  
ATOM   10151 H  HB3  . LEU A 1 9  ? 14.447  -18.284 -12.585 1.00 0.00 ? 430 LEU A HB3  8  
ATOM   10152 H  HG   . LEU A 1 9  ? 11.994  -16.526 -12.563 1.00 0.00 ? 430 LEU A HG   8  
ATOM   10153 H  HD11 . LEU A 1 9  ? 12.190  -19.072 -11.616 1.00 0.00 ? 430 LEU A HD11 8  
ATOM   10154 H  HD12 . LEU A 1 9  ? 11.106  -17.835 -10.980 1.00 0.00 ? 430 LEU A HD12 8  
ATOM   10155 H  HD13 . LEU A 1 9  ? 12.664  -18.124 -10.206 1.00 0.00 ? 430 LEU A HD13 8  
ATOM   10156 H  HD21 . LEU A 1 9  ? 12.932  -15.347 -10.797 1.00 0.00 ? 430 LEU A HD21 8  
ATOM   10157 H  HD22 . LEU A 1 9  ? 14.294  -15.560 -11.897 1.00 0.00 ? 430 LEU A HD22 8  
ATOM   10158 H  HD23 . LEU A 1 9  ? 14.139  -16.592 -10.475 1.00 0.00 ? 430 LEU A HD23 8  
ATOM   10159 N  N    . PRO A 1 10 ? 12.416  -15.662 -15.075 1.00 0.00 ? 431 PRO A N    8  
ATOM   10160 C  CA   . PRO A 1 10 ? 11.518  -14.532 -15.335 1.00 0.00 ? 431 PRO A CA   8  
ATOM   10161 C  C    . PRO A 1 10 ? 10.722  -14.128 -14.099 1.00 0.00 ? 431 PRO A C    8  
ATOM   10162 O  O    . PRO A 1 10 ? 9.692   -14.728 -13.788 1.00 0.00 ? 431 PRO A O    8  
ATOM   10163 C  CB   . PRO A 1 10 ? 10.583  -15.065 -16.424 1.00 0.00 ? 431 PRO A CB   8  
ATOM   10164 C  CG   . PRO A 1 10 ? 10.595  -16.544 -16.242 1.00 0.00 ? 431 PRO A CG   8  
ATOM   10165 C  CD   . PRO A 1 10 ? 11.975  -16.891 -15.756 1.00 0.00 ? 431 PRO A CD   8  
ATOM   10166 H  HA   . PRO A 1 10 ? 12.058  -13.675 -15.710 1.00 0.00 ? 431 PRO A HA   8  
ATOM   10167 H  HB2  . PRO A 1 10 ? 9.593   -14.657 -16.282 1.00 0.00 ? 431 PRO A HB2  8  
ATOM   10168 H  HB3  . PRO A 1 10 ? 10.960  -14.784 -17.396 1.00 0.00 ? 431 PRO A HB3  8  
ATOM   10169 H  HG2  . PRO A 1 10 ? 9.857   -16.830 -15.508 1.00 0.00 ? 431 PRO A HG2  8  
ATOM   10170 H  HG3  . PRO A 1 10 ? 10.397  -17.031 -17.185 1.00 0.00 ? 431 PRO A HG3  8  
ATOM   10171 H  HD2  . PRO A 1 10 ? 11.935  -17.721 -15.066 1.00 0.00 ? 431 PRO A HD2  8  
ATOM   10172 H  HD3  . PRO A 1 10 ? 12.622  -17.121 -16.590 1.00 0.00 ? 431 PRO A HD3  8  
ATOM   10173 N  N    . LYS A 1 11 ? 11.204  -13.108 -13.398 1.00 0.00 ? 432 LYS A N    8  
ATOM   10174 C  CA   . LYS A 1 11 ? 10.536  -12.622 -12.196 1.00 0.00 ? 432 LYS A CA   8  
ATOM   10175 C  C    . LYS A 1 11 ? 10.788  -11.130 -12.000 1.00 0.00 ? 432 LYS A C    8  
ATOM   10176 O  O    . LYS A 1 11 ? 11.836  -10.611 -12.383 1.00 0.00 ? 432 LYS A O    8  
ATOM   10177 C  CB   . LYS A 1 11 ? 11.021  -13.398 -10.969 1.00 0.00 ? 432 LYS A CB   8  
ATOM   10178 C  CG   . LYS A 1 11 ? 10.337  -14.742 -10.791 1.00 0.00 ? 432 LYS A CG   8  
ATOM   10179 C  CD   . LYS A 1 11 ? 8.883   -14.579 -10.381 1.00 0.00 ? 432 LYS A CD   8  
ATOM   10180 C  CE   . LYS A 1 11 ? 8.041   -15.762 -10.832 1.00 0.00 ? 432 LYS A CE   8  
ATOM   10181 N  NZ   . LYS A 1 11 ? 6.599   -15.406 -10.943 1.00 0.00 ? 432 LYS A NZ   8  
ATOM   10182 H  H    . LYS A 1 11 ? 12.029  -12.670 -13.696 1.00 0.00 ? 432 LYS A H    8  
ATOM   10183 H  HA   . LYS A 1 11 ? 9.476   -12.783 -12.318 1.00 0.00 ? 432 LYS A HA   8  
ATOM   10184 H  HB2  . LYS A 1 11 ? 12.083  -13.567 -11.062 1.00 0.00 ? 432 LYS A HB2  8  
ATOM   10185 H  HB3  . LYS A 1 11 ? 10.835  -12.803 -10.086 1.00 0.00 ? 432 LYS A HB3  8  
ATOM   10186 H  HG2  . LYS A 1 11 ? 10.378  -15.284 -11.725 1.00 0.00 ? 432 LYS A HG2  8  
ATOM   10187 H  HG3  . LYS A 1 11 ? 10.857  -15.301 -10.026 1.00 0.00 ? 432 LYS A HG3  8  
ATOM   10188 H  HD2  . LYS A 1 11 ? 8.828   -14.501 -9.305  1.00 0.00 ? 432 LYS A HD2  8  
ATOM   10189 H  HD3  . LYS A 1 11 ? 8.491   -13.677 -10.830 1.00 0.00 ? 432 LYS A HD3  8  
ATOM   10190 H  HE2  . LYS A 1 11 ? 8.396   -16.094 -11.795 1.00 0.00 ? 432 LYS A HE2  8  
ATOM   10191 H  HE3  . LYS A 1 11 ? 8.152   -16.561 -10.113 1.00 0.00 ? 432 LYS A HE3  8  
ATOM   10192 H  HZ1  . LYS A 1 11 ? 6.282   -14.927 -10.076 1.00 0.00 ? 432 LYS A HZ1  8  
ATOM   10193 H  HZ2  . LYS A 1 11 ? 6.028   -16.265 -11.078 1.00 0.00 ? 432 LYS A HZ2  8  
ATOM   10194 H  HZ3  . LYS A 1 11 ? 6.448   -14.771 -11.752 1.00 0.00 ? 432 LYS A HZ3  8  
ATOM   10195 N  N    . LYS A 1 12 ? 9.820   -10.446 -11.399 1.00 0.00 ? 433 LYS A N    8  
ATOM   10196 C  CA   . LYS A 1 12 ? 9.937   -9.014  -11.148 1.00 0.00 ? 433 LYS A CA   8  
ATOM   10197 C  C    . LYS A 1 12 ? 9.729   -8.702  -9.670  1.00 0.00 ? 433 LYS A C    8  
ATOM   10198 O  O    . LYS A 1 12 ? 8.842   -9.262  -9.026  1.00 0.00 ? 433 LYS A O    8  
ATOM   10199 C  CB   . LYS A 1 12 ? 8.919   -8.243  -11.991 1.00 0.00 ? 433 LYS A CB   8  
ATOM   10200 C  CG   . LYS A 1 12 ? 9.098   -8.435  -13.487 1.00 0.00 ? 433 LYS A CG   8  
ATOM   10201 C  CD   . LYS A 1 12 ? 10.254  -7.605  -14.021 1.00 0.00 ? 433 LYS A CD   8  
ATOM   10202 C  CE   . LYS A 1 12 ? 9.884   -6.133  -14.122 1.00 0.00 ? 433 LYS A CE   8  
ATOM   10203 N  NZ   . LYS A 1 12 ? 11.085  -5.269  -14.283 1.00 0.00 ? 433 LYS A NZ   8  
ATOM   10204 H  H    . LYS A 1 12 ? 9.007   -10.916 -11.116 1.00 0.00 ? 433 LYS A H    8  
ATOM   10205 H  HA   . LYS A 1 12 ? 10.932  -8.708  -11.432 1.00 0.00 ? 433 LYS A HA   8  
ATOM   10206 H  HB2  . LYS A 1 12 ? 7.925   -8.572  -11.724 1.00 0.00 ? 433 LYS A HB2  8  
ATOM   10207 H  HB3  . LYS A 1 12 ? 9.012   -7.189  -11.771 1.00 0.00 ? 433 LYS A HB3  8  
ATOM   10208 H  HG2  . LYS A 1 12 ? 9.296   -9.477  -13.687 1.00 0.00 ? 433 LYS A HG2  8  
ATOM   10209 H  HG3  . LYS A 1 12 ? 8.190   -8.136  -13.991 1.00 0.00 ? 433 LYS A HG3  8  
ATOM   10210 H  HD2  . LYS A 1 12 ? 11.097  -7.707  -13.354 1.00 0.00 ? 433 LYS A HD2  8  
ATOM   10211 H  HD3  . LYS A 1 12 ? 10.523  -7.968  -15.003 1.00 0.00 ? 433 LYS A HD3  8  
ATOM   10212 H  HE2  . LYS A 1 12 ? 9.236   -5.997  -14.974 1.00 0.00 ? 433 LYS A HE2  8  
ATOM   10213 H  HE3  . LYS A 1 12 ? 9.361   -5.845  -13.223 1.00 0.00 ? 433 LYS A HE3  8  
ATOM   10214 H  HZ1  . LYS A 1 12 ? 11.039  -4.467  -13.622 1.00 0.00 ? 433 LYS A HZ1  8  
ATOM   10215 H  HZ2  . LYS A 1 12 ? 11.133  -4.900  -15.255 1.00 0.00 ? 433 LYS A HZ2  8  
ATOM   10216 H  HZ3  . LYS A 1 12 ? 11.948  -5.816  -14.089 1.00 0.00 ? 433 LYS A HZ3  8  
ATOM   10217 N  N    . ARG A 1 13 ? 10.552  -7.804  -9.138  1.00 0.00 ? 434 ARG A N    8  
ATOM   10218 C  CA   . ARG A 1 13 ? 10.458  -7.418  -7.735  1.00 0.00 ? 434 ARG A CA   8  
ATOM   10219 C  C    . ARG A 1 13 ? 9.841   -6.029  -7.594  1.00 0.00 ? 434 ARG A C    8  
ATOM   10220 O  O    . ARG A 1 13 ? 10.358  -5.181  -6.868  1.00 0.00 ? 434 ARG A O    8  
ATOM   10221 C  CB   . ARG A 1 13 ? 11.842  -7.441  -7.084  1.00 0.00 ? 434 ARG A CB   8  
ATOM   10222 C  CG   . ARG A 1 13 ? 12.155  -8.743  -6.364  1.00 0.00 ? 434 ARG A CG   8  
ATOM   10223 C  CD   . ARG A 1 13 ? 12.612  -9.820  -7.335  1.00 0.00 ? 434 ARG A CD   8  
ATOM   10224 N  NE   . ARG A 1 13 ? 13.953  -9.559  -7.851  1.00 0.00 ? 434 ARG A NE   8  
ATOM   10225 C  CZ   . ARG A 1 13 ? 14.756  -10.505 -8.324  1.00 0.00 ? 434 ARG A CZ   8  
ATOM   10226 N  NH1  . ARG A 1 13 ? 14.355  -11.769 -8.346  1.00 0.00 ? 434 ARG A NH1  8  
ATOM   10227 N  NH2  . ARG A 1 13 ? 15.962  -10.189 -8.776  1.00 0.00 ? 434 ARG A NH2  8  
ATOM   10228 H  H    . ARG A 1 13 ? 11.240  -7.392  -9.702  1.00 0.00 ? 434 ARG A H    8  
ATOM   10229 H  HA   . ARG A 1 13 ? 9.823   -8.133  -7.236  1.00 0.00 ? 434 ARG A HA   8  
ATOM   10230 H  HB2  . ARG A 1 13 ? 12.590  -7.290  -7.848  1.00 0.00 ? 434 ARG A HB2  8  
ATOM   10231 H  HB3  . ARG A 1 13 ? 11.903  -6.636  -6.368  1.00 0.00 ? 434 ARG A HB3  8  
ATOM   10232 H  HG2  . ARG A 1 13 ? 12.940  -8.566  -5.644  1.00 0.00 ? 434 ARG A HG2  8  
ATOM   10233 H  HG3  . ARG A 1 13 ? 11.266  -9.083  -5.854  1.00 0.00 ? 434 ARG A HG3  8  
ATOM   10234 H  HD2  . ARG A 1 13 ? 12.613  -10.771 -6.823  1.00 0.00 ? 434 ARG A HD2  8  
ATOM   10235 H  HD3  . ARG A 1 13 ? 11.919  -9.858  -8.162  1.00 0.00 ? 434 ARG A HD3  8  
ATOM   10236 H  HE   . ARG A 1 13 ? 14.269  -8.632  -7.844  1.00 0.00 ? 434 ARG A HE   8  
ATOM   10237 H  HH11 . ARG A 1 13 ? 13.446  -12.010 -8.006  1.00 0.00 ? 434 ARG A HH11 8  
ATOM   10238 H  HH12 . ARG A 1 13 ? 14.962  -12.480 -8.703  1.00 0.00 ? 434 ARG A HH12 8  
ATOM   10239 H  HH21 . ARG A 1 13 ? 16.268  -9.237  -8.761  1.00 0.00 ? 434 ARG A HH21 8  
ATOM   10240 H  HH22 . ARG A 1 13 ? 16.566  -10.902 -9.131  1.00 0.00 ? 434 ARG A HH22 8  
ATOM   10241 N  N    . GLU A 1 14 ? 8.733   -5.806  -8.295  1.00 0.00 ? 435 GLU A N    8  
ATOM   10242 C  CA   . GLU A 1 14 ? 8.048   -4.520  -8.248  1.00 0.00 ? 435 GLU A CA   8  
ATOM   10243 C  C    . GLU A 1 14 ? 6.585   -4.697  -7.849  1.00 0.00 ? 435 GLU A C    8  
ATOM   10244 O  O    . GLU A 1 14 ? 5.940   -5.674  -8.231  1.00 0.00 ? 435 GLU A O    8  
ATOM   10245 C  CB   . GLU A 1 14 ? 8.136   -3.820  -9.606  1.00 0.00 ? 435 GLU A CB   8  
ATOM   10246 C  CG   . GLU A 1 14 ? 9.490   -3.186  -9.876  1.00 0.00 ? 435 GLU A CG   8  
ATOM   10247 C  CD   . GLU A 1 14 ? 9.710   -2.885  -11.346 1.00 0.00 ? 435 GLU A CD   8  
ATOM   10248 O  OE1  . GLU A 1 14 ? 9.394   -3.757  -12.183 1.00 0.00 ? 435 GLU A OE1  8  
ATOM   10249 O  OE2  . GLU A 1 14 ? 10.199  -1.780  -11.660 1.00 0.00 ? 435 GLU A OE2  8  
ATOM   10250 H  H    . GLU A 1 14 ? 8.370   -6.522  -8.856  1.00 0.00 ? 435 GLU A H    8  
ATOM   10251 H  HA   . GLU A 1 14 ? 8.539   -3.909  -7.506  1.00 0.00 ? 435 GLU A HA   8  
ATOM   10252 H  HB2  . GLU A 1 14 ? 7.937   -4.542  -10.383 1.00 0.00 ? 435 GLU A HB2  8  
ATOM   10253 H  HB3  . GLU A 1 14 ? 7.385   -3.045  -9.647  1.00 0.00 ? 435 GLU A HB3  8  
ATOM   10254 H  HG2  . GLU A 1 14 ? 9.559   -2.262  -9.322  1.00 0.00 ? 435 GLU A HG2  8  
ATOM   10255 H  HG3  . GLU A 1 14 ? 10.263  -3.862  -9.543  1.00 0.00 ? 435 GLU A HG3  8  
ATOM   10256 N  N    . LEU A 1 15 ? 6.069   -3.746  -7.079  1.00 0.00 ? 436 LEU A N    8  
ATOM   10257 C  CA   . LEU A 1 15 ? 4.682   -3.797  -6.627  1.00 0.00 ? 436 LEU A CA   8  
ATOM   10258 C  C    . LEU A 1 15 ? 3.725   -3.472  -7.770  1.00 0.00 ? 436 LEU A C    8  
ATOM   10259 O  O    . LEU A 1 15 ? 3.551   -2.310  -8.137  1.00 0.00 ? 436 LEU A O    8  
ATOM   10260 C  CB   . LEU A 1 15 ? 4.466   -2.817  -5.472  1.00 0.00 ? 436 LEU A CB   8  
ATOM   10261 C  CG   . LEU A 1 15 ? 3.014   -2.582  -5.054  1.00 0.00 ? 436 LEU A CG   8  
ATOM   10262 C  CD1  . LEU A 1 15 ? 2.477   -3.784  -4.293  1.00 0.00 ? 436 LEU A CD1  8  
ATOM   10263 C  CD2  . LEU A 1 15 ? 2.899   -1.320  -4.213  1.00 0.00 ? 436 LEU A CD2  8  
ATOM   10264 H  H    . LEU A 1 15 ? 6.632   -2.992  -6.807  1.00 0.00 ? 436 LEU A H    8  
ATOM   10265 H  HA   . LEU A 1 15 ? 4.483   -4.799  -6.280  1.00 0.00 ? 436 LEU A HA   8  
ATOM   10266 H  HB2  . LEU A 1 15 ? 5.000   -3.195  -4.614  1.00 0.00 ? 436 LEU A HB2  8  
ATOM   10267 H  HB3  . LEU A 1 15 ? 4.886   -1.865  -5.764  1.00 0.00 ? 436 LEU A HB3  8  
ATOM   10268 H  HG   . LEU A 1 15 ? 2.408   -2.451  -5.940  1.00 0.00 ? 436 LEU A HG   8  
ATOM   10269 H  HD11 . LEU A 1 15 ? 2.685   -4.685  -4.849  1.00 0.00 ? 436 LEU A HD11 8  
ATOM   10270 H  HD12 . LEU A 1 15 ? 1.410   -3.680  -4.162  1.00 0.00 ? 436 LEU A HD12 8  
ATOM   10271 H  HD13 . LEU A 1 15 ? 2.954   -3.839  -3.325  1.00 0.00 ? 436 LEU A HD13 8  
ATOM   10272 H  HD21 . LEU A 1 15 ? 1.868   -0.998  -4.187  1.00 0.00 ? 436 LEU A HD21 8  
ATOM   10273 H  HD22 . LEU A 1 15 ? 3.509   -0.541  -4.647  1.00 0.00 ? 436 LEU A HD22 8  
ATOM   10274 H  HD23 . LEU A 1 15 ? 3.237   -1.525  -3.208  1.00 0.00 ? 436 LEU A HD23 8  
ATOM   10275 N  N    . CYS A 1 16 ? 3.105   -4.507  -8.327  1.00 0.00 ? 437 CYS A N    8  
ATOM   10276 C  CA   . CYS A 1 16 ? 2.164   -4.334  -9.426  1.00 0.00 ? 437 CYS A CA   8  
ATOM   10277 C  C    . CYS A 1 16 ? 1.290   -3.103  -9.205  1.00 0.00 ? 437 CYS A C    8  
ATOM   10278 O  O    . CYS A 1 16 ? 0.621   -2.979  -8.179  1.00 0.00 ? 437 CYS A O    8  
ATOM   10279 C  CB   . CYS A 1 16 ? 1.285   -5.578  -9.574  1.00 0.00 ? 437 CYS A CB   8  
ATOM   10280 S  SG   . CYS A 1 16 ? 0.406   -5.682  -11.166 1.00 0.00 ? 437 CYS A SG   8  
ATOM   10281 H  H    . CYS A 1 16 ? 3.286   -5.411  -7.990  1.00 0.00 ? 437 CYS A H    8  
ATOM   10282 H  HA   . CYS A 1 16 ? 2.734   -4.197  -10.333 1.00 0.00 ? 437 CYS A HA   8  
ATOM   10283 H  HB2  . CYS A 1 16 ? 1.903   -6.459  -9.483  1.00 0.00 ? 437 CYS A HB2  8  
ATOM   10284 H  HB3  . CYS A 1 16 ? 0.544   -5.581  -8.788  1.00 0.00 ? 437 CYS A HB3  8  
ATOM   10285 N  N    . LYS A 1 17 ? 1.299   -2.195  -10.175 1.00 0.00 ? 438 LYS A N    8  
ATOM   10286 C  CA   . LYS A 1 17 ? 0.507   -0.974  -10.089 1.00 0.00 ? 438 LYS A CA   8  
ATOM   10287 C  C    . LYS A 1 17 ? -0.984  -1.287  -10.166 1.00 0.00 ? 438 LYS A C    8  
ATOM   10288 O  O    . LYS A 1 17 ? -1.822  -0.392  -10.055 1.00 0.00 ? 438 LYS A O    8  
ATOM   10289 C  CB   . LYS A 1 17 ? 0.896   -0.009  -11.211 1.00 0.00 ? 438 LYS A CB   8  
ATOM   10290 C  CG   . LYS A 1 17 ? 0.529   -0.510  -12.598 1.00 0.00 ? 438 LYS A CG   8  
ATOM   10291 C  CD   . LYS A 1 17 ? 1.020   0.437   -13.680 1.00 0.00 ? 438 LYS A CD   8  
ATOM   10292 C  CE   . LYS A 1 17 ? 0.165   1.692   -13.753 1.00 0.00 ? 438 LYS A CE   8  
ATOM   10293 N  NZ   . LYS A 1 17 ? 0.303   2.383   -15.065 1.00 0.00 ? 438 LYS A NZ   8  
ATOM   10294 H  H    . LYS A 1 17 ? 1.853   -2.351  -10.970 1.00 0.00 ? 438 LYS A H    8  
ATOM   10295 H  HA   . LYS A 1 17 ? 0.716   -0.509  -9.138  1.00 0.00 ? 438 LYS A HA   8  
ATOM   10296 H  HB2  . LYS A 1 17 ? 0.396   0.934   -11.048 1.00 0.00 ? 438 LYS A HB2  8  
ATOM   10297 H  HB3  . LYS A 1 17 ? 1.964   0.149   -11.180 1.00 0.00 ? 438 LYS A HB3  8  
ATOM   10298 H  HG2  . LYS A 1 17 ? 0.980   -1.479  -12.751 1.00 0.00 ? 438 LYS A HG2  8  
ATOM   10299 H  HG3  . LYS A 1 17 ? -0.546  -0.595  -12.667 1.00 0.00 ? 438 LYS A HG3  8  
ATOM   10300 H  HD2  . LYS A 1 17 ? 2.039   0.721   -13.463 1.00 0.00 ? 438 LYS A HD2  8  
ATOM   10301 H  HD3  . LYS A 1 17 ? 0.982   -0.070  -14.634 1.00 0.00 ? 438 LYS A HD3  8  
ATOM   10302 H  HE2  . LYS A 1 17 ? -0.868  1.417   -13.608 1.00 0.00 ? 438 LYS A HE2  8  
ATOM   10303 H  HE3  . LYS A 1 17 ? 0.471   2.367   -12.967 1.00 0.00 ? 438 LYS A HE3  8  
ATOM   10304 H  HZ1  . LYS A 1 17 ? 0.855   1.795   -15.721 1.00 0.00 ? 438 LYS A HZ1  8  
ATOM   10305 H  HZ2  . LYS A 1 17 ? 0.790   3.293   -14.940 1.00 0.00 ? 438 LYS A HZ2  8  
ATOM   10306 H  HZ3  . LYS A 1 17 ? -0.635  2.557   -15.478 1.00 0.00 ? 438 LYS A HZ3  8  
ATOM   10307 N  N    . PHE A 1 18 ? -1.308  -2.561  -10.356 1.00 0.00 ? 439 PHE A N    8  
ATOM   10308 C  CA   . PHE A 1 18 ? -2.698  -2.991  -10.448 1.00 0.00 ? 439 PHE A CA   8  
ATOM   10309 C  C    . PHE A 1 18 ? -3.154  -3.638  -9.143  1.00 0.00 ? 439 PHE A C    8  
ATOM   10310 O  O    . PHE A 1 18 ? -4.187  -3.269  -8.583  1.00 0.00 ? 439 PHE A O    8  
ATOM   10311 C  CB   . PHE A 1 18 ? -2.875  -3.975  -11.607 1.00 0.00 ? 439 PHE A CB   8  
ATOM   10312 C  CG   . PHE A 1 18 ? -2.498  -3.401  -12.943 1.00 0.00 ? 439 PHE A CG   8  
ATOM   10313 C  CD1  . PHE A 1 18 ? -3.111  -2.251  -13.415 1.00 0.00 ? 439 PHE A CD1  8  
ATOM   10314 C  CD2  . PHE A 1 18 ? -1.533  -4.012  -13.727 1.00 0.00 ? 439 PHE A CD2  8  
ATOM   10315 C  CE1  . PHE A 1 18 ? -2.766  -1.720  -14.644 1.00 0.00 ? 439 PHE A CE1  8  
ATOM   10316 C  CE2  . PHE A 1 18 ? -1.185  -3.485  -14.956 1.00 0.00 ? 439 PHE A CE2  8  
ATOM   10317 C  CZ   . PHE A 1 18 ? -1.803  -2.338  -15.416 1.00 0.00 ? 439 PHE A CZ   8  
ATOM   10318 H  H    . PHE A 1 18 ? -0.594  -3.229  -10.438 1.00 0.00 ? 439 PHE A H    8  
ATOM   10319 H  HA   . PHE A 1 18 ? -3.303  -2.117  -10.633 1.00 0.00 ? 439 PHE A HA   8  
ATOM   10320 H  HB2  . PHE A 1 18 ? -2.255  -4.841  -11.432 1.00 0.00 ? 439 PHE A HB2  8  
ATOM   10321 H  HB3  . PHE A 1 18 ? -3.909  -4.281  -11.655 1.00 0.00 ? 439 PHE A HB3  8  
ATOM   10322 H  HD1  . PHE A 1 18 ? -3.865  -1.766  -12.811 1.00 0.00 ? 439 PHE A HD1  8  
ATOM   10323 H  HD2  . PHE A 1 18 ? -1.050  -4.909  -13.370 1.00 0.00 ? 439 PHE A HD2  8  
ATOM   10324 H  HE1  . PHE A 1 18 ? -3.252  -0.823  -14.999 1.00 0.00 ? 439 PHE A HE1  8  
ATOM   10325 H  HE2  . PHE A 1 18 ? -0.431  -3.971  -15.558 1.00 0.00 ? 439 PHE A HE2  8  
ATOM   10326 H  HZ   . PHE A 1 18 ? -1.532  -1.925  -16.376 1.00 0.00 ? 439 PHE A HZ   8  
ATOM   10327 N  N    . TYR A 1 19 ? -2.378  -4.605  -8.666  1.00 0.00 ? 440 TYR A N    8  
ATOM   10328 C  CA   . TYR A 1 19 ? -2.703  -5.305  -7.429  1.00 0.00 ? 440 TYR A CA   8  
ATOM   10329 C  C    . TYR A 1 19 ? -3.061  -4.319  -6.322  1.00 0.00 ? 440 TYR A C    8  
ATOM   10330 O  O    . TYR A 1 19 ? -3.956  -4.573  -5.516  1.00 0.00 ? 440 TYR A O    8  
ATOM   10331 C  CB   . TYR A 1 19 ? -1.526  -6.178  -6.989  1.00 0.00 ? 440 TYR A CB   8  
ATOM   10332 C  CG   . TYR A 1 19 ? -1.879  -7.164  -5.898  1.00 0.00 ? 440 TYR A CG   8  
ATOM   10333 C  CD1  . TYR A 1 19 ? -2.805  -8.175  -6.121  1.00 0.00 ? 440 TYR A CD1  8  
ATOM   10334 C  CD2  . TYR A 1 19 ? -1.287  -7.083  -4.644  1.00 0.00 ? 440 TYR A CD2  8  
ATOM   10335 C  CE1  . TYR A 1 19 ? -3.131  -9.078  -5.127  1.00 0.00 ? 440 TYR A CE1  8  
ATOM   10336 C  CE2  . TYR A 1 19 ? -1.605  -7.982  -3.644  1.00 0.00 ? 440 TYR A CE2  8  
ATOM   10337 C  CZ   . TYR A 1 19 ? -2.528  -8.977  -3.890  1.00 0.00 ? 440 TYR A CZ   8  
ATOM   10338 O  OH   . TYR A 1 19 ? -2.849  -9.873  -2.897  1.00 0.00 ? 440 TYR A OH   8  
ATOM   10339 H  H    . TYR A 1 19 ? -1.568  -4.854  -9.158  1.00 0.00 ? 440 TYR A H    8  
ATOM   10340 H  HA   . TYR A 1 19 ? -3.556  -5.939  -7.622  1.00 0.00 ? 440 TYR A HA   8  
ATOM   10341 H  HB2  . TYR A 1 19 ? -1.166  -6.739  -7.838  1.00 0.00 ? 440 TYR A HB2  8  
ATOM   10342 H  HB3  . TYR A 1 19 ? -0.734  -5.543  -6.620  1.00 0.00 ? 440 TYR A HB3  8  
ATOM   10343 H  HD1  . TYR A 1 19 ? -3.275  -8.252  -7.091  1.00 0.00 ? 440 TYR A HD1  8  
ATOM   10344 H  HD2  . TYR A 1 19 ? -0.565  -6.302  -4.454  1.00 0.00 ? 440 TYR A HD2  8  
ATOM   10345 H  HE1  . TYR A 1 19 ? -3.853  -9.857  -5.319  1.00 0.00 ? 440 TYR A HE1  8  
ATOM   10346 H  HE2  . TYR A 1 19 ? -1.133  -7.903  -2.676  1.00 0.00 ? 440 TYR A HE2  8  
ATOM   10347 H  HH   . TYR A 1 19 ? -2.210  -10.590 -2.894  1.00 0.00 ? 440 TYR A HH   8  
ATOM   10348 N  N    . ILE A 1 20 ? -2.356  -3.193  -6.291  1.00 0.00 ? 441 ILE A N    8  
ATOM   10349 C  CA   . ILE A 1 20 ? -2.600  -2.167  -5.285  1.00 0.00 ? 441 ILE A CA   8  
ATOM   10350 C  C    . ILE A 1 20 ? -4.094  -1.975  -5.047  1.00 0.00 ? 441 ILE A C    8  
ATOM   10351 O  O    . ILE A 1 20 ? -4.520  -1.637  -3.942  1.00 0.00 ? 441 ILE A O    8  
ATOM   10352 C  CB   . ILE A 1 20 ? -1.979  -0.819  -5.694  1.00 0.00 ? 441 ILE A CB   8  
ATOM   10353 C  CG1  . ILE A 1 20 ? -0.464  -0.959  -5.860  1.00 0.00 ? 441 ILE A CG1  8  
ATOM   10354 C  CG2  . ILE A 1 20 ? -2.307  0.250   -4.662  1.00 0.00 ? 441 ILE A CG2  8  
ATOM   10355 C  CD1  . ILE A 1 20 ? 0.175   0.206   -6.583  1.00 0.00 ? 441 ILE A CD1  8  
ATOM   10356 H  H    . ILE A 1 20 ? -1.656  -3.049  -6.961  1.00 0.00 ? 441 ILE A H    8  
ATOM   10357 H  HA   . ILE A 1 20 ? -2.138  -2.489  -4.362  1.00 0.00 ? 441 ILE A HA   8  
ATOM   10358 H  HB   . ILE A 1 20 ? -2.411  -0.519  -6.636  1.00 0.00 ? 441 ILE A HB   8  
ATOM   10359 H  HG12 . ILE A 1 20 ? -0.007  -1.036  -4.886  1.00 0.00 ? 441 ILE A HG12 8  
ATOM   10360 H  HG13 . ILE A 1 20 ? -0.254  -1.857  -6.424  1.00 0.00 ? 441 ILE A HG13 8  
ATOM   10361 H  HG21 . ILE A 1 20 ? -2.445  -0.212  -3.696  1.00 0.00 ? 441 ILE A HG21 8  
ATOM   10362 H  HG22 . ILE A 1 20 ? -1.494  0.959   -4.608  1.00 0.00 ? 441 ILE A HG22 8  
ATOM   10363 H  HG23 . ILE A 1 20 ? -3.213  0.762   -4.949  1.00 0.00 ? 441 ILE A HG23 8  
ATOM   10364 H  HD11 . ILE A 1 20 ? 1.235   0.027   -6.686  1.00 0.00 ? 441 ILE A HD11 8  
ATOM   10365 H  HD12 . ILE A 1 20 ? -0.271  0.312   -7.560  1.00 0.00 ? 441 ILE A HD12 8  
ATOM   10366 H  HD13 . ILE A 1 20 ? 0.018   1.112   -6.015  1.00 0.00 ? 441 ILE A HD13 8  
ATOM   10367 N  N    . THR A 1 21 ? -4.887  -2.193  -6.091  1.00 0.00 ? 442 THR A N    8  
ATOM   10368 C  CA   . THR A 1 21 ? -6.334  -2.045  -5.997  1.00 0.00 ? 442 THR A CA   8  
ATOM   10369 C  C    . THR A 1 21 ? -7.021  -3.403  -5.907  1.00 0.00 ? 442 THR A C    8  
ATOM   10370 O  O    . THR A 1 21 ? -8.045  -3.548  -5.241  1.00 0.00 ? 442 THR A O    8  
ATOM   10371 C  CB   . THR A 1 21 ? -6.900  -1.274  -7.205  1.00 0.00 ? 442 THR A CB   8  
ATOM   10372 O  OG1  . THR A 1 21 ? -6.479  -1.897  -8.424  1.00 0.00 ? 442 THR A OG1  8  
ATOM   10373 C  CG2  . THR A 1 21 ? -6.440  0.175   -7.186  1.00 0.00 ? 442 THR A CG2  8  
ATOM   10374 H  H    . THR A 1 21 ? -4.488  -2.460  -6.946  1.00 0.00 ? 442 THR A H    8  
ATOM   10375 H  HA   . THR A 1 21 ? -6.553  -1.481  -5.102  1.00 0.00 ? 442 THR A HA   8  
ATOM   10376 H  HB   . THR A 1 21 ? -7.979  -1.295  -7.152  1.00 0.00 ? 442 THR A HB   8  
ATOM   10377 H  HG1  . THR A 1 21 ? -6.554  -1.270  -9.146  1.00 0.00 ? 442 THR A HG1  8  
ATOM   10378 H  HG21 . THR A 1 21 ? -7.271  0.813   -6.921  1.00 0.00 ? 442 THR A HG21 8  
ATOM   10379 H  HG22 . THR A 1 21 ? -6.072  0.449   -8.163  1.00 0.00 ? 442 THR A HG22 8  
ATOM   10380 H  HG23 . THR A 1 21 ? -5.651  0.293   -6.458  1.00 0.00 ? 442 THR A HG23 8  
ATOM   10381 N  N    . GLY A 1 22 ? -6.450  -4.396  -6.582  1.00 0.00 ? 443 GLY A N    8  
ATOM   10382 C  CA   . GLY A 1 22 ? -7.022  -5.729  -6.564  1.00 0.00 ? 443 GLY A CA   8  
ATOM   10383 C  C    . GLY A 1 22 ? -7.476  -6.184  -7.937  1.00 0.00 ? 443 GLY A C    8  
ATOM   10384 O  O    . GLY A 1 22 ? -7.807  -7.353  -8.135  1.00 0.00 ? 443 GLY A O    8  
ATOM   10385 H  H    . GLY A 1 22 ? -5.634  -4.221  -7.096  1.00 0.00 ? 443 GLY A H    8  
ATOM   10386 H  HA2  . GLY A 1 22 ? -6.281  -6.422  -6.194  1.00 0.00 ? 443 GLY A HA2  8  
ATOM   10387 H  HA3  . GLY A 1 22 ? -7.871  -5.736  -5.897  1.00 0.00 ? 443 GLY A HA3  8  
ATOM   10388 N  N    . PHE A 1 23 ? -7.494  -5.257  -8.890  1.00 0.00 ? 444 PHE A N    8  
ATOM   10389 C  CA   . PHE A 1 23 ? -7.914  -5.567  -10.251 1.00 0.00 ? 444 PHE A CA   8  
ATOM   10390 C  C    . PHE A 1 23 ? -6.706  -5.768  -11.161 1.00 0.00 ? 444 PHE A C    8  
ATOM   10391 O  O    . PHE A 1 23 ? -6.121  -4.804  -11.657 1.00 0.00 ? 444 PHE A O    8  
ATOM   10392 C  CB   . PHE A 1 23 ? -8.801  -4.449  -10.802 1.00 0.00 ? 444 PHE A CB   8  
ATOM   10393 C  CG   . PHE A 1 23 ? -9.484  -4.805  -12.091 1.00 0.00 ? 444 PHE A CG   8  
ATOM   10394 C  CD1  . PHE A 1 23 ? -8.760  -4.905  -13.269 1.00 0.00 ? 444 PHE A CD1  8  
ATOM   10395 C  CD2  . PHE A 1 23 ? -10.849 -5.039  -12.127 1.00 0.00 ? 444 PHE A CD2  8  
ATOM   10396 C  CE1  . PHE A 1 23 ? -9.385  -5.232  -14.457 1.00 0.00 ? 444 PHE A CE1  8  
ATOM   10397 C  CE2  . PHE A 1 23 ? -11.480 -5.367  -13.312 1.00 0.00 ? 444 PHE A CE2  8  
ATOM   10398 C  CZ   . PHE A 1 23 ? -10.747 -5.464  -14.478 1.00 0.00 ? 444 PHE A CZ   8  
ATOM   10399 H  H    . PHE A 1 23 ? -7.219  -4.341  -8.671  1.00 0.00 ? 444 PHE A H    8  
ATOM   10400 H  HA   . PHE A 1 23 ? -8.483  -6.484  -10.221 1.00 0.00 ? 444 PHE A HA   8  
ATOM   10401 H  HB2  . PHE A 1 23 ? -9.566  -4.215  -10.076 1.00 0.00 ? 444 PHE A HB2  8  
ATOM   10402 H  HB3  . PHE A 1 23 ? -8.196  -3.572  -10.976 1.00 0.00 ? 444 PHE A HB3  8  
ATOM   10403 H  HD1  . PHE A 1 23 ? -7.695  -4.725  -13.253 1.00 0.00 ? 444 PHE A HD1  8  
ATOM   10404 H  HD2  . PHE A 1 23 ? -11.423 -4.963  -11.214 1.00 0.00 ? 444 PHE A HD2  8  
ATOM   10405 H  HE1  . PHE A 1 23 ? -8.810  -5.308  -15.367 1.00 0.00 ? 444 PHE A HE1  8  
ATOM   10406 H  HE2  . PHE A 1 23 ? -12.544 -5.547  -13.325 1.00 0.00 ? 444 PHE A HE2  8  
ATOM   10407 H  HZ   . PHE A 1 23 ? -11.238 -5.719  -15.406 1.00 0.00 ? 444 PHE A HZ   8  
ATOM   10408 N  N    . CYS A 1 24 ? -6.336  -7.026  -11.375 1.00 0.00 ? 445 CYS A N    8  
ATOM   10409 C  CA   . CYS A 1 24 ? -5.197  -7.355  -12.223 1.00 0.00 ? 445 CYS A CA   8  
ATOM   10410 C  C    . CYS A 1 24 ? -5.548  -8.480  -13.193 1.00 0.00 ? 445 CYS A C    8  
ATOM   10411 O  O    . CYS A 1 24 ? -5.728  -9.628  -12.789 1.00 0.00 ? 445 CYS A O    8  
ATOM   10412 C  CB   . CYS A 1 24 ? -3.997  -7.762  -11.366 1.00 0.00 ? 445 CYS A CB   8  
ATOM   10413 S  SG   . CYS A 1 24 ? -2.502  -8.168  -12.325 1.00 0.00 ? 445 CYS A SG   8  
ATOM   10414 H  H    . CYS A 1 24 ? -6.842  -7.752  -10.951 1.00 0.00 ? 445 CYS A H    8  
ATOM   10415 H  HA   . CYS A 1 24 ? -4.940  -6.474  -12.791 1.00 0.00 ? 445 CYS A HA   8  
ATOM   10416 H  HB2  . CYS A 1 24 ? -3.748  -6.949  -10.699 1.00 0.00 ? 445 CYS A HB2  8  
ATOM   10417 H  HB3  . CYS A 1 24 ? -4.260  -8.632  -10.782 1.00 0.00 ? 445 CYS A HB3  8  
ATOM   10418 N  N    . ALA A 1 25 ? -5.644  -8.140  -14.474 1.00 0.00 ? 446 ALA A N    8  
ATOM   10419 C  CA   . ALA A 1 25 ? -5.971  -9.120  -15.502 1.00 0.00 ? 446 ALA A CA   8  
ATOM   10420 C  C    . ALA A 1 25 ? -5.268  -10.448 -15.238 1.00 0.00 ? 446 ALA A C    8  
ATOM   10421 O  O    . ALA A 1 25 ? -5.906  -11.439 -14.884 1.00 0.00 ? 446 ALA A O    8  
ATOM   10422 C  CB   . ALA A 1 25 ? -5.598  -8.587  -16.877 1.00 0.00 ? 446 ALA A CB   8  
ATOM   10423 H  H    . ALA A 1 25 ? -5.489  -7.208  -14.734 1.00 0.00 ? 446 ALA A H    8  
ATOM   10424 H  HA   . ALA A 1 25 ? -7.039  -9.280  -15.483 1.00 0.00 ? 446 ALA A HA   8  
ATOM   10425 H  HB1  . ALA A 1 25 ? -5.997  -7.591  -16.997 1.00 0.00 ? 446 ALA A HB1  8  
ATOM   10426 H  HB2  . ALA A 1 25 ? -4.522  -8.559  -16.973 1.00 0.00 ? 446 ALA A HB2  8  
ATOM   10427 H  HB3  . ALA A 1 25 ? -6.010  -9.234  -17.638 1.00 0.00 ? 446 ALA A HB3  8  
ATOM   10428 N  N    . ARG A 1 26 ? -3.950  -10.459 -15.413 1.00 0.00 ? 447 ARG A N    8  
ATOM   10429 C  CA   . ARG A 1 26 ? -3.162  -11.666 -15.196 1.00 0.00 ? 447 ARG A CA   8  
ATOM   10430 C  C    . ARG A 1 26 ? -2.945  -11.912 -13.706 1.00 0.00 ? 447 ARG A C    8  
ATOM   10431 O  O    . ARG A 1 26 ? -2.204  -11.182 -13.047 1.00 0.00 ? 447 ARG A O    8  
ATOM   10432 C  CB   . ARG A 1 26 ? -1.812  -11.553 -15.907 1.00 0.00 ? 447 ARG A CB   8  
ATOM   10433 C  CG   . ARG A 1 26 ? -1.895  -11.770 -17.409 1.00 0.00 ? 447 ARG A CG   8  
ATOM   10434 C  CD   . ARG A 1 26 ? -0.747  -11.086 -18.135 1.00 0.00 ? 447 ARG A CD   8  
ATOM   10435 N  NE   . ARG A 1 26 ? -0.841  -11.246 -19.583 1.00 0.00 ? 447 ARG A NE   8  
ATOM   10436 C  CZ   . ARG A 1 26 ? -0.301  -10.400 -20.453 1.00 0.00 ? 447 ARG A CZ   8  
ATOM   10437 N  NH1  . ARG A 1 26 ? 0.369   -9.340  -20.024 1.00 0.00 ? 447 ARG A NH1  8  
ATOM   10438 N  NH2  . ARG A 1 26 ? -0.431  -10.615 -21.756 1.00 0.00 ? 447 ARG A NH2  8  
ATOM   10439 H  H    . ARG A 1 26 ? -3.498  -9.637  -15.696 1.00 0.00 ? 447 ARG A H    8  
ATOM   10440 H  HA   . ARG A 1 26 ? -3.708  -12.499 -15.610 1.00 0.00 ? 447 ARG A HA   8  
ATOM   10441 H  HB2  . ARG A 1 26 ? -1.405  -10.568 -15.729 1.00 0.00 ? 447 ARG A HB2  8  
ATOM   10442 H  HB3  . ARG A 1 26 ? -1.139  -12.290 -15.495 1.00 0.00 ? 447 ARG A HB3  8  
ATOM   10443 H  HG2  . ARG A 1 26 ? -1.854  -12.830 -17.613 1.00 0.00 ? 447 ARG A HG2  8  
ATOM   10444 H  HG3  . ARG A 1 26 ? -2.829  -11.367 -17.770 1.00 0.00 ? 447 ARG A HG3  8  
ATOM   10445 H  HD2  . ARG A 1 26 ? -0.764  -10.033 -17.897 1.00 0.00 ? 447 ARG A HD2  8  
ATOM   10446 H  HD3  . ARG A 1 26 ? 0.184   -11.516 -17.794 1.00 0.00 ? 447 ARG A HD3  8  
ATOM   10447 H  HE   . ARG A 1 26 ? -1.332  -12.023 -19.922 1.00 0.00 ? 447 ARG A HE   8  
ATOM   10448 H  HH11 . ARG A 1 26 ? 0.469   -9.177  -19.042 1.00 0.00 ? 447 ARG A HH11 8  
ATOM   10449 H  HH12 . ARG A 1 26 ? 0.775   -8.705  -20.681 1.00 0.00 ? 447 ARG A HH12 8  
ATOM   10450 H  HH21 . ARG A 1 26 ? -0.935  -11.413 -22.084 1.00 0.00 ? 447 ARG A HH21 8  
ATOM   10451 H  HH22 . ARG A 1 26 ? -0.024  -9.977  -22.410 1.00 0.00 ? 447 ARG A HH22 8  
ATOM   10452 N  N    . ALA A 1 27 ? -3.596  -12.945 -13.181 1.00 0.00 ? 448 ALA A N    8  
ATOM   10453 C  CA   . ALA A 1 27 ? -3.473  -13.289 -11.770 1.00 0.00 ? 448 ALA A CA   8  
ATOM   10454 C  C    . ALA A 1 27 ? -2.195  -14.077 -11.506 1.00 0.00 ? 448 ALA A C    8  
ATOM   10455 O  O    . ALA A 1 27 ? -1.214  -13.535 -10.998 1.00 0.00 ? 448 ALA A O    8  
ATOM   10456 C  CB   . ALA A 1 27 ? -4.688  -14.081 -11.312 1.00 0.00 ? 448 ALA A CB   8  
ATOM   10457 H  H    . ALA A 1 27 ? -4.171  -13.490 -13.757 1.00 0.00 ? 448 ALA A H    8  
ATOM   10458 H  HA   . ALA A 1 27 ? -3.440  -12.369 -11.204 1.00 0.00 ? 448 ALA A HA   8  
ATOM   10459 H  HB1  . ALA A 1 27 ? -4.383  -15.081 -11.040 1.00 0.00 ? 448 ALA A HB1  8  
ATOM   10460 H  HB2  . ALA A 1 27 ? -5.134  -13.595 -10.457 1.00 0.00 ? 448 ALA A HB2  8  
ATOM   10461 H  HB3  . ALA A 1 27 ? -5.409  -14.130 -12.114 1.00 0.00 ? 448 ALA A HB3  8  
ATOM   10462 N  N    . GLU A 1 28 ? -2.214  -15.360 -11.854 1.00 0.00 ? 449 GLU A N    8  
ATOM   10463 C  CA   . GLU A 1 28 ? -1.056  -16.223 -11.652 1.00 0.00 ? 449 GLU A CA   8  
ATOM   10464 C  C    . GLU A 1 28 ? -0.043  -16.046 -12.780 1.00 0.00 ? 449 GLU A C    8  
ATOM   10465 O  O    . GLU A 1 28 ? 0.955   -16.763 -12.850 1.00 0.00 ? 449 GLU A O    8  
ATOM   10466 C  CB   . GLU A 1 28 ? -1.492  -17.688 -11.568 1.00 0.00 ? 449 GLU A CB   8  
ATOM   10467 C  CG   . GLU A 1 28 ? -0.381  -18.629 -11.134 1.00 0.00 ? 449 GLU A CG   8  
ATOM   10468 C  CD   . GLU A 1 28 ? -0.880  -20.036 -10.866 1.00 0.00 ? 449 GLU A CD   8  
ATOM   10469 O  OE1  . GLU A 1 28 ? -1.344  -20.693 -11.821 1.00 0.00 ? 449 GLU A OE1  8  
ATOM   10470 O  OE2  . GLU A 1 28 ? -0.805  -20.479 -9.701  1.00 0.00 ? 449 GLU A OE2  8  
ATOM   10471 H  H    . GLU A 1 28 ? -3.026  -15.735 -12.254 1.00 0.00 ? 449 GLU A H    8  
ATOM   10472 H  HA   . GLU A 1 28 ? -0.591  -15.942 -10.719 1.00 0.00 ? 449 GLU A HA   8  
ATOM   10473 H  HB2  . GLU A 1 28 ? -2.303  -17.769 -10.860 1.00 0.00 ? 449 GLU A HB2  8  
ATOM   10474 H  HB3  . GLU A 1 28 ? -1.842  -18.002 -12.540 1.00 0.00 ? 449 GLU A HB3  8  
ATOM   10475 H  HG2  . GLU A 1 28 ? 0.364   -18.670 -11.914 1.00 0.00 ? 449 GLU A HG2  8  
ATOM   10476 H  HG3  . GLU A 1 28 ? 0.067   -18.244 -10.230 1.00 0.00 ? 449 GLU A HG3  8  
ATOM   10477 N  N    . ASN A 1 29 ? -0.308  -15.087 -13.660 1.00 0.00 ? 450 ASN A N    8  
ATOM   10478 C  CA   . ASN A 1 29 ? 0.579   -14.816 -14.785 1.00 0.00 ? 450 ASN A CA   8  
ATOM   10479 C  C    . ASN A 1 29 ? 1.418   -13.567 -14.529 1.00 0.00 ? 450 ASN A C    8  
ATOM   10480 O  O    . ASN A 1 29 ? 2.461   -13.368 -15.151 1.00 0.00 ? 450 ASN A O    8  
ATOM   10481 C  CB   . ASN A 1 29 ? -0.232  -14.643 -16.071 1.00 0.00 ? 450 ASN A CB   8  
ATOM   10482 C  CG   . ASN A 1 29 ? -0.415  -15.950 -16.819 1.00 0.00 ? 450 ASN A CG   8  
ATOM   10483 O  OD1  . ASN A 1 29 ? 0.556   -16.575 -17.246 1.00 0.00 ? 450 ASN A OD1  8  
ATOM   10484 N  ND2  . ASN A 1 29 ? -1.665  -16.368 -16.981 1.00 0.00 ? 450 ASN A ND2  8  
ATOM   10485 H  H    . ASN A 1 29 ? -1.120  -14.548 -13.551 1.00 0.00 ? 450 ASN A H    8  
ATOM   10486 H  HA   . ASN A 1 29 ? 1.240   -15.662 -14.898 1.00 0.00 ? 450 ASN A HA   8  
ATOM   10487 H  HB2  . ASN A 1 29 ? -1.209  -14.253 -15.824 1.00 0.00 ? 450 ASN A HB2  8  
ATOM   10488 H  HB3  . ASN A 1 29 ? 0.276   -13.946 -16.720 1.00 0.00 ? 450 ASN A HB3  8  
ATOM   10489 H  HD21 . ASN A 1 29 ? -2.389  -15.819 -16.615 1.00 0.00 ? 450 ASN A HD21 8  
ATOM   10490 H  HD22 . ASN A 1 29 ? -1.812  -17.210 -17.461 1.00 0.00 ? 450 ASN A HD22 8  
ATOM   10491 N  N    . CYS A 1 30 ? 0.955   -12.730 -13.607 1.00 0.00 ? 451 CYS A N    8  
ATOM   10492 C  CA   . CYS A 1 30 ? 1.661   -11.500 -13.266 1.00 0.00 ? 451 CYS A CA   8  
ATOM   10493 C  C    . CYS A 1 30 ? 3.056   -11.805 -12.729 1.00 0.00 ? 451 CYS A C    8  
ATOM   10494 O  O    . CYS A 1 30 ? 3.223   -12.336 -11.630 1.00 0.00 ? 451 CYS A O    8  
ATOM   10495 C  CB   . CYS A 1 30 ? 0.867   -10.702 -12.230 1.00 0.00 ? 451 CYS A CB   8  
ATOM   10496 S  SG   . CYS A 1 30 ? 1.396   -8.967  -12.064 1.00 0.00 ? 451 CYS A SG   8  
ATOM   10497 H  H    . CYS A 1 30 ? 0.117   -12.943 -13.144 1.00 0.00 ? 451 CYS A H    8  
ATOM   10498 H  HA   . CYS A 1 30 ? 1.756   -10.912 -14.166 1.00 0.00 ? 451 CYS A HA   8  
ATOM   10499 H  HB2  . CYS A 1 30 ? -0.177  -10.701 -12.511 1.00 0.00 ? 451 CYS A HB2  8  
ATOM   10500 H  HB3  . CYS A 1 30 ? 0.974   -11.173 -11.264 1.00 0.00 ? 451 CYS A HB3  8  
ATOM   10501 N  N    . PRO A 1 31 ? 4.083   -11.463 -13.521 1.00 0.00 ? 452 PRO A N    8  
ATOM   10502 C  CA   . PRO A 1 31 ? 5.482   -11.690 -13.146 1.00 0.00 ? 452 PRO A CA   8  
ATOM   10503 C  C    . PRO A 1 31 ? 5.931   -10.782 -12.006 1.00 0.00 ? 452 PRO A C    8  
ATOM   10504 O  O    . PRO A 1 31 ? 7.099   -10.788 -11.618 1.00 0.00 ? 452 PRO A O    8  
ATOM   10505 C  CB   . PRO A 1 31 ? 6.251   -11.359 -14.427 1.00 0.00 ? 452 PRO A CB   8  
ATOM   10506 C  CG   . PRO A 1 31 ? 5.367   -10.415 -15.166 1.00 0.00 ? 452 PRO A CG   8  
ATOM   10507 C  CD   . PRO A 1 31 ? 3.957   -10.828 -14.843 1.00 0.00 ? 452 PRO A CD   8  
ATOM   10508 H  HA   . PRO A 1 31 ? 5.657   -12.721 -12.874 1.00 0.00 ? 452 PRO A HA   8  
ATOM   10509 H  HB2  . PRO A 1 31 ? 7.196   -10.901 -14.174 1.00 0.00 ? 452 PRO A HB2  8  
ATOM   10510 H  HB3  . PRO A 1 31 ? 6.422   -12.263 -14.992 1.00 0.00 ? 452 PRO A HB3  8  
ATOM   10511 H  HG2  . PRO A 1 31 ? 5.548   -9.404  -14.832 1.00 0.00 ? 452 PRO A HG2  8  
ATOM   10512 H  HG3  . PRO A 1 31 ? 5.547   -10.498 -16.228 1.00 0.00 ? 452 PRO A HG3  8  
ATOM   10513 H  HD2  . PRO A 1 31 ? 3.312   -9.963  -14.796 1.00 0.00 ? 452 PRO A HD2  8  
ATOM   10514 H  HD3  . PRO A 1 31 ? 3.593   -11.533 -15.576 1.00 0.00 ? 452 PRO A HD3  8  
ATOM   10515 N  N    . TYR A 1 32 ? 4.996   -10.004 -11.472 1.00 0.00 ? 453 TYR A N    8  
ATOM   10516 C  CA   . TYR A 1 32 ? 5.296   -9.089  -10.378 1.00 0.00 ? 453 TYR A CA   8  
ATOM   10517 C  C    . TYR A 1 32 ? 4.868   -9.682  -9.039  1.00 0.00 ? 453 TYR A C    8  
ATOM   10518 O  O    . TYR A 1 32 ? 4.315   -10.780 -8.982  1.00 0.00 ? 453 TYR A O    8  
ATOM   10519 C  CB   . TYR A 1 32 ? 4.598   -7.746  -10.601 1.00 0.00 ? 453 TYR A CB   8  
ATOM   10520 C  CG   . TYR A 1 32 ? 5.250   -6.894  -11.666 1.00 0.00 ? 453 TYR A CG   8  
ATOM   10521 C  CD1  . TYR A 1 32 ? 5.399   -7.364  -12.965 1.00 0.00 ? 453 TYR A CD1  8  
ATOM   10522 C  CD2  . TYR A 1 32 ? 5.718   -5.619  -11.373 1.00 0.00 ? 453 TYR A CD2  8  
ATOM   10523 C  CE1  . TYR A 1 32 ? 5.995   -6.589  -13.941 1.00 0.00 ? 453 TYR A CE1  8  
ATOM   10524 C  CE2  . TYR A 1 32 ? 6.314   -4.837  -12.343 1.00 0.00 ? 453 TYR A CE2  8  
ATOM   10525 C  CZ   . TYR A 1 32 ? 6.450   -5.326  -13.625 1.00 0.00 ? 453 TYR A CZ   8  
ATOM   10526 O  OH   . TYR A 1 32 ? 7.044   -4.550  -14.594 1.00 0.00 ? 453 TYR A OH   8  
ATOM   10527 H  H    . TYR A 1 32 ? 4.082   -10.044 -11.824 1.00 0.00 ? 453 TYR A H    8  
ATOM   10528 H  HA   . TYR A 1 32 ? 6.365   -8.929  -10.362 1.00 0.00 ? 453 TYR A HA   8  
ATOM   10529 H  HB2  . TYR A 1 32 ? 3.576   -7.925  -10.899 1.00 0.00 ? 453 TYR A HB2  8  
ATOM   10530 H  HB3  . TYR A 1 32 ? 4.605   -7.187  -9.677  1.00 0.00 ? 453 TYR A HB3  8  
ATOM   10531 H  HD1  . TYR A 1 32 ? 5.041   -8.354  -13.209 1.00 0.00 ? 453 TYR A HD1  8  
ATOM   10532 H  HD2  . TYR A 1 32 ? 5.610   -5.239  -10.367 1.00 0.00 ? 453 TYR A HD2  8  
ATOM   10533 H  HE1  . TYR A 1 32 ? 6.102   -6.972  -14.945 1.00 0.00 ? 453 TYR A HE1  8  
ATOM   10534 H  HE2  . TYR A 1 32 ? 6.671   -3.848  -12.096 1.00 0.00 ? 453 TYR A HE2  8  
ATOM   10535 H  HH   . TYR A 1 32 ? 7.722   -4.001  -14.193 1.00 0.00 ? 453 TYR A HH   8  
ATOM   10536 N  N    . MET A 1 33 ? 5.126   -8.945  -7.963  1.00 0.00 ? 454 MET A N    8  
ATOM   10537 C  CA   . MET A 1 33 ? 4.766   -9.397  -6.624  1.00 0.00 ? 454 MET A CA   8  
ATOM   10538 C  C    . MET A 1 33 ? 3.376   -8.899  -6.238  1.00 0.00 ? 454 MET A C    8  
ATOM   10539 O  O    . MET A 1 33 ? 3.006   -7.764  -6.540  1.00 0.00 ? 454 MET A O    8  
ATOM   10540 C  CB   . MET A 1 33 ? 5.796   -8.909  -5.604  1.00 0.00 ? 454 MET A CB   8  
ATOM   10541 C  CG   . MET A 1 33 ? 7.141   -9.608  -5.717  1.00 0.00 ? 454 MET A CG   8  
ATOM   10542 S  SD   . MET A 1 33 ? 7.149   -11.230 -4.930  1.00 0.00 ? 454 MET A SD   8  
ATOM   10543 C  CE   . MET A 1 33 ? 8.045   -10.871 -3.422  1.00 0.00 ? 454 MET A CE   8  
ATOM   10544 H  H    . MET A 1 33 ? 5.569   -8.078  -8.072  1.00 0.00 ? 454 MET A H    8  
ATOM   10545 H  HA   . MET A 1 33 ? 4.760   -10.476 -6.629  1.00 0.00 ? 454 MET A HA   8  
ATOM   10546 H  HB2  . MET A 1 33 ? 5.952   -7.850  -5.745  1.00 0.00 ? 454 MET A HB2  8  
ATOM   10547 H  HB3  . MET A 1 33 ? 5.410   -9.078  -4.610  1.00 0.00 ? 454 MET A HB3  8  
ATOM   10548 H  HG2  . MET A 1 33 ? 7.382   -9.730  -6.762  1.00 0.00 ? 454 MET A HG2  8  
ATOM   10549 H  HG3  . MET A 1 33 ? 7.892   -8.991  -5.246  1.00 0.00 ? 454 MET A HG3  8  
ATOM   10550 H  HE1  . MET A 1 33 ? 7.789   -9.880  -3.078  1.00 0.00 ? 454 MET A HE1  8  
ATOM   10551 H  HE2  . MET A 1 33 ? 7.780   -11.595 -2.665  1.00 0.00 ? 454 MET A HE2  8  
ATOM   10552 H  HE3  . MET A 1 33 ? 9.107   -10.922 -3.614  1.00 0.00 ? 454 MET A HE3  8  
ATOM   10553 N  N    . HIS A 1 34 ? 2.610   -9.756  -5.570  1.00 0.00 ? 455 HIS A N    8  
ATOM   10554 C  CA   . HIS A 1 34 ? 1.261   -9.402  -5.143  1.00 0.00 ? 455 HIS A CA   8  
ATOM   10555 C  C    . HIS A 1 34 ? 1.128   -9.501  -3.626  1.00 0.00 ? 455 HIS A C    8  
ATOM   10556 O  O    . HIS A 1 34 ? 1.117   -8.488  -2.927  1.00 0.00 ? 455 HIS A O    8  
ATOM   10557 C  CB   . HIS A 1 34 ? 0.235   -10.314 -5.817  1.00 0.00 ? 455 HIS A CB   8  
ATOM   10558 C  CG   . HIS A 1 34 ? -0.090  -9.913  -7.223  1.00 0.00 ? 455 HIS A CG   8  
ATOM   10559 N  ND1  . HIS A 1 34 ? -1.219  -10.345 -7.886  1.00 0.00 ? 455 HIS A ND1  8  
ATOM   10560 C  CD2  . HIS A 1 34 ? 0.572   -9.113  -8.091  1.00 0.00 ? 455 HIS A CD2  8  
ATOM   10561 C  CE1  . HIS A 1 34 ? -1.236  -9.830  -9.103  1.00 0.00 ? 455 HIS A CE1  8  
ATOM   10562 N  NE2  . HIS A 1 34 ? -0.161  -9.078  -9.252  1.00 0.00 ? 455 HIS A NE2  8  
ATOM   10563 H  H    . HIS A 1 34 ? 2.961   -10.646 -5.359  1.00 0.00 ? 455 HIS A H    8  
ATOM   10564 H  HA   . HIS A 1 34 ? 1.075   -8.382  -5.443  1.00 0.00 ? 455 HIS A HA   8  
ATOM   10565 H  HB2  . HIS A 1 34 ? 0.620   -11.323 -5.841  1.00 0.00 ? 455 HIS A HB2  8  
ATOM   10566 H  HB3  . HIS A 1 34 ? -0.682  -10.297 -5.245  1.00 0.00 ? 455 HIS A HB3  8  
ATOM   10567 H  HD1  . HIS A 1 34 ? -1.905  -10.942 -7.521  1.00 0.00 ? 455 HIS A HD1  8  
ATOM   10568 H  HD2  . HIS A 1 34 ? 1.504   -8.598  -7.906  1.00 0.00 ? 455 HIS A HD2  8  
ATOM   10569 H  HE1  . HIS A 1 34 ? -2.000  -9.995  -9.849  1.00 0.00 ? 455 HIS A HE1  8  
ATOM   10570 N  N    . GLY A 1 35 ? 1.027   -10.728 -3.124  1.00 0.00 ? 456 GLY A N    8  
ATOM   10571 C  CA   . GLY A 1 35 ? 0.895   -10.935 -1.694  1.00 0.00 ? 456 GLY A CA   8  
ATOM   10572 C  C    . GLY A 1 35 ? 2.225   -10.854 -0.971  1.00 0.00 ? 456 GLY A C    8  
ATOM   10573 O  O    . GLY A 1 35 ? 2.442   -9.957  -0.156  1.00 0.00 ? 456 GLY A O    8  
ATOM   10574 H  H    . GLY A 1 35 ? 1.042   -11.498 -3.730  1.00 0.00 ? 456 GLY A H    8  
ATOM   10575 H  HA2  . GLY A 1 35 ? 0.232   -10.184 -1.292  1.00 0.00 ? 456 GLY A HA2  8  
ATOM   10576 H  HA3  . GLY A 1 35 ? 0.464   -11.910 -1.521  1.00 0.00 ? 456 GLY A HA3  8  
ATOM   10577 N  N    . ASP A 1 36 ? 3.116   -11.793 -1.268  1.00 0.00 ? 457 ASP A N    8  
ATOM   10578 C  CA   . ASP A 1 36 ? 4.432   -11.824 -0.640  1.00 0.00 ? 457 ASP A CA   8  
ATOM   10579 C  C    . ASP A 1 36 ? 4.922   -10.412 -0.335  1.00 0.00 ? 457 ASP A C    8  
ATOM   10580 O  O    . ASP A 1 36 ? 5.382   -10.129 0.772   1.00 0.00 ? 457 ASP A O    8  
ATOM   10581 C  CB   . ASP A 1 36 ? 5.435   -12.540 -1.545  1.00 0.00 ? 457 ASP A CB   8  
ATOM   10582 C  CG   . ASP A 1 36 ? 6.638   -13.057 -0.780  1.00 0.00 ? 457 ASP A CG   8  
ATOM   10583 O  OD1  . ASP A 1 36 ? 6.572   -13.108 0.465   1.00 0.00 ? 457 ASP A OD1  8  
ATOM   10584 O  OD2  . ASP A 1 36 ? 7.647   -13.410 -1.428  1.00 0.00 ? 457 ASP A OD2  8  
ATOM   10585 H  H    . ASP A 1 36 ? 2.884   -12.481 -1.926  1.00 0.00 ? 457 ASP A H    8  
ATOM   10586 H  HA   . ASP A 1 36 ? 4.344   -12.369 0.287   1.00 0.00 ? 457 ASP A HA   8  
ATOM   10587 H  HB2  . ASP A 1 36 ? 4.947   -13.379 -2.020  1.00 0.00 ? 457 ASP A HB2  8  
ATOM   10588 H  HB3  . ASP A 1 36 ? 5.781   -11.854 -2.303  1.00 0.00 ? 457 ASP A HB3  8  
ATOM   10589 N  N    . PHE A 1 37 ? 4.820   -9.529  -1.323  1.00 0.00 ? 458 PHE A N    8  
ATOM   10590 C  CA   . PHE A 1 37 ? 5.255   -8.146  -1.160  1.00 0.00 ? 458 PHE A CA   8  
ATOM   10591 C  C    . PHE A 1 37 ? 4.866   -7.612  0.215   1.00 0.00 ? 458 PHE A C    8  
ATOM   10592 O  O    . PHE A 1 37 ? 3.705   -7.658  0.622   1.00 0.00 ? 458 PHE A O    8  
ATOM   10593 C  CB   . PHE A 1 37 ? 4.645   -7.266  -2.253  1.00 0.00 ? 458 PHE A CB   8  
ATOM   10594 C  CG   . PHE A 1 37 ? 5.369   -5.964  -2.447  1.00 0.00 ? 458 PHE A CG   8  
ATOM   10595 C  CD1  . PHE A 1 37 ? 6.634   -5.937  -3.011  1.00 0.00 ? 458 PHE A CD1  8  
ATOM   10596 C  CD2  . PHE A 1 37 ? 4.783   -4.767  -2.067  1.00 0.00 ? 458 PHE A CD2  8  
ATOM   10597 C  CE1  . PHE A 1 37 ? 7.302   -4.741  -3.190  1.00 0.00 ? 458 PHE A CE1  8  
ATOM   10598 C  CE2  . PHE A 1 37 ? 5.446   -3.568  -2.244  1.00 0.00 ? 458 PHE A CE2  8  
ATOM   10599 C  CZ   . PHE A 1 37 ? 6.707   -3.554  -2.807  1.00 0.00 ? 458 PHE A CZ   8  
ATOM   10600 H  H    . PHE A 1 37 ? 4.444   -9.814  -2.182  1.00 0.00 ? 458 PHE A H    8  
ATOM   10601 H  HA   . PHE A 1 37 ? 6.330   -8.125  -1.251  1.00 0.00 ? 458 PHE A HA   8  
ATOM   10602 H  HB2  . PHE A 1 37 ? 4.668   -7.801  -3.190  1.00 0.00 ? 458 PHE A HB2  8  
ATOM   10603 H  HB3  . PHE A 1 37 ? 3.621   -7.043  -1.995  1.00 0.00 ? 458 PHE A HB3  8  
ATOM   10604 H  HD1  . PHE A 1 37 ? 7.100   -6.864  -3.312  1.00 0.00 ? 458 PHE A HD1  8  
ATOM   10605 H  HD2  . PHE A 1 37 ? 3.796   -4.777  -1.626  1.00 0.00 ? 458 PHE A HD2  8  
ATOM   10606 H  HE1  . PHE A 1 37 ? 8.288   -4.733  -3.631  1.00 0.00 ? 458 PHE A HE1  8  
ATOM   10607 H  HE2  . PHE A 1 37 ? 4.978   -2.642  -1.943  1.00 0.00 ? 458 PHE A HE2  8  
ATOM   10608 H  HZ   . PHE A 1 37 ? 7.227   -2.618  -2.946  1.00 0.00 ? 458 PHE A HZ   8  
ATOM   10609 N  N    . PRO A 1 38 ? 5.861   -7.093  0.950   1.00 0.00 ? 459 PRO A N    8  
ATOM   10610 C  CA   . PRO A 1 38 ? 5.648   -6.540  2.291   1.00 0.00 ? 459 PRO A CA   8  
ATOM   10611 C  C    . PRO A 1 38 ? 4.858   -5.236  2.262   1.00 0.00 ? 459 PRO A C    8  
ATOM   10612 O  O    . PRO A 1 38 ? 4.847   -4.527  1.256   1.00 0.00 ? 459 PRO A O    8  
ATOM   10613 C  CB   . PRO A 1 38 ? 7.070   -6.291  2.802   1.00 0.00 ? 459 PRO A CB   8  
ATOM   10614 C  CG   . PRO A 1 38 ? 7.889   -6.115  1.570   1.00 0.00 ? 459 PRO A CG   8  
ATOM   10615 C  CD   . PRO A 1 38 ? 7.269   -7.005  0.529   1.00 0.00 ? 459 PRO A CD   8  
ATOM   10616 H  HA   . PRO A 1 38 ? 5.150   -7.247  2.938   1.00 0.00 ? 459 PRO A HA   8  
ATOM   10617 H  HB2  . PRO A 1 38 ? 7.084   -5.403  3.417   1.00 0.00 ? 459 PRO A HB2  8  
ATOM   10618 H  HB3  . PRO A 1 38 ? 7.403   -7.141  3.379   1.00 0.00 ? 459 PRO A HB3  8  
ATOM   10619 H  HG2  . PRO A 1 38 ? 7.855   -5.084  1.251   1.00 0.00 ? 459 PRO A HG2  8  
ATOM   10620 H  HG3  . PRO A 1 38 ? 8.909   -6.417  1.761   1.00 0.00 ? 459 PRO A HG3  8  
ATOM   10621 H  HD2  . PRO A 1 38 ? 7.351   -6.556  -0.449  1.00 0.00 ? 459 PRO A HD2  8  
ATOM   10622 H  HD3  . PRO A 1 38 ? 7.735   -7.979  0.539   1.00 0.00 ? 459 PRO A HD3  8  
ATOM   10623 N  N    . CYS A 1 39 ? 4.197   -4.926  3.372   1.00 0.00 ? 460 CYS A N    8  
ATOM   10624 C  CA   . CYS A 1 39 ? 3.403   -3.707  3.474   1.00 0.00 ? 460 CYS A CA   8  
ATOM   10625 C  C    . CYS A 1 39 ? 4.302   -2.480  3.596   1.00 0.00 ? 460 CYS A C    8  
ATOM   10626 O  O    . CYS A 1 39 ? 5.376   -2.541  4.194   1.00 0.00 ? 460 CYS A O    8  
ATOM   10627 C  CB   . CYS A 1 39 ? 2.463   -3.785  4.679   1.00 0.00 ? 460 CYS A CB   8  
ATOM   10628 S  SG   . CYS A 1 39 ? 1.159   -2.513  4.689   1.00 0.00 ? 460 CYS A SG   8  
ATOM   10629 H  H    . CYS A 1 39 ? 4.243   -5.531  4.142   1.00 0.00 ? 460 CYS A H    8  
ATOM   10630 H  HA   . CYS A 1 39 ? 2.813   -3.619  2.575   1.00 0.00 ? 460 CYS A HA   8  
ATOM   10631 H  HB2  . CYS A 1 39 ? 1.979   -4.751  4.687   1.00 0.00 ? 460 CYS A HB2  8  
ATOM   10632 H  HB3  . CYS A 1 39 ? 3.041   -3.672  5.585   1.00 0.00 ? 460 CYS A HB3  8  
ATOM   10633 N  N    . LYS A 1 40 ? 3.855   -1.368  3.023   1.00 0.00 ? 461 LYS A N    8  
ATOM   10634 C  CA   . LYS A 1 40 ? 4.617   -0.125  3.067   1.00 0.00 ? 461 LYS A CA   8  
ATOM   10635 C  C    . LYS A 1 40 ? 4.440   0.574   4.411   1.00 0.00 ? 461 LYS A C    8  
ATOM   10636 O  O    . LYS A 1 40 ? 5.372   0.645   5.213   1.00 0.00 ? 461 LYS A O    8  
ATOM   10637 C  CB   . LYS A 1 40 ? 4.180   0.806   1.934   1.00 0.00 ? 461 LYS A CB   8  
ATOM   10638 C  CG   . LYS A 1 40 ? 4.976   2.097   1.866   1.00 0.00 ? 461 LYS A CG   8  
ATOM   10639 C  CD   . LYS A 1 40 ? 4.378   3.069   0.862   1.00 0.00 ? 461 LYS A CD   8  
ATOM   10640 C  CE   . LYS A 1 40 ? 4.800   4.501   1.153   1.00 0.00 ? 461 LYS A CE   8  
ATOM   10641 N  NZ   . LYS A 1 40 ? 6.239   4.729   0.847   1.00 0.00 ? 461 LYS A NZ   8  
ATOM   10642 H  H    . LYS A 1 40 ? 2.991   -1.382  2.560   1.00 0.00 ? 461 LYS A H    8  
ATOM   10643 H  HA   . LYS A 1 40 ? 5.660   -0.371  2.937   1.00 0.00 ? 461 LYS A HA   8  
ATOM   10644 H  HB2  . LYS A 1 40 ? 4.294   0.287   0.994   1.00 0.00 ? 461 LYS A HB2  8  
ATOM   10645 H  HB3  . LYS A 1 40 ? 3.138   1.056   2.072   1.00 0.00 ? 461 LYS A HB3  8  
ATOM   10646 H  HG2  . LYS A 1 40 ? 4.977   2.561   2.842   1.00 0.00 ? 461 LYS A HG2  8  
ATOM   10647 H  HG3  . LYS A 1 40 ? 5.991   1.869   1.573   1.00 0.00 ? 461 LYS A HG3  8  
ATOM   10648 H  HD2  . LYS A 1 40 ? 4.714   2.801   -0.129  1.00 0.00 ? 461 LYS A HD2  8  
ATOM   10649 H  HD3  . LYS A 1 40 ? 3.300   3.003   0.909   1.00 0.00 ? 461 LYS A HD3  8  
ATOM   10650 H  HE2  . LYS A 1 40 ? 4.203   5.168   0.551   1.00 0.00 ? 461 LYS A HE2  8  
ATOM   10651 H  HE3  . LYS A 1 40 ? 4.625   4.708   2.199   1.00 0.00 ? 461 LYS A HE3  8  
ATOM   10652 H  HZ1  . LYS A 1 40 ? 6.373   5.681   0.450   1.00 0.00 ? 461 LYS A HZ1  8  
ATOM   10653 H  HZ2  . LYS A 1 40 ? 6.573   4.027   0.156   1.00 0.00 ? 461 LYS A HZ2  8  
ATOM   10654 H  HZ3  . LYS A 1 40 ? 6.807   4.643   1.714   1.00 0.00 ? 461 LYS A HZ3  8  
ATOM   10655 N  N    . LEU A 1 41 ? 3.239   1.089   4.651   1.00 0.00 ? 462 LEU A N    8  
ATOM   10656 C  CA   . LEU A 1 41 ? 2.939   1.782   5.899   1.00 0.00 ? 462 LEU A CA   8  
ATOM   10657 C  C    . LEU A 1 41 ? 3.497   1.016   7.095   1.00 0.00 ? 462 LEU A C    8  
ATOM   10658 O  O    . LEU A 1 41 ? 4.318   1.536   7.850   1.00 0.00 ? 462 LEU A O    8  
ATOM   10659 C  CB   . LEU A 1 41 ? 1.428   1.963   6.054   1.00 0.00 ? 462 LEU A CB   8  
ATOM   10660 C  CG   . LEU A 1 41 ? 0.806   3.114   5.264   1.00 0.00 ? 462 LEU A CG   8  
ATOM   10661 C  CD1  . LEU A 1 41 ? -0.703  3.135   5.449   1.00 0.00 ? 462 LEU A CD1  8  
ATOM   10662 C  CD2  . LEU A 1 41 ? 1.415   4.443   5.687   1.00 0.00 ? 462 LEU A CD2  8  
ATOM   10663 H  H    . LEU A 1 41 ? 2.537   1.001   3.974   1.00 0.00 ? 462 LEU A H    8  
ATOM   10664 H  HA   . LEU A 1 41 ? 3.408   2.754   5.859   1.00 0.00 ? 462 LEU A HA   8  
ATOM   10665 H  HB2  . LEU A 1 41 ? 0.951   1.049   5.738   1.00 0.00 ? 462 LEU A HB2  8  
ATOM   10666 H  HB3  . LEU A 1 41 ? 1.222   2.131   7.102   1.00 0.00 ? 462 LEU A HB3  8  
ATOM   10667 H  HG   . LEU A 1 41 ? 1.010   2.972   4.211   1.00 0.00 ? 462 LEU A HG   8  
ATOM   10668 H  HD11 . LEU A 1 41 ? -1.085  2.126   5.409   1.00 0.00 ? 462 LEU A HD11 8  
ATOM   10669 H  HD12 . LEU A 1 41 ? -1.155  3.722   4.664   1.00 0.00 ? 462 LEU A HD12 8  
ATOM   10670 H  HD13 . LEU A 1 41 ? -0.942  3.573   6.408   1.00 0.00 ? 462 LEU A HD13 8  
ATOM   10671 H  HD21 . LEU A 1 41 ? 1.512   4.468   6.762   1.00 0.00 ? 462 LEU A HD21 8  
ATOM   10672 H  HD22 . LEU A 1 41 ? 0.775   5.252   5.364   1.00 0.00 ? 462 LEU A HD22 8  
ATOM   10673 H  HD23 . LEU A 1 41 ? 2.390   4.552   5.235   1.00 0.00 ? 462 LEU A HD23 8  
ATOM   10674 N  N    . TYR A 1 42 ? 3.046   -0.223  7.259   1.00 0.00 ? 463 TYR A N    8  
ATOM   10675 C  CA   . TYR A 1 42 ? 3.499   -1.061  8.363   1.00 0.00 ? 463 TYR A CA   8  
ATOM   10676 C  C    . TYR A 1 42 ? 4.993   -0.874  8.611   1.00 0.00 ? 463 TYR A C    8  
ATOM   10677 O  O    . TYR A 1 42 ? 5.482   -1.091  9.720   1.00 0.00 ? 463 TYR A O    8  
ATOM   10678 C  CB   . TYR A 1 42 ? 3.200   -2.532  8.070   1.00 0.00 ? 463 TYR A CB   8  
ATOM   10679 C  CG   . TYR A 1 42 ? 3.480   -3.451  9.237   1.00 0.00 ? 463 TYR A CG   8  
ATOM   10680 C  CD1  . TYR A 1 42 ? 2.509   -3.700  10.199  1.00 0.00 ? 463 TYR A CD1  8  
ATOM   10681 C  CD2  . TYR A 1 42 ? 4.716   -4.071  9.378   1.00 0.00 ? 463 TYR A CD2  8  
ATOM   10682 C  CE1  . TYR A 1 42 ? 2.761   -4.539  11.268  1.00 0.00 ? 463 TYR A CE1  8  
ATOM   10683 C  CE2  . TYR A 1 42 ? 4.976   -4.912  10.443  1.00 0.00 ? 463 TYR A CE2  8  
ATOM   10684 C  CZ   . TYR A 1 42 ? 3.995   -5.142  11.385  1.00 0.00 ? 463 TYR A CZ   8  
ATOM   10685 O  OH   . TYR A 1 42 ? 4.250   -5.979  12.448  1.00 0.00 ? 463 TYR A OH   8  
ATOM   10686 H  H    . TYR A 1 42 ? 2.392   -0.582  6.624   1.00 0.00 ? 463 TYR A H    8  
ATOM   10687 H  HA   . TYR A 1 42 ? 2.959   -0.763  9.249   1.00 0.00 ? 463 TYR A HA   8  
ATOM   10688 H  HB2  . TYR A 1 42 ? 2.158   -2.636  7.810   1.00 0.00 ? 463 TYR A HB2  8  
ATOM   10689 H  HB3  . TYR A 1 42 ? 3.808   -2.858  7.238   1.00 0.00 ? 463 TYR A HB3  8  
ATOM   10690 H  HD1  . TYR A 1 42 ? 1.543   -3.226  10.104  1.00 0.00 ? 463 TYR A HD1  8  
ATOM   10691 H  HD2  . TYR A 1 42 ? 5.482   -3.889  8.638   1.00 0.00 ? 463 TYR A HD2  8  
ATOM   10692 H  HE1  . TYR A 1 42 ? 1.993   -4.719  12.006  1.00 0.00 ? 463 TYR A HE1  8  
ATOM   10693 H  HE2  . TYR A 1 42 ? 5.943   -5.385  10.535  1.00 0.00 ? 463 TYR A HE2  8  
ATOM   10694 H  HH   . TYR A 1 42 ? 5.117   -6.377  12.341  1.00 0.00 ? 463 TYR A HH   8  
ATOM   10695 N  N    . HIS A 1 43 ? 5.713   -0.469  7.569   1.00 0.00 ? 464 HIS A N    8  
ATOM   10696 C  CA   . HIS A 1 43 ? 7.152   -0.251  7.673   1.00 0.00 ? 464 HIS A CA   8  
ATOM   10697 C  C    . HIS A 1 43 ? 7.464   1.231   7.861   1.00 0.00 ? 464 HIS A C    8  
ATOM   10698 O  O    . HIS A 1 43 ? 8.203   1.610   8.771   1.00 0.00 ? 464 HIS A O    8  
ATOM   10699 C  CB   . HIS A 1 43 ? 7.860   -0.779  6.426   1.00 0.00 ? 464 HIS A CB   8  
ATOM   10700 C  CG   . HIS A 1 43 ? 7.865   -2.274  6.327   1.00 0.00 ? 464 HIS A CG   8  
ATOM   10701 N  ND1  . HIS A 1 43 ? 8.030   -3.099  7.420   1.00 0.00 ? 464 HIS A ND1  8  
ATOM   10702 C  CD2  . HIS A 1 43 ? 7.722   -3.091  5.258   1.00 0.00 ? 464 HIS A CD2  8  
ATOM   10703 C  CE1  . HIS A 1 43 ? 7.990   -4.360  7.026   1.00 0.00 ? 464 HIS A CE1  8  
ATOM   10704 N  NE2  . HIS A 1 43 ? 7.804   -4.382  5.719   1.00 0.00 ? 464 HIS A NE2  8  
ATOM   10705 H  H    . HIS A 1 43 ? 5.267   -0.313  6.711   1.00 0.00 ? 464 HIS A H    8  
ATOM   10706 H  HA   . HIS A 1 43 ? 7.508   -0.793  8.536   1.00 0.00 ? 464 HIS A HA   8  
ATOM   10707 H  HB2  . HIS A 1 43 ? 7.366   -0.391  5.547   1.00 0.00 ? 464 HIS A HB2  8  
ATOM   10708 H  HB3  . HIS A 1 43 ? 8.887   -0.443  6.433   1.00 0.00 ? 464 HIS A HB3  8  
ATOM   10709 H  HD2  . HIS A 1 43 ? 7.572   -2.786  4.232   1.00 0.00 ? 464 HIS A HD2  8  
ATOM   10710 H  HE1  . HIS A 1 43 ? 8.092   -5.225  7.664   1.00 0.00 ? 464 HIS A HE1  8  
ATOM   10711 H  HE2  . HIS A 1 43 ? 7.821   -5.187  5.160   1.00 0.00 ? 464 HIS A HE2  8  
ATOM   10712 N  N    . THR A 1 44 ? 6.898   2.065   6.994   1.00 0.00 ? 465 THR A N    8  
ATOM   10713 C  CA   . THR A 1 44 ? 7.118   3.504   7.063   1.00 0.00 ? 465 THR A CA   8  
ATOM   10714 C  C    . THR A 1 44 ? 7.232   3.974   8.509   1.00 0.00 ? 465 THR A C    8  
ATOM   10715 O  O    . THR A 1 44 ? 8.098   4.784   8.843   1.00 0.00 ? 465 THR A O    8  
ATOM   10716 C  CB   . THR A 1 44 ? 5.981   4.279   6.371   1.00 0.00 ? 465 THR A CB   8  
ATOM   10717 O  OG1  . THR A 1 44 ? 4.753   4.085   7.080   1.00 0.00 ? 465 THR A OG1  8  
ATOM   10718 C  CG2  . THR A 1 44 ? 5.817   3.826   4.928   1.00 0.00 ? 465 THR A CG2  8  
ATOM   10719 H  H    . THR A 1 44 ? 6.320   1.702   6.291   1.00 0.00 ? 465 THR A H    8  
ATOM   10720 H  HA   . THR A 1 44 ? 8.042   3.725   6.549   1.00 0.00 ? 465 THR A HA   8  
ATOM   10721 H  HB   . THR A 1 44 ? 6.228   5.332   6.377   1.00 0.00 ? 465 THR A HB   8  
ATOM   10722 H  HG1  . THR A 1 44 ? 4.902   4.210   8.021   1.00 0.00 ? 465 THR A HG1  8  
ATOM   10723 H  HG21 . THR A 1 44 ? 6.323   2.882   4.788   1.00 0.00 ? 465 THR A HG21 8  
ATOM   10724 H  HG22 . THR A 1 44 ? 6.244   4.566   4.268   1.00 0.00 ? 465 THR A HG22 8  
ATOM   10725 H  HG23 . THR A 1 44 ? 4.767   3.708   4.706   1.00 0.00 ? 465 THR A HG23 8  
ATOM   10726 N  N    . THR A 1 45 ? 6.353   3.461   9.364   1.00 0.00 ? 466 THR A N    8  
ATOM   10727 C  CA   . THR A 1 45 ? 6.355   3.829   10.774  1.00 0.00 ? 466 THR A CA   8  
ATOM   10728 C  C    . THR A 1 45 ? 6.431   2.594   11.665  1.00 0.00 ? 466 THR A C    8  
ATOM   10729 O  O    . THR A 1 45 ? 7.035   2.625   12.736  1.00 0.00 ? 466 THR A O    8  
ATOM   10730 C  CB   . THR A 1 45 ? 5.098   4.638   11.146  1.00 0.00 ? 466 THR A CB   8  
ATOM   10731 O  OG1  . THR A 1 45 ? 3.923   3.945   10.711  1.00 0.00 ? 466 THR A OG1  8  
ATOM   10732 C  CG2  . THR A 1 45 ? 5.139   6.022   10.515  1.00 0.00 ? 466 THR A CG2  8  
ATOM   10733 H  H    . THR A 1 45 ? 5.687   2.821   9.037   1.00 0.00 ? 466 THR A H    8  
ATOM   10734 H  HA   . THR A 1 45 ? 7.222   4.447   10.957  1.00 0.00 ? 466 THR A HA   8  
ATOM   10735 H  HB   . THR A 1 45 ? 5.064   4.749   12.220  1.00 0.00 ? 466 THR A HB   8  
ATOM   10736 H  HG1  . THR A 1 45 ? 3.678   4.250   9.834   1.00 0.00 ? 466 THR A HG1  8  
ATOM   10737 H  HG21 . THR A 1 45 ? 5.963   6.583   10.931  1.00 0.00 ? 466 THR A HG21 8  
ATOM   10738 H  HG22 . THR A 1 45 ? 4.213   6.537   10.717  1.00 0.00 ? 466 THR A HG22 8  
ATOM   10739 H  HG23 . THR A 1 45 ? 5.273   5.926   9.448   1.00 0.00 ? 466 THR A HG23 8  
ATOM   10740 N  N    . GLY A 1 46 ? 5.816   1.505   11.213  1.00 0.00 ? 467 GLY A N    8  
ATOM   10741 C  CA   . GLY A 1 46 ? 5.827   0.274   11.981  1.00 0.00 ? 467 GLY A CA   8  
ATOM   10742 C  C    . GLY A 1 46 ? 4.463   -0.385  12.041  1.00 0.00 ? 467 GLY A C    8  
ATOM   10743 O  O    . GLY A 1 46 ? 4.355   -1.609  11.988  1.00 0.00 ? 467 GLY A O    8  
ATOM   10744 H  H    . GLY A 1 46 ? 5.350   1.538   10.351  1.00 0.00 ? 467 GLY A H    8  
ATOM   10745 H  HA2  . GLY A 1 46 ? 6.527   -0.413  11.530  1.00 0.00 ? 467 GLY A HA2  8  
ATOM   10746 H  HA3  . GLY A 1 46 ? 6.151   0.494   12.988  1.00 0.00 ? 467 GLY A HA3  8  
ATOM   10747 N  N    . ASN A 1 47 ? 3.419   0.430   12.153  1.00 0.00 ? 468 ASN A N    8  
ATOM   10748 C  CA   . ASN A 1 47 ? 2.055   -0.082  12.223  1.00 0.00 ? 468 ASN A CA   8  
ATOM   10749 C  C    . ASN A 1 47 ? 1.295   0.217   10.933  1.00 0.00 ? 468 ASN A C    8  
ATOM   10750 O  O    . ASN A 1 47 ? 1.736   1.023   10.113  1.00 0.00 ? 468 ASN A O    8  
ATOM   10751 C  CB   . ASN A 1 47 ? 1.318   0.532   13.415  1.00 0.00 ? 468 ASN A CB   8  
ATOM   10752 C  CG   . ASN A 1 47 ? 0.145   -0.316  13.868  1.00 0.00 ? 468 ASN A CG   8  
ATOM   10753 O  OD1  . ASN A 1 47 ? 0.307   -1.487  14.211  1.00 0.00 ? 468 ASN A OD1  8  
ATOM   10754 N  ND2  . ASN A 1 47 ? -1.045  0.274   13.870  1.00 0.00 ? 468 ASN A ND2  8  
ATOM   10755 H  H    . ASN A 1 47 ? 3.569   1.398   12.191  1.00 0.00 ? 468 ASN A H    8  
ATOM   10756 H  HA   . ASN A 1 47 ? 2.108   -1.151  12.355  1.00 0.00 ? 468 ASN A HA   8  
ATOM   10757 H  HB2  . ASN A 1 47 ? 2.006   0.631   14.243  1.00 0.00 ? 468 ASN A HB2  8  
ATOM   10758 H  HB3  . ASN A 1 47 ? 0.949   1.508   13.140  1.00 0.00 ? 468 ASN A HB3  8  
ATOM   10759 H  HD21 . ASN A 1 47 ? -1.099  1.210   13.584  1.00 0.00 ? 468 ASN A HD21 8  
ATOM   10760 H  HD22 . ASN A 1 47 ? -1.821  -0.251  14.159  1.00 0.00 ? 468 ASN A HD22 8  
ATOM   10761 N  N    . CYS A 1 48 ? 0.151   -0.437  10.762  1.00 0.00 ? 469 CYS A N    8  
ATOM   10762 C  CA   . CYS A 1 48 ? -0.670  -0.242  9.574   1.00 0.00 ? 469 CYS A CA   8  
ATOM   10763 C  C    . CYS A 1 48 ? -2.102  0.124   9.956   1.00 0.00 ? 469 CYS A C    8  
ATOM   10764 O  O    . CYS A 1 48 ? -2.713  -0.525  10.805  1.00 0.00 ? 469 CYS A O    8  
ATOM   10765 C  CB   . CYS A 1 48 ? -0.669  -1.508  8.714   1.00 0.00 ? 469 CYS A CB   8  
ATOM   10766 S  SG   . CYS A 1 48 ? -1.213  -1.240  6.996   1.00 0.00 ? 469 CYS A SG   8  
ATOM   10767 H  H    . CYS A 1 48 ? -0.148  -1.067  11.452  1.00 0.00 ? 469 CYS A H    8  
ATOM   10768 H  HA   . CYS A 1 48 ? -0.244  0.570   9.004   1.00 0.00 ? 469 CYS A HA   8  
ATOM   10769 H  HB2  . CYS A 1 48 ? 0.334   -1.910  8.681   1.00 0.00 ? 469 CYS A HB2  8  
ATOM   10770 H  HB3  . CYS A 1 48 ? -1.329  -2.237  9.159   1.00 0.00 ? 469 CYS A HB3  8  
ATOM   10771 N  N    . ILE A 1 49 ? -2.628  1.168   9.324   1.00 0.00 ? 470 ILE A N    8  
ATOM   10772 C  CA   . ILE A 1 49 ? -3.987  1.619   9.597   1.00 0.00 ? 470 ILE A CA   8  
ATOM   10773 C  C    . ILE A 1 49 ? -5.009  0.768   8.851   1.00 0.00 ? 470 ILE A C    8  
ATOM   10774 O  O    . ILE A 1 49 ? -6.141  1.195   8.626   1.00 0.00 ? 470 ILE A O    8  
ATOM   10775 C  CB   . ILE A 1 49 ? -4.179  3.095   9.202   1.00 0.00 ? 470 ILE A CB   8  
ATOM   10776 C  CG1  . ILE A 1 49 ? -5.406  3.678   9.906   1.00 0.00 ? 470 ILE A CG1  8  
ATOM   10777 C  CG2  . ILE A 1 49 ? -4.316  3.226   7.692   1.00 0.00 ? 470 ILE A CG2  8  
ATOM   10778 C  CD1  . ILE A 1 49 ? -5.149  4.068   11.345  1.00 0.00 ? 470 ILE A CD1  8  
ATOM   10779 H  H    . ILE A 1 49 ? -2.091  1.644   8.658   1.00 0.00 ? 470 ILE A H    8  
ATOM   10780 H  HA   . ILE A 1 49 ? -4.162  1.526   10.659  1.00 0.00 ? 470 ILE A HA   8  
ATOM   10781 H  HB   . ILE A 1 49 ? -3.302  3.644   9.509   1.00 0.00 ? 470 ILE A HB   8  
ATOM   10782 H  HG12 . ILE A 1 49 ? -5.732  4.560   9.377   1.00 0.00 ? 470 ILE A HG12 8  
ATOM   10783 H  HG13 . ILE A 1 49 ? -6.200  2.945   9.896   1.00 0.00 ? 470 ILE A HG13 8  
ATOM   10784 H  HG21 . ILE A 1 49 ? -3.589  2.590   7.209   1.00 0.00 ? 470 ILE A HG21 8  
ATOM   10785 H  HG22 . ILE A 1 49 ? -5.310  2.928   7.394   1.00 0.00 ? 470 ILE A HG22 8  
ATOM   10786 H  HG23 . ILE A 1 49 ? -4.146  4.252   7.403   1.00 0.00 ? 470 ILE A HG23 8  
ATOM   10787 H  HD11 . ILE A 1 49 ? -4.097  4.268   11.481  1.00 0.00 ? 470 ILE A HD11 8  
ATOM   10788 H  HD12 . ILE A 1 49 ? -5.720  4.952   11.586  1.00 0.00 ? 470 ILE A HD12 8  
ATOM   10789 H  HD13 . ILE A 1 49 ? -5.448  3.258   11.995  1.00 0.00 ? 470 ILE A HD13 8  
ATOM   10790 N  N    . ASN A 1 50 ? -4.603  -0.440  8.473   1.00 0.00 ? 471 ASN A N    8  
ATOM   10791 C  CA   . ASN A 1 50 ? -5.484  -1.353  7.754   1.00 0.00 ? 471 ASN A CA   8  
ATOM   10792 C  C    . ASN A 1 50 ? -6.085  -2.387  8.701   1.00 0.00 ? 471 ASN A C    8  
ATOM   10793 O  O    . ASN A 1 50 ? -7.289  -2.641  8.676   1.00 0.00 ? 471 ASN A O    8  
ATOM   10794 C  CB   . ASN A 1 50 ? -4.718  -2.057  6.633   1.00 0.00 ? 471 ASN A CB   8  
ATOM   10795 C  CG   . ASN A 1 50 ? -4.758  -1.281  5.330   1.00 0.00 ? 471 ASN A CG   8  
ATOM   10796 O  OD1  . ASN A 1 50 ? -5.779  -0.692  4.977   1.00 0.00 ? 471 ASN A OD1  8  
ATOM   10797 N  ND2  . ASN A 1 50 ? -3.643  -1.279  4.608   1.00 0.00 ? 471 ASN A ND2  8  
ATOM   10798 H  H    . ASN A 1 50 ? -3.688  -0.724  8.682   1.00 0.00 ? 471 ASN A H    8  
ATOM   10799 H  HA   . ASN A 1 50 ? -6.283  -0.770  7.322   1.00 0.00 ? 471 ASN A HA   8  
ATOM   10800 H  HB2  . ASN A 1 50 ? -3.685  -2.172  6.928   1.00 0.00 ? 471 ASN A HB2  8  
ATOM   10801 H  HB3  . ASN A 1 50 ? -5.151  -3.031  6.465   1.00 0.00 ? 471 ASN A HB3  8  
ATOM   10802 H  HD21 . ASN A 1 50 ? -2.868  -1.771  4.951   1.00 0.00 ? 471 ASN A HD21 8  
ATOM   10803 H  HD22 . ASN A 1 50 ? -3.642  -0.786  3.761   1.00 0.00 ? 471 ASN A HD22 8  
ATOM   10804 N  N    . GLY A 1 51 ? -5.238  -2.980  9.537   1.00 0.00 ? 472 GLY A N    8  
ATOM   10805 C  CA   . GLY A 1 51 ? -5.704  -3.979  10.480  1.00 0.00 ? 472 GLY A CA   8  
ATOM   10806 C  C    . GLY A 1 51 ? -5.131  -5.354  10.199  1.00 0.00 ? 472 GLY A C    8  
ATOM   10807 O  O    . GLY A 1 51 ? -4.443  -5.555  9.198   1.00 0.00 ? 472 GLY A O    8  
ATOM   10808 H  H    . GLY A 1 51 ? -4.289  -2.738  9.512   1.00 0.00 ? 472 GLY A H    8  
ATOM   10809 H  HA2  . GLY A 1 51 ? -5.417  -3.678  11.477  1.00 0.00 ? 472 GLY A HA2  8  
ATOM   10810 H  HA3  . GLY A 1 51 ? -6.781  -4.033  10.427  1.00 0.00 ? 472 GLY A HA3  8  
ATOM   10811 N  N    . ASP A 1 52 ? -5.414  -6.303  11.085  1.00 0.00 ? 473 ASP A N    8  
ATOM   10812 C  CA   . ASP A 1 52 ? -4.922  -7.667  10.927  1.00 0.00 ? 473 ASP A CA   8  
ATOM   10813 C  C    . ASP A 1 52 ? -5.377  -8.259  9.597   1.00 0.00 ? 473 ASP A C    8  
ATOM   10814 O  O    . ASP A 1 52 ? -4.825  -9.254  9.127   1.00 0.00 ? 473 ASP A O    8  
ATOM   10815 C  CB   . ASP A 1 52 ? -5.407  -8.544  12.082  1.00 0.00 ? 473 ASP A CB   8  
ATOM   10816 C  CG   . ASP A 1 52 ? -4.732  -8.198  13.395  1.00 0.00 ? 473 ASP A CG   8  
ATOM   10817 O  OD1  . ASP A 1 52 ? -4.353  -7.022  13.575  1.00 0.00 ? 473 ASP A OD1  8  
ATOM   10818 O  OD2  . ASP A 1 52 ? -4.581  -9.104  14.242  1.00 0.00 ? 473 ASP A OD2  8  
ATOM   10819 H  H    . ASP A 1 52 ? -5.968  -6.082  11.863  1.00 0.00 ? 473 ASP A H    8  
ATOM   10820 H  HA   . ASP A 1 52 ? -3.843  -7.634  10.941  1.00 0.00 ? 473 ASP A HA   8  
ATOM   10821 H  HB2  . ASP A 1 52 ? -6.473  -8.413  12.202  1.00 0.00 ? 473 ASP A HB2  8  
ATOM   10822 H  HB3  . ASP A 1 52 ? -5.200  -9.578  11.852  1.00 0.00 ? 473 ASP A HB3  8  
ATOM   10823 N  N    . ASP A 1 53 ? -6.387  -7.641  8.995   1.00 0.00 ? 474 ASP A N    8  
ATOM   10824 C  CA   . ASP A 1 53 ? -6.917  -8.106  7.719   1.00 0.00 ? 474 ASP A CA   8  
ATOM   10825 C  C    . ASP A 1 53 ? -6.401  -7.246  6.570   1.00 0.00 ? 474 ASP A C    8  
ATOM   10826 O  O    . ASP A 1 53 ? -7.156  -6.871  5.672   1.00 0.00 ? 474 ASP A O    8  
ATOM   10827 C  CB   . ASP A 1 53 ? -8.446  -8.087  7.739   1.00 0.00 ? 474 ASP A CB   8  
ATOM   10828 C  CG   . ASP A 1 53 ? -9.003  -6.729  8.119   1.00 0.00 ? 474 ASP A CG   8  
ATOM   10829 O  OD1  . ASP A 1 53 ? -8.889  -5.792  7.302   1.00 0.00 ? 474 ASP A OD1  8  
ATOM   10830 O  OD2  . ASP A 1 53 ? -9.553  -6.603  9.233   1.00 0.00 ? 474 ASP A OD2  8  
ATOM   10831 H  H    . ASP A 1 53 ? -6.786  -6.852  9.419   1.00 0.00 ? 474 ASP A H    8  
ATOM   10832 H  HA   . ASP A 1 53 ? -6.581  -9.121  7.570   1.00 0.00 ? 474 ASP A HA   8  
ATOM   10833 H  HB2  . ASP A 1 53 ? -8.817  -8.345  6.758   1.00 0.00 ? 474 ASP A HB2  8  
ATOM   10834 H  HB3  . ASP A 1 53 ? -8.799  -8.814  8.456   1.00 0.00 ? 474 ASP A HB3  8  
ATOM   10835 N  N    . CYS A 1 54 ? -5.109  -6.934  6.604   1.00 0.00 ? 475 CYS A N    8  
ATOM   10836 C  CA   . CYS A 1 54 ? -4.491  -6.117  5.568   1.00 0.00 ? 475 CYS A CA   8  
ATOM   10837 C  C    . CYS A 1 54 ? -4.318  -6.913  4.278   1.00 0.00 ? 475 CYS A C    8  
ATOM   10838 O  O    . CYS A 1 54 ? -4.076  -8.119  4.309   1.00 0.00 ? 475 CYS A O    8  
ATOM   10839 C  CB   . CYS A 1 54 ? -3.134  -5.593  6.043   1.00 0.00 ? 475 CYS A CB   8  
ATOM   10840 S  SG   . CYS A 1 54 ? -2.366  -4.388  4.914   1.00 0.00 ? 475 CYS A SG   8  
ATOM   10841 H  H    . CYS A 1 54 ? -4.558  -7.263  7.346   1.00 0.00 ? 475 CYS A H    8  
ATOM   10842 H  HA   . CYS A 1 54 ? -5.143  -5.278  5.374   1.00 0.00 ? 475 CYS A HA   8  
ATOM   10843 H  HB2  . CYS A 1 54 ? -3.259  -5.111  7.002   1.00 0.00 ? 475 CYS A HB2  8  
ATOM   10844 H  HB3  . CYS A 1 54 ? -2.454  -6.425  6.150   1.00 0.00 ? 475 CYS A HB3  8  
ATOM   10845 N  N    . MET A 1 55 ? -4.445  -6.229  3.145   1.00 0.00 ? 476 MET A N    8  
ATOM   10846 C  CA   . MET A 1 55 ? -4.301  -6.873  1.844   1.00 0.00 ? 476 MET A CA   8  
ATOM   10847 C  C    . MET A 1 55 ? -2.844  -7.238  1.577   1.00 0.00 ? 476 MET A C    8  
ATOM   10848 O  O    . MET A 1 55 ? -2.554  -8.117  0.765   1.00 0.00 ? 476 MET A O    8  
ATOM   10849 C  CB   . MET A 1 55 ? -4.820  -5.953  0.737   1.00 0.00 ? 476 MET A CB   8  
ATOM   10850 C  CG   . MET A 1 55 ? -3.939  -4.739  0.493   1.00 0.00 ? 476 MET A CG   8  
ATOM   10851 S  SD   . MET A 1 55 ? -2.497  -5.119  -0.521  1.00 0.00 ? 476 MET A SD   8  
ATOM   10852 C  CE   . MET A 1 55 ? -3.227  -5.129  -2.157  1.00 0.00 ? 476 MET A CE   8  
ATOM   10853 H  H    . MET A 1 55 ? -4.639  -5.269  3.184   1.00 0.00 ? 476 MET A H    8  
ATOM   10854 H  HA   . MET A 1 55 ? -4.891  -7.777  1.855   1.00 0.00 ? 476 MET A HA   8  
ATOM   10855 H  HB2  . MET A 1 55 ? -4.882  -6.517  -0.182  1.00 0.00 ? 476 MET A HB2  8  
ATOM   10856 H  HB3  . MET A 1 55 ? -5.807  -5.607  1.005   1.00 0.00 ? 476 MET A HB3  8  
ATOM   10857 H  HG2  . MET A 1 55 ? -4.523  -3.981  -0.008  1.00 0.00 ? 476 MET A HG2  8  
ATOM   10858 H  HG3  . MET A 1 55 ? -3.602  -4.359  1.446   1.00 0.00 ? 476 MET A HG3  8  
ATOM   10859 H  HE1  . MET A 1 55 ? -4.150  -5.689  -2.137  1.00 0.00 ? 476 MET A HE1  8  
ATOM   10860 H  HE2  . MET A 1 55 ? -3.429  -4.114  -2.467  1.00 0.00 ? 476 MET A HE2  8  
ATOM   10861 H  HE3  . MET A 1 55 ? -2.541  -5.589  -2.854  1.00 0.00 ? 476 MET A HE3  8  
ATOM   10862 N  N    . PHE A 1 56 ? -1.933  -6.558  2.264   1.00 0.00 ? 477 PHE A N    8  
ATOM   10863 C  CA   . PHE A 1 56 ? -0.506  -6.811  2.099   1.00 0.00 ? 477 PHE A CA   8  
ATOM   10864 C  C    . PHE A 1 56 ? 0.027   -7.681  3.234   1.00 0.00 ? 477 PHE A C    8  
ATOM   10865 O  O    . PHE A 1 56 ? -0.578  -7.765  4.303   1.00 0.00 ? 477 PHE A O    8  
ATOM   10866 C  CB   . PHE A 1 56 ? 0.265   -5.490  2.048   1.00 0.00 ? 477 PHE A CB   8  
ATOM   10867 C  CG   . PHE A 1 56 ? 0.212   -4.816  0.707   1.00 0.00 ? 477 PHE A CG   8  
ATOM   10868 C  CD1  . PHE A 1 56 ? 0.572   -5.501  -0.442  1.00 0.00 ? 477 PHE A CD1  8  
ATOM   10869 C  CD2  . PHE A 1 56 ? -0.198  -3.497  0.596   1.00 0.00 ? 477 PHE A CD2  8  
ATOM   10870 C  CE1  . PHE A 1 56 ? 0.524   -4.883  -1.678  1.00 0.00 ? 477 PHE A CE1  8  
ATOM   10871 C  CE2  . PHE A 1 56 ? -0.248  -2.875  -0.637  1.00 0.00 ? 477 PHE A CE2  8  
ATOM   10872 C  CZ   . PHE A 1 56 ? 0.114   -3.568  -1.775  1.00 0.00 ? 477 PHE A CZ   8  
ATOM   10873 H  H    . PHE A 1 56 ? -2.226  -5.869  2.896   1.00 0.00 ? 477 PHE A H    8  
ATOM   10874 H  HA   . PHE A 1 56 ? -0.368  -7.334  1.165   1.00 0.00 ? 477 PHE A HA   8  
ATOM   10875 H  HB2  . PHE A 1 56 ? -0.150  -4.811  2.777   1.00 0.00 ? 477 PHE A HB2  8  
ATOM   10876 H  HB3  . PHE A 1 56 ? 1.301   -5.678  2.286   1.00 0.00 ? 477 PHE A HB3  8  
ATOM   10877 H  HD1  . PHE A 1 56 ? 0.894   -6.530  -0.367  1.00 0.00 ? 477 PHE A HD1  8  
ATOM   10878 H  HD2  . PHE A 1 56 ? -0.481  -2.953  1.485   1.00 0.00 ? 477 PHE A HD2  8  
ATOM   10879 H  HE1  . PHE A 1 56 ? 0.809   -5.429  -2.566  1.00 0.00 ? 477 PHE A HE1  8  
ATOM   10880 H  HE2  . PHE A 1 56 ? -0.569  -1.846  -0.711  1.00 0.00 ? 477 PHE A HE2  8  
ATOM   10881 H  HZ   . PHE A 1 56 ? 0.075   -3.084  -2.740  1.00 0.00 ? 477 PHE A HZ   8  
ATOM   10882 N  N    . SER A 1 57 ? 1.163   -8.327  2.992   1.00 0.00 ? 478 SER A N    8  
ATOM   10883 C  CA   . SER A 1 57 ? 1.776   -9.194  3.992   1.00 0.00 ? 478 SER A CA   8  
ATOM   10884 C  C    . SER A 1 57 ? 2.546   -8.375  5.023   1.00 0.00 ? 478 SER A C    8  
ATOM   10885 O  O    . SER A 1 57 ? 3.276   -7.446  4.676   1.00 0.00 ? 478 SER A O    8  
ATOM   10886 C  CB   . SER A 1 57 ? 2.713   -10.199 3.319   1.00 0.00 ? 478 SER A CB   8  
ATOM   10887 O  OG   . SER A 1 57 ? 1.981   -11.223 2.667   1.00 0.00 ? 478 SER A OG   8  
ATOM   10888 H  H    . SER A 1 57 ? 1.598   -8.219  2.120   1.00 0.00 ? 478 SER A H    8  
ATOM   10889 H  HA   . SER A 1 57 ? 0.986   -9.732  4.493   1.00 0.00 ? 478 SER A HA   8  
ATOM   10890 H  HB2  . SER A 1 57 ? 3.322   -9.688  2.589   1.00 0.00 ? 478 SER A HB2  8  
ATOM   10891 H  HB3  . SER A 1 57 ? 3.351   -10.649 4.067   1.00 0.00 ? 478 SER A HB3  8  
ATOM   10892 H  HG   . SER A 1 57 ? 2.545   -11.661 2.026   1.00 0.00 ? 478 SER A HG   8  
ATOM   10893 N  N    . HIS A 1 58 ? 2.377   -8.727  6.294   1.00 0.00 ? 479 HIS A N    8  
ATOM   10894 C  CA   . HIS A 1 58 ? 3.056   -8.025  7.378   1.00 0.00 ? 479 HIS A CA   8  
ATOM   10895 C  C    . HIS A 1 58 ? 4.269   -8.815  7.861   1.00 0.00 ? 479 HIS A C    8  
ATOM   10896 O  O    . HIS A 1 58 ? 4.705   -8.665  9.003   1.00 0.00 ? 479 HIS A O    8  
ATOM   10897 C  CB   . HIS A 1 58 ? 2.093   -7.785  8.540   1.00 0.00 ? 479 HIS A CB   8  
ATOM   10898 C  CG   . HIS A 1 58 ? 1.175   -6.621  8.327   1.00 0.00 ? 479 HIS A CG   8  
ATOM   10899 N  ND1  . HIS A 1 58 ? 0.232   -6.227  9.252   1.00 0.00 ? 479 HIS A ND1  8  
ATOM   10900 C  CD2  . HIS A 1 58 ? 1.061   -5.762  7.287   1.00 0.00 ? 479 HIS A CD2  8  
ATOM   10901 C  CE1  . HIS A 1 58 ? -0.424  -5.177  8.789   1.00 0.00 ? 479 HIS A CE1  8  
ATOM   10902 N  NE2  . HIS A 1 58 ? 0.060   -4.875  7.598   1.00 0.00 ? 479 HIS A NE2  8  
ATOM   10903 H  H    . HIS A 1 58 ? 1.783   -9.475  6.508   1.00 0.00 ? 479 HIS A H    8  
ATOM   10904 H  HA   . HIS A 1 58 ? 3.392   -7.072  6.997   1.00 0.00 ? 479 HIS A HA   8  
ATOM   10905 H  HB2  . HIS A 1 58 ? 1.484   -8.665  8.682   1.00 0.00 ? 479 HIS A HB2  8  
ATOM   10906 H  HB3  . HIS A 1 58 ? 2.663   -7.598  9.439   1.00 0.00 ? 479 HIS A HB3  8  
ATOM   10907 H  HD1  . HIS A 1 58 ? 0.066   -6.654  10.118  1.00 0.00 ? 479 HIS A HD1  8  
ATOM   10908 H  HD2  . HIS A 1 58 ? 1.648   -5.773  6.379   1.00 0.00 ? 479 HIS A HD2  8  
ATOM   10909 H  HE1  . HIS A 1 58 ? -1.221  -4.655  9.298   1.00 0.00 ? 479 HIS A HE1  8  
ATOM   10910 N  N    . ASP A 1 59 ? 4.807   -9.657  6.986   1.00 0.00 ? 480 ASP A N    8  
ATOM   10911 C  CA   . ASP A 1 59 ? 5.969   -10.471 7.323   1.00 0.00 ? 480 ASP A CA   8  
ATOM   10912 C  C    . ASP A 1 59 ? 7.176   -9.592  7.637   1.00 0.00 ? 480 ASP A C    8  
ATOM   10913 O  O    . ASP A 1 59 ? 7.293   -8.463  7.160   1.00 0.00 ? 480 ASP A O    8  
ATOM   10914 C  CB   . ASP A 1 59 ? 6.302   -11.424 6.174   1.00 0.00 ? 480 ASP A CB   8  
ATOM   10915 C  CG   . ASP A 1 59 ? 6.529   -10.695 4.864   1.00 0.00 ? 480 ASP A CG   8  
ATOM   10916 O  OD1  . ASP A 1 59 ? 6.015   -9.566  4.717   1.00 0.00 ? 480 ASP A OD1  8  
ATOM   10917 O  OD2  . ASP A 1 59 ? 7.219   -11.253 3.986   1.00 0.00 ? 480 ASP A OD2  8  
ATOM   10918 H  H    . ASP A 1 59 ? 4.414   -9.732  6.091   1.00 0.00 ? 480 ASP A H    8  
ATOM   10919 H  HA   . ASP A 1 59 ? 5.725   -11.051 8.200   1.00 0.00 ? 480 ASP A HA   8  
ATOM   10920 H  HB2  . ASP A 1 59 ? 7.200   -11.973 6.419   1.00 0.00 ? 480 ASP A HB2  8  
ATOM   10921 H  HB3  . ASP A 1 59 ? 5.485   -12.118 6.043   1.00 0.00 ? 480 ASP A HB3  8  
ATOM   10922 N  N    . PRO A 1 60 ? 8.095   -10.119 8.459   1.00 0.00 ? 481 PRO A N    8  
ATOM   10923 C  CA   . PRO A 1 60 ? 9.309   -9.399  8.855   1.00 0.00 ? 481 PRO A CA   8  
ATOM   10924 C  C    . PRO A 1 60 ? 10.291  -9.239  7.700   1.00 0.00 ? 481 PRO A C    8  
ATOM   10925 O  O    . PRO A 1 60 ? 10.763  -10.225 7.132   1.00 0.00 ? 481 PRO A O    8  
ATOM   10926 C  CB   . PRO A 1 60 ? 9.908   -10.288 9.948   1.00 0.00 ? 481 PRO A CB   8  
ATOM   10927 C  CG   . PRO A 1 60 ? 9.392   -11.654 9.650   1.00 0.00 ? 481 PRO A CG   8  
ATOM   10928 C  CD   . PRO A 1 60 ? 8.020   -11.459 9.065   1.00 0.00 ? 481 PRO A CD   8  
ATOM   10929 H  HA   . PRO A 1 60 ? 9.077   -8.427  9.267   1.00 0.00 ? 481 PRO A HA   8  
ATOM   10930 H  HB2  . PRO A 1 60 ? 10.987  -10.252 9.893   1.00 0.00 ? 481 PRO A HB2  8  
ATOM   10931 H  HB3  . PRO A 1 60 ? 9.579   -9.945  10.917  1.00 0.00 ? 481 PRO A HB3  8  
ATOM   10932 H  HG2  . PRO A 1 60 ? 10.038  -12.144 8.938   1.00 0.00 ? 481 PRO A HG2  8  
ATOM   10933 H  HG3  . PRO A 1 60 ? 9.331   -12.229 10.562  1.00 0.00 ? 481 PRO A HG3  8  
ATOM   10934 H  HD2  . PRO A 1 60 ? 7.820   -12.211 8.315   1.00 0.00 ? 481 PRO A HD2  8  
ATOM   10935 H  HD3  . PRO A 1 60 ? 7.270   -11.489 9.841   1.00 0.00 ? 481 PRO A HD3  8  
ATOM   10936 N  N    . LEU A 1 61 ? 10.597  -7.993  7.358   1.00 0.00 ? 482 LEU A N    8  
ATOM   10937 C  CA   . LEU A 1 61 ? 11.524  -7.704  6.270   1.00 0.00 ? 482 LEU A CA   8  
ATOM   10938 C  C    . LEU A 1 61 ? 12.715  -8.656  6.302   1.00 0.00 ? 482 LEU A C    8  
ATOM   10939 O  O    . LEU A 1 61 ? 13.193  -9.035  7.372   1.00 0.00 ? 482 LEU A O    8  
ATOM   10940 C  CB   . LEU A 1 61 ? 12.012  -6.257  6.360   1.00 0.00 ? 482 LEU A CB   8  
ATOM   10941 C  CG   . LEU A 1 61 ? 10.977  -5.178  6.037   1.00 0.00 ? 482 LEU A CG   8  
ATOM   10942 C  CD1  . LEU A 1 61 ? 11.564  -3.792  6.255   1.00 0.00 ? 482 LEU A CD1  8  
ATOM   10943 C  CD2  . LEU A 1 61 ? 10.478  -5.329  4.607   1.00 0.00 ? 482 LEU A CD2  8  
ATOM   10944 H  H    . LEU A 1 61 ? 10.189  -7.248  7.847   1.00 0.00 ? 482 LEU A H    8  
ATOM   10945 H  HA   . LEU A 1 61 ? 10.995  -7.839  5.338   1.00 0.00 ? 482 LEU A HA   8  
ATOM   10946 H  HB2  . LEU A 1 61 ? 12.362  -6.088  7.367   1.00 0.00 ? 482 LEU A HB2  8  
ATOM   10947 H  HB3  . LEU A 1 61 ? 12.836  -6.143  5.670   1.00 0.00 ? 482 LEU A HB3  8  
ATOM   10948 H  HG   . LEU A 1 61 ? 10.131  -5.290  6.701   1.00 0.00 ? 482 LEU A HG   8  
ATOM   10949 H  HD11 . LEU A 1 61 ? 11.522  -3.234  5.332   1.00 0.00 ? 482 LEU A HD11 8  
ATOM   10950 H  HD12 . LEU A 1 61 ? 12.592  -3.883  6.574   1.00 0.00 ? 482 LEU A HD12 8  
ATOM   10951 H  HD13 . LEU A 1 61 ? 10.996  -3.276  7.015   1.00 0.00 ? 482 LEU A HD13 8  
ATOM   10952 H  HD21 . LEU A 1 61 ? 11.317  -5.295  3.928   1.00 0.00 ? 482 LEU A HD21 8  
ATOM   10953 H  HD22 . LEU A 1 61 ? 9.797   -4.523  4.377   1.00 0.00 ? 482 LEU A HD22 8  
ATOM   10954 H  HD23 . LEU A 1 61 ? 9.968   -6.275  4.502   1.00 0.00 ? 482 LEU A HD23 8  
ATOM   10955 N  N    . THR A 1 62 ? 13.192  -9.039  5.121   1.00 0.00 ? 483 THR A N    8  
ATOM   10956 C  CA   . THR A 1 62 ? 14.328  -9.947  5.014   1.00 0.00 ? 483 THR A CA   8  
ATOM   10957 C  C    . THR A 1 62 ? 15.280  -9.507  3.908   1.00 0.00 ? 483 THR A C    8  
ATOM   10958 O  O    . THR A 1 62 ? 14.911  -8.723  3.035   1.00 0.00 ? 483 THR A O    8  
ATOM   10959 C  CB   . THR A 1 62 ? 13.869  -11.391 4.736   1.00 0.00 ? 483 THR A CB   8  
ATOM   10960 O  OG1  . THR A 1 62 ? 12.851  -11.396 3.728   1.00 0.00 ? 483 THR A OG1  8  
ATOM   10961 C  CG2  . THR A 1 62 ? 13.337  -12.043 6.003   1.00 0.00 ? 483 THR A CG2  8  
ATOM   10962 H  H    . THR A 1 62 ? 12.769  -8.703  4.304   1.00 0.00 ? 483 THR A H    8  
ATOM   10963 H  HA   . THR A 1 62 ? 14.855  -9.934  5.957   1.00 0.00 ? 483 THR A HA   8  
ATOM   10964 H  HB   . THR A 1 62 ? 14.717  -11.960 4.383   1.00 0.00 ? 483 THR A HB   8  
ATOM   10965 H  HG1  . THR A 1 62 ? 12.795  -12.270 3.335   1.00 0.00 ? 483 THR A HG1  8  
ATOM   10966 H  HG21 . THR A 1 62 ? 12.821  -12.957 5.748   1.00 0.00 ? 483 THR A HG21 8  
ATOM   10967 H  HG22 . THR A 1 62 ? 12.653  -11.368 6.496   1.00 0.00 ? 483 THR A HG22 8  
ATOM   10968 H  HG23 . THR A 1 62 ? 14.161  -12.268 6.664   1.00 0.00 ? 483 THR A HG23 8  
ATOM   10969 N  N    . GLU A 1 63 ? 16.508  -10.016 3.953   1.00 0.00 ? 484 GLU A N    8  
ATOM   10970 C  CA   . GLU A 1 63 ? 17.513  -9.674  2.954   1.00 0.00 ? 484 GLU A CA   8  
ATOM   10971 C  C    . GLU A 1 63 ? 16.891  -9.591  1.563   1.00 0.00 ? 484 GLU A C    8  
ATOM   10972 O  O    . GLU A 1 63 ? 17.286  -8.761  0.745   1.00 0.00 ? 484 GLU A O    8  
ATOM   10973 C  CB   . GLU A 1 63 ? 18.641  -10.708 2.959   1.00 0.00 ? 484 GLU A CB   8  
ATOM   10974 C  CG   . GLU A 1 63 ? 19.691  -10.468 1.887   1.00 0.00 ? 484 GLU A CG   8  
ATOM   10975 C  CD   . GLU A 1 63 ? 20.519  -11.704 1.595   1.00 0.00 ? 484 GLU A CD   8  
ATOM   10976 O  OE1  . GLU A 1 63 ? 19.923  -12.785 1.405   1.00 0.00 ? 484 GLU A OE1  8  
ATOM   10977 O  OE2  . GLU A 1 63 ? 21.762  -11.591 1.556   1.00 0.00 ? 484 GLU A OE2  8  
ATOM   10978 H  H    . GLU A 1 63 ? 16.742  -10.636 4.675   1.00 0.00 ? 484 GLU A H    8  
ATOM   10979 H  HA   . GLU A 1 63 ? 17.921  -8.709  3.211   1.00 0.00 ? 484 GLU A HA   8  
ATOM   10980 H  HB2  . GLU A 1 63 ? 19.129  -10.686 3.923   1.00 0.00 ? 484 GLU A HB2  8  
ATOM   10981 H  HB3  . GLU A 1 63 ? 18.215  -11.688 2.803   1.00 0.00 ? 484 GLU A HB3  8  
ATOM   10982 H  HG2  . GLU A 1 63 ? 19.195  -10.163 0.978   1.00 0.00 ? 484 GLU A HG2  8  
ATOM   10983 H  HG3  . GLU A 1 63 ? 20.352  -9.680  2.218   1.00 0.00 ? 484 GLU A HG3  8  
ATOM   10984 N  N    . GLU A 1 64 ? 15.917  -10.458 1.304   1.00 0.00 ? 485 GLU A N    8  
ATOM   10985 C  CA   . GLU A 1 64 ? 15.242  -10.483 0.011   1.00 0.00 ? 485 GLU A CA   8  
ATOM   10986 C  C    . GLU A 1 64 ? 14.183  -9.388  -0.070  1.00 0.00 ? 485 GLU A C    8  
ATOM   10987 O  O    . GLU A 1 64 ? 14.328  -8.421  -0.820  1.00 0.00 ? 485 GLU A O    8  
ATOM   10988 C  CB   . GLU A 1 64 ? 14.597  -11.850 -0.226  1.00 0.00 ? 485 GLU A CB   8  
ATOM   10989 C  CG   . GLU A 1 64 ? 15.598  -12.991 -0.298  1.00 0.00 ? 485 GLU A CG   8  
ATOM   10990 C  CD   . GLU A 1 64 ? 16.225  -13.304 1.047   1.00 0.00 ? 485 GLU A CD   8  
ATOM   10991 O  OE1  . GLU A 1 64 ? 15.479  -13.376 2.046   1.00 0.00 ? 485 GLU A OE1  8  
ATOM   10992 O  OE2  . GLU A 1 64 ? 17.460  -13.477 1.099   1.00 0.00 ? 485 GLU A OE2  8  
ATOM   10993 H  H    . GLU A 1 64 ? 15.647  -11.095 1.997   1.00 0.00 ? 485 GLU A H    8  
ATOM   10994 H  HA   . GLU A 1 64 ? 15.983  -10.307 -0.754  1.00 0.00 ? 485 GLU A HA   8  
ATOM   10995 H  HB2  . GLU A 1 64 ? 13.907  -12.054 0.580   1.00 0.00 ? 485 GLU A HB2  8  
ATOM   10996 H  HB3  . GLU A 1 64 ? 14.050  -11.820 -1.157  1.00 0.00 ? 485 GLU A HB3  8  
ATOM   10997 H  HG2  . GLU A 1 64 ? 15.093  -13.875 -0.657  1.00 0.00 ? 485 GLU A HG2  8  
ATOM   10998 H  HG3  . GLU A 1 64 ? 16.383  -12.721 -0.990  1.00 0.00 ? 485 GLU A HG3  8  
ATOM   10999 N  N    . THR A 1 65 ? 13.115  -9.546  0.706   1.00 0.00 ? 486 THR A N    8  
ATOM   11000 C  CA   . THR A 1 65 ? 12.030  -8.573  0.721   1.00 0.00 ? 486 THR A CA   8  
ATOM   11001 C  C    . THR A 1 65 ? 12.557  -7.165  0.976   1.00 0.00 ? 486 THR A C    8  
ATOM   11002 O  O    . THR A 1 65 ? 12.307  -6.248  0.194   1.00 0.00 ? 486 THR A O    8  
ATOM   11003 C  CB   . THR A 1 65 ? 10.981  -8.918  1.796   1.00 0.00 ? 486 THR A CB   8  
ATOM   11004 O  OG1  . THR A 1 65 ? 11.633  -9.336  3.000   1.00 0.00 ? 486 THR A OG1  8  
ATOM   11005 C  CG2  . THR A 1 65 ? 10.050  -10.018 1.309   1.00 0.00 ? 486 THR A CG2  8  
ATOM   11006 H  H    . THR A 1 65 ? 13.057  -10.337 1.282   1.00 0.00 ? 486 THR A H    8  
ATOM   11007 H  HA   . THR A 1 65 ? 11.547  -8.597  -0.245  1.00 0.00 ? 486 THR A HA   8  
ATOM   11008 H  HB   . THR A 1 65 ? 10.394  -8.034  2.001   1.00 0.00 ? 486 THR A HB   8  
ATOM   11009 H  HG1  . THR A 1 65 ? 10.999  -9.779  3.570   1.00 0.00 ? 486 THR A HG1  8  
ATOM   11010 H  HG21 . THR A 1 65 ? 10.338  -10.958 1.757   1.00 0.00 ? 486 THR A HG21 8  
ATOM   11011 H  HG22 . THR A 1 65 ? 10.116  -10.096 0.234   1.00 0.00 ? 486 THR A HG22 8  
ATOM   11012 H  HG23 . THR A 1 65 ? 9.036   -9.781  1.591   1.00 0.00 ? 486 THR A HG23 8  
ATOM   11013 N  N    . ARG A 1 66 ? 13.288  -7.002  2.074   1.00 0.00 ? 487 ARG A N    8  
ATOM   11014 C  CA   . ARG A 1 66 ? 13.850  -5.704  2.431   1.00 0.00 ? 487 ARG A CA   8  
ATOM   11015 C  C    . ARG A 1 66 ? 14.355  -4.971  1.192   1.00 0.00 ? 487 ARG A C    8  
ATOM   11016 O  O    . ARG A 1 66 ? 14.041  -3.800  0.982   1.00 0.00 ? 487 ARG A O    8  
ATOM   11017 C  CB   . ARG A 1 66 ? 14.991  -5.878  3.435   1.00 0.00 ? 487 ARG A CB   8  
ATOM   11018 C  CG   . ARG A 1 66 ? 15.150  -4.704  4.386   1.00 0.00 ? 487 ARG A CG   8  
ATOM   11019 C  CD   . ARG A 1 66 ? 15.688  -3.475  3.669   1.00 0.00 ? 487 ARG A CD   8  
ATOM   11020 N  NE   . ARG A 1 66 ? 15.764  -2.315  4.553   1.00 0.00 ? 487 ARG A NE   8  
ATOM   11021 C  CZ   . ARG A 1 66 ? 16.845  -1.998  5.257   1.00 0.00 ? 487 ARG A CZ   8  
ATOM   11022 N  NH1  . ARG A 1 66 ? 17.935  -2.749  5.180   1.00 0.00 ? 487 ARG A NH1  8  
ATOM   11023 N  NH2  . ARG A 1 66 ? 16.837  -0.926  6.040   1.00 0.00 ? 487 ARG A NH2  8  
ATOM   11024 H  H    . ARG A 1 66 ? 13.452  -7.771  2.658   1.00 0.00 ? 487 ARG A H    8  
ATOM   11025 H  HA   . ARG A 1 66 ? 13.067  -5.118  2.888   1.00 0.00 ? 487 ARG A HA   8  
ATOM   11026 H  HB2  . ARG A 1 66 ? 14.807  -6.766  4.022   1.00 0.00 ? 487 ARG A HB2  8  
ATOM   11027 H  HB3  . ARG A 1 66 ? 15.916  -6.001  2.891   1.00 0.00 ? 487 ARG A HB3  8  
ATOM   11028 H  HG2  . ARG A 1 66 ? 14.187  -4.465  4.812   1.00 0.00 ? 487 ARG A HG2  8  
ATOM   11029 H  HG3  . ARG A 1 66 ? 15.836  -4.980  5.173   1.00 0.00 ? 487 ARG A HG3  8  
ATOM   11030 H  HD2  . ARG A 1 66 ? 16.677  -3.697  3.296   1.00 0.00 ? 487 ARG A HD2  8  
ATOM   11031 H  HD3  . ARG A 1 66 ? 15.034  -3.243  2.842   1.00 0.00 ? 487 ARG A HD3  8  
ATOM   11032 H  HE   . ARG A 1 66 ? 14.970  -1.746  4.625   1.00 0.00 ? 487 ARG A HE   8  
ATOM   11033 H  HH11 . ARG A 1 66 ? 17.944  -3.556  4.590   1.00 0.00 ? 487 ARG A HH11 8  
ATOM   11034 H  HH12 . ARG A 1 66 ? 18.748  -2.507  5.710   1.00 0.00 ? 487 ARG A HH12 8  
ATOM   11035 H  HH21 . ARG A 1 66 ? 16.018  -0.357  6.100   1.00 0.00 ? 487 ARG A HH21 8  
ATOM   11036 H  HH22 . ARG A 1 66 ? 17.651  -0.688  6.569   1.00 0.00 ? 487 ARG A HH22 8  
ATOM   11037 N  N    . GLU A 1 67 ? 15.138  -5.669  0.376   1.00 0.00 ? 488 GLU A N    8  
ATOM   11038 C  CA   . GLU A 1 67 ? 15.687  -5.082  -0.841  1.00 0.00 ? 488 GLU A CA   8  
ATOM   11039 C  C    . GLU A 1 67 ? 14.584  -4.454  -1.688  1.00 0.00 ? 488 GLU A C    8  
ATOM   11040 O  O    . GLU A 1 67 ? 14.769  -3.389  -2.278  1.00 0.00 ? 488 GLU A O    8  
ATOM   11041 C  CB   . GLU A 1 67 ? 16.428  -6.144  -1.656  1.00 0.00 ? 488 GLU A CB   8  
ATOM   11042 C  CG   . GLU A 1 67 ? 17.853  -6.387  -1.187  1.00 0.00 ? 488 GLU A CG   8  
ATOM   11043 C  CD   . GLU A 1 67 ? 18.802  -5.283  -1.611  1.00 0.00 ? 488 GLU A CD   8  
ATOM   11044 O  OE1  . GLU A 1 67 ? 18.999  -5.107  -2.832  1.00 0.00 ? 488 GLU A OE1  8  
ATOM   11045 O  OE2  . GLU A 1 67 ? 19.348  -4.596  -0.723  1.00 0.00 ? 488 GLU A OE2  8  
ATOM   11046 H  H    . GLU A 1 67 ? 15.352  -6.599  0.597   1.00 0.00 ? 488 GLU A H    8  
ATOM   11047 H  HA   . GLU A 1 67 ? 16.385  -4.312  -0.552  1.00 0.00 ? 488 GLU A HA   8  
ATOM   11048 H  HB2  . GLU A 1 67 ? 15.885  -7.076  -1.590  1.00 0.00 ? 488 GLU A HB2  8  
ATOM   11049 H  HB3  . GLU A 1 67 ? 16.460  -5.830  -2.689  1.00 0.00 ? 488 GLU A HB3  8  
ATOM   11050 H  HG2  . GLU A 1 67 ? 17.858  -6.451  -0.110  1.00 0.00 ? 488 GLU A HG2  8  
ATOM   11051 H  HG3  . GLU A 1 67 ? 18.201  -7.321  -1.603  1.00 0.00 ? 488 GLU A HG3  8  
ATOM   11052 N  N    . LEU A 1 68 ? 13.436  -5.121  -1.743  1.00 0.00 ? 489 LEU A N    8  
ATOM   11053 C  CA   . LEU A 1 68 ? 12.302  -4.629  -2.518  1.00 0.00 ? 489 LEU A CA   8  
ATOM   11054 C  C    . LEU A 1 68 ? 12.016  -3.165  -2.196  1.00 0.00 ? 489 LEU A C    8  
ATOM   11055 O  O    . LEU A 1 68 ? 12.172  -2.289  -3.047  1.00 0.00 ? 489 LEU A O    8  
ATOM   11056 C  CB   . LEU A 1 68 ? 11.061  -5.477  -2.236  1.00 0.00 ? 489 LEU A CB   8  
ATOM   11057 C  CG   . LEU A 1 68 ? 11.216  -6.984  -2.444  1.00 0.00 ? 489 LEU A CG   8  
ATOM   11058 C  CD1  . LEU A 1 68 ? 9.913   -7.703  -2.131  1.00 0.00 ? 489 LEU A CD1  8  
ATOM   11059 C  CD2  . LEU A 1 68 ? 11.663  -7.283  -3.868  1.00 0.00 ? 489 LEU A CD2  8  
ATOM   11060 H  H    . LEU A 1 68 ? 13.348  -5.964  -1.252  1.00 0.00 ? 489 LEU A H    8  
ATOM   11061 H  HA   . LEU A 1 68 ? 12.555  -4.712  -3.564  1.00 0.00 ? 489 LEU A HA   8  
ATOM   11062 H  HB2  . LEU A 1 68 ? 10.775  -5.313  -1.209  1.00 0.00 ? 489 LEU A HB2  8  
ATOM   11063 H  HB3  . LEU A 1 68 ? 10.271  -5.132  -2.888  1.00 0.00 ? 489 LEU A HB3  8  
ATOM   11064 H  HG   . LEU A 1 68 ? 11.973  -7.358  -1.769  1.00 0.00 ? 489 LEU A HG   8  
ATOM   11065 H  HD11 . LEU A 1 68 ? 10.129  -8.647  -1.654  1.00 0.00 ? 489 LEU A HD11 8  
ATOM   11066 H  HD12 . LEU A 1 68 ? 9.369   -7.878  -3.047  1.00 0.00 ? 489 LEU A HD12 8  
ATOM   11067 H  HD13 . LEU A 1 68 ? 9.315   -7.093  -1.469  1.00 0.00 ? 489 LEU A HD13 8  
ATOM   11068 H  HD21 . LEU A 1 68 ? 11.894  -8.334  -3.959  1.00 0.00 ? 489 LEU A HD21 8  
ATOM   11069 H  HD22 . LEU A 1 68 ? 12.544  -6.700  -4.098  1.00 0.00 ? 489 LEU A HD22 8  
ATOM   11070 H  HD23 . LEU A 1 68 ? 10.871  -7.026  -4.555  1.00 0.00 ? 489 LEU A HD23 8  
ATOM   11071 N  N    . LEU A 1 69 ? 11.600  -2.908  -0.961  1.00 0.00 ? 490 LEU A N    8  
ATOM   11072 C  CA   . LEU A 1 69 ? 11.294  -1.549  -0.525  1.00 0.00 ? 490 LEU A CA   8  
ATOM   11073 C  C    . LEU A 1 69 ? 12.306  -0.556  -1.087  1.00 0.00 ? 490 LEU A C    8  
ATOM   11074 O  O    . LEU A 1 69 ? 11.947  0.354   -1.834  1.00 0.00 ? 490 LEU A O    8  
ATOM   11075 C  CB   . LEU A 1 69 ? 11.284  -1.474  1.003   1.00 0.00 ? 490 LEU A CB   8  
ATOM   11076 C  CG   . LEU A 1 69 ? 10.168  -2.247  1.706   1.00 0.00 ? 490 LEU A CG   8  
ATOM   11077 C  CD1  . LEU A 1 69 ? 10.462  -2.376  3.192   1.00 0.00 ? 490 LEU A CD1  8  
ATOM   11078 C  CD2  . LEU A 1 69 ? 8.825   -1.566  1.483   1.00 0.00 ? 490 LEU A CD2  8  
ATOM   11079 H  H    . LEU A 1 69 ? 11.495  -3.647  -0.327  1.00 0.00 ? 490 LEU A H    8  
ATOM   11080 H  HA   . LEU A 1 69 ? 10.313  -1.295  -0.896  1.00 0.00 ? 490 LEU A HA   8  
ATOM   11081 H  HB2  . LEU A 1 69 ? 12.227  -1.858  1.360   1.00 0.00 ? 490 LEU A HB2  8  
ATOM   11082 H  HB3  . LEU A 1 69 ? 11.193  -0.433  1.281   1.00 0.00 ? 490 LEU A HB3  8  
ATOM   11083 H  HG   . LEU A 1 69 ? 10.112  -3.244  1.290   1.00 0.00 ? 490 LEU A HG   8  
ATOM   11084 H  HD11 . LEU A 1 69 ? 9.535   -2.487  3.734   1.00 0.00 ? 490 LEU A HD11 8  
ATOM   11085 H  HD12 . LEU A 1 69 ? 10.976  -1.491  3.536   1.00 0.00 ? 490 LEU A HD12 8  
ATOM   11086 H  HD13 . LEU A 1 69 ? 11.085  -3.242  3.362   1.00 0.00 ? 490 LEU A HD13 8  
ATOM   11087 H  HD21 . LEU A 1 69 ? 8.660   -0.835  2.260   1.00 0.00 ? 490 LEU A HD21 8  
ATOM   11088 H  HD22 . LEU A 1 69 ? 8.038   -2.306  1.512   1.00 0.00 ? 490 LEU A HD22 8  
ATOM   11089 H  HD23 . LEU A 1 69 ? 8.825   -1.077  0.521   1.00 0.00 ? 490 LEU A HD23 8  
ATOM   11090 N  N    . ASP A 1 70 ? 13.571  -0.739  -0.726  1.00 0.00 ? 491 ASP A N    8  
ATOM   11091 C  CA   . ASP A 1 70 ? 14.636  0.139   -1.197  1.00 0.00 ? 491 ASP A CA   8  
ATOM   11092 C  C    . ASP A 1 70 ? 14.429  0.505   -2.664  1.00 0.00 ? 491 ASP A C    8  
ATOM   11093 O  O    . ASP A 1 70 ? 14.662  1.643   -3.070  1.00 0.00 ? 491 ASP A O    8  
ATOM   11094 C  CB   . ASP A 1 70 ? 15.998  -0.532  -1.013  1.00 0.00 ? 491 ASP A CB   8  
ATOM   11095 C  CG   . ASP A 1 70 ? 16.426  -0.584  0.440   1.00 0.00 ? 491 ASP A CG   8  
ATOM   11096 O  OD1  . ASP A 1 70 ? 15.934  -1.469  1.171   1.00 0.00 ? 491 ASP A OD1  8  
ATOM   11097 O  OD2  . ASP A 1 70 ? 17.252  0.259   0.847   1.00 0.00 ? 491 ASP A OD2  8  
ATOM   11098 H  H    . ASP A 1 70 ? 13.794  -1.483  -0.128  1.00 0.00 ? 491 ASP A H    8  
ATOM   11099 H  HA   . ASP A 1 70 ? 14.607  1.042   -0.607  1.00 0.00 ? 491 ASP A HA   8  
ATOM   11100 H  HB2  . ASP A 1 70 ? 15.948  -1.543  -1.391  1.00 0.00 ? 491 ASP A HB2  8  
ATOM   11101 H  HB3  . ASP A 1 70 ? 16.741  0.020   -1.570  1.00 0.00 ? 491 ASP A HB3  8  
ATOM   11102 N  N    . LYS A 1 71 ? 13.991  -0.469  -3.455  1.00 0.00 ? 492 LYS A N    8  
ATOM   11103 C  CA   . LYS A 1 71 ? 13.752  -0.250  -4.877  1.00 0.00 ? 492 LYS A CA   8  
ATOM   11104 C  C    . LYS A 1 71 ? 12.415  0.448   -5.103  1.00 0.00 ? 492 LYS A C    8  
ATOM   11105 O  O    . LYS A 1 71 ? 12.305  1.341   -5.942  1.00 0.00 ? 492 LYS A O    8  
ATOM   11106 C  CB   . LYS A 1 71 ? 13.777  -1.583  -5.629  1.00 0.00 ? 492 LYS A CB   8  
ATOM   11107 C  CG   . LYS A 1 71 ? 13.636  -1.434  -7.134  1.00 0.00 ? 492 LYS A CG   8  
ATOM   11108 C  CD   . LYS A 1 71 ? 14.282  -2.595  -7.872  1.00 0.00 ? 492 LYS A CD   8  
ATOM   11109 C  CE   . LYS A 1 71 ? 13.480  -3.877  -7.704  1.00 0.00 ? 492 LYS A CE   8  
ATOM   11110 N  NZ   . LYS A 1 71 ? 14.274  -5.080  -8.077  1.00 0.00 ? 492 LYS A NZ   8  
ATOM   11111 H  H    . LYS A 1 71 ? 13.823  -1.356  -3.073  1.00 0.00 ? 492 LYS A H    8  
ATOM   11112 H  HA   . LYS A 1 71 ? 14.542  0.381   -5.253  1.00 0.00 ? 492 LYS A HA   8  
ATOM   11113 H  HB2  . LYS A 1 71 ? 14.713  -2.081  -5.424  1.00 0.00 ? 492 LYS A HB2  8  
ATOM   11114 H  HB3  . LYS A 1 71 ? 12.965  -2.200  -5.272  1.00 0.00 ? 492 LYS A HB3  8  
ATOM   11115 H  HG2  . LYS A 1 71 ? 12.587  -1.399  -7.387  1.00 0.00 ? 492 LYS A HG2  8  
ATOM   11116 H  HG3  . LYS A 1 71 ? 14.113  -0.514  -7.442  1.00 0.00 ? 492 LYS A HG3  8  
ATOM   11117 H  HD2  . LYS A 1 71 ? 14.339  -2.355  -8.924  1.00 0.00 ? 492 LYS A HD2  8  
ATOM   11118 H  HD3  . LYS A 1 71 ? 15.278  -2.749  -7.482  1.00 0.00 ? 492 LYS A HD3  8  
ATOM   11119 H  HE2  . LYS A 1 71 ? 13.175  -3.962  -6.673  1.00 0.00 ? 492 LYS A HE2  8  
ATOM   11120 H  HE3  . LYS A 1 71 ? 12.605  -3.823  -8.335  1.00 0.00 ? 492 LYS A HE3  8  
ATOM   11121 H  HZ1  . LYS A 1 71 ? 14.045  -5.870  -7.439  1.00 0.00 ? 492 LYS A HZ1  8  
ATOM   11122 H  HZ2  . LYS A 1 71 ? 15.291  -4.874  -8.004  1.00 0.00 ? 492 LYS A HZ2  8  
ATOM   11123 H  HZ3  . LYS A 1 71 ? 14.057  -5.363  -9.054  1.00 0.00 ? 492 LYS A HZ3  8  
ATOM   11124 N  N    . MET A 1 72 ? 11.402  0.036   -4.348  1.00 0.00 ? 493 MET A N    8  
ATOM   11125 C  CA   . MET A 1 72 ? 10.073  0.624   -4.465  1.00 0.00 ? 493 MET A CA   8  
ATOM   11126 C  C    . MET A 1 72 ? 10.102  2.108   -4.111  1.00 0.00 ? 493 MET A C    8  
ATOM   11127 O  O    . MET A 1 72 ? 9.758   2.959   -4.931  1.00 0.00 ? 493 MET A O    8  
ATOM   11128 C  CB   . MET A 1 72 ? 9.085   -0.109  -3.556  1.00 0.00 ? 493 MET A CB   8  
ATOM   11129 C  CG   . MET A 1 72 ? 7.628   0.162   -3.897  1.00 0.00 ? 493 MET A CG   8  
ATOM   11130 S  SD   . MET A 1 72 ? 7.052   1.750   -3.268  1.00 0.00 ? 493 MET A SD   8  
ATOM   11131 C  CE   . MET A 1 72 ? 6.693   1.330   -1.565  1.00 0.00 ? 493 MET A CE   8  
ATOM   11132 H  H    . MET A 1 72 ? 11.551  -0.681  -3.696  1.00 0.00 ? 493 MET A H    8  
ATOM   11133 H  HA   . MET A 1 72 ? 9.752   0.517   -5.490  1.00 0.00 ? 493 MET A HA   8  
ATOM   11134 H  HB2  . MET A 1 72 ? 9.259   -1.172  -3.638  1.00 0.00 ? 493 MET A HB2  8  
ATOM   11135 H  HB3  . MET A 1 72 ? 9.255   0.198   -2.535  1.00 0.00 ? 493 MET A HB3  8  
ATOM   11136 H  HG2  . MET A 1 72 ? 7.516   0.155   -4.971  1.00 0.00 ? 493 MET A HG2  8  
ATOM   11137 H  HG3  . MET A 1 72 ? 7.021   -0.622  -3.469  1.00 0.00 ? 493 MET A HG3  8  
ATOM   11138 H  HE1  . MET A 1 72 ? 6.630   2.233   -0.976  1.00 0.00 ? 493 MET A HE1  8  
ATOM   11139 H  HE2  . MET A 1 72 ? 5.752   0.801   -1.515  1.00 0.00 ? 493 MET A HE2  8  
ATOM   11140 H  HE3  . MET A 1 72 ? 7.481   0.701   -1.176  1.00 0.00 ? 493 MET A HE3  8  
ATOM   11141 N  N    . LEU A 1 73 ? 10.514  2.411   -2.885  1.00 0.00 ? 494 LEU A N    8  
ATOM   11142 C  CA   . LEU A 1 73 ? 10.588  3.792   -2.422  1.00 0.00 ? 494 LEU A CA   8  
ATOM   11143 C  C    . LEU A 1 73 ? 11.292  4.673   -3.448  1.00 0.00 ? 494 LEU A C    8  
ATOM   11144 O  O    . LEU A 1 73 ? 10.829  5.770   -3.762  1.00 0.00 ? 494 LEU A O    8  
ATOM   11145 C  CB   . LEU A 1 73 ? 11.324  3.863   -1.082  1.00 0.00 ? 494 LEU A CB   8  
ATOM   11146 C  CG   . LEU A 1 73 ? 10.524  3.428   0.146   1.00 0.00 ? 494 LEU A CG   8  
ATOM   11147 C  CD1  . LEU A 1 73 ? 9.384   4.398   0.412   1.00 0.00 ? 494 LEU A CD1  8  
ATOM   11148 C  CD2  . LEU A 1 73 ? 9.991   2.014   -0.038  1.00 0.00 ? 494 LEU A CD2  8  
ATOM   11149 H  H    . LEU A 1 73 ? 10.775  1.689   -2.276  1.00 0.00 ? 494 LEU A H    8  
ATOM   11150 H  HA   . LEU A 1 73 ? 9.579   4.151   -2.289  1.00 0.00 ? 494 LEU A HA   8  
ATOM   11151 H  HB2  . LEU A 1 73 ? 12.196  3.231   -1.150  1.00 0.00 ? 494 LEU A HB2  8  
ATOM   11152 H  HB3  . LEU A 1 73 ? 11.634  4.887   -0.930  1.00 0.00 ? 494 LEU A HB3  8  
ATOM   11153 H  HG   . LEU A 1 73 ? 11.174  3.432   1.011   1.00 0.00 ? 494 LEU A HG   8  
ATOM   11154 H  HD11 . LEU A 1 73 ? 9.232   5.022   -0.455  1.00 0.00 ? 494 LEU A HD11 8  
ATOM   11155 H  HD12 . LEU A 1 73 ? 9.630   5.018   1.262   1.00 0.00 ? 494 LEU A HD12 8  
ATOM   11156 H  HD13 . LEU A 1 73 ? 8.481   3.844   0.621   1.00 0.00 ? 494 LEU A HD13 8  
ATOM   11157 H  HD21 . LEU A 1 73 ? 10.815  1.341   -0.222  1.00 0.00 ? 494 LEU A HD21 8  
ATOM   11158 H  HD22 . LEU A 1 73 ? 9.313   1.991   -0.878  1.00 0.00 ? 494 LEU A HD22 8  
ATOM   11159 H  HD23 . LEU A 1 73 ? 9.468   1.708   0.856   1.00 0.00 ? 494 LEU A HD23 8  
ATOM   11160 N  N    . ALA A 1 74 ? 12.413  4.186   -3.970  1.00 0.00 ? 495 ALA A N    8  
ATOM   11161 C  CA   . ALA A 1 74 ? 13.179  4.927   -4.965  1.00 0.00 ? 495 ALA A CA   8  
ATOM   11162 C  C    . ALA A 1 74 ? 12.381  5.103   -6.252  1.00 0.00 ? 495 ALA A C    8  
ATOM   11163 O  O    . ALA A 1 74 ? 12.421  6.161   -6.880  1.00 0.00 ? 495 ALA A O    8  
ATOM   11164 C  CB   . ALA A 1 74 ? 14.496  4.222   -5.250  1.00 0.00 ? 495 ALA A CB   8  
ATOM   11165 H  H    . ALA A 1 74 ? 12.732  3.306   -3.680  1.00 0.00 ? 495 ALA A H    8  
ATOM   11166 H  HA   . ALA A 1 74 ? 13.402  5.902   -4.556  1.00 0.00 ? 495 ALA A HA   8  
ATOM   11167 H  HB1  . ALA A 1 74 ? 15.064  4.797   -5.967  1.00 0.00 ? 495 ALA A HB1  8  
ATOM   11168 H  HB2  . ALA A 1 74 ? 15.061  4.129   -4.334  1.00 0.00 ? 495 ALA A HB2  8  
ATOM   11169 H  HB3  . ALA A 1 74 ? 14.298  3.239   -5.652  1.00 0.00 ? 495 ALA A HB3  8  
ATOM   11170 N  N    . ASP A 1 75 ? 11.657  4.059   -6.641  1.00 0.00 ? 496 ASP A N    8  
ATOM   11171 C  CA   . ASP A 1 75 ? 10.849  4.098   -7.855  1.00 0.00 ? 496 ASP A CA   8  
ATOM   11172 C  C    . ASP A 1 75 ? 9.895   5.289   -7.834  1.00 0.00 ? 496 ASP A C    8  
ATOM   11173 O  O    . ASP A 1 75 ? 9.694   5.953   -8.851  1.00 0.00 ? 496 ASP A O    8  
ATOM   11174 C  CB   . ASP A 1 75 ? 10.058  2.798   -8.009  1.00 0.00 ? 496 ASP A CB   8  
ATOM   11175 C  CG   . ASP A 1 75 ? 9.112   2.832   -9.193  1.00 0.00 ? 496 ASP A CG   8  
ATOM   11176 O  OD1  . ASP A 1 75 ? 9.475   3.435   -10.225 1.00 0.00 ? 496 ASP A OD1  8  
ATOM   11177 O  OD2  . ASP A 1 75 ? 8.010   2.256   -9.088  1.00 0.00 ? 496 ASP A OD2  8  
ATOM   11178 H  H    . ASP A 1 75 ? 11.665  3.242   -6.099  1.00 0.00 ? 496 ASP A H    8  
ATOM   11179 H  HA   . ASP A 1 75 ? 11.518  4.204   -8.695  1.00 0.00 ? 496 ASP A HA   8  
ATOM   11180 H  HB2  . ASP A 1 75 ? 10.749  1.979   -8.147  1.00 0.00 ? 496 ASP A HB2  8  
ATOM   11181 H  HB3  . ASP A 1 75 ? 9.479   2.628   -7.113  1.00 0.00 ? 496 ASP A HB3  8  
ATOM   11182 N  N    . ASP A 1 76 ? 9.310   5.551   -6.671  1.00 0.00 ? 497 ASP A N    8  
ATOM   11183 C  CA   . ASP A 1 76 ? 8.376   6.661   -6.517  1.00 0.00 ? 497 ASP A CA   8  
ATOM   11184 C  C    . ASP A 1 76 ? 9.108   7.998   -6.584  1.00 0.00 ? 497 ASP A C    8  
ATOM   11185 O  O    . ASP A 1 76 ? 8.862   8.807   -7.478  1.00 0.00 ? 497 ASP A O    8  
ATOM   11186 C  CB   . ASP A 1 76 ? 7.623   6.543   -5.192  1.00 0.00 ? 497 ASP A CB   8  
ATOM   11187 C  CG   . ASP A 1 76 ? 6.949   7.840   -4.791  1.00 0.00 ? 497 ASP A CG   8  
ATOM   11188 O  OD1  . ASP A 1 76 ? 5.946   8.211   -5.435  1.00 0.00 ? 497 ASP A OD1  8  
ATOM   11189 O  OD2  . ASP A 1 76 ? 7.426   8.486   -3.834  1.00 0.00 ? 497 ASP A OD2  8  
ATOM   11190 H  H    . ASP A 1 76 ? 9.510   4.985   -5.896  1.00 0.00 ? 497 ASP A H    8  
ATOM   11191 H  HA   . ASP A 1 76 ? 7.667   6.612   -7.330  1.00 0.00 ? 497 ASP A HA   8  
ATOM   11192 H  HB2  . ASP A 1 76 ? 6.865   5.778   -5.283  1.00 0.00 ? 497 ASP A HB2  8  
ATOM   11193 H  HB3  . ASP A 1 76 ? 8.318   6.263   -4.414  1.00 0.00 ? 497 ASP A HB3  8  
ATOM   11194 N  N    . ALA A 1 77 ? 10.006  8.224   -5.631  1.00 0.00 ? 498 ALA A N    8  
ATOM   11195 C  CA   . ALA A 1 77 ? 10.773  9.462   -5.581  1.00 0.00 ? 498 ALA A CA   8  
ATOM   11196 C  C    . ALA A 1 77 ? 11.416  9.764   -6.931  1.00 0.00 ? 498 ALA A C    8  
ATOM   11197 O  O    . ALA A 1 77 ? 11.134  10.791  -7.547  1.00 0.00 ? 498 ALA A O    8  
ATOM   11198 C  CB   . ALA A 1 77 ? 11.834  9.383   -4.494  1.00 0.00 ? 498 ALA A CB   8  
ATOM   11199 H  H    . ALA A 1 77 ? 10.157  7.540   -4.945  1.00 0.00 ? 498 ALA A H    8  
ATOM   11200 H  HA   . ALA A 1 77 ? 10.095  10.265  -5.330  1.00 0.00 ? 498 ALA A HA   8  
ATOM   11201 H  HB1  . ALA A 1 77 ? 12.798  9.629   -4.915  1.00 0.00 ? 498 ALA A HB1  8  
ATOM   11202 H  HB2  . ALA A 1 77 ? 11.596  10.081  -3.706  1.00 0.00 ? 498 ALA A HB2  8  
ATOM   11203 H  HB3  . ALA A 1 77 ? 11.863  8.381   -4.092  1.00 0.00 ? 498 ALA A HB3  8  
ATOM   11204 N  N    . GLU A 1 78 ? 12.282  8.862   -7.383  1.00 0.00 ? 499 GLU A N    8  
ATOM   11205 C  CA   . GLU A 1 78 ? 12.966  9.034   -8.659  1.00 0.00 ? 499 GLU A CA   8  
ATOM   11206 C  C    . GLU A 1 78 ? 12.061  9.728   -9.672  1.00 0.00 ? 499 GLU A C    8  
ATOM   11207 O  O    . GLU A 1 78 ? 12.452  10.713  -10.297 1.00 0.00 ? 499 GLU A O    8  
ATOM   11208 C  CB   . GLU A 1 78 ? 13.419  7.679   -9.207  1.00 0.00 ? 499 GLU A CB   8  
ATOM   11209 C  CG   . GLU A 1 78 ? 14.349  7.786   -10.404 1.00 0.00 ? 499 GLU A CG   8  
ATOM   11210 C  CD   . GLU A 1 78 ? 15.523  8.711   -10.149 1.00 0.00 ? 499 GLU A CD   8  
ATOM   11211 O  OE1  . GLU A 1 78 ? 16.293  8.445   -9.203  1.00 0.00 ? 499 GLU A OE1  8  
ATOM   11212 O  OE2  . GLU A 1 78 ? 15.671  9.701   -10.896 1.00 0.00 ? 499 GLU A OE2  8  
ATOM   11213 H  H    . GLU A 1 78 ? 12.465  8.063   -6.845  1.00 0.00 ? 499 GLU A H    8  
ATOM   11214 H  HA   . GLU A 1 78 ? 13.835  9.651   -8.489  1.00 0.00 ? 499 GLU A HA   8  
ATOM   11215 H  HB2  . GLU A 1 78 ? 13.933  7.141   -8.424  1.00 0.00 ? 499 GLU A HB2  8  
ATOM   11216 H  HB3  . GLU A 1 78 ? 12.546  7.115   -9.505  1.00 0.00 ? 499 GLU A HB3  8  
ATOM   11217 H  HG2  . GLU A 1 78 ? 14.729  6.802   -10.637 1.00 0.00 ? 499 GLU A HG2  8  
ATOM   11218 H  HG3  . GLU A 1 78 ? 13.788  8.163   -11.246 1.00 0.00 ? 499 GLU A HG3  8  
ATOM   11219 N  N    . ALA A 1 79 ? 10.849  9.205   -9.830  1.00 0.00 ? 500 ALA A N    8  
ATOM   11220 C  CA   . ALA A 1 79 ? 9.888   9.775   -10.766 1.00 0.00 ? 500 ALA A CA   8  
ATOM   11221 C  C    . ALA A 1 79 ? 9.760   11.282  -10.573 1.00 0.00 ? 500 ALA A C    8  
ATOM   11222 O  O    . ALA A 1 79 ? 9.019   11.747  -9.708  1.00 0.00 ? 500 ALA A O    8  
ATOM   11223 C  CB   . ALA A 1 79 ? 8.532   9.103   -10.603 1.00 0.00 ? 500 ALA A CB   8  
ATOM   11224 H  H    . ALA A 1 79 ? 10.596  8.419   -9.303  1.00 0.00 ? 500 ALA A H    8  
ATOM   11225 H  HA   . ALA A 1 79 ? 10.241  9.578   -11.768 1.00 0.00 ? 500 ALA A HA   8  
ATOM   11226 H  HB1  . ALA A 1 79 ? 8.141   8.844   -11.576 1.00 0.00 ? 500 ALA A HB1  8  
ATOM   11227 H  HB2  . ALA A 1 79 ? 8.642   8.209   -10.008 1.00 0.00 ? 500 ALA A HB2  8  
ATOM   11228 H  HB3  . ALA A 1 79 ? 7.851   9.782   -10.111 1.00 0.00 ? 500 ALA A HB3  8  
ATOM   11229 N  N    . GLY A 1 80 ? 10.489  12.041  -11.385 1.00 0.00 ? 501 GLY A N    8  
ATOM   11230 C  CA   . GLY A 1 80 ? 10.444  13.489  -11.287 1.00 0.00 ? 501 GLY A CA   8  
ATOM   11231 C  C    . GLY A 1 80 ? 11.217  14.170  -12.399 1.00 0.00 ? 501 GLY A C    8  
ATOM   11232 O  O    . GLY A 1 80 ? 10.630  14.808  -13.272 1.00 0.00 ? 501 GLY A O    8  
ATOM   11233 H  H    . GLY A 1 80 ? 11.063  11.616  -12.056 1.00 0.00 ? 501 GLY A H    8  
ATOM   11234 H  HA2  . GLY A 1 80 ? 9.414   13.810  -11.330 1.00 0.00 ? 501 GLY A HA2  8  
ATOM   11235 H  HA3  . GLY A 1 80 ? 10.864  13.787  -10.337 1.00 0.00 ? 501 GLY A HA3  8  
ATOM   11236 N  N    . ALA A 1 81 ? 12.539  14.036  -12.366 1.00 0.00 ? 502 ALA A N    8  
ATOM   11237 C  CA   . ALA A 1 81 ? 13.393  14.643  -13.379 1.00 0.00 ? 502 ALA A CA   8  
ATOM   11238 C  C    . ALA A 1 81 ? 14.241  13.591  -14.085 1.00 0.00 ? 502 ALA A C    8  
ATOM   11239 O  O    . ALA A 1 81 ? 14.825  12.719  -13.444 1.00 0.00 ? 502 ALA A O    8  
ATOM   11240 C  CB   . ALA A 1 81 ? 14.284  15.705  -12.750 1.00 0.00 ? 502 ALA A CB   8  
ATOM   11241 H  H    . ALA A 1 81 ? 12.949  13.515  -11.644 1.00 0.00 ? 502 ALA A H    8  
ATOM   11242 H  HA   . ALA A 1 81 ? 12.757  15.127  -14.106 1.00 0.00 ? 502 ALA A HA   8  
ATOM   11243 H  HB1  . ALA A 1 81 ? 13.708  16.283  -12.042 1.00 0.00 ? 502 ALA A HB1  8  
ATOM   11244 H  HB2  . ALA A 1 81 ? 15.108  15.229  -12.241 1.00 0.00 ? 502 ALA A HB2  8  
ATOM   11245 H  HB3  . ALA A 1 81 ? 14.665  16.357  -13.522 1.00 0.00 ? 502 ALA A HB3  8  
ATOM   11246 N  N    . GLU A 1 82 ? 14.302  13.679  -15.411 1.00 0.00 ? 503 GLU A N    8  
ATOM   11247 C  CA   . GLU A 1 82 ? 15.077  12.732  -16.203 1.00 0.00 ? 503 GLU A CA   8  
ATOM   11248 C  C    . GLU A 1 82 ? 16.573  12.939  -15.989 1.00 0.00 ? 503 GLU A C    8  
ATOM   11249 O  O    . GLU A 1 82 ? 17.243  13.584  -16.796 1.00 0.00 ? 503 GLU A O    8  
ATOM   11250 C  CB   . GLU A 1 82 ? 14.738  12.878  -17.688 1.00 0.00 ? 503 GLU A CB   8  
ATOM   11251 C  CG   . GLU A 1 82 ? 15.333  11.784  -18.559 1.00 0.00 ? 503 GLU A CG   8  
ATOM   11252 C  CD   . GLU A 1 82 ? 14.594  10.466  -18.426 1.00 0.00 ? 503 GLU A CD   8  
ATOM   11253 O  OE1  . GLU A 1 82 ? 13.575  10.283  -19.123 1.00 0.00 ? 503 GLU A OE1  8  
ATOM   11254 O  OE2  . GLU A 1 82 ? 15.037  9.618   -17.623 1.00 0.00 ? 503 GLU A OE2  8  
ATOM   11255 H  H    . GLU A 1 82 ? 13.814  14.397  -15.865 1.00 0.00 ? 503 GLU A H    8  
ATOM   11256 H  HA   . GLU A 1 82 ? 14.814  11.736  -15.880 1.00 0.00 ? 503 GLU A HA   8  
ATOM   11257 H  HB2  . GLU A 1 82 ? 13.664  12.858  -17.804 1.00 0.00 ? 503 GLU A HB2  8  
ATOM   11258 H  HB3  . GLU A 1 82 ? 15.111  13.830  -18.038 1.00 0.00 ? 503 GLU A HB3  8  
ATOM   11259 H  HG2  . GLU A 1 82 ? 15.290  12.100  -19.591 1.00 0.00 ? 503 GLU A HG2  8  
ATOM   11260 H  HG3  . GLU A 1 82 ? 16.363  11.634  -18.272 1.00 0.00 ? 503 GLU A HG3  8  
ATOM   11261 N  N    . ASP A 1 83 ? 17.090  12.389  -14.896 1.00 0.00 ? 504 ASP A N    8  
ATOM   11262 C  CA   . ASP A 1 83 ? 18.507  12.513  -14.575 1.00 0.00 ? 504 ASP A CA   8  
ATOM   11263 C  C    . ASP A 1 83 ? 19.219  11.172  -14.730 1.00 0.00 ? 504 ASP A C    8  
ATOM   11264 O  O    . ASP A 1 83 ? 18.944  10.224  -13.995 1.00 0.00 ? 504 ASP A O    8  
ATOM   11265 C  CB   . ASP A 1 83 ? 18.685  13.036  -13.149 1.00 0.00 ? 504 ASP A CB   8  
ATOM   11266 C  CG   . ASP A 1 83 ? 20.088  13.549  -12.891 1.00 0.00 ? 504 ASP A CG   8  
ATOM   11267 O  OD1  . ASP A 1 83 ? 20.739  14.006  -13.854 1.00 0.00 ? 504 ASP A OD1  8  
ATOM   11268 O  OD2  . ASP A 1 83 ? 20.535  13.494  -11.727 1.00 0.00 ? 504 ASP A OD2  8  
ATOM   11269 H  H    . ASP A 1 83 ? 16.505  11.886  -14.291 1.00 0.00 ? 504 ASP A H    8  
ATOM   11270 H  HA   . ASP A 1 83 ? 18.943  13.219  -15.265 1.00 0.00 ? 504 ASP A HA   8  
ATOM   11271 H  HB2  . ASP A 1 83 ? 17.989  13.846  -12.980 1.00 0.00 ? 504 ASP A HB2  8  
ATOM   11272 H  HB3  . ASP A 1 83 ? 18.478  12.238  -12.451 1.00 0.00 ? 504 ASP A HB3  8  
ATOM   11273 N  N    . GLU A 1 84 ? 20.134  11.101  -15.692 1.00 0.00 ? 505 GLU A N    8  
ATOM   11274 C  CA   . GLU A 1 84 ? 20.882  9.875   -15.944 1.00 0.00 ? 505 GLU A CA   8  
ATOM   11275 C  C    . GLU A 1 84 ? 22.361  10.065  -15.620 1.00 0.00 ? 505 GLU A C    8  
ATOM   11276 O  O    . GLU A 1 84 ? 23.103  10.681  -16.386 1.00 0.00 ? 505 GLU A O    8  
ATOM   11277 C  CB   . GLU A 1 84 ? 20.720  9.443   -17.403 1.00 0.00 ? 505 GLU A CB   8  
ATOM   11278 C  CG   . GLU A 1 84 ? 19.275  9.221   -17.815 1.00 0.00 ? 505 GLU A CG   8  
ATOM   11279 C  CD   . GLU A 1 84 ? 18.655  8.012   -17.142 1.00 0.00 ? 505 GLU A CD   8  
ATOM   11280 O  OE1  . GLU A 1 84 ? 19.298  6.941   -17.140 1.00 0.00 ? 505 GLU A OE1  8  
ATOM   11281 O  OE2  . GLU A 1 84 ? 17.529  8.136   -16.617 1.00 0.00 ? 505 GLU A OE2  8  
ATOM   11282 H  H    . GLU A 1 84 ? 20.308