data_2CR9
# 
_entry.id   2CR9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CR9         
RCSB  RCSB024536   
WWPDB D_1000024536 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001003531.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CR9 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagashima, T.'                                          1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of WGR domain of poly(ADP-ribose) polymerase-1' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nagashima, T.' 1 
primary 'Hayashi, F.'   2 
primary 'Yokoyama, S.'  3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Poly [ADP-ribose] polymerase-1' 
_entity.formula_weight             15442.455 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.4.2.30 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'WGR domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PARP-1, ADPRT, NAD+, ADP-ribosyltransferase-1, Poly[ADP-ribose] synthetase-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWG
RVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEISGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWG
RVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEISGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001003531.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   LYS n 
1 9   SER n 
1 10  GLU n 
1 11  LYS n 
1 12  ARG n 
1 13  MET n 
1 14  LYS n 
1 15  LEU n 
1 16  THR n 
1 17  LEU n 
1 18  LYS n 
1 19  GLY n 
1 20  GLY n 
1 21  ALA n 
1 22  ALA n 
1 23  VAL n 
1 24  ASP n 
1 25  PRO n 
1 26  ASP n 
1 27  SER n 
1 28  GLY n 
1 29  LEU n 
1 30  GLU n 
1 31  HIS n 
1 32  SER n 
1 33  ALA n 
1 34  HIS n 
1 35  VAL n 
1 36  LEU n 
1 37  GLU n 
1 38  LYS n 
1 39  GLY n 
1 40  GLY n 
1 41  LYS n 
1 42  VAL n 
1 43  PHE n 
1 44  SER n 
1 45  ALA n 
1 46  THR n 
1 47  LEU n 
1 48  GLY n 
1 49  LEU n 
1 50  VAL n 
1 51  ASP n 
1 52  ILE n 
1 53  VAL n 
1 54  LYS n 
1 55  GLY n 
1 56  THR n 
1 57  ASN n 
1 58  SER n 
1 59  TYR n 
1 60  TYR n 
1 61  LYS n 
1 62  LEU n 
1 63  GLN n 
1 64  LEU n 
1 65  LEU n 
1 66  GLU n 
1 67  ASP n 
1 68  ASP n 
1 69  LYS n 
1 70  GLU n 
1 71  ASN n 
1 72  ARG n 
1 73  TYR n 
1 74  TRP n 
1 75  ILE n 
1 76  PHE n 
1 77  ARG n 
1 78  SER n 
1 79  TRP n 
1 80  GLY n 
1 81  ARG n 
1 82  VAL n 
1 83  GLY n 
1 84  THR n 
1 85  VAL n 
1 86  ILE n 
1 87  GLY n 
1 88  SER n 
1 89  ASN n 
1 90  LYS n 
1 91  LEU n 
1 92  GLU n 
1 93  GLN n 
1 94  MET n 
1 95  PRO n 
1 96  SER n 
1 97  LYS n 
1 98  GLU n 
1 99  ASP n 
1 100 ALA n 
1 101 ILE n 
1 102 GLU n 
1 103 HIS n 
1 104 PHE n 
1 105 MET n 
1 106 LYS n 
1 107 LEU n 
1 108 TYR n 
1 109 GLU n 
1 110 GLU n 
1 111 LYS n 
1 112 THR n 
1 113 GLY n 
1 114 ASN n 
1 115 ALA n 
1 116 TRP n 
1 117 HIS n 
1 118 SER n 
1 119 LYS n 
1 120 ASN n 
1 121 PHE n 
1 122 THR n 
1 123 LYS n 
1 124 TYR n 
1 125 PRO n 
1 126 LYS n 
1 127 LYS n 
1 128 PHE n 
1 129 TYR n 
1 130 PRO n 
1 131 LEU n 
1 132 GLU n 
1 133 ILE n 
1 134 SER n 
1 135 GLY n 
1 136 PRO n 
1 137 SER n 
1 138 SER n 
1 139 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PARP1, ADPRT, PPOL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040517-11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARP1_HUMAN 
_struct_ref.pdbx_db_accession          P09874 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIG
SNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEI
;
_struct_ref.pdbx_align_begin           517 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CR9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 133 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P09874 
_struct_ref_seq.db_align_beg                  517 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  642 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       133 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CR9 GLY A 1   ? UNP P09874 ? ? 'CLONING ARTIFACT' 1   1  
1 2CR9 SER A 2   ? UNP P09874 ? ? 'CLONING ARTIFACT' 2   2  
1 2CR9 SER A 3   ? UNP P09874 ? ? 'CLONING ARTIFACT' 3   3  
1 2CR9 GLY A 4   ? UNP P09874 ? ? 'CLONING ARTIFACT' 4   4  
1 2CR9 SER A 5   ? UNP P09874 ? ? 'CLONING ARTIFACT' 5   5  
1 2CR9 SER A 6   ? UNP P09874 ? ? 'CLONING ARTIFACT' 6   6  
1 2CR9 GLY A 7   ? UNP P09874 ? ? 'CLONING ARTIFACT' 7   7  
1 2CR9 SER A 134 ? UNP P09874 ? ? 'CLONING ARTIFACT' 134 8  
1 2CR9 GLY A 135 ? UNP P09874 ? ? 'CLONING ARTIFACT' 135 9  
1 2CR9 PRO A 136 ? UNP P09874 ? ? 'CLONING ARTIFACT' 136 10 
1 2CR9 SER A 137 ? UNP P09874 ? ? 'CLONING ARTIFACT' 137 11 
1 2CR9 SER A 138 ? UNP P09874 ? ? 'CLONING ARTIFACT' 138 12 
1 2CR9 GLY A 139 ? UNP P09874 ? ? 'CLONING ARTIFACT' 139 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.15mM WGR domain U-13C,15N; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 900 ? 
2 INOVA Varian 800 ? 
# 
_pdbx_nmr_refine.entry_id           2CR9 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2CR9 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CR9 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.901    'Kobayashi, N.' 4 
'structure solution' CYANA   1.0.7    'Guntert, P.'   5 
refinement           CYANA   1.0.7    'Guntert, P.'   6 
# 
_exptl.entry_id          2CR9 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CR9 
_struct.title                     'Solution structure of WGR domain of poly(ADP-ribose) polymerase-1' 
_struct.pdbx_descriptor           'Poly [ADP-ribose] polymerase-1 (E.C.2.4.2.30)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CR9 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;parp, DNA repair, necrosis, apoptosis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        96 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        112 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         96 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         112 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 33  ? VAL A 35  ? ALA A 33  VAL A 35  
A 2 ASN A 57  ? ASP A 67  ? ASN A 57  ASP A 67  
A 3 ARG A 72  ? TRP A 79  ? ARG A 72  TRP A 79  
A 4 SER A 88  ? MET A 94  ? SER A 88  MET A 94  
B 1 ALA A 33  ? VAL A 35  ? ALA A 33  VAL A 35  
B 2 ASN A 57  ? ASP A 67  ? ASN A 57  ASP A 67  
B 3 SER A 44  ? VAL A 50  ? SER A 44  VAL A 50  
B 4 TYR A 129 ? PRO A 130 ? TYR A 129 PRO A 130 
C 1 GLU A 37  ? LYS A 38  ? GLU A 37  LYS A 38  
C 2 LYS A 41  ? VAL A 42  ? LYS A 41  VAL A 42  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 34 ? N HIS A 34 O GLU A 66  ? O GLU A 66  
A 2 3 N ASP A 67 ? N ASP A 67 O ARG A 72  ? O ARG A 72  
A 3 4 N TYR A 73 ? N TYR A 73 O MET A 94  ? O MET A 94  
B 1 2 N HIS A 34 ? N HIS A 34 O GLU A 66  ? O GLU A 66  
B 2 3 O SER A 58 ? O SER A 58 N LEU A 49  ? N LEU A 49  
B 3 4 N GLY A 48 ? N GLY A 48 O TYR A 129 ? O TYR A 129 
C 1 2 N LYS A 38 ? N LYS A 38 O LYS A 41  ? O LYS A 41  
# 
_database_PDB_matrix.entry_id          2CR9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CR9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 21.769  -0.993  46.192  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 22.523  -0.964  44.951  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 22.080  0.204   44.067  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 21.031  0.802   44.302  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 21.272  -0.152  46.405  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 23.587  -0.876  45.169  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 22.384  -1.903  44.415  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 22.902  0.495   43.070  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 22.609  1.581   42.151  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 23.740  1.724   41.130  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 24.885  1.376   41.415  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 22.403  2.898   42.902  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 21.022  3.219   43.048  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 23.754  0.004   42.886  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 21.680  1.297   41.655  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 22.865  2.830   43.886  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 22.907  3.703   42.367  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 20.917  4.192   43.254  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 23.379  2.235   39.962  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 24.350  2.428   38.898  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 23.693  3.138   37.713  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 22.474  3.298   37.679  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 24.949  1.093   38.451  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 26.164  1.269   37.727  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 22.446  2.516   39.739  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 25.133  3.050   39.331  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 25.136  0.469   39.325  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 24.229  0.563   37.828  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 26.587  2.140   37.975  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 24.530  3.545   36.770  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 24.046  4.235   35.586  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 25.193  4.540   34.622  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 26.361  4.490   35.005  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 25.520  3.411   36.806  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 23.298  3.621   35.084  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 23.554  5.163   35.878  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 24.821  4.851   33.389  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 25.805  5.164   32.367  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 25.101  5.567   31.069  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 23.893  5.382   30.931  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 26.739  3.978   32.118  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 28.020  4.395   31.656  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 23.869  4.889   33.085  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 26.379  6.001   32.765  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 26.853  3.408   33.040  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 26.288  3.310   31.384  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 28.117  5.385   31.763  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 25.887  6.110   30.151  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 25.354  6.540   28.869  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 26.499  6.916   27.926  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 27.654  6.984   28.343  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 24.396  7.721   29.039  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 23.080  7.409   28.592  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 26.869  6.257   30.271  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 24.806  5.681   28.482  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 24.363  8.013   30.089  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 24.775  8.578   28.482  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 22.453  7.379   29.370  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 26.138  7.151   26.673  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 27.120  7.519   25.668  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 26.440  7.941   24.364  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 25.253  7.682   24.168  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 25.196  7.093   26.343  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 27.739  8.335   26.040  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 27.785  6.676   25.479  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . LYS A 1 8   ? 27.220  8.583   23.508  1.00 0.00 ? 8   LYS A N    1  
ATOM 67    C CA   . LYS A 1 8   ? 26.707  9.043   22.229  1.00 0.00 ? 8   LYS A CA   1  
ATOM 68    C C    . LYS A 1 8   ? 27.876  9.282   21.271  1.00 0.00 ? 8   LYS A C    1  
ATOM 69    O O    . LYS A 1 8   ? 28.677  10.193  21.478  1.00 0.00 ? 8   LYS A O    1  
ATOM 70    C CB   . LYS A 1 8   ? 25.810  10.268  22.420  1.00 0.00 ? 8   LYS A CB   1  
ATOM 71    C CG   . LYS A 1 8   ? 24.661  10.269  21.410  1.00 0.00 ? 8   LYS A CG   1  
ATOM 72    C CD   . LYS A 1 8   ? 23.356  10.730  22.063  1.00 0.00 ? 8   LYS A CD   1  
ATOM 73    C CE   . LYS A 1 8   ? 22.178  9.872   21.599  1.00 0.00 ? 8   LYS A CE   1  
ATOM 74    N NZ   . LYS A 1 8   ? 21.006  10.081  22.479  1.00 0.00 ? 8   LYS A NZ   1  
ATOM 75    H H    . LYS A 1 8   ? 28.184  8.789   23.675  1.00 0.00 ? 8   LYS A H    1  
ATOM 76    H HA   . LYS A 1 8   ? 26.084  8.248   21.821  1.00 0.00 ? 8   LYS A HA   1  
ATOM 77    H HB2  . LYS A 1 8   ? 25.407  10.274  23.433  1.00 0.00 ? 8   LYS A HB2  1  
ATOM 78    H HB3  . LYS A 1 8   ? 26.400  11.177  22.307  1.00 0.00 ? 8   LYS A HB3  1  
ATOM 79    H HG2  . LYS A 1 8   ? 24.906  10.927  20.576  1.00 0.00 ? 8   LYS A HG2  1  
ATOM 80    H HG3  . LYS A 1 8   ? 24.532  9.268   20.999  1.00 0.00 ? 8   LYS A HG3  1  
ATOM 81    H HD2  . LYS A 1 8   ? 23.448  10.672  23.148  1.00 0.00 ? 8   LYS A HD2  1  
ATOM 82    H HD3  . LYS A 1 8   ? 23.170  11.775  21.815  1.00 0.00 ? 8   LYS A HD3  1  
ATOM 83    H HE2  . LYS A 1 8   ? 21.918  10.126  20.572  1.00 0.00 ? 8   LYS A HE2  1  
ATOM 84    H HE3  . LYS A 1 8   ? 22.462  8.820   21.606  1.00 0.00 ? 8   LYS A HE3  1  
ATOM 85    H HZ1  . LYS A 1 8   ? 21.069  9.469   23.268  1.00 0.00 ? 8   LYS A HZ1  1  
ATOM 86    H HZ2  . LYS A 1 8   ? 20.991  11.030  22.794  1.00 0.00 ? 8   LYS A HZ2  1  
ATOM 87    H HZ3  . LYS A 1 8   ? 20.168  9.884   21.971  1.00 0.00 ? 8   LYS A HZ3  1  
ATOM 88    N N    . SER A 1 9   ? 27.938  8.448   20.244  1.00 0.00 ? 9   SER A N    1  
ATOM 89    C CA   . SER A 1 9   ? 28.996  8.557   19.254  1.00 0.00 ? 9   SER A CA   1  
ATOM 90    C C    . SER A 1 9   ? 28.697  7.641   18.065  1.00 0.00 ? 9   SER A C    1  
ATOM 91    O O    . SER A 1 9   ? 28.509  6.437   18.237  1.00 0.00 ? 9   SER A O    1  
ATOM 92    C CB   . SER A 1 9   ? 30.357  8.210   19.862  1.00 0.00 ? 9   SER A CB   1  
ATOM 93    O OG   . SER A 1 9   ? 30.493  6.813   20.104  1.00 0.00 ? 9   SER A OG   1  
ATOM 94    H H    . SER A 1 9   ? 27.283  7.710   20.083  1.00 0.00 ? 9   SER A H    1  
ATOM 95    H HA   . SER A 1 9   ? 28.993  9.601   18.942  1.00 0.00 ? 9   SER A HA   1  
ATOM 96    H HB2  . SER A 1 9   ? 31.149  8.540   19.189  1.00 0.00 ? 9   SER A HB2  1  
ATOM 97    H HB3  . SER A 1 9   ? 30.485  8.755   20.797  1.00 0.00 ? 9   SER A HB3  1  
ATOM 98    H HG   . SER A 1 9   ? 30.530  6.317   19.237  1.00 0.00 ? 9   SER A HG   1  
ATOM 99    N N    . GLU A 1 10  ? 28.663  8.245   16.887  1.00 0.00 ? 10  GLU A N    1  
ATOM 100   C CA   . GLU A 1 10  ? 28.390  7.499   15.671  1.00 0.00 ? 10  GLU A CA   1  
ATOM 101   C C    . GLU A 1 10  ? 28.912  8.262   14.451  1.00 0.00 ? 10  GLU A C    1  
ATOM 102   O O    . GLU A 1 10  ? 29.125  9.472   14.516  1.00 0.00 ? 10  GLU A O    1  
ATOM 103   C CB   . GLU A 1 10  ? 26.896  7.202   15.533  1.00 0.00 ? 10  GLU A CB   1  
ATOM 104   C CG   . GLU A 1 10  ? 26.660  5.741   15.145  1.00 0.00 ? 10  GLU A CG   1  
ATOM 105   C CD   . GLU A 1 10  ? 25.403  5.598   14.284  1.00 0.00 ? 10  GLU A CD   1  
ATOM 106   O OE1  . GLU A 1 10  ? 24.374  6.187   14.680  1.00 0.00 ? 10  GLU A OE1  1  
ATOM 107   O OE2  . GLU A 1 10  ? 25.499  4.903   13.250  1.00 0.00 ? 10  GLU A OE2  1  
ATOM 108   H H    . GLU A 1 10  ? 28.817  9.225   16.757  1.00 0.00 ? 10  GLU A H    1  
ATOM 109   H HA   . GLU A 1 10  ? 28.932  6.560   15.779  1.00 0.00 ? 10  GLU A HA   1  
ATOM 110   H HB2  . GLU A 1 10  ? 26.390  7.418   16.474  1.00 0.00 ? 10  GLU A HB2  1  
ATOM 111   H HB3  . GLU A 1 10  ? 26.459  7.858   14.779  1.00 0.00 ? 10  GLU A HB3  1  
ATOM 112   H HG2  . GLU A 1 10  ? 27.524  5.363   14.598  1.00 0.00 ? 10  GLU A HG2  1  
ATOM 113   H HG3  . GLU A 1 10  ? 26.561  5.134   16.044  1.00 0.00 ? 10  GLU A HG3  1  
ATOM 114   N N    . LYS A 1 11  ? 29.103  7.524   13.368  1.00 0.00 ? 11  LYS A N    1  
ATOM 115   C CA   . LYS A 1 11  ? 29.596  8.116   12.136  1.00 0.00 ? 11  LYS A CA   1  
ATOM 116   C C    . LYS A 1 11  ? 28.597  7.845   11.010  1.00 0.00 ? 11  LYS A C    1  
ATOM 117   O O    . LYS A 1 11  ? 28.497  6.720   10.521  1.00 0.00 ? 11  LYS A O    1  
ATOM 118   C CB   . LYS A 1 11  ? 31.012  7.622   11.834  1.00 0.00 ? 11  LYS A CB   1  
ATOM 119   C CG   . LYS A 1 11  ? 32.050  8.698   12.163  1.00 0.00 ? 11  LYS A CG   1  
ATOM 120   C CD   . LYS A 1 11  ? 32.664  9.277   10.887  1.00 0.00 ? 11  LYS A CD   1  
ATOM 121   C CE   . LYS A 1 11  ? 34.147  9.593   11.087  1.00 0.00 ? 11  LYS A CE   1  
ATOM 122   N NZ   . LYS A 1 11  ? 34.989  8.553   10.454  1.00 0.00 ? 11  LYS A NZ   1  
ATOM 123   H H    . LYS A 1 11  ? 28.927  6.540   13.324  1.00 0.00 ? 11  LYS A H    1  
ATOM 124   H HA   . LYS A 1 11  ? 29.657  9.193   12.293  1.00 0.00 ? 11  LYS A HA   1  
ATOM 125   H HB2  . LYS A 1 11  ? 31.220  6.722   12.413  1.00 0.00 ? 11  LYS A HB2  1  
ATOM 126   H HB3  . LYS A 1 11  ? 31.089  7.348   10.782  1.00 0.00 ? 11  LYS A HB3  1  
ATOM 127   H HG2  . LYS A 1 11  ? 31.581  9.495   12.740  1.00 0.00 ? 11  LYS A HG2  1  
ATOM 128   H HG3  . LYS A 1 11  ? 32.835  8.271   12.788  1.00 0.00 ? 11  LYS A HG3  1  
ATOM 129   H HD2  . LYS A 1 11  ? 32.547  8.567   10.068  1.00 0.00 ? 11  LYS A HD2  1  
ATOM 130   H HD3  . LYS A 1 11  ? 32.130  10.183  10.602  1.00 0.00 ? 11  LYS A HD3  1  
ATOM 131   H HE2  . LYS A 1 11  ? 34.378  10.568  10.658  1.00 0.00 ? 11  LYS A HE2  1  
ATOM 132   H HE3  . LYS A 1 11  ? 34.372  9.652   12.152  1.00 0.00 ? 11  LYS A HE3  1  
ATOM 133   H HZ1  . LYS A 1 11  ? 34.424  7.987   9.853   1.00 0.00 ? 11  LYS A HZ1  1  
ATOM 134   H HZ2  . LYS A 1 11  ? 35.711  8.990   9.917   1.00 0.00 ? 11  LYS A HZ2  1  
ATOM 135   H HZ3  . LYS A 1 11  ? 35.400  7.980   11.162  1.00 0.00 ? 11  LYS A HZ3  1  
ATOM 136   N N    . ARG A 1 12  ? 27.883  8.894   10.630  1.00 0.00 ? 12  ARG A N    1  
ATOM 137   C CA   . ARG A 1 12  ? 26.895  8.783   9.570   1.00 0.00 ? 12  ARG A CA   1  
ATOM 138   C C    . ARG A 1 12  ? 27.579  8.474   8.237   1.00 0.00 ? 12  ARG A C    1  
ATOM 139   O O    . ARG A 1 12  ? 28.205  9.348   7.639   1.00 0.00 ? 12  ARG A O    1  
ATOM 140   C CB   . ARG A 1 12  ? 26.087  10.075  9.433   1.00 0.00 ? 12  ARG A CB   1  
ATOM 141   C CG   . ARG A 1 12  ? 24.834  10.034  10.311  1.00 0.00 ? 12  ARG A CG   1  
ATOM 142   C CD   . ARG A 1 12  ? 25.096  10.686  11.671  1.00 0.00 ? 12  ARG A CD   1  
ATOM 143   N NE   . ARG A 1 12  ? 23.819  10.878  12.394  1.00 0.00 ? 12  ARG A NE   1  
ATOM 144   C CZ   . ARG A 1 12  ? 23.665  11.702  13.439  1.00 0.00 ? 12  ARG A CZ   1  
ATOM 145   N NH1  . ARG A 1 12  ? 24.706  12.415  13.890  1.00 0.00 ? 12  ARG A NH1  1  
ATOM 146   N NH2  . ARG A 1 12  ? 22.469  11.813  14.034  1.00 0.00 ? 12  ARG A NH2  1  
ATOM 147   H H    . ARG A 1 12  ? 27.970  9.805   11.033  1.00 0.00 ? 12  ARG A H    1  
ATOM 148   H HA   . ARG A 1 12  ? 26.247  7.963   9.878   1.00 0.00 ? 12  ARG A HA   1  
ATOM 149   H HB2  . ARG A 1 12  ? 26.705  10.927  9.716   1.00 0.00 ? 12  ARG A HB2  1  
ATOM 150   H HB3  . ARG A 1 12  ? 25.800  10.221  8.392   1.00 0.00 ? 12  ARG A HB3  1  
ATOM 151   H HG2  . ARG A 1 12  ? 24.016  10.549  9.808   1.00 0.00 ? 12  ARG A HG2  1  
ATOM 152   H HG3  . ARG A 1 12  ? 24.520  9.000   10.454  1.00 0.00 ? 12  ARG A HG3  1  
ATOM 153   H HD2  . ARG A 1 12  ? 25.767  10.061  12.260  1.00 0.00 ? 12  ARG A HD2  1  
ATOM 154   H HD3  . ARG A 1 12  ? 25.594  11.646  11.533  1.00 0.00 ? 12  ARG A HD3  1  
ATOM 155   H HE   . ARG A 1 12  ? 23.022  10.361  12.083  1.00 0.00 ? 12  ARG A HE   1  
ATOM 156   H HH11 . ARG A 1 12  ? 25.598  12.332  13.447  1.00 0.00 ? 12  ARG A HH11 1  
ATOM 157   H HH12 . ARG A 1 12  ? 24.591  13.029  14.671  1.00 0.00 ? 12  ARG A HH12 1  
ATOM 158   H HH21 . ARG A 1 12  ? 21.692  11.281  13.697  1.00 0.00 ? 12  ARG A HH21 1  
ATOM 159   H HH22 . ARG A 1 12  ? 22.354  12.428  14.814  1.00 0.00 ? 12  ARG A HH22 1  
ATOM 160   N N    . MET A 1 13  ? 27.436  7.228   7.810   1.00 0.00 ? 13  MET A N    1  
ATOM 161   C CA   . MET A 1 13  ? 28.033  6.793   6.559   1.00 0.00 ? 13  MET A CA   1  
ATOM 162   C C    . MET A 1 13  ? 26.991  6.128   5.657   1.00 0.00 ? 13  MET A C    1  
ATOM 163   O O    . MET A 1 13  ? 26.859  4.905   5.651   1.00 0.00 ? 13  MET A O    1  
ATOM 164   C CB   . MET A 1 13  ? 29.163  5.803   6.849   1.00 0.00 ? 13  MET A CB   1  
ATOM 165   C CG   . MET A 1 13  ? 30.451  6.538   7.229   1.00 0.00 ? 13  MET A CG   1  
ATOM 166   S SD   . MET A 1 13  ? 31.580  6.544   5.847   1.00 0.00 ? 13  MET A SD   1  
ATOM 167   C CE   . MET A 1 13  ? 32.573  7.967   6.264   1.00 0.00 ? 13  MET A CE   1  
ATOM 168   H H    . MET A 1 13  ? 26.925  6.523   8.302   1.00 0.00 ? 13  MET A H    1  
ATOM 169   H HA   . MET A 1 13  ? 28.410  7.699   6.084   1.00 0.00 ? 13  MET A HA   1  
ATOM 170   H HB2  . MET A 1 13  ? 28.868  5.136   7.658   1.00 0.00 ? 13  MET A HB2  1  
ATOM 171   H HB3  . MET A 1 13  ? 29.341  5.181   5.971   1.00 0.00 ? 13  MET A HB3  1  
ATOM 172   H HG2  . MET A 1 13  ? 30.221  7.561   7.526   1.00 0.00 ? 13  MET A HG2  1  
ATOM 173   H HG3  . MET A 1 13  ? 30.916  6.053   8.087   1.00 0.00 ? 13  MET A HG3  1  
ATOM 174   H HE1  . MET A 1 13  ? 33.530  7.637   6.668   1.00 0.00 ? 13  MET A HE1  1  
ATOM 175   H HE2  . MET A 1 13  ? 32.743  8.567   5.370   1.00 0.00 ? 13  MET A HE2  1  
ATOM 176   H HE3  . MET A 1 13  ? 32.052  8.568   7.010   1.00 0.00 ? 13  MET A HE3  1  
ATOM 177   N N    . LYS A 1 14  ? 26.277  6.963   4.916   1.00 0.00 ? 14  LYS A N    1  
ATOM 178   C CA   . LYS A 1 14  ? 25.251  6.472   4.012   1.00 0.00 ? 14  LYS A CA   1  
ATOM 179   C C    . LYS A 1 14  ? 24.166  5.757   4.819   1.00 0.00 ? 14  LYS A C    1  
ATOM 180   O O    . LYS A 1 14  ? 24.157  4.530   4.902   1.00 0.00 ? 14  LYS A O    1  
ATOM 181   C CB   . LYS A 1 14  ? 25.874  5.605   2.915   1.00 0.00 ? 14  LYS A CB   1  
ATOM 182   C CG   . LYS A 1 14  ? 25.697  6.251   1.539   1.00 0.00 ? 14  LYS A CG   1  
ATOM 183   C CD   . LYS A 1 14  ? 26.929  6.019   0.662   1.00 0.00 ? 14  LYS A CD   1  
ATOM 184   C CE   . LYS A 1 14  ? 26.616  6.303   -0.808  1.00 0.00 ? 14  LYS A CE   1  
ATOM 185   N NZ   . LYS A 1 14  ? 27.796  6.014   -1.654  1.00 0.00 ? 14  LYS A NZ   1  
ATOM 186   H H    . LYS A 1 14  ? 26.391  7.957   4.926   1.00 0.00 ? 14  LYS A H    1  
ATOM 187   H HA   . LYS A 1 14  ? 24.805  7.338   3.523   1.00 0.00 ? 14  LYS A HA   1  
ATOM 188   H HB2  . LYS A 1 14  ? 26.935  5.460   3.119   1.00 0.00 ? 14  LYS A HB2  1  
ATOM 189   H HB3  . LYS A 1 14  ? 25.411  4.618   2.920   1.00 0.00 ? 14  LYS A HB3  1  
ATOM 190   H HG2  . LYS A 1 14  ? 24.815  5.837   1.051   1.00 0.00 ? 14  LYS A HG2  1  
ATOM 191   H HG3  . LYS A 1 14  ? 25.525  7.321   1.655   1.00 0.00 ? 14  LYS A HG3  1  
ATOM 192   H HD2  . LYS A 1 14  ? 27.743  6.661   0.996   1.00 0.00 ? 14  LYS A HD2  1  
ATOM 193   H HD3  . LYS A 1 14  ? 27.269  4.989   0.773   1.00 0.00 ? 14  LYS A HD3  1  
ATOM 194   H HE2  . LYS A 1 14  ? 25.772  5.694   -1.131  1.00 0.00 ? 14  LYS A HE2  1  
ATOM 195   H HE3  . LYS A 1 14  ? 26.322  7.346   -0.928  1.00 0.00 ? 14  LYS A HE3  1  
ATOM 196   H HZ1  . LYS A 1 14  ? 28.012  5.039   -1.603  1.00 0.00 ? 14  LYS A HZ1  1  
ATOM 197   H HZ2  . LYS A 1 14  ? 27.595  6.262   -2.602  1.00 0.00 ? 14  LYS A HZ2  1  
ATOM 198   H HZ3  . LYS A 1 14  ? 28.578  6.546   -1.329  1.00 0.00 ? 14  LYS A HZ3  1  
ATOM 199   N N    . LEU A 1 15  ? 23.279  6.555   5.394   1.00 0.00 ? 15  LEU A N    1  
ATOM 200   C CA   . LEU A 1 15  ? 22.192  6.014   6.192   1.00 0.00 ? 15  LEU A CA   1  
ATOM 201   C C    . LEU A 1 15  ? 21.065  7.045   6.277   1.00 0.00 ? 15  LEU A C    1  
ATOM 202   O O    . LEU A 1 15  ? 21.309  8.214   6.572   1.00 0.00 ? 15  LEU A O    1  
ATOM 203   C CB   . LEU A 1 15  ? 22.707  5.552   7.557   1.00 0.00 ? 15  LEU A CB   1  
ATOM 204   C CG   . LEU A 1 15  ? 22.436  4.090   7.916   1.00 0.00 ? 15  LEU A CG   1  
ATOM 205   C CD1  . LEU A 1 15  ? 23.292  3.650   9.106   1.00 0.00 ? 15  LEU A CD1  1  
ATOM 206   C CD2  . LEU A 1 15  ? 20.945  3.854   8.165   1.00 0.00 ? 15  LEU A CD2  1  
ATOM 207   H H    . LEU A 1 15  ? 23.294  7.552   5.322   1.00 0.00 ? 15  LEU A H    1  
ATOM 208   H HA   . LEU A 1 15  ? 21.814  5.132   5.675   1.00 0.00 ? 15  LEU A HA   1  
ATOM 209   H HB2  . LEU A 1 15  ? 23.784  5.721   7.592   1.00 0.00 ? 15  LEU A HB2  1  
ATOM 210   H HB3  . LEU A 1 15  ? 22.260  6.183   8.324   1.00 0.00 ? 15  LEU A HB3  1  
ATOM 211   H HG   . LEU A 1 15  ? 22.723  3.470   7.067   1.00 0.00 ? 15  LEU A HG   1  
ATOM 212   H HD11 . LEU A 1 15  ? 24.028  4.422   9.329   1.00 0.00 ? 15  LEU A HD11 1  
ATOM 213   H HD12 . LEU A 1 15  ? 22.653  3.494   9.975   1.00 0.00 ? 15  LEU A HD12 1  
ATOM 214   H HD13 . LEU A 1 15  ? 23.805  2.720   8.860   1.00 0.00 ? 15  LEU A HD13 1  
ATOM 215   H HD21 . LEU A 1 15  ? 20.680  2.843   7.852   1.00 0.00 ? 15  LEU A HD21 1  
ATOM 216   H HD22 . LEU A 1 15  ? 20.730  3.973   9.227   1.00 0.00 ? 15  LEU A HD22 1  
ATOM 217   H HD23 . LEU A 1 15  ? 20.363  4.576   7.592   1.00 0.00 ? 15  LEU A HD23 1  
ATOM 218   N N    . THR A 1 16  ? 19.854  6.575   6.014   1.00 0.00 ? 16  THR A N    1  
ATOM 219   C CA   . THR A 1 16  ? 18.689  7.441   6.058   1.00 0.00 ? 16  THR A CA   1  
ATOM 220   C C    . THR A 1 16  ? 17.678  6.925   7.084   1.00 0.00 ? 16  THR A C    1  
ATOM 221   O O    . THR A 1 16  ? 16.725  6.234   6.729   1.00 0.00 ? 16  THR A O    1  
ATOM 222   C CB   . THR A 1 16  ? 18.120  7.539   4.641   1.00 0.00 ? 16  THR A CB   1  
ATOM 223   O OG1  . THR A 1 16  ? 17.869  6.186   4.273   1.00 0.00 ? 16  THR A OG1  1  
ATOM 224   C CG2  . THR A 1 16  ? 19.159  8.016   3.624   1.00 0.00 ? 16  THR A CG2  1  
ATOM 225   H H    . THR A 1 16  ? 19.664  5.622   5.775   1.00 0.00 ? 16  THR A H    1  
ATOM 226   H HA   . THR A 1 16  ? 19.007  8.429   6.391   1.00 0.00 ? 16  THR A HA   1  
ATOM 227   H HB   . THR A 1 16  ? 17.235  8.175   4.620   1.00 0.00 ? 16  THR A HB   1  
ATOM 228   H HG1  . THR A 1 16  ? 17.518  6.145   3.337   1.00 0.00 ? 16  THR A HG1  1  
ATOM 229   H HG21 . THR A 1 16  ? 20.160  7.843   4.019   1.00 0.00 ? 16  THR A HG21 1  
ATOM 230   H HG22 . THR A 1 16  ? 19.035  7.464   2.692   1.00 0.00 ? 16  THR A HG22 1  
ATOM 231   H HG23 . THR A 1 16  ? 19.022  9.081   3.436   1.00 0.00 ? 16  THR A HG23 1  
ATOM 232   N N    . LEU A 1 17  ? 17.921  7.282   8.337   1.00 0.00 ? 17  LEU A N    1  
ATOM 233   C CA   . LEU A 1 17  ? 17.044  6.863   9.417   1.00 0.00 ? 17  LEU A CA   1  
ATOM 234   C C    . LEU A 1 17  ? 15.915  7.883   9.575   1.00 0.00 ? 17  LEU A C    1  
ATOM 235   O O    . LEU A 1 17  ? 16.129  8.977   10.097  1.00 0.00 ? 17  LEU A O    1  
ATOM 236   C CB   . LEU A 1 17  ? 17.847  6.631   10.699  1.00 0.00 ? 17  LEU A CB   1  
ATOM 237   C CG   . LEU A 1 17  ? 17.195  5.721   11.742  1.00 0.00 ? 17  LEU A CG   1  
ATOM 238   C CD1  . LEU A 1 17  ? 15.790  6.212   12.096  1.00 0.00 ? 17  LEU A CD1  1  
ATOM 239   C CD2  . LEU A 1 17  ? 17.193  4.264   11.275  1.00 0.00 ? 17  LEU A CD2  1  
ATOM 240   H H    . LEU A 1 17  ? 18.699  7.844   8.617   1.00 0.00 ? 17  LEU A H    1  
ATOM 241   H HA   . LEU A 1 17  ? 16.608  5.906   9.132   1.00 0.00 ? 17  LEU A HA   1  
ATOM 242   H HB2  . LEU A 1 17  ? 18.813  6.205   10.427  1.00 0.00 ? 17  LEU A HB2  1  
ATOM 243   H HB3  . LEU A 1 17  ? 18.044  7.598   11.161  1.00 0.00 ? 17  LEU A HB3  1  
ATOM 244   H HG   . LEU A 1 17  ? 17.791  5.766   12.654  1.00 0.00 ? 17  LEU A HG   1  
ATOM 245   H HD11 . LEU A 1 17  ? 15.823  7.279   12.318  1.00 0.00 ? 17  LEU A HD11 1  
ATOM 246   H HD12 . LEU A 1 17  ? 15.121  6.036   11.254  1.00 0.00 ? 17  LEU A HD12 1  
ATOM 247   H HD13 . LEU A 1 17  ? 15.425  5.670   12.969  1.00 0.00 ? 17  LEU A HD13 1  
ATOM 248   H HD21 . LEU A 1 17  ? 16.165  3.931   11.129  1.00 0.00 ? 17  LEU A HD21 1  
ATOM 249   H HD22 . LEU A 1 17  ? 17.738  4.183   10.335  1.00 0.00 ? 17  LEU A HD22 1  
ATOM 250   H HD23 . LEU A 1 17  ? 17.673  3.640   12.029  1.00 0.00 ? 17  LEU A HD23 1  
ATOM 251   N N    . LYS A 1 18  ? 14.736  7.489   9.116   1.00 0.00 ? 18  LYS A N    1  
ATOM 252   C CA   . LYS A 1 18  ? 13.573  8.355   9.200   1.00 0.00 ? 18  LYS A CA   1  
ATOM 253   C C    . LYS A 1 18  ? 12.327  7.571   8.782   1.00 0.00 ? 18  LYS A C    1  
ATOM 254   O O    . LYS A 1 18  ? 12.434  6.460   8.265   1.00 0.00 ? 18  LYS A O    1  
ATOM 255   C CB   . LYS A 1 18  ? 13.796  9.633   8.389   1.00 0.00 ? 18  LYS A CB   1  
ATOM 256   C CG   . LYS A 1 18  ? 12.918  10.773  8.908   1.00 0.00 ? 18  LYS A CG   1  
ATOM 257   C CD   . LYS A 1 18  ? 13.704  12.084  8.978   1.00 0.00 ? 18  LYS A CD   1  
ATOM 258   C CE   . LYS A 1 18  ? 13.114  13.128  8.029   1.00 0.00 ? 18  LYS A CE   1  
ATOM 259   N NZ   . LYS A 1 18  ? 14.171  14.044  7.545   1.00 0.00 ? 18  LYS A NZ   1  
ATOM 260   H H    . LYS A 1 18  ? 14.570  6.598   8.694   1.00 0.00 ? 18  LYS A H    1  
ATOM 261   H HA   . LYS A 1 18  ? 13.460  8.651   10.243  1.00 0.00 ? 18  LYS A HA   1  
ATOM 262   H HB2  . LYS A 1 18  ? 14.845  9.924   8.443   1.00 0.00 ? 18  LYS A HB2  1  
ATOM 263   H HB3  . LYS A 1 18  ? 13.572  9.446   7.339   1.00 0.00 ? 18  LYS A HB3  1  
ATOM 264   H HG2  . LYS A 1 18  ? 12.054  10.898  8.255   1.00 0.00 ? 18  LYS A HG2  1  
ATOM 265   H HG3  . LYS A 1 18  ? 12.536  10.521  9.897   1.00 0.00 ? 18  LYS A HG3  1  
ATOM 266   H HD2  . LYS A 1 18  ? 13.691  12.466  9.999   1.00 0.00 ? 18  LYS A HD2  1  
ATOM 267   H HD3  . LYS A 1 18  ? 14.747  11.900  8.720   1.00 0.00 ? 18  LYS A HD3  1  
ATOM 268   H HE2  . LYS A 1 18  ? 12.639  12.632  7.182   1.00 0.00 ? 18  LYS A HE2  1  
ATOM 269   H HE3  . LYS A 1 18  ? 12.339  13.697  8.541   1.00 0.00 ? 18  LYS A HE3  1  
ATOM 270   H HZ1  . LYS A 1 18  ? 13.906  14.419  6.656   1.00 0.00 ? 18  LYS A HZ1  1  
ATOM 271   H HZ2  . LYS A 1 18  ? 14.291  14.791  8.199   1.00 0.00 ? 18  LYS A HZ2  1  
ATOM 272   H HZ3  . LYS A 1 18  ? 15.031  13.542  7.451   1.00 0.00 ? 18  LYS A HZ3  1  
ATOM 273   N N    . GLY A 1 19  ? 11.175  8.181   9.020   1.00 0.00 ? 19  GLY A N    1  
ATOM 274   C CA   . GLY A 1 19  ? 9.911   7.554   8.675   1.00 0.00 ? 19  GLY A CA   1  
ATOM 275   C C    . GLY A 1 19  ? 8.922   8.582   8.123   1.00 0.00 ? 19  GLY A C    1  
ATOM 276   O O    . GLY A 1 19  ? 9.321   9.660   7.685   1.00 0.00 ? 19  GLY A O    1  
ATOM 277   H H    . GLY A 1 19  ? 11.098  9.085   9.441   1.00 0.00 ? 19  GLY A H    1  
ATOM 278   H HA2  . GLY A 1 19  ? 10.079  6.772   7.934   1.00 0.00 ? 19  GLY A HA2  1  
ATOM 279   H HA3  . GLY A 1 19  ? 9.487   7.072   9.556   1.00 0.00 ? 19  GLY A HA3  1  
ATOM 280   N N    . GLY A 1 20  ? 7.650   8.212   8.161   1.00 0.00 ? 20  GLY A N    1  
ATOM 281   C CA   . GLY A 1 20  ? 6.601   9.089   7.671   1.00 0.00 ? 20  GLY A CA   1  
ATOM 282   C C    . GLY A 1 20  ? 5.231   8.653   8.196   1.00 0.00 ? 20  GLY A C    1  
ATOM 283   O O    . GLY A 1 20  ? 4.767   9.153   9.220   1.00 0.00 ? 20  GLY A O    1  
ATOM 284   H H    . GLY A 1 20  ? 7.334   7.334   8.519   1.00 0.00 ? 20  GLY A H    1  
ATOM 285   H HA2  . GLY A 1 20  ? 6.803   10.114  7.981   1.00 0.00 ? 20  GLY A HA2  1  
ATOM 286   H HA3  . GLY A 1 20  ? 6.595   9.081   6.581   1.00 0.00 ? 20  GLY A HA3  1  
ATOM 287   N N    . ALA A 1 21  ? 4.623   7.726   7.471   1.00 0.00 ? 21  ALA A N    1  
ATOM 288   C CA   . ALA A 1 21  ? 3.316   7.217   7.851   1.00 0.00 ? 21  ALA A CA   1  
ATOM 289   C C    . ALA A 1 21  ? 3.490   6.083   8.864   1.00 0.00 ? 21  ALA A C    1  
ATOM 290   O O    . ALA A 1 21  ? 4.590   5.559   9.031   1.00 0.00 ? 21  ALA A O    1  
ATOM 291   C CB   . ALA A 1 21  ? 2.559   6.769   6.599   1.00 0.00 ? 21  ALA A CB   1  
ATOM 292   H H    . ALA A 1 21  ? 5.007   7.325   6.639   1.00 0.00 ? 21  ALA A H    1  
ATOM 293   H HA   . ALA A 1 21  ? 2.766   8.032   8.321   1.00 0.00 ? 21  ALA A HA   1  
ATOM 294   H HB1  . ALA A 1 21  ? 2.606   7.555   5.846   1.00 0.00 ? 21  ALA A HB1  1  
ATOM 295   H HB2  . ALA A 1 21  ? 3.013   5.860   6.205   1.00 0.00 ? 21  ALA A HB2  1  
ATOM 296   H HB3  . ALA A 1 21  ? 1.517   6.574   6.855   1.00 0.00 ? 21  ALA A HB3  1  
ATOM 297   N N    . ALA A 1 22  ? 2.388   5.738   9.512   1.00 0.00 ? 22  ALA A N    1  
ATOM 298   C CA   . ALA A 1 22  ? 2.404   4.676   10.504  1.00 0.00 ? 22  ALA A CA   1  
ATOM 299   C C    . ALA A 1 22  ? 2.105   3.340   9.820   1.00 0.00 ? 22  ALA A C    1  
ATOM 300   O O    . ALA A 1 22  ? 1.323   3.286   8.872   1.00 0.00 ? 22  ALA A O    1  
ATOM 301   C CB   . ALA A 1 22  ? 1.404   4.999   11.615  1.00 0.00 ? 22  ALA A CB   1  
ATOM 302   H H    . ALA A 1 22  ? 1.497   6.169   9.370   1.00 0.00 ? 22  ALA A H    1  
ATOM 303   H HA   . ALA A 1 22  ? 3.406   4.638   10.933  1.00 0.00 ? 22  ALA A HA   1  
ATOM 304   H HB1  . ALA A 1 22  ? 0.401   4.713   11.296  1.00 0.00 ? 22  ALA A HB1  1  
ATOM 305   H HB2  . ALA A 1 22  ? 1.670   4.446   12.516  1.00 0.00 ? 22  ALA A HB2  1  
ATOM 306   H HB3  . ALA A 1 22  ? 1.427   6.068   11.825  1.00 0.00 ? 22  ALA A HB3  1  
ATOM 307   N N    . VAL A 1 23  ? 2.743   2.296   10.327  1.00 0.00 ? 23  VAL A N    1  
ATOM 308   C CA   . VAL A 1 23  ? 2.555   0.964   9.777   1.00 0.00 ? 23  VAL A CA   1  
ATOM 309   C C    . VAL A 1 23  ? 1.513   0.216   10.611  1.00 0.00 ? 23  VAL A C    1  
ATOM 310   O O    . VAL A 1 23  ? 1.299   0.537   11.778  1.00 0.00 ? 23  VAL A O    1  
ATOM 311   C CB   . VAL A 1 23  ? 3.897   0.235   9.702   1.00 0.00 ? 23  VAL A CB   1  
ATOM 312   C CG1  . VAL A 1 23  ? 3.694   -1.267  9.494   1.00 0.00 ? 23  VAL A CG1  1  
ATOM 313   C CG2  . VAL A 1 23  ? 4.782   0.826   8.602   1.00 0.00 ? 23  VAL A CG2  1  
ATOM 314   H H    . VAL A 1 23  ? 3.378   2.349   11.098  1.00 0.00 ? 23  VAL A H    1  
ATOM 315   H HA   . VAL A 1 23  ? 2.175   1.079   8.762   1.00 0.00 ? 23  VAL A HA   1  
ATOM 316   H HB   . VAL A 1 23  ? 4.409   0.375   10.654  1.00 0.00 ? 23  VAL A HB   1  
ATOM 317   H HG11 . VAL A 1 23  ? 4.643   -1.728  9.218   1.00 0.00 ? 23  VAL A HG11 1  
ATOM 318   H HG12 . VAL A 1 23  ? 3.328   -1.716  10.418  1.00 0.00 ? 23  VAL A HG12 1  
ATOM 319   H HG13 . VAL A 1 23  ? 2.966   -1.429  8.699   1.00 0.00 ? 23  VAL A HG13 1  
ATOM 320   H HG21 . VAL A 1 23  ? 5.708   0.255   8.535   1.00 0.00 ? 23  VAL A HG21 1  
ATOM 321   H HG22 . VAL A 1 23  ? 4.256   0.779   7.649   1.00 0.00 ? 23  VAL A HG22 1  
ATOM 322   H HG23 . VAL A 1 23  ? 5.012   1.864   8.840   1.00 0.00 ? 23  VAL A HG23 1  
ATOM 323   N N    . ASP A 1 24  ? 0.893   -0.769  9.978   1.00 0.00 ? 24  ASP A N    1  
ATOM 324   C CA   . ASP A 1 24  ? -0.122  -1.567  10.646  1.00 0.00 ? 24  ASP A CA   1  
ATOM 325   C C    . ASP A 1 24  ? 0.559   -2.583  11.565  1.00 0.00 ? 24  ASP A C    1  
ATOM 326   O O    . ASP A 1 24  ? 1.584   -3.161  11.207  1.00 0.00 ? 24  ASP A O    1  
ATOM 327   C CB   . ASP A 1 24  ? -0.971  -2.338  9.635   1.00 0.00 ? 24  ASP A CB   1  
ATOM 328   C CG   . ASP A 1 24  ? -2.483  -2.193  9.816   1.00 0.00 ? 24  ASP A CG   1  
ATOM 329   O OD1  . ASP A 1 24  ? -2.876  -1.360  10.661  1.00 0.00 ? 24  ASP A OD1  1  
ATOM 330   O OD2  . ASP A 1 24  ? -3.212  -2.917  9.104   1.00 0.00 ? 24  ASP A OD2  1  
ATOM 331   H H    . ASP A 1 24  ? 1.072   -1.025  9.028   1.00 0.00 ? 24  ASP A H    1  
ATOM 332   H HA   . ASP A 1 24  ? -0.732  -0.851  11.196  1.00 0.00 ? 24  ASP A HA   1  
ATOM 333   H HB2  . ASP A 1 24  ? -0.707  -2.005  8.631   1.00 0.00 ? 24  ASP A HB2  1  
ATOM 334   H HB3  . ASP A 1 24  ? -0.713  -3.395  9.698   1.00 0.00 ? 24  ASP A HB3  1  
ATOM 335   N N    . PRO A 1 25  ? -0.055  -2.776  12.764  1.00 0.00 ? 25  PRO A N    1  
ATOM 336   C CA   . PRO A 1 25  ? 0.481   -3.713  13.737  1.00 0.00 ? 25  PRO A CA   1  
ATOM 337   C C    . PRO A 1 25  ? 0.198   -5.158  13.320  1.00 0.00 ? 25  PRO A C    1  
ATOM 338   O O    . PRO A 1 25  ? 0.864   -6.082  13.782  1.00 0.00 ? 25  PRO A O    1  
ATOM 339   C CB   . PRO A 1 25  ? -0.179  -3.334  15.052  1.00 0.00 ? 25  PRO A CB   1  
ATOM 340   C CG   . PRO A 1 25  ? -1.401  -2.508  14.683  1.00 0.00 ? 25  PRO A CG   1  
ATOM 341   C CD   . PRO A 1 25  ? -1.270  -2.110  13.222  1.00 0.00 ? 25  PRO A CD   1  
ATOM 342   H HA   . PRO A 1 25  ? 1.476   -3.632  13.785  1.00 0.00 ? 25  PRO A HA   1  
ATOM 343   H HB2  . PRO A 1 25  ? -0.464  -4.222  15.617  1.00 0.00 ? 25  PRO A HB2  1  
ATOM 344   H HB3  . PRO A 1 25  ? 0.503   -2.762  15.681  1.00 0.00 ? 25  PRO A HB3  1  
ATOM 345   H HG2  . PRO A 1 25  ? -2.313  -3.084  14.842  1.00 0.00 ? 25  PRO A HG2  1  
ATOM 346   H HG3  . PRO A 1 25  ? -1.469  -1.623  15.316  1.00 0.00 ? 25  PRO A HG3  1  
ATOM 347   H HD2  . PRO A 1 25  ? -2.138  -2.428  12.646  1.00 0.00 ? 25  PRO A HD2  1  
ATOM 348   H HD3  . PRO A 1 25  ? -1.194  -1.028  13.112  1.00 0.00 ? 25  PRO A HD3  1  
ATOM 349   N N    . ASP A 1 26  ? -0.792  -5.306  12.452  1.00 0.00 ? 26  ASP A N    1  
ATOM 350   C CA   . ASP A 1 26  ? -1.172  -6.623  11.968  1.00 0.00 ? 26  ASP A CA   1  
ATOM 351   C C    . ASP A 1 26  ? -0.104  -7.133  10.999  1.00 0.00 ? 26  ASP A C    1  
ATOM 352   O O    . ASP A 1 26  ? -0.011  -8.333  10.748  1.00 0.00 ? 26  ASP A O    1  
ATOM 353   C CB   . ASP A 1 26  ? -2.505  -6.571  11.219  1.00 0.00 ? 26  ASP A CB   1  
ATOM 354   C CG   . ASP A 1 26  ? -2.829  -7.815  10.390  1.00 0.00 ? 26  ASP A CG   1  
ATOM 355   O OD1  . ASP A 1 26  ? -2.345  -7.874  9.240   1.00 0.00 ? 26  ASP A OD1  1  
ATOM 356   O OD2  . ASP A 1 26  ? -3.555  -8.681  10.927  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 357   H H    . ASP A 1 26  ? -1.330  -4.549  12.082  1.00 0.00 ? 26  ASP A H    1  
ATOM 358   H HA   . ASP A 1 26  ? -1.256  -7.243  12.861  1.00 0.00 ? 26  ASP A HA   1  
ATOM 359   H HB2  . ASP A 1 26  ? -3.305  -6.415  11.942  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 360   H HB3  . ASP A 1 26  ? -2.499  -5.704  10.558  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 361   N N    . SER A 1 27  ? 0.676   -6.195  10.482  1.00 0.00 ? 27  SER A N    1  
ATOM 362   C CA   . SER A 1 27  ? 1.734   -6.534  9.545   1.00 0.00 ? 27  SER A CA   1  
ATOM 363   C C    . SER A 1 27  ? 2.949   -7.076  10.302  1.00 0.00 ? 27  SER A C    1  
ATOM 364   O O    . SER A 1 27  ? 3.705   -7.888  9.770   1.00 0.00 ? 27  SER A O    1  
ATOM 365   C CB   . SER A 1 27  ? 2.133   -5.322  8.701   1.00 0.00 ? 27  SER A CB   1  
ATOM 366   O OG   . SER A 1 27  ? 3.034   -4.463  9.393   1.00 0.00 ? 27  SER A OG   1  
ATOM 367   H H    . SER A 1 27  ? 0.594   -5.221  10.691  1.00 0.00 ? 27  SER A H    1  
ATOM 368   H HA   . SER A 1 27  ? 1.312   -7.304  8.899   1.00 0.00 ? 27  SER A HA   1  
ATOM 369   H HB2  . SER A 1 27  ? 2.595   -5.662  7.774   1.00 0.00 ? 27  SER A HB2  1  
ATOM 370   H HB3  . SER A 1 27  ? 1.239   -4.763  8.425   1.00 0.00 ? 27  SER A HB3  1  
ATOM 371   H HG   . SER A 1 27  ? 2.571   -3.614  9.646   1.00 0.00 ? 27  SER A HG   1  
ATOM 372   N N    . GLY A 1 28  ? 3.098   -6.605  11.532  1.00 0.00 ? 28  GLY A N    1  
ATOM 373   C CA   . GLY A 1 28  ? 4.208   -7.032  12.367  1.00 0.00 ? 28  GLY A CA   1  
ATOM 374   C C    . GLY A 1 28  ? 5.514   -6.373  11.922  1.00 0.00 ? 28  GLY A C    1  
ATOM 375   O O    . GLY A 1 28  ? 6.596   -6.786  12.338  1.00 0.00 ? 28  GLY A O    1  
ATOM 376   H H    . GLY A 1 28  ? 2.479   -5.945  11.957  1.00 0.00 ? 28  GLY A H    1  
ATOM 377   H HA2  . GLY A 1 28  ? 4.003   -6.778  13.407  1.00 0.00 ? 28  GLY A HA2  1  
ATOM 378   H HA3  . GLY A 1 28  ? 4.308   -8.116  12.318  1.00 0.00 ? 28  GLY A HA3  1  
ATOM 379   N N    . LEU A 1 29  ? 5.372   -5.359  11.081  1.00 0.00 ? 29  LEU A N    1  
ATOM 380   C CA   . LEU A 1 29  ? 6.528   -4.638  10.575  1.00 0.00 ? 29  LEU A CA   1  
ATOM 381   C C    . LEU A 1 29  ? 6.482   -3.193  11.076  1.00 0.00 ? 29  LEU A C    1  
ATOM 382   O O    . LEU A 1 29  ? 7.266   -2.355  10.635  1.00 0.00 ? 29  LEU A O    1  
ATOM 383   C CB   . LEU A 1 29  ? 6.609   -4.759  9.052   1.00 0.00 ? 29  LEU A CB   1  
ATOM 384   C CG   . LEU A 1 29  ? 6.167   -6.099  8.460   1.00 0.00 ? 29  LEU A CG   1  
ATOM 385   C CD1  . LEU A 1 29  ? 6.143   -6.042  6.932   1.00 0.00 ? 29  LEU A CD1  1  
ATOM 386   C CD2  . LEU A 1 29  ? 7.041   -7.242  8.978   1.00 0.00 ? 29  LEU A CD2  1  
ATOM 387   H H    . LEU A 1 29  ? 4.489   -5.029  10.747  1.00 0.00 ? 29  LEU A H    1  
ATOM 388   H HA   . LEU A 1 29  ? 7.417   -5.118  10.984  1.00 0.00 ? 29  LEU A HA   1  
ATOM 389   H HB2  . LEU A 1 29  ? 5.999   -3.970  8.612   1.00 0.00 ? 29  LEU A HB2  1  
ATOM 390   H HB3  . LEU A 1 29  ? 7.639   -4.572  8.747   1.00 0.00 ? 29  LEU A HB3  1  
ATOM 391   H HG   . LEU A 1 29  ? 5.147   -6.298  8.791   1.00 0.00 ? 29  LEU A HG   1  
ATOM 392   H HD11 . LEU A 1 29  ? 6.954   -6.652  6.533   1.00 0.00 ? 29  LEU A HD11 1  
ATOM 393   H HD12 . LEU A 1 29  ? 5.189   -6.423  6.569   1.00 0.00 ? 29  LEU A HD12 1  
ATOM 394   H HD13 . LEU A 1 29  ? 6.271   -5.010  6.604   1.00 0.00 ? 29  LEU A HD13 1  
ATOM 395   H HD21 . LEU A 1 29  ? 6.849   -8.141  8.392   1.00 0.00 ? 29  LEU A HD21 1  
ATOM 396   H HD22 . LEU A 1 29  ? 8.092   -6.967  8.886   1.00 0.00 ? 29  LEU A HD22 1  
ATOM 397   H HD23 . LEU A 1 29  ? 6.807   -7.434  10.025  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 398   N N    . GLU A 1 30  ? 5.556   -2.947  11.991  1.00 0.00 ? 30  GLU A N    1  
ATOM 399   C CA   . GLU A 1 30  ? 5.398   -1.618  12.557  1.00 0.00 ? 30  GLU A CA   1  
ATOM 400   C C    . GLU A 1 30  ? 6.528   -1.324  13.546  1.00 0.00 ? 30  GLU A C    1  
ATOM 401   O O    . GLU A 1 30  ? 6.791   -0.166  13.866  1.00 0.00 ? 30  GLU A O    1  
ATOM 402   C CB   . GLU A 1 30  ? 4.030   -1.466  13.226  1.00 0.00 ? 30  GLU A CB   1  
ATOM 403   C CG   . GLU A 1 30  ? 3.900   -2.405  14.427  1.00 0.00 ? 30  GLU A CG   1  
ATOM 404   C CD   . GLU A 1 30  ? 3.024   -1.783  15.516  1.00 0.00 ? 30  GLU A CD   1  
ATOM 405   O OE1  . GLU A 1 30  ? 1.970   -1.222  15.145  1.00 0.00 ? 30  GLU A OE1  1  
ATOM 406   O OE2  . GLU A 1 30  ? 3.427   -1.884  16.695  1.00 0.00 ? 30  GLU A OE2  1  
ATOM 407   H H    . GLU A 1 30  ? 4.922   -3.635  12.344  1.00 0.00 ? 30  GLU A H    1  
ATOM 408   H HA   . GLU A 1 30  ? 5.459   -0.934  11.710  1.00 0.00 ? 30  GLU A HA   1  
ATOM 409   H HB2  . GLU A 1 30  ? 3.892   -0.434  13.549  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 410   H HB3  . GLU A 1 30  ? 3.242   -1.682  12.504  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 411   H HG2  . GLU A 1 30  ? 3.470   -3.354  14.106  1.00 0.00 ? 30  GLU A HG2  1  
ATOM 412   H HG3  . GLU A 1 30  ? 4.888   -2.623  14.831  1.00 0.00 ? 30  GLU A HG3  1  
ATOM 413   N N    . HIS A 1 31  ? 7.165   -2.393  14.001  1.00 0.00 ? 31  HIS A N    1  
ATOM 414   C CA   . HIS A 1 31  ? 8.260   -2.264  14.947  1.00 0.00 ? 31  HIS A CA   1  
ATOM 415   C C    . HIS A 1 31  ? 9.553   -2.774  14.308  1.00 0.00 ? 31  HIS A C    1  
ATOM 416   O O    . HIS A 1 31  ? 10.564  -2.940  14.989  1.00 0.00 ? 31  HIS A O    1  
ATOM 417   C CB   . HIS A 1 31  ? 7.929   -2.973  16.262  1.00 0.00 ? 31  HIS A CB   1  
ATOM 418   C CG   . HIS A 1 31  ? 6.913   -4.081  16.123  1.00 0.00 ? 31  HIS A CG   1  
ATOM 419   N ND1  . HIS A 1 31  ? 7.009   -5.071  15.160  1.00 0.00 ? 31  HIS A ND1  1  
ATOM 420   C CD2  . HIS A 1 31  ? 5.780   -4.346  16.835  1.00 0.00 ? 31  HIS A CD2  1  
ATOM 421   C CE1  . HIS A 1 31  ? 5.975   -5.888  15.295  1.00 0.00 ? 31  HIS A CE1  1  
ATOM 422   N NE2  . HIS A 1 31  ? 5.214   -5.437  16.333  1.00 0.00 ? 31  HIS A NE2  1  
ATOM 423   H H    . HIS A 1 31  ? 6.944   -3.331  13.735  1.00 0.00 ? 31  HIS A H    1  
ATOM 424   H HA   . HIS A 1 31  ? 8.366   -1.200  15.161  1.00 0.00 ? 31  HIS A HA   1  
ATOM 425   H HB2  . HIS A 1 31  ? 8.847   -3.386  16.681  1.00 0.00 ? 31  HIS A HB2  1  
ATOM 426   H HB3  . HIS A 1 31  ? 7.555   -2.238  16.975  1.00 0.00 ? 31  HIS A HB3  1  
ATOM 427   H HD1  . HIS A 1 31  ? 7.736   -5.154  14.478  1.00 0.00 ? 31  HIS A HD1  1  
ATOM 428   H HD2  . HIS A 1 31  ? 5.403   -3.760  17.673  1.00 0.00 ? 31  HIS A HD2  1  
ATOM 429   H HE1  . HIS A 1 31  ? 5.769   -6.766  14.684  1.00 0.00 ? 31  HIS A HE1  1  
ATOM 430   N N    . SER A 1 32  ? 9.479   -3.008  13.006  1.00 0.00 ? 32  SER A N    1  
ATOM 431   C CA   . SER A 1 32  ? 10.631  -3.496  12.266  1.00 0.00 ? 32  SER A CA   1  
ATOM 432   C C    . SER A 1 32  ? 10.812  -2.683  10.983  1.00 0.00 ? 32  SER A C    1  
ATOM 433   O O    . SER A 1 32  ? 11.884  -2.130  10.740  1.00 0.00 ? 32  SER A O    1  
ATOM 434   C CB   . SER A 1 32  ? 10.484  -4.983  11.936  1.00 0.00 ? 32  SER A CB   1  
ATOM 435   O OG   . SER A 1 32  ? 11.663  -5.718  12.253  1.00 0.00 ? 32  SER A OG   1  
ATOM 436   H H    . SER A 1 32  ? 8.653   -2.870  12.459  1.00 0.00 ? 32  SER A H    1  
ATOM 437   H HA   . SER A 1 32  ? 11.482  -3.354  12.932  1.00 0.00 ? 32  SER A HA   1  
ATOM 438   H HB2  . SER A 1 32  ? 9.641   -5.395  12.489  1.00 0.00 ? 32  SER A HB2  1  
ATOM 439   H HB3  . SER A 1 32  ? 10.258  -5.098  10.877  1.00 0.00 ? 32  SER A HB3  1  
ATOM 440   H HG   . SER A 1 32  ? 12.369  -5.545  11.566  1.00 0.00 ? 32  SER A HG   1  
ATOM 441   N N    . ALA A 1 33  ? 9.747   -2.636  10.195  1.00 0.00 ? 33  ALA A N    1  
ATOM 442   C CA   . ALA A 1 33  ? 9.775   -1.899  8.943   1.00 0.00 ? 33  ALA A CA   1  
ATOM 443   C C    . ALA A 1 33  ? 8.981   -0.601  9.102   1.00 0.00 ? 33  ALA A C    1  
ATOM 444   O O    . ALA A 1 33  ? 8.444   -0.325  10.173  1.00 0.00 ? 33  ALA A O    1  
ATOM 445   C CB   . ALA A 1 33  ? 9.231   -2.783  7.819   1.00 0.00 ? 33  ALA A CB   1  
ATOM 446   H H    . ALA A 1 33  ? 8.880   -3.088  10.400  1.00 0.00 ? 33  ALA A H    1  
ATOM 447   H HA   . ALA A 1 33  ? 10.815  -1.655  8.725   1.00 0.00 ? 33  ALA A HA   1  
ATOM 448   H HB1  . ALA A 1 33  ? 8.144   -2.836  7.893   1.00 0.00 ? 33  ALA A HB1  1  
ATOM 449   H HB2  . ALA A 1 33  ? 9.508   -2.357  6.855   1.00 0.00 ? 33  ALA A HB2  1  
ATOM 450   H HB3  . ALA A 1 33  ? 9.651   -3.784  7.908   1.00 0.00 ? 33  ALA A HB3  1  
ATOM 451   N N    . HIS A 1 34  ? 8.931   0.161   8.019   1.00 0.00 ? 34  HIS A N    1  
ATOM 452   C CA   . HIS A 1 34  ? 8.211   1.423   8.025   1.00 0.00 ? 34  HIS A CA   1  
ATOM 453   C C    . HIS A 1 34  ? 7.650   1.700   6.628   1.00 0.00 ? 34  HIS A C    1  
ATOM 454   O O    . HIS A 1 34  ? 8.124   1.138   5.642   1.00 0.00 ? 34  HIS A O    1  
ATOM 455   C CB   . HIS A 1 34  ? 9.102   2.554   8.541   1.00 0.00 ? 34  HIS A CB   1  
ATOM 456   C CG   . HIS A 1 34  ? 10.389  2.723   7.769   1.00 0.00 ? 34  HIS A CG   1  
ATOM 457   N ND1  . HIS A 1 34  ? 11.601  2.222   8.214   1.00 0.00 ? 34  HIS A ND1  1  
ATOM 458   C CD2  . HIS A 1 34  ? 10.641  3.340   6.579   1.00 0.00 ? 34  HIS A CD2  1  
ATOM 459   C CE1  . HIS A 1 34  ? 12.532  2.531   7.324   1.00 0.00 ? 34  HIS A CE1  1  
ATOM 460   N NE2  . HIS A 1 34  ? 11.936  3.224   6.312   1.00 0.00 ? 34  HIS A NE2  1  
ATOM 461   H H    . HIS A 1 34  ? 9.370   -0.071  7.151   1.00 0.00 ? 34  HIS A H    1  
ATOM 462   H HA   . HIS A 1 34  ? 7.382   1.307   8.723   1.00 0.00 ? 34  HIS A HA   1  
ATOM 463   H HB2  . HIS A 1 34  ? 8.543   3.489   8.503   1.00 0.00 ? 34  HIS A HB2  1  
ATOM 464   H HB3  . HIS A 1 34  ? 9.340   2.367   9.588   1.00 0.00 ? 34  HIS A HB3  1  
ATOM 465   H HD1  . HIS A 1 34  ? 11.747  1.714   9.062   1.00 0.00 ? 34  HIS A HD1  1  
ATOM 466   H HD2  . HIS A 1 34  ? 9.903   3.843   5.954   1.00 0.00 ? 34  HIS A HD2  1  
ATOM 467   H HE1  . HIS A 1 34  ? 13.590  2.275   7.389   1.00 0.00 ? 34  HIS A HE1  1  
ATOM 468   N N    . VAL A 1 35  ? 6.648   2.566   6.589   1.00 0.00 ? 35  VAL A N    1  
ATOM 469   C CA   . VAL A 1 35  ? 6.017   2.924   5.330   1.00 0.00 ? 35  VAL A CA   1  
ATOM 470   C C    . VAL A 1 35  ? 7.093   3.351   4.330   1.00 0.00 ? 35  VAL A C    1  
ATOM 471   O O    . VAL A 1 35  ? 7.973   4.145   4.660   1.00 0.00 ? 35  VAL A O    1  
ATOM 472   C CB   . VAL A 1 35  ? 4.956   4.001   5.565   1.00 0.00 ? 35  VAL A CB   1  
ATOM 473   C CG1  . VAL A 1 35  ? 4.273   4.392   4.253   1.00 0.00 ? 35  VAL A CG1  1  
ATOM 474   C CG2  . VAL A 1 35  ? 3.930   3.543   6.602   1.00 0.00 ? 35  VAL A CG2  1  
ATOM 475   H H    . VAL A 1 35  ? 6.268   3.018   7.396   1.00 0.00 ? 35  VAL A H    1  
ATOM 476   H HA   . VAL A 1 35  ? 5.516   2.034   4.949   1.00 0.00 ? 35  VAL A HA   1  
ATOM 477   H HB   . VAL A 1 35  ? 5.458   4.886   5.958   1.00 0.00 ? 35  VAL A HB   1  
ATOM 478   H HG11 . VAL A 1 35  ? 3.842   3.505   3.789   1.00 0.00 ? 35  VAL A HG11 1  
ATOM 479   H HG12 . VAL A 1 35  ? 3.483   5.116   4.456   1.00 0.00 ? 35  VAL A HG12 1  
ATOM 480   H HG13 . VAL A 1 35  ? 5.007   4.835   3.579   1.00 0.00 ? 35  VAL A HG13 1  
ATOM 481   H HG21 . VAL A 1 35  ? 2.992   3.300   6.103   1.00 0.00 ? 35  VAL A HG21 1  
ATOM 482   H HG22 . VAL A 1 35  ? 4.305   2.661   7.120   1.00 0.00 ? 35  VAL A HG22 1  
ATOM 483   H HG23 . VAL A 1 35  ? 3.761   4.343   7.324   1.00 0.00 ? 35  VAL A HG23 1  
ATOM 484   N N    . LEU A 1 36  ? 6.986   2.807   3.127   1.00 0.00 ? 36  LEU A N    1  
ATOM 485   C CA   . LEU A 1 36  ? 7.939   3.122   2.076   1.00 0.00 ? 36  LEU A CA   1  
ATOM 486   C C    . LEU A 1 36  ? 7.645   4.520   1.530   1.00 0.00 ? 36  LEU A C    1  
ATOM 487   O O    . LEU A 1 36  ? 6.601   4.747   0.921   1.00 0.00 ? 36  LEU A O    1  
ATOM 488   C CB   . LEU A 1 36  ? 7.934   2.030   1.004   1.00 0.00 ? 36  LEU A CB   1  
ATOM 489   C CG   . LEU A 1 36  ? 9.179   1.955   0.117   1.00 0.00 ? 36  LEU A CG   1  
ATOM 490   C CD1  . LEU A 1 36  ? 8.803   2.027   -1.364  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 491   C CD2  . LEU A 1 36  ? 10.193  3.034   0.504   1.00 0.00 ? 36  LEU A CD2  1  
ATOM 492   H H    . LEU A 1 36  ? 6.267   2.162   2.866   1.00 0.00 ? 36  LEU A H    1  
ATOM 493   H HA   . LEU A 1 36  ? 8.932   3.127   2.525   1.00 0.00 ? 36  LEU A HA   1  
ATOM 494   H HB2  . LEU A 1 36  ? 7.805   1.066   1.496   1.00 0.00 ? 36  LEU A HB2  1  
ATOM 495   H HB3  . LEU A 1 36  ? 7.065   2.181   0.363   1.00 0.00 ? 36  LEU A HB3  1  
ATOM 496   H HG   . LEU A 1 36  ? 9.658   0.990   0.281   1.00 0.00 ? 36  LEU A HG   1  
ATOM 497   H HD11 . LEU A 1 36  ? 8.180   2.904   -1.538  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 498   H HD12 . LEU A 1 36  ? 9.709   2.099   -1.966  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 499   H HD13 . LEU A 1 36  ? 8.252   1.128   -1.643  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 500   H HD21 . LEU A 1 36  ? 9.712   4.012   0.475   1.00 0.00 ? 36  LEU A HD21 1  
ATOM 501   H HD22 . LEU A 1 36  ? 10.564  2.841   1.510   1.00 0.00 ? 36  LEU A HD22 1  
ATOM 502   H HD23 . LEU A 1 36  ? 11.026  3.018   -0.199  1.00 0.00 ? 36  LEU A HD23 1  
ATOM 503   N N    . GLU A 1 37  ? 8.586   5.423   1.768   1.00 0.00 ? 37  GLU A N    1  
ATOM 504   C CA   . GLU A 1 37  ? 8.441   6.794   1.308   1.00 0.00 ? 37  GLU A CA   1  
ATOM 505   C C    . GLU A 1 37  ? 9.295   7.028   0.060   1.00 0.00 ? 37  GLU A C    1  
ATOM 506   O O    . GLU A 1 37  ? 10.449  6.604   0.004   1.00 0.00 ? 37  GLU A O    1  
ATOM 507   C CB   . GLU A 1 37  ? 8.805   7.785   2.415   1.00 0.00 ? 37  GLU A CB   1  
ATOM 508   C CG   . GLU A 1 37  ? 7.551   8.295   3.128   1.00 0.00 ? 37  GLU A CG   1  
ATOM 509   C CD   . GLU A 1 37  ? 7.797   8.438   4.632   1.00 0.00 ? 37  GLU A CD   1  
ATOM 510   O OE1  . GLU A 1 37  ? 7.669   7.408   5.328   1.00 0.00 ? 37  GLU A OE1  1  
ATOM 511   O OE2  . GLU A 1 37  ? 8.106   9.575   5.051   1.00 0.00 ? 37  GLU A OE2  1  
ATOM 512   H H    . GLU A 1 37  ? 9.432   5.231   2.264   1.00 0.00 ? 37  GLU A H    1  
ATOM 513   H HA   . GLU A 1 37  ? 7.386   6.906   1.060   1.00 0.00 ? 37  GLU A HA   1  
ATOM 514   H HB2  . GLU A 1 37  ? 9.468   7.304   3.135   1.00 0.00 ? 37  GLU A HB2  1  
ATOM 515   H HB3  . GLU A 1 37  ? 9.353   8.626   1.989   1.00 0.00 ? 37  GLU A HB3  1  
ATOM 516   H HG2  . GLU A 1 37  ? 7.257   9.257   2.711   1.00 0.00 ? 37  GLU A HG2  1  
ATOM 517   H HG3  . GLU A 1 37  ? 6.725   7.606   2.955   1.00 0.00 ? 37  GLU A HG3  1  
ATOM 518   N N    . LYS A 1 38  ? 8.695   7.701   -0.911  1.00 0.00 ? 38  LYS A N    1  
ATOM 519   C CA   . LYS A 1 38  ? 9.386   7.996   -2.155  1.00 0.00 ? 38  LYS A CA   1  
ATOM 520   C C    . LYS A 1 38  ? 8.943   9.368   -2.666  1.00 0.00 ? 38  LYS A C    1  
ATOM 521   O O    . LYS A 1 38  ? 7.813   9.790   -2.424  1.00 0.00 ? 38  LYS A O    1  
ATOM 522   C CB   . LYS A 1 38  ? 9.176   6.866   -3.165  1.00 0.00 ? 38  LYS A CB   1  
ATOM 523   C CG   . LYS A 1 38  ? 10.427  6.657   -4.021  1.00 0.00 ? 38  LYS A CG   1  
ATOM 524   C CD   . LYS A 1 38  ? 10.413  5.278   -4.685  1.00 0.00 ? 38  LYS A CD   1  
ATOM 525   C CE   . LYS A 1 38  ? 9.897   5.367   -6.122  1.00 0.00 ? 38  LYS A CE   1  
ATOM 526   N NZ   . LYS A 1 38  ? 10.964  4.997   -7.079  1.00 0.00 ? 38  LYS A NZ   1  
ATOM 527   H H    . LYS A 1 38  ? 7.756   8.041   -0.858  1.00 0.00 ? 38  LYS A H    1  
ATOM 528   H HA   . LYS A 1 38  ? 10.452  8.037   -1.934  1.00 0.00 ? 38  LYS A HA   1  
ATOM 529   H HB2  . LYS A 1 38  ? 8.932   5.943   -2.640  1.00 0.00 ? 38  LYS A HB2  1  
ATOM 530   H HB3  . LYS A 1 38  ? 8.327   7.101   -3.807  1.00 0.00 ? 38  LYS A HB3  1  
ATOM 531   H HG2  . LYS A 1 38  ? 10.483  7.432   -4.785  1.00 0.00 ? 38  LYS A HG2  1  
ATOM 532   H HG3  . LYS A 1 38  ? 11.318  6.756   -3.400  1.00 0.00 ? 38  LYS A HG3  1  
ATOM 533   H HD2  . LYS A 1 38  ? 11.419  4.858   -4.681  1.00 0.00 ? 38  LYS A HD2  1  
ATOM 534   H HD3  . LYS A 1 38  ? 9.782   4.600   -4.110  1.00 0.00 ? 38  LYS A HD3  1  
ATOM 535   H HE2  . LYS A 1 38  ? 9.041   4.706   -6.249  1.00 0.00 ? 38  LYS A HE2  1  
ATOM 536   H HE3  . LYS A 1 38  ? 9.551   6.380   -6.329  1.00 0.00 ? 38  LYS A HE3  1  
ATOM 537   H HZ1  . LYS A 1 38  ? 10.613  4.315   -7.722  1.00 0.00 ? 38  LYS A HZ1  1  
ATOM 538   H HZ2  . LYS A 1 38  ? 11.257  5.810   -7.583  1.00 0.00 ? 38  LYS A HZ2  1  
ATOM 539   H HZ3  . LYS A 1 38  ? 11.742  4.615   -6.580  1.00 0.00 ? 38  LYS A HZ3  1  
ATOM 540   N N    . GLY A 1 39  ? 9.857   10.028  -3.363  1.00 0.00 ? 39  GLY A N    1  
ATOM 541   C CA   . GLY A 1 39  ? 9.574   11.344  -3.910  1.00 0.00 ? 39  GLY A CA   1  
ATOM 542   C C    . GLY A 1 39  ? 8.828   12.211  -2.895  1.00 0.00 ? 39  GLY A C    1  
ATOM 543   O O    . GLY A 1 39  ? 7.816   12.828  -3.225  1.00 0.00 ? 39  GLY A O    1  
ATOM 544   H H    . GLY A 1 39  ? 10.773  9.678   -3.555  1.00 0.00 ? 39  GLY A H    1  
ATOM 545   H HA2  . GLY A 1 39  ? 10.507  11.831  -4.194  1.00 0.00 ? 39  GLY A HA2  1  
ATOM 546   H HA3  . GLY A 1 39  ? 8.978   11.244  -4.817  1.00 0.00 ? 39  GLY A HA3  1  
ATOM 547   N N    . GLY A 1 40  ? 9.355   12.230  -1.680  1.00 0.00 ? 40  GLY A N    1  
ATOM 548   C CA   . GLY A 1 40  ? 8.751   13.011  -0.614  1.00 0.00 ? 40  GLY A CA   1  
ATOM 549   C C    . GLY A 1 40  ? 7.264   12.684  -0.469  1.00 0.00 ? 40  GLY A C    1  
ATOM 550   O O    . GLY A 1 40  ? 6.468   13.546  -0.100  1.00 0.00 ? 40  GLY A O    1  
ATOM 551   H H    . GLY A 1 40  ? 10.178  11.725  -1.419  1.00 0.00 ? 40  GLY A H    1  
ATOM 552   H HA2  . GLY A 1 40  ? 9.265   12.809  0.326   1.00 0.00 ? 40  GLY A HA2  1  
ATOM 553   H HA3  . GLY A 1 40  ? 8.875   14.074  -0.822  1.00 0.00 ? 40  GLY A HA3  1  
ATOM 554   N N    . LYS A 1 41  ? 6.933   11.436  -0.768  1.00 0.00 ? 41  LYS A N    1  
ATOM 555   C CA   . LYS A 1 41  ? 5.555   10.984  -0.676  1.00 0.00 ? 41  LYS A CA   1  
ATOM 556   C C    . LYS A 1 41  ? 5.486   9.754   0.230   1.00 0.00 ? 41  LYS A C    1  
ATOM 557   O O    . LYS A 1 41  ? 6.517   9.226   0.646   1.00 0.00 ? 41  LYS A O    1  
ATOM 558   C CB   . LYS A 1 41  ? 4.973   10.754  -2.072  1.00 0.00 ? 41  LYS A CB   1  
ATOM 559   C CG   . LYS A 1 41  ? 4.652   12.083  -2.759  1.00 0.00 ? 41  LYS A CG   1  
ATOM 560   C CD   . LYS A 1 41  ? 3.164   12.417  -2.641  1.00 0.00 ? 41  LYS A CD   1  
ATOM 561   C CE   . LYS A 1 41  ? 2.403   11.977  -3.893  1.00 0.00 ? 41  LYS A CE   1  
ATOM 562   N NZ   . LYS A 1 41  ? 1.455   13.031  -4.319  1.00 0.00 ? 41  LYS A NZ   1  
ATOM 563   H H    . LYS A 1 41  ? 7.587   10.741  -1.068  1.00 0.00 ? 41  LYS A H    1  
ATOM 564   H HA   . LYS A 1 41  ? 4.979   11.786  -0.215  1.00 0.00 ? 41  LYS A HA   1  
ATOM 565   H HB2  . LYS A 1 41  ? 5.681   10.189  -2.677  1.00 0.00 ? 41  LYS A HB2  1  
ATOM 566   H HB3  . LYS A 1 41  ? 4.067   10.152  -1.997  1.00 0.00 ? 41  LYS A HB3  1  
ATOM 567   H HG2  . LYS A 1 41  ? 5.244   12.880  -2.309  1.00 0.00 ? 41  LYS A HG2  1  
ATOM 568   H HG3  . LYS A 1 41  ? 4.935   12.030  -3.810  1.00 0.00 ? 41  LYS A HG3  1  
ATOM 569   H HD2  . LYS A 1 41  ? 2.745   11.923  -1.764  1.00 0.00 ? 41  LYS A HD2  1  
ATOM 570   H HD3  . LYS A 1 41  ? 3.039   13.489  -2.492  1.00 0.00 ? 41  LYS A HD3  1  
ATOM 571   H HE2  . LYS A 1 41  ? 3.106   11.765  -4.698  1.00 0.00 ? 41  LYS A HE2  1  
ATOM 572   H HE3  . LYS A 1 41  ? 1.861   11.053  -3.691  1.00 0.00 ? 41  LYS A HE3  1  
ATOM 573   H HZ1  . LYS A 1 41  ? 0.880   13.295  -3.545  1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 574   H HZ2  . LYS A 1 41  ? 1.965   13.828  -4.643  1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 575   H HZ3  . LYS A 1 41  ? 0.879   12.681  -5.059  1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 576   N N    . VAL A 1 42  ? 4.262   9.332   0.510   1.00 0.00 ? 42  VAL A N    1  
ATOM 577   C CA   . VAL A 1 42  ? 4.045   8.173   1.359   1.00 0.00 ? 42  VAL A CA   1  
ATOM 578   C C    . VAL A 1 42  ? 3.229   7.130   0.593   1.00 0.00 ? 42  VAL A C    1  
ATOM 579   O O    . VAL A 1 42  ? 2.299   7.477   -0.134  1.00 0.00 ? 42  VAL A O    1  
ATOM 580   C CB   . VAL A 1 42  ? 3.385   8.602   2.672   1.00 0.00 ? 42  VAL A CB   1  
ATOM 581   C CG1  . VAL A 1 42  ? 2.929   7.386   3.479   1.00 0.00 ? 42  VAL A CG1  1  
ATOM 582   C CG2  . VAL A 1 42  ? 4.326   9.485   3.495   1.00 0.00 ? 42  VAL A CG2  1  
ATOM 583   H H    . VAL A 1 42  ? 3.429   9.767   0.168   1.00 0.00 ? 42  VAL A H    1  
ATOM 584   H HA   . VAL A 1 42  ? 5.022   7.751   1.595   1.00 0.00 ? 42  VAL A HA   1  
ATOM 585   H HB   . VAL A 1 42  ? 2.502   9.192   2.426   1.00 0.00 ? 42  VAL A HB   1  
ATOM 586   H HG11 . VAL A 1 42  ? 1.984   7.612   3.974   1.00 0.00 ? 42  VAL A HG11 1  
ATOM 587   H HG12 . VAL A 1 42  ? 2.794   6.536   2.810   1.00 0.00 ? 42  VAL A HG12 1  
ATOM 588   H HG13 . VAL A 1 42  ? 3.682   7.143   4.228   1.00 0.00 ? 42  VAL A HG13 1  
ATOM 589   H HG21 . VAL A 1 42  ? 5.360   9.228   3.264   1.00 0.00 ? 42  VAL A HG21 1  
ATOM 590   H HG22 . VAL A 1 42  ? 4.148   10.532  3.249   1.00 0.00 ? 42  VAL A HG22 1  
ATOM 591   H HG23 . VAL A 1 42  ? 4.139   9.324   4.556   1.00 0.00 ? 42  VAL A HG23 1  
ATOM 592   N N    . PHE A 1 43  ? 3.606   5.875   0.782   1.00 0.00 ? 43  PHE A N    1  
ATOM 593   C CA   . PHE A 1 43  ? 2.921   4.779   0.118   1.00 0.00 ? 43  PHE A CA   1  
ATOM 594   C C    . PHE A 1 43  ? 1.773   4.248   0.979   1.00 0.00 ? 43  PHE A C    1  
ATOM 595   O O    . PHE A 1 43  ? 1.666   3.043   1.203   1.00 0.00 ? 43  PHE A O    1  
ATOM 596   C CB   . PHE A 1 43  ? 3.949   3.664   -0.084  1.00 0.00 ? 43  PHE A CB   1  
ATOM 597   C CG   . PHE A 1 43  ? 4.887   3.890   -1.271  1.00 0.00 ? 43  PHE A CG   1  
ATOM 598   C CD1  . PHE A 1 43  ? 5.545   5.074   -1.403  1.00 0.00 ? 43  PHE A CD1  1  
ATOM 599   C CD2  . PHE A 1 43  ? 5.064   2.908   -2.195  1.00 0.00 ? 43  PHE A CD2  1  
ATOM 600   C CE1  . PHE A 1 43  ? 6.416   5.283   -2.505  1.00 0.00 ? 43  PHE A CE1  1  
ATOM 601   C CE2  . PHE A 1 43  ? 5.934   3.118   -3.297  1.00 0.00 ? 43  PHE A CE2  1  
ATOM 602   C CZ   . PHE A 1 43  ? 6.592   4.301   -3.428  1.00 0.00 ? 43  PHE A CZ   1  
ATOM 603   H H    . PHE A 1 43  ? 4.364   5.602   1.375   1.00 0.00 ? 43  PHE A H    1  
ATOM 604   H HA   . PHE A 1 43  ? 2.521   5.168   -0.818  1.00 0.00 ? 43  PHE A HA   1  
ATOM 605   H HB2  . PHE A 1 43  ? 4.546   3.566   0.823   1.00 0.00 ? 43  PHE A HB2  1  
ATOM 606   H HB3  . PHE A 1 43  ? 3.424   2.720   -0.224  1.00 0.00 ? 43  PHE A HB3  1  
ATOM 607   H HD1  . PHE A 1 43  ? 5.404   5.861   -0.662  1.00 0.00 ? 43  PHE A HD1  1  
ATOM 608   H HD2  . PHE A 1 43  ? 4.537   1.960   -2.089  1.00 0.00 ? 43  PHE A HD2  1  
ATOM 609   H HE1  . PHE A 1 43  ? 6.943   6.231   -2.610  1.00 0.00 ? 43  PHE A HE1  1  
ATOM 610   H HE2  . PHE A 1 43  ? 6.075   2.330   -4.037  1.00 0.00 ? 43  PHE A HE2  1  
ATOM 611   H HZ   . PHE A 1 43  ? 7.260   4.462   -4.274  1.00 0.00 ? 43  PHE A HZ   1  
ATOM 612   N N    . SER A 1 44  ? 0.943   5.173   1.438   1.00 0.00 ? 44  SER A N    1  
ATOM 613   C CA   . SER A 1 44  ? -0.193  4.813   2.269   1.00 0.00 ? 44  SER A CA   1  
ATOM 614   C C    . SER A 1 44  ? -1.475  5.421   1.696   1.00 0.00 ? 44  SER A C    1  
ATOM 615   O O    . SER A 1 44  ? -1.738  6.609   1.878   1.00 0.00 ? 44  SER A O    1  
ATOM 616   C CB   . SER A 1 44  ? 0.013   5.274   3.713   1.00 0.00 ? 44  SER A CB   1  
ATOM 617   O OG   . SER A 1 44  ? -1.221  5.409   4.412   1.00 0.00 ? 44  SER A OG   1  
ATOM 618   H H    . SER A 1 44  ? 1.037   6.151   1.251   1.00 0.00 ? 44  SER A H    1  
ATOM 619   H HA   . SER A 1 44  ? -0.240  3.725   2.239   1.00 0.00 ? 44  SER A HA   1  
ATOM 620   H HB2  . SER A 1 44  ? 0.649   4.558   4.235   1.00 0.00 ? 44  SER A HB2  1  
ATOM 621   H HB3  . SER A 1 44  ? 0.539   6.229   3.718   1.00 0.00 ? 44  SER A HB3  1  
ATOM 622   H HG   . SER A 1 44  ? -1.122  5.077   5.350   1.00 0.00 ? 44  SER A HG   1  
ATOM 623   N N    . ALA A 1 45  ? -2.238  4.580   1.014   1.00 0.00 ? 45  ALA A N    1  
ATOM 624   C CA   . ALA A 1 45  ? -3.486  5.020   0.413   1.00 0.00 ? 45  ALA A CA   1  
ATOM 625   C C    . ALA A 1 45  ? -4.644  4.214   1.005   1.00 0.00 ? 45  ALA A C    1  
ATOM 626   O O    . ALA A 1 45  ? -4.515  3.013   1.235   1.00 0.00 ? 45  ALA A O    1  
ATOM 627   C CB   . ALA A 1 45  ? -3.396  4.881   -1.108  1.00 0.00 ? 45  ALA A CB   1  
ATOM 628   H H    . ALA A 1 45  ? -2.017  3.615   0.871   1.00 0.00 ? 45  ALA A H    1  
ATOM 629   H HA   . ALA A 1 45  ? -3.621  6.072   0.663   1.00 0.00 ? 45  ALA A HA   1  
ATOM 630   H HB1  . ALA A 1 45  ? -2.358  4.988   -1.422  1.00 0.00 ? 45  ALA A HB1  1  
ATOM 631   H HB2  . ALA A 1 45  ? -3.767  3.901   -1.406  1.00 0.00 ? 45  ALA A HB2  1  
ATOM 632   H HB3  . ALA A 1 45  ? -4.001  5.656   -1.579  1.00 0.00 ? 45  ALA A HB3  1  
ATOM 633   N N    . THR A 1 46  ? -5.749  4.908   1.235   1.00 0.00 ? 46  THR A N    1  
ATOM 634   C CA   . THR A 1 46  ? -6.929  4.272   1.795   1.00 0.00 ? 46  THR A CA   1  
ATOM 635   C C    . THR A 1 46  ? -8.111  4.399   0.832   1.00 0.00 ? 46  THR A C    1  
ATOM 636   O O    . THR A 1 46  ? -8.695  5.473   0.699   1.00 0.00 ? 46  THR A O    1  
ATOM 637   C CB   . THR A 1 46  ? -7.194  4.893   3.168   1.00 0.00 ? 46  THR A CB   1  
ATOM 638   O OG1  . THR A 1 46  ? -6.007  4.620   3.907   1.00 0.00 ? 46  THR A OG1  1  
ATOM 639   C CG2  . THR A 1 46  ? -8.292  4.159   3.941   1.00 0.00 ? 46  THR A CG2  1  
ATOM 640   H H    . THR A 1 46  ? -5.845  5.885   1.044   1.00 0.00 ? 46  THR A H    1  
ATOM 641   H HA   . THR A 1 46  ? -6.724  3.208   1.911   1.00 0.00 ? 46  THR A HA   1  
ATOM 642   H HB   . THR A 1 46  ? -7.425  5.954   3.077   1.00 0.00 ? 46  THR A HB   1  
ATOM 643   H HG1  . THR A 1 46  ? -5.990  3.660   4.185   1.00 0.00 ? 46  THR A HG1  1  
ATOM 644   H HG21 . THR A 1 46  ? -9.223  4.201   3.377   1.00 0.00 ? 46  THR A HG21 1  
ATOM 645   H HG22 . THR A 1 46  ? -8.000  3.119   4.085   1.00 0.00 ? 46  THR A HG22 1  
ATOM 646   H HG23 . THR A 1 46  ? -8.433  4.635   4.911   1.00 0.00 ? 46  THR A HG23 1  
ATOM 647   N N    . LEU A 1 47  ? -8.429  3.287   0.186   1.00 0.00 ? 47  LEU A N    1  
ATOM 648   C CA   . LEU A 1 47  ? -9.531  3.260   -0.760  1.00 0.00 ? 47  LEU A CA   1  
ATOM 649   C C    . LEU A 1 47  ? -10.774 2.688   -0.074  1.00 0.00 ? 47  LEU A C    1  
ATOM 650   O O    . LEU A 1 47  ? -10.669 2.029   0.959   1.00 0.00 ? 47  LEU A O    1  
ATOM 651   C CB   . LEU A 1 47  ? -9.129  2.506   -2.030  1.00 0.00 ? 47  LEU A CB   1  
ATOM 652   C CG   . LEU A 1 47  ? -7.816  2.945   -2.682  1.00 0.00 ? 47  LEU A CG   1  
ATOM 653   C CD1  . LEU A 1 47  ? -7.389  1.958   -3.771  1.00 0.00 ? 47  LEU A CD1  1  
ATOM 654   C CD2  . LEU A 1 47  ? -7.919  4.376   -3.214  1.00 0.00 ? 47  LEU A CD2  1  
ATOM 655   H H    . LEU A 1 47  ? -7.949  2.417   0.301   1.00 0.00 ? 47  LEU A H    1  
ATOM 656   H HA   . LEU A 1 47  ? -9.739  4.290   -1.049  1.00 0.00 ? 47  LEU A HA   1  
ATOM 657   H HB2  . LEU A 1 47  ? -9.057  1.445   -1.791  1.00 0.00 ? 47  LEU A HB2  1  
ATOM 658   H HB3  . LEU A 1 47  ? -9.930  2.615   -2.762  1.00 0.00 ? 47  LEU A HB3  1  
ATOM 659   H HG   . LEU A 1 47  ? -7.038  2.939   -1.919  1.00 0.00 ? 47  LEU A HG   1  
ATOM 660   H HD11 . LEU A 1 47  ? -8.274  1.502   -4.215  1.00 0.00 ? 47  LEU A HD11 1  
ATOM 661   H HD12 . LEU A 1 47  ? -6.827  2.487   -4.540  1.00 0.00 ? 47  LEU A HD12 1  
ATOM 662   H HD13 . LEU A 1 47  ? -6.762  1.182   -3.332  1.00 0.00 ? 47  LEU A HD13 1  
ATOM 663   H HD21 . LEU A 1 47  ? -8.588  4.953   -2.575  1.00 0.00 ? 47  LEU A HD21 1  
ATOM 664   H HD22 . LEU A 1 47  ? -6.930  4.835   -3.214  1.00 0.00 ? 47  LEU A HD22 1  
ATOM 665   H HD23 . LEU A 1 47  ? -8.312  4.358   -4.230  1.00 0.00 ? 47  LEU A HD23 1  
ATOM 666   N N    . GLY A 1 48  ? -11.922 2.963   -0.675  1.00 0.00 ? 48  GLY A N    1  
ATOM 667   C CA   . GLY A 1 48  ? -13.183 2.485   -0.135  1.00 0.00 ? 48  GLY A CA   1  
ATOM 668   C C    . GLY A 1 48  ? -14.246 2.384   -1.230  1.00 0.00 ? 48  GLY A C    1  
ATOM 669   O O    . GLY A 1 48  ? -14.348 3.263   -2.084  1.00 0.00 ? 48  GLY A O    1  
ATOM 670   H H    . GLY A 1 48  ? -11.999 3.500   -1.515  1.00 0.00 ? 48  GLY A H    1  
ATOM 671   H HA2  . GLY A 1 48  ? -13.038 1.508   0.327   1.00 0.00 ? 48  GLY A HA2  1  
ATOM 672   H HA3  . GLY A 1 48  ? -13.526 3.160   0.649   1.00 0.00 ? 48  GLY A HA3  1  
ATOM 673   N N    . LEU A 1 49  ? -15.011 1.304   -1.170  1.00 0.00 ? 49  LEU A N    1  
ATOM 674   C CA   . LEU A 1 49  ? -16.063 1.077   -2.147  1.00 0.00 ? 49  LEU A CA   1  
ATOM 675   C C    . LEU A 1 49  ? -17.262 0.424   -1.456  1.00 0.00 ? 49  LEU A C    1  
ATOM 676   O O    . LEU A 1 49  ? -17.097 -0.497  -0.658  1.00 0.00 ? 49  LEU A O    1  
ATOM 677   C CB   . LEU A 1 49  ? -15.527 0.276   -3.335  1.00 0.00 ? 49  LEU A CB   1  
ATOM 678   C CG   . LEU A 1 49  ? -16.501 0.065   -4.496  1.00 0.00 ? 49  LEU A CG   1  
ATOM 679   C CD1  . LEU A 1 49  ? -16.181 1.009   -5.658  1.00 0.00 ? 49  LEU A CD1  1  
ATOM 680   C CD2  . LEU A 1 49  ? -16.521 -1.400  -4.937  1.00 0.00 ? 49  LEU A CD2  1  
ATOM 681   H H    . LEU A 1 49  ? -14.922 0.593   -0.473  1.00 0.00 ? 49  LEU A H    1  
ATOM 682   H HA   . LEU A 1 49  ? -16.371 2.050   -2.527  1.00 0.00 ? 49  LEU A HA   1  
ATOM 683   H HB2  . LEU A 1 49  ? -14.640 0.781   -3.718  1.00 0.00 ? 49  LEU A HB2  1  
ATOM 684   H HB3  . LEU A 1 49  ? -15.206 -0.702  -2.974  1.00 0.00 ? 49  LEU A HB3  1  
ATOM 685   H HG   . LEU A 1 49  ? -17.505 0.311   -4.149  1.00 0.00 ? 49  LEU A HG   1  
ATOM 686   H HD11 . LEU A 1 49  ? -15.101 1.079   -5.782  1.00 0.00 ? 49  LEU A HD11 1  
ATOM 687   H HD12 . LEU A 1 49  ? -16.628 0.622   -6.574  1.00 0.00 ? 49  LEU A HD12 1  
ATOM 688   H HD13 . LEU A 1 49  ? -16.588 1.997   -5.445  1.00 0.00 ? 49  LEU A HD13 1  
ATOM 689   H HD21 . LEU A 1 49  ? -15.523 -1.826  -4.827  1.00 0.00 ? 49  LEU A HD21 1  
ATOM 690   H HD22 . LEU A 1 49  ? -17.224 -1.956  -4.317  1.00 0.00 ? 49  LEU A HD22 1  
ATOM 691   H HD23 . LEU A 1 49  ? -16.829 -1.461  -5.980  1.00 0.00 ? 49  LEU A HD23 1  
ATOM 692   N N    . VAL A 1 50  ? -18.442 0.927   -1.789  1.00 0.00 ? 50  VAL A N    1  
ATOM 693   C CA   . VAL A 1 50  ? -19.668 0.405   -1.210  1.00 0.00 ? 50  VAL A CA   1  
ATOM 694   C C    . VAL A 1 50  ? -20.785 0.463   -2.255  1.00 0.00 ? 50  VAL A C    1  
ATOM 695   O O    . VAL A 1 50  ? -21.077 1.527   -2.797  1.00 0.00 ? 50  VAL A O    1  
ATOM 696   C CB   . VAL A 1 50  ? -20.008 1.167   0.072   1.00 0.00 ? 50  VAL A CB   1  
ATOM 697   C CG1  . VAL A 1 50  ? -19.722 2.662   -0.087  1.00 0.00 ? 50  VAL A CG1  1  
ATOM 698   C CG2  . VAL A 1 50  ? -21.462 0.928   0.483   1.00 0.00 ? 50  VAL A CG2  1  
ATOM 699   H H    . VAL A 1 50  ? -18.567 1.676   -2.439  1.00 0.00 ? 50  VAL A H    1  
ATOM 700   H HA   . VAL A 1 50  ? -19.489 -0.638  -0.946  1.00 0.00 ? 50  VAL A HA   1  
ATOM 701   H HB   . VAL A 1 50  ? -19.368 0.786   0.868   1.00 0.00 ? 50  VAL A HB   1  
ATOM 702   H HG11 . VAL A 1 50  ? -18.675 2.805   -0.354  1.00 0.00 ? 50  VAL A HG11 1  
ATOM 703   H HG12 . VAL A 1 50  ? -20.357 3.072   -0.872  1.00 0.00 ? 50  VAL A HG12 1  
ATOM 704   H HG13 . VAL A 1 50  ? -19.930 3.173   0.853   1.00 0.00 ? 50  VAL A HG13 1  
ATOM 705   H HG21 . VAL A 1 50  ? -21.880 0.117   -0.115  1.00 0.00 ? 50  VAL A HG21 1  
ATOM 706   H HG22 . VAL A 1 50  ? -21.502 0.658   1.538   1.00 0.00 ? 50  VAL A HG22 1  
ATOM 707   H HG23 . VAL A 1 50  ? -22.041 1.836   0.318   1.00 0.00 ? 50  VAL A HG23 1  
ATOM 708   N N    . ASP A 1 51  ? -21.378 -0.695  -2.505  1.00 0.00 ? 51  ASP A N    1  
ATOM 709   C CA   . ASP A 1 51  ? -22.456 -0.789  -3.474  1.00 0.00 ? 51  ASP A CA   1  
ATOM 710   C C    . ASP A 1 51  ? -23.742 -0.238  -2.856  1.00 0.00 ? 51  ASP A C    1  
ATOM 711   O O    . ASP A 1 51  ? -23.952 -0.350  -1.649  1.00 0.00 ? 51  ASP A O    1  
ATOM 712   C CB   . ASP A 1 51  ? -22.710 -2.243  -3.876  1.00 0.00 ? 51  ASP A CB   1  
ATOM 713   C CG   . ASP A 1 51  ? -23.009 -2.461  -5.361  1.00 0.00 ? 51  ASP A CG   1  
ATOM 714   O OD1  . ASP A 1 51  ? -23.960 -1.813  -5.850  1.00 0.00 ? 51  ASP A OD1  1  
ATOM 715   O OD2  . ASP A 1 51  ? -22.281 -3.271  -5.973  1.00 0.00 ? 51  ASP A OD2  1  
ATOM 716   H H    . ASP A 1 51  ? -21.134 -1.556  -2.059  1.00 0.00 ? 51  ASP A H    1  
ATOM 717   H HA   . ASP A 1 51  ? -22.122 -0.205  -4.332  1.00 0.00 ? 51  ASP A HA   1  
ATOM 718   H HB2  . ASP A 1 51  ? -21.837 -2.837  -3.606  1.00 0.00 ? 51  ASP A HB2  1  
ATOM 719   H HB3  . ASP A 1 51  ? -23.548 -2.625  -3.292  1.00 0.00 ? 51  ASP A HB3  1  
ATOM 720   N N    . ILE A 1 52  ? -24.570 0.345   -3.711  1.00 0.00 ? 52  ILE A N    1  
ATOM 721   C CA   . ILE A 1 52  ? -25.830 0.914   -3.263  1.00 0.00 ? 52  ILE A CA   1  
ATOM 722   C C    . ILE A 1 52  ? -26.926 -0.149  -3.357  1.00 0.00 ? 52  ILE A C    1  
ATOM 723   O O    . ILE A 1 52  ? -27.845 -0.172  -2.538  1.00 0.00 ? 52  ILE A O    1  
ATOM 724   C CB   . ILE A 1 52  ? -26.146 2.194   -4.040  1.00 0.00 ? 52  ILE A CB   1  
ATOM 725   C CG1  . ILE A 1 52  ? -27.558 2.691   -3.726  1.00 0.00 ? 52  ILE A CG1  1  
ATOM 726   C CG2  . ILE A 1 52  ? -25.931 1.991   -5.541  1.00 0.00 ? 52  ILE A CG2  1  
ATOM 727   C CD1  . ILE A 1 52  ? -27.584 3.473   -2.411  1.00 0.00 ? 52  ILE A CD1  1  
ATOM 728   H H    . ILE A 1 52  ? -24.392 0.432   -4.691  1.00 0.00 ? 52  ILE A H    1  
ATOM 729   H HA   . ILE A 1 52  ? -25.708 1.194   -2.217  1.00 0.00 ? 52  ILE A HA   1  
ATOM 730   H HB   . ILE A 1 52  ? -25.452 2.969   -3.717  1.00 0.00 ? 52  ILE A HB   1  
ATOM 731   H HG12 . ILE A 1 52  ? -27.913 3.326   -4.538  1.00 0.00 ? 52  ILE A HG12 1  
ATOM 732   H HG13 . ILE A 1 52  ? -28.241 1.844   -3.662  1.00 0.00 ? 52  ILE A HG13 1  
ATOM 733   H HG21 . ILE A 1 52  ? -24.893 2.211   -5.793  1.00 0.00 ? 52  ILE A HG21 1  
ATOM 734   H HG22 . ILE A 1 52  ? -26.157 0.957   -5.805  1.00 0.00 ? 52  ILE A HG22 1  
ATOM 735   H HG23 . ILE A 1 52  ? -26.589 2.659   -6.096  1.00 0.00 ? 52  ILE A HG23 1  
ATOM 736   H HD11 . ILE A 1 52  ? -26.865 3.039   -1.716  1.00 0.00 ? 52  ILE A HD11 1  
ATOM 737   H HD12 . ILE A 1 52  ? -27.322 4.514   -2.602  1.00 0.00 ? 52  ILE A HD12 1  
ATOM 738   H HD13 . ILE A 1 52  ? -28.583 3.424   -1.978  1.00 0.00 ? 52  ILE A HD13 1  
ATOM 739   N N    . VAL A 1 53  ? -26.794 -1.003  -4.361  1.00 0.00 ? 53  VAL A N    1  
ATOM 740   C CA   . VAL A 1 53  ? -27.762 -2.066  -4.572  1.00 0.00 ? 53  VAL A CA   1  
ATOM 741   C C    . VAL A 1 53  ? -27.459 -3.222  -3.616  1.00 0.00 ? 53  VAL A C    1  
ATOM 742   O O    . VAL A 1 53  ? -28.294 -3.582  -2.788  1.00 0.00 ? 53  VAL A O    1  
ATOM 743   C CB   . VAL A 1 53  ? -27.762 -2.490  -6.042  1.00 0.00 ? 53  VAL A CB   1  
ATOM 744   C CG1  . VAL A 1 53  ? -28.303 -3.912  -6.202  1.00 0.00 ? 53  VAL A CG1  1  
ATOM 745   C CG2  . VAL A 1 53  ? -28.556 -1.501  -6.897  1.00 0.00 ? 53  VAL A CG2  1  
ATOM 746   H H    . VAL A 1 53  ? -26.044 -0.977  -5.022  1.00 0.00 ? 53  VAL A H    1  
ATOM 747   H HA   . VAL A 1 53  ? -28.748 -1.665  -4.336  1.00 0.00 ? 53  VAL A HA   1  
ATOM 748   H HB   . VAL A 1 53  ? -26.730 -2.482  -6.393  1.00 0.00 ? 53  VAL A HB   1  
ATOM 749   H HG11 . VAL A 1 53  ? -28.656 -4.053  -7.224  1.00 0.00 ? 53  VAL A HG11 1  
ATOM 750   H HG12 . VAL A 1 53  ? -27.509 -4.629  -5.991  1.00 0.00 ? 53  VAL A HG12 1  
ATOM 751   H HG13 . VAL A 1 53  ? -29.128 -4.068  -5.507  1.00 0.00 ? 53  VAL A HG13 1  
ATOM 752   H HG21 . VAL A 1 53  ? -28.644 -0.552  -6.368  1.00 0.00 ? 53  VAL A HG21 1  
ATOM 753   H HG22 . VAL A 1 53  ? -28.039 -1.343  -7.844  1.00 0.00 ? 53  VAL A HG22 1  
ATOM 754   H HG23 . VAL A 1 53  ? -29.551 -1.904  -7.089  1.00 0.00 ? 53  VAL A HG23 1  
ATOM 755   N N    . LYS A 1 54  ? -26.263 -3.772  -3.763  1.00 0.00 ? 54  LYS A N    1  
ATOM 756   C CA   . LYS A 1 54  ? -25.840 -4.880  -2.924  1.00 0.00 ? 54  LYS A CA   1  
ATOM 757   C C    . LYS A 1 54  ? -25.769 -4.413  -1.468  1.00 0.00 ? 54  LYS A C    1  
ATOM 758   O O    . LYS A 1 54  ? -25.676 -5.231  -0.554  1.00 0.00 ? 54  LYS A O    1  
ATOM 759   C CB   . LYS A 1 54  ? -24.530 -5.476  -3.443  1.00 0.00 ? 54  LYS A CB   1  
ATOM 760   C CG   . LYS A 1 54  ? -24.717 -6.082  -4.836  1.00 0.00 ? 54  LYS A CG   1  
ATOM 761   C CD   . LYS A 1 54  ? -24.704 -7.610  -4.775  1.00 0.00 ? 54  LYS A CD   1  
ATOM 762   C CE   . LYS A 1 54  ? -26.105 -8.160  -4.499  1.00 0.00 ? 54  LYS A CE   1  
ATOM 763   N NZ   . LYS A 1 54  ? -26.028 -9.561  -4.027  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 764   H H    . LYS A 1 54  ? -25.590 -3.473  -4.440  1.00 0.00 ? 54  LYS A H    1  
ATOM 765   H HA   . LYS A 1 54  ? -26.601 -5.657  -3.001  1.00 0.00 ? 54  LYS A HA   1  
ATOM 766   H HB2  . LYS A 1 54  ? -23.763 -4.703  -3.479  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 767   H HB3  . LYS A 1 54  ? -24.177 -6.243  -2.754  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 768   H HG2  . LYS A 1 54  ? -25.660 -5.739  -5.261  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 769   H HG3  . LYS A 1 54  ? -23.924 -5.733  -5.497  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 770   H HD2  . LYS A 1 54  ? -24.331 -8.012  -5.718  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 771   H HD3  . LYS A 1 54  ? -24.019 -7.941  -3.995  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 772   H HE2  . LYS A 1 54  ? -26.602 -7.544  -3.750  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 773   H HE3  . LYS A 1 54  ? -26.708 -8.108  -5.406  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 774   H HZ1  . LYS A 1 54  ? -25.393 -10.073 -4.606  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 775   H HZ2  . LYS A 1 54  ? -25.704 -9.577  -3.081  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 776   H HZ3  . LYS A 1 54  ? -26.935 -9.979  -4.076  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 777   N N    . GLY A 1 55  ? -25.816 -3.100  -1.298  1.00 0.00 ? 55  GLY A N    1  
ATOM 778   C CA   . GLY A 1 55  ? -25.758 -2.515  0.030   1.00 0.00 ? 55  GLY A CA   1  
ATOM 779   C C    . GLY A 1 55  ? -24.522 -3.000  0.790   1.00 0.00 ? 55  GLY A C    1  
ATOM 780   O O    . GLY A 1 55  ? -24.466 -2.907  2.015   1.00 0.00 ? 55  GLY A O    1  
ATOM 781   H H    . GLY A 1 55  ? -25.892 -2.442  -2.047  1.00 0.00 ? 55  GLY A H    1  
ATOM 782   H HA2  . GLY A 1 55  ? -25.738 -1.428  -0.048  1.00 0.00 ? 55  GLY A HA2  1  
ATOM 783   H HA3  . GLY A 1 55  ? -26.658 -2.778  0.587   1.00 0.00 ? 55  GLY A HA3  1  
ATOM 784   N N    . THR A 1 56  ? -23.562 -3.508  0.031   1.00 0.00 ? 56  THR A N    1  
ATOM 785   C CA   . THR A 1 56  ? -22.330 -4.009  0.617   1.00 0.00 ? 56  THR A CA   1  
ATOM 786   C C    . THR A 1 56  ? -21.257 -2.918  0.614   1.00 0.00 ? 56  THR A C    1  
ATOM 787   O O    . THR A 1 56  ? -21.039 -2.260  -0.402  1.00 0.00 ? 56  THR A O    1  
ATOM 788   C CB   . THR A 1 56  ? -21.920 -5.268  -0.148  1.00 0.00 ? 56  THR A CB   1  
ATOM 789   O OG1  . THR A 1 56  ? -22.161 -4.939  -1.514  1.00 0.00 ? 56  THR A OG1  1  
ATOM 790   C CG2  . THR A 1 56  ? -22.856 -6.448  0.121   1.00 0.00 ? 56  THR A CG2  1  
ATOM 791   H H    . THR A 1 56  ? -23.616 -3.581  -0.965  1.00 0.00 ? 56  THR A H    1  
ATOM 792   H HA   . THR A 1 56  ? -22.524 -4.263  1.659   1.00 0.00 ? 56  THR A HA   1  
ATOM 793   H HB   . THR A 1 56  ? -20.885 -5.534  0.067   1.00 0.00 ? 56  THR A HB   1  
ATOM 794   H HG1  . THR A 1 56  ? -21.644 -4.120  -1.765  1.00 0.00 ? 56  THR A HG1  1  
ATOM 795   H HG21 . THR A 1 56  ? -23.137 -6.912  -0.824  1.00 0.00 ? 56  THR A HG21 1  
ATOM 796   H HG22 . THR A 1 56  ? -22.346 -7.180  0.748   1.00 0.00 ? 56  THR A HG22 1  
ATOM 797   H HG23 . THR A 1 56  ? -23.751 -6.093  0.632   1.00 0.00 ? 56  THR A HG23 1  
ATOM 798   N N    . ASN A 1 57  ? -20.614 -2.762  1.762   1.00 0.00 ? 57  ASN A N    1  
ATOM 799   C CA   . ASN A 1 57  ? -19.569 -1.763  1.904   1.00 0.00 ? 57  ASN A CA   1  
ATOM 800   C C    . ASN A 1 57  ? -18.213 -2.462  2.016   1.00 0.00 ? 57  ASN A C    1  
ATOM 801   O O    . ASN A 1 57  ? -18.039 -3.360  2.838   1.00 0.00 ? 57  ASN A O    1  
ATOM 802   C CB   . ASN A 1 57  ? -19.775 -0.926  3.168   1.00 0.00 ? 57  ASN A CB   1  
ATOM 803   C CG   . ASN A 1 57  ? -18.616 0.052   3.373   1.00 0.00 ? 57  ASN A CG   1  
ATOM 804   O OD1  . ASN A 1 57  ? -17.600 0.000   2.701   1.00 0.00 ? 57  ASN A OD1  1  
ATOM 805   N ND2  . ASN A 1 57  ? -18.826 0.945   4.336   1.00 0.00 ? 57  ASN A ND2  1  
ATOM 806   H H    . ASN A 1 57  ? -20.797 -3.302  2.583   1.00 0.00 ? 57  ASN A H    1  
ATOM 807   H HA   . ASN A 1 57  ? -19.645 -1.140  1.012   1.00 0.00 ? 57  ASN A HA   1  
ATOM 808   H HB2  . ASN A 1 57  ? -20.712 -0.375  3.095   1.00 0.00 ? 57  ASN A HB2  1  
ATOM 809   H HB3  . ASN A 1 57  ? -19.858 -1.583  4.034   1.00 0.00 ? 57  ASN A HB3  1  
ATOM 810   H HD21 . ASN A 1 57  ? -19.684 0.933   4.850   1.00 0.00 ? 57  ASN A HD21 1  
ATOM 811   H HD22 . ASN A 1 57  ? -18.126 1.628   4.546   1.00 0.00 ? 57  ASN A HD22 1  
ATOM 812   N N    . SER A 1 58  ? -17.286 -2.025  1.176   1.00 0.00 ? 58  SER A N    1  
ATOM 813   C CA   . SER A 1 58  ? -15.951 -2.598  1.170   1.00 0.00 ? 58  SER A CA   1  
ATOM 814   C C    . SER A 1 58  ? -14.911 -1.503  1.417   1.00 0.00 ? 58  SER A C    1  
ATOM 815   O O    . SER A 1 58  ? -15.205 -0.318  1.270   1.00 0.00 ? 58  SER A O    1  
ATOM 816   C CB   . SER A 1 58  ? -15.664 -3.314  -0.151  1.00 0.00 ? 58  SER A CB   1  
ATOM 817   O OG   . SER A 1 58  ? -16.571 -4.388  -0.384  1.00 0.00 ? 58  SER A OG   1  
ATOM 818   H H    . SER A 1 58  ? -17.435 -1.294  0.510   1.00 0.00 ? 58  SER A H    1  
ATOM 819   H HA   . SER A 1 58  ? -15.944 -3.323  1.984   1.00 0.00 ? 58  SER A HA   1  
ATOM 820   H HB2  . SER A 1 58  ? -15.730 -2.599  -0.972  1.00 0.00 ? 58  SER A HB2  1  
ATOM 821   H HB3  . SER A 1 58  ? -14.644 -3.696  -0.143  1.00 0.00 ? 58  SER A HB3  1  
ATOM 822   H HG   . SER A 1 58  ? -16.209 -4.994  -1.093  1.00 0.00 ? 58  SER A HG   1  
ATOM 823   N N    . TYR A 1 59  ? -13.716 -1.940  1.789   1.00 0.00 ? 59  TYR A N    1  
ATOM 824   C CA   . TYR A 1 59  ? -12.631 -1.012  2.058   1.00 0.00 ? 59  TYR A CA   1  
ATOM 825   C C    . TYR A 1 59  ? -11.273 -1.659  1.776   1.00 0.00 ? 59  TYR A C    1  
ATOM 826   O O    . TYR A 1 59  ? -10.925 -2.670  2.385   1.00 0.00 ? 59  TYR A O    1  
ATOM 827   C CB   . TYR A 1 59  ? -12.723 -0.676  3.547   1.00 0.00 ? 59  TYR A CB   1  
ATOM 828   C CG   . TYR A 1 59  ? -12.117 -1.740  4.464   1.00 0.00 ? 59  TYR A CG   1  
ATOM 829   C CD1  . TYR A 1 59  ? -10.766 -1.721  4.746   1.00 0.00 ? 59  TYR A CD1  1  
ATOM 830   C CD2  . TYR A 1 59  ? -12.921 -2.720  5.009   1.00 0.00 ? 59  TYR A CD2  1  
ATOM 831   C CE1  . TYR A 1 59  ? -10.195 -2.723  5.608   1.00 0.00 ? 59  TYR A CE1  1  
ATOM 832   C CE2  . TYR A 1 59  ? -12.351 -3.722  5.872   1.00 0.00 ? 59  TYR A CE2  1  
ATOM 833   C CZ   . TYR A 1 59  ? -11.016 -3.674  6.129   1.00 0.00 ? 59  TYR A CZ   1  
ATOM 834   O OH   . TYR A 1 59  ? -10.478 -4.620  6.944   1.00 0.00 ? 59  TYR A OH   1  
ATOM 835   H H    . TYR A 1 59  ? -13.485 -2.906  1.906   1.00 0.00 ? 59  TYR A H    1  
ATOM 836   H HA   . TYR A 1 59  ? -12.756 -0.149  1.404   1.00 0.00 ? 59  TYR A HA   1  
ATOM 837   H HB2  . TYR A 1 59  ? -12.218 0.274   3.727   1.00 0.00 ? 59  TYR A HB2  1  
ATOM 838   H HB3  . TYR A 1 59  ? -13.770 -0.535  3.814   1.00 0.00 ? 59  TYR A HB3  1  
ATOM 839   H HD1  . TYR A 1 59  ? -10.131 -0.947  4.315   1.00 0.00 ? 59  TYR A HD1  1  
ATOM 840   H HD2  . TYR A 1 59  ? -13.988 -2.736  4.787   1.00 0.00 ? 59  TYR A HD2  1  
ATOM 841   H HE1  . TYR A 1 59  ? -9.130  -2.719  5.839   1.00 0.00 ? 59  TYR A HE1  1  
ATOM 842   H HE2  . TYR A 1 59  ? -12.975 -4.502  6.310   1.00 0.00 ? 59  TYR A HE2  1  
ATOM 843   H HH   . TYR A 1 59  ? -10.135 -5.386  6.399   1.00 0.00 ? 59  TYR A HH   1  
ATOM 844   N N    . TYR A 1 60  ? -10.544 -1.051  0.853   1.00 0.00 ? 60  TYR A N    1  
ATOM 845   C CA   . TYR A 1 60  ? -9.232  -1.555  0.483   1.00 0.00 ? 60  TYR A CA   1  
ATOM 846   C C    . TYR A 1 60  ? -8.126  -0.615  0.967   1.00 0.00 ? 60  TYR A C    1  
ATOM 847   O O    . TYR A 1 60  ? -8.192  0.593   0.744   1.00 0.00 ? 60  TYR A O    1  
ATOM 848   C CB   . TYR A 1 60  ? -9.213  -1.600  -1.046  1.00 0.00 ? 60  TYR A CB   1  
ATOM 849   C CG   . TYR A 1 60  ? -7.982  -2.293  -1.633  1.00 0.00 ? 60  TYR A CG   1  
ATOM 850   C CD1  . TYR A 1 60  ? -6.787  -1.611  -1.730  1.00 0.00 ? 60  TYR A CD1  1  
ATOM 851   C CD2  . TYR A 1 60  ? -8.067  -3.601  -2.067  1.00 0.00 ? 60  TYR A CD2  1  
ATOM 852   C CE1  . TYR A 1 60  ? -5.628  -2.263  -2.282  1.00 0.00 ? 60  TYR A CE1  1  
ATOM 853   C CE2  . TYR A 1 60  ? -6.909  -4.253  -2.619  1.00 0.00 ? 60  TYR A CE2  1  
ATOM 854   C CZ   . TYR A 1 60  ? -5.746  -3.552  -2.700  1.00 0.00 ? 60  TYR A CZ   1  
ATOM 855   O OH   . TYR A 1 60  ? -4.652  -4.168  -3.222  1.00 0.00 ? 60  TYR A OH   1  
ATOM 856   H H    . TYR A 1 60  ? -10.834 -0.229  0.362   1.00 0.00 ? 60  TYR A H    1  
ATOM 857   H HA   . TYR A 1 60  ? -9.102  -2.530  0.953   1.00 0.00 ? 60  TYR A HA   1  
ATOM 858   H HB2  . TYR A 1 60  ? -10.108 -2.115  -1.396  1.00 0.00 ? 60  TYR A HB2  1  
ATOM 859   H HB3  . TYR A 1 60  ? -9.261  -0.581  -1.430  1.00 0.00 ? 60  TYR A HB3  1  
ATOM 860   H HD1  . TYR A 1 60  ? -6.719  -0.578  -1.388  1.00 0.00 ? 60  TYR A HD1  1  
ATOM 861   H HD2  . TYR A 1 60  ? -9.012  -4.140  -1.991  1.00 0.00 ? 60  TYR A HD2  1  
ATOM 862   H HE1  . TYR A 1 60  ? -4.677  -1.736  -2.364  1.00 0.00 ? 60  TYR A HE1  1  
ATOM 863   H HE2  . TYR A 1 60  ? -6.962  -5.285  -2.965  1.00 0.00 ? 60  TYR A HE2  1  
ATOM 864   H HH   . TYR A 1 60  ? -3.838  -3.925  -2.695  1.00 0.00 ? 60  TYR A HH   1  
ATOM 865   N N    . LYS A 1 61  ? -7.137  -1.205  1.621   1.00 0.00 ? 61  LYS A N    1  
ATOM 866   C CA   . LYS A 1 61  ? -6.018  -0.436  2.139   1.00 0.00 ? 61  LYS A CA   1  
ATOM 867   C C    . LYS A 1 61  ? -4.717  -0.964  1.533   1.00 0.00 ? 61  LYS A C    1  
ATOM 868   O O    . LYS A 1 61  ? -4.523  -2.174  1.428   1.00 0.00 ? 61  LYS A O    1  
ATOM 869   C CB   . LYS A 1 61  ? -6.029  -0.439  3.669   1.00 0.00 ? 61  LYS A CB   1  
ATOM 870   C CG   . LYS A 1 61  ? -6.083  0.988   4.220   1.00 0.00 ? 61  LYS A CG   1  
ATOM 871   C CD   . LYS A 1 61  ? -4.707  1.654   4.153   1.00 0.00 ? 61  LYS A CD   1  
ATOM 872   C CE   . LYS A 1 61  ? -4.358  2.326   5.482   1.00 0.00 ? 61  LYS A CE   1  
ATOM 873   N NZ   . LYS A 1 61  ? -3.237  3.276   5.304   1.00 0.00 ? 61  LYS A NZ   1  
ATOM 874   H H    . LYS A 1 61  ? -7.091  -2.189  1.799   1.00 0.00 ? 61  LYS A H    1  
ATOM 875   H HA   . LYS A 1 61  ? -6.155  0.597   1.818   1.00 0.00 ? 61  LYS A HA   1  
ATOM 876   H HB2  . LYS A 1 61  ? -6.888  -1.004  4.030   1.00 0.00 ? 61  LYS A HB2  1  
ATOM 877   H HB3  . LYS A 1 61  ? -5.137  -0.943  4.042   1.00 0.00 ? 61  LYS A HB3  1  
ATOM 878   H HG2  . LYS A 1 61  ? -6.803  1.575   3.649   1.00 0.00 ? 61  LYS A HG2  1  
ATOM 879   H HG3  . LYS A 1 61  ? -6.433  0.970   5.252   1.00 0.00 ? 61  LYS A HG3  1  
ATOM 880   H HD2  . LYS A 1 61  ? -3.950  0.909   3.909   1.00 0.00 ? 61  LYS A HD2  1  
ATOM 881   H HD3  . LYS A 1 61  ? -4.696  2.394   3.353   1.00 0.00 ? 61  LYS A HD3  1  
ATOM 882   H HE2  . LYS A 1 61  ? -5.230  2.853   5.870   1.00 0.00 ? 61  LYS A HE2  1  
ATOM 883   H HE3  . LYS A 1 61  ? -4.088  1.570   6.219   1.00 0.00 ? 61  LYS A HE3  1  
ATOM 884   H HZ1  . LYS A 1 61  ? -2.819  3.469   6.192   1.00 0.00 ? 61  LYS A HZ1  1  
ATOM 885   H HZ2  . LYS A 1 61  ? -2.554  2.875   4.694   1.00 0.00 ? 61  LYS A HZ2  1  
ATOM 886   H HZ3  . LYS A 1 61  ? -3.581  4.127   4.906   1.00 0.00 ? 61  LYS A HZ3  1  
ATOM 887   N N    . LEU A 1 62  ? -3.859  -0.030  1.149   1.00 0.00 ? 62  LEU A N    1  
ATOM 888   C CA   . LEU A 1 62  ? -2.581  -0.387  0.556   1.00 0.00 ? 62  LEU A CA   1  
ATOM 889   C C    . LEU A 1 62  ? -1.458  0.342   1.297   1.00 0.00 ? 62  LEU A C    1  
ATOM 890   O O    . LEU A 1 62  ? -1.555  1.541   1.554   1.00 0.00 ? 62  LEU A O    1  
ATOM 891   C CB   . LEU A 1 62  ? -2.597  -0.120  -0.951  1.00 0.00 ? 62  LEU A CB   1  
ATOM 892   C CG   . LEU A 1 62  ? -1.510  -0.821  -1.768  1.00 0.00 ? 62  LEU A CG   1  
ATOM 893   C CD1  . LEU A 1 62  ? -1.891  -2.274  -2.056  1.00 0.00 ? 62  LEU A CD1  1  
ATOM 894   C CD2  . LEU A 1 62  ? -1.200  -0.045  -3.049  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 895   H H    . LEU A 1 62  ? -4.024  0.952   1.238   1.00 0.00 ? 62  LEU A H    1  
ATOM 896   H HA   . LEU A 1 62  ? -2.445  -1.460  0.692   1.00 0.00 ? 62  LEU A HA   1  
ATOM 897   H HB2  . LEU A 1 62  ? -3.569  -0.421  -1.343  1.00 0.00 ? 62  LEU A HB2  1  
ATOM 898   H HB3  . LEU A 1 62  ? -2.508  0.954   -1.111  1.00 0.00 ? 62  LEU A HB3  1  
ATOM 899   H HG   . LEU A 1 62  ? -0.595  -0.840  -1.174  1.00 0.00 ? 62  LEU A HG   1  
ATOM 900   H HD11 . LEU A 1 62  ? -2.481  -2.320  -2.972  1.00 0.00 ? 62  LEU A HD11 1  
ATOM 901   H HD12 . LEU A 1 62  ? -0.987  -2.871  -2.176  1.00 0.00 ? 62  LEU A HD12 1  
ATOM 902   H HD13 . LEU A 1 62  ? -2.478  -2.667  -1.226  1.00 0.00 ? 62  LEU A HD13 1  
ATOM 903   H HD21 . LEU A 1 62  ? -1.507  0.994   -2.927  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 904   H HD22 . LEU A 1 62  ? -0.130  -0.086  -3.249  1.00 0.00 ? 62  LEU A HD22 1  
ATOM 905   H HD23 . LEU A 1 62  ? -1.744  -0.489  -3.883  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 906   N N    . GLN A 1 63  ? -0.418  -0.413  1.620   1.00 0.00 ? 63  GLN A N    1  
ATOM 907   C CA   . GLN A 1 63  ? 0.722   0.146   2.327   1.00 0.00 ? 63  GLN A CA   1  
ATOM 908   C C    . GLN A 1 63  ? 1.997   -0.617  1.963   1.00 0.00 ? 63  GLN A C    1  
ATOM 909   O O    . GLN A 1 63  ? 2.082   -1.826  2.170   1.00 0.00 ? 63  GLN A O    1  
ATOM 910   C CB   . GLN A 1 63  ? 0.488   0.135   3.839   1.00 0.00 ? 63  GLN A CB   1  
ATOM 911   C CG   . GLN A 1 63  ? -0.649  1.083   4.225   1.00 0.00 ? 63  GLN A CG   1  
ATOM 912   C CD   . GLN A 1 63  ? -0.791  1.179   5.745   1.00 0.00 ? 63  GLN A CD   1  
ATOM 913   O OE1  . GLN A 1 63  ? -1.535  0.443   6.373   1.00 0.00 ? 63  GLN A OE1  1  
ATOM 914   N NE2  . GLN A 1 63  ? -0.039  2.125   6.300   1.00 0.00 ? 63  GLN A NE2  1  
ATOM 915   H H    . GLN A 1 63  ? -0.347  -1.388  1.407   1.00 0.00 ? 63  GLN A H    1  
ATOM 916   H HA   . GLN A 1 63  ? 0.797   1.178   1.984   1.00 0.00 ? 63  GLN A HA   1  
ATOM 917   H HB2  . GLN A 1 63  ? 0.250   -0.877  4.167   1.00 0.00 ? 63  GLN A HB2  1  
ATOM 918   H HB3  . GLN A 1 63  ? 1.403   0.431   4.353   1.00 0.00 ? 63  GLN A HB3  1  
ATOM 919   H HG2  . GLN A 1 63  ? -0.459  2.073   3.810   1.00 0.00 ? 63  GLN A HG2  1  
ATOM 920   H HG3  . GLN A 1 63  ? -1.585  0.730   3.790   1.00 0.00 ? 63  GLN A HG3  1  
ATOM 921   H HE21 . GLN A 1 63  ? 0.550   2.695   5.727   1.00 0.00 ? 63  GLN A HE21 1  
ATOM 922   H HE22 . GLN A 1 63  ? -0.062  2.265   7.290   1.00 0.00 ? 63  GLN A HE22 1  
ATOM 923   N N    . LEU A 1 64  ? 2.958   0.122   1.429   1.00 0.00 ? 64  LEU A N    1  
ATOM 924   C CA   . LEU A 1 64  ? 4.226   -0.469  1.035   1.00 0.00 ? 64  LEU A CA   1  
ATOM 925   C C    . LEU A 1 64  ? 5.248   -0.266  2.154   1.00 0.00 ? 64  LEU A C    1  
ATOM 926   O O    . LEU A 1 64  ? 5.795   0.825   2.310   1.00 0.00 ? 64  LEU A O    1  
ATOM 927   C CB   . LEU A 1 64  ? 4.677   0.084   -0.319  1.00 0.00 ? 64  LEU A CB   1  
ATOM 928   C CG   . LEU A 1 64  ? 6.068   -0.348  -0.789  1.00 0.00 ? 64  LEU A CG   1  
ATOM 929   C CD1  . LEU A 1 64  ? 6.460   -1.694  -0.176  1.00 0.00 ? 64  LEU A CD1  1  
ATOM 930   C CD2  . LEU A 1 64  ? 6.147   -0.369  -2.317  1.00 0.00 ? 64  LEU A CD2  1  
ATOM 931   H H    . LEU A 1 64  ? 2.882   1.106   1.264   1.00 0.00 ? 64  LEU A H    1  
ATOM 932   H HA   . LEU A 1 64  ? 4.061   -1.539  0.907   1.00 0.00 ? 64  LEU A HA   1  
ATOM 933   H HB2  . LEU A 1 64  ? 3.950   -0.218  -1.073  1.00 0.00 ? 64  LEU A HB2  1  
ATOM 934   H HB3  . LEU A 1 64  ? 4.654   1.172   -0.270  1.00 0.00 ? 64  LEU A HB3  1  
ATOM 935   H HG   . LEU A 1 64  ? 6.791   0.388   -0.439  1.00 0.00 ? 64  LEU A HG   1  
ATOM 936   H HD11 . LEU A 1 64  ? 7.268   -2.137  -0.760  1.00 0.00 ? 64  LEU A HD11 1  
ATOM 937   H HD12 . LEU A 1 64  ? 6.795   -1.542  0.850   1.00 0.00 ? 64  LEU A HD12 1  
ATOM 938   H HD13 . LEU A 1 64  ? 5.599   -2.361  -0.183  1.00 0.00 ? 64  LEU A HD13 1  
ATOM 939   H HD21 . LEU A 1 64  ? 7.147   -0.677  -2.625  1.00 0.00 ? 64  LEU A HD21 1  
ATOM 940   H HD22 . LEU A 1 64  ? 5.413   -1.073  -2.710  1.00 0.00 ? 64  LEU A HD22 1  
ATOM 941   H HD23 . LEU A 1 64  ? 5.938   0.628   -2.705  1.00 0.00 ? 64  LEU A HD23 1  
ATOM 942   N N    . LEU A 1 65  ? 5.476   -1.333  2.905   1.00 0.00 ? 65  LEU A N    1  
ATOM 943   C CA   . LEU A 1 65  ? 6.424   -1.286  4.006   1.00 0.00 ? 65  LEU A CA   1  
ATOM 944   C C    . LEU A 1 65  ? 7.828   -1.584  3.477   1.00 0.00 ? 65  LEU A C    1  
ATOM 945   O O    . LEU A 1 65  ? 7.993   -2.391  2.563   1.00 0.00 ? 65  LEU A O    1  
ATOM 946   C CB   . LEU A 1 65  ? 5.981   -2.218  5.135   1.00 0.00 ? 65  LEU A CB   1  
ATOM 947   C CG   . LEU A 1 65  ? 4.473   -2.310  5.376   1.00 0.00 ? 65  LEU A CG   1  
ATOM 948   C CD1  . LEU A 1 65  ? 4.112   -3.603  6.109   1.00 0.00 ? 65  LEU A CD1  1  
ATOM 949   C CD2  . LEU A 1 65  ? 3.959   -1.071  6.113   1.00 0.00 ? 65  LEU A CD2  1  
ATOM 950   H H    . LEU A 1 65  ? 5.028   -2.217  2.772   1.00 0.00 ? 65  LEU A H    1  
ATOM 951   H HA   . LEU A 1 65  ? 6.413   -0.271  4.403   1.00 0.00 ? 65  LEU A HA   1  
ATOM 952   H HB2  . LEU A 1 65  ? 6.356   -3.219  4.921   1.00 0.00 ? 65  LEU A HB2  1  
ATOM 953   H HB3  . LEU A 1 65  ? 6.457   -1.890  6.059   1.00 0.00 ? 65  LEU A HB3  1  
ATOM 954   H HG   . LEU A 1 65  ? 3.973   -2.338  4.408   1.00 0.00 ? 65  LEU A HG   1  
ATOM 955   H HD11 . LEU A 1 65  ? 3.030   -3.664  6.228   1.00 0.00 ? 65  LEU A HD11 1  
ATOM 956   H HD12 . LEU A 1 65  ? 4.464   -4.458  5.532   1.00 0.00 ? 65  LEU A HD12 1  
ATOM 957   H HD13 . LEU A 1 65  ? 4.586   -3.609  7.091   1.00 0.00 ? 65  LEU A HD13 1  
ATOM 958   H HD21 . LEU A 1 65  ? 4.243   -1.129  7.164   1.00 0.00 ? 65  LEU A HD21 1  
ATOM 959   H HD22 . LEU A 1 65  ? 4.395   -0.177  5.668   1.00 0.00 ? 65  LEU A HD22 1  
ATOM 960   H HD23 . LEU A 1 65  ? 2.873   -1.025  6.032   1.00 0.00 ? 65  LEU A HD23 1  
ATOM 961   N N    . GLU A 1 66  ? 8.805   -0.918  4.075   1.00 0.00 ? 66  GLU A N    1  
ATOM 962   C CA   . GLU A 1 66  ? 10.190  -1.102  3.676   1.00 0.00 ? 66  GLU A CA   1  
ATOM 963   C C    . GLU A 1 66  ? 11.024  -1.591  4.862   1.00 0.00 ? 66  GLU A C    1  
ATOM 964   O O    . GLU A 1 66  ? 10.973  -1.006  5.944   1.00 0.00 ? 66  GLU A O    1  
ATOM 965   C CB   . GLU A 1 66  ? 10.769  0.189   3.094   1.00 0.00 ? 66  GLU A CB   1  
ATOM 966   C CG   . GLU A 1 66  ? 11.019  1.223   4.194   1.00 0.00 ? 66  GLU A CG   1  
ATOM 967   C CD   . GLU A 1 66  ? 11.630  2.501   3.616   1.00 0.00 ? 66  GLU A CD   1  
ATOM 968   O OE1  . GLU A 1 66  ? 12.793  2.421   3.166   1.00 0.00 ? 66  GLU A OE1  1  
ATOM 969   O OE2  . GLU A 1 66  ? 10.920  3.529   3.637   1.00 0.00 ? 66  GLU A OE2  1  
ATOM 970   H H    . GLU A 1 66  ? 8.662   -0.264  4.818   1.00 0.00 ? 66  GLU A H    1  
ATOM 971   H HA   . GLU A 1 66  ? 10.169  -1.866  2.899   1.00 0.00 ? 66  GLU A HA   1  
ATOM 972   H HB2  . GLU A 1 66  ? 11.702  -0.029  2.575   1.00 0.00 ? 66  GLU A HB2  1  
ATOM 973   H HB3  . GLU A 1 66  ? 10.081  0.599   2.354   1.00 0.00 ? 66  GLU A HB3  1  
ATOM 974   H HG2  . GLU A 1 66  ? 10.081  1.459   4.696   1.00 0.00 ? 66  GLU A HG2  1  
ATOM 975   H HG3  . GLU A 1 66  ? 11.687  0.804   4.946   1.00 0.00 ? 66  GLU A HG3  1  
ATOM 976   N N    . ASP A 1 67  ? 11.772  -2.657  4.620   1.00 0.00 ? 67  ASP A N    1  
ATOM 977   C CA   . ASP A 1 67  ? 12.615  -3.231  5.655   1.00 0.00 ? 67  ASP A CA   1  
ATOM 978   C C    . ASP A 1 67  ? 13.761  -2.266  5.965   1.00 0.00 ? 67  ASP A C    1  
ATOM 979   O O    . ASP A 1 67  ? 14.455  -1.808  5.059   1.00 0.00 ? 67  ASP A O    1  
ATOM 980   C CB   . ASP A 1 67  ? 13.225  -4.557  5.196   1.00 0.00 ? 67  ASP A CB   1  
ATOM 981   C CG   . ASP A 1 67  ? 13.492  -5.567  6.314   1.00 0.00 ? 67  ASP A CG   1  
ATOM 982   O OD1  . ASP A 1 67  ? 13.030  -5.297  7.444   1.00 0.00 ? 67  ASP A OD1  1  
ATOM 983   O OD2  . ASP A 1 67  ? 14.151  -6.585  6.013   1.00 0.00 ? 67  ASP A OD2  1  
ATOM 984   H H    . ASP A 1 67  ? 11.807  -3.126  3.737   1.00 0.00 ? 67  ASP A H    1  
ATOM 985   H HA   . ASP A 1 67  ? 11.956  -3.384  6.509   1.00 0.00 ? 67  ASP A HA   1  
ATOM 986   H HB2  . ASP A 1 67  ? 12.557  -5.013  4.466   1.00 0.00 ? 67  ASP A HB2  1  
ATOM 987   H HB3  . ASP A 1 67  ? 14.164  -4.349  4.682   1.00 0.00 ? 67  ASP A HB3  1  
ATOM 988   N N    . ASP A 1 68  ? 13.924  -1.986  7.250   1.00 0.00 ? 68  ASP A N    1  
ATOM 989   C CA   . ASP A 1 68  ? 14.974  -1.083  7.692   1.00 0.00 ? 68  ASP A CA   1  
ATOM 990   C C    . ASP A 1 68  ? 16.061  -1.886  8.411   1.00 0.00 ? 68  ASP A C    1  
ATOM 991   O O    . ASP A 1 68  ? 16.537  -1.482  9.470   1.00 0.00 ? 68  ASP A O    1  
ATOM 992   C CB   . ASP A 1 68  ? 14.430  -0.042  8.671   1.00 0.00 ? 68  ASP A CB   1  
ATOM 993   C CG   . ASP A 1 68  ? 15.384  1.112   8.985   1.00 0.00 ? 68  ASP A CG   1  
ATOM 994   O OD1  . ASP A 1 68  ? 16.559  1.005   8.572   1.00 0.00 ? 68  ASP A OD1  1  
ATOM 995   O OD2  . ASP A 1 68  ? 14.918  2.075   9.631   1.00 0.00 ? 68  ASP A OD2  1  
ATOM 996   H H    . ASP A 1 68  ? 13.356  -2.362  7.981   1.00 0.00 ? 68  ASP A H    1  
ATOM 997   H HA   . ASP A 1 68  ? 15.341  -0.605  6.784   1.00 0.00 ? 68  ASP A HA   1  
ATOM 998   H HB2  . ASP A 1 68  ? 13.507  0.371   8.263   1.00 0.00 ? 68  ASP A HB2  1  
ATOM 999   H HB3  . ASP A 1 68  ? 14.170  -0.543  9.604   1.00 0.00 ? 68  ASP A HB3  1  
ATOM 1000  N N    . LYS A 1 69  ? 16.421  -3.008  7.806   1.00 0.00 ? 69  LYS A N    1  
ATOM 1001  C CA   . LYS A 1 69  ? 17.443  -3.870  8.375   1.00 0.00 ? 69  LYS A CA   1  
ATOM 1002  C C    . LYS A 1 69  ? 18.660  -3.892  7.448   1.00 0.00 ? 69  LYS A C    1  
ATOM 1003  O O    . LYS A 1 69  ? 19.724  -3.387  7.804   1.00 0.00 ? 69  LYS A O    1  
ATOM 1004  C CB   . LYS A 1 69  ? 16.870  -5.258  8.669   1.00 0.00 ? 69  LYS A CB   1  
ATOM 1005  C CG   . LYS A 1 69  ? 15.908  -5.213  9.858   1.00 0.00 ? 69  LYS A CG   1  
ATOM 1006  C CD   . LYS A 1 69  ? 16.041  -6.471  10.719  1.00 0.00 ? 69  LYS A CD   1  
ATOM 1007  C CE   . LYS A 1 69  ? 15.327  -6.295  12.061  1.00 0.00 ? 69  LYS A CE   1  
ATOM 1008  N NZ   . LYS A 1 69  ? 15.383  -7.548  12.846  1.00 0.00 ? 69  LYS A NZ   1  
ATOM 1009  H H    . LYS A 1 69  ? 16.029  -3.329  6.944   1.00 0.00 ? 69  LYS A H    1  
ATOM 1010  H HA   . LYS A 1 69  ? 17.742  -3.436  9.329   1.00 0.00 ? 69  LYS A HA   1  
ATOM 1011  H HB2  . LYS A 1 69  ? 16.348  -5.635  7.789   1.00 0.00 ? 69  LYS A HB2  1  
ATOM 1012  H HB3  . LYS A 1 69  ? 17.682  -5.954  8.880   1.00 0.00 ? 69  LYS A HB3  1  
ATOM 1013  H HG2  . LYS A 1 69  ? 16.113  -4.330  10.463  1.00 0.00 ? 69  LYS A HG2  1  
ATOM 1014  H HG3  . LYS A 1 69  ? 14.883  -5.121  9.498   1.00 0.00 ? 69  LYS A HG3  1  
ATOM 1015  H HD2  . LYS A 1 69  ? 15.621  -7.325  10.189  1.00 0.00 ? 69  LYS A HD2  1  
ATOM 1016  H HD3  . LYS A 1 69  ? 17.096  -6.689  10.890  1.00 0.00 ? 69  LYS A HD3  1  
ATOM 1017  H HE2  . LYS A 1 69  ? 15.792  -5.485  12.624  1.00 0.00 ? 69  LYS A HE2  1  
ATOM 1018  H HE3  . LYS A 1 69  ? 14.289  -6.011  11.892  1.00 0.00 ? 69  LYS A HE3  1  
ATOM 1019  H HZ1  . LYS A 1 69  ? 15.570  -7.333  13.804  1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 1020  H HZ2  . LYS A 1 69  ? 14.507  -8.025  12.776  1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 1021  H HZ3  . LYS A 1 69  ? 16.111  -8.134  12.488  1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 1022  N N    . GLU A 1 70  ? 18.463  -4.481  6.278   1.00 0.00 ? 70  GLU A N    1  
ATOM 1023  C CA   . GLU A 1 70  ? 19.532  -4.575  5.298   1.00 0.00 ? 70  GLU A CA   1  
ATOM 1024  C C    . GLU A 1 70  ? 19.053  -4.058  3.940   1.00 0.00 ? 70  GLU A C    1  
ATOM 1025  O O    . GLU A 1 70  ? 19.674  -3.171  3.355   1.00 0.00 ? 70  GLU A O    1  
ATOM 1026  C CB   . GLU A 1 70  ? 20.049  -6.010  5.187   1.00 0.00 ? 70  GLU A CB   1  
ATOM 1027  C CG   . GLU A 1 70  ? 18.963  -7.016  5.573   1.00 0.00 ? 70  GLU A CG   1  
ATOM 1028  C CD   . GLU A 1 70  ? 19.517  -8.443  5.587   1.00 0.00 ? 70  GLU A CD   1  
ATOM 1029  O OE1  . GLU A 1 70  ? 19.781  -8.959  4.480   1.00 0.00 ? 70  GLU A OE1  1  
ATOM 1030  O OE2  . GLU A 1 70  ? 19.663  -8.984  6.704   1.00 0.00 ? 70  GLU A OE2  1  
ATOM 1031  H H    . GLU A 1 70  ? 17.595  -4.889  5.997   1.00 0.00 ? 70  GLU A H    1  
ATOM 1032  H HA   . GLU A 1 70  ? 20.330  -3.936  5.677   1.00 0.00 ? 70  GLU A HA   1  
ATOM 1033  H HB2  . GLU A 1 70  ? 20.382  -6.203  4.167   1.00 0.00 ? 70  GLU A HB2  1  
ATOM 1034  H HB3  . GLU A 1 70  ? 20.916  -6.139  5.835   1.00 0.00 ? 70  GLU A HB3  1  
ATOM 1035  H HG2  . GLU A 1 70  ? 18.565  -6.767  6.557   1.00 0.00 ? 70  GLU A HG2  1  
ATOM 1036  H HG3  . GLU A 1 70  ? 18.134  -6.951  4.868   1.00 0.00 ? 70  GLU A HG3  1  
ATOM 1037  N N    . ASN A 1 71  ? 17.953  -4.633  3.477   1.00 0.00 ? 71  ASN A N    1  
ATOM 1038  C CA   . ASN A 1 71  ? 17.384  -4.242  2.199   1.00 0.00 ? 71  ASN A CA   1  
ATOM 1039  C C    . ASN A 1 71  ? 16.272  -5.221  1.819   1.00 0.00 ? 71  ASN A C    1  
ATOM 1040  O O    . ASN A 1 71  ? 16.514  -6.194  1.106   1.00 0.00 ? 71  ASN A O    1  
ATOM 1041  C CB   . ASN A 1 71  ? 18.441  -4.274  1.093   1.00 0.00 ? 71  ASN A CB   1  
ATOM 1042  C CG   . ASN A 1 71  ? 19.181  -5.612  1.080   1.00 0.00 ? 71  ASN A CG   1  
ATOM 1043  O OD1  . ASN A 1 71  ? 19.644  -6.105  2.096   1.00 0.00 ? 71  ASN A OD1  1  
ATOM 1044  N ND2  . ASN A 1 71  ? 19.266  -6.172  -0.123  1.00 0.00 ? 71  ASN A ND2  1  
ATOM 1045  H H    . ASN A 1 71  ? 17.454  -5.354  3.959   1.00 0.00 ? 71  ASN A H    1  
ATOM 1046  H HA   . ASN A 1 71  ? 17.014  -3.228  2.349   1.00 0.00 ? 71  ASN A HA   1  
ATOM 1047  H HB2  . ASN A 1 71  ? 17.966  -4.107  0.126   1.00 0.00 ? 71  ASN A HB2  1  
ATOM 1048  H HB3  . ASN A 1 71  ? 19.153  -3.462  1.242   1.00 0.00 ? 71  ASN A HB3  1  
ATOM 1049  H HD21 . ASN A 1 71  ? 18.864  -5.715  -0.917  1.00 0.00 ? 71  ASN A HD21 1  
ATOM 1050  H HD22 . ASN A 1 71  ? 19.732  -7.050  -0.235  1.00 0.00 ? 71  ASN A HD22 1  
ATOM 1051  N N    . ARG A 1 72  ? 15.077  -4.931  2.312   1.00 0.00 ? 72  ARG A N    1  
ATOM 1052  C CA   . ARG A 1 72  ? 13.928  -5.774  2.033   1.00 0.00 ? 72  ARG A CA   1  
ATOM 1053  C C    . ARG A 1 72  ? 12.640  -4.948  2.078   1.00 0.00 ? 72  ARG A C    1  
ATOM 1054  O O    . ARG A 1 72  ? 12.641  -3.816  2.559   1.00 0.00 ? 72  ARG A O    1  
ATOM 1055  C CB   . ARG A 1 72  ? 13.826  -6.919  3.043   1.00 0.00 ? 72  ARG A CB   1  
ATOM 1056  C CG   . ARG A 1 72  ? 13.914  -8.277  2.344   1.00 0.00 ? 72  ARG A CG   1  
ATOM 1057  C CD   . ARG A 1 72  ? 13.755  -9.422  3.346   1.00 0.00 ? 72  ARG A CD   1  
ATOM 1058  N NE   . ARG A 1 72  ? 14.735  -10.491 3.054   1.00 0.00 ? 72  ARG A NE   1  
ATOM 1059  C CZ   . ARG A 1 72  ? 15.061  -11.467 3.912   1.00 0.00 ? 72  ARG A CZ   1  
ATOM 1060  N NH1  . ARG A 1 72  ? 14.486  -11.515 5.121   1.00 0.00 ? 72  ARG A NH1  1  
ATOM 1061  N NH2  . ARG A 1 72  ? 15.961  -12.395 3.561   1.00 0.00 ? 72  ARG A NH2  1  
ATOM 1062  H H    . ARG A 1 72  ? 14.889  -4.138  2.892   1.00 0.00 ? 72  ARG A H    1  
ATOM 1063  H HA   . ARG A 1 72  ? 14.107  -6.168  1.033   1.00 0.00 ? 72  ARG A HA   1  
ATOM 1064  H HB2  . ARG A 1 72  ? 14.626  -6.832  3.778   1.00 0.00 ? 72  ARG A HB2  1  
ATOM 1065  H HB3  . ARG A 1 72  ? 12.884  -6.847  3.587   1.00 0.00 ? 72  ARG A HB3  1  
ATOM 1066  H HG2  . ARG A 1 72  ? 13.139  -8.347  1.580   1.00 0.00 ? 72  ARG A HG2  1  
ATOM 1067  H HG3  . ARG A 1 72  ? 14.873  -8.366  1.834   1.00 0.00 ? 72  ARG A HG3  1  
ATOM 1068  H HD2  . ARG A 1 72  ? 13.900  -9.051  4.361   1.00 0.00 ? 72  ARG A HD2  1  
ATOM 1069  H HD3  . ARG A 1 72  ? 12.742  -9.822  3.296   1.00 0.00 ? 72  ARG A HD3  1  
ATOM 1070  H HE   . ARG A 1 72  ? 15.183  -10.484 2.160   1.00 0.00 ? 72  ARG A HE   1  
ATOM 1071  H HH11 . ARG A 1 72  ? 13.814  -10.822 5.383   1.00 0.00 ? 72  ARG A HH11 1  
ATOM 1072  H HH12 . ARG A 1 72  ? 14.729  -12.244 5.762   1.00 0.00 ? 72  ARG A HH12 1  
ATOM 1073  H HH21 . ARG A 1 72  ? 16.391  -12.359 2.659   1.00 0.00 ? 72  ARG A HH21 1  
ATOM 1074  H HH22 . ARG A 1 72  ? 16.204  -13.123 4.202   1.00 0.00 ? 72  ARG A HH22 1  
ATOM 1075  N N    . TYR A 1 73  ? 11.573  -5.547  1.570   1.00 0.00 ? 73  TYR A N    1  
ATOM 1076  C CA   . TYR A 1 73  ? 10.282  -4.881  1.546   1.00 0.00 ? 73  TYR A CA   1  
ATOM 1077  C C    . TYR A 1 73  ? 9.140   -5.899  1.555   1.00 0.00 ? 73  TYR A C    1  
ATOM 1078  O O    . TYR A 1 73  ? 9.325   -7.049  1.160   1.00 0.00 ? 73  TYR A O    1  
ATOM 1079  C CB   . TYR A 1 73  ? 10.238  -4.095  0.235   1.00 0.00 ? 73  TYR A CB   1  
ATOM 1080  C CG   . TYR A 1 73  ? 11.301  -3.000  0.129   1.00 0.00 ? 73  TYR A CG   1  
ATOM 1081  C CD1  . TYR A 1 73  ? 12.576  -3.315  -0.298  1.00 0.00 ? 73  TYR A CD1  1  
ATOM 1082  C CD2  . TYR A 1 73  ? 10.987  -1.698  0.461   1.00 0.00 ? 73  TYR A CD2  1  
ATOM 1083  C CE1  . TYR A 1 73  ? 13.577  -2.285  -0.397  1.00 0.00 ? 73  TYR A CE1  1  
ATOM 1084  C CE2  . TYR A 1 73  ? 11.989  -0.668  0.362   1.00 0.00 ? 73  TYR A CE2  1  
ATOM 1085  C CZ   . TYR A 1 73  ? 13.234  -1.012  -0.062  1.00 0.00 ? 73  TYR A CZ   1  
ATOM 1086  O OH   . TYR A 1 73  ? 14.180  -0.039  -0.156  1.00 0.00 ? 73  TYR A OH   1  
ATOM 1087  H H    . TYR A 1 73  ? 11.581  -6.468  1.181   1.00 0.00 ? 73  TYR A H    1  
ATOM 1088  H HA   . TYR A 1 73  ? 10.209  -4.256  2.436   1.00 0.00 ? 73  TYR A HA   1  
ATOM 1089  H HB2  . TYR A 1 73  ? 10.361  -4.788  -0.598  1.00 0.00 ? 73  TYR A HB2  1  
ATOM 1090  H HB3  . TYR A 1 73  ? 9.252   -3.641  0.128   1.00 0.00 ? 73  TYR A HB3  1  
ATOM 1091  H HD1  . TYR A 1 73  ? 12.824  -4.344  -0.560  1.00 0.00 ? 73  TYR A HD1  1  
ATOM 1092  H HD2  . TYR A 1 73  ? 9.981   -1.449  0.798   1.00 0.00 ? 73  TYR A HD2  1  
ATOM 1093  H HE1  . TYR A 1 73  ? 14.587  -2.520  -0.733  1.00 0.00 ? 73  TYR A HE1  1  
ATOM 1094  H HE2  . TYR A 1 73  ? 11.754  0.364   0.621   1.00 0.00 ? 73  TYR A HE2  1  
ATOM 1095  H HH   . TYR A 1 73  ? 14.600  -0.058  -1.063  1.00 0.00 ? 73  TYR A HH   1  
ATOM 1096  N N    . TRP A 1 74  ? 7.983   -5.439  2.011   1.00 0.00 ? 74  TRP A N    1  
ATOM 1097  C CA   . TRP A 1 74  ? 6.811   -6.295  2.076   1.00 0.00 ? 74  TRP A CA   1  
ATOM 1098  C C    . TRP A 1 74  ? 5.659   -5.573  1.375   1.00 0.00 ? 74  TRP A C    1  
ATOM 1099  O O    . TRP A 1 74  ? 5.742   -4.375  1.109   1.00 0.00 ? 74  TRP A O    1  
ATOM 1100  C CB   . TRP A 1 74  ? 6.488   -6.672  3.524   1.00 0.00 ? 74  TRP A CB   1  
ATOM 1101  C CG   . TRP A 1 74  ? 7.411   -7.743  4.109   1.00 0.00 ? 74  TRP A CG   1  
ATOM 1102  C CD1  . TRP A 1 74  ? 7.268   -9.074  4.055   1.00 0.00 ? 74  TRP A CD1  1  
ATOM 1103  C CD2  . TRP A 1 74  ? 8.633   -7.517  4.843   1.00 0.00 ? 74  TRP A CD2  1  
ATOM 1104  N NE1  . TRP A 1 74  ? 8.303   -9.721  4.698   1.00 0.00 ? 74  TRP A NE1  1  
ATOM 1105  C CE2  . TRP A 1 74  ? 9.160   -8.744  5.192   1.00 0.00 ? 74  TRP A CE2  1  
ATOM 1106  C CE3  . TRP A 1 74  ? 9.271   -6.317  5.200   1.00 0.00 ? 74  TRP A CE3  1  
ATOM 1107  C CZ2  . TRP A 1 74  ? 10.350  -8.889  5.916   1.00 0.00 ? 74  TRP A CZ2  1  
ATOM 1108  C CZ3  . TRP A 1 74  ? 10.459  -6.479  5.923   1.00 0.00 ? 74  TRP A CZ3  1  
ATOM 1109  C CH2  . TRP A 1 74  ? 11.003  -7.706  6.282   1.00 0.00 ? 74  TRP A CH2  1  
ATOM 1110  H H    . TRP A 1 74  ? 7.841   -4.502  2.330   1.00 0.00 ? 74  TRP A H    1  
ATOM 1111  H HA   . TRP A 1 74  ? 7.045   -7.221  1.552   1.00 0.00 ? 74  TRP A HA   1  
ATOM 1112  H HB2  . TRP A 1 74  ? 6.548   -5.777  4.143   1.00 0.00 ? 74  TRP A HB2  1  
ATOM 1113  H HB3  . TRP A 1 74  ? 5.459   -7.026  3.575   1.00 0.00 ? 74  TRP A HB3  1  
ATOM 1114  H HD1  . TRP A 1 74  ? 6.437   -9.582  3.565   1.00 0.00 ? 74  TRP A HD1  1  
ATOM 1115  H HE1  . TRP A 1 74  ? 8.427   -10.799 4.800   1.00 0.00 ? 74  TRP A HE1  1  
ATOM 1116  H HE3  . TRP A 1 74  ? 8.875   -5.336  4.936   1.00 0.00 ? 74  TRP A HE3  1  
ATOM 1117  H HZ2  . TRP A 1 74  ? 10.746  -9.869  6.180   1.00 0.00 ? 74  TRP A HZ2  1  
ATOM 1118  H HZ3  . TRP A 1 74  ? 10.995  -5.579  6.225   1.00 0.00 ? 74  TRP A HZ3  1  
ATOM 1119  H HH2  . TRP A 1 74  ? 11.935  -7.748  6.847   1.00 0.00 ? 74  TRP A HH2  1  
ATOM 1120  N N    . ILE A 1 75  ? 4.610   -6.333  1.095   1.00 0.00 ? 75  ILE A N    1  
ATOM 1121  C CA   . ILE A 1 75  ? 3.442   -5.781  0.430   1.00 0.00 ? 75  ILE A CA   1  
ATOM 1122  C C    . ILE A 1 75  ? 2.190   -6.119  1.242   1.00 0.00 ? 75  ILE A C    1  
ATOM 1123  O O    . ILE A 1 75  ? 1.703   -7.247  1.196   1.00 0.00 ? 75  ILE A O    1  
ATOM 1124  C CB   . ILE A 1 75  ? 3.379   -6.255  -1.023  1.00 0.00 ? 75  ILE A CB   1  
ATOM 1125  C CG1  . ILE A 1 75  ? 4.402   -5.514  -1.887  1.00 0.00 ? 75  ILE A CG1  1  
ATOM 1126  C CG2  . ILE A 1 75  ? 1.960   -6.129  -1.580  1.00 0.00 ? 75  ILE A CG2  1  
ATOM 1127  C CD1  . ILE A 1 75  ? 3.889   -4.125  -2.273  1.00 0.00 ? 75  ILE A CD1  1  
ATOM 1128  H H    . ILE A 1 75  ? 4.550   -7.307  1.315   1.00 0.00 ? 75  ILE A H    1  
ATOM 1129  H HA   . ILE A 1 75  ? 3.559   -4.697  0.410   1.00 0.00 ? 75  ILE A HA   1  
ATOM 1130  H HB   . ILE A 1 75  ? 3.643   -7.313  -1.049  1.00 0.00 ? 75  ILE A HB   1  
ATOM 1131  H HG12 . ILE A 1 75  ? 5.342   -5.420  -1.344  1.00 0.00 ? 75  ILE A HG12 1  
ATOM 1132  H HG13 . ILE A 1 75  ? 4.610   -6.092  -2.787  1.00 0.00 ? 75  ILE A HG13 1  
ATOM 1133  H HG21 . ILE A 1 75  ? 2.003   -5.752  -2.602  1.00 0.00 ? 75  ILE A HG21 1  
ATOM 1134  H HG22 . ILE A 1 75  ? 1.479   -7.107  -1.575  1.00 0.00 ? 75  ILE A HG22 1  
ATOM 1135  H HG23 . ILE A 1 75  ? 1.387   -5.439  -0.962  1.00 0.00 ? 75  ILE A HG23 1  
ATOM 1136  H HD11 . ILE A 1 75  ? 3.688   -4.096  -3.344  1.00 0.00 ? 75  ILE A HD11 1  
ATOM 1137  H HD12 . ILE A 1 75  ? 2.972   -3.911  -1.725  1.00 0.00 ? 75  ILE A HD12 1  
ATOM 1138  H HD13 . ILE A 1 75  ? 4.643   -3.377  -2.025  1.00 0.00 ? 75  ILE A HD13 1  
ATOM 1139  N N    . PHE A 1 76  ? 1.706   -5.121  1.966   1.00 0.00 ? 76  PHE A N    1  
ATOM 1140  C CA   . PHE A 1 76  ? 0.521   -5.298  2.787   1.00 0.00 ? 76  PHE A CA   1  
ATOM 1141  C C    . PHE A 1 76  ? -0.746  -4.940  2.007   1.00 0.00 ? 76  PHE A C    1  
ATOM 1142  O O    . PHE A 1 76  ? -0.786  -3.922  1.316   1.00 0.00 ? 76  PHE A O    1  
ATOM 1143  C CB   . PHE A 1 76  ? 0.656   -4.350  3.980   1.00 0.00 ? 76  PHE A CB   1  
ATOM 1144  C CG   . PHE A 1 76  ? -0.485  -4.457  4.993   1.00 0.00 ? 76  PHE A CG   1  
ATOM 1145  C CD1  . PHE A 1 76  ? -0.496  -5.471  5.900   1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1146  C CD2  . PHE A 1 76  ? -1.489  -3.540  4.987   1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1147  C CE1  . PHE A 1 76  ? -1.555  -5.571  6.841   1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1148  C CE2  . PHE A 1 76  ? -2.548  -3.639  5.928   1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1149  C CZ   . PHE A 1 76  ? -2.558  -4.653  6.835   1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1150  H H    . PHE A 1 76  ? 2.109   -4.206  1.998   1.00 0.00 ? 76  PHE A H    1  
ATOM 1151  H HA   . PHE A 1 76  ? 0.482   -6.349  3.076   1.00 0.00 ? 76  PHE A HA   1  
ATOM 1152  H HB2  . PHE A 1 76  ? 1.599   -4.553  4.487   1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1153  H HB3  . PHE A 1 76  ? 0.706   -3.325  3.612   1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1154  H HD1  . PHE A 1 76  ? 0.309   -6.207  5.905   1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1155  H HD2  . PHE A 1 76  ? -1.480  -2.727  4.260   1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1156  H HE1  . PHE A 1 76  ? -1.564  -6.383  7.567   1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1157  H HE2  . PHE A 1 76  ? -3.352  -2.904  5.923   1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1158  H HZ   . PHE A 1 76  ? -3.372  -4.730  7.557   1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1159  N N    . ARG A 1 77  ? -1.748  -5.795  2.142   1.00 0.00 ? 77  ARG A N    1  
ATOM 1160  C CA   . ARG A 1 77  ? -3.012  -5.581  1.458   1.00 0.00 ? 77  ARG A CA   1  
ATOM 1161  C C    . ARG A 1 77  ? -4.178  -6.011  2.351   1.00 0.00 ? 77  ARG A C    1  
ATOM 1162  O O    . ARG A 1 77  ? -4.318  -7.191  2.669   1.00 0.00 ? 77  ARG A O    1  
ATOM 1163  C CB   . ARG A 1 77  ? -3.068  -6.365  0.146   1.00 0.00 ? 77  ARG A CB   1  
ATOM 1164  C CG   . ARG A 1 77  ? -1.686  -6.442  -0.506  1.00 0.00 ? 77  ARG A CG   1  
ATOM 1165  C CD   . ARG A 1 77  ? -1.670  -7.470  -1.639  1.00 0.00 ? 77  ARG A CD   1  
ATOM 1166  N NE   . ARG A 1 77  ? -0.480  -8.341  -1.515  1.00 0.00 ? 77  ARG A NE   1  
ATOM 1167  C CZ   . ARG A 1 77  ? -0.041  -9.156  -2.484  1.00 0.00 ? 77  ARG A CZ   1  
ATOM 1168  N NH1  . ARG A 1 77  ? -0.691  -9.216  -3.655  1.00 0.00 ? 77  ARG A NH1  1  
ATOM 1169  N NH2  . ARG A 1 77  ? 1.048   -9.910  -2.283  1.00 0.00 ? 77  ARG A NH2  1  
ATOM 1170  H H    . ARG A 1 77  ? -1.707  -6.620  2.706   1.00 0.00 ? 77  ARG A H    1  
ATOM 1171  H HA   . ARG A 1 77  ? -3.044  -4.510  1.260   1.00 0.00 ? 77  ARG A HA   1  
ATOM 1172  H HB2  . ARG A 1 77  ? -3.441  -7.372  0.335   1.00 0.00 ? 77  ARG A HB2  1  
ATOM 1173  H HB3  . ARG A 1 77  ? -3.770  -5.888  -0.538  1.00 0.00 ? 77  ARG A HB3  1  
ATOM 1174  H HG2  . ARG A 1 77  ? -1.409  -5.462  -0.896  1.00 0.00 ? 77  ARG A HG2  1  
ATOM 1175  H HG3  . ARG A 1 77  ? -0.941  -6.709  0.243   1.00 0.00 ? 77  ARG A HG3  1  
ATOM 1176  H HD2  . ARG A 1 77  ? -2.577  -8.073  -1.606  1.00 0.00 ? 77  ARG A HD2  1  
ATOM 1177  H HD3  . ARG A 1 77  ? -1.660  -6.962  -2.603  1.00 0.00 ? 77  ARG A HD3  1  
ATOM 1178  H HE   . ARG A 1 77  ? 0.028   -8.321  -0.654  1.00 0.00 ? 77  ARG A HE   1  
ATOM 1179  H HH11 . ARG A 1 77  ? -1.504  -8.653  -3.805  1.00 0.00 ? 77  ARG A HH11 1  
ATOM 1180  H HH12 . ARG A 1 77  ? -0.364  -9.824  -4.378  1.00 0.00 ? 77  ARG A HH12 1  
ATOM 1181  H HH21 . ARG A 1 77  ? 1.533   -9.866  -1.410  1.00 0.00 ? 77  ARG A HH21 1  
ATOM 1182  H HH22 . ARG A 1 77  ? 1.375   -10.518 -3.007  1.00 0.00 ? 77  ARG A HH22 1  
ATOM 1183  N N    . SER A 1 78  ? -4.985  -5.031  2.729   1.00 0.00 ? 78  SER A N    1  
ATOM 1184  C CA   . SER A 1 78  ? -6.134  -5.293  3.579   1.00 0.00 ? 78  SER A CA   1  
ATOM 1185  C C    . SER A 1 78  ? -7.426  -5.144  2.773   1.00 0.00 ? 78  SER A C    1  
ATOM 1186  O O    . SER A 1 78  ? -7.529  -4.267  1.916   1.00 0.00 ? 78  SER A O    1  
ATOM 1187  C CB   . SER A 1 78  ? -6.151  -4.354  4.787   1.00 0.00 ? 78  SER A CB   1  
ATOM 1188  O OG   . SER A 1 78  ? -6.925  -3.183  4.543   1.00 0.00 ? 78  SER A OG   1  
ATOM 1189  H H    . SER A 1 78  ? -4.864  -4.074  2.466   1.00 0.00 ? 78  SER A H    1  
ATOM 1190  H HA   . SER A 1 78  ? -6.012  -6.321  3.920   1.00 0.00 ? 78  SER A HA   1  
ATOM 1191  H HB2  . SER A 1 78  ? -6.555  -4.883  5.651   1.00 0.00 ? 78  SER A HB2  1  
ATOM 1192  H HB3  . SER A 1 78  ? -5.130  -4.068  5.038   1.00 0.00 ? 78  SER A HB3  1  
ATOM 1193  H HG   . SER A 1 78  ? -6.891  -2.947  3.572   1.00 0.00 ? 78  SER A HG   1  
ATOM 1194  N N    . TRP A 1 79  ? -8.378  -6.013  3.075   1.00 0.00 ? 79  TRP A N    1  
ATOM 1195  C CA   . TRP A 1 79  ? -9.659  -5.990  2.389   1.00 0.00 ? 79  TRP A CA   1  
ATOM 1196  C C    . TRP A 1 79  ? -10.700 -6.630  3.310   1.00 0.00 ? 79  TRP A C    1  
ATOM 1197  O O    . TRP A 1 79  ? -10.349 -7.276  4.295   1.00 0.00 ? 79  TRP A O    1  
ATOM 1198  C CB   . TRP A 1 79  ? -9.563  -6.676  1.026   1.00 0.00 ? 79  TRP A CB   1  
ATOM 1199  C CG   . TRP A 1 79  ? -9.282  -8.178  1.104   1.00 0.00 ? 79  TRP A CG   1  
ATOM 1200  C CD1  . TRP A 1 79  ? -10.144 -9.166  1.381   1.00 0.00 ? 79  TRP A CD1  1  
ATOM 1201  C CD2  . TRP A 1 79  ? -8.011  -8.827  0.890   1.00 0.00 ? 79  TRP A CD2  1  
ATOM 1202  N NE1  . TRP A 1 79  ? -9.525  -10.399 1.361   1.00 0.00 ? 79  TRP A NE1  1  
ATOM 1203  C CE2  . TRP A 1 79  ? -8.186  -10.186 1.053   1.00 0.00 ? 79  TRP A CE2  1  
ATOM 1204  C CE3  . TRP A 1 79  ? -6.755  -8.284  0.569   1.00 0.00 ? 79  TRP A CE3  1  
ATOM 1205  C CZ2  . TRP A 1 79  ? -7.148  -11.115 0.915   1.00 0.00 ? 79  TRP A CZ2  1  
ATOM 1206  C CZ3  . TRP A 1 79  ? -5.727  -9.225  0.434   1.00 0.00 ? 79  TRP A CZ3  1  
ATOM 1207  C CH2  . TRP A 1 79  ? -5.887  -10.597 0.595   1.00 0.00 ? 79  TRP A CH2  1  
ATOM 1208  H H    . TRP A 1 79  ? -8.286  -6.724  3.773   1.00 0.00 ? 79  TRP A H    1  
ATOM 1209  H HA   . TRP A 1 79  ? -9.917  -4.947  2.202   1.00 0.00 ? 79  TRP A HA   1  
ATOM 1210  H HB2  . TRP A 1 79  ? -10.497 -6.520  0.485   1.00 0.00 ? 79  TRP A HB2  1  
ATOM 1211  H HB3  . TRP A 1 79  ? -8.775  -6.199  0.444   1.00 0.00 ? 79  TRP A HB3  1  
ATOM 1212  H HD1  . TRP A 1 79  ? -11.202 -9.014  1.595   1.00 0.00 ? 79  TRP A HD1  1  
ATOM 1213  H HE1  . TRP A 1 79  ? -9.998  -11.362 1.552   1.00 0.00 ? 79  TRP A HE1  1  
ATOM 1214  H HE3  . TRP A 1 79  ? -6.591  -7.215  0.435   1.00 0.00 ? 79  TRP A HE3  1  
ATOM 1215  H HZ2  . TRP A 1 79  ? -7.312  -12.184 1.049   1.00 0.00 ? 79  TRP A HZ2  1  
ATOM 1216  H HZ3  . TRP A 1 79  ? -4.732  -8.857  0.186   1.00 0.00 ? 79  TRP A HZ3  1  
ATOM 1217  H HH2  . TRP A 1 79  ? -5.035  -11.265 0.473   1.00 0.00 ? 79  TRP A HH2  1  
ATOM 1218  N N    . GLY A 1 80  ? -11.961 -6.427  2.955   1.00 0.00 ? 80  GLY A N    1  
ATOM 1219  C CA   . GLY A 1 80  ? -13.055 -6.976  3.737   1.00 0.00 ? 80  GLY A CA   1  
ATOM 1220  C C    . GLY A 1 80  ? -14.158 -5.936  3.943   1.00 0.00 ? 80  GLY A C    1  
ATOM 1221  O O    . GLY A 1 80  ? -13.917 -4.737  3.814   1.00 0.00 ? 80  GLY A O    1  
ATOM 1222  H H    . GLY A 1 80  ? -12.238 -5.900  2.152   1.00 0.00 ? 80  GLY A H    1  
ATOM 1223  H HA2  . GLY A 1 80  ? -13.465 -7.851  3.231   1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1224  H HA3  . GLY A 1 80  ? -12.683 -7.313  4.704   1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1225  N N    . ARG A 1 81  ? -15.345 -6.433  4.259   1.00 0.00 ? 81  ARG A N    1  
ATOM 1226  C CA   . ARG A 1 81  ? -16.485 -5.561  4.484   1.00 0.00 ? 81  ARG A CA   1  
ATOM 1227  C C    . ARG A 1 81  ? -16.192 -4.587  5.627   1.00 0.00 ? 81  ARG A C    1  
ATOM 1228  O O    . ARG A 1 81  ? -15.165 -4.699  6.295   1.00 0.00 ? 81  ARG A O    1  
ATOM 1229  C CB   . ARG A 1 81  ? -17.739 -6.371  4.823   1.00 0.00 ? 81  ARG A CB   1  
ATOM 1230  C CG   . ARG A 1 81  ? -18.686 -6.442  3.624   1.00 0.00 ? 81  ARG A CG   1  
ATOM 1231  C CD   . ARG A 1 81  ? -19.789 -7.477  3.857   1.00 0.00 ? 81  ARG A CD   1  
ATOM 1232  N NE   . ARG A 1 81  ? -21.108 -6.809  3.908   1.00 0.00 ? 81  ARG A NE   1  
ATOM 1233  C CZ   . ARG A 1 81  ? -22.237 -7.405  4.315   1.00 0.00 ? 81  ARG A CZ   1  
ATOM 1234  N NH1  . ARG A 1 81  ? -22.214 -8.686  4.709   1.00 0.00 ? 81  ARG A NH1  1  
ATOM 1235  N NH2  . ARG A 1 81  ? -23.389 -6.721  4.329   1.00 0.00 ? 81  ARG A NH2  1  
ATOM 1236  H H    . ARG A 1 81  ? -15.533 -7.410  4.362   1.00 0.00 ? 81  ARG A H    1  
ATOM 1237  H HA   . ARG A 1 81  ? -16.621 -5.031  3.542   1.00 0.00 ? 81  ARG A HA   1  
ATOM 1238  H HB2  . ARG A 1 81  ? -17.454 -7.378  5.127   1.00 0.00 ? 81  ARG A HB2  1  
ATOM 1239  H HB3  . ARG A 1 81  ? -18.252 -5.916  5.670   1.00 0.00 ? 81  ARG A HB3  1  
ATOM 1240  H HG2  . ARG A 1 81  ? -19.133 -5.463  3.451   1.00 0.00 ? 81  ARG A HG2  1  
ATOM 1241  H HG3  . ARG A 1 81  ? -18.124 -6.700  2.727   1.00 0.00 ? 81  ARG A HG3  1  
ATOM 1242  H HD2  . ARG A 1 81  ? -19.778 -8.218  3.058   1.00 0.00 ? 81  ARG A HD2  1  
ATOM 1243  H HD3  . ARG A 1 81  ? -19.606 -8.012  4.789   1.00 0.00 ? 81  ARG A HD3  1  
ATOM 1244  H HE   . ARG A 1 81  ? -21.161 -5.853  3.621   1.00 0.00 ? 81  ARG A HE   1  
ATOM 1245  H HH11 . ARG A 1 81  ? -21.354 -9.197  4.699   1.00 0.00 ? 81  ARG A HH11 1  
ATOM 1246  H HH12 . ARG A 1 81  ? -23.056 -9.131  5.012   1.00 0.00 ? 81  ARG A HH12 1  
ATOM 1247  H HH21 . ARG A 1 81  ? -23.406 -5.765  4.035   1.00 0.00 ? 81  ARG A HH21 1  
ATOM 1248  H HH22 . ARG A 1 81  ? -24.231 -7.166  4.632   1.00 0.00 ? 81  ARG A HH22 1  
ATOM 1249  N N    . VAL A 1 82  ? -17.112 -3.652  5.816   1.00 0.00 ? 82  VAL A N    1  
ATOM 1250  C CA   . VAL A 1 82  ? -16.964 -2.659  6.866   1.00 0.00 ? 82  VAL A CA   1  
ATOM 1251  C C    . VAL A 1 82  ? -17.692 -3.140  8.123   1.00 0.00 ? 82  VAL A C    1  
ATOM 1252  O O    . VAL A 1 82  ? -18.913 -3.288  8.119   1.00 0.00 ? 82  VAL A O    1  
ATOM 1253  C CB   . VAL A 1 82  ? -17.459 -1.298  6.372   1.00 0.00 ? 82  VAL A CB   1  
ATOM 1254  C CG1  . VAL A 1 82  ? -17.589 -0.308  7.531   1.00 0.00 ? 82  VAL A CG1  1  
ATOM 1255  C CG2  . VAL A 1 82  ? -16.542 -0.745  5.279   1.00 0.00 ? 82  VAL A CG2  1  
ATOM 1256  H H    . VAL A 1 82  ? -17.944 -3.568  5.268   1.00 0.00 ? 82  VAL A H    1  
ATOM 1257  H HA   . VAL A 1 82  ? -15.901 -2.571  7.089   1.00 0.00 ? 82  VAL A HA   1  
ATOM 1258  H HB   . VAL A 1 82  ? -18.449 -1.439  5.939   1.00 0.00 ? 82  VAL A HB   1  
ATOM 1259  H HG11 . VAL A 1 82  ? -18.618 0.048   7.591   1.00 0.00 ? 82  VAL A HG11 1  
ATOM 1260  H HG12 . VAL A 1 82  ? -17.321 -0.804  8.464   1.00 0.00 ? 82  VAL A HG12 1  
ATOM 1261  H HG13 . VAL A 1 82  ? -16.921 0.537   7.364   1.00 0.00 ? 82  VAL A HG13 1  
ATOM 1262  H HG21 . VAL A 1 82  ? -16.684 0.333   5.197   1.00 0.00 ? 82  VAL A HG21 1  
ATOM 1263  H HG22 . VAL A 1 82  ? -15.504 -0.957  5.534   1.00 0.00 ? 82  VAL A HG22 1  
ATOM 1264  H HG23 . VAL A 1 82  ? -16.786 -1.217  4.327   1.00 0.00 ? 82  VAL A HG23 1  
ATOM 1265  N N    . GLY A 1 83  ? -16.912 -3.369  9.169   1.00 0.00 ? 83  GLY A N    1  
ATOM 1266  C CA   . GLY A 1 83  ? -17.468 -3.830  10.430  1.00 0.00 ? 83  GLY A CA   1  
ATOM 1267  C C    . GLY A 1 83  ? -18.345 -5.066  10.223  1.00 0.00 ? 83  GLY A C    1  
ATOM 1268  O O    . GLY A 1 83  ? -19.572 -4.970  10.231  1.00 0.00 ? 83  GLY A O    1  
ATOM 1269  H H    . GLY A 1 83  ? -15.920 -3.246  9.164   1.00 0.00 ? 83  GLY A H    1  
ATOM 1270  H HA2  . GLY A 1 83  ? -16.660 -4.065  11.123  1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1271  H HA3  . GLY A 1 83  ? -18.056 -3.033  10.885  1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1272  N N    . THR A 1 84  ? -17.683 -6.200  10.044  1.00 0.00 ? 84  THR A N    1  
ATOM 1273  C CA   . THR A 1 84  ? -18.387 -7.453  9.836   1.00 0.00 ? 84  THR A CA   1  
ATOM 1274  C C    . THR A 1 84  ? -17.519 -8.633  10.276  1.00 0.00 ? 84  THR A C    1  
ATOM 1275  O O    . THR A 1 84  ? -16.515 -8.447  10.963  1.00 0.00 ? 84  THR A O    1  
ATOM 1276  C CB   . THR A 1 84  ? -18.806 -7.522  8.366   1.00 0.00 ? 84  THR A CB   1  
ATOM 1277  O OG1  . THR A 1 84  ? -17.757 -6.849  7.675   1.00 0.00 ? 84  THR A OG1  1  
ATOM 1278  C CG2  . THR A 1 84  ? -20.048 -6.679  8.070   1.00 0.00 ? 84  THR A CG2  1  
ATOM 1279  H H    . THR A 1 84  ? -16.685 -6.270  10.039  1.00 0.00 ? 84  THR A H    1  
ATOM 1280  H HA   . THR A 1 84  ? -19.276 -7.457  10.467  1.00 0.00 ? 84  THR A HA   1  
ATOM 1281  H HB   . THR A 1 84  ? -18.952 -8.555  8.051   1.00 0.00 ? 84  THR A HB   1  
ATOM 1282  H HG1  . THR A 1 84  ? -17.790 -5.869  7.874   1.00 0.00 ? 84  THR A HG1  1  
ATOM 1283  H HG21 . THR A 1 84  ? -19.774 -5.625  8.043   1.00 0.00 ? 84  THR A HG21 1  
ATOM 1284  H HG22 . THR A 1 84  ? -20.465 -6.972  7.106   1.00 0.00 ? 84  THR A HG22 1  
ATOM 1285  H HG23 . THR A 1 84  ? -20.791 -6.841  8.851   1.00 0.00 ? 84  THR A HG23 1  
ATOM 1286  N N    . VAL A 1 85  ? -17.935 -9.820  9.863   1.00 0.00 ? 85  VAL A N    1  
ATOM 1287  C CA   . VAL A 1 85  ? -17.208 -11.030 10.206  1.00 0.00 ? 85  VAL A CA   1  
ATOM 1288  C C    . VAL A 1 85  ? -15.983 -11.159 9.298   1.00 0.00 ? 85  VAL A C    1  
ATOM 1289  O O    . VAL A 1 85  ? -15.082 -11.950 9.572   1.00 0.00 ? 85  VAL A O    1  
ATOM 1290  C CB   . VAL A 1 85  ? -18.139 -12.241 10.128  1.00 0.00 ? 85  VAL A CB   1  
ATOM 1291  C CG1  . VAL A 1 85  ? -17.558 -13.322 9.215   1.00 0.00 ? 85  VAL A CG1  1  
ATOM 1292  C CG2  . VAL A 1 85  ? -18.430 -12.800 11.523  1.00 0.00 ? 85  VAL A CG2  1  
ATOM 1293  H H    . VAL A 1 85  ? -18.753 -9.963  9.304   1.00 0.00 ? 85  VAL A H    1  
ATOM 1294  H HA   . VAL A 1 85  ? -16.870 -10.930 11.238  1.00 0.00 ? 85  VAL A HA   1  
ATOM 1295  H HB   . VAL A 1 85  ? -19.084 -11.910 9.696   1.00 0.00 ? 85  VAL A HB   1  
ATOM 1296  H HG11 . VAL A 1 85  ? -17.463 -12.930 8.202   1.00 0.00 ? 85  VAL A HG11 1  
ATOM 1297  H HG12 . VAL A 1 85  ? -16.576 -13.620 9.583   1.00 0.00 ? 85  VAL A HG12 1  
ATOM 1298  H HG13 . VAL A 1 85  ? -18.221 -14.188 9.208   1.00 0.00 ? 85  VAL A HG13 1  
ATOM 1299  H HG21 . VAL A 1 85  ? -19.037 -13.701 11.433  1.00 0.00 ? 85  VAL A HG21 1  
ATOM 1300  H HG22 . VAL A 1 85  ? -17.491 -13.042 12.020  1.00 0.00 ? 85  VAL A HG22 1  
ATOM 1301  H HG23 . VAL A 1 85  ? -18.970 -12.055 12.107  1.00 0.00 ? 85  VAL A HG23 1  
ATOM 1302  N N    . ILE A 1 86  ? -15.989 -10.368 8.234   1.00 0.00 ? 86  ILE A N    1  
ATOM 1303  C CA   . ILE A 1 86  ? -14.890 -10.384 7.284   1.00 0.00 ? 86  ILE A CA   1  
ATOM 1304  C C    . ILE A 1 86  ? -13.702 -9.621  7.873   1.00 0.00 ? 86  ILE A C    1  
ATOM 1305  O O    . ILE A 1 86  ? -13.849 -8.899  8.858   1.00 0.00 ? 86  ILE A O    1  
ATOM 1306  C CB   . ILE A 1 86  ? -15.349 -9.852  5.925   1.00 0.00 ? 86  ILE A CB   1  
ATOM 1307  C CG1  . ILE A 1 86  ? -16.585 -10.606 5.430   1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1308  C CG2  . ILE A 1 86  ? -14.208 -9.891  4.907   1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1309  C CD1  . ILE A 1 86  ? -17.235 -9.880  4.251   1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1310  H H    . ILE A 1 86  ? -16.726 -9.727  8.018   1.00 0.00 ? 86  ILE A H    1  
ATOM 1311  H HA   . ILE A 1 86  ? -14.597 -11.424 7.141   1.00 0.00 ? 86  ILE A HA   1  
ATOM 1312  H HB   . ILE A 1 86  ? -15.637 -8.808  6.047   1.00 0.00 ? 86  ILE A HB   1  
ATOM 1313  H HG12 . ILE A 1 86  ? -16.304 -11.615 5.130   1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1314  H HG13 . ILE A 1 86  ? -17.305 -10.705 6.243   1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1315  H HG21 . ILE A 1 86  ? -13.734 -10.872 4.931   1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1316  H HG22 . ILE A 1 86  ? -14.605 -9.703  3.909   1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1317  H HG23 . ILE A 1 86  ? -13.473 -9.126  5.156   1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1318  H HD11 . ILE A 1 86  ? -16.578 -9.080  3.910   1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1319  H HD12 . ILE A 1 86  ? -17.402 -10.585 3.437   1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1320  H HD13 . ILE A 1 86  ? -18.189 -9.457  4.566   1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1321  N N    . GLY A 1 87  ? -12.550 -9.808  7.246   1.00 0.00 ? 87  GLY A N    1  
ATOM 1322  C CA   . GLY A 1 87  ? -11.337 -9.147  7.696   1.00 0.00 ? 87  GLY A CA   1  
ATOM 1323  C C    . GLY A 1 87  ? -10.111 -10.031 7.459   1.00 0.00 ? 87  GLY A C    1  
ATOM 1324  O O    . GLY A 1 87  ? -9.848  -10.954 8.229   1.00 0.00 ? 87  GLY A O    1  
ATOM 1325  H H    . GLY A 1 87  ? -12.438 -10.398 6.446   1.00 0.00 ? 87  GLY A H    1  
ATOM 1326  H HA2  . GLY A 1 87  ? -11.216 -8.202  7.166   1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1327  H HA3  . GLY A 1 87  ? -11.419 -8.910  8.756   1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1328  N N    . SER A 1 88  ? -9.392  -9.718  6.391   1.00 0.00 ? 88  SER A N    1  
ATOM 1329  C CA   . SER A 1 88  ? -8.200  -10.472 6.043   1.00 0.00 ? 88  SER A CA   1  
ATOM 1330  C C    . SER A 1 88  ? -7.139  -9.536  5.462   1.00 0.00 ? 88  SER A C    1  
ATOM 1331  O O    . SER A 1 88  ? -7.468  -8.494  4.897   1.00 0.00 ? 88  SER A O    1  
ATOM 1332  C CB   . SER A 1 88  ? -8.525  -11.589 5.049   1.00 0.00 ? 88  SER A CB   1  
ATOM 1333  O OG   . SER A 1 88  ? -8.638  -12.857 5.688   1.00 0.00 ? 88  SER A OG   1  
ATOM 1334  H H    . SER A 1 88  ? -9.612  -8.966  5.770   1.00 0.00 ? 88  SER A H    1  
ATOM 1335  H HA   . SER A 1 88  ? -7.852  -10.910 6.979   1.00 0.00 ? 88  SER A HA   1  
ATOM 1336  H HB2  . SER A 1 88  ? -9.458  -11.357 4.536   1.00 0.00 ? 88  SER A HB2  1  
ATOM 1337  H HB3  . SER A 1 88  ? -7.746  -11.634 4.288   1.00 0.00 ? 88  SER A HB3  1  
ATOM 1338  H HG   . SER A 1 88  ? -8.543  -13.590 5.014   1.00 0.00 ? 88  SER A HG   1  
ATOM 1339  N N    . ASN A 1 89  ? -5.887  -9.941  5.621   1.00 0.00 ? 89  ASN A N    1  
ATOM 1340  C CA   . ASN A 1 89  ? -4.776  -9.151  5.118   1.00 0.00 ? 89  ASN A CA   1  
ATOM 1341  C C    . ASN A 1 89  ? -3.767  -10.075 4.434   1.00 0.00 ? 89  ASN A C    1  
ATOM 1342  O O    . ASN A 1 89  ? -3.787  -11.286 4.645   1.00 0.00 ? 89  ASN A O    1  
ATOM 1343  C CB   . ASN A 1 89  ? -4.056  -8.426  6.258   1.00 0.00 ? 89  ASN A CB   1  
ATOM 1344  C CG   . ASN A 1 89  ? -3.720  -9.392  7.396   1.00 0.00 ? 89  ASN A CG   1  
ATOM 1345  O OD1  . ASN A 1 89  ? -4.559  -9.760  8.201   1.00 0.00 ? 89  ASN A OD1  1  
ATOM 1346  N ND2  . ASN A 1 89  ? -2.448  -9.780  7.417   1.00 0.00 ? 89  ASN A ND2  1  
ATOM 1347  H H    . ASN A 1 89  ? -5.628  -10.790 6.081   1.00 0.00 ? 89  ASN A H    1  
ATOM 1348  H HA   . ASN A 1 89  ? -5.222  -8.435  4.428   1.00 0.00 ? 89  ASN A HA   1  
ATOM 1349  H HB2  . ASN A 1 89  ? -3.141  -7.968  5.882   1.00 0.00 ? 89  ASN A HB2  1  
ATOM 1350  H HB3  . ASN A 1 89  ? -4.685  -7.619  6.635   1.00 0.00 ? 89  ASN A HB3  1  
ATOM 1351  H HD21 . ASN A 1 89  ? -1.810  -9.440  6.727   1.00 0.00 ? 89  ASN A HD21 1  
ATOM 1352  H HD22 . ASN A 1 89  ? -2.130  -10.412 8.125   1.00 0.00 ? 89  ASN A HD22 1  
ATOM 1353  N N    . LYS A 1 90  ? -2.909  -9.467  3.628   1.00 0.00 ? 90  LYS A N    1  
ATOM 1354  C CA   . LYS A 1 90  ? -1.894  -10.221 2.911   1.00 0.00 ? 90  LYS A CA   1  
ATOM 1355  C C    . LYS A 1 90  ? -0.524  -9.587  3.159   1.00 0.00 ? 90  LYS A C    1  
ATOM 1356  O O    . LYS A 1 90  ? -0.382  -8.366  3.109   1.00 0.00 ? 90  LYS A O    1  
ATOM 1357  C CB   . LYS A 1 90  ? -2.259  -10.336 1.430   1.00 0.00 ? 90  LYS A CB   1  
ATOM 1358  C CG   . LYS A 1 90  ? -1.229  -11.179 0.675   1.00 0.00 ? 90  LYS A CG   1  
ATOM 1359  C CD   . LYS A 1 90  ? -1.842  -12.498 0.199   1.00 0.00 ? 90  LYS A CD   1  
ATOM 1360  C CE   . LYS A 1 90  ? -2.049  -12.490 -1.317  1.00 0.00 ? 90  LYS A CE   1  
ATOM 1361  N NZ   . LYS A 1 90  ? -3.492  -12.469 -1.643  1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1362  H H    . LYS A 1 90  ? -2.899  -8.481  3.462   1.00 0.00 ? 90  LYS A H    1  
ATOM 1363  H HA   . LYS A 1 90  ? -1.886  -11.231 3.321   1.00 0.00 ? 90  LYS A HA   1  
ATOM 1364  H HB2  . LYS A 1 90  ? -3.246  -10.786 1.328   1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1365  H HB3  . LYS A 1 90  ? -2.315  -9.342  0.987   1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1366  H HG2  . LYS A 1 90  ? -0.852  -10.619 -0.181  1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1367  H HG3  . LYS A 1 90  ? -0.376  -11.384 1.323   1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1368  H HD2  . LYS A 1 90  ? -1.191  -13.327 0.477   1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1369  H HD3  . LYS A 1 90  ? -2.796  -12.660 0.699   1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1370  H HE2  . LYS A 1 90  ? -1.559  -11.620 -1.752  1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1371  H HE3  . LYS A 1 90  ? -1.584  -13.372 -1.758  1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1372  H HZ1  . LYS A 1 90  ? -3.950  -11.777 -1.084  1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1373  H HZ2  . LYS A 1 90  ? -3.612  -12.248 -2.611  1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1374  H HZ3  . LYS A 1 90  ? -3.890  -13.367 -1.454  1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1375  N N    . LEU A 1 91  ? 0.451   -10.445 3.422   1.00 0.00 ? 91  LEU A N    1  
ATOM 1376  C CA   . LEU A 1 91  ? 1.805   -9.984  3.678   1.00 0.00 ? 91  LEU A CA   1  
ATOM 1377  C C    . LEU A 1 91  ? 2.793   -10.861 2.906   1.00 0.00 ? 91  LEU A C    1  
ATOM 1378  O O    . LEU A 1 91  ? 2.889   -12.062 3.156   1.00 0.00 ? 91  LEU A O    1  
ATOM 1379  C CB   . LEU A 1 91  ? 2.077   -9.929  5.183   1.00 0.00 ? 91  LEU A CB   1  
ATOM 1380  C CG   . LEU A 1 91  ? 3.333   -9.168  5.610   1.00 0.00 ? 91  LEU A CG   1  
ATOM 1381  C CD1  . LEU A 1 91  ? 3.165   -7.663  5.386   1.00 0.00 ? 91  LEU A CD1  1  
ATOM 1382  C CD2  . LEU A 1 91  ? 3.706   -9.494  7.058   1.00 0.00 ? 91  LEU A CD2  1  
ATOM 1383  H H    . LEU A 1 91  ? 0.328   -11.436 3.461   1.00 0.00 ? 91  LEU A H    1  
ATOM 1384  H HA   . LEU A 1 91  ? 1.880   -8.964  3.300   1.00 0.00 ? 91  LEU A HA   1  
ATOM 1385  H HB2  . LEU A 1 91  ? 1.216   -9.473  5.671   1.00 0.00 ? 91  LEU A HB2  1  
ATOM 1386  H HB3  . LEU A 1 91  ? 2.151   -10.951 5.556   1.00 0.00 ? 91  LEU A HB3  1  
ATOM 1387  H HG   . LEU A 1 91  ? 4.162   -9.496  4.983   1.00 0.00 ? 91  LEU A HG   1  
ATOM 1388  H HD11 . LEU A 1 91  ? 2.885   -7.186  6.325   1.00 0.00 ? 91  LEU A HD11 1  
ATOM 1389  H HD12 . LEU A 1 91  ? 4.106   -7.242  5.031   1.00 0.00 ? 91  LEU A HD12 1  
ATOM 1390  H HD13 . LEU A 1 91  ? 2.386   -7.491  4.643   1.00 0.00 ? 91  LEU A HD13 1  
ATOM 1391  H HD21 . LEU A 1 91  ? 3.481   -8.637  7.693   1.00 0.00 ? 91  LEU A HD21 1  
ATOM 1392  H HD22 . LEU A 1 91  ? 3.132   -10.357 7.395   1.00 0.00 ? 91  LEU A HD22 1  
ATOM 1393  H HD23 . LEU A 1 91  ? 4.771   -9.720  7.117   1.00 0.00 ? 91  LEU A HD23 1  
ATOM 1394  N N    . GLU A 1 92  ? 3.502   -10.228 1.983   1.00 0.00 ? 92  GLU A N    1  
ATOM 1395  C CA   . GLU A 1 92  ? 4.478   -10.936 1.173   1.00 0.00 ? 92  GLU A CA   1  
ATOM 1396  C C    . GLU A 1 92  ? 5.755   -10.105 1.034   1.00 0.00 ? 92  GLU A C    1  
ATOM 1397  O O    . GLU A 1 92  ? 5.694   -8.882  0.914   1.00 0.00 ? 92  GLU A O    1  
ATOM 1398  C CB   . GLU A 1 92  ? 3.901   -11.287 -0.200  1.00 0.00 ? 92  GLU A CB   1  
ATOM 1399  C CG   . GLU A 1 92  ? 3.116   -12.600 -0.145  1.00 0.00 ? 92  GLU A CG   1  
ATOM 1400  C CD   . GLU A 1 92  ? 3.716   -13.637 -1.096  1.00 0.00 ? 92  GLU A CD   1  
ATOM 1401  O OE1  . GLU A 1 92  ? 3.605   -13.415 -2.321  1.00 0.00 ? 92  GLU A OE1  1  
ATOM 1402  O OE2  . GLU A 1 92  ? 4.272   -14.629 -0.577  1.00 0.00 ? 92  GLU A OE2  1  
ATOM 1403  H H    . GLU A 1 92  ? 3.417   -9.251  1.786   1.00 0.00 ? 92  GLU A H    1  
ATOM 1404  H HA   . GLU A 1 92  ? 4.693   -11.856 1.716   1.00 0.00 ? 92  GLU A HA   1  
ATOM 1405  H HB2  . GLU A 1 92  ? 3.248   -10.483 -0.540  1.00 0.00 ? 92  GLU A HB2  1  
ATOM 1406  H HB3  . GLU A 1 92  ? 4.708   -11.372 -0.927  1.00 0.00 ? 92  GLU A HB3  1  
ATOM 1407  H HG2  . GLU A 1 92  ? 3.122   -12.989 0.874   1.00 0.00 ? 92  GLU A HG2  1  
ATOM 1408  H HG3  . GLU A 1 92  ? 2.075   -12.416 -0.410  1.00 0.00 ? 92  GLU A HG3  1  
ATOM 1409  N N    . GLN A 1 93  ? 6.882   -10.802 1.056   1.00 0.00 ? 93  GLN A N    1  
ATOM 1410  C CA   . GLN A 1 93  ? 8.172   -10.143 0.934   1.00 0.00 ? 93  GLN A CA   1  
ATOM 1411  C C    . GLN A 1 93  ? 8.526   -9.939  -0.541  1.00 0.00 ? 93  GLN A C    1  
ATOM 1412  O O    . GLN A 1 93  ? 8.328   -10.834 -1.360  1.00 0.00 ? 93  GLN A O    1  
ATOM 1413  C CB   . GLN A 1 93  ? 9.263   -10.937 1.655   1.00 0.00 ? 93  GLN A CB   1  
ATOM 1414  C CG   . GLN A 1 93  ? 10.605  -10.205 1.593   1.00 0.00 ? 93  GLN A CG   1  
ATOM 1415  C CD   . GLN A 1 93  ? 11.744  -11.174 1.273   1.00 0.00 ? 93  GLN A CD   1  
ATOM 1416  O OE1  . GLN A 1 93  ? 12.284  -11.199 0.179   1.00 0.00 ? 93  GLN A OE1  1  
ATOM 1417  N NE2  . GLN A 1 93  ? 12.079  -11.969 2.286   1.00 0.00 ? 93  GLN A NE2  1  
ATOM 1418  H H    . GLN A 1 93  ? 6.923   -11.796 1.154   1.00 0.00 ? 93  GLN A H    1  
ATOM 1419  H HA   . GLN A 1 93  ? 8.051   -9.177  1.423   1.00 0.00 ? 93  GLN A HA   1  
ATOM 1420  H HB2  . GLN A 1 93  ? 8.977   -11.093 2.695   1.00 0.00 ? 93  GLN A HB2  1  
ATOM 1421  H HB3  . GLN A 1 93  ? 9.361   -11.923 1.200   1.00 0.00 ? 93  GLN A HB3  1  
ATOM 1422  H HG2  . GLN A 1 93  ? 10.563  -9.424  0.834   1.00 0.00 ? 93  GLN A HG2  1  
ATOM 1423  H HG3  . GLN A 1 93  ? 10.798  -9.713  2.546   1.00 0.00 ? 93  GLN A HG3  1  
ATOM 1424  H HE21 . GLN A 1 93  ? 11.596  -11.898 3.158   1.00 0.00 ? 93  GLN A HE21 1  
ATOM 1425  H HE22 . GLN A 1 93  ? 12.814  -12.638 2.174   1.00 0.00 ? 93  GLN A HE22 1  
ATOM 1426  N N    . MET A 1 94  ? 9.043   -8.754  -0.833  1.00 0.00 ? 94  MET A N    1  
ATOM 1427  C CA   . MET A 1 94  ? 9.427   -8.421  -2.194  1.00 0.00 ? 94  MET A CA   1  
ATOM 1428  C C    . MET A 1 94  ? 10.923  -8.651  -2.414  1.00 0.00 ? 94  MET A C    1  
ATOM 1429  O O    . MET A 1 94  ? 11.714  -8.556  -1.477  1.00 0.00 ? 94  MET A O    1  
ATOM 1430  C CB   . MET A 1 94  ? 9.089   -6.956  -2.476  1.00 0.00 ? 94  MET A CB   1  
ATOM 1431  C CG   . MET A 1 94  ? 7.607   -6.791  -2.819  1.00 0.00 ? 94  MET A CG   1  
ATOM 1432  S SD   . MET A 1 94  ? 7.346   -7.096  -4.558  1.00 0.00 ? 94  MET A SD   1  
ATOM 1433  C CE   . MET A 1 94  ? 5.916   -8.162  -4.475  1.00 0.00 ? 94  MET A CE   1  
ATOM 1434  H H    . MET A 1 94  ? 9.201   -8.032  -0.160  1.00 0.00 ? 94  MET A H    1  
ATOM 1435  H HA   . MET A 1 94  ? 8.851   -9.091  -2.833  1.00 0.00 ? 94  MET A HA   1  
ATOM 1436  H HB2  . MET A 1 94  ? 9.333   -6.348  -1.604  1.00 0.00 ? 94  MET A HB2  1  
ATOM 1437  H HB3  . MET A 1 94  ? 9.700   -6.589  -3.301  1.00 0.00 ? 94  MET A HB3  1  
ATOM 1438  H HG2  . MET A 1 94  ? 7.009   -7.483  -2.227  1.00 0.00 ? 94  MET A HG2  1  
ATOM 1439  H HG3  . MET A 1 94  ? 7.275   -5.784  -2.565  1.00 0.00 ? 94  MET A HG3  1  
ATOM 1440  H HE1  . MET A 1 94  ? 6.117   -9.082  -5.023  1.00 0.00 ? 94  MET A HE1  1  
ATOM 1441  H HE2  . MET A 1 94  ? 5.700   -8.399  -3.434  1.00 0.00 ? 94  MET A HE2  1  
ATOM 1442  H HE3  . MET A 1 94  ? 5.059   -7.655  -4.918  1.00 0.00 ? 94  MET A HE3  1  
ATOM 1443  N N    . PRO A 1 95  ? 11.276  -8.957  -3.691  1.00 0.00 ? 95  PRO A N    1  
ATOM 1444  C CA   . PRO A 1 95  ? 12.664  -9.202  -4.046  1.00 0.00 ? 95  PRO A CA   1  
ATOM 1445  C C    . PRO A 1 95  ? 13.453  -7.892  -4.106  1.00 0.00 ? 95  PRO A C    1  
ATOM 1446  O O    . PRO A 1 95  ? 14.496  -7.762  -3.465  1.00 0.00 ? 95  PRO A O    1  
ATOM 1447  C CB   . PRO A 1 95  ? 12.607  -9.922  -5.384  1.00 0.00 ? 95  PRO A CB   1  
ATOM 1448  C CG   . PRO A 1 95  ? 11.224  -9.642  -5.949  1.00 0.00 ? 95  PRO A CG   1  
ATOM 1449  C CD   . PRO A 1 95  ? 10.367  -9.079  -4.827  1.00 0.00 ? 95  PRO A CD   1  
ATOM 1450  H HA   . PRO A 1 95  ? 13.109  -9.758  -3.344  1.00 0.00 ? 95  PRO A HA   1  
ATOM 1451  H HB2  . PRO A 1 95  ? 13.384  -9.559  -6.056  1.00 0.00 ? 95  PRO A HB2  1  
ATOM 1452  H HB3  . PRO A 1 95  ? 12.768  -10.992 -5.258  1.00 0.00 ? 95  PRO A HB3  1  
ATOM 1453  H HG2  . PRO A 1 95  ? 11.285  -8.934  -6.775  1.00 0.00 ? 95  PRO A HG2  1  
ATOM 1454  H HG3  . PRO A 1 95  ? 10.781  -10.557 -6.345  1.00 0.00 ? 95  PRO A HG3  1  
ATOM 1455  H HD2  . PRO A 1 95  ? 9.943   -8.112  -5.100  1.00 0.00 ? 95  PRO A HD2  1  
ATOM 1456  H HD3  . PRO A 1 95  ? 9.531   -9.739  -4.597  1.00 0.00 ? 95  PRO A HD3  1  
ATOM 1457  N N    . SER A 1 96  ? 12.926  -6.955  -4.880  1.00 0.00 ? 96  SER A N    1  
ATOM 1458  C CA   . SER A 1 96  ? 13.569  -5.661  -5.031  1.00 0.00 ? 96  SER A CA   1  
ATOM 1459  C C    . SER A 1 96  ? 12.593  -4.545  -4.653  1.00 0.00 ? 96  SER A C    1  
ATOM 1460  O O    . SER A 1 96  ? 11.385  -4.683  -4.838  1.00 0.00 ? 96  SER A O    1  
ATOM 1461  C CB   . SER A 1 96  ? 14.076  -5.461  -6.460  1.00 0.00 ? 96  SER A CB   1  
ATOM 1462  O OG   . SER A 1 96  ? 15.339  -4.801  -6.492  1.00 0.00 ? 96  SER A OG   1  
ATOM 1463  H H    . SER A 1 96  ? 12.078  -7.069  -5.397  1.00 0.00 ? 96  SER A H    1  
ATOM 1464  H HA   . SER A 1 96  ? 14.415  -5.677  -4.344  1.00 0.00 ? 96  SER A HA   1  
ATOM 1465  H HB2  . SER A 1 96  ? 14.161  -6.430  -6.954  1.00 0.00 ? 96  SER A HB2  1  
ATOM 1466  H HB3  . SER A 1 96  ? 13.348  -4.879  -7.025  1.00 0.00 ? 96  SER A HB3  1  
ATOM 1467  H HG   . SER A 1 96  ? 15.563  -4.449  -5.583  1.00 0.00 ? 96  SER A HG   1  
ATOM 1468  N N    . LYS A 1 97  ? 13.153  -3.464  -4.131  1.00 0.00 ? 97  LYS A N    1  
ATOM 1469  C CA   . LYS A 1 97  ? 12.347  -2.325  -3.726  1.00 0.00 ? 97  LYS A CA   1  
ATOM 1470  C C    . LYS A 1 97  ? 11.336  -2.003  -4.828  1.00 0.00 ? 97  LYS A C    1  
ATOM 1471  O O    . LYS A 1 97  ? 10.161  -1.769  -4.548  1.00 0.00 ? 97  LYS A O    1  
ATOM 1472  C CB   . LYS A 1 97  ? 13.242  -1.142  -3.348  1.00 0.00 ? 97  LYS A CB   1  
ATOM 1473  C CG   . LYS A 1 97  ? 12.405  0.059   -2.903  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1474  C CD   . LYS A 1 97  ? 13.294  1.270   -2.616  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1475  C CE   . LYS A 1 97  ? 12.762  2.520   -3.321  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1476  N NZ   . LYS A 1 97  ? 13.701  3.651   -3.148  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1477  H H    . LYS A 1 97  ? 14.136  -3.359  -3.984  1.00 0.00 ? 97  LYS A H    1  
ATOM 1478  H HA   . LYS A 1 97  ? 11.800  -2.614  -2.829  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1479  H HB2  . LYS A 1 97  ? 13.919  -1.435  -2.546  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1480  H HB3  . LYS A 1 97  ? 13.860  -0.863  -4.201  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1481  H HG2  . LYS A 1 97  ? 11.681  0.310   -3.679  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1482  H HG3  . LYS A 1 97  ? 11.837  -0.200  -2.010  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1483  H HD2  . LYS A 1 97  ? 13.338  1.446   -1.541  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1484  H HD3  . LYS A 1 97  ? 14.312  1.066   -2.948  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1485  H HE2  . LYS A 1 97  ? 12.623  2.314   -4.382  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1486  H HE3  . LYS A 1 97  ? 11.785  2.785   -2.917  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1487  H HZ1  . LYS A 1 97  ? 13.230  4.409   -2.696  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1488  H HZ2  . LYS A 1 97  ? 14.476  3.359   -2.588  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1489  H HZ3  . LYS A 1 97  ? 14.031  3.950   -4.043  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1490  N N    . GLU A 1 98  ? 11.829  -2.003  -6.058  1.00 0.00 ? 98  GLU A N    1  
ATOM 1491  C CA   . GLU A 1 98  ? 10.983  -1.714  -7.203  1.00 0.00 ? 98  GLU A CA   1  
ATOM 1492  C C    . GLU A 1 98  ? 9.823   -2.710  -7.271  1.00 0.00 ? 98  GLU A C    1  
ATOM 1493  O O    . GLU A 1 98  ? 8.659   -2.313  -7.284  1.00 0.00 ? 98  GLU A O    1  
ATOM 1494  C CB   . GLU A 1 98  ? 11.793  -1.726  -8.501  1.00 0.00 ? 98  GLU A CB   1  
ATOM 1495  C CG   . GLU A 1 98  ? 12.736  -0.523  -8.570  1.00 0.00 ? 98  GLU A CG   1  
ATOM 1496  C CD   . GLU A 1 98  ? 12.759  0.075   -9.978  1.00 0.00 ? 98  GLU A CD   1  
ATOM 1497  O OE1  . GLU A 1 98  ? 11.654  0.312   -10.512 1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1498  O OE2  . GLU A 1 98  ? 13.881  0.281   -10.489 1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1499  H H    . GLU A 1 98  ? 12.785  -2.194  -6.277  1.00 0.00 ? 98  GLU A H    1  
ATOM 1500  H HA   . GLU A 1 98  ? 10.597  -0.709  -7.032  1.00 0.00 ? 98  GLU A HA   1  
ATOM 1501  H HB2  . GLU A 1 98  ? 12.370  -2.649  -8.564  1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1502  H HB3  . GLU A 1 98  ? 11.118  -1.713  -9.356  1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1503  H HG2  . GLU A 1 98  ? 12.417  0.235   -7.854  1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1504  H HG3  . GLU A 1 98  ? 13.742  -0.828  -8.284  1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1505  N N    . ASP A 1 99  ? 10.182  -3.985  -7.313  1.00 0.00 ? 99  ASP A N    1  
ATOM 1506  C CA   . ASP A 1 99  ? 9.186   -5.041  -7.380  1.00 0.00 ? 99  ASP A CA   1  
ATOM 1507  C C    . ASP A 1 99  ? 8.089   -4.766  -6.350  1.00 0.00 ? 99  ASP A C    1  
ATOM 1508  O O    . ASP A 1 99  ? 6.942   -5.172  -6.536  1.00 0.00 ? 99  ASP A O    1  
ATOM 1509  C CB   . ASP A 1 99  ? 9.805   -6.403  -7.060  1.00 0.00 ? 99  ASP A CB   1  
ATOM 1510  C CG   . ASP A 1 99  ? 10.911  -6.852  -8.017  1.00 0.00 ? 99  ASP A CG   1  
ATOM 1511  O OD1  . ASP A 1 99  ? 10.551  -7.326  -9.116  1.00 0.00 ? 99  ASP A OD1  1  
ATOM 1512  O OD2  . ASP A 1 99  ? 12.090  -6.711  -7.628  1.00 0.00 ? 99  ASP A OD2  1  
ATOM 1513  H H    . ASP A 1 99  ? 11.131  -4.299  -7.303  1.00 0.00 ? 99  ASP A H    1  
ATOM 1514  H HA   . ASP A 1 99  ? 8.813   -5.018  -8.404  1.00 0.00 ? 99  ASP A HA   1  
ATOM 1515  H HB2  . ASP A 1 99  ? 10.212  -6.371  -6.049  1.00 0.00 ? 99  ASP A HB2  1  
ATOM 1516  H HB3  . ASP A 1 99  ? 9.015   -7.154  -7.062  1.00 0.00 ? 99  ASP A HB3  1  
ATOM 1517  N N    . ALA A 1 100 ? 8.478   -4.079  -5.286  1.00 0.00 ? 100 ALA A N    1  
ATOM 1518  C CA   . ALA A 1 100 ? 7.541   -3.746  -4.227  1.00 0.00 ? 100 ALA A CA   1  
ATOM 1519  C C    . ALA A 1 100 ? 6.724   -2.521  -4.642  1.00 0.00 ? 100 ALA A C    1  
ATOM 1520  O O    . ALA A 1 100 ? 5.518   -2.466  -4.405  1.00 0.00 ? 100 ALA A O    1  
ATOM 1521  C CB   . ALA A 1 100 ? 8.306   -3.521  -2.921  1.00 0.00 ? 100 ALA A CB   1  
ATOM 1522  H H    . ALA A 1 100 ? 9.412   -3.753  -5.143  1.00 0.00 ? 100 ALA A H    1  
ATOM 1523  H HA   . ALA A 1 100 ? 6.869   -4.594  -4.099  1.00 0.00 ? 100 ALA A HA   1  
ATOM 1524  H HB1  . ALA A 1 100 ? 7.701   -3.865  -2.082  1.00 0.00 ? 100 ALA A HB1  1  
ATOM 1525  H HB2  . ALA A 1 100 ? 9.242   -4.080  -2.947  1.00 0.00 ? 100 ALA A HB2  1  
ATOM 1526  H HB3  . ALA A 1 100 ? 8.520   -2.459  -2.803  1.00 0.00 ? 100 ALA A HB3  1  
ATOM 1527  N N    . ILE A 1 101 ? 7.413   -1.569  -5.254  1.00 0.00 ? 101 ILE A N    1  
ATOM 1528  C CA   . ILE A 1 101 ? 6.766   -0.348  -5.703  1.00 0.00 ? 101 ILE A CA   1  
ATOM 1529  C C    . ILE A 1 101 ? 5.821   -0.674  -6.862  1.00 0.00 ? 101 ILE A C    1  
ATOM 1530  O O    . ILE A 1 101 ? 4.649   -0.301  -6.836  1.00 0.00 ? 101 ILE A O    1  
ATOM 1531  C CB   . ILE A 1 101 ? 7.809   0.718   -6.043  1.00 0.00 ? 101 ILE A CB   1  
ATOM 1532  C CG1  . ILE A 1 101 ? 8.470   1.262   -4.774  1.00 0.00 ? 101 ILE A CG1  1  
ATOM 1533  C CG2  . ILE A 1 101 ? 7.198   1.833   -6.894  1.00 0.00 ? 101 ILE A CG2  1  
ATOM 1534  C CD1  . ILE A 1 101 ? 9.978   1.431   -4.970  1.00 0.00 ? 101 ILE A CD1  1  
ATOM 1535  H H    . ILE A 1 101 ? 8.393   -1.621  -5.442  1.00 0.00 ? 101 ILE A H    1  
ATOM 1536  H HA   . ILE A 1 101 ? 6.173   0.034   -4.872  1.00 0.00 ? 101 ILE A HA   1  
ATOM 1537  H HB   . ILE A 1 101 ? 8.593   0.251   -6.639  1.00 0.00 ? 101 ILE A HB   1  
ATOM 1538  H HG12 . ILE A 1 101 ? 8.024   2.221   -4.510  1.00 0.00 ? 101 ILE A HG12 1  
ATOM 1539  H HG13 . ILE A 1 101 ? 8.281   0.583   -3.942  1.00 0.00 ? 101 ILE A HG13 1  
ATOM 1540  H HG21 . ILE A 1 101 ? 6.458   2.376   -6.305  1.00 0.00 ? 101 ILE A HG21 1  
ATOM 1541  H HG22 . ILE A 1 101 ? 7.983   2.519   -7.213  1.00 0.00 ? 101 ILE A HG22 1  
ATOM 1542  H HG23 . ILE A 1 101 ? 6.717   1.399   -7.770  1.00 0.00 ? 101 ILE A HG23 1  
ATOM 1543  H HD11 . ILE A 1 101 ? 10.162  2.135   -5.781  1.00 0.00 ? 101 ILE A HD11 1  
ATOM 1544  H HD12 . ILE A 1 101 ? 10.423  1.811   -4.051  1.00 0.00 ? 101 ILE A HD12 1  
ATOM 1545  H HD13 . ILE A 1 101 ? 10.422  0.467   -5.218  1.00 0.00 ? 101 ILE A HD13 1  
ATOM 1546  N N    . GLU A 1 102 ? 6.366   -1.367  -7.851  1.00 0.00 ? 102 GLU A N    1  
ATOM 1547  C CA   . GLU A 1 102 ? 5.586   -1.748  -9.016  1.00 0.00 ? 102 GLU A CA   1  
ATOM 1548  C C    . GLU A 1 102 ? 4.262   -2.383  -8.586  1.00 0.00 ? 102 GLU A C    1  
ATOM 1549  O O    . GLU A 1 102 ? 3.195   -1.966  -9.033  1.00 0.00 ? 102 GLU A O    1  
ATOM 1550  C CB   . GLU A 1 102 ? 6.378   -2.693  -9.922  1.00 0.00 ? 102 GLU A CB   1  
ATOM 1551  C CG   . GLU A 1 102 ? 7.768   -2.127  -10.223 1.00 0.00 ? 102 GLU A CG   1  
ATOM 1552  C CD   . GLU A 1 102 ? 8.152   -2.365  -11.684 1.00 0.00 ? 102 GLU A CD   1  
ATOM 1553  O OE1  . GLU A 1 102 ? 7.997   -3.523  -12.131 1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1554  O OE2  . GLU A 1 102 ? 8.591   -1.385  -12.323 1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1555  H H    . GLU A 1 102 ? 7.320   -1.667  -7.864  1.00 0.00 ? 102 GLU A H    1  
ATOM 1556  H HA   . GLU A 1 102 ? 5.393   -0.818  -9.552  1.00 0.00 ? 102 GLU A HA   1  
ATOM 1557  H HB2  . GLU A 1 102 ? 6.474   -3.667  -9.441  1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1558  H HB3  . GLU A 1 102 ? 5.836   -2.849  -10.854 1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1559  H HG2  . GLU A 1 102 ? 7.784   -1.059  -10.008 1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1560  H HG3  . GLU A 1 102 ? 8.504   -2.595  -9.569  1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1561  N N    . HIS A 1 103 ? 4.375   -3.381  -7.721  1.00 0.00 ? 103 HIS A N    1  
ATOM 1562  C CA   . HIS A 1 103 ? 3.201   -4.077  -7.225  1.00 0.00 ? 103 HIS A CA   1  
ATOM 1563  C C    . HIS A 1 103 ? 2.281   -3.086  -6.508  1.00 0.00 ? 103 HIS A C    1  
ATOM 1564  O O    . HIS A 1 103 ? 1.079   -3.051  -6.766  1.00 0.00 ? 103 HIS A O    1  
ATOM 1565  C CB   . HIS A 1 103 ? 3.603   -5.259  -6.341  1.00 0.00 ? 103 HIS A CB   1  
ATOM 1566  C CG   . HIS A 1 103 ? 2.544   -6.330  -6.228  1.00 0.00 ? 103 HIS A CG   1  
ATOM 1567  N ND1  . HIS A 1 103 ? 1.806   -6.772  -7.312  1.00 0.00 ? 103 HIS A ND1  1  
ATOM 1568  C CD2  . HIS A 1 103 ? 2.109   -7.043  -5.150  1.00 0.00 ? 103 HIS A CD2  1  
ATOM 1569  C CE1  . HIS A 1 103 ? 0.967   -7.708  -6.893  1.00 0.00 ? 103 HIS A CE1  1  
ATOM 1570  N NE2  . HIS A 1 103 ? 1.156   -7.874  -5.553  1.00 0.00 ? 103 HIS A NE2  1  
ATOM 1571  H H    . HIS A 1 103 ? 5.247   -3.714  -7.362  1.00 0.00 ? 103 HIS A H    1  
ATOM 1572  H HA   . HIS A 1 103 ? 2.682   -4.476  -8.097  1.00 0.00 ? 103 HIS A HA   1  
ATOM 1573  H HB2  . HIS A 1 103 ? 4.515   -5.704  -6.740  1.00 0.00 ? 103 HIS A HB2  1  
ATOM 1574  H HB3  . HIS A 1 103 ? 3.839   -4.889  -5.343  1.00 0.00 ? 103 HIS A HB3  1  
ATOM 1575  H HD1  . HIS A 1 103 ? 1.892   -6.441  -8.252  1.00 0.00 ? 103 HIS A HD1  1  
ATOM 1576  H HD2  . HIS A 1 103 ? 2.481   -6.946  -4.130  1.00 0.00 ? 103 HIS A HD2  1  
ATOM 1577  H HE1  . HIS A 1 103 ? 0.251   -8.250  -7.512  1.00 0.00 ? 103 HIS A HE1  1  
ATOM 1578  N N    . PHE A 1 104 ? 2.882   -2.306  -5.622  1.00 0.00 ? 104 PHE A N    1  
ATOM 1579  C CA   . PHE A 1 104 ? 2.132   -1.318  -4.865  1.00 0.00 ? 104 PHE A CA   1  
ATOM 1580  C C    . PHE A 1 104 ? 1.512   -0.272  -5.794  1.00 0.00 ? 104 PHE A C    1  
ATOM 1581  O O    . PHE A 1 104 ? 0.477   0.312   -5.474  1.00 0.00 ? 104 PHE A O    1  
ATOM 1582  C CB   . PHE A 1 104 ? 3.123   -0.626  -3.927  1.00 0.00 ? 104 PHE A CB   1  
ATOM 1583  C CG   . PHE A 1 104 ? 2.534   0.564   -3.167  1.00 0.00 ? 104 PHE A CG   1  
ATOM 1584  C CD1  . PHE A 1 104 ? 1.860   0.360   -2.003  1.00 0.00 ? 104 PHE A CD1  1  
ATOM 1585  C CD2  . PHE A 1 104 ? 2.684   1.824   -3.654  1.00 0.00 ? 104 PHE A CD2  1  
ATOM 1586  C CE1  . PHE A 1 104 ? 1.313   1.464   -1.297  1.00 0.00 ? 104 PHE A CE1  1  
ATOM 1587  C CE2  . PHE A 1 104 ? 2.137   2.928   -2.948  1.00 0.00 ? 104 PHE A CE2  1  
ATOM 1588  C CZ   . PHE A 1 104 ? 1.463   2.725   -1.785  1.00 0.00 ? 104 PHE A CZ   1  
ATOM 1589  H H    . PHE A 1 104 ? 3.860   -2.342  -5.417  1.00 0.00 ? 104 PHE A H    1  
ATOM 1590  H HA   . PHE A 1 104 ? 1.339   -1.847  -4.337  1.00 0.00 ? 104 PHE A HA   1  
ATOM 1591  H HB2  . PHE A 1 104 ? 3.497   -1.355  -3.208  1.00 0.00 ? 104 PHE A HB2  1  
ATOM 1592  H HB3  . PHE A 1 104 ? 3.980   -0.284  -4.509  1.00 0.00 ? 104 PHE A HB3  1  
ATOM 1593  H HD1  . PHE A 1 104 ? 1.740   -0.650  -1.613  1.00 0.00 ? 104 PHE A HD1  1  
ATOM 1594  H HD2  . PHE A 1 104 ? 3.224   1.987   -4.587  1.00 0.00 ? 104 PHE A HD2  1  
ATOM 1595  H HE1  . PHE A 1 104 ? 0.773   1.301   -0.365  1.00 0.00 ? 104 PHE A HE1  1  
ATOM 1596  H HE2  . PHE A 1 104 ? 2.257   3.939   -3.339  1.00 0.00 ? 104 PHE A HE2  1  
ATOM 1597  H HZ   . PHE A 1 104 ? 1.043   3.573   -1.243  1.00 0.00 ? 104 PHE A HZ   1  
ATOM 1598  N N    . MET A 1 105 ? 2.170   -0.067  -6.925  1.00 0.00 ? 105 MET A N    1  
ATOM 1599  C CA   . MET A 1 105 ? 1.697   0.899   -7.903  1.00 0.00 ? 105 MET A CA   1  
ATOM 1600  C C    . MET A 1 105 ? 0.627   0.283   -8.807  1.00 0.00 ? 105 MET A C    1  
ATOM 1601  O O    . MET A 1 105 ? -0.317  0.962   -9.209  1.00 0.00 ? 105 MET A O    1  
ATOM 1602  C CB   . MET A 1 105 ? 2.872   1.381   -8.756  1.00 0.00 ? 105 MET A CB   1  
ATOM 1603  C CG   . MET A 1 105 ? 3.559   2.586   -8.111  1.00 0.00 ? 105 MET A CG   1  
ATOM 1604  S SD   . MET A 1 105 ? 3.754   3.892   -9.312  1.00 0.00 ? 105 MET A SD   1  
ATOM 1605  C CE   . MET A 1 105 ? 4.611   3.002   -10.601 1.00 0.00 ? 105 MET A CE   1  
ATOM 1606  H H    . MET A 1 105 ? 3.011   -0.546  -7.178  1.00 0.00 ? 105 MET A H    1  
ATOM 1607  H HA   . MET A 1 105 ? 1.266   1.715   -7.323  1.00 0.00 ? 105 MET A HA   1  
ATOM 1608  H HB2  . MET A 1 105 ? 3.591   0.571   -8.881  1.00 0.00 ? 105 MET A HB2  1  
ATOM 1609  H HB3  . MET A 1 105 ? 2.518   1.649   -9.751  1.00 0.00 ? 105 MET A HB3  1  
ATOM 1610  H HG2  . MET A 1 105 ? 2.970   2.942   -7.266  1.00 0.00 ? 105 MET A HG2  1  
ATOM 1611  H HG3  . MET A 1 105 ? 4.533   2.293   -7.719  1.00 0.00 ? 105 MET A HG3  1  
ATOM 1612  H HE1  . MET A 1 105 ? 5.685   3.050   -10.423 1.00 0.00 ? 105 MET A HE1  1  
ATOM 1613  H HE2  . MET A 1 105 ? 4.288   1.961   -10.600 1.00 0.00 ? 105 MET A HE2  1  
ATOM 1614  H HE3  . MET A 1 105 ? 4.382   3.453   -11.567 1.00 0.00 ? 105 MET A HE3  1  
ATOM 1615  N N    . LYS A 1 106 ? 0.811   -0.995  -9.102  1.00 0.00 ? 106 LYS A N    1  
ATOM 1616  C CA   . LYS A 1 106 ? -0.126  -1.710  -9.952  1.00 0.00 ? 106 LYS A CA   1  
ATOM 1617  C C    . LYS A 1 106 ? -1.361  -2.091  -9.134  1.00 0.00 ? 106 LYS A C    1  
ATOM 1618  O O    . LYS A 1 106 ? -2.489  -1.951  -9.605  1.00 0.00 ? 106 LYS A O    1  
ATOM 1619  C CB   . LYS A 1 106 ? 0.560   -2.902  -10.622 1.00 0.00 ? 106 LYS A CB   1  
ATOM 1620  C CG   . LYS A 1 106 ? -0.414  -4.069  -10.794 1.00 0.00 ? 106 LYS A CG   1  
ATOM 1621  C CD   . LYS A 1 106 ? 0.295   -5.295  -11.374 1.00 0.00 ? 106 LYS A CD   1  
ATOM 1622  C CE   . LYS A 1 106 ? -0.136  -5.544  -12.821 1.00 0.00 ? 106 LYS A CE   1  
ATOM 1623  N NZ   . LYS A 1 106 ? 1.046   -5.624  -13.708 1.00 0.00 ? 106 LYS A NZ   1  
ATOM 1624  H H    . LYS A 1 106 ? 1.582   -1.540  -8.771  1.00 0.00 ? 106 LYS A H    1  
ATOM 1625  H HA   . LYS A 1 106 ? -0.433  -1.028  -10.745 1.00 0.00 ? 106 LYS A HA   1  
ATOM 1626  H HB2  . LYS A 1 106 ? 0.951   -2.603  -11.594 1.00 0.00 ? 106 LYS A HB2  1  
ATOM 1627  H HB3  . LYS A 1 106 ? 1.412   -3.221  -10.021 1.00 0.00 ? 106 LYS A HB3  1  
ATOM 1628  H HG2  . LYS A 1 106 ? -0.857  -4.323  -9.831  1.00 0.00 ? 106 LYS A HG2  1  
ATOM 1629  H HG3  . LYS A 1 106 ? -1.231  -3.772  -11.452 1.00 0.00 ? 106 LYS A HG3  1  
ATOM 1630  H HD2  . LYS A 1 106 ? 1.374   -5.148  -11.333 1.00 0.00 ? 106 LYS A HD2  1  
ATOM 1631  H HD3  . LYS A 1 106 ? 0.069   -6.171  -10.768 1.00 0.00 ? 106 LYS A HD3  1  
ATOM 1632  H HE2  . LYS A 1 106 ? -0.708  -6.470  -12.882 1.00 0.00 ? 106 LYS A HE2  1  
ATOM 1633  H HE3  . LYS A 1 106 ? -0.794  -4.741  -13.154 1.00 0.00 ? 106 LYS A HE3  1  
ATOM 1634  H HZ1  . LYS A 1 106 ? 0.792   -5.330  -14.629 1.00 0.00 ? 106 LYS A HZ1  1  
ATOM 1635  H HZ2  . LYS A 1 106 ? 1.768   -5.029  -13.355 1.00 0.00 ? 106 LYS A HZ2  1  
ATOM 1636  H HZ3  . LYS A 1 106 ? 1.377   -6.567  -13.738 1.00 0.00 ? 106 LYS A HZ3  1  
ATOM 1637  N N    . LEU A 1 107 ? -1.107  -2.564  -7.923  1.00 0.00 ? 107 LEU A N    1  
ATOM 1638  C CA   . LEU A 1 107 ? -2.184  -2.967  -7.035  1.00 0.00 ? 107 LEU A CA   1  
ATOM 1639  C C    . LEU A 1 107 ? -3.199  -1.827  -6.923  1.00 0.00 ? 107 LEU A C    1  
ATOM 1640  O O    . LEU A 1 107 ? -4.376  -2.006  -7.235  1.00 0.00 ? 107 LEU A O    1  
ATOM 1641  C CB   . LEU A 1 107 ? -1.625  -3.426  -5.687  1.00 0.00 ? 107 LEU A CB   1  
ATOM 1642  C CG   . LEU A 1 107 ? -1.328  -4.921  -5.559  1.00 0.00 ? 107 LEU A CG   1  
ATOM 1643  C CD1  . LEU A 1 107 ? -0.886  -5.272  -4.137  1.00 0.00 ? 107 LEU A CD1  1  
ATOM 1644  C CD2  . LEU A 1 107 ? -2.526  -5.759  -6.010  1.00 0.00 ? 107 LEU A CD2  1  
ATOM 1645  H H    . LEU A 1 107 ? -0.187  -2.675  -7.548  1.00 0.00 ? 107 LEU A H    1  
ATOM 1646  H HA   . LEU A 1 107 ? -2.678  -3.826  -7.489  1.00 0.00 ? 107 LEU A HA   1  
ATOM 1647  H HB2  . LEU A 1 107 ? -0.705  -2.875  -5.491  1.00 0.00 ? 107 LEU A HB2  1  
ATOM 1648  H HB3  . LEU A 1 107 ? -2.335  -3.148  -4.908  1.00 0.00 ? 107 LEU A HB3  1  
ATOM 1649  H HG   . LEU A 1 107 ? -0.497  -5.163  -6.222  1.00 0.00 ? 107 LEU A HG   1  
ATOM 1650  H HD11 . LEU A 1 107 ? -0.535  -6.304  -4.109  1.00 0.00 ? 107 LEU A HD11 1  
ATOM 1651  H HD12 . LEU A 1 107 ? -0.079  -4.606  -3.832  1.00 0.00 ? 107 LEU A HD12 1  
ATOM 1652  H HD13 . LEU A 1 107 ? -1.729  -5.157  -3.455  1.00 0.00 ? 107 LEU A HD13 1  
ATOM 1653  H HD21 . LEU A 1 107 ? -2.279  -6.274  -6.939  1.00 0.00 ? 107 LEU A HD21 1  
ATOM 1654  H HD22 . LEU A 1 107 ? -2.767  -6.493  -5.241  1.00 0.00 ? 107 LEU A HD22 1  
ATOM 1655  H HD23 . LEU A 1 107 ? -3.384  -5.107  -6.173  1.00 0.00 ? 107 LEU A HD23 1  
ATOM 1656  N N    . TYR A 1 108 ? -2.708  -0.681  -6.477  1.00 0.00 ? 108 TYR A N    1  
ATOM 1657  C CA   . TYR A 1 108 ? -3.557  0.488   -6.321  1.00 0.00 ? 108 TYR A CA   1  
ATOM 1658  C C    . TYR A 1 108 ? -4.113  0.947   -7.670  1.00 0.00 ? 108 TYR A C    1  
ATOM 1659  O O    . TYR A 1 108 ? -4.996  1.801   -7.724  1.00 0.00 ? 108 TYR A O    1  
ATOM 1660  C CB   . TYR A 1 108 ? -2.660  1.588   -5.751  1.00 0.00 ? 108 TYR A CB   1  
ATOM 1661  C CG   . TYR A 1 108 ? -3.396  2.893   -5.442  1.00 0.00 ? 108 TYR A CG   1  
ATOM 1662  C CD1  . TYR A 1 108 ? -3.554  3.847   -6.427  1.00 0.00 ? 108 TYR A CD1  1  
ATOM 1663  C CD2  . TYR A 1 108 ? -3.901  3.118   -4.177  1.00 0.00 ? 108 TYR A CD2  1  
ATOM 1664  C CE1  . TYR A 1 108 ? -4.247  5.075   -6.136  1.00 0.00 ? 108 TYR A CE1  1  
ATOM 1665  C CE2  . TYR A 1 108 ? -4.594  4.346   -3.886  1.00 0.00 ? 108 TYR A CE2  1  
ATOM 1666  C CZ   . TYR A 1 108 ? -4.732  5.264   -4.880  1.00 0.00 ? 108 TYR A CZ   1  
ATOM 1667  O OH   . TYR A 1 108 ? -5.387  6.424   -4.604  1.00 0.00 ? 108 TYR A OH   1  
ATOM 1668  H H    . TYR A 1 108 ? -1.749  -0.543  -6.226  1.00 0.00 ? 108 TYR A H    1  
ATOM 1669  H HA   . TYR A 1 108 ? -4.387  0.215   -5.668  1.00 0.00 ? 108 TYR A HA   1  
ATOM 1670  H HB2  . TYR A 1 108 ? -2.189  1.223   -4.838  1.00 0.00 ? 108 TYR A HB2  1  
ATOM 1671  H HB3  . TYR A 1 108 ? -1.859  1.794   -6.462  1.00 0.00 ? 108 TYR A HB3  1  
ATOM 1672  H HD1  . TYR A 1 108 ? -3.155  3.670   -7.426  1.00 0.00 ? 108 TYR A HD1  1  
ATOM 1673  H HD2  . TYR A 1 108 ? -3.776  2.365   -3.399  1.00 0.00 ? 108 TYR A HD2  1  
ATOM 1674  H HE1  . TYR A 1 108 ? -4.379  5.836   -6.905  1.00 0.00 ? 108 TYR A HE1  1  
ATOM 1675  H HE2  . TYR A 1 108 ? -4.998  4.535   -2.891  1.00 0.00 ? 108 TYR A HE2  1  
ATOM 1676  H HH   . TYR A 1 108 ? -6.367  6.250   -4.512  1.00 0.00 ? 108 TYR A HH   1  
ATOM 1677  N N    . GLU A 1 109 ? -3.572  0.359   -8.728  1.00 0.00 ? 109 GLU A N    1  
ATOM 1678  C CA   . GLU A 1 109 ? -4.003  0.696   -10.074 1.00 0.00 ? 109 GLU A CA   1  
ATOM 1679  C C    . GLU A 1 109 ? -5.100  -0.265  -10.537 1.00 0.00 ? 109 GLU A C    1  
ATOM 1680  O O    . GLU A 1 109 ? -5.851  0.044   -11.460 1.00 0.00 ? 109 GLU A O    1  
ATOM 1681  C CB   . GLU A 1 109 ? -2.821  0.689   -11.045 1.00 0.00 ? 109 GLU A CB   1  
ATOM 1682  C CG   . GLU A 1 109 ? -3.303  0.767   -12.495 1.00 0.00 ? 109 GLU A CG   1  
ATOM 1683  C CD   . GLU A 1 109 ? -2.122  0.760   -13.467 1.00 0.00 ? 109 GLU A CD   1  
ATOM 1684  O OE1  . GLU A 1 109 ? -1.272  -0.146  -13.322 1.00 0.00 ? 109 GLU A OE1  1  
ATOM 1685  O OE2  . GLU A 1 109 ? -2.094  1.661   -14.334 1.00 0.00 ? 109 GLU A OE2  1  
ATOM 1686  H H    . GLU A 1 109 ? -2.854  -0.336  -8.675  1.00 0.00 ? 109 GLU A H    1  
ATOM 1687  H HA   . GLU A 1 109 ? -4.402  1.708   -10.005 1.00 0.00 ? 109 GLU A HA   1  
ATOM 1688  H HB2  . GLU A 1 109 ? -2.164  1.532   -10.831 1.00 0.00 ? 109 GLU A HB2  1  
ATOM 1689  H HB3  . GLU A 1 109 ? -2.233  -0.217  -10.902 1.00 0.00 ? 109 GLU A HB3  1  
ATOM 1690  H HG2  . GLU A 1 109 ? -3.960  -0.076  -12.710 1.00 0.00 ? 109 GLU A HG2  1  
ATOM 1691  H HG3  . GLU A 1 109 ? -3.891  1.674   -12.639 1.00 0.00 ? 109 GLU A HG3  1  
ATOM 1692  N N    . GLU A 1 110 ? -5.156  -1.411  -9.875  1.00 0.00 ? 110 GLU A N    1  
ATOM 1693  C CA   . GLU A 1 110 ? -6.148  -2.419  -10.207 1.00 0.00 ? 110 GLU A CA   1  
ATOM 1694  C C    . GLU A 1 110 ? -7.484  -2.091  -9.536  1.00 0.00 ? 110 GLU A C    1  
ATOM 1695  O O    . GLU A 1 110 ? -8.538  -2.194  -10.161 1.00 0.00 ? 110 GLU A O    1  
ATOM 1696  C CB   . GLU A 1 110 ? -5.665  -3.816  -9.811  1.00 0.00 ? 110 GLU A CB   1  
ATOM 1697  C CG   . GLU A 1 110 ? -6.206  -4.214  -8.437  1.00 0.00 ? 110 GLU A CG   1  
ATOM 1698  C CD   . GLU A 1 110 ? -5.760  -5.629  -8.061  1.00 0.00 ? 110 GLU A CD   1  
ATOM 1699  O OE1  . GLU A 1 110 ? -5.849  -6.506  -8.947  1.00 0.00 ? 110 GLU A OE1  1  
ATOM 1700  O OE2  . GLU A 1 110 ? -5.340  -5.801  -6.897  1.00 0.00 ? 110 GLU A OE2  1  
ATOM 1701  H H    . GLU A 1 110 ? -4.541  -1.655  -9.125  1.00 0.00 ? 110 GLU A H    1  
ATOM 1702  H HA   . GLU A 1 110 ? -6.257  -2.372  -11.290 1.00 0.00 ? 110 GLU A HA   1  
ATOM 1703  H HB2  . GLU A 1 110 ? -5.988  -4.541  -10.558 1.00 0.00 ? 110 GLU A HB2  1  
ATOM 1704  H HB3  . GLU A 1 110 ? -4.575  -3.837  -9.797  1.00 0.00 ? 110 GLU A HB3  1  
ATOM 1705  H HG2  . GLU A 1 110 ? -5.856  -3.507  -7.685  1.00 0.00 ? 110 GLU A HG2  1  
ATOM 1706  H HG3  . GLU A 1 110 ? -7.295  -4.162  -8.441  1.00 0.00 ? 110 GLU A HG3  1  
ATOM 1707  N N    . LYS A 1 111 ? -7.395  -1.702  -8.273  1.00 0.00 ? 111 LYS A N    1  
ATOM 1708  C CA   . LYS A 1 111 ? -8.584  -1.358  -7.511  1.00 0.00 ? 111 LYS A CA   1  
ATOM 1709  C C    . LYS A 1 111 ? -9.243  -0.125  -8.131  1.00 0.00 ? 111 LYS A C    1  
ATOM 1710  O O    . LYS A 1 111 ? -10.363 -0.202  -8.633  1.00 0.00 ? 111 LYS A O    1  
ATOM 1711  C CB   . LYS A 1 111 ? -8.240  -1.192  -6.029  1.00 0.00 ? 111 LYS A CB   1  
ATOM 1712  C CG   . LYS A 1 111 ? -7.699  -2.497  -5.442  1.00 0.00 ? 111 LYS A CG   1  
ATOM 1713  C CD   . LYS A 1 111 ? -8.825  -3.512  -5.231  1.00 0.00 ? 111 LYS A CD   1  
ATOM 1714  C CE   . LYS A 1 111 ? -8.280  -4.941  -5.223  1.00 0.00 ? 111 LYS A CE   1  
ATOM 1715  N NZ   . LYS A 1 111 ? -9.075  -5.794  -4.311  1.00 0.00 ? 111 LYS A NZ   1  
ATOM 1716  H H    . LYS A 1 111 ? -6.534  -1.621  -7.772  1.00 0.00 ? 111 LYS A H    1  
ATOM 1717  H HA   . LYS A 1 111 ? -9.276  -2.196  -7.589  1.00 0.00 ? 111 LYS A HA   1  
ATOM 1718  H HB2  . LYS A 1 111 ? -7.500  -0.401  -5.909  1.00 0.00 ? 111 LYS A HB2  1  
ATOM 1719  H HB3  . LYS A 1 111 ? -9.129  -0.882  -5.479  1.00 0.00 ? 111 LYS A HB3  1  
ATOM 1720  H HG2  . LYS A 1 111 ? -6.947  -2.916  -6.110  1.00 0.00 ? 111 LYS A HG2  1  
ATOM 1721  H HG3  . LYS A 1 111 ? -7.204  -2.295  -4.492  1.00 0.00 ? 111 LYS A HG3  1  
ATOM 1722  H HD2  . LYS A 1 111 ? -9.332  -3.307  -4.288  1.00 0.00 ? 111 LYS A HD2  1  
ATOM 1723  H HD3  . LYS A 1 111 ? -9.568  -3.406  -6.022  1.00 0.00 ? 111 LYS A HD3  1  
ATOM 1724  H HE2  . LYS A 1 111 ? -8.308  -5.353  -6.232  1.00 0.00 ? 111 LYS A HE2  1  
ATOM 1725  H HE3  . LYS A 1 111 ? -7.236  -4.937  -4.909  1.00 0.00 ? 111 LYS A HE3  1  
ATOM 1726  H HZ1  . LYS A 1 111 ? -9.857  -6.174  -4.806  1.00 0.00 ? 111 LYS A HZ1  1  
ATOM 1727  H HZ2  . LYS A 1 111 ? -8.503  -6.539  -3.968  1.00 0.00 ? 111 LYS A HZ2  1  
ATOM 1728  H HZ3  . LYS A 1 111 ? -9.403  -5.245  -3.542  1.00 0.00 ? 111 LYS A HZ3  1  
ATOM 1729  N N    . THR A 1 112 ? -8.520  0.984   -8.076  1.00 0.00 ? 112 THR A N    1  
ATOM 1730  C CA   . THR A 1 112 ? -9.021  2.232   -8.626  1.00 0.00 ? 112 THR A CA   1  
ATOM 1731  C C    . THR A 1 112 ? -9.116  2.143   -10.150 1.00 0.00 ? 112 THR A C    1  
ATOM 1732  O O    . THR A 1 112 ? -10.026 2.710   -10.754 1.00 0.00 ? 112 THR A O    1  
ATOM 1733  C CB   . THR A 1 112 ? -8.111  3.362   -8.140  1.00 0.00 ? 112 THR A CB   1  
ATOM 1734  O OG1  . THR A 1 112 ? -6.912  3.190   -8.890  1.00 0.00 ? 112 THR A OG1  1  
ATOM 1735  C CG2  . THR A 1 112 ? -7.671  3.175   -6.686  1.00 0.00 ? 112 THR A CG2  1  
ATOM 1736  H H    . THR A 1 112 ? -7.610  1.038   -7.665  1.00 0.00 ? 112 THR A H    1  
ATOM 1737  H HA   . THR A 1 112 ? -10.032 2.392   -8.251  1.00 0.00 ? 112 THR A HA   1  
ATOM 1738  H HB   . THR A 1 112 ? -8.587  4.333   -8.281  1.00 0.00 ? 112 THR A HB   1  
ATOM 1739  H HG1  . THR A 1 112 ? -6.441  2.359   -8.596  1.00 0.00 ? 112 THR A HG1  1  
ATOM 1740  H HG21 . THR A 1 112 ? -7.812  4.108   -6.141  1.00 0.00 ? 112 THR A HG21 1  
ATOM 1741  H HG22 . THR A 1 112 ? -8.269  2.390   -6.224  1.00 0.00 ? 112 THR A HG22 1  
ATOM 1742  H HG23 . THR A 1 112 ? -6.618  2.894   -6.659  1.00 0.00 ? 112 THR A HG23 1  
ATOM 1743  N N    . GLY A 1 113 ? -8.164  1.426   -10.730 1.00 0.00 ? 113 GLY A N    1  
ATOM 1744  C CA   . GLY A 1 113 ? -8.129  1.255   -12.172 1.00 0.00 ? 113 GLY A CA   1  
ATOM 1745  C C    . GLY A 1 113 ? -7.179  2.263   -12.821 1.00 0.00 ? 113 GLY A C    1  
ATOM 1746  O O    . GLY A 1 113 ? -6.703  2.046   -13.935 1.00 0.00 ? 113 GLY A O    1  
ATOM 1747  H H    . GLY A 1 113 ? -7.427  0.968   -10.232 1.00 0.00 ? 113 GLY A H    1  
ATOM 1748  H HA2  . GLY A 1 113 ? -7.810  0.241   -12.414 1.00 0.00 ? 113 GLY A HA2  1  
ATOM 1749  H HA3  . GLY A 1 113 ? -9.132  1.380   -12.581 1.00 0.00 ? 113 GLY A HA3  1  
ATOM 1750  N N    . ASN A 1 114 ? -6.930  3.345   -12.097 1.00 0.00 ? 114 ASN A N    1  
ATOM 1751  C CA   . ASN A 1 114 ? -6.045  4.387   -12.589 1.00 0.00 ? 114 ASN A CA   1  
ATOM 1752  C C    . ASN A 1 114 ? -4.661  4.212   -11.962 1.00 0.00 ? 114 ASN A C    1  
ATOM 1753  O O    . ASN A 1 114 ? -4.541  3.730   -10.836 1.00 0.00 ? 114 ASN A O    1  
ATOM 1754  C CB   . ASN A 1 114 ? -6.564  5.775   -12.208 1.00 0.00 ? 114 ASN A CB   1  
ATOM 1755  C CG   . ASN A 1 114 ? -7.440  6.357   -13.320 1.00 0.00 ? 114 ASN A CG   1  
ATOM 1756  O OD1  . ASN A 1 114 ? -6.997  7.126   -14.156 1.00 0.00 ? 114 ASN A OD1  1  
ATOM 1757  N ND2  . ASN A 1 114 ? -8.705  5.946   -13.283 1.00 0.00 ? 114 ASN A ND2  1  
ATOM 1758  H H    . ASN A 1 114 ? -7.321  3.514   -11.193 1.00 0.00 ? 114 ASN A H    1  
ATOM 1759  H HA   . ASN A 1 114 ? -6.031  4.264   -13.671 1.00 0.00 ? 114 ASN A HA   1  
ATOM 1760  H HB2  . ASN A 1 114 ? -7.138  5.712   -11.284 1.00 0.00 ? 114 ASN A HB2  1  
ATOM 1761  H HB3  . ASN A 1 114 ? -5.724  6.442   -12.016 1.00 0.00 ? 114 ASN A HB3  1  
ATOM 1762  H HD21 . ASN A 1 114 ? -9.004  5.313   -12.569 1.00 0.00 ? 114 ASN A HD21 1  
ATOM 1763  H HD22 . ASN A 1 114 ? -9.356  6.271   -13.968 1.00 0.00 ? 114 ASN A HD22 1  
ATOM 1764  N N    . ALA A 1 115 ? -3.649  4.613   -12.717 1.00 0.00 ? 115 ALA A N    1  
ATOM 1765  C CA   . ALA A 1 115 ? -2.277  4.507   -12.249 1.00 0.00 ? 115 ALA A CA   1  
ATOM 1766  C C    . ALA A 1 115 ? -2.108  5.351   -10.984 1.00 0.00 ? 115 ALA A C    1  
ATOM 1767  O O    . ALA A 1 115 ? -2.759  6.382   -10.829 1.00 0.00 ? 115 ALA A O    1  
ATOM 1768  C CB   . ALA A 1 115 ? -1.322  4.932   -13.366 1.00 0.00 ? 115 ALA A CB   1  
ATOM 1769  H H    . ALA A 1 115 ? -3.754  5.005   -13.631 1.00 0.00 ? 115 ALA A H    1  
ATOM 1770  H HA   . ALA A 1 115 ? -2.090  3.461   -12.006 1.00 0.00 ? 115 ALA A HA   1  
ATOM 1771  H HB1  . ALA A 1 115 ? -0.601  4.137   -13.550 1.00 0.00 ? 115 ALA A HB1  1  
ATOM 1772  H HB2  . ALA A 1 115 ? -1.890  5.125   -14.276 1.00 0.00 ? 115 ALA A HB2  1  
ATOM 1773  H HB3  . ALA A 1 115 ? -0.796  5.839   -13.068 1.00 0.00 ? 115 ALA A HB3  1  
ATOM 1774  N N    . TRP A 1 116 ? -1.228  4.880   -10.111 1.00 0.00 ? 116 TRP A N    1  
ATOM 1775  C CA   . TRP A 1 116 ? -0.965  5.579   -8.865  1.00 0.00 ? 116 TRP A CA   1  
ATOM 1776  C C    . TRP A 1 116 ? -0.528  7.005   -9.205  1.00 0.00 ? 116 TRP A C    1  
ATOM 1777  O O    . TRP A 1 116 ? -1.149  7.970   -8.764  1.00 0.00 ? 116 TRP A O    1  
ATOM 1778  C CB   . TRP A 1 116 ? 0.064   4.824   -8.020  1.00 0.00 ? 116 TRP A CB   1  
ATOM 1779  C CG   . TRP A 1 116 ? 0.779   5.695   -6.985  1.00 0.00 ? 116 TRP A CG   1  
ATOM 1780  C CD1  . TRP A 1 116 ? 1.717   6.627   -7.199  1.00 0.00 ? 116 TRP A CD1  1  
ATOM 1781  C CD2  . TRP A 1 116 ? 0.575   5.675   -5.557  1.00 0.00 ? 116 TRP A CD2  1  
ATOM 1782  N NE1  . TRP A 1 116 ? 2.131   7.208   -6.017  1.00 0.00 ? 116 TRP A NE1  1  
ATOM 1783  C CE2  . TRP A 1 116 ? 1.414   6.611   -4.987  1.00 0.00 ? 116 TRP A CE2  1  
ATOM 1784  C CE3  . TRP A 1 116 ? -0.290  4.893   -4.772  1.00 0.00 ? 116 TRP A CE3  1  
ATOM 1785  C CZ2  . TRP A 1 116 ? 1.470   6.852   -3.609  1.00 0.00 ? 116 TRP A CZ2  1  
ATOM 1786  C CZ3  . TRP A 1 116 ? -0.222  5.146   -3.397  1.00 0.00 ? 116 TRP A CZ3  1  
ATOM 1787  C CH2  . TRP A 1 116 ? 0.617   6.084   -2.808  1.00 0.00 ? 116 TRP A CH2  1  
ATOM 1788  H H    . TRP A 1 116 ? -0.702  4.041   -10.245 1.00 0.00 ? 116 TRP A H    1  
ATOM 1789  H HA   . TRP A 1 116 ? -1.892  5.600   -8.292  1.00 0.00 ? 116 TRP A HA   1  
ATOM 1790  H HB2  . TRP A 1 116 ? -0.436  4.003   -7.506  1.00 0.00 ? 116 TRP A HB2  1  
ATOM 1791  H HB3  . TRP A 1 116 ? 0.807   4.380   -8.683  1.00 0.00 ? 116 TRP A HB3  1  
ATOM 1792  H HD1  . TRP A 1 116 ? 2.104   6.894   -8.182  1.00 0.00 ? 116 TRP A HD1  1  
ATOM 1793  H HE1  . TRP A 1 116 ? 2.881   7.992   -5.912  1.00 0.00 ? 116 TRP A HE1  1  
ATOM 1794  H HE3  . TRP A 1 116 ? -0.962  4.147   -5.198  1.00 0.00 ? 116 TRP A HE3  1  
ATOM 1795  H HZ2  . TRP A 1 116 ? 2.142   7.597   -3.184  1.00 0.00 ? 116 TRP A HZ2  1  
ATOM 1796  H HZ3  . TRP A 1 116 ? -0.872  4.566   -2.742  1.00 0.00 ? 116 TRP A HZ3  1  
ATOM 1797  H HH2  . TRP A 1 116 ? 0.611   6.222   -1.726  1.00 0.00 ? 116 TRP A HH2  1  
ATOM 1798  N N    . HIS A 1 117 ? 0.539   7.092   -9.986  1.00 0.00 ? 117 HIS A N    1  
ATOM 1799  C CA   . HIS A 1 117 ? 1.066   8.385   -10.391 1.00 0.00 ? 117 HIS A CA   1  
ATOM 1800  C C    . HIS A 1 117 ? 0.384   8.836   -11.683 1.00 0.00 ? 117 HIS A C    1  
ATOM 1801  O O    . HIS A 1 117 ? 1.020   8.908   -12.733 1.00 0.00 ? 117 HIS A O    1  
ATOM 1802  C CB   . HIS A 1 117 ? 2.591   8.335   -10.511 1.00 0.00 ? 117 HIS A CB   1  
ATOM 1803  C CG   . HIS A 1 117 ? 3.313   9.252   -9.553  1.00 0.00 ? 117 HIS A CG   1  
ATOM 1804  N ND1  . HIS A 1 117 ? 3.834   8.815   -8.347  1.00 0.00 ? 117 HIS A ND1  1  
ATOM 1805  C CD2  . HIS A 1 117 ? 3.595   10.584  -9.635  1.00 0.00 ? 117 HIS A CD2  1  
ATOM 1806  C CE1  . HIS A 1 117 ? 4.402   9.847   -7.739  1.00 0.00 ? 117 HIS A CE1  1  
ATOM 1807  N NE2  . HIS A 1 117 ? 4.252   10.942  -8.538  1.00 0.00 ? 117 HIS A NE2  1  
ATOM 1808  H H    . HIS A 1 117 ? 1.039   6.302   -10.340 1.00 0.00 ? 117 HIS A H    1  
ATOM 1809  H HA   . HIS A 1 117 ? 0.819   9.087   -9.594  1.00 0.00 ? 117 HIS A HA   1  
ATOM 1810  H HB2  . HIS A 1 117 ? 2.926   7.312   -10.342 1.00 0.00 ? 117 HIS A HB2  1  
ATOM 1811  H HB3  . HIS A 1 117 ? 2.873   8.598   -11.531 1.00 0.00 ? 117 HIS A HB3  1  
ATOM 1812  H HD1  . HIS A 1 117 ? 3.790   7.880   -7.995  1.00 0.00 ? 117 HIS A HD1  1  
ATOM 1813  H HD2  . HIS A 1 117 ? 3.326   11.242  -10.461 1.00 0.00 ? 117 HIS A HD2  1  
ATOM 1814  H HE1  . HIS A 1 117 ? 4.901   9.824   -6.770  1.00 0.00 ? 117 HIS A HE1  1  
ATOM 1815  N N    . SER A 1 118 ? -0.903  9.128   -11.564 1.00 0.00 ? 118 SER A N    1  
ATOM 1816  C CA   . SER A 1 118 ? -1.680  9.570   -12.710 1.00 0.00 ? 118 SER A CA   1  
ATOM 1817  C C    . SER A 1 118 ? -2.513  10.797  -12.335 1.00 0.00 ? 118 SER A C    1  
ATOM 1818  O O    . SER A 1 118 ? -2.811  11.015  -11.162 1.00 0.00 ? 118 SER A O    1  
ATOM 1819  C CB   . SER A 1 118 ? -2.586  8.451   -13.226 1.00 0.00 ? 118 SER A CB   1  
ATOM 1820  O OG   . SER A 1 118 ? -3.221  8.801   -14.453 1.00 0.00 ? 118 SER A OG   1  
ATOM 1821  H H    . SER A 1 118 ? -1.414  9.066   -10.706 1.00 0.00 ? 118 SER A H    1  
ATOM 1822  H HA   . SER A 1 118 ? -0.946  9.825   -13.474 1.00 0.00 ? 118 SER A HA   1  
ATOM 1823  H HB2  . SER A 1 118 ? -1.997  7.545   -13.369 1.00 0.00 ? 118 SER A HB2  1  
ATOM 1824  H HB3  . SER A 1 118 ? -3.344  8.224   -12.477 1.00 0.00 ? 118 SER A HB3  1  
ATOM 1825  H HG   . SER A 1 118 ? -4.199  8.944   -14.303 1.00 0.00 ? 118 SER A HG   1  
ATOM 1826  N N    . LYS A 1 119 ? -2.865  11.567  -13.354 1.00 0.00 ? 119 LYS A N    1  
ATOM 1827  C CA   . LYS A 1 119 ? -3.658  12.767  -13.146 1.00 0.00 ? 119 LYS A CA   1  
ATOM 1828  C C    . LYS A 1 119 ? -5.109  12.489  -13.543 1.00 0.00 ? 119 LYS A C    1  
ATOM 1829  O O    . LYS A 1 119 ? -5.377  11.598  -14.347 1.00 0.00 ? 119 LYS A O    1  
ATOM 1830  C CB   . LYS A 1 119 ? -3.036  13.955  -13.883 1.00 0.00 ? 119 LYS A CB   1  
ATOM 1831  C CG   . LYS A 1 119 ? -3.531  15.281  -13.303 1.00 0.00 ? 119 LYS A CG   1  
ATOM 1832  C CD   . LYS A 1 119 ? -2.483  16.382  -13.478 1.00 0.00 ? 119 LYS A CD   1  
ATOM 1833  C CE   . LYS A 1 119 ? -3.002  17.492  -14.394 1.00 0.00 ? 119 LYS A CE   1  
ATOM 1834  N NZ   . LYS A 1 119 ? -1.875  18.278  -14.944 1.00 0.00 ? 119 LYS A NZ   1  
ATOM 1835  H H    . LYS A 1 119 ? -2.618  11.384  -14.305 1.00 0.00 ? 119 LYS A H    1  
ATOM 1836  H HA   . LYS A 1 119 ? -3.629  12.998  -12.081 1.00 0.00 ? 119 LYS A HA   1  
ATOM 1837  H HB2  . LYS A 1 119 ? -1.950  13.905  -13.811 1.00 0.00 ? 119 LYS A HB2  1  
ATOM 1838  H HB3  . LYS A 1 119 ? -3.287  13.902  -14.943 1.00 0.00 ? 119 LYS A HB3  1  
ATOM 1839  H HG2  . LYS A 1 119 ? -4.458  15.575  -13.796 1.00 0.00 ? 119 LYS A HG2  1  
ATOM 1840  H HG3  . LYS A 1 119 ? -3.759  15.156  -12.244 1.00 0.00 ? 119 LYS A HG3  1  
ATOM 1841  H HD2  . LYS A 1 119 ? -2.223  16.799  -12.505 1.00 0.00 ? 119 LYS A HD2  1  
ATOM 1842  H HD3  . LYS A 1 119 ? -1.571  15.957  -13.896 1.00 0.00 ? 119 LYS A HD3  1  
ATOM 1843  H HE2  . LYS A 1 119 ? -3.583  17.058  -15.208 1.00 0.00 ? 119 LYS A HE2  1  
ATOM 1844  H HE3  . LYS A 1 119 ? -3.672  18.147  -13.837 1.00 0.00 ? 119 LYS A HE3  1  
ATOM 1845  H HZ1  . LYS A 1 119 ? -2.232  19.074  -15.433 1.00 0.00 ? 119 LYS A HZ1  1  
ATOM 1846  H HZ2  . LYS A 1 119 ? -1.284  18.583  -14.197 1.00 0.00 ? 119 LYS A HZ2  1  
ATOM 1847  H HZ3  . LYS A 1 119 ? -1.348  17.709  -15.575 1.00 0.00 ? 119 LYS A HZ3  1  
ATOM 1848  N N    . ASN A 1 120 ? -6.008  13.268  -12.959 1.00 0.00 ? 120 ASN A N    1  
ATOM 1849  C CA   . ASN A 1 120 ? -7.426  13.116  -13.241 1.00 0.00 ? 120 ASN A CA   1  
ATOM 1850  C C    . ASN A 1 120 ? -7.885  11.728  -12.792 1.00 0.00 ? 120 ASN A C    1  
ATOM 1851  O O    . ASN A 1 120 ? -7.284  10.721  -13.163 1.00 0.00 ? 120 ASN A O    1  
ATOM 1852  C CB   . ASN A 1 120 ? -7.706  13.246  -14.739 1.00 0.00 ? 120 ASN A CB   1  
ATOM 1853  C CG   . ASN A 1 120 ? -8.758  14.323  -15.010 1.00 0.00 ? 120 ASN A CG   1  
ATOM 1854  O OD1  . ASN A 1 120 ? -8.498  15.513  -14.938 1.00 0.00 ? 120 ASN A OD1  1  
ATOM 1855  N ND2  . ASN A 1 120 ? -9.957  13.841  -15.323 1.00 0.00 ? 120 ASN A ND2  1  
ATOM 1856  H H    . ASN A 1 120 ? -5.782  13.990  -12.305 1.00 0.00 ? 120 ASN A H    1  
ATOM 1857  H HA   . ASN A 1 120 ? -7.915  13.917  -12.687 1.00 0.00 ? 120 ASN A HA   1  
ATOM 1858  H HB2  . ASN A 1 120 ? -6.784  13.493  -15.266 1.00 0.00 ? 120 ASN A HB2  1  
ATOM 1859  H HB3  . ASN A 1 120 ? -8.050  12.289  -15.132 1.00 0.00 ? 120 ASN A HB3  1  
ATOM 1860  H HD21 . ASN A 1 120 ? -10.104 12.853  -15.365 1.00 0.00 ? 120 ASN A HD21 1  
ATOM 1861  H HD22 . ASN A 1 120 ? -10.712 14.467  -15.518 1.00 0.00 ? 120 ASN A HD22 1  
ATOM 1862  N N    . PHE A 1 121 ? -8.947  11.718  -12.000 1.00 0.00 ? 121 PHE A N    1  
ATOM 1863  C CA   . PHE A 1 121 ? -9.494  10.470  -11.496 1.00 0.00 ? 121 PHE A CA   1  
ATOM 1864  C C    . PHE A 1 121 ? -10.939 10.277  -11.961 1.00 0.00 ? 121 PHE A C    1  
ATOM 1865  O O    . PHE A 1 121 ? -11.799 11.115  -11.691 1.00 0.00 ? 121 PHE A O    1  
ATOM 1866  C CB   . PHE A 1 121 ? -9.469  10.555  -9.969  1.00 0.00 ? 121 PHE A CB   1  
ATOM 1867  C CG   . PHE A 1 121 ? -9.787  9.233   -9.267  1.00 0.00 ? 121 PHE A CG   1  
ATOM 1868  C CD1  . PHE A 1 121 ? -8.813  8.297   -9.106  1.00 0.00 ? 121 PHE A CD1  1  
ATOM 1869  C CD2  . PHE A 1 121 ? -11.043 8.993   -8.805  1.00 0.00 ? 121 PHE A CD2  1  
ATOM 1870  C CE1  . PHE A 1 121 ? -9.108  7.070   -8.455  1.00 0.00 ? 121 PHE A CE1  1  
ATOM 1871  C CE2  . PHE A 1 121 ? -11.338 7.766   -8.154  1.00 0.00 ? 121 PHE A CE2  1  
ATOM 1872  C CZ   . PHE A 1 121 ? -10.364 6.830   -7.992  1.00 0.00 ? 121 PHE A CZ   1  
ATOM 1873  H H    . PHE A 1 121 ? -9.430  12.542  -11.702 1.00 0.00 ? 121 PHE A H    1  
ATOM 1874  H HA   . PHE A 1 121 ? -8.877  9.663   -11.892 1.00 0.00 ? 121 PHE A HA   1  
ATOM 1875  H HB2  . PHE A 1 121 ? -8.485  10.896  -9.650  1.00 0.00 ? 121 PHE A HB2  1  
ATOM 1876  H HB3  . PHE A 1 121 ? -10.188 11.308  -9.645  1.00 0.00 ? 121 PHE A HB3  1  
ATOM 1877  H HD1  . PHE A 1 121 ? -7.806  8.489   -9.477  1.00 0.00 ? 121 PHE A HD1  1  
ATOM 1878  H HD2  . PHE A 1 121 ? -11.824 9.742   -8.934  1.00 0.00 ? 121 PHE A HD2  1  
ATOM 1879  H HE1  . PHE A 1 121 ? -8.327  6.320   -8.326  1.00 0.00 ? 121 PHE A HE1  1  
ATOM 1880  H HE2  . PHE A 1 121 ? -12.345 7.574   -7.783  1.00 0.00 ? 121 PHE A HE2  1  
ATOM 1881  H HZ   . PHE A 1 121 ? -10.590 5.888   -7.493  1.00 0.00 ? 121 PHE A HZ   1  
ATOM 1882  N N    . THR A 1 122 ? -11.162 9.169   -12.653 1.00 0.00 ? 122 THR A N    1  
ATOM 1883  C CA   . THR A 1 122 ? -12.488 8.856   -13.158 1.00 0.00 ? 122 THR A CA   1  
ATOM 1884  C C    . THR A 1 122 ? -13.159 7.801   -12.276 1.00 0.00 ? 122 THR A C    1  
ATOM 1885  O O    . THR A 1 122 ? -12.680 6.672   -12.180 1.00 0.00 ? 122 THR A O    1  
ATOM 1886  C CB   . THR A 1 122 ? -12.348 8.427   -14.620 1.00 0.00 ? 122 THR A CB   1  
ATOM 1887  O OG1  . THR A 1 122 ? -12.019 9.633   -15.305 1.00 0.00 ? 122 THR A OG1  1  
ATOM 1888  C CG2  . THR A 1 122 ? -13.682 8.000   -15.235 1.00 0.00 ? 122 THR A CG2  1  
ATOM 1889  H H    . THR A 1 122 ? -10.457 8.494   -12.868 1.00 0.00 ? 122 THR A H    1  
ATOM 1890  H HA   . THR A 1 122 ? -13.099 9.757   -13.100 1.00 0.00 ? 122 THR A HA   1  
ATOM 1891  H HB   . THR A 1 122 ? -11.601 7.641   -14.724 1.00 0.00 ? 122 THR A HB   1  
ATOM 1892  H HG1  . THR A 1 122 ? -11.031 9.688   -15.446 1.00 0.00 ? 122 THR A HG1  1  
ATOM 1893  H HG21 . THR A 1 122 ? -13.870 6.952   -15.002 1.00 0.00 ? 122 THR A HG21 1  
ATOM 1894  H HG22 . THR A 1 122 ? -14.484 8.613   -14.824 1.00 0.00 ? 122 THR A HG22 1  
ATOM 1895  H HG23 . THR A 1 122 ? -13.641 8.131   -16.316 1.00 0.00 ? 122 THR A HG23 1  
ATOM 1896  N N    . LYS A 1 123 ? -14.257 8.206   -11.655 1.00 0.00 ? 123 LYS A N    1  
ATOM 1897  C CA   . LYS A 1 123 ? -14.998 7.310   -10.785 1.00 0.00 ? 123 LYS A CA   1  
ATOM 1898  C C    . LYS A 1 123 ? -15.665 6.222   -11.630 1.00 0.00 ? 123 LYS A C    1  
ATOM 1899  O O    . LYS A 1 123 ? -16.774 6.409   -12.127 1.00 0.00 ? 123 LYS A O    1  
ATOM 1900  C CB   . LYS A 1 123 ? -15.978 8.098   -9.913  1.00 0.00 ? 123 LYS A CB   1  
ATOM 1901  C CG   . LYS A 1 123 ? -15.912 7.633   -8.457  1.00 0.00 ? 123 LYS A CG   1  
ATOM 1902  C CD   . LYS A 1 123 ? -16.948 6.540   -8.183  1.00 0.00 ? 123 LYS A CD   1  
ATOM 1903  C CE   . LYS A 1 123 ? -17.455 6.614   -6.742  1.00 0.00 ? 123 LYS A CE   1  
ATOM 1904  N NZ   . LYS A 1 123 ? -18.050 5.321   -6.335  1.00 0.00 ? 123 LYS A NZ   1  
ATOM 1905  H H    . LYS A 1 123 ? -14.639 9.126   -11.739 1.00 0.00 ? 123 LYS A H    1  
ATOM 1906  H HA   . LYS A 1 123 ? -14.280 6.836   -10.116 1.00 0.00 ? 123 LYS A HA   1  
ATOM 1907  H HB2  . LYS A 1 123 ? -15.746 9.161   -9.970  1.00 0.00 ? 123 LYS A HB2  1  
ATOM 1908  H HB3  . LYS A 1 123 ? -16.991 7.972   -10.294 1.00 0.00 ? 123 LYS A HB3  1  
ATOM 1909  H HG2  . LYS A 1 123 ? -14.914 7.255   -8.237  1.00 0.00 ? 123 LYS A HG2  1  
ATOM 1910  H HG3  . LYS A 1 123 ? -16.087 8.479   -7.793  1.00 0.00 ? 123 LYS A HG3  1  
ATOM 1911  H HD2  . LYS A 1 123 ? -17.785 6.647   -8.873  1.00 0.00 ? 123 LYS A HD2  1  
ATOM 1912  H HD3  . LYS A 1 123 ? -16.506 5.561   -8.368  1.00 0.00 ? 123 LYS A HD3  1  
ATOM 1913  H HE2  . LYS A 1 123 ? -16.632 6.869   -6.073  1.00 0.00 ? 123 LYS A HE2  1  
ATOM 1914  H HE3  . LYS A 1 123 ? -18.196 7.407   -6.651  1.00 0.00 ? 123 LYS A HE3  1  
ATOM 1915  H HZ1  . LYS A 1 123 ? -18.663 5.467   -5.558  1.00 0.00 ? 123 LYS A HZ1  1  
ATOM 1916  H HZ2  . LYS A 1 123 ? -18.566 4.937   -7.100  1.00 0.00 ? 123 LYS A HZ2  1  
ATOM 1917  H HZ3  . LYS A 1 123 ? -17.322 4.688   -6.071  1.00 0.00 ? 123 LYS A HZ3  1  
ATOM 1918  N N    . TYR A 1 124 ? -14.960 5.108   -11.766 1.00 0.00 ? 124 TYR A N    1  
ATOM 1919  C CA   . TYR A 1 124 ? -15.470 3.990   -12.542 1.00 0.00 ? 124 TYR A CA   1  
ATOM 1920  C C    . TYR A 1 124 ? -16.363 3.090   -11.685 1.00 0.00 ? 124 TYR A C    1  
ATOM 1921  O O    . TYR A 1 124 ? -16.392 3.221   -10.462 1.00 0.00 ? 124 TYR A O    1  
ATOM 1922  C CB   . TYR A 1 124 ? -14.243 3.193   -12.989 1.00 0.00 ? 124 TYR A CB   1  
ATOM 1923  C CG   . TYR A 1 124 ? -13.684 3.621   -14.348 1.00 0.00 ? 124 TYR A CG   1  
ATOM 1924  C CD1  . TYR A 1 124 ? -14.508 3.651   -15.454 1.00 0.00 ? 124 TYR A CD1  1  
ATOM 1925  C CD2  . TYR A 1 124 ? -12.356 3.978   -14.466 1.00 0.00 ? 124 TYR A CD2  1  
ATOM 1926  C CE1  . TYR A 1 124 ? -13.983 4.054   -16.733 1.00 0.00 ? 124 TYR A CE1  1  
ATOM 1927  C CE2  . TYR A 1 124 ? -11.830 4.380   -15.745 1.00 0.00 ? 124 TYR A CE2  1  
ATOM 1928  C CZ   . TYR A 1 124 ? -12.670 4.399   -16.815 1.00 0.00 ? 124 TYR A CZ   1  
ATOM 1929  O OH   . TYR A 1 124 ? -12.173 4.779   -18.023 1.00 0.00 ? 124 TYR A OH   1  
ATOM 1930  H H    . TYR A 1 124 ? -14.058 4.963   -11.358 1.00 0.00 ? 124 TYR A H    1  
ATOM 1931  H HA   . TYR A 1 124 ? -16.057 4.393   -13.367 1.00 0.00 ? 124 TYR A HA   1  
ATOM 1932  H HB2  . TYR A 1 124 ? -13.460 3.297   -12.237 1.00 0.00 ? 124 TYR A HB2  1  
ATOM 1933  H HB3  . TYR A 1 124 ? -14.504 2.136   -13.032 1.00 0.00 ? 124 TYR A HB3  1  
ATOM 1934  H HD1  . TYR A 1 124 ? -15.557 3.369   -15.360 1.00 0.00 ? 124 TYR A HD1  1  
ATOM 1935  H HD2  . TYR A 1 124 ? -11.705 3.954   -13.592 1.00 0.00 ? 124 TYR A HD2  1  
ATOM 1936  H HE1  . TYR A 1 124 ? -14.623 4.081   -17.615 1.00 0.00 ? 124 TYR A HE1  1  
ATOM 1937  H HE2  . TYR A 1 124 ? -10.784 4.664   -15.853 1.00 0.00 ? 124 TYR A HE2  1  
ATOM 1938  H HH   . TYR A 1 124 ? -12.487 4.151   -18.735 1.00 0.00 ? 124 TYR A HH   1  
ATOM 1939  N N    . PRO A 1 125 ? -17.089 2.173   -12.379 1.00 0.00 ? 125 PRO A N    1  
ATOM 1940  C CA   . PRO A 1 125 ? -17.980 1.252   -11.695 1.00 0.00 ? 125 PRO A CA   1  
ATOM 1941  C C    . PRO A 1 125 ? -17.191 0.146   -10.991 1.00 0.00 ? 125 PRO A C    1  
ATOM 1942  O O    . PRO A 1 125 ? -16.428 -0.578  -11.628 1.00 0.00 ? 125 PRO A O    1  
ATOM 1943  C CB   . PRO A 1 125 ? -18.906 0.723   -12.779 1.00 0.00 ? 125 PRO A CB   1  
ATOM 1944  C CG   . PRO A 1 125 ? -18.208 1.008   -14.099 1.00 0.00 ? 125 PRO A CG   1  
ATOM 1945  C CD   . PRO A 1 125 ? -17.080 1.989   -13.827 1.00 0.00 ? 125 PRO A CD   1  
ATOM 1946  H HA   . PRO A 1 125 ? -18.486 1.728   -10.976 1.00 0.00 ? 125 PRO A HA   1  
ATOM 1947  H HB2  . PRO A 1 125 ? -19.084 -0.345  -12.654 1.00 0.00 ? 125 PRO A HB2  1  
ATOM 1948  H HB3  . PRO A 1 125 ? -19.878 1.216   -12.737 1.00 0.00 ? 125 PRO A HB3  1  
ATOM 1949  H HG2  . PRO A 1 125 ? -17.816 0.086   -14.530 1.00 0.00 ? 125 PRO A HG2  1  
ATOM 1950  H HG3  . PRO A 1 125 ? -18.911 1.424   -14.821 1.00 0.00 ? 125 PRO A HG3  1  
ATOM 1951  H HD2  . PRO A 1 125 ? -16.122 1.597   -14.171 1.00 0.00 ? 125 PRO A HD2  1  
ATOM 1952  H HD3  . PRO A 1 125 ? -17.242 2.933   -14.347 1.00 0.00 ? 125 PRO A HD3  1  
ATOM 1953  N N    . LYS A 1 126 ? -17.403 0.051   -9.687  1.00 0.00 ? 126 LYS A N    1  
ATOM 1954  C CA   . LYS A 1 126 ? -16.721 -0.954  -8.889  1.00 0.00 ? 126 LYS A CA   1  
ATOM 1955  C C    . LYS A 1 126 ? -15.363 -0.410  -8.444  1.00 0.00 ? 126 LYS A C    1  
ATOM 1956  O O    . LYS A 1 126 ? -14.960 -0.600  -7.297  1.00 0.00 ? 126 LYS A O    1  
ATOM 1957  C CB   . LYS A 1 126 ? -16.633 -2.276  -9.655  1.00 0.00 ? 126 LYS A CB   1  
ATOM 1958  C CG   . LYS A 1 126 ? -17.973 -2.622  -10.308 1.00 0.00 ? 126 LYS A CG   1  
ATOM 1959  C CD   . LYS A 1 126 ? -18.053 -4.113  -10.640 1.00 0.00 ? 126 LYS A CD   1  
ATOM 1960  C CE   . LYS A 1 126 ? -18.889 -4.862  -9.601  1.00 0.00 ? 126 LYS A CE   1  
ATOM 1961  N NZ   . LYS A 1 126 ? -18.050 -5.831  -8.861  1.00 0.00 ? 126 LYS A NZ   1  
ATOM 1962  H H    . LYS A 1 126 ? -18.026 0.644   -9.177  1.00 0.00 ? 126 LYS A H    1  
ATOM 1963  H HA   . LYS A 1 126 ? -17.329 -1.135  -8.003  1.00 0.00 ? 126 LYS A HA   1  
ATOM 1964  H HB2  . LYS A 1 126 ? -15.859 -2.208  -10.419 1.00 0.00 ? 126 LYS A HB2  1  
ATOM 1965  H HB3  . LYS A 1 126 ? -16.340 -3.075  -8.974  1.00 0.00 ? 126 LYS A HB3  1  
ATOM 1966  H HG2  . LYS A 1 126 ? -18.789 -2.350  -9.638  1.00 0.00 ? 126 LYS A HG2  1  
ATOM 1967  H HG3  . LYS A 1 126 ? -18.100 -2.035  -11.218 1.00 0.00 ? 126 LYS A HG3  1  
ATOM 1968  H HD2  . LYS A 1 126 ? -18.491 -4.246  -11.629 1.00 0.00 ? 126 LYS A HD2  1  
ATOM 1969  H HD3  . LYS A 1 126 ? -17.049 -4.535  -10.677 1.00 0.00 ? 126 LYS A HD3  1  
ATOM 1970  H HE2  . LYS A 1 126 ? -19.336 -4.152  -8.904  1.00 0.00 ? 126 LYS A HE2  1  
ATOM 1971  H HE3  . LYS A 1 126 ? -19.709 -5.384  -10.093 1.00 0.00 ? 126 LYS A HE3  1  
ATOM 1972  H HZ1  . LYS A 1 126 ? -17.188 -5.966  -9.349  1.00 0.00 ? 126 LYS A HZ1  1  
ATOM 1973  H HZ2  . LYS A 1 126 ? -17.862 -5.478  -7.944  1.00 0.00 ? 126 LYS A HZ2  1  
ATOM 1974  H HZ3  . LYS A 1 126 ? -18.533 -6.704  -8.789  1.00 0.00 ? 126 LYS A HZ3  1  
ATOM 1975  N N    . LYS A 1 127 ? -14.694 0.256   -9.373  1.00 0.00 ? 127 LYS A N    1  
ATOM 1976  C CA   . LYS A 1 127 ? -13.389 0.829   -9.090  1.00 0.00 ? 127 LYS A CA   1  
ATOM 1977  C C    . LYS A 1 127 ? -13.433 1.544   -7.738  1.00 0.00 ? 127 LYS A C    1  
ATOM 1978  O O    . LYS A 1 127 ? -14.378 2.276   -7.449  1.00 0.00 ? 127 LYS A O    1  
ATOM 1979  C CB   . LYS A 1 127 ? -12.936 1.725   -10.245 1.00 0.00 ? 127 LYS A CB   1  
ATOM 1980  C CG   . LYS A 1 127 ? -12.690 0.904   -11.512 1.00 0.00 ? 127 LYS A CG   1  
ATOM 1981  C CD   . LYS A 1 127 ? -11.517 -0.060  -11.322 1.00 0.00 ? 127 LYS A CD   1  
ATOM 1982  C CE   . LYS A 1 127 ? -11.136 -0.726  -12.646 1.00 0.00 ? 127 LYS A CE   1  
ATOM 1983  N NZ   . LYS A 1 127 ? -11.492 -2.163  -12.624 1.00 0.00 ? 127 LYS A NZ   1  
ATOM 1984  H H    . LYS A 1 127 ? -15.029 0.407   -10.303 1.00 0.00 ? 127 LYS A H    1  
ATOM 1985  H HA   . LYS A 1 127 ? -12.678 0.006   -9.023  1.00 0.00 ? 127 LYS A HA   1  
ATOM 1986  H HB2  . LYS A 1 127 ? -13.693 2.485   -10.440 1.00 0.00 ? 127 LYS A HB2  1  
ATOM 1987  H HB3  . LYS A 1 127 ? -12.023 2.251   -9.965  1.00 0.00 ? 127 LYS A HB3  1  
ATOM 1988  H HG2  . LYS A 1 127 ? -13.589 0.342   -11.766 1.00 0.00 ? 127 LYS A HG2  1  
ATOM 1989  H HG3  . LYS A 1 127 ? -12.485 1.572   -12.349 1.00 0.00 ? 127 LYS A HG3  1  
ATOM 1990  H HD2  . LYS A 1 127 ? -10.659 0.481   -10.923 1.00 0.00 ? 127 LYS A HD2  1  
ATOM 1991  H HD3  . LYS A 1 127 ? -11.783 -0.822  -10.590 1.00 0.00 ? 127 LYS A HD3  1  
ATOM 1992  H HE2  . LYS A 1 127 ? -11.648 -0.231  -13.470 1.00 0.00 ? 127 LYS A HE2  1  
ATOM 1993  H HE3  . LYS A 1 127 ? -10.066 -0.613  -12.821 1.00 0.00 ? 127 LYS A HE3  1  
ATOM 1994  H HZ1  . LYS A 1 127 ? -12.367 -2.296  -13.088 1.00 0.00 ? 127 LYS A HZ1  1  
ATOM 1995  H HZ2  . LYS A 1 127 ? -10.782 -2.689  -13.093 1.00 0.00 ? 127 LYS A HZ2  1  
ATOM 1996  H HZ3  . LYS A 1 127 ? -11.566 -2.473  -11.676 1.00 0.00 ? 127 LYS A HZ3  1  
ATOM 1997  N N    . PHE A 1 128 ? -12.398 1.306   -6.945  1.00 0.00 ? 128 PHE A N    1  
ATOM 1998  C CA   . PHE A 1 128 ? -12.307 1.917   -5.630  1.00 0.00 ? 128 PHE A CA   1  
ATOM 1999  C C    . PHE A 1 128 ? -11.742 3.336   -5.724  1.00 0.00 ? 128 PHE A C    1  
ATOM 2000  O O    . PHE A 1 128 ? -10.966 3.641   -6.628  1.00 0.00 ? 128 PHE A O    1  
ATOM 2001  C CB   . PHE A 1 128 ? -11.353 1.055   -4.802  1.00 0.00 ? 128 PHE A CB   1  
ATOM 2002  C CG   . PHE A 1 128 ? -11.859 -0.366  -4.549  1.00 0.00 ? 128 PHE A CG   1  
ATOM 2003  C CD1  . PHE A 1 128 ? -11.574 -1.357  -5.436  1.00 0.00 ? 128 PHE A CD1  1  
ATOM 2004  C CD2  . PHE A 1 128 ? -12.593 -0.639  -3.437  1.00 0.00 ? 128 PHE A CD2  1  
ATOM 2005  C CE1  . PHE A 1 128 ? -12.044 -2.676  -5.202  1.00 0.00 ? 128 PHE A CE1  1  
ATOM 2006  C CE2  . PHE A 1 128 ? -13.063 -1.959  -3.203  1.00 0.00 ? 128 PHE A CE2  1  
ATOM 2007  C CZ   . PHE A 1 128 ? -12.779 -2.949  -4.090  1.00 0.00 ? 128 PHE A CZ   1  
ATOM 2008  H H    . PHE A 1 128 ? -11.634 0.709   -7.188  1.00 0.00 ? 128 PHE A H    1  
ATOM 2009  H HA   . PHE A 1 128 ? -13.316 1.956   -5.221  1.00 0.00 ? 128 PHE A HA   1  
ATOM 2010  H HB2  . PHE A 1 128 ? -10.391 1.002   -5.312  1.00 0.00 ? 128 PHE A HB2  1  
ATOM 2011  H HB3  . PHE A 1 128 ? -11.178 1.543   -3.843  1.00 0.00 ? 128 PHE A HB3  1  
ATOM 2012  H HD1  . PHE A 1 128 ? -10.986 -1.138  -6.327  1.00 0.00 ? 128 PHE A HD1  1  
ATOM 2013  H HD2  . PHE A 1 128 ? -12.822 0.155   -2.726  1.00 0.00 ? 128 PHE A HD2  1  
ATOM 2014  H HE1  . PHE A 1 128 ? -11.816 -3.471  -5.913  1.00 0.00 ? 128 PHE A HE1  1  
ATOM 2015  H HE2  . PHE A 1 128 ? -13.652 -2.177  -2.312  1.00 0.00 ? 128 PHE A HE2  1  
ATOM 2016  H HZ   . PHE A 1 128 ? -13.139 -3.962  -3.910  1.00 0.00 ? 128 PHE A HZ   1  
ATOM 2017  N N    . TYR A 1 129 ? -12.154 4.166   -4.777  1.00 0.00 ? 129 TYR A N    1  
ATOM 2018  C CA   . TYR A 1 129 ? -11.699 5.546   -4.741  1.00 0.00 ? 129 TYR A CA   1  
ATOM 2019  C C    . TYR A 1 129 ? -11.053 5.875   -3.394  1.00 0.00 ? 129 TYR A C    1  
ATOM 2020  O O    . TYR A 1 129 ? -11.212 5.132   -2.426  1.00 0.00 ? 129 TYR A O    1  
ATOM 2021  C CB   . TYR A 1 129 ? -12.951 6.408   -4.917  1.00 0.00 ? 129 TYR A CB   1  
ATOM 2022  C CG   . TYR A 1 129 ? -14.091 6.051   -3.960  1.00 0.00 ? 129 TYR A CG   1  
ATOM 2023  C CD1  . TYR A 1 129 ? -14.031 6.444   -2.639  1.00 0.00 ? 129 TYR A CD1  1  
ATOM 2024  C CD2  . TYR A 1 129 ? -15.179 5.337   -4.419  1.00 0.00 ? 129 TYR A CD2  1  
ATOM 2025  C CE1  . TYR A 1 129 ? -15.104 6.109   -1.739  1.00 0.00 ? 129 TYR A CE1  1  
ATOM 2026  C CE2  . TYR A 1 129 ? -16.252 5.002   -3.519  1.00 0.00 ? 129 TYR A CE2  1  
ATOM 2027  C CZ   . TYR A 1 129 ? -16.161 5.404   -2.223  1.00 0.00 ? 129 TYR A CZ   1  
ATOM 2028  O OH   . TYR A 1 129 ? -17.174 5.088   -1.373  1.00 0.00 ? 129 TYR A OH   1  
ATOM 2029  H H    . TYR A 1 129 ? -12.785 3.911   -4.045  1.00 0.00 ? 129 TYR A H    1  
ATOM 2030  H HA   . TYR A 1 129 ? -10.960 5.677   -5.532  1.00 0.00 ? 129 TYR A HA   1  
ATOM 2031  H HB2  . TYR A 1 129 ? -12.682 7.454   -4.772  1.00 0.00 ? 129 TYR A HB2  1  
ATOM 2032  H HB3  . TYR A 1 129 ? -13.306 6.309   -5.942  1.00 0.00 ? 129 TYR A HB3  1  
ATOM 2033  H HD1  . TYR A 1 129 ? -13.172 7.009   -2.276  1.00 0.00 ? 129 TYR A HD1  1  
ATOM 2034  H HD2  . TYR A 1 129 ? -15.226 5.027   -5.463  1.00 0.00 ? 129 TYR A HD2  1  
ATOM 2035  H HE1  . TYR A 1 129 ? -15.069 6.413   -0.693  1.00 0.00 ? 129 TYR A HE1  1  
ATOM 2036  H HE2  . TYR A 1 129 ? -17.117 4.438   -3.869  1.00 0.00 ? 129 TYR A HE2  1  
ATOM 2037  H HH   . TYR A 1 129 ? -17.837 4.499   -1.836  1.00 0.00 ? 129 TYR A HH   1  
ATOM 2038  N N    . PRO A 1 130 ? -10.317 7.019   -3.373  1.00 0.00 ? 130 PRO A N    1  
ATOM 2039  C CA   . PRO A 1 130 ? -9.646  7.456   -2.161  1.00 0.00 ? 130 PRO A CA   1  
ATOM 2040  C C    . PRO A 1 130 ? -10.646 8.040   -1.161  1.00 0.00 ? 130 PRO A C    1  
ATOM 2041  O O    . PRO A 1 130 ? -11.362 8.989   -1.476  1.00 0.00 ? 130 PRO A O    1  
ATOM 2042  C CB   . PRO A 1 130 ? -8.612  8.468   -2.627  1.00 0.00 ? 130 PRO A CB   1  
ATOM 2043  C CG   . PRO A 1 130 ? -9.051  8.905   -4.015  1.00 0.00 ? 130 PRO A CG   1  
ATOM 2044  C CD   . PRO A 1 130 ? -10.106 7.923   -4.500  1.00 0.00 ? 130 PRO A CD   1  
ATOM 2045  H HA   . PRO A 1 130 ? -9.221  6.677   -1.700  1.00 0.00 ? 130 PRO A HA   1  
ATOM 2046  H HB2  . PRO A 1 130 ? -8.563  9.318   -1.946  1.00 0.00 ? 130 PRO A HB2  1  
ATOM 2047  H HB3  . PRO A 1 130 ? -7.616  8.024   -2.654  1.00 0.00 ? 130 PRO A HB3  1  
ATOM 2048  H HG2  . PRO A 1 130 ? -9.456  9.916   -3.986  1.00 0.00 ? 130 PRO A HG2  1  
ATOM 2049  H HG3  . PRO A 1 130 ? -8.202  8.921   -4.697  1.00 0.00 ? 130 PRO A HG3  1  
ATOM 2050  H HD2  . PRO A 1 130 ? -11.028 8.436   -4.774  1.00 0.00 ? 130 PRO A HD2  1  
ATOM 2051  H HD3  . PRO A 1 130 ? -9.767  7.383   -5.384  1.00 0.00 ? 130 PRO A HD3  1  
ATOM 2052  N N    . LEU A 1 131 ? -10.663 7.448   0.024   1.00 0.00 ? 131 LEU A N    1  
ATOM 2053  C CA   . LEU A 1 131 ? -11.563 7.898   1.073   1.00 0.00 ? 131 LEU A CA   1  
ATOM 2054  C C    . LEU A 1 131 ? -11.069 9.238   1.623   1.00 0.00 ? 131 LEU A C    1  
ATOM 2055  O O    . LEU A 1 131 ? -11.569 10.293  1.236   1.00 0.00 ? 131 LEU A O    1  
ATOM 2056  C CB   . LEU A 1 131 ? -11.723 6.816   2.142   1.00 0.00 ? 131 LEU A CB   1  
ATOM 2057  C CG   . LEU A 1 131 ? -12.207 5.451   1.648   1.00 0.00 ? 131 LEU A CG   1  
ATOM 2058  C CD1  . LEU A 1 131 ? -12.330 4.460   2.807   1.00 0.00 ? 131 LEU A CD1  1  
ATOM 2059  C CD2  . LEU A 1 131 ? -13.516 5.584   0.867   1.00 0.00 ? 131 LEU A CD2  1  
ATOM 2060  H H    . LEU A 1 131 ? -10.077 6.677   0.273   1.00 0.00 ? 131 LEU A H    1  
ATOM 2061  H HA   . LEU A 1 131 ? -12.542 8.051   0.619   1.00 0.00 ? 131 LEU A HA   1  
ATOM 2062  H HB2  . LEU A 1 131 ? -10.763 6.680   2.640   1.00 0.00 ? 131 LEU A HB2  1  
ATOM 2063  H HB3  . LEU A 1 131 ? -12.424 7.177   2.895   1.00 0.00 ? 131 LEU A HB3  1  
ATOM 2064  H HG   . LEU A 1 131 ? -11.461 5.052   0.961   1.00 0.00 ? 131 LEU A HG   1  
ATOM 2065  H HD11 . LEU A 1 131 ? -12.865 3.572   2.471   1.00 0.00 ? 131 LEU A HD11 1  
ATOM 2066  H HD12 . LEU A 1 131 ? -11.335 4.177   3.150   1.00 0.00 ? 131 LEU A HD12 1  
ATOM 2067  H HD13 . LEU A 1 131 ? -12.877 4.926   3.627   1.00 0.00 ? 131 LEU A HD13 1  
ATOM 2068  H HD21 . LEU A 1 131 ? -14.259 4.903   1.283   1.00 0.00 ? 131 LEU A HD21 1  
ATOM 2069  H HD22 . LEU A 1 131 ? -13.881 6.608   0.941   1.00 0.00 ? 131 LEU A HD22 1  
ATOM 2070  H HD23 . LEU A 1 131 ? -13.341 5.335   -0.180  1.00 0.00 ? 131 LEU A HD23 1  
ATOM 2071  N N    . GLU A 1 132 ? -10.094 9.152   2.516   1.00 0.00 ? 132 GLU A N    1  
ATOM 2072  C CA   . GLU A 1 132 ? -9.528  10.344  3.123   1.00 0.00 ? 132 GLU A CA   1  
ATOM 2073  C C    . GLU A 1 132 ? -8.581  11.040  2.143   1.00 0.00 ? 132 GLU A C    1  
ATOM 2074  O O    . GLU A 1 132 ? -7.445  10.606  1.958   1.00 0.00 ? 132 GLU A O    1  
ATOM 2075  C CB   . GLU A 1 132 ? -8.810  10.005  4.431   1.00 0.00 ? 132 GLU A CB   1  
ATOM 2076  C CG   . GLU A 1 132 ? -8.857  11.186  5.403   1.00 0.00 ? 132 GLU A CG   1  
ATOM 2077  C CD   . GLU A 1 132 ? -9.550  10.793  6.710   1.00 0.00 ? 132 GLU A CD   1  
ATOM 2078  O OE1  . GLU A 1 132 ? -10.748 10.446  6.634   1.00 0.00 ? 132 GLU A OE1  1  
ATOM 2079  O OE2  . GLU A 1 132 ? -8.866  10.850  7.754   1.00 0.00 ? 132 GLU A OE2  1  
ATOM 2080  H H    . GLU A 1 132 ? -9.693  8.289   2.824   1.00 0.00 ? 132 GLU A H    1  
ATOM 2081  H HA   . GLU A 1 132 ? -10.378 10.991  3.339   1.00 0.00 ? 132 GLU A HA   1  
ATOM 2082  H HB2  . GLU A 1 132 ? -9.276  9.133   4.890   1.00 0.00 ? 132 GLU A HB2  1  
ATOM 2083  H HB3  . GLU A 1 132 ? -7.773  9.741   4.224   1.00 0.00 ? 132 GLU A HB3  1  
ATOM 2084  H HG2  . GLU A 1 132 ? -7.844  11.528  5.614   1.00 0.00 ? 132 GLU A HG2  1  
ATOM 2085  H HG3  . GLU A 1 132 ? -9.386  12.020  4.943   1.00 0.00 ? 132 GLU A HG3  1  
ATOM 2086  N N    . ILE A 1 133 ? -9.084  12.107  1.541   1.00 0.00 ? 133 ILE A N    1  
ATOM 2087  C CA   . ILE A 1 133 ? -8.297  12.867  0.584   1.00 0.00 ? 133 ILE A CA   1  
ATOM 2088  C C    . ILE A 1 133 ? -7.675  14.075  1.287   1.00 0.00 ? 133 ILE A C    1  
ATOM 2089  O O    . ILE A 1 133 ? -8.362  14.806  1.999   1.00 0.00 ? 133 ILE A O    1  
ATOM 2090  C CB   . ILE A 1 133 ? -9.145  13.235  -0.635  1.00 0.00 ? 133 ILE A CB   1  
ATOM 2091  C CG1  . ILE A 1 133 ? -9.587  11.982  -1.394  1.00 0.00 ? 133 ILE A CG1  1  
ATOM 2092  C CG2  . ILE A 1 133 ? -8.405  14.222  -1.540  1.00 0.00 ? 133 ILE A CG2  1  
ATOM 2093  C CD1  . ILE A 1 133 ? -11.111 11.921  -1.510  1.00 0.00 ? 133 ILE A CD1  1  
ATOM 2094  H H    . ILE A 1 133 ? -10.009 12.453  1.697   1.00 0.00 ? 133 ILE A H    1  
ATOM 2095  H HA   . ILE A 1 133 ? -7.494  12.219  0.234   1.00 0.00 ? 133 ILE A HA   1  
ATOM 2096  H HB   . ILE A 1 133 ? -10.048 13.735  -0.285  1.00 0.00 ? 133 ILE A HB   1  
ATOM 2097  H HG12 . ILE A 1 133 ? -9.143  11.980  -2.389  1.00 0.00 ? 133 ILE A HG12 1  
ATOM 2098  H HG13 . ILE A 1 133 ? -9.222  11.094  -0.880  1.00 0.00 ? 133 ILE A HG13 1  
ATOM 2099  H HG21 . ILE A 1 133 ? -7.494  14.557  -1.044  1.00 0.00 ? 133 ILE A HG21 1  
ATOM 2100  H HG22 . ILE A 1 133 ? -8.149  13.732  -2.479  1.00 0.00 ? 133 ILE A HG22 1  
ATOM 2101  H HG23 . ILE A 1 133 ? -9.045  15.081  -1.741  1.00 0.00 ? 133 ILE A HG23 1  
ATOM 2102  H HD11 . ILE A 1 133 ? -11.386 11.536  -2.492  1.00 0.00 ? 133 ILE A HD11 1  
ATOM 2103  H HD12 . ILE A 1 133 ? -11.508 11.262  -0.738  1.00 0.00 ? 133 ILE A HD12 1  
ATOM 2104  H HD13 . ILE A 1 133 ? -11.526 12.921  -1.383  1.00 0.00 ? 133 ILE A HD13 1  
ATOM 2105  N N    . SER A 1 134 ? -6.380  14.247  1.064   1.00 0.00 ? 134 SER A N    1  
ATOM 2106  C CA   . SER A 1 134 ? -5.657  15.354  1.668   1.00 0.00 ? 134 SER A CA   1  
ATOM 2107  C C    . SER A 1 134 ? -4.388  15.649  0.866   1.00 0.00 ? 134 SER A C    1  
ATOM 2108  O O    . SER A 1 134 ? -3.703  14.730  0.421   1.00 0.00 ? 134 SER A O    1  
ATOM 2109  C CB   . SER A 1 134 ? -5.306  15.052  3.126   1.00 0.00 ? 134 SER A CB   1  
ATOM 2110  O OG   . SER A 1 134 ? -5.027  16.239  3.864   1.00 0.00 ? 134 SER A OG   1  
ATOM 2111  H H    . SER A 1 134 ? -5.828  13.648  0.484   1.00 0.00 ? 134 SER A H    1  
ATOM 2112  H HA   . SER A 1 134 ? -6.341  16.202  1.627   1.00 0.00 ? 134 SER A HA   1  
ATOM 2113  H HB2  . SER A 1 134 ? -6.133  14.519  3.595   1.00 0.00 ? 134 SER A HB2  1  
ATOM 2114  H HB3  . SER A 1 134 ? -4.440  14.392  3.161   1.00 0.00 ? 134 SER A HB3  1  
ATOM 2115  H HG   . SER A 1 134 ? -4.222  16.102  4.441   1.00 0.00 ? 134 SER A HG   1  
ATOM 2116  N N    . GLY A 1 135 ? -4.113  16.935  0.706   1.00 0.00 ? 135 GLY A N    1  
ATOM 2117  C CA   . GLY A 1 135 ? -2.938  17.363  -0.034  1.00 0.00 ? 135 GLY A CA   1  
ATOM 2118  C C    . GLY A 1 135 ? -3.330  17.965  -1.385  1.00 0.00 ? 135 GLY A C    1  
ATOM 2119  O O    . GLY A 1 135 ? -4.514  18.064  -1.705  1.00 0.00 ? 135 GLY A O    1  
ATOM 2120  H H    . GLY A 1 135 ? -4.676  17.677  1.071   1.00 0.00 ? 135 GLY A H    1  
ATOM 2121  H HA2  . GLY A 1 135 ? -2.385  18.099  0.549   1.00 0.00 ? 135 GLY A HA2  1  
ATOM 2122  H HA3  . GLY A 1 135 ? -2.273  16.514  -0.189  1.00 0.00 ? 135 GLY A HA3  1  
ATOM 2123  N N    . PRO A 1 136 ? -2.287  18.362  -2.162  1.00 0.00 ? 136 PRO A N    1  
ATOM 2124  C CA   . PRO A 1 136 ? -2.510  18.951  -3.471  1.00 0.00 ? 136 PRO A CA   1  
ATOM 2125  C C    . PRO A 1 136 ? -2.910  17.883  -4.492  1.00 0.00 ? 136 PRO A C    1  
ATOM 2126  O O    . PRO A 1 136 ? -2.716  16.692  -4.257  1.00 0.00 ? 136 PRO A O    1  
ATOM 2127  C CB   . PRO A 1 136 ? -1.204  19.645  -3.818  1.00 0.00 ? 136 PRO A CB   1  
ATOM 2128  C CG   . PRO A 1 136 ? -0.151  19.032  -2.909  1.00 0.00 ? 136 PRO A CG   1  
ATOM 2129  C CD   . PRO A 1 136 ? -0.872  18.260  -1.816  1.00 0.00 ? 136 PRO A CD   1  
ATOM 2130  H HA   . PRO A 1 136 ? -3.275  19.595  -3.436  1.00 0.00 ? 136 PRO A HA   1  
ATOM 2131  H HB2  . PRO A 1 136 ? -0.949  19.496  -4.867  1.00 0.00 ? 136 PRO A HB2  1  
ATOM 2132  H HB3  . PRO A 1 136 ? -1.279  20.721  -3.659  1.00 0.00 ? 136 PRO A HB3  1  
ATOM 2133  H HG2  . PRO A 1 136 ? 0.503   18.369  -3.476  1.00 0.00 ? 136 PRO A HG2  1  
ATOM 2134  H HG3  . PRO A 1 136 ? 0.479   19.809  -2.476  1.00 0.00 ? 136 PRO A HG3  1  
ATOM 2135  H HD2  . PRO A 1 136 ? -0.546  17.221  -1.784  1.00 0.00 ? 136 PRO A HD2  1  
ATOM 2136  H HD3  . PRO A 1 136 ? -0.673  18.687  -0.833  1.00 0.00 ? 136 PRO A HD3  1  
ATOM 2137  N N    . SER A 1 137 ? -3.460  18.349  -5.604  1.00 0.00 ? 137 SER A N    1  
ATOM 2138  C CA   . SER A 1 137 ? -3.888  17.450  -6.661  1.00 0.00 ? 137 SER A CA   1  
ATOM 2139  C C    . SER A 1 137 ? -5.089  16.626  -6.193  1.00 0.00 ? 137 SER A C    1  
ATOM 2140  O O    . SER A 1 137 ? -5.148  16.209  -5.037  1.00 0.00 ? 137 SER A O    1  
ATOM 2141  C CB   . SER A 1 137 ? -2.747  16.526  -7.094  1.00 0.00 ? 137 SER A CB   1  
ATOM 2142  O OG   . SER A 1 137 ? -2.436  16.674  -8.476  1.00 0.00 ? 137 SER A OG   1  
ATOM 2143  H H    . SER A 1 137 ? -3.614  19.320  -5.787  1.00 0.00 ? 137 SER A H    1  
ATOM 2144  H HA   . SER A 1 137 ? -4.168  18.095  -7.494  1.00 0.00 ? 137 SER A HA   1  
ATOM 2145  H HB2  . SER A 1 137 ? -1.861  16.741  -6.497  1.00 0.00 ? 137 SER A HB2  1  
ATOM 2146  H HB3  . SER A 1 137 ? -3.023  15.491  -6.893  1.00 0.00 ? 137 SER A HB3  1  
ATOM 2147  H HG   . SER A 1 137 ? -1.995  17.557  -8.635  1.00 0.00 ? 137 SER A HG   1  
ATOM 2148  N N    . SER A 1 138 ? -6.018  16.417  -7.114  1.00 0.00 ? 138 SER A N    1  
ATOM 2149  C CA   . SER A 1 138 ? -7.215  15.651  -6.810  1.00 0.00 ? 138 SER A CA   1  
ATOM 2150  C C    . SER A 1 138 ? -7.970  16.299  -5.648  1.00 0.00 ? 138 SER A C    1  
ATOM 2151  O O    . SER A 1 138 ? -7.405  17.101  -4.906  1.00 0.00 ? 138 SER A O    1  
ATOM 2152  C CB   . SER A 1 138 ? -6.868  14.199  -6.474  1.00 0.00 ? 138 SER A CB   1  
ATOM 2153  O OG   . SER A 1 138 ? -7.904  13.300  -6.860  1.00 0.00 ? 138 SER A OG   1  
ATOM 2154  H H    . SER A 1 138 ? -5.963  16.760  -8.052  1.00 0.00 ? 138 SER A H    1  
ATOM 2155  H HA   . SER A 1 138 ? -7.814  15.679  -7.720  1.00 0.00 ? 138 SER A HA   1  
ATOM 2156  H HB2  . SER A 1 138 ? -5.942  13.922  -6.976  1.00 0.00 ? 138 SER A HB2  1  
ATOM 2157  H HB3  . SER A 1 138 ? -6.690  14.107  -5.403  1.00 0.00 ? 138 SER A HB3  1  
ATOM 2158  H HG   . SER A 1 138 ? -7.539  12.600  -7.474  1.00 0.00 ? 138 SER A HG   1  
ATOM 2159  N N    . GLY A 1 139 ? -9.236  15.927  -5.527  1.00 0.00 ? 139 GLY A N    1  
ATOM 2160  C CA   . GLY A 1 139 ? -10.074 16.463  -4.468  1.00 0.00 ? 139 GLY A CA   1  
ATOM 2161  C C    . GLY A 1 139 ? -10.501 17.899  -4.779  1.00 0.00 ? 139 GLY A C    1  
ATOM 2162  O O    . GLY A 1 139 ? -11.003 18.179  -5.866  1.00 0.00 ? 139 GLY A O    1  
ATOM 2163  H H    . GLY A 1 139 ? -9.688  15.275  -6.135  1.00 0.00 ? 139 GLY A H    1  
ATOM 2164  H HA2  . GLY A 1 139 ? -10.958 15.836  -4.346  1.00 0.00 ? 139 GLY A HA2  1  
ATOM 2165  H HA3  . GLY A 1 139 ? -9.533  16.437  -3.522  1.00 0.00 ? 139 GLY A HA3  1  
ATOM 2166  N N    . GLY A 1 1   ? 41.810  -0.693  46.307  1.00 0.00 ? 1   GLY A N    2  
ATOM 2167  C CA   . GLY A 1 1   ? 40.895  -0.649  45.179  1.00 0.00 ? 1   GLY A CA   2  
ATOM 2168  C C    . GLY A 1 1   ? 40.435  0.784   44.901  1.00 0.00 ? 1   GLY A C    2  
ATOM 2169  O O    . GLY A 1 1   ? 40.818  1.711   45.612  1.00 0.00 ? 1   GLY A O    2  
ATOM 2170  H H1   . GLY A 1 1   ? 42.193  0.191   46.574  1.00 0.00 ? 1   GLY A H1   2  
ATOM 2171  H HA2  . GLY A 1 1   ? 41.383  -1.056  44.294  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2172  H HA3  . GLY A 1 1   ? 40.029  -1.279  45.384  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2173  N N    . SER A 1 2   ? 39.621  0.919   43.864  1.00 0.00 ? 2   SER A N    2  
ATOM 2174  C CA   . SER A 1 2   ? 39.105  2.223   43.483  1.00 0.00 ? 2   SER A CA   2  
ATOM 2175  C C    . SER A 1 2   ? 37.729  2.071   42.832  1.00 0.00 ? 2   SER A C    2  
ATOM 2176  O O    . SER A 1 2   ? 36.745  2.632   43.313  1.00 0.00 ? 2   SER A O    2  
ATOM 2177  C CB   . SER A 1 2   ? 40.066  2.939   42.532  1.00 0.00 ? 2   SER A CB   2  
ATOM 2178  O OG   . SER A 1 2   ? 41.258  3.357   43.192  1.00 0.00 ? 2   SER A OG   2  
ATOM 2179  H H    . SER A 1 2   ? 39.315  0.159   43.291  1.00 0.00 ? 2   SER A H    2  
ATOM 2180  H HA   . SER A 1 2   ? 39.028  2.786   44.413  1.00 0.00 ? 2   SER A HA   2  
ATOM 2181  H HB2  . SER A 1 2   ? 40.323  2.274   41.708  1.00 0.00 ? 2   SER A HB2  2  
ATOM 2182  H HB3  . SER A 1 2   ? 39.568  3.806   42.099  1.00 0.00 ? 2   SER A HB3  2  
ATOM 2183  H HG   . SER A 1 2   ? 41.482  4.296   42.931  1.00 0.00 ? 2   SER A HG   2  
ATOM 2184  N N    . SER A 1 3   ? 37.703  1.310   41.748  1.00 0.00 ? 3   SER A N    2  
ATOM 2185  C CA   . SER A 1 3   ? 36.463  1.077   41.026  1.00 0.00 ? 3   SER A CA   2  
ATOM 2186  C C    . SER A 1 3   ? 35.857  2.411   40.585  1.00 0.00 ? 3   SER A C    2  
ATOM 2187  O O    . SER A 1 3   ? 36.289  3.472   41.033  1.00 0.00 ? 3   SER A O    2  
ATOM 2188  C CB   . SER A 1 3   ? 35.464  0.299   41.884  1.00 0.00 ? 3   SER A CB   2  
ATOM 2189  O OG   . SER A 1 3   ? 34.930  -0.827  41.193  1.00 0.00 ? 3   SER A OG   2  
ATOM 2190  H H    . SER A 1 3   ? 38.507  0.857   41.364  1.00 0.00 ? 3   SER A H    2  
ATOM 2191  H HA   . SER A 1 3   ? 36.742  0.478   40.160  1.00 0.00 ? 3   SER A HA   2  
ATOM 2192  H HB2  . SER A 1 3   ? 35.955  -0.037  42.798  1.00 0.00 ? 3   SER A HB2  2  
ATOM 2193  H HB3  . SER A 1 3   ? 34.651  0.960   42.184  1.00 0.00 ? 3   SER A HB3  2  
ATOM 2194  H HG   . SER A 1 3   ? 35.568  -1.127  40.483  1.00 0.00 ? 3   SER A HG   2  
ATOM 2195  N N    . GLY A 1 4   ? 34.867  2.313   39.710  1.00 0.00 ? 4   GLY A N    2  
ATOM 2196  C CA   . GLY A 1 4   ? 34.197  3.498   39.202  1.00 0.00 ? 4   GLY A CA   2  
ATOM 2197  C C    . GLY A 1 4   ? 33.008  3.120   38.318  1.00 0.00 ? 4   GLY A C    2  
ATOM 2198  O O    . GLY A 1 4   ? 32.881  1.969   37.901  1.00 0.00 ? 4   GLY A O    2  
ATOM 2199  H H    . GLY A 1 4   ? 34.522  1.446   39.350  1.00 0.00 ? 4   GLY A H    2  
ATOM 2200  H HA2  . GLY A 1 4   ? 33.854  4.112   40.036  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 2201  H HA3  . GLY A 1 4   ? 34.902  4.102   38.631  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 2202  N N    . SER A 1 5   ? 32.166  4.109   38.056  1.00 0.00 ? 5   SER A N    2  
ATOM 2203  C CA   . SER A 1 5   ? 30.992  3.895   37.229  1.00 0.00 ? 5   SER A CA   2  
ATOM 2204  C C    . SER A 1 5   ? 30.245  5.215   37.027  1.00 0.00 ? 5   SER A C    2  
ATOM 2205  O O    . SER A 1 5   ? 30.559  6.214   37.671  1.00 0.00 ? 5   SER A O    2  
ATOM 2206  C CB   . SER A 1 5   ? 30.063  2.850   37.851  1.00 0.00 ? 5   SER A CB   2  
ATOM 2207  O OG   . SER A 1 5   ? 29.352  3.368   38.972  1.00 0.00 ? 5   SER A OG   2  
ATOM 2208  H H    . SER A 1 5   ? 32.277  5.042   38.399  1.00 0.00 ? 5   SER A H    2  
ATOM 2209  H HA   . SER A 1 5   ? 31.373  3.521   36.278  1.00 0.00 ? 5   SER A HA   2  
ATOM 2210  H HB2  . SER A 1 5   ? 29.354  2.502   37.100  1.00 0.00 ? 5   SER A HB2  2  
ATOM 2211  H HB3  . SER A 1 5   ? 30.648  1.984   38.161  1.00 0.00 ? 5   SER A HB3  2  
ATOM 2212  H HG   . SER A 1 5   ? 29.328  2.689   39.705  1.00 0.00 ? 5   SER A HG   2  
ATOM 2213  N N    . SER A 1 6   ? 29.272  5.176   36.129  1.00 0.00 ? 6   SER A N    2  
ATOM 2214  C CA   . SER A 1 6   ? 28.478  6.357   35.834  1.00 0.00 ? 6   SER A CA   2  
ATOM 2215  C C    . SER A 1 6   ? 27.218  5.961   35.062  1.00 0.00 ? 6   SER A C    2  
ATOM 2216  O O    . SER A 1 6   ? 27.097  4.825   34.604  1.00 0.00 ? 6   SER A O    2  
ATOM 2217  C CB   . SER A 1 6   ? 29.289  7.380   35.036  1.00 0.00 ? 6   SER A CB   2  
ATOM 2218  O OG   . SER A 1 6   ? 29.245  8.675   35.630  1.00 0.00 ? 6   SER A OG   2  
ATOM 2219  H H    . SER A 1 6   ? 29.023  4.359   35.608  1.00 0.00 ? 6   SER A H    2  
ATOM 2220  H HA   . SER A 1 6   ? 28.216  6.778   36.804  1.00 0.00 ? 6   SER A HA   2  
ATOM 2221  H HB2  . SER A 1 6   ? 30.325  7.048   34.968  1.00 0.00 ? 6   SER A HB2  2  
ATOM 2222  H HB3  . SER A 1 6   ? 28.904  7.435   34.018  1.00 0.00 ? 6   SER A HB3  2  
ATOM 2223  H HG   . SER A 1 6   ? 30.168  9.058   35.684  1.00 0.00 ? 6   SER A HG   2  
ATOM 2224  N N    . GLY A 1 7   ? 26.311  6.919   34.940  1.00 0.00 ? 7   GLY A N    2  
ATOM 2225  C CA   . GLY A 1 7   ? 25.065  6.685   34.231  1.00 0.00 ? 7   GLY A CA   2  
ATOM 2226  C C    . GLY A 1 7   ? 24.195  7.944   34.220  1.00 0.00 ? 7   GLY A C    2  
ATOM 2227  O O    . GLY A 1 7   ? 24.399  8.850   35.026  1.00 0.00 ? 7   GLY A O    2  
ATOM 2228  H H    . GLY A 1 7   ? 26.418  7.840   35.315  1.00 0.00 ? 7   GLY A H    2  
ATOM 2229  H HA2  . GLY A 1 7   ? 25.277  6.376   33.208  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2230  H HA3  . GLY A 1 7   ? 24.521  5.867   34.705  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2231  N N    . LYS A 1 8   ? 23.244  7.959   33.298  1.00 0.00 ? 8   LYS A N    2  
ATOM 2232  C CA   . LYS A 1 8   ? 22.343  9.091   33.172  1.00 0.00 ? 8   LYS A CA   2  
ATOM 2233  C C    . LYS A 1 8   ? 21.164  8.702   32.277  1.00 0.00 ? 8   LYS A C    2  
ATOM 2234  O O    . LYS A 1 8   ? 21.240  7.725   31.535  1.00 0.00 ? 8   LYS A O    2  
ATOM 2235  C CB   . LYS A 1 8   ? 23.101  10.328  32.686  1.00 0.00 ? 8   LYS A CB   2  
ATOM 2236  C CG   . LYS A 1 8   ? 23.517  11.214  33.863  1.00 0.00 ? 8   LYS A CG   2  
ATOM 2237  C CD   . LYS A 1 8   ? 25.041  11.303  33.970  1.00 0.00 ? 8   LYS A CD   2  
ATOM 2238  C CE   . LYS A 1 8   ? 25.491  11.261  35.431  1.00 0.00 ? 8   LYS A CE   2  
ATOM 2239  N NZ   . LYS A 1 8   ? 26.117  12.545  35.817  1.00 0.00 ? 8   LYS A NZ   2  
ATOM 2240  H H    . LYS A 1 8   ? 23.085  7.217   32.647  1.00 0.00 ? 8   LYS A H    2  
ATOM 2241  H HA   . LYS A 1 8   ? 21.961  9.318   34.167  1.00 0.00 ? 8   LYS A HA   2  
ATOM 2242  H HB2  . LYS A 1 8   ? 23.985  10.021  32.127  1.00 0.00 ? 8   LYS A HB2  2  
ATOM 2243  H HB3  . LYS A 1 8   ? 22.473  10.898  32.001  1.00 0.00 ? 8   LYS A HB3  2  
ATOM 2244  H HG2  . LYS A 1 8   ? 23.098  12.212  33.736  1.00 0.00 ? 8   LYS A HG2  2  
ATOM 2245  H HG3  . LYS A 1 8   ? 23.107  10.811  34.788  1.00 0.00 ? 8   LYS A HG3  2  
ATOM 2246  H HD2  . LYS A 1 8   ? 25.496  10.479  33.421  1.00 0.00 ? 8   LYS A HD2  2  
ATOM 2247  H HD3  . LYS A 1 8   ? 25.388  12.226  33.505  1.00 0.00 ? 8   LYS A HD3  2  
ATOM 2248  H HE2  . LYS A 1 8   ? 24.636  11.059  36.076  1.00 0.00 ? 8   LYS A HE2  2  
ATOM 2249  H HE3  . LYS A 1 8   ? 26.200  10.446  35.576  1.00 0.00 ? 8   LYS A HE3  2  
ATOM 2250  H HZ1  . LYS A 1 8   ? 26.192  12.594  36.814  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM 2251  H HZ2  . LYS A 1 8   ? 27.029  12.607  35.411  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM 2252  H HZ3  . LYS A 1 8   ? 25.554  13.303  35.488  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM 2253  N N    . SER A 1 9   ? 20.101  9.487   32.378  1.00 0.00 ? 9   SER A N    2  
ATOM 2254  C CA   . SER A 1 9   ? 18.908  9.237   31.587  1.00 0.00 ? 9   SER A CA   2  
ATOM 2255  C C    . SER A 1 9   ? 18.447  10.530  30.912  1.00 0.00 ? 9   SER A C    2  
ATOM 2256  O O    . SER A 1 9   ? 18.024  11.469  31.585  1.00 0.00 ? 9   SER A O    2  
ATOM 2257  C CB   . SER A 1 9   ? 17.786  8.660   32.452  1.00 0.00 ? 9   SER A CB   2  
ATOM 2258  O OG   . SER A 1 9   ? 17.323  9.596   33.421  1.00 0.00 ? 9   SER A OG   2  
ATOM 2259  H H    . SER A 1 9   ? 20.048  10.280  32.985  1.00 0.00 ? 9   SER A H    2  
ATOM 2260  H HA   . SER A 1 9   ? 19.206  8.501   30.841  1.00 0.00 ? 9   SER A HA   2  
ATOM 2261  H HB2  . SER A 1 9   ? 16.955  8.358   31.813  1.00 0.00 ? 9   SER A HB2  2  
ATOM 2262  H HB3  . SER A 1 9   ? 18.142  7.762   32.956  1.00 0.00 ? 9   SER A HB3  2  
ATOM 2263  H HG   . SER A 1 9   ? 17.577  9.292   34.339  1.00 0.00 ? 9   SER A HG   2  
ATOM 2264  N N    . GLU A 1 10  ? 18.544  10.538  29.591  1.00 0.00 ? 10  GLU A N    2  
ATOM 2265  C CA   . GLU A 1 10  ? 18.141  11.700  28.818  1.00 0.00 ? 10  GLU A CA   2  
ATOM 2266  C C    . GLU A 1 10  ? 18.271  11.413  27.321  1.00 0.00 ? 10  GLU A C    2  
ATOM 2267  O O    . GLU A 1 10  ? 19.055  10.556  26.915  1.00 0.00 ? 10  GLU A O    2  
ATOM 2268  C CB   . GLU A 1 10  ? 18.960  12.931  29.213  1.00 0.00 ? 10  GLU A CB   2  
ATOM 2269  C CG   . GLU A 1 10  ? 18.073  13.993  29.865  1.00 0.00 ? 10  GLU A CG   2  
ATOM 2270  C CD   . GLU A 1 10  ? 18.915  15.138  30.433  1.00 0.00 ? 10  GLU A CD   2  
ATOM 2271  O OE1  . GLU A 1 10  ? 19.358  15.975  29.618  1.00 0.00 ? 10  GLU A OE1  2  
ATOM 2272  O OE2  . GLU A 1 10  ? 19.096  15.149  31.670  1.00 0.00 ? 10  GLU A OE2  2  
ATOM 2273  H H    . GLU A 1 10  ? 18.888  9.770   29.051  1.00 0.00 ? 10  GLU A H    2  
ATOM 2274  H HA   . GLU A 1 10  ? 17.095  11.870  29.073  1.00 0.00 ? 10  GLU A HA   2  
ATOM 2275  H HB2  . GLU A 1 10  ? 19.752  12.640  29.902  1.00 0.00 ? 10  GLU A HB2  2  
ATOM 2276  H HB3  . GLU A 1 10  ? 19.444  13.349  28.330  1.00 0.00 ? 10  GLU A HB3  2  
ATOM 2277  H HG2  . GLU A 1 10  ? 17.369  14.385  29.131  1.00 0.00 ? 10  GLU A HG2  2  
ATOM 2278  H HG3  . GLU A 1 10  ? 17.483  13.540  30.662  1.00 0.00 ? 10  GLU A HG3  2  
ATOM 2279  N N    . LYS A 1 11  ? 17.489  12.145  26.540  1.00 0.00 ? 11  LYS A N    2  
ATOM 2280  C CA   . LYS A 1 11  ? 17.507  11.979  25.097  1.00 0.00 ? 11  LYS A CA   2  
ATOM 2281  C C    . LYS A 1 11  ? 16.916  13.227  24.437  1.00 0.00 ? 11  LYS A C    2  
ATOM 2282  O O    . LYS A 1 11  ? 16.033  13.872  25.001  1.00 0.00 ? 11  LYS A O    2  
ATOM 2283  C CB   . LYS A 1 11  ? 16.803  10.681  24.698  1.00 0.00 ? 11  LYS A CB   2  
ATOM 2284  C CG   . LYS A 1 11  ? 15.379  10.635  25.257  1.00 0.00 ? 11  LYS A CG   2  
ATOM 2285  C CD   . LYS A 1 11  ? 15.303  9.735   26.491  1.00 0.00 ? 11  LYS A CD   2  
ATOM 2286  C CE   . LYS A 1 11  ? 13.905  9.771   27.111  1.00 0.00 ? 11  LYS A CE   2  
ATOM 2287  N NZ   . LYS A 1 11  ? 13.792  8.770   28.195  1.00 0.00 ? 11  LYS A NZ   2  
ATOM 2288  H H    . LYS A 1 11  ? 16.854  12.839  26.878  1.00 0.00 ? 11  LYS A H    2  
ATOM 2289  H HA   . LYS A 1 11  ? 18.549  11.888  24.791  1.00 0.00 ? 11  LYS A HA   2  
ATOM 2290  H HB2  . LYS A 1 11  ? 16.774  10.597  23.612  1.00 0.00 ? 11  LYS A HB2  2  
ATOM 2291  H HB3  . LYS A 1 11  ? 17.370  9.827   25.068  1.00 0.00 ? 11  LYS A HB3  2  
ATOM 2292  H HG2  . LYS A 1 11  ? 15.054  11.643  25.516  1.00 0.00 ? 11  LYS A HG2  2  
ATOM 2293  H HG3  . LYS A 1 11  ? 14.696  10.267  24.491  1.00 0.00 ? 11  LYS A HG3  2  
ATOM 2294  H HD2  . LYS A 1 11  ? 15.556  8.711   26.216  1.00 0.00 ? 11  LYS A HD2  2  
ATOM 2295  H HD3  . LYS A 1 11  ? 16.039  10.058  27.227  1.00 0.00 ? 11  LYS A HD3  2  
ATOM 2296  H HE2  . LYS A 1 11  ? 13.701  10.767  27.505  1.00 0.00 ? 11  LYS A HE2  2  
ATOM 2297  H HE3  . LYS A 1 11  ? 13.155  9.572   26.345  1.00 0.00 ? 11  LYS A HE3  2  
ATOM 2298  H HZ1  . LYS A 1 11  ? 12.892  8.336   28.156  1.00 0.00 ? 11  LYS A HZ1  2  
ATOM 2299  H HZ2  . LYS A 1 11  ? 14.502  8.074   28.082  1.00 0.00 ? 11  LYS A HZ2  2  
ATOM 2300  H HZ3  . LYS A 1 11  ? 13.906  9.222   29.080  1.00 0.00 ? 11  LYS A HZ3  2  
ATOM 2301  N N    . ARG A 1 12  ? 17.426  13.529  23.253  1.00 0.00 ? 12  ARG A N    2  
ATOM 2302  C CA   . ARG A 1 12  ? 16.960  14.688  22.511  1.00 0.00 ? 12  ARG A CA   2  
ATOM 2303  C C    . ARG A 1 12  ? 17.174  14.479  21.010  1.00 0.00 ? 12  ARG A C    2  
ATOM 2304  O O    . ARG A 1 12  ? 18.201  14.880  20.464  1.00 0.00 ? 12  ARG A O    2  
ATOM 2305  C CB   . ARG A 1 12  ? 17.693  15.956  22.952  1.00 0.00 ? 12  ARG A CB   2  
ATOM 2306  C CG   . ARG A 1 12  ? 16.758  16.890  23.722  1.00 0.00 ? 12  ARG A CG   2  
ATOM 2307  C CD   . ARG A 1 12  ? 16.895  16.682  25.231  1.00 0.00 ? 12  ARG A CD   2  
ATOM 2308  N NE   . ARG A 1 12  ? 17.580  17.842  25.843  1.00 0.00 ? 12  ARG A NE   2  
ATOM 2309  C CZ   . ARG A 1 12  ? 17.814  17.970  27.156  1.00 0.00 ? 12  ARG A CZ   2  
ATOM 2310  N NH1  . ARG A 1 12  ? 17.420  17.010  28.003  1.00 0.00 ? 12  ARG A NH1  2  
ATOM 2311  N NH2  . ARG A 1 12  ? 18.442  19.059  27.621  1.00 0.00 ? 12  ARG A NH2  2  
ATOM 2312  H H    . ARG A 1 12  ? 18.144  12.999  22.801  1.00 0.00 ? 12  ARG A H    2  
ATOM 2313  H HA   . ARG A 1 12  ? 15.898  14.763  22.748  1.00 0.00 ? 12  ARG A HA   2  
ATOM 2314  H HB2  . ARG A 1 12  ? 18.543  15.689  23.579  1.00 0.00 ? 12  ARG A HB2  2  
ATOM 2315  H HB3  . ARG A 1 12  ? 18.091  16.473  22.078  1.00 0.00 ? 12  ARG A HB3  2  
ATOM 2316  H HG2  . ARG A 1 12  ? 16.986  17.926  23.472  1.00 0.00 ? 12  ARG A HG2  2  
ATOM 2317  H HG3  . ARG A 1 12  ? 15.726  16.710  23.418  1.00 0.00 ? 12  ARG A HG3  2  
ATOM 2318  H HD2  . ARG A 1 12  ? 15.910  16.552  25.680  1.00 0.00 ? 12  ARG A HD2  2  
ATOM 2319  H HD3  . ARG A 1 12  ? 17.458  15.770  25.431  1.00 0.00 ? 12  ARG A HD3  2  
ATOM 2320  H HE   . ARG A 1 12  ? 17.887  18.577  25.238  1.00 0.00 ? 12  ARG A HE   2  
ATOM 2321  H HH11 . ARG A 1 12  ? 16.951  16.198  27.656  1.00 0.00 ? 12  ARG A HH11 2  
ATOM 2322  H HH12 . ARG A 1 12  ? 17.595  17.106  28.983  1.00 0.00 ? 12  ARG A HH12 2  
ATOM 2323  H HH21 . ARG A 1 12  ? 18.736  19.775  26.989  1.00 0.00 ? 12  ARG A HH21 2  
ATOM 2324  H HH22 . ARG A 1 12  ? 18.617  19.154  28.601  1.00 0.00 ? 12  ARG A HH22 2  
ATOM 2325  N N    . MET A 1 13  ? 16.188  13.852  20.386  1.00 0.00 ? 13  MET A N    2  
ATOM 2326  C CA   . MET A 1 13  ? 16.256  13.585  18.959  1.00 0.00 ? 13  MET A CA   2  
ATOM 2327  C C    . MET A 1 13  ? 14.892  13.789  18.297  1.00 0.00 ? 13  MET A C    2  
ATOM 2328  O O    . MET A 1 13  ? 13.858  13.491  18.893  1.00 0.00 ? 13  MET A O    2  
ATOM 2329  C CB   . MET A 1 13  ? 16.724  12.146  18.730  1.00 0.00 ? 13  MET A CB   2  
ATOM 2330  C CG   . MET A 1 13  ? 18.170  11.959  19.195  1.00 0.00 ? 13  MET A CG   2  
ATOM 2331  S SD   . MET A 1 13  ? 19.266  12.946  18.190  1.00 0.00 ? 13  MET A SD   2  
ATOM 2332  C CE   . MET A 1 13  ? 19.234  12.002  16.676  1.00 0.00 ? 13  MET A CE   2  
ATOM 2333  H H    . MET A 1 13  ? 15.356  13.529  20.837  1.00 0.00 ? 13  MET A H    2  
ATOM 2334  H HA   . MET A 1 13  ? 16.973  14.303  18.560  1.00 0.00 ? 13  MET A HA   2  
ATOM 2335  H HB2  . MET A 1 13  ? 16.073  11.458  19.270  1.00 0.00 ? 13  MET A HB2  2  
ATOM 2336  H HB3  . MET A 1 13  ? 16.643  11.897  17.672  1.00 0.00 ? 13  MET A HB3  2  
ATOM 2337  H HG2  . MET A 1 13  ? 18.264  12.247  20.241  1.00 0.00 ? 13  MET A HG2  2  
ATOM 2338  H HG3  . MET A 1 13  ? 18.449  10.908  19.127  1.00 0.00 ? 13  MET A HG3  2  
ATOM 2339  H HE1  . MET A 1 13  ? 19.674  11.020  16.850  1.00 0.00 ? 13  MET A HE1  2  
ATOM 2340  H HE2  . MET A 1 13  ? 18.202  11.883  16.343  1.00 0.00 ? 13  MET A HE2  2  
ATOM 2341  H HE3  . MET A 1 13  ? 19.805  12.524  15.909  1.00 0.00 ? 13  MET A HE3  2  
ATOM 2342  N N    . LYS A 1 14  ? 14.934  14.297  17.074  1.00 0.00 ? 14  LYS A N    2  
ATOM 2343  C CA   . LYS A 1 14  ? 13.713  14.545  16.325  1.00 0.00 ? 14  LYS A CA   2  
ATOM 2344  C C    . LYS A 1 14  ? 12.944  13.233  16.163  1.00 0.00 ? 14  LYS A C    2  
ATOM 2345  O O    . LYS A 1 14  ? 13.424  12.174  16.565  1.00 0.00 ? 14  LYS A O    2  
ATOM 2346  C CB   . LYS A 1 14  ? 14.031  15.240  14.999  1.00 0.00 ? 14  LYS A CB   2  
ATOM 2347  C CG   . LYS A 1 14  ? 14.496  16.679  15.232  1.00 0.00 ? 14  LYS A CG   2  
ATOM 2348  C CD   . LYS A 1 14  ? 15.597  17.066  14.243  1.00 0.00 ? 14  LYS A CD   2  
ATOM 2349  C CE   . LYS A 1 14  ? 15.523  18.554  13.894  1.00 0.00 ? 14  LYS A CE   2  
ATOM 2350  N NZ   . LYS A 1 14  ? 16.877  19.152  13.883  1.00 0.00 ? 14  LYS A NZ   2  
ATOM 2351  H H    . LYS A 1 14  ? 15.779  14.537  16.597  1.00 0.00 ? 14  LYS A H    2  
ATOM 2352  H HA   . LYS A 1 14  ? 13.104  15.233  16.911  1.00 0.00 ? 14  LYS A HA   2  
ATOM 2353  H HB2  . LYS A 1 14  ? 14.805  14.685  14.469  1.00 0.00 ? 14  LYS A HB2  2  
ATOM 2354  H HB3  . LYS A 1 14  ? 13.146  15.238  14.363  1.00 0.00 ? 14  LYS A HB3  2  
ATOM 2355  H HG2  . LYS A 1 14  ? 13.651  17.360  15.125  1.00 0.00 ? 14  LYS A HG2  2  
ATOM 2356  H HG3  . LYS A 1 14  ? 14.864  16.786  16.252  1.00 0.00 ? 14  LYS A HG3  2  
ATOM 2357  H HD2  . LYS A 1 14  ? 16.573  16.837  14.671  1.00 0.00 ? 14  LYS A HD2  2  
ATOM 2358  H HD3  . LYS A 1 14  ? 15.501  16.471  13.334  1.00 0.00 ? 14  LYS A HD3  2  
ATOM 2359  H HE2  . LYS A 1 14  ? 15.054  18.682  12.919  1.00 0.00 ? 14  LYS A HE2  2  
ATOM 2360  H HE3  . LYS A 1 14  ? 14.896  19.073  14.620  1.00 0.00 ? 14  LYS A HE3  2  
ATOM 2361  H HZ1  . LYS A 1 14  ? 16.834  20.066  13.480  1.00 0.00 ? 14  LYS A HZ1  2  
ATOM 2362  H HZ2  . LYS A 1 14  ? 17.220  19.216  14.820  1.00 0.00 ? 14  LYS A HZ2  2  
ATOM 2363  H HZ3  . LYS A 1 14  ? 17.490  18.577  13.342  1.00 0.00 ? 14  LYS A HZ3  2  
ATOM 2364  N N    . LEU A 1 15  ? 11.763  13.346  15.573  1.00 0.00 ? 15  LEU A N    2  
ATOM 2365  C CA   . LEU A 1 15  ? 10.922  12.181  15.352  1.00 0.00 ? 15  LEU A CA   2  
ATOM 2366  C C    . LEU A 1 15  ? 11.553  11.299  14.274  1.00 0.00 ? 15  LEU A C    2  
ATOM 2367  O O    . LEU A 1 15  ? 11.148  11.345  13.113  1.00 0.00 ? 15  LEU A O    2  
ATOM 2368  C CB   . LEU A 1 15  ? 9.488   12.608  15.036  1.00 0.00 ? 15  LEU A CB   2  
ATOM 2369  C CG   . LEU A 1 15  ? 8.702   13.232  16.191  1.00 0.00 ? 15  LEU A CG   2  
ATOM 2370  C CD1  . LEU A 1 15  ? 7.553   14.097  15.670  1.00 0.00 ? 15  LEU A CD1  2  
ATOM 2371  C CD2  . LEU A 1 15  ? 8.215   12.158  17.166  1.00 0.00 ? 15  LEU A CD2  2  
ATOM 2372  H H    . LEU A 1 15  ? 11.380  14.211  15.249  1.00 0.00 ? 15  LEU A H    2  
ATOM 2373  H HA   . LEU A 1 15  ? 10.892  11.619  16.286  1.00 0.00 ? 15  LEU A HA   2  
ATOM 2374  H HB2  . LEU A 1 15  ? 9.516   13.324  14.214  1.00 0.00 ? 15  LEU A HB2  2  
ATOM 2375  H HB3  . LEU A 1 15  ? 8.940   11.736  14.680  1.00 0.00 ? 15  LEU A HB3  2  
ATOM 2376  H HG   . LEU A 1 15  ? 9.374   13.888  16.745  1.00 0.00 ? 15  LEU A HG   2  
ATOM 2377  H HD11 . LEU A 1 15  ? 7.715   15.133  15.967  1.00 0.00 ? 15  LEU A HD11 2  
ATOM 2378  H HD12 . LEU A 1 15  ? 7.514   14.032  14.583  1.00 0.00 ? 15  LEU A HD12 2  
ATOM 2379  H HD13 . LEU A 1 15  ? 6.612   13.741  16.089  1.00 0.00 ? 15  LEU A HD13 2  
ATOM 2380  H HD21 . LEU A 1 15  ? 8.206   12.562  18.178  1.00 0.00 ? 15  LEU A HD21 2  
ATOM 2381  H HD22 . LEU A 1 15  ? 7.208   11.847  16.890  1.00 0.00 ? 15  LEU A HD22 2  
ATOM 2382  H HD23 . LEU A 1 15  ? 8.885   11.299  17.124  1.00 0.00 ? 15  LEU A HD23 2  
ATOM 2383  N N    . THR A 1 16  ? 12.535  10.515  14.695  1.00 0.00 ? 16  THR A N    2  
ATOM 2384  C CA   . THR A 1 16  ? 13.226  9.623   13.780  1.00 0.00 ? 16  THR A CA   2  
ATOM 2385  C C    . THR A 1 16  ? 12.580  8.236   13.797  1.00 0.00 ? 16  THR A C    2  
ATOM 2386  O O    . THR A 1 16  ? 12.641  7.507   12.809  1.00 0.00 ? 16  THR A O    2  
ATOM 2387  C CB   . THR A 1 16  ? 14.708  9.608   14.162  1.00 0.00 ? 16  THR A CB   2  
ATOM 2388  O OG1  . THR A 1 16  ? 15.329  8.870   13.114  1.00 0.00 ? 16  THR A OG1  2  
ATOM 2389  C CG2  . THR A 1 16  ? 14.980  8.776   15.417  1.00 0.00 ? 16  THR A CG2  2  
ATOM 2390  H H    . THR A 1 16  ? 12.858  10.483  15.641  1.00 0.00 ? 16  THR A H    2  
ATOM 2391  H HA   . THR A 1 16  ? 13.115  10.015  12.769  1.00 0.00 ? 16  THR A HA   2  
ATOM 2392  H HB   . THR A 1 16  ? 15.090  10.623  14.277  1.00 0.00 ? 16  THR A HB   2  
ATOM 2393  H HG1  . THR A 1 16  ? 15.079  7.904   13.181  1.00 0.00 ? 16  THR A HG1  2  
ATOM 2394  H HG21 . THR A 1 16  ? 14.306  9.089   16.214  1.00 0.00 ? 16  THR A HG21 2  
ATOM 2395  H HG22 . THR A 1 16  ? 14.817  7.721   15.196  1.00 0.00 ? 16  THR A HG22 2  
ATOM 2396  H HG23 . THR A 1 16  ? 16.012  8.925   15.735  1.00 0.00 ? 16  THR A HG23 2  
ATOM 2397  N N    . LEU A 1 17  ? 11.977  7.914   14.932  1.00 0.00 ? 17  LEU A N    2  
ATOM 2398  C CA   . LEU A 1 17  ? 11.321  6.627   15.091  1.00 0.00 ? 17  LEU A CA   2  
ATOM 2399  C C    . LEU A 1 17  ? 10.152  6.531   14.108  1.00 0.00 ? 17  LEU A C    2  
ATOM 2400  O O    . LEU A 1 17  ? 10.222  5.794   13.126  1.00 0.00 ? 17  LEU A O    2  
ATOM 2401  C CB   . LEU A 1 17  ? 10.916  6.409   16.550  1.00 0.00 ? 17  LEU A CB   2  
ATOM 2402  C CG   . LEU A 1 17  ? 10.883  4.955   17.027  1.00 0.00 ? 17  LEU A CG   2  
ATOM 2403  C CD1  . LEU A 1 17  ? 9.664   4.222   16.464  1.00 0.00 ? 17  LEU A CD1  2  
ATOM 2404  C CD2  . LEU A 1 17  ? 12.191  4.237   16.689  1.00 0.00 ? 17  LEU A CD2  2  
ATOM 2405  H H    . LEU A 1 17  ? 11.932  8.513   15.731  1.00 0.00 ? 17  LEU A H    2  
ATOM 2406  H HA   . LEU A 1 17  ? 12.048  5.856   14.839  1.00 0.00 ? 17  LEU A HA   2  
ATOM 2407  H HB2  . LEU A 1 17  ? 11.608  6.963   17.185  1.00 0.00 ? 17  LEU A HB2  2  
ATOM 2408  H HB3  . LEU A 1 17  ? 9.928   6.843   16.702  1.00 0.00 ? 17  LEU A HB3  2  
ATOM 2409  H HG   . LEU A 1 17  ? 10.786  4.954   18.112  1.00 0.00 ? 17  LEU A HG   2  
ATOM 2410  H HD11 . LEU A 1 17  ? 9.995   3.424   15.799  1.00 0.00 ? 17  LEU A HD11 2  
ATOM 2411  H HD12 . LEU A 1 17  ? 9.086   3.795   17.283  1.00 0.00 ? 17  LEU A HD12 2  
ATOM 2412  H HD13 . LEU A 1 17  ? 9.042   4.923   15.908  1.00 0.00 ? 17  LEU A HD13 2  
ATOM 2413  H HD21 . LEU A 1 17  ? 13.019  4.943   16.749  1.00 0.00 ? 17  LEU A HD21 2  
ATOM 2414  H HD22 . LEU A 1 17  ? 12.353  3.425   17.398  1.00 0.00 ? 17  LEU A HD22 2  
ATOM 2415  H HD23 . LEU A 1 17  ? 12.132  3.831   15.679  1.00 0.00 ? 17  LEU A HD23 2  
ATOM 2416  N N    . LYS A 1 18  ? 9.105   7.286   14.407  1.00 0.00 ? 18  LYS A N    2  
ATOM 2417  C CA   . LYS A 1 18  ? 7.923   7.294   13.562  1.00 0.00 ? 18  LYS A CA   2  
ATOM 2418  C C    . LYS A 1 18  ? 8.351   7.360   12.095  1.00 0.00 ? 18  LYS A C    2  
ATOM 2419  O O    . LYS A 1 18  ? 8.247   6.372   11.369  1.00 0.00 ? 18  LYS A O    2  
ATOM 2420  C CB   . LYS A 1 18  ? 6.976   8.422   13.977  1.00 0.00 ? 18  LYS A CB   2  
ATOM 2421  C CG   . LYS A 1 18  ? 5.583   7.877   14.300  1.00 0.00 ? 18  LYS A CG   2  
ATOM 2422  C CD   . LYS A 1 18  ? 5.346   7.840   15.811  1.00 0.00 ? 18  LYS A CD   2  
ATOM 2423  C CE   . LYS A 1 18  ? 6.097   6.673   16.456  1.00 0.00 ? 18  LYS A CE   2  
ATOM 2424  N NZ   . LYS A 1 18  ? 6.183   6.858   17.922  1.00 0.00 ? 18  LYS A NZ   2  
ATOM 2425  H H    . LYS A 1 18  ? 9.056   7.882   15.208  1.00 0.00 ? 18  LYS A H    2  
ATOM 2426  H HA   . LYS A 1 18  ? 7.397   6.354   13.727  1.00 0.00 ? 18  LYS A HA   2  
ATOM 2427  H HB2  . LYS A 1 18  ? 7.379   8.939   14.848  1.00 0.00 ? 18  LYS A HB2  2  
ATOM 2428  H HB3  . LYS A 1 18  ? 6.906   9.157   13.175  1.00 0.00 ? 18  LYS A HB3  2  
ATOM 2429  H HG2  . LYS A 1 18  ? 4.826   8.500   13.825  1.00 0.00 ? 18  LYS A HG2  2  
ATOM 2430  H HG3  . LYS A 1 18  ? 5.476   6.874   13.887  1.00 0.00 ? 18  LYS A HG3  2  
ATOM 2431  H HD2  . LYS A 1 18  ? 5.673   8.779   16.258  1.00 0.00 ? 18  LYS A HD2  2  
ATOM 2432  H HD3  . LYS A 1 18  ? 4.279   7.746   16.013  1.00 0.00 ? 18  LYS A HD3  2  
ATOM 2433  H HE2  . LYS A 1 18  ? 5.589   5.736   16.231  1.00 0.00 ? 18  LYS A HE2  2  
ATOM 2434  H HE3  . LYS A 1 18  ? 7.100   6.601   16.034  1.00 0.00 ? 18  LYS A HE3  2  
ATOM 2435  H HZ1  . LYS A 1 18  ? 5.402   7.399   18.236  1.00 0.00 ? 18  LYS A HZ1  2  
ATOM 2436  H HZ2  . LYS A 1 18  ? 6.172   5.965   18.372  1.00 0.00 ? 18  LYS A HZ2  2  
ATOM 2437  H HZ3  . LYS A 1 18  ? 7.031   7.336   18.149  1.00 0.00 ? 18  LYS A HZ3  2  
ATOM 2438  N N    . GLY A 1 19  ? 8.823   8.533   11.701  1.00 0.00 ? 19  GLY A N    2  
ATOM 2439  C CA   . GLY A 1 19  ? 9.267   8.741   10.333  1.00 0.00 ? 19  GLY A CA   2  
ATOM 2440  C C    . GLY A 1 19  ? 8.093   9.111   9.425   1.00 0.00 ? 19  GLY A C    2  
ATOM 2441  O O    . GLY A 1 19  ? 7.426   10.121  9.648   1.00 0.00 ? 19  GLY A O    2  
ATOM 2442  H H    . GLY A 1 19  ? 8.904   9.332   12.297  1.00 0.00 ? 19  GLY A H    2  
ATOM 2443  H HA2  . GLY A 1 19  ? 10.016  9.532   10.306  1.00 0.00 ? 19  GLY A HA2  2  
ATOM 2444  H HA3  . GLY A 1 19  ? 9.747   7.835   9.961   1.00 0.00 ? 19  GLY A HA3  2  
ATOM 2445  N N    . GLY A 1 20  ? 7.875   8.274   8.421   1.00 0.00 ? 20  GLY A N    2  
ATOM 2446  C CA   . GLY A 1 20  ? 6.793   8.501   7.479   1.00 0.00 ? 20  GLY A CA   2  
ATOM 2447  C C    . GLY A 1 20  ? 5.452   8.058   8.067   1.00 0.00 ? 20  GLY A C    2  
ATOM 2448  O O    . GLY A 1 20  ? 5.092   8.459   9.173   1.00 0.00 ? 20  GLY A O    2  
ATOM 2449  H H    . GLY A 1 20  ? 8.422   7.456   8.247   1.00 0.00 ? 20  GLY A H    2  
ATOM 2450  H HA2  . GLY A 1 20  ? 6.748   9.559   7.219   1.00 0.00 ? 20  GLY A HA2  2  
ATOM 2451  H HA3  . GLY A 1 20  ? 6.988   7.954   6.557   1.00 0.00 ? 20  GLY A HA3  2  
ATOM 2452  N N    . ALA A 1 21  ? 4.748   7.237   7.302   1.00 0.00 ? 21  ALA A N    2  
ATOM 2453  C CA   . ALA A 1 21  ? 3.455   6.735   7.733   1.00 0.00 ? 21  ALA A CA   2  
ATOM 2454  C C    . ALA A 1 21  ? 3.662   5.621   8.761   1.00 0.00 ? 21  ALA A C    2  
ATOM 2455  O O    . ALA A 1 21  ? 4.762   5.086   8.888   1.00 0.00 ? 21  ALA A O    2  
ATOM 2456  C CB   . ALA A 1 21  ? 2.657   6.264   6.516   1.00 0.00 ? 21  ALA A CB   2  
ATOM 2457  H H    . ALA A 1 21  ? 5.048   6.916   6.403   1.00 0.00 ? 21  ALA A H    2  
ATOM 2458  H HA   . ALA A 1 21  ? 2.920   7.559   8.206   1.00 0.00 ? 21  ALA A HA   2  
ATOM 2459  H HB1  . ALA A 1 21  ? 2.306   7.130   5.954   1.00 0.00 ? 21  ALA A HB1  2  
ATOM 2460  H HB2  . ALA A 1 21  ? 3.295   5.652   5.878   1.00 0.00 ? 21  ALA A HB2  2  
ATOM 2461  H HB3  . ALA A 1 21  ? 1.802   5.675   6.847   1.00 0.00 ? 21  ALA A HB3  2  
ATOM 2462  N N    . ALA A 1 22  ? 2.587   5.305   9.469   1.00 0.00 ? 22  ALA A N    2  
ATOM 2463  C CA   . ALA A 1 22  ? 2.637   4.264   10.482  1.00 0.00 ? 22  ALA A CA   2  
ATOM 2464  C C    . ALA A 1 22  ? 2.367   2.908   9.827   1.00 0.00 ? 22  ALA A C    2  
ATOM 2465  O O    . ALA A 1 22  ? 1.573   2.813   8.893   1.00 0.00 ? 22  ALA A O    2  
ATOM 2466  C CB   . ALA A 1 22  ? 1.636   4.585   11.593  1.00 0.00 ? 22  ALA A CB   2  
ATOM 2467  H H    . ALA A 1 22  ? 1.696   5.746   9.359   1.00 0.00 ? 22  ALA A H    2  
ATOM 2468  H HA   . ALA A 1 22  ? 3.642   4.261   10.904  1.00 0.00 ? 22  ALA A HA   2  
ATOM 2469  H HB1  . ALA A 1 22  ? 0.623   4.535   11.195  1.00 0.00 ? 22  ALA A HB1  2  
ATOM 2470  H HB2  . ALA A 1 22  ? 1.745   3.861   12.400  1.00 0.00 ? 22  ALA A HB2  2  
ATOM 2471  H HB3  . ALA A 1 22  ? 1.827   5.587   11.976  1.00 0.00 ? 22  ALA A HB3  2  
ATOM 2472  N N    . VAL A 1 23  ? 3.044   1.893   10.343  1.00 0.00 ? 23  VAL A N    2  
ATOM 2473  C CA   . VAL A 1 23  ? 2.887   0.546   9.820   1.00 0.00 ? 23  VAL A CA   2  
ATOM 2474  C C    . VAL A 1 23  ? 1.840   -0.200  10.649  1.00 0.00 ? 23  VAL A C    2  
ATOM 2475  O O    . VAL A 1 23  ? 1.623   0.123   11.816  1.00 0.00 ? 23  VAL A O    2  
ATOM 2476  C CB   . VAL A 1 23  ? 4.242   -0.164  9.789   1.00 0.00 ? 23  VAL A CB   2  
ATOM 2477  C CG1  . VAL A 1 23  ? 4.070   -1.662  9.527   1.00 0.00 ? 23  VAL A CG1  2  
ATOM 2478  C CG2  . VAL A 1 23  ? 5.170   0.471   8.751   1.00 0.00 ? 23  VAL A CG2  2  
ATOM 2479  H H    . VAL A 1 23  ? 3.689   1.979   11.102  1.00 0.00 ? 23  VAL A H    2  
ATOM 2480  H HA   . VAL A 1 23  ? 2.527   0.631   8.794   1.00 0.00 ? 23  VAL A HA   2  
ATOM 2481  H HB   . VAL A 1 23  ? 4.705   -0.046  10.769  1.00 0.00 ? 23  VAL A HB   2  
ATOM 2482  H HG11 . VAL A 1 23  ? 5.044   -2.110  9.328   1.00 0.00 ? 23  VAL A HG11 2  
ATOM 2483  H HG12 . VAL A 1 23  ? 3.624   -2.135  10.402  1.00 0.00 ? 23  VAL A HG12 2  
ATOM 2484  H HG13 . VAL A 1 23  ? 3.420   -1.808  8.665   1.00 0.00 ? 23  VAL A HG13 2  
ATOM 2485  H HG21 . VAL A 1 23  ? 4.589   0.771   7.879   1.00 0.00 ? 23  VAL A HG21 2  
ATOM 2486  H HG22 . VAL A 1 23  ? 5.654   1.346   9.184   1.00 0.00 ? 23  VAL A HG22 2  
ATOM 2487  H HG23 . VAL A 1 23  ? 5.929   -0.253  8.451   1.00 0.00 ? 23  VAL A HG23 2  
ATOM 2488  N N    . ASP A 1 24  ? 1.219   -1.183  10.014  1.00 0.00 ? 24  ASP A N    2  
ATOM 2489  C CA   . ASP A 1 24  ? 0.200   -1.977  10.679  1.00 0.00 ? 24  ASP A CA   2  
ATOM 2490  C C    . ASP A 1 24  ? 0.875   -3.026  11.565  1.00 0.00 ? 24  ASP A C    2  
ATOM 2491  O O    . ASP A 1 24  ? 1.926   -3.558  11.213  1.00 0.00 ? 24  ASP A O    2  
ATOM 2492  C CB   . ASP A 1 24  ? -0.677  -2.710  9.662   1.00 0.00 ? 24  ASP A CB   2  
ATOM 2493  C CG   . ASP A 1 24  ? -2.184  -2.532  9.860   1.00 0.00 ? 24  ASP A CG   2  
ATOM 2494  O OD1  . ASP A 1 24  ? -2.710  -1.527  9.336   1.00 0.00 ? 24  ASP A OD1  2  
ATOM 2495  O OD2  . ASP A 1 24  ? -2.775  -3.406  10.530  1.00 0.00 ? 24  ASP A OD2  2  
ATOM 2496  H H    . ASP A 1 24  ? 1.402   -1.439  9.065   1.00 0.00 ? 24  ASP A H    2  
ATOM 2497  H HA   . ASP A 1 24  ? -0.390  -1.263  11.253  1.00 0.00 ? 24  ASP A HA   2  
ATOM 2498  H HB2  . ASP A 1 24  ? -0.414  -2.365  8.662   1.00 0.00 ? 24  ASP A HB2  2  
ATOM 2499  H HB3  . ASP A 1 24  ? -0.443  -3.774  9.704   1.00 0.00 ? 24  ASP A HB3  2  
ATOM 2500  N N    . PRO A 1 25  ? 0.225   -3.300  12.728  1.00 0.00 ? 25  PRO A N    2  
ATOM 2501  C CA   . PRO A 1 25  ? 0.751   -4.276  13.667  1.00 0.00 ? 25  PRO A CA   2  
ATOM 2502  C C    . PRO A 1 25  ? 0.520   -5.701  13.163  1.00 0.00 ? 25  PRO A C    2  
ATOM 2503  O O    . PRO A 1 25  ? 1.193   -6.634  13.599  1.00 0.00 ? 25  PRO A O    2  
ATOM 2504  C CB   . PRO A 1 25  ? 0.035   -3.986  14.977  1.00 0.00 ? 25  PRO A CB   2  
ATOM 2505  C CG   . PRO A 1 25  ? -1.194  -3.171  14.609  1.00 0.00 ? 25  PRO A CG   2  
ATOM 2506  C CD   . PRO A 1 25  ? -1.023  -2.689  13.178  1.00 0.00 ? 25  PRO A CD   2  
ATOM 2507  H HA   . PRO A 1 25  ? 1.741   -4.174  13.756  1.00 0.00 ? 25  PRO A HA   2  
ATOM 2508  H HB2  . PRO A 1 25  ? -0.245  -4.911  15.481  1.00 0.00 ? 25  PRO A HB2  2  
ATOM 2509  H HB3  . PRO A 1 25  ? 0.680   -3.433  15.660  1.00 0.00 ? 25  PRO A HB3  2  
ATOM 2510  H HG2  . PRO A 1 25  ? -2.095  -3.777  14.703  1.00 0.00 ? 25  PRO A HG2  2  
ATOM 2511  H HG3  . PRO A 1 25  ? -1.307  -2.325  15.286  1.00 0.00 ? 25  PRO A HG3  2  
ATOM 2512  H HD2  . PRO A 1 25  ? -1.862  -2.997  12.553  1.00 0.00 ? 25  PRO A HD2  2  
ATOM 2513  H HD3  . PRO A 1 25  ? -0.972  -1.602  13.130  1.00 0.00 ? 25  PRO A HD3  2  
ATOM 2514  N N    . ASP A 1 26  ? -0.433  -5.826  12.250  1.00 0.00 ? 26  ASP A N    2  
ATOM 2515  C CA   . ASP A 1 26  ? -0.760  -7.122  11.682  1.00 0.00 ? 26  ASP A CA   2  
ATOM 2516  C C    . ASP A 1 26  ? 0.355   -7.551  10.726  1.00 0.00 ? 26  ASP A C    2  
ATOM 2517  O O    . ASP A 1 26  ? 0.459   -8.726  10.375  1.00 0.00 ? 26  ASP A O    2  
ATOM 2518  C CB   . ASP A 1 26  ? -2.066  -7.061  10.888  1.00 0.00 ? 26  ASP A CB   2  
ATOM 2519  C CG   . ASP A 1 26  ? -2.865  -8.366  10.855  1.00 0.00 ? 26  ASP A CG   2  
ATOM 2520  O OD1  . ASP A 1 26  ? -2.220  -9.429  10.989  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 2521  O OD2  . ASP A 1 26  ? -4.101  -8.271  10.696  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 2522  H H    . ASP A 1 26  ? -0.975  -5.062  11.901  1.00 0.00 ? 26  ASP A H    2  
ATOM 2523  H HA   . ASP A 1 26  ? -0.859  -7.793  12.536  1.00 0.00 ? 26  ASP A HA   2  
ATOM 2524  H HB2  . ASP A 1 26  ? -2.695  -6.278  11.311  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 2525  H HB3  . ASP A 1 26  ? -1.838  -6.767  9.863   1.00 0.00 ? 26  ASP A HB3  2  
ATOM 2526  N N    . SER A 1 27  ? 1.161   -6.576  10.332  1.00 0.00 ? 27  SER A N    2  
ATOM 2527  C CA   . SER A 1 27  ? 2.264   -6.838  9.423   1.00 0.00 ? 27  SER A CA   2  
ATOM 2528  C C    . SER A 1 27  ? 3.449   -7.423  10.194  1.00 0.00 ? 27  SER A C    2  
ATOM 2529  O O    . SER A 1 27  ? 4.225   -8.205  9.647   1.00 0.00 ? 27  SER A O    2  
ATOM 2530  C CB   . SER A 1 27  ? 2.686   -5.565  8.687   1.00 0.00 ? 27  SER A CB   2  
ATOM 2531  O OG   . SER A 1 27  ? 3.563   -4.761  9.471   1.00 0.00 ? 27  SER A OG   2  
ATOM 2532  H H    . SER A 1 27  ? 1.069   -5.624  10.622  1.00 0.00 ? 27  SER A H    2  
ATOM 2533  H HA   . SER A 1 27  ? 1.880   -7.562  8.705   1.00 0.00 ? 27  SER A HA   2  
ATOM 2534  H HB2  . SER A 1 27  ? 3.178   -5.833  7.752   1.00 0.00 ? 27  SER A HB2  2  
ATOM 2535  H HB3  . SER A 1 27  ? 1.800   -4.987  8.426   1.00 0.00 ? 27  SER A HB3  2  
ATOM 2536  H HG   . SER A 1 27  ? 3.057   -4.000  9.879   1.00 0.00 ? 27  SER A HG   2  
ATOM 2537  N N    . GLY A 1 28  ? 3.551   -7.022  11.453  1.00 0.00 ? 28  GLY A N    2  
ATOM 2538  C CA   . GLY A 1 28  ? 4.629   -7.496  12.304  1.00 0.00 ? 28  GLY A CA   2  
ATOM 2539  C C    . GLY A 1 28  ? 5.943   -6.785  11.974  1.00 0.00 ? 28  GLY A C    2  
ATOM 2540  O O    . GLY A 1 28  ? 6.993   -7.132  12.512  1.00 0.00 ? 28  GLY A O    2  
ATOM 2541  H H    . GLY A 1 28  ? 2.916   -6.385  11.890  1.00 0.00 ? 28  GLY A H    2  
ATOM 2542  H HA2  . GLY A 1 28  ? 4.372   -7.326  13.350  1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2543  H HA3  . GLY A 1 28  ? 4.751   -8.572  12.177  1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2544  N N    . LEU A 1 29  ? 5.841   -5.803  11.090  1.00 0.00 ? 29  LEU A N    2  
ATOM 2545  C CA   . LEU A 1 29  ? 7.008   -5.041  10.681  1.00 0.00 ? 29  LEU A CA   2  
ATOM 2546  C C    . LEU A 1 29  ? 6.948   -3.647  11.310  1.00 0.00 ? 29  LEU A C    2  
ATOM 2547  O O    . LEU A 1 29  ? 7.868   -2.848  11.147  1.00 0.00 ? 29  LEU A O    2  
ATOM 2548  C CB   . LEU A 1 29  ? 7.129   -5.022  9.156   1.00 0.00 ? 29  LEU A CB   2  
ATOM 2549  C CG   . LEU A 1 29  ? 6.904   -6.360  8.449   1.00 0.00 ? 29  LEU A CG   2  
ATOM 2550  C CD1  . LEU A 1 29  ? 6.877   -6.180  6.930   1.00 0.00 ? 29  LEU A CD1  2  
ATOM 2551  C CD2  . LEU A 1 29  ? 7.944   -7.393  8.885   1.00 0.00 ? 29  LEU A CD2  2  
ATOM 2552  H H    . LEU A 1 29  ? 4.983   -5.528  10.656  1.00 0.00 ? 29  LEU A H    2  
ATOM 2553  H HA   . LEU A 1 29  ? 7.887   -5.557  11.067  1.00 0.00 ? 29  LEU A HA   2  
ATOM 2554  H HB2  . LEU A 1 29  ? 6.412   -4.301  8.763   1.00 0.00 ? 29  LEU A HB2  2  
ATOM 2555  H HB3  . LEU A 1 29  ? 8.122   -4.658  8.894   1.00 0.00 ? 29  LEU A HB3  2  
ATOM 2556  H HG   . LEU A 1 29  ? 5.927   -6.743  8.745   1.00 0.00 ? 29  LEU A HG   2  
ATOM 2557  H HD11 . LEU A 1 29  ? 7.634   -6.819  6.475   1.00 0.00 ? 29  LEU A HD11 2  
ATOM 2558  H HD12 . LEU A 1 29  ? 5.893   -6.453  6.549   1.00 0.00 ? 29  LEU A HD12 2  
ATOM 2559  H HD13 . LEU A 1 29  ? 7.086   -5.139  6.684   1.00 0.00 ? 29  LEU A HD13 2  
ATOM 2560  H HD21 . LEU A 1 29  ? 7.642   -8.382  8.541   1.00 0.00 ? 29  LEU A HD21 2  
ATOM 2561  H HD22 . LEU A 1 29  ? 8.912   -7.139  8.453   1.00 0.00 ? 29  LEU A HD22 2  
ATOM 2562  H HD23 . LEU A 1 29  ? 8.021   -7.395  9.973   1.00 0.00 ? 29  LEU A HD23 2  
ATOM 2563  N N    . GLU A 1 30  ? 5.854   -3.399  12.016  1.00 0.00 ? 30  GLU A N    2  
ATOM 2564  C CA   . GLU A 1 30  ? 5.662   -2.116  12.670  1.00 0.00 ? 30  GLU A CA   2  
ATOM 2565  C C    . GLU A 1 30  ? 6.806   -1.842  13.648  1.00 0.00 ? 30  GLU A C    2  
ATOM 2566  O O    . GLU A 1 30  ? 7.022   -0.700  14.052  1.00 0.00 ? 30  GLU A O    2  
ATOM 2567  C CB   . GLU A 1 30  ? 4.308   -2.061  13.381  1.00 0.00 ? 30  GLU A CB   2  
ATOM 2568  C CG   . GLU A 1 30  ? 4.149   -3.234  14.350  1.00 0.00 ? 30  GLU A CG   2  
ATOM 2569  C CD   . GLU A 1 30  ? 3.199   -2.875  15.495  1.00 0.00 ? 30  GLU A CD   2  
ATOM 2570  O OE1  . GLU A 1 30  ? 2.645   -1.756  15.442  1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2571  O OE2  . GLU A 1 30  ? 3.049   -3.728  16.396  1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2572  H H    . GLU A 1 30  ? 5.110   -4.054  12.144  1.00 0.00 ? 30  GLU A H    2  
ATOM 2573  H HA   . GLU A 1 30  ? 5.675   -1.377  11.869  1.00 0.00 ? 30  GLU A HA   2  
ATOM 2574  H HB2  . GLU A 1 30  ? 4.217   -1.120  13.925  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2575  H HB3  . GLU A 1 30  ? 3.505   -2.082  12.644  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2576  H HG2  . GLU A 1 30  ? 3.767   -4.103  13.815  1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2577  H HG3  . GLU A 1 30  ? 5.123   -3.511  14.754  1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2578  N N    . HIS A 1 31  ? 7.509   -2.908  14.001  1.00 0.00 ? 31  HIS A N    2  
ATOM 2579  C CA   . HIS A 1 31  ? 8.626   -2.797  14.924  1.00 0.00 ? 31  HIS A CA   2  
ATOM 2580  C C    . HIS A 1 31  ? 9.909   -3.266  14.236  1.00 0.00 ? 31  HIS A C    2  
ATOM 2581  O O    . HIS A 1 31  ? 10.929  -3.472  14.891  1.00 0.00 ? 31  HIS A O    2  
ATOM 2582  C CB   . HIS A 1 31  ? 8.337   -3.556  16.221  1.00 0.00 ? 31  HIS A CB   2  
ATOM 2583  C CG   . HIS A 1 31  ? 7.455   -4.768  16.039  1.00 0.00 ? 31  HIS A CG   2  
ATOM 2584  N ND1  . HIS A 1 31  ? 7.795   -5.826  15.214  1.00 0.00 ? 31  HIS A ND1  2  
ATOM 2585  C CD2  . HIS A 1 31  ? 6.244   -5.079  16.584  1.00 0.00 ? 31  HIS A CD2  2  
ATOM 2586  C CE1  . HIS A 1 31  ? 6.826   -6.727  15.268  1.00 0.00 ? 31  HIS A CE1  2  
ATOM 2587  N NE2  . HIS A 1 31  ? 5.865   -6.262  16.117  1.00 0.00 ? 31  HIS A NE2  2  
ATOM 2588  H H    . HIS A 1 31  ? 7.326   -3.833  13.668  1.00 0.00 ? 31  HIS A H    2  
ATOM 2589  H HA   . HIS A 1 31  ? 8.722   -1.740  15.172  1.00 0.00 ? 31  HIS A HA   2  
ATOM 2590  H HB2  . HIS A 1 31  ? 9.281   -3.870  16.664  1.00 0.00 ? 31  HIS A HB2  2  
ATOM 2591  H HB3  . HIS A 1 31  ? 7.862   -2.877  16.929  1.00 0.00 ? 31  HIS A HB3  2  
ATOM 2592  H HD1  . HIS A 1 31  ? 8.632   -5.899  14.671  1.00 0.00 ? 31  HIS A HD1  2  
ATOM 2593  H HD2  . HIS A 1 31  ? 5.683   -4.461  17.285  1.00 0.00 ? 31  HIS A HD2  2  
ATOM 2594  H HE1  . HIS A 1 31  ? 6.800   -7.674  14.728  1.00 0.00 ? 31  HIS A HE1  2  
ATOM 2595  N N    . SER A 1 32  ? 9.816   -3.420  12.923  1.00 0.00 ? 32  SER A N    2  
ATOM 2596  C CA   . SER A 1 32  ? 10.957  -3.861  12.139  1.00 0.00 ? 32  SER A CA   2  
ATOM 2597  C C    . SER A 1 32  ? 11.112  -2.978  10.899  1.00 0.00 ? 32  SER A C    2  
ATOM 2598  O O    . SER A 1 32  ? 12.137  -2.321  10.725  1.00 0.00 ? 32  SER A O    2  
ATOM 2599  C CB   . SER A 1 32  ? 10.811  -5.328  11.731  1.00 0.00 ? 32  SER A CB   2  
ATOM 2600  O OG   . SER A 1 32  ? 11.766  -6.161  12.383  1.00 0.00 ? 32  SER A OG   2  
ATOM 2601  H H    . SER A 1 32  ? 8.982   -3.250  12.398  1.00 0.00 ? 32  SER A H    2  
ATOM 2602  H HA   . SER A 1 32  ? 11.819  -3.751  12.797  1.00 0.00 ? 32  SER A HA   2  
ATOM 2603  H HB2  . SER A 1 32  ? 9.806   -5.673  11.971  1.00 0.00 ? 32  SER A HB2  2  
ATOM 2604  H HB3  . SER A 1 32  ? 10.929  -5.418  10.651  1.00 0.00 ? 32  SER A HB3  2  
ATOM 2605  H HG   . SER A 1 32  ? 11.664  -7.106  12.074  1.00 0.00 ? 32  SER A HG   2  
ATOM 2606  N N    . ALA A 1 33  ? 10.079  -2.992  10.069  1.00 0.00 ? 33  ALA A N    2  
ATOM 2607  C CA   . ALA A 1 33  ? 10.087  -2.200  8.851   1.00 0.00 ? 33  ALA A CA   2  
ATOM 2608  C C    . ALA A 1 33  ? 9.195   -0.972  9.039   1.00 0.00 ? 33  ALA A C    2  
ATOM 2609  O O    . ALA A 1 33  ? 8.561   -0.815  10.081  1.00 0.00 ? 33  ALA A O    2  
ATOM 2610  C CB   . ALA A 1 33  ? 9.641   -3.071  7.674   1.00 0.00 ? 33  ALA A CB   2  
ATOM 2611  H H    . ALA A 1 33  ? 9.249   -3.529  10.219  1.00 0.00 ? 33  ALA A H    2  
ATOM 2612  H HA   . ALA A 1 33  ? 11.112  -1.871  8.676   1.00 0.00 ? 33  ALA A HA   2  
ATOM 2613  H HB1  . ALA A 1 33  ? 10.095  -2.699  6.755   1.00 0.00 ? 33  ALA A HB1  2  
ATOM 2614  H HB2  . ALA A 1 33  ? 9.956   -4.100  7.844   1.00 0.00 ? 33  ALA A HB2  2  
ATOM 2615  H HB3  . ALA A 1 33  ? 8.556   -3.032  7.585   1.00 0.00 ? 33  ALA A HB3  2  
ATOM 2616  N N    . HIS A 1 34  ? 9.173   -0.133  8.013   1.00 0.00 ? 34  HIS A N    2  
ATOM 2617  C CA   . HIS A 1 34  ? 8.368   1.076   8.053   1.00 0.00 ? 34  HIS A CA   2  
ATOM 2618  C C    . HIS A 1 34  ? 7.807   1.364   6.659   1.00 0.00 ? 34  HIS A C    2  
ATOM 2619  O O    . HIS A 1 34  ? 8.286   0.817   5.667   1.00 0.00 ? 34  HIS A O    2  
ATOM 2620  C CB   . HIS A 1 34  ? 9.174   2.246   8.621   1.00 0.00 ? 34  HIS A CB   2  
ATOM 2621  C CG   . HIS A 1 34  ? 10.465  2.516   7.887   1.00 0.00 ? 34  HIS A CG   2  
ATOM 2622  N ND1  . HIS A 1 34  ? 11.708  2.378   8.480   1.00 0.00 ? 34  HIS A ND1  2  
ATOM 2623  C CD2  . HIS A 1 34  ? 10.694  2.917   6.603   1.00 0.00 ? 34  HIS A CD2  2  
ATOM 2624  C CE1  . HIS A 1 34  ? 12.635  2.685   7.585   1.00 0.00 ? 34  HIS A CE1  2  
ATOM 2625  N NE2  . HIS A 1 34  ? 12.005  3.020   6.423   1.00 0.00 ? 34  HIS A NE2  2  
ATOM 2626  H H    . HIS A 1 34  ? 9.691   -0.269  7.169   1.00 0.00 ? 34  HIS A H    2  
ATOM 2627  H HA   . HIS A 1 34  ? 7.541   0.879   8.735   1.00 0.00 ? 34  HIS A HA   2  
ATOM 2628  H HB2  . HIS A 1 34  ? 8.557   3.145   8.594   1.00 0.00 ? 34  HIS A HB2  2  
ATOM 2629  H HB3  . HIS A 1 34  ? 9.398   2.044   9.668   1.00 0.00 ? 34  HIS A HB3  2  
ATOM 2630  H HD1  . HIS A 1 34  ? 11.877  2.095   9.424   1.00 0.00 ? 34  HIS A HD1  2  
ATOM 2631  H HD2  . HIS A 1 34  ? 9.929   3.119   5.853   1.00 0.00 ? 34  HIS A HD2  2  
ATOM 2632  H HE1  . HIS A 1 34  ? 13.713  2.673   7.749   1.00 0.00 ? 34  HIS A HE1  2  
ATOM 2633  N N    . VAL A 1 35  ? 6.798   2.222   6.629   1.00 0.00 ? 35  VAL A N    2  
ATOM 2634  C CA   . VAL A 1 35  ? 6.165   2.590   5.373   1.00 0.00 ? 35  VAL A CA   2  
ATOM 2635  C C    . VAL A 1 35  ? 7.235   3.065   4.388   1.00 0.00 ? 35  VAL A C    2  
ATOM 2636  O O    . VAL A 1 35  ? 8.127   3.828   4.756   1.00 0.00 ? 35  VAL A O    2  
ATOM 2637  C CB   . VAL A 1 35  ? 5.076   3.634   5.622   1.00 0.00 ? 35  VAL A CB   2  
ATOM 2638  C CG1  . VAL A 1 35  ? 4.408   4.053   4.311   1.00 0.00 ? 35  VAL A CG1  2  
ATOM 2639  C CG2  . VAL A 1 35  ? 4.041   3.119   6.624   1.00 0.00 ? 35  VAL A CG2  2  
ATOM 2640  H H    . VAL A 1 35  ? 6.413   2.662   7.440   1.00 0.00 ? 35  VAL A H    2  
ATOM 2641  H HA   . VAL A 1 35  ? 5.690   1.695   4.970   1.00 0.00 ? 35  VAL A HA   2  
ATOM 2642  H HB   . VAL A 1 35  ? 5.549   4.516   6.054   1.00 0.00 ? 35  VAL A HB   2  
ATOM 2643  H HG11 . VAL A 1 35  ? 4.533   3.263   3.571   1.00 0.00 ? 35  VAL A HG11 2  
ATOM 2644  H HG12 . VAL A 1 35  ? 3.345   4.225   4.483   1.00 0.00 ? 35  VAL A HG12 2  
ATOM 2645  H HG13 . VAL A 1 35  ? 4.870   4.970   3.945   1.00 0.00 ? 35  VAL A HG13 2  
ATOM 2646  H HG21 . VAL A 1 35  ? 3.217   3.829   6.693   1.00 0.00 ? 35  VAL A HG21 2  
ATOM 2647  H HG22 . VAL A 1 35  ? 3.661   2.154   6.290   1.00 0.00 ? 35  VAL A HG22 2  
ATOM 2648  H HG23 . VAL A 1 35  ? 4.507   3.007   7.603   1.00 0.00 ? 35  VAL A HG23 2  
ATOM 2649  N N    . LEU A 1 36  ? 7.111   2.594   3.156   1.00 0.00 ? 36  LEU A N    2  
ATOM 2650  C CA   . LEU A 1 36  ? 8.057   2.961   2.116   1.00 0.00 ? 36  LEU A CA   2  
ATOM 2651  C C    . LEU A 1 36  ? 7.717   4.359   1.594   1.00 0.00 ? 36  LEU A C    2  
ATOM 2652  O O    . LEU A 1 36  ? 6.580   4.619   1.203   1.00 0.00 ? 36  LEU A O    2  
ATOM 2653  C CB   . LEU A 1 36  ? 8.095   1.890   1.024   1.00 0.00 ? 36  LEU A CB   2  
ATOM 2654  C CG   . LEU A 1 36  ? 9.084   2.131   -0.118  1.00 0.00 ? 36  LEU A CG   2  
ATOM 2655  C CD1  . LEU A 1 36  ? 8.418   2.890   -1.268  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2656  C CD2  . LEU A 1 36  ? 10.341  2.842   0.386   1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2657  H H    . LEU A 1 36  ? 6.383   1.973   2.865   1.00 0.00 ? 36  LEU A H    2  
ATOM 2658  H HA   . LEU A 1 36  ? 9.047   2.994   2.571   1.00 0.00 ? 36  LEU A HA   2  
ATOM 2659  H HB2  . LEU A 1 36  ? 8.335   0.934   1.490   1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2660  H HB3  . LEU A 1 36  ? 7.096   1.795   0.600   1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2661  H HG   . LEU A 1 36  ? 9.397   1.163   -0.510  1.00 0.00 ? 36  LEU A HG   2  
ATOM 2662  H HD11 . LEU A 1 36  ? 8.214   2.202   -2.088  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 2663  H HD12 . LEU A 1 36  ? 7.483   3.329   -0.920  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 2664  H HD13 . LEU A 1 36  ? 9.083   3.681   -1.614  1.00 0.00 ? 36  LEU A HD13 2  
ATOM 2665  H HD21 . LEU A 1 36  ? 10.169  3.918   0.401   1.00 0.00 ? 36  LEU A HD21 2  
ATOM 2666  H HD22 . LEU A 1 36  ? 10.575  2.497   1.393   1.00 0.00 ? 36  LEU A HD22 2  
ATOM 2667  H HD23 . LEU A 1 36  ? 11.176  2.618   -0.278  1.00 0.00 ? 36  LEU A HD23 2  
ATOM 2668  N N    . GLU A 1 37  ? 8.723   5.221   1.604   1.00 0.00 ? 37  GLU A N    2  
ATOM 2669  C CA   . GLU A 1 37  ? 8.545   6.585   1.137   1.00 0.00 ? 37  GLU A CA   2  
ATOM 2670  C C    . GLU A 1 37  ? 9.363   6.822   -0.134  1.00 0.00 ? 37  GLU A C    2  
ATOM 2671  O O    . GLU A 1 37  ? 10.474  6.310   -0.266  1.00 0.00 ? 37  GLU A O    2  
ATOM 2672  C CB   . GLU A 1 37  ? 8.920   7.591   2.226   1.00 0.00 ? 37  GLU A CB   2  
ATOM 2673  C CG   . GLU A 1 37  ? 7.677   8.080   2.973   1.00 0.00 ? 37  GLU A CG   2  
ATOM 2674  C CD   . GLU A 1 37  ? 8.013   8.434   4.423   1.00 0.00 ? 37  GLU A CD   2  
ATOM 2675  O OE1  . GLU A 1 37  ? 8.625   7.573   5.091   1.00 0.00 ? 37  GLU A OE1  2  
ATOM 2676  O OE2  . GLU A 1 37  ? 7.651   9.559   4.831   1.00 0.00 ? 37  GLU A OE2  2  
ATOM 2677  H H    . GLU A 1 37  ? 9.644   5.000   1.924   1.00 0.00 ? 37  GLU A H    2  
ATOM 2678  H HA   . GLU A 1 37  ? 7.481   6.678   0.915   1.00 0.00 ? 37  GLU A HA   2  
ATOM 2679  H HB2  . GLU A 1 37  ? 9.613   7.130   2.930   1.00 0.00 ? 37  GLU A HB2  2  
ATOM 2680  H HB3  . GLU A 1 37  ? 9.438   8.440   1.780   1.00 0.00 ? 37  GLU A HB3  2  
ATOM 2681  H HG2  . GLU A 1 37  ? 7.265   8.953   2.468   1.00 0.00 ? 37  GLU A HG2  2  
ATOM 2682  H HG3  . GLU A 1 37  ? 6.909   7.307   2.953   1.00 0.00 ? 37  GLU A HG3  2  
ATOM 2683  N N    . LYS A 1 38  ? 8.783   7.598   -1.037  1.00 0.00 ? 38  LYS A N    2  
ATOM 2684  C CA   . LYS A 1 38  ? 9.444   7.909   -2.293  1.00 0.00 ? 38  LYS A CA   2  
ATOM 2685  C C    . LYS A 1 38  ? 8.986   9.285   -2.779  1.00 0.00 ? 38  LYS A C    2  
ATOM 2686  O O    . LYS A 1 38  ? 7.842   9.677   -2.554  1.00 0.00 ? 38  LYS A O    2  
ATOM 2687  C CB   . LYS A 1 38  ? 9.215   6.789   -3.311  1.00 0.00 ? 38  LYS A CB   2  
ATOM 2688  C CG   . LYS A 1 38  ? 10.453  6.582   -4.186  1.00 0.00 ? 38  LYS A CG   2  
ATOM 2689  C CD   . LYS A 1 38  ? 10.181  5.555   -5.286  1.00 0.00 ? 38  LYS A CD   2  
ATOM 2690  C CE   . LYS A 1 38  ? 11.482  5.122   -5.966  1.00 0.00 ? 38  LYS A CE   2  
ATOM 2691  N NZ   . LYS A 1 38  ? 11.372  5.266   -7.435  1.00 0.00 ? 38  LYS A NZ   2  
ATOM 2692  H H    . LYS A 1 38  ? 7.879   8.010   -0.922  1.00 0.00 ? 38  LYS A H    2  
ATOM 2693  H HA   . LYS A 1 38  ? 10.515  7.951   -2.096  1.00 0.00 ? 38  LYS A HA   2  
ATOM 2694  H HB2  . LYS A 1 38  ? 8.975   5.862   -2.790  1.00 0.00 ? 38  LYS A HB2  2  
ATOM 2695  H HB3  . LYS A 1 38  ? 8.359   7.033   -3.938  1.00 0.00 ? 38  LYS A HB3  2  
ATOM 2696  H HG2  . LYS A 1 38  ? 10.749  7.531   -4.634  1.00 0.00 ? 38  LYS A HG2  2  
ATOM 2697  H HG3  . LYS A 1 38  ? 11.287  6.248   -3.569  1.00 0.00 ? 38  LYS A HG3  2  
ATOM 2698  H HD2  . LYS A 1 38  ? 9.682   4.684   -4.861  1.00 0.00 ? 38  LYS A HD2  2  
ATOM 2699  H HD3  . LYS A 1 38  ? 9.504   5.980   -6.027  1.00 0.00 ? 38  LYS A HD3  2  
ATOM 2700  H HE2  . LYS A 1 38  ? 12.311  5.726   -5.597  1.00 0.00 ? 38  LYS A HE2  2  
ATOM 2701  H HE3  . LYS A 1 38  ? 11.705  4.086   -5.712  1.00 0.00 ? 38  LYS A HE3  2  
ATOM 2702  H HZ1  . LYS A 1 38  ? 11.847  4.508   -7.881  1.00 0.00 ? 38  LYS A HZ1  2  
ATOM 2703  H HZ2  . LYS A 1 38  ? 10.407  5.257   -7.699  1.00 0.00 ? 38  LYS A HZ2  2  
ATOM 2704  H HZ3  . LYS A 1 38  ? 11.786  6.132   -7.717  1.00 0.00 ? 38  LYS A HZ3  2  
ATOM 2705  N N    . GLY A 1 39  ? 9.902   9.981   -3.436  1.00 0.00 ? 39  GLY A N    2  
ATOM 2706  C CA   . GLY A 1 39  ? 9.606   11.305  -3.956  1.00 0.00 ? 39  GLY A CA   2  
ATOM 2707  C C    . GLY A 1 39  ? 8.844   12.140  -2.926  1.00 0.00 ? 39  GLY A C    2  
ATOM 2708  O O    . GLY A 1 39  ? 7.895   12.843  -3.270  1.00 0.00 ? 39  GLY A O    2  
ATOM 2709  H H    . GLY A 1 39  ? 10.830  9.654   -3.615  1.00 0.00 ? 39  GLY A H    2  
ATOM 2710  H HA2  . GLY A 1 39  ? 10.534  11.810  -4.224  1.00 0.00 ? 39  GLY A HA2  2  
ATOM 2711  H HA3  . GLY A 1 39  ? 9.015   11.218  -4.868  1.00 0.00 ? 39  GLY A HA3  2  
ATOM 2712  N N    . GLY A 1 40  ? 9.287   12.036  -1.682  1.00 0.00 ? 40  GLY A N    2  
ATOM 2713  C CA   . GLY A 1 40  ? 8.659   12.774  -0.599  1.00 0.00 ? 40  GLY A CA   2  
ATOM 2714  C C    . GLY A 1 40  ? 7.180   12.405  -0.470  1.00 0.00 ? 40  GLY A C    2  
ATOM 2715  O O    . GLY A 1 40  ? 6.357   13.241  -0.099  1.00 0.00 ? 40  GLY A O    2  
ATOM 2716  H H    . GLY A 1 40  ? 10.060  11.462  -1.410  1.00 0.00 ? 40  GLY A H    2  
ATOM 2717  H HA2  . GLY A 1 40  ? 9.173   12.560  0.338   1.00 0.00 ? 40  GLY A HA2  2  
ATOM 2718  H HA3  . GLY A 1 40  ? 8.756   13.844  -0.779  1.00 0.00 ? 40  GLY A HA3  2  
ATOM 2719  N N    . LYS A 1 41  ? 6.886   11.151  -0.784  1.00 0.00 ? 41  LYS A N    2  
ATOM 2720  C CA   . LYS A 1 41  ? 5.520   10.661  -0.708  1.00 0.00 ? 41  LYS A CA   2  
ATOM 2721  C C    . LYS A 1 41  ? 5.489   9.378   0.123   1.00 0.00 ? 41  LYS A C    2  
ATOM 2722  O O    . LYS A 1 41  ? 6.514   8.721   0.297   1.00 0.00 ? 41  LYS A O    2  
ATOM 2723  C CB   . LYS A 1 41  ? 4.930   10.500  -2.111  1.00 0.00 ? 41  LYS A CB   2  
ATOM 2724  C CG   . LYS A 1 41  ? 4.420   11.839  -2.649  1.00 0.00 ? 41  LYS A CG   2  
ATOM 2725  C CD   . LYS A 1 41  ? 2.960   12.068  -2.253  1.00 0.00 ? 41  LYS A CD   2  
ATOM 2726  C CE   . LYS A 1 41  ? 2.017   11.707  -3.402  1.00 0.00 ? 41  LYS A CE   2  
ATOM 2727  N NZ   . LYS A 1 41  ? 0.758   12.478  -3.301  1.00 0.00 ? 41  LYS A NZ   2  
ATOM 2728  H H    . LYS A 1 41  ? 7.561   10.477  -1.085  1.00 0.00 ? 41  LYS A H    2  
ATOM 2729  H HA   . LYS A 1 41  ? 4.929   11.420  -0.195  1.00 0.00 ? 41  LYS A HA   2  
ATOM 2730  H HB2  . LYS A 1 41  ? 5.687   10.098  -2.784  1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2731  H HB3  . LYS A 1 41  ? 4.113   9.779   -2.085  1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2732  H HG2  . LYS A 1 41  ? 5.038   12.649  -2.261  1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2733  H HG3  . LYS A 1 41  ? 4.514   11.858  -3.734  1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2734  H HD2  . LYS A 1 41  ? 2.718   11.467  -1.376  1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2735  H HD3  . LYS A 1 41  ? 2.815   13.112  -1.973  1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2736  H HE2  . LYS A 1 41  ? 2.502   11.913  -4.357  1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2737  H HE3  . LYS A 1 41  ? 1.800   10.639  -3.380  1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2738  H HZ1  . LYS A 1 41  ? 0.880   13.233  -2.657  1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2739  H HZ2  . LYS A 1 41  ? 0.518   12.843  -4.201  1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2740  H HZ3  . LYS A 1 41  ? 0.025   11.879  -2.978  1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2741  N N    . VAL A 1 42  ? 4.301   9.058   0.616   1.00 0.00 ? 42  VAL A N    2  
ATOM 2742  C CA   . VAL A 1 42  ? 4.123   7.865   1.425   1.00 0.00 ? 42  VAL A CA   2  
ATOM 2743  C C    . VAL A 1 42  ? 3.316   6.833   0.634   1.00 0.00 ? 42  VAL A C    2  
ATOM 2744  O O    . VAL A 1 42  ? 2.365   7.185   -0.062  1.00 0.00 ? 42  VAL A O    2  
ATOM 2745  C CB   . VAL A 1 42  ? 3.476   8.231   2.762   1.00 0.00 ? 42  VAL A CB   2  
ATOM 2746  C CG1  . VAL A 1 42  ? 3.008   6.979   3.507   1.00 0.00 ? 42  VAL A CG1  2  
ATOM 2747  C CG2  . VAL A 1 42  ? 4.431   9.057   3.626   1.00 0.00 ? 42  VAL A CG2  2  
ATOM 2748  H H    . VAL A 1 42  ? 3.472   9.598   0.470   1.00 0.00 ? 42  VAL A H    2  
ATOM 2749  H HA   . VAL A 1 42  ? 5.112   7.455   1.630   1.00 0.00 ? 42  VAL A HA   2  
ATOM 2750  H HB   . VAL A 1 42  ? 2.599   8.844   2.554   1.00 0.00 ? 42  VAL A HB   2  
ATOM 2751  H HG11 . VAL A 1 42  ? 2.898   6.156   2.800   1.00 0.00 ? 42  VAL A HG11 2  
ATOM 2752  H HG12 . VAL A 1 42  ? 3.744   6.710   4.264   1.00 0.00 ? 42  VAL A HG12 2  
ATOM 2753  H HG13 . VAL A 1 42  ? 2.049   7.177   3.985   1.00 0.00 ? 42  VAL A HG13 2  
ATOM 2754  H HG21 . VAL A 1 42  ? 4.053   10.076  3.714   1.00 0.00 ? 42  VAL A HG21 2  
ATOM 2755  H HG22 . VAL A 1 42  ? 4.504   8.610   4.617   1.00 0.00 ? 42  VAL A HG22 2  
ATOM 2756  H HG23 . VAL A 1 42  ? 5.418   9.074   3.162   1.00 0.00 ? 42  VAL A HG23 2  
ATOM 2757  N N    . PHE A 1 43  ? 3.726   5.580   0.767   1.00 0.00 ? 43  PHE A N    2  
ATOM 2758  C CA   . PHE A 1 43  ? 3.054   4.495   0.073   1.00 0.00 ? 43  PHE A CA   2  
ATOM 2759  C C    . PHE A 1 43  ? 1.900   3.940   0.911   1.00 0.00 ? 43  PHE A C    2  
ATOM 2760  O O    . PHE A 1 43  ? 1.788   2.730   1.097   1.00 0.00 ? 43  PHE A O    2  
ATOM 2761  C CB   . PHE A 1 43  ? 4.090   3.390   -0.140  1.00 0.00 ? 43  PHE A CB   2  
ATOM 2762  C CG   . PHE A 1 43  ? 4.998   3.613   -1.351  1.00 0.00 ? 43  PHE A CG   2  
ATOM 2763  C CD1  . PHE A 1 43  ? 5.635   4.803   -1.514  1.00 0.00 ? 43  PHE A CD1  2  
ATOM 2764  C CD2  . PHE A 1 43  ? 5.166   2.621   -2.266  1.00 0.00 ? 43  PHE A CD2  2  
ATOM 2765  C CE1  . PHE A 1 43  ? 6.477   5.010   -2.638  1.00 0.00 ? 43  PHE A CE1  2  
ATOM 2766  C CE2  . PHE A 1 43  ? 6.008   2.828   -3.391  1.00 0.00 ? 43  PHE A CE2  2  
ATOM 2767  C CZ   . PHE A 1 43  ? 6.646   4.018   -3.553  1.00 0.00 ? 43  PHE A CZ   2  
ATOM 2768  H H    . PHE A 1 43  ? 4.501   5.303   1.335   1.00 0.00 ? 43  PHE A H    2  
ATOM 2769  H HA   . PHE A 1 43  ? 2.662   4.901   -0.859  1.00 0.00 ? 43  PHE A HA   2  
ATOM 2770  H HB2  . PHE A 1 43  ? 4.709   3.309   0.754   1.00 0.00 ? 43  PHE A HB2  2  
ATOM 2771  H HB3  . PHE A 1 43  ? 3.573   2.438   -0.257  1.00 0.00 ? 43  PHE A HB3  2  
ATOM 2772  H HD1  . PHE A 1 43  ? 5.500   5.598   -0.780  1.00 0.00 ? 43  PHE A HD1  2  
ATOM 2773  H HD2  . PHE A 1 43  ? 4.655   1.667   -2.137  1.00 0.00 ? 43  PHE A HD2  2  
ATOM 2774  H HE1  . PHE A 1 43  ? 6.988   5.964   -2.768  1.00 0.00 ? 43  PHE A HE1  2  
ATOM 2775  H HE2  . PHE A 1 43  ? 6.143   2.033   -4.124  1.00 0.00 ? 43  PHE A HE2  2  
ATOM 2776  H HZ   . PHE A 1 43  ? 7.292   4.177   -4.417  1.00 0.00 ? 43  PHE A HZ   2  
ATOM 2777  N N    . SER A 1 44  ? 1.069   4.853   1.394   1.00 0.00 ? 44  SER A N    2  
ATOM 2778  C CA   . SER A 1 44  ? -0.072  4.471   2.207   1.00 0.00 ? 44  SER A CA   2  
ATOM 2779  C C    . SER A 1 44  ? -1.332  5.182   1.708   1.00 0.00 ? 44  SER A C    2  
ATOM 2780  O O    . SER A 1 44  ? -1.579  6.334   2.061   1.00 0.00 ? 44  SER A O    2  
ATOM 2781  C CB   . SER A 1 44  ? 0.170   4.793   3.683   1.00 0.00 ? 44  SER A CB   2  
ATOM 2782  O OG   . SER A 1 44  ? -1.046  4.842   4.425   1.00 0.00 ? 44  SER A OG   2  
ATOM 2783  H H    . SER A 1 44  ? 1.167   5.836   1.238   1.00 0.00 ? 44  SER A H    2  
ATOM 2784  H HA   . SER A 1 44  ? -0.167  3.392   2.082   1.00 0.00 ? 44  SER A HA   2  
ATOM 2785  H HB2  . SER A 1 44  ? 0.828   4.039   4.115   1.00 0.00 ? 44  SER A HB2  2  
ATOM 2786  H HB3  . SER A 1 44  ? 0.684   5.750   3.765   1.00 0.00 ? 44  SER A HB3  2  
ATOM 2787  H HG   . SER A 1 44  ? -1.381  5.783   4.469   1.00 0.00 ? 44  SER A HG   2  
ATOM 2788  N N    . ALA A 1 45  ? -2.095  4.466   0.896   1.00 0.00 ? 45  ALA A N    2  
ATOM 2789  C CA   . ALA A 1 45  ? -3.323  5.014   0.345   1.00 0.00 ? 45  ALA A CA   2  
ATOM 2790  C C    . ALA A 1 45  ? -4.513  4.197   0.852   1.00 0.00 ? 45  ALA A C    2  
ATOM 2791  O O    . ALA A 1 45  ? -4.444  2.971   0.923   1.00 0.00 ? 45  ALA A O    2  
ATOM 2792  C CB   . ALA A 1 45  ? -3.235  5.031   -1.182  1.00 0.00 ? 45  ALA A CB   2  
ATOM 2793  H H    . ALA A 1 45  ? -1.887  3.529   0.614   1.00 0.00 ? 45  ALA A H    2  
ATOM 2794  H HA   . ALA A 1 45  ? -3.418  6.040   0.702   1.00 0.00 ? 45  ALA A HA   2  
ATOM 2795  H HB1  . ALA A 1 45  ? -2.220  5.289   -1.485  1.00 0.00 ? 45  ALA A HB1  2  
ATOM 2796  H HB2  . ALA A 1 45  ? -3.491  4.045   -1.572  1.00 0.00 ? 45  ALA A HB2  2  
ATOM 2797  H HB3  . ALA A 1 45  ? -3.931  5.770   -1.578  1.00 0.00 ? 45  ALA A HB3  2  
ATOM 2798  N N    . THR A 1 46  ? -5.578  4.910   1.190   1.00 0.00 ? 46  THR A N    2  
ATOM 2799  C CA   . THR A 1 46  ? -6.782  4.267   1.688   1.00 0.00 ? 46  THR A CA   2  
ATOM 2800  C C    . THR A 1 46  ? -7.926  4.428   0.685   1.00 0.00 ? 46  THR A C    2  
ATOM 2801  O O    . THR A 1 46  ? -8.328  5.547   0.371   1.00 0.00 ? 46  THR A O    2  
ATOM 2802  C CB   . THR A 1 46  ? -7.095  4.851   3.067   1.00 0.00 ? 46  THR A CB   2  
ATOM 2803  O OG1  . THR A 1 46  ? -5.997  4.439   3.876   1.00 0.00 ? 46  THR A OG1  2  
ATOM 2804  C CG2  . THR A 1 46  ? -8.309  4.190   3.721   1.00 0.00 ? 46  THR A CG2  2  
ATOM 2805  H H    . THR A 1 46  ? -5.626  5.907   1.129   1.00 0.00 ? 46  THR A H    2  
ATOM 2806  H HA   . THR A 1 46  ? -6.587  3.198   1.781   1.00 0.00 ? 46  THR A HA   2  
ATOM 2807  H HB   . THR A 1 46  ? -7.223  5.932   3.011   1.00 0.00 ? 46  THR A HB   2  
ATOM 2808  H HG1  . THR A 1 46  ? -6.076  4.839   4.789   1.00 0.00 ? 46  THR A HG1  2  
ATOM 2809  H HG21 . THR A 1 46  ? -9.156  4.227   3.036   1.00 0.00 ? 46  THR A HG21 2  
ATOM 2810  H HG22 . THR A 1 46  ? -8.075  3.151   3.954   1.00 0.00 ? 46  THR A HG22 2  
ATOM 2811  H HG23 . THR A 1 46  ? -8.561  4.721   4.639   1.00 0.00 ? 46  THR A HG23 2  
ATOM 2812  N N    . LEU A 1 47  ? -8.418  3.293   0.211   1.00 0.00 ? 47  LEU A N    2  
ATOM 2813  C CA   . LEU A 1 47  ? -9.509  3.294   -0.750  1.00 0.00 ? 47  LEU A CA   2  
ATOM 2814  C C    . LEU A 1 47  ? -10.780 2.780   -0.072  1.00 0.00 ? 47  LEU A C    2  
ATOM 2815  O O    . LEU A 1 47  ? -10.722 2.219   1.021   1.00 0.00 ? 47  LEU A O    2  
ATOM 2816  C CB   . LEU A 1 47  ? -9.119  2.508   -2.004  1.00 0.00 ? 47  LEU A CB   2  
ATOM 2817  C CG   . LEU A 1 47  ? -7.788  2.897   -2.652  1.00 0.00 ? 47  LEU A CG   2  
ATOM 2818  C CD1  . LEU A 1 47  ? -7.413  1.915   -3.764  1.00 0.00 ? 47  LEU A CD1  2  
ATOM 2819  C CD2  . LEU A 1 47  ? -7.823  4.342   -3.151  1.00 0.00 ? 47  LEU A CD2  2  
ATOM 2820  H H    . LEU A 1 47  ? -8.086  2.387   0.471   1.00 0.00 ? 47  LEU A H    2  
ATOM 2821  H HA   . LEU A 1 47  ? -9.674  4.327   -1.055  1.00 0.00 ? 47  LEU A HA   2  
ATOM 2822  H HB2  . LEU A 1 47  ? -9.080  1.450   -1.747  1.00 0.00 ? 47  LEU A HB2  2  
ATOM 2823  H HB3  . LEU A 1 47  ? -9.910  2.629   -2.744  1.00 0.00 ? 47  LEU A HB3  2  
ATOM 2824  H HG   . LEU A 1 47  ? -7.008  2.836   -1.893  1.00 0.00 ? 47  LEU A HG   2  
ATOM 2825  H HD11 . LEU A 1 47  ? -6.811  2.428   -4.514  1.00 0.00 ? 47  LEU A HD11 2  
ATOM 2826  H HD12 . LEU A 1 47  ? -6.841  1.089   -3.342  1.00 0.00 ? 47  LEU A HD12 2  
ATOM 2827  H HD13 . LEU A 1 47  ? -8.321  1.529   -4.229  1.00 0.00 ? 47  LEU A HD13 2  
ATOM 2828  H HD21 . LEU A 1 47  ? -7.203  4.964   -2.505  1.00 0.00 ? 47  LEU A HD21 2  
ATOM 2829  H HD22 . LEU A 1 47  ? -7.441  4.384   -4.171  1.00 0.00 ? 47  LEU A HD22 2  
ATOM 2830  H HD23 . LEU A 1 47  ? -8.849  4.709   -3.132  1.00 0.00 ? 47  LEU A HD23 2  
ATOM 2831  N N    . GLY A 1 48  ? -11.900 2.989   -0.750  1.00 0.00 ? 48  GLY A N    2  
ATOM 2832  C CA   . GLY A 1 48  ? -13.183 2.554   -0.226  1.00 0.00 ? 48  GLY A CA   2  
ATOM 2833  C C    . GLY A 1 48  ? -14.188 2.327   -1.358  1.00 0.00 ? 48  GLY A C    2  
ATOM 2834  O O    . GLY A 1 48  ? -14.395 3.205   -2.194  1.00 0.00 ? 48  GLY A O    2  
ATOM 2835  H H    . GLY A 1 48  ? -11.938 3.446   -1.638  1.00 0.00 ? 48  GLY A H    2  
ATOM 2836  H HA2  . GLY A 1 48  ? -13.055 1.632   0.341   1.00 0.00 ? 48  GLY A HA2  2  
ATOM 2837  H HA3  . GLY A 1 48  ? -13.571 3.302   0.465   1.00 0.00 ? 48  GLY A HA3  2  
ATOM 2838  N N    . LEU A 1 49  ? -14.785 1.144   -1.348  1.00 0.00 ? 49  LEU A N    2  
ATOM 2839  C CA   . LEU A 1 49  ? -15.763 0.791   -2.363  1.00 0.00 ? 49  LEU A CA   2  
ATOM 2840  C C    . LEU A 1 49  ? -17.041 0.295   -1.683  1.00 0.00 ? 49  LEU A C    2  
ATOM 2841  O O    . LEU A 1 49  ? -16.979 -0.397  -0.667  1.00 0.00 ? 49  LEU A O    2  
ATOM 2842  C CB   . LEU A 1 49  ? -15.167 -0.209  -3.356  1.00 0.00 ? 49  LEU A CB   2  
ATOM 2843  C CG   . LEU A 1 49  ? -15.843 -0.277  -4.727  1.00 0.00 ? 49  LEU A CG   2  
ATOM 2844  C CD1  . LEU A 1 49  ? -17.002 -1.275  -4.717  1.00 0.00 ? 49  LEU A CD1  2  
ATOM 2845  C CD2  . LEU A 1 49  ? -16.288 1.113   -5.188  1.00 0.00 ? 49  LEU A CD2  2  
ATOM 2846  H H    . LEU A 1 49  ? -14.611 0.436   -0.664  1.00 0.00 ? 49  LEU A H    2  
ATOM 2847  H HA   . LEU A 1 49  ? -15.998 1.698   -2.920  1.00 0.00 ? 49  LEU A HA   2  
ATOM 2848  H HB2  . LEU A 1 49  ? -14.116 0.039   -3.504  1.00 0.00 ? 49  LEU A HB2  2  
ATOM 2849  H HB3  . LEU A 1 49  ? -15.201 -1.201  -2.907  1.00 0.00 ? 49  LEU A HB3  2  
ATOM 2850  H HG   . LEU A 1 49  ? -15.113 -0.638  -5.451  1.00 0.00 ? 49  LEU A HG   2  
ATOM 2851  H HD11 . LEU A 1 49  ? -16.636 -2.254  -4.407  1.00 0.00 ? 49  LEU A HD11 2  
ATOM 2852  H HD12 . LEU A 1 49  ? -17.768 -0.936  -4.020  1.00 0.00 ? 49  LEU A HD12 2  
ATOM 2853  H HD13 . LEU A 1 49  ? -17.428 -1.347  -5.718  1.00 0.00 ? 49  LEU A HD13 2  
ATOM 2854  H HD21 . LEU A 1 49  ? -16.350 1.132   -6.276  1.00 0.00 ? 49  LEU A HD21 2  
ATOM 2855  H HD22 . LEU A 1 49  ? -17.266 1.341   -4.764  1.00 0.00 ? 49  LEU A HD22 2  
ATOM 2856  H HD23 . LEU A 1 49  ? -15.564 1.856   -4.853  1.00 0.00 ? 49  LEU A HD23 2  
ATOM 2857  N N    . VAL A 1 50  ? -18.168 0.667   -2.271  1.00 0.00 ? 50  VAL A N    2  
ATOM 2858  C CA   . VAL A 1 50  ? -19.459 0.268   -1.734  1.00 0.00 ? 50  VAL A CA   2  
ATOM 2859  C C    . VAL A 1 50  ? -20.371 -0.168  -2.883  1.00 0.00 ? 50  VAL A C    2  
ATOM 2860  O O    . VAL A 1 50  ? -20.548 0.567   -3.853  1.00 0.00 ? 50  VAL A O    2  
ATOM 2861  C CB   . VAL A 1 50  ? -20.052 1.404   -0.899  1.00 0.00 ? 50  VAL A CB   2  
ATOM 2862  C CG1  . VAL A 1 50  ? -21.468 1.060   -0.432  1.00 0.00 ? 50  VAL A CG1  2  
ATOM 2863  C CG2  . VAL A 1 50  ? -19.149 1.740   0.290   1.00 0.00 ? 50  VAL A CG2  2  
ATOM 2864  H H    . VAL A 1 50  ? -18.209 1.229   -3.096  1.00 0.00 ? 50  VAL A H    2  
ATOM 2865  H HA   . VAL A 1 50  ? -19.292 -0.584  -1.075  1.00 0.00 ? 50  VAL A HA   2  
ATOM 2866  H HB   . VAL A 1 50  ? -20.114 2.289   -1.532  1.00 0.00 ? 50  VAL A HB   2  
ATOM 2867  H HG11 . VAL A 1 50  ? -21.938 0.397   -1.158  1.00 0.00 ? 50  VAL A HG11 2  
ATOM 2868  H HG12 . VAL A 1 50  ? -21.420 0.563   0.537   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 2869  H HG13 . VAL A 1 50  ? -22.053 1.975   -0.343  1.00 0.00 ? 50  VAL A HG13 2  
ATOM 2870  H HG21 . VAL A 1 50  ? -18.377 2.442   -0.027  1.00 0.00 ? 50  VAL A HG21 2  
ATOM 2871  H HG22 . VAL A 1 50  ? -19.745 2.190   1.084   1.00 0.00 ? 50  VAL A HG22 2  
ATOM 2872  H HG23 . VAL A 1 50  ? -18.681 0.828   0.660   1.00 0.00 ? 50  VAL A HG23 2  
ATOM 2873  N N    . ASP A 1 51  ? -20.924 -1.363  -2.735  1.00 0.00 ? 51  ASP A N    2  
ATOM 2874  C CA   . ASP A 1 51  ? -21.814 -1.906  -3.747  1.00 0.00 ? 51  ASP A CA   2  
ATOM 2875  C C    . ASP A 1 51  ? -23.241 -1.425  -3.478  1.00 0.00 ? 51  ASP A C    2  
ATOM 2876  O O    . ASP A 1 51  ? -23.817 -1.734  -2.436  1.00 0.00 ? 51  ASP A O    2  
ATOM 2877  C CB   . ASP A 1 51  ? -21.816 -3.436  -3.715  1.00 0.00 ? 51  ASP A CB   2  
ATOM 2878  C CG   . ASP A 1 51  ? -21.342 -4.110  -5.004  1.00 0.00 ? 51  ASP A CG   2  
ATOM 2879  O OD1  . ASP A 1 51  ? -21.305 -3.404  -6.034  1.00 0.00 ? 51  ASP A OD1  2  
ATOM 2880  O OD2  . ASP A 1 51  ? -21.028 -5.318  -4.929  1.00 0.00 ? 51  ASP A OD2  2  
ATOM 2881  H H    . ASP A 1 51  ? -20.775 -1.955  -1.943  1.00 0.00 ? 51  ASP A H    2  
ATOM 2882  H HA   . ASP A 1 51  ? -21.423 -1.541  -4.697  1.00 0.00 ? 51  ASP A HA   2  
ATOM 2883  H HB2  . ASP A 1 51  ? -21.181 -3.768  -2.894  1.00 0.00 ? 51  ASP A HB2  2  
ATOM 2884  H HB3  . ASP A 1 51  ? -22.827 -3.778  -3.494  1.00 0.00 ? 51  ASP A HB3  2  
ATOM 2885  N N    . ILE A 1 52  ? -23.770 -0.677  -4.435  1.00 0.00 ? 52  ILE A N    2  
ATOM 2886  C CA   . ILE A 1 52  ? -25.119 -0.150  -4.314  1.00 0.00 ? 52  ILE A CA   2  
ATOM 2887  C C    . ILE A 1 52  ? -26.121 -1.227  -4.733  1.00 0.00 ? 52  ILE A C    2  
ATOM 2888  O O    . ILE A 1 52  ? -27.229 -1.290  -4.201  1.00 0.00 ? 52  ILE A O    2  
ATOM 2889  C CB   . ILE A 1 52  ? -25.256 1.156   -5.098  1.00 0.00 ? 52  ILE A CB   2  
ATOM 2890  C CG1  . ILE A 1 52  ? -26.691 1.683   -5.038  1.00 0.00 ? 52  ILE A CG1  2  
ATOM 2891  C CG2  . ILE A 1 52  ? -24.768 0.986   -6.538  1.00 0.00 ? 52  ILE A CG2  2  
ATOM 2892  C CD1  . ILE A 1 52  ? -26.710 3.202   -4.853  1.00 0.00 ? 52  ILE A CD1  2  
ATOM 2893  H H    . ILE A 1 52  ? -23.294 -0.430  -5.279  1.00 0.00 ? 52  ILE A H    2  
ATOM 2894  H HA   . ILE A 1 52  ? -25.284 0.086   -3.263  1.00 0.00 ? 52  ILE A HA   2  
ATOM 2895  H HB   . ILE A 1 52  ? -24.618 1.905   -4.628  1.00 0.00 ? 52  ILE A HB   2  
ATOM 2896  H HG12 . ILE A 1 52  ? -27.218 1.419   -5.955  1.00 0.00 ? 52  ILE A HG12 2  
ATOM 2897  H HG13 . ILE A 1 52  ? -27.224 1.206   -4.216  1.00 0.00 ? 52  ILE A HG13 2  
ATOM 2898  H HG21 . ILE A 1 52  ? -23.825 1.518   -6.667  1.00 0.00 ? 52  ILE A HG21 2  
ATOM 2899  H HG22 . ILE A 1 52  ? -24.618 -0.074  -6.748  1.00 0.00 ? 52  ILE A HG22 2  
ATOM 2900  H HG23 . ILE A 1 52  ? -25.511 1.390   -7.224  1.00 0.00 ? 52  ILE A HG23 2  
ATOM 2901  H HD11 . ILE A 1 52  ? -27.102 3.442   -3.864  1.00 0.00 ? 52  ILE A HD11 2  
ATOM 2902  H HD12 . ILE A 1 52  ? -25.697 3.592   -4.947  1.00 0.00 ? 52  ILE A HD12 2  
ATOM 2903  H HD13 . ILE A 1 52  ? -27.346 3.653   -5.614  1.00 0.00 ? 52  ILE A HD13 2  
ATOM 2904  N N    . VAL A 1 53  ? -25.697 -2.048  -5.682  1.00 0.00 ? 53  VAL A N    2  
ATOM 2905  C CA   . VAL A 1 53  ? -26.545 -3.119  -6.179  1.00 0.00 ? 53  VAL A CA   2  
ATOM 2906  C C    . VAL A 1 53  ? -26.550 -4.269  -5.169  1.00 0.00 ? 53  VAL A C    2  
ATOM 2907  O O    . VAL A 1 53  ? -27.612 -4.710  -4.732  1.00 0.00 ? 53  VAL A O    2  
ATOM 2908  C CB   . VAL A 1 53  ? -26.081 -3.550  -7.572  1.00 0.00 ? 53  VAL A CB   2  
ATOM 2909  C CG1  . VAL A 1 53  ? -26.085 -2.366  -8.541  1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2910  C CG2  . VAL A 1 53  ? -24.700 -4.205  -7.512  1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2911  H H    . VAL A 1 53  ? -24.795 -1.990  -6.110  1.00 0.00 ? 53  VAL A H    2  
ATOM 2912  H HA   . VAL A 1 53  ? -27.557 -2.724  -6.267  1.00 0.00 ? 53  VAL A HA   2  
ATOM 2913  H HB   . VAL A 1 53  ? -26.788 -4.291  -7.946  1.00 0.00 ? 53  VAL A HB   2  
ATOM 2914  H HG11 . VAL A 1 53  ? -26.811 -2.548  -9.334  1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2915  H HG12 . VAL A 1 53  ? -26.354 -1.457  -8.004  1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2916  H HG13 . VAL A 1 53  ? -25.093 -2.250  -8.977  1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2917  H HG21 . VAL A 1 53  ? -24.778 -5.173  -7.017  1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2918  H HG22 . VAL A 1 53  ? -24.320 -4.345  -8.524  1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2919  H HG23 . VAL A 1 53  ? -24.018 -3.565  -6.953  1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2920  N N    . LYS A 1 54  ? -25.353 -4.720  -4.828  1.00 0.00 ? 54  LYS A N    2  
ATOM 2921  C CA   . LYS A 1 54  ? -25.206 -5.810  -3.877  1.00 0.00 ? 54  LYS A CA   2  
ATOM 2922  C C    . LYS A 1 54  ? -25.491 -5.292  -2.466  1.00 0.00 ? 54  LYS A C    2  
ATOM 2923  O O    . LYS A 1 54  ? -25.641 -6.077  -1.531  1.00 0.00 ? 54  LYS A O    2  
ATOM 2924  C CB   . LYS A 1 54  ? -23.833 -6.469  -4.025  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2925  C CG   . LYS A 1 54  ? -23.826 -7.466  -5.186  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2926  C CD   . LYS A 1 54  ? -24.486 -8.785  -4.780  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2927  C CE   . LYS A 1 54  ? -23.806 -9.972  -5.464  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2928  N NZ   . LYS A 1 54  ? -24.780 -11.058 -5.708  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2929  H H    . LYS A 1 54  ? -24.494 -4.356  -5.188  1.00 0.00 ? 54  LYS A H    2  
ATOM 2930  H HA   . LYS A 1 54  ? -25.954 -6.563  -4.126  1.00 0.00 ? 54  LYS A HA   2  
ATOM 2931  H HB2  . LYS A 1 54  ? -23.075 -5.705  -4.192  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2932  H HB3  . LYS A 1 54  ? -23.571 -6.981  -3.099  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2933  H HG2  . LYS A 1 54  ? -24.352 -7.039  -6.040  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2934  H HG3  . LYS A 1 54  ? -22.800 -7.651  -5.504  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2935  H HD2  . LYS A 1 54  ? -24.433 -8.905  -3.698  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2936  H HD3  . LYS A 1 54  ? -25.543 -8.764  -5.047  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2937  H HE2  . LYS A 1 54  ? -23.365 -9.652  -6.408  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2938  H HE3  . LYS A 1 54  ? -22.990 -10.340 -4.841  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2939  H HZ1  . LYS A 1 54  ? -24.299 -11.872 -6.035  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2940  H HZ2  . LYS A 1 54  ? -25.259 -11.274 -4.857  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2941  H HZ3  . LYS A 1 54  ? -25.442 -10.764 -6.398  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2942  N N    . GLY A 1 55  ? -25.557 -3.973  -2.357  1.00 0.00 ? 55  GLY A N    2  
ATOM 2943  C CA   . GLY A 1 55  ? -25.822 -3.341  -1.075  1.00 0.00 ? 55  GLY A CA   2  
ATOM 2944  C C    . GLY A 1 55  ? -24.777 -3.751  -0.036  1.00 0.00 ? 55  GLY A C    2  
ATOM 2945  O O    . GLY A 1 55  ? -25.108 -3.978  1.127   1.00 0.00 ? 55  GLY A O    2  
ATOM 2946  H H    . GLY A 1 55  ? -25.435 -3.341  -3.122  1.00 0.00 ? 55  GLY A H    2  
ATOM 2947  H HA2  . GLY A 1 55  ? -25.818 -2.257  -1.193  1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2948  H HA3  . GLY A 1 55  ? -26.816 -3.620  -0.726  1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2949  N N    . THR A 1 56  ? -23.535 -3.833  -0.492  1.00 0.00 ? 56  THR A N    2  
ATOM 2950  C CA   . THR A 1 56  ? -22.440 -4.211  0.384   1.00 0.00 ? 56  THR A CA   2  
ATOM 2951  C C    . THR A 1 56  ? -21.409 -3.083  0.466   1.00 0.00 ? 56  THR A C    2  
ATOM 2952  O O    . THR A 1 56  ? -21.333 -2.241  -0.426  1.00 0.00 ? 56  THR A O    2  
ATOM 2953  C CB   . THR A 1 56  ? -21.858 -5.530  -0.129  1.00 0.00 ? 56  THR A CB   2  
ATOM 2954  O OG1  . THR A 1 56  ? -21.848 -5.377  -1.546  1.00 0.00 ? 56  THR A OG1  2  
ATOM 2955  C CG2  . THR A 1 56  ? -22.794 -6.716  0.111   1.00 0.00 ? 56  THR A CG2  2  
ATOM 2956  H H    . THR A 1 56  ? -23.274 -3.646  -1.439  1.00 0.00 ? 56  THR A H    2  
ATOM 2957  H HA   . THR A 1 56  ? -22.837 -4.355  1.389   1.00 0.00 ? 56  THR A HA   2  
ATOM 2958  H HB   . THR A 1 56  ? -20.875 -5.716  0.303   1.00 0.00 ? 56  THR A HB   2  
ATOM 2959  H HG1  . THR A 1 56  ? -22.778 -5.448  -1.904  1.00 0.00 ? 56  THR A HG1  2  
ATOM 2960  H HG21 . THR A 1 56  ? -23.787 -6.348  0.372   1.00 0.00 ? 56  THR A HG21 2  
ATOM 2961  H HG22 . THR A 1 56  ? -22.857 -7.318  -0.796  1.00 0.00 ? 56  THR A HG22 2  
ATOM 2962  H HG23 . THR A 1 56  ? -22.406 -7.326  0.926   1.00 0.00 ? 56  THR A HG23 2  
ATOM 2963  N N    . ASN A 1 57  ? -20.642 -3.104  1.546   1.00 0.00 ? 57  ASN A N    2  
ATOM 2964  C CA   . ASN A 1 57  ? -19.619 -2.094  1.757   1.00 0.00 ? 57  ASN A CA   2  
ATOM 2965  C C    . ASN A 1 57  ? -18.244 -2.765  1.785   1.00 0.00 ? 57  ASN A C    2  
ATOM 2966  O O    . ASN A 1 57  ? -18.070 -3.807  2.414   1.00 0.00 ? 57  ASN A O    2  
ATOM 2967  C CB   . ASN A 1 57  ? -19.821 -1.375  3.093   1.00 0.00 ? 57  ASN A CB   2  
ATOM 2968  C CG   . ASN A 1 57  ? -21.057 -0.475  3.049   1.00 0.00 ? 57  ASN A CG   2  
ATOM 2969  O OD1  . ASN A 1 57  ? -22.036 -0.753  2.375   1.00 0.00 ? 57  ASN A OD1  2  
ATOM 2970  N ND2  . ASN A 1 57  ? -20.959 0.616   3.803   1.00 0.00 ? 57  ASN A ND2  2  
ATOM 2971  H H    . ASN A 1 57  ? -20.710 -3.793  2.268   1.00 0.00 ? 57  ASN A H    2  
ATOM 2972  H HA   . ASN A 1 57  ? -19.727 -1.399  0.925   1.00 0.00 ? 57  ASN A HA   2  
ATOM 2973  H HB2  . ASN A 1 57  ? -19.929 -2.109  3.892   1.00 0.00 ? 57  ASN A HB2  2  
ATOM 2974  H HB3  . ASN A 1 57  ? -18.940 -0.778  3.325   1.00 0.00 ? 57  ASN A HB3  2  
ATOM 2975  H HD21 . ASN A 1 57  ? -20.127 0.785   4.332   1.00 0.00 ? 57  ASN A HD21 2  
ATOM 2976  H HD22 . ASN A 1 57  ? -21.716 1.268   3.841   1.00 0.00 ? 57  ASN A HD22 2  
ATOM 2977  N N    . SER A 1 58  ? -17.302 -2.139  1.094   1.00 0.00 ? 58  SER A N    2  
ATOM 2978  C CA   . SER A 1 58  ? -15.948 -2.662  1.032   1.00 0.00 ? 58  SER A CA   2  
ATOM 2979  C C    . SER A 1 58  ? -14.939 -1.530  1.234   1.00 0.00 ? 58  SER A C    2  
ATOM 2980  O O    . SER A 1 58  ? -15.245 -0.368  0.972   1.00 0.00 ? 58  SER A O    2  
ATOM 2981  C CB   . SER A 1 58  ? -15.691 -3.370  -0.301  1.00 0.00 ? 58  SER A CB   2  
ATOM 2982  O OG   . SER A 1 58  ? -16.630 -4.415  -0.539  1.00 0.00 ? 58  SER A OG   2  
ATOM 2983  H H    . SER A 1 58  ? -17.451 -1.292  0.585   1.00 0.00 ? 58  SER A H    2  
ATOM 2984  H HA   . SER A 1 58  ? -15.880 -3.385  1.845   1.00 0.00 ? 58  SER A HA   2  
ATOM 2985  H HB2  . SER A 1 58  ? -15.743 -2.644  -1.112  1.00 0.00 ? 58  SER A HB2  2  
ATOM 2986  H HB3  . SER A 1 58  ? -14.682 -3.780  -0.305  1.00 0.00 ? 58  SER A HB3  2  
ATOM 2987  H HG   . SER A 1 58  ? -16.755 -4.545  -1.523  1.00 0.00 ? 58  SER A HG   2  
ATOM 2988  N N    . TYR A 1 59  ? -13.758 -1.909  1.699   1.00 0.00 ? 59  TYR A N    2  
ATOM 2989  C CA   . TYR A 1 59  ? -12.702 -0.939  1.940   1.00 0.00 ? 59  TYR A CA   2  
ATOM 2990  C C    . TYR A 1 59  ? -11.322 -1.581  1.782   1.00 0.00 ? 59  TYR A C    2  
ATOM 2991  O O    . TYR A 1 59  ? -11.055 -2.635  2.356   1.00 0.00 ? 59  TYR A O    2  
ATOM 2992  C CB   . TYR A 1 59  ? -12.875 -0.479  3.389   1.00 0.00 ? 59  TYR A CB   2  
ATOM 2993  C CG   . TYR A 1 59  ? -12.261 -1.428  4.420   1.00 0.00 ? 59  TYR A CG   2  
ATOM 2994  C CD1  . TYR A 1 59  ? -10.914 -1.355  4.708   1.00 0.00 ? 59  TYR A CD1  2  
ATOM 2995  C CD2  . TYR A 1 59  ? -13.056 -2.356  5.062   1.00 0.00 ? 59  TYR A CD2  2  
ATOM 2996  C CE1  . TYR A 1 59  ? -10.336 -2.248  5.679   1.00 0.00 ? 59  TYR A CE1  2  
ATOM 2997  C CE2  . TYR A 1 59  ? -12.479 -3.249  6.033   1.00 0.00 ? 59  TYR A CE2  2  
ATOM 2998  C CZ   . TYR A 1 59  ? -11.147 -3.151  6.294   1.00 0.00 ? 59  TYR A CZ   2  
ATOM 2999  O OH   . TYR A 1 59  ? -10.602 -3.994  7.211   1.00 0.00 ? 59  TYR A OH   2  
ATOM 3000  H H    . TYR A 1 59  ? -13.517 -2.856  1.910   1.00 0.00 ? 59  TYR A H    2  
ATOM 3001  H HA   . TYR A 1 59  ? -12.808 -0.138  1.208   1.00 0.00 ? 59  TYR A HA   2  
ATOM 3002  H HB2  . TYR A 1 59  ? -12.423 0.507   3.502   1.00 0.00 ? 59  TYR A HB2  2  
ATOM 3003  H HB3  . TYR A 1 59  ? -13.938 -0.368  3.600   1.00 0.00 ? 59  TYR A HB3  2  
ATOM 3004  H HD1  . TYR A 1 59  ? -10.286 -0.623  4.201   1.00 0.00 ? 59  TYR A HD1  2  
ATOM 3005  H HD2  . TYR A 1 59  ? -14.120 -2.412  4.835   1.00 0.00 ? 59  TYR A HD2  2  
ATOM 3006  H HE1  . TYR A 1 59  ? -9.274  -2.202  5.917   1.00 0.00 ? 59  TYR A HE1  2  
ATOM 3007  H HE2  . TYR A 1 59  ? -13.094 -3.986  6.548   1.00 0.00 ? 59  TYR A HE2  2  
ATOM 3008  H HH   . TYR A 1 59  ? -10.751 -4.943  6.934   1.00 0.00 ? 59  TYR A HH   2  
ATOM 3009  N N    . TYR A 1 60  ? -10.482 -0.917  1.001   1.00 0.00 ? 60  TYR A N    2  
ATOM 3010  C CA   . TYR A 1 60  ? -9.137  -1.409  0.761   1.00 0.00 ? 60  TYR A CA   2  
ATOM 3011  C C    . TYR A 1 60  ? -8.092  -0.466  1.361   1.00 0.00 ? 60  TYR A C    2  
ATOM 3012  O O    . TYR A 1 60  ? -8.361  0.718   1.561   1.00 0.00 ? 60  TYR A O    2  
ATOM 3013  C CB   . TYR A 1 60  ? -8.964  -1.440  -0.759  1.00 0.00 ? 60  TYR A CB   2  
ATOM 3014  C CG   . TYR A 1 60  ? -7.745  -2.235  -1.231  1.00 0.00 ? 60  TYR A CG   2  
ATOM 3015  C CD1  . TYR A 1 60  ? -7.835  -3.602  -1.396  1.00 0.00 ? 60  TYR A CD1  2  
ATOM 3016  C CD2  . TYR A 1 60  ? -6.556  -1.585  -1.492  1.00 0.00 ? 60  TYR A CD2  2  
ATOM 3017  C CE1  . TYR A 1 60  ? -6.687  -4.350  -1.841  1.00 0.00 ? 60  TYR A CE1  2  
ATOM 3018  C CE2  . TYR A 1 60  ? -5.409  -2.333  -1.937  1.00 0.00 ? 60  TYR A CE2  2  
ATOM 3019  C CZ   . TYR A 1 60  ? -5.531  -3.679  -2.089  1.00 0.00 ? 60  TYR A CZ   2  
ATOM 3020  O OH   . TYR A 1 60  ? -4.448  -4.386  -2.508  1.00 0.00 ? 60  TYR A OH   2  
ATOM 3021  H H    . TYR A 1 60  ? -10.708 -0.060  0.538   1.00 0.00 ? 60  TYR A H    2  
ATOM 3022  H HA   . TYR A 1 60  ? -9.046  -2.387  1.233   1.00 0.00 ? 60  TYR A HA   2  
ATOM 3023  H HB2  . TYR A 1 60  ? -9.860  -1.868  -1.208  1.00 0.00 ? 60  TYR A HB2  2  
ATOM 3024  H HB3  . TYR A 1 60  ? -8.882  -0.416  -1.126  1.00 0.00 ? 60  TYR A HB3  2  
ATOM 3025  H HD1  . TYR A 1 60  ? -8.774  -4.115  -1.190  1.00 0.00 ? 60  TYR A HD1  2  
ATOM 3026  H HD2  . TYR A 1 60  ? -6.485  -0.505  -1.362  1.00 0.00 ? 60  TYR A HD2  2  
ATOM 3027  H HE1  . TYR A 1 60  ? -6.745  -5.430  -1.975  1.00 0.00 ? 60  TYR A HE1  2  
ATOM 3028  H HE2  . TYR A 1 60  ? -4.464  -1.832  -2.146  1.00 0.00 ? 60  TYR A HE2  2  
ATOM 3029  H HH   . TYR A 1 60  ? -4.670  -5.360  -2.550  1.00 0.00 ? 60  TYR A HH   2  
ATOM 3030  N N    . LYS A 1 61  ? -6.923  -1.025  1.633   1.00 0.00 ? 61  LYS A N    2  
ATOM 3031  C CA   . LYS A 1 61  ? -5.837  -0.249  2.207   1.00 0.00 ? 61  LYS A CA   2  
ATOM 3032  C C    . LYS A 1 61  ? -4.511  -0.705  1.595   1.00 0.00 ? 61  LYS A C    2  
ATOM 3033  O O    . LYS A 1 61  ? -4.221  -1.900  1.551   1.00 0.00 ? 61  LYS A O    2  
ATOM 3034  C CB   . LYS A 1 61  ? -5.869  -0.330  3.735   1.00 0.00 ? 61  LYS A CB   2  
ATOM 3035  C CG   . LYS A 1 61  ? -6.032  1.059   4.354   1.00 0.00 ? 61  LYS A CG   2  
ATOM 3036  C CD   . LYS A 1 61  ? -4.671  1.719   4.587   1.00 0.00 ? 61  LYS A CD   2  
ATOM 3037  C CE   . LYS A 1 61  ? -4.304  1.710   6.072   1.00 0.00 ? 61  LYS A CE   2  
ATOM 3038  N NZ   . LYS A 1 61  ? -3.386  0.589   6.372   1.00 0.00 ? 61  LYS A NZ   2  
ATOM 3039  H H    . LYS A 1 61  ? -6.712  -1.989  1.468   1.00 0.00 ? 61  LYS A H    2  
ATOM 3040  H HA   . LYS A 1 61  ? -6.002  0.794   1.936   1.00 0.00 ? 61  LYS A HA   2  
ATOM 3041  H HB2  . LYS A 1 61  ? -6.691  -0.972  4.052   1.00 0.00 ? 61  LYS A HB2  2  
ATOM 3042  H HB3  . LYS A 1 61  ? -4.950  -0.789  4.098   1.00 0.00 ? 61  LYS A HB3  2  
ATOM 3043  H HG2  . LYS A 1 61  ? -6.637  1.685   3.698   1.00 0.00 ? 61  LYS A HG2  2  
ATOM 3044  H HG3  . LYS A 1 61  ? -6.568  0.979   5.300   1.00 0.00 ? 61  LYS A HG3  2  
ATOM 3045  H HD2  . LYS A 1 61  ? -3.906  1.193   4.016   1.00 0.00 ? 61  LYS A HD2  2  
ATOM 3046  H HD3  . LYS A 1 61  ? -4.693  2.745   4.220   1.00 0.00 ? 61  LYS A HD3  2  
ATOM 3047  H HE2  . LYS A 1 61  ? -3.833  2.656   6.341   1.00 0.00 ? 61  LYS A HE2  2  
ATOM 3048  H HE3  . LYS A 1 61  ? -5.208  1.621   6.675   1.00 0.00 ? 61  LYS A HE3  2  
ATOM 3049  H HZ1  . LYS A 1 61  ? -2.871  0.794   7.204   1.00 0.00 ? 61  LYS A HZ1  2  
ATOM 3050  H HZ2  . LYS A 1 61  ? -3.916  -0.249  6.506   1.00 0.00 ? 61  LYS A HZ2  2  
ATOM 3051  H HZ3  . LYS A 1 61  ? -2.752  0.464   5.609   1.00 0.00 ? 61  LYS A HZ3  2  
ATOM 3052  N N    . LEU A 1 62  ? -3.740  0.271   1.138   1.00 0.00 ? 62  LEU A N    2  
ATOM 3053  C CA   . LEU A 1 62  ? -2.451  -0.015  0.531   1.00 0.00 ? 62  LEU A CA   2  
ATOM 3054  C C    . LEU A 1 62  ? -1.336  0.436   1.475   1.00 0.00 ? 62  LEU A C    2  
ATOM 3055  O O    . LEU A 1 62  ? -1.454  1.468   2.134   1.00 0.00 ? 62  LEU A O    2  
ATOM 3056  C CB   . LEU A 1 62  ? -2.366  0.609   -0.864  1.00 0.00 ? 62  LEU A CB   2  
ATOM 3057  C CG   . LEU A 1 62  ? -2.271  -0.373  -2.033  1.00 0.00 ? 62  LEU A CG   2  
ATOM 3058  C CD1  . LEU A 1 62  ? -1.226  0.086   -3.052  1.00 0.00 ? 62  LEU A CD1  2  
ATOM 3059  C CD2  . LEU A 1 62  ? -2.000  -1.794  -1.535  1.00 0.00 ? 62  LEU A CD2  2  
ATOM 3060  H H    . LEU A 1 62  ? -3.983  1.240   1.178   1.00 0.00 ? 62  LEU A H    2  
ATOM 3061  H HA   . LEU A 1 62  ? -2.382  -1.095  0.405   1.00 0.00 ? 62  LEU A HA   2  
ATOM 3062  H HB2  . LEU A 1 62  ? -3.244  1.237   -1.013  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 3063  H HB3  . LEU A 1 62  ? -1.496  1.265   -0.894  1.00 0.00 ? 62  LEU A HB3  2  
ATOM 3064  H HG   . LEU A 1 62  ? -3.234  -0.389  -2.545  1.00 0.00 ? 62  LEU A HG   2  
ATOM 3065  H HD11 . LEU A 1 62  ? -1.551  -0.189  -4.055  1.00 0.00 ? 62  LEU A HD11 2  
ATOM 3066  H HD12 . LEU A 1 62  ? -1.112  1.169   -2.992  1.00 0.00 ? 62  LEU A HD12 2  
ATOM 3067  H HD13 . LEU A 1 62  ? -0.272  -0.393  -2.834  1.00 0.00 ? 62  LEU A HD13 2  
ATOM 3068  H HD21 . LEU A 1 62  ? -2.883  -2.173  -1.020  1.00 0.00 ? 62  LEU A HD21 2  
ATOM 3069  H HD22 . LEU A 1 62  ? -1.770  -2.439  -2.384  1.00 0.00 ? 62  LEU A HD22 2  
ATOM 3070  H HD23 . LEU A 1 62  ? -1.155  -1.783  -0.847  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 3071  N N    . GLN A 1 63  ? -0.277  -0.360  1.512   1.00 0.00 ? 63  GLN A N    2  
ATOM 3072  C CA   . GLN A 1 63  ? 0.859   -0.055  2.365   1.00 0.00 ? 63  GLN A CA   2  
ATOM 3073  C C    . GLN A 1 63  ? 2.089   -0.845  1.913   1.00 0.00 ? 63  GLN A C    2  
ATOM 3074  O O    . GLN A 1 63  ? 2.052   -2.073  1.845   1.00 0.00 ? 63  GLN A O    2  
ATOM 3075  C CB   . GLN A 1 63  ? 0.534   -0.339  3.833   1.00 0.00 ? 63  GLN A CB   2  
ATOM 3076  C CG   . GLN A 1 63  ? -0.440  0.702   4.390   1.00 0.00 ? 63  GLN A CG   2  
ATOM 3077  C CD   . GLN A 1 63  ? -0.340  0.786   5.914   1.00 0.00 ? 63  GLN A CD   2  
ATOM 3078  O OE1  . GLN A 1 63  ? -0.951  0.024   6.645   1.00 0.00 ? 63  GLN A OE1  2  
ATOM 3079  N NE2  . GLN A 1 63  ? 0.463   1.752   6.351   1.00 0.00 ? 63  GLN A NE2  2  
ATOM 3080  H H    . GLN A 1 63  ? -0.189  -1.197  0.973   1.00 0.00 ? 63  GLN A H    2  
ATOM 3081  H HA   . GLN A 1 63  ? 1.038   1.013   2.239   1.00 0.00 ? 63  GLN A HA   2  
ATOM 3082  H HB2  . GLN A 1 63  ? 0.101   -1.334  3.928   1.00 0.00 ? 63  GLN A HB2  2  
ATOM 3083  H HB3  . GLN A 1 63  ? 1.452   -0.333  4.420   1.00 0.00 ? 63  GLN A HB3  2  
ATOM 3084  H HG2  . GLN A 1 63  ? -0.225  1.677   3.953   1.00 0.00 ? 63  GLN A HG2  2  
ATOM 3085  H HG3  . GLN A 1 63  ? -1.459  0.442   4.102   1.00 0.00 ? 63  GLN A HG3  2  
ATOM 3086  H HE21 . GLN A 1 63  ? 0.935   2.344   5.698   1.00 0.00 ? 63  GLN A HE21 2  
ATOM 3087  H HE22 . GLN A 1 63  ? 0.594   1.887   7.333   1.00 0.00 ? 63  GLN A HE22 2  
ATOM 3088  N N    . LEU A 1 64  ? 3.149   -0.109  1.617   1.00 0.00 ? 64  LEU A N    2  
ATOM 3089  C CA   . LEU A 1 64  ? 4.388   -0.725  1.174   1.00 0.00 ? 64  LEU A CA   2  
ATOM 3090  C C    . LEU A 1 64  ? 5.445   -0.584  2.271   1.00 0.00 ? 64  LEU A C    2  
ATOM 3091  O O    . LEU A 1 64  ? 6.071   0.466   2.403   1.00 0.00 ? 64  LEU A O    2  
ATOM 3092  C CB   . LEU A 1 64  ? 4.822   -0.147  -0.175  1.00 0.00 ? 64  LEU A CB   2  
ATOM 3093  C CG   . LEU A 1 64  ? 5.819   -0.987  -0.976  1.00 0.00 ? 64  LEU A CG   2  
ATOM 3094  C CD1  . LEU A 1 64  ? 6.162   -0.312  -2.305  1.00 0.00 ? 64  LEU A CD1  2  
ATOM 3095  C CD2  . LEU A 1 64  ? 7.069   -1.291  -0.148  1.00 0.00 ? 64  LEU A CD2  2  
ATOM 3096  H H    . LEU A 1 64  ? 3.171   0.889   1.675   1.00 0.00 ? 64  LEU A H    2  
ATOM 3097  H HA   . LEU A 1 64  ? 4.189   -1.786  1.020   1.00 0.00 ? 64  LEU A HA   2  
ATOM 3098  H HB2  . LEU A 1 64  ? 3.932   0.005   -0.786  1.00 0.00 ? 64  LEU A HB2  2  
ATOM 3099  H HB3  . LEU A 1 64  ? 5.261   0.836   -0.002  1.00 0.00 ? 64  LEU A HB3  2  
ATOM 3100  H HG   . LEU A 1 64  ? 5.349   -1.942  -1.212  1.00 0.00 ? 64  LEU A HG   2  
ATOM 3101  H HD11 . LEU A 1 64  ? 6.692   0.622   -2.112  1.00 0.00 ? 64  LEU A HD11 2  
ATOM 3102  H HD12 . LEU A 1 64  ? 6.796   -0.973  -2.896  1.00 0.00 ? 64  LEU A HD12 2  
ATOM 3103  H HD13 . LEU A 1 64  ? 5.244   -0.102  -2.854  1.00 0.00 ? 64  LEU A HD13 2  
ATOM 3104  H HD21 . LEU A 1 64  ? 7.515   -0.357  0.193   1.00 0.00 ? 64  LEU A HD21 2  
ATOM 3105  H HD22 . LEU A 1 64  ? 6.794   -1.899  0.715   1.00 0.00 ? 64  LEU A HD22 2  
ATOM 3106  H HD23 . LEU A 1 64  ? 7.788   -1.835  -0.761  1.00 0.00 ? 64  LEU A HD23 2  
ATOM 3107  N N    . LEU A 1 65  ? 5.609   -1.657  3.031   1.00 0.00 ? 65  LEU A N    2  
ATOM 3108  C CA   . LEU A 1 65  ? 6.579   -1.666  4.114   1.00 0.00 ? 65  LEU A CA   2  
ATOM 3109  C C    . LEU A 1 65  ? 7.980   -1.870  3.535   1.00 0.00 ? 65  LEU A C    2  
ATOM 3110  O O    . LEU A 1 65  ? 8.176   -2.704  2.652   1.00 0.00 ? 65  LEU A O    2  
ATOM 3111  C CB   . LEU A 1 65  ? 6.192   -2.702  5.170   1.00 0.00 ? 65  LEU A CB   2  
ATOM 3112  C CG   . LEU A 1 65  ? 4.727   -2.698  5.610   1.00 0.00 ? 65  LEU A CG   2  
ATOM 3113  C CD1  . LEU A 1 65  ? 4.490   -3.703  6.739   1.00 0.00 ? 65  LEU A CD1  2  
ATOM 3114  C CD2  . LEU A 1 65  ? 4.273   -1.288  5.993   1.00 0.00 ? 65  LEU A CD2  2  
ATOM 3115  H H    . LEU A 1 65  ? 5.095   -2.507  2.917   1.00 0.00 ? 65  LEU A H    2  
ATOM 3116  H HA   . LEU A 1 65  ? 6.542   -0.687  4.593   1.00 0.00 ? 65  LEU A HA   2  
ATOM 3117  H HB2  . LEU A 1 65  ? 6.432   -3.693  4.784   1.00 0.00 ? 65  LEU A HB2  2  
ATOM 3118  H HB3  . LEU A 1 65  ? 6.815   -2.544  6.051   1.00 0.00 ? 65  LEU A HB3  2  
ATOM 3119  H HG   . LEU A 1 65  ? 4.116   -3.014  4.765   1.00 0.00 ? 65  LEU A HG   2  
ATOM 3120  H HD11 . LEU A 1 65  ? 4.674   -3.220  7.699   1.00 0.00 ? 65  LEU A HD11 2  
ATOM 3121  H HD12 . LEU A 1 65  ? 3.460   -4.056  6.702   1.00 0.00 ? 65  LEU A HD12 2  
ATOM 3122  H HD13 . LEU A 1 65  ? 5.168   -4.548  6.621   1.00 0.00 ? 65  LEU A HD13 2  
ATOM 3123  H HD21 . LEU A 1 65  ? 4.648   -1.043  6.987   1.00 0.00 ? 65  LEU A HD21 2  
ATOM 3124  H HD22 . LEU A 1 65  ? 4.664   -0.572  5.270   1.00 0.00 ? 65  LEU A HD22 2  
ATOM 3125  H HD23 . LEU A 1 65  ? 3.184   -1.245  5.995   1.00 0.00 ? 65  LEU A HD23 2  
ATOM 3126  N N    . GLU A 1 66  ? 8.920   -1.095  4.057   1.00 0.00 ? 66  GLU A N    2  
ATOM 3127  C CA   . GLU A 1 66  ? 10.297  -1.180  3.603   1.00 0.00 ? 66  GLU A CA   2  
ATOM 3128  C C    . GLU A 1 66  ? 11.226  -1.482  4.781   1.00 0.00 ? 66  GLU A C    2  
ATOM 3129  O O    . GLU A 1 66  ? 11.051  -0.937  5.870   1.00 0.00 ? 66  GLU A O    2  
ATOM 3130  C CB   . GLU A 1 66  ? 10.720  0.104   2.887   1.00 0.00 ? 66  GLU A CB   2  
ATOM 3131  C CG   . GLU A 1 66  ? 12.230  0.322   2.996   1.00 0.00 ? 66  GLU A CG   2  
ATOM 3132  C CD   . GLU A 1 66  ? 12.650  1.615   2.294   1.00 0.00 ? 66  GLU A CD   2  
ATOM 3133  O OE1  . GLU A 1 66  ? 12.249  2.688   2.794   1.00 0.00 ? 66  GLU A OE1  2  
ATOM 3134  O OE2  . GLU A 1 66  ? 13.362  1.500   1.273   1.00 0.00 ? 66  GLU A OE2  2  
ATOM 3135  H H    . GLU A 1 66  ? 8.752   -0.419  4.775   1.00 0.00 ? 66  GLU A H    2  
ATOM 3136  H HA   . GLU A 1 66  ? 10.318  -2.008  2.895   1.00 0.00 ? 66  GLU A HA   2  
ATOM 3137  H HB2  . GLU A 1 66  ? 10.431  0.050   1.837   1.00 0.00 ? 66  GLU A HB2  2  
ATOM 3138  H HB3  . GLU A 1 66  ? 10.194  0.955   3.319   1.00 0.00 ? 66  GLU A HB3  2  
ATOM 3139  H HG2  . GLU A 1 66  ? 12.520  0.363   4.046   1.00 0.00 ? 66  GLU A HG2  2  
ATOM 3140  H HG3  . GLU A 1 66  ? 12.756  -0.524  2.553   1.00 0.00 ? 66  GLU A HG3  2  
ATOM 3141  N N    . ASP A 1 67  ? 12.195  -2.348  4.523   1.00 0.00 ? 67  ASP A N    2  
ATOM 3142  C CA   . ASP A 1 67  ? 13.151  -2.729  5.549   1.00 0.00 ? 67  ASP A CA   2  
ATOM 3143  C C    . ASP A 1 67  ? 13.924  -1.489  6.004   1.00 0.00 ? 67  ASP A C    2  
ATOM 3144  O O    . ASP A 1 67  ? 14.339  -0.675  5.181   1.00 0.00 ? 67  ASP A O    2  
ATOM 3145  C CB   . ASP A 1 67  ? 14.161  -3.744  5.010   1.00 0.00 ? 67  ASP A CB   2  
ATOM 3146  C CG   . ASP A 1 67  ? 15.483  -3.811  5.779   1.00 0.00 ? 67  ASP A CG   2  
ATOM 3147  O OD1  . ASP A 1 67  ? 15.411  -3.931  7.021   1.00 0.00 ? 67  ASP A OD1  2  
ATOM 3148  O OD2  . ASP A 1 67  ? 16.534  -3.742  5.107   1.00 0.00 ? 67  ASP A OD2  2  
ATOM 3149  H H    . ASP A 1 67  ? 12.330  -2.787  3.635   1.00 0.00 ? 67  ASP A H    2  
ATOM 3150  H HA   . ASP A 1 67  ? 12.555  -3.166  6.349   1.00 0.00 ? 67  ASP A HA   2  
ATOM 3151  H HB2  . ASP A 1 67  ? 13.702  -4.732  5.021   1.00 0.00 ? 67  ASP A HB2  2  
ATOM 3152  H HB3  . ASP A 1 67  ? 14.376  -3.503  3.969   1.00 0.00 ? 67  ASP A HB3  2  
ATOM 3153  N N    . ASP A 1 68  ? 14.093  -1.385  7.314   1.00 0.00 ? 68  ASP A N    2  
ATOM 3154  C CA   . ASP A 1 68  ? 14.809  -0.258  7.889   1.00 0.00 ? 68  ASP A CA   2  
ATOM 3155  C C    . ASP A 1 68  ? 16.220  -0.203  7.301   1.00 0.00 ? 68  ASP A C    2  
ATOM 3156  O O    . ASP A 1 68  ? 16.744  0.878   7.037   1.00 0.00 ? 68  ASP A O    2  
ATOM 3157  C CB   . ASP A 1 68  ? 14.934  -0.402  9.407   1.00 0.00 ? 68  ASP A CB   2  
ATOM 3158  C CG   . ASP A 1 68  ? 14.635  0.869   10.204  1.00 0.00 ? 68  ASP A CG   2  
ATOM 3159  O OD1  . ASP A 1 68  ? 15.369  1.858   9.991   1.00 0.00 ? 68  ASP A OD1  2  
ATOM 3160  O OD2  . ASP A 1 68  ? 13.678  0.823   11.008  1.00 0.00 ? 68  ASP A OD2  2  
ATOM 3161  H H    . ASP A 1 68  ? 13.753  -2.052  7.977   1.00 0.00 ? 68  ASP A H    2  
ATOM 3162  H HA   . ASP A 1 68  ? 14.215  0.619   7.632   1.00 0.00 ? 68  ASP A HA   2  
ATOM 3163  H HB2  . ASP A 1 68  ? 14.257  -1.189  9.740   1.00 0.00 ? 68  ASP A HB2  2  
ATOM 3164  H HB3  . ASP A 1 68  ? 15.946  -0.731  9.644   1.00 0.00 ? 68  ASP A HB3  2  
ATOM 3165  N N    . LYS A 1 69  ? 16.796  -1.381  7.115   1.00 0.00 ? 69  LYS A N    2  
ATOM 3166  C CA   . LYS A 1 69  ? 18.137  -1.480  6.563   1.00 0.00 ? 69  LYS A CA   2  
ATOM 3167  C C    . LYS A 1 69  ? 18.098  -1.131  5.074   1.00 0.00 ? 69  LYS A C    2  
ATOM 3168  O O    . LYS A 1 69  ? 19.140  -1.044  4.426   1.00 0.00 ? 69  LYS A O    2  
ATOM 3169  C CB   . LYS A 1 69  ? 18.736  -2.857  6.856   1.00 0.00 ? 69  LYS A CB   2  
ATOM 3170  C CG   . LYS A 1 69  ? 19.556  -2.834  8.148   1.00 0.00 ? 69  LYS A CG   2  
ATOM 3171  C CD   . LYS A 1 69  ? 20.962  -3.392  7.915   1.00 0.00 ? 69  LYS A CD   2  
ATOM 3172  C CE   . LYS A 1 69  ? 21.116  -4.773  8.555   1.00 0.00 ? 69  LYS A CE   2  
ATOM 3173  N NZ   . LYS A 1 69  ? 22.514  -5.245  8.439   1.00 0.00 ? 69  LYS A NZ   2  
ATOM 3174  H H    . LYS A 1 69  ? 16.363  -2.256  7.333   1.00 0.00 ? 69  LYS A H    2  
ATOM 3175  H HA   . LYS A 1 69  ? 18.756  -0.743  7.075   1.00 0.00 ? 69  LYS A HA   2  
ATOM 3176  H HB2  . LYS A 1 69  ? 17.939  -3.595  6.940   1.00 0.00 ? 69  LYS A HB2  2  
ATOM 3177  H HB3  . LYS A 1 69  ? 19.370  -3.166  6.025   1.00 0.00 ? 69  LYS A HB3  2  
ATOM 3178  H HG2  . LYS A 1 69  ? 19.624  -1.812  8.522   1.00 0.00 ? 69  LYS A HG2  2  
ATOM 3179  H HG3  . LYS A 1 69  ? 19.050  -3.421  8.914   1.00 0.00 ? 69  LYS A HG3  2  
ATOM 3180  H HD2  . LYS A 1 69  ? 21.158  -3.458  6.845   1.00 0.00 ? 69  LYS A HD2  2  
ATOM 3181  H HD3  . LYS A 1 69  ? 21.701  -2.709  8.333   1.00 0.00 ? 69  LYS A HD3  2  
ATOM 3182  H HE2  . LYS A 1 69  ? 20.826  -4.729  9.604   1.00 0.00 ? 69  LYS A HE2  2  
ATOM 3183  H HE3  . LYS A 1 69  ? 20.445  -5.482  8.069   1.00 0.00 ? 69  LYS A HE3  2  
ATOM 3184  H HZ1  . LYS A 1 69  ? 23.086  -4.757  9.098   1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 3185  H HZ2  . LYS A 1 69  ? 22.551  -6.226  8.628   1.00 0.00 ? 69  LYS A HZ2  2  
ATOM 3186  H HZ3  . LYS A 1 69  ? 22.849  -5.070  7.513   1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 3187  N N    . GLU A 1 70  ? 16.886  -0.940  4.575   1.00 0.00 ? 70  GLU A N    2  
ATOM 3188  C CA   . GLU A 1 70  ? 16.697  -0.601  3.174   1.00 0.00 ? 70  GLU A CA   2  
ATOM 3189  C C    . GLU A 1 70  ? 17.268  -1.705  2.281   1.00 0.00 ? 70  GLU A C    2  
ATOM 3190  O O    . GLU A 1 70  ? 18.363  -1.565  1.739   1.00 0.00 ? 70  GLU A O    2  
ATOM 3191  C CB   . GLU A 1 70  ? 17.332  0.752   2.847   1.00 0.00 ? 70  GLU A CB   2  
ATOM 3192  C CG   . GLU A 1 70  ? 16.539  1.897   3.481   1.00 0.00 ? 70  GLU A CG   2  
ATOM 3193  C CD   . GLU A 1 70  ? 17.133  3.253   3.096   1.00 0.00 ? 70  GLU A CD   2  
ATOM 3194  O OE1  . GLU A 1 70  ? 18.377  3.360   3.136   1.00 0.00 ? 70  GLU A OE1  2  
ATOM 3195  O OE2  . GLU A 1 70  ? 16.328  4.153   2.770   1.00 0.00 ? 70  GLU A OE2  2  
ATOM 3196  H H    . GLU A 1 70  ? 16.043  -1.012  5.109   1.00 0.00 ? 70  GLU A H    2  
ATOM 3197  H HA   . GLU A 1 70  ? 15.619  -0.533  3.035   1.00 0.00 ? 70  GLU A HA   2  
ATOM 3198  H HB2  . GLU A 1 70  ? 18.360  0.773   3.209   1.00 0.00 ? 70  GLU A HB2  2  
ATOM 3199  H HB3  . GLU A 1 70  ? 17.372  0.887   1.766   1.00 0.00 ? 70  GLU A HB3  2  
ATOM 3200  H HG2  . GLU A 1 70  ? 15.499  1.846   3.158   1.00 0.00 ? 70  GLU A HG2  2  
ATOM 3201  H HG3  . GLU A 1 70  ? 16.542  1.789   4.565   1.00 0.00 ? 70  GLU A HG3  2  
ATOM 3202  N N    . ASN A 1 71  ? 16.499  -2.777  2.155   1.00 0.00 ? 71  ASN A N    2  
ATOM 3203  C CA   . ASN A 1 71  ? 16.914  -3.903  1.337   1.00 0.00 ? 71  ASN A CA   2  
ATOM 3204  C C    . ASN A 1 71  ? 15.710  -4.812  1.079   1.00 0.00 ? 71  ASN A C    2  
ATOM 3205  O O    . ASN A 1 71  ? 15.392  -5.116  -0.069  1.00 0.00 ? 71  ASN A O    2  
ATOM 3206  C CB   . ASN A 1 71  ? 17.989  -4.732  2.044   1.00 0.00 ? 71  ASN A CB   2  
ATOM 3207  C CG   . ASN A 1 71  ? 19.298  -3.948  2.158   1.00 0.00 ? 71  ASN A CG   2  
ATOM 3208  O OD1  . ASN A 1 71  ? 19.840  -3.450  1.185   1.00 0.00 ? 71  ASN A OD1  2  
ATOM 3209  N ND2  . ASN A 1 71  ? 19.774  -3.868  3.397   1.00 0.00 ? 71  ASN A ND2  2  
ATOM 3210  H H    . ASN A 1 71  ? 15.609  -2.882  2.600   1.00 0.00 ? 71  ASN A H    2  
ATOM 3211  H HA   . ASN A 1 71  ? 17.307  -3.463  0.421   1.00 0.00 ? 71  ASN A HA   2  
ATOM 3212  H HB2  . ASN A 1 71  ? 17.641  -5.012  3.038   1.00 0.00 ? 71  ASN A HB2  2  
ATOM 3213  H HB3  . ASN A 1 71  ? 18.161  -5.657  1.493   1.00 0.00 ? 71  ASN A HB3  2  
ATOM 3214  H HD21 . ASN A 1 71  ? 19.280  -4.300  4.151   1.00 0.00 ? 71  ASN A HD21 2  
ATOM 3215  H HD22 . ASN A 1 71  ? 20.627  -3.376  3.574   1.00 0.00 ? 71  ASN A HD22 2  
ATOM 3216  N N    . ARG A 1 72  ? 15.074  -5.220  2.167   1.00 0.00 ? 72  ARG A N    2  
ATOM 3217  C CA   . ARG A 1 72  ? 13.912  -6.088  2.074   1.00 0.00 ? 72  ARG A CA   2  
ATOM 3218  C C    . ARG A 1 72  ? 12.627  -5.273  2.234   1.00 0.00 ? 72  ARG A C    2  
ATOM 3219  O O    . ARG A 1 72  ? 12.570  -4.349  3.044   1.00 0.00 ? 72  ARG A O    2  
ATOM 3220  C CB   . ARG A 1 72  ? 13.952  -7.180  3.145   1.00 0.00 ? 72  ARG A CB   2  
ATOM 3221  C CG   . ARG A 1 72  ? 13.452  -8.514  2.587   1.00 0.00 ? 72  ARG A CG   2  
ATOM 3222  C CD   . ARG A 1 72  ? 14.073  -9.691  3.342   1.00 0.00 ? 72  ARG A CD   2  
ATOM 3223  N NE   . ARG A 1 72  ? 15.130  -10.320 2.519   1.00 0.00 ? 72  ARG A NE   2  
ATOM 3224  C CZ   . ARG A 1 72  ? 15.870  -11.364 2.915   1.00 0.00 ? 72  ARG A CZ   2  
ATOM 3225  N NH1  . ARG A 1 72  ? 15.673  -11.903 4.126   1.00 0.00 ? 72  ARG A NH1  2  
ATOM 3226  N NH2  . ARG A 1 72  ? 16.807  -11.869 2.101   1.00 0.00 ? 72  ARG A NH2  2  
ATOM 3227  H H    . ARG A 1 72  ? 15.339  -4.968  3.098   1.00 0.00 ? 72  ARG A H    2  
ATOM 3228  H HA   . ARG A 1 72  ? 13.975  -6.531  1.080   1.00 0.00 ? 72  ARG A HA   2  
ATOM 3229  H HB2  . ARG A 1 72  ? 14.972  -7.295  3.514   1.00 0.00 ? 72  ARG A HB2  2  
ATOM 3230  H HB3  . ARG A 1 72  ? 13.338  -6.883  3.995   1.00 0.00 ? 72  ARG A HB3  2  
ATOM 3231  H HG2  . ARG A 1 72  ? 12.366  -8.560  2.664   1.00 0.00 ? 72  ARG A HG2  2  
ATOM 3232  H HG3  . ARG A 1 72  ? 13.700  -8.585  1.528   1.00 0.00 ? 72  ARG A HG3  2  
ATOM 3233  H HD2  . ARG A 1 72  ? 14.493  -9.347  4.287   1.00 0.00 ? 72  ARG A HD2  2  
ATOM 3234  H HD3  . ARG A 1 72  ? 13.304  -10.425 3.584   1.00 0.00 ? 72  ARG A HD3  2  
ATOM 3235  H HE   . ARG A 1 72  ? 15.302  -9.941  1.609   1.00 0.00 ? 72  ARG A HE   2  
ATOM 3236  H HH11 . ARG A 1 72  ? 14.974  -11.526 4.734   1.00 0.00 ? 72  ARG A HH11 2  
ATOM 3237  H HH12 . ARG A 1 72  ? 16.225  -12.682 4.422   1.00 0.00 ? 72  ARG A HH12 2  
ATOM 3238  H HH21 . ARG A 1 72  ? 16.953  -11.467 1.198   1.00 0.00 ? 72  ARG A HH21 2  
ATOM 3239  H HH22 . ARG A 1 72  ? 17.359  -12.648 2.397   1.00 0.00 ? 72  ARG A HH22 2  
ATOM 3240  N N    . TYR A 1 73  ? 11.627  -5.645  1.448   1.00 0.00 ? 73  TYR A N    2  
ATOM 3241  C CA   . TYR A 1 73  ? 10.346  -4.961  1.492   1.00 0.00 ? 73  TYR A CA   2  
ATOM 3242  C C    . TYR A 1 73  ? 9.189   -5.962  1.505   1.00 0.00 ? 73  TYR A C    2  
ATOM 3243  O O    . TYR A 1 73  ? 9.381   -7.141  1.212   1.00 0.00 ? 73  TYR A O    2  
ATOM 3244  C CB   . TYR A 1 73  ? 10.269  -4.126  0.212   1.00 0.00 ? 73  TYR A CB   2  
ATOM 3245  C CG   . TYR A 1 73  ? 11.355  -3.054  0.102   1.00 0.00 ? 73  TYR A CG   2  
ATOM 3246  C CD1  . TYR A 1 73  ? 12.664  -3.419  -0.135  1.00 0.00 ? 73  TYR A CD1  2  
ATOM 3247  C CD2  . TYR A 1 73  ? 11.024  -1.721  0.241   1.00 0.00 ? 73  TYR A CD2  2  
ATOM 3248  C CE1  . TYR A 1 73  ? 13.686  -2.409  -0.238  1.00 0.00 ? 73  TYR A CE1  2  
ATOM 3249  C CE2  . TYR A 1 73  ? 12.046  -0.711  0.137   1.00 0.00 ? 73  TYR A CE2  2  
ATOM 3250  C CZ   . TYR A 1 73  ? 13.326  -1.105  -0.097  1.00 0.00 ? 73  TYR A CZ   2  
ATOM 3251  O OH   . TYR A 1 73  ? 14.291  -0.152  -0.195  1.00 0.00 ? 73  TYR A OH   2  
ATOM 3252  H H    . TYR A 1 73  ? 11.681  -6.398  0.792   1.00 0.00 ? 73  TYR A H    2  
ATOM 3253  H HA   . TYR A 1 73  ? 10.313  -4.367  2.406   1.00 0.00 ? 73  TYR A HA   2  
ATOM 3254  H HB2  . TYR A 1 73  ? 10.342  -4.792  -0.648  1.00 0.00 ? 73  TYR A HB2  2  
ATOM 3255  H HB3  . TYR A 1 73  ? 9.292   -3.646  0.161   1.00 0.00 ? 73  TYR A HB3  2  
ATOM 3256  H HD1  . TYR A 1 73  ? 12.925  -4.471  -0.244  1.00 0.00 ? 73  TYR A HD1  2  
ATOM 3257  H HD2  . TYR A 1 73  ? 9.990   -1.432  0.428   1.00 0.00 ? 73  TYR A HD2  2  
ATOM 3258  H HE1  . TYR A 1 73  ? 14.724  -2.684  -0.426  1.00 0.00 ? 73  TYR A HE1  2  
ATOM 3259  H HE2  . TYR A 1 73  ? 11.798  0.345   0.244   1.00 0.00 ? 73  TYR A HE2  2  
ATOM 3260  H HH   . TYR A 1 73  ? 13.921  0.665   -0.638  1.00 0.00 ? 73  TYR A HH   2  
ATOM 3261  N N    . TRP A 1 74  ? 8.014   -5.455  1.847   1.00 0.00 ? 74  TRP A N    2  
ATOM 3262  C CA   . TRP A 1 74  ? 6.826   -6.290  1.901   1.00 0.00 ? 74  TRP A CA   2  
ATOM 3263  C C    . TRP A 1 74  ? 5.674   -5.517  1.257   1.00 0.00 ? 74  TRP A C    2  
ATOM 3264  O O    . TRP A 1 74  ? 5.740   -4.296  1.122   1.00 0.00 ? 74  TRP A O    2  
ATOM 3265  C CB   . TRP A 1 74  ? 6.526   -6.724  3.338   1.00 0.00 ? 74  TRP A CB   2  
ATOM 3266  C CG   . TRP A 1 74  ? 7.500   -7.766  3.890   1.00 0.00 ? 74  TRP A CG   2  
ATOM 3267  C CD1  . TRP A 1 74  ? 7.309   -9.086  4.022   1.00 0.00 ? 74  TRP A CD1  2  
ATOM 3268  C CD2  . TRP A 1 74  ? 8.834   -7.520  4.382   1.00 0.00 ? 74  TRP A CD2  2  
ATOM 3269  N NE1  . TRP A 1 74  ? 8.417   -9.706  4.561   1.00 0.00 ? 74  TRP A NE1  2  
ATOM 3270  C CE2  . TRP A 1 74  ? 9.375   -8.724  4.787   1.00 0.00 ? 74  TRP A CE2  2  
ATOM 3271  C CE3  . TRP A 1 74  ? 9.561   -6.321  4.481   1.00 0.00 ? 74  TRP A CE3  2  
ATOM 3272  C CZ2  . TRP A 1 74  ? 10.664  -8.845  5.318   1.00 0.00 ? 74  TRP A CZ2  2  
ATOM 3273  C CZ3  . TRP A 1 74  ? 10.848  -6.459  5.014   1.00 0.00 ? 74  TRP A CZ3  2  
ATOM 3274  C CH2  . TRP A 1 74  ? 11.406  -7.663  5.427   1.00 0.00 ? 74  TRP A CH2  2  
ATOM 3275  H H    . TRP A 1 74  ? 7.866   -4.495  2.084   1.00 0.00 ? 74  TRP A H    2  
ATOM 3276  H HA   . TRP A 1 74  ? 7.030   -7.197  1.332   1.00 0.00 ? 74  TRP A HA   2  
ATOM 3277  H HB2  . TRP A 1 74  ? 6.545   -5.845  3.983   1.00 0.00 ? 74  TRP A HB2  2  
ATOM 3278  H HB3  . TRP A 1 74  ? 5.514   -7.128  3.380   1.00 0.00 ? 74  TRP A HB3  2  
ATOM 3279  H HD1  . TRP A 1 74  ? 6.392   -9.604  3.740   1.00 0.00 ? 74  TRP A HD1  2  
ATOM 3280  H HE1  . TRP A 1 74  ? 8.523   -10.770 4.772   1.00 0.00 ? 74  TRP A HE1  2  
ATOM 3281  H HE3  . TRP A 1 74  ? 9.157   -5.358  4.168   1.00 0.00 ? 74  TRP A HE3  2  
ATOM 3282  H HZ2  . TRP A 1 74  ? 11.068  -9.808  5.631   1.00 0.00 ? 74  TRP A HZ2  2  
ATOM 3283  H HZ3  . TRP A 1 74  ? 11.455  -5.558  5.113   1.00 0.00 ? 74  TRP A HZ3  2  
ATOM 3284  H HH2  . TRP A 1 74  ? 12.418  -7.687  5.833   1.00 0.00 ? 74  TRP A HH2  2  
ATOM 3285  N N    . ILE A 1 75  ? 4.645   -6.259  0.876   1.00 0.00 ? 75  ILE A N    2  
ATOM 3286  C CA   . ILE A 1 75  ? 3.480   -5.658  0.249   1.00 0.00 ? 75  ILE A CA   2  
ATOM 3287  C C    . ILE A 1 75  ? 2.241   -5.953  1.097   1.00 0.00 ? 75  ILE A C    2  
ATOM 3288  O O    . ILE A 1 75  ? 1.716   -7.065  1.070   1.00 0.00 ? 75  ILE A O    2  
ATOM 3289  C CB   . ILE A 1 75  ? 3.355   -6.120  -1.204  1.00 0.00 ? 75  ILE A CB   2  
ATOM 3290  C CG1  . ILE A 1 75  ? 4.231   -5.270  -2.127  1.00 0.00 ? 75  ILE A CG1  2  
ATOM 3291  C CG2  . ILE A 1 75  ? 1.892   -6.131  -1.652  1.00 0.00 ? 75  ILE A CG2  2  
ATOM 3292  C CD1  . ILE A 1 75  ? 3.587   -3.908  -2.393  1.00 0.00 ? 75  ILE A CD1  2  
ATOM 3293  H H    . ILE A 1 75  ? 4.599   -7.251  0.990   1.00 0.00 ? 75  ILE A H    2  
ATOM 3294  H HA   . ILE A 1 75  ? 3.638   -4.580  0.232   1.00 0.00 ? 75  ILE A HA   2  
ATOM 3295  H HB   . ILE A 1 75  ? 3.720   -7.145  -1.269  1.00 0.00 ? 75  ILE A HB   2  
ATOM 3296  H HG12 . ILE A 1 75  ? 5.213   -5.130  -1.674  1.00 0.00 ? 75  ILE A HG12 2  
ATOM 3297  H HG13 . ILE A 1 75  ? 4.387   -5.793  -3.070  1.00 0.00 ? 75  ILE A HG13 2  
ATOM 3298  H HG21 . ILE A 1 75  ? 1.841   -5.965  -2.728  1.00 0.00 ? 75  ILE A HG21 2  
ATOM 3299  H HG22 . ILE A 1 75  ? 1.446   -7.096  -1.412  1.00 0.00 ? 75  ILE A HG22 2  
ATOM 3300  H HG23 . ILE A 1 75  ? 1.348   -5.341  -1.136  1.00 0.00 ? 75  ILE A HG23 2  
ATOM 3301  H HD11 . ILE A 1 75  ? 4.365   -3.156  -2.517  1.00 0.00 ? 75  ILE A HD11 2  
ATOM 3302  H HD12 . ILE A 1 75  ? 2.985   -3.962  -3.301  1.00 0.00 ? 75  ILE A HD12 2  
ATOM 3303  H HD13 . ILE A 1 75  ? 2.950   -3.637  -1.551  1.00 0.00 ? 75  ILE A HD13 2  
ATOM 3304  N N    . PHE A 1 76  ? 1.809   -4.937  1.830   1.00 0.00 ? 76  PHE A N    2  
ATOM 3305  C CA   . PHE A 1 76  ? 0.641   -5.074  2.684   1.00 0.00 ? 76  PHE A CA   2  
ATOM 3306  C C    . PHE A 1 76  ? -0.633  -4.674  1.937   1.00 0.00 ? 76  PHE A C    2  
ATOM 3307  O O    . PHE A 1 76  ? -0.647  -3.682  1.211   1.00 0.00 ? 76  PHE A O    2  
ATOM 3308  C CB   . PHE A 1 76  ? 0.841   -4.128  3.869   1.00 0.00 ? 76  PHE A CB   2  
ATOM 3309  C CG   . PHE A 1 76  ? -0.267  -4.205  4.921   1.00 0.00 ? 76  PHE A CG   2  
ATOM 3310  C CD1  . PHE A 1 76  ? -0.185  -5.114  5.930   1.00 0.00 ? 76  PHE A CD1  2  
ATOM 3311  C CD2  . PHE A 1 76  ? -1.335  -3.366  4.847   1.00 0.00 ? 76  PHE A CD2  2  
ATOM 3312  C CE1  . PHE A 1 76  ? -1.214  -5.186  6.906   1.00 0.00 ? 76  PHE A CE1  2  
ATOM 3313  C CE2  . PHE A 1 76  ? -2.363  -3.438  5.823   1.00 0.00 ? 76  PHE A CE2  2  
ATOM 3314  C CZ   . PHE A 1 76  ? -2.281  -4.346  6.832   1.00 0.00 ? 76  PHE A CZ   2  
ATOM 3315  H H    . PHE A 1 76  ? 2.241   -4.036  1.846   1.00 0.00 ? 76  PHE A H    2  
ATOM 3316  H HA   . PHE A 1 76  ? 0.575   -6.121  2.977   1.00 0.00 ? 76  PHE A HA   2  
ATOM 3317  H HB2  . PHE A 1 76  ? 1.796   -4.354  4.345   1.00 0.00 ? 76  PHE A HB2  2  
ATOM 3318  H HB3  . PHE A 1 76  ? 0.905   -3.105  3.498   1.00 0.00 ? 76  PHE A HB3  2  
ATOM 3319  H HD1  . PHE A 1 76  ? 0.671   -5.786  5.989   1.00 0.00 ? 76  PHE A HD1  2  
ATOM 3320  H HD2  . PHE A 1 76  ? -1.400  -2.638  4.039   1.00 0.00 ? 76  PHE A HD2  2  
ATOM 3321  H HE1  . PHE A 1 76  ? -1.148  -5.914  7.715   1.00 0.00 ? 76  PHE A HE1  2  
ATOM 3322  H HE2  . PHE A 1 76  ? -3.219  -2.765  5.764   1.00 0.00 ? 76  PHE A HE2  2  
ATOM 3323  H HZ   . PHE A 1 76  ? -3.071  -4.401  7.581   1.00 0.00 ? 76  PHE A HZ   2  
ATOM 3324  N N    . ARG A 1 77  ? -1.674  -5.468  2.143   1.00 0.00 ? 77  ARG A N    2  
ATOM 3325  C CA   . ARG A 1 77  ? -2.951  -5.210  1.498   1.00 0.00 ? 77  ARG A CA   2  
ATOM 3326  C C    . ARG A 1 77  ? -4.101  -5.678  2.393   1.00 0.00 ? 77  ARG A C    2  
ATOM 3327  O O    . ARG A 1 77  ? -4.235  -6.870  2.664   1.00 0.00 ? 77  ARG A O    2  
ATOM 3328  C CB   . ARG A 1 77  ? -3.041  -5.924  0.148   1.00 0.00 ? 77  ARG A CB   2  
ATOM 3329  C CG   . ARG A 1 77  ? -1.653  -6.329  -0.351  1.00 0.00 ? 77  ARG A CG   2  
ATOM 3330  C CD   . ARG A 1 77  ? -1.754  -7.202  -1.604  1.00 0.00 ? 77  ARG A CD   2  
ATOM 3331  N NE   . ARG A 1 77  ? -0.589  -8.112  -1.682  1.00 0.00 ? 77  ARG A NE   2  
ATOM 3332  C CZ   . ARG A 1 77  ? -0.230  -8.780  -2.786  1.00 0.00 ? 77  ARG A CZ   2  
ATOM 3333  N NH1  . ARG A 1 77  ? -0.943  -8.644  -3.913  1.00 0.00 ? 77  ARG A NH1  2  
ATOM 3334  N NH2  . ARG A 1 77  ? 0.841   -9.584  -2.765  1.00 0.00 ? 77  ARG A NH2  2  
ATOM 3335  H H    . ARG A 1 77  ? -1.655  -6.273  2.735   1.00 0.00 ? 77  ARG A H    2  
ATOM 3336  H HA   . ARG A 1 77  ? -2.978  -4.129  1.357   1.00 0.00 ? 77  ARG A HA   2  
ATOM 3337  H HB2  . ARG A 1 77  ? -3.670  -6.809  0.242   1.00 0.00 ? 77  ARG A HB2  2  
ATOM 3338  H HB3  . ARG A 1 77  ? -3.517  -5.270  -0.582  1.00 0.00 ? 77  ARG A HB3  2  
ATOM 3339  H HG2  . ARG A 1 77  ? -1.067  -5.437  -0.572  1.00 0.00 ? 77  ARG A HG2  2  
ATOM 3340  H HG3  . ARG A 1 77  ? -1.124  -6.871  0.433   1.00 0.00 ? 77  ARG A HG3  2  
ATOM 3341  H HD2  . ARG A 1 77  ? -2.677  -7.781  -1.580  1.00 0.00 ? 77  ARG A HD2  2  
ATOM 3342  H HD3  . ARG A 1 77  ? -1.795  -6.574  -2.493  1.00 0.00 ? 77  ARG A HD3  2  
ATOM 3343  H HE   . ARG A 1 77  ? -0.035  -8.237  -0.858  1.00 0.00 ? 77  ARG A HE   2  
ATOM 3344  H HH11 . ARG A 1 77  ? -1.743  -8.044  -3.929  1.00 0.00 ? 77  ARG A HH11 2  
ATOM 3345  H HH12 . ARG A 1 77  ? -0.675  -9.143  -4.737  1.00 0.00 ? 77  ARG A HH12 2  
ATOM 3346  H HH21 . ARG A 1 77  ? 1.374   -9.686  -1.924  1.00 0.00 ? 77  ARG A HH21 2  
ATOM 3347  H HH22 . ARG A 1 77  ? 1.109   -10.083 -3.589  1.00 0.00 ? 77  ARG A HH22 2  
ATOM 3348  N N    . SER A 1 78  ? -4.901  -4.714  2.826   1.00 0.00 ? 78  SER A N    2  
ATOM 3349  C CA   . SER A 1 78  ? -6.035  -5.013  3.684   1.00 0.00 ? 78  SER A CA   2  
ATOM 3350  C C    . SER A 1 78  ? -7.341  -4.810  2.913   1.00 0.00 ? 78  SER A C    2  
ATOM 3351  O O    . SER A 1 78  ? -7.445  -3.905  2.087   1.00 0.00 ? 78  SER A O    2  
ATOM 3352  C CB   . SER A 1 78  ? -6.019  -4.140  4.940   1.00 0.00 ? 78  SER A CB   2  
ATOM 3353  O OG   . SER A 1 78  ? -6.872  -3.006  4.814   1.00 0.00 ? 78  SER A OG   2  
ATOM 3354  H H    . SER A 1 78  ? -4.784  -3.747  2.600   1.00 0.00 ? 78  SER A H    2  
ATOM 3355  H HA   . SER A 1 78  ? -5.916  -6.059  3.966   1.00 0.00 ? 78  SER A HA   2  
ATOM 3356  H HB2  . SER A 1 78  ? -6.332  -4.736  5.799   1.00 0.00 ? 78  SER A HB2  2  
ATOM 3357  H HB3  . SER A 1 78  ? -5.000  -3.808  5.138   1.00 0.00 ? 78  SER A HB3  2  
ATOM 3358  H HG   . SER A 1 78  ? -7.106  -2.651  5.719   1.00 0.00 ? 78  SER A HG   2  
ATOM 3359  N N    . TRP A 1 79  ? -8.306  -5.668  3.211   1.00 0.00 ? 79  TRP A N    2  
ATOM 3360  C CA   . TRP A 1 79  ? -9.601  -5.595  2.557   1.00 0.00 ? 79  TRP A CA   2  
ATOM 3361  C C    . TRP A 1 79  ? -10.647 -6.170  3.514   1.00 0.00 ? 79  TRP A C    2  
ATOM 3362  O O    . TRP A 1 79  ? -10.311 -6.625  4.606   1.00 0.00 ? 79  TRP A O    2  
ATOM 3363  C CB   . TRP A 1 79  ? -9.573  -6.308  1.204   1.00 0.00 ? 79  TRP A CB   2  
ATOM 3364  C CG   . TRP A 1 79  ? -9.262  -7.803  1.294   1.00 0.00 ? 79  TRP A CG   2  
ATOM 3365  C CD1  . TRP A 1 79  ? -10.081 -8.795  1.671   1.00 0.00 ? 79  TRP A CD1  2  
ATOM 3366  C CD2  . TRP A 1 79  ? -8.005  -8.440  0.986   1.00 0.00 ? 79  TRP A CD2  2  
ATOM 3367  N NE1  . TRP A 1 79  ? -9.446  -10.019 1.628   1.00 0.00 ? 79  TRP A NE1  2  
ATOM 3368  C CE2  . TRP A 1 79  ? -8.143  -9.797  1.198   1.00 0.00 ? 79  TRP A CE2  2  
ATOM 3369  C CE3  . TRP A 1 79  ? -6.790  -7.889  0.542   1.00 0.00 ? 79  TRP A CE3  2  
ATOM 3370  C CZ2  . TRP A 1 79  ? -7.106  -10.715 0.992   1.00 0.00 ? 79  TRP A CZ2  2  
ATOM 3371  C CZ3  . TRP A 1 79  ? -5.763  -8.819  0.342   1.00 0.00 ? 79  TRP A CZ3  2  
ATOM 3372  C CH2  . TRP A 1 79  ? -5.887  -10.188 0.550   1.00 0.00 ? 79  TRP A CH2  2  
ATOM 3373  H H    . TRP A 1 79  ? -8.213  -6.402  3.884   1.00 0.00 ? 79  TRP A H    2  
ATOM 3374  H HA   . TRP A 1 79  ? -9.815  -4.545  2.358   1.00 0.00 ? 79  TRP A HA   2  
ATOM 3375  H HB2  . TRP A 1 79  ? -10.539 -6.177  0.715   1.00 0.00 ? 79  TRP A HB2  2  
ATOM 3376  H HB3  . TRP A 1 79  ? -8.827  -5.830  0.568   1.00 0.00 ? 79  TRP A HB3  2  
ATOM 3377  H HD1  . TRP A 1 79  ? -11.119 -8.652  1.973   1.00 0.00 ? 79  TRP A HD1  2  
ATOM 3378  H HE1  . TRP A 1 79  ? -9.886  -10.984 1.883   1.00 0.00 ? 79  TRP A HE1  2  
ATOM 3379  H HE3  . TRP A 1 79  ? -6.655  -6.821  0.368   1.00 0.00 ? 79  TRP A HE3  2  
ATOM 3380  H HZ2  . TRP A 1 79  ? -7.241  -11.782 1.167   1.00 0.00 ? 79  TRP A HZ2  2  
ATOM 3381  H HZ3  . TRP A 1 79  ? -4.800  -8.444  -0.002  1.00 0.00 ? 79  TRP A HZ3  2  
ATOM 3382  H HH2  . TRP A 1 79  ? -5.038  -10.848 0.371   1.00 0.00 ? 79  TRP A HH2  2  
ATOM 3383  N N    . GLY A 1 80  ? -11.895 -6.130  3.070   1.00 0.00 ? 80  GLY A N    2  
ATOM 3384  C CA   . GLY A 1 80  ? -12.992 -6.641  3.873   1.00 0.00 ? 80  GLY A CA   2  
ATOM 3385  C C    . GLY A 1 80  ? -14.182 -5.679  3.852   1.00 0.00 ? 80  GLY A C    2  
ATOM 3386  O O    . GLY A 1 80  ? -14.114 -4.615  3.238   1.00 0.00 ? 80  GLY A O    2  
ATOM 3387  H H    . GLY A 1 80  ? -12.160 -5.758  2.180   1.00 0.00 ? 80  GLY A H    2  
ATOM 3388  H HA2  . GLY A 1 80  ? -13.301 -7.616  3.495   1.00 0.00 ? 80  GLY A HA2  2  
ATOM 3389  H HA3  . GLY A 1 80  ? -12.658 -6.789  4.900   1.00 0.00 ? 80  GLY A HA3  2  
ATOM 3390  N N    . ARG A 1 81  ? -15.245 -6.088  4.530   1.00 0.00 ? 81  ARG A N    2  
ATOM 3391  C CA   . ARG A 1 81  ? -16.447 -5.275  4.596   1.00 0.00 ? 81  ARG A CA   2  
ATOM 3392  C C    . ARG A 1 81  ? -16.276 -4.156  5.626   1.00 0.00 ? 81  ARG A C    2  
ATOM 3393  O O    . ARG A 1 81  ? -15.278 -4.117  6.345   1.00 0.00 ? 81  ARG A O    2  
ATOM 3394  C CB   . ARG A 1 81  ? -17.664 -6.123  4.973   1.00 0.00 ? 81  ARG A CB   2  
ATOM 3395  C CG   . ARG A 1 81  ? -18.354 -6.678  3.725   1.00 0.00 ? 81  ARG A CG   2  
ATOM 3396  C CD   . ARG A 1 81  ? -19.865 -6.789  3.937   1.00 0.00 ? 81  ARG A CD   2  
ATOM 3397  N NE   . ARG A 1 81  ? -20.417 -5.478  4.344   1.00 0.00 ? 81  ARG A NE   2  
ATOM 3398  C CZ   . ARG A 1 81  ? -21.621 -5.312  4.907   1.00 0.00 ? 81  ARG A CZ   2  
ATOM 3399  N NH1  . ARG A 1 81  ? -22.407 -6.374  5.133   1.00 0.00 ? 81  ARG A NH1  2  
ATOM 3400  N NH2  . ARG A 1 81  ? -22.040 -4.085  5.244   1.00 0.00 ? 81  ARG A NH2  2  
ATOM 3401  H H    . ARG A 1 81  ? -15.292 -6.955  5.026   1.00 0.00 ? 81  ARG A H    2  
ATOM 3402  H HA   . ARG A 1 81  ? -16.566 -4.870  3.592   1.00 0.00 ? 81  ARG A HA   2  
ATOM 3403  H HB2  . ARG A 1 81  ? -17.354 -6.946  5.617   1.00 0.00 ? 81  ARG A HB2  2  
ATOM 3404  H HB3  . ARG A 1 81  ? -18.369 -5.520  5.544   1.00 0.00 ? 81  ARG A HB3  2  
ATOM 3405  H HG2  . ARG A 1 81  ? -18.149 -6.029  2.873   1.00 0.00 ? 81  ARG A HG2  2  
ATOM 3406  H HG3  . ARG A 1 81  ? -17.943 -7.658  3.484   1.00 0.00 ? 81  ARG A HG3  2  
ATOM 3407  H HD2  . ARG A 1 81  ? -20.345 -7.126  3.018   1.00 0.00 ? 81  ARG A HD2  2  
ATOM 3408  H HD3  . ARG A 1 81  ? -20.079 -7.536  4.701   1.00 0.00 ? 81  ARG A HD3  2  
ATOM 3409  H HE   . ARG A 1 81  ? -19.856 -4.665  4.189   1.00 0.00 ? 81  ARG A HE   2  
ATOM 3410  H HH11 . ARG A 1 81  ? -22.095 -7.290  4.881   1.00 0.00 ? 81  ARG A HH11 2  
ATOM 3411  H HH12 . ARG A 1 81  ? -23.306 -6.250  5.553   1.00 0.00 ? 81  ARG A HH12 2  
ATOM 3412  H HH21 . ARG A 1 81  ? -21.454 -3.292  5.076   1.00 0.00 ? 81  ARG A HH21 2  
ATOM 3413  H HH22 . ARG A 1 81  ? -22.939 -3.961  5.664   1.00 0.00 ? 81  ARG A HH22 2  
ATOM 3414  N N    . VAL A 1 82  ? -17.263 -3.274  5.663   1.00 0.00 ? 82  VAL A N    2  
ATOM 3415  C CA   . VAL A 1 82  ? -17.234 -2.157  6.593   1.00 0.00 ? 82  VAL A CA   2  
ATOM 3416  C C    . VAL A 1 82  ? -18.120 -2.479  7.798   1.00 0.00 ? 82  VAL A C    2  
ATOM 3417  O O    . VAL A 1 82  ? -19.333 -2.628  7.659   1.00 0.00 ? 82  VAL A O    2  
ATOM 3418  C CB   . VAL A 1 82  ? -17.644 -0.869  5.876   1.00 0.00 ? 82  VAL A CB   2  
ATOM 3419  C CG1  . VAL A 1 82  ? -17.931 0.249   6.880   1.00 0.00 ? 82  VAL A CG1  2  
ATOM 3420  C CG2  . VAL A 1 82  ? -16.578 -0.440  4.866   1.00 0.00 ? 82  VAL A CG2  2  
ATOM 3421  H H    . VAL A 1 82  ? -18.071 -3.313  5.075   1.00 0.00 ? 82  VAL A H    2  
ATOM 3422  H HA   . VAL A 1 82  ? -16.206 -2.041  6.934   1.00 0.00 ? 82  VAL A HA   2  
ATOM 3423  H HB   . VAL A 1 82  ? -18.564 -1.070  5.326   1.00 0.00 ? 82  VAL A HB   2  
ATOM 3424  H HG11 . VAL A 1 82  ? -19.006 0.422   6.934   1.00 0.00 ? 82  VAL A HG11 2  
ATOM 3425  H HG12 . VAL A 1 82  ? -17.559 -0.041  7.863   1.00 0.00 ? 82  VAL A HG12 2  
ATOM 3426  H HG13 . VAL A 1 82  ? -17.432 1.163   6.558   1.00 0.00 ? 82  VAL A HG13 2  
ATOM 3427  H HG21 . VAL A 1 82  ? -17.051 -0.221  3.909   1.00 0.00 ? 82  VAL A HG21 2  
ATOM 3428  H HG22 . VAL A 1 82  ? -16.069 0.451   5.233   1.00 0.00 ? 82  VAL A HG22 2  
ATOM 3429  H HG23 . VAL A 1 82  ? -15.854 -1.245  4.738   1.00 0.00 ? 82  VAL A HG23 2  
ATOM 3430  N N    . GLY A 1 83  ? -17.479 -2.577  8.953   1.00 0.00 ? 83  GLY A N    2  
ATOM 3431  C CA   . GLY A 1 83  ? -18.194 -2.878  10.182  1.00 0.00 ? 83  GLY A CA   2  
ATOM 3432  C C    . GLY A 1 83  ? -18.902 -4.231  10.087  1.00 0.00 ? 83  GLY A C    2  
ATOM 3433  O O    . GLY A 1 83  ? -20.082 -4.342  10.416  1.00 0.00 ? 83  GLY A O    2  
ATOM 3434  H H    . GLY A 1 83  ? -16.492 -2.454  9.058   1.00 0.00 ? 83  GLY A H    2  
ATOM 3435  H HA2  . GLY A 1 83  ? -17.496 -2.887  11.020  1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3436  H HA3  . GLY A 1 83  ? -18.924 -2.094  10.384  1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3437  N N    . THR A 1 84  ? -18.152 -5.225  9.635   1.00 0.00 ? 84  THR A N    2  
ATOM 3438  C CA   . THR A 1 84  ? -18.694 -6.566  9.492   1.00 0.00 ? 84  THR A CA   2  
ATOM 3439  C C    . THR A 1 84  ? -17.717 -7.598  10.058  1.00 0.00 ? 84  THR A C    2  
ATOM 3440  O O    . THR A 1 84  ? -16.679 -7.238  10.611  1.00 0.00 ? 84  THR A O    2  
ATOM 3441  C CB   . THR A 1 84  ? -19.024 -6.788  8.014   1.00 0.00 ? 84  THR A CB   2  
ATOM 3442  O OG1  . THR A 1 84  ? -19.690 -5.590  7.624   1.00 0.00 ? 84  THR A OG1  2  
ATOM 3443  C CG2  . THR A 1 84  ? -20.072 -7.882  7.806   1.00 0.00 ? 84  THR A CG2  2  
ATOM 3444  H H    . THR A 1 84  ? -17.193 -5.126  9.369   1.00 0.00 ? 84  THR A H    2  
ATOM 3445  H HA   . THR A 1 84  ? -19.607 -6.632  10.083  1.00 0.00 ? 84  THR A HA   2  
ATOM 3446  H HB   . THR A 1 84  ? -18.121 -6.999  7.441   1.00 0.00 ? 84  THR A HB   2  
ATOM 3447  H HG1  . THR A 1 84  ? -20.100 -5.706  6.719   1.00 0.00 ? 84  THR A HG1  2  
ATOM 3448  H HG21 . THR A 1 84  ? -19.577 -8.809  7.518   1.00 0.00 ? 84  THR A HG21 2  
ATOM 3449  H HG22 . THR A 1 84  ? -20.624 -8.038  8.734   1.00 0.00 ? 84  THR A HG22 2  
ATOM 3450  H HG23 . THR A 1 84  ? -20.763 -7.579  7.019   1.00 0.00 ? 84  THR A HG23 2  
ATOM 3451  N N    . VAL A 1 85  ? -18.084 -8.862  9.900   1.00 0.00 ? 85  VAL A N    2  
ATOM 3452  C CA   . VAL A 1 85  ? -17.253 -9.949  10.388  1.00 0.00 ? 85  VAL A CA   2  
ATOM 3453  C C    . VAL A 1 85  ? -16.084 -10.164 9.425   1.00 0.00 ? 85  VAL A C    2  
ATOM 3454  O O    . VAL A 1 85  ? -14.989 -10.536 9.845   1.00 0.00 ? 85  VAL A O    2  
ATOM 3455  C CB   . VAL A 1 85  ? -18.102 -11.207 10.589  1.00 0.00 ? 85  VAL A CB   2  
ATOM 3456  C CG1  . VAL A 1 85  ? -19.377 -10.888 11.372  1.00 0.00 ? 85  VAL A CG1  2  
ATOM 3457  C CG2  . VAL A 1 85  ? -18.432 -11.865 9.248   1.00 0.00 ? 85  VAL A CG2  2  
ATOM 3458  H H    . VAL A 1 85  ? -18.930 -9.146  9.449   1.00 0.00 ? 85  VAL A H    2  
ATOM 3459  H HA   . VAL A 1 85  ? -16.858 -9.650  11.359  1.00 0.00 ? 85  VAL A HA   2  
ATOM 3460  H HB   . VAL A 1 85  ? -17.516 -11.916 11.175  1.00 0.00 ? 85  VAL A HB   2  
ATOM 3461  H HG11 . VAL A 1 85  ? -19.155 -10.882 12.440  1.00 0.00 ? 85  VAL A HG11 2  
ATOM 3462  H HG12 . VAL A 1 85  ? -19.752 -9.910  11.074  1.00 0.00 ? 85  VAL A HG12 2  
ATOM 3463  H HG13 . VAL A 1 85  ? -20.131 -11.647 11.162  1.00 0.00 ? 85  VAL A HG13 2  
ATOM 3464  H HG21 . VAL A 1 85  ? -17.772 -12.718 9.089   1.00 0.00 ? 85  VAL A HG21 2  
ATOM 3465  H HG22 . VAL A 1 85  ? -19.468 -12.203 9.255   1.00 0.00 ? 85  VAL A HG22 2  
ATOM 3466  H HG23 . VAL A 1 85  ? -18.291 -11.142 8.444   1.00 0.00 ? 85  VAL A HG23 2  
ATOM 3467  N N    . ILE A 1 86  ? -16.356 -9.921  8.151   1.00 0.00 ? 86  ILE A N    2  
ATOM 3468  C CA   . ILE A 1 86  ? -15.340 -10.084 7.125   1.00 0.00 ? 86  ILE A CA   2  
ATOM 3469  C C    . ILE A 1 86  ? -14.168 -9.146  7.421   1.00 0.00 ? 86  ILE A C    2  
ATOM 3470  O O    . ILE A 1 86  ? -14.323 -8.160  8.140   1.00 0.00 ? 86  ILE A O    2  
ATOM 3471  C CB   . ILE A 1 86  ? -15.948 -9.889  5.734   1.00 0.00 ? 86  ILE A CB   2  
ATOM 3472  C CG1  . ILE A 1 86  ? -17.102 -10.866 5.499   1.00 0.00 ? 86  ILE A CG1  2  
ATOM 3473  C CG2  . ILE A 1 86  ? -14.876 -9.996  4.648   1.00 0.00 ? 86  ILE A CG2  2  
ATOM 3474  C CD1  . ILE A 1 86  ? -17.789 -10.590 4.160   1.00 0.00 ? 86  ILE A CD1  2  
ATOM 3475  H H    . ILE A 1 86  ? -17.249 -9.619  7.818   1.00 0.00 ? 86  ILE A H    2  
ATOM 3476  H HA   . ILE A 1 86  ? -14.982 -11.112 7.179   1.00 0.00 ? 86  ILE A HA   2  
ATOM 3477  H HB   . ILE A 1 86  ? -16.362 -8.883  5.680   1.00 0.00 ? 86  ILE A HB   2  
ATOM 3478  H HG12 . ILE A 1 86  ? -16.725 -11.889 5.514   1.00 0.00 ? 86  ILE A HG12 2  
ATOM 3479  H HG13 . ILE A 1 86  ? -17.826 -10.781 6.308   1.00 0.00 ? 86  ILE A HG13 2  
ATOM 3480  H HG21 . ILE A 1 86  ? -14.108 -9.241  4.819   1.00 0.00 ? 86  ILE A HG21 2  
ATOM 3481  H HG22 . ILE A 1 86  ? -14.423 -10.987 4.679   1.00 0.00 ? 86  ILE A HG22 2  
ATOM 3482  H HG23 . ILE A 1 86  ? -15.331 -9.835  3.671   1.00 0.00 ? 86  ILE A HG23 2  
ATOM 3483  H HD11 . ILE A 1 86  ? -17.520 -9.592  3.812   1.00 0.00 ? 86  ILE A HD11 2  
ATOM 3484  H HD12 . ILE A 1 86  ? -17.468 -11.329 3.427   1.00 0.00 ? 86  ILE A HD12 2  
ATOM 3485  H HD13 . ILE A 1 86  ? -18.870 -10.650 4.288   1.00 0.00 ? 86  ILE A HD13 2  
ATOM 3486  N N    . GLY A 1 87  ? -13.022 -9.485  6.850   1.00 0.00 ? 87  GLY A N    2  
ATOM 3487  C CA   . GLY A 1 87  ? -11.824 -8.686  7.044   1.00 0.00 ? 87  GLY A CA   2  
ATOM 3488  C C    . GLY A 1 87  ? -10.569 -9.561  7.012   1.00 0.00 ? 87  GLY A C    2  
ATOM 3489  O O    . GLY A 1 87  ? -10.398 -10.438 7.857   1.00 0.00 ? 87  GLY A O    2  
ATOM 3490  H H    . GLY A 1 87  ? -12.904 -10.288 6.266   1.00 0.00 ? 87  GLY A H    2  
ATOM 3491  H HA2  . GLY A 1 87  ? -11.761 -7.925  6.266   1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3492  H HA3  . GLY A 1 87  ? -11.882 -8.162  7.998   1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3493  N N    . SER A 1 88  ? -9.724  -9.292  6.027   1.00 0.00 ? 88  SER A N    2  
ATOM 3494  C CA   . SER A 1 88  ? -8.490  -10.044 5.874   1.00 0.00 ? 88  SER A CA   2  
ATOM 3495  C C    . SER A 1 88  ? -7.385  -9.133  5.336   1.00 0.00 ? 88  SER A C    2  
ATOM 3496  O O    . SER A 1 88  ? -7.656  -8.017  4.895   1.00 0.00 ? 88  SER A O    2  
ATOM 3497  C CB   . SER A 1 88  ? -8.688  -11.244 4.946   1.00 0.00 ? 88  SER A CB   2  
ATOM 3498  O OG   . SER A 1 88  ? -8.962  -12.440 5.671   1.00 0.00 ? 88  SER A OG   2  
ATOM 3499  H H    . SER A 1 88  ? -9.871  -8.577  5.344   1.00 0.00 ? 88  SER A H    2  
ATOM 3500  H HA   . SER A 1 88  ? -8.241  -10.397 6.875   1.00 0.00 ? 88  SER A HA   2  
ATOM 3501  H HB2  . SER A 1 88  ? -9.510  -11.040 4.260   1.00 0.00 ? 88  SER A HB2  2  
ATOM 3502  H HB3  . SER A 1 88  ? -7.794  -11.385 4.339   1.00 0.00 ? 88  SER A HB3  2  
ATOM 3503  H HG   . SER A 1 88  ? -9.345  -13.132 5.058   1.00 0.00 ? 88  SER A HG   2  
ATOM 3504  N N    . ASN A 1 89  ? -6.164  -9.643  5.389   1.00 0.00 ? 89  ASN A N    2  
ATOM 3505  C CA   . ASN A 1 89  ? -5.017  -8.889  4.912   1.00 0.00 ? 89  ASN A CA   2  
ATOM 3506  C C    . ASN A 1 89  ? -4.076  -9.827  4.152   1.00 0.00 ? 89  ASN A C    2  
ATOM 3507  O O    . ASN A 1 89  ? -4.344  -11.022 4.038   1.00 0.00 ? 89  ASN A O    2  
ATOM 3508  C CB   . ASN A 1 89  ? -4.236  -8.278  6.077   1.00 0.00 ? 89  ASN A CB   2  
ATOM 3509  C CG   . ASN A 1 89  ? -4.056  -9.292  7.208   1.00 0.00 ? 89  ASN A CG   2  
ATOM 3510  O OD1  . ASN A 1 89  ? -5.007  -9.807  7.772   1.00 0.00 ? 89  ASN A OD1  2  
ATOM 3511  N ND2  . ASN A 1 89  ? -2.785  -9.549  7.507   1.00 0.00 ? 89  ASN A ND2  2  
ATOM 3512  H H    . ASN A 1 89  ? -5.952  -10.551 5.749   1.00 0.00 ? 89  ASN A H    2  
ATOM 3513  H HA   . ASN A 1 89  ? -5.432  -8.109  4.274   1.00 0.00 ? 89  ASN A HA   2  
ATOM 3514  H HB2  . ASN A 1 89  ? -3.260  -7.939  5.728   1.00 0.00 ? 89  ASN A HB2  2  
ATOM 3515  H HB3  . ASN A 1 89  ? -4.763  -7.400  6.451   1.00 0.00 ? 89  ASN A HB3  2  
ATOM 3516  H HD21 . ASN A 1 89  ? -2.051  -9.091  7.005   1.00 0.00 ? 89  ASN A HD21 2  
ATOM 3517  H HD22 . ASN A 1 89  ? -2.564  -10.199 8.233   1.00 0.00 ? 89  ASN A HD22 2  
ATOM 3518  N N    . LYS A 1 90  ? -2.993  -9.249  3.652   1.00 0.00 ? 90  LYS A N    2  
ATOM 3519  C CA   . LYS A 1 90  ? -2.011  -10.018 2.907   1.00 0.00 ? 90  LYS A CA   2  
ATOM 3520  C C    . LYS A 1 90  ? -0.639  -9.355  3.045   1.00 0.00 ? 90  LYS A C    2  
ATOM 3521  O O    . LYS A 1 90  ? -0.493  -8.162  2.783   1.00 0.00 ? 90  LYS A O    2  
ATOM 3522  C CB   . LYS A 1 90  ? -2.463  -10.201 1.457   1.00 0.00 ? 90  LYS A CB   2  
ATOM 3523  C CG   . LYS A 1 90  ? -1.314  -10.712 0.585   1.00 0.00 ? 90  LYS A CG   2  
ATOM 3524  C CD   . LYS A 1 90  ? -1.692  -12.023 -0.108  1.00 0.00 ? 90  LYS A CD   2  
ATOM 3525  C CE   . LYS A 1 90  ? -2.139  -11.772 -1.549  1.00 0.00 ? 90  LYS A CE   2  
ATOM 3526  N NZ   . LYS A 1 90  ? -3.355  -10.929 -1.575  1.00 0.00 ? 90  LYS A NZ   2  
ATOM 3527  H H    . LYS A 1 90  ? -2.783  -8.276  3.750   1.00 0.00 ? 90  LYS A H    2  
ATOM 3528  H HA   . LYS A 1 90  ? -1.963  -11.009 3.357   1.00 0.00 ? 90  LYS A HA   2  
ATOM 3529  H HB2  . LYS A 1 90  ? -3.295  -10.904 1.417   1.00 0.00 ? 90  LYS A HB2  2  
ATOM 3530  H HB3  . LYS A 1 90  ? -2.828  -9.252  1.063   1.00 0.00 ? 90  LYS A HB3  2  
ATOM 3531  H HG2  . LYS A 1 90  ? -1.059  -9.962  -0.163  1.00 0.00 ? 90  LYS A HG2  2  
ATOM 3532  H HG3  . LYS A 1 90  ? -0.426  -10.864 1.200   1.00 0.00 ? 90  LYS A HG3  2  
ATOM 3533  H HD2  . LYS A 1 90  ? -0.839  -12.701 -0.100  1.00 0.00 ? 90  LYS A HD2  2  
ATOM 3534  H HD3  . LYS A 1 90  ? -2.494  -12.512 0.446   1.00 0.00 ? 90  LYS A HD3  2  
ATOM 3535  H HE2  . LYS A 1 90  ? -1.339  -11.283 -2.104  1.00 0.00 ? 90  LYS A HE2  2  
ATOM 3536  H HE3  . LYS A 1 90  ? -2.337  -12.722 -2.045  1.00 0.00 ? 90  LYS A HE3  2  
ATOM 3537  H HZ1  . LYS A 1 90  ? -3.376  -10.400 -2.424  1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 3538  H HZ2  . LYS A 1 90  ? -4.166  -11.512 -1.526  1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 3539  H HZ3  . LYS A 1 90  ? -3.345  -10.305 -0.794  1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 3540  N N    . LEU A 1 91  ? 0.331   -10.157 3.457   1.00 0.00 ? 91  LEU A N    2  
ATOM 3541  C CA   . LEU A 1 91  ? 1.686   -9.663  3.633   1.00 0.00 ? 91  LEU A CA   2  
ATOM 3542  C C    . LEU A 1 91  ? 2.651   -10.532 2.822   1.00 0.00 ? 91  LEU A C    2  
ATOM 3543  O O    . LEU A 1 91  ? 2.899   -11.684 3.173   1.00 0.00 ? 91  LEU A O    2  
ATOM 3544  C CB   . LEU A 1 91  ? 2.037   -9.579  5.120   1.00 0.00 ? 91  LEU A CB   2  
ATOM 3545  C CG   . LEU A 1 91  ? 3.372   -8.912  5.457   1.00 0.00 ? 91  LEU A CG   2  
ATOM 3546  C CD1  . LEU A 1 91  ? 3.317   -7.407  5.185   1.00 0.00 ? 91  LEU A CD1  2  
ATOM 3547  C CD2  . LEU A 1 91  ? 3.790   -9.219  6.897   1.00 0.00 ? 91  LEU A CD2  2  
ATOM 3548  H H    . LEU A 1 91  ? 0.204   -11.126 3.668   1.00 0.00 ? 91  LEU A H    2  
ATOM 3549  H HA   . LEU A 1 91  ? 1.718   -8.649  3.236   1.00 0.00 ? 91  LEU A HA   2  
ATOM 3550  H HB2  . LEU A 1 91  ? 1.242   -9.035  5.630   1.00 0.00 ? 91  LEU A HB2  2  
ATOM 3551  H HB3  . LEU A 1 91  ? 2.045   -10.590 5.528   1.00 0.00 ? 91  LEU A HB3  2  
ATOM 3552  H HG   . LEU A 1 91  ? 4.138   -9.329  4.804   1.00 0.00 ? 91  LEU A HG   2  
ATOM 3553  H HD11 . LEU A 1 91  ? 2.680   -7.217  4.321   1.00 0.00 ? 91  LEU A HD11 2  
ATOM 3554  H HD12 . LEU A 1 91  ? 2.908   -6.895  6.056   1.00 0.00 ? 91  LEU A HD12 2  
ATOM 3555  H HD13 . LEU A 1 91  ? 4.322   -7.037  4.984   1.00 0.00 ? 91  LEU A HD13 2  
ATOM 3556  H HD21 . LEU A 1 91  ? 4.810   -9.602  6.905   1.00 0.00 ? 91  LEU A HD21 2  
ATOM 3557  H HD22 . LEU A 1 91  ? 3.739   -8.307  7.492   1.00 0.00 ? 91  LEU A HD22 2  
ATOM 3558  H HD23 . LEU A 1 91  ? 3.118   -9.966  7.319   1.00 0.00 ? 91  LEU A HD23 2  
ATOM 3559  N N    . GLU A 1 92  ? 3.167   -9.945  1.752   1.00 0.00 ? 92  GLU A N    2  
ATOM 3560  C CA   . GLU A 1 92  ? 4.099   -10.651 0.888   1.00 0.00 ? 92  GLU A CA   2  
ATOM 3561  C C    . GLU A 1 92  ? 5.430   -9.901  0.819   1.00 0.00 ? 92  GLU A C    2  
ATOM 3562  O O    . GLU A 1 92  ? 5.452   -8.677  0.693   1.00 0.00 ? 92  GLU A O    2  
ATOM 3563  C CB   . GLU A 1 92  ? 3.508   -10.850 -0.509  1.00 0.00 ? 92  GLU A CB   2  
ATOM 3564  C CG   . GLU A 1 92  ? 2.208   -11.655 -0.445  1.00 0.00 ? 92  GLU A CG   2  
ATOM 3565  C CD   . GLU A 1 92  ? 2.115   -12.639 -1.613  1.00 0.00 ? 92  GLU A CD   2  
ATOM 3566  O OE1  . GLU A 1 92  ? 1.729   -12.183 -2.710  1.00 0.00 ? 92  GLU A OE1  2  
ATOM 3567  O OE2  . GLU A 1 92  ? 2.433   -13.826 -1.381  1.00 0.00 ? 92  GLU A OE2  2  
ATOM 3568  H H    . GLU A 1 92  ? 2.960   -9.007  1.473   1.00 0.00 ? 92  GLU A H    2  
ATOM 3569  H HA   . GLU A 1 92  ? 4.246   -11.624 1.356   1.00 0.00 ? 92  GLU A HA   2  
ATOM 3570  H HB2  . GLU A 1 92  ? 3.316   -9.880  -0.968  1.00 0.00 ? 92  GLU A HB2  2  
ATOM 3571  H HB3  . GLU A 1 92  ? 4.229   -11.366 -1.143  1.00 0.00 ? 92  GLU A HB3  2  
ATOM 3572  H HG2  . GLU A 1 92  ? 2.159   -12.198 0.498   1.00 0.00 ? 92  GLU A HG2  2  
ATOM 3573  H HG3  . GLU A 1 92  ? 1.355   -10.977 -0.467  1.00 0.00 ? 92  GLU A HG3  2  
ATOM 3574  N N    . GLN A 1 93  ? 6.509   -10.666 0.903   1.00 0.00 ? 93  GLN A N    2  
ATOM 3575  C CA   . GLN A 1 93  ? 7.841   -10.089 0.851   1.00 0.00 ? 93  GLN A CA   2  
ATOM 3576  C C    . GLN A 1 93  ? 8.286   -9.909  -0.602  1.00 0.00 ? 93  GLN A C    2  
ATOM 3577  O O    . GLN A 1 93  ? 8.312   -10.869 -1.370  1.00 0.00 ? 93  GLN A O    2  
ATOM 3578  C CB   . GLN A 1 93  ? 8.841   -10.948 1.628   1.00 0.00 ? 93  GLN A CB   2  
ATOM 3579  C CG   . GLN A 1 93  ? 10.254  -10.368 1.530   1.00 0.00 ? 93  GLN A CG   2  
ATOM 3580  C CD   . GLN A 1 93  ? 11.076  -11.102 0.469   1.00 0.00 ? 93  GLN A CD   2  
ATOM 3581  O OE1  . GLN A 1 93  ? 10.655  -11.287 -0.661  1.00 0.00 ? 93  GLN A OE1  2  
ATOM 3582  N NE2  . GLN A 1 93  ? 12.269  -11.508 0.894   1.00 0.00 ? 93  GLN A NE2  2  
ATOM 3583  H H    . GLN A 1 93  ? 6.482   -11.660 1.005   1.00 0.00 ? 93  GLN A H    2  
ATOM 3584  H HA   . GLN A 1 93  ? 7.755   -9.116  1.335   1.00 0.00 ? 93  GLN A HA   2  
ATOM 3585  H HB2  . GLN A 1 93  ? 8.540   -11.007 2.674   1.00 0.00 ? 93  GLN A HB2  2  
ATOM 3586  H HB3  . GLN A 1 93  ? 8.834   -11.965 1.236   1.00 0.00 ? 93  GLN A HB3  2  
ATOM 3587  H HG2  . GLN A 1 93  ? 10.199  -9.308  1.285   1.00 0.00 ? 93  GLN A HG2  2  
ATOM 3588  H HG3  . GLN A 1 93  ? 10.750  -10.446 2.498   1.00 0.00 ? 93  GLN A HG3  2  
ATOM 3589  H HE21 . GLN A 1 93  ? 12.554  -11.324 1.834   1.00 0.00 ? 93  GLN A HE21 2  
ATOM 3590  H HE22 . GLN A 1 93  ? 12.881  -11.998 0.272   1.00 0.00 ? 93  GLN A HE22 2  
ATOM 3591  N N    . MET A 1 94  ? 8.623   -8.672  -0.935  1.00 0.00 ? 94  MET A N    2  
ATOM 3592  C CA   . MET A 1 94  ? 9.065   -8.354  -2.282  1.00 0.00 ? 94  MET A CA   2  
ATOM 3593  C C    . MET A 1 94  ? 10.562  -8.624  -2.447  1.00 0.00 ? 94  MET A C    2  
ATOM 3594  O O    . MET A 1 94  ? 11.316  -8.573  -1.476  1.00 0.00 ? 94  MET A O    2  
ATOM 3595  C CB   . MET A 1 94  ? 8.776   -6.881  -2.580  1.00 0.00 ? 94  MET A CB   2  
ATOM 3596  C CG   . MET A 1 94  ? 7.347   -6.511  -2.180  1.00 0.00 ? 94  MET A CG   2  
ATOM 3597  S SD   . MET A 1 94  ? 6.207   -7.752  -2.769  1.00 0.00 ? 94  MET A SD   2  
ATOM 3598  C CE   . MET A 1 94  ? 6.000   -7.206  -4.456  1.00 0.00 ? 94  MET A CE   2  
ATOM 3599  H H    . MET A 1 94  ? 8.599   -7.896  -0.304  1.00 0.00 ? 94  MET A H    2  
ATOM 3600  H HA   . MET A 1 94  ? 8.496   -9.010  -2.940  1.00 0.00 ? 94  MET A HA   2  
ATOM 3601  H HB2  . MET A 1 94  ? 9.484   -6.252  -2.039  1.00 0.00 ? 94  MET A HB2  2  
ATOM 3602  H HB3  . MET A 1 94  ? 8.923   -6.685  -3.642  1.00 0.00 ? 94  MET A HB3  2  
ATOM 3603  H HG2  . MET A 1 94  ? 7.274   -6.424  -1.096  1.00 0.00 ? 94  MET A HG2  2  
ATOM 3604  H HG3  . MET A 1 94  ? 7.084   -5.538  -2.595  1.00 0.00 ? 94  MET A HG3  2  
ATOM 3605  H HE1  . MET A 1 94  ? 5.183   -7.759  -4.919  1.00 0.00 ? 94  MET A HE1  2  
ATOM 3606  H HE2  . MET A 1 94  ? 5.770   -6.141  -4.468  1.00 0.00 ? 94  MET A HE2  2  
ATOM 3607  H HE3  . MET A 1 94  ? 6.921   -7.385  -5.011  1.00 0.00 ? 94  MET A HE3  2  
ATOM 3608  N N    . PRO A 1 95  ? 10.958  -8.913  -3.715  1.00 0.00 ? 95  PRO A N    2  
ATOM 3609  C CA   . PRO A 1 95  ? 12.351  -9.192  -4.019  1.00 0.00 ? 95  PRO A CA   2  
ATOM 3610  C C    . PRO A 1 95  ? 13.181  -7.906  -4.016  1.00 0.00 ? 95  PRO A C    2  
ATOM 3611  O O    . PRO A 1 95  ? 14.169  -7.802  -3.292  1.00 0.00 ? 95  PRO A O    2  
ATOM 3612  C CB   . PRO A 1 95  ? 12.328  -9.880  -5.374  1.00 0.00 ? 95  PRO A CB   2  
ATOM 3613  C CG   . PRO A 1 95  ? 10.978  -9.547  -5.988  1.00 0.00 ? 95  PRO A CG   2  
ATOM 3614  C CD   . PRO A 1 95  ? 10.093  -8.982  -4.889  1.00 0.00 ? 95  PRO A CD   2  
ATOM 3615  H HA   . PRO A 1 95  ? 12.751  -9.776  -3.313  1.00 0.00 ? 95  PRO A HA   2  
ATOM 3616  H HB2  . PRO A 1 95  ? 13.143  -9.527  -6.006  1.00 0.00 ? 95  PRO A HB2  2  
ATOM 3617  H HB3  . PRO A 1 95  ? 12.453  -10.958 -5.266  1.00 0.00 ? 95  PRO A HB3  2  
ATOM 3618  H HG2  . PRO A 1 95  ? 11.094  -8.824  -6.795  1.00 0.00 ? 95  PRO A HG2  2  
ATOM 3619  H HG3  . PRO A 1 95  ? 10.526  -10.439 -6.422  1.00 0.00 ? 95  PRO A HG3  2  
ATOM 3620  H HD2  . PRO A 1 95  ? 9.709   -7.998  -5.157  1.00 0.00 ? 95  PRO A HD2  2  
ATOM 3621  H HD3  . PRO A 1 95  ? 9.229   -9.622  -4.708  1.00 0.00 ? 95  PRO A HD3  2  
ATOM 3622  N N    . SER A 1 96  ? 12.747  -6.958  -4.835  1.00 0.00 ? 96  SER A N    2  
ATOM 3623  C CA   . SER A 1 96  ? 13.437  -5.683  -4.936  1.00 0.00 ? 96  SER A CA   2  
ATOM 3624  C C    . SER A 1 96  ? 12.494  -4.545  -4.540  1.00 0.00 ? 96  SER A C    2  
ATOM 3625  O O    . SER A 1 96  ? 11.275  -4.693  -4.605  1.00 0.00 ? 96  SER A O    2  
ATOM 3626  C CB   . SER A 1 96  ? 13.975  -5.459  -6.350  1.00 0.00 ? 96  SER A CB   2  
ATOM 3627  O OG   . SER A 1 96  ? 14.866  -6.496  -6.753  1.00 0.00 ? 96  SER A OG   2  
ATOM 3628  H H    . SER A 1 96  ? 11.942  -7.050  -5.420  1.00 0.00 ? 96  SER A H    2  
ATOM 3629  H HA   . SER A 1 96  ? 14.271  -5.750  -4.237  1.00 0.00 ? 96  SER A HA   2  
ATOM 3630  H HB2  . SER A 1 96  ? 13.142  -5.405  -7.051  1.00 0.00 ? 96  SER A HB2  2  
ATOM 3631  H HB3  . SER A 1 96  ? 14.492  -4.500  -6.394  1.00 0.00 ? 96  SER A HB3  2  
ATOM 3632  H HG   . SER A 1 96  ? 14.777  -6.661  -7.735  1.00 0.00 ? 96  SER A HG   2  
ATOM 3633  N N    . LYS A 1 97  ? 13.095  -3.435  -4.137  1.00 0.00 ? 97  LYS A N    2  
ATOM 3634  C CA   . LYS A 1 97  ? 12.324  -2.272  -3.731  1.00 0.00 ? 97  LYS A CA   2  
ATOM 3635  C C    . LYS A 1 97  ? 11.360  -1.887  -4.854  1.00 0.00 ? 97  LYS A C    2  
ATOM 3636  O O    . LYS A 1 97  ? 10.178  -1.649  -4.609  1.00 0.00 ? 97  LYS A O    2  
ATOM 3637  C CB   . LYS A 1 97  ? 13.255  -1.136  -3.302  1.00 0.00 ? 97  LYS A CB   2  
ATOM 3638  C CG   . LYS A 1 97  ? 12.464  0.144   -3.020  1.00 0.00 ? 97  LYS A CG   2  
ATOM 3639  C CD   . LYS A 1 97  ? 13.087  1.343   -3.737  1.00 0.00 ? 97  LYS A CD   2  
ATOM 3640  C CE   . LYS A 1 97  ? 13.454  2.446   -2.742  1.00 0.00 ? 97  LYS A CE   2  
ATOM 3641  N NZ   . LYS A 1 97  ? 14.909  2.717   -2.781  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 3642  H H    . LYS A 1 97  ? 14.088  -3.323  -4.087  1.00 0.00 ? 97  LYS A H    2  
ATOM 3643  H HA   . LYS A 1 97  ? 11.740  -2.557  -2.856  1.00 0.00 ? 97  LYS A HA   2  
ATOM 3644  H HB2  . LYS A 1 97  ? 13.808  -1.430  -2.411  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 3645  H HB3  . LYS A 1 97  ? 13.990  -0.948  -4.085  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 3646  H HG2  . LYS A 1 97  ? 11.432  0.017   -3.346  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 3647  H HG3  . LYS A 1 97  ? 12.438  0.330   -1.946  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 3648  H HD2  . LYS A 1 97  ? 13.979  1.025   -4.278  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 3649  H HD3  . LYS A 1 97  ? 12.388  1.733   -4.476  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 3650  H HE2  . LYS A 1 97  ? 12.902  3.356   -2.979  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 3651  H HE3  . LYS A 1 97  ? 13.161  2.148   -1.735  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 3652  H HZ1  . LYS A 1 97  ? 15.402  1.863   -2.945  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 3653  H HZ2  . LYS A 1 97  ? 15.108  3.363   -3.517  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 3654  H HZ3  . LYS A 1 97  ? 15.199  3.107   -1.907  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 3655  N N    . GLU A 1 98  ? 11.900  -1.837  -6.063  1.00 0.00 ? 98  GLU A N    2  
ATOM 3656  C CA   . GLU A 1 98  ? 11.102  -1.484  -7.225  1.00 0.00 ? 98  GLU A CA   2  
ATOM 3657  C C    . GLU A 1 98  ? 9.942   -2.468  -7.391  1.00 0.00 ? 98  GLU A C    2  
ATOM 3658  O O    . GLU A 1 98  ? 8.782   -2.062  -7.444  1.00 0.00 ? 98  GLU A O    2  
ATOM 3659  C CB   . GLU A 1 98  ? 11.964  -1.436  -8.488  1.00 0.00 ? 98  GLU A CB   2  
ATOM 3660  C CG   . GLU A 1 98  ? 12.952  -0.269  -8.434  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3661  C CD   . GLU A 1 98  ? 12.940  0.522   -9.744  1.00 0.00 ? 98  GLU A CD   2  
ATOM 3662  O OE1  . GLU A 1 98  ? 12.998  -0.137  -10.804 1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3663  O OE2  . GLU A 1 98  ? 12.873  1.767   -9.655  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3664  H H    . GLU A 1 98  ? 12.862  -2.031  -6.255  1.00 0.00 ? 98  GLU A H    2  
ATOM 3665  H HA   . GLU A 1 98  ? 10.714  -0.486  -7.019  1.00 0.00 ? 98  GLU A HA   2  
ATOM 3666  H HB2  . GLU A 1 98  ? 12.509  -2.374  -8.597  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3667  H HB3  . GLU A 1 98  ? 11.325  -1.335  -9.366  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3668  H HG2  . GLU A 1 98  ? 12.695  0.391   -7.604  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3669  H HG3  . GLU A 1 98  ? 13.956  -0.647  -8.242  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3670  N N    . ASP A 1 99  ? 10.295  -3.743  -7.467  1.00 0.00 ? 99  ASP A N    2  
ATOM 3671  C CA   . ASP A 1 99  ? 9.297   -4.787  -7.625  1.00 0.00 ? 99  ASP A CA   2  
ATOM 3672  C C    . ASP A 1 99  ? 8.195   -4.596  -6.581  1.00 0.00 ? 99  ASP A C    2  
ATOM 3673  O O    . ASP A 1 99  ? 7.061   -5.027  -6.785  1.00 0.00 ? 99  ASP A O    2  
ATOM 3674  C CB   . ASP A 1 99  ? 9.913   -6.172  -7.415  1.00 0.00 ? 99  ASP A CB   2  
ATOM 3675  C CG   . ASP A 1 99  ? 10.841  -6.644  -8.536  1.00 0.00 ? 99  ASP A CG   2  
ATOM 3676  O OD1  . ASP A 1 99  ? 10.349  -6.729  -9.682  1.00 0.00 ? 99  ASP A OD1  2  
ATOM 3677  O OD2  . ASP A 1 99  ? 12.021  -6.910  -8.221  1.00 0.00 ? 99  ASP A OD2  2  
ATOM 3678  H H    . ASP A 1 99  ? 11.241  -4.064  -7.423  1.00 0.00 ? 99  ASP A H    2  
ATOM 3679  H HA   . ASP A 1 99  ? 8.929   -4.680  -8.645  1.00 0.00 ? 99  ASP A HA   2  
ATOM 3680  H HB2  . ASP A 1 99  ? 10.471  -6.167  -6.479  1.00 0.00 ? 99  ASP A HB2  2  
ATOM 3681  H HB3  . ASP A 1 99  ? 9.107   -6.898  -7.301  1.00 0.00 ? 99  ASP A HB3  2  
ATOM 3682  N N    . ALA A 1 100 ? 8.567   -3.951  -5.486  1.00 0.00 ? 100 ALA A N    2  
ATOM 3683  C CA   . ALA A 1 100 ? 7.624   -3.697  -4.410  1.00 0.00 ? 100 ALA A CA   2  
ATOM 3684  C C    . ALA A 1 100 ? 6.773   -2.476  -4.761  1.00 0.00 ? 100 ALA A C    2  
ATOM 3685  O O    . ALA A 1 100 ? 5.561   -2.476  -4.546  1.00 0.00 ? 100 ALA A O    2  
ATOM 3686  C CB   . ALA A 1 100 ? 8.386   -3.519  -3.095  1.00 0.00 ? 100 ALA A CB   2  
ATOM 3687  H H    . ALA A 1 100 ? 9.492   -3.604  -5.328  1.00 0.00 ? 100 ALA A H    2  
ATOM 3688  H HA   . ALA A 1 100 ? 6.976   -4.569  -4.325  1.00 0.00 ? 100 ALA A HA   2  
ATOM 3689  H HB1  . ALA A 1 100 ? 9.181   -4.262  -3.032  1.00 0.00 ? 100 ALA A HB1  2  
ATOM 3690  H HB2  . ALA A 1 100 ? 8.818   -2.519  -3.058  1.00 0.00 ? 100 ALA A HB2  2  
ATOM 3691  H HB3  . ALA A 1 100 ? 7.700   -3.649  -2.258  1.00 0.00 ? 100 ALA A HB3  2  
ATOM 3692  N N    . ILE A 1 101 ? 7.440   -1.463  -5.295  1.00 0.00 ? 101 ILE A N    2  
ATOM 3693  C CA   . ILE A 1 101 ? 6.759   -0.237  -5.677  1.00 0.00 ? 101 ILE A CA   2  
ATOM 3694  C C    . ILE A 1 101 ? 5.783   -0.536  -6.817  1.00 0.00 ? 101 ILE A C    2  
ATOM 3695  O O    . ILE A 1 101 ? 4.606   -0.188  -6.738  1.00 0.00 ? 101 ILE A O    2  
ATOM 3696  C CB   . ILE A 1 101 ? 7.774   0.858   -6.008  1.00 0.00 ? 101 ILE A CB   2  
ATOM 3697  C CG1  . ILE A 1 101 ? 8.467   1.365   -4.741  1.00 0.00 ? 101 ILE A CG1  2  
ATOM 3698  C CG2  . ILE A 1 101 ? 7.118   1.994   -6.796  1.00 0.00 ? 101 ILE A CG2  2  
ATOM 3699  C CD1  . ILE A 1 101 ? 9.982   1.446   -4.939  1.00 0.00 ? 101 ILE A CD1  2  
ATOM 3700  H H    . ILE A 1 101 ? 8.425   -1.470  -5.466  1.00 0.00 ? 101 ILE A H    2  
ATOM 3701  H HA   . ILE A 1 101 ? 6.188   0.103   -4.813  1.00 0.00 ? 101 ILE A HA   2  
ATOM 3702  H HB   . ILE A 1 101 ? 8.546   0.428   -6.646  1.00 0.00 ? 101 ILE A HB   2  
ATOM 3703  H HG12 . ILE A 1 101 ? 8.077   2.349   -4.479  1.00 0.00 ? 101 ILE A HG12 2  
ATOM 3704  H HG13 . ILE A 1 101 ? 8.240   0.700   -3.908  1.00 0.00 ? 101 ILE A HG13 2  
ATOM 3705  H HG21 . ILE A 1 101 ? 6.127   2.194   -6.389  1.00 0.00 ? 101 ILE A HG21 2  
ATOM 3706  H HG22 . ILE A 1 101 ? 7.731   2.892   -6.717  1.00 0.00 ? 101 ILE A HG22 2  
ATOM 3707  H HG23 . ILE A 1 101 ? 7.029   1.705   -7.843  1.00 0.00 ? 101 ILE A HG23 2  
ATOM 3708  H HD11 . ILE A 1 101 ? 10.460  1.686   -3.990  1.00 0.00 ? 101 ILE A HD11 2  
ATOM 3709  H HD12 . ILE A 1 101 ? 10.353  0.487   -5.300  1.00 0.00 ? 101 ILE A HD12 2  
ATOM 3710  H HD13 . ILE A 1 101 ? 10.212  2.223   -5.669  1.00 0.00 ? 101 ILE A HD13 2  
ATOM 3711  N N    . GLU A 1 102 ? 6.308   -1.176  -7.851  1.00 0.00 ? 102 GLU A N    2  
ATOM 3712  C CA   . GLU A 1 102 ? 5.498   -1.525  -9.006  1.00 0.00 ? 102 GLU A CA   2  
ATOM 3713  C C    . GLU A 1 102 ? 4.209   -2.217  -8.559  1.00 0.00 ? 102 GLU A C    2  
ATOM 3714  O O    . GLU A 1 102 ? 3.124   -1.883  -9.034  1.00 0.00 ? 102 GLU A O    2  
ATOM 3715  C CB   . GLU A 1 102 ? 6.283   -2.405  -9.981  1.00 0.00 ? 102 GLU A CB   2  
ATOM 3716  C CG   . GLU A 1 102 ? 7.659   -1.803  -10.277 1.00 0.00 ? 102 GLU A CG   2  
ATOM 3717  C CD   . GLU A 1 102 ? 8.070   -2.063  -11.727 1.00 0.00 ? 102 GLU A CD   2  
ATOM 3718  O OE1  . GLU A 1 102 ? 7.277   -1.688  -12.618 1.00 0.00 ? 102 GLU A OE1  2  
ATOM 3719  O OE2  . GLU A 1 102 ? 9.168   -2.631  -11.913 1.00 0.00 ? 102 GLU A OE2  2  
ATOM 3720  H H    . GLU A 1 102 ? 7.267   -1.455  -7.908  1.00 0.00 ? 102 GLU A H    2  
ATOM 3721  H HA   . GLU A 1 102 ? 5.262   -0.578  -9.490  1.00 0.00 ? 102 GLU A HA   2  
ATOM 3722  H HB2  . GLU A 1 102 ? 6.402   -3.404  -9.560  1.00 0.00 ? 102 GLU A HB2  2  
ATOM 3723  H HB3  . GLU A 1 102 ? 5.723   -2.515  -10.909 1.00 0.00 ? 102 GLU A HB3  2  
ATOM 3724  H HG2  . GLU A 1 102 ? 7.638   -0.730  -10.087 1.00 0.00 ? 102 GLU A HG2  2  
ATOM 3725  H HG3  . GLU A 1 102 ? 8.400   -2.232  -9.602  1.00 0.00 ? 102 GLU A HG3  2  
ATOM 3726  N N    . HIS A 1 103 ? 4.369   -3.169  -7.652  1.00 0.00 ? 103 HIS A N    2  
ATOM 3727  C CA   . HIS A 1 103 ? 3.231   -3.911  -7.136  1.00 0.00 ? 103 HIS A CA   2  
ATOM 3728  C C    . HIS A 1 103 ? 2.293   -2.959  -6.392  1.00 0.00 ? 103 HIS A C    2  
ATOM 3729  O O    . HIS A 1 103 ? 1.074   -3.044  -6.535  1.00 0.00 ? 103 HIS A O    2  
ATOM 3730  C CB   . HIS A 1 103 ? 3.694   -5.084  -6.271  1.00 0.00 ? 103 HIS A CB   2  
ATOM 3731  C CG   . HIS A 1 103 ? 2.691   -6.208  -6.172  1.00 0.00 ? 103 HIS A CG   2  
ATOM 3732  N ND1  . HIS A 1 103 ? 1.879   -6.584  -7.229  1.00 0.00 ? 103 HIS A ND1  2  
ATOM 3733  C CD2  . HIS A 1 103 ? 2.377   -7.035  -5.134  1.00 0.00 ? 103 HIS A CD2  2  
ATOM 3734  C CE1  . HIS A 1 103 ? 1.115   -7.591  -6.832  1.00 0.00 ? 103 HIS A CE1  2  
ATOM 3735  N NE2  . HIS A 1 103 ? 1.425   -7.868  -5.533  1.00 0.00 ? 103 HIS A NE2  2  
ATOM 3736  H H    . HIS A 1 103 ? 5.254   -3.435  -7.271  1.00 0.00 ? 103 HIS A H    2  
ATOM 3737  H HA   . HIS A 1 103 ? 2.707   -4.321  -8.000  1.00 0.00 ? 103 HIS A HA   2  
ATOM 3738  H HB2  . HIS A 1 103 ? 4.626   -5.477  -6.678  1.00 0.00 ? 103 HIS A HB2  2  
ATOM 3739  H HB3  . HIS A 1 103 ? 3.914   -4.718  -5.268  1.00 0.00 ? 103 HIS A HB3  2  
ATOM 3740  H HD1  . HIS A 1 103 ? 1.871   -6.166  -8.137  1.00 0.00 ? 103 HIS A HD1  2  
ATOM 3741  H HD2  . HIS A 1 103 ? 2.832   -7.014  -4.143  1.00 0.00 ? 103 HIS A HD2  2  
ATOM 3742  H HE1  . HIS A 1 103 ? 0.370   -8.107  -7.438  1.00 0.00 ? 103 HIS A HE1  2  
ATOM 3743  N N    . PHE A 1 104 ? 2.896   -2.073  -5.612  1.00 0.00 ? 104 PHE A N    2  
ATOM 3744  C CA   . PHE A 1 104 ? 2.130   -1.106  -4.845  1.00 0.00 ? 104 PHE A CA   2  
ATOM 3745  C C    . PHE A 1 104 ? 1.460   -0.084  -5.765  1.00 0.00 ? 104 PHE A C    2  
ATOM 3746  O O    . PHE A 1 104 ? 0.375   0.411   -5.462  1.00 0.00 ? 104 PHE A O    2  
ATOM 3747  C CB   . PHE A 1 104 ? 3.117   -0.380  -3.928  1.00 0.00 ? 104 PHE A CB   2  
ATOM 3748  C CG   . PHE A 1 104 ? 2.513   0.812   -3.184  1.00 0.00 ? 104 PHE A CG   2  
ATOM 3749  C CD1  . PHE A 1 104 ? 1.658   0.604   -2.147  1.00 0.00 ? 104 PHE A CD1  2  
ATOM 3750  C CD2  . PHE A 1 104 ? 2.830   2.080   -3.560  1.00 0.00 ? 104 PHE A CD2  2  
ATOM 3751  C CE1  . PHE A 1 104 ? 1.097   1.711   -1.456  1.00 0.00 ? 104 PHE A CE1  2  
ATOM 3752  C CE2  . PHE A 1 104 ? 2.270   3.187   -2.869  1.00 0.00 ? 104 PHE A CE2  2  
ATOM 3753  C CZ   . PHE A 1 104 ? 1.415   2.979   -1.832  1.00 0.00 ? 104 PHE A CZ   2  
ATOM 3754  H H    . PHE A 1 104 ? 3.888   -2.010  -5.502  1.00 0.00 ? 104 PHE A H    2  
ATOM 3755  H HA   . PHE A 1 104 ? 1.365   -1.659  -4.300  1.00 0.00 ? 104 PHE A HA   2  
ATOM 3756  H HB2  . PHE A 1 104 ? 3.509   -1.090  -3.199  1.00 0.00 ? 104 PHE A HB2  2  
ATOM 3757  H HB3  . PHE A 1 104 ? 3.962   -0.034  -4.522  1.00 0.00 ? 104 PHE A HB3  2  
ATOM 3758  H HD1  . PHE A 1 104 ? 1.403   -0.412  -1.846  1.00 0.00 ? 104 PHE A HD1  2  
ATOM 3759  H HD2  . PHE A 1 104 ? 3.516   2.246   -4.391  1.00 0.00 ? 104 PHE A HD2  2  
ATOM 3760  H HE1  . PHE A 1 104 ? 0.412   1.545   -0.625  1.00 0.00 ? 104 PHE A HE1  2  
ATOM 3761  H HE2  . PHE A 1 104 ? 2.524   4.203   -3.170  1.00 0.00 ? 104 PHE A HE2  2  
ATOM 3762  H HZ   . PHE A 1 104 ? 0.984   3.829   -1.302  1.00 0.00 ? 104 PHE A HZ   2  
ATOM 3763  N N    . MET A 1 105 ? 2.134   0.203   -6.869  1.00 0.00 ? 105 MET A N    2  
ATOM 3764  C CA   . MET A 1 105 ? 1.617   1.158   -7.834  1.00 0.00 ? 105 MET A CA   2  
ATOM 3765  C C    . MET A 1 105 ? 0.481   0.545   -8.657  1.00 0.00 ? 105 MET A C    2  
ATOM 3766  O O    . MET A 1 105 ? -0.477  1.233   -9.006  1.00 0.00 ? 105 MET A O    2  
ATOM 3767  C CB   . MET A 1 105 ? 2.744   1.599   -8.770  1.00 0.00 ? 105 MET A CB   2  
ATOM 3768  C CG   . MET A 1 105 ? 3.582   2.709   -8.132  1.00 0.00 ? 105 MET A CG   2  
ATOM 3769  S SD   . MET A 1 105 ? 3.825   4.038   -9.300  1.00 0.00 ? 105 MET A SD   2  
ATOM 3770  C CE   . MET A 1 105 ? 4.482   3.120   -10.682 1.00 0.00 ? 105 MET A CE   2  
ATOM 3771  H H    . MET A 1 105 ? 3.016   -0.204  -7.107  1.00 0.00 ? 105 MET A H    2  
ATOM 3772  H HA   . MET A 1 105 ? 1.239   1.994   -7.246  1.00 0.00 ? 105 MET A HA   2  
ATOM 3773  H HB2  . MET A 1 105 ? 3.382   0.747   -9.004  1.00 0.00 ? 105 MET A HB2  2  
ATOM 3774  H HB3  . MET A 1 105 ? 2.323   1.951   -9.711  1.00 0.00 ? 105 MET A HB3  2  
ATOM 3775  H HG2  . MET A 1 105 ? 3.084   3.086   -7.239  1.00 0.00 ? 105 MET A HG2  2  
ATOM 3776  H HG3  . MET A 1 105 ? 4.547   2.312   -7.816  1.00 0.00 ? 105 MET A HG3  2  
ATOM 3777  H HE1  . MET A 1 105 ? 4.696   3.803   -11.504 1.00 0.00 ? 105 MET A HE1  2  
ATOM 3778  H HE2  . MET A 1 105 ? 5.400   2.615   -10.380 1.00 0.00 ? 105 MET A HE2  2  
ATOM 3779  H HE3  . MET A 1 105 ? 3.750   2.379   -11.007 1.00 0.00 ? 105 MET A HE3  2  
ATOM 3780  N N    . LYS A 1 106 ? 0.626   -0.740  -8.942  1.00 0.00 ? 106 LYS A N    2  
ATOM 3781  C CA   . LYS A 1 106 ? -0.375  -1.453  -9.716  1.00 0.00 ? 106 LYS A CA   2  
ATOM 3782  C C    . LYS A 1 106 ? -1.531  -1.857  -8.799  1.00 0.00 ? 106 LYS A C    2  
ATOM 3783  O O    . LYS A 1 106 ? -2.697  -1.729  -9.170  1.00 0.00 ? 106 LYS A O    2  
ATOM 3784  C CB   . LYS A 1 106 ? 0.260   -2.629  -10.460 1.00 0.00 ? 106 LYS A CB   2  
ATOM 3785  C CG   . LYS A 1 106 ? -0.718  -3.802  -10.568 1.00 0.00 ? 106 LYS A CG   2  
ATOM 3786  C CD   . LYS A 1 106 ? -0.045  -5.020  -11.203 1.00 0.00 ? 106 LYS A CD   2  
ATOM 3787  C CE   . LYS A 1 106 ? -0.571  -5.261  -12.619 1.00 0.00 ? 106 LYS A CE   2  
ATOM 3788  N NZ   . LYS A 1 106 ? -0.923  -6.687  -12.806 1.00 0.00 ? 106 LYS A NZ   2  
ATOM 3789  H H    . LYS A 1 106 ? 1.409   -1.292  -8.653  1.00 0.00 ? 106 LYS A H    2  
ATOM 3790  H HA   . LYS A 1 106 ? -0.757  -0.764  -10.470 1.00 0.00 ? 106 LYS A HA   2  
ATOM 3791  H HB2  . LYS A 1 106 ? 0.565   -2.313  -11.457 1.00 0.00 ? 106 LYS A HB2  2  
ATOM 3792  H HB3  . LYS A 1 106 ? 1.161   -2.950  -9.939  1.00 0.00 ? 106 LYS A HB3  2  
ATOM 3793  H HG2  . LYS A 1 106 ? -1.090  -4.062  -9.577  1.00 0.00 ? 106 LYS A HG2  2  
ATOM 3794  H HG3  . LYS A 1 106 ? -1.581  -3.506  -11.165 1.00 0.00 ? 106 LYS A HG3  2  
ATOM 3795  H HD2  . LYS A 1 106 ? 1.035   -4.870  -11.233 1.00 0.00 ? 106 LYS A HD2  2  
ATOM 3796  H HD3  . LYS A 1 106 ? -0.227  -5.902  -10.589 1.00 0.00 ? 106 LYS A HD3  2  
ATOM 3797  H HE2  . LYS A 1 106 ? -1.446  -4.638  -12.800 1.00 0.00 ? 106 LYS A HE2  2  
ATOM 3798  H HE3  . LYS A 1 106 ? 0.185   -4.969  -13.349 1.00 0.00 ? 106 LYS A HE3  2  
ATOM 3799  H HZ1  . LYS A 1 106 ? -0.089  -7.220  -12.952 1.00 0.00 ? 106 LYS A HZ1  2  
ATOM 3800  H HZ2  . LYS A 1 106 ? -1.395  -7.023  -11.991 1.00 0.00 ? 106 LYS A HZ2  2  
ATOM 3801  H HZ3  . LYS A 1 106 ? -1.522  -6.781  -13.601 1.00 0.00 ? 106 LYS A HZ3  2  
ATOM 3802  N N    . LEU A 1 107 ? -1.168  -2.337  -7.619  1.00 0.00 ? 107 LEU A N    2  
ATOM 3803  C CA   . LEU A 1 107 ? -2.160  -2.761  -6.645  1.00 0.00 ? 107 LEU A CA   2  
ATOM 3804  C C    . LEU A 1 107 ? -3.218  -1.667  -6.493  1.00 0.00 ? 107 LEU A C    2  
ATOM 3805  O O    . LEU A 1 107 ? -4.405  -1.913  -6.700  1.00 0.00 ? 107 LEU A O    2  
ATOM 3806  C CB   . LEU A 1 107 ? -1.485  -3.152  -5.329  1.00 0.00 ? 107 LEU A CB   2  
ATOM 3807  C CG   . LEU A 1 107 ? -1.087  -4.622  -5.190  1.00 0.00 ? 107 LEU A CG   2  
ATOM 3808  C CD1  . LEU A 1 107 ? -0.503  -4.904  -3.804  1.00 0.00 ? 107 LEU A CD1  2  
ATOM 3809  C CD2  . LEU A 1 107 ? -2.266  -5.542  -5.513  1.00 0.00 ? 107 LEU A CD2  2  
ATOM 3810  H H    . LEU A 1 107 ? -0.217  -2.438  -7.325  1.00 0.00 ? 107 LEU A H    2  
ATOM 3811  H HA   . LEU A 1 107 ? -2.642  -3.656  -7.038  1.00 0.00 ? 107 LEU A HA   2  
ATOM 3812  H HB2  . LEU A 1 107 ? -0.591  -2.540  -5.206  1.00 0.00 ? 107 LEU A HB2  2  
ATOM 3813  H HB3  . LEU A 1 107 ? -2.159  -2.899  -4.510  1.00 0.00 ? 107 LEU A HB3  2  
ATOM 3814  H HG   . LEU A 1 107 ? -0.304  -4.834  -5.918  1.00 0.00 ? 107 LEU A HG   2  
ATOM 3815  H HD11 . LEU A 1 107 ? -0.272  -5.965  -3.716  1.00 0.00 ? 107 LEU A HD11 2  
ATOM 3816  H HD12 . LEU A 1 107 ? 0.407   -4.321  -3.668  1.00 0.00 ? 107 LEU A HD12 2  
ATOM 3817  H HD13 . LEU A 1 107 ? -1.230  -4.626  -3.040  1.00 0.00 ? 107 LEU A HD13 2  
ATOM 3818  H HD21 . LEU A 1 107 ? -2.396  -6.264  -4.706  1.00 0.00 ? 107 LEU A HD21 2  
ATOM 3819  H HD22 . LEU A 1 107 ? -3.173  -4.948  -5.618  1.00 0.00 ? 107 LEU A HD22 2  
ATOM 3820  H HD23 . LEU A 1 107 ? -2.068  -6.072  -6.445  1.00 0.00 ? 107 LEU A HD23 2  
ATOM 3821  N N    . TYR A 1 108 ? -2.750  -0.481  -6.132  1.00 0.00 ? 108 TYR A N    2  
ATOM 3822  C CA   . TYR A 1 108 ? -3.642  0.652   -5.950  1.00 0.00 ? 108 TYR A CA   2  
ATOM 3823  C C    . TYR A 1 108 ? -4.344  1.014   -7.260  1.00 0.00 ? 108 TYR A C    2  
ATOM 3824  O O    . TYR A 1 108 ? -5.292  1.797   -7.265  1.00 0.00 ? 108 TYR A O    2  
ATOM 3825  C CB   . TYR A 1 108 ? -2.754  1.822   -5.520  1.00 0.00 ? 108 TYR A CB   2  
ATOM 3826  C CG   . TYR A 1 108 ? -3.525  3.109   -5.220  1.00 0.00 ? 108 TYR A CG   2  
ATOM 3827  C CD1  . TYR A 1 108 ? -4.069  3.312   -3.968  1.00 0.00 ? 108 TYR A CD1  2  
ATOM 3828  C CD2  . TYR A 1 108 ? -3.676  4.068   -6.201  1.00 0.00 ? 108 TYR A CD2  2  
ATOM 3829  C CE1  . TYR A 1 108 ? -4.794  4.523   -3.685  1.00 0.00 ? 108 TYR A CE1  2  
ATOM 3830  C CE2  . TYR A 1 108 ? -4.401  5.280   -5.918  1.00 0.00 ? 108 TYR A CE2  2  
ATOM 3831  C CZ   . TYR A 1 108 ? -4.924  5.448   -4.674  1.00 0.00 ? 108 TYR A CZ   2  
ATOM 3832  O OH   . TYR A 1 108 ? -5.609  6.592   -4.407  1.00 0.00 ? 108 TYR A OH   2  
ATOM 3833  H H    . TYR A 1 108 ? -1.783  -0.288  -5.965  1.00 0.00 ? 108 TYR A H    2  
ATOM 3834  H HA   . TYR A 1 108 ? -4.392  0.374   -5.209  1.00 0.00 ? 108 TYR A HA   2  
ATOM 3835  H HB2  . TYR A 1 108 ? -2.192  1.532   -4.633  1.00 0.00 ? 108 TYR A HB2  2  
ATOM 3836  H HB3  . TYR A 1 108 ? -2.027  2.021   -6.307  1.00 0.00 ? 108 TYR A HB3  2  
ATOM 3837  H HD1  . TYR A 1 108 ? -3.949  2.555   -3.193  1.00 0.00 ? 108 TYR A HD1  2  
ATOM 3838  H HD2  . TYR A 1 108 ? -3.246  3.908   -7.190  1.00 0.00 ? 108 TYR A HD2  2  
ATOM 3839  H HE1  . TYR A 1 108 ? -5.228  4.696   -2.700  1.00 0.00 ? 108 TYR A HE1  2  
ATOM 3840  H HE2  . TYR A 1 108 ? -4.527  6.045   -6.684  1.00 0.00 ? 108 TYR A HE2  2  
ATOM 3841  H HH   . TYR A 1 108 ? -6.063  6.920   -5.235  1.00 0.00 ? 108 TYR A HH   2  
ATOM 3842  N N    . GLU A 1 109 ? -3.851  0.426   -8.340  1.00 0.00 ? 109 GLU A N    2  
ATOM 3843  C CA   . GLU A 1 109 ? -4.419  0.676   -9.654  1.00 0.00 ? 109 GLU A CA   2  
ATOM 3844  C C    . GLU A 1 109 ? -5.403  -0.434  -10.027 1.00 0.00 ? 109 GLU A C    2  
ATOM 3845  O O    . GLU A 1 109 ? -6.323  -0.215  -10.814 1.00 0.00 ? 109 GLU A O    2  
ATOM 3846  C CB   . GLU A 1 109 ? -3.320  0.813   -10.710 1.00 0.00 ? 109 GLU A CB   2  
ATOM 3847  C CG   . GLU A 1 109 ? -3.908  0.775   -12.122 1.00 0.00 ? 109 GLU A CG   2  
ATOM 3848  C CD   . GLU A 1 109 ? -2.800  0.772   -13.177 1.00 0.00 ? 109 GLU A CD   2  
ATOM 3849  O OE1  . GLU A 1 109 ? -1.737  1.360   -12.885 1.00 0.00 ? 109 GLU A OE1  2  
ATOM 3850  O OE2  . GLU A 1 109 ? -3.043  0.182   -14.252 1.00 0.00 ? 109 GLU A OE2  2  
ATOM 3851  H H    . GLU A 1 109 ? -3.079  -0.210  -8.328  1.00 0.00 ? 109 GLU A H    2  
ATOM 3852  H HA   . GLU A 1 109 ? -4.948  1.625   -9.565  1.00 0.00 ? 109 GLU A HA   2  
ATOM 3853  H HB2  . GLU A 1 109 ? -2.782  1.749   -10.561 1.00 0.00 ? 109 GLU A HB2  2  
ATOM 3854  H HB3  . GLU A 1 109 ? -2.595  0.007   -10.592 1.00 0.00 ? 109 GLU A HB3  2  
ATOM 3855  H HG2  . GLU A 1 109 ? -4.528  -0.114  -12.237 1.00 0.00 ? 109 GLU A HG2  2  
ATOM 3856  H HG3  . GLU A 1 109 ? -4.557  1.638   -12.272 1.00 0.00 ? 109 GLU A HG3  2  
ATOM 3857  N N    . GLU A 1 110 ? -5.176  -1.603  -9.445  1.00 0.00 ? 110 GLU A N    2  
ATOM 3858  C CA   . GLU A 1 110 ? -6.031  -2.748  -9.707  1.00 0.00 ? 110 GLU A CA   2  
ATOM 3859  C C    . GLU A 1 110 ? -7.412  -2.532  -9.086  1.00 0.00 ? 110 GLU A C    2  
ATOM 3860  O O    . GLU A 1 110 ? -8.408  -3.059  -9.580  1.00 0.00 ? 110 GLU A O    2  
ATOM 3861  C CB   . GLU A 1 110 ? -5.393  -4.038  -9.189  1.00 0.00 ? 110 GLU A CB   2  
ATOM 3862  C CG   . GLU A 1 110 ? -5.920  -4.390  -7.796  1.00 0.00 ? 110 GLU A CG   2  
ATOM 3863  C CD   . GLU A 1 110 ? -5.357  -5.730  -7.319  1.00 0.00 ? 110 GLU A CD   2  
ATOM 3864  O OE1  . GLU A 1 110 ? -4.125  -5.905  -7.443  1.00 0.00 ? 110 GLU A OE1  2  
ATOM 3865  O OE2  . GLU A 1 110 ? -6.171  -6.550  -6.841  1.00 0.00 ? 110 GLU A OE2  2  
ATOM 3866  H H    . GLU A 1 110 ? -4.425  -1.773  -8.807  1.00 0.00 ? 110 GLU A H    2  
ATOM 3867  H HA   . GLU A 1 110 ? -6.117  -2.803  -10.792 1.00 0.00 ? 110 GLU A HA   2  
ATOM 3868  H HB2  . GLU A 1 110 ? -5.604  -4.855  -9.879  1.00 0.00 ? 110 GLU A HB2  2  
ATOM 3869  H HB3  . GLU A 1 110 ? -4.309  -3.924  -9.153  1.00 0.00 ? 110 GLU A HB3  2  
ATOM 3870  H HG2  . GLU A 1 110 ? -5.646  -3.605  -7.091  1.00 0.00 ? 110 GLU A HG2  2  
ATOM 3871  H HG3  . GLU A 1 110 ? -7.009  -4.435  -7.816  1.00 0.00 ? 110 GLU A HG3  2  
ATOM 3872  N N    . LYS A 1 111 ? -7.429  -1.755  -8.013  1.00 0.00 ? 111 LYS A N    2  
ATOM 3873  C CA   . LYS A 1 111 ? -8.672  -1.463  -7.320  1.00 0.00 ? 111 LYS A CA   2  
ATOM 3874  C C    . LYS A 1 111 ? -9.343  -0.254  -7.974  1.00 0.00 ? 111 LYS A C    2  
ATOM 3875  O O    . LYS A 1 111 ? -10.429 -0.373  -8.540  1.00 0.00 ? 111 LYS A O    2  
ATOM 3876  C CB   . LYS A 1 111 ? -8.421  -1.290  -5.820  1.00 0.00 ? 111 LYS A CB   2  
ATOM 3877  C CG   . LYS A 1 111 ? -7.887  -2.584  -5.201  1.00 0.00 ? 111 LYS A CG   2  
ATOM 3878  C CD   . LYS A 1 111 ? -8.956  -3.678  -5.209  1.00 0.00 ? 111 LYS A CD   2  
ATOM 3879  C CE   . LYS A 1 111 ? -8.437  -4.957  -4.550  1.00 0.00 ? 111 LYS A CE   2  
ATOM 3880  N NZ   . LYS A 1 111 ? -9.460  -5.526  -3.644  1.00 0.00 ? 111 LYS A NZ   2  
ATOM 3881  H H    . LYS A 1 111 ? -6.614  -1.330  -7.618  1.00 0.00 ? 111 LYS A H    2  
ATOM 3882  H HA   . LYS A 1 111 ? -9.324  -2.328  -7.440  1.00 0.00 ? 111 LYS A HA   2  
ATOM 3883  H HB2  . LYS A 1 111 ? -7.707  -0.483  -5.657  1.00 0.00 ? 111 LYS A HB2  2  
ATOM 3884  H HB3  . LYS A 1 111 ? -9.347  -1.001  -5.324  1.00 0.00 ? 111 LYS A HB3  2  
ATOM 3885  H HG2  . LYS A 1 111 ? -7.012  -2.922  -5.755  1.00 0.00 ? 111 LYS A HG2  2  
ATOM 3886  H HG3  . LYS A 1 111 ? -7.563  -2.394  -4.178  1.00 0.00 ? 111 LYS A HG3  2  
ATOM 3887  H HD2  . LYS A 1 111 ? -9.844  -3.327  -4.682  1.00 0.00 ? 111 LYS A HD2  2  
ATOM 3888  H HD3  . LYS A 1 111 ? -9.258  -3.889  -6.235  1.00 0.00 ? 111 LYS A HD3  2  
ATOM 3889  H HE2  . LYS A 1 111 ? -8.175  -5.687  -5.316  1.00 0.00 ? 111 LYS A HE2  2  
ATOM 3890  H HE3  . LYS A 1 111 ? -7.527  -4.741  -3.991  1.00 0.00 ? 111 LYS A HE3  2  
ATOM 3891  H HZ1  . LYS A 1 111 ? -9.272  -6.497  -3.497  1.00 0.00 ? 111 LYS A HZ1  2  
ATOM 3892  H HZ2  . LYS A 1 111 ? -9.433  -5.045  -2.768  1.00 0.00 ? 111 LYS A HZ2  2  
ATOM 3893  H HZ3  . LYS A 1 111 ? -10.365 -5.420  -4.055  1.00 0.00 ? 111 LYS A HZ3  2  
ATOM 3894  N N    . THR A 1 112 ? -8.670  0.883   -7.874  1.00 0.00 ? 112 THR A N    2  
ATOM 3895  C CA   . THR A 1 112 ? -9.188  2.112   -8.449  1.00 0.00 ? 112 THR A CA   2  
ATOM 3896  C C    . THR A 1 112 ? -9.285  1.990   -9.971  1.00 0.00 ? 112 THR A C    2  
ATOM 3897  O O    . THR A 1 112 ? -10.237 2.479   -10.577 1.00 0.00 ? 112 THR A O    2  
ATOM 3898  C CB   . THR A 1 112 ? -8.292  3.264   -7.989  1.00 0.00 ? 112 THR A CB   2  
ATOM 3899  O OG1  . THR A 1 112 ? -7.060  3.039   -8.669  1.00 0.00 ? 112 THR A OG1  2  
ATOM 3900  C CG2  . THR A 1 112 ? -7.924  3.163   -6.507  1.00 0.00 ? 112 THR A CG2  2  
ATOM 3901  H H    . THR A 1 112 ? -7.788  0.971   -7.412  1.00 0.00 ? 112 THR A H    2  
ATOM 3902  H HA   . THR A 1 112 ? -10.200 2.267   -8.076  1.00 0.00 ? 112 THR A HA   2  
ATOM 3903  H HB   . THR A 1 112 ? -8.751  4.227   -8.211  1.00 0.00 ? 112 THR A HB   2  
ATOM 3904  H HG1  . THR A 1 112 ? -6.600  2.238   -8.286  1.00 0.00 ? 112 THR A HG1  2  
ATOM 3905  H HG21 . THR A 1 112 ? -8.392  2.278   -6.076  1.00 0.00 ? 112 THR A HG21 2  
ATOM 3906  H HG22 . THR A 1 112 ? -6.841  3.088   -6.406  1.00 0.00 ? 112 THR A HG22 2  
ATOM 3907  H HG23 . THR A 1 112 ? -8.277  4.051   -5.984  1.00 0.00 ? 112 THR A HG23 2  
ATOM 3908  N N    . GLY A 1 113 ? -8.288  1.333   -10.545 1.00 0.00 ? 113 GLY A N    2  
ATOM 3909  C CA   . GLY A 1 113 ? -8.249  1.140   -11.985 1.00 0.00 ? 113 GLY A CA   2  
ATOM 3910  C C    . GLY A 1 113 ? -7.288  2.131   -12.645 1.00 0.00 ? 113 GLY A C    2  
ATOM 3911  O O    . GLY A 1 113 ? -6.847  1.915   -13.773 1.00 0.00 ? 113 GLY A O    2  
ATOM 3912  H H    . GLY A 1 113 ? -7.517  0.938   -10.045 1.00 0.00 ? 113 GLY A H    2  
ATOM 3913  H HA2  . GLY A 1 113 ? -7.937  0.120   -12.210 1.00 0.00 ? 113 GLY A HA2  2  
ATOM 3914  H HA3  . GLY A 1 113 ? -9.249  1.266   -12.399 1.00 0.00 ? 113 GLY A HA3  2  
ATOM 3915  N N    . ASN A 1 114 ? -6.993  3.196   -11.915 1.00 0.00 ? 114 ASN A N    2  
ATOM 3916  C CA   . ASN A 1 114 ? -6.093  4.221   -12.416 1.00 0.00 ? 114 ASN A CA   2  
ATOM 3917  C C    . ASN A 1 114 ? -4.701  4.008   -11.816 1.00 0.00 ? 114 ASN A C    2  
ATOM 3918  O O    . ASN A 1 114 ? -4.567  3.430   -10.739 1.00 0.00 ? 114 ASN A O    2  
ATOM 3919  C CB   . ASN A 1 114 ? -6.572  5.618   -12.016 1.00 0.00 ? 114 ASN A CB   2  
ATOM 3920  C CG   . ASN A 1 114 ? -7.452  6.229   -13.107 1.00 0.00 ? 114 ASN A CG   2  
ATOM 3921  O OD1  . ASN A 1 114 ? -6.984  6.877   -14.028 1.00 0.00 ? 114 ASN A OD1  2  
ATOM 3922  N ND2  . ASN A 1 114 ? -8.751  5.987   -12.953 1.00 0.00 ? 114 ASN A ND2  2  
ATOM 3923  H H    . ASN A 1 114 ? -7.357  3.364   -10.998 1.00 0.00 ? 114 ASN A H    2  
ATOM 3924  H HA   . ASN A 1 114 ? -6.102  4.105   -13.499 1.00 0.00 ? 114 ASN A HA   2  
ATOM 3925  H HB2  . ASN A 1 114 ? -7.130  5.561   -11.081 1.00 0.00 ? 114 ASN A HB2  2  
ATOM 3926  H HB3  . ASN A 1 114 ? -5.712  6.262   -11.834 1.00 0.00 ? 114 ASN A HB3  2  
ATOM 3927  H HD21 . ASN A 1 114 ? -9.070  5.447   -12.174 1.00 0.00 ? 114 ASN A HD21 2  
ATOM 3928  H HD22 . ASN A 1 114 ? -9.409  6.345   -13.616 1.00 0.00 ? 114 ASN A HD22 2  
ATOM 3929  N N    . ALA A 1 115 ? -3.700  4.487   -12.541 1.00 0.00 ? 115 ALA A N    2  
ATOM 3930  C CA   . ALA A 1 115 ? -2.324  4.357   -12.094 1.00 0.00 ? 115 ALA A CA   2  
ATOM 3931  C C    . ALA A 1 115 ? -2.106  5.238   -10.862 1.00 0.00 ? 115 ALA A C    2  
ATOM 3932  O O    . ALA A 1 115 ? -2.574  6.374   -10.817 1.00 0.00 ? 115 ALA A O    2  
ATOM 3933  C CB   . ALA A 1 115 ? -1.378  4.716   -13.242 1.00 0.00 ? 115 ALA A CB   2  
ATOM 3934  H H    . ALA A 1 115 ? -3.818  4.956   -13.416 1.00 0.00 ? 115 ALA A H    2  
ATOM 3935  H HA   . ALA A 1 115 ? -2.162  3.314   -11.819 1.00 0.00 ? 115 ALA A HA   2  
ATOM 3936  H HB1  . ALA A 1 115 ? -0.760  5.565   -12.951 1.00 0.00 ? 115 ALA A HB1  2  
ATOM 3937  H HB2  . ALA A 1 115 ? -0.740  3.862   -13.468 1.00 0.00 ? 115 ALA A HB2  2  
ATOM 3938  H HB3  . ALA A 1 115 ? -1.962  4.977   -14.125 1.00 0.00 ? 115 ALA A HB3  2  
ATOM 3939  N N    . TRP A 1 116 ? -1.396  4.679   -9.893  1.00 0.00 ? 116 TRP A N    2  
ATOM 3940  C CA   . TRP A 1 116 ? -1.111  5.400   -8.664  1.00 0.00 ? 116 TRP A CA   2  
ATOM 3941  C C    . TRP A 1 116 ? -0.743  6.838   -9.034  1.00 0.00 ? 116 TRP A C    2  
ATOM 3942  O O    . TRP A 1 116 ? -1.071  7.773   -8.305  1.00 0.00 ? 116 TRP A O    2  
ATOM 3943  C CB   . TRP A 1 116 ? -0.022  4.694   -7.855  1.00 0.00 ? 116 TRP A CB   2  
ATOM 3944  C CG   . TRP A 1 116 ? 0.682   5.595   -6.839  1.00 0.00 ? 116 TRP A CG   2  
ATOM 3945  C CD1  . TRP A 1 116 ? 1.566   6.574   -7.077  1.00 0.00 ? 116 TRP A CD1  2  
ATOM 3946  C CD2  . TRP A 1 116 ? 0.524   5.562   -5.404  1.00 0.00 ? 116 TRP A CD2  2  
ATOM 3947  N NE1  . TRP A 1 116 ? 1.987   7.171   -5.907  1.00 0.00 ? 116 TRP A NE1  2  
ATOM 3948  C CE2  . TRP A 1 116 ? 1.333   6.536   -4.857  1.00 0.00 ? 116 TRP A CE2  2  
ATOM 3949  C CE3  . TRP A 1 116 ? -0.277  4.736   -4.596  1.00 0.00 ? 116 TRP A CE3  2  
ATOM 3950  C CZ2  . TRP A 1 116 ? 1.421   6.776   -3.481  1.00 0.00 ? 116 TRP A CZ2  2  
ATOM 3951  C CZ3  . TRP A 1 116 ? -0.178  4.988   -3.223  1.00 0.00 ? 116 TRP A CZ3  2  
ATOM 3952  C CH2  . TRP A 1 116 ? 0.632   5.965   -2.656  1.00 0.00 ? 116 TRP A CH2  2  
ATOM 3953  H H    . TRP A 1 116 ? -1.020  3.754   -9.938  1.00 0.00 ? 116 TRP A H    2  
ATOM 3954  H HA   . TRP A 1 116 ? -2.015  5.391   -8.055  1.00 0.00 ? 116 TRP A HA   2  
ATOM 3955  H HB2  . TRP A 1 116 ? -0.465  3.848   -7.329  1.00 0.00 ? 116 TRP A HB2  2  
ATOM 3956  H HB3  . TRP A 1 116 ? 0.721   4.288   -8.541  1.00 0.00 ? 116 TRP A HB3  2  
ATOM 3957  H HD1  . TRP A 1 116 ? 1.909   6.862   -8.071  1.00 0.00 ? 116 TRP A HD1  2  
ATOM 3958  H HE1  . TRP A 1 116 ? 2.702   7.990   -5.821  1.00 0.00 ? 116 TRP A HE1  2  
ATOM 3959  H HE3  . TRP A 1 116 ? -0.925  3.960   -5.004  1.00 0.00 ? 116 TRP A HE3  2  
ATOM 3960  H HZ2  . TRP A 1 116 ? 2.069   7.552   -3.073  1.00 0.00 ? 116 TRP A HZ2  2  
ATOM 3961  H HZ3  . TRP A 1 116 ? -0.779  4.375   -2.551  1.00 0.00 ? 116 TRP A HZ3  2  
ATOM 3962  H HH2  . TRP A 1 116 ? 0.653   6.099   -1.575  1.00 0.00 ? 116 TRP A HH2  2  
ATOM 3963  N N    . HIS A 1 117 ? -0.068  6.970   -10.166 1.00 0.00 ? 117 HIS A N    2  
ATOM 3964  C CA   . HIS A 1 117 ? 0.348   8.279   -10.641 1.00 0.00 ? 117 HIS A CA   2  
ATOM 3965  C C    . HIS A 1 117 ? -0.034  8.435   -12.115 1.00 0.00 ? 117 HIS A C    2  
ATOM 3966  O O    . HIS A 1 117 ? 0.734   8.065   -13.001 1.00 0.00 ? 117 HIS A O    2  
ATOM 3967  C CB   . HIS A 1 117 ? 1.841   8.499   -10.389 1.00 0.00 ? 117 HIS A CB   2  
ATOM 3968  C CG   . HIS A 1 117 ? 2.140   9.586   -9.384  1.00 0.00 ? 117 HIS A CG   2  
ATOM 3969  N ND1  . HIS A 1 117 ? 3.144   9.476   -8.438  1.00 0.00 ? 117 HIS A ND1  2  
ATOM 3970  C CD2  . HIS A 1 117 ? 1.558   10.804  -9.188  1.00 0.00 ? 117 HIS A CD2  2  
ATOM 3971  C CE1  . HIS A 1 117 ? 3.156   10.583  -7.711  1.00 0.00 ? 117 HIS A CE1  2  
ATOM 3972  N NE2  . HIS A 1 117 ? 2.172   11.405  -8.177  1.00 0.00 ? 117 HIS A NE2  2  
ATOM 3973  H H    . HIS A 1 117 ? 0.194   6.204   -10.753 1.00 0.00 ? 117 HIS A H    2  
ATOM 3974  H HA   . HIS A 1 117 ? -0.201  9.014   -10.053 1.00 0.00 ? 117 HIS A HA   2  
ATOM 3975  H HB2  . HIS A 1 117 ? 2.282   7.565   -10.041 1.00 0.00 ? 117 HIS A HB2  2  
ATOM 3976  H HB3  . HIS A 1 117 ? 2.325   8.748   -11.333 1.00 0.00 ? 117 HIS A HB3  2  
ATOM 3977  H HD1  . HIS A 1 117 ? 3.757   8.694   -8.323  1.00 0.00 ? 117 HIS A HD1  2  
ATOM 3978  H HD2  . HIS A 1 117 ? 0.728   11.213  -9.765  1.00 0.00 ? 117 HIS A HD2  2  
ATOM 3979  H HE1  . HIS A 1 117 ? 3.834   10.800  -6.885  1.00 0.00 ? 117 HIS A HE1  2  
ATOM 3980  N N    . SER A 1 118 ? -1.221  8.983   -12.330 1.00 0.00 ? 118 SER A N    2  
ATOM 3981  C CA   . SER A 1 118 ? -1.714  9.192   -13.681 1.00 0.00 ? 118 SER A CA   2  
ATOM 3982  C C    . SER A 1 118 ? -2.726  10.339  -13.696 1.00 0.00 ? 118 SER A C    2  
ATOM 3983  O O    . SER A 1 118 ? -3.918  10.117  -13.904 1.00 0.00 ? 118 SER A O    2  
ATOM 3984  C CB   . SER A 1 118 ? -2.349  7.917   -14.240 1.00 0.00 ? 118 SER A CB   2  
ATOM 3985  O OG   . SER A 1 118 ? -1.476  7.235   -15.137 1.00 0.00 ? 118 SER A OG   2  
ATOM 3986  H H    . SER A 1 118 ? -1.840  9.280   -11.603 1.00 0.00 ? 118 SER A H    2  
ATOM 3987  H HA   . SER A 1 118 ? -0.835  9.449   -14.272 1.00 0.00 ? 118 SER A HA   2  
ATOM 3988  H HB2  . SER A 1 118 ? -2.613  7.253   -13.416 1.00 0.00 ? 118 SER A HB2  2  
ATOM 3989  H HB3  . SER A 1 118 ? -3.275  8.169   -14.756 1.00 0.00 ? 118 SER A HB3  2  
ATOM 3990  H HG   . SER A 1 118 ? -2.009  6.696   -15.789 1.00 0.00 ? 118 SER A HG   2  
ATOM 3991  N N    . LYS A 1 119 ? -2.214  11.541  -13.473 1.00 0.00 ? 119 LYS A N    2  
ATOM 3992  C CA   . LYS A 1 119 ? -3.059  12.723  -13.459 1.00 0.00 ? 119 LYS A CA   2  
ATOM 3993  C C    . LYS A 1 119 ? -4.240  12.490  -12.514 1.00 0.00 ? 119 LYS A C    2  
ATOM 3994  O O    . LYS A 1 119 ? -4.332  11.442  -11.877 1.00 0.00 ? 119 LYS A O    2  
ATOM 3995  C CB   . LYS A 1 119 ? -3.475  13.102  -14.882 1.00 0.00 ? 119 LYS A CB   2  
ATOM 3996  C CG   . LYS A 1 119 ? -2.289  13.663  -15.669 1.00 0.00 ? 119 LYS A CG   2  
ATOM 3997  C CD   . LYS A 1 119 ? -1.409  12.535  -16.212 1.00 0.00 ? 119 LYS A CD   2  
ATOM 3998  C CE   . LYS A 1 119 ? -1.577  12.389  -17.725 1.00 0.00 ? 119 LYS A CE   2  
ATOM 3999  N NZ   . LYS A 1 119 ? -0.362  11.795  -18.327 1.00 0.00 ? 119 LYS A NZ   2  
ATOM 4000  H H    . LYS A 1 119 ? -1.244  11.713  -13.305 1.00 0.00 ? 119 LYS A H    2  
ATOM 4001  H HA   . LYS A 1 119 ? -2.461  13.547  -13.068 1.00 0.00 ? 119 LYS A HA   2  
ATOM 4002  H HB2  . LYS A 1 119 ? -3.874  12.226  -15.393 1.00 0.00 ? 119 LYS A HB2  2  
ATOM 4003  H HB3  . LYS A 1 119 ? -4.275  13.842  -14.846 1.00 0.00 ? 119 LYS A HB3  2  
ATOM 4004  H HG2  . LYS A 1 119 ? -2.652  14.275  -16.494 1.00 0.00 ? 119 LYS A HG2  2  
ATOM 4005  H HG3  . LYS A 1 119 ? -1.696  14.314  -15.026 1.00 0.00 ? 119 LYS A HG3  2  
ATOM 4006  H HD2  . LYS A 1 119 ? -0.364  12.739  -15.976 1.00 0.00 ? 119 LYS A HD2  2  
ATOM 4007  H HD3  . LYS A 1 119 ? -1.669  11.597  -15.721 1.00 0.00 ? 119 LYS A HD3  2  
ATOM 4008  H HE2  . LYS A 1 119 ? -2.441  11.761  -17.942 1.00 0.00 ? 119 LYS A HE2  2  
ATOM 4009  H HE3  . LYS A 1 119 ? -1.771  13.364  -18.172 1.00 0.00 ? 119 LYS A HE3  2  
ATOM 4010  H HZ1  . LYS A 1 119 ? 0.171   12.511  -18.777 1.00 0.00 ? 119 LYS A HZ1  2  
ATOM 4011  H HZ2  . LYS A 1 119 ? 0.190   11.368  -17.610 1.00 0.00 ? 119 LYS A HZ2  2  
ATOM 4012  H HZ3  . LYS A 1 119 ? -0.627  11.103  -18.999 1.00 0.00 ? 119 LYS A HZ3  2  
ATOM 4013  N N    . ASN A 1 120 ? -5.114  13.483  -12.455 1.00 0.00 ? 120 ASN A N    2  
ATOM 4014  C CA   . ASN A 1 120 ? -6.285  13.399  -11.599 1.00 0.00 ? 120 ASN A CA   2  
ATOM 4015  C C    . ASN A 1 120 ? -6.881  11.993  -11.693 1.00 0.00 ? 120 ASN A C    2  
ATOM 4016  O O    . ASN A 1 120 ? -6.687  11.299  -12.690 1.00 0.00 ? 120 ASN A O    2  
ATOM 4017  C CB   . ASN A 1 120 ? -7.360  14.397  -12.036 1.00 0.00 ? 120 ASN A CB   2  
ATOM 4018  C CG   . ASN A 1 120 ? -8.112  14.957  -10.827 1.00 0.00 ? 120 ASN A CG   2  
ATOM 4019  O OD1  . ASN A 1 120 ? -7.625  15.805  -10.098 1.00 0.00 ? 120 ASN A OD1  2  
ATOM 4020  N ND2  . ASN A 1 120 ? -9.324  14.436  -10.656 1.00 0.00 ? 120 ASN A ND2  2  
ATOM 4021  H H    . ASN A 1 120 ? -5.032  14.332  -12.977 1.00 0.00 ? 120 ASN A H    2  
ATOM 4022  H HA   . ASN A 1 120 ? -5.926  13.634  -10.597 1.00 0.00 ? 120 ASN A HA   2  
ATOM 4023  H HB2  . ASN A 1 120 ? -6.898  15.214  -12.591 1.00 0.00 ? 120 ASN A HB2  2  
ATOM 4024  H HB3  . ASN A 1 120 ? -8.062  13.909  -12.712 1.00 0.00 ? 120 ASN A HB3  2  
ATOM 4025  H HD21 . ASN A 1 120 ? -9.665  13.743  -11.291 1.00 0.00 ? 120 ASN A HD21 2  
ATOM 4026  H HD22 . ASN A 1 120 ? -9.895  14.738  -9.892  1.00 0.00 ? 120 ASN A HD22 2  
ATOM 4027  N N    . PHE A 1 121 ? -7.593  11.615  -10.642 1.00 0.00 ? 121 PHE A N    2  
ATOM 4028  C CA   . PHE A 1 121 ? -8.217  10.304  -10.593 1.00 0.00 ? 121 PHE A CA   2  
ATOM 4029  C C    . PHE A 1 121 ? -9.685  10.380  -11.017 1.00 0.00 ? 121 PHE A C    2  
ATOM 4030  O O    . PHE A 1 121 ? -10.398 11.307  -10.636 1.00 0.00 ? 121 PHE A O    2  
ATOM 4031  C CB   . PHE A 1 121 ? -8.142  9.826   -9.142  1.00 0.00 ? 121 PHE A CB   2  
ATOM 4032  C CG   . PHE A 1 121 ? -9.056  8.640   -8.829  1.00 0.00 ? 121 PHE A CG   2  
ATOM 4033  C CD1  . PHE A 1 121 ? -8.845  7.440   -9.435  1.00 0.00 ? 121 PHE A CD1  2  
ATOM 4034  C CD2  . PHE A 1 121 ? -10.080 8.784   -7.946  1.00 0.00 ? 121 PHE A CD2  2  
ATOM 4035  C CE1  . PHE A 1 121 ? -9.694  6.339   -9.145  1.00 0.00 ? 121 PHE A CE1  2  
ATOM 4036  C CE2  . PHE A 1 121 ? -10.929 7.683   -7.655  1.00 0.00 ? 121 PHE A CE2  2  
ATOM 4037  C CZ   . PHE A 1 121 ? -10.718 6.484   -8.261  1.00 0.00 ? 121 PHE A CZ   2  
ATOM 4038  H H    . PHE A 1 121 ? -7.745  12.186  -9.835  1.00 0.00 ? 121 PHE A H    2  
ATOM 4039  H HA   . PHE A 1 121 ? -7.674  9.661   -11.286 1.00 0.00 ? 121 PHE A HA   2  
ATOM 4040  H HB2  . PHE A 1 121 ? -7.113  9.548   -8.914  1.00 0.00 ? 121 PHE A HB2  2  
ATOM 4041  H HB3  . PHE A 1 121 ? -8.402  10.655  -8.483  1.00 0.00 ? 121 PHE A HB3  2  
ATOM 4042  H HD1  . PHE A 1 121 ? -8.025  7.324   -10.143 1.00 0.00 ? 121 PHE A HD1  2  
ATOM 4043  H HD2  . PHE A 1 121 ? -10.249 9.745   -7.460  1.00 0.00 ? 121 PHE A HD2  2  
ATOM 4044  H HE1  . PHE A 1 121 ? -9.525  5.378   -9.630  1.00 0.00 ? 121 PHE A HE1  2  
ATOM 4045  H HE2  . PHE A 1 121 ? -11.749 7.799   -6.947  1.00 0.00 ? 121 PHE A HE2  2  
ATOM 4046  H HZ   . PHE A 1 121 ? -11.369 5.639   -8.039  1.00 0.00 ? 121 PHE A HZ   2  
ATOM 4047  N N    . THR A 1 122 ? -10.093 9.393   -11.801 1.00 0.00 ? 122 THR A N    2  
ATOM 4048  C CA   . THR A 1 122 ? -11.464 9.336   -12.282 1.00 0.00 ? 122 THR A CA   2  
ATOM 4049  C C    . THR A 1 122 ? -12.272 8.323   -11.469 1.00 0.00 ? 122 THR A C    2  
ATOM 4050  O O    . THR A 1 122 ? -12.013 7.122   -11.533 1.00 0.00 ? 122 THR A O    2  
ATOM 4051  C CB   . THR A 1 122 ? -11.427 9.024   -13.779 1.00 0.00 ? 122 THR A CB   2  
ATOM 4052  O OG1  . THR A 1 122 ? -10.891 10.206  -14.367 1.00 0.00 ? 122 THR A OG1  2  
ATOM 4053  C CG2  . THR A 1 122 ? -12.827 8.907   -14.387 1.00 0.00 ? 122 THR A CG2  2  
ATOM 4054  H H    . THR A 1 122 ? -9.507  8.643   -12.107 1.00 0.00 ? 122 THR A H    2  
ATOM 4055  H HA   . THR A 1 122 ? -11.923 10.312  -12.124 1.00 0.00 ? 122 THR A HA   2  
ATOM 4056  H HB   . THR A 1 122 ? -10.841 8.126   -13.975 1.00 0.00 ? 122 THR A HB   2  
ATOM 4057  H HG1  . THR A 1 122 ? -11.022 10.184  -15.358 1.00 0.00 ? 122 THR A HG1  2  
ATOM 4058  H HG21 . THR A 1 122 ? -13.256 7.940   -14.126 1.00 0.00 ? 122 THR A HG21 2  
ATOM 4059  H HG22 . THR A 1 122 ? -13.460 9.703   -13.996 1.00 0.00 ? 122 THR A HG22 2  
ATOM 4060  H HG23 . THR A 1 122 ? -12.760 8.995   -15.471 1.00 0.00 ? 122 THR A HG23 2  
ATOM 4061  N N    . LYS A 1 123 ? -13.235 8.844   -10.723 1.00 0.00 ? 123 LYS A N    2  
ATOM 4062  C CA   . LYS A 1 123 ? -14.083 8.000   -9.899  1.00 0.00 ? 123 LYS A CA   2  
ATOM 4063  C C    . LYS A 1 123 ? -14.964 7.133   -10.801 1.00 0.00 ? 123 LYS A C    2  
ATOM 4064  O O    . LYS A 1 123 ? -16.041 7.558   -11.216 1.00 0.00 ? 123 LYS A O    2  
ATOM 4065  C CB   . LYS A 1 123 ? -14.873 8.848   -8.899  1.00 0.00 ? 123 LYS A CB   2  
ATOM 4066  C CG   . LYS A 1 123 ? -14.738 8.291   -7.481  1.00 0.00 ? 123 LYS A CG   2  
ATOM 4067  C CD   . LYS A 1 123 ? -15.820 7.246   -7.197  1.00 0.00 ? 123 LYS A CD   2  
ATOM 4068  C CE   . LYS A 1 123 ? -16.806 7.751   -6.141  1.00 0.00 ? 123 LYS A CE   2  
ATOM 4069  N NZ   . LYS A 1 123 ? -17.662 8.821   -6.702  1.00 0.00 ? 123 LYS A NZ   2  
ATOM 4070  H H    . LYS A 1 123 ? -13.439 9.822   -10.677 1.00 0.00 ? 123 LYS A H    2  
ATOM 4071  H HA   . LYS A 1 123 ? -13.430 7.346   -9.321  1.00 0.00 ? 123 LYS A HA   2  
ATOM 4072  H HB2  . LYS A 1 123 ? -14.515 9.877   -8.925  1.00 0.00 ? 123 LYS A HB2  2  
ATOM 4073  H HB3  . LYS A 1 123 ? -15.924 8.870   -9.187  1.00 0.00 ? 123 LYS A HB3  2  
ATOM 4074  H HG2  . LYS A 1 123 ? -13.753 7.842   -7.355  1.00 0.00 ? 123 LYS A HG2  2  
ATOM 4075  H HG3  . LYS A 1 123 ? -14.814 9.103   -6.758  1.00 0.00 ? 123 LYS A HG3  2  
ATOM 4076  H HD2  . LYS A 1 123 ? -16.355 7.012   -8.117  1.00 0.00 ? 123 LYS A HD2  2  
ATOM 4077  H HD3  . LYS A 1 123 ? -15.356 6.322   -6.853  1.00 0.00 ? 123 LYS A HD3  2  
ATOM 4078  H HE2  . LYS A 1 123 ? -17.427 6.927   -5.791  1.00 0.00 ? 123 LYS A HE2  2  
ATOM 4079  H HE3  . LYS A 1 123 ? -16.261 8.129   -5.277  1.00 0.00 ? 123 LYS A HE3  2  
ATOM 4080  H HZ1  . LYS A 1 123 ? -18.605 8.685   -6.401  1.00 0.00 ? 123 LYS A HZ1  2  
ATOM 4081  H HZ2  . LYS A 1 123 ? -17.335 9.711   -6.382  1.00 0.00 ? 123 LYS A HZ2  2  
ATOM 4082  H HZ3  . LYS A 1 123 ? -17.622 8.791   -7.701  1.00 0.00 ? 123 LYS A HZ3  2  
ATOM 4083  N N    . TYR A 1 124 ? -14.473 5.934   -11.077 1.00 0.00 ? 124 TYR A N    2  
ATOM 4084  C CA   . TYR A 1 124 ? -15.201 5.004   -11.923 1.00 0.00 ? 124 TYR A CA   2  
ATOM 4085  C C    . TYR A 1 124 ? -16.158 4.144   -11.094 1.00 0.00 ? 124 TYR A C    2  
ATOM 4086  O O    . TYR A 1 124 ? -16.032 4.070   -9.873  1.00 0.00 ? 124 TYR A O    2  
ATOM 4087  C CB   . TYR A 1 124 ? -14.146 4.100   -12.562 1.00 0.00 ? 124 TYR A CB   2  
ATOM 4088  C CG   . TYR A 1 124 ? -13.684 4.564   -13.945 1.00 0.00 ? 124 TYR A CG   2  
ATOM 4089  C CD1  . TYR A 1 124 ? -14.604 5.050   -14.852 1.00 0.00 ? 124 TYR A CD1  2  
ATOM 4090  C CD2  . TYR A 1 124 ? -12.348 4.496   -14.286 1.00 0.00 ? 124 TYR A CD2  2  
ATOM 4091  C CE1  . TYR A 1 124 ? -14.169 5.487   -16.154 1.00 0.00 ? 124 TYR A CE1  2  
ATOM 4092  C CE2  . TYR A 1 124 ? -11.914 4.933   -15.587 1.00 0.00 ? 124 TYR A CE2  2  
ATOM 4093  C CZ   . TYR A 1 124 ? -12.846 5.407   -16.457 1.00 0.00 ? 124 TYR A CZ   2  
ATOM 4094  O OH   . TYR A 1 124 ? -12.436 5.819   -17.686 1.00 0.00 ? 124 TYR A OH   2  
ATOM 4095  H H    . TYR A 1 124 ? -13.596 5.597   -10.736 1.00 0.00 ? 124 TYR A H    2  
ATOM 4096  H HA   . TYR A 1 124 ? -15.778 5.584   -12.643 1.00 0.00 ? 124 TYR A HA   2  
ATOM 4097  H HB2  . TYR A 1 124 ? -13.281 4.045   -11.902 1.00 0.00 ? 124 TYR A HB2  2  
ATOM 4098  H HB3  . TYR A 1 124 ? -14.548 3.090   -12.645 1.00 0.00 ? 124 TYR A HB3  2  
ATOM 4099  H HD1  . TYR A 1 124 ? -15.659 5.104   -14.583 1.00 0.00 ? 124 TYR A HD1  2  
ATOM 4100  H HD2  . TYR A 1 124 ? -11.622 4.112   -13.569 1.00 0.00 ? 124 TYR A HD2  2  
ATOM 4101  H HE1  . TYR A 1 124 ? -14.885 5.873   -16.880 1.00 0.00 ? 124 TYR A HE1  2  
ATOM 4102  H HE2  . TYR A 1 124 ? -10.862 4.885   -15.869 1.00 0.00 ? 124 TYR A HE2  2  
ATOM 4103  H HH   . TYR A 1 124 ? -13.156 5.656   -18.360 1.00 0.00 ? 124 TYR A HH   2  
ATOM 4104  N N    . PRO A 1 125 ? -17.117 3.499   -11.810 1.00 0.00 ? 125 PRO A N    2  
ATOM 4105  C CA   . PRO A 1 125 ? -18.094 2.647   -11.154 1.00 0.00 ? 125 PRO A CA   2  
ATOM 4106  C C    . PRO A 1 125 ? -17.467 1.317   -10.731 1.00 0.00 ? 125 PRO A C    2  
ATOM 4107  O O    . PRO A 1 125 ? -16.885 0.612   -11.554 1.00 0.00 ? 125 PRO A O    2  
ATOM 4108  C CB   . PRO A 1 125 ? -19.214 2.479   -12.169 1.00 0.00 ? 125 PRO A CB   2  
ATOM 4109  C CG   . PRO A 1 125 ? -18.616 2.854   -13.515 1.00 0.00 ? 125 PRO A CG   2  
ATOM 4110  C CD   . PRO A 1 125 ? -17.296 3.563   -13.258 1.00 0.00 ? 125 PRO A CD   2  
ATOM 4111  H HA   . PRO A 1 125 ? -18.419 3.076   -10.311 1.00 0.00 ? 125 PRO A HA   2  
ATOM 4112  H HB2  . PRO A 1 125 ? -19.583 1.453   -12.177 1.00 0.00 ? 125 PRO A HB2  2  
ATOM 4113  H HB3  . PRO A 1 125 ? -20.061 3.120   -11.925 1.00 0.00 ? 125 PRO A HB3  2  
ATOM 4114  H HG2  . PRO A 1 125 ? -18.460 1.964   -14.124 1.00 0.00 ? 125 PRO A HG2  2  
ATOM 4115  H HG3  . PRO A 1 125 ? -19.296 3.503   -14.067 1.00 0.00 ? 125 PRO A HG3  2  
ATOM 4116  H HD2  . PRO A 1 125 ? -16.475 3.072   -13.780 1.00 0.00 ? 125 PRO A HD2  2  
ATOM 4117  H HD3  . PRO A 1 125 ? -17.326 4.594   -13.608 1.00 0.00 ? 125 PRO A HD3  2  
ATOM 4118  N N    . LYS A 1 126 ? -17.606 1.014   -9.449  1.00 0.00 ? 126 LYS A N    2  
ATOM 4119  C CA   . LYS A 1 126 ? -17.060 -0.218  -8.907  1.00 0.00 ? 126 LYS A CA   2  
ATOM 4120  C C    . LYS A 1 126 ? -15.555 -0.053  -8.692  1.00 0.00 ? 126 LYS A C    2  
ATOM 4121  O O    . LYS A 1 126 ? -14.887 -0.971  -8.220  1.00 0.00 ? 126 LYS A O    2  
ATOM 4122  C CB   . LYS A 1 126 ? -17.427 -1.405  -9.800  1.00 0.00 ? 126 LYS A CB   2  
ATOM 4123  C CG   . LYS A 1 126 ? -18.907 -1.364  -10.186 1.00 0.00 ? 126 LYS A CG   2  
ATOM 4124  C CD   . LYS A 1 126 ? -19.353 -2.695  -10.795 1.00 0.00 ? 126 LYS A CD   2  
ATOM 4125  C CE   . LYS A 1 126 ? -19.926 -3.624  -9.723  1.00 0.00 ? 126 LYS A CE   2  
ATOM 4126  N NZ   . LYS A 1 126 ? -21.384 -3.798  -9.914  1.00 0.00 ? 126 LYS A NZ   2  
ATOM 4127  H H    . LYS A 1 126 ? -18.081 1.593   -8.786  1.00 0.00 ? 126 LYS A H    2  
ATOM 4128  H HA   . LYS A 1 126 ? -17.531 -0.386  -7.938  1.00 0.00 ? 126 LYS A HA   2  
ATOM 4129  H HB2  . LYS A 1 126 ? -16.813 -1.392  -10.700 1.00 0.00 ? 126 LYS A HB2  2  
ATOM 4130  H HB3  . LYS A 1 126 ? -17.209 -2.338  -9.280  1.00 0.00 ? 126 LYS A HB3  2  
ATOM 4131  H HG2  . LYS A 1 126 ? -19.510 -1.143  -9.305  1.00 0.00 ? 126 LYS A HG2  2  
ATOM 4132  H HG3  . LYS A 1 126 ? -19.079 -0.558  -10.899 1.00 0.00 ? 126 LYS A HG3  2  
ATOM 4133  H HD2  . LYS A 1 126 ? -20.103 -2.514  -11.564 1.00 0.00 ? 126 LYS A HD2  2  
ATOM 4134  H HD3  . LYS A 1 126 ? -18.506 -3.177  -11.283 1.00 0.00 ? 126 LYS A HD3  2  
ATOM 4135  H HE2  . LYS A 1 126 ? -19.430 -4.593  -9.769  1.00 0.00 ? 126 LYS A HE2  2  
ATOM 4136  H HE3  . LYS A 1 126 ? -19.730 -3.212  -8.733  1.00 0.00 ? 126 LYS A HE3  2  
ATOM 4137  H HZ1  . LYS A 1 126 ? -21.548 -4.400  -10.695 1.00 0.00 ? 126 LYS A HZ1  2  
ATOM 4138  H HZ2  . LYS A 1 126 ? -21.782 -4.202  -9.091  1.00 0.00 ? 126 LYS A HZ2  2  
ATOM 4139  H HZ3  . LYS A 1 126 ? -21.806 -2.907  -10.086 1.00 0.00 ? 126 LYS A HZ3  2  
ATOM 4140  N N    . LYS A 1 127 ? -15.064 1.125   -9.050  1.00 0.00 ? 127 LYS A N    2  
ATOM 4141  C CA   . LYS A 1 127 ? -13.649 1.423   -8.902  1.00 0.00 ? 127 LYS A CA   2  
ATOM 4142  C C    . LYS A 1 127 ? -13.395 1.987   -7.503  1.00 0.00 ? 127 LYS A C    2  
ATOM 4143  O O    . LYS A 1 127 ? -14.097 2.894   -7.059  1.00 0.00 ? 127 LYS A O    2  
ATOM 4144  C CB   . LYS A 1 127 ? -13.174 2.339   -10.031 1.00 0.00 ? 127 LYS A CB   2  
ATOM 4145  C CG   . LYS A 1 127 ? -13.006 1.559   -11.337 1.00 0.00 ? 127 LYS A CG   2  
ATOM 4146  C CD   . LYS A 1 127 ? -12.116 0.332   -11.131 1.00 0.00 ? 127 LYS A CD   2  
ATOM 4147  C CE   . LYS A 1 127 ? -11.458 -0.095  -12.445 1.00 0.00 ? 127 LYS A CE   2  
ATOM 4148  N NZ   . LYS A 1 127 ? -10.345 -1.036  -12.186 1.00 0.00 ? 127 LYS A NZ   2  
ATOM 4149  H H    . LYS A 1 127 ? -15.614 1.867   -9.433  1.00 0.00 ? 127 LYS A H    2  
ATOM 4150  H HA   . LYS A 1 127 ? -13.106 0.483   -8.999  1.00 0.00 ? 127 LYS A HA   2  
ATOM 4151  H HB2  . LYS A 1 127 ? -13.891 3.147   -10.176 1.00 0.00 ? 127 LYS A HB2  2  
ATOM 4152  H HB3  . LYS A 1 127 ? -12.226 2.801   -9.755  1.00 0.00 ? 127 LYS A HB3  2  
ATOM 4153  H HG2  . LYS A 1 127 ? -13.983 1.246   -11.706 1.00 0.00 ? 127 LYS A HG2  2  
ATOM 4154  H HG3  . LYS A 1 127 ? -12.570 2.206   -12.097 1.00 0.00 ? 127 LYS A HG3  2  
ATOM 4155  H HD2  . LYS A 1 127 ? -11.347 0.555   -10.391 1.00 0.00 ? 127 LYS A HD2  2  
ATOM 4156  H HD3  . LYS A 1 127 ? -12.710 -0.491  -10.734 1.00 0.00 ? 127 LYS A HD3  2  
ATOM 4157  H HE2  . LYS A 1 127 ? -12.197 -0.566  -13.093 1.00 0.00 ? 127 LYS A HE2  2  
ATOM 4158  H HE3  . LYS A 1 127 ? -11.084 0.783   -12.973 1.00 0.00 ? 127 LYS A HE3  2  
ATOM 4159  H HZ1  . LYS A 1 127 ? -10.073 -0.974  -11.226 1.00 0.00 ? 127 LYS A HZ1  2  
ATOM 4160  H HZ2  . LYS A 1 127 ? -10.643 -1.968  -12.389 1.00 0.00 ? 127 LYS A HZ2  2  
ATOM 4161  H HZ3  . LYS A 1 127 ? -9.567  -0.800  -12.769 1.00 0.00 ? 127 LYS A HZ3  2  
ATOM 4162  N N    . PHE A 1 128 ? -12.388 1.428   -6.848  1.00 0.00 ? 128 PHE A N    2  
ATOM 4163  C CA   . PHE A 1 128 ? -12.032 1.865   -5.509  1.00 0.00 ? 128 PHE A CA   2  
ATOM 4164  C C    . PHE A 1 128 ? -11.449 3.279   -5.530  1.00 0.00 ? 128 PHE A C    2  
ATOM 4165  O O    . PHE A 1 128 ? -10.456 3.535   -6.209  1.00 0.00 ? 128 PHE A O    2  
ATOM 4166  C CB   . PHE A 1 128 ? -10.968 0.895   -4.990  1.00 0.00 ? 128 PHE A CB   2  
ATOM 4167  C CG   . PHE A 1 128 ? -11.529 -0.443  -4.505  1.00 0.00 ? 128 PHE A CG   2  
ATOM 4168  C CD1  . PHE A 1 128 ? -11.920 -0.587  -3.210  1.00 0.00 ? 128 PHE A CD1  2  
ATOM 4169  C CD2  . PHE A 1 128 ? -11.637 -1.489  -5.368  1.00 0.00 ? 128 PHE A CD2  2  
ATOM 4170  C CE1  . PHE A 1 128 ? -12.441 -1.829  -2.760  1.00 0.00 ? 128 PHE A CE1  2  
ATOM 4171  C CE2  . PHE A 1 128 ? -12.158 -2.730  -4.918  1.00 0.00 ? 128 PHE A CE2  2  
ATOM 4172  C CZ   . PHE A 1 128 ? -12.549 -2.875  -3.624  1.00 0.00 ? 128 PHE A CZ   2  
ATOM 4173  H H    . PHE A 1 128 ? -11.822 0.691   -7.217  1.00 0.00 ? 128 PHE A H    2  
ATOM 4174  H HA   . PHE A 1 128 ? -12.945 1.859   -4.913  1.00 0.00 ? 128 PHE A HA   2  
ATOM 4175  H HB2  . PHE A 1 128 ? -10.245 0.708   -5.783  1.00 0.00 ? 128 PHE A HB2  2  
ATOM 4176  H HB3  . PHE A 1 128 ? -10.428 1.369   -4.171  1.00 0.00 ? 128 PHE A HB3  2  
ATOM 4177  H HD1  . PHE A 1 128 ? -11.834 0.250   -2.518  1.00 0.00 ? 128 PHE A HD1  2  
ATOM 4178  H HD2  . PHE A 1 128 ? -11.324 -1.373  -6.406  1.00 0.00 ? 128 PHE A HD2  2  
ATOM 4179  H HE1  . PHE A 1 128 ? -12.754 -1.945  -1.723  1.00 0.00 ? 128 PHE A HE1  2  
ATOM 4180  H HE2  . PHE A 1 128 ? -12.244 -3.568  -5.610  1.00 0.00 ? 128 PHE A HE2  2  
ATOM 4181  H HZ   . PHE A 1 128 ? -12.949 -3.828  -3.278  1.00 0.00 ? 128 PHE A HZ   2  
ATOM 4182  N N    . TYR A 1 129 ? -12.092 4.161   -4.778  1.00 0.00 ? 129 TYR A N    2  
ATOM 4183  C CA   . TYR A 1 129 ? -11.649 5.543   -4.702  1.00 0.00 ? 129 TYR A CA   2  
ATOM 4184  C C    . TYR A 1 129 ? -11.023 5.844   -3.338  1.00 0.00 ? 129 TYR A C    2  
ATOM 4185  O O    . TYR A 1 129 ? -11.211 5.089   -2.385  1.00 0.00 ? 129 TYR A O    2  
ATOM 4186  C CB   . TYR A 1 129 ? -12.906 6.398   -4.872  1.00 0.00 ? 129 TYR A CB   2  
ATOM 4187  C CG   . TYR A 1 129 ? -13.890 6.298   -3.705  1.00 0.00 ? 129 TYR A CG   2  
ATOM 4188  C CD1  . TYR A 1 129 ? -13.572 6.858   -2.484  1.00 0.00 ? 129 TYR A CD1  2  
ATOM 4189  C CD2  . TYR A 1 129 ? -15.096 5.647   -3.872  1.00 0.00 ? 129 TYR A CD2  2  
ATOM 4190  C CE1  . TYR A 1 129 ? -14.498 6.764   -1.385  1.00 0.00 ? 129 TYR A CE1  2  
ATOM 4191  C CE2  . TYR A 1 129 ? -16.022 5.553   -2.773  1.00 0.00 ? 129 TYR A CE2  2  
ATOM 4192  C CZ   . TYR A 1 129 ? -15.677 6.116   -1.584  1.00 0.00 ? 129 TYR A CZ   2  
ATOM 4193  O OH   . TYR A 1 129 ? -16.551 6.027   -0.546  1.00 0.00 ? 129 TYR A OH   2  
ATOM 4194  H H    . TYR A 1 129 ? -12.899 3.944   -4.228  1.00 0.00 ? 129 TYR A H    2  
ATOM 4195  H HA   . TYR A 1 129 ? -10.902 5.700   -5.479  1.00 0.00 ? 129 TYR A HA   2  
ATOM 4196  H HB2  . TYR A 1 129 ? -12.611 7.439   -4.996  1.00 0.00 ? 129 TYR A HB2  2  
ATOM 4197  H HB3  . TYR A 1 129 ? -13.415 6.099   -5.789  1.00 0.00 ? 129 TYR A HB3  2  
ATOM 4198  H HD1  . TYR A 1 129 ? -12.619 7.371   -2.352  1.00 0.00 ? 129 TYR A HD1  2  
ATOM 4199  H HD2  . TYR A 1 129 ? -15.347 5.205   -4.836  1.00 0.00 ? 129 TYR A HD2  2  
ATOM 4200  H HE1  . TYR A 1 129 ? -14.259 7.201   -0.416  1.00 0.00 ? 129 TYR A HE1  2  
ATOM 4201  H HE2  . TYR A 1 129 ? -16.977 5.042   -2.892  1.00 0.00 ? 129 TYR A HE2  2  
ATOM 4202  H HH   . TYR A 1 129 ? -16.102 5.612   0.245   1.00 0.00 ? 129 TYR A HH   2  
ATOM 4203  N N    . PRO A 1 130 ? -10.273 6.977   -3.288  1.00 0.00 ? 130 PRO A N    2  
ATOM 4204  C CA   . PRO A 1 130 ? -9.618  7.387   -2.057  1.00 0.00 ? 130 PRO A CA   2  
ATOM 4205  C C    . PRO A 1 130 ? -10.628 7.970   -1.067  1.00 0.00 ? 130 PRO A C    2  
ATOM 4206  O O    . PRO A 1 130 ? -11.291 8.963   -1.363  1.00 0.00 ? 130 PRO A O    2  
ATOM 4207  C CB   . PRO A 1 130 ? -8.562  8.391   -2.490  1.00 0.00 ? 130 PRO A CB   2  
ATOM 4208  C CG   . PRO A 1 130 ? -8.971  8.854   -3.878  1.00 0.00 ? 130 PRO A CG   2  
ATOM 4209  C CD   . PRO A 1 130 ? -10.029 7.894   -4.397  1.00 0.00 ? 130 PRO A CD   2  
ATOM 4210  H HA   . PRO A 1 130 ? -9.212  6.596   -1.600  1.00 0.00 ? 130 PRO A HA   2  
ATOM 4211  H HB2  . PRO A 1 130 ? -8.515  9.231   -1.796  1.00 0.00 ? 130 PRO A HB2  2  
ATOM 4212  H HB3  . PRO A 1 130 ? -7.573  7.935   -2.505  1.00 0.00 ? 130 PRO A HB3  2  
ATOM 4213  H HG2  . PRO A 1 130 ? -9.362  9.871   -3.842  1.00 0.00 ? 130 PRO A HG2  2  
ATOM 4214  H HG3  . PRO A 1 130 ? -8.109  8.868   -4.545  1.00 0.00 ? 130 PRO A HG3  2  
ATOM 4215  H HD2  . PRO A 1 130 ? -10.939 8.424   -4.681  1.00 0.00 ? 130 PRO A HD2  2  
ATOM 4216  H HD3  . PRO A 1 130 ? -9.681  7.362   -5.282  1.00 0.00 ? 130 PRO A HD3  2  
ATOM 4217  N N    . LEU A 1 131 ? -10.713 7.328   0.089   1.00 0.00 ? 131 LEU A N    2  
ATOM 4218  C CA   . LEU A 1 131 ? -11.631 7.771   1.125   1.00 0.00 ? 131 LEU A CA   2  
ATOM 4219  C C    . LEU A 1 131 ? -11.159 9.117   1.677   1.00 0.00 ? 131 LEU A C    2  
ATOM 4220  O O    . LEU A 1 131 ? -11.723 10.160  1.349   1.00 0.00 ? 131 LEU A O    2  
ATOM 4221  C CB   . LEU A 1 131 ? -11.793 6.690   2.195   1.00 0.00 ? 131 LEU A CB   2  
ATOM 4222  C CG   . LEU A 1 131 ? -12.365 5.353   1.717   1.00 0.00 ? 131 LEU A CG   2  
ATOM 4223  C CD1  . LEU A 1 131 ? -12.189 4.269   2.782   1.00 0.00 ? 131 LEU A CD1  2  
ATOM 4224  C CD2  . LEU A 1 131 ? -13.826 5.504   1.289   1.00 0.00 ? 131 LEU A CD2  2  
ATOM 4225  H H    . LEU A 1 131 ? -10.170 6.522   0.322   1.00 0.00 ? 131 LEU A H    2  
ATOM 4226  H HA   . LEU A 1 131 ? -12.606 7.912   0.659   1.00 0.00 ? 131 LEU A HA   2  
ATOM 4227  H HB2  . LEU A 1 131 ? -10.818 6.504   2.647   1.00 0.00 ? 131 LEU A HB2  2  
ATOM 4228  H HB3  . LEU A 1 131 ? -12.440 7.079   2.981   1.00 0.00 ? 131 LEU A HB3  2  
ATOM 4229  H HG   . LEU A 1 131 ? -11.803 5.036   0.839   1.00 0.00 ? 131 LEU A HG   2  
ATOM 4230  H HD11 . LEU A 1 131 ? -11.143 4.225   3.087   1.00 0.00 ? 131 LEU A HD11 2  
ATOM 4231  H HD12 . LEU A 1 131 ? -12.809 4.505   3.647   1.00 0.00 ? 131 LEU A HD12 2  
ATOM 4232  H HD13 . LEU A 1 131 ? -12.489 3.305   2.372   1.00 0.00 ? 131 LEU A HD13 2  
ATOM 4233  H HD21 . LEU A 1 131 ? -14.451 4.845   1.891   1.00 0.00 ? 131 LEU A HD21 2  
ATOM 4234  H HD22 . LEU A 1 131 ? -14.142 6.537   1.434   1.00 0.00 ? 131 LEU A HD22 2  
ATOM 4235  H HD23 . LEU A 1 131 ? -13.926 5.238   0.237   1.00 0.00 ? 131 LEU A HD23 2  
ATOM 4236  N N    . GLU A 1 132 ? -10.128 9.051   2.507   1.00 0.00 ? 132 GLU A N    2  
ATOM 4237  C CA   . GLU A 1 132 ? -9.574  10.252  3.108   1.00 0.00 ? 132 GLU A CA   2  
ATOM 4238  C C    . GLU A 1 132 ? -9.020  11.181  2.026   1.00 0.00 ? 132 GLU A C    2  
ATOM 4239  O O    . GLU A 1 132 ? -7.852  11.080  1.654   1.00 0.00 ? 132 GLU A O    2  
ATOM 4240  C CB   . GLU A 1 132 ? -8.494  9.903   4.135   1.00 0.00 ? 132 GLU A CB   2  
ATOM 4241  C CG   . GLU A 1 132 ? -8.991  10.156  5.560   1.00 0.00 ? 132 GLU A CG   2  
ATOM 4242  C CD   . GLU A 1 132 ? -8.060  9.510   6.588   1.00 0.00 ? 132 GLU A CD   2  
ATOM 4243  O OE1  . GLU A 1 132 ? -7.871  8.279   6.487   1.00 0.00 ? 132 GLU A OE1  2  
ATOM 4244  O OE2  . GLU A 1 132 ? -7.559  10.262  7.452   1.00 0.00 ? 132 GLU A OE2  2  
ATOM 4245  H H    . GLU A 1 132 ? -9.675  8.200   2.769   1.00 0.00 ? 132 GLU A H    2  
ATOM 4246  H HA   . GLU A 1 132 ? -10.409 10.734  3.617   1.00 0.00 ? 132 GLU A HA   2  
ATOM 4247  H HB2  . GLU A 1 132 ? -8.208  8.857   4.026   1.00 0.00 ? 132 GLU A HB2  2  
ATOM 4248  H HB3  . GLU A 1 132 ? -7.601  10.499  3.947   1.00 0.00 ? 132 GLU A HB3  2  
ATOM 4249  H HG2  . GLU A 1 132 ? -9.052  11.229  5.743   1.00 0.00 ? 132 GLU A HG2  2  
ATOM 4250  H HG3  . GLU A 1 132 ? -9.999  9.755   5.674   1.00 0.00 ? 132 GLU A HG3  2  
ATOM 4251  N N    . ILE A 1 133 ? -9.885  12.064  1.550   1.00 0.00 ? 133 ILE A N    2  
ATOM 4252  C CA   . ILE A 1 133 ? -9.498  13.010  0.517   1.00 0.00 ? 133 ILE A CA   2  
ATOM 4253  C C    . ILE A 1 133 ? -8.235  13.752  0.960   1.00 0.00 ? 133 ILE A C    2  
ATOM 4254  O O    . ILE A 1 133 ? -8.142  14.202  2.101   1.00 0.00 ? 133 ILE A O    2  
ATOM 4255  C CB   . ILE A 1 133 ? -10.666 13.936  0.173   1.00 0.00 ? 133 ILE A CB   2  
ATOM 4256  C CG1  . ILE A 1 133 ? -11.897 13.132  -0.248  1.00 0.00 ? 133 ILE A CG1  2  
ATOM 4257  C CG2  . ILE A 1 133 ? -10.259 14.961  -0.888  1.00 0.00 ? 133 ILE A CG2  2  
ATOM 4258  C CD1  . ILE A 1 133 ? -11.544 12.121  -1.341  1.00 0.00 ? 133 ILE A CD1  2  
ATOM 4259  H H    . ILE A 1 133 ? -10.834 12.140  1.858   1.00 0.00 ? 133 ILE A H    2  
ATOM 4260  H HA   . ILE A 1 133 ? -9.266  12.437  -0.380  1.00 0.00 ? 133 ILE A HA   2  
ATOM 4261  H HB   . ILE A 1 133 ? -10.936 14.493  1.071   1.00 0.00 ? 133 ILE A HB   2  
ATOM 4262  H HG12 . ILE A 1 133 ? -12.309 12.610  0.616   1.00 0.00 ? 133 ILE A HG12 2  
ATOM 4263  H HG13 . ILE A 1 133 ? -12.672 13.809  -0.610  1.00 0.00 ? 133 ILE A HG13 2  
ATOM 4264  H HG21 . ILE A 1 133 ? -10.191 15.948  -0.432  1.00 0.00 ? 133 ILE A HG21 2  
ATOM 4265  H HG22 . ILE A 1 133 ? -9.291  14.686  -1.306  1.00 0.00 ? 133 ILE A HG22 2  
ATOM 4266  H HG23 . ILE A 1 133 ? -11.006 14.977  -1.682  1.00 0.00 ? 133 ILE A HG23 2  
ATOM 4267  H HD11 . ILE A 1 133 ? -12.443 11.863  -1.901  1.00 0.00 ? 133 ILE A HD11 2  
ATOM 4268  H HD12 . ILE A 1 133 ? -10.808 12.558  -2.016  1.00 0.00 ? 133 ILE A HD12 2  
ATOM 4269  H HD13 . ILE A 1 133 ? -11.130 11.222  -0.884  1.00 0.00 ? 133 ILE A HD13 2  
ATOM 4270  N N    . SER A 1 134 ? -7.293  13.857  0.033   1.00 0.00 ? 134 SER A N    2  
ATOM 4271  C CA   . SER A 1 134 ? -6.040  14.536  0.313   1.00 0.00 ? 134 SER A CA   2  
ATOM 4272  C C    . SER A 1 134 ? -5.094  14.403  -0.883  1.00 0.00 ? 134 SER A C    2  
ATOM 4273  O O    . SER A 1 134 ? -4.468  13.361  -1.071  1.00 0.00 ? 134 SER A O    2  
ATOM 4274  C CB   . SER A 1 134 ? -5.381  13.978  1.575   1.00 0.00 ? 134 SER A CB   2  
ATOM 4275  O OG   . SER A 1 134 ? -4.907  15.013  2.433   1.00 0.00 ? 134 SER A OG   2  
ATOM 4276  H H    . SER A 1 134 ? -7.377  13.488  -0.893  1.00 0.00 ? 134 SER A H    2  
ATOM 4277  H HA   . SER A 1 134 ? -6.308  15.580  0.474   1.00 0.00 ? 134 SER A HA   2  
ATOM 4278  H HB2  . SER A 1 134 ? -6.098  13.359  2.115   1.00 0.00 ? 134 SER A HB2  2  
ATOM 4279  H HB3  . SER A 1 134 ? -4.550  13.331  1.295   1.00 0.00 ? 134 SER A HB3  2  
ATOM 4280  H HG   . SER A 1 134 ? -3.925  15.143  2.302   1.00 0.00 ? 134 SER A HG   2  
ATOM 4281  N N    . GLY A 1 135 ? -5.021  15.474  -1.660  1.00 0.00 ? 135 GLY A N    2  
ATOM 4282  C CA   . GLY A 1 135 ? -4.162  15.489  -2.832  1.00 0.00 ? 135 GLY A CA   2  
ATOM 4283  C C    . GLY A 1 135 ? -4.441  16.718  -3.700  1.00 0.00 ? 135 GLY A C    2  
ATOM 4284  O O    . GLY A 1 135 ? -5.574  17.195  -3.762  1.00 0.00 ? 135 GLY A O    2  
ATOM 4285  H H    . GLY A 1 135 ? -5.533  16.317  -1.501  1.00 0.00 ? 135 GLY A H    2  
ATOM 4286  H HA2  . GLY A 1 135 ? -3.117  15.489  -2.522  1.00 0.00 ? 135 GLY A HA2  2  
ATOM 4287  H HA3  . GLY A 1 135 ? -4.322  14.583  -3.417  1.00 0.00 ? 135 GLY A HA3  2  
ATOM 4288  N N    . PRO A 1 136 ? -3.361  17.210  -4.365  1.00 0.00 ? 136 PRO A N    2  
ATOM 4289  C CA   . PRO A 1 136 ? -3.479  18.374  -5.226  1.00 0.00 ? 136 PRO A CA   2  
ATOM 4290  C C    . PRO A 1 136 ? -4.170  18.014  -6.543  1.00 0.00 ? 136 PRO A C    2  
ATOM 4291  O O    . PRO A 1 136 ? -4.628  16.887  -6.720  1.00 0.00 ? 136 PRO A O    2  
ATOM 4292  C CB   . PRO A 1 136 ? -2.054  18.867  -5.418  1.00 0.00 ? 136 PRO A CB   2  
ATOM 4293  C CG   . PRO A 1 136 ? -1.155  17.699  -5.045  1.00 0.00 ? 136 PRO A CG   2  
ATOM 4294  C CD   . PRO A 1 136 ? -2.005  16.672  -4.315  1.00 0.00 ? 136 PRO A CD   2  
ATOM 4295  H HA   . PRO A 1 136 ? -4.056  19.068  -4.795  1.00 0.00 ? 136 PRO A HA   2  
ATOM 4296  H HB2  . PRO A 1 136 ? -1.883  19.177  -6.449  1.00 0.00 ? 136 PRO A HB2  2  
ATOM 4297  H HB3  . PRO A 1 136 ? -1.852  19.733  -4.788  1.00 0.00 ? 136 PRO A HB3  2  
ATOM 4298  H HG2  . PRO A 1 136 ? -0.708  17.261  -5.937  1.00 0.00 ? 136 PRO A HG2  2  
ATOM 4299  H HG3  . PRO A 1 136 ? -0.335  18.036  -4.411  1.00 0.00 ? 136 PRO A HG3  2  
ATOM 4300  H HD2  . PRO A 1 136 ? -1.948  15.696  -4.797  1.00 0.00 ? 136 PRO A HD2  2  
ATOM 4301  H HD3  . PRO A 1 136 ? -1.669  16.539  -3.286  1.00 0.00 ? 136 PRO A HD3  2  
ATOM 4302  N N    . SER A 1 137 ? -4.222  18.994  -7.434  1.00 0.00 ? 137 SER A N    2  
ATOM 4303  C CA   . SER A 1 137 ? -4.850  18.795  -8.729  1.00 0.00 ? 137 SER A CA   2  
ATOM 4304  C C    . SER A 1 137 ? -3.785  18.484  -9.783  1.00 0.00 ? 137 SER A C    2  
ATOM 4305  O O    . SER A 1 137 ? -3.862  17.463  -10.465 1.00 0.00 ? 137 SER A O    2  
ATOM 4306  C CB   . SER A 1 137 ? -5.663  20.024  -9.142  1.00 0.00 ? 137 SER A CB   2  
ATOM 4307  O OG   . SER A 1 137 ? -6.996  19.682  -9.511  1.00 0.00 ? 137 SER A OG   2  
ATOM 4308  H H    . SER A 1 137 ? -3.847  19.908  -7.282  1.00 0.00 ? 137 SER A H    2  
ATOM 4309  H HA   . SER A 1 137 ? -5.518  17.945  -8.598  1.00 0.00 ? 137 SER A HA   2  
ATOM 4310  H HB2  . SER A 1 137 ? -5.686  20.736  -8.317  1.00 0.00 ? 137 SER A HB2  2  
ATOM 4311  H HB3  . SER A 1 137 ? -5.171  20.520  -9.978  1.00 0.00 ? 137 SER A HB3  2  
ATOM 4312  H HG   . SER A 1 137 ? -7.636  19.994  -8.809  1.00 0.00 ? 137 SER A HG   2  
ATOM 4313  N N    . SER A 1 138 ? -2.818  19.384  -9.884  1.00 0.00 ? 138 SER A N    2  
ATOM 4314  C CA   . SER A 1 138 ? -1.739  19.218  -10.844 1.00 0.00 ? 138 SER A CA   2  
ATOM 4315  C C    . SER A 1 138 ? -0.778  20.405  -10.761 1.00 0.00 ? 138 SER A C    2  
ATOM 4316  O O    . SER A 1 138 ? 0.404   20.232  -10.465 1.00 0.00 ? 138 SER A O    2  
ATOM 4317  C CB   . SER A 1 138 ? -2.285  19.076  -12.266 1.00 0.00 ? 138 SER A CB   2  
ATOM 4318  O OG   . SER A 1 138 ? -2.018  17.788  -12.815 1.00 0.00 ? 138 SER A OG   2  
ATOM 4319  H H    . SER A 1 138 ? -2.763  20.211  -9.326  1.00 0.00 ? 138 SER A H    2  
ATOM 4320  H HA   . SER A 1 138 ? -1.235  18.296  -10.555 1.00 0.00 ? 138 SER A HA   2  
ATOM 4321  H HB2  . SER A 1 138 ? -3.361  19.252  -12.261 1.00 0.00 ? 138 SER A HB2  2  
ATOM 4322  H HB3  . SER A 1 138 ? -1.841  19.841  -12.903 1.00 0.00 ? 138 SER A HB3  2  
ATOM 4323  H HG   . SER A 1 138 ? -1.031  17.643  -12.880 1.00 0.00 ? 138 SER A HG   2  
ATOM 4324  N N    . GLY A 1 139 ? -1.320  21.585  -11.027 1.00 0.00 ? 139 GLY A N    2  
ATOM 4325  C CA   . GLY A 1 139 ? -0.525  22.800  -10.985 1.00 0.00 ? 139 GLY A CA   2  
ATOM 4326  C C    . GLY A 1 139 ? -0.486  23.477  -12.357 1.00 0.00 ? 139 GLY A C    2  
ATOM 4327  O O    . GLY A 1 139 ? -0.584  24.699  -12.453 1.00 0.00 ? 139 GLY A O    2  
ATOM 4328  H H    . GLY A 1 139 ? -2.282  21.717  -11.266 1.00 0.00 ? 139 GLY A H    2  
ATOM 4329  H HA2  . GLY A 1 139 ? -0.942  23.487  -10.249 1.00 0.00 ? 139 GLY A HA2  2  
ATOM 4330  H HA3  . GLY A 1 139 ? 0.489   22.565  -10.663 1.00 0.00 ? 139 GLY A HA3  2  
ATOM 4331  N N    . GLY A 1 1   ? 19.350  -21.991 -29.678 1.00 0.00 ? 1   GLY A N    3  
ATOM 4332  C CA   . GLY A 1 1   ? 20.185  -20.838 -29.384 1.00 0.00 ? 1   GLY A CA   3  
ATOM 4333  C C    . GLY A 1 1   ? 20.879  -20.996 -28.030 1.00 0.00 ? 1   GLY A C    3  
ATOM 4334  O O    . GLY A 1 1   ? 21.126  -22.115 -27.581 1.00 0.00 ? 1   GLY A O    3  
ATOM 4335  H H1   . GLY A 1 1   ? 18.800  -22.321 -28.911 1.00 0.00 ? 1   GLY A H1   3  
ATOM 4336  H HA2  . GLY A 1 1   ? 20.932  -20.716 -30.168 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4337  H HA3  . GLY A 1 1   ? 19.575  -19.935 -29.381 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4338  N N    . SER A 1 2   ? 21.175  -19.860 -27.416 1.00 0.00 ? 2   SER A N    3  
ATOM 4339  C CA   . SER A 1 2   ? 21.837  -19.858 -26.123 1.00 0.00 ? 2   SER A CA   3  
ATOM 4340  C C    . SER A 1 2   ? 21.384  -18.646 -25.305 1.00 0.00 ? 2   SER A C    3  
ATOM 4341  O O    . SER A 1 2   ? 20.716  -17.755 -25.828 1.00 0.00 ? 2   SER A O    3  
ATOM 4342  C CB   . SER A 1 2   ? 23.358  -19.852 -26.282 1.00 0.00 ? 2   SER A CB   3  
ATOM 4343  O OG   . SER A 1 2   ? 23.821  -18.677 -26.943 1.00 0.00 ? 2   SER A OG   3  
ATOM 4344  H H    . SER A 1 2   ? 20.971  -18.954 -27.788 1.00 0.00 ? 2   SER A H    3  
ATOM 4345  H HA   . SER A 1 2   ? 21.526  -20.783 -25.638 1.00 0.00 ? 2   SER A HA   3  
ATOM 4346  H HB2  . SER A 1 2   ? 23.826  -19.924 -25.300 1.00 0.00 ? 2   SER A HB2  3  
ATOM 4347  H HB3  . SER A 1 2   ? 23.667  -20.731 -26.847 1.00 0.00 ? 2   SER A HB3  3  
ATOM 4348  H HG   . SER A 1 2   ? 23.164  -18.396 -27.642 1.00 0.00 ? 2   SER A HG   3  
ATOM 4349  N N    . SER A 1 3   ? 21.766  -18.652 -24.037 1.00 0.00 ? 3   SER A N    3  
ATOM 4350  C CA   . SER A 1 3   ? 21.408  -17.564 -23.142 1.00 0.00 ? 3   SER A CA   3  
ATOM 4351  C C    . SER A 1 3   ? 22.011  -17.806 -21.757 1.00 0.00 ? 3   SER A C    3  
ATOM 4352  O O    . SER A 1 3   ? 21.505  -18.624 -20.991 1.00 0.00 ? 3   SER A O    3  
ATOM 4353  C CB   . SER A 1 3   ? 19.889  -17.412 -23.041 1.00 0.00 ? 3   SER A CB   3  
ATOM 4354  O OG   . SER A 1 3   ? 19.447  -16.143 -23.516 1.00 0.00 ? 3   SER A OG   3  
ATOM 4355  H H    . SER A 1 3   ? 22.310  -19.380 -23.620 1.00 0.00 ? 3   SER A H    3  
ATOM 4356  H HA   . SER A 1 3   ? 21.833  -16.667 -23.593 1.00 0.00 ? 3   SER A HA   3  
ATOM 4357  H HB2  . SER A 1 3   ? 19.406  -18.202 -23.616 1.00 0.00 ? 3   SER A HB2  3  
ATOM 4358  H HB3  . SER A 1 3   ? 19.580  -17.538 -22.004 1.00 0.00 ? 3   SER A HB3  3  
ATOM 4359  H HG   . SER A 1 3   ? 19.683  -15.430 -22.857 1.00 0.00 ? 3   SER A HG   3  
ATOM 4360  N N    . GLY A 1 4   ? 23.082  -17.078 -21.478 1.00 0.00 ? 4   GLY A N    3  
ATOM 4361  C CA   . GLY A 1 4   ? 23.759  -17.204 -20.198 1.00 0.00 ? 4   GLY A CA   3  
ATOM 4362  C C    . GLY A 1 4   ? 22.984  -16.480 -19.095 1.00 0.00 ? 4   GLY A C    3  
ATOM 4363  O O    . GLY A 1 4   ? 21.754  -16.471 -19.099 1.00 0.00 ? 4   GLY A O    3  
ATOM 4364  H H    . GLY A 1 4   ? 23.487  -16.415 -22.107 1.00 0.00 ? 4   GLY A H    3  
ATOM 4365  H HA2  . GLY A 1 4   ? 23.866  -18.257 -19.941 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 4366  H HA3  . GLY A 1 4   ? 24.765  -16.790 -20.273 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 4367  N N    . SER A 1 5   ? 23.736  -15.890 -18.177 1.00 0.00 ? 5   SER A N    3  
ATOM 4368  C CA   . SER A 1 5   ? 23.135  -15.165 -17.071 1.00 0.00 ? 5   SER A CA   3  
ATOM 4369  C C    . SER A 1 5   ? 24.228  -14.591 -16.166 1.00 0.00 ? 5   SER A C    3  
ATOM 4370  O O    . SER A 1 5   ? 25.203  -15.274 -15.855 1.00 0.00 ? 5   SER A O    3  
ATOM 4371  C CB   . SER A 1 5   ? 22.199  -16.068 -16.265 1.00 0.00 ? 5   SER A CB   3  
ATOM 4372  O OG   . SER A 1 5   ? 21.640  -15.391 -15.142 1.00 0.00 ? 5   SER A OG   3  
ATOM 4373  H H    . SER A 1 5   ? 24.736  -15.902 -18.182 1.00 0.00 ? 5   SER A H    3  
ATOM 4374  H HA   . SER A 1 5   ? 22.559  -14.363 -17.530 1.00 0.00 ? 5   SER A HA   3  
ATOM 4375  H HB2  . SER A 1 5   ? 21.396  -16.425 -16.909 1.00 0.00 ? 5   SER A HB2  3  
ATOM 4376  H HB3  . SER A 1 5   ? 22.747  -16.945 -15.922 1.00 0.00 ? 5   SER A HB3  3  
ATOM 4377  H HG   . SER A 1 5   ? 21.683  -14.402 -15.283 1.00 0.00 ? 5   SER A HG   3  
ATOM 4378  N N    . SER A 1 6   ? 24.028  -13.343 -15.770 1.00 0.00 ? 6   SER A N    3  
ATOM 4379  C CA   . SER A 1 6   ? 24.985  -12.670 -14.907 1.00 0.00 ? 6   SER A CA   3  
ATOM 4380  C C    . SER A 1 6   ? 24.401  -11.345 -14.413 1.00 0.00 ? 6   SER A C    3  
ATOM 4381  O O    . SER A 1 6   ? 23.372  -10.891 -14.912 1.00 0.00 ? 6   SER A O    3  
ATOM 4382  C CB   . SER A 1 6   ? 26.308  -12.428 -15.635 1.00 0.00 ? 6   SER A CB   3  
ATOM 4383  O OG   . SER A 1 6   ? 26.168  -11.493 -16.701 1.00 0.00 ? 6   SER A OG   3  
ATOM 4384  H H    . SER A 1 6   ? 23.233  -12.795 -16.027 1.00 0.00 ? 6   SER A H    3  
ATOM 4385  H HA   . SER A 1 6   ? 25.149  -13.351 -14.072 1.00 0.00 ? 6   SER A HA   3  
ATOM 4386  H HB2  . SER A 1 6   ? 27.051  -12.061 -14.926 1.00 0.00 ? 6   SER A HB2  3  
ATOM 4387  H HB3  . SER A 1 6   ? 26.683  -13.373 -16.029 1.00 0.00 ? 6   SER A HB3  3  
ATOM 4388  H HG   . SER A 1 6   ? 26.063  -10.569 -16.334 1.00 0.00 ? 6   SER A HG   3  
ATOM 4389  N N    . GLY A 1 7   ? 25.084  -10.761 -13.439 1.00 0.00 ? 7   GLY A N    3  
ATOM 4390  C CA   . GLY A 1 7   ? 24.646  -9.497  -12.872 1.00 0.00 ? 7   GLY A CA   3  
ATOM 4391  C C    . GLY A 1 7   ? 25.261  -9.274  -11.488 1.00 0.00 ? 7   GLY A C    3  
ATOM 4392  O O    . GLY A 1 7   ? 26.244  -9.922  -11.131 1.00 0.00 ? 7   GLY A O    3  
ATOM 4393  H H    . GLY A 1 7   ? 25.920  -11.137 -13.039 1.00 0.00 ? 7   GLY A H    3  
ATOM 4394  H HA2  . GLY A 1 7   ? 24.928  -8.680  -13.535 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 4395  H HA3  . GLY A 1 7   ? 23.558  -9.485  -12.796 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 4396  N N    . LYS A 1 8   ? 24.657  -8.357  -10.748 1.00 0.00 ? 8   LYS A N    3  
ATOM 4397  C CA   . LYS A 1 8   ? 25.132  -8.040  -9.412  1.00 0.00 ? 8   LYS A CA   3  
ATOM 4398  C C    . LYS A 1 8   ? 26.534  -7.433  -9.505  1.00 0.00 ? 8   LYS A C    3  
ATOM 4399  O O    . LYS A 1 8   ? 27.436  -8.031  -10.090 1.00 0.00 ? 8   LYS A O    3  
ATOM 4400  C CB   . LYS A 1 8   ? 25.055  -9.274  -8.510  1.00 0.00 ? 8   LYS A CB   3  
ATOM 4401  C CG   . LYS A 1 8   ? 25.680  -8.992  -7.142  1.00 0.00 ? 8   LYS A CG   3  
ATOM 4402  C CD   . LYS A 1 8   ? 26.403  -10.229 -6.604  1.00 0.00 ? 8   LYS A CD   3  
ATOM 4403  C CE   . LYS A 1 8   ? 27.672  -10.515 -7.409  1.00 0.00 ? 8   LYS A CE   3  
ATOM 4404  N NZ   . LYS A 1 8   ? 28.841  -9.857  -6.785  1.00 0.00 ? 8   LYS A NZ   3  
ATOM 4405  H H    . LYS A 1 8   ? 23.858  -7.834  -11.047 1.00 0.00 ? 8   LYS A H    3  
ATOM 4406  H HA   . LYS A 1 8   ? 24.459  -7.292  -8.994  1.00 0.00 ? 8   LYS A HA   3  
ATOM 4407  H HB2  . LYS A 1 8   ? 24.015  -9.573  -8.384  1.00 0.00 ? 8   LYS A HB2  3  
ATOM 4408  H HB3  . LYS A 1 8   ? 25.571  -10.109 -8.984  1.00 0.00 ? 8   LYS A HB3  3  
ATOM 4409  H HG2  . LYS A 1 8   ? 26.382  -8.162  -7.222  1.00 0.00 ? 8   LYS A HG2  3  
ATOM 4410  H HG3  . LYS A 1 8   ? 24.904  -8.686  -6.440  1.00 0.00 ? 8   LYS A HG3  3  
ATOM 4411  H HD2  . LYS A 1 8   ? 26.659  -10.077 -5.556  1.00 0.00 ? 8   LYS A HD2  3  
ATOM 4412  H HD3  . LYS A 1 8   ? 25.737  -11.091 -6.648  1.00 0.00 ? 8   LYS A HD3  3  
ATOM 4413  H HE2  . LYS A 1 8   ? 27.839  -11.591 -7.466  1.00 0.00 ? 8   LYS A HE2  3  
ATOM 4414  H HE3  . LYS A 1 8   ? 27.549  -10.158 -8.432  1.00 0.00 ? 8   LYS A HE3  3  
ATOM 4415  H HZ1  . LYS A 1 8   ? 29.322  -9.311  -7.471  1.00 0.00 ? 8   LYS A HZ1  3  
ATOM 4416  H HZ2  . LYS A 1 8   ? 28.532  -9.263  -6.042  1.00 0.00 ? 8   LYS A HZ2  3  
ATOM 4417  H HZ3  . LYS A 1 8   ? 29.460  -10.553 -6.420  1.00 0.00 ? 8   LYS A HZ3  3  
ATOM 4418  N N    . SER A 1 9   ? 26.673  -6.253  -8.919  1.00 0.00 ? 9   SER A N    3  
ATOM 4419  C CA   . SER A 1 9   ? 27.949  -5.558  -8.929  1.00 0.00 ? 9   SER A CA   3  
ATOM 4420  C C    . SER A 1 9   ? 27.765  -4.120  -8.441  1.00 0.00 ? 9   SER A C    3  
ATOM 4421  O O    . SER A 1 9   ? 27.236  -3.278  -9.165  1.00 0.00 ? 9   SER A O    3  
ATOM 4422  C CB   . SER A 1 9   ? 28.572  -5.569  -10.326 1.00 0.00 ? 9   SER A CB   3  
ATOM 4423  O OG   . SER A 1 9   ? 29.616  -6.532  -10.437 1.00 0.00 ? 9   SER A OG   3  
ATOM 4424  H H    . SER A 1 9   ? 25.934  -5.773  -8.446  1.00 0.00 ? 9   SER A H    3  
ATOM 4425  H HA   . SER A 1 9   ? 28.586  -6.116  -8.243  1.00 0.00 ? 9   SER A HA   3  
ATOM 4426  H HB2  . SER A 1 9   ? 27.800  -5.785  -11.065 1.00 0.00 ? 9   SER A HB2  3  
ATOM 4427  H HB3  . SER A 1 9   ? 28.965  -4.579  -10.556 1.00 0.00 ? 9   SER A HB3  3  
ATOM 4428  H HG   . SER A 1 9   ? 29.778  -6.752  -11.399 1.00 0.00 ? 9   SER A HG   3  
ATOM 4429  N N    . GLU A 1 10  ? 28.213  -3.882  -7.217  1.00 0.00 ? 10  GLU A N    3  
ATOM 4430  C CA   . GLU A 1 10  ? 28.105  -2.560  -6.624  1.00 0.00 ? 10  GLU A CA   3  
ATOM 4431  C C    . GLU A 1 10  ? 26.638  -2.133  -6.544  1.00 0.00 ? 10  GLU A C    3  
ATOM 4432  O O    . GLU A 1 10  ? 25.820  -2.551  -7.362  1.00 0.00 ? 10  GLU A O    3  
ATOM 4433  C CB   . GLU A 1 10  ? 28.931  -1.539  -7.407  1.00 0.00 ? 10  GLU A CB   3  
ATOM 4434  C CG   . GLU A 1 10  ? 30.377  -1.504  -6.908  1.00 0.00 ? 10  GLU A CG   3  
ATOM 4435  C CD   . GLU A 1 10  ? 31.359  -1.757  -8.054  1.00 0.00 ? 10  GLU A CD   3  
ATOM 4436  O OE1  . GLU A 1 10  ? 31.643  -0.782  -8.783  1.00 0.00 ? 10  GLU A OE1  3  
ATOM 4437  O OE2  . GLU A 1 10  ? 31.803  -2.919  -8.176  1.00 0.00 ? 10  GLU A OE2  3  
ATOM 4438  H H    . GLU A 1 10  ? 28.642  -4.573  -6.635  1.00 0.00 ? 10  GLU A H    3  
ATOM 4439  H HA   . GLU A 1 10  ? 28.517  -2.658  -5.620  1.00 0.00 ? 10  GLU A HA   3  
ATOM 4440  H HB2  . GLU A 1 10  ? 28.915  -1.789  -8.468  1.00 0.00 ? 10  GLU A HB2  3  
ATOM 4441  H HB3  . GLU A 1 10  ? 28.484  -0.549  -7.306  1.00 0.00 ? 10  GLU A HB3  3  
ATOM 4442  H HG2  . GLU A 1 10  ? 30.586  -0.536  -6.453  1.00 0.00 ? 10  GLU A HG2  3  
ATOM 4443  H HG3  . GLU A 1 10  ? 30.516  -2.258  -6.133  1.00 0.00 ? 10  GLU A HG3  3  
ATOM 4444  N N    . LYS A 1 11  ? 26.349  -1.305  -5.550  1.00 0.00 ? 11  LYS A N    3  
ATOM 4445  C CA   . LYS A 1 11  ? 24.995  -0.817  -5.352  1.00 0.00 ? 11  LYS A CA   3  
ATOM 4446  C C    . LYS A 1 11  ? 25.032  0.436   -4.475  1.00 0.00 ? 11  LYS A C    3  
ATOM 4447  O O    . LYS A 1 11  ? 26.092  0.824   -3.985  1.00 0.00 ? 11  LYS A O    3  
ATOM 4448  C CB   . LYS A 1 11  ? 24.100  -1.928  -4.800  1.00 0.00 ? 11  LYS A CB   3  
ATOM 4449  C CG   . LYS A 1 11  ? 23.383  -2.668  -5.931  1.00 0.00 ? 11  LYS A CG   3  
ATOM 4450  C CD   . LYS A 1 11  ? 23.849  -4.123  -6.015  1.00 0.00 ? 11  LYS A CD   3  
ATOM 4451  C CE   . LYS A 1 11  ? 22.798  -5.070  -5.432  1.00 0.00 ? 11  LYS A CE   3  
ATOM 4452  N NZ   . LYS A 1 11  ? 22.025  -5.717  -6.515  1.00 0.00 ? 11  LYS A NZ   3  
ATOM 4453  H H    . LYS A 1 11  ? 27.020  -0.970  -4.889  1.00 0.00 ? 11  LYS A H    3  
ATOM 4454  H HA   . LYS A 1 11  ? 24.601  -0.542  -6.331  1.00 0.00 ? 11  LYS A HA   3  
ATOM 4455  H HB2  . LYS A 1 11  ? 24.701  -2.631  -4.223  1.00 0.00 ? 11  LYS A HB2  3  
ATOM 4456  H HB3  . LYS A 1 11  ? 23.366  -1.502  -4.116  1.00 0.00 ? 11  LYS A HB3  3  
ATOM 4457  H HG2  . LYS A 1 11  ? 22.306  -2.636  -5.765  1.00 0.00 ? 11  LYS A HG2  3  
ATOM 4458  H HG3  . LYS A 1 11  ? 23.575  -2.165  -6.878  1.00 0.00 ? 11  LYS A HG3  3  
ATOM 4459  H HD2  . LYS A 1 11  ? 24.044  -4.386  -7.055  1.00 0.00 ? 11  LYS A HD2  3  
ATOM 4460  H HD3  . LYS A 1 11  ? 24.789  -4.240  -5.475  1.00 0.00 ? 11  LYS A HD3  3  
ATOM 4461  H HE2  . LYS A 1 11  ? 23.284  -5.829  -4.819  1.00 0.00 ? 11  LYS A HE2  3  
ATOM 4462  H HE3  . LYS A 1 11  ? 22.125  -4.516  -4.777  1.00 0.00 ? 11  LYS A HE3  3  
ATOM 4463  H HZ1  . LYS A 1 11  ? 22.087  -6.711  -6.420  1.00 0.00 ? 11  LYS A HZ1  3  
ATOM 4464  H HZ2  . LYS A 1 11  ? 21.068  -5.436  -6.456  1.00 0.00 ? 11  LYS A HZ2  3  
ATOM 4465  H HZ3  . LYS A 1 11  ? 22.399  -5.443  -7.401  1.00 0.00 ? 11  LYS A HZ3  3  
ATOM 4466  N N    . ARG A 1 12  ? 23.863  1.035   -4.304  1.00 0.00 ? 12  ARG A N    3  
ATOM 4467  C CA   . ARG A 1 12  ? 23.749  2.236   -3.495  1.00 0.00 ? 12  ARG A CA   3  
ATOM 4468  C C    . ARG A 1 12  ? 22.363  2.312   -2.850  1.00 0.00 ? 12  ARG A C    3  
ATOM 4469  O O    . ARG A 1 12  ? 21.402  1.746   -3.368  1.00 0.00 ? 12  ARG A O    3  
ATOM 4470  C CB   . ARG A 1 12  ? 23.982  3.492   -4.337  1.00 0.00 ? 12  ARG A CB   3  
ATOM 4471  C CG   . ARG A 1 12  ? 25.411  4.010   -4.165  1.00 0.00 ? 12  ARG A CG   3  
ATOM 4472  C CD   . ARG A 1 12  ? 26.335  3.438   -5.243  1.00 0.00 ? 12  ARG A CD   3  
ATOM 4473  N NE   . ARG A 1 12  ? 26.995  4.538   -5.980  1.00 0.00 ? 12  ARG A NE   3  
ATOM 4474  C CZ   . ARG A 1 12  ? 26.442  5.187   -7.014  1.00 0.00 ? 12  ARG A CZ   3  
ATOM 4475  N NH1  . ARG A 1 12  ? 25.217  4.849   -7.439  1.00 0.00 ? 12  ARG A NH1  3  
ATOM 4476  N NH2  . ARG A 1 12  ? 27.115  6.172   -7.624  1.00 0.00 ? 12  ARG A NH2  3  
ATOM 4477  H H    . ARG A 1 12  ? 23.006  0.713   -4.706  1.00 0.00 ? 12  ARG A H    3  
ATOM 4478  H HA   . ARG A 1 12  ? 24.528  2.138   -2.739  1.00 0.00 ? 12  ARG A HA   3  
ATOM 4479  H HB2  . ARG A 1 12  ? 23.795  3.270   -5.388  1.00 0.00 ? 12  ARG A HB2  3  
ATOM 4480  H HB3  . ARG A 1 12  ? 23.273  4.267   -4.045  1.00 0.00 ? 12  ARG A HB3  3  
ATOM 4481  H HG2  . ARG A 1 12  ? 25.416  5.099   -4.218  1.00 0.00 ? 12  ARG A HG2  3  
ATOM 4482  H HG3  . ARG A 1 12  ? 25.784  3.738   -3.178  1.00 0.00 ? 12  ARG A HG3  3  
ATOM 4483  H HD2  . ARG A 1 12  ? 27.086  2.794   -4.785  1.00 0.00 ? 12  ARG A HD2  3  
ATOM 4484  H HD3  . ARG A 1 12  ? 25.762  2.818   -5.933  1.00 0.00 ? 12  ARG A HD3  3  
ATOM 4485  H HE   . ARG A 1 12  ? 27.910  4.815   -5.689  1.00 0.00 ? 12  ARG A HE   3  
ATOM 4486  H HH11 . ARG A 1 12  ? 24.715  4.114   -6.985  1.00 0.00 ? 12  ARG A HH11 3  
ATOM 4487  H HH12 . ARG A 1 12  ? 24.804  5.333   -8.211  1.00 0.00 ? 12  ARG A HH12 3  
ATOM 4488  H HH21 . ARG A 1 12  ? 28.029  6.424   -7.307  1.00 0.00 ? 12  ARG A HH21 3  
ATOM 4489  H HH22 . ARG A 1 12  ? 26.702  6.656   -8.396  1.00 0.00 ? 12  ARG A HH22 3  
ATOM 4490  N N    . MET A 1 13  ? 22.304  3.017   -1.730  1.00 0.00 ? 13  MET A N    3  
ATOM 4491  C CA   . MET A 1 13  ? 21.053  3.175   -1.009  1.00 0.00 ? 13  MET A CA   3  
ATOM 4492  C C    . MET A 1 13  ? 21.040  4.480   -0.211  1.00 0.00 ? 13  MET A C    3  
ATOM 4493  O O    . MET A 1 13  ? 21.628  4.559   0.866   1.00 0.00 ? 13  MET A O    3  
ATOM 4494  C CB   . MET A 1 13  ? 20.859  1.992   -0.058  1.00 0.00 ? 13  MET A CB   3  
ATOM 4495  C CG   . MET A 1 13  ? 19.931  0.941   -0.671  1.00 0.00 ? 13  MET A CG   3  
ATOM 4496  S SD   . MET A 1 13  ? 20.681  -0.675  -0.558  1.00 0.00 ? 13  MET A SD   3  
ATOM 4497  C CE   . MET A 1 13  ? 20.519  -0.970  1.195   1.00 0.00 ? 13  MET A CE   3  
ATOM 4498  H H    . MET A 1 13  ? 23.091  3.475   -1.315  1.00 0.00 ? 13  MET A H    3  
ATOM 4499  H HA   . MET A 1 13  ? 20.276  3.200   -1.774  1.00 0.00 ? 13  MET A HA   3  
ATOM 4500  H HB2  . MET A 1 13  ? 21.825  1.542   0.169   1.00 0.00 ? 13  MET A HB2  3  
ATOM 4501  H HB3  . MET A 1 13  ? 20.442  2.345   0.886   1.00 0.00 ? 13  MET A HB3  3  
ATOM 4502  H HG2  . MET A 1 13  ? 18.972  0.944   -0.152  1.00 0.00 ? 13  MET A HG2  3  
ATOM 4503  H HG3  . MET A 1 13  ? 19.730  1.186   -1.714  1.00 0.00 ? 13  MET A HG3  3  
ATOM 4504  H HE1  . MET A 1 13  ? 21.439  -1.413  1.575   1.00 0.00 ? 13  MET A HE1  3  
ATOM 4505  H HE2  . MET A 1 13  ? 20.331  -0.026  1.706   1.00 0.00 ? 13  MET A HE2  3  
ATOM 4506  H HE3  . MET A 1 13  ? 19.687  -1.652  1.373   1.00 0.00 ? 13  MET A HE3  3  
ATOM 4507  N N    . LYS A 1 14  ? 20.362  5.471   -0.771  1.00 0.00 ? 14  LYS A N    3  
ATOM 4508  C CA   . LYS A 1 14  ? 20.264  6.769   -0.125  1.00 0.00 ? 14  LYS A CA   3  
ATOM 4509  C C    . LYS A 1 14  ? 18.903  6.891   0.562   1.00 0.00 ? 14  LYS A C    3  
ATOM 4510  O O    . LYS A 1 14  ? 17.879  7.040   -0.103  1.00 0.00 ? 14  LYS A O    3  
ATOM 4511  C CB   . LYS A 1 14  ? 20.549  7.889   -1.127  1.00 0.00 ? 14  LYS A CB   3  
ATOM 4512  C CG   . LYS A 1 14  ? 22.052  8.035   -1.373  1.00 0.00 ? 14  LYS A CG   3  
ATOM 4513  C CD   . LYS A 1 14  ? 22.542  9.427   -0.969  1.00 0.00 ? 14  LYS A CD   3  
ATOM 4514  C CE   . LYS A 1 14  ? 24.067  9.459   -0.849  1.00 0.00 ? 14  LYS A CE   3  
ATOM 4515  N NZ   . LYS A 1 14  ? 24.471  9.728   0.549   1.00 0.00 ? 14  LYS A NZ   3  
ATOM 4516  H H    . LYS A 1 14  ? 19.885  5.399   -1.647  1.00 0.00 ? 14  LYS A H    3  
ATOM 4517  H HA   . LYS A 1 14  ? 21.041  6.814   0.638   1.00 0.00 ? 14  LYS A HA   3  
ATOM 4518  H HB2  . LYS A 1 14  ? 20.042  7.679   -2.069  1.00 0.00 ? 14  LYS A HB2  3  
ATOM 4519  H HB3  . LYS A 1 14  ? 20.146  8.830   -0.752  1.00 0.00 ? 14  LYS A HB3  3  
ATOM 4520  H HG2  . LYS A 1 14  ? 22.593  7.277   -0.806  1.00 0.00 ? 14  LYS A HG2  3  
ATOM 4521  H HG3  . LYS A 1 14  ? 22.271  7.861   -2.427  1.00 0.00 ? 14  LYS A HG3  3  
ATOM 4522  H HD2  . LYS A 1 14  ? 22.216  10.160  -1.707  1.00 0.00 ? 14  LYS A HD2  3  
ATOM 4523  H HD3  . LYS A 1 14  ? 22.093  9.712   -0.017  1.00 0.00 ? 14  LYS A HD3  3  
ATOM 4524  H HE2  . LYS A 1 14  ? 24.483  8.507   -1.178  1.00 0.00 ? 14  LYS A HE2  3  
ATOM 4525  H HE3  . LYS A 1 14  ? 24.473  10.229  -1.506  1.00 0.00 ? 14  LYS A HE3  3  
ATOM 4526  H HZ1  . LYS A 1 14  ? 24.721  8.868   0.995   1.00 0.00 ? 14  LYS A HZ1  3  
ATOM 4527  H HZ2  . LYS A 1 14  ? 25.257  10.347  0.556   1.00 0.00 ? 14  LYS A HZ2  3  
ATOM 4528  H HZ3  . LYS A 1 14  ? 23.710  10.150  1.041   1.00 0.00 ? 14  LYS A HZ3  3  
ATOM 4529  N N    . LEU A 1 15  ? 18.935  6.823   1.885   1.00 0.00 ? 15  LEU A N    3  
ATOM 4530  C CA   . LEU A 1 15  ? 17.716  6.924   2.670   1.00 0.00 ? 15  LEU A CA   3  
ATOM 4531  C C    . LEU A 1 15  ? 18.073  6.952   4.157   1.00 0.00 ? 15  LEU A C    3  
ATOM 4532  O O    . LEU A 1 15  ? 18.741  6.047   4.656   1.00 0.00 ? 15  LEU A O    3  
ATOM 4533  C CB   . LEU A 1 15  ? 16.742  5.807   2.292   1.00 0.00 ? 15  LEU A CB   3  
ATOM 4534  C CG   . LEU A 1 15  ? 15.388  5.828   3.005   1.00 0.00 ? 15  LEU A CG   3  
ATOM 4535  C CD1  . LEU A 1 15  ? 14.325  6.513   2.144   1.00 0.00 ? 15  LEU A CD1  3  
ATOM 4536  C CD2  . LEU A 1 15  ? 14.966  4.417   3.422   1.00 0.00 ? 15  LEU A CD2  3  
ATOM 4537  H H    . LEU A 1 15  ? 19.772  6.702   2.418   1.00 0.00 ? 15  LEU A H    3  
ATOM 4538  H HA   . LEU A 1 15  ? 17.239  7.869   2.411   1.00 0.00 ? 15  LEU A HA   3  
ATOM 4539  H HB2  . LEU A 1 15  ? 16.565  5.854   1.217   1.00 0.00 ? 15  LEU A HB2  3  
ATOM 4540  H HB3  . LEU A 1 15  ? 17.222  4.849   2.494   1.00 0.00 ? 15  LEU A HB3  3  
ATOM 4541  H HG   . LEU A 1 15  ? 15.492  6.415   3.917   1.00 0.00 ? 15  LEU A HG   3  
ATOM 4542  H HD11 . LEU A 1 15  ? 14.810  7.182   1.433   1.00 0.00 ? 15  LEU A HD11 3  
ATOM 4543  H HD12 . LEU A 1 15  ? 13.755  5.758   1.602   1.00 0.00 ? 15  LEU A HD12 3  
ATOM 4544  H HD13 . LEU A 1 15  ? 13.654  7.086   2.783   1.00 0.00 ? 15  LEU A HD13 3  
ATOM 4545  H HD21 . LEU A 1 15  ? 14.426  4.464   4.367   1.00 0.00 ? 15  LEU A HD21 3  
ATOM 4546  H HD22 . LEU A 1 15  ? 14.320  3.990   2.655   1.00 0.00 ? 15  LEU A HD22 3  
ATOM 4547  H HD23 . LEU A 1 15  ? 15.852  3.793   3.540   1.00 0.00 ? 15  LEU A HD23 3  
ATOM 4548  N N    . THR A 1 16  ? 17.613  8.000   4.824   1.00 0.00 ? 16  THR A N    3  
ATOM 4549  C CA   . THR A 1 16  ? 17.875  8.157   6.245   1.00 0.00 ? 16  THR A CA   3  
ATOM 4550  C C    . THR A 1 16  ? 17.181  9.411   6.780   1.00 0.00 ? 16  THR A C    3  
ATOM 4551  O O    . THR A 1 16  ? 16.808  10.295  6.010   1.00 0.00 ? 16  THR A O    3  
ATOM 4552  C CB   . THR A 1 16  ? 19.391  8.169   6.447   1.00 0.00 ? 16  THR A CB   3  
ATOM 4553  O OG1  . THR A 1 16  ? 19.556  8.513   7.820   1.00 0.00 ? 16  THR A OG1  3  
ATOM 4554  C CG2  . THR A 1 16  ? 20.074  9.312   5.693   1.00 0.00 ? 16  THR A CG2  3  
ATOM 4555  H H    . THR A 1 16  ? 17.070  8.731   4.411   1.00 0.00 ? 16  THR A H    3  
ATOM 4556  H HA   . THR A 1 16  ? 17.445  7.305   6.770   1.00 0.00 ? 16  THR A HA   3  
ATOM 4557  H HB   . THR A 1 16  ? 19.828  7.208   6.175   1.00 0.00 ? 16  THR A HB   3  
ATOM 4558  H HG1  . THR A 1 16  ? 19.246  9.450   7.978   1.00 0.00 ? 16  THR A HG1  3  
ATOM 4559  H HG21 . THR A 1 16  ? 19.403  10.171  5.650   1.00 0.00 ? 16  THR A HG21 3  
ATOM 4560  H HG22 . THR A 1 16  ? 20.991  9.593   6.210   1.00 0.00 ? 16  THR A HG22 3  
ATOM 4561  H HG23 . THR A 1 16  ? 20.313  8.988   4.680   1.00 0.00 ? 16  THR A HG23 3  
ATOM 4562  N N    . LEU A 1 17  ? 17.027  9.448   8.095   1.00 0.00 ? 17  LEU A N    3  
ATOM 4563  C CA   . LEU A 1 17  ? 16.384  10.579  8.742   1.00 0.00 ? 17  LEU A CA   3  
ATOM 4564  C C    . LEU A 1 17  ? 14.881  10.534  8.463   1.00 0.00 ? 17  LEU A C    3  
ATOM 4565  O O    . LEU A 1 17  ? 14.081  10.348  9.379   1.00 0.00 ? 17  LEU A O    3  
ATOM 4566  C CB   . LEU A 1 17  ? 17.050  11.890  8.316   1.00 0.00 ? 17  LEU A CB   3  
ATOM 4567  C CG   . LEU A 1 17  ? 17.844  12.622  9.399   1.00 0.00 ? 17  LEU A CG   3  
ATOM 4568  C CD1  . LEU A 1 17  ? 18.998  13.420  8.789   1.00 0.00 ? 17  LEU A CD1  3  
ATOM 4569  C CD2  . LEU A 1 17  ? 16.927  13.501  10.252  1.00 0.00 ? 17  LEU A CD2  3  
ATOM 4570  H H    . LEU A 1 17  ? 17.333  8.725   8.714   1.00 0.00 ? 17  LEU A H    3  
ATOM 4571  H HA   . LEU A 1 17  ? 16.540  10.473  9.816   1.00 0.00 ? 17  LEU A HA   3  
ATOM 4572  H HB2  . LEU A 1 17  ? 17.719  11.680  7.482   1.00 0.00 ? 17  LEU A HB2  3  
ATOM 4573  H HB3  . LEU A 1 17  ? 16.277  12.562  7.943   1.00 0.00 ? 17  LEU A HB3  3  
ATOM 4574  H HG   . LEU A 1 17  ? 18.283  11.877  10.063  1.00 0.00 ? 17  LEU A HG   3  
ATOM 4575  H HD11 . LEU A 1 17  ? 19.908  12.822  8.818   1.00 0.00 ? 17  LEU A HD11 3  
ATOM 4576  H HD12 . LEU A 1 17  ? 18.760  13.669  7.754   1.00 0.00 ? 17  LEU A HD12 3  
ATOM 4577  H HD13 . LEU A 1 17  ? 19.147  14.337  9.358   1.00 0.00 ? 17  LEU A HD13 3  
ATOM 4578  H HD21 . LEU A 1 17  ? 17.498  14.337  10.655  1.00 0.00 ? 17  LEU A HD21 3  
ATOM 4579  H HD22 . LEU A 1 17  ? 16.112  13.882  9.635   1.00 0.00 ? 17  LEU A HD22 3  
ATOM 4580  H HD23 . LEU A 1 17  ? 16.517  12.912  11.072  1.00 0.00 ? 17  LEU A HD23 3  
ATOM 4581  N N    . LYS A 1 18  ? 14.541  10.707  7.194   1.00 0.00 ? 18  LYS A N    3  
ATOM 4582  C CA   . LYS A 1 18  ? 13.148  10.688  6.782   1.00 0.00 ? 18  LYS A CA   3  
ATOM 4583  C C    . LYS A 1 18  ? 12.407  9.594   7.555   1.00 0.00 ? 18  LYS A C    3  
ATOM 4584  O O    . LYS A 1 18  ? 12.697  8.410   7.392   1.00 0.00 ? 18  LYS A O    3  
ATOM 4585  C CB   . LYS A 1 18  ? 13.040  10.548  5.263   1.00 0.00 ? 18  LYS A CB   3  
ATOM 4586  C CG   . LYS A 1 18  ? 12.660  11.881  4.615   1.00 0.00 ? 18  LYS A CG   3  
ATOM 4587  C CD   . LYS A 1 18  ? 13.532  12.163  3.389   1.00 0.00 ? 18  LYS A CD   3  
ATOM 4588  C CE   . LYS A 1 18  ? 12.762  11.892  2.095   1.00 0.00 ? 18  LYS A CE   3  
ATOM 4589  N NZ   . LYS A 1 18  ? 13.635  11.225  1.103   1.00 0.00 ? 18  LYS A NZ   3  
ATOM 4590  H H    . LYS A 1 18  ? 15.198  10.857  6.455   1.00 0.00 ? 18  LYS A H    3  
ATOM 4591  H HA   . LYS A 1 18  ? 12.716  11.652  7.049   1.00 0.00 ? 18  LYS A HA   3  
ATOM 4592  H HB2  . LYS A 1 18  ? 13.990  10.200  4.857   1.00 0.00 ? 18  LYS A HB2  3  
ATOM 4593  H HB3  . LYS A 1 18  ? 12.293  9.793   5.016   1.00 0.00 ? 18  LYS A HB3  3  
ATOM 4594  H HG2  . LYS A 1 18  ? 11.610  11.861  4.322   1.00 0.00 ? 18  LYS A HG2  3  
ATOM 4595  H HG3  . LYS A 1 18  ? 12.773  12.687  5.339   1.00 0.00 ? 18  LYS A HG3  3  
ATOM 4596  H HD2  . LYS A 1 18  ? 13.866  13.200  3.407   1.00 0.00 ? 18  LYS A HD2  3  
ATOM 4597  H HD3  . LYS A 1 18  ? 14.425  11.540  3.423   1.00 0.00 ? 18  LYS A HD3  3  
ATOM 4598  H HE2  . LYS A 1 18  ? 11.895  11.265  2.305   1.00 0.00 ? 18  LYS A HE2  3  
ATOM 4599  H HE3  . LYS A 1 18  ? 12.386  12.829  1.685   1.00 0.00 ? 18  LYS A HE3  3  
ATOM 4600  H HZ1  . LYS A 1 18  ? 13.196  11.247  0.205   1.00 0.00 ? 18  LYS A HZ1  3  
ATOM 4601  H HZ2  . LYS A 1 18  ? 14.512  11.702  1.057   1.00 0.00 ? 18  LYS A HZ2  3  
ATOM 4602  H HZ3  . LYS A 1 18  ? 13.786  10.275  1.377   1.00 0.00 ? 18  LYS A HZ3  3  
ATOM 4603  N N    . GLY A 1 19  ? 11.466  10.031  8.379   1.00 0.00 ? 19  GLY A N    3  
ATOM 4604  C CA   . GLY A 1 19  ? 10.682  9.104   9.177   1.00 0.00 ? 19  GLY A CA   3  
ATOM 4605  C C    . GLY A 1 19  ? 9.913   8.127   8.286   1.00 0.00 ? 19  GLY A C    3  
ATOM 4606  O O    . GLY A 1 19  ? 10.515  7.373   7.523   1.00 0.00 ? 19  GLY A O    3  
ATOM 4607  H H    . GLY A 1 19  ? 11.237  10.996  8.506   1.00 0.00 ? 19  GLY A H    3  
ATOM 4608  H HA2  . GLY A 1 19  ? 11.339  8.550   9.848   1.00 0.00 ? 19  GLY A HA2  3  
ATOM 4609  H HA3  . GLY A 1 19  ? 9.983   9.659   9.803   1.00 0.00 ? 19  GLY A HA3  3  
ATOM 4610  N N    . GLY A 1 20  ? 8.595   8.172   8.412   1.00 0.00 ? 20  GLY A N    3  
ATOM 4611  C CA   . GLY A 1 20  ? 7.738   7.300   7.627   1.00 0.00 ? 20  GLY A CA   3  
ATOM 4612  C C    . GLY A 1 20  ? 6.341   7.206   8.243   1.00 0.00 ? 20  GLY A C    3  
ATOM 4613  O O    . GLY A 1 20  ? 6.138   7.591   9.394   1.00 0.00 ? 20  GLY A O    3  
ATOM 4614  H H    . GLY A 1 20  ? 8.114   8.789   9.035   1.00 0.00 ? 20  GLY A H    3  
ATOM 4615  H HA2  . GLY A 1 20  ? 7.665   7.678   6.607   1.00 0.00 ? 20  GLY A HA2  3  
ATOM 4616  H HA3  . GLY A 1 20  ? 8.181   6.306   7.567   1.00 0.00 ? 20  GLY A HA3  3  
ATOM 4617  N N    . ALA A 1 21  ? 5.413   6.691   7.450   1.00 0.00 ? 21  ALA A N    3  
ATOM 4618  C CA   . ALA A 1 21  ? 4.040   6.540   7.903   1.00 0.00 ? 21  ALA A CA   3  
ATOM 4619  C C    . ALA A 1 21  ? 3.960   5.380   8.897   1.00 0.00 ? 21  ALA A C    3  
ATOM 4620  O O    . ALA A 1 21  ? 4.884   4.573   8.990   1.00 0.00 ? 21  ALA A O    3  
ATOM 4621  C CB   . ALA A 1 21  ? 3.123   6.338   6.695   1.00 0.00 ? 21  ALA A CB   3  
ATOM 4622  H H    . ALA A 1 21  ? 5.586   6.380   6.515   1.00 0.00 ? 21  ALA A H    3  
ATOM 4623  H HA   . ALA A 1 21  ? 3.755   7.462   8.410   1.00 0.00 ? 21  ALA A HA   3  
ATOM 4624  H HB1  . ALA A 1 21  ? 3.613   5.688   5.971   1.00 0.00 ? 21  ALA A HB1  3  
ATOM 4625  H HB2  . ALA A 1 21  ? 2.189   5.881   7.021   1.00 0.00 ? 21  ALA A HB2  3  
ATOM 4626  H HB3  . ALA A 1 21  ? 2.913   7.303   6.233   1.00 0.00 ? 21  ALA A HB3  3  
ATOM 4627  N N    . ALA A 1 22  ? 2.847   5.333   9.615   1.00 0.00 ? 22  ALA A N    3  
ATOM 4628  C CA   . ALA A 1 22  ? 2.635   4.285   10.598  1.00 0.00 ? 22  ALA A CA   3  
ATOM 4629  C C    . ALA A 1 22  ? 2.399   2.956   9.877   1.00 0.00 ? 22  ALA A C    3  
ATOM 4630  O O    . ALA A 1 22  ? 1.815   2.927   8.795   1.00 0.00 ? 22  ALA A O    3  
ATOM 4631  C CB   . ALA A 1 22  ? 1.467   4.669   11.509  1.00 0.00 ? 22  ALA A CB   3  
ATOM 4632  H H    . ALA A 1 22  ? 2.101   5.994   9.533   1.00 0.00 ? 22  ALA A H    3  
ATOM 4633  H HA   . ALA A 1 22  ? 3.539   4.207   11.201  1.00 0.00 ? 22  ALA A HA   3  
ATOM 4634  H HB1  . ALA A 1 22  ? 1.483   5.744   11.687  1.00 0.00 ? 22  ALA A HB1  3  
ATOM 4635  H HB2  . ALA A 1 22  ? 0.527   4.394   11.031  1.00 0.00 ? 22  ALA A HB2  3  
ATOM 4636  H HB3  . ALA A 1 22  ? 1.559   4.142   12.459  1.00 0.00 ? 22  ALA A HB3  3  
ATOM 4637  N N    . VAL A 1 23  ? 2.867   1.887   10.506  1.00 0.00 ? 23  VAL A N    3  
ATOM 4638  C CA   . VAL A 1 23  ? 2.715   0.559   9.938   1.00 0.00 ? 23  VAL A CA   3  
ATOM 4639  C C    . VAL A 1 23  ? 1.666   -0.216  10.739  1.00 0.00 ? 23  VAL A C    3  
ATOM 4640  O O    . VAL A 1 23  ? 1.352   0.146   11.872  1.00 0.00 ? 23  VAL A O    3  
ATOM 4641  C CB   . VAL A 1 23  ? 4.071   -0.148  9.889   1.00 0.00 ? 23  VAL A CB   3  
ATOM 4642  C CG1  . VAL A 1 23  ? 3.908   -1.621  9.509   1.00 0.00 ? 23  VAL A CG1  3  
ATOM 4643  C CG2  . VAL A 1 23  ? 5.025   0.564   8.928   1.00 0.00 ? 23  VAL A CG2  3  
ATOM 4644  H H    . VAL A 1 23  ? 3.341   1.919   11.386  1.00 0.00 ? 23  VAL A H    3  
ATOM 4645  H HA   . VAL A 1 23  ? 2.358   0.677   8.915   1.00 0.00 ? 23  VAL A HA   3  
ATOM 4646  H HB   . VAL A 1 23  ? 4.507   -0.106  10.887  1.00 0.00 ? 23  VAL A HB   3  
ATOM 4647  H HG11 . VAL A 1 23  ? 4.888   -2.057  9.317   1.00 0.00 ? 23  VAL A HG11 3  
ATOM 4648  H HG12 . VAL A 1 23  ? 3.427   -2.156  10.328  1.00 0.00 ? 23  VAL A HG12 3  
ATOM 4649  H HG13 . VAL A 1 23  ? 3.293   -1.699  8.613   1.00 0.00 ? 23  VAL A HG13 3  
ATOM 4650  H HG21 . VAL A 1 23  ? 5.686   -0.168  8.464   1.00 0.00 ? 23  VAL A HG21 3  
ATOM 4651  H HG22 . VAL A 1 23  ? 4.450   1.074   8.156   1.00 0.00 ? 23  VAL A HG22 3  
ATOM 4652  H HG23 . VAL A 1 23  ? 5.620   1.292   9.480   1.00 0.00 ? 23  VAL A HG23 3  
ATOM 4653  N N    . ASP A 1 24  ? 1.152   -1.268  10.118  1.00 0.00 ? 24  ASP A N    3  
ATOM 4654  C CA   . ASP A 1 24  ? 0.145   -2.097  10.758  1.00 0.00 ? 24  ASP A CA   3  
ATOM 4655  C C    . ASP A 1 24  ? 0.831   -3.101  11.685  1.00 0.00 ? 24  ASP A C    3  
ATOM 4656  O O    . ASP A 1 24  ? 1.884   -3.642  11.350  1.00 0.00 ? 24  ASP A O    3  
ATOM 4657  C CB   . ASP A 1 24  ? -0.661  -2.883  9.722   1.00 0.00 ? 24  ASP A CB   3  
ATOM 4658  C CG   . ASP A 1 24  ? -2.177  -2.688  9.798   1.00 0.00 ? 24  ASP A CG   3  
ATOM 4659  O OD1  . ASP A 1 24  ? -2.594  -1.770  10.536  1.00 0.00 ? 24  ASP A OD1  3  
ATOM 4660  O OD2  . ASP A 1 24  ? -2.883  -3.461  9.116   1.00 0.00 ? 24  ASP A OD2  3  
ATOM 4661  H H    . ASP A 1 24  ? 1.412   -1.555  9.196   1.00 0.00 ? 24  ASP A H    3  
ATOM 4662  H HA   . ASP A 1 24  ? -0.497  -1.401  11.299  1.00 0.00 ? 24  ASP A HA   3  
ATOM 4663  H HB2  . ASP A 1 24  ? -0.322  -2.597  8.727   1.00 0.00 ? 24  ASP A HB2  3  
ATOM 4664  H HB3  . ASP A 1 24  ? -0.440  -3.944  9.842   1.00 0.00 ? 24  ASP A HB3  3  
ATOM 4665  N N    . PRO A 1 25  ? 0.191   -3.327  12.864  1.00 0.00 ? 25  PRO A N    3  
ATOM 4666  C CA   . PRO A 1 25  ? 0.729   -4.257  13.842  1.00 0.00 ? 25  PRO A CA   3  
ATOM 4667  C C    . PRO A 1 25  ? 0.504   -5.705  13.403  1.00 0.00 ? 25  PRO A C    3  
ATOM 4668  O O    . PRO A 1 25  ? 1.177   -6.615  13.885  1.00 0.00 ? 25  PRO A O    3  
ATOM 4669  C CB   . PRO A 1 25  ? 0.020   -3.914  15.142  1.00 0.00 ? 25  PRO A CB   3  
ATOM 4670  C CG   . PRO A 1 25  ? -1.216  -3.123  14.747  1.00 0.00 ? 25  PRO A CG   3  
ATOM 4671  C CD   . PRO A 1 25  ? -1.058  -2.704  13.294  1.00 0.00 ? 25  PRO A CD   3  
ATOM 4672  H HA   . PRO A 1 25  ? 1.720   -4.145  13.919  1.00 0.00 ? 25  PRO A HA   3  
ATOM 4673  H HB2  . PRO A 1 25  ? -0.251  -4.817  15.689  1.00 0.00 ? 25  PRO A HB2  3  
ATOM 4674  H HB3  . PRO A 1 25  ? 0.666   -3.327  15.796  1.00 0.00 ? 25  PRO A HB3  3  
ATOM 4675  H HG2  . PRO A 1 25  ? -2.113  -3.730  14.874  1.00 0.00 ? 25  PRO A HG2  3  
ATOM 4676  H HG3  . PRO A 1 25  ? -1.330  -2.248  15.386  1.00 0.00 ? 25  PRO A HG3  3  
ATOM 4677  H HD2  . PRO A 1 25  ? -1.899  -3.044  12.690  1.00 0.00 ? 25  PRO A HD2  3  
ATOM 4678  H HD3  . PRO A 1 25  ? -1.013  -1.620  13.198  1.00 0.00 ? 25  PRO A HD3  3  
ATOM 4679  N N    . ASP A 1 26  ? -0.444  -5.874  12.493  1.00 0.00 ? 26  ASP A N    3  
ATOM 4680  C CA   . ASP A 1 26  ? -0.766  -7.196  11.983  1.00 0.00 ? 26  ASP A CA   3  
ATOM 4681  C C    . ASP A 1 26  ? 0.300   -7.621  10.972  1.00 0.00 ? 26  ASP A C    3  
ATOM 4682  O O    . ASP A 1 26  ? 0.402   -8.798  10.630  1.00 0.00 ? 26  ASP A O    3  
ATOM 4683  C CB   . ASP A 1 26  ? -2.121  -7.197  11.272  1.00 0.00 ? 26  ASP A CB   3  
ATOM 4684  C CG   . ASP A 1 26  ? -3.335  -7.067  12.193  1.00 0.00 ? 26  ASP A CG   3  
ATOM 4685  O OD1  . ASP A 1 26  ? -3.507  -7.973  13.037  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 4686  O OD2  . ASP A 1 26  ? -4.065  -6.065  12.032  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 4687  H H    . ASP A 1 26  ? -0.987  -5.128  12.106  1.00 0.00 ? 26  ASP A H    3  
ATOM 4688  H HA   . ASP A 1 26  ? -0.791  -7.842  12.860  1.00 0.00 ? 26  ASP A HA   3  
ATOM 4689  H HB2  . ASP A 1 26  ? -2.138  -6.376  10.554  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 4690  H HB3  . ASP A 1 26  ? -2.214  -8.121  10.701  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 4691  N N    . SER A 1 27  ? 1.067   -6.640  10.521  1.00 0.00 ? 27  SER A N    3  
ATOM 4692  C CA   . SER A 1 27  ? 2.122   -6.898  9.555   1.00 0.00 ? 27  SER A CA   3  
ATOM 4693  C C    . SER A 1 27  ? 3.367   -7.427  10.269  1.00 0.00 ? 27  SER A C    3  
ATOM 4694  O O    . SER A 1 27  ? 4.141   -8.189  9.692   1.00 0.00 ? 27  SER A O    3  
ATOM 4695  C CB   . SER A 1 27  ? 2.462   -5.636  8.761   1.00 0.00 ? 27  SER A CB   3  
ATOM 4696  O OG   . SER A 1 27  ? 1.639   -4.533  9.132   1.00 0.00 ? 27  SER A OG   3  
ATOM 4697  H H    . SER A 1 27  ? 0.978   -5.685  10.804  1.00 0.00 ? 27  SER A H    3  
ATOM 4698  H HA   . SER A 1 27  ? 1.718   -7.653  8.881   1.00 0.00 ? 27  SER A HA   3  
ATOM 4699  H HB2  . SER A 1 27  ? 3.509   -5.377  8.921   1.00 0.00 ? 27  SER A HB2  3  
ATOM 4700  H HB3  . SER A 1 27  ? 2.343   -5.834  7.696   1.00 0.00 ? 27  SER A HB3  3  
ATOM 4701  H HG   . SER A 1 27  ? 2.193   -3.826  9.572   1.00 0.00 ? 27  SER A HG   3  
ATOM 4702  N N    . GLY A 1 28  ? 3.521   -7.002  11.515  1.00 0.00 ? 28  GLY A N    3  
ATOM 4703  C CA   . GLY A 1 28  ? 4.659   -7.424  12.314  1.00 0.00 ? 28  GLY A CA   3  
ATOM 4704  C C    . GLY A 1 28  ? 5.941   -6.725  11.854  1.00 0.00 ? 28  GLY A C    3  
ATOM 4705  O O    . GLY A 1 28  ? 7.030   -7.046  12.327  1.00 0.00 ? 28  GLY A O    3  
ATOM 4706  H H    . GLY A 1 28  ? 2.887   -6.383  11.977  1.00 0.00 ? 28  GLY A H    3  
ATOM 4707  H HA2  . GLY A 1 28  ? 4.474   -7.198  13.364  1.00 0.00 ? 28  GLY A HA2  3  
ATOM 4708  H HA3  . GLY A 1 28  ? 4.782   -8.504  12.237  1.00 0.00 ? 28  GLY A HA3  3  
ATOM 4709  N N    . LEU A 1 29  ? 5.768   -5.783  10.939  1.00 0.00 ? 29  LEU A N    3  
ATOM 4710  C CA   . LEU A 1 29  ? 6.897   -5.037  10.411  1.00 0.00 ? 29  LEU A CA   3  
ATOM 4711  C C    . LEU A 1 29  ? 6.856   -3.607  10.954  1.00 0.00 ? 29  LEU A C    3  
ATOM 4712  O O    . LEU A 1 29  ? 7.636   -2.756  10.530  1.00 0.00 ? 29  LEU A O    3  
ATOM 4713  C CB   . LEU A 1 29  ? 6.922   -5.114  8.883   1.00 0.00 ? 29  LEU A CB   3  
ATOM 4714  C CG   . LEU A 1 29  ? 6.282   -6.358  8.263   1.00 0.00 ? 29  LEU A CG   3  
ATOM 4715  C CD1  . LEU A 1 29  ? 6.079   -6.178  6.757   1.00 0.00 ? 29  LEU A CD1  3  
ATOM 4716  C CD2  . LEU A 1 29  ? 7.098   -7.612  8.586   1.00 0.00 ? 29  LEU A CD2  3  
ATOM 4717  H H    . LEU A 1 29  ? 4.878   -5.528  10.560  1.00 0.00 ? 29  LEU A H    3  
ATOM 4718  H HA   . LEU A 1 29  ? 7.805   -5.518  10.773  1.00 0.00 ? 29  LEU A HA   3  
ATOM 4719  H HB2  . LEU A 1 29  ? 6.416   -4.233  8.486   1.00 0.00 ? 29  LEU A HB2  3  
ATOM 4720  H HB3  . LEU A 1 29  ? 7.959   -5.060  8.553   1.00 0.00 ? 29  LEU A HB3  3  
ATOM 4721  H HG   . LEU A 1 29  ? 5.296   -6.492  8.707   1.00 0.00 ? 29  LEU A HG   3  
ATOM 4722  H HD11 . LEU A 1 29  ? 6.341   -5.158  6.475   1.00 0.00 ? 29  LEU A HD11 3  
ATOM 4723  H HD12 . LEU A 1 29  ? 6.716   -6.879  6.218   1.00 0.00 ? 29  LEU A HD12 3  
ATOM 4724  H HD13 . LEU A 1 29  ? 5.036   -6.368  6.506   1.00 0.00 ? 29  LEU A HD13 3  
ATOM 4725  H HD21 . LEU A 1 29  ? 6.643   -8.475  8.100   1.00 0.00 ? 29  LEU A HD21 3  
ATOM 4726  H HD22 . LEU A 1 29  ? 8.117   -7.485  8.223   1.00 0.00 ? 29  LEU A HD22 3  
ATOM 4727  H HD23 . LEU A 1 29  ? 7.112   -7.768  9.664   1.00 0.00 ? 29  LEU A HD23 3  
ATOM 4728  N N    . GLU A 1 30  ? 5.939   -3.387  11.884  1.00 0.00 ? 30  GLU A N    3  
ATOM 4729  C CA   . GLU A 1 30  ? 5.787   -2.075  12.490  1.00 0.00 ? 30  GLU A CA   3  
ATOM 4730  C C    . GLU A 1 30  ? 6.906   -1.824  13.502  1.00 0.00 ? 30  GLU A C    3  
ATOM 4731  O O    . GLU A 1 30  ? 7.087   -0.700  13.967  1.00 0.00 ? 30  GLU A O    3  
ATOM 4732  C CB   . GLU A 1 30  ? 4.412   -1.930  13.146  1.00 0.00 ? 30  GLU A CB   3  
ATOM 4733  C CG   . GLU A 1 30  ? 4.198   -3.005  14.214  1.00 0.00 ? 30  GLU A CG   3  
ATOM 4734  C CD   . GLU A 1 30  ? 3.196   -2.537  15.271  1.00 0.00 ? 30  GLU A CD   3  
ATOM 4735  O OE1  . GLU A 1 30  ? 2.167   -1.959  14.860  1.00 0.00 ? 30  GLU A OE1  3  
ATOM 4736  O OE2  . GLU A 1 30  ? 3.482   -2.766  16.466  1.00 0.00 ? 30  GLU A OE2  3  
ATOM 4737  H H    . GLU A 1 30  ? 5.308   -4.085  12.224  1.00 0.00 ? 30  GLU A H    3  
ATOM 4738  H HA   . GLU A 1 30  ? 5.866   -1.365  11.667  1.00 0.00 ? 30  GLU A HA   3  
ATOM 4739  H HB2  . GLU A 1 30  ? 4.323   -0.942  13.597  1.00 0.00 ? 30  GLU A HB2  3  
ATOM 4740  H HB3  . GLU A 1 30  ? 3.633   -2.006  12.388  1.00 0.00 ? 30  GLU A HB3  3  
ATOM 4741  H HG2  . GLU A 1 30  ? 3.837   -3.921  13.746  1.00 0.00 ? 30  GLU A HG2  3  
ATOM 4742  H HG3  . GLU A 1 30  ? 5.149   -3.244  14.690  1.00 0.00 ? 30  GLU A HG3  3  
ATOM 4743  N N    . HIS A 1 31  ? 7.629   -2.891  13.813  1.00 0.00 ? 31  HIS A N    3  
ATOM 4744  C CA   . HIS A 1 31  ? 8.726   -2.800  14.762  1.00 0.00 ? 31  HIS A CA   3  
ATOM 4745  C C    . HIS A 1 31  ? 10.034  -3.195  14.073  1.00 0.00 ? 31  HIS A C    3  
ATOM 4746  O O    . HIS A 1 31  ? 11.052  -3.396  14.733  1.00 0.00 ? 31  HIS A O    3  
ATOM 4747  C CB   . HIS A 1 31  ? 8.437   -3.638  16.009  1.00 0.00 ? 31  HIS A CB   3  
ATOM 4748  C CG   . HIS A 1 31  ? 7.432   -4.743  15.787  1.00 0.00 ? 31  HIS A CG   3  
ATOM 4749  N ND1  . HIS A 1 31  ? 7.671   -5.815  14.944  1.00 0.00 ? 31  HIS A ND1  3  
ATOM 4750  C CD2  . HIS A 1 31  ? 6.185   -4.932  16.307  1.00 0.00 ? 31  HIS A CD2  3  
ATOM 4751  C CE1  . HIS A 1 31  ? 6.608   -6.606  14.963  1.00 0.00 ? 31  HIS A CE1  3  
ATOM 4752  N NE2  . HIS A 1 31  ? 5.689   -6.057  15.807  1.00 0.00 ? 31  HIS A NE2  3  
ATOM 4753  H H    . HIS A 1 31  ? 7.475   -3.802  13.431  1.00 0.00 ? 31  HIS A H    3  
ATOM 4754  H HA   . HIS A 1 31  ? 8.788   -1.756  15.069  1.00 0.00 ? 31  HIS A HA   3  
ATOM 4755  H HB2  . HIS A 1 31  ? 9.370   -4.075  16.365  1.00 0.00 ? 31  HIS A HB2  3  
ATOM 4756  H HB3  . HIS A 1 31  ? 8.071   -2.981  16.798  1.00 0.00 ? 31  HIS A HB3  3  
ATOM 4757  H HD1  . HIS A 1 31  ? 8.503   -5.966  14.411  1.00 0.00 ? 31  HIS A HD1  3  
ATOM 4758  H HD2  . HIS A 1 31  ? 5.683   -4.271  17.013  1.00 0.00 ? 31  HIS A HD2  3  
ATOM 4759  H HE1  . HIS A 1 31  ? 6.490   -7.533  14.402  1.00 0.00 ? 31  HIS A HE1  3  
ATOM 4760  N N    . SER A 1 32  ? 9.964   -3.295  12.753  1.00 0.00 ? 32  SER A N    3  
ATOM 4761  C CA   . SER A 1 32  ? 11.129  -3.662  11.967  1.00 0.00 ? 32  SER A CA   3  
ATOM 4762  C C    . SER A 1 32  ? 11.194  -2.809  10.698  1.00 0.00 ? 32  SER A C    3  
ATOM 4763  O O    . SER A 1 32  ? 12.201  -2.152  10.439  1.00 0.00 ? 32  SER A O    3  
ATOM 4764  C CB   . SER A 1 32  ? 11.105  -5.149  11.607  1.00 0.00 ? 32  SER A CB   3  
ATOM 4765  O OG   . SER A 1 32  ? 12.073  -5.892  12.342  1.00 0.00 ? 32  SER A OG   3  
ATOM 4766  H H    . SER A 1 32  ? 9.131   -3.130  12.223  1.00 0.00 ? 32  SER A H    3  
ATOM 4767  H HA   . SER A 1 32  ? 11.986  -3.458  12.610  1.00 0.00 ? 32  SER A HA   3  
ATOM 4768  H HB2  . SER A 1 32  ? 10.112  -5.553  11.805  1.00 0.00 ? 32  SER A HB2  3  
ATOM 4769  H HB3  . SER A 1 32  ? 11.290  -5.266  10.540  1.00 0.00 ? 32  SER A HB3  3  
ATOM 4770  H HG   . SER A 1 32  ? 11.619  -6.574  12.915  1.00 0.00 ? 32  SER A HG   3  
ATOM 4771  N N    . ALA A 1 33  ? 10.108  -2.848  9.941   1.00 0.00 ? 33  ALA A N    3  
ATOM 4772  C CA   . ALA A 1 33  ? 10.029  -2.088  8.706   1.00 0.00 ? 33  ALA A CA   3  
ATOM 4773  C C    . ALA A 1 33  ? 9.151   -0.854  8.926   1.00 0.00 ? 33  ALA A C    3  
ATOM 4774  O O    . ALA A 1 33  ? 8.632   -0.645  10.022  1.00 0.00 ? 33  ALA A O    3  
ATOM 4775  C CB   . ALA A 1 33  ? 9.501   -2.986  7.585   1.00 0.00 ? 33  ALA A CB   3  
ATOM 4776  H H    . ALA A 1 33  ? 9.293   -3.386  10.159  1.00 0.00 ? 33  ALA A H    3  
ATOM 4777  H HA   . ALA A 1 33  ? 11.038  -1.764  8.450   1.00 0.00 ? 33  ALA A HA   3  
ATOM 4778  H HB1  . ALA A 1 33  ? 10.117  -2.856  6.695   1.00 0.00 ? 33  ALA A HB1  3  
ATOM 4779  H HB2  . ALA A 1 33  ? 9.541   -4.028  7.906   1.00 0.00 ? 33  ALA A HB2  3  
ATOM 4780  H HB3  . ALA A 1 33  ? 8.471   -2.716  7.358   1.00 0.00 ? 33  ALA A HB3  3  
ATOM 4781  N N    . HIS A 1 34  ? 9.012   -0.070  7.868   1.00 0.00 ? 34  HIS A N    3  
ATOM 4782  C CA   . HIS A 1 34  ? 8.205   1.137   7.932   1.00 0.00 ? 34  HIS A CA   3  
ATOM 4783  C C    . HIS A 1 34  ? 7.660   1.465   6.541   1.00 0.00 ? 34  HIS A C    3  
ATOM 4784  O O    . HIS A 1 34  ? 8.192   0.997   5.535   1.00 0.00 ? 34  HIS A O    3  
ATOM 4785  C CB   . HIS A 1 34  ? 9.002   2.291   8.543   1.00 0.00 ? 34  HIS A CB   3  
ATOM 4786  C CG   . HIS A 1 34  ? 10.215  2.694   7.739   1.00 0.00 ? 34  HIS A CG   3  
ATOM 4787  N ND1  . HIS A 1 34  ? 11.472  2.842   8.301   1.00 0.00 ? 34  HIS A ND1  3  
ATOM 4788  C CD2  . HIS A 1 34  ? 10.351  2.976   6.412   1.00 0.00 ? 34  HIS A CD2  3  
ATOM 4789  C CE1  . HIS A 1 34  ? 12.318  3.198   7.346   1.00 0.00 ? 34  HIS A CE1  3  
ATOM 4790  N NE2  . HIS A 1 34  ? 11.621  3.281   6.176   1.00 0.00 ? 34  HIS A NE2  3  
ATOM 4791  H H    . HIS A 1 34  ? 9.437   -0.247  6.981   1.00 0.00 ? 34  HIS A H    3  
ATOM 4792  H HA   . HIS A 1 34  ? 7.370   0.921   8.598   1.00 0.00 ? 34  HIS A HA   3  
ATOM 4793  H HB2  . HIS A 1 34  ? 8.347   3.156   8.650   1.00 0.00 ? 34  HIS A HB2  3  
ATOM 4794  H HB3  . HIS A 1 34  ? 9.321   2.008   9.546   1.00 0.00 ? 34  HIS A HB3  3  
ATOM 4795  H HD1  . HIS A 1 34  ? 11.702  2.703   9.264   1.00 0.00 ? 34  HIS A HD1  3  
ATOM 4796  H HD2  . HIS A 1 34  ? 9.552   2.955   5.671   1.00 0.00 ? 34  HIS A HD2  3  
ATOM 4797  H HE1  . HIS A 1 34  ? 13.383  3.391   7.472   1.00 0.00 ? 34  HIS A HE1  3  
ATOM 4798  N N    . VAL A 1 35  ? 6.605   2.267   6.527   1.00 0.00 ? 35  VAL A N    3  
ATOM 4799  C CA   . VAL A 1 35  ? 5.982   2.663   5.275   1.00 0.00 ? 35  VAL A CA   3  
ATOM 4800  C C    . VAL A 1 35  ? 7.051   3.219   4.332   1.00 0.00 ? 35  VAL A C    3  
ATOM 4801  O O    . VAL A 1 35  ? 7.869   4.045   4.734   1.00 0.00 ? 35  VAL A O    3  
ATOM 4802  C CB   . VAL A 1 35  ? 4.849   3.654   5.546   1.00 0.00 ? 35  VAL A CB   3  
ATOM 4803  C CG1  . VAL A 1 35  ? 4.252   4.175   4.237   1.00 0.00 ? 35  VAL A CG1  3  
ATOM 4804  C CG2  . VAL A 1 35  ? 3.769   3.025   6.429   1.00 0.00 ? 35  VAL A CG2  3  
ATOM 4805  H H    . VAL A 1 35  ? 6.179   2.643   7.349   1.00 0.00 ? 35  VAL A H    3  
ATOM 4806  H HA   . VAL A 1 35  ? 5.549   1.769   4.827   1.00 0.00 ? 35  VAL A HA   3  
ATOM 4807  H HB   . VAL A 1 35  ? 5.268   4.504   6.084   1.00 0.00 ? 35  VAL A HB   3  
ATOM 4808  H HG11 . VAL A 1 35  ? 4.449   5.243   4.147   1.00 0.00 ? 35  VAL A HG11 3  
ATOM 4809  H HG12 . VAL A 1 35  ? 4.706   3.649   3.396   1.00 0.00 ? 35  VAL A HG12 3  
ATOM 4810  H HG13 . VAL A 1 35  ? 3.175   4.003   4.234   1.00 0.00 ? 35  VAL A HG13 3  
ATOM 4811  H HG21 . VAL A 1 35  ? 3.876   3.390   7.450   1.00 0.00 ? 35  VAL A HG21 3  
ATOM 4812  H HG22 . VAL A 1 35  ? 2.785   3.295   6.047   1.00 0.00 ? 35  VAL A HG22 3  
ATOM 4813  H HG23 . VAL A 1 35  ? 3.877   1.940   6.418   1.00 0.00 ? 35  VAL A HG23 3  
ATOM 4814  N N    . LEU A 1 36  ? 7.009   2.745   3.096   1.00 0.00 ? 36  LEU A N    3  
ATOM 4815  C CA   . LEU A 1 36  ? 7.963   3.184   2.093   1.00 0.00 ? 36  LEU A CA   3  
ATOM 4816  C C    . LEU A 1 36  ? 7.694   4.650   1.747   1.00 0.00 ? 36  LEU A C    3  
ATOM 4817  O O    . LEU A 1 36  ? 6.583   5.142   1.936   1.00 0.00 ? 36  LEU A O    3  
ATOM 4818  C CB   . LEU A 1 36  ? 7.935   2.251   0.881   1.00 0.00 ? 36  LEU A CB   3  
ATOM 4819  C CG   . LEU A 1 36  ? 8.698   2.733   -0.355  1.00 0.00 ? 36  LEU A CG   3  
ATOM 4820  C CD1  . LEU A 1 36  ? 10.181  2.935   -0.038  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 4821  C CD2  . LEU A 1 36  ? 8.489   1.781   -1.534  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 4822  H H    . LEU A 1 36  ? 6.340   2.073   2.777   1.00 0.00 ? 36  LEU A H    3  
ATOM 4823  H HA   . LEU A 1 36  ? 8.958   3.111   2.533   1.00 0.00 ? 36  LEU A HA   3  
ATOM 4824  H HB2  . LEU A 1 36  ? 8.341   1.285   1.181   1.00 0.00 ? 36  LEU A HB2  3  
ATOM 4825  H HB3  . LEU A 1 36  ? 6.895   2.086   0.599   1.00 0.00 ? 36  LEU A HB3  3  
ATOM 4826  H HG   . LEU A 1 36  ? 8.297   3.703   -0.648  1.00 0.00 ? 36  LEU A HG   3  
ATOM 4827  H HD11 . LEU A 1 36  ? 10.343  2.820   1.033   1.00 0.00 ? 36  LEU A HD11 3  
ATOM 4828  H HD12 . LEU A 1 36  ? 10.772  2.194   -0.577  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 4829  H HD13 . LEU A 1 36  ? 10.486  3.936   -0.347  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 4830  H HD21 . LEU A 1 36  ? 7.569   1.215   -1.386  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 4831  H HD22 . LEU A 1 36  ? 8.415   2.357   -2.457  1.00 0.00 ? 36  LEU A HD22 3  
ATOM 4832  H HD23 . LEU A 1 36  ? 9.332   1.094   -1.601  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 4833  N N    . GLU A 1 37  ? 8.730   5.307   1.245   1.00 0.00 ? 37  GLU A N    3  
ATOM 4834  C CA   . GLU A 1 37  ? 8.619   6.706   0.871   1.00 0.00 ? 37  GLU A CA   3  
ATOM 4835  C C    . GLU A 1 37  ? 9.408   6.977   -0.411  1.00 0.00 ? 37  GLU A C    3  
ATOM 4836  O O    . GLU A 1 37  ? 10.549  6.536   -0.547  1.00 0.00 ? 37  GLU A O    3  
ATOM 4837  C CB   . GLU A 1 37  ? 9.089   7.617   2.007   1.00 0.00 ? 37  GLU A CB   3  
ATOM 4838  C CG   . GLU A 1 37  ? 7.917   8.031   2.899   1.00 0.00 ? 37  GLU A CG   3  
ATOM 4839  C CD   . GLU A 1 37  ? 8.367   8.206   4.351   1.00 0.00 ? 37  GLU A CD   3  
ATOM 4840  O OE1  . GLU A 1 37  ? 9.210   7.391   4.785   1.00 0.00 ? 37  GLU A OE1  3  
ATOM 4841  O OE2  . GLU A 1 37  ? 7.858   9.149   4.993   1.00 0.00 ? 37  GLU A OE2  3  
ATOM 4842  H H    . GLU A 1 37  ? 9.630   4.899   1.094   1.00 0.00 ? 37  GLU A H    3  
ATOM 4843  H HA   . GLU A 1 37  ? 7.557   6.876   0.694   1.00 0.00 ? 37  GLU A HA   3  
ATOM 4844  H HB2  . GLU A 1 37  ? 9.840   7.100   2.605   1.00 0.00 ? 37  GLU A HB2  3  
ATOM 4845  H HB3  . GLU A 1 37  ? 9.567   8.504   1.593   1.00 0.00 ? 37  GLU A HB3  3  
ATOM 4846  H HG2  . GLU A 1 37  ? 7.489   8.965   2.533   1.00 0.00 ? 37  GLU A HG2  3  
ATOM 4847  H HG3  . GLU A 1 37  ? 7.131   7.278   2.846   1.00 0.00 ? 37  GLU A HG3  3  
ATOM 4848  N N    . LYS A 1 38  ? 8.771   7.701   -1.319  1.00 0.00 ? 38  LYS A N    3  
ATOM 4849  C CA   . LYS A 1 38  ? 9.399   8.036   -2.585  1.00 0.00 ? 38  LYS A CA   3  
ATOM 4850  C C    . LYS A 1 38  ? 8.860   9.381   -3.077  1.00 0.00 ? 38  LYS A C    3  
ATOM 4851  O O    . LYS A 1 38  ? 7.723   9.745   -2.780  1.00 0.00 ? 38  LYS A O    3  
ATOM 4852  C CB   . LYS A 1 38  ? 9.219   6.897   -3.591  1.00 0.00 ? 38  LYS A CB   3  
ATOM 4853  C CG   . LYS A 1 38  ? 10.094  7.114   -4.827  1.00 0.00 ? 38  LYS A CG   3  
ATOM 4854  C CD   . LYS A 1 38  ? 10.104  5.869   -5.717  1.00 0.00 ? 38  LYS A CD   3  
ATOM 4855  C CE   . LYS A 1 38  ? 10.767  6.163   -7.064  1.00 0.00 ? 38  LYS A CE   3  
ATOM 4856  N NZ   . LYS A 1 38  ? 9.943   7.106   -7.853  1.00 0.00 ? 38  LYS A NZ   3  
ATOM 4857  H H    . LYS A 1 38  ? 7.843   8.056   -1.200  1.00 0.00 ? 38  LYS A H    3  
ATOM 4858  H HA   . LYS A 1 38  ? 10.469  8.139   -2.402  1.00 0.00 ? 38  LYS A HA   3  
ATOM 4859  H HB2  . LYS A 1 38  ? 9.477   5.948   -3.121  1.00 0.00 ? 38  LYS A HB2  3  
ATOM 4860  H HB3  . LYS A 1 38  ? 8.173   6.831   -3.888  1.00 0.00 ? 38  LYS A HB3  3  
ATOM 4861  H HG2  . LYS A 1 38  ? 9.723   7.968   -5.394  1.00 0.00 ? 38  LYS A HG2  3  
ATOM 4862  H HG3  . LYS A 1 38  ? 11.112  7.354   -4.520  1.00 0.00 ? 38  LYS A HG3  3  
ATOM 4863  H HD2  . LYS A 1 38  ? 10.636  5.062   -5.213  1.00 0.00 ? 38  LYS A HD2  3  
ATOM 4864  H HD3  . LYS A 1 38  ? 9.082   5.525   -5.878  1.00 0.00 ? 38  LYS A HD3  3  
ATOM 4865  H HE2  . LYS A 1 38  ? 11.759  6.585   -6.903  1.00 0.00 ? 38  LYS A HE2  3  
ATOM 4866  H HE3  . LYS A 1 38  ? 10.902  5.235   -7.620  1.00 0.00 ? 38  LYS A HE3  3  
ATOM 4867  H HZ1  . LYS A 1 38  ? 9.604   6.646   -8.673  1.00 0.00 ? 38  LYS A HZ1  3  
ATOM 4868  H HZ2  . LYS A 1 38  ? 9.169   7.415   -7.300  1.00 0.00 ? 38  LYS A HZ2  3  
ATOM 4869  H HZ3  . LYS A 1 38  ? 10.499  7.893   -8.118  1.00 0.00 ? 38  LYS A HZ3  3  
ATOM 4870  N N    . GLY A 1 39  ? 9.702   10.084  -3.821  1.00 0.00 ? 39  GLY A N    3  
ATOM 4871  C CA   . GLY A 1 39  ? 9.325   11.380  -4.357  1.00 0.00 ? 39  GLY A CA   3  
ATOM 4872  C C    . GLY A 1 39  ? 8.599   12.219  -3.303  1.00 0.00 ? 39  GLY A C    3  
ATOM 4873  O O    . GLY A 1 39  ? 7.537   12.778  -3.573  1.00 0.00 ? 39  GLY A O    3  
ATOM 4874  H H    . GLY A 1 39  ? 10.626  9.781   -4.058  1.00 0.00 ? 39  GLY A H    3  
ATOM 4875  H HA2  . GLY A 1 39  ? 10.215  11.910  -4.699  1.00 0.00 ? 39  GLY A HA2  3  
ATOM 4876  H HA3  . GLY A 1 39  ? 8.681   11.245  -5.226  1.00 0.00 ? 39  GLY A HA3  3  
ATOM 4877  N N    . GLY A 1 40  ? 9.202   12.281  -2.125  1.00 0.00 ? 40  GLY A N    3  
ATOM 4878  C CA   . GLY A 1 40  ? 8.626   13.042  -1.029  1.00 0.00 ? 40  GLY A CA   3  
ATOM 4879  C C    . GLY A 1 40  ? 7.157   12.670  -0.815  1.00 0.00 ? 40  GLY A C    3  
ATOM 4880  O O    . GLY A 1 40  ? 6.321   13.541  -0.580  1.00 0.00 ? 40  GLY A O    3  
ATOM 4881  H H    . GLY A 1 40  ? 10.066  11.823  -1.913  1.00 0.00 ? 40  GLY A H    3  
ATOM 4882  H HA2  . GLY A 1 40  ? 9.189   12.853  -0.115  1.00 0.00 ? 40  GLY A HA2  3  
ATOM 4883  H HA3  . GLY A 1 40  ? 8.709   14.108  -1.239  1.00 0.00 ? 40  GLY A HA3  3  
ATOM 4884  N N    . LYS A 1 41  ? 6.888   11.376  -0.904  1.00 0.00 ? 41  LYS A N    3  
ATOM 4885  C CA   . LYS A 1 41  ? 5.535   10.879  -0.724  1.00 0.00 ? 41  LYS A CA   3  
ATOM 4886  C C    . LYS A 1 41  ? 5.564   9.657   0.196   1.00 0.00 ? 41  LYS A C    3  
ATOM 4887  O O    . LYS A 1 41  ? 6.634   9.143   0.518   1.00 0.00 ? 41  LYS A O    3  
ATOM 4888  C CB   . LYS A 1 41  ? 4.877   10.613  -2.079  1.00 0.00 ? 41  LYS A CB   3  
ATOM 4889  C CG   . LYS A 1 41  ? 4.157   11.862  -2.594  1.00 0.00 ? 41  LYS A CG   3  
ATOM 4890  C CD   . LYS A 1 41  ? 2.696   11.877  -2.141  1.00 0.00 ? 41  LYS A CD   3  
ATOM 4891  C CE   . LYS A 1 41  ? 1.775   11.347  -3.242  1.00 0.00 ? 41  LYS A CE   3  
ATOM 4892  N NZ   . LYS A 1 41  ? 0.571   12.197  -3.366  1.00 0.00 ? 41  LYS A NZ   3  
ATOM 4893  H H    . LYS A 1 41  ? 7.574   10.674  -1.096  1.00 0.00 ? 41  LYS A H    3  
ATOM 4894  H HA   . LYS A 1 41  ? 4.960   11.666  -0.235  1.00 0.00 ? 41  LYS A HA   3  
ATOM 4895  H HB2  . LYS A 1 41  ? 5.632   10.302  -2.800  1.00 0.00 ? 41  LYS A HB2  3  
ATOM 4896  H HB3  . LYS A 1 41  ? 4.167   9.791   -1.988  1.00 0.00 ? 41  LYS A HB3  3  
ATOM 4897  H HG2  . LYS A 1 41  ? 4.664   12.754  -2.228  1.00 0.00 ? 41  LYS A HG2  3  
ATOM 4898  H HG3  . LYS A 1 41  ? 4.205   11.891  -3.682  1.00 0.00 ? 41  LYS A HG3  3  
ATOM 4899  H HD2  . LYS A 1 41  ? 2.582   11.270  -1.243  1.00 0.00 ? 41  LYS A HD2  3  
ATOM 4900  H HD3  . LYS A 1 41  ? 2.404   12.894  -1.877  1.00 0.00 ? 41  LYS A HD3  3  
ATOM 4901  H HE2  . LYS A 1 41  ? 2.310   11.323  -4.192  1.00 0.00 ? 41  LYS A HE2  3  
ATOM 4902  H HE3  . LYS A 1 41  ? 1.482   10.321  -3.016  1.00 0.00 ? 41  LYS A HE3  3  
ATOM 4903  H HZ1  . LYS A 1 41  ? 0.467   12.494  -4.315  1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 4904  H HZ2  . LYS A 1 41  ? -0.236  11.675  -3.090  1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 4905  H HZ3  . LYS A 1 41  ? 0.666   12.999  -2.775  1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 4906  N N    . VAL A 1 42  ? 4.375   9.226   0.593   1.00 0.00 ? 42  VAL A N    3  
ATOM 4907  C CA   . VAL A 1 42  ? 4.251   8.074   1.469   1.00 0.00 ? 42  VAL A CA   3  
ATOM 4908  C C    . VAL A 1 42  ? 3.376   7.016   0.793   1.00 0.00 ? 42  VAL A C    3  
ATOM 4909  O O    . VAL A 1 42  ? 2.321   7.335   0.247   1.00 0.00 ? 42  VAL A O    3  
ATOM 4910  C CB   . VAL A 1 42  ? 3.714   8.510   2.834   1.00 0.00 ? 42  VAL A CB   3  
ATOM 4911  C CG1  . VAL A 1 42  ? 3.306   7.299   3.675   1.00 0.00 ? 42  VAL A CG1  3  
ATOM 4912  C CG2  . VAL A 1 42  ? 4.738   9.372   3.575   1.00 0.00 ? 42  VAL A CG2  3  
ATOM 4913  H H    . VAL A 1 42  ? 3.510   9.650   0.326   1.00 0.00 ? 42  VAL A H    3  
ATOM 4914  H HA   . VAL A 1 42  ? 5.250   7.662   1.615   1.00 0.00 ? 42  VAL A HA   3  
ATOM 4915  H HB   . VAL A 1 42  ? 2.824   9.117   2.666   1.00 0.00 ? 42  VAL A HB   3  
ATOM 4916  H HG11 . VAL A 1 42  ? 4.028   7.154   4.478   1.00 0.00 ? 42  VAL A HG11 3  
ATOM 4917  H HG12 . VAL A 1 42  ? 2.317   7.470   4.102   1.00 0.00 ? 42  VAL A HG12 3  
ATOM 4918  H HG13 . VAL A 1 42  ? 3.280   6.410   3.044   1.00 0.00 ? 42  VAL A HG13 3  
ATOM 4919  H HG21 . VAL A 1 42  ? 5.034   8.872   4.497   1.00 0.00 ? 42  VAL A HG21 3  
ATOM 4920  H HG22 . VAL A 1 42  ? 5.614   9.520   2.944   1.00 0.00 ? 42  VAL A HG22 3  
ATOM 4921  H HG23 . VAL A 1 42  ? 4.294   10.339  3.813   1.00 0.00 ? 42  VAL A HG23 3  
ATOM 4922  N N    . PHE A 1 43  ? 3.847   5.779   0.851   1.00 0.00 ? 43  PHE A N    3  
ATOM 4923  C CA   . PHE A 1 43  ? 3.121   4.673   0.251   1.00 0.00 ? 43  PHE A CA   3  
ATOM 4924  C C    . PHE A 1 43  ? 2.025   4.163   1.189   1.00 0.00 ? 43  PHE A C    3  
ATOM 4925  O O    . PHE A 1 43  ? 1.998   2.984   1.536   1.00 0.00 ? 43  PHE A O    3  
ATOM 4926  C CB   . PHE A 1 43  ? 4.133   3.551   0.012   1.00 0.00 ? 43  PHE A CB   3  
ATOM 4927  C CG   . PHE A 1 43  ? 5.092   3.815   -1.150  1.00 0.00 ? 43  PHE A CG   3  
ATOM 4928  C CD1  . PHE A 1 43  ? 5.872   4.929   -1.149  1.00 0.00 ? 43  PHE A CD1  3  
ATOM 4929  C CD2  . PHE A 1 43  ? 5.164   2.936   -2.186  1.00 0.00 ? 43  PHE A CD2  3  
ATOM 4930  C CE1  . PHE A 1 43  ? 6.762   5.174   -2.228  1.00 0.00 ? 43  PHE A CE1  3  
ATOM 4931  C CE2  . PHE A 1 43  ? 6.054   3.181   -3.265  1.00 0.00 ? 43  PHE A CE2  3  
ATOM 4932  C CZ   . PHE A 1 43  ? 6.834   4.295   -3.263  1.00 0.00 ? 43  PHE A CZ   3  
ATOM 4933  H H    . PHE A 1 43  ? 4.706   5.528   1.297   1.00 0.00 ? 43  PHE A H    3  
ATOM 4934  H HA   . PHE A 1 43  ? 2.667   5.044   -0.667  1.00 0.00 ? 43  PHE A HA   3  
ATOM 4935  H HB2  . PHE A 1 43  ? 4.714   3.400   0.922   1.00 0.00 ? 43  PHE A HB2  3  
ATOM 4936  H HB3  . PHE A 1 43  ? 3.593   2.623   -0.179  1.00 0.00 ? 43  PHE A HB3  3  
ATOM 4937  H HD1  . PHE A 1 43  ? 5.815   5.633   -0.319  1.00 0.00 ? 43  PHE A HD1  3  
ATOM 4938  H HD2  . PHE A 1 43  ? 4.538   2.043   -2.187  1.00 0.00 ? 43  PHE A HD2  3  
ATOM 4939  H HE1  . PHE A 1 43  ? 7.388   6.067   -2.226  1.00 0.00 ? 43  PHE A HE1  3  
ATOM 4940  H HE2  . PHE A 1 43  ? 6.111   2.476   -4.094  1.00 0.00 ? 43  PHE A HE2  3  
ATOM 4941  H HZ   . PHE A 1 43  ? 7.517   4.483   -4.091  1.00 0.00 ? 43  PHE A HZ   3  
ATOM 4942  N N    . SER A 1 44  ? 1.147   5.078   1.574   1.00 0.00 ? 44  SER A N    3  
ATOM 4943  C CA   . SER A 1 44  ? 0.051   4.737   2.465   1.00 0.00 ? 44  SER A CA   3  
ATOM 4944  C C    . SER A 1 44  ? -1.245  5.383   1.972   1.00 0.00 ? 44  SER A C    3  
ATOM 4945  O O    . SER A 1 44  ? -1.502  6.554   2.248   1.00 0.00 ? 44  SER A O    3  
ATOM 4946  C CB   . SER A 1 44  ? 0.351   5.175   3.900   1.00 0.00 ? 44  SER A CB   3  
ATOM 4947  O OG   . SER A 1 44  ? -0.831  5.254   4.692   1.00 0.00 ? 44  SER A OG   3  
ATOM 4948  H H    . SER A 1 44  ? 1.175   6.036   1.287   1.00 0.00 ? 44  SER A H    3  
ATOM 4949  H HA   . SER A 1 44  ? -0.024  3.650   2.425   1.00 0.00 ? 44  SER A HA   3  
ATOM 4950  H HB2  . SER A 1 44  ? 1.047   4.470   4.356   1.00 0.00 ? 44  SER A HB2  3  
ATOM 4951  H HB3  . SER A 1 44  ? 0.845   6.146   3.886   1.00 0.00 ? 44  SER A HB3  3  
ATOM 4952  H HG   . SER A 1 44  ? -1.171  4.335   4.891   1.00 0.00 ? 44  SER A HG   3  
ATOM 4953  N N    . ALA A 1 45  ? -2.027  4.593   1.252   1.00 0.00 ? 45  ALA A N    3  
ATOM 4954  C CA   . ALA A 1 45  ? -3.290  5.073   0.719   1.00 0.00 ? 45  ALA A CA   3  
ATOM 4955  C C    . ALA A 1 45  ? -4.430  4.207   1.259   1.00 0.00 ? 45  ALA A C    3  
ATOM 4956  O O    . ALA A 1 45  ? -4.308  2.985   1.323   1.00 0.00 ? 45  ALA A O    3  
ATOM 4957  C CB   . ALA A 1 45  ? -3.232  5.074   -0.810  1.00 0.00 ? 45  ALA A CB   3  
ATOM 4958  H H    . ALA A 1 45  ? -1.810  3.641   1.033   1.00 0.00 ? 45  ALA A H    3  
ATOM 4959  H HA   . ALA A 1 45  ? -3.428  6.098   1.066   1.00 0.00 ? 45  ALA A HA   3  
ATOM 4960  H HB1  . ALA A 1 45  ? -2.277  5.486   -1.137  1.00 0.00 ? 45  ALA A HB1  3  
ATOM 4961  H HB2  . ALA A 1 45  ? -3.332  4.053   -1.178  1.00 0.00 ? 45  ALA A HB2  3  
ATOM 4962  H HB3  . ALA A 1 45  ? -4.045  5.684   -1.204  1.00 0.00 ? 45  ALA A HB3  3  
ATOM 4963  N N    . THR A 1 46  ? -5.512  4.874   1.633   1.00 0.00 ? 46  THR A N    3  
ATOM 4964  C CA   . THR A 1 46  ? -6.672  4.180   2.165   1.00 0.00 ? 46  THR A CA   3  
ATOM 4965  C C    . THR A 1 46  ? -7.845  4.277   1.189   1.00 0.00 ? 46  THR A C    3  
ATOM 4966  O O    . THR A 1 46  ? -8.542  5.290   1.148   1.00 0.00 ? 46  THR A O    3  
ATOM 4967  C CB   . THR A 1 46  ? -6.980  4.763   3.546   1.00 0.00 ? 46  THR A CB   3  
ATOM 4968  O OG1  . THR A 1 46  ? -5.847  4.409   4.333   1.00 0.00 ? 46  THR A OG1  3  
ATOM 4969  C CG2  . THR A 1 46  ? -8.148  4.055   4.233   1.00 0.00 ? 46  THR A CG2  3  
ATOM 4970  H H    . THR A 1 46  ? -5.603  5.868   1.578   1.00 0.00 ? 46  THR A H    3  
ATOM 4971  H HA   . THR A 1 46  ? -6.425  3.123   2.264   1.00 0.00 ? 46  THR A HA   3  
ATOM 4972  H HB   . THR A 1 46  ? -7.158  5.837   3.483   1.00 0.00 ? 46  THR A HB   3  
ATOM 4973  H HG1  . THR A 1 46  ? -5.130  5.099   4.231   1.00 0.00 ? 46  THR A HG1  3  
ATOM 4974  H HG21 . THR A 1 46  ? -8.392  4.572   5.162   1.00 0.00 ? 46  THR A HG21 3  
ATOM 4975  H HG22 . THR A 1 46  ? -9.017  4.062   3.575   1.00 0.00 ? 46  THR A HG22 3  
ATOM 4976  H HG23 . THR A 1 46  ? -7.869  3.024   4.454   1.00 0.00 ? 46  THR A HG23 3  
ATOM 4977  N N    . LEU A 1 47  ? -8.029  3.209   0.426   1.00 0.00 ? 47  LEU A N    3  
ATOM 4978  C CA   . LEU A 1 47  ? -9.106  3.161   -0.548  1.00 0.00 ? 47  LEU A CA   3  
ATOM 4979  C C    . LEU A 1 47  ? -10.377 2.642   0.129   1.00 0.00 ? 47  LEU A C    3  
ATOM 4980  O O    . LEU A 1 47  ? -10.315 2.059   1.210   1.00 0.00 ? 47  LEU A O    3  
ATOM 4981  C CB   . LEU A 1 47  ? -8.686  2.346   -1.773  1.00 0.00 ? 47  LEU A CB   3  
ATOM 4982  C CG   . LEU A 1 47  ? -7.431  2.831   -2.502  1.00 0.00 ? 47  LEU A CG   3  
ATOM 4983  C CD1  . LEU A 1 47  ? -7.062  1.885   -3.646  1.00 0.00 ? 47  LEU A CD1  3  
ATOM 4984  C CD2  . LEU A 1 47  ? -7.600  4.274   -2.983  1.00 0.00 ? 47  LEU A CD2  3  
ATOM 4985  H H    . LEU A 1 47  ? -7.458  2.389   0.466   1.00 0.00 ? 47  LEU A H    3  
ATOM 4986  H HA   . LEU A 1 47  ? -9.287  4.181   -0.886  1.00 0.00 ? 47  LEU A HA   3  
ATOM 4987  H HB2  . LEU A 1 47  ? -8.525  1.315   -1.460  1.00 0.00 ? 47  LEU A HB2  3  
ATOM 4988  H HB3  . LEU A 1 47  ? -9.514  2.339   -2.481  1.00 0.00 ? 47  LEU A HB3  3  
ATOM 4989  H HG   . LEU A 1 47  ? -6.601  2.822   -1.796  1.00 0.00 ? 47  LEU A HG   3  
ATOM 4990  H HD11 . LEU A 1 47  ? -6.484  1.048   -3.253  1.00 0.00 ? 47  LEU A HD11 3  
ATOM 4991  H HD12 . LEU A 1 47  ? -7.971  1.509   -4.115  1.00 0.00 ? 47  LEU A HD12 3  
ATOM 4992  H HD13 . LEU A 1 47  ? -6.467  2.422   -4.384  1.00 0.00 ? 47  LEU A HD13 3  
ATOM 4993  H HD21 . LEU A 1 47  ? -8.660  4.524   -3.017  1.00 0.00 ? 47  LEU A HD21 3  
ATOM 4994  H HD22 . LEU A 1 47  ? -7.089  4.948   -2.296  1.00 0.00 ? 47  LEU A HD22 3  
ATOM 4995  H HD23 . LEU A 1 47  ? -7.170  4.377   -3.980  1.00 0.00 ? 47  LEU A HD23 3  
ATOM 4996  N N    . GLY A 1 48  ? -11.500 2.874   -0.535  1.00 0.00 ? 48  GLY A N    3  
ATOM 4997  C CA   . GLY A 1 48  ? -12.783 2.437   -0.011  1.00 0.00 ? 48  GLY A CA   3  
ATOM 4998  C C    . GLY A 1 48  ? -13.808 2.277   -1.136  1.00 0.00 ? 48  GLY A C    3  
ATOM 4999  O O    . GLY A 1 48  ? -14.091 3.229   -1.862  1.00 0.00 ? 48  GLY A O    3  
ATOM 5000  H H    . GLY A 1 48  ? -11.542 3.349   -1.414  1.00 0.00 ? 48  GLY A H    3  
ATOM 5001  H HA2  . GLY A 1 48  ? -12.662 1.489   0.513   1.00 0.00 ? 48  GLY A HA2  3  
ATOM 5002  H HA3  . GLY A 1 48  ? -13.147 3.161   0.718   1.00 0.00 ? 48  GLY A HA3  3  
ATOM 5003  N N    . LEU A 1 49  ? -14.337 1.067   -1.244  1.00 0.00 ? 49  LEU A N    3  
ATOM 5004  C CA   . LEU A 1 49  ? -15.325 0.771   -2.267  1.00 0.00 ? 49  LEU A CA   3  
ATOM 5005  C C    . LEU A 1 49  ? -16.559 0.146   -1.613  1.00 0.00 ? 49  LEU A C    3  
ATOM 5006  O O    . LEU A 1 49  ? -16.436 -0.664  -0.696  1.00 0.00 ? 49  LEU A O    3  
ATOM 5007  C CB   . LEU A 1 49  ? -14.710 -0.092  -3.371  1.00 0.00 ? 49  LEU A CB   3  
ATOM 5008  C CG   . LEU A 1 49  ? -15.527 -0.215  -4.659  1.00 0.00 ? 49  LEU A CG   3  
ATOM 5009  C CD1  . LEU A 1 49  ? -16.680 -1.205  -4.484  1.00 0.00 ? 49  LEU A CD1  3  
ATOM 5010  C CD2  . LEU A 1 49  ? -16.014 1.156   -5.132  1.00 0.00 ? 49  LEU A CD2  3  
ATOM 5011  H H    . LEU A 1 49  ? -14.101 0.299   -0.649  1.00 0.00 ? 49  LEU A H    3  
ATOM 5012  H HA   . LEU A 1 49  ? -15.617 1.717   -2.723  1.00 0.00 ? 49  LEU A HA   3  
ATOM 5013  H HB2  . LEU A 1 49  ? -13.732 0.317   -3.622  1.00 0.00 ? 49  LEU A HB2  3  
ATOM 5014  H HB3  . LEU A 1 49  ? -14.545 -1.093  -2.972  1.00 0.00 ? 49  LEU A HB3  3  
ATOM 5015  H HG   . LEU A 1 49  ? -14.877 -0.613  -5.439  1.00 0.00 ? 49  LEU A HG   3  
ATOM 5016  H HD11 . LEU A 1 49  ? -16.972 -1.599  -5.458  1.00 0.00 ? 49  LEU A HD11 3  
ATOM 5017  H HD12 . LEU A 1 49  ? -16.361 -2.025  -3.841  1.00 0.00 ? 49  LEU A HD12 3  
ATOM 5018  H HD13 . LEU A 1 49  ? -17.530 -0.696  -4.029  1.00 0.00 ? 49  LEU A HD13 3  
ATOM 5019  H HD21 . LEU A 1 49  ? -16.990 1.366   -4.694  1.00 0.00 ? 49  LEU A HD21 3  
ATOM 5020  H HD22 . LEU A 1 49  ? -15.304 1.921   -4.821  1.00 0.00 ? 49  LEU A HD22 3  
ATOM 5021  H HD23 . LEU A 1 49  ? -16.097 1.157   -6.219  1.00 0.00 ? 49  LEU A HD23 3  
ATOM 5022  N N    . VAL A 1 50  ? -17.719 0.546   -2.110  1.00 0.00 ? 50  VAL A N    3  
ATOM 5023  C CA   . VAL A 1 50  ? -18.974 0.036   -1.586  1.00 0.00 ? 50  VAL A CA   3  
ATOM 5024  C C    . VAL A 1 50  ? -19.938 -0.226  -2.745  1.00 0.00 ? 50  VAL A C    3  
ATOM 5025  O O    . VAL A 1 50  ? -20.101 0.618   -3.624  1.00 0.00 ? 50  VAL A O    3  
ATOM 5026  C CB   . VAL A 1 50  ? -19.540 1.005   -0.546  1.00 0.00 ? 50  VAL A CB   3  
ATOM 5027  C CG1  . VAL A 1 50  ? -18.854 2.370   -0.639  1.00 0.00 ? 50  VAL A CG1  3  
ATOM 5028  C CG2  . VAL A 1 50  ? -21.057 1.142   -0.692  1.00 0.00 ? 50  VAL A CG2  3  
ATOM 5029  H H    . VAL A 1 50  ? -17.810 1.206   -2.857  1.00 0.00 ? 50  VAL A H    3  
ATOM 5030  H HA   . VAL A 1 50  ? -18.762 -0.909  -1.086  1.00 0.00 ? 50  VAL A HA   3  
ATOM 5031  H HB   . VAL A 1 50  ? -19.334 0.594   0.442   1.00 0.00 ? 50  VAL A HB   3  
ATOM 5032  H HG11 . VAL A 1 50  ? -17.929 2.352   -0.063  1.00 0.00 ? 50  VAL A HG11 3  
ATOM 5033  H HG12 . VAL A 1 50  ? -18.629 2.593   -1.682  1.00 0.00 ? 50  VAL A HG12 3  
ATOM 5034  H HG13 . VAL A 1 50  ? -19.517 3.137   -0.238  1.00 0.00 ? 50  VAL A HG13 3  
ATOM 5035  H HG21 . VAL A 1 50  ? -21.527 0.174   -0.519  1.00 0.00 ? 50  VAL A HG21 3  
ATOM 5036  H HG22 . VAL A 1 50  ? -21.428 1.862   0.038   1.00 0.00 ? 50  VAL A HG22 3  
ATOM 5037  H HG23 . VAL A 1 50  ? -21.295 1.488   -1.697  1.00 0.00 ? 50  VAL A HG23 3  
ATOM 5038  N N    . ASP A 1 51  ? -20.552 -1.400  -2.709  1.00 0.00 ? 51  ASP A N    3  
ATOM 5039  C CA   . ASP A 1 51  ? -21.495 -1.784  -3.745  1.00 0.00 ? 51  ASP A CA   3  
ATOM 5040  C C    . ASP A 1 51  ? -22.870 -1.197  -3.420  1.00 0.00 ? 51  ASP A C    3  
ATOM 5041  O O    . ASP A 1 51  ? -23.290 -1.194  -2.264  1.00 0.00 ? 51  ASP A O    3  
ATOM 5042  C CB   . ASP A 1 51  ? -21.637 -3.305  -3.825  1.00 0.00 ? 51  ASP A CB   3  
ATOM 5043  C CG   . ASP A 1 51  ? -20.921 -3.960  -5.009  1.00 0.00 ? 51  ASP A CG   3  
ATOM 5044  O OD1  . ASP A 1 51  ? -19.691 -4.151  -4.893  1.00 0.00 ? 51  ASP A OD1  3  
ATOM 5045  O OD2  . ASP A 1 51  ? -21.621 -4.255  -6.002  1.00 0.00 ? 51  ASP A OD2  3  
ATOM 5046  H H    . ASP A 1 51  ? -20.414 -2.081  -1.990  1.00 0.00 ? 51  ASP A H    3  
ATOM 5047  H HA   . ASP A 1 51  ? -21.080 -1.386  -4.671  1.00 0.00 ? 51  ASP A HA   3  
ATOM 5048  H HB2  . ASP A 1 51  ? -21.253 -3.740  -2.902  1.00 0.00 ? 51  ASP A HB2  3  
ATOM 5049  H HB3  . ASP A 1 51  ? -22.696 -3.554  -3.878  1.00 0.00 ? 51  ASP A HB3  3  
ATOM 5050  N N    . ILE A 1 52  ? -23.533 -0.715  -4.461  1.00 0.00 ? 52  ILE A N    3  
ATOM 5051  C CA   . ILE A 1 52  ? -24.852 -0.127  -4.301  1.00 0.00 ? 52  ILE A CA   3  
ATOM 5052  C C    . ILE A 1 52  ? -25.917 -1.183  -4.603  1.00 0.00 ? 52  ILE A C    3  
ATOM 5053  O O    . ILE A 1 52  ? -27.007 -1.151  -4.034  1.00 0.00 ? 52  ILE A O    3  
ATOM 5054  C CB   . ILE A 1 52  ? -24.982 1.138   -5.151  1.00 0.00 ? 52  ILE A CB   3  
ATOM 5055  C CG1  . ILE A 1 52  ? -26.406 1.695   -5.092  1.00 0.00 ? 52  ILE A CG1  3  
ATOM 5056  C CG2  . ILE A 1 52  ? -24.526 0.881   -6.589  1.00 0.00 ? 52  ILE A CG2  3  
ATOM 5057  C CD1  . ILE A 1 52  ? -26.393 3.212   -4.893  1.00 0.00 ? 52  ILE A CD1  3  
ATOM 5058  H H    . ILE A 1 52  ? -23.184 -0.721  -5.398  1.00 0.00 ? 52  ILE A H    3  
ATOM 5059  H HA   . ILE A 1 52  ? -24.951 0.175   -3.258  1.00 0.00 ? 52  ILE A HA   3  
ATOM 5060  H HB   . ILE A 1 52  ? -24.321 1.899   -4.735  1.00 0.00 ? 52  ILE A HB   3  
ATOM 5061  H HG12 . ILE A 1 52  ? -26.934 1.450   -6.014  1.00 0.00 ? 52  ILE A HG12 3  
ATOM 5062  H HG13 . ILE A 1 52  ? -26.952 1.222   -4.276  1.00 0.00 ? 52  ILE A HG13 3  
ATOM 5063  H HG21 . ILE A 1 52  ? -24.460 -0.193  -6.763  1.00 0.00 ? 52  ILE A HG21 3  
ATOM 5064  H HG22 . ILE A 1 52  ? -25.246 1.318   -7.282  1.00 0.00 ? 52  ILE A HG22 3  
ATOM 5065  H HG23 . ILE A 1 52  ? -23.548 1.336   -6.747  1.00 0.00 ? 52  ILE A HG23 3  
ATOM 5066  H HD11 . ILE A 1 52  ? -26.445 3.706   -5.863  1.00 0.00 ? 52  ILE A HD11 3  
ATOM 5067  H HD12 . ILE A 1 52  ? -27.252 3.506   -4.289  1.00 0.00 ? 52  ILE A HD12 3  
ATOM 5068  H HD13 . ILE A 1 52  ? -25.475 3.504   -4.384  1.00 0.00 ? 52  ILE A HD13 3  
ATOM 5069  N N    . VAL A 1 53  ? -25.563 -2.094  -5.498  1.00 0.00 ? 53  VAL A N    3  
ATOM 5070  C CA   . VAL A 1 53  ? -26.475 -3.158  -5.883  1.00 0.00 ? 53  VAL A CA   3  
ATOM 5071  C C    . VAL A 1 53  ? -26.495 -4.227  -4.789  1.00 0.00 ? 53  VAL A C    3  
ATOM 5072  O O    . VAL A 1 53  ? -27.557 -4.573  -4.273  1.00 0.00 ? 53  VAL A O    3  
ATOM 5073  C CB   . VAL A 1 53  ? -26.083 -3.713  -7.254  1.00 0.00 ? 53  VAL A CB   3  
ATOM 5074  C CG1  . VAL A 1 53  ? -26.073 -2.606  -8.311  1.00 0.00 ? 53  VAL A CG1  3  
ATOM 5075  C CG2  . VAL A 1 53  ? -24.729 -4.423  -7.191  1.00 0.00 ? 53  VAL A CG2  3  
ATOM 5076  H H    . VAL A 1 53  ? -24.675 -2.113  -5.956  1.00 0.00 ? 53  VAL A H    3  
ATOM 5077  H HA   . VAL A 1 53  ? -27.471 -2.723  -5.967  1.00 0.00 ? 53  VAL A HA   3  
ATOM 5078  H HB   . VAL A 1 53  ? -26.833 -4.448  -7.545  1.00 0.00 ? 53  VAL A HB   3  
ATOM 5079  H HG11 . VAL A 1 53  ? -25.121 -2.620  -8.842  1.00 0.00 ? 53  VAL A HG11 3  
ATOM 5080  H HG12 . VAL A 1 53  ? -26.886 -2.772  -9.018  1.00 0.00 ? 53  VAL A HG12 3  
ATOM 5081  H HG13 . VAL A 1 53  ? -26.205 -1.639  -7.825  1.00 0.00 ? 53  VAL A HG13 3  
ATOM 5082  H HG21 . VAL A 1 53  ? -24.393 -4.653  -8.202  1.00 0.00 ? 53  VAL A HG21 3  
ATOM 5083  H HG22 . VAL A 1 53  ? -24.001 -3.774  -6.705  1.00 0.00 ? 53  VAL A HG22 3  
ATOM 5084  H HG23 . VAL A 1 53  ? -24.830 -5.347  -6.622  1.00 0.00 ? 53  VAL A HG23 3  
ATOM 5085  N N    . LYS A 1 54  ? -25.308 -4.721  -4.467  1.00 0.00 ? 54  LYS A N    3  
ATOM 5086  C CA   . LYS A 1 54  ? -25.176 -5.744  -3.444  1.00 0.00 ? 54  LYS A CA   3  
ATOM 5087  C C    . LYS A 1 54  ? -25.234 -5.088  -2.063  1.00 0.00 ? 54  LYS A C    3  
ATOM 5088  O O    . LYS A 1 54  ? -25.333 -5.777  -1.048  1.00 0.00 ? 54  LYS A O    3  
ATOM 5089  C CB   . LYS A 1 54  ? -23.913 -6.576  -3.677  1.00 0.00 ? 54  LYS A CB   3  
ATOM 5090  C CG   . LYS A 1 54  ? -24.084 -7.506  -4.880  1.00 0.00 ? 54  LYS A CG   3  
ATOM 5091  C CD   . LYS A 1 54  ? -24.522 -8.903  -4.435  1.00 0.00 ? 54  LYS A CD   3  
ATOM 5092  C CE   . LYS A 1 54  ? -26.025 -9.100  -4.644  1.00 0.00 ? 54  LYS A CE   3  
ATOM 5093  N NZ   . LYS A 1 54  ? -26.290 -10.394 -5.312  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 5094  H H    . LYS A 1 54  ? -24.449 -4.435  -4.892  1.00 0.00 ? 54  LYS A H    3  
ATOM 5095  H HA   . LYS A 1 54  ? -26.028 -6.417  -3.542  1.00 0.00 ? 54  LYS A HA   3  
ATOM 5096  H HB2  . LYS A 1 54  ? -23.063 -5.915  -3.843  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 5097  H HB3  . LYS A 1 54  ? -23.691 -7.164  -2.787  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 5098  H HG2  . LYS A 1 54  ? -24.824 -7.090  -5.564  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 5099  H HG3  . LYS A 1 54  ? -23.145 -7.573  -5.429  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 5100  H HD2  . LYS A 1 54  ? -23.971 -9.657  -4.997  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 5101  H HD3  . LYS A 1 54  ? -24.277 -9.047  -3.383  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 5102  H HE2  . LYS A 1 54  ? -26.540 -9.067  -3.684  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 5103  H HE3  . LYS A 1 54  ? -26.424 -8.284  -5.248  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 5104  H HZ1  . LYS A 1 54  ? -26.735 -10.229 -6.193  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 5105  H HZ2  . LYS A 1 54  ? -25.427 -10.876 -5.460  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 5106  H HZ3  . LYS A 1 54  ? -26.888 -10.950 -4.735  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 5107  N N    . GLY A 1 55  ? -25.168 -3.765  -2.068  1.00 0.00 ? 55  GLY A N    3  
ATOM 5108  C CA   . GLY A 1 55  ? -25.211 -3.008  -0.829  1.00 0.00 ? 55  GLY A CA   3  
ATOM 5109  C C    . GLY A 1 55  ? -24.146 -3.502  0.153   1.00 0.00 ? 55  GLY A C    3  
ATOM 5110  O O    . GLY A 1 55  ? -24.359 -3.487  1.364   1.00 0.00 ? 55  GLY A O    3  
ATOM 5111  H H    . GLY A 1 55  ? -25.087 -3.213  -2.898  1.00 0.00 ? 55  GLY A H    3  
ATOM 5112  H HA2  . GLY A 1 55  ? -25.055 -1.950  -1.038  1.00 0.00 ? 55  GLY A HA2  3  
ATOM 5113  H HA3  . GLY A 1 55  ? -26.199 -3.101  -0.376  1.00 0.00 ? 55  GLY A HA3  3  
ATOM 5114  N N    . THR A 1 56  ? -23.024 -3.928  -0.407  1.00 0.00 ? 56  THR A N    3  
ATOM 5115  C CA   . THR A 1 56  ? -21.925 -4.425  0.403   1.00 0.00 ? 56  THR A CA   3  
ATOM 5116  C C    . THR A 1 56  ? -20.737 -3.463  0.340   1.00 0.00 ? 56  THR A C    3  
ATOM 5117  O O    . THR A 1 56  ? -20.164 -3.248  -0.727  1.00 0.00 ? 56  THR A O    3  
ATOM 5118  C CB   . THR A 1 56  ? -21.587 -5.839  -0.074  1.00 0.00 ? 56  THR A CB   3  
ATOM 5119  O OG1  . THR A 1 56  ? -21.860 -5.807  -1.473  1.00 0.00 ? 56  THR A OG1  3  
ATOM 5120  C CG2  . THR A 1 56  ? -22.558 -6.889  0.470   1.00 0.00 ? 56  THR A CG2  3  
ATOM 5121  H H    . THR A 1 56  ? -22.859 -3.937  -1.394  1.00 0.00 ? 56  THR A H    3  
ATOM 5122  H HA   . THR A 1 56  ? -22.253 -4.461  1.442   1.00 0.00 ? 56  THR A HA   3  
ATOM 5123  H HB   . THR A 1 56  ? -20.557 -6.097  0.170   1.00 0.00 ? 56  THR A HB   3  
ATOM 5124  H HG1  . THR A 1 56  ? -22.847 -5.826  -1.630  1.00 0.00 ? 56  THR A HG1  3  
ATOM 5125  H HG21 . THR A 1 56  ? -23.035 -7.409  -0.360  1.00 0.00 ? 56  THR A HG21 3  
ATOM 5126  H HG22 . THR A 1 56  ? -22.011 -7.606  1.083   1.00 0.00 ? 56  THR A HG22 3  
ATOM 5127  H HG23 . THR A 1 56  ? -23.320 -6.399  1.078   1.00 0.00 ? 56  THR A HG23 3  
ATOM 5128  N N    . ASN A 1 57  ? -20.403 -2.909  1.496   1.00 0.00 ? 57  ASN A N    3  
ATOM 5129  C CA   . ASN A 1 57  ? -19.294 -1.974  1.586   1.00 0.00 ? 57  ASN A CA   3  
ATOM 5130  C C    . ASN A 1 57  ? -17.976 -2.748  1.538   1.00 0.00 ? 57  ASN A C    3  
ATOM 5131  O O    . ASN A 1 57  ? -17.949 -3.953  1.786   1.00 0.00 ? 57  ASN A O    3  
ATOM 5132  C CB   . ASN A 1 57  ? -19.337 -1.194  2.901   1.00 0.00 ? 57  ASN A CB   3  
ATOM 5133  C CG   . ASN A 1 57  ? -20.543 -0.253  2.941   1.00 0.00 ? 57  ASN A CG   3  
ATOM 5134  O OD1  . ASN A 1 57  ? -21.605 -0.540  2.414   1.00 0.00 ? 57  ASN A OD1  3  
ATOM 5135  N ND2  . ASN A 1 57  ? -20.320 0.884   3.595   1.00 0.00 ? 57  ASN A ND2  3  
ATOM 5136  H H    . ASN A 1 57  ? -20.875 -3.089  2.359   1.00 0.00 ? 57  ASN A H    3  
ATOM 5137  H HA   . ASN A 1 57  ? -19.416 -1.304  0.735   1.00 0.00 ? 57  ASN A HA   3  
ATOM 5138  H HB2  . ASN A 1 57  ? -19.385 -1.889  3.739   1.00 0.00 ? 57  ASN A HB2  3  
ATOM 5139  H HB3  . ASN A 1 57  ? -18.418 -0.618  3.016   1.00 0.00 ? 57  ASN A HB3  3  
ATOM 5140  H HD21 . ASN A 1 57  ? -19.425 1.058   4.005   1.00 0.00 ? 57  ASN A HD21 3  
ATOM 5141  H HD22 . ASN A 1 57  ? -21.048 1.565   3.676   1.00 0.00 ? 57  ASN A HD22 3  
ATOM 5142  N N    . SER A 1 58  ? -16.913 -2.025  1.217   1.00 0.00 ? 58  SER A N    3  
ATOM 5143  C CA   . SER A 1 58  ? -15.594 -2.629  1.134   1.00 0.00 ? 58  SER A CA   3  
ATOM 5144  C C    . SER A 1 58  ? -14.517 -1.568  1.370   1.00 0.00 ? 58  SER A C    3  
ATOM 5145  O O    . SER A 1 58  ? -14.671 -0.419  0.959   1.00 0.00 ? 58  SER A O    3  
ATOM 5146  C CB   . SER A 1 58  ? -15.383 -3.306  -0.222  1.00 0.00 ? 58  SER A CB   3  
ATOM 5147  O OG   . SER A 1 58  ? -16.445 -4.201  -0.542  1.00 0.00 ? 58  SER A OG   3  
ATOM 5148  H H    . SER A 1 58  ? -16.943 -1.046  1.017   1.00 0.00 ? 58  SER A H    3  
ATOM 5149  H HA   . SER A 1 58  ? -15.570 -3.381  1.923   1.00 0.00 ? 58  SER A HA   3  
ATOM 5150  H HB2  . SER A 1 58  ? -15.303 -2.546  -0.998  1.00 0.00 ? 58  SER A HB2  3  
ATOM 5151  H HB3  . SER A 1 58  ? -14.440 -3.852  -0.211  1.00 0.00 ? 58  SER A HB3  3  
ATOM 5152  H HG   . SER A 1 58  ? -16.721 -4.076  -1.495  1.00 0.00 ? 58  SER A HG   3  
ATOM 5153  N N    . TYR A 1 59  ? -13.450 -1.991  2.032   1.00 0.00 ? 59  TYR A N    3  
ATOM 5154  C CA   . TYR A 1 59  ? -12.348 -1.092  2.328   1.00 0.00 ? 59  TYR A CA   3  
ATOM 5155  C C    . TYR A 1 59  ? -11.002 -1.764  2.049   1.00 0.00 ? 59  TYR A C    3  
ATOM 5156  O O    . TYR A 1 59  ? -10.671 -2.778  2.661   1.00 0.00 ? 59  TYR A O    3  
ATOM 5157  C CB   . TYR A 1 59  ? -12.448 -0.780  3.823   1.00 0.00 ? 59  TYR A CB   3  
ATOM 5158  C CG   . TYR A 1 59  ? -11.859 -1.866  4.726   1.00 0.00 ? 59  TYR A CG   3  
ATOM 5159  C CD1  . TYR A 1 59  ? -10.511 -1.863  5.020   1.00 0.00 ? 59  TYR A CD1  3  
ATOM 5160  C CD2  . TYR A 1 59  ? -12.677 -2.849  5.246   1.00 0.00 ? 59  TYR A CD2  3  
ATOM 5161  C CE1  . TYR A 1 59  ? -9.957  -2.885  5.870   1.00 0.00 ? 59  TYR A CE1  3  
ATOM 5162  C CE2  . TYR A 1 59  ? -12.123 -3.871  6.096   1.00 0.00 ? 59  TYR A CE2  3  
ATOM 5163  C CZ   . TYR A 1 59  ? -10.791 -3.838  6.366   1.00 0.00 ? 59  TYR A CZ   3  
ATOM 5164  O OH   . TYR A 1 59  ? -10.268 -4.804  7.169   1.00 0.00 ? 59  TYR A OH   3  
ATOM 5165  H H    . TYR A 1 59  ? -13.332 -2.927  2.363   1.00 0.00 ? 59  TYR A H    3  
ATOM 5166  H HA   . TYR A 1 59  ? -12.448 -0.215  1.689   1.00 0.00 ? 59  TYR A HA   3  
ATOM 5167  H HB2  . TYR A 1 59  ? -11.935 0.161   4.022   1.00 0.00 ? 59  TYR A HB2  3  
ATOM 5168  H HB3  . TYR A 1 59  ? -13.496 -0.634  4.084   1.00 0.00 ? 59  TYR A HB3  3  
ATOM 5169  H HD1  . TYR A 1 59  ? -9.866  -1.087  4.610   1.00 0.00 ? 59  TYR A HD1  3  
ATOM 5170  H HD2  . TYR A 1 59  ? -13.742 -2.851  5.013   1.00 0.00 ? 59  TYR A HD2  3  
ATOM 5171  H HE1  . TYR A 1 59  ? -8.894  -2.894  6.111   1.00 0.00 ? 59  TYR A HE1  3  
ATOM 5172  H HE2  . TYR A 1 59  ? -12.758 -4.653  6.513   1.00 0.00 ? 59  TYR A HE2  3  
ATOM 5173  H HH   . TYR A 1 59  ? -10.950 -5.515  7.337   1.00 0.00 ? 59  TYR A HH   3  
ATOM 5174  N N    . TYR A 1 60  ? -10.262 -1.171  1.123   1.00 0.00 ? 60  TYR A N    3  
ATOM 5175  C CA   . TYR A 1 60  ? -8.959  -1.699  0.755   1.00 0.00 ? 60  TYR A CA   3  
ATOM 5176  C C    . TYR A 1 60  ? -7.841  -0.741  1.171   1.00 0.00 ? 60  TYR A C    3  
ATOM 5177  O O    . TYR A 1 60  ? -7.834  0.421   0.768   1.00 0.00 ? 60  TYR A O    3  
ATOM 5178  C CB   . TYR A 1 60  ? -8.969  -1.821  -0.770  1.00 0.00 ? 60  TYR A CB   3  
ATOM 5179  C CG   . TYR A 1 60  ? -7.700  -2.445  -1.353  1.00 0.00 ? 60  TYR A CG   3  
ATOM 5180  C CD1  . TYR A 1 60  ? -6.565  -1.677  -1.515  1.00 0.00 ? 60  TYR A CD1  3  
ATOM 5181  C CD2  . TYR A 1 60  ? -7.689  -3.777  -1.716  1.00 0.00 ? 60  TYR A CD2  3  
ATOM 5182  C CE1  . TYR A 1 60  ? -5.370  -2.264  -2.064  1.00 0.00 ? 60  TYR A CE1  3  
ATOM 5183  C CE2  . TYR A 1 60  ? -6.494  -4.364  -2.265  1.00 0.00 ? 60  TYR A CE2  3  
ATOM 5184  C CZ   . TYR A 1 60  ? -5.394  -3.578  -2.411  1.00 0.00 ? 60  TYR A CZ   3  
ATOM 5185  O OH   . TYR A 1 60  ? -4.265  -4.133  -2.929  1.00 0.00 ? 60  TYR A OH   3  
ATOM 5186  H H    . TYR A 1 60  ? -10.538 -0.346  0.630   1.00 0.00 ? 60  TYR A H    3  
ATOM 5187  H HA   . TYR A 1 60  ? -8.824  -2.650  1.271   1.00 0.00 ? 60  TYR A HA   3  
ATOM 5188  H HB2  . TYR A 1 60  ? -9.828  -2.422  -1.070  1.00 0.00 ? 60  TYR A HB2  3  
ATOM 5189  H HB3  . TYR A 1 60  ? -9.107  -0.830  -1.202  1.00 0.00 ? 60  TYR A HB3  3  
ATOM 5190  H HD1  . TYR A 1 60  ? -6.574  -0.625  -1.228  1.00 0.00 ? 60  TYR A HD1  3  
ATOM 5191  H HD2  . TYR A 1 60  ? -8.585  -4.384  -1.588  1.00 0.00 ? 60  TYR A HD2  3  
ATOM 5192  H HE1  . TYR A 1 60  ? -4.467  -1.668  -2.197  1.00 0.00 ? 60  TYR A HE1  3  
ATOM 5193  H HE2  . TYR A 1 60  ? -6.472  -5.414  -2.556  1.00 0.00 ? 60  TYR A HE2  3  
ATOM 5194  H HH   . TYR A 1 60  ? -4.343  -5.130  -2.930  1.00 0.00 ? 60  TYR A HH   3  
ATOM 5195  N N    . LYS A 1 61  ? -6.924  -1.264  1.971   1.00 0.00 ? 61  LYS A N    3  
ATOM 5196  C CA   . LYS A 1 61  ? -5.804  -0.470  2.446   1.00 0.00 ? 61  LYS A CA   3  
ATOM 5197  C C    . LYS A 1 61  ? -4.517  -0.963  1.782   1.00 0.00 ? 61  LYS A C    3  
ATOM 5198  O O    . LYS A 1 61  ? -4.285  -2.168  1.689   1.00 0.00 ? 61  LYS A O    3  
ATOM 5199  C CB   . LYS A 1 61  ? -5.750  -0.479  3.975   1.00 0.00 ? 61  LYS A CB   3  
ATOM 5200  C CG   . LYS A 1 61  ? -5.901  0.936   4.537   1.00 0.00 ? 61  LYS A CG   3  
ATOM 5201  C CD   . LYS A 1 61  ? -4.592  1.718   4.413   1.00 0.00 ? 61  LYS A CD   3  
ATOM 5202  C CE   . LYS A 1 61  ? -4.221  2.380   5.741   1.00 0.00 ? 61  LYS A CE   3  
ATOM 5203  N NZ   . LYS A 1 61  ? -3.239  3.465   5.523   1.00 0.00 ? 61  LYS A NZ   3  
ATOM 5204  H H    . LYS A 1 61  ? -6.938  -2.211  2.294   1.00 0.00 ? 61  LYS A H    3  
ATOM 5205  H HA   . LYS A 1 61  ? -5.979  0.560   2.136   1.00 0.00 ? 61  LYS A HA   3  
ATOM 5206  H HB2  . LYS A 1 61  ? -6.543  -1.117  4.367   1.00 0.00 ? 61  LYS A HB2  3  
ATOM 5207  H HB3  . LYS A 1 61  ? -4.804  -0.907  4.306   1.00 0.00 ? 61  LYS A HB3  3  
ATOM 5208  H HG2  . LYS A 1 61  ? -6.694  1.460   4.004   1.00 0.00 ? 61  LYS A HG2  3  
ATOM 5209  H HG3  . LYS A 1 61  ? -6.201  0.885   5.584   1.00 0.00 ? 61  LYS A HG3  3  
ATOM 5210  H HD2  . LYS A 1 61  ? -3.792  1.047   4.101   1.00 0.00 ? 61  LYS A HD2  3  
ATOM 5211  H HD3  . LYS A 1 61  ? -4.691  2.479   3.638   1.00 0.00 ? 61  LYS A HD3  3  
ATOM 5212  H HE2  . LYS A 1 61  ? -5.116  2.782   6.217   1.00 0.00 ? 61  LYS A HE2  3  
ATOM 5213  H HE3  . LYS A 1 61  ? -3.805  1.637   6.422   1.00 0.00 ? 61  LYS A HE3  3  
ATOM 5214  H HZ1  . LYS A 1 61  ? -2.392  3.252   6.011   1.00 0.00 ? 61  LYS A HZ1  3  
ATOM 5215  H HZ2  . LYS A 1 61  ? -3.047  3.550   4.545   1.00 0.00 ? 61  LYS A HZ2  3  
ATOM 5216  H HZ3  . LYS A 1 61  ? -3.612  4.327   5.865   1.00 0.00 ? 61  LYS A HZ3  3  
ATOM 5217  N N    . LEU A 1 62  ? -3.713  -0.008  1.338   1.00 0.00 ? 62  LEU A N    3  
ATOM 5218  C CA   . LEU A 1 62  ? -2.456  -0.330  0.686   1.00 0.00 ? 62  LEU A CA   3  
ATOM 5219  C C    . LEU A 1 62  ? -1.311  0.367   1.423   1.00 0.00 ? 62  LEU A C    3  
ATOM 5220  O O    . LEU A 1 62  ? -1.375  1.567   1.685   1.00 0.00 ? 62  LEU A O    3  
ATOM 5221  C CB   . LEU A 1 62  ? -2.523  0.008   -0.805  1.00 0.00 ? 62  LEU A CB   3  
ATOM 5222  C CG   . LEU A 1 62  ? -1.498  -0.693  -1.698  1.00 0.00 ? 62  LEU A CG   3  
ATOM 5223  C CD1  . LEU A 1 62  ? -1.932  -2.126  -2.012  1.00 0.00 ? 62  LEU A CD1  3  
ATOM 5224  C CD2  . LEU A 1 62  ? -1.233  0.117   -2.969  1.00 0.00 ? 62  LEU A CD2  3  
ATOM 5225  H H    . LEU A 1 62  ? -3.910  0.970   1.418   1.00 0.00 ? 62  LEU A H    3  
ATOM 5226  H HA   . LEU A 1 62  ? -2.313  -1.408  0.766   1.00 0.00 ? 62  LEU A HA   3  
ATOM 5227  H HB2  . LEU A 1 62  ? -3.521  -0.239  -1.168  1.00 0.00 ? 62  LEU A HB2  3  
ATOM 5228  H HB3  . LEU A 1 62  ? -2.399  1.085   -0.919  1.00 0.00 ? 62  LEU A HB3  3  
ATOM 5229  H HG   . LEU A 1 62  ? -0.555  -0.754  -1.154  1.00 0.00 ? 62  LEU A HG   3  
ATOM 5230  H HD11 . LEU A 1 62  ? -2.518  -2.518  -1.181  1.00 0.00 ? 62  LEU A HD11 3  
ATOM 5231  H HD12 . LEU A 1 62  ? -2.538  -2.131  -2.918  1.00 0.00 ? 62  LEU A HD12 3  
ATOM 5232  H HD13 . LEU A 1 62  ? -1.050  -2.749  -2.161  1.00 0.00 ? 62  LEU A HD13 3  
ATOM 5233  H HD21 . LEU A 1 62  ? -1.847  -0.271  -3.782  1.00 0.00 ? 62  LEU A HD21 3  
ATOM 5234  H HD22 . LEU A 1 62  ? -1.485  1.163   -2.792  1.00 0.00 ? 62  LEU A HD22 3  
ATOM 5235  H HD23 . LEU A 1 62  ? -0.180  0.037   -3.238  1.00 0.00 ? 62  LEU A HD23 3  
ATOM 5236  N N    . GLN A 1 63  ? -0.289  -0.416  1.738   1.00 0.00 ? 63  GLN A N    3  
ATOM 5237  C CA   . GLN A 1 63  ? 0.869   0.111   2.440   1.00 0.00 ? 63  GLN A CA   3  
ATOM 5238  C C    . GLN A 1 63  ? 2.119   -0.696  2.083   1.00 0.00 ? 63  GLN A C    3  
ATOM 5239  O O    . GLN A 1 63  ? 2.172   -1.902  2.321   1.00 0.00 ? 63  GLN A O    3  
ATOM 5240  C CB   . GLN A 1 63  ? 0.636   0.122   3.952   1.00 0.00 ? 63  GLN A CB   3  
ATOM 5241  C CG   . GLN A 1 63  ? -0.517  1.056   4.322   1.00 0.00 ? 63  GLN A CG   3  
ATOM 5242  C CD   . GLN A 1 63  ? -0.725  1.097   5.838   1.00 0.00 ? 63  GLN A CD   3  
ATOM 5243  O OE1  . GLN A 1 63  ? -1.617  0.471   6.385   1.00 0.00 ? 63  GLN A OE1  3  
ATOM 5244  N NE2  . GLN A 1 63  ? 0.147   1.868   6.482   1.00 0.00 ? 63  GLN A NE2  3  
ATOM 5245  H H    . GLN A 1 63  ? -0.244  -1.391  1.521   1.00 0.00 ? 63  GLN A H    3  
ATOM 5246  H HA   . GLN A 1 63  ? 0.979   1.137   2.088   1.00 0.00 ? 63  GLN A HA   3  
ATOM 5247  H HB2  . GLN A 1 63  ? 0.415   -0.889  4.296   1.00 0.00 ? 63  GLN A HB2  3  
ATOM 5248  H HB3  . GLN A 1 63  ? 1.545   0.440   4.461   1.00 0.00 ? 63  GLN A HB3  3  
ATOM 5249  H HG2  . GLN A 1 63  ? -0.309  2.061   3.953   1.00 0.00 ? 63  GLN A HG2  3  
ATOM 5250  H HG3  . GLN A 1 63  ? -1.433  0.721   3.835   1.00 0.00 ? 63  GLN A HG3  3  
ATOM 5251  H HE21 . GLN A 1 63  ? 0.856   2.356   5.973   1.00 0.00 ? 63  GLN A HE21 3  
ATOM 5252  H HE22 . GLN A 1 63  ? 0.093   1.960   7.477   1.00 0.00 ? 63  GLN A HE22 3  
ATOM 5253  N N    . LEU A 1 64  ? 3.094   0.001   1.519   1.00 0.00 ? 64  LEU A N    3  
ATOM 5254  C CA   . LEU A 1 64  ? 4.340   -0.636  1.127   1.00 0.00 ? 64  LEU A CA   3  
ATOM 5255  C C    . LEU A 1 64  ? 5.378   -0.440  2.235   1.00 0.00 ? 64  LEU A C    3  
ATOM 5256  O O    . LEU A 1 64  ? 6.021   0.606   2.310   1.00 0.00 ? 64  LEU A O    3  
ATOM 5257  C CB   . LEU A 1 64  ? 4.796   -0.125  -0.240  1.00 0.00 ? 64  LEU A CB   3  
ATOM 5258  C CG   . LEU A 1 64  ? 5.823   -0.992  -0.972  1.00 0.00 ? 64  LEU A CG   3  
ATOM 5259  C CD1  . LEU A 1 64  ? 6.111   -0.439  -2.369  1.00 0.00 ? 64  LEU A CD1  3  
ATOM 5260  C CD2  . LEU A 1 64  ? 7.099   -1.148  -0.143  1.00 0.00 ? 64  LEU A CD2  3  
ATOM 5261  H H    . LEU A 1 64  ? 3.043   0.982   1.329   1.00 0.00 ? 64  LEU A H    3  
ATOM 5262  H HA   . LEU A 1 64  ? 4.143   -1.703  1.023   1.00 0.00 ? 64  LEU A HA   3  
ATOM 5263  H HB2  . LEU A 1 64  ? 3.919   -0.019  -0.878  1.00 0.00 ? 64  LEU A HB2  3  
ATOM 5264  H HB3  . LEU A 1 64  ? 5.218   0.872   -0.112  1.00 0.00 ? 64  LEU A HB3  3  
ATOM 5265  H HG   . LEU A 1 64  ? 5.399   -1.988  -1.101  1.00 0.00 ? 64  LEU A HG   3  
ATOM 5266  H HD11 . LEU A 1 64  ? 5.938   0.637   -2.377  1.00 0.00 ? 64  LEU A HD11 3  
ATOM 5267  H HD12 . LEU A 1 64  ? 7.149   -0.642  -2.633  1.00 0.00 ? 64  LEU A HD12 3  
ATOM 5268  H HD13 . LEU A 1 64  ? 5.452   -0.919  -3.093  1.00 0.00 ? 64  LEU A HD13 3  
ATOM 5269  H HD21 . LEU A 1 64  ? 7.510   -0.164  0.080   1.00 0.00 ? 64  LEU A HD21 3  
ATOM 5270  H HD22 . LEU A 1 64  ? 6.866   -1.665  0.788   1.00 0.00 ? 64  LEU A HD22 3  
ATOM 5271  H HD23 . LEU A 1 64  ? 7.830   -1.728  -0.707  1.00 0.00 ? 64  LEU A HD23 3  
ATOM 5272  N N    . LEU A 1 65  ? 5.509   -1.463  3.066   1.00 0.00 ? 65  LEU A N    3  
ATOM 5273  C CA   . LEU A 1 65  ? 6.458   -1.417  4.166   1.00 0.00 ? 65  LEU A CA   3  
ATOM 5274  C C    . LEU A 1 65  ? 7.861   -1.717  3.636   1.00 0.00 ? 65  LEU A C    3  
ATOM 5275  O O    . LEU A 1 65  ? 8.057   -2.682  2.899   1.00 0.00 ? 65  LEU A O    3  
ATOM 5276  C CB   . LEU A 1 65  ? 6.015   -2.349  5.295   1.00 0.00 ? 65  LEU A CB   3  
ATOM 5277  C CG   . LEU A 1 65  ? 4.514   -2.377  5.593   1.00 0.00 ? 65  LEU A CG   3  
ATOM 5278  C CD1  . LEU A 1 65  ? 4.173   -3.488  6.587   1.00 0.00 ? 65  LEU A CD1  3  
ATOM 5279  C CD2  . LEU A 1 65  ? 4.025   -1.009  6.072   1.00 0.00 ? 65  LEU A CD2  3  
ATOM 5280  H H    . LEU A 1 65  ? 4.982   -2.311  2.998   1.00 0.00 ? 65  LEU A H    3  
ATOM 5281  H HA   . LEU A 1 65  ? 6.448   -0.402  4.563   1.00 0.00 ? 65  LEU A HA   3  
ATOM 5282  H HB2  . LEU A 1 65  ? 6.335   -3.362  5.050   1.00 0.00 ? 65  LEU A HB2  3  
ATOM 5283  H HB3  . LEU A 1 65  ? 6.540   -2.060  6.205   1.00 0.00 ? 65  LEU A HB3  3  
ATOM 5284  H HG   . LEU A 1 65  ? 3.986   -2.600  4.666   1.00 0.00 ? 65  LEU A HG   3  
ATOM 5285  H HD11 . LEU A 1 65  ? 4.503   -4.447  6.188   1.00 0.00 ? 65  LEU A HD11 3  
ATOM 5286  H HD12 . LEU A 1 65  ? 4.676   -3.296  7.534   1.00 0.00 ? 65  LEU A HD12 3  
ATOM 5287  H HD13 . LEU A 1 65  ? 3.095   -3.514  6.747   1.00 0.00 ? 65  LEU A HD13 3  
ATOM 5288  H HD21 . LEU A 1 65  ? 2.935   -0.989  6.066   1.00 0.00 ? 65  LEU A HD21 3  
ATOM 5289  H HD22 . LEU A 1 65  ? 4.386   -0.828  7.085   1.00 0.00 ? 65  LEU A HD22 3  
ATOM 5290  H HD23 . LEU A 1 65  ? 4.406   -0.233  5.408   1.00 0.00 ? 65  LEU A HD23 3  
ATOM 5291  N N    . GLU A 1 66  ? 8.802   -0.871  4.031   1.00 0.00 ? 66  GLU A N    3  
ATOM 5292  C CA   . GLU A 1 66  ? 10.181  -1.034  3.605   1.00 0.00 ? 66  GLU A CA   3  
ATOM 5293  C C    . GLU A 1 66  ? 11.088  -1.258  4.817   1.00 0.00 ? 66  GLU A C    3  
ATOM 5294  O O    . GLU A 1 66  ? 10.731  -0.901  5.939   1.00 0.00 ? 66  GLU A O    3  
ATOM 5295  C CB   . GLU A 1 66  ? 10.648  0.172   2.787   1.00 0.00 ? 66  GLU A CB   3  
ATOM 5296  C CG   . GLU A 1 66  ? 10.833  1.401   3.679   1.00 0.00 ? 66  GLU A CG   3  
ATOM 5297  C CD   . GLU A 1 66  ? 11.680  2.465   2.978   1.00 0.00 ? 66  GLU A CD   3  
ATOM 5298  O OE1  . GLU A 1 66  ? 12.584  2.059   2.215   1.00 0.00 ? 66  GLU A OE1  3  
ATOM 5299  O OE2  . GLU A 1 66  ? 11.405  3.660   3.220   1.00 0.00 ? 66  GLU A OE2  3  
ATOM 5300  H H    . GLU A 1 66  ? 8.634   -0.089  4.631   1.00 0.00 ? 66  GLU A H    3  
ATOM 5301  H HA   . GLU A 1 66  ? 10.186  -1.920  2.970   1.00 0.00 ? 66  GLU A HA   3  
ATOM 5302  H HB2  . GLU A 1 66  ? 11.588  -0.064  2.288   1.00 0.00 ? 66  GLU A HB2  3  
ATOM 5303  H HB3  . GLU A 1 66  ? 9.919   0.391   2.007   1.00 0.00 ? 66  GLU A HB3  3  
ATOM 5304  H HG2  . GLU A 1 66  ? 9.859   1.818   3.936   1.00 0.00 ? 66  GLU A HG2  3  
ATOM 5305  H HG3  . GLU A 1 66  ? 11.311  1.108   4.613   1.00 0.00 ? 66  GLU A HG3  3  
ATOM 5306  N N    . ASP A 1 67  ? 12.244  -1.849  4.550   1.00 0.00 ? 67  ASP A N    3  
ATOM 5307  C CA   . ASP A 1 67  ? 13.204  -2.125  5.604   1.00 0.00 ? 67  ASP A CA   3  
ATOM 5308  C C    . ASP A 1 67  ? 13.648  -0.807  6.242   1.00 0.00 ? 67  ASP A C    3  
ATOM 5309  O O    . ASP A 1 67  ? 13.755  0.212   5.561   1.00 0.00 ? 67  ASP A O    3  
ATOM 5310  C CB   . ASP A 1 67  ? 14.447  -2.822  5.048   1.00 0.00 ? 67  ASP A CB   3  
ATOM 5311  C CG   . ASP A 1 67  ? 15.148  -2.082  3.907   1.00 0.00 ? 67  ASP A CG   3  
ATOM 5312  O OD1  . ASP A 1 67  ? 15.959  -1.185  4.226   1.00 0.00 ? 67  ASP A OD1  3  
ATOM 5313  O OD2  . ASP A 1 67  ? 14.858  -2.430  2.742   1.00 0.00 ? 67  ASP A OD2  3  
ATOM 5314  H H    . ASP A 1 67  ? 12.527  -2.136  3.634   1.00 0.00 ? 67  ASP A H    3  
ATOM 5315  H HA   . ASP A 1 67  ? 12.680  -2.773  6.306   1.00 0.00 ? 67  ASP A HA   3  
ATOM 5316  H HB2  . ASP A 1 67  ? 15.160  -2.965  5.860   1.00 0.00 ? 67  ASP A HB2  3  
ATOM 5317  H HB3  . ASP A 1 67  ? 14.162  -3.814  4.697   1.00 0.00 ? 67  ASP A HB3  3  
ATOM 5318  N N    . ASP A 1 68  ? 13.893  -0.869  7.543   1.00 0.00 ? 68  ASP A N    3  
ATOM 5319  C CA   . ASP A 1 68  ? 14.322  0.306   8.281   1.00 0.00 ? 68  ASP A CA   3  
ATOM 5320  C C    . ASP A 1 68  ? 15.714  0.725   7.801   1.00 0.00 ? 68  ASP A C    3  
ATOM 5321  O O    . ASP A 1 68  ? 15.935  1.887   7.466   1.00 0.00 ? 68  ASP A O    3  
ATOM 5322  C CB   . ASP A 1 68  ? 14.408  0.015   9.780   1.00 0.00 ? 68  ASP A CB   3  
ATOM 5323  C CG   . ASP A 1 68  ? 13.183  0.442   10.592  1.00 0.00 ? 68  ASP A CG   3  
ATOM 5324  O OD1  . ASP A 1 68  ? 12.099  0.535   9.978   1.00 0.00 ? 68  ASP A OD1  3  
ATOM 5325  O OD2  . ASP A 1 68  ? 13.359  0.665   11.810  1.00 0.00 ? 68  ASP A OD2  3  
ATOM 5326  H H    . ASP A 1 68  ? 13.803  -1.702  8.090   1.00 0.00 ? 68  ASP A H    3  
ATOM 5327  H HA   . ASP A 1 68  ? 13.566  1.064   8.077   1.00 0.00 ? 68  ASP A HA   3  
ATOM 5328  H HB2  . ASP A 1 68  ? 14.562  -1.055  9.919   1.00 0.00 ? 68  ASP A HB2  3  
ATOM 5329  H HB3  . ASP A 1 68  ? 15.286  0.519   10.184  1.00 0.00 ? 68  ASP A HB3  3  
ATOM 5330  N N    . LYS A 1 69  ? 16.615  -0.246  7.783   1.00 0.00 ? 69  LYS A N    3  
ATOM 5331  C CA   . LYS A 1 69  ? 17.979  0.007   7.349   1.00 0.00 ? 69  LYS A CA   3  
ATOM 5332  C C    . LYS A 1 69  ? 18.629  -1.313  6.928   1.00 0.00 ? 69  LYS A C    3  
ATOM 5333  O O    . LYS A 1 69  ? 19.690  -1.675  7.433   1.00 0.00 ? 69  LYS A O    3  
ATOM 5334  C CB   . LYS A 1 69  ? 18.755  0.756   8.434   1.00 0.00 ? 69  LYS A CB   3  
ATOM 5335  C CG   . LYS A 1 69  ? 18.419  2.249   8.417   1.00 0.00 ? 69  LYS A CG   3  
ATOM 5336  C CD   . LYS A 1 69  ? 19.605  3.084   8.903   1.00 0.00 ? 69  LYS A CD   3  
ATOM 5337  C CE   . LYS A 1 69  ? 19.461  4.545   8.471   1.00 0.00 ? 69  LYS A CE   3  
ATOM 5338  N NZ   . LYS A 1 69  ? 20.792  5.158   8.266   1.00 0.00 ? 69  LYS A NZ   3  
ATOM 5339  H H    . LYS A 1 69  ? 16.427  -1.189  8.057   1.00 0.00 ? 69  LYS A H    3  
ATOM 5340  H HA   . LYS A 1 69  ? 17.929  0.661   6.479   1.00 0.00 ? 69  LYS A HA   3  
ATOM 5341  H HB2  . LYS A 1 69  ? 18.518  0.337   9.412   1.00 0.00 ? 69  LYS A HB2  3  
ATOM 5342  H HB3  . LYS A 1 69  ? 19.826  0.619   8.280   1.00 0.00 ? 69  LYS A HB3  3  
ATOM 5343  H HG2  . LYS A 1 69  ? 18.145  2.552   7.406   1.00 0.00 ? 69  LYS A HG2  3  
ATOM 5344  H HG3  . LYS A 1 69  ? 17.553  2.437   9.052   1.00 0.00 ? 69  LYS A HG3  3  
ATOM 5345  H HD2  . LYS A 1 69  ? 19.674  3.027   9.989   1.00 0.00 ? 69  LYS A HD2  3  
ATOM 5346  H HD3  . LYS A 1 69  ? 20.532  2.673   8.503   1.00 0.00 ? 69  LYS A HD3  3  
ATOM 5347  H HE2  . LYS A 1 69  ? 18.881  4.602   7.550   1.00 0.00 ? 69  LYS A HE2  3  
ATOM 5348  H HE3  . LYS A 1 69  ? 18.910  5.101   9.229   1.00 0.00 ? 69  LYS A HE3  3  
ATOM 5349  H HZ1  . LYS A 1 69  ? 21.111  5.557   9.126   1.00 0.00 ? 69  LYS A HZ1  3  
ATOM 5350  H HZ2  . LYS A 1 69  ? 21.438  4.459   7.962   1.00 0.00 ? 69  LYS A HZ2  3  
ATOM 5351  H HZ3  . LYS A 1 69  ? 20.725  5.875   7.571   1.00 0.00 ? 69  LYS A HZ3  3  
ATOM 5352  N N    . GLU A 1 70  ? 17.964  -1.995  6.007   1.00 0.00 ? 70  GLU A N    3  
ATOM 5353  C CA   . GLU A 1 70  ? 18.464  -3.267  5.513   1.00 0.00 ? 70  GLU A CA   3  
ATOM 5354  C C    . GLU A 1 70  ? 18.366  -3.318  3.987   1.00 0.00 ? 70  GLU A C    3  
ATOM 5355  O O    . GLU A 1 70  ? 19.098  -2.616  3.290   1.00 0.00 ? 70  GLU A O    3  
ATOM 5356  C CB   . GLU A 1 70  ? 17.711  -4.437  6.150   1.00 0.00 ? 70  GLU A CB   3  
ATOM 5357  C CG   . GLU A 1 70  ? 17.982  -4.509  7.654   1.00 0.00 ? 70  GLU A CG   3  
ATOM 5358  C CD   . GLU A 1 70  ? 18.797  -5.755  8.005   1.00 0.00 ? 70  GLU A CD   3  
ATOM 5359  O OE1  . GLU A 1 70  ? 18.312  -6.861  7.681   1.00 0.00 ? 70  GLU A OE1  3  
ATOM 5360  O OE2  . GLU A 1 70  ? 19.888  -5.574  8.589   1.00 0.00 ? 70  GLU A OE2  3  
ATOM 5361  H H    . GLU A 1 70  ? 17.101  -1.693  5.602   1.00 0.00 ? 70  GLU A H    3  
ATOM 5362  H HA   . GLU A 1 70  ? 19.509  -3.306  5.818   1.00 0.00 ? 70  GLU A HA   3  
ATOM 5363  H HB2  . GLU A 1 70  ? 16.641  -4.324  5.974   1.00 0.00 ? 70  GLU A HB2  3  
ATOM 5364  H HB3  . GLU A 1 70  ? 18.015  -5.370  5.677   1.00 0.00 ? 70  GLU A HB3  3  
ATOM 5365  H HG2  . GLU A 1 70  ? 18.520  -3.616  7.973   1.00 0.00 ? 70  GLU A HG2  3  
ATOM 5366  H HG3  . GLU A 1 70  ? 17.037  -4.523  8.197   1.00 0.00 ? 70  GLU A HG3  3  
ATOM 5367  N N    . ASN A 1 71  ? 17.456  -4.156  3.511   1.00 0.00 ? 71  ASN A N    3  
ATOM 5368  C CA   . ASN A 1 71  ? 17.254  -4.308  2.081   1.00 0.00 ? 71  ASN A CA   3  
ATOM 5369  C C    . ASN A 1 71  ? 16.133  -5.320  1.833   1.00 0.00 ? 71  ASN A C    3  
ATOM 5370  O O    . ASN A 1 71  ? 16.349  -6.345  1.189   1.00 0.00 ? 71  ASN A O    3  
ATOM 5371  C CB   . ASN A 1 71  ? 18.520  -4.828  1.397   1.00 0.00 ? 71  ASN A CB   3  
ATOM 5372  C CG   . ASN A 1 71  ? 18.262  -5.126  -0.081  1.00 0.00 ? 71  ASN A CG   3  
ATOM 5373  O OD1  . ASN A 1 71  ? 17.301  -4.666  -0.675  1.00 0.00 ? 71  ASN A OD1  3  
ATOM 5374  N ND2  . ASN A 1 71  ? 19.172  -5.920  -0.640  1.00 0.00 ? 71  ASN A ND2  3  
ATOM 5375  H H    . ASN A 1 71  ? 16.865  -4.724  4.085   1.00 0.00 ? 71  ASN A H    3  
ATOM 5376  H HA   . ASN A 1 71  ? 17.003  -3.311  1.720   1.00 0.00 ? 71  ASN A HA   3  
ATOM 5377  H HB2  . ASN A 1 71  ? 19.317  -4.090  1.490   1.00 0.00 ? 71  ASN A HB2  3  
ATOM 5378  H HB3  . ASN A 1 71  ? 18.863  -5.733  1.900   1.00 0.00 ? 71  ASN A HB3  3  
ATOM 5379  H HD21 . ASN A 1 71  ? 19.937  -6.264  -0.095  1.00 0.00 ? 71  ASN A HD21 3  
ATOM 5380  H HD22 . ASN A 1 71  ? 19.090  -6.173  -1.604  1.00 0.00 ? 71  ASN A HD22 3  
ATOM 5381  N N    . ARG A 1 72  ? 14.961  -4.997  2.359   1.00 0.00 ? 72  ARG A N    3  
ATOM 5382  C CA   . ARG A 1 72  ? 13.806  -5.865  2.203   1.00 0.00 ? 72  ARG A CA   3  
ATOM 5383  C C    . ARG A 1 72  ? 12.516  -5.042  2.230   1.00 0.00 ? 72  ARG A C    3  
ATOM 5384  O O    . ARG A 1 72  ? 12.489  -3.942  2.780   1.00 0.00 ? 72  ARG A O    3  
ATOM 5385  C CB   . ARG A 1 72  ? 13.754  -6.917  3.313   1.00 0.00 ? 72  ARG A CB   3  
ATOM 5386  C CG   . ARG A 1 72  ? 14.481  -8.195  2.890   1.00 0.00 ? 72  ARG A CG   3  
ATOM 5387  C CD   . ARG A 1 72  ? 14.479  -9.227  4.020   1.00 0.00 ? 72  ARG A CD   3  
ATOM 5388  N NE   . ARG A 1 72  ? 15.868  -9.607  4.360   1.00 0.00 ? 72  ARG A NE   3  
ATOM 5389  C CZ   . ARG A 1 72  ? 16.193  -10.477 5.326   1.00 0.00 ? 72  ARG A CZ   3  
ATOM 5390  N NH1  . ARG A 1 72  ? 15.232  -11.061 6.054   1.00 0.00 ? 72  ARG A NH1  3  
ATOM 5391  N NH2  . ARG A 1 72  ? 17.481  -10.763 5.565   1.00 0.00 ? 72  ARG A NH2  3  
ATOM 5392  H H    . ARG A 1 72  ? 14.794  -4.161  2.882   1.00 0.00 ? 72  ARG A H    3  
ATOM 5393  H HA   . ARG A 1 72  ? 13.946  -6.343  1.234   1.00 0.00 ? 72  ARG A HA   3  
ATOM 5394  H HB2  . ARG A 1 72  ? 14.210  -6.518  4.219   1.00 0.00 ? 72  ARG A HB2  3  
ATOM 5395  H HB3  . ARG A 1 72  ? 12.716  -7.147  3.553   1.00 0.00 ? 72  ARG A HB3  3  
ATOM 5396  H HG2  . ARG A 1 72  ? 13.999  -8.617  2.007   1.00 0.00 ? 72  ARG A HG2  3  
ATOM 5397  H HG3  . ARG A 1 72  ? 15.507  -7.959  2.610   1.00 0.00 ? 72  ARG A HG3  3  
ATOM 5398  H HD2  . ARG A 1 72  ? 13.980  -8.815  4.898   1.00 0.00 ? 72  ARG A HD2  3  
ATOM 5399  H HD3  . ARG A 1 72  ? 13.915  -10.109 3.718   1.00 0.00 ? 72  ARG A HD3  3  
ATOM 5400  H HE   . ARG A 1 72  ? 16.610  -9.189  3.837   1.00 0.00 ? 72  ARG A HE   3  
ATOM 5401  H HH11 . ARG A 1 72  ? 14.271  -10.848 5.875   1.00 0.00 ? 72  ARG A HH11 3  
ATOM 5402  H HH12 . ARG A 1 72  ? 15.475  -11.711 6.774   1.00 0.00 ? 72  ARG A HH12 3  
ATOM 5403  H HH21 . ARG A 1 72  ? 18.199  -10.326 5.022   1.00 0.00 ? 72  ARG A HH21 3  
ATOM 5404  H HH22 . ARG A 1 72  ? 17.724  -11.412 6.286   1.00 0.00 ? 72  ARG A HH22 3  
ATOM 5405  N N    . TYR A 1 73  ? 11.479  -5.606  1.629   1.00 0.00 ? 73  TYR A N    3  
ATOM 5406  C CA   . TYR A 1 73  ? 10.190  -4.939  1.576   1.00 0.00 ? 73  TYR A CA   3  
ATOM 5407  C C    . TYR A 1 73  ? 9.045   -5.951  1.656   1.00 0.00 ? 73  TYR A C    3  
ATOM 5408  O O    . TYR A 1 73  ? 9.257   -7.149  1.474   1.00 0.00 ? 73  TYR A O    3  
ATOM 5409  C CB   . TYR A 1 73  ? 10.136  -4.231  0.221   1.00 0.00 ? 73  TYR A CB   3  
ATOM 5410  C CG   . TYR A 1 73  ? 11.118  -3.066  0.088   1.00 0.00 ? 73  TYR A CG   3  
ATOM 5411  C CD1  . TYR A 1 73  ? 12.460  -3.315  -0.117  1.00 0.00 ? 73  TYR A CD1  3  
ATOM 5412  C CD2  . TYR A 1 73  ? 10.662  -1.766  0.172   1.00 0.00 ? 73  TYR A CD2  3  
ATOM 5413  C CE1  . TYR A 1 73  ? 13.385  -2.218  -0.242  1.00 0.00 ? 73  TYR A CE1  3  
ATOM 5414  C CE2  . TYR A 1 73  ? 11.587  -0.669  0.046   1.00 0.00 ? 73  TYR A CE2  3  
ATOM 5415  C CZ   . TYR A 1 73  ? 12.903  -0.950  -0.155  1.00 0.00 ? 73  TYR A CZ   3  
ATOM 5416  O OH   . TYR A 1 73  ? 13.776  0.086   -0.273  1.00 0.00 ? 73  TYR A OH   3  
ATOM 5417  H H    . TYR A 1 73  ? 11.510  -6.501  1.183   1.00 0.00 ? 73  TYR A H    3  
ATOM 5418  H HA   . TYR A 1 73  ? 10.127  -4.262  2.428   1.00 0.00 ? 73  TYR A HA   3  
ATOM 5419  H HB2  . TYR A 1 73  ? 10.341  -4.958  -0.565  1.00 0.00 ? 73  TYR A HB2  3  
ATOM 5420  H HB3  . TYR A 1 73  ? 9.124   -3.861  0.056   1.00 0.00 ? 73  TYR A HB3  3  
ATOM 5421  H HD1  . TYR A 1 73  ? 12.820  -4.342  -0.183  1.00 0.00 ? 73  TYR A HD1  3  
ATOM 5422  H HD2  . TYR A 1 73  ? 9.603   -1.570  0.333   1.00 0.00 ? 73  TYR A HD2  3  
ATOM 5423  H HE1  . TYR A 1 73  ? 14.447  -2.400  -0.404  1.00 0.00 ? 73  TYR A HE1  3  
ATOM 5424  H HE2  . TYR A 1 73  ? 11.240  0.362   0.111   1.00 0.00 ? 73  TYR A HE2  3  
ATOM 5425  H HH   . TYR A 1 73  ? 14.715  -0.246  -0.184  1.00 0.00 ? 73  TYR A HH   3  
ATOM 5426  N N    . TRP A 1 74  ? 7.857   -5.432  1.928   1.00 0.00 ? 74  TRP A N    3  
ATOM 5427  C CA   . TRP A 1 74  ? 6.678   -6.275  2.035   1.00 0.00 ? 74  TRP A CA   3  
ATOM 5428  C C    . TRP A 1 74  ? 5.509   -5.537  1.380   1.00 0.00 ? 74  TRP A C    3  
ATOM 5429  O O    . TRP A 1 74  ? 5.530   -4.313  1.262   1.00 0.00 ? 74  TRP A O    3  
ATOM 5430  C CB   . TRP A 1 74  ? 6.405   -6.655  3.491   1.00 0.00 ? 74  TRP A CB   3  
ATOM 5431  C CG   . TRP A 1 74  ? 7.385   -7.683  4.060   1.00 0.00 ? 74  TRP A CG   3  
ATOM 5432  C CD1  . TRP A 1 74  ? 7.272   -9.018  4.060   1.00 0.00 ? 74  TRP A CD1  3  
ATOM 5433  C CD2  . TRP A 1 74  ? 8.639   -7.404  4.717   1.00 0.00 ? 74  TRP A CD2  3  
ATOM 5434  N NE1  . TRP A 1 74  ? 8.358   -9.618  4.666   1.00 0.00 ? 74  TRP A NE1  3  
ATOM 5435  C CE2  . TRP A 1 74  ? 9.215   -8.605  5.078   1.00 0.00 ? 74  TRP A CE2  3  
ATOM 5436  C CE3  . TRP A 1 74  ? 9.267   -6.177  4.997   1.00 0.00 ? 74  TRP A CE3  3  
ATOM 5437  C CZ2  . TRP A 1 74  ? 10.446  -8.696  5.739   1.00 0.00 ? 74  TRP A CZ2  3  
ATOM 5438  C CZ3  . TRP A 1 74  ? 10.496  -6.286  5.658   1.00 0.00 ? 74  TRP A CZ3  3  
ATOM 5439  C CH2  . TRP A 1 74  ? 11.089  -7.487  6.028   1.00 0.00 ? 74  TRP A CH2  3  
ATOM 5440  H H    . TRP A 1 74  ? 7.693   -4.456  2.075   1.00 0.00 ? 74  TRP A H    3  
ATOM 5441  H HA   . TRP A 1 74  ? 6.882   -7.201  1.498   1.00 0.00 ? 74  TRP A HA   3  
ATOM 5442  H HB2  . TRP A 1 74  ? 6.443   -5.754  4.104   1.00 0.00 ? 74  TRP A HB2  3  
ATOM 5443  H HB3  . TRP A 1 74  ? 5.393   -7.051  3.569   1.00 0.00 ? 74  TRP A HB3  3  
ATOM 5444  H HD1  . TRP A 1 74  ? 6.429   -9.563  3.634   1.00 0.00 ? 74  TRP A HD1  3  
ATOM 5445  H HE1  . TRP A 1 74  ? 8.514   -10.688 4.797   1.00 0.00 ? 74  TRP A HE1  3  
ATOM 5446  H HE3  . TRP A 1 74  ? 8.832   -5.216  4.722   1.00 0.00 ? 74  TRP A HE3  3  
ATOM 5447  H HZ2  . TRP A 1 74  ? 10.880  -9.657  6.014   1.00 0.00 ? 74  TRP A HZ2  3  
ATOM 5448  H HZ3  . TRP A 1 74  ? 11.025  -5.364  5.899   1.00 0.00 ? 74  TRP A HZ3  3  
ATOM 5449  H HH2  . TRP A 1 74  ? 12.051  -7.487  6.541   1.00 0.00 ? 74  TRP A HH2  3  
ATOM 5450  N N    . ILE A 1 75  ? 4.515   -6.313  0.972   1.00 0.00 ? 75  ILE A N    3  
ATOM 5451  C CA   . ILE A 1 75  ? 3.339   -5.748  0.332   1.00 0.00 ? 75  ILE A CA   3  
ATOM 5452  C C    . ILE A 1 75  ? 2.096   -6.117  1.144   1.00 0.00 ? 75  ILE A C    3  
ATOM 5453  O O    . ILE A 1 75  ? 1.592   -7.235  1.042   1.00 0.00 ? 75  ILE A O    3  
ATOM 5454  C CB   . ILE A 1 75  ? 3.267   -6.180  -1.134  1.00 0.00 ? 75  ILE A CB   3  
ATOM 5455  C CG1  . ILE A 1 75  ? 4.314   -5.446  -1.974  1.00 0.00 ? 75  ILE A CG1  3  
ATOM 5456  C CG2  . ILE A 1 75  ? 1.853   -5.997  -1.690  1.00 0.00 ? 75  ILE A CG2  3  
ATOM 5457  C CD1  . ILE A 1 75  ? 3.794   -4.080  -2.426  1.00 0.00 ? 75  ILE A CD1  3  
ATOM 5458  H H    . ILE A 1 75  ? 4.505   -7.308  1.072   1.00 0.00 ? 75  ILE A H    3  
ATOM 5459  H HA   . ILE A 1 75  ? 3.450   -4.664  0.343   1.00 0.00 ? 75  ILE A HA   3  
ATOM 5460  H HB   . ILE A 1 75  ? 3.499   -7.244  -1.188  1.00 0.00 ? 75  ILE A HB   3  
ATOM 5461  H HG12 . ILE A 1 75  ? 5.227   -5.318  -1.393  1.00 0.00 ? 75  ILE A HG12 3  
ATOM 5462  H HG13 . ILE A 1 75  ? 4.573   -6.048  -2.845  1.00 0.00 ? 75  ILE A HG13 3  
ATOM 5463  H HG21 . ILE A 1 75  ? 1.909   -5.541  -2.679  1.00 0.00 ? 75  ILE A HG21 3  
ATOM 5464  H HG22 . ILE A 1 75  ? 1.364   -6.968  -1.766  1.00 0.00 ? 75  ILE A HG22 3  
ATOM 5465  H HG23 . ILE A 1 75  ? 1.281   -5.352  -1.024  1.00 0.00 ? 75  ILE A HG23 3  
ATOM 5466  H HD11 . ILE A 1 75  ? 3.476   -4.139  -3.467  1.00 0.00 ? 75  ILE A HD11 3  
ATOM 5467  H HD12 . ILE A 1 75  ? 2.948   -3.789  -1.804  1.00 0.00 ? 75  ILE A HD12 3  
ATOM 5468  H HD13 . ILE A 1 75  ? 4.588   -3.339  -2.330  1.00 0.00 ? 75  ILE A HD13 3  
ATOM 5469  N N    . PHE A 1 76  ? 1.637   -5.157  1.933   1.00 0.00 ? 76  PHE A N    3  
ATOM 5470  C CA   . PHE A 1 76  ? 0.462   -5.367  2.762   1.00 0.00 ? 76  PHE A CA   3  
ATOM 5471  C C    . PHE A 1 76  ? -0.810  -4.936  2.029   1.00 0.00 ? 76  PHE A C    3  
ATOM 5472  O O    . PHE A 1 76  ? -0.822  -3.912  1.347   1.00 0.00 ? 76  PHE A O    3  
ATOM 5473  C CB   . PHE A 1 76  ? 0.635   -4.500  4.010   1.00 0.00 ? 76  PHE A CB   3  
ATOM 5474  C CG   . PHE A 1 76  ? -0.545  -4.567  4.983   1.00 0.00 ? 76  PHE A CG   3  
ATOM 5475  C CD1  . PHE A 1 76  ? -0.564  -5.508  5.964   1.00 0.00 ? 76  PHE A CD1  3  
ATOM 5476  C CD2  . PHE A 1 76  ? -1.574  -3.685  4.865   1.00 0.00 ? 76  PHE A CD2  3  
ATOM 5477  C CE1  . PHE A 1 76  ? -1.659  -5.569  6.867   1.00 0.00 ? 76  PHE A CE1  3  
ATOM 5478  C CE2  . PHE A 1 76  ? -2.668  -3.747  5.767   1.00 0.00 ? 76  PHE A CE2  3  
ATOM 5479  C CZ   . PHE A 1 76  ? -2.688  -4.688  6.749   1.00 0.00 ? 76  PHE A CZ   3  
ATOM 5480  H H    . PHE A 1 76  ? 2.052   -4.250  2.010   1.00 0.00 ? 76  PHE A H    3  
ATOM 5481  H HA   . PHE A 1 76  ? 0.408   -6.433  2.983   1.00 0.00 ? 76  PHE A HA   3  
ATOM 5482  H HB2  . PHE A 1 76  ? 1.540   -4.809  4.532   1.00 0.00 ? 76  PHE A HB2  3  
ATOM 5483  H HB3  . PHE A 1 76  ? 0.782   -3.464  3.704   1.00 0.00 ? 76  PHE A HB3  3  
ATOM 5484  H HD1  . PHE A 1 76  ? 0.260   -6.214  6.059   1.00 0.00 ? 76  PHE A HD1  3  
ATOM 5485  H HD2  . PHE A 1 76  ? -1.558  -2.931  4.078   1.00 0.00 ? 76  PHE A HD2  3  
ATOM 5486  H HE1  . PHE A 1 76  ? -1.675  -6.323  7.654   1.00 0.00 ? 76  PHE A HE1  3  
ATOM 5487  H HE2  . PHE A 1 76  ? -3.493  -3.041  5.673   1.00 0.00 ? 76  PHE A HE2  3  
ATOM 5488  H HZ   . PHE A 1 76  ? -3.528  -4.735  7.441   1.00 0.00 ? 76  PHE A HZ   3  
ATOM 5489  N N    . ARG A 1 77  ? -1.851  -5.740  2.194   1.00 0.00 ? 77  ARG A N    3  
ATOM 5490  C CA   . ARG A 1 77  ? -3.125  -5.455  1.556   1.00 0.00 ? 77  ARG A CA   3  
ATOM 5491  C C    . ARG A 1 77  ? -4.280  -5.857  2.475   1.00 0.00 ? 77  ARG A C    3  
ATOM 5492  O O    . ARG A 1 77  ? -4.250  -6.926  3.084   1.00 0.00 ? 77  ARG A O    3  
ATOM 5493  C CB   . ARG A 1 77  ? -3.256  -6.202  0.227   1.00 0.00 ? 77  ARG A CB   3  
ATOM 5494  C CG   . ARG A 1 77  ? -1.895  -6.344  -0.458  1.00 0.00 ? 77  ARG A CG   3  
ATOM 5495  C CD   . ARG A 1 77  ? -1.988  -7.264  -1.676  1.00 0.00 ? 77  ARG A CD   3  
ATOM 5496  N NE   . ARG A 1 77  ? -0.729  -8.026  -1.833  1.00 0.00 ? 77  ARG A NE   3  
ATOM 5497  C CZ   . ARG A 1 77  ? -0.368  -8.657  -2.958  1.00 0.00 ? 77  ARG A CZ   3  
ATOM 5498  N NH1  . ARG A 1 77  ? -1.167  -8.622  -4.033  1.00 0.00 ? 77  ARG A NH1  3  
ATOM 5499  N NH2  . ARG A 1 77  ? 0.794   -9.324  -3.009  1.00 0.00 ? 77  ARG A NH2  3  
ATOM 5500  H H    . ARG A 1 77  ? -1.833  -6.571  2.749   1.00 0.00 ? 77  ARG A H    3  
ATOM 5501  H HA   . ARG A 1 77  ? -3.117  -4.378  1.385   1.00 0.00 ? 77  ARG A HA   3  
ATOM 5502  H HB2  . ARG A 1 77  ? -3.684  -7.189  0.401   1.00 0.00 ? 77  ARG A HB2  3  
ATOM 5503  H HB3  . ARG A 1 77  ? -3.943  -5.667  -0.429  1.00 0.00 ? 77  ARG A HB3  3  
ATOM 5504  H HG2  . ARG A 1 77  ? -1.534  -5.363  -0.765  1.00 0.00 ? 77  ARG A HG2  3  
ATOM 5505  H HG3  . ARG A 1 77  ? -1.168  -6.744  0.250   1.00 0.00 ? 77  ARG A HG3  3  
ATOM 5506  H HD2  . ARG A 1 77  ? -2.826  -7.951  -1.560  1.00 0.00 ? 77  ARG A HD2  3  
ATOM 5507  H HD3  . ARG A 1 77  ? -2.180  -6.676  -2.573  1.00 0.00 ? 77  ARG A HD3  3  
ATOM 5508  H HE   . ARG A 1 77  ? -0.109  -8.073  -1.050  1.00 0.00 ? 77  ARG A HE   3  
ATOM 5509  H HH11 . ARG A 1 77  ? -2.034  -8.124  -3.995  1.00 0.00 ? 77  ARG A HH11 3  
ATOM 5510  H HH12 . ARG A 1 77  ? -0.898  -9.093  -4.873  1.00 0.00 ? 77  ARG A HH12 3  
ATOM 5511  H HH21 . ARG A 1 77  ? 1.391   -9.351  -2.207  1.00 0.00 ? 77  ARG A HH21 3  
ATOM 5512  H HH22 . ARG A 1 77  ? 1.063   -9.795  -3.849  1.00 0.00 ? 77  ARG A HH22 3  
ATOM 5513  N N    . SER A 1 78  ? -5.271  -4.981  2.547   1.00 0.00 ? 78  SER A N    3  
ATOM 5514  C CA   . SER A 1 78  ? -6.433  -5.231  3.381   1.00 0.00 ? 78  SER A CA   3  
ATOM 5515  C C    . SER A 1 78  ? -7.707  -5.173  2.535   1.00 0.00 ? 78  SER A C    3  
ATOM 5516  O O    . SER A 1 78  ? -7.728  -4.540  1.481   1.00 0.00 ? 78  SER A O    3  
ATOM 5517  C CB   . SER A 1 78  ? -6.513  -4.225  4.531   1.00 0.00 ? 78  SER A CB   3  
ATOM 5518  O OG   . SER A 1 78  ? -7.399  -3.148  4.238   1.00 0.00 ? 78  SER A OG   3  
ATOM 5519  H H    . SER A 1 78  ? -5.287  -4.114  2.048   1.00 0.00 ? 78  SER A H    3  
ATOM 5520  H HA   . SER A 1 78  ? -6.288  -6.233  3.785   1.00 0.00 ? 78  SER A HA   3  
ATOM 5521  H HB2  . SER A 1 78  ? -6.848  -4.734  5.435   1.00 0.00 ? 78  SER A HB2  3  
ATOM 5522  H HB3  . SER A 1 78  ? -5.518  -3.831  4.738   1.00 0.00 ? 78  SER A HB3  3  
ATOM 5523  H HG   . SER A 1 78  ? -8.341  -3.481  4.199   1.00 0.00 ? 78  SER A HG   3  
ATOM 5524  N N    . TRP A 1 79  ? -8.739  -5.841  3.030   1.00 0.00 ? 79  TRP A N    3  
ATOM 5525  C CA   . TRP A 1 79  ? -10.013 -5.873  2.332   1.00 0.00 ? 79  TRP A CA   3  
ATOM 5526  C C    . TRP A 1 79  ? -11.048 -6.500  3.268   1.00 0.00 ? 79  TRP A C    3  
ATOM 5527  O O    . TRP A 1 79  ? -10.764 -7.491  3.940   1.00 0.00 ? 79  TRP A O    3  
ATOM 5528  C CB   . TRP A 1 79  ? -9.890  -6.610  0.997   1.00 0.00 ? 79  TRP A CB   3  
ATOM 5529  C CG   . TRP A 1 79  ? -9.539  -8.093  1.135   1.00 0.00 ? 79  TRP A CG   3  
ATOM 5530  C CD1  . TRP A 1 79  ? -10.341 -9.099  1.509   1.00 0.00 ? 79  TRP A CD1  3  
ATOM 5531  C CD2  . TRP A 1 79  ? -8.254  -8.699  0.884   1.00 0.00 ? 79  TRP A CD2  3  
ATOM 5532  N NE1  . TRP A 1 79  ? -9.670  -10.305 1.517   1.00 0.00 ? 79  TRP A NE1  3  
ATOM 5533  C CE2  . TRP A 1 79  ? -8.360  -10.054 1.125   1.00 0.00 ? 79  TRP A CE2  3  
ATOM 5534  C CE3  . TRP A 1 79  ? -7.041  -8.123  0.468   1.00 0.00 ? 79  TRP A CE3  3  
ATOM 5535  C CZ2  . TRP A 1 79  ? -7.291  -10.946 0.977   1.00 0.00 ? 79  TRP A CZ2  3  
ATOM 5536  C CZ3  . TRP A 1 79  ? -5.982  -9.027  0.324   1.00 0.00 ? 79  TRP A CZ3  3  
ATOM 5537  C CH2  . TRP A 1 79  ? -6.073  -10.393 0.563   1.00 0.00 ? 79  TRP A CH2  3  
ATOM 5538  H H    . TRP A 1 79  ? -8.714  -6.353  3.888   1.00 0.00 ? 79  TRP A H    3  
ATOM 5539  H HA   . TRP A 1 79  ? -10.293 -4.845  2.103   1.00 0.00 ? 79  TRP A HA   3  
ATOM 5540  H HB2  . TRP A 1 79  ? -10.831 -6.519  0.455   1.00 0.00 ? 79  TRP A HB2  3  
ATOM 5541  H HB3  . TRP A 1 79  ? -9.125  -6.121  0.393   1.00 0.00 ? 79  TRP A HB3  3  
ATOM 5542  H HD1  . TRP A 1 79  ? -11.392 -8.980  1.773   1.00 0.00 ? 79  TRP A HD1  3  
ATOM 5543  H HE1  . TRP A 1 79  ? -10.090 -11.275 1.782   1.00 0.00 ? 79  TRP A HE1  3  
ATOM 5544  H HE3  . TRP A 1 79  ? -6.931  -7.056  0.271   1.00 0.00 ? 79  TRP A HE3  3  
ATOM 5545  H HZ2  . TRP A 1 79  ? -7.401  -12.012 1.174   1.00 0.00 ? 79  TRP A HZ2  3  
ATOM 5546  H HZ3  . TRP A 1 79  ? -5.018  -8.632  0.003   1.00 0.00 ? 79  TRP A HZ3  3  
ATOM 5547  H HH2  . TRP A 1 79  ? -5.200  -11.032 0.428   1.00 0.00 ? 79  TRP A HH2  3  
ATOM 5548  N N    . GLY A 1 80  ? -12.228 -5.898  3.282   1.00 0.00 ? 80  GLY A N    3  
ATOM 5549  C CA   . GLY A 1 80  ? -13.307 -6.385  4.124   1.00 0.00 ? 80  GLY A CA   3  
ATOM 5550  C C    . GLY A 1 80  ? -14.667 -5.931  3.591   1.00 0.00 ? 80  GLY A C    3  
ATOM 5551  O O    . GLY A 1 80  ? -14.822 -5.697  2.393   1.00 0.00 ? 80  GLY A O    3  
ATOM 5552  H H    . GLY A 1 80  ? -12.452 -5.093  2.733   1.00 0.00 ? 80  GLY A H    3  
ATOM 5553  H HA2  . GLY A 1 80  ? -13.276 -7.474  4.169   1.00 0.00 ? 80  GLY A HA2  3  
ATOM 5554  H HA3  . GLY A 1 80  ? -13.172 -6.021  5.143   1.00 0.00 ? 80  GLY A HA3  3  
ATOM 5555  N N    . ARG A 1 81  ? -15.619 -5.820  4.506   1.00 0.00 ? 81  ARG A N    3  
ATOM 5556  C CA   . ARG A 1 81  ? -16.961 -5.398  4.142   1.00 0.00 ? 81  ARG A CA   3  
ATOM 5557  C C    . ARG A 1 81  ? -17.351 -4.140  4.921   1.00 0.00 ? 81  ARG A C    3  
ATOM 5558  O O    . ARG A 1 81  ? -18.466 -3.640  4.781   1.00 0.00 ? 81  ARG A O    3  
ATOM 5559  C CB   . ARG A 1 81  ? -17.982 -6.502  4.426   1.00 0.00 ? 81  ARG A CB   3  
ATOM 5560  C CG   . ARG A 1 81  ? -17.293 -7.859  4.580   1.00 0.00 ? 81  ARG A CG   3  
ATOM 5561  C CD   . ARG A 1 81  ? -17.297 -8.629  3.258   1.00 0.00 ? 81  ARG A CD   3  
ATOM 5562  N NE   . ARG A 1 81  ? -17.087 -10.072 3.512   1.00 0.00 ? 81  ARG A NE   3  
ATOM 5563  C CZ   . ARG A 1 81  ? -16.906 -10.986 2.549   1.00 0.00 ? 81  ARG A CZ   3  
ATOM 5564  N NH1  . ARG A 1 81  ? -16.907 -10.613 1.263   1.00 0.00 ? 81  ARG A NH1  3  
ATOM 5565  N NH2  . ARG A 1 81  ? -16.723 -12.273 2.873   1.00 0.00 ? 81  ARG A NH2  3  
ATOM 5566  H H    . ARG A 1 81  ? -15.486 -6.012  5.478   1.00 0.00 ? 81  ARG A H    3  
ATOM 5567  H HA   . ARG A 1 81  ? -16.910 -5.196  3.072   1.00 0.00 ? 81  ARG A HA   3  
ATOM 5568  H HB2  . ARG A 1 81  ? -18.535 -6.266  5.335   1.00 0.00 ? 81  ARG A HB2  3  
ATOM 5569  H HB3  . ARG A 1 81  ? -18.708 -6.549  3.614   1.00 0.00 ? 81  ARG A HB3  3  
ATOM 5570  H HG2  . ARG A 1 81  ? -16.266 -7.714  4.917   1.00 0.00 ? 81  ARG A HG2  3  
ATOM 5571  H HG3  . ARG A 1 81  ? -17.800 -8.444  5.347   1.00 0.00 ? 81  ARG A HG3  3  
ATOM 5572  H HD2  . ARG A 1 81  ? -18.245 -8.477  2.742   1.00 0.00 ? 81  ARG A HD2  3  
ATOM 5573  H HD3  . ARG A 1 81  ? -16.513 -8.249  2.603   1.00 0.00 ? 81  ARG A HD3  3  
ATOM 5574  H HE   . ARG A 1 81  ? -17.081 -10.385 4.462   1.00 0.00 ? 81  ARG A HE   3  
ATOM 5575  H HH11 . ARG A 1 81  ? -17.043 -9.652  1.021   1.00 0.00 ? 81  ARG A HH11 3  
ATOM 5576  H HH12 . ARG A 1 81  ? -16.771 -11.295 0.544   1.00 0.00 ? 81  ARG A HH12 3  
ATOM 5577  H HH21 . ARG A 1 81  ? -16.722 -12.552 3.834   1.00 0.00 ? 81  ARG A HH21 3  
ATOM 5578  H HH22 . ARG A 1 81  ? -16.587 -12.956 2.155   1.00 0.00 ? 81  ARG A HH22 3  
ATOM 5579  N N    . VAL A 1 82  ? -16.411 -3.665  5.724   1.00 0.00 ? 82  VAL A N    3  
ATOM 5580  C CA   . VAL A 1 82  ? -16.642 -2.475  6.526   1.00 0.00 ? 82  VAL A CA   3  
ATOM 5581  C C    . VAL A 1 82  ? -17.654 -2.796  7.628   1.00 0.00 ? 82  VAL A C    3  
ATOM 5582  O O    . VAL A 1 82  ? -17.275 -3.025  8.775   1.00 0.00 ? 82  VAL A O    3  
ATOM 5583  C CB   . VAL A 1 82  ? -17.084 -1.317  5.628   1.00 0.00 ? 82  VAL A CB   3  
ATOM 5584  C CG1  . VAL A 1 82  ? -17.364 -0.059  6.453   1.00 0.00 ? 82  VAL A CG1  3  
ATOM 5585  C CG2  . VAL A 1 82  ? -16.043 -1.039  4.541   1.00 0.00 ? 82  VAL A CG2  3  
ATOM 5586  H H    . VAL A 1 82  ? -15.507 -4.077  5.832   1.00 0.00 ? 82  VAL A H    3  
ATOM 5587  H HA   . VAL A 1 82  ? -15.694 -2.201  6.989   1.00 0.00 ? 82  VAL A HA   3  
ATOM 5588  H HB   . VAL A 1 82  ? -18.012 -1.609  5.137   1.00 0.00 ? 82  VAL A HB   3  
ATOM 5589  H HG11 . VAL A 1 82  ? -17.032 -0.217  7.480   1.00 0.00 ? 82  VAL A HG11 3  
ATOM 5590  H HG12 . VAL A 1 82  ? -16.825 0.785   6.023   1.00 0.00 ? 82  VAL A HG12 3  
ATOM 5591  H HG13 . VAL A 1 82  ? -18.433 0.150   6.445   1.00 0.00 ? 82  VAL A HG13 3  
ATOM 5592  H HG21 . VAL A 1 82  ? -15.270 -0.382  4.938   1.00 0.00 ? 82  VAL A HG21 3  
ATOM 5593  H HG22 . VAL A 1 82  ? -15.593 -1.979  4.221   1.00 0.00 ? 82  VAL A HG22 3  
ATOM 5594  H HG23 . VAL A 1 82  ? -16.527 -0.559  3.690   1.00 0.00 ? 82  VAL A HG23 3  
ATOM 5595  N N    . GLY A 1 83  ? -18.921 -2.802  7.240   1.00 0.00 ? 83  GLY A N    3  
ATOM 5596  C CA   . GLY A 1 83  ? -19.990 -3.091  8.181   1.00 0.00 ? 83  GLY A CA   3  
ATOM 5597  C C    . GLY A 1 83  ? -19.604 -4.241  9.113   1.00 0.00 ? 83  GLY A C    3  
ATOM 5598  O O    . GLY A 1 83  ? -19.435 -4.041  10.315  1.00 0.00 ? 83  GLY A O    3  
ATOM 5599  H H    . GLY A 1 83  ? -19.221 -2.615  6.304   1.00 0.00 ? 83  GLY A H    3  
ATOM 5600  H HA2  . GLY A 1 83  ? -20.213 -2.201  8.768   1.00 0.00 ? 83  GLY A HA2  3  
ATOM 5601  H HA3  . GLY A 1 83  ? -20.898 -3.349  7.636   1.00 0.00 ? 83  GLY A HA3  3  
ATOM 5602  N N    . THR A 1 84  ? -19.475 -5.421  8.524   1.00 0.00 ? 84  THR A N    3  
ATOM 5603  C CA   . THR A 1 84  ? -19.112 -6.603  9.287   1.00 0.00 ? 84  THR A CA   3  
ATOM 5604  C C    . THR A 1 84  ? -17.851 -6.339  10.111  1.00 0.00 ? 84  THR A C    3  
ATOM 5605  O O    . THR A 1 84  ? -17.299 -5.240  10.073  1.00 0.00 ? 84  THR A O    3  
ATOM 5606  C CB   . THR A 1 84  ? -18.965 -7.770  8.309   1.00 0.00 ? 84  THR A CB   3  
ATOM 5607  O OG1  . THR A 1 84  ? -18.156 -7.245  7.260   1.00 0.00 ? 84  THR A OG1  3  
ATOM 5608  C CG2  . THR A 1 84  ? -20.284 -8.126  7.619   1.00 0.00 ? 84  THR A CG2  3  
ATOM 5609  H H    . THR A 1 84  ? -19.615 -5.576  7.546   1.00 0.00 ? 84  THR A H    3  
ATOM 5610  H HA   . THR A 1 84  ? -19.916 -6.818  9.991   1.00 0.00 ? 84  THR A HA   3  
ATOM 5611  H HB   . THR A 1 84  ? -18.537 -8.642  8.804   1.00 0.00 ? 84  THR A HB   3  
ATOM 5612  H HG1  . THR A 1 84  ? -17.189 -7.402  7.462   1.00 0.00 ? 84  THR A HG1  3  
ATOM 5613  H HG21 . THR A 1 84  ? -21.069 -7.457  7.970   1.00 0.00 ? 84  THR A HG21 3  
ATOM 5614  H HG22 . THR A 1 84  ? -20.170 -8.020  6.540   1.00 0.00 ? 84  THR A HG22 3  
ATOM 5615  H HG23 . THR A 1 84  ? -20.551 -9.156  7.856   1.00 0.00 ? 84  THR A HG23 3  
ATOM 5616  N N    . VAL A 1 85  ? -17.431 -7.365  10.837  1.00 0.00 ? 85  VAL A N    3  
ATOM 5617  C CA   . VAL A 1 85  ? -16.245 -7.257  11.670  1.00 0.00 ? 85  VAL A CA   3  
ATOM 5618  C C    . VAL A 1 85  ? -15.074 -7.953  10.974  1.00 0.00 ? 85  VAL A C    3  
ATOM 5619  O O    . VAL A 1 85  ? -13.920 -7.762  11.353  1.00 0.00 ? 85  VAL A O    3  
ATOM 5620  C CB   . VAL A 1 85  ? -16.532 -7.819  13.064  1.00 0.00 ? 85  VAL A CB   3  
ATOM 5621  C CG1  . VAL A 1 85  ? -17.340 -6.824  13.900  1.00 0.00 ? 85  VAL A CG1  3  
ATOM 5622  C CG2  . VAL A 1 85  ? -17.247 -9.168  12.975  1.00 0.00 ? 85  VAL A CG2  3  
ATOM 5623  H H    . VAL A 1 85  ? -17.886 -8.255  10.863  1.00 0.00 ? 85  VAL A H    3  
ATOM 5624  H HA   . VAL A 1 85  ? -16.012 -6.198  11.774  1.00 0.00 ? 85  VAL A HA   3  
ATOM 5625  H HB   . VAL A 1 85  ? -15.577 -7.978  13.564  1.00 0.00 ? 85  VAL A HB   3  
ATOM 5626  H HG11 . VAL A 1 85  ? -18.324 -6.688  13.452  1.00 0.00 ? 85  VAL A HG11 3  
ATOM 5627  H HG12 . VAL A 1 85  ? -17.452 -7.209  14.914  1.00 0.00 ? 85  VAL A HG12 3  
ATOM 5628  H HG13 . VAL A 1 85  ? -16.819 -5.867  13.930  1.00 0.00 ? 85  VAL A HG13 3  
ATOM 5629  H HG21 . VAL A 1 85  ? -16.876 -9.828  13.759  1.00 0.00 ? 85  VAL A HG21 3  
ATOM 5630  H HG22 . VAL A 1 85  ? -18.320 -9.020  13.102  1.00 0.00 ? 85  VAL A HG22 3  
ATOM 5631  H HG23 . VAL A 1 85  ? -17.055 -9.618  12.001  1.00 0.00 ? 85  VAL A HG23 3  
ATOM 5632  N N    . ILE A 1 86  ? -15.412 -8.747  9.968   1.00 0.00 ? 86  ILE A N    3  
ATOM 5633  C CA   . ILE A 1 86  ? -14.403 -9.473  9.216   1.00 0.00 ? 86  ILE A CA   3  
ATOM 5634  C C    . ILE A 1 86  ? -13.221 -8.544  8.929   1.00 0.00 ? 86  ILE A C    3  
ATOM 5635  O O    . ILE A 1 86  ? -13.379 -7.325  8.894   1.00 0.00 ? 86  ILE A O    3  
ATOM 5636  C CB   . ILE A 1 86  ? -15.015 -10.095 7.960   1.00 0.00 ? 86  ILE A CB   3  
ATOM 5637  C CG1  . ILE A 1 86  ? -16.065 -11.146 8.325   1.00 0.00 ? 86  ILE A CG1  3  
ATOM 5638  C CG2  . ILE A 1 86  ? -13.929 -10.663 7.044   1.00 0.00 ? 86  ILE A CG2  3  
ATOM 5639  C CD1  . ILE A 1 86  ? -17.140 -11.247 7.241   1.00 0.00 ? 86  ILE A CD1  3  
ATOM 5640  H H    . ILE A 1 86  ? -16.353 -8.897  9.666   1.00 0.00 ? 86  ILE A H    3  
ATOM 5641  H HA   . ILE A 1 86  ? -14.054 -10.292 9.844   1.00 0.00 ? 86  ILE A HA   3  
ATOM 5642  H HB   . ILE A 1 86  ? -15.526 -9.309  7.404   1.00 0.00 ? 86  ILE A HB   3  
ATOM 5643  H HG12 . ILE A 1 86  ? -15.584 -12.116 8.456   1.00 0.00 ? 86  ILE A HG12 3  
ATOM 5644  H HG13 . ILE A 1 86  ? -16.528 -10.888 9.277   1.00 0.00 ? 86  ILE A HG13 3  
ATOM 5645  H HG21 . ILE A 1 86  ? -14.386 -11.036 6.127   1.00 0.00 ? 86  ILE A HG21 3  
ATOM 5646  H HG22 . ILE A 1 86  ? -13.212 -9.879  6.801   1.00 0.00 ? 86  ILE A HG22 3  
ATOM 5647  H HG23 . ILE A 1 86  ? -13.416 -11.480 7.552   1.00 0.00 ? 86  ILE A HG23 3  
ATOM 5648  H HD11 . ILE A 1 86  ? -17.037 -10.412 6.547   1.00 0.00 ? 86  ILE A HD11 3  
ATOM 5649  H HD12 . ILE A 1 86  ? -17.023 -12.186 6.699   1.00 0.00 ? 86  ILE A HD12 3  
ATOM 5650  H HD13 . ILE A 1 86  ? -18.127 -11.215 7.703   1.00 0.00 ? 86  ILE A HD13 3  
ATOM 5651  N N    . GLY A 1 87  ? -12.063 -9.157  8.731   1.00 0.00 ? 87  GLY A N    3  
ATOM 5652  C CA   . GLY A 1 87  ? -10.855 -8.401  8.448   1.00 0.00 ? 87  GLY A CA   3  
ATOM 5653  C C    . GLY A 1 87  ? -9.761  -9.307  7.881   1.00 0.00 ? 87  GLY A C    3  
ATOM 5654  O O    . GLY A 1 87  ? -9.056  -9.979  8.632   1.00 0.00 ? 87  GLY A O    3  
ATOM 5655  H H    . GLY A 1 87  ? -11.943 -10.149 8.761   1.00 0.00 ? 87  GLY A H    3  
ATOM 5656  H HA2  . GLY A 1 87  ? -11.078 -7.605  7.737   1.00 0.00 ? 87  GLY A HA2  3  
ATOM 5657  H HA3  . GLY A 1 87  ? -10.499 -7.922  9.360   1.00 0.00 ? 87  GLY A HA3  3  
ATOM 5658  N N    . SER A 1 88  ? -9.653  -9.297  6.560   1.00 0.00 ? 88  SER A N    3  
ATOM 5659  C CA   . SER A 1 88  ? -8.656  -10.110 5.884   1.00 0.00 ? 88  SER A CA   3  
ATOM 5660  C C    . SER A 1 88  ? -7.543  -9.219  5.329   1.00 0.00 ? 88  SER A C    3  
ATOM 5661  O O    . SER A 1 88  ? -7.816  -8.178  4.732   1.00 0.00 ? 88  SER A O    3  
ATOM 5662  C CB   . SER A 1 88  ? -9.288  -10.933 4.760   1.00 0.00 ? 88  SER A CB   3  
ATOM 5663  O OG   . SER A 1 88  ? -10.116 -11.977 5.263   1.00 0.00 ? 88  SER A OG   3  
ATOM 5664  H H    . SER A 1 88  ? -10.231 -8.747  5.957   1.00 0.00 ? 88  SER A H    3  
ATOM 5665  H HA   . SER A 1 88  ? -8.264  -10.780 6.649   1.00 0.00 ? 88  SER A HA   3  
ATOM 5666  H HB2  . SER A 1 88  ? -9.879  -10.278 4.119   1.00 0.00 ? 88  SER A HB2  3  
ATOM 5667  H HB3  . SER A 1 88  ? -8.501  -11.361 4.138   1.00 0.00 ? 88  SER A HB3  3  
ATOM 5668  H HG   . SER A 1 88  ? -9.613  -12.842 5.265   1.00 0.00 ? 88  SER A HG   3  
ATOM 5669  N N    . ASN A 1 89  ? -6.313  -9.659  5.546   1.00 0.00 ? 89  ASN A N    3  
ATOM 5670  C CA   . ASN A 1 89  ? -5.157  -8.915  5.075   1.00 0.00 ? 89  ASN A CA   3  
ATOM 5671  C C    . ASN A 1 89  ? -4.146  -9.885  4.461   1.00 0.00 ? 89  ASN A C    3  
ATOM 5672  O O    . ASN A 1 89  ? -4.190  -11.085 4.730   1.00 0.00 ? 89  ASN A O    3  
ATOM 5673  C CB   . ASN A 1 89  ? -4.469  -8.180  6.226   1.00 0.00 ? 89  ASN A CB   3  
ATOM 5674  C CG   . ASN A 1 89  ? -3.719  -9.160  7.132   1.00 0.00 ? 89  ASN A CG   3  
ATOM 5675  O OD1  . ASN A 1 89  ? -2.501  -9.201  7.172   1.00 0.00 ? 89  ASN A OD1  3  
ATOM 5676  N ND2  . ASN A 1 89  ? -4.514  -9.944  7.854   1.00 0.00 ? 89  ASN A ND2  3  
ATOM 5677  H H    . ASN A 1 89  ? -6.100  -10.507 6.032   1.00 0.00 ? 89  ASN A H    3  
ATOM 5678  H HA   . ASN A 1 89  ? -5.551  -8.206  4.346   1.00 0.00 ? 89  ASN A HA   3  
ATOM 5679  H HB2  . ASN A 1 89  ? -3.772  -7.443  5.827   1.00 0.00 ? 89  ASN A HB2  3  
ATOM 5680  H HB3  . ASN A 1 89  ? -5.210  -7.634  6.810   1.00 0.00 ? 89  ASN A HB3  3  
ATOM 5681  H HD21 . ASN A 1 89  ? -5.507  -9.859  7.775   1.00 0.00 ? 89  ASN A HD21 3  
ATOM 5682  H HD22 . ASN A 1 89  ? -4.118  -10.619 8.478   1.00 0.00 ? 89  ASN A HD22 3  
ATOM 5683  N N    . LYS A 1 90  ? -3.260  -9.330  3.648   1.00 0.00 ? 90  LYS A N    3  
ATOM 5684  C CA   . LYS A 1 90  ? -2.239  -10.132 2.994   1.00 0.00 ? 90  LYS A CA   3  
ATOM 5685  C C    . LYS A 1 90  ? -0.869  -9.491  3.222   1.00 0.00 ? 90  LYS A C    3  
ATOM 5686  O O    . LYS A 1 90  ? -0.753  -8.267  3.274   1.00 0.00 ? 90  LYS A O    3  
ATOM 5687  C CB   . LYS A 1 90  ? -2.584  -10.337 1.517   1.00 0.00 ? 90  LYS A CB   3  
ATOM 5688  C CG   . LYS A 1 90  ? -1.406  -10.952 0.759   1.00 0.00 ? 90  LYS A CG   3  
ATOM 5689  C CD   . LYS A 1 90  ? -1.892  -11.783 -0.429  1.00 0.00 ? 90  LYS A CD   3  
ATOM 5690  C CE   . LYS A 1 90  ? -1.595  -11.074 -1.752  1.00 0.00 ? 90  LYS A CE   3  
ATOM 5691  N NZ   . LYS A 1 90  ? -1.899  -11.963 -2.896  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 5692  H H    . LYS A 1 90  ? -3.232  -8.354  3.434   1.00 0.00 ? 90  LYS A H    3  
ATOM 5693  H HA   . LYS A 1 90  ? -2.244  -11.114 3.465   1.00 0.00 ? 90  LYS A HA   3  
ATOM 5694  H HB2  . LYS A 1 90  ? -3.456  -10.986 1.430   1.00 0.00 ? 90  LYS A HB2  3  
ATOM 5695  H HB3  . LYS A 1 90  ? -2.852  -9.382  1.067   1.00 0.00 ? 90  LYS A HB3  3  
ATOM 5696  H HG2  . LYS A 1 90  ? -0.743  -10.161 0.408   1.00 0.00 ? 90  LYS A HG2  3  
ATOM 5697  H HG3  . LYS A 1 90  ? -0.823  -11.580 1.433   1.00 0.00 ? 90  LYS A HG3  3  
ATOM 5698  H HD2  . LYS A 1 90  ? -1.406  -12.759 -0.418  1.00 0.00 ? 90  LYS A HD2  3  
ATOM 5699  H HD3  . LYS A 1 90  ? -2.964  -11.960 -0.340  1.00 0.00 ? 90  LYS A HD3  3  
ATOM 5700  H HE2  . LYS A 1 90  ? -2.189  -10.163 -1.824  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 5701  H HE3  . LYS A 1 90  ? -0.548  -10.775 -1.785  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 5702  H HZ1  . LYS A 1 90  ? -1.046  -12.245 -3.335  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 5703  H HZ2  . LYS A 1 90  ? -2.390  -12.771 -2.569  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 5704  H HZ3  . LYS A 1 90  ? -2.468  -11.473 -3.557  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 5705  N N    . LEU A 1 91  ? 0.134   -10.346 3.352   1.00 0.00 ? 91  LEU A N    3  
ATOM 5706  C CA   . LEU A 1 91  ? 1.492   -9.878  3.574   1.00 0.00 ? 91  LEU A CA   3  
ATOM 5707  C C    . LEU A 1 91  ? 2.458   -10.710 2.728   1.00 0.00 ? 91  LEU A C    3  
ATOM 5708  O O    . LEU A 1 91  ? 2.618   -11.907 2.960   1.00 0.00 ? 91  LEU A O    3  
ATOM 5709  C CB   . LEU A 1 91  ? 1.823   -9.881  5.068   1.00 0.00 ? 91  LEU A CB   3  
ATOM 5710  C CG   . LEU A 1 91  ? 3.156   -9.241  5.461   1.00 0.00 ? 91  LEU A CG   3  
ATOM 5711  C CD1  . LEU A 1 91  ? 3.081   -7.716  5.365   1.00 0.00 ? 91  LEU A CD1  3  
ATOM 5712  C CD2  . LEU A 1 91  ? 3.599   -9.707  6.849   1.00 0.00 ? 91  LEU A CD2  3  
ATOM 5713  H H    . LEU A 1 91  ? 0.032   -11.339 3.309   1.00 0.00 ? 91  LEU A H    3  
ATOM 5714  H HA   . LEU A 1 91  ? 1.540   -8.843  3.236   1.00 0.00 ? 91  LEU A HA   3  
ATOM 5715  H HB2  . LEU A 1 91  ? 1.023   -9.364  5.598   1.00 0.00 ? 91  LEU A HB2  3  
ATOM 5716  H HB3  . LEU A 1 91  ? 1.821   -10.914 5.418   1.00 0.00 ? 91  LEU A HB3  3  
ATOM 5717  H HG   . LEU A 1 91  ? 3.916   -9.571  4.753   1.00 0.00 ? 91  LEU A HG   3  
ATOM 5718  H HD11 . LEU A 1 91  ? 2.889   -7.299  6.354   1.00 0.00 ? 91  LEU A HD11 3  
ATOM 5719  H HD12 . LEU A 1 91  ? 4.026   -7.329  4.985   1.00 0.00 ? 91  LEU A HD12 3  
ATOM 5720  H HD13 . LEU A 1 91  ? 2.274   -7.434  4.689   1.00 0.00 ? 91  LEU A HD13 3  
ATOM 5721  H HD21 . LEU A 1 91  ? 3.080   -10.630 7.106   1.00 0.00 ? 91  LEU A HD21 3  
ATOM 5722  H HD22 . LEU A 1 91  ? 4.675   -9.884  6.847   1.00 0.00 ? 91  LEU A HD22 3  
ATOM 5723  H HD23 . LEU A 1 91  ? 3.359   -8.939  7.584   1.00 0.00 ? 91  LEU A HD23 3  
ATOM 5724  N N    . GLU A 1 92  ? 3.077   -10.043 1.765   1.00 0.00 ? 92  GLU A N    3  
ATOM 5725  C CA   . GLU A 1 92  ? 4.023   -10.706 0.884   1.00 0.00 ? 92  GLU A CA   3  
ATOM 5726  C C    . GLU A 1 92  ? 5.368   -9.977  0.904   1.00 0.00 ? 92  GLU A C    3  
ATOM 5727  O O    . GLU A 1 92  ? 5.412   -8.751  0.998   1.00 0.00 ? 92  GLU A O    3  
ATOM 5728  C CB   . GLU A 1 92  ? 3.471   -10.800 -0.540  1.00 0.00 ? 92  GLU A CB   3  
ATOM 5729  C CG   . GLU A 1 92  ? 2.670   -12.089 -0.734  1.00 0.00 ? 92  GLU A CG   3  
ATOM 5730  C CD   . GLU A 1 92  ? 3.595   -13.307 -0.782  1.00 0.00 ? 92  GLU A CD   3  
ATOM 5731  O OE1  . GLU A 1 92  ? 4.645   -13.196 -1.451  1.00 0.00 ? 92  GLU A OE1  3  
ATOM 5732  O OE2  . GLU A 1 92  ? 3.231   -14.322 -0.149  1.00 0.00 ? 92  GLU A OE2  3  
ATOM 5733  H H    . GLU A 1 92  ? 2.941   -9.069  1.583   1.00 0.00 ? 92  GLU A H    3  
ATOM 5734  H HA   . GLU A 1 92  ? 4.140   -11.711 1.288   1.00 0.00 ? 92  GLU A HA   3  
ATOM 5735  H HB2  . GLU A 1 92  ? 2.836   -9.938  -0.746  1.00 0.00 ? 92  GLU A HB2  3  
ATOM 5736  H HB3  . GLU A 1 92  ? 4.294   -10.768 -1.255  1.00 0.00 ? 92  GLU A HB3  3  
ATOM 5737  H HG2  . GLU A 1 92  ? 1.955   -12.203 0.081   1.00 0.00 ? 92  GLU A HG2  3  
ATOM 5738  H HG3  . GLU A 1 92  ? 2.095   -12.028 -1.658  1.00 0.00 ? 92  GLU A HG3  3  
ATOM 5739  N N    . GLN A 1 93  ? 6.431   -10.762 0.813   1.00 0.00 ? 93  GLN A N    3  
ATOM 5740  C CA   . GLN A 1 93  ? 7.774   -10.206 0.820   1.00 0.00 ? 93  GLN A CA   3  
ATOM 5741  C C    . GLN A 1 93  ? 8.256   -9.965  -0.612  1.00 0.00 ? 93  GLN A C    3  
ATOM 5742  O O    . GLN A 1 93  ? 8.153   -10.849 -1.462  1.00 0.00 ? 93  GLN A O    3  
ATOM 5743  C CB   . GLN A 1 93  ? 8.741   -11.118 1.578   1.00 0.00 ? 93  GLN A CB   3  
ATOM 5744  C CG   . GLN A 1 93  ? 9.995   -10.354 2.004   1.00 0.00 ? 93  GLN A CG   3  
ATOM 5745  C CD   . GLN A 1 93  ? 11.231  -10.872 1.265   1.00 0.00 ? 93  GLN A CD   3  
ATOM 5746  O OE1  . GLN A 1 93  ? 11.565  -10.432 0.177   1.00 0.00 ? 93  GLN A OE1  3  
ATOM 5747  N NE2  . GLN A 1 93  ? 11.888  -11.828 1.915   1.00 0.00 ? 93  GLN A NE2  3  
ATOM 5748  H H    . GLN A 1 93  ? 6.386   -11.758 0.737   1.00 0.00 ? 93  GLN A H    3  
ATOM 5749  H HA   . GLN A 1 93  ? 7.692   -9.256  1.348   1.00 0.00 ? 93  GLN A HA   3  
ATOM 5750  H HB2  . GLN A 1 93  ? 8.245   -11.530 2.457   1.00 0.00 ? 93  GLN A HB2  3  
ATOM 5751  H HB3  . GLN A 1 93  ? 9.021   -11.961 0.947   1.00 0.00 ? 93  GLN A HB3  3  
ATOM 5752  H HG2  . GLN A 1 93  ? 9.865   -9.291  1.801   1.00 0.00 ? 93  GLN A HG2  3  
ATOM 5753  H HG3  . GLN A 1 93  ? 10.141  -10.457 3.080   1.00 0.00 ? 93  GLN A HG3  3  
ATOM 5754  H HE21 . GLN A 1 93  ? 11.560  -12.144 2.805   1.00 0.00 ? 93  GLN A HE21 3  
ATOM 5755  H HE22 . GLN A 1 93  ? 12.710  -12.232 1.513   1.00 0.00 ? 93  GLN A HE22 3  
ATOM 5756  N N    . MET A 1 94  ? 8.771   -8.765  -0.835  1.00 0.00 ? 94  MET A N    3  
ATOM 5757  C CA   . MET A 1 94  ? 9.269   -8.397  -2.149  1.00 0.00 ? 94  MET A CA   3  
ATOM 5758  C C    . MET A 1 94  ? 10.782  -8.607  -2.241  1.00 0.00 ? 94  MET A C    3  
ATOM 5759  O O    . MET A 1 94  ? 11.496  -8.442  -1.253  1.00 0.00 ? 94  MET A O    3  
ATOM 5760  C CB   . MET A 1 94  ? 8.939   -6.929  -2.428  1.00 0.00 ? 94  MET A CB   3  
ATOM 5761  C CG   . MET A 1 94  ? 7.508   -6.778  -2.948  1.00 0.00 ? 94  MET A CG   3  
ATOM 5762  S SD   . MET A 1 94  ? 7.472   -7.028  -4.715  1.00 0.00 ? 94  MET A SD   3  
ATOM 5763  C CE   . MET A 1 94  ? 6.202   -8.277  -4.825  1.00 0.00 ? 94  MET A CE   3  
ATOM 5764  H H    . MET A 1 94  ? 8.850   -8.052  -0.138  1.00 0.00 ? 94  MET A H    3  
ATOM 5765  H HA   . MET A 1 94  ? 8.760   -9.058  -2.851  1.00 0.00 ? 94  MET A HA   3  
ATOM 5766  H HB2  . MET A 1 94  ? 9.061   -6.346  -1.515  1.00 0.00 ? 94  MET A HB2  3  
ATOM 5767  H HB3  . MET A 1 94  ? 9.641   -6.527  -3.159  1.00 0.00 ? 94  MET A HB3  3  
ATOM 5768  H HG2  . MET A 1 94  ? 6.856   -7.499  -2.457  1.00 0.00 ? 94  MET A HG2  3  
ATOM 5769  H HG3  . MET A 1 94  ? 7.127   -5.786  -2.705  1.00 0.00 ? 94  MET A HG3  3  
ATOM 5770  H HE1  . MET A 1 94  ? 5.748   -8.421  -3.845  1.00 0.00 ? 94  MET A HE1  3  
ATOM 5771  H HE2  . MET A 1 94  ? 5.439   -7.958  -5.535  1.00 0.00 ? 94  MET A HE2  3  
ATOM 5772  H HE3  . MET A 1 94  ? 6.643   -9.215  -5.163  1.00 0.00 ? 94  MET A HE3  3  
ATOM 5773  N N    . PRO A 1 95  ? 11.237  -8.978  -3.468  1.00 0.00 ? 95  PRO A N    3  
ATOM 5774  C CA   . PRO A 1 95  ? 12.652  -9.212  -3.701  1.00 0.00 ? 95  PRO A CA   3  
ATOM 5775  C C    . PRO A 1 95  ? 13.421  -7.891  -3.777  1.00 0.00 ? 95  PRO A C    3  
ATOM 5776  O O    . PRO A 1 95  ? 14.444  -7.727  -3.114  1.00 0.00 ? 95  PRO A O    3  
ATOM 5777  C CB   . PRO A 1 95  ? 12.710  -10.008 -4.995  1.00 0.00 ? 95  PRO A CB   3  
ATOM 5778  C CG   . PRO A 1 95  ? 11.370  -9.791  -5.679  1.00 0.00 ? 95  PRO A CG   3  
ATOM 5779  C CD   . PRO A 1 95  ? 10.420  -9.183  -4.660  1.00 0.00 ? 95  PRO A CD   3  
ATOM 5780  H HA   . PRO A 1 95  ? 13.051  -9.718  -2.937  1.00 0.00 ? 95  PRO A HA   3  
ATOM 5781  H HB2  . PRO A 1 95  ? 13.531  -9.667  -5.626  1.00 0.00 ? 95  PRO A HB2  3  
ATOM 5782  H HB3  . PRO A 1 95  ? 12.880  -11.066 -4.795  1.00 0.00 ? 95  PRO A HB3  3  
ATOM 5783  H HG2  . PRO A 1 95  ? 11.483  -9.130  -6.538  1.00 0.00 ? 95  PRO A HG2  3  
ATOM 5784  H HG3  . PRO A 1 95  ? 10.975  -10.735 -6.053  1.00 0.00 ? 95  PRO A HG3  3  
ATOM 5785  H HD2  . PRO A 1 95  ? 10.002  -8.243  -5.020  1.00 0.00 ? 95  PRO A HD2  3  
ATOM 5786  H HD3  . PRO A 1 95  ? 9.581   -9.847  -4.456  1.00 0.00 ? 95  PRO A HD3  3  
ATOM 5787  N N    . SER A 1 96  ? 12.899  -6.985  -4.589  1.00 0.00 ? 96  SER A N    3  
ATOM 5788  C CA   . SER A 1 96  ? 13.524  -5.684  -4.760  1.00 0.00 ? 96  SER A CA   3  
ATOM 5789  C C    . SER A 1 96  ? 12.563  -4.580  -4.316  1.00 0.00 ? 96  SER A C    3  
ATOM 5790  O O    . SER A 1 96  ? 11.373  -4.827  -4.124  1.00 0.00 ? 96  SER A O    3  
ATOM 5791  C CB   . SER A 1 96  ? 13.950  -5.464  -6.212  1.00 0.00 ? 96  SER A CB   3  
ATOM 5792  O OG   . SER A 1 96  ? 15.221  -4.825  -6.305  1.00 0.00 ? 96  SER A OG   3  
ATOM 5793  H H    . SER A 1 96  ? 12.066  -7.127  -5.125  1.00 0.00 ? 96  SER A H    3  
ATOM 5794  H HA   . SER A 1 96  ? 14.407  -5.702  -4.121  1.00 0.00 ? 96  SER A HA   3  
ATOM 5795  H HB2  . SER A 1 96  ? 13.989  -6.423  -6.728  1.00 0.00 ? 96  SER A HB2  3  
ATOM 5796  H HB3  . SER A 1 96  ? 13.202  -4.858  -6.722  1.00 0.00 ? 96  SER A HB3  3  
ATOM 5797  H HG   . SER A 1 96  ? 15.937  -5.438  -5.973  1.00 0.00 ? 96  SER A HG   3  
ATOM 5798  N N    . LYS A 1 97  ? 13.114  -3.384  -4.165  1.00 0.00 ? 97  LYS A N    3  
ATOM 5799  C CA   . LYS A 1 97  ? 12.321  -2.241  -3.747  1.00 0.00 ? 97  LYS A CA   3  
ATOM 5800  C C    . LYS A 1 97  ? 11.345  -1.867  -4.865  1.00 0.00 ? 97  LYS A C    3  
ATOM 5801  O O    . LYS A 1 97  ? 10.188  -1.546  -4.601  1.00 0.00 ? 97  LYS A O    3  
ATOM 5802  C CB   . LYS A 1 97  ? 13.229  -1.089  -3.312  1.00 0.00 ? 97  LYS A CB   3  
ATOM 5803  C CG   . LYS A 1 97  ? 12.423  0.194   -3.101  1.00 0.00 ? 97  LYS A CG   3  
ATOM 5804  C CD   . LYS A 1 97  ? 12.974  1.335   -3.959  1.00 0.00 ? 97  LYS A CD   3  
ATOM 5805  C CE   . LYS A 1 97  ? 13.033  2.640   -3.163  1.00 0.00 ? 97  LYS A CE   3  
ATOM 5806  N NZ   . LYS A 1 97  ? 12.572  3.775   -3.993  1.00 0.00 ? 97  LYS A NZ   3  
ATOM 5807  H H    . LYS A 1 97  ? 14.083  -3.192  -4.323  1.00 0.00 ? 97  LYS A H    3  
ATOM 5808  H HA   . LYS A 1 97  ? 11.745  -2.545  -2.873  1.00 0.00 ? 97  LYS A HA   3  
ATOM 5809  H HB2  . LYS A 1 97  ? 13.744  -1.355  -2.390  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 5810  H HB3  . LYS A 1 97  ? 13.996  -0.921  -4.068  1.00 0.00 ? 97  LYS A HB3  3  
ATOM 5811  H HG2  . LYS A 1 97  ? 11.377  0.017   -3.352  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 5812  H HG3  . LYS A 1 97  ? 12.454  0.478   -2.049  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 5813  H HD2  . LYS A 1 97  ? 13.970  1.078   -4.317  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 5814  H HD3  . LYS A 1 97  ? 12.344  1.470   -4.838  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 5815  H HE2  . LYS A 1 97  ? 12.411  2.558   -2.271  1.00 0.00 ? 97  LYS A HE2  3  
ATOM 5816  H HE3  . LYS A 1 97  ? 14.053  2.821   -2.824  1.00 0.00 ? 97  LYS A HE3  3  
ATOM 5817  H HZ1  . LYS A 1 97  ? 13.313  4.069   -4.598  1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 5818  H HZ2  . LYS A 1 97  ? 11.787  3.489   -4.543  1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 5819  H HZ3  . LYS A 1 97  ? 12.304  4.535   -3.401  1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 5820  N N    . GLU A 1 98  ? 11.849  -1.921  -6.089  1.00 0.00 ? 98  GLU A N    3  
ATOM 5821  C CA   . GLU A 1 98  ? 11.037  -1.591  -7.248  1.00 0.00 ? 98  GLU A CA   3  
ATOM 5822  C C    . GLU A 1 98  ? 9.884   -2.588  -7.388  1.00 0.00 ? 98  GLU A C    3  
ATOM 5823  O O    . GLU A 1 98  ? 8.727   -2.190  -7.520  1.00 0.00 ? 98  GLU A O    3  
ATOM 5824  C CB   . GLU A 1 98  ? 11.886  -1.553  -8.520  1.00 0.00 ? 98  GLU A CB   3  
ATOM 5825  C CG   . GLU A 1 98  ? 12.884  -0.394  -8.478  1.00 0.00 ? 98  GLU A CG   3  
ATOM 5826  C CD   . GLU A 1 98  ? 12.969  0.307   -9.835  1.00 0.00 ? 98  GLU A CD   3  
ATOM 5827  O OE1  . GLU A 1 98  ? 11.991  1.008   -10.174 1.00 0.00 ? 98  GLU A OE1  3  
ATOM 5828  O OE2  . GLU A 1 98  ? 14.010  0.125   -10.503 1.00 0.00 ? 98  GLU A OE2  3  
ATOM 5829  H H    . GLU A 1 98  ? 12.792  -2.183  -6.295  1.00 0.00 ? 98  GLU A H    3  
ATOM 5830  H HA   . GLU A 1 98  ? 10.642  -0.595  -7.051  1.00 0.00 ? 98  GLU A HA   3  
ATOM 5831  H HB2  . GLU A 1 98  ? 12.422  -2.495  -8.633  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 5832  H HB3  . GLU A 1 98  ? 11.238  -1.448  -9.391  1.00 0.00 ? 98  GLU A HB3  3  
ATOM 5833  H HG2  . GLU A 1 98  ? 12.583  0.322   -7.713  1.00 0.00 ? 98  GLU A HG2  3  
ATOM 5834  H HG3  . GLU A 1 98  ? 13.868  -0.768  -8.195  1.00 0.00 ? 98  GLU A HG3  3  
ATOM 5835  N N    . ASP A 1 99  ? 10.239  -3.864  -7.355  1.00 0.00 ? 99  ASP A N    3  
ATOM 5836  C CA   . ASP A 1 99  ? 9.249   -4.920  -7.477  1.00 0.00 ? 99  ASP A CA   3  
ATOM 5837  C C    . ASP A 1 99  ? 8.125   -4.678  -6.468  1.00 0.00 ? 99  ASP A C    3  
ATOM 5838  O O    . ASP A 1 99  ? 6.990   -5.102  -6.683  1.00 0.00 ? 99  ASP A O    3  
ATOM 5839  C CB   . ASP A 1 99  ? 9.864   -6.289  -7.179  1.00 0.00 ? 99  ASP A CB   3  
ATOM 5840  C CG   . ASP A 1 99  ? 10.754  -6.852  -8.289  1.00 0.00 ? 99  ASP A CG   3  
ATOM 5841  O OD1  . ASP A 1 99  ? 10.340  -6.737  -9.462  1.00 0.00 ? 99  ASP A OD1  3  
ATOM 5842  O OD2  . ASP A 1 99  ? 11.829  -7.386  -7.938  1.00 0.00 ? 99  ASP A OD2  3  
ATOM 5843  H H    . ASP A 1 99  ? 11.182  -4.179  -7.247  1.00 0.00 ? 99  ASP A H    3  
ATOM 5844  H HA   . ASP A 1 99  ? 8.902   -4.869  -8.509  1.00 0.00 ? 99  ASP A HA   3  
ATOM 5845  H HB2  . ASP A 1 99  ? 10.452  -6.215  -6.264  1.00 0.00 ? 99  ASP A HB2  3  
ATOM 5846  H HB3  . ASP A 1 99  ? 9.059   -6.998  -6.984  1.00 0.00 ? 99  ASP A HB3  3  
ATOM 5847  N N    . ALA A 1 100 ? 8.478   -3.996  -5.388  1.00 0.00 ? 100 ALA A N    3  
ATOM 5848  C CA   . ALA A 1 100 ? 7.513   -3.693  -4.345  1.00 0.00 ? 100 ALA A CA   3  
ATOM 5849  C C    . ALA A 1 100 ? 6.680   -2.480  -4.765  1.00 0.00 ? 100 ALA A C    3  
ATOM 5850  O O    . ALA A 1 100 ? 5.458   -2.485  -4.630  1.00 0.00 ? 100 ALA A O    3  
ATOM 5851  C CB   . ALA A 1 100 ? 8.246   -3.467  -3.021  1.00 0.00 ? 100 ALA A CB   3  
ATOM 5852  H H    . ALA A 1 100 ? 9.403   -3.655  -5.220  1.00 0.00 ? 100 ALA A H    3  
ATOM 5853  H HA   . ALA A 1 100 ? 6.856   -4.556  -4.240  1.00 0.00 ? 100 ALA A HA   3  
ATOM 5854  H HB1  . ALA A 1 100 ? 7.579   -3.703  -2.192  1.00 0.00 ? 100 ALA A HB1  3  
ATOM 5855  H HB2  . ALA A 1 100 ? 9.123   -4.113  -2.976  1.00 0.00 ? 100 ALA A HB2  3  
ATOM 5856  H HB3  . ALA A 1 100 ? 8.558   -2.425  -2.951  1.00 0.00 ? 100 ALA A HB3  3  
ATOM 5857  N N    . ILE A 1 101 ? 7.376   -1.469  -5.265  1.00 0.00 ? 101 ILE A N    3  
ATOM 5858  C CA   . ILE A 1 101 ? 6.716   -0.252  -5.705  1.00 0.00 ? 101 ILE A CA   3  
ATOM 5859  C C    . ILE A 1 101 ? 5.746   -0.584  -6.840  1.00 0.00 ? 101 ILE A C    3  
ATOM 5860  O O    . ILE A 1 101 ? 4.580   -0.196  -6.799  1.00 0.00 ? 101 ILE A O    3  
ATOM 5861  C CB   . ILE A 1 101 ? 7.749   0.816   -6.071  1.00 0.00 ? 101 ILE A CB   3  
ATOM 5862  C CG1  . ILE A 1 101 ? 8.432   1.371   -4.820  1.00 0.00 ? 101 ILE A CG1  3  
ATOM 5863  C CG2  . ILE A 1 101 ? 7.118   1.922   -6.919  1.00 0.00 ? 101 ILE A CG2  3  
ATOM 5864  C CD1  . ILE A 1 101 ? 9.948   1.442   -5.008  1.00 0.00 ? 101 ILE A CD1  3  
ATOM 5865  H H    . ILE A 1 101 ? 8.370   -1.473  -5.371  1.00 0.00 ? 101 ILE A H    3  
ATOM 5866  H HA   . ILE A 1 101 ? 6.142   0.132   -4.861  1.00 0.00 ? 101 ILE A HA   3  
ATOM 5867  H HB   . ILE A 1 101 ? 8.523   0.347   -6.679  1.00 0.00 ? 101 ILE A HB   3  
ATOM 5868  H HG12 . ILE A 1 101 ? 8.042   2.365   -4.600  1.00 0.00 ? 101 ILE A HG12 3  
ATOM 5869  H HG13 . ILE A 1 101 ? 8.197   0.740   -3.963  1.00 0.00 ? 101 ILE A HG13 3  
ATOM 5870  H HG21 . ILE A 1 101 ? 6.716   1.492   -7.836  1.00 0.00 ? 101 ILE A HG21 3  
ATOM 5871  H HG22 . ILE A 1 101 ? 6.313   2.396   -6.357  1.00 0.00 ? 101 ILE A HG22 3  
ATOM 5872  H HG23 . ILE A 1 101 ? 7.875   2.666   -7.167  1.00 0.00 ? 101 ILE A HG23 3  
ATOM 5873  H HD11 . ILE A 1 101 ? 10.309  0.494   -5.407  1.00 0.00 ? 101 ILE A HD11 3  
ATOM 5874  H HD12 . ILE A 1 101 ? 10.191  2.245   -5.703  1.00 0.00 ? 101 ILE A HD12 3  
ATOM 5875  H HD13 . ILE A 1 101 ? 10.425  1.636   -4.047  1.00 0.00 ? 101 ILE A HD13 3  
ATOM 5876  N N    . GLU A 1 102 ? 6.264   -1.300  -7.828  1.00 0.00 ? 102 GLU A N    3  
ATOM 5877  C CA   . GLU A 1 102 ? 5.459   -1.689  -8.973  1.00 0.00 ? 102 GLU A CA   3  
ATOM 5878  C C    . GLU A 1 102 ? 4.157   -2.345  -8.507  1.00 0.00 ? 102 GLU A C    3  
ATOM 5879  O O    . GLU A 1 102 ? 3.069   -1.882  -8.847  1.00 0.00 ? 102 GLU A O    3  
ATOM 5880  C CB   . GLU A 1 102 ? 6.240   -2.620  -9.902  1.00 0.00 ? 102 GLU A CB   3  
ATOM 5881  C CG   . GLU A 1 102 ? 7.592   -2.010  -10.279 1.00 0.00 ? 102 GLU A CG   3  
ATOM 5882  C CD   . GLU A 1 102 ? 7.871   -2.177  -11.774 1.00 0.00 ? 102 GLU A CD   3  
ATOM 5883  O OE1  . GLU A 1 102 ? 7.094   -1.600  -12.564 1.00 0.00 ? 102 GLU A OE1  3  
ATOM 5884  O OE2  . GLU A 1 102 ? 8.856   -2.878  -12.092 1.00 0.00 ? 102 GLU A OE2  3  
ATOM 5885  H H    . GLU A 1 102 ? 7.214   -1.612  -7.854  1.00 0.00 ? 102 GLU A H    3  
ATOM 5886  H HA   . GLU A 1 102 ? 5.237   -0.761  -9.500  1.00 0.00 ? 102 GLU A HA   3  
ATOM 5887  H HB2  . GLU A 1 102 ? 6.395   -3.582  -9.413  1.00 0.00 ? 102 GLU A HB2  3  
ATOM 5888  H HB3  . GLU A 1 102 ? 5.659   -2.811  -10.804 1.00 0.00 ? 102 GLU A HB3  3  
ATOM 5889  H HG2  . GLU A 1 102 ? 7.602   -0.952  -10.019 1.00 0.00 ? 102 GLU A HG2  3  
ATOM 5890  H HG3  . GLU A 1 102 ? 8.384   -2.488  -9.702  1.00 0.00 ? 102 GLU A HG3  3  
ATOM 5891  N N    . HIS A 1 103 ? 4.312   -3.412  -7.738  1.00 0.00 ? 103 HIS A N    3  
ATOM 5892  C CA   . HIS A 1 103 ? 3.162   -4.136  -7.222  1.00 0.00 ? 103 HIS A CA   3  
ATOM 5893  C C    . HIS A 1 103 ? 2.243   -3.172  -6.471  1.00 0.00 ? 103 HIS A C    3  
ATOM 5894  O O    . HIS A 1 103 ? 1.021   -3.263  -6.578  1.00 0.00 ? 103 HIS A O    3  
ATOM 5895  C CB   . HIS A 1 103 ? 3.607   -5.322  -6.364  1.00 0.00 ? 103 HIS A CB   3  
ATOM 5896  C CG   . HIS A 1 103 ? 2.581   -6.425  -6.260  1.00 0.00 ? 103 HIS A CG   3  
ATOM 5897  N ND1  . HIS A 1 103 ? 1.949   -6.967  -7.366  1.00 0.00 ? 103 HIS A ND1  3  
ATOM 5898  C CD2  . HIS A 1 103 ? 2.085   -7.081  -5.172  1.00 0.00 ? 103 HIS A CD2  3  
ATOM 5899  C CE1  . HIS A 1 103 ? 1.112   -7.906  -6.950  1.00 0.00 ? 103 HIS A CE1  3  
ATOM 5900  N NE2  . HIS A 1 103 ? 1.197   -7.975  -5.591  1.00 0.00 ? 103 HIS A NE2  3  
ATOM 5901  H H    . HIS A 1 103 ? 5.201   -3.782  -7.466  1.00 0.00 ? 103 HIS A H    3  
ATOM 5902  H HA   . HIS A 1 103 ? 2.630   -4.534  -8.087  1.00 0.00 ? 103 HIS A HA   3  
ATOM 5903  H HB2  . HIS A 1 103 ? 4.527   -5.733  -6.779  1.00 0.00 ? 103 HIS A HB2  3  
ATOM 5904  H HB3  . HIS A 1 103 ? 3.843   -4.963  -5.362  1.00 0.00 ? 103 HIS A HB3  3  
ATOM 5905  H HD1  . HIS A 1 103 ? 2.099   -6.696  -8.316  1.00 0.00 ? 103 HIS A HD1  3  
ATOM 5906  H HD2  . HIS A 1 103 ? 2.370   -6.902  -4.136  1.00 0.00 ? 103 HIS A HD2  3  
ATOM 5907  H HE1  . HIS A 1 103 ? 0.468   -8.516  -7.583  1.00 0.00 ? 103 HIS A HE1  3  
ATOM 5908  N N    . PHE A 1 104 ? 2.866   -2.269  -5.727  1.00 0.00 ? 104 PHE A N    3  
ATOM 5909  C CA   . PHE A 1 104 ? 2.119   -1.289  -4.958  1.00 0.00 ? 104 PHE A CA   3  
ATOM 5910  C C    . PHE A 1 104 ? 1.484   -0.241  -5.875  1.00 0.00 ? 104 PHE A C    3  
ATOM 5911  O O    . PHE A 1 104 ? 0.465   0.355   -5.530  1.00 0.00 ? 104 PHE A O    3  
ATOM 5912  C CB   . PHE A 1 104 ? 3.116   -0.597  -4.027  1.00 0.00 ? 104 PHE A CB   3  
ATOM 5913  C CG   . PHE A 1 104 ? 2.518   0.558   -3.221  1.00 0.00 ? 104 PHE A CG   3  
ATOM 5914  C CD1  . PHE A 1 104 ? 1.890   0.310   -2.041  1.00 0.00 ? 104 PHE A CD1  3  
ATOM 5915  C CD2  . PHE A 1 104 ? 2.613   1.833   -3.686  1.00 0.00 ? 104 PHE A CD2  3  
ATOM 5916  C CE1  . PHE A 1 104 ? 1.334   1.382   -1.293  1.00 0.00 ? 104 PHE A CE1  3  
ATOM 5917  C CE2  . PHE A 1 104 ? 2.057   2.904   -2.939  1.00 0.00 ? 104 PHE A CE2  3  
ATOM 5918  C CZ   . PHE A 1 104 ? 1.429   2.656   -1.758  1.00 0.00 ? 104 PHE A CZ   3  
ATOM 5919  H H    . PHE A 1 104 ? 3.860   -2.202  -5.646  1.00 0.00 ? 104 PHE A H    3  
ATOM 5920  H HA   . PHE A 1 104 ? 1.334   -1.825  -4.425  1.00 0.00 ? 104 PHE A HA   3  
ATOM 5921  H HB2  . PHE A 1 104 ? 3.525   -1.334  -3.336  1.00 0.00 ? 104 PHE A HB2  3  
ATOM 5922  H HB3  . PHE A 1 104 ? 3.950   -0.219  -4.619  1.00 0.00 ? 104 PHE A HB3  3  
ATOM 5923  H HD1  . PHE A 1 104 ? 1.813   -0.711  -1.668  1.00 0.00 ? 104 PHE A HD1  3  
ATOM 5924  H HD2  . PHE A 1 104 ? 3.116   2.031   -4.633  1.00 0.00 ? 104 PHE A HD2  3  
ATOM 5925  H HE1  . PHE A 1 104 ? 0.831   1.183   -0.347  1.00 0.00 ? 104 PHE A HE1  3  
ATOM 5926  H HE2  . PHE A 1 104 ? 2.134   3.926   -3.312  1.00 0.00 ? 104 PHE A HE2  3  
ATOM 5927  H HZ   . PHE A 1 104 ? 1.003   3.479   -1.184  1.00 0.00 ? 104 PHE A HZ   3  
ATOM 5928  N N    . MET A 1 105 ? 2.113   -0.048  -7.025  1.00 0.00 ? 105 MET A N    3  
ATOM 5929  C CA   . MET A 1 105 ? 1.623   0.917   -7.994  1.00 0.00 ? 105 MET A CA   3  
ATOM 5930  C C    . MET A 1 105 ? 0.528   0.306   -8.870  1.00 0.00 ? 105 MET A C    3  
ATOM 5931  O O    . MET A 1 105 ? -0.408  0.996   -9.272  1.00 0.00 ? 105 MET A O    3  
ATOM 5932  C CB   . MET A 1 105 ? 2.780   1.389   -8.876  1.00 0.00 ? 105 MET A CB   3  
ATOM 5933  C CG   . MET A 1 105 ? 3.407   2.669   -8.320  1.00 0.00 ? 105 MET A CG   3  
ATOM 5934  S SD   . MET A 1 105 ? 3.574   3.881   -9.620  1.00 0.00 ? 105 MET A SD   3  
ATOM 5935  C CE   . MET A 1 105 ? 4.502   2.931   -10.813 1.00 0.00 ? 105 MET A CE   3  
ATOM 5936  H H    . MET A 1 105 ? 2.942   -0.537  -7.298  1.00 0.00 ? 105 MET A H    3  
ATOM 5937  H HA   . MET A 1 105 ? 1.211   1.738   -7.406  1.00 0.00 ? 105 MET A HA   3  
ATOM 5938  H HB2  . MET A 1 105 ? 3.536   0.606   -8.939  1.00 0.00 ? 105 MET A HB2  3  
ATOM 5939  H HB3  . MET A 1 105 ? 2.420   1.566   -9.890  1.00 0.00 ? 105 MET A HB3  3  
ATOM 5940  H HG2  . MET A 1 105 ? 2.789   3.068   -7.517  1.00 0.00 ? 105 MET A HG2  3  
ATOM 5941  H HG3  . MET A 1 105 ? 4.384   2.447   -7.890  1.00 0.00 ? 105 MET A HG3  3  
ATOM 5942  H HE1  . MET A 1 105 ? 4.612   3.508   -11.731 1.00 0.00 ? 105 MET A HE1  3  
ATOM 5943  H HE2  . MET A 1 105 ? 5.487   2.701   -10.408 1.00 0.00 ? 105 MET A HE2  3  
ATOM 5944  H HE3  . MET A 1 105 ? 3.973   2.003   -11.029 1.00 0.00 ? 105 MET A HE3  3  
ATOM 5945  N N    . LYS A 1 106 ? 0.681   -0.981  -9.142  1.00 0.00 ? 106 LYS A N    3  
ATOM 5946  C CA   . LYS A 1 106 ? -0.283  -1.693  -9.964  1.00 0.00 ? 106 LYS A CA   3  
ATOM 5947  C C    . LYS A 1 106 ? -1.506  -2.048  -9.116  1.00 0.00 ? 106 LYS A C    3  
ATOM 5948  O O    . LYS A 1 106 ? -2.641  -1.917  -9.572  1.00 0.00 ? 106 LYS A O    3  
ATOM 5949  C CB   . LYS A 1 106 ? 0.373   -2.902  -10.633 1.00 0.00 ? 106 LYS A CB   3  
ATOM 5950  C CG   . LYS A 1 106 ? -0.621  -4.056  -10.777 1.00 0.00 ? 106 LYS A CG   3  
ATOM 5951  C CD   . LYS A 1 106 ? 0.063   -5.303  -11.342 1.00 0.00 ? 106 LYS A CD   3  
ATOM 5952  C CE   . LYS A 1 106 ? -0.390  -5.574  -12.778 1.00 0.00 ? 106 LYS A CE   3  
ATOM 5953  N NZ   . LYS A 1 106 ? 0.394   -4.756  -13.731 1.00 0.00 ? 106 LYS A NZ   3  
ATOM 5954  H H    . LYS A 1 106 ? 1.445   -1.535  -8.811  1.00 0.00 ? 106 LYS A H    3  
ATOM 5955  H HA   . LYS A 1 106 ? -0.598  -1.016  -10.758 1.00 0.00 ? 106 LYS A HA   3  
ATOM 5956  H HB2  . LYS A 1 106 ? 0.751   -2.619  -11.616 1.00 0.00 ? 106 LYS A HB2  3  
ATOM 5957  H HB3  . LYS A 1 106 ? 1.231   -3.228  -10.044 1.00 0.00 ? 106 LYS A HB3  3  
ATOM 5958  H HG2  . LYS A 1 106 ? -1.060  -4.286  -9.806  1.00 0.00 ? 106 LYS A HG2  3  
ATOM 5959  H HG3  . LYS A 1 106 ? -1.439  -3.757  -11.433 1.00 0.00 ? 106 LYS A HG3  3  
ATOM 5960  H HD2  . LYS A 1 106 ? 1.145   -5.171  -11.316 1.00 0.00 ? 106 LYS A HD2  3  
ATOM 5961  H HD3  . LYS A 1 106 ? -0.168  -6.164  -10.715 1.00 0.00 ? 106 LYS A HD3  3  
ATOM 5962  H HE2  . LYS A 1 106 ? -0.268  -6.631  -13.010 1.00 0.00 ? 106 LYS A HE2  3  
ATOM 5963  H HE3  . LYS A 1 106 ? -1.451  -5.345  -12.880 1.00 0.00 ? 106 LYS A HE3  3  
ATOM 5964  H HZ1  . LYS A 1 106 ? 1.345   -4.709  -13.426 1.00 0.00 ? 106 LYS A HZ1  3  
ATOM 5965  H HZ2  . LYS A 1 106 ? 0.355   -5.174  -14.638 1.00 0.00 ? 106 LYS A HZ2  3  
ATOM 5966  H HZ3  . LYS A 1 106 ? 0.011   -3.834  -13.772 1.00 0.00 ? 106 LYS A HZ3  3  
ATOM 5967  N N    . LEU A 1 107 ? -1.233  -2.491  -7.897  1.00 0.00 ? 107 LEU A N    3  
ATOM 5968  C CA   . LEU A 1 107 ? -2.297  -2.865  -6.981  1.00 0.00 ? 107 LEU A CA   3  
ATOM 5969  C C    . LEU A 1 107 ? -3.309  -1.721  -6.886  1.00 0.00 ? 107 LEU A C    3  
ATOM 5970  O O    . LEU A 1 107 ? -4.488  -1.904  -7.184  1.00 0.00 ? 107 LEU A O    3  
ATOM 5971  C CB   . LEU A 1 107 ? -1.717  -3.287  -5.630  1.00 0.00 ? 107 LEU A CB   3  
ATOM 5972  C CG   . LEU A 1 107 ? -1.414  -4.778  -5.466  1.00 0.00 ? 107 LEU A CG   3  
ATOM 5973  C CD1  . LEU A 1 107 ? -1.047  -5.107  -4.018  1.00 0.00 ? 107 LEU A CD1  3  
ATOM 5974  C CD2  . LEU A 1 107 ? -2.579  -5.633  -5.971  1.00 0.00 ? 107 LEU A CD2  3  
ATOM 5975  H H    . LEU A 1 107 ? -0.307  -2.594  -7.534  1.00 0.00 ? 107 LEU A H    3  
ATOM 5976  H HA   . LEU A 1 107 ? -2.799  -3.736  -7.403  1.00 0.00 ? 107 LEU A HA   3  
ATOM 5977  H HB2  . LEU A 1 107 ? -0.796  -2.729  -5.462  1.00 0.00 ? 107 LEU A HB2  3  
ATOM 5978  H HB3  . LEU A 1 107 ? -2.416  -2.991  -4.848  1.00 0.00 ? 107 LEU A HB3  3  
ATOM 5979  H HG   . LEU A 1 107 ? -0.547  -5.020  -6.081  1.00 0.00 ? 107 LEU A HG   3  
ATOM 5980  H HD11 . LEU A 1 107 ? -1.887  -4.865  -3.366  1.00 0.00 ? 107 LEU A HD11 3  
ATOM 5981  H HD12 . LEU A 1 107 ? -0.816  -6.169  -3.934  1.00 0.00 ? 107 LEU A HD12 3  
ATOM 5982  H HD13 . LEU A 1 107 ? -0.177  -4.521  -3.721  1.00 0.00 ? 107 LEU A HD13 3  
ATOM 5983  H HD21 . LEU A 1 107 ? -2.334  -6.035  -6.954  1.00 0.00 ? 107 LEU A HD21 3  
ATOM 5984  H HD22 . LEU A 1 107 ? -2.755  -6.454  -5.276  1.00 0.00 ? 107 LEU A HD22 3  
ATOM 5985  H HD23 . LEU A 1 107 ? -3.476  -5.018  -6.042  1.00 0.00 ? 107 LEU A HD23 3  
ATOM 5986  N N    . TYR A 1 108 ? -2.810  -0.567  -6.470  1.00 0.00 ? 108 TYR A N    3  
ATOM 5987  C CA   . TYR A 1 108 ? -3.656  0.607   -6.331  1.00 0.00 ? 108 TYR A CA   3  
ATOM 5988  C C    . TYR A 1 108 ? -4.214  1.043   -7.687  1.00 0.00 ? 108 TYR A C    3  
ATOM 5989  O O    . TYR A 1 108 ? -5.080  1.914   -7.755  1.00 0.00 ? 108 TYR A O    3  
ATOM 5990  C CB   . TYR A 1 108 ? -2.754  1.715   -5.784  1.00 0.00 ? 108 TYR A CB   3  
ATOM 5991  C CG   . TYR A 1 108 ? -3.496  3.006   -5.433  1.00 0.00 ? 108 TYR A CG   3  
ATOM 5992  C CD1  . TYR A 1 108 ? -4.064  3.157   -4.184  1.00 0.00 ? 108 TYR A CD1  3  
ATOM 5993  C CD2  . TYR A 1 108 ? -3.598  4.018   -6.365  1.00 0.00 ? 108 TYR A CD2  3  
ATOM 5994  C CE1  . TYR A 1 108 ? -4.763  4.372   -3.854  1.00 0.00 ? 108 TYR A CE1  3  
ATOM 5995  C CE2  . TYR A 1 108 ? -4.297  5.233   -6.034  1.00 0.00 ? 108 TYR A CE2  3  
ATOM 5996  C CZ   . TYR A 1 108 ? -4.845  5.350   -4.795  1.00 0.00 ? 108 TYR A CZ   3  
ATOM 5997  O OH   . TYR A 1 108 ? -5.505  6.497   -4.483  1.00 0.00 ? 108 TYR A OH   3  
ATOM 5998  H H    . TYR A 1 108 ? -1.850  -0.426  -6.229  1.00 0.00 ? 108 TYR A H    3  
ATOM 5999  H HA   . TYR A 1 108 ? -4.484  0.349   -5.672  1.00 0.00 ? 108 TYR A HA   3  
ATOM 6000  H HB2  . TYR A 1 108 ? -2.244  1.347   -4.894  1.00 0.00 ? 108 TYR A HB2  3  
ATOM 6001  H HB3  . TYR A 1 108 ? -1.984  1.940   -6.522  1.00 0.00 ? 108 TYR A HB3  3  
ATOM 6002  H HD1  . TYR A 1 108 ? -3.984  2.357   -3.448  1.00 0.00 ? 108 TYR A HD1  3  
ATOM 6003  H HD2  . TYR A 1 108 ? -3.149  3.899   -7.351  1.00 0.00 ? 108 TYR A HD2  3  
ATOM 6004  H HE1  . TYR A 1 108 ? -5.216  4.504   -2.871  1.00 0.00 ? 108 TYR A HE1  3  
ATOM 6005  H HE2  . TYR A 1 108 ? -4.385  6.041   -6.761  1.00 0.00 ? 108 TYR A HE2  3  
ATOM 6006  H HH   . TYR A 1 108 ? -5.885  6.433   -3.560  1.00 0.00 ? 108 TYR A HH   3  
ATOM 6007  N N    . GLU A 1 109 ? -3.695  0.418   -8.734  1.00 0.00 ? 109 GLU A N    3  
ATOM 6008  C CA   . GLU A 1 109 ? -4.130  0.731   -10.084 1.00 0.00 ? 109 GLU A CA   3  
ATOM 6009  C C    . GLU A 1 109 ? -5.226  -0.240  -10.527 1.00 0.00 ? 109 GLU A C    3  
ATOM 6010  O O    . GLU A 1 109 ? -5.978  0.048   -11.457 1.00 0.00 ? 109 GLU A O    3  
ATOM 6011  C CB   . GLU A 1 109 ? -2.952  0.710   -11.059 1.00 0.00 ? 109 GLU A CB   3  
ATOM 6012  C CG   . GLU A 1 109 ? -3.435  0.823   -12.507 1.00 0.00 ? 109 GLU A CG   3  
ATOM 6013  C CD   . GLU A 1 109 ? -2.256  0.807   -13.481 1.00 0.00 ? 109 GLU A CD   3  
ATOM 6014  O OE1  . GLU A 1 109 ? -1.660  1.890   -13.668 1.00 0.00 ? 109 GLU A OE1  3  
ATOM 6015  O OE2  . GLU A 1 109 ? -1.977  -0.287  -14.018 1.00 0.00 ? 109 GLU A OE2  3  
ATOM 6016  H H    . GLU A 1 109 ? -2.990  -0.289  -8.670  1.00 0.00 ? 109 GLU A H    3  
ATOM 6017  H HA   . GLU A 1 109 ? -4.532  1.743   -10.032 1.00 0.00 ? 109 GLU A HA   3  
ATOM 6018  H HB2  . GLU A 1 109 ? -2.273  1.533   -10.834 1.00 0.00 ? 109 GLU A HB2  3  
ATOM 6019  H HB3  . GLU A 1 109 ? -2.386  -0.213  -10.932 1.00 0.00 ? 109 GLU A HB3  3  
ATOM 6020  H HG2  . GLU A 1 109 ? -4.110  -0.003  -12.734 1.00 0.00 ? 109 GLU A HG2  3  
ATOM 6021  H HG3  . GLU A 1 109 ? -4.004  1.743   -12.633 1.00 0.00 ? 109 GLU A HG3  3  
ATOM 6022  N N    . GLU A 1 110 ? -5.282  -1.372  -9.841  1.00 0.00 ? 110 GLU A N    3  
ATOM 6023  C CA   . GLU A 1 110 ? -6.273  -2.388  -10.151 1.00 0.00 ? 110 GLU A CA   3  
ATOM 6024  C C    . GLU A 1 110 ? -7.574  -2.110  -9.395  1.00 0.00 ? 110 GLU A C    3  
ATOM 6025  O O    . GLU A 1 110 ? -8.662  -2.253  -9.951  1.00 0.00 ? 110 GLU A O    3  
ATOM 6026  C CB   . GLU A 1 110 ? -5.742  -3.787  -9.833  1.00 0.00 ? 110 GLU A CB   3  
ATOM 6027  C CG   . GLU A 1 110 ? -6.182  -4.237  -8.439  1.00 0.00 ? 110 GLU A CG   3  
ATOM 6028  C CD   . GLU A 1 110 ? -5.694  -5.656  -8.140  1.00 0.00 ? 110 GLU A CD   3  
ATOM 6029  O OE1  . GLU A 1 110 ? -4.480  -5.889  -8.325  1.00 0.00 ? 110 GLU A OE1  3  
ATOM 6030  O OE2  . GLU A 1 110 ? -6.546  -6.475  -7.734  1.00 0.00 ? 110 GLU A OE2  3  
ATOM 6031  H H    . GLU A 1 110 ? -4.667  -1.599  -9.086  1.00 0.00 ? 110 GLU A H    3  
ATOM 6032  H HA   . GLU A 1 110 ? -6.444  -2.306  -11.225 1.00 0.00 ? 110 GLU A HA   3  
ATOM 6033  H HB2  . GLU A 1 110 ? -6.104  -4.496  -10.579 1.00 0.00 ? 110 GLU A HB2  3  
ATOM 6034  H HB3  . GLU A 1 110 ? -4.654  -3.790  -9.894  1.00 0.00 ? 110 GLU A HB3  3  
ATOM 6035  H HG2  . GLU A 1 110 ? -5.790  -3.548  -7.690  1.00 0.00 ? 110 GLU A HG2  3  
ATOM 6036  H HG3  . GLU A 1 110 ? -7.269  -4.199  -8.367  1.00 0.00 ? 110 GLU A HG3  3  
ATOM 6037  N N    . LYS A 1 111 ? -7.418  -1.717  -8.139  1.00 0.00 ? 111 LYS A N    3  
ATOM 6038  C CA   . LYS A 1 111 ? -8.566  -1.418  -7.301  1.00 0.00 ? 111 LYS A CA   3  
ATOM 6039  C C    . LYS A 1 111 ? -9.294  -0.193  -7.859  1.00 0.00 ? 111 LYS A C    3  
ATOM 6040  O O    . LYS A 1 111 ? -10.454 -0.284  -8.258  1.00 0.00 ? 111 LYS A O    3  
ATOM 6041  C CB   . LYS A 1 111 ? -8.138  -1.266  -5.840  1.00 0.00 ? 111 LYS A CB   3  
ATOM 6042  C CG   . LYS A 1 111 ? -7.518  -2.561  -5.313  1.00 0.00 ? 111 LYS A CG   3  
ATOM 6043  C CD   . LYS A 1 111 ? -8.597  -3.602  -5.010  1.00 0.00 ? 111 LYS A CD   3  
ATOM 6044  C CE   . LYS A 1 111 ? -7.989  -5.000  -4.879  1.00 0.00 ? 111 LYS A CE   3  
ATOM 6045  N NZ   . LYS A 1 111 ? -8.797  -5.833  -3.961  1.00 0.00 ? 111 LYS A NZ   3  
ATOM 6046  H H    . LYS A 1 111 ? -6.529  -1.603  -7.695  1.00 0.00 ? 111 LYS A H    3  
ATOM 6047  H HA   . LYS A 1 111 ? -9.240  -2.273  -7.352  1.00 0.00 ? 111 LYS A HA   3  
ATOM 6048  H HB2  . LYS A 1 111 ? -7.420  -0.451  -5.750  1.00 0.00 ? 111 LYS A HB2  3  
ATOM 6049  H HB3  . LYS A 1 111 ? -9.001  -0.997  -5.231  1.00 0.00 ? 111 LYS A HB3  3  
ATOM 6050  H HG2  . LYS A 1 111 ? -6.820  -2.960  -6.049  1.00 0.00 ? 111 LYS A HG2  3  
ATOM 6051  H HG3  . LYS A 1 111 ? -6.945  -2.353  -4.410  1.00 0.00 ? 111 LYS A HG3  3  
ATOM 6052  H HD2  . LYS A 1 111 ? -9.113  -3.339  -4.087  1.00 0.00 ? 111 LYS A HD2  3  
ATOM 6053  H HD3  . LYS A 1 111 ? -9.344  -3.599  -5.804  1.00 0.00 ? 111 LYS A HD3  3  
ATOM 6054  H HE2  . LYS A 1 111 ? -7.938  -5.474  -5.860  1.00 0.00 ? 111 LYS A HE2  3  
ATOM 6055  H HE3  . LYS A 1 111 ? -6.967  -4.926  -4.508  1.00 0.00 ? 111 LYS A HE3  3  
ATOM 6056  H HZ1  . LYS A 1 111 ? -9.210  -5.252  -3.260  1.00 0.00 ? 111 LYS A HZ1  3  
ATOM 6057  H HZ2  . LYS A 1 111 ? -9.518  -6.296  -4.477  1.00 0.00 ? 111 LYS A HZ2  3  
ATOM 6058  H HZ3  . LYS A 1 111 ? -8.209  -6.515  -3.525  1.00 0.00 ? 111 LYS A HZ3  3  
ATOM 6059  N N    . THR A 1 112 ? -8.583  0.925   -7.870  1.00 0.00 ? 112 THR A N    3  
ATOM 6060  C CA   . THR A 1 112 ? -9.146  2.166   -8.372  1.00 0.00 ? 112 THR A CA   3  
ATOM 6061  C C    . THR A 1 112 ? -9.297  2.106   -9.894  1.00 0.00 ? 112 THR A C    3  
ATOM 6062  O O    . THR A 1 112 ? -10.287 2.588   -10.442 1.00 0.00 ? 112 THR A O    3  
ATOM 6063  C CB   . THR A 1 112 ? -8.257  3.316   -7.895  1.00 0.00 ? 112 THR A CB   3  
ATOM 6064  O OG1  . THR A 1 112 ? -7.103  3.232   -8.727  1.00 0.00 ? 112 THR A OG1  3  
ATOM 6065  C CG2  . THR A 1 112 ? -7.715  3.090   -6.482  1.00 0.00 ? 112 THR A CG2  3  
ATOM 6066  H H    . THR A 1 112 ? -7.639  0.990   -7.543  1.00 0.00 ? 112 THR A H    3  
ATOM 6067  H HA   . THR A 1 112 ? -10.147 2.283   -7.956  1.00 0.00 ? 112 THR A HA   3  
ATOM 6068  H HB   . THR A 1 112 ? -8.783  4.269   -7.962  1.00 0.00 ? 112 THR A HB   3  
ATOM 6069  H HG1  . THR A 1 112 ? -6.635  2.362   -8.574  1.00 0.00 ? 112 THR A HG1  3  
ATOM 6070  H HG21 . THR A 1 112 ? -6.677  2.763   -6.539  1.00 0.00 ? 112 THR A HG21 3  
ATOM 6071  H HG22 . THR A 1 112 ? -7.772  4.021   -5.918  1.00 0.00 ? 112 THR A HG22 3  
ATOM 6072  H HG23 . THR A 1 112 ? -8.310  2.325   -5.983  1.00 0.00 ? 112 THR A HG23 3  
ATOM 6073  N N    . GLY A 1 113 ? -8.301  1.510   -10.532 1.00 0.00 ? 113 GLY A N    3  
ATOM 6074  C CA   . GLY A 1 113 ? -8.310  1.380   -11.979 1.00 0.00 ? 113 GLY A CA   3  
ATOM 6075  C C    . GLY A 1 113 ? -7.410  2.432   -12.630 1.00 0.00 ? 113 GLY A C    3  
ATOM 6076  O O    . GLY A 1 113 ? -6.992  2.274   -13.776 1.00 0.00 ? 113 GLY A O    3  
ATOM 6077  H H    . GLY A 1 113 ? -7.499  1.120   -10.078 1.00 0.00 ? 113 GLY A H    3  
ATOM 6078  H HA2  . GLY A 1 113 ? -7.973  0.383   -12.261 1.00 0.00 ? 113 GLY A HA2  3  
ATOM 6079  H HA3  . GLY A 1 113 ? -9.329  1.489   -12.351 1.00 0.00 ? 113 GLY A HA3  3  
ATOM 6080  N N    . ASN A 1 114 ? -7.136  3.482   -11.870 1.00 0.00 ? 114 ASN A N    3  
ATOM 6081  C CA   . ASN A 1 114 ? -6.292  4.560   -12.358 1.00 0.00 ? 114 ASN A CA   3  
ATOM 6082  C C    . ASN A 1 114 ? -4.882  4.395   -11.789 1.00 0.00 ? 114 ASN A C    3  
ATOM 6083  O O    . ASN A 1 114 ? -4.705  3.822   -10.715 1.00 0.00 ? 114 ASN A O    3  
ATOM 6084  C CB   . ASN A 1 114 ? -6.826  5.923   -11.912 1.00 0.00 ? 114 ASN A CB   3  
ATOM 6085  C CG   . ASN A 1 114 ? -7.858  6.459   -12.905 1.00 0.00 ? 114 ASN A CG   3  
ATOM 6086  O OD1  . ASN A 1 114 ? -7.550  7.209   -13.817 1.00 0.00 ? 114 ASN A OD1  3  
ATOM 6087  N ND2  . ASN A 1 114 ? -9.099  6.035   -12.679 1.00 0.00 ? 114 ASN A ND2  3  
ATOM 6088  H H    . ASN A 1 114 ? -7.480  3.603   -10.939 1.00 0.00 ? 114 ASN A H    3  
ATOM 6089  H HA   . ASN A 1 114 ? -6.317  4.473   -13.444 1.00 0.00 ? 114 ASN A HA   3  
ATOM 6090  H HB2  . ASN A 1 114 ? -7.278  5.834   -10.924 1.00 0.00 ? 114 ASN A HB2  3  
ATOM 6091  H HB3  . ASN A 1 114 ? -6.001  6.629   -11.823 1.00 0.00 ? 114 ASN A HB3  3  
ATOM 6092  H HD21 . ASN A 1 114 ? -9.284  5.421   -11.912 1.00 0.00 ? 114 ASN A HD21 3  
ATOM 6093  H HD22 . ASN A 1 114 ? -9.845  6.332   -13.275 1.00 0.00 ? 114 ASN A HD22 3  
ATOM 6094  N N    . ALA A 1 115 ? -3.914  4.908   -12.535 1.00 0.00 ? 115 ALA A N    3  
ATOM 6095  C CA   . ALA A 1 115 ? -2.524  4.825   -12.118 1.00 0.00 ? 115 ALA A CA   3  
ATOM 6096  C C    . ALA A 1 115 ? -2.340  5.605   -10.815 1.00 0.00 ? 115 ALA A C    3  
ATOM 6097  O O    . ALA A 1 115 ? -3.055  6.573   -10.560 1.00 0.00 ? 115 ALA A O    3  
ATOM 6098  C CB   . ALA A 1 115 ? -1.623  5.343   -13.240 1.00 0.00 ? 115 ALA A CB   3  
ATOM 6099  H H    . ALA A 1 115 ? -4.066  5.373   -13.407 1.00 0.00 ? 115 ALA A H    3  
ATOM 6100  H HA   . ALA A 1 115 ? -2.294  3.775   -11.939 1.00 0.00 ? 115 ALA A HA   3  
ATOM 6101  H HB1  . ALA A 1 115 ? -2.230  5.581   -14.113 1.00 0.00 ? 115 ALA A HB1  3  
ATOM 6102  H HB2  . ALA A 1 115 ? -1.103  6.240   -12.903 1.00 0.00 ? 115 ALA A HB2  3  
ATOM 6103  H HB3  . ALA A 1 115 ? -0.893  4.577   -13.503 1.00 0.00 ? 115 ALA A HB3  3  
ATOM 6104  N N    . TRP A 1 116 ? -1.377  5.154   -10.024 1.00 0.00 ? 116 TRP A N    3  
ATOM 6105  C CA   . TRP A 1 116 ? -1.089  5.798   -8.753  1.00 0.00 ? 116 TRP A CA   3  
ATOM 6106  C C    . TRP A 1 116 ? -0.581  7.212   -9.044  1.00 0.00 ? 116 TRP A C    3  
ATOM 6107  O O    . TRP A 1 116 ? -0.982  8.167   -8.381  1.00 0.00 ? 116 TRP A O    3  
ATOM 6108  C CB   . TRP A 1 116 ? -0.105  4.967   -7.928  1.00 0.00 ? 116 TRP A CB   3  
ATOM 6109  C CG   . TRP A 1 116 ? 0.672   5.775   -6.887  1.00 0.00 ? 116 TRP A CG   3  
ATOM 6110  C CD1  . TRP A 1 116 ? 1.667   6.648   -7.096  1.00 0.00 ? 116 TRP A CD1  3  
ATOM 6111  C CD2  . TRP A 1 116 ? 0.477   5.750   -5.458  1.00 0.00 ? 116 TRP A CD2  3  
ATOM 6112  N NE1  . TRP A 1 116 ? 2.126   7.185   -5.910  1.00 0.00 ? 116 TRP A NE1  3  
ATOM 6113  C CE2  . TRP A 1 116 ? 1.379   6.621   -4.882  1.00 0.00 ? 116 TRP A CE2  3  
ATOM 6114  C CE3  . TRP A 1 116 ? -0.432  5.014   -4.677  1.00 0.00 ? 116 TRP A CE3  3  
ATOM 6115  C CZ2  . TRP A 1 116 ? 1.460   6.839   -3.502  1.00 0.00 ? 116 TRP A CZ2  3  
ATOM 6116  C CZ3  . TRP A 1 116 ? -0.338  5.244   -3.299  1.00 0.00 ? 116 TRP A CZ3  3  
ATOM 6117  C CH2  . TRP A 1 116 ? 0.564   6.118   -2.704  1.00 0.00 ? 116 TRP A CH2  3  
ATOM 6118  H H    . TRP A 1 116 ? -0.800  4.366   -10.239 1.00 0.00 ? 116 TRP A H    3  
ATOM 6119  H HA   . TRP A 1 116 ? -2.019  5.845   -8.186  1.00 0.00 ? 116 TRP A HA   3  
ATOM 6120  H HB2  . TRP A 1 116 ? -0.652  4.172   -7.421  1.00 0.00 ? 116 TRP A HB2  3  
ATOM 6121  H HB3  . TRP A 1 116 ? 0.603   4.486   -8.603  1.00 0.00 ? 116 TRP A HB3  3  
ATOM 6122  H HD1  . TRP A 1 116 ? 2.065   6.902   -8.078  1.00 0.00 ? 116 TRP A HD1  3  
ATOM 6123  H HE1  . TRP A 1 116 ? 2.926   7.916   -5.800  1.00 0.00 ? 116 TRP A HE1  3  
ATOM 6124  H HE3  . TRP A 1 116 ? -1.154  4.320   -5.107  1.00 0.00 ? 116 TRP A HE3  3  
ATOM 6125  H HZ2  . TRP A 1 116 ? 2.182   7.534   -3.071  1.00 0.00 ? 116 TRP A HZ2  3  
ATOM 6126  H HZ3  . TRP A 1 116 ? -1.020  4.699   -2.647  1.00 0.00 ? 116 TRP A HZ3  3  
ATOM 6127  H HH2  . TRP A 1 116 ? 0.574   6.241   -1.621  1.00 0.00 ? 116 TRP A HH2  3  
ATOM 6128  N N    . HIS A 1 117 ? 0.294   7.300   -10.035 1.00 0.00 ? 117 HIS A N    3  
ATOM 6129  C CA   . HIS A 1 117 ? 0.861   8.581   -10.421 1.00 0.00 ? 117 HIS A CA   3  
ATOM 6130  C C    . HIS A 1 117 ? 0.629   8.815   -11.915 1.00 0.00 ? 117 HIS A C    3  
ATOM 6131  O O    . HIS A 1 117 ? 1.392   8.330   -12.749 1.00 0.00 ? 117 HIS A O    3  
ATOM 6132  C CB   . HIS A 1 117 ? 2.338   8.661   -10.030 1.00 0.00 ? 117 HIS A CB   3  
ATOM 6133  C CG   . HIS A 1 117 ? 2.609   9.540   -8.833  1.00 0.00 ? 117 HIS A CG   3  
ATOM 6134  N ND1  . HIS A 1 117 ? 3.808   9.514   -8.141  1.00 0.00 ? 117 HIS A ND1  3  
ATOM 6135  C CD2  . HIS A 1 117 ? 1.826   10.469  -8.213  1.00 0.00 ? 117 HIS A CD2  3  
ATOM 6136  C CE1  . HIS A 1 117 ? 3.737   10.392  -7.151  1.00 0.00 ? 117 HIS A CE1  3  
ATOM 6137  N NE2  . HIS A 1 117 ? 2.508   10.982  -7.197  1.00 0.00 ? 117 HIS A NE2  3  
ATOM 6138  H H    . HIS A 1 117 ? 0.615   6.517   -10.569 1.00 0.00 ? 117 HIS A H    3  
ATOM 6139  H HA   . HIS A 1 117 ? 0.325   9.343   -9.855  1.00 0.00 ? 117 HIS A HA   3  
ATOM 6140  H HB2  . HIS A 1 117 ? 2.703   7.655   -9.821  1.00 0.00 ? 117 HIS A HB2  3  
ATOM 6141  H HB3  . HIS A 1 117 ? 2.908   9.036   -10.880 1.00 0.00 ? 117 HIS A HB3  3  
ATOM 6142  H HD1  . HIS A 1 117 ? 4.593   8.932   -8.352  1.00 0.00 ? 117 HIS A HD1  3  
ATOM 6143  H HD2  . HIS A 1 117 ? 0.812   10.743  -8.504  1.00 0.00 ? 117 HIS A HD2  3  
ATOM 6144  H HE1  . HIS A 1 117 ? 4.523   10.605  -6.426  1.00 0.00 ? 117 HIS A HE1  3  
ATOM 6145  N N    . SER A 1 118 ? -0.428  9.558   -12.208 1.00 0.00 ? 118 SER A N    3  
ATOM 6146  C CA   . SER A 1 118 ? -0.770  9.863   -13.587 1.00 0.00 ? 118 SER A CA   3  
ATOM 6147  C C    . SER A 1 118 ? -1.109  11.348  -13.726 1.00 0.00 ? 118 SER A C    3  
ATOM 6148  O O    . SER A 1 118 ? -0.588  12.027  -14.610 1.00 0.00 ? 118 SER A O    3  
ATOM 6149  C CB   . SER A 1 118 ? -1.942  9.004   -14.066 1.00 0.00 ? 118 SER A CB   3  
ATOM 6150  O OG   . SER A 1 118 ? -1.936  8.835   -15.481 1.00 0.00 ? 118 SER A OG   3  
ATOM 6151  H H    . SER A 1 118 ? -1.044  9.948   -11.524 1.00 0.00 ? 118 SER A H    3  
ATOM 6152  H HA   . SER A 1 118 ? 0.120   9.617   -14.166 1.00 0.00 ? 118 SER A HA   3  
ATOM 6153  H HB2  . SER A 1 118 ? -1.897  8.027   -13.584 1.00 0.00 ? 118 SER A HB2  3  
ATOM 6154  H HB3  . SER A 1 118 ? -2.880  9.467   -13.760 1.00 0.00 ? 118 SER A HB3  3  
ATOM 6155  H HG   . SER A 1 118 ? -2.583  9.469   -15.904 1.00 0.00 ? 118 SER A HG   3  
ATOM 6156  N N    . LYS A 1 119 ? -1.979  11.809  -12.840 1.00 0.00 ? 119 LYS A N    3  
ATOM 6157  C CA   . LYS A 1 119 ? -2.394  13.202  -12.853 1.00 0.00 ? 119 LYS A CA   3  
ATOM 6158  C C    . LYS A 1 119 ? -3.662  13.360  -12.012 1.00 0.00 ? 119 LYS A C    3  
ATOM 6159  O O    . LYS A 1 119 ? -3.587  13.622  -10.813 1.00 0.00 ? 119 LYS A O    3  
ATOM 6160  C CB   . LYS A 1 119 ? -2.543  13.703  -14.291 1.00 0.00 ? 119 LYS A CB   3  
ATOM 6161  C CG   . LYS A 1 119 ? -1.323  14.523  -14.715 1.00 0.00 ? 119 LYS A CG   3  
ATOM 6162  C CD   . LYS A 1 119 ? -1.634  16.021  -14.693 1.00 0.00 ? 119 LYS A CD   3  
ATOM 6163  C CE   . LYS A 1 119 ? -2.447  16.430  -15.923 1.00 0.00 ? 119 LYS A CE   3  
ATOM 6164  N NZ   . LYS A 1 119 ? -3.384  17.524  -15.584 1.00 0.00 ? 119 LYS A NZ   3  
ATOM 6165  H H    . LYS A 1 119 ? -2.398  11.251  -12.124 1.00 0.00 ? 119 LYS A H    3  
ATOM 6166  H HA   . LYS A 1 119 ? -1.597  13.784  -12.390 1.00 0.00 ? 119 LYS A HA   3  
ATOM 6167  H HB2  . LYS A 1 119 ? -2.668  12.856  -14.965 1.00 0.00 ? 119 LYS A HB2  3  
ATOM 6168  H HB3  . LYS A 1 119 ? -3.443  14.313  -14.376 1.00 0.00 ? 119 LYS A HB3  3  
ATOM 6169  H HG2  . LYS A 1 119 ? -0.488  14.312  -14.047 1.00 0.00 ? 119 LYS A HG2  3  
ATOM 6170  H HG3  . LYS A 1 119 ? -1.012  14.227  -15.717 1.00 0.00 ? 119 LYS A HG3  3  
ATOM 6171  H HD2  . LYS A 1 119 ? -2.188  16.268  -13.788 1.00 0.00 ? 119 LYS A HD2  3  
ATOM 6172  H HD3  . LYS A 1 119 ? -0.704  16.589  -14.663 1.00 0.00 ? 119 LYS A HD3  3  
ATOM 6173  H HE2  . LYS A 1 119 ? -1.777  16.751  -16.720 1.00 0.00 ? 119 LYS A HE2  3  
ATOM 6174  H HE3  . LYS A 1 119 ? -3.003  15.572  -16.301 1.00 0.00 ? 119 LYS A HE3  3  
ATOM 6175  H HZ1  . LYS A 1 119 ? -4.096  17.583  -16.284 1.00 0.00 ? 119 LYS A HZ1  3  
ATOM 6176  H HZ2  . LYS A 1 119 ? -3.805  17.340  -14.696 1.00 0.00 ? 119 LYS A HZ2  3  
ATOM 6177  H HZ3  . LYS A 1 119 ? -2.885  18.390  -15.543 1.00 0.00 ? 119 LYS A HZ3  3  
ATOM 6178  N N    . ASN A 1 120 ? -4.797  13.195  -12.675 1.00 0.00 ? 120 ASN A N    3  
ATOM 6179  C CA   . ASN A 1 120 ? -6.080  13.316  -12.003 1.00 0.00 ? 120 ASN A CA   3  
ATOM 6180  C C    . ASN A 1 120 ? -6.769  11.950  -11.978 1.00 0.00 ? 120 ASN A C    3  
ATOM 6181  O O    . ASN A 1 120 ? -6.558  11.128  -12.868 1.00 0.00 ? 120 ASN A O    3  
ATOM 6182  C CB   . ASN A 1 120 ? -6.997  14.294  -12.740 1.00 0.00 ? 120 ASN A CB   3  
ATOM 6183  C CG   . ASN A 1 120 ? -6.885  15.702  -12.150 1.00 0.00 ? 120 ASN A CG   3  
ATOM 6184  O OD1  . ASN A 1 120 ? -5.862  16.361  -12.241 1.00 0.00 ? 120 ASN A OD1  3  
ATOM 6185  N ND2  . ASN A 1 120 ? -7.990  16.123  -11.542 1.00 0.00 ? 120 ASN A ND2  3  
ATOM 6186  H H    . ASN A 1 120 ? -4.850  12.982  -13.651 1.00 0.00 ? 120 ASN A H    3  
ATOM 6187  H HA   . ASN A 1 120 ? -5.847  13.684  -11.004 1.00 0.00 ? 120 ASN A HA   3  
ATOM 6188  H HB2  . ASN A 1 120 ? -6.736  14.317  -13.798 1.00 0.00 ? 120 ASN A HB2  3  
ATOM 6189  H HB3  . ASN A 1 120 ? -8.030  13.950  -12.674 1.00 0.00 ? 120 ASN A HB3  3  
ATOM 6190  H HD21 . ASN A 1 120 ? -8.795  15.532  -11.502 1.00 0.00 ? 120 ASN A HD21 3  
ATOM 6191  H HD22 . ASN A 1 120 ? -8.015  17.031  -11.124 1.00 0.00 ? 120 ASN A HD22 3  
ATOM 6192  N N    . PHE A 1 121 ? -7.578  11.750  -10.948 1.00 0.00 ? 121 PHE A N    3  
ATOM 6193  C CA   . PHE A 1 121 ? -8.299  10.498  -10.795 1.00 0.00 ? 121 PHE A CA   3  
ATOM 6194  C C    . PHE A 1 121 ? -9.742  10.632  -11.287 1.00 0.00 ? 121 PHE A C    3  
ATOM 6195  O O    . PHE A 1 121 ? -10.262 11.741  -11.401 1.00 0.00 ? 121 PHE A O    3  
ATOM 6196  C CB   . PHE A 1 121 ? -8.311  10.168  -9.301  1.00 0.00 ? 121 PHE A CB   3  
ATOM 6197  C CG   . PHE A 1 121 ? -9.014  8.852   -8.960  1.00 0.00 ? 121 PHE A CG   3  
ATOM 6198  C CD1  . PHE A 1 121 ? -8.527  7.677   -9.441  1.00 0.00 ? 121 PHE A CD1  3  
ATOM 6199  C CD2  . PHE A 1 121 ? -10.125 8.859   -8.175  1.00 0.00 ? 121 PHE A CD2  3  
ATOM 6200  C CE1  . PHE A 1 121 ? -9.180  6.456   -9.124  1.00 0.00 ? 121 PHE A CE1  3  
ATOM 6201  C CE2  . PHE A 1 121 ? -10.777 7.638   -7.859  1.00 0.00 ? 121 PHE A CE2  3  
ATOM 6202  C CZ   . PHE A 1 121 ? -10.291 6.462   -8.340  1.00 0.00 ? 121 PHE A CZ   3  
ATOM 6203  H H    . PHE A 1 121 ? -7.744  12.424  -10.228 1.00 0.00 ? 121 PHE A H    3  
ATOM 6204  H HA   . PHE A 1 121 ? -7.781  9.751   -11.396 1.00 0.00 ? 121 PHE A HA   3  
ATOM 6205  H HB2  . PHE A 1 121 ? -7.283  10.122  -8.942  1.00 0.00 ? 121 PHE A HB2  3  
ATOM 6206  H HB3  . PHE A 1 121 ? -8.801  10.980  -8.764  1.00 0.00 ? 121 PHE A HB3  3  
ATOM 6207  H HD1  . PHE A 1 121 ? -7.637  7.672   -10.070 1.00 0.00 ? 121 PHE A HD1  3  
ATOM 6208  H HD2  . PHE A 1 121 ? -10.514 9.801   -7.790  1.00 0.00 ? 121 PHE A HD2  3  
ATOM 6209  H HE1  . PHE A 1 121 ? -8.790  5.514   -9.510  1.00 0.00 ? 121 PHE A HE1  3  
ATOM 6210  H HE2  . PHE A 1 121 ? -11.667 7.643   -7.230  1.00 0.00 ? 121 PHE A HE2  3  
ATOM 6211  H HZ   . PHE A 1 121 ? -10.792 5.525   -8.096  1.00 0.00 ? 121 PHE A HZ   3  
ATOM 6212  N N    . THR A 1 122 ? -10.348 9.487   -11.564 1.00 0.00 ? 122 THR A N    3  
ATOM 6213  C CA   . THR A 1 122 ? -11.720 9.463   -12.041 1.00 0.00 ? 122 THR A CA   3  
ATOM 6214  C C    . THR A 1 122 ? -12.531 8.413   -11.278 1.00 0.00 ? 122 THR A C    3  
ATOM 6215  O O    . THR A 1 122 ? -12.207 7.227   -11.313 1.00 0.00 ? 122 THR A O    3  
ATOM 6216  C CB   . THR A 1 122 ? -11.692 9.228   -13.552 1.00 0.00 ? 122 THR A CB   3  
ATOM 6217  O OG1  . THR A 1 122 ? -11.258 10.474  -14.089 1.00 0.00 ? 122 THR A OG1  3  
ATOM 6218  C CG2  . THR A 1 122 ? -13.091 9.035   -14.141 1.00 0.00 ? 122 THR A CG2  3  
ATOM 6219  H H    . THR A 1 122 ? -9.918  8.589   -11.469 1.00 0.00 ? 122 THR A H    3  
ATOM 6220  H HA   . THR A 1 122 ? -12.174 10.432  -11.832 1.00 0.00 ? 122 THR A HA   3  
ATOM 6221  H HB   . THR A 1 122 ? -11.044 8.388   -13.804 1.00 0.00 ? 122 THR A HB   3  
ATOM 6222  H HG1  . THR A 1 122 ? -11.789 11.222  -13.691 1.00 0.00 ? 122 THR A HG1  3  
ATOM 6223  H HG21 . THR A 1 122 ? -13.119 9.444   -15.151 1.00 0.00 ? 122 THR A HG21 3  
ATOM 6224  H HG22 . THR A 1 122 ? -13.328 7.972   -14.173 1.00 0.00 ? 122 THR A HG22 3  
ATOM 6225  H HG23 . THR A 1 122 ? -13.821 9.552   -13.519 1.00 0.00 ? 122 THR A HG23 3  
ATOM 6226  N N    . LYS A 1 123 ? -13.570 8.888   -10.606 1.00 0.00 ? 123 LYS A N    3  
ATOM 6227  C CA   . LYS A 1 123 ? -14.430 8.006   -9.836  1.00 0.00 ? 123 LYS A CA   3  
ATOM 6228  C C    . LYS A 1 123 ? -15.186 7.078   -10.789 1.00 0.00 ? 123 LYS A C    3  
ATOM 6229  O O    . LYS A 1 123 ? -16.038 7.528   -11.553 1.00 0.00 ? 123 LYS A O    3  
ATOM 6230  C CB   . LYS A 1 123 ? -15.342 8.817   -8.914  1.00 0.00 ? 123 LYS A CB   3  
ATOM 6231  C CG   . LYS A 1 123 ? -15.372 8.219   -7.507  1.00 0.00 ? 123 LYS A CG   3  
ATOM 6232  C CD   . LYS A 1 123 ? -16.767 7.690   -7.165  1.00 0.00 ? 123 LYS A CD   3  
ATOM 6233  C CE   . LYS A 1 123 ? -16.700 6.654   -6.041  1.00 0.00 ? 123 LYS A CE   3  
ATOM 6234  N NZ   . LYS A 1 123 ? -18.015 6.529   -5.373  1.00 0.00 ? 123 LYS A NZ   3  
ATOM 6235  H H    . LYS A 1 123 ? -13.826 9.854   -10.582 1.00 0.00 ? 123 LYS A H    3  
ATOM 6236  H HA   . LYS A 1 123 ? -13.787 7.398   -9.199  1.00 0.00 ? 123 LYS A HA   3  
ATOM 6237  H HB2  . LYS A 1 123 ? -14.994 9.849   -8.867  1.00 0.00 ? 123 LYS A HB2  3  
ATOM 6238  H HB3  . LYS A 1 123 ? -16.352 8.840   -9.325  1.00 0.00 ? 123 LYS A HB3  3  
ATOM 6239  H HG2  . LYS A 1 123 ? -14.645 7.410   -7.436  1.00 0.00 ? 123 LYS A HG2  3  
ATOM 6240  H HG3  . LYS A 1 123 ? -15.079 8.976   -6.780  1.00 0.00 ? 123 LYS A HG3  3  
ATOM 6241  H HD2  . LYS A 1 123 ? -17.410 8.517   -6.865  1.00 0.00 ? 123 LYS A HD2  3  
ATOM 6242  H HD3  . LYS A 1 123 ? -17.217 7.242   -8.051  1.00 0.00 ? 123 LYS A HD3  3  
ATOM 6243  H HE2  . LYS A 1 123 ? -16.398 5.688   -6.445  1.00 0.00 ? 123 LYS A HE2  3  
ATOM 6244  H HE3  . LYS A 1 123 ? -15.943 6.947   -5.313  1.00 0.00 ? 123 LYS A HE3  3  
ATOM 6245  H HZ1  . LYS A 1 123 ? -18.403 7.439   -5.227  1.00 0.00 ? 123 LYS A HZ1  3  
ATOM 6246  H HZ2  . LYS A 1 123 ? -18.632 5.993   -5.950  1.00 0.00 ? 123 LYS A HZ2  3  
ATOM 6247  H HZ3  . LYS A 1 123 ? -17.900 6.070   -4.492  1.00 0.00 ? 123 LYS A HZ3  3  
ATOM 6248  N N    . TYR A 1 124 ? -14.846 5.799   -10.712 1.00 0.00 ? 124 TYR A N    3  
ATOM 6249  C CA   . TYR A 1 124 ? -15.483 4.804   -11.559 1.00 0.00 ? 124 TYR A CA   3  
ATOM 6250  C C    . TYR A 1 124 ? -16.334 3.842   -10.728 1.00 0.00 ? 124 TYR A C    3  
ATOM 6251  O O    . TYR A 1 124 ? -16.162 3.745   -9.514  1.00 0.00 ? 124 TYR A O    3  
ATOM 6252  C CB   . TYR A 1 124 ? -14.345 4.022   -12.218 1.00 0.00 ? 124 TYR A CB   3  
ATOM 6253  C CG   . TYR A 1 124 ? -13.926 4.565   -13.585 1.00 0.00 ? 124 TYR A CG   3  
ATOM 6254  C CD1  . TYR A 1 124 ? -14.887 4.934   -14.505 1.00 0.00 ? 124 TYR A CD1  3  
ATOM 6255  C CD2  . TYR A 1 124 ? -12.588 4.687   -13.899 1.00 0.00 ? 124 TYR A CD2  3  
ATOM 6256  C CE1  . TYR A 1 124 ? -14.493 5.446   -15.792 1.00 0.00 ? 124 TYR A CE1  3  
ATOM 6257  C CE2  . TYR A 1 124 ? -12.194 5.199   -15.186 1.00 0.00 ? 124 TYR A CE2  3  
ATOM 6258  C CZ   . TYR A 1 124 ? -13.165 5.553   -16.069 1.00 0.00 ? 124 TYR A CZ   3  
ATOM 6259  O OH   . TYR A 1 124 ? -12.793 6.036   -17.284 1.00 0.00 ? 124 TYR A OH   3  
ATOM 6260  H H    . TYR A 1 124 ? -14.152 5.441   -10.088 1.00 0.00 ? 124 TYR A H    3  
ATOM 6261  H HA   . TYR A 1 124 ? -16.125 5.327   -12.267 1.00 0.00 ? 124 TYR A HA   3  
ATOM 6262  H HB2  . TYR A 1 124 ? -13.480 4.030   -11.554 1.00 0.00 ? 124 TYR A HB2  3  
ATOM 6263  H HB3  . TYR A 1 124 ? -14.651 2.981   -12.330 1.00 0.00 ? 124 TYR A HB3  3  
ATOM 6264  H HD1  . TYR A 1 124 ? -15.944 4.838   -14.257 1.00 0.00 ? 124 TYR A HD1  3  
ATOM 6265  H HD2  . TYR A 1 124 ? -11.829 4.396   -13.172 1.00 0.00 ? 124 TYR A HD2  3  
ATOM 6266  H HE1  . TYR A 1 124 ? -15.241 5.741   -16.527 1.00 0.00 ? 124 TYR A HE1  3  
ATOM 6267  H HE2  . TYR A 1 124 ? -11.140 5.300   -15.446 1.00 0.00 ? 124 TYR A HE2  3  
ATOM 6268  H HH   . TYR A 1 124 ? -13.073 5.402   -18.005 1.00 0.00 ? 124 TYR A HH   3  
ATOM 6269  N N    . PRO A 1 125 ? -17.257 3.136   -11.434 1.00 0.00 ? 125 PRO A N    3  
ATOM 6270  C CA   . PRO A 1 125 ? -18.136 2.184   -10.776 1.00 0.00 ? 125 PRO A CA   3  
ATOM 6271  C C    . PRO A 1 125 ? -17.383 0.903   -10.413 1.00 0.00 ? 125 PRO A C    3  
ATOM 6272  O O    . PRO A 1 125 ? -16.755 0.283   -11.271 1.00 0.00 ? 125 PRO A O    3  
ATOM 6273  C CB   . PRO A 1 125 ? -19.270 1.949   -11.760 1.00 0.00 ? 125 PRO A CB   3  
ATOM 6274  C CG   . PRO A 1 125 ? -18.751 2.412   -13.112 1.00 0.00 ? 125 PRO A CG   3  
ATOM 6275  C CD   . PRO A 1 125 ? -17.489 3.225   -12.873 1.00 0.00 ? 125 PRO A CD   3  
ATOM 6276  H HA   . PRO A 1 125 ? -18.468 2.560   -9.910  1.00 0.00 ? 125 PRO A HA   3  
ATOM 6277  H HB2  . PRO A 1 125 ? -19.549 0.896   -11.789 1.00 0.00 ? 125 PRO A HB2  3  
ATOM 6278  H HB3  . PRO A 1 125 ? -20.160 2.507   -11.471 1.00 0.00 ? 125 PRO A HB3  3  
ATOM 6279  H HG2  . PRO A 1 125 ? -18.539 1.557   -13.753 1.00 0.00 ? 125 PRO A HG2  3  
ATOM 6280  H HG3  . PRO A 1 125 ? -19.502 3.015   -13.622 1.00 0.00 ? 125 PRO A HG3  3  
ATOM 6281  H HD2  . PRO A 1 125 ? -16.647 2.822   -13.435 1.00 0.00 ? 125 PRO A HD2  3  
ATOM 6282  H HD3  . PRO A 1 125 ? -17.619 4.260   -13.190 1.00 0.00 ? 125 PRO A HD3  3  
ATOM 6283  N N    . LYS A 1 126 ? -17.470 0.543   -9.141  1.00 0.00 ? 126 LYS A N    3  
ATOM 6284  C CA   . LYS A 1 126 ? -16.804 -0.654  -8.655  1.00 0.00 ? 126 LYS A CA   3  
ATOM 6285  C C    . LYS A 1 126 ? -15.311 -0.368  -8.484  1.00 0.00 ? 126 LYS A C    3  
ATOM 6286  O O    . LYS A 1 126 ? -14.550 -1.246  -8.079  1.00 0.00 ? 126 LYS A O    3  
ATOM 6287  C CB   . LYS A 1 126 ? -17.102 -1.843  -9.571  1.00 0.00 ? 126 LYS A CB   3  
ATOM 6288  C CG   . LYS A 1 126 ? -18.599 -1.941  -9.873  1.00 0.00 ? 126 LYS A CG   3  
ATOM 6289  C CD   . LYS A 1 126 ? -18.977 -3.355  -10.319 1.00 0.00 ? 126 LYS A CD   3  
ATOM 6290  C CE   . LYS A 1 126 ? -18.805 -3.517  -11.831 1.00 0.00 ? 126 LYS A CE   3  
ATOM 6291  N NZ   . LYS A 1 126 ? -17.972 -4.702  -12.133 1.00 0.00 ? 126 LYS A NZ   3  
ATOM 6292  H H    . LYS A 1 126 ? -17.982 1.052   -8.450  1.00 0.00 ? 126 LYS A H    3  
ATOM 6293  H HA   . LYS A 1 126 ? -17.225 -0.888  -7.677  1.00 0.00 ? 126 LYS A HA   3  
ATOM 6294  H HB2  . LYS A 1 126 ? -16.546 -1.737  -10.503 1.00 0.00 ? 126 LYS A HB2  3  
ATOM 6295  H HB3  . LYS A 1 126 ? -16.761 -2.764  -9.100  1.00 0.00 ? 126 LYS A HB3  3  
ATOM 6296  H HG2  . LYS A 1 126 ? -19.171 -1.670  -8.986  1.00 0.00 ? 126 LYS A HG2  3  
ATOM 6297  H HG3  . LYS A 1 126 ? -18.864 -1.227  -10.653 1.00 0.00 ? 126 LYS A HG3  3  
ATOM 6298  H HD2  . LYS A 1 126 ? -18.354 -4.082  -9.799  1.00 0.00 ? 126 LYS A HD2  3  
ATOM 6299  H HD3  . LYS A 1 126 ? -20.010 -3.563  -10.043 1.00 0.00 ? 126 LYS A HD3  3  
ATOM 6300  H HE2  . LYS A 1 126 ? -19.781 -3.621  -12.305 1.00 0.00 ? 126 LYS A HE2  3  
ATOM 6301  H HE3  . LYS A 1 126 ? -18.341 -2.623  -12.248 1.00 0.00 ? 126 LYS A HE3  3  
ATOM 6302  H HZ1  . LYS A 1 126 ? -18.372 -5.511  -11.702 1.00 0.00 ? 126 LYS A HZ1  3  
ATOM 6303  H HZ2  . LYS A 1 126 ? -17.932 -4.838  -13.123 1.00 0.00 ? 126 LYS A HZ2  3  
ATOM 6304  H HZ3  . LYS A 1 126 ? -17.047 -4.559  -11.779 1.00 0.00 ? 126 LYS A HZ3  3  
ATOM 6305  N N    . LYS A 1 127 ? -14.936 0.862   -8.801  1.00 0.00 ? 127 LYS A N    3  
ATOM 6306  C CA   . LYS A 1 127 ? -13.548 1.275   -8.688  1.00 0.00 ? 127 LYS A CA   3  
ATOM 6307  C C    . LYS A 1 127 ? -13.294 1.814   -7.279  1.00 0.00 ? 127 LYS A C    3  
ATOM 6308  O O    . LYS A 1 127 ? -14.120 2.542   -6.731  1.00 0.00 ? 127 LYS A O    3  
ATOM 6309  C CB   . LYS A 1 127 ? -13.190 2.264   -9.799  1.00 0.00 ? 127 LYS A CB   3  
ATOM 6310  C CG   . LYS A 1 127 ? -13.044 1.549   -11.144 1.00 0.00 ? 127 LYS A CG   3  
ATOM 6311  C CD   . LYS A 1 127 ? -12.083 0.364   -11.033 1.00 0.00 ? 127 LYS A CD   3  
ATOM 6312  C CE   . LYS A 1 127 ? -11.519 -0.014  -12.404 1.00 0.00 ? 127 LYS A CE   3  
ATOM 6313  N NZ   . LYS A 1 127 ? -12.165 -1.247  -12.908 1.00 0.00 ? 127 LYS A NZ   3  
ATOM 6314  H H    . LYS A 1 127 ? -15.562 1.570   -9.130  1.00 0.00 ? 127 LYS A H    3  
ATOM 6315  H HA   . LYS A 1 127 ? -12.931 0.388   -8.835  1.00 0.00 ? 127 LYS A HA   3  
ATOM 6316  H HB2  . LYS A 1 127 ? -13.963 3.030   -9.872  1.00 0.00 ? 127 LYS A HB2  3  
ATOM 6317  H HB3  . LYS A 1 127 ? -12.259 2.774   -9.551  1.00 0.00 ? 127 LYS A HB3  3  
ATOM 6318  H HG2  . LYS A 1 127 ? -14.020 1.201   -11.482 1.00 0.00 ? 127 LYS A HG2  3  
ATOM 6319  H HG3  . LYS A 1 127 ? -12.678 2.250   -11.894 1.00 0.00 ? 127 LYS A HG3  3  
ATOM 6320  H HD2  . LYS A 1 127 ? -11.266 0.615   -10.357 1.00 0.00 ? 127 LYS A HD2  3  
ATOM 6321  H HD3  . LYS A 1 127 ? -12.603 -0.491  -10.601 1.00 0.00 ? 127 LYS A HD3  3  
ATOM 6322  H HE2  . LYS A 1 127 ? -11.681 0.801   -13.108 1.00 0.00 ? 127 LYS A HE2  3  
ATOM 6323  H HE3  . LYS A 1 127 ? -10.442 -0.164  -12.332 1.00 0.00 ? 127 LYS A HE3  3  
ATOM 6324  H HZ1  . LYS A 1 127 ? -12.825 -1.578  -12.233 1.00 0.00 ? 127 LYS A HZ1  3  
ATOM 6325  H HZ2  . LYS A 1 127 ? -12.637 -1.050  -13.767 1.00 0.00 ? 127 LYS A HZ2  3  
ATOM 6326  H HZ3  . LYS A 1 127 ? -11.469 -1.948  -13.064 1.00 0.00 ? 127 LYS A HZ3  3  
ATOM 6327  N N    . PHE A 1 128 ? -12.147 1.437   -6.733  1.00 0.00 ? 128 PHE A N    3  
ATOM 6328  C CA   . PHE A 1 128 ? -11.774 1.873   -5.398  1.00 0.00 ? 128 PHE A CA   3  
ATOM 6329  C C    . PHE A 1 128 ? -11.182 3.284   -5.428  1.00 0.00 ? 128 PHE A C    3  
ATOM 6330  O O    . PHE A 1 128 ? -10.236 3.548   -6.169  1.00 0.00 ? 128 PHE A O    3  
ATOM 6331  C CB   . PHE A 1 128 ? -10.711 0.898   -4.889  1.00 0.00 ? 128 PHE A CB   3  
ATOM 6332  C CG   . PHE A 1 128 ? -11.276 -0.436  -4.397  1.00 0.00 ? 128 PHE A CG   3  
ATOM 6333  C CD1  . PHE A 1 128 ? -11.647 -0.579  -3.096  1.00 0.00 ? 128 PHE A CD1  3  
ATOM 6334  C CD2  . PHE A 1 128 ? -11.407 -1.479  -5.260  1.00 0.00 ? 128 PHE A CD2  3  
ATOM 6335  C CE1  . PHE A 1 128 ? -12.171 -1.817  -2.639  1.00 0.00 ? 128 PHE A CE1  3  
ATOM 6336  C CE2  . PHE A 1 128 ? -11.931 -2.717  -4.803  1.00 0.00 ? 128 PHE A CE2  3  
ATOM 6337  C CZ   . PHE A 1 128 ? -12.302 -2.860  -3.502  1.00 0.00 ? 128 PHE A CZ   3  
ATOM 6338  H H    . PHE A 1 128 ? -11.481 0.845   -7.186  1.00 0.00 ? 128 PHE A H    3  
ATOM 6339  H HA   . PHE A 1 128 ? -12.681 1.875   -4.793  1.00 0.00 ? 128 PHE A HA   3  
ATOM 6340  H HB2  . PHE A 1 128 ? -9.997  0.705   -5.689  1.00 0.00 ? 128 PHE A HB2  3  
ATOM 6341  H HB3  . PHE A 1 128 ? -10.160 1.369   -4.076  1.00 0.00 ? 128 PHE A HB3  3  
ATOM 6342  H HD1  . PHE A 1 128 ? -11.542 0.257   -2.405  1.00 0.00 ? 128 PHE A HD1  3  
ATOM 6343  H HD2  . PHE A 1 128 ? -11.110 -1.365  -6.302  1.00 0.00 ? 128 PHE A HD2  3  
ATOM 6344  H HE1  . PHE A 1 128 ? -12.468 -1.932  -1.597  1.00 0.00 ? 128 PHE A HE1  3  
ATOM 6345  H HE2  . PHE A 1 128 ? -12.036 -3.553  -5.495  1.00 0.00 ? 128 PHE A HE2  3  
ATOM 6346  H HZ   . PHE A 1 128 ? -12.704 -3.811  -3.151  1.00 0.00 ? 128 PHE A HZ   3  
ATOM 6347  N N    . TYR A 1 129 ? -11.763 4.153   -4.614  1.00 0.00 ? 129 TYR A N    3  
ATOM 6348  C CA   . TYR A 1 129 ? -11.305 5.529   -4.538  1.00 0.00 ? 129 TYR A CA   3  
ATOM 6349  C C    . TYR A 1 129 ? -10.669 5.821   -3.178  1.00 0.00 ? 129 TYR A C    3  
ATOM 6350  O O    . TYR A 1 129 ? -10.852 5.063   -2.227  1.00 0.00 ? 129 TYR A O    3  
ATOM 6351  C CB   . TYR A 1 129 ? -12.554 6.399   -4.700  1.00 0.00 ? 129 TYR A CB   3  
ATOM 6352  C CG   . TYR A 1 129 ? -13.696 6.030   -3.752  1.00 0.00 ? 129 TYR A CG   3  
ATOM 6353  C CD1  . TYR A 1 129 ? -13.676 6.468   -2.444  1.00 0.00 ? 129 TYR A CD1  3  
ATOM 6354  C CD2  . TYR A 1 129 ? -14.748 5.259   -4.205  1.00 0.00 ? 129 TYR A CD2  3  
ATOM 6355  C CE1  . TYR A 1 129 ? -14.752 6.121   -1.551  1.00 0.00 ? 129 TYR A CE1  3  
ATOM 6356  C CE2  . TYR A 1 129 ? -15.823 4.912   -3.313  1.00 0.00 ? 129 TYR A CE2  3  
ATOM 6357  C CZ   . TYR A 1 129 ? -15.772 5.360   -2.030  1.00 0.00 ? 129 TYR A CZ   3  
ATOM 6358  O OH   . TYR A 1 129 ? -16.788 5.032   -1.187  1.00 0.00 ? 129 TYR A OH   3  
ATOM 6359  H H    . TYR A 1 129 ? -12.532 3.929   -4.015  1.00 0.00 ? 129 TYR A H    3  
ATOM 6360  H HA   . TYR A 1 129 ? -10.560 5.680   -5.319  1.00 0.00 ? 129 TYR A HA   3  
ATOM 6361  H HB2  . TYR A 1 129 ? -12.282 7.442   -4.537  1.00 0.00 ? 129 TYR A HB2  3  
ATOM 6362  H HB3  . TYR A 1 129 ? -12.908 6.320   -5.728  1.00 0.00 ? 129 TYR A HB3  3  
ATOM 6363  H HD1  . TYR A 1 129 ? -12.846 7.077   -2.086  1.00 0.00 ? 129 TYR A HD1  3  
ATOM 6364  H HD2  . TYR A 1 129 ? -14.764 4.913   -5.239  1.00 0.00 ? 129 TYR A HD2  3  
ATOM 6365  H HE1  . TYR A 1 129 ? -14.748 6.461   -0.516  1.00 0.00 ? 129 TYR A HE1  3  
ATOM 6366  H HE2  . TYR A 1 129 ? -16.659 4.304   -3.658  1.00 0.00 ? 129 TYR A HE2  3  
ATOM 6367  H HH   . TYR A 1 129 ? -16.973 5.792   -0.563  1.00 0.00 ? 129 TYR A HH   3  
ATOM 6368  N N    . PRO A 1 130 ? -9.914  6.951   -3.127  1.00 0.00 ? 130 PRO A N    3  
ATOM 6369  C CA   . PRO A 1 130 ? -9.249  7.352   -1.899  1.00 0.00 ? 130 PRO A CA   3  
ATOM 6370  C C    . PRO A 1 130 ? -10.249 7.935   -0.899  1.00 0.00 ? 130 PRO A C    3  
ATOM 6371  O O    . PRO A 1 130 ? -10.939 8.908   -1.200  1.00 0.00 ? 130 PRO A O    3  
ATOM 6372  C CB   . PRO A 1 130 ? -8.192  8.354   -2.334  1.00 0.00 ? 130 PRO A CB   3  
ATOM 6373  C CG   . PRO A 1 130 ? -8.608  8.826   -3.717  1.00 0.00 ? 130 PRO A CG   3  
ATOM 6374  C CD   . PRO A 1 130 ? -9.674  7.873   -4.233  1.00 0.00 ? 130 PRO A CD   3  
ATOM 6375  H HA   . PRO A 1 130 ? -8.843  6.557   -1.448  1.00 0.00 ? 130 PRO A HA   3  
ATOM 6376  H HB2  . PRO A 1 130 ? -8.136  9.191   -1.636  1.00 0.00 ? 130 PRO A HB2  3  
ATOM 6377  H HB3  . PRO A 1 130 ? -7.204  7.894   -2.359  1.00 0.00 ? 130 PRO A HB3  3  
ATOM 6378  H HG2  . PRO A 1 130 ? -8.995  9.844   -3.673  1.00 0.00 ? 130 PRO A HG2  3  
ATOM 6379  H HG3  . PRO A 1 130 ? -7.750  8.840   -4.390  1.00 0.00 ? 130 PRO A HG3  3  
ATOM 6380  H HD2  . PRO A 1 130 ? -10.583 8.407   -4.508  1.00 0.00 ? 130 PRO A HD2  3  
ATOM 6381  H HD3  . PRO A 1 130 ? -9.334  7.344   -5.124  1.00 0.00 ? 130 PRO A HD3  3  
ATOM 6382  N N    . LEU A 1 131 ? -10.297 7.314   0.271   1.00 0.00 ? 131 LEU A N    3  
ATOM 6383  C CA   . LEU A 1 131 ? -11.202 7.759   1.317   1.00 0.00 ? 131 LEU A CA   3  
ATOM 6384  C C    . LEU A 1 131 ? -10.669 9.056   1.929   1.00 0.00 ? 131 LEU A C    3  
ATOM 6385  O O    . LEU A 1 131 ? -11.131 10.144  1.585   1.00 0.00 ? 131 LEU A O    3  
ATOM 6386  C CB   . LEU A 1 131 ? -11.426 6.644   2.341   1.00 0.00 ? 131 LEU A CB   3  
ATOM 6387  C CG   . LEU A 1 131 ? -11.919 5.308   1.780   1.00 0.00 ? 131 LEU A CG   3  
ATOM 6388  C CD1  . LEU A 1 131 ? -12.053 4.264   2.890   1.00 0.00 ? 131 LEU A CD1  3  
ATOM 6389  C CD2  . LEU A 1 131 ? -13.224 5.488   1.002   1.00 0.00 ? 131 LEU A CD2  3  
ATOM 6390  H H    . LEU A 1 131 ? -9.733  6.524   0.508   1.00 0.00 ? 131 LEU A H    3  
ATOM 6391  H HA   . LEU A 1 131 ? -12.164 7.966   0.850   1.00 0.00 ? 131 LEU A HA   3  
ATOM 6392  H HB2  . LEU A 1 131 ? -10.490 6.470   2.870   1.00 0.00 ? 131 LEU A HB2  3  
ATOM 6393  H HB3  . LEU A 1 131 ? -12.149 6.995   3.078   1.00 0.00 ? 131 LEU A HB3  3  
ATOM 6394  H HG   . LEU A 1 131 ? -11.174 4.937   1.077   1.00 0.00 ? 131 LEU A HG   3  
ATOM 6395  H HD11 . LEU A 1 131 ? -12.199 3.279   2.446   1.00 0.00 ? 131 LEU A HD11 3  
ATOM 6396  H HD12 . LEU A 1 131 ? -11.146 4.258   3.495   1.00 0.00 ? 131 LEU A HD12 3  
ATOM 6397  H HD13 . LEU A 1 131 ? -12.908 4.509   3.519   1.00 0.00 ? 131 LEU A HD13 3  
ATOM 6398  H HD21 . LEU A 1 131 ? -13.058 5.246   -0.047  1.00 0.00 ? 131 LEU A HD21 3  
ATOM 6399  H HD22 . LEU A 1 131 ? -13.986 4.824   1.412   1.00 0.00 ? 131 LEU A HD22 3  
ATOM 6400  H HD23 . LEU A 1 131 ? -13.559 6.522   1.088   1.00 0.00 ? 131 LEU A HD23 3  
ATOM 6401  N N    . GLU A 1 132 ? -9.705  8.899   2.824   1.00 0.00 ? 132 GLU A N    3  
ATOM 6402  C CA   . GLU A 1 132 ? -9.105  10.045  3.486   1.00 0.00 ? 132 GLU A CA   3  
ATOM 6403  C C    . GLU A 1 132 ? -8.252  10.843  2.498   1.00 0.00 ? 132 GLU A C    3  
ATOM 6404  O O    . GLU A 1 132 ? -7.081  10.530  2.290   1.00 0.00 ? 132 GLU A O    3  
ATOM 6405  C CB   . GLU A 1 132 ? -8.278  9.607   4.696   1.00 0.00 ? 132 GLU A CB   3  
ATOM 6406  C CG   . GLU A 1 132 ? -8.945  10.041  6.003   1.00 0.00 ? 132 GLU A CG   3  
ATOM 6407  C CD   . GLU A 1 132 ? -9.734  8.887   6.625   1.00 0.00 ? 132 GLU A CD   3  
ATOM 6408  O OE1  . GLU A 1 132 ? -9.074  7.990   7.193   1.00 0.00 ? 132 GLU A OE1  3  
ATOM 6409  O OE2  . GLU A 1 132 ? -10.978 8.928   6.519   1.00 0.00 ? 132 GLU A OE2  3  
ATOM 6410  H H    . GLU A 1 132 ? -9.336  8.012   3.098   1.00 0.00 ? 132 GLU A H    3  
ATOM 6411  H HA   . GLU A 1 132 ? -9.943  10.654  3.827   1.00 0.00 ? 132 GLU A HA   3  
ATOM 6412  H HB2  . GLU A 1 132 ? -8.158  8.524   4.687   1.00 0.00 ? 132 GLU A HB2  3  
ATOM 6413  H HB3  . GLU A 1 132 ? -7.279  10.039  4.634   1.00 0.00 ? 132 GLU A HB3  3  
ATOM 6414  H HG2  . GLU A 1 132 ? -8.187  10.389  6.705   1.00 0.00 ? 132 GLU A HG2  3  
ATOM 6415  H HG3  . GLU A 1 132 ? -9.613  10.882  5.813   1.00 0.00 ? 132 GLU A HG3  3  
ATOM 6416  N N    . ILE A 1 133 ? -8.872  11.858  1.915   1.00 0.00 ? 133 ILE A N    3  
ATOM 6417  C CA   . ILE A 1 133 ? -8.184  12.703  0.953   1.00 0.00 ? 133 ILE A CA   3  
ATOM 6418  C C    . ILE A 1 133 ? -7.379  13.768  1.701   1.00 0.00 ? 133 ILE A C    3  
ATOM 6419  O O    . ILE A 1 133 ? -6.150  13.729  1.710   1.00 0.00 ? 133 ILE A O    3  
ATOM 6420  C CB   . ILE A 1 133 ? -9.176  13.280  -0.059  1.00 0.00 ? 133 ILE A CB   3  
ATOM 6421  C CG1  . ILE A 1 133 ? -9.830  12.167  -0.880  1.00 0.00 ? 133 ILE A CG1  3  
ATOM 6422  C CG2  . ILE A 1 133 ? -8.504  14.329  -0.947  1.00 0.00 ? 133 ILE A CG2  3  
ATOM 6423  C CD1  . ILE A 1 133 ? -11.348 12.165  -0.690  1.00 0.00 ? 133 ILE A CD1  3  
ATOM 6424  H H    . ILE A 1 133 ? -9.825  12.106  2.090   1.00 0.00 ? 133 ILE A H    3  
ATOM 6425  H HA   . ILE A 1 133 ? -7.490  12.070  0.400   1.00 0.00 ? 133 ILE A HA   3  
ATOM 6426  H HB   . ILE A 1 133 ? -9.970  13.784  0.491   1.00 0.00 ? 133 ILE A HB   3  
ATOM 6427  H HG12 . ILE A 1 133 ? -9.592  12.301  -1.936  1.00 0.00 ? 133 ILE A HG12 3  
ATOM 6428  H HG13 . ILE A 1 133 ? -9.422  11.201  -0.582  1.00 0.00 ? 133 ILE A HG13 3  
ATOM 6429  H HG21 . ILE A 1 133 ? -8.947  14.298  -1.943  1.00 0.00 ? 133 ILE A HG21 3  
ATOM 6430  H HG22 . ILE A 1 133 ? -8.651  15.319  -0.515  1.00 0.00 ? 133 ILE A HG22 3  
ATOM 6431  H HG23 . ILE A 1 133 ? -7.437  14.117  -1.017  1.00 0.00 ? 133 ILE A HG23 3  
ATOM 6432  H HD11 . ILE A 1 133 ? -11.776 11.295  -1.187  1.00 0.00 ? 133 ILE A HD11 3  
ATOM 6433  H HD12 . ILE A 1 133 ? -11.581 12.127  0.374   1.00 0.00 ? 133 ILE A HD12 3  
ATOM 6434  H HD13 . ILE A 1 133 ? -11.769 13.073  -1.122  1.00 0.00 ? 133 ILE A HD13 3  
ATOM 6435  N N    . SER A 1 134 ? -8.105  14.694  2.310   1.00 0.00 ? 134 SER A N    3  
ATOM 6436  C CA   . SER A 1 134 ? -7.474  15.767  3.058   1.00 0.00 ? 134 SER A CA   3  
ATOM 6437  C C    . SER A 1 134 ? -8.455  16.338  4.084   1.00 0.00 ? 134 SER A C    3  
ATOM 6438  O O    . SER A 1 134 ? -9.639  16.005  4.067   1.00 0.00 ? 134 SER A O    3  
ATOM 6439  C CB   . SER A 1 134 ? -6.980  16.874  2.124   1.00 0.00 ? 134 SER A CB   3  
ATOM 6440  O OG   . SER A 1 134 ? -5.627  17.232  2.389   1.00 0.00 ? 134 SER A OG   3  
ATOM 6441  H H    . SER A 1 134 ? -9.105  14.718  2.297   1.00 0.00 ? 134 SER A H    3  
ATOM 6442  H HA   . SER A 1 134 ? -6.622  15.308  3.558   1.00 0.00 ? 134 SER A HA   3  
ATOM 6443  H HB2  . SER A 1 134 ? -7.072  16.543  1.089   1.00 0.00 ? 134 SER A HB2  3  
ATOM 6444  H HB3  . SER A 1 134 ? -7.616  17.752  2.234   1.00 0.00 ? 134 SER A HB3  3  
ATOM 6445  H HG   . SER A 1 134 ? -5.569  17.736  3.250   1.00 0.00 ? 134 SER A HG   3  
ATOM 6446  N N    . GLY A 1 135 ? -7.927  17.188  4.952   1.00 0.00 ? 135 GLY A N    3  
ATOM 6447  C CA   . GLY A 1 135 ? -8.742  17.807  5.983   1.00 0.00 ? 135 GLY A CA   3  
ATOM 6448  C C    . GLY A 1 135 ? -8.961  19.293  5.690   1.00 0.00 ? 135 GLY A C    3  
ATOM 6449  O O    . GLY A 1 135 ? -8.712  19.753  4.577   1.00 0.00 ? 135 GLY A O    3  
ATOM 6450  H H    . GLY A 1 135 ? -6.963  17.453  4.959   1.00 0.00 ? 135 GLY A H    3  
ATOM 6451  H HA2  . GLY A 1 135 ? -9.704  17.299  6.046   1.00 0.00 ? 135 GLY A HA2  3  
ATOM 6452  H HA3  . GLY A 1 135 ? -8.257  17.692  6.953   1.00 0.00 ? 135 GLY A HA3  3  
ATOM 6453  N N    . PRO A 1 136 ? -9.437  20.021  6.735   1.00 0.00 ? 136 PRO A N    3  
ATOM 6454  C CA   . PRO A 1 136 ? -9.693  21.445  6.601   1.00 0.00 ? 136 PRO A CA   3  
ATOM 6455  C C    . PRO A 1 136 ? -8.385  22.239  6.598   1.00 0.00 ? 136 PRO A C    3  
ATOM 6456  O O    . PRO A 1 136 ? -7.588  22.131  7.528   1.00 0.00 ? 136 PRO A O    3  
ATOM 6457  C CB   . PRO A 1 136 ? -10.598 21.794  7.771   1.00 0.00 ? 136 PRO A CB   3  
ATOM 6458  C CG   . PRO A 1 136 ? -10.439 20.663  8.773   1.00 0.00 ? 136 PRO A CG   3  
ATOM 6459  C CD   . PRO A 1 136 ? -9.744  19.510  8.068   1.00 0.00 ? 136 PRO A CD   3  
ATOM 6460  H HA   . PRO A 1 136 ? -10.131 21.637  5.722   1.00 0.00 ? 136 PRO A HA   3  
ATOM 6461  H HB2  . PRO A 1 136 ? -10.315 22.750  8.212   1.00 0.00 ? 136 PRO A HB2  3  
ATOM 6462  H HB3  . PRO A 1 136 ? -11.635 21.887  7.448   1.00 0.00 ? 136 PRO A HB3  3  
ATOM 6463  H HG2  . PRO A 1 136 ? -9.855  20.993  9.632   1.00 0.00 ? 136 PRO A HG2  3  
ATOM 6464  H HG3  . PRO A 1 136 ? -11.412 20.348  9.151   1.00 0.00 ? 136 PRO A HG3  3  
ATOM 6465  H HD2  . PRO A 1 136 ? -8.838  19.212  8.596   1.00 0.00 ? 136 PRO A HD2  3  
ATOM 6466  H HD3  . PRO A 1 136 ? -10.386 18.631  8.017   1.00 0.00 ? 136 PRO A HD3  3  
ATOM 6467  N N    . SER A 1 137 ? -8.206  23.019  5.542   1.00 0.00 ? 137 SER A N    3  
ATOM 6468  C CA   . SER A 1 137 ? -7.009  23.831  5.407   1.00 0.00 ? 137 SER A CA   3  
ATOM 6469  C C    . SER A 1 137 ? -5.781  23.031  5.845   1.00 0.00 ? 137 SER A C    3  
ATOM 6470  O O    . SER A 1 137 ? -5.393  23.072  7.012   1.00 0.00 ? 137 SER A O    3  
ATOM 6471  C CB   . SER A 1 137 ? -7.122  25.120  6.224   1.00 0.00 ? 137 SER A CB   3  
ATOM 6472  O OG   . SER A 1 137 ? -7.119  24.865  7.626   1.00 0.00 ? 137 SER A OG   3  
ATOM 6473  H H    . SER A 1 137 ? -8.860  23.101  4.790   1.00 0.00 ? 137 SER A H    3  
ATOM 6474  H HA   . SER A 1 137 ? -6.946  24.078  4.347   1.00 0.00 ? 137 SER A HA   3  
ATOM 6475  H HB2  . SER A 1 137 ? -6.292  25.781  5.974   1.00 0.00 ? 137 SER A HB2  3  
ATOM 6476  H HB3  . SER A 1 137 ? -8.039  25.642  5.952   1.00 0.00 ? 137 SER A HB3  3  
ATOM 6477  H HG   . SER A 1 137 ? -7.959  25.217  8.039   1.00 0.00 ? 137 SER A HG   3  
ATOM 6478  N N    . SER A 1 138 ? -5.204  22.321  4.887   1.00 0.00 ? 138 SER A N    3  
ATOM 6479  C CA   . SER A 1 138 ? -4.028  21.512  5.159   1.00 0.00 ? 138 SER A CA   3  
ATOM 6480  C C    . SER A 1 138 ? -2.789  22.166  4.544   1.00 0.00 ? 138 SER A C    3  
ATOM 6481  O O    . SER A 1 138 ? -2.337  21.763  3.474   1.00 0.00 ? 138 SER A O    3  
ATOM 6482  C CB   . SER A 1 138 ? -4.200  20.091  4.621   1.00 0.00 ? 138 SER A CB   3  
ATOM 6483  O OG   . SER A 1 138 ? -3.722  19.111  5.539   1.00 0.00 ? 138 SER A OG   3  
ATOM 6484  H H    . SER A 1 138 ? -5.525  22.293  3.940   1.00 0.00 ? 138 SER A H    3  
ATOM 6485  H HA   . SER A 1 138 ? -3.944  21.481  6.246   1.00 0.00 ? 138 SER A HA   3  
ATOM 6486  H HB2  . SER A 1 138 ? -5.254  19.908  4.412   1.00 0.00 ? 138 SER A HB2  3  
ATOM 6487  H HB3  . SER A 1 138 ? -3.666  19.993  3.676   1.00 0.00 ? 138 SER A HB3  3  
ATOM 6488  H HG   . SER A 1 138 ? -4.485  18.729  6.060   1.00 0.00 ? 138 SER A HG   3  
ATOM 6489  N N    . GLY A 1 139 ? -2.275  23.164  5.248   1.00 0.00 ? 139 GLY A N    3  
ATOM 6490  C CA   . GLY A 1 139 ? -1.097  23.878  4.784   1.00 0.00 ? 139 GLY A CA   3  
ATOM 6491  C C    . GLY A 1 139 ? -1.178  24.151  3.281   1.00 0.00 ? 139 GLY A C    3  
ATOM 6492  O O    . GLY A 1 139 ? -0.165  24.107  2.583   1.00 0.00 ? 139 GLY A O    3  
ATOM 6493  H H    . GLY A 1 139 ? -2.648  23.486  6.118   1.00 0.00 ? 139 GLY A H    3  
ATOM 6494  H HA2  . GLY A 1 139 ? -1.002  24.820  5.324   1.00 0.00 ? 139 GLY A HA2  3  
ATOM 6495  H HA3  . GLY A 1 139 ? -0.203  23.293  5.004   1.00 0.00 ? 139 GLY A HA3  3  
ATOM 6496  N N    . GLY A 1 1   ? 31.956  -7.844  3.902   1.00 0.00 ? 1   GLY A N    4  
ATOM 6497  C CA   . GLY A 1 1   ? 30.830  -7.646  4.799   1.00 0.00 ? 1   GLY A CA   4  
ATOM 6498  C C    . GLY A 1 1   ? 31.146  -6.580  5.850   1.00 0.00 ? 1   GLY A C    4  
ATOM 6499  O O    . GLY A 1 1   ? 32.306  -6.379  6.206   1.00 0.00 ? 1   GLY A O    4  
ATOM 6500  H H1   . GLY A 1 1   ? 32.665  -7.140  3.953   1.00 0.00 ? 1   GLY A H1   4  
ATOM 6501  H HA2  . GLY A 1 1   ? 29.952  -7.348  4.226   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 6502  H HA3  . GLY A 1 1   ? 30.584  -8.586  5.293   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 6503  N N    . SER A 1 2   ? 30.093  -5.924  6.316   1.00 0.00 ? 2   SER A N    4  
ATOM 6504  C CA   . SER A 1 2   ? 30.244  -4.883  7.319   1.00 0.00 ? 2   SER A CA   4  
ATOM 6505  C C    . SER A 1 2   ? 28.871  -4.344  7.724   1.00 0.00 ? 2   SER A C    4  
ATOM 6506  O O    . SER A 1 2   ? 27.992  -4.177  6.880   1.00 0.00 ? 2   SER A O    4  
ATOM 6507  C CB   . SER A 1 2   ? 31.129  -3.747  6.804   1.00 0.00 ? 2   SER A CB   4  
ATOM 6508  O OG   . SER A 1 2   ? 32.104  -3.352  7.765   1.00 0.00 ? 2   SER A OG   4  
ATOM 6509  H H    . SER A 1 2   ? 29.153  -6.094  6.021   1.00 0.00 ? 2   SER A H    4  
ATOM 6510  H HA   . SER A 1 2   ? 30.731  -5.367  8.166   1.00 0.00 ? 2   SER A HA   4  
ATOM 6511  H HB2  . SER A 1 2   ? 31.630  -4.063  5.889   1.00 0.00 ? 2   SER A HB2  4  
ATOM 6512  H HB3  . SER A 1 2   ? 30.506  -2.890  6.546   1.00 0.00 ? 2   SER A HB3  4  
ATOM 6513  H HG   . SER A 1 2   ? 31.663  -2.870  8.522   1.00 0.00 ? 2   SER A HG   4  
ATOM 6514  N N    . SER A 1 3   ? 28.729  -4.088  9.016   1.00 0.00 ? 3   SER A N    4  
ATOM 6515  C CA   . SER A 1 3   ? 27.478  -3.571  9.544   1.00 0.00 ? 3   SER A CA   4  
ATOM 6516  C C    . SER A 1 3   ? 27.736  -2.792  10.835  1.00 0.00 ? 3   SER A C    4  
ATOM 6517  O O    . SER A 1 3   ? 28.827  -2.863  11.399  1.00 0.00 ? 3   SER A O    4  
ATOM 6518  C CB   . SER A 1 3   ? 26.478  -4.702  9.796   1.00 0.00 ? 3   SER A CB   4  
ATOM 6519  O OG   . SER A 1 3   ? 26.848  -5.501  10.917  1.00 0.00 ? 3   SER A OG   4  
ATOM 6520  H H    . SER A 1 3   ? 29.449  -4.226  9.696   1.00 0.00 ? 3   SER A H    4  
ATOM 6521  H HA   . SER A 1 3   ? 27.089  -2.910  8.770   1.00 0.00 ? 3   SER A HA   4  
ATOM 6522  H HB2  . SER A 1 3   ? 25.487  -4.279  9.964   1.00 0.00 ? 3   SER A HB2  4  
ATOM 6523  H HB3  . SER A 1 3   ? 26.410  -5.331  8.909   1.00 0.00 ? 3   SER A HB3  4  
ATOM 6524  H HG   . SER A 1 3   ? 26.612  -6.457  10.748  1.00 0.00 ? 3   SER A HG   4  
ATOM 6525  N N    . GLY A 1 4   ? 26.713  -2.068  11.266  1.00 0.00 ? 4   GLY A N    4  
ATOM 6526  C CA   . GLY A 1 4   ? 26.816  -1.277  12.481  1.00 0.00 ? 4   GLY A CA   4  
ATOM 6527  C C    . GLY A 1 4   ? 25.663  -0.277  12.583  1.00 0.00 ? 4   GLY A C    4  
ATOM 6528  O O    . GLY A 1 4   ? 25.605  0.690   11.825  1.00 0.00 ? 4   GLY A O    4  
ATOM 6529  H H    . GLY A 1 4   ? 25.829  -2.017  10.802  1.00 0.00 ? 4   GLY A H    4  
ATOM 6530  H HA2  . GLY A 1 4   ? 26.810  -1.935  13.349  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 6531  H HA3  . GLY A 1 4   ? 27.767  -0.744  12.492  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 6532  N N    . SER A 1 5   ? 24.772  -0.545  13.527  1.00 0.00 ? 5   SER A N    4  
ATOM 6533  C CA   . SER A 1 5   ? 23.623  0.320   13.738  1.00 0.00 ? 5   SER A CA   4  
ATOM 6534  C C    . SER A 1 5   ? 23.499  0.672   15.222  1.00 0.00 ? 5   SER A C    4  
ATOM 6535  O O    . SER A 1 5   ? 24.112  0.026   16.070  1.00 0.00 ? 5   SER A O    4  
ATOM 6536  C CB   . SER A 1 5   ? 22.337  -0.342  13.240  1.00 0.00 ? 5   SER A CB   4  
ATOM 6537  O OG   . SER A 1 5   ? 21.627  0.490   12.327  1.00 0.00 ? 5   SER A OG   4  
ATOM 6538  H H    . SER A 1 5   ? 24.826  -1.333  14.139  1.00 0.00 ? 5   SER A H    4  
ATOM 6539  H HA   . SER A 1 5   ? 23.823  1.214   13.148  1.00 0.00 ? 5   SER A HA   4  
ATOM 6540  H HB2  . SER A 1 5   ? 22.580  -1.288  12.755  1.00 0.00 ? 5   SER A HB2  4  
ATOM 6541  H HB3  . SER A 1 5   ? 21.696  -0.576  14.090  1.00 0.00 ? 5   SER A HB3  4  
ATOM 6542  H HG   . SER A 1 5   ? 20.903  -0.034  11.879  1.00 0.00 ? 5   SER A HG   4  
ATOM 6543  N N    . SER A 1 6   ? 22.701  1.695   15.490  1.00 0.00 ? 6   SER A N    4  
ATOM 6544  C CA   . SER A 1 6   ? 22.488  2.140   16.856  1.00 0.00 ? 6   SER A CA   4  
ATOM 6545  C C    . SER A 1 6   ? 21.132  2.838   16.974  1.00 0.00 ? 6   SER A C    4  
ATOM 6546  O O    . SER A 1 6   ? 20.524  3.196   15.966  1.00 0.00 ? 6   SER A O    4  
ATOM 6547  C CB   . SER A 1 6   ? 23.608  3.077   17.311  1.00 0.00 ? 6   SER A CB   4  
ATOM 6548  O OG   . SER A 1 6   ? 24.447  2.471   18.291  1.00 0.00 ? 6   SER A OG   4  
ATOM 6549  H H    . SER A 1 6   ? 22.205  2.215   14.794  1.00 0.00 ? 6   SER A H    4  
ATOM 6550  H HA   . SER A 1 6   ? 22.506  1.234   17.461  1.00 0.00 ? 6   SER A HA   4  
ATOM 6551  H HB2  . SER A 1 6   ? 24.210  3.368   16.449  1.00 0.00 ? 6   SER A HB2  4  
ATOM 6552  H HB3  . SER A 1 6   ? 23.175  3.990   17.719  1.00 0.00 ? 6   SER A HB3  4  
ATOM 6553  H HG   . SER A 1 6   ? 23.941  1.764   18.784  1.00 0.00 ? 6   SER A HG   4  
ATOM 6554  N N    . GLY A 1 7   ? 20.697  3.011   18.214  1.00 0.00 ? 7   GLY A N    4  
ATOM 6555  C CA   . GLY A 1 7   ? 19.423  3.660   18.476  1.00 0.00 ? 7   GLY A CA   4  
ATOM 6556  C C    . GLY A 1 7   ? 19.562  5.182   18.422  1.00 0.00 ? 7   GLY A C    4  
ATOM 6557  O O    . GLY A 1 7   ? 20.501  5.744   18.985  1.00 0.00 ? 7   GLY A O    4  
ATOM 6558  H H    . GLY A 1 7   ? 21.197  2.717   19.028  1.00 0.00 ? 7   GLY A H    4  
ATOM 6559  H HA2  . GLY A 1 7   ? 18.686  3.332   17.743  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 6560  H HA3  . GLY A 1 7   ? 19.053  3.359   19.456  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 6561  N N    . LYS A 1 8   ? 18.614  5.808   17.741  1.00 0.00 ? 8   LYS A N    4  
ATOM 6562  C CA   . LYS A 1 8   ? 18.619  7.254   17.606  1.00 0.00 ? 8   LYS A CA   4  
ATOM 6563  C C    . LYS A 1 8   ? 17.184  7.749   17.413  1.00 0.00 ? 8   LYS A C    4  
ATOM 6564  O O    . LYS A 1 8   ? 16.308  6.983   17.016  1.00 0.00 ? 8   LYS A O    4  
ATOM 6565  C CB   . LYS A 1 8   ? 19.573  7.685   16.491  1.00 0.00 ? 8   LYS A CB   4  
ATOM 6566  C CG   . LYS A 1 8   ? 19.061  7.228   15.123  1.00 0.00 ? 8   LYS A CG   4  
ATOM 6567  C CD   . LYS A 1 8   ? 19.880  6.048   14.597  1.00 0.00 ? 8   LYS A CD   4  
ATOM 6568  C CE   . LYS A 1 8   ? 20.692  6.450   13.365  1.00 0.00 ? 8   LYS A CE   4  
ATOM 6569  N NZ   . LYS A 1 8   ? 19.833  6.466   12.160  1.00 0.00 ? 8   LYS A NZ   4  
ATOM 6570  H H    . LYS A 1 8   ? 17.854  5.343   17.286  1.00 0.00 ? 8   LYS A H    4  
ATOM 6571  H HA   . LYS A 1 8   ? 19.005  7.668   18.538  1.00 0.00 ? 8   LYS A HA   4  
ATOM 6572  H HB2  . LYS A 1 8   ? 19.682  8.770   16.498  1.00 0.00 ? 8   LYS A HB2  4  
ATOM 6573  H HB3  . LYS A 1 8   ? 20.563  7.265   16.671  1.00 0.00 ? 8   LYS A HB3  4  
ATOM 6574  H HG2  . LYS A 1 8   ? 18.012  6.942   15.201  1.00 0.00 ? 8   LYS A HG2  4  
ATOM 6575  H HG3  . LYS A 1 8   ? 19.113  8.056   14.416  1.00 0.00 ? 8   LYS A HG3  4  
ATOM 6576  H HD2  . LYS A 1 8   ? 20.550  5.689   15.378  1.00 0.00 ? 8   LYS A HD2  4  
ATOM 6577  H HD3  . LYS A 1 8   ? 19.214  5.223   14.345  1.00 0.00 ? 8   LYS A HD3  4  
ATOM 6578  H HE2  . LYS A 1 8   ? 21.132  7.436   13.518  1.00 0.00 ? 8   LYS A HE2  4  
ATOM 6579  H HE3  . LYS A 1 8   ? 21.517  5.752   13.222  1.00 0.00 ? 8   LYS A HE3  4  
ATOM 6580  H HZ1  . LYS A 1 8   ? 19.491  5.543   11.982  1.00 0.00 ? 8   LYS A HZ1  4  
ATOM 6581  H HZ2  . LYS A 1 8   ? 19.062  7.084   12.309  1.00 0.00 ? 8   LYS A HZ2  4  
ATOM 6582  H HZ3  . LYS A 1 8   ? 20.366  6.781   11.374  1.00 0.00 ? 8   LYS A HZ3  4  
ATOM 6583  N N    . SER A 1 9   ? 16.989  9.027   17.703  1.00 0.00 ? 9   SER A N    4  
ATOM 6584  C CA   . SER A 1 9   ? 15.675  9.633   17.566  1.00 0.00 ? 9   SER A CA   4  
ATOM 6585  C C    . SER A 1 9   ? 14.689  8.968   18.528  1.00 0.00 ? 9   SER A C    4  
ATOM 6586  O O    . SER A 1 9   ? 15.002  7.943   19.133  1.00 0.00 ? 9   SER A O    4  
ATOM 6587  C CB   . SER A 1 9   ? 15.166  9.526   16.127  1.00 0.00 ? 9   SER A CB   4  
ATOM 6588  O OG   . SER A 1 9   ? 16.026  10.193  15.206  1.00 0.00 ? 9   SER A OG   4  
ATOM 6589  H H    . SER A 1 9   ? 17.707  9.643   18.025  1.00 0.00 ? 9   SER A H    4  
ATOM 6590  H HA   . SER A 1 9   ? 15.813  10.683  17.825  1.00 0.00 ? 9   SER A HA   4  
ATOM 6591  H HB2  . SER A 1 9   ? 15.082  8.476   15.849  1.00 0.00 ? 9   SER A HB2  4  
ATOM 6592  H HB3  . SER A 1 9   ? 14.166  9.954   16.064  1.00 0.00 ? 9   SER A HB3  4  
ATOM 6593  H HG   . SER A 1 9   ? 16.054  11.171  15.411  1.00 0.00 ? 9   SER A HG   4  
ATOM 6594  N N    . GLU A 1 10  ? 13.518  9.578   18.641  1.00 0.00 ? 10  GLU A N    4  
ATOM 6595  C CA   . GLU A 1 10  ? 12.485  9.058   19.519  1.00 0.00 ? 10  GLU A CA   4  
ATOM 6596  C C    . GLU A 1 10  ? 11.181  9.833   19.322  1.00 0.00 ? 10  GLU A C    4  
ATOM 6597  O O    . GLU A 1 10  ? 11.176  10.904  18.716  1.00 0.00 ? 10  GLU A O    4  
ATOM 6598  C CB   . GLU A 1 10  ? 12.934  9.102   20.981  1.00 0.00 ? 10  GLU A CB   4  
ATOM 6599  C CG   . GLU A 1 10  ? 13.184  10.542  21.434  1.00 0.00 ? 10  GLU A CG   4  
ATOM 6600  C CD   . GLU A 1 10  ? 14.676  10.795  21.659  1.00 0.00 ? 10  GLU A CD   4  
ATOM 6601  O OE1  . GLU A 1 10  ? 15.468  10.295  20.831  1.00 0.00 ? 10  GLU A OE1  4  
ATOM 6602  O OE2  . GLU A 1 10  ? 14.992  11.482  22.654  1.00 0.00 ? 10  GLU A OE2  4  
ATOM 6603  H H    . GLU A 1 10  ? 13.272  10.411  18.146  1.00 0.00 ? 10  GLU A H    4  
ATOM 6604  H HA   . GLU A 1 10  ? 12.346  8.019   19.220  1.00 0.00 ? 10  GLU A HA   4  
ATOM 6605  H HB2  . GLU A 1 10  ? 12.172  8.646   21.613  1.00 0.00 ? 10  GLU A HB2  4  
ATOM 6606  H HB3  . GLU A 1 10  ? 13.844  8.515   21.104  1.00 0.00 ? 10  GLU A HB3  4  
ATOM 6607  H HG2  . GLU A 1 10  ? 12.804  11.235  20.683  1.00 0.00 ? 10  GLU A HG2  4  
ATOM 6608  H HG3  . GLU A 1 10  ? 12.635  10.738  22.355  1.00 0.00 ? 10  GLU A HG3  4  
ATOM 6609  N N    . LYS A 1 11  ? 10.105  9.263   19.845  1.00 0.00 ? 11  LYS A N    4  
ATOM 6610  C CA   . LYS A 1 11  ? 8.798   9.887   19.735  1.00 0.00 ? 11  LYS A CA   4  
ATOM 6611  C C    . LYS A 1 11  ? 8.550   10.762  20.965  1.00 0.00 ? 11  LYS A C    4  
ATOM 6612  O O    . LYS A 1 11  ? 7.788   10.386  21.855  1.00 0.00 ? 11  LYS A O    4  
ATOM 6613  C CB   . LYS A 1 11  ? 7.717   8.830   19.503  1.00 0.00 ? 11  LYS A CB   4  
ATOM 6614  C CG   . LYS A 1 11  ? 7.787   8.277   18.078  1.00 0.00 ? 11  LYS A CG   4  
ATOM 6615  C CD   . LYS A 1 11  ? 8.376   6.865   18.066  1.00 0.00 ? 11  LYS A CD   4  
ATOM 6616  C CE   . LYS A 1 11  ? 9.739   6.845   17.373  1.00 0.00 ? 11  LYS A CE   4  
ATOM 6617  N NZ   . LYS A 1 11  ? 9.924   5.579   16.629  1.00 0.00 ? 11  LYS A NZ   4  
ATOM 6618  H H    . LYS A 1 11  ? 10.117  8.392   20.337  1.00 0.00 ? 11  LYS A H    4  
ATOM 6619  H HA   . LYS A 1 11  ? 8.816   10.528  18.853  1.00 0.00 ? 11  LYS A HA   4  
ATOM 6620  H HB2  . LYS A 1 11  ? 7.838   8.017   20.219  1.00 0.00 ? 11  LYS A HB2  4  
ATOM 6621  H HB3  . LYS A 1 11  ? 6.733   9.265   19.680  1.00 0.00 ? 11  LYS A HB3  4  
ATOM 6622  H HG2  . LYS A 1 11  ? 6.789   8.262   17.641  1.00 0.00 ? 11  LYS A HG2  4  
ATOM 6623  H HG3  . LYS A 1 11  ? 8.397   8.934   17.459  1.00 0.00 ? 11  LYS A HG3  4  
ATOM 6624  H HD2  . LYS A 1 11  ? 8.479   6.501   19.089  1.00 0.00 ? 11  LYS A HD2  4  
ATOM 6625  H HD3  . LYS A 1 11  ? 7.693   6.187   17.554  1.00 0.00 ? 11  LYS A HD3  4  
ATOM 6626  H HE2  . LYS A 1 11  ? 9.818   7.691   16.689  1.00 0.00 ? 11  LYS A HE2  4  
ATOM 6627  H HE3  . LYS A 1 11  ? 10.532  6.958   18.112  1.00 0.00 ? 11  LYS A HE3  4  
ATOM 6628  H HZ1  . LYS A 1 11  ? 10.303  4.885   17.241  1.00 0.00 ? 11  LYS A HZ1  4  
ATOM 6629  H HZ2  . LYS A 1 11  ? 9.042   5.268   16.276  1.00 0.00 ? 11  LYS A HZ2  4  
ATOM 6630  H HZ3  . LYS A 1 11  ? 10.553  5.730   15.866  1.00 0.00 ? 11  LYS A HZ3  4  
ATOM 6631  N N    . ARG A 1 12  ? 9.206   11.913  20.976  1.00 0.00 ? 12  ARG A N    4  
ATOM 6632  C CA   . ARG A 1 12  ? 9.066   12.844  22.083  1.00 0.00 ? 12  ARG A CA   4  
ATOM 6633  C C    . ARG A 1 12  ? 8.925   14.274  21.559  1.00 0.00 ? 12  ARG A C    4  
ATOM 6634  O O    . ARG A 1 12  ? 9.919   14.920  21.231  1.00 0.00 ? 12  ARG A O    4  
ATOM 6635  C CB   . ARG A 1 12  ? 10.271  12.769  23.022  1.00 0.00 ? 12  ARG A CB   4  
ATOM 6636  C CG   . ARG A 1 12  ? 9.972   11.876  24.228  1.00 0.00 ? 12  ARG A CG   4  
ATOM 6637  C CD   . ARG A 1 12  ? 10.501  10.458  24.005  1.00 0.00 ? 12  ARG A CD   4  
ATOM 6638  N NE   . ARG A 1 12  ? 9.599   9.475   24.647  1.00 0.00 ? 12  ARG A NE   4  
ATOM 6639  C CZ   . ARG A 1 12  ? 9.909   8.186   24.840  1.00 0.00 ? 12  ARG A CZ   4  
ATOM 6640  N NH1  . ARG A 1 12  ? 11.099  7.716   24.442  1.00 0.00 ? 12  ARG A NH1  4  
ATOM 6641  N NH2  . ARG A 1 12  ? 9.029   7.366   25.431  1.00 0.00 ? 12  ARG A NH2  4  
ATOM 6642  H H    . ARG A 1 12  ? 9.824   12.211  20.249  1.00 0.00 ? 12  ARG A H    4  
ATOM 6643  H HA   . ARG A 1 12  ? 8.162   12.525  22.602  1.00 0.00 ? 12  ARG A HA   4  
ATOM 6644  H HB2  . ARG A 1 12  ? 11.134  12.379  22.482  1.00 0.00 ? 12  ARG A HB2  4  
ATOM 6645  H HB3  . ARG A 1 12  ? 10.535  13.770  23.362  1.00 0.00 ? 12  ARG A HB3  4  
ATOM 6646  H HG2  . ARG A 1 12  ? 10.428  12.302  25.122  1.00 0.00 ? 12  ARG A HG2  4  
ATOM 6647  H HG3  . ARG A 1 12  ? 8.897   11.844  24.404  1.00 0.00 ? 12  ARG A HG3  4  
ATOM 6648  H HD2  . ARG A 1 12  ? 10.576  10.252  22.938  1.00 0.00 ? 12  ARG A HD2  4  
ATOM 6649  H HD3  . ARG A 1 12  ? 11.505  10.366  24.419  1.00 0.00 ? 12  ARG A HD3  4  
ATOM 6650  H HE   . ARG A 1 12  ? 8.703   9.793   24.956  1.00 0.00 ? 12  ARG A HE   4  
ATOM 6651  H HH11 . ARG A 1 12  ? 11.756  8.327   24.001  1.00 0.00 ? 12  ARG A HH11 4  
ATOM 6652  H HH12 . ARG A 1 12  ? 11.330  6.753   24.586  1.00 0.00 ? 12  ARG A HH12 4  
ATOM 6653  H HH21 . ARG A 1 12  ? 8.141   7.717   25.728  1.00 0.00 ? 12  ARG A HH21 4  
ATOM 6654  H HH22 . ARG A 1 12  ? 9.260   6.404   25.575  1.00 0.00 ? 12  ARG A HH22 4  
ATOM 6655  N N    . MET A 1 13  ? 7.681   14.727  21.496  1.00 0.00 ? 13  MET A N    4  
ATOM 6656  C CA   . MET A 1 13  ? 7.397   16.069  21.017  1.00 0.00 ? 13  MET A CA   4  
ATOM 6657  C C    . MET A 1 13  ? 7.908   16.261  19.588  1.00 0.00 ? 13  MET A C    4  
ATOM 6658  O O    . MET A 1 13  ? 8.847   15.589  19.165  1.00 0.00 ? 13  MET A O    4  
ATOM 6659  C CB   . MET A 1 13  ? 8.064   17.092  21.939  1.00 0.00 ? 13  MET A CB   4  
ATOM 6660  C CG   . MET A 1 13  ? 7.324   17.192  23.274  1.00 0.00 ? 13  MET A CG   4  
ATOM 6661  S SD   . MET A 1 13  ? 7.882   18.627  24.177  1.00 0.00 ? 13  MET A SD   4  
ATOM 6662  C CE   . MET A 1 13  ? 6.726   19.844  23.571  1.00 0.00 ? 13  MET A CE   4  
ATOM 6663  H H    . MET A 1 13  ? 6.878   14.196  21.765  1.00 0.00 ? 13  MET A H    4  
ATOM 6664  H HA   . MET A 1 13  ? 6.312   16.164  21.038  1.00 0.00 ? 13  MET A HA   4  
ATOM 6665  H HB2  . MET A 1 13  ? 9.101   16.807  22.115  1.00 0.00 ? 13  MET A HB2  4  
ATOM 6666  H HB3  . MET A 1 13  ? 8.080   18.069  21.454  1.00 0.00 ? 13  MET A HB3  4  
ATOM 6667  H HG2  . MET A 1 13  ? 6.250   17.257  23.100  1.00 0.00 ? 13  MET A HG2  4  
ATOM 6668  H HG3  . MET A 1 13  ? 7.497   16.291  23.863  1.00 0.00 ? 13  MET A HG3  4  
ATOM 6669  H HE1  . MET A 1 13  ? 5.731   19.625  23.960  1.00 0.00 ? 13  MET A HE1  4  
ATOM 6670  H HE2  . MET A 1 13  ? 7.035   20.835  23.901  1.00 0.00 ? 13  MET A HE2  4  
ATOM 6671  H HE3  . MET A 1 13  ? 6.705   19.814  22.482  1.00 0.00 ? 13  MET A HE3  4  
ATOM 6672  N N    . LYS A 1 14  ? 7.267   17.182  18.883  1.00 0.00 ? 14  LYS A N    4  
ATOM 6673  C CA   . LYS A 1 14  ? 7.644   17.470  17.510  1.00 0.00 ? 14  LYS A CA   4  
ATOM 6674  C C    . LYS A 1 14  ? 9.166   17.595  17.419  1.00 0.00 ? 14  LYS A C    4  
ATOM 6675  O O    . LYS A 1 14  ? 9.799   18.171  18.302  1.00 0.00 ? 14  LYS A O    4  
ATOM 6676  C CB   . LYS A 1 14  ? 6.895   18.701  16.995  1.00 0.00 ? 14  LYS A CB   4  
ATOM 6677  C CG   . LYS A 1 14  ? 5.482   18.331  16.539  1.00 0.00 ? 14  LYS A CG   4  
ATOM 6678  C CD   . LYS A 1 14  ? 4.474   18.512  17.676  1.00 0.00 ? 14  LYS A CD   4  
ATOM 6679  C CE   . LYS A 1 14  ? 3.714   17.211  17.946  1.00 0.00 ? 14  LYS A CE   4  
ATOM 6680  N NZ   . LYS A 1 14  ? 2.794   17.378  19.093  1.00 0.00 ? 14  LYS A NZ   4  
ATOM 6681  H H    . LYS A 1 14  ? 6.504   17.724  19.234  1.00 0.00 ? 14  LYS A H    4  
ATOM 6682  H HA   . LYS A 1 14  ? 7.330   16.623  16.900  1.00 0.00 ? 14  LYS A HA   4  
ATOM 6683  H HB2  . LYS A 1 14  ? 6.841   19.454  17.781  1.00 0.00 ? 14  LYS A HB2  4  
ATOM 6684  H HB3  . LYS A 1 14  ? 7.444   19.145  16.165  1.00 0.00 ? 14  LYS A HB3  4  
ATOM 6685  H HG2  . LYS A 1 14  ? 5.195   18.954  15.691  1.00 0.00 ? 14  LYS A HG2  4  
ATOM 6686  H HG3  . LYS A 1 14  ? 5.466   17.297  16.194  1.00 0.00 ? 14  LYS A HG3  4  
ATOM 6687  H HD2  . LYS A 1 14  ? 4.993   18.828  18.580  1.00 0.00 ? 14  LYS A HD2  4  
ATOM 6688  H HD3  . LYS A 1 14  ? 3.769   19.303  17.419  1.00 0.00 ? 14  LYS A HD3  4  
ATOM 6689  H HE2  . LYS A 1 14  ? 3.150   16.922  17.059  1.00 0.00 ? 14  LYS A HE2  4  
ATOM 6690  H HE3  . LYS A 1 14  ? 4.419   16.407  18.151  1.00 0.00 ? 14  LYS A HE3  4  
ATOM 6691  H HZ1  . LYS A 1 14  ? 2.210   16.569  19.172  1.00 0.00 ? 14  LYS A HZ1  4  
ATOM 6692  H HZ2  . LYS A 1 14  ? 3.325   17.488  19.933  1.00 0.00 ? 14  LYS A HZ2  4  
ATOM 6693  H HZ3  . LYS A 1 14  ? 2.224   18.187  18.949  1.00 0.00 ? 14  LYS A HZ3  4  
ATOM 6694  N N    . LEU A 1 15  ? 9.710   17.045  16.343  1.00 0.00 ? 15  LEU A N    4  
ATOM 6695  C CA   . LEU A 1 15  ? 11.146  17.088  16.126  1.00 0.00 ? 15  LEU A CA   4  
ATOM 6696  C C    . LEU A 1 15  ? 11.428  17.196  14.626  1.00 0.00 ? 15  LEU A C    4  
ATOM 6697  O O    . LEU A 1 15  ? 11.725  16.197  13.973  1.00 0.00 ? 15  LEU A O    4  
ATOM 6698  C CB   . LEU A 1 15  ? 11.825  15.890  16.794  1.00 0.00 ? 15  LEU A CB   4  
ATOM 6699  C CG   . LEU A 1 15  ? 12.549  16.178  18.111  1.00 0.00 ? 15  LEU A CG   4  
ATOM 6700  C CD1  . LEU A 1 15  ? 12.961  14.878  18.805  1.00 0.00 ? 15  LEU A CD1  4  
ATOM 6701  C CD2  . LEU A 1 15  ? 13.741  17.111  17.888  1.00 0.00 ? 15  LEU A CD2  4  
ATOM 6702  H H    . LEU A 1 15  ? 9.188   16.578  15.630  1.00 0.00 ? 15  LEU A H    4  
ATOM 6703  H HA   . LEU A 1 15  ? 11.524  17.986  16.615  1.00 0.00 ? 15  LEU A HA   4  
ATOM 6704  H HB2  . LEU A 1 15  ? 11.070  15.125  16.977  1.00 0.00 ? 15  LEU A HB2  4  
ATOM 6705  H HB3  . LEU A 1 15  ? 12.543  15.467  16.092  1.00 0.00 ? 15  LEU A HB3  4  
ATOM 6706  H HG   . LEU A 1 15  ? 11.856  16.693  18.776  1.00 0.00 ? 15  LEU A HG   4  
ATOM 6707  H HD11 . LEU A 1 15  ? 13.967  14.601  18.491  1.00 0.00 ? 15  LEU A HD11 4  
ATOM 6708  H HD12 . LEU A 1 15  ? 12.944  15.022  19.886  1.00 0.00 ? 15  LEU A HD12 4  
ATOM 6709  H HD13 . LEU A 1 15  ? 12.264  14.085  18.534  1.00 0.00 ? 15  LEU A HD13 4  
ATOM 6710  H HD21 . LEU A 1 15  ? 13.385  18.072  17.515  1.00 0.00 ? 15  LEU A HD21 4  
ATOM 6711  H HD22 . LEU A 1 15  ? 14.267  17.260  18.831  1.00 0.00 ? 15  LEU A HD22 4  
ATOM 6712  H HD23 . LEU A 1 15  ? 14.419  16.667  17.160  1.00 0.00 ? 15  LEU A HD23 4  
ATOM 6713  N N    . THR A 1 16  ? 11.325  18.418  14.124  1.00 0.00 ? 16  THR A N    4  
ATOM 6714  C CA   . THR A 1 16  ? 11.564  18.670  12.713  1.00 0.00 ? 16  THR A CA   4  
ATOM 6715  C C    . THR A 1 16  ? 10.816  17.649  11.854  1.00 0.00 ? 16  THR A C    4  
ATOM 6716  O O    . THR A 1 16  ? 10.048  16.840  12.373  1.00 0.00 ? 16  THR A O    4  
ATOM 6717  C CB   . THR A 1 16  ? 13.077  18.666  12.483  1.00 0.00 ? 16  THR A CB   4  
ATOM 6718  O OG1  . THR A 1 16  ? 13.223  19.086  11.129  1.00 0.00 ? 16  THR A OG1  4  
ATOM 6719  C CG2  . THR A 1 16  ? 13.668  17.254  12.500  1.00 0.00 ? 16  THR A CG2  4  
ATOM 6720  H H    . THR A 1 16  ? 11.083  19.225  14.663  1.00 0.00 ? 16  THR A H    4  
ATOM 6721  H HA   . THR A 1 16  ? 11.161  19.652  12.467  1.00 0.00 ? 16  THR A HA   4  
ATOM 6722  H HB   . THR A 1 16  ? 13.582  19.308  13.203  1.00 0.00 ? 16  THR A HB   4  
ATOM 6723  H HG1  . THR A 1 16  ? 12.824  19.995  11.009  1.00 0.00 ? 16  THR A HG1  4  
ATOM 6724  H HG21 . THR A 1 16  ? 12.963  16.560  12.044  1.00 0.00 ? 16  THR A HG21 4  
ATOM 6725  H HG22 . THR A 1 16  ? 14.602  17.245  11.939  1.00 0.00 ? 16  THR A HG22 4  
ATOM 6726  H HG23 . THR A 1 16  ? 13.859  16.953  13.530  1.00 0.00 ? 16  THR A HG23 4  
ATOM 6727  N N    . LEU A 1 17  ? 11.066  17.720  10.555  1.00 0.00 ? 17  LEU A N    4  
ATOM 6728  C CA   . LEU A 1 17  ? 10.425  16.812  9.619   1.00 0.00 ? 17  LEU A CA   4  
ATOM 6729  C C    . LEU A 1 17  ? 11.299  15.568  9.443   1.00 0.00 ? 17  LEU A C    4  
ATOM 6730  O O    . LEU A 1 17  ? 12.337  15.623  8.786   1.00 0.00 ? 17  LEU A O    4  
ATOM 6731  C CB   . LEU A 1 17  ? 10.107  17.531  8.307   1.00 0.00 ? 17  LEU A CB   4  
ATOM 6732  C CG   . LEU A 1 17  ? 8.716   18.160  8.207   1.00 0.00 ? 17  LEU A CG   4  
ATOM 6733  C CD1  . LEU A 1 17  ? 8.634   19.445  9.034   1.00 0.00 ? 17  LEU A CD1  4  
ATOM 6734  C CD2  . LEU A 1 17  ? 8.323   18.393  6.746   1.00 0.00 ? 17  LEU A CD2  4  
ATOM 6735  H H    . LEU A 1 17  ? 11.692  18.381  10.141  1.00 0.00 ? 17  LEU A H    4  
ATOM 6736  H HA   . LEU A 1 17  ? 9.475   16.507  10.058  1.00 0.00 ? 17  LEU A HA   4  
ATOM 6737  H HB2  . LEU A 1 17  ? 10.850  18.315  8.156   1.00 0.00 ? 17  LEU A HB2  4  
ATOM 6738  H HB3  . LEU A 1 17  ? 10.222  16.820  7.489   1.00 0.00 ? 17  LEU A HB3  4  
ATOM 6739  H HG   . LEU A 1 17  ? 7.994   17.461  8.627   1.00 0.00 ? 17  LEU A HG   4  
ATOM 6740  H HD11 . LEU A 1 17  ? 9.108   20.260  8.486   1.00 0.00 ? 17  LEU A HD11 4  
ATOM 6741  H HD12 . LEU A 1 17  ? 7.589   19.691  9.220   1.00 0.00 ? 17  LEU A HD12 4  
ATOM 6742  H HD13 . LEU A 1 17  ? 9.148   19.299  9.984   1.00 0.00 ? 17  LEU A HD13 4  
ATOM 6743  H HD21 . LEU A 1 17  ? 7.680   19.270  6.678   1.00 0.00 ? 17  LEU A HD21 4  
ATOM 6744  H HD22 . LEU A 1 17  ? 9.221   18.552  6.150   1.00 0.00 ? 17  LEU A HD22 4  
ATOM 6745  H HD23 . LEU A 1 17  ? 7.788   17.520  6.371   1.00 0.00 ? 17  LEU A HD23 4  
ATOM 6746  N N    . LYS A 1 18  ? 10.845  14.476  10.040  1.00 0.00 ? 18  LYS A N    4  
ATOM 6747  C CA   . LYS A 1 18  ? 11.572  13.221  9.957   1.00 0.00 ? 18  LYS A CA   4  
ATOM 6748  C C    . LYS A 1 18  ? 10.620  12.063  10.263  1.00 0.00 ? 18  LYS A C    4  
ATOM 6749  O O    . LYS A 1 18  ? 9.972   12.047  11.308  1.00 0.00 ? 18  LYS A O    4  
ATOM 6750  C CB   . LYS A 1 18  ? 12.807  13.256  10.860  1.00 0.00 ? 18  LYS A CB   4  
ATOM 6751  C CG   . LYS A 1 18  ? 14.088  13.076  10.044  1.00 0.00 ? 18  LYS A CG   4  
ATOM 6752  C CD   . LYS A 1 18  ? 14.485  11.600  9.964   1.00 0.00 ? 18  LYS A CD   4  
ATOM 6753  C CE   . LYS A 1 18  ? 15.228  11.302  8.660   1.00 0.00 ? 18  LYS A CE   4  
ATOM 6754  N NZ   . LYS A 1 18  ? 16.673  11.587  8.811   1.00 0.00 ? 18  LYS A NZ   4  
ATOM 6755  H H    . LYS A 1 18  ? 9.999   14.440  10.572  1.00 0.00 ? 18  LYS A H    4  
ATOM 6756  H HA   . LYS A 1 18  ? 11.926  13.115  8.931   1.00 0.00 ? 18  LYS A HA   4  
ATOM 6757  H HB2  . LYS A 1 18  ? 12.843  14.204  11.396  1.00 0.00 ? 18  LYS A HB2  4  
ATOM 6758  H HB3  . LYS A 1 18  ? 12.736  12.469  11.610  1.00 0.00 ? 18  LYS A HB3  4  
ATOM 6759  H HG2  . LYS A 1 18  ? 13.942  13.472  9.039   1.00 0.00 ? 18  LYS A HG2  4  
ATOM 6760  H HG3  . LYS A 1 18  ? 14.897  13.649  10.498  1.00 0.00 ? 18  LYS A HG3  4  
ATOM 6761  H HD2  . LYS A 1 18  ? 15.116  11.343  10.814  1.00 0.00 ? 18  LYS A HD2  4  
ATOM 6762  H HD3  . LYS A 1 18  ? 13.593  10.976  10.029  1.00 0.00 ? 18  LYS A HD3  4  
ATOM 6763  H HE2  . LYS A 1 18  ? 15.084  10.258  8.384   1.00 0.00 ? 18  LYS A HE2  4  
ATOM 6764  H HE3  . LYS A 1 18  ? 14.815  11.906  7.853   1.00 0.00 ? 18  LYS A HE3  4  
ATOM 6765  H HZ1  . LYS A 1 18  ? 16.802  12.298  9.502   1.00 0.00 ? 18  LYS A HZ1  4  
ATOM 6766  H HZ2  . LYS A 1 18  ? 17.149  10.755  9.096   1.00 0.00 ? 18  LYS A HZ2  4  
ATOM 6767  H HZ3  . LYS A 1 18  ? 17.044  11.900  7.937   1.00 0.00 ? 18  LYS A HZ3  4  
ATOM 6768  N N    . GLY A 1 19  ? 10.565  11.122  9.331   1.00 0.00 ? 19  GLY A N    4  
ATOM 6769  C CA   . GLY A 1 19  ? 9.702   9.964   9.488   1.00 0.00 ? 19  GLY A CA   4  
ATOM 6770  C C    . GLY A 1 19  ? 8.541   10.006  8.493   1.00 0.00 ? 19  GLY A C    4  
ATOM 6771  O O    . GLY A 1 19  ? 8.126   11.081  8.063   1.00 0.00 ? 19  GLY A O    4  
ATOM 6772  H H    . GLY A 1 19  ? 11.095  11.143  8.484   1.00 0.00 ? 19  GLY A H    4  
ATOM 6773  H HA2  . GLY A 1 19  ? 10.281  9.052   9.339   1.00 0.00 ? 19  GLY A HA2  4  
ATOM 6774  H HA3  . GLY A 1 19  ? 9.313   9.931   10.506  1.00 0.00 ? 19  GLY A HA3  4  
ATOM 6775  N N    . GLY A 1 20  ? 8.049   8.822   8.156   1.00 0.00 ? 20  GLY A N    4  
ATOM 6776  C CA   . GLY A 1 20  ? 6.944   8.710   7.219   1.00 0.00 ? 20  GLY A CA   4  
ATOM 6777  C C    . GLY A 1 20  ? 5.654   8.310   7.938   1.00 0.00 ? 20  GLY A C    4  
ATOM 6778  O O    . GLY A 1 20  ? 5.466   8.635   9.110   1.00 0.00 ? 20  GLY A O    4  
ATOM 6779  H H    . GLY A 1 20  ? 8.393   7.953   8.510   1.00 0.00 ? 20  GLY A H    4  
ATOM 6780  H HA2  . GLY A 1 20  ? 6.799   9.662   6.707   1.00 0.00 ? 20  GLY A HA2  4  
ATOM 6781  H HA3  . GLY A 1 20  ? 7.184   7.971   6.455   1.00 0.00 ? 20  GLY A HA3  4  
ATOM 6782  N N    . ALA A 1 21  ? 4.799   7.611   7.207   1.00 0.00 ? 21  ALA A N    4  
ATOM 6783  C CA   . ALA A 1 21  ? 3.532   7.163   7.760   1.00 0.00 ? 21  ALA A CA   4  
ATOM 6784  C C    . ALA A 1 21  ? 3.785   6.007   8.729   1.00 0.00 ? 21  ALA A C    4  
ATOM 6785  O O    . ALA A 1 21  ? 4.865   5.419   8.732   1.00 0.00 ? 21  ALA A O    4  
ATOM 6786  C CB   . ALA A 1 21  ? 2.587   6.775   6.622   1.00 0.00 ? 21  ALA A CB   4  
ATOM 6787  H H    . ALA A 1 21  ? 4.960   7.351   6.254   1.00 0.00 ? 21  ALA A H    4  
ATOM 6788  H HA   . ALA A 1 21  ? 3.097   7.998   8.309   1.00 0.00 ? 21  ALA A HA   4  
ATOM 6789  H HB1  . ALA A 1 21  ? 3.065   6.024   5.992   1.00 0.00 ? 21  ALA A HB1  4  
ATOM 6790  H HB2  . ALA A 1 21  ? 1.666   6.367   7.038   1.00 0.00 ? 21  ALA A HB2  4  
ATOM 6791  H HB3  . ALA A 1 21  ? 2.356   7.657   6.024   1.00 0.00 ? 21  ALA A HB3  4  
ATOM 6792  N N    . ALA A 1 22  ? 2.769   5.714   9.528   1.00 0.00 ? 22  ALA A N    4  
ATOM 6793  C CA   . ALA A 1 22  ? 2.867   4.638   10.500  1.00 0.00 ? 22  ALA A CA   4  
ATOM 6794  C C    . ALA A 1 22  ? 2.656   3.298   9.793   1.00 0.00 ? 22  ALA A C    4  
ATOM 6795  O O    . ALA A 1 22  ? 1.861   3.203   8.859   1.00 0.00 ? 22  ALA A O    4  
ATOM 6796  C CB   . ALA A 1 22  ? 1.855   4.871   11.624  1.00 0.00 ? 22  ALA A CB   4  
ATOM 6797  H H    . ALA A 1 22  ? 1.894   6.197   9.520   1.00 0.00 ? 22  ALA A H    4  
ATOM 6798  H HA   . ALA A 1 22  ? 3.872   4.663   10.922  1.00 0.00 ? 22  ALA A HA   4  
ATOM 6799  H HB1  . ALA A 1 22  ? 0.857   4.970   11.198  1.00 0.00 ? 22  ALA A HB1  4  
ATOM 6800  H HB2  . ALA A 1 22  ? 1.875   4.025   12.311  1.00 0.00 ? 22  ALA A HB2  4  
ATOM 6801  H HB3  . ALA A 1 22  ? 2.114   5.783   12.162  1.00 0.00 ? 22  ALA A HB3  4  
ATOM 6802  N N    . VAL A 1 23  ? 3.382   2.295   10.265  1.00 0.00 ? 23  VAL A N    4  
ATOM 6803  C CA   . VAL A 1 23  ? 3.284   0.964   9.690   1.00 0.00 ? 23  VAL A CA   4  
ATOM 6804  C C    . VAL A 1 23  ? 2.285   0.136   10.501  1.00 0.00 ? 23  VAL A C    4  
ATOM 6805  O O    . VAL A 1 23  ? 2.051   0.415   11.675  1.00 0.00 ? 23  VAL A O    4  
ATOM 6806  C CB   . VAL A 1 23  ? 4.671   0.323   9.614   1.00 0.00 ? 23  VAL A CB   4  
ATOM 6807  C CG1  . VAL A 1 23  ? 4.566   -1.183  9.369   1.00 0.00 ? 23  VAL A CG1  4  
ATOM 6808  C CG2  . VAL A 1 23  ? 5.528   0.996   8.540   1.00 0.00 ? 23  VAL A CG2  4  
ATOM 6809  H H    . VAL A 1 23  ? 4.026   2.381   11.025  1.00 0.00 ? 23  VAL A H    4  
ATOM 6810  H HA   . VAL A 1 23  ? 2.906   1.073   8.673   1.00 0.00 ? 23  VAL A HA   4  
ATOM 6811  H HB   . VAL A 1 23  ? 5.162   0.473   10.576  1.00 0.00 ? 23  VAL A HB   4  
ATOM 6812  H HG11 . VAL A 1 23  ? 3.948   -1.366  8.489   1.00 0.00 ? 23  VAL A HG11 4  
ATOM 6813  H HG12 . VAL A 1 23  ? 5.562   -1.595  9.206   1.00 0.00 ? 23  VAL A HG12 4  
ATOM 6814  H HG13 . VAL A 1 23  ? 4.112   -1.662  10.237  1.00 0.00 ? 23  VAL A HG13 4  
ATOM 6815  H HG21 . VAL A 1 23  ? 5.821   1.989   8.878   1.00 0.00 ? 23  VAL A HG21 4  
ATOM 6816  H HG22 . VAL A 1 23  ? 6.419   0.396   8.358   1.00 0.00 ? 23  VAL A HG22 4  
ATOM 6817  H HG23 . VAL A 1 23  ? 4.953   1.081   7.617   1.00 0.00 ? 23  VAL A HG23 4  
ATOM 6818  N N    . ASP A 1 24  ? 1.724   -0.867  9.841   1.00 0.00 ? 24  ASP A N    4  
ATOM 6819  C CA   . ASP A 1 24  ? 0.757   -1.739  10.486  1.00 0.00 ? 24  ASP A CA   4  
ATOM 6820  C C    . ASP A 1 24  ? 1.496   -2.771  11.340  1.00 0.00 ? 24  ASP A C    4  
ATOM 6821  O O    . ASP A 1 24  ? 2.551   -3.265  10.947  1.00 0.00 ? 24  ASP A O    4  
ATOM 6822  C CB   . ASP A 1 24  ? -0.080  -2.493  9.451   1.00 0.00 ? 24  ASP A CB   4  
ATOM 6823  C CG   . ASP A 1 24  ? -1.529  -2.018  9.320   1.00 0.00 ? 24  ASP A CG   4  
ATOM 6824  O OD1  . ASP A 1 24  ? -1.745  -0.800  9.500   1.00 0.00 ? 24  ASP A OD1  4  
ATOM 6825  O OD2  . ASP A 1 24  ? -2.387  -2.883  9.042   1.00 0.00 ? 24  ASP A OD2  4  
ATOM 6826  H H    . ASP A 1 24  ? 1.921   -1.088  8.886   1.00 0.00 ? 24  ASP A H    4  
ATOM 6827  H HA   . ASP A 1 24  ? 0.128   -1.077  11.082  1.00 0.00 ? 24  ASP A HA   4  
ATOM 6828  H HB2  . ASP A 1 24  ? 0.405   -2.405  8.479   1.00 0.00 ? 24  ASP A HB2  4  
ATOM 6829  H HB3  . ASP A 1 24  ? -0.083  -3.552  9.710   1.00 0.00 ? 24  ASP A HB3  4  
ATOM 6830  N N    . PRO A 1 25  ? 0.896   -3.074  12.522  1.00 0.00 ? 25  PRO A N    4  
ATOM 6831  C CA   . PRO A 1 25  ? 1.486   -4.038  13.435  1.00 0.00 ? 25  PRO A CA   4  
ATOM 6832  C C    . PRO A 1 25  ? 1.285   -5.467  12.927  1.00 0.00 ? 25  PRO A C    4  
ATOM 6833  O O    . PRO A 1 25  ? 2.007   -6.379  13.327  1.00 0.00 ? 25  PRO A O    4  
ATOM 6834  C CB   . PRO A 1 25  ? 0.808   -3.781  14.771  1.00 0.00 ? 25  PRO A CB   4  
ATOM 6835  C CG   . PRO A 1 25  ? -0.460  -3.005  14.452  1.00 0.00 ? 25  PRO A CG   4  
ATOM 6836  C CD   . PRO A 1 25  ? -0.355  -2.508  13.020  1.00 0.00 ? 25  PRO A CD   4  
ATOM 6837  H HA   . PRO A 1 25  ? 2.476   -3.904  13.490  1.00 0.00 ? 25  PRO A HA   4  
ATOM 6838  H HB2  . PRO A 1 25  ? 0.576   -4.718  15.277  1.00 0.00 ? 25  PRO A HB2  4  
ATOM 6839  H HB3  . PRO A 1 25  ? 1.458   -3.212  15.436  1.00 0.00 ? 25  PRO A HB3  4  
ATOM 6840  H HG2  . PRO A 1 25  ? -1.337  -3.641  14.572  1.00 0.00 ? 25  PRO A HG2  4  
ATOM 6841  H HG3  . PRO A 1 25  ? -0.577  -2.167  15.140  1.00 0.00 ? 25  PRO A HG3  4  
ATOM 6842  H HD2  . PRO A 1 25  ? -1.204  -2.839  12.422  1.00 0.00 ? 25  PRO A HD2  4  
ATOM 6843  H HD3  . PRO A 1 25  ? -0.341  -1.419  12.979  1.00 0.00 ? 25  PRO A HD3  4  
ATOM 6844  N N    . ASP A 1 26  ? 0.300   -5.618  12.054  1.00 0.00 ? 26  ASP A N    4  
ATOM 6845  C CA   . ASP A 1 26  ? -0.005  -6.921  11.487  1.00 0.00 ? 26  ASP A CA   4  
ATOM 6846  C C    . ASP A 1 26  ? 1.075   -7.295  10.470  1.00 0.00 ? 26  ASP A C    4  
ATOM 6847  O O    . ASP A 1 26  ? 1.194   -8.458  10.086  1.00 0.00 ? 26  ASP A O    4  
ATOM 6848  C CB   . ASP A 1 26  ? -1.352  -6.905  10.763  1.00 0.00 ? 26  ASP A CB   4  
ATOM 6849  C CG   . ASP A 1 26  ? -2.454  -7.732  11.429  1.00 0.00 ? 26  ASP A CG   4  
ATOM 6850  O OD1  . ASP A 1 26  ? -2.214  -8.943  11.627  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 6851  O OD2  . ASP A 1 26  ? -3.512  -7.135  11.725  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 6852  H H    . ASP A 1 26  ? -0.282  -4.871  11.734  1.00 0.00 ? 26  ASP A H    4  
ATOM 6853  H HA   . ASP A 1 26  ? -0.031  -7.603  12.337  1.00 0.00 ? 26  ASP A HA   4  
ATOM 6854  H HB2  . ASP A 1 26  ? -1.692  -5.872  10.683  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 6855  H HB3  . ASP A 1 26  ? -1.206  -7.272  9.747   1.00 0.00 ? 26  ASP A HB3  4  
ATOM 6856  N N    . SER A 1 27  ? 1.833   -6.288  10.062  1.00 0.00 ? 27  SER A N    4  
ATOM 6857  C CA   . SER A 1 27  ? 2.899   -6.497  9.096   1.00 0.00 ? 27  SER A CA   4  
ATOM 6858  C C    . SER A 1 27  ? 4.135   -7.066  9.796   1.00 0.00 ? 27  SER A C    4  
ATOM 6859  O O    . SER A 1 27  ? 4.898   -7.822  9.197   1.00 0.00 ? 27  SER A O    4  
ATOM 6860  C CB   . SER A 1 27  ? 3.250   -5.195  8.374   1.00 0.00 ? 27  SER A CB   4  
ATOM 6861  O OG   . SER A 1 27  ? 4.000   -4.311  9.202   1.00 0.00 ? 27  SER A OG   4  
ATOM 6862  H H    . SER A 1 27  ? 1.729   -5.346  10.379  1.00 0.00 ? 27  SER A H    4  
ATOM 6863  H HA   . SER A 1 27  ? 2.501   -7.214  8.378   1.00 0.00 ? 27  SER A HA   4  
ATOM 6864  H HB2  . SER A 1 27  ? 3.822   -5.423  7.475   1.00 0.00 ? 27  SER A HB2  4  
ATOM 6865  H HB3  . SER A 1 27  ? 2.334   -4.700  8.052   1.00 0.00 ? 27  SER A HB3  4  
ATOM 6866  H HG   . SER A 1 27  ? 3.552   -3.418  9.243   1.00 0.00 ? 27  SER A HG   4  
ATOM 6867  N N    . GLY A 1 28  ? 4.293   -6.682  11.053  1.00 0.00 ? 28  GLY A N    4  
ATOM 6868  C CA   . GLY A 1 28  ? 5.424   -7.145  11.841  1.00 0.00 ? 28  GLY A CA   4  
ATOM 6869  C C    . GLY A 1 28  ? 6.623   -6.208  11.681  1.00 0.00 ? 28  GLY A C    4  
ATOM 6870  O O    . GLY A 1 28  ? 7.546   -6.232  12.494  1.00 0.00 ? 28  GLY A O    4  
ATOM 6871  H H    . GLY A 1 28  ? 3.668   -6.067  11.533  1.00 0.00 ? 28  GLY A H    4  
ATOM 6872  H HA2  . GLY A 1 28  ? 5.140   -7.203  12.891  1.00 0.00 ? 28  GLY A HA2  4  
ATOM 6873  H HA3  . GLY A 1 28  ? 5.700   -8.152  11.529  1.00 0.00 ? 28  GLY A HA3  4  
ATOM 6874  N N    . LEU A 1 29  ? 6.570   -5.405  10.629  1.00 0.00 ? 29  LEU A N    4  
ATOM 6875  C CA   . LEU A 1 29  ? 7.641   -4.462  10.352  1.00 0.00 ? 29  LEU A CA   4  
ATOM 6876  C C    . LEU A 1 29  ? 7.259   -3.088  10.905  1.00 0.00 ? 29  LEU A C    4  
ATOM 6877  O O    . LEU A 1 29  ? 7.852   -2.077  10.530  1.00 0.00 ? 29  LEU A O    4  
ATOM 6878  C CB   . LEU A 1 29  ? 7.975   -4.453  8.859   1.00 0.00 ? 29  LEU A CB   4  
ATOM 6879  C CG   . LEU A 1 29  ? 7.959   -5.814  8.160   1.00 0.00 ? 29  LEU A CG   4  
ATOM 6880  C CD1  . LEU A 1 29  ? 8.228   -6.945  9.155   1.00 0.00 ? 29  LEU A CD1  4  
ATOM 6881  C CD2  . LEU A 1 29  ? 6.650   -6.023  7.396   1.00 0.00 ? 29  LEU A CD2  4  
ATOM 6882  H H    . LEU A 1 29  ? 5.816   -5.392  9.972   1.00 0.00 ? 29  LEU A H    4  
ATOM 6883  H HA   . LEU A 1 29  ? 8.528   -4.812  10.879  1.00 0.00 ? 29  LEU A HA   4  
ATOM 6884  H HB2  . LEU A 1 29  ? 7.266   -3.798  8.353   1.00 0.00 ? 29  LEU A HB2  4  
ATOM 6885  H HB3  . LEU A 1 29  ? 8.964   -4.013  8.731   1.00 0.00 ? 29  LEU A HB3  4  
ATOM 6886  H HG   . LEU A 1 29  ? 8.766   -5.831  7.428   1.00 0.00 ? 29  LEU A HG   4  
ATOM 6887  H HD11 . LEU A 1 29  ? 8.860   -6.575  9.963   1.00 0.00 ? 29  LEU A HD11 4  
ATOM 6888  H HD12 . LEU A 1 29  ? 7.283   -7.300  9.566   1.00 0.00 ? 29  LEU A HD12 4  
ATOM 6889  H HD13 . LEU A 1 29  ? 8.734   -7.765  8.645   1.00 0.00 ? 29  LEU A HD13 4  
ATOM 6890  H HD21 . LEU A 1 29  ? 6.348   -7.067  7.472   1.00 0.00 ? 29  LEU A HD21 4  
ATOM 6891  H HD22 . LEU A 1 29  ? 5.875   -5.388  7.824   1.00 0.00 ? 29  LEU A HD22 4  
ATOM 6892  H HD23 . LEU A 1 29  ? 6.796   -5.762  6.348   1.00 0.00 ? 29  LEU A HD23 4  
ATOM 6893  N N    . GLU A 1 30  ? 6.272   -3.094  11.789  1.00 0.00 ? 30  GLU A N    4  
ATOM 6894  C CA   . GLU A 1 30  ? 5.804   -1.860  12.397  1.00 0.00 ? 30  GLU A CA   4  
ATOM 6895  C C    . GLU A 1 30  ? 6.927   -1.208  13.206  1.00 0.00 ? 30  GLU A C    4  
ATOM 6896  O O    . GLU A 1 30  ? 6.964   0.013   13.352  1.00 0.00 ? 30  GLU A O    4  
ATOM 6897  C CB   . GLU A 1 30  ? 4.573   -2.111  13.271  1.00 0.00 ? 30  GLU A CB   4  
ATOM 6898  C CG   . GLU A 1 30  ? 4.802   -3.296  14.212  1.00 0.00 ? 30  GLU A CG   4  
ATOM 6899  C CD   . GLU A 1 30  ? 4.082   -3.083  15.545  1.00 0.00 ? 30  GLU A CD   4  
ATOM 6900  O OE1  . GLU A 1 30  ? 3.449   -2.015  15.684  1.00 0.00 ? 30  GLU A OE1  4  
ATOM 6901  O OE2  . GLU A 1 30  ? 4.182   -3.994  16.395  1.00 0.00 ? 30  GLU A OE2  4  
ATOM 6902  H H    . GLU A 1 30  ? 5.795   -3.920  12.088  1.00 0.00 ? 30  GLU A H    4  
ATOM 6903  H HA   . GLU A 1 30  ? 5.525   -1.214  11.564  1.00 0.00 ? 30  GLU A HA   4  
ATOM 6904  H HB2  . GLU A 1 30  ? 4.347   -1.218  13.853  1.00 0.00 ? 30  GLU A HB2  4  
ATOM 6905  H HB3  . GLU A 1 30  ? 3.708   -2.307  12.638  1.00 0.00 ? 30  GLU A HB3  4  
ATOM 6906  H HG2  . GLU A 1 30  ? 4.443   -4.212  13.743  1.00 0.00 ? 30  GLU A HG2  4  
ATOM 6907  H HG3  . GLU A 1 30  ? 5.870   -3.425  14.387  1.00 0.00 ? 30  GLU A HG3  4  
ATOM 6908  N N    . HIS A 1 31  ? 7.815   -2.052  13.711  1.00 0.00 ? 31  HIS A N    4  
ATOM 6909  C CA   . HIS A 1 31  ? 8.936   -1.573  14.502  1.00 0.00 ? 31  HIS A CA   4  
ATOM 6910  C C    . HIS A 1 31  ? 10.249  -1.960  13.819  1.00 0.00 ? 31  HIS A C    4  
ATOM 6911  O O    . HIS A 1 31  ? 11.319  -1.853  14.416  1.00 0.00 ? 31  HIS A O    4  
ATOM 6912  C CB   . HIS A 1 31  ? 8.844   -2.085  15.941  1.00 0.00 ? 31  HIS A CB   4  
ATOM 6913  C CG   . HIS A 1 31  ? 8.429   -3.532  16.053  1.00 0.00 ? 31  HIS A CG   4  
ATOM 6914  N ND1  . HIS A 1 31  ? 8.676   -4.462  15.058  1.00 0.00 ? 31  HIS A ND1  4  
ATOM 6915  C CD2  . HIS A 1 31  ? 7.784   -4.200  17.052  1.00 0.00 ? 31  HIS A CD2  4  
ATOM 6916  C CE1  . HIS A 1 31  ? 8.196   -5.633  15.450  1.00 0.00 ? 31  HIS A CE1  4  
ATOM 6917  N NE2  . HIS A 1 31  ? 7.642   -5.468  16.686  1.00 0.00 ? 31  HIS A NE2  4  
ATOM 6918  H H    . HIS A 1 31  ? 7.778   -3.043  13.588  1.00 0.00 ? 31  HIS A H    4  
ATOM 6919  H HA   . HIS A 1 31  ? 8.858   -0.486  14.530  1.00 0.00 ? 31  HIS A HA   4  
ATOM 6920  H HB2  . HIS A 1 31  ? 9.812   -1.956  16.425  1.00 0.00 ? 31  HIS A HB2  4  
ATOM 6921  H HB3  . HIS A 1 31  ? 8.130   -1.470  16.489  1.00 0.00 ? 31  HIS A HB3  4  
ATOM 6922  H HD1  . HIS A 1 31  ? 9.139   -4.281  14.190  1.00 0.00 ? 31  HIS A HD1  4  
ATOM 6923  H HD2  . HIS A 1 31  ? 7.441   -3.766  17.991  1.00 0.00 ? 31  HIS A HD2  4  
ATOM 6924  H HE1  . HIS A 1 31  ? 8.236   -6.564  14.885  1.00 0.00 ? 31  HIS A HE1  4  
ATOM 6925  N N    . SER A 1 32  ? 10.124  -2.403  12.576  1.00 0.00 ? 32  SER A N    4  
ATOM 6926  C CA   . SER A 1 32  ? 11.287  -2.807  11.805  1.00 0.00 ? 32  SER A CA   4  
ATOM 6927  C C    . SER A 1 32  ? 11.376  -1.980  10.520  1.00 0.00 ? 32  SER A C    4  
ATOM 6928  O O    . SER A 1 32  ? 12.380  -1.313  10.276  1.00 0.00 ? 32  SER A O    4  
ATOM 6929  C CB   . SER A 1 32  ? 11.237  -4.299  11.473  1.00 0.00 ? 32  SER A CB   4  
ATOM 6930  O OG   . SER A 1 32  ? 12.531  -4.895  11.494  1.00 0.00 ? 32  SER A OG   4  
ATOM 6931  H H    . SER A 1 32  ? 9.250   -2.487  12.098  1.00 0.00 ? 32  SER A H    4  
ATOM 6932  H HA   . SER A 1 32  ? 12.144  -2.607  12.449  1.00 0.00 ? 32  SER A HA   4  
ATOM 6933  H HB2  . SER A 1 32  ? 10.592  -4.809  12.189  1.00 0.00 ? 32  SER A HB2  4  
ATOM 6934  H HB3  . SER A 1 32  ? 10.791  -4.437  10.488  1.00 0.00 ? 32  SER A HB3  4  
ATOM 6935  H HG   . SER A 1 32  ? 13.155  -4.339  12.044  1.00 0.00 ? 32  SER A HG   4  
ATOM 6936  N N    . ALA A 1 33  ? 10.313  -2.052  9.734   1.00 0.00 ? 33  ALA A N    4  
ATOM 6937  C CA   . ALA A 1 33  ? 10.258  -1.319  8.480   1.00 0.00 ? 33  ALA A CA   4  
ATOM 6938  C C    . ALA A 1 33  ? 9.342   -0.104  8.644   1.00 0.00 ? 33  ALA A C    4  
ATOM 6939  O O    . ALA A 1 33  ? 8.628   0.009   9.640   1.00 0.00 ? 33  ALA A O    4  
ATOM 6940  C CB   . ALA A 1 33  ? 9.793   -2.253  7.362   1.00 0.00 ? 33  ALA A CB   4  
ATOM 6941  H H    . ALA A 1 33  ? 9.500   -2.597  9.940   1.00 0.00 ? 33  ALA A H    4  
ATOM 6942  H HA   . ALA A 1 33  ? 11.267  -0.974  8.253   1.00 0.00 ? 33  ALA A HA   4  
ATOM 6943  H HB1  . ALA A 1 33  ? 9.960   -1.775  6.396   1.00 0.00 ? 33  ALA A HB1  4  
ATOM 6944  H HB2  . ALA A 1 33  ? 10.358  -3.184  7.408   1.00 0.00 ? 33  ALA A HB2  4  
ATOM 6945  H HB3  . ALA A 1 33  ? 8.731   -2.466  7.484   1.00 0.00 ? 33  ALA A HB3  4  
ATOM 6946  N N    . HIS A 1 34  ? 9.392   0.773   7.653   1.00 0.00 ? 34  HIS A N    4  
ATOM 6947  C CA   . HIS A 1 34  ? 8.575   1.974   7.675   1.00 0.00 ? 34  HIS A CA   4  
ATOM 6948  C C    . HIS A 1 34  ? 7.906   2.165   6.312   1.00 0.00 ? 34  HIS A C    4  
ATOM 6949  O O    . HIS A 1 34  ? 8.378   1.638   5.306   1.00 0.00 ? 34  HIS A O    4  
ATOM 6950  C CB   . HIS A 1 34  ? 9.404   3.187   8.103   1.00 0.00 ? 34  HIS A CB   4  
ATOM 6951  C CG   . HIS A 1 34  ? 10.674  3.375   7.307   1.00 0.00 ? 34  HIS A CG   4  
ATOM 6952  N ND1  . HIS A 1 34  ? 11.925  3.056   7.806   1.00 0.00 ? 34  HIS A ND1  4  
ATOM 6953  C CD2  . HIS A 1 34  ? 10.872  3.850   6.044   1.00 0.00 ? 34  HIS A CD2  4  
ATOM 6954  C CE1  . HIS A 1 34  ? 12.828  3.332   6.877   1.00 0.00 ? 34  HIS A CE1  4  
ATOM 6955  N NE2  . HIS A 1 34  ? 12.174  3.824   5.786   1.00 0.00 ? 34  HIS A NE2  4  
ATOM 6956  H H    . HIS A 1 34  ? 9.975   0.673   6.847   1.00 0.00 ? 34  HIS A H    4  
ATOM 6957  H HA   . HIS A 1 34  ? 7.805   1.815   8.429   1.00 0.00 ? 34  HIS A HA   4  
ATOM 6958  H HB2  . HIS A 1 34  ? 8.792   4.084   8.008   1.00 0.00 ? 34  HIS A HB2  4  
ATOM 6959  H HB3  . HIS A 1 34  ? 9.660   3.085   9.157   1.00 0.00 ? 34  HIS A HB3  4  
ATOM 6960  H HD1  . HIS A 1 34  ? 12.115  2.681   8.714   1.00 0.00 ? 34  HIS A HD1  4  
ATOM 6961  H HD2  . HIS A 1 34  ? 10.094  4.192   5.363   1.00 0.00 ? 34  HIS A HD2  4  
ATOM 6962  H HE1  . HIS A 1 34  ? 13.905  3.191   6.969   1.00 0.00 ? 34  HIS A HE1  4  
ATOM 6963  N N    . VAL A 1 35  ? 6.817   2.919   6.324   1.00 0.00 ? 35  VAL A N    4  
ATOM 6964  C CA   . VAL A 1 35  ? 6.078   3.186   5.102   1.00 0.00 ? 35  VAL A CA   4  
ATOM 6965  C C    . VAL A 1 35  ? 7.039   3.711   4.034   1.00 0.00 ? 35  VAL A C    4  
ATOM 6966  O O    . VAL A 1 35  ? 7.660   4.758   4.213   1.00 0.00 ? 35  VAL A O    4  
ATOM 6967  C CB   . VAL A 1 35  ? 4.921   4.145   5.388   1.00 0.00 ? 35  VAL A CB   4  
ATOM 6968  C CG1  . VAL A 1 35  ? 4.151   4.474   4.108   1.00 0.00 ? 35  VAL A CG1  4  
ATOM 6969  C CG2  . VAL A 1 35  ? 3.988   3.575   6.458   1.00 0.00 ? 35  VAL A CG2  4  
ATOM 6970  H H    . VAL A 1 35  ? 6.440   3.344   7.147   1.00 0.00 ? 35  VAL A H    4  
ATOM 6971  H HA   . VAL A 1 35  ? 5.656   2.241   4.760   1.00 0.00 ? 35  VAL A HA   4  
ATOM 6972  H HB   . VAL A 1 35  ? 5.343   5.074   5.772   1.00 0.00 ? 35  VAL A HB   4  
ATOM 6973  H HG11 . VAL A 1 35  ? 4.716   5.196   3.519   1.00 0.00 ? 35  VAL A HG11 4  
ATOM 6974  H HG12 . VAL A 1 35  ? 4.009   3.563   3.526   1.00 0.00 ? 35  VAL A HG12 4  
ATOM 6975  H HG13 . VAL A 1 35  ? 3.179   4.895   4.366   1.00 0.00 ? 35  VAL A HG13 4  
ATOM 6976  H HG21 . VAL A 1 35  ? 3.531   4.393   7.015   1.00 0.00 ? 35  VAL A HG21 4  
ATOM 6977  H HG22 . VAL A 1 35  ? 3.209   2.980   5.982   1.00 0.00 ? 35  VAL A HG22 4  
ATOM 6978  H HG23 . VAL A 1 35  ? 4.560   2.947   7.141   1.00 0.00 ? 35  VAL A HG23 4  
ATOM 6979  N N    . LEU A 1 36  ? 7.132   2.960   2.946   1.00 0.00 ? 36  LEU A N    4  
ATOM 6980  C CA   . LEU A 1 36  ? 8.008   3.337   1.849   1.00 0.00 ? 36  LEU A CA   4  
ATOM 6981  C C    . LEU A 1 36  ? 7.693   4.772   1.420   1.00 0.00 ? 36  LEU A C    4  
ATOM 6982  O O    . LEU A 1 36  ? 6.585   5.059   0.968   1.00 0.00 ? 36  LEU A O    4  
ATOM 6983  C CB   . LEU A 1 36  ? 7.909   2.319   0.711   1.00 0.00 ? 36  LEU A CB   4  
ATOM 6984  C CG   . LEU A 1 36  ? 9.103   2.263   -0.244  1.00 0.00 ? 36  LEU A CG   4  
ATOM 6985  C CD1  . LEU A 1 36  ? 8.641   2.295   -1.702  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 6986  C CD2  . LEU A 1 36  ? 10.104  3.378   0.064   1.00 0.00 ? 36  LEU A CD2  4  
ATOM 6987  H H    . LEU A 1 36  ? 6.623   2.111   2.808   1.00 0.00 ? 36  LEU A H    4  
ATOM 6988  H HA   . LEU A 1 36  ? 9.031   3.305   2.222   1.00 0.00 ? 36  LEU A HA   4  
ATOM 6989  H HB2  . LEU A 1 36  ? 7.770   1.330   1.146   1.00 0.00 ? 36  LEU A HB2  4  
ATOM 6990  H HB3  . LEU A 1 36  ? 7.014   2.540   0.129   1.00 0.00 ? 36  LEU A HB3  4  
ATOM 6991  H HG   . LEU A 1 36  ? 9.619   1.315   -0.091  1.00 0.00 ? 36  LEU A HG   4  
ATOM 6992  H HD11 . LEU A 1 36  ? 7.929   3.109   -1.840  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 6993  H HD12 . LEU A 1 36  ? 9.501   2.451   -2.353  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 6994  H HD13 . LEU A 1 36  ? 8.163   1.348   -1.953  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 6995  H HD21 . LEU A 1 36  ? 9.595   4.341   0.036   1.00 0.00 ? 36  LEU A HD21 4  
ATOM 6996  H HD22 . LEU A 1 36  ? 10.530  3.220   1.055   1.00 0.00 ? 36  LEU A HD22 4  
ATOM 6997  H HD23 . LEU A 1 36  ? 10.901  3.366   -0.680  1.00 0.00 ? 36  LEU A HD23 4  
ATOM 6998  N N    . GLU A 1 37  ? 8.686   5.634   1.578   1.00 0.00 ? 37  GLU A N    4  
ATOM 6999  C CA   . GLU A 1 37  ? 8.529   7.031   1.212   1.00 0.00 ? 37  GLU A CA   4  
ATOM 7000  C C    . GLU A 1 37  ? 9.341   7.346   -0.045  1.00 0.00 ? 37  GLU A C    4  
ATOM 7001  O O    . GLU A 1 37  ? 10.529  7.032   -0.116  1.00 0.00 ? 37  GLU A O    4  
ATOM 7002  C CB   . GLU A 1 37  ? 8.931   7.949   2.369   1.00 0.00 ? 37  GLU A CB   4  
ATOM 7003  C CG   . GLU A 1 37  ? 7.698   8.561   3.037   1.00 0.00 ? 37  GLU A CG   4  
ATOM 7004  C CD   . GLU A 1 37  ? 8.069   9.234   4.360   1.00 0.00 ? 37  GLU A CD   4  
ATOM 7005  O OE1  . GLU A 1 37  ? 9.000   8.720   5.017   1.00 0.00 ? 37  GLU A OE1  4  
ATOM 7006  O OE2  . GLU A 1 37  ? 7.412   10.246  4.686   1.00 0.00 ? 37  GLU A OE2  4  
ATOM 7007  H H    . GLU A 1 37  ? 9.584   5.392   1.946   1.00 0.00 ? 37  GLU A H    4  
ATOM 7008  H HA   . GLU A 1 37  ? 7.466   7.160   1.008   1.00 0.00 ? 37  GLU A HA   4  
ATOM 7009  H HB2  . GLU A 1 37  ? 9.504   7.384   3.104   1.00 0.00 ? 37  GLU A HB2  4  
ATOM 7010  H HB3  . GLU A 1 37  ? 9.581   8.742   2.000   1.00 0.00 ? 37  GLU A HB3  4  
ATOM 7011  H HG2  . GLU A 1 37  ? 7.243   9.292   2.368   1.00 0.00 ? 37  GLU A HG2  4  
ATOM 7012  H HG3  . GLU A 1 37  ? 6.953   7.786   3.215   1.00 0.00 ? 37  GLU A HG3  4  
ATOM 7013  N N    . LYS A 1 38  ? 8.670   7.963   -1.006  1.00 0.00 ? 38  LYS A N    4  
ATOM 7014  C CA   . LYS A 1 38  ? 9.315   8.324   -2.257  1.00 0.00 ? 38  LYS A CA   4  
ATOM 7015  C C    . LYS A 1 38  ? 8.828   9.706   -2.697  1.00 0.00 ? 38  LYS A C    4  
ATOM 7016  O O    . LYS A 1 38  ? 7.661   10.046  -2.508  1.00 0.00 ? 38  LYS A O    4  
ATOM 7017  C CB   . LYS A 1 38  ? 9.096   7.232   -3.307  1.00 0.00 ? 38  LYS A CB   4  
ATOM 7018  C CG   . LYS A 1 38  ? 10.300  7.125   -4.245  1.00 0.00 ? 38  LYS A CG   4  
ATOM 7019  C CD   . LYS A 1 38  ? 10.285  5.799   -5.008  1.00 0.00 ? 38  LYS A CD   4  
ATOM 7020  C CE   . LYS A 1 38  ? 11.189  5.864   -6.240  1.00 0.00 ? 38  LYS A CE   4  
ATOM 7021  N NZ   . LYS A 1 38  ? 10.564  6.689   -7.299  1.00 0.00 ? 38  LYS A NZ   4  
ATOM 7022  H H    . LYS A 1 38  ? 7.704   8.215   -0.940  1.00 0.00 ? 38  LYS A H    4  
ATOM 7023  H HA   . LYS A 1 38  ? 10.387  8.379   -2.068  1.00 0.00 ? 38  LYS A HA   4  
ATOM 7024  H HB2  . LYS A 1 38  ? 8.930   6.275   -2.813  1.00 0.00 ? 38  LYS A HB2  4  
ATOM 7025  H HB3  . LYS A 1 38  ? 8.199   7.452   -3.885  1.00 0.00 ? 38  LYS A HB3  4  
ATOM 7026  H HG2  . LYS A 1 38  ? 10.290  7.955   -4.952  1.00 0.00 ? 38  LYS A HG2  4  
ATOM 7027  H HG3  . LYS A 1 38  ? 11.222  7.208   -3.670  1.00 0.00 ? 38  LYS A HG3  4  
ATOM 7028  H HD2  . LYS A 1 38  ? 10.616  4.994   -4.352  1.00 0.00 ? 38  LYS A HD2  4  
ATOM 7029  H HD3  . LYS A 1 38  ? 9.265   5.562   -5.313  1.00 0.00 ? 38  LYS A HD3  4  
ATOM 7030  H HE2  . LYS A 1 38  ? 12.156  6.286   -5.967  1.00 0.00 ? 38  LYS A HE2  4  
ATOM 7031  H HE3  . LYS A 1 38  ? 11.374  4.858   -6.617  1.00 0.00 ? 38  LYS A HE3  4  
ATOM 7032  H HZ1  . LYS A 1 38  ? 10.361  7.599   -6.936  1.00 0.00 ? 38  LYS A HZ1  4  
ATOM 7033  H HZ2  . LYS A 1 38  ? 11.192  6.770   -8.072  1.00 0.00 ? 38  LYS A HZ2  4  
ATOM 7034  H HZ3  . LYS A 1 38  ? 9.716   6.254   -7.602  1.00 0.00 ? 38  LYS A HZ3  4  
ATOM 7035  N N    . GLY A 1 39  ? 9.747   10.465  -3.276  1.00 0.00 ? 39  GLY A N    4  
ATOM 7036  C CA   . GLY A 1 39  ? 9.426   11.803  -3.744  1.00 0.00 ? 39  GLY A CA   4  
ATOM 7037  C C    . GLY A 1 39  ? 8.550   12.543  -2.731  1.00 0.00 ? 39  GLY A C    4  
ATOM 7038  O O    . GLY A 1 39  ? 7.540   13.141  -3.098  1.00 0.00 ? 39  GLY A O    4  
ATOM 7039  H H    . GLY A 1 39  ? 10.694  10.181  -3.426  1.00 0.00 ? 39  GLY A H    4  
ATOM 7040  H HA2  . GLY A 1 39  ? 10.345  12.363  -3.913  1.00 0.00 ? 39  GLY A HA2  4  
ATOM 7041  H HA3  . GLY A 1 39  ? 8.908   11.742  -4.701  1.00 0.00 ? 39  GLY A HA3  4  
ATOM 7042  N N    . GLY A 1 40  ? 8.970   12.478  -1.476  1.00 0.00 ? 40  GLY A N    4  
ATOM 7043  C CA   . GLY A 1 40  ? 8.236   13.135  -0.407  1.00 0.00 ? 40  GLY A CA   4  
ATOM 7044  C C    . GLY A 1 40  ? 6.764   12.720  -0.417  1.00 0.00 ? 40  GLY A C    4  
ATOM 7045  O O    . GLY A 1 40  ? 5.886   13.525  -0.109  1.00 0.00 ? 40  GLY A O    4  
ATOM 7046  H H    . GLY A 1 40  ? 9.792   11.989  -1.185  1.00 0.00 ? 40  GLY A H    4  
ATOM 7047  H HA2  . GLY A 1 40  ? 8.683   12.881  0.555   1.00 0.00 ? 40  GLY A HA2  4  
ATOM 7048  H HA3  . GLY A 1 40  ? 8.314   14.216  -0.519  1.00 0.00 ? 40  GLY A HA3  4  
ATOM 7049  N N    . LYS A 1 41  ? 6.538   11.464  -0.773  1.00 0.00 ? 41  LYS A N    4  
ATOM 7050  C CA   . LYS A 1 41  ? 5.187   10.932  -0.827  1.00 0.00 ? 41  LYS A CA   4  
ATOM 7051  C C    . LYS A 1 41  ? 5.152   9.570   -0.131  1.00 0.00 ? 41  LYS A C    4  
ATOM 7052  O O    . LYS A 1 41  ? 5.967   8.697   -0.425  1.00 0.00 ? 41  LYS A O    4  
ATOM 7053  C CB   . LYS A 1 41  ? 4.682   10.898  -2.271  1.00 0.00 ? 41  LYS A CB   4  
ATOM 7054  C CG   . LYS A 1 41  ? 4.209   12.283  -2.719  1.00 0.00 ? 41  LYS A CG   4  
ATOM 7055  C CD   . LYS A 1 41  ? 2.788   12.563  -2.225  1.00 0.00 ? 41  LYS A CD   4  
ATOM 7056  C CE   . LYS A 1 41  ? 1.758   12.252  -3.313  1.00 0.00 ? 41  LYS A CE   4  
ATOM 7057  N NZ   . LYS A 1 41  ? 0.689   13.275  -3.322  1.00 0.00 ? 41  LYS A NZ   4  
ATOM 7058  H H    . LYS A 1 41  ? 7.258   10.815  -1.021  1.00 0.00 ? 41  LYS A H    4  
ATOM 7059  H HA   . LYS A 1 41  ? 4.544   11.618  -0.276  1.00 0.00 ? 41  LYS A HA   4  
ATOM 7060  H HB2  . LYS A 1 41  ? 5.477   10.550  -2.931  1.00 0.00 ? 41  LYS A HB2  4  
ATOM 7061  H HB3  . LYS A 1 41  ? 3.863   10.185  -2.356  1.00 0.00 ? 41  LYS A HB3  4  
ATOM 7062  H HG2  . LYS A 1 41  ? 4.888   13.044  -2.335  1.00 0.00 ? 41  LYS A HG2  4  
ATOM 7063  H HG3  . LYS A 1 41  ? 4.239   12.347  -3.806  1.00 0.00 ? 41  LYS A HG3  4  
ATOM 7064  H HD2  . LYS A 1 41  ? 2.581   11.961  -1.340  1.00 0.00 ? 41  LYS A HD2  4  
ATOM 7065  H HD3  . LYS A 1 41  ? 2.703   13.608  -1.926  1.00 0.00 ? 41  LYS A HD3  4  
ATOM 7066  H HE2  . LYS A 1 41  ? 2.247   12.220  -4.286  1.00 0.00 ? 41  LYS A HE2  4  
ATOM 7067  H HE3  . LYS A 1 41  ? 1.326   11.266  -3.141  1.00 0.00 ? 41  LYS A HE3  4  
ATOM 7068  H HZ1  . LYS A 1 41  ? -0.121  12.906  -3.779  1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 7069  H HZ2  . LYS A 1 41  ? 0.457   13.522  -2.381  1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 7070  H HZ3  . LYS A 1 41  ? 1.008   14.086  -3.811  1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 7071  N N    . VAL A 1 42  ? 4.199   9.430   0.779   1.00 0.00 ? 42  VAL A N    4  
ATOM 7072  C CA   . VAL A 1 42  ? 4.046   8.189   1.519   1.00 0.00 ? 42  VAL A CA   4  
ATOM 7073  C C    . VAL A 1 42  ? 3.161   7.230   0.721   1.00 0.00 ? 42  VAL A C    4  
ATOM 7074  O O    . VAL A 1 42  ? 2.162   7.644   0.135   1.00 0.00 ? 42  VAL A O    4  
ATOM 7075  C CB   . VAL A 1 42  ? 3.503   8.479   2.920   1.00 0.00 ? 42  VAL A CB   4  
ATOM 7076  C CG1  . VAL A 1 42  ? 3.029   7.193   3.600   1.00 0.00 ? 42  VAL A CG1  4  
ATOM 7077  C CG2  . VAL A 1 42  ? 4.547   9.200   3.775   1.00 0.00 ? 42  VAL A CG2  4  
ATOM 7078  H H    . VAL A 1 42  ? 3.539   10.145  1.012   1.00 0.00 ? 42  VAL A H    4  
ATOM 7079  H HA   . VAL A 1 42  ? 5.036   7.747   1.626   1.00 0.00 ? 42  VAL A HA   4  
ATOM 7080  H HB   . VAL A 1 42  ? 2.642   9.139   2.815   1.00 0.00 ? 42  VAL A HB   4  
ATOM 7081  H HG11 . VAL A 1 42  ? 3.757   6.892   4.354   1.00 0.00 ? 42  VAL A HG11 4  
ATOM 7082  H HG12 . VAL A 1 42  ? 2.064   7.368   4.077   1.00 0.00 ? 42  VAL A HG12 4  
ATOM 7083  H HG13 . VAL A 1 42  ? 2.929   6.404   2.856   1.00 0.00 ? 42  VAL A HG13 4  
ATOM 7084  H HG21 . VAL A 1 42  ? 5.448   9.365   3.184   1.00 0.00 ? 42  VAL A HG21 4  
ATOM 7085  H HG22 . VAL A 1 42  ? 4.147   10.159  4.104   1.00 0.00 ? 42  VAL A HG22 4  
ATOM 7086  H HG23 . VAL A 1 42  ? 4.789   8.588   4.644   1.00 0.00 ? 42  VAL A HG23 4  
ATOM 7087  N N    . PHE A 1 43  ? 3.560   5.967   0.724   1.00 0.00 ? 43  PHE A N    4  
ATOM 7088  C CA   . PHE A 1 43  ? 2.815   4.945   0.007   1.00 0.00 ? 43  PHE A CA   4  
ATOM 7089  C C    . PHE A 1 43  ? 1.739   4.323   0.900   1.00 0.00 ? 43  PHE A C    4  
ATOM 7090  O O    . PHE A 1 43  ? 1.704   3.107   1.080   1.00 0.00 ? 43  PHE A O    4  
ATOM 7091  C CB   . PHE A 1 43  ? 3.817   3.861   -0.395  1.00 0.00 ? 43  PHE A CB   4  
ATOM 7092  C CG   . PHE A 1 43  ? 4.564   4.156   -1.698  1.00 0.00 ? 43  PHE A CG   4  
ATOM 7093  C CD1  . PHE A 1 43  ? 5.457   5.180   -1.752  1.00 0.00 ? 43  PHE A CD1  4  
ATOM 7094  C CD2  . PHE A 1 43  ? 4.335   3.394   -2.800  1.00 0.00 ? 43  PHE A CD2  4  
ATOM 7095  C CE1  . PHE A 1 43  ? 6.150   5.454   -2.961  1.00 0.00 ? 43  PHE A CE1  4  
ATOM 7096  C CE2  . PHE A 1 43  ? 5.028   3.668   -4.009  1.00 0.00 ? 43  PHE A CE2  4  
ATOM 7097  C CZ   . PHE A 1 43  ? 5.921   4.692   -4.064  1.00 0.00 ? 43  PHE A CZ   4  
ATOM 7098  H H    . PHE A 1 43  ? 4.374   5.638   1.203   1.00 0.00 ? 43  PHE A H    4  
ATOM 7099  H HA   . PHE A 1 43  ? 2.341   5.430   -0.847  1.00 0.00 ? 43  PHE A HA   4  
ATOM 7100  H HB2  . PHE A 1 43  ? 4.543   3.736   0.408   1.00 0.00 ? 43  PHE A HB2  4  
ATOM 7101  H HB3  . PHE A 1 43  ? 3.289   2.913   -0.498  1.00 0.00 ? 43  PHE A HB3  4  
ATOM 7102  H HD1  . PHE A 1 43  ? 5.640   5.791   -0.868  1.00 0.00 ? 43  PHE A HD1  4  
ATOM 7103  H HD2  . PHE A 1 43  ? 3.619   2.573   -2.757  1.00 0.00 ? 43  PHE A HD2  4  
ATOM 7104  H HE1  . PHE A 1 43  ? 6.866   6.275   -3.005  1.00 0.00 ? 43  PHE A HE1  4  
ATOM 7105  H HE2  . PHE A 1 43  ? 4.844   3.057   -4.893  1.00 0.00 ? 43  PHE A HE2  4  
ATOM 7106  H HZ   . PHE A 1 43  ? 6.453   4.902   -4.992  1.00 0.00 ? 43  PHE A HZ   4  
ATOM 7107  N N    . SER A 1 44  ? 0.888   5.186   1.435   1.00 0.00 ? 44  SER A N    4  
ATOM 7108  C CA   . SER A 1 44  ? -0.186  4.737   2.304   1.00 0.00 ? 44  SER A CA   4  
ATOM 7109  C C    . SER A 1 44  ? -1.511  5.362   1.865   1.00 0.00 ? 44  SER A C    4  
ATOM 7110  O O    . SER A 1 44  ? -1.818  6.496   2.231   1.00 0.00 ? 44  SER A O    4  
ATOM 7111  C CB   . SER A 1 44  ? 0.106   5.084   3.765   1.00 0.00 ? 44  SER A CB   4  
ATOM 7112  O OG   . SER A 1 44  ? 0.274   3.919   4.568   1.00 0.00 ? 44  SER A OG   4  
ATOM 7113  H H    . SER A 1 44  ? 0.924   6.174   1.283   1.00 0.00 ? 44  SER A H    4  
ATOM 7114  H HA   . SER A 1 44  ? -0.217  3.654   2.188   1.00 0.00 ? 44  SER A HA   4  
ATOM 7115  H HB2  . SER A 1 44  ? 1.008   5.694   3.819   1.00 0.00 ? 44  SER A HB2  4  
ATOM 7116  H HB3  . SER A 1 44  ? -0.710  5.686   4.165   1.00 0.00 ? 44  SER A HB3  4  
ATOM 7117  H HG   . SER A 1 44  ? 0.547   4.178   5.494   1.00 0.00 ? 44  SER A HG   4  
ATOM 7118  N N    . ALA A 1 45  ? -2.261  4.596   1.086   1.00 0.00 ? 45  ALA A N    4  
ATOM 7119  C CA   . ALA A 1 45  ? -3.547  5.061   0.593   1.00 0.00 ? 45  ALA A CA   4  
ATOM 7120  C C    . ALA A 1 45  ? -4.657  4.174   1.160   1.00 0.00 ? 45  ALA A C    4  
ATOM 7121  O O    . ALA A 1 45  ? -4.488  2.961   1.276   1.00 0.00 ? 45  ALA A O    4  
ATOM 7122  C CB   . ALA A 1 45  ? -3.533  5.072   -0.936  1.00 0.00 ? 45  ALA A CB   4  
ATOM 7123  H H    . ALA A 1 45  ? -2.004  3.675   0.793   1.00 0.00 ? 45  ALA A H    4  
ATOM 7124  H HA   . ALA A 1 45  ? -3.690  6.081   0.951   1.00 0.00 ? 45  ALA A HA   4  
ATOM 7125  H HB1  . ALA A 1 45  ? -2.550  5.385   -1.289  1.00 0.00 ? 45  ALA A HB1  4  
ATOM 7126  H HB2  . ALA A 1 45  ? -3.751  4.071   -1.309  1.00 0.00 ? 45  ALA A HB2  4  
ATOM 7127  H HB3  . ALA A 1 45  ? -4.289  5.768   -1.302  1.00 0.00 ? 45  ALA A HB3  4  
ATOM 7128  N N    . THR A 1 46  ? -5.767  4.813   1.498   1.00 0.00 ? 46  THR A N    4  
ATOM 7129  C CA   . THR A 1 46  ? -6.904  4.097   2.050   1.00 0.00 ? 46  THR A CA   4  
ATOM 7130  C C    . THR A 1 46  ? -8.105  4.194   1.106   1.00 0.00 ? 46  THR A C    4  
ATOM 7131  O O    . THR A 1 46  ? -8.830  5.188   1.120   1.00 0.00 ? 46  THR A O    4  
ATOM 7132  C CB   . THR A 1 46  ? -7.182  4.655   3.447   1.00 0.00 ? 46  THR A CB   4  
ATOM 7133  O OG1  . THR A 1 46  ? -6.088  4.189   4.231   1.00 0.00 ? 46  THR A OG1  4  
ATOM 7134  C CG2  . THR A 1 46  ? -8.409  4.015   4.100   1.00 0.00 ? 46  THR A CG2  4  
ATOM 7135  H H    . THR A 1 46  ? -5.896  5.800   1.400   1.00 0.00 ? 46  THR A H    4  
ATOM 7136  H HA   . THR A 1 46  ? -6.642  3.041   2.125   1.00 0.00 ? 46  THR A HA   4  
ATOM 7137  H HB   . THR A 1 46  ? -7.278  5.741   3.420   1.00 0.00 ? 46  THR A HB   4  
ATOM 7138  H HG1  . THR A 1 46  ? -5.839  4.876   4.913   1.00 0.00 ? 46  THR A HG1  4  
ATOM 7139  H HG21 . THR A 1 46  ? -8.153  3.015   4.452   1.00 0.00 ? 46  THR A HG21 4  
ATOM 7140  H HG22 . THR A 1 46  ? -8.731  4.625   4.943   1.00 0.00 ? 46  THR A HG22 4  
ATOM 7141  H HG23 . THR A 1 46  ? -9.216  3.947   3.370   1.00 0.00 ? 46  THR A HG23 4  
ATOM 7142  N N    . LEU A 1 47  ? -8.277  3.150   0.310   1.00 0.00 ? 47  LEU A N    4  
ATOM 7143  C CA   . LEU A 1 47  ? -9.378  3.106   -0.639  1.00 0.00 ? 47  LEU A CA   4  
ATOM 7144  C C    . LEU A 1 47  ? -10.635 2.596   0.069   1.00 0.00 ? 47  LEU A C    4  
ATOM 7145  O O    . LEU A 1 47  ? -10.548 1.980   1.130   1.00 0.00 ? 47  LEU A O    4  
ATOM 7146  C CB   . LEU A 1 47  ? -8.990  2.286   -1.871  1.00 0.00 ? 47  LEU A CB   4  
ATOM 7147  C CG   . LEU A 1 47  ? -7.671  2.669   -2.544  1.00 0.00 ? 47  LEU A CG   4  
ATOM 7148  C CD1  . LEU A 1 47  ? -7.326  1.693   -3.671  1.00 0.00 ? 47  LEU A CD1  4  
ATOM 7149  C CD2  . LEU A 1 47  ? -7.705  4.119   -3.032  1.00 0.00 ? 47  LEU A CD2  4  
ATOM 7150  H H    . LEU A 1 47  ? -7.683  2.346   0.305   1.00 0.00 ? 47  LEU A H    4  
ATOM 7151  H HA   . LEU A 1 47  ? -9.560  4.126   -0.975  1.00 0.00 ? 47  LEU A HA   4  
ATOM 7152  H HB2  . LEU A 1 47  ? -8.936  1.236   -1.582  1.00 0.00 ? 47  LEU A HB2  4  
ATOM 7153  H HB3  . LEU A 1 47  ? -9.790  2.373   -2.607  1.00 0.00 ? 47  LEU A HB3  4  
ATOM 7154  H HG   . LEU A 1 47  ? -6.875  2.598   -1.802  1.00 0.00 ? 47  LEU A HG   4  
ATOM 7155  H HD11 . LEU A 1 47  ? -6.807  0.829   -3.256  1.00 0.00 ? 47  LEU A HD11 4  
ATOM 7156  H HD12 . LEU A 1 47  ? -8.243  1.365   -4.161  1.00 0.00 ? 47  LEU A HD12 4  
ATOM 7157  H HD13 . LEU A 1 47  ? -6.683  2.189   -4.398  1.00 0.00 ? 47  LEU A HD13 4  
ATOM 7158  H HD21 . LEU A 1 47  ? -6.690  4.458   -3.234  1.00 0.00 ? 47  LEU A HD21 4  
ATOM 7159  H HD22 . LEU A 1 47  ? -8.298  4.181   -3.945  1.00 0.00 ? 47  LEU A HD22 4  
ATOM 7160  H HD23 . LEU A 1 47  ? -8.154  4.750   -2.265  1.00 0.00 ? 47  LEU A HD23 4  
ATOM 7161  N N    . GLY A 1 48  ? -11.775 2.872   -0.547  1.00 0.00 ? 48  GLY A N    4  
ATOM 7162  C CA   . GLY A 1 48  ? -13.048 2.450   0.011   1.00 0.00 ? 48  GLY A CA   4  
ATOM 7163  C C    . GLY A 1 48  ? -14.145 2.461   -1.056  1.00 0.00 ? 48  GLY A C    4  
ATOM 7164  O O    . GLY A 1 48  ? -14.237 3.399   -1.847  1.00 0.00 ? 48  GLY A O    4  
ATOM 7165  H H    . GLY A 1 48  ? -11.837 3.374   -1.410  1.00 0.00 ? 48  GLY A H    4  
ATOM 7166  H HA2  . GLY A 1 48  ? -12.952 1.447   0.428   1.00 0.00 ? 48  GLY A HA2  4  
ATOM 7167  H HA3  . GLY A 1 48  ? -13.327 3.111   0.831   1.00 0.00 ? 48  GLY A HA3  4  
ATOM 7168  N N    . LEU A 1 49  ? -14.948 1.408   -1.044  1.00 0.00 ? 49  LEU A N    4  
ATOM 7169  C CA   . LEU A 1 49  ? -16.035 1.284   -2.001  1.00 0.00 ? 49  LEU A CA   4  
ATOM 7170  C C    . LEU A 1 49  ? -17.317 0.895   -1.263  1.00 0.00 ? 49  LEU A C    4  
ATOM 7171  O O    . LEU A 1 49  ? -17.266 0.217   -0.238  1.00 0.00 ? 49  LEU A O    4  
ATOM 7172  C CB   . LEU A 1 49  ? -15.654 0.317   -3.123  1.00 0.00 ? 49  LEU A CB   4  
ATOM 7173  C CG   . LEU A 1 49  ? -16.541 0.351   -4.369  1.00 0.00 ? 49  LEU A CG   4  
ATOM 7174  C CD1  . LEU A 1 49  ? -15.888 1.169   -5.485  1.00 0.00 ? 49  LEU A CD1  4  
ATOM 7175  C CD2  . LEU A 1 49  ? -16.896 -1.064  -4.829  1.00 0.00 ? 49  LEU A CD2  4  
ATOM 7176  H H    . LEU A 1 49  ? -14.867 0.649   -0.398  1.00 0.00 ? 49  LEU A H    4  
ATOM 7177  H HA   . LEU A 1 49  ? -16.182 2.264   -2.456  1.00 0.00 ? 49  LEU A HA   4  
ATOM 7178  H HB2  . LEU A 1 49  ? -14.628 0.529   -3.426  1.00 0.00 ? 49  LEU A HB2  4  
ATOM 7179  H HB3  . LEU A 1 49  ? -15.664 -0.696  -2.722  1.00 0.00 ? 49  LEU A HB3  4  
ATOM 7180  H HG   . LEU A 1 49  ? -17.475 0.849   -4.109  1.00 0.00 ? 49  LEU A HG   4  
ATOM 7181  H HD11 . LEU A 1 49  ? -14.840 0.885   -5.578  1.00 0.00 ? 49  LEU A HD11 4  
ATOM 7182  H HD12 . LEU A 1 49  ? -16.403 0.976   -6.426  1.00 0.00 ? 49  LEU A HD12 4  
ATOM 7183  H HD13 . LEU A 1 49  ? -15.957 2.231   -5.245  1.00 0.00 ? 49  LEU A HD13 4  
ATOM 7184  H HD21 . LEU A 1 49  ? -17.270 -1.031  -5.852  1.00 0.00 ? 49  LEU A HD21 4  
ATOM 7185  H HD22 . LEU A 1 49  ? -16.007 -1.694  -4.787  1.00 0.00 ? 49  LEU A HD22 4  
ATOM 7186  H HD23 . LEU A 1 49  ? -17.664 -1.477  -4.175  1.00 0.00 ? 49  LEU A HD23 4  
ATOM 7187  N N    . VAL A 1 50  ? -18.437 1.340   -1.813  1.00 0.00 ? 50  VAL A N    4  
ATOM 7188  C CA   . VAL A 1 50  ? -19.731 1.047   -1.219  1.00 0.00 ? 50  VAL A CA   4  
ATOM 7189  C C    . VAL A 1 50  ? -20.768 0.868   -2.330  1.00 0.00 ? 50  VAL A C    4  
ATOM 7190  O O    . VAL A 1 50  ? -20.874 1.703   -3.226  1.00 0.00 ? 50  VAL A O    4  
ATOM 7191  C CB   . VAL A 1 50  ? -20.108 2.142   -0.220  1.00 0.00 ? 50  VAL A CB   4  
ATOM 7192  C CG1  . VAL A 1 50  ? -21.421 1.807   0.491   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 7193  C CG2  . VAL A 1 50  ? -18.983 2.375   0.790   1.00 0.00 ? 50  VAL A CG2  4  
ATOM 7194  H H    . VAL A 1 50  ? -18.470 1.891   -2.647  1.00 0.00 ? 50  VAL A H    4  
ATOM 7195  H HA   . VAL A 1 50  ? -19.636 0.109   -0.672  1.00 0.00 ? 50  VAL A HA   4  
ATOM 7196  H HB   . VAL A 1 50  ? -20.256 3.068   -0.777  1.00 0.00 ? 50  VAL A HB   4  
ATOM 7197  H HG11 . VAL A 1 50  ? -22.085 1.285   -0.199  1.00 0.00 ? 50  VAL A HG11 4  
ATOM 7198  H HG12 . VAL A 1 50  ? -21.217 1.170   1.351   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 7199  H HG13 . VAL A 1 50  ? -21.898 2.728   0.826   1.00 0.00 ? 50  VAL A HG13 4  
ATOM 7200  H HG21 . VAL A 1 50  ? -18.615 1.415   1.152   1.00 0.00 ? 50  VAL A HG21 4  
ATOM 7201  H HG22 . VAL A 1 50  ? -18.169 2.917   0.308   1.00 0.00 ? 50  VAL A HG22 4  
ATOM 7202  H HG23 . VAL A 1 50  ? -19.361 2.960   1.628   1.00 0.00 ? 50  VAL A HG23 4  
ATOM 7203  N N    . ASP A 1 51  ? -21.507 -0.228  -2.234  1.00 0.00 ? 51  ASP A N    4  
ATOM 7204  C CA   . ASP A 1 51  ? -22.532 -0.528  -3.219  1.00 0.00 ? 51  ASP A CA   4  
ATOM 7205  C C    . ASP A 1 51  ? -23.881 -0.006  -2.720  1.00 0.00 ? 51  ASP A C    4  
ATOM 7206  O O    . ASP A 1 51  ? -24.218 -0.167  -1.549  1.00 0.00 ? 51  ASP A O    4  
ATOM 7207  C CB   . ASP A 1 51  ? -22.660 -2.036  -3.438  1.00 0.00 ? 51  ASP A CB   4  
ATOM 7208  C CG   . ASP A 1 51  ? -22.343 -2.513  -4.857  1.00 0.00 ? 51  ASP A CG   4  
ATOM 7209  O OD1  . ASP A 1 51  ? -23.237 -2.365  -5.719  1.00 0.00 ? 51  ASP A OD1  4  
ATOM 7210  O OD2  . ASP A 1 51  ? -21.214 -3.015  -5.048  1.00 0.00 ? 51  ASP A OD2  4  
ATOM 7211  H H    . ASP A 1 51  ? -21.414 -0.903  -1.502  1.00 0.00 ? 51  ASP A H    4  
ATOM 7212  H HA   . ASP A 1 51  ? -22.204 -0.032  -4.133  1.00 0.00 ? 51  ASP A HA   4  
ATOM 7213  H HB2  . ASP A 1 51  ? -21.996 -2.548  -2.742  1.00 0.00 ? 51  ASP A HB2  4  
ATOM 7214  H HB3  . ASP A 1 51  ? -23.677 -2.339  -3.188  1.00 0.00 ? 51  ASP A HB3  4  
ATOM 7215  N N    . ILE A 1 52  ? -24.616 0.610   -3.635  1.00 0.00 ? 52  ILE A N    4  
ATOM 7216  C CA   . ILE A 1 52  ? -25.920 1.157   -3.303  1.00 0.00 ? 52  ILE A CA   4  
ATOM 7217  C C    . ILE A 1 52  ? -26.979 0.061   -3.445  1.00 0.00 ? 52  ILE A C    4  
ATOM 7218  O O    . ILE A 1 52  ? -27.944 0.023   -2.684  1.00 0.00 ? 52  ILE A O    4  
ATOM 7219  C CB   . ILE A 1 52  ? -26.208 2.403   -4.142  1.00 0.00 ? 52  ILE A CB   4  
ATOM 7220  C CG1  . ILE A 1 52  ? -27.567 3.006   -3.781  1.00 0.00 ? 52  ILE A CG1  4  
ATOM 7221  C CG2  . ILE A 1 52  ? -26.097 2.096   -5.637  1.00 0.00 ? 52  ILE A CG2  4  
ATOM 7222  C CD1  . ILE A 1 52  ? -27.475 4.527   -3.650  1.00 0.00 ? 52  ILE A CD1  4  
ATOM 7223  H H    . ILE A 1 52  ? -24.334 0.737   -4.586  1.00 0.00 ? 52  ILE A H    4  
ATOM 7224  H HA   . ILE A 1 52  ? -25.887 1.471   -2.260  1.00 0.00 ? 52  ILE A HA   4  
ATOM 7225  H HB   . ILE A 1 52  ? -25.452 3.153   -3.911  1.00 0.00 ? 52  ILE A HB   4  
ATOM 7226  H HG12 . ILE A 1 52  ? -28.299 2.746   -4.546  1.00 0.00 ? 52  ILE A HG12 4  
ATOM 7227  H HG13 . ILE A 1 52  ? -27.921 2.577   -2.843  1.00 0.00 ? 52  ILE A HG13 4  
ATOM 7228  H HG21 . ILE A 1 52  ? -27.049 2.306   -6.123  1.00 0.00 ? 52  ILE A HG21 4  
ATOM 7229  H HG22 . ILE A 1 52  ? -25.318 2.717   -6.079  1.00 0.00 ? 52  ILE A HG22 4  
ATOM 7230  H HG23 . ILE A 1 52  ? -25.844 1.044   -5.773  1.00 0.00 ? 52  ILE A HG23 4  
ATOM 7231  H HD11 . ILE A 1 52  ? -27.309 4.967   -4.633  1.00 0.00 ? 52  ILE A HD11 4  
ATOM 7232  H HD12 . ILE A 1 52  ? -28.405 4.913   -3.232  1.00 0.00 ? 52  ILE A HD12 4  
ATOM 7233  H HD13 . ILE A 1 52  ? -26.646 4.785   -2.991  1.00 0.00 ? 52  ILE A HD13 4  
ATOM 7234  N N    . VAL A 1 53  ? -26.762 -0.803  -4.426  1.00 0.00 ? 53  VAL A N    4  
ATOM 7235  C CA   . VAL A 1 53  ? -27.685 -1.896  -4.678  1.00 0.00 ? 53  VAL A CA   4  
ATOM 7236  C C    . VAL A 1 53  ? -27.406 -3.032  -3.691  1.00 0.00 ? 53  VAL A C    4  
ATOM 7237  O O    . VAL A 1 53  ? -28.309 -3.486  -2.990  1.00 0.00 ? 53  VAL A O    4  
ATOM 7238  C CB   . VAL A 1 53  ? -27.587 -2.338  -6.140  1.00 0.00 ? 53  VAL A CB   4  
ATOM 7239  C CG1  . VAL A 1 53  ? -27.847 -1.163  -7.085  1.00 0.00 ? 53  VAL A CG1  4  
ATOM 7240  C CG2  . VAL A 1 53  ? -26.231 -2.984  -6.428  1.00 0.00 ? 53  VAL A CG2  4  
ATOM 7241  H H    . VAL A 1 53  ? -25.974 -0.765  -5.040  1.00 0.00 ? 53  VAL A H    4  
ATOM 7242  H HA   . VAL A 1 53  ? -28.694 -1.521  -4.505  1.00 0.00 ? 53  VAL A HA   4  
ATOM 7243  H HB   . VAL A 1 53  ? -28.359 -3.087  -6.316  1.00 0.00 ? 53  VAL A HB   4  
ATOM 7244  H HG11 . VAL A 1 53  ? -27.817 -0.230  -6.523  1.00 0.00 ? 53  VAL A HG11 4  
ATOM 7245  H HG12 . VAL A 1 53  ? -27.082 -1.145  -7.861  1.00 0.00 ? 53  VAL A HG12 4  
ATOM 7246  H HG13 . VAL A 1 53  ? -28.829 -1.278  -7.546  1.00 0.00 ? 53  VAL A HG13 4  
ATOM 7247  H HG21 . VAL A 1 53  ? -26.124 -3.141  -7.501  1.00 0.00 ? 53  VAL A HG21 4  
ATOM 7248  H HG22 . VAL A 1 53  ? -25.434 -2.328  -6.076  1.00 0.00 ? 53  VAL A HG22 4  
ATOM 7249  H HG23 . VAL A 1 53  ? -26.167 -3.942  -5.912  1.00 0.00 ? 53  VAL A HG23 4  
ATOM 7250  N N    . LYS A 1 54  ? -26.152 -3.458  -3.667  1.00 0.00 ? 54  LYS A N    4  
ATOM 7251  C CA   . LYS A 1 54  ? -25.743 -4.531  -2.778  1.00 0.00 ? 54  LYS A CA   4  
ATOM 7252  C C    . LYS A 1 54  ? -25.749 -4.022  -1.335  1.00 0.00 ? 54  LYS A C    4  
ATOM 7253  O O    . LYS A 1 54  ? -25.872 -4.808  -0.396  1.00 0.00 ? 54  LYS A O    4  
ATOM 7254  C CB   . LYS A 1 54  ? -24.397 -5.110  -3.220  1.00 0.00 ? 54  LYS A CB   4  
ATOM 7255  C CG   . LYS A 1 54  ? -24.487 -5.685  -4.635  1.00 0.00 ? 54  LYS A CG   4  
ATOM 7256  C CD   . LYS A 1 54  ? -23.459 -6.800  -4.840  1.00 0.00 ? 54  LYS A CD   4  
ATOM 7257  C CE   . LYS A 1 54  ? -22.099 -6.225  -5.243  1.00 0.00 ? 54  LYS A CE   4  
ATOM 7258  N NZ   . LYS A 1 54  ? -21.304 -7.237  -5.972  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7259  H H    . LYS A 1 54  ? -25.423 -3.083  -4.240  1.00 0.00 ? 54  LYS A H    4  
ATOM 7260  H HA   . LYS A 1 54  ? -26.481 -5.328  -2.866  1.00 0.00 ? 54  LYS A HA   4  
ATOM 7261  H HB2  . LYS A 1 54  ? -23.634 -4.333  -3.187  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 7262  H HB3  . LYS A 1 54  ? -24.087 -5.891  -2.525  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 7263  H HG2  . LYS A 1 54  ? -25.490 -6.074  -4.811  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 7264  H HG3  . LYS A 1 54  ? -24.319 -4.893  -5.365  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 7265  H HD2  . LYS A 1 54  ? -23.355 -7.378  -3.921  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 7266  H HD3  . LYS A 1 54  ? -23.810 -7.487  -5.610  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 7267  H HE2  . LYS A 1 54  ? -22.241 -5.345  -5.869  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 7268  H HE3  . LYS A 1 54  ? -21.558 -5.900  -4.354  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 7269  H HZ1  . LYS A 1 54  ? -21.564 -7.233  -6.938  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7270  H HZ2  . LYS A 1 54  ? -20.331 -7.021  -5.888  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7271  H HZ3  . LYS A 1 54  ? -21.479 -8.142  -5.584  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7272  N N    . GLY A 1 55  ? -25.614 -2.711  -1.203  1.00 0.00 ? 55  GLY A N    4  
ATOM 7273  C CA   . GLY A 1 55  ? -25.602 -2.088  0.110   1.00 0.00 ? 55  GLY A CA   4  
ATOM 7274  C C    . GLY A 1 55  ? -24.441 -2.615  0.956   1.00 0.00 ? 55  GLY A C    4  
ATOM 7275  O O    . GLY A 1 55  ? -24.554 -2.713  2.177   1.00 0.00 ? 55  GLY A O    4  
ATOM 7276  H H    . GLY A 1 55  ? -25.514 -2.079  -1.972  1.00 0.00 ? 55  GLY A H    4  
ATOM 7277  H HA2  . GLY A 1 55  ? -25.517 -1.007  0.002   1.00 0.00 ? 55  GLY A HA2  4  
ATOM 7278  H HA3  . GLY A 1 55  ? -26.546 -2.284  0.618   1.00 0.00 ? 55  GLY A HA3  4  
ATOM 7279  N N    . THR A 1 56  ? -23.353 -2.940  0.274   1.00 0.00 ? 56  THR A N    4  
ATOM 7280  C CA   . THR A 1 56  ? -22.173 -3.454  0.948   1.00 0.00 ? 56  THR A CA   4  
ATOM 7281  C C    . THR A 1 56  ? -21.125 -2.351  1.104   1.00 0.00 ? 56  THR A C    4  
ATOM 7282  O O    . THR A 1 56  ? -21.146 -1.362  0.374   1.00 0.00 ? 56  THR A O    4  
ATOM 7283  C CB   . THR A 1 56  ? -21.669 -4.665  0.160   1.00 0.00 ? 56  THR A CB   4  
ATOM 7284  O OG1  . THR A 1 56  ? -21.720 -4.240  -1.199  1.00 0.00 ? 56  THR A OG1  4  
ATOM 7285  C CG2  . THR A 1 56  ? -22.638 -5.847  0.218   1.00 0.00 ? 56  THR A CG2  4  
ATOM 7286  H H    . THR A 1 56  ? -23.270 -2.857  -0.719  1.00 0.00 ? 56  THR A H    4  
ATOM 7287  H HA   . THR A 1 56  ? -22.460 -3.767  1.952   1.00 0.00 ? 56  THR A HA   4  
ATOM 7288  H HB   . THR A 1 56  ? -20.674 -4.960  0.495   1.00 0.00 ? 56  THR A HB   4  
ATOM 7289  H HG1  . THR A 1 56  ? -20.889 -3.734  -1.431  1.00 0.00 ? 56  THR A HG1  4  
ATOM 7290  H HG21 . THR A 1 56  ? -22.188 -6.659  0.789   1.00 0.00 ? 56  THR A HG21 4  
ATOM 7291  H HG22 . THR A 1 56  ? -23.564 -5.534  0.700   1.00 0.00 ? 56  THR A HG22 4  
ATOM 7292  H HG23 . THR A 1 56  ? -22.854 -6.190  -0.794  1.00 0.00 ? 56  THR A HG23 4  
ATOM 7293  N N    . ASN A 1 57  ? -20.232 -2.558  2.061   1.00 0.00 ? 57  ASN A N    4  
ATOM 7294  C CA   . ASN A 1 57  ? -19.178 -1.593  2.323   1.00 0.00 ? 57  ASN A CA   4  
ATOM 7295  C C    . ASN A 1 57  ? -17.822 -2.300  2.269   1.00 0.00 ? 57  ASN A C    4  
ATOM 7296  O O    . ASN A 1 57  ? -17.471 -3.049  3.179   1.00 0.00 ? 57  ASN A O    4  
ATOM 7297  C CB   . ASN A 1 57  ? -19.332 -0.972  3.712   1.00 0.00 ? 57  ASN A CB   4  
ATOM 7298  C CG   . ASN A 1 57  ? -20.552 -0.050  3.768   1.00 0.00 ? 57  ASN A CG   4  
ATOM 7299  O OD1  . ASN A 1 57  ? -21.533 -0.233  3.066   1.00 0.00 ? 57  ASN A OD1  4  
ATOM 7300  N ND2  . ASN A 1 57  ? -20.436 0.948   4.640   1.00 0.00 ? 57  ASN A ND2  4  
ATOM 7301  H H    . ASN A 1 57  ? -20.222 -3.366  2.651   1.00 0.00 ? 57  ASN A H    4  
ATOM 7302  H HA   . ASN A 1 57  ? -19.284 -0.835  1.547   1.00 0.00 ? 57  ASN A HA   4  
ATOM 7303  H HB2  . ASN A 1 57  ? -19.433 -1.760  4.458   1.00 0.00 ? 57  ASN A HB2  4  
ATOM 7304  H HB3  . ASN A 1 57  ? -18.434 -0.408  3.964   1.00 0.00 ? 57  ASN A HB3  4  
ATOM 7305  H HD21 . ASN A 1 57  ? -19.604 1.041   5.186   1.00 0.00 ? 57  ASN A HD21 4  
ATOM 7306  H HD22 . ASN A 1 57  ? -21.182 1.605   4.750   1.00 0.00 ? 57  ASN A HD22 4  
ATOM 7307  N N    . SER A 1 58  ? -17.095 -2.036  1.192   1.00 0.00 ? 58  SER A N    4  
ATOM 7308  C CA   . SER A 1 58  ? -15.785 -2.636  1.008   1.00 0.00 ? 58  SER A CA   4  
ATOM 7309  C C    . SER A 1 58  ? -14.695 -1.577  1.178   1.00 0.00 ? 58  SER A C    4  
ATOM 7310  O O    . SER A 1 58  ? -14.920 -0.399  0.902   1.00 0.00 ? 58  SER A O    4  
ATOM 7311  C CB   . SER A 1 58  ? -15.672 -3.299  -0.367  1.00 0.00 ? 58  SER A CB   4  
ATOM 7312  O OG   . SER A 1 58  ? -16.605 -4.364  -0.524  1.00 0.00 ? 58  SER A OG   4  
ATOM 7313  H H    . SER A 1 58  ? -17.388 -1.425  0.457   1.00 0.00 ? 58  SER A H    4  
ATOM 7314  H HA   . SER A 1 58  ? -15.704 -3.397  1.785   1.00 0.00 ? 58  SER A HA   4  
ATOM 7315  H HB2  . SER A 1 58  ? -15.839 -2.553  -1.144  1.00 0.00 ? 58  SER A HB2  4  
ATOM 7316  H HB3  . SER A 1 58  ? -14.660 -3.680  -0.503  1.00 0.00 ? 58  SER A HB3  4  
ATOM 7317  H HG   . SER A 1 58  ? -17.537 -4.003  -0.536  1.00 0.00 ? 58  SER A HG   4  
ATOM 7318  N N    . TYR A 1 59  ? -13.536 -2.033  1.631   1.00 0.00 ? 59  TYR A N    4  
ATOM 7319  C CA   . TYR A 1 59  ? -12.410 -1.139  1.841   1.00 0.00 ? 59  TYR A CA   4  
ATOM 7320  C C    . TYR A 1 59  ? -11.086 -1.846  1.546   1.00 0.00 ? 59  TYR A C    4  
ATOM 7321  O O    . TYR A 1 59  ? -10.827 -2.929  2.068   1.00 0.00 ? 59  TYR A O    4  
ATOM 7322  C CB   . TYR A 1 59  ? -12.450 -0.752  3.321   1.00 0.00 ? 59  TYR A CB   4  
ATOM 7323  C CG   . TYR A 1 59  ? -11.949 -1.848  4.264   1.00 0.00 ? 59  TYR A CG   4  
ATOM 7324  C CD1  . TYR A 1 59  ? -10.596 -2.005  4.484   1.00 0.00 ? 59  TYR A CD1  4  
ATOM 7325  C CD2  . TYR A 1 59  ? -12.852 -2.681  4.895   1.00 0.00 ? 59  TYR A CD2  4  
ATOM 7326  C CE1  . TYR A 1 59  ? -10.126 -3.036  5.372   1.00 0.00 ? 59  TYR A CE1  4  
ATOM 7327  C CE2  . TYR A 1 59  ? -12.381 -3.712  5.782   1.00 0.00 ? 59  TYR A CE2  4  
ATOM 7328  C CZ   . TYR A 1 59  ? -11.041 -3.839  5.977   1.00 0.00 ? 59  TYR A CZ   4  
ATOM 7329  O OH   . TYR A 1 59  ? -10.597 -4.813  6.815   1.00 0.00 ? 59  TYR A OH   4  
ATOM 7330  H H    . TYR A 1 59  ? -13.361 -2.992  1.853   1.00 0.00 ? 59  TYR A H    4  
ATOM 7331  H HA   . TYR A 1 59  ? -12.521 -0.293  1.163   1.00 0.00 ? 59  TYR A HA   4  
ATOM 7332  H HB2  . TYR A 1 59  ? -11.845 0.143   3.468   1.00 0.00 ? 59  TYR A HB2  4  
ATOM 7333  H HB3  . TYR A 1 59  ? -13.473 -0.494  3.591   1.00 0.00 ? 59  TYR A HB3  4  
ATOM 7334  H HD1  . TYR A 1 59  ? -9.883  -1.347  3.986   1.00 0.00 ? 59  TYR A HD1  4  
ATOM 7335  H HD2  . TYR A 1 59  ? -13.921 -2.557  4.721   1.00 0.00 ? 59  TYR A HD2  4  
ATOM 7336  H HE1  . TYR A 1 59  ? -9.059  -3.171  5.554   1.00 0.00 ? 59  TYR A HE1  4  
ATOM 7337  H HE2  . TYR A 1 59  ? -13.083 -4.376  6.287   1.00 0.00 ? 59  TYR A HE2  4  
ATOM 7338  H HH   . TYR A 1 59  ? -9.626  -4.679  7.012   1.00 0.00 ? 59  TYR A HH   4  
ATOM 7339  N N    . TYR A 1 60  ? -10.283 -1.205  0.709   1.00 0.00 ? 60  TYR A N    4  
ATOM 7340  C CA   . TYR A 1 60  ? -8.992  -1.759  0.338   1.00 0.00 ? 60  TYR A CA   4  
ATOM 7341  C C    . TYR A 1 60  ? -7.855  -0.821  0.747   1.00 0.00 ? 60  TYR A C    4  
ATOM 7342  O O    . TYR A 1 60  ? -7.644  0.215   0.118   1.00 0.00 ? 60  TYR A O    4  
ATOM 7343  C CB   . TYR A 1 60  ? -9.010  -1.886  -1.186  1.00 0.00 ? 60  TYR A CB   4  
ATOM 7344  C CG   . TYR A 1 60  ? -7.775  -2.577  -1.768  1.00 0.00 ? 60  TYR A CG   4  
ATOM 7345  C CD1  . TYR A 1 60  ? -6.592  -1.879  -1.900  1.00 0.00 ? 60  TYR A CD1  4  
ATOM 7346  C CD2  . TYR A 1 60  ? -7.844  -3.898  -2.160  1.00 0.00 ? 60  TYR A CD2  4  
ATOM 7347  C CE1  . TYR A 1 60  ? -5.429  -2.529  -2.447  1.00 0.00 ? 60  TYR A CE1  4  
ATOM 7348  C CE2  . TYR A 1 60  ? -6.682  -4.548  -2.707  1.00 0.00 ? 60  TYR A CE2  4  
ATOM 7349  C CZ   . TYR A 1 60  ? -5.532  -3.832  -2.824  1.00 0.00 ? 60  TYR A CZ   4  
ATOM 7350  O OH   . TYR A 1 60  ? -4.434  -4.446  -3.341  1.00 0.00 ? 60  TYR A OH   4  
ATOM 7351  H H    . TYR A 1 60  ? -10.502 -0.325  0.289   1.00 0.00 ? 60  TYR A H    4  
ATOM 7352  H HA   . TYR A 1 60  ? -8.873  -2.710  0.857   1.00 0.00 ? 60  TYR A HA   4  
ATOM 7353  H HB2  . TYR A 1 60  ? -9.899  -2.442  -1.484  1.00 0.00 ? 60  TYR A HB2  4  
ATOM 7354  H HB3  . TYR A 1 60  ? -9.096  -0.891  -1.622  1.00 0.00 ? 60  TYR A HB3  4  
ATOM 7355  H HD1  . TYR A 1 60  ? -6.537  -0.835  -1.590  1.00 0.00 ? 60  TYR A HD1  4  
ATOM 7356  H HD2  . TYR A 1 60  ? -8.779  -4.450  -2.056  1.00 0.00 ? 60  TYR A HD2  4  
ATOM 7357  H HE1  . TYR A 1 60  ? -4.489  -1.989  -2.557  1.00 0.00 ? 60  TYR A HE1  4  
ATOM 7358  H HE2  . TYR A 1 60  ? -6.723  -5.592  -3.021  1.00 0.00 ? 60  TYR A HE2  4  
ATOM 7359  H HH   . TYR A 1 60  ? -4.630  -5.412  -3.508  1.00 0.00 ? 60  TYR A HH   4  
ATOM 7360  N N    . LYS A 1 61  ? -7.153  -1.217  1.798   1.00 0.00 ? 61  LYS A N    4  
ATOM 7361  C CA   . LYS A 1 61  ? -6.042  -0.424  2.298   1.00 0.00 ? 61  LYS A CA   4  
ATOM 7362  C C    . LYS A 1 61  ? -4.739  -0.930  1.676   1.00 0.00 ? 61  LYS A C    4  
ATOM 7363  O O    . LYS A 1 61  ? -4.532  -2.137  1.556   1.00 0.00 ? 61  LYS A O    4  
ATOM 7364  C CB   . LYS A 1 61  ? -6.033  -0.421  3.828   1.00 0.00 ? 61  LYS A CB   4  
ATOM 7365  C CG   . LYS A 1 61  ? -6.121  1.006   4.374   1.00 0.00 ? 61  LYS A CG   4  
ATOM 7366  C CD   . LYS A 1 61  ? -4.809  1.760   4.151   1.00 0.00 ? 61  LYS A CD   4  
ATOM 7367  C CE   . LYS A 1 61  ? -4.335  2.428   5.443   1.00 0.00 ? 61  LYS A CE   4  
ATOM 7368  N NZ   . LYS A 1 61  ? -3.360  3.501   5.144   1.00 0.00 ? 61  LYS A NZ   4  
ATOM 7369  H H    . LYS A 1 61  ? -7.331  -2.061  2.304   1.00 0.00 ? 61  LYS A H    4  
ATOM 7370  H HA   . LYS A 1 61  ? -6.203  0.604   1.975   1.00 0.00 ? 61  LYS A HA   4  
ATOM 7371  H HB2  . LYS A 1 61  ? -6.870  -1.010  4.203   1.00 0.00 ? 61  LYS A HB2  4  
ATOM 7372  H HB3  . LYS A 1 61  ? -5.122  -0.897  4.191   1.00 0.00 ? 61  LYS A HB3  4  
ATOM 7373  H HG2  . LYS A 1 61  ? -6.938  1.536   3.884   1.00 0.00 ? 61  LYS A HG2  4  
ATOM 7374  H HG3  . LYS A 1 61  ? -6.353  0.978   5.439   1.00 0.00 ? 61  LYS A HG3  4  
ATOM 7375  H HD2  . LYS A 1 61  ? -4.045  1.071   3.792   1.00 0.00 ? 61  LYS A HD2  4  
ATOM 7376  H HD3  . LYS A 1 61  ? -4.947  2.515   3.377   1.00 0.00 ? 61  LYS A HD3  4  
ATOM 7377  H HE2  . LYS A 1 61  ? -5.188  2.843   5.980   1.00 0.00 ? 61  LYS A HE2  4  
ATOM 7378  H HE3  . LYS A 1 61  ? -3.877  1.685   6.097   1.00 0.00 ? 61  LYS A HE3  4  
ATOM 7379  H HZ1  . LYS A 1 61  ? -2.432  3.130   5.187   1.00 0.00 ? 61  LYS A HZ1  4  
ATOM 7380  H HZ2  . LYS A 1 61  ? -3.532  3.862   4.228   1.00 0.00 ? 61  LYS A HZ2  4  
ATOM 7381  H HZ3  . LYS A 1 61  ? -3.457  4.236   5.816   1.00 0.00 ? 61  LYS A HZ3  4  
ATOM 7382  N N    . LEU A 1 62  ? -3.895  0.018   1.297   1.00 0.00 ? 62  LEU A N    4  
ATOM 7383  C CA   . LEU A 1 62  ? -2.618  -0.317  0.690   1.00 0.00 ? 62  LEU A CA   4  
ATOM 7384  C C    . LEU A 1 62  ? -1.493  0.369   1.468   1.00 0.00 ? 62  LEU A C    4  
ATOM 7385  O O    . LEU A 1 62  ? -1.628  1.523   1.872   1.00 0.00 ? 62  LEU A O    4  
ATOM 7386  C CB   . LEU A 1 62  ? -2.629  0.022   -0.802  1.00 0.00 ? 62  LEU A CB   4  
ATOM 7387  C CG   . LEU A 1 62  ? -1.531  -0.630  -1.646  1.00 0.00 ? 62  LEU A CG   4  
ATOM 7388  C CD1  . LEU A 1 62  ? -1.833  -2.110  -1.889  1.00 0.00 ? 62  LEU A CD1  4  
ATOM 7389  C CD2  . LEU A 1 62  ? -1.318  0.134   -2.954  1.00 0.00 ? 62  LEU A CD2  4  
ATOM 7390  H H    . LEU A 1 62  ? -4.071  0.997   1.398   1.00 0.00 ? 62  LEU A H    4  
ATOM 7391  H HA   . LEU A 1 62  ? -2.488  -1.396  0.775   1.00 0.00 ? 62  LEU A HA   4  
ATOM 7392  H HB2  . LEU A 1 62  ? -3.596  -0.269  -1.213  1.00 0.00 ? 62  LEU A HB2  4  
ATOM 7393  H HB3  . LEU A 1 62  ? -2.548  1.103   -0.910  1.00 0.00 ? 62  LEU A HB3  4  
ATOM 7394  H HG   . LEU A 1 62  ? -0.596  -0.580  -1.088  1.00 0.00 ? 62  LEU A HG   4  
ATOM 7395  H HD11 . LEU A 1 62  ? -2.334  -2.527  -1.016  1.00 0.00 ? 62  LEU A HD11 4  
ATOM 7396  H HD12 . LEU A 1 62  ? -2.478  -2.211  -2.761  1.00 0.00 ? 62  LEU A HD12 4  
ATOM 7397  H HD13 . LEU A 1 62  ? -0.900  -2.647  -2.064  1.00 0.00 ? 62  LEU A HD13 4  
ATOM 7398  H HD21 . LEU A 1 62  ? -1.899  -0.336  -3.748  1.00 0.00 ? 62  LEU A HD21 4  
ATOM 7399  H HD22 . LEU A 1 62  ? -1.643  1.167   -2.828  1.00 0.00 ? 62  LEU A HD22 4  
ATOM 7400  H HD23 . LEU A 1 62  ? -0.261  0.115   -3.218  1.00 0.00 ? 62  LEU A HD23 4  
ATOM 7401  N N    . GLN A 1 63  ? -0.409  -0.369  1.654   1.00 0.00 ? 63  GLN A N    4  
ATOM 7402  C CA   . GLN A 1 63  ? 0.738   0.153   2.376   1.00 0.00 ? 63  GLN A CA   4  
ATOM 7403  C C    . GLN A 1 63  ? 2.013   -0.574  1.945   1.00 0.00 ? 63  GLN A C    4  
ATOM 7404  O O    . GLN A 1 63  ? 2.094   -1.798  2.036   1.00 0.00 ? 63  GLN A O    4  
ATOM 7405  C CB   . GLN A 1 63  ? 0.529   0.046   3.888   1.00 0.00 ? 63  GLN A CB   4  
ATOM 7406  C CG   . GLN A 1 63  ? -0.677  0.874   4.335   1.00 0.00 ? 63  GLN A CG   4  
ATOM 7407  C CD   . GLN A 1 63  ? -0.708  1.020   5.858   1.00 0.00 ? 63  GLN A CD   4  
ATOM 7408  O OE1  . GLN A 1 63  ? -1.558  0.475   6.543   1.00 0.00 ? 63  GLN A OE1  4  
ATOM 7409  N NE2  . GLN A 1 63  ? 0.265   1.783   6.348   1.00 0.00 ? 63  GLN A NE2  4  
ATOM 7410  H H    . GLN A 1 63  ? -0.308  -1.307  1.322   1.00 0.00 ? 63  GLN A H    4  
ATOM 7411  H HA   . GLN A 1 63  ? 0.800   1.206   2.098   1.00 0.00 ? 63  GLN A HA   4  
ATOM 7412  H HB2  . GLN A 1 63  ? 0.382   -0.998  4.165   1.00 0.00 ? 63  GLN A HB2  4  
ATOM 7413  H HB3  . GLN A 1 63  ? 1.424   0.390   4.408   1.00 0.00 ? 63  GLN A HB3  4  
ATOM 7414  H HG2  . GLN A 1 63  ? -0.638  1.860   3.873   1.00 0.00 ? 63  GLN A HG2  4  
ATOM 7415  H HG3  . GLN A 1 63  ? -1.596  0.397   3.994   1.00 0.00 ? 63  GLN A HG3  4  
ATOM 7416  H HE21 . GLN A 1 63  ? 0.932   2.200   5.731   1.00 0.00 ? 63  GLN A HE21 4  
ATOM 7417  H HE22 . GLN A 1 63  ? 0.330   1.939   7.334   1.00 0.00 ? 63  GLN A HE22 4  
ATOM 7418  N N    . LEU A 1 64  ? 2.977   0.210   1.486   1.00 0.00 ? 64  LEU A N    4  
ATOM 7419  C CA   . LEU A 1 64  ? 4.244   -0.344  1.041   1.00 0.00 ? 64  LEU A CA   4  
ATOM 7420  C C    . LEU A 1 64  ? 5.315   -0.073  2.100   1.00 0.00 ? 64  LEU A C    4  
ATOM 7421  O O    . LEU A 1 64  ? 5.811   1.047   2.215   1.00 0.00 ? 64  LEU A O    4  
ATOM 7422  C CB   . LEU A 1 64  ? 4.604   0.188   -0.347  1.00 0.00 ? 64  LEU A CB   4  
ATOM 7423  C CG   . LEU A 1 64  ? 6.019   -0.125  -0.840  1.00 0.00 ? 64  LEU A CG   4  
ATOM 7424  C CD1  . LEU A 1 64  ? 6.442   -1.536  -0.429  1.00 0.00 ? 64  LEU A CD1  4  
ATOM 7425  C CD2  . LEU A 1 64  ? 6.134   0.092   -2.350  1.00 0.00 ? 64  LEU A CD2  4  
ATOM 7426  H H    . LEU A 1 64  ? 2.903   1.205   1.416   1.00 0.00 ? 64  LEU A H    4  
ATOM 7427  H HA   . LEU A 1 64  ? 4.115   -1.423  0.949   1.00 0.00 ? 64  LEU A HA   4  
ATOM 7428  H HB2  . LEU A 1 64  ? 3.893   -0.217  -1.066  1.00 0.00 ? 64  LEU A HB2  4  
ATOM 7429  H HB3  . LEU A 1 64  ? 4.473   1.270   -0.345  1.00 0.00 ? 64  LEU A HB3  4  
ATOM 7430  H HG   . LEU A 1 64  ? 6.709   0.570   -0.361  1.00 0.00 ? 64  LEU A HG   4  
ATOM 7431  H HD11 . LEU A 1 64  ? 6.336   -1.648  0.650   1.00 0.00 ? 64  LEU A HD11 4  
ATOM 7432  H HD12 . LEU A 1 64  ? 5.810   -2.267  -0.934  1.00 0.00 ? 64  LEU A HD12 4  
ATOM 7433  H HD13 . LEU A 1 64  ? 7.483   -1.700  -0.711  1.00 0.00 ? 64  LEU A HD13 4  
ATOM 7434  H HD21 . LEU A 1 64  ? 5.373   -0.498  -2.861  1.00 0.00 ? 64  LEU A HD21 4  
ATOM 7435  H HD22 . LEU A 1 64  ? 5.988   1.148   -2.578  1.00 0.00 ? 64  LEU A HD22 4  
ATOM 7436  H HD23 . LEU A 1 64  ? 7.122   -0.220  -2.687  1.00 0.00 ? 64  LEU A HD23 4  
ATOM 7437  N N    . LEU A 1 65  ? 5.640   -1.118  2.848   1.00 0.00 ? 65  LEU A N    4  
ATOM 7438  C CA   . LEU A 1 65  ? 6.642   -1.006  3.894   1.00 0.00 ? 65  LEU A CA   4  
ATOM 7439  C C    . LEU A 1 65  ? 8.036   -1.052  3.265   1.00 0.00 ? 65  LEU A C    4  
ATOM 7440  O O    . LEU A 1 65  ? 8.253   -1.753  2.279   1.00 0.00 ? 65  LEU A O    4  
ATOM 7441  C CB   . LEU A 1 65  ? 6.417   -2.072  4.968   1.00 0.00 ? 65  LEU A CB   4  
ATOM 7442  C CG   . LEU A 1 65  ? 4.964   -2.305  5.388   1.00 0.00 ? 65  LEU A CG   4  
ATOM 7443  C CD1  . LEU A 1 65  ? 4.858   -3.468  6.376   1.00 0.00 ? 65  LEU A CD1  4  
ATOM 7444  C CD2  . LEU A 1 65  ? 4.342   -1.022  5.943   1.00 0.00 ? 65  LEU A CD2  4  
ATOM 7445  H H    . LEU A 1 65  ? 5.232   -2.025  2.749   1.00 0.00 ? 65  LEU A H    4  
ATOM 7446  H HA   . LEU A 1 65  ? 6.510   -0.035  4.371   1.00 0.00 ? 65  LEU A HA   4  
ATOM 7447  H HB2  . LEU A 1 65  ? 6.825   -3.016  4.607   1.00 0.00 ? 65  LEU A HB2  4  
ATOM 7448  H HB3  . LEU A 1 65  ? 6.990   -1.795  5.853   1.00 0.00 ? 65  LEU A HB3  4  
ATOM 7449  H HG   . LEU A 1 65  ? 4.393   -2.582  4.502   1.00 0.00 ? 65  LEU A HG   4  
ATOM 7450  H HD11 . LEU A 1 65  ? 3.981   -3.329  7.008   1.00 0.00 ? 65  LEU A HD11 4  
ATOM 7451  H HD12 . LEU A 1 65  ? 4.766   -4.405  5.827   1.00 0.00 ? 65  LEU A HD12 4  
ATOM 7452  H HD13 . LEU A 1 65  ? 5.753   -3.498  6.999   1.00 0.00 ? 65  LEU A HD13 4  
ATOM 7453  H HD21 . LEU A 1 65  ? 4.436   -0.224  5.207   1.00 0.00 ? 65  LEU A HD21 4  
ATOM 7454  H HD22 . LEU A 1 65  ? 3.287   -1.194  6.160   1.00 0.00 ? 65  LEU A HD22 4  
ATOM 7455  H HD23 . LEU A 1 65  ? 4.858   -0.735  6.859   1.00 0.00 ? 65  LEU A HD23 4  
ATOM 7456  N N    . GLU A 1 66  ? 8.945   -0.295  3.863   1.00 0.00 ? 66  GLU A N    4  
ATOM 7457  C CA   . GLU A 1 66  ? 10.312  -0.240  3.373   1.00 0.00 ? 66  GLU A CA   4  
ATOM 7458  C C    . GLU A 1 66  ? 11.291  -0.605  4.491   1.00 0.00 ? 66  GLU A C    4  
ATOM 7459  O O    . GLU A 1 66  ? 11.162  -0.124  5.616   1.00 0.00 ? 66  GLU A O    4  
ATOM 7460  C CB   . GLU A 1 66  ? 10.632  1.139   2.793   1.00 0.00 ? 66  GLU A CB   4  
ATOM 7461  C CG   . GLU A 1 66  ? 12.142  1.331   2.637   1.00 0.00 ? 66  GLU A CG   4  
ATOM 7462  C CD   . GLU A 1 66  ? 12.480  2.793   2.339   1.00 0.00 ? 66  GLU A CD   4  
ATOM 7463  O OE1  . GLU A 1 66  ? 11.927  3.660   3.050   1.00 0.00 ? 66  GLU A OE1  4  
ATOM 7464  O OE2  . GLU A 1 66  ? 13.285  3.011   1.408   1.00 0.00 ? 66  GLU A OE2  4  
ATOM 7465  H H    . GLU A 1 66  ? 8.760   0.273   4.665   1.00 0.00 ? 66  GLU A H    4  
ATOM 7466  H HA   . GLU A 1 66  ? 10.365  -0.983  2.578   1.00 0.00 ? 66  GLU A HA   4  
ATOM 7467  H HB2  . GLU A 1 66  ? 10.145  1.252   1.825   1.00 0.00 ? 66  GLU A HB2  4  
ATOM 7468  H HB3  . GLU A 1 66  ? 10.229  1.914   3.445   1.00 0.00 ? 66  GLU A HB3  4  
ATOM 7469  H HG2  . GLU A 1 66  ? 12.649  1.015   3.548   1.00 0.00 ? 66  GLU A HG2  4  
ATOM 7470  H HG3  . GLU A 1 66  ? 12.511  0.697   1.830   1.00 0.00 ? 66  GLU A HG3  4  
ATOM 7471  N N    . ASP A 1 67  ? 12.247  -1.453  4.143   1.00 0.00 ? 67  ASP A N    4  
ATOM 7472  C CA   . ASP A 1 67  ? 13.247  -1.889  5.103   1.00 0.00 ? 67  ASP A CA   4  
ATOM 7473  C C    . ASP A 1 67  ? 14.010  -0.670  5.627   1.00 0.00 ? 67  ASP A C    4  
ATOM 7474  O O    . ASP A 1 67  ? 14.291  0.261   4.874   1.00 0.00 ? 67  ASP A O    4  
ATOM 7475  C CB   . ASP A 1 67  ? 14.259  -2.835  4.454   1.00 0.00 ? 67  ASP A CB   4  
ATOM 7476  C CG   . ASP A 1 67  ? 14.631  -4.058  5.294   1.00 0.00 ? 67  ASP A CG   4  
ATOM 7477  O OD1  . ASP A 1 67  ? 14.269  -4.057  6.490   1.00 0.00 ? 67  ASP A OD1  4  
ATOM 7478  O OD2  . ASP A 1 67  ? 15.271  -4.967  4.721   1.00 0.00 ? 67  ASP A OD2  4  
ATOM 7479  H H    . ASP A 1 67  ? 12.345  -1.841  3.226   1.00 0.00 ? 67  ASP A H    4  
ATOM 7480  H HA   . ASP A 1 67  ? 12.689  -2.400  5.887   1.00 0.00 ? 67  ASP A HA   4  
ATOM 7481  H HB2  . ASP A 1 67  ? 13.854  -3.177  3.501   1.00 0.00 ? 67  ASP A HB2  4  
ATOM 7482  H HB3  . ASP A 1 67  ? 15.167  -2.276  4.232   1.00 0.00 ? 67  ASP A HB3  4  
ATOM 7483  N N    . ASP A 1 68  ? 14.321  -0.715  6.914   1.00 0.00 ? 68  ASP A N    4  
ATOM 7484  C CA   . ASP A 1 68  ? 15.045  0.374   7.547   1.00 0.00 ? 68  ASP A CA   4  
ATOM 7485  C C    . ASP A 1 68  ? 16.442  0.479   6.931   1.00 0.00 ? 68  ASP A C    4  
ATOM 7486  O O    . ASP A 1 68  ? 17.106  1.506   7.060   1.00 0.00 ? 68  ASP A O    4  
ATOM 7487  C CB   . ASP A 1 68  ? 15.208  0.127   9.049   1.00 0.00 ? 68  ASP A CB   4  
ATOM 7488  C CG   . ASP A 1 68  ? 15.491  1.379   9.882   1.00 0.00 ? 68  ASP A CG   4  
ATOM 7489  O OD1  . ASP A 1 68  ? 16.410  2.128   9.487   1.00 0.00 ? 68  ASP A OD1  4  
ATOM 7490  O OD2  . ASP A 1 68  ? 14.782  1.558   10.896  1.00 0.00 ? 68  ASP A OD2  4  
ATOM 7491  H H    . ASP A 1 68  ? 14.088  -1.476  7.519   1.00 0.00 ? 68  ASP A H    4  
ATOM 7492  H HA   . ASP A 1 68  ? 14.442  1.263   7.366   1.00 0.00 ? 68  ASP A HA   4  
ATOM 7493  H HB2  . ASP A 1 68  ? 14.300  -0.344  9.425   1.00 0.00 ? 68  ASP A HB2  4  
ATOM 7494  H HB3  . ASP A 1 68  ? 16.021  -0.583  9.199   1.00 0.00 ? 68  ASP A HB3  4  
ATOM 7495  N N    . LYS A 1 69  ? 16.847  -0.599  6.275   1.00 0.00 ? 69  LYS A N    4  
ATOM 7496  C CA   . LYS A 1 69  ? 18.152  -0.641  5.639   1.00 0.00 ? 69  LYS A CA   4  
ATOM 7497  C C    . LYS A 1 69  ? 17.973  -0.786  4.126   1.00 0.00 ? 69  LYS A C    4  
ATOM 7498  O O    . LYS A 1 69  ? 18.932  -1.066  3.408   1.00 0.00 ? 69  LYS A O    4  
ATOM 7499  C CB   . LYS A 1 69  ? 19.017  -1.737  6.263   1.00 0.00 ? 69  LYS A CB   4  
ATOM 7500  C CG   . LYS A 1 69  ? 19.879  -1.177  7.396   1.00 0.00 ? 69  LYS A CG   4  
ATOM 7501  C CD   . LYS A 1 69  ? 21.337  -1.615  7.245   1.00 0.00 ? 69  LYS A CD   4  
ATOM 7502  C CE   . LYS A 1 69  ? 21.883  -2.172  8.561   1.00 0.00 ? 69  LYS A CE   4  
ATOM 7503  N NZ   . LYS A 1 69  ? 23.362  -2.138  8.565   1.00 0.00 ? 69  LYS A NZ   4  
ATOM 7504  H H    . LYS A 1 69  ? 16.300  -1.431  6.175   1.00 0.00 ? 69  LYS A H    4  
ATOM 7505  H HA   . LYS A 1 69  ? 18.644  0.311   5.839   1.00 0.00 ? 69  LYS A HA   4  
ATOM 7506  H HB2  . LYS A 1 69  ? 18.381  -2.535  6.647   1.00 0.00 ? 69  LYS A HB2  4  
ATOM 7507  H HB3  . LYS A 1 69  ? 19.657  -2.180  5.500   1.00 0.00 ? 69  LYS A HB3  4  
ATOM 7508  H HG2  . LYS A 1 69  ? 19.821  -0.088  7.398   1.00 0.00 ? 69  LYS A HG2  4  
ATOM 7509  H HG3  . LYS A 1 69  ? 19.492  -1.518  8.356   1.00 0.00 ? 69  LYS A HG3  4  
ATOM 7510  H HD2  . LYS A 1 69  ? 21.414  -2.373  6.465   1.00 0.00 ? 69  LYS A HD2  4  
ATOM 7511  H HD3  . LYS A 1 69  ? 21.944  -0.767  6.925   1.00 0.00 ? 69  LYS A HD3  4  
ATOM 7512  H HE2  . LYS A 1 69  ? 21.497  -1.588  9.397   1.00 0.00 ? 69  LYS A HE2  4  
ATOM 7513  H HE3  . LYS A 1 69  ? 21.536  -3.196  8.701   1.00 0.00 ? 69  LYS A HE3  4  
ATOM 7514  H HZ1  . LYS A 1 69  ? 23.716  -3.062  8.709   1.00 0.00 ? 69  LYS A HZ1  4  
ATOM 7515  H HZ2  . LYS A 1 69  ? 23.690  -1.789  7.687   1.00 0.00 ? 69  LYS A HZ2  4  
ATOM 7516  H HZ3  . LYS A 1 69  ? 23.680  -1.541  9.301   1.00 0.00 ? 69  LYS A HZ3  4  
ATOM 7517  N N    . GLU A 1 70  ? 16.739  -0.589  3.687   1.00 0.00 ? 70  GLU A N    4  
ATOM 7518  C CA   . GLU A 1 70  ? 16.421  -0.695  2.273   1.00 0.00 ? 70  GLU A CA   4  
ATOM 7519  C C    . GLU A 1 70  ? 17.053  -1.956  1.680   1.00 0.00 ? 70  GLU A C    4  
ATOM 7520  O O    . GLU A 1 70  ? 18.211  -1.939  1.265   1.00 0.00 ? 70  GLU A O    4  
ATOM 7521  C CB   . GLU A 1 70  ? 16.876  0.554   1.515   1.00 0.00 ? 70  GLU A CB   4  
ATOM 7522  C CG   . GLU A 1 70  ? 16.378  1.826   2.205   1.00 0.00 ? 70  GLU A CG   4  
ATOM 7523  C CD   . GLU A 1 70  ? 17.487  2.877   2.282   1.00 0.00 ? 70  GLU A CD   4  
ATOM 7524  O OE1  . GLU A 1 70  ? 18.290  2.786   3.235   1.00 0.00 ? 70  GLU A OE1  4  
ATOM 7525  O OE2  . GLU A 1 70  ? 17.506  3.748   1.385   1.00 0.00 ? 70  GLU A OE2  4  
ATOM 7526  H H    . GLU A 1 70  ? 15.964  -0.362  4.278   1.00 0.00 ? 70  GLU A H    4  
ATOM 7527  H HA   . GLU A 1 70  ? 15.335  -0.767  2.224   1.00 0.00 ? 70  GLU A HA   4  
ATOM 7528  H HB2  . GLU A 1 70  ? 17.964  0.571   1.453   1.00 0.00 ? 70  GLU A HB2  4  
ATOM 7529  H HB3  . GLU A 1 70  ? 16.499  0.520   0.492   1.00 0.00 ? 70  GLU A HB3  4  
ATOM 7530  H HG2  . GLU A 1 70  ? 15.526  2.230   1.659   1.00 0.00 ? 70  GLU A HG2  4  
ATOM 7531  H HG3  . GLU A 1 70  ? 16.029  1.586   3.209   1.00 0.00 ? 70  GLU A HG3  4  
ATOM 7532  N N    . ASN A 1 71  ? 16.264  -3.020  1.659   1.00 0.00 ? 71  ASN A N    4  
ATOM 7533  C CA   . ASN A 1 71  ? 16.731  -4.288  1.124   1.00 0.00 ? 71  ASN A CA   4  
ATOM 7534  C C    . ASN A 1 71  ? 15.567  -5.280  1.084   1.00 0.00 ? 71  ASN A C    4  
ATOM 7535  O O    . ASN A 1 71  ? 15.348  -5.946  0.073   1.00 0.00 ? 71  ASN A O    4  
ATOM 7536  C CB   . ASN A 1 71  ? 17.831  -4.885  2.003   1.00 0.00 ? 71  ASN A CB   4  
ATOM 7537  C CG   . ASN A 1 71  ? 19.039  -5.304  1.162   1.00 0.00 ? 71  ASN A CG   4  
ATOM 7538  O OD1  . ASN A 1 71  ? 19.761  -4.486  0.615   1.00 0.00 ? 71  ASN A OD1  4  
ATOM 7539  N ND2  . ASN A 1 71  ? 19.217  -6.620  1.089   1.00 0.00 ? 71  ASN A ND2  4  
ATOM 7540  H H    . ASN A 1 71  ? 15.323  -3.026  1.998   1.00 0.00 ? 71  ASN A H    4  
ATOM 7541  H HA   . ASN A 1 71  ? 17.115  -4.055  0.130   1.00 0.00 ? 71  ASN A HA   4  
ATOM 7542  H HB2  . ASN A 1 71  ? 18.140  -4.155  2.751   1.00 0.00 ? 71  ASN A HB2  4  
ATOM 7543  H HB3  . ASN A 1 71  ? 17.442  -5.749  2.542   1.00 0.00 ? 71  ASN A HB3  4  
ATOM 7544  H HD21 . ASN A 1 71  ? 18.587  -7.236  1.562   1.00 0.00 ? 71  ASN A HD21 4  
ATOM 7545  H HD22 . ASN A 1 71  ? 19.980  -6.993  0.562   1.00 0.00 ? 71  ASN A HD22 4  
ATOM 7546  N N    . ARG A 1 72  ? 14.850  -5.347  2.196   1.00 0.00 ? 72  ARG A N    4  
ATOM 7547  C CA   . ARG A 1 72  ? 13.714  -6.247  2.301   1.00 0.00 ? 72  ARG A CA   4  
ATOM 7548  C C    . ARG A 1 72  ? 12.421  -5.449  2.484   1.00 0.00 ? 72  ARG A C    4  
ATOM 7549  O O    . ARG A 1 72  ? 12.284  -4.693  3.444   1.00 0.00 ? 72  ARG A O    4  
ATOM 7550  C CB   . ARG A 1 72  ? 13.881  -7.210  3.478   1.00 0.00 ? 72  ARG A CB   4  
ATOM 7551  C CG   . ARG A 1 72  ? 13.051  -8.479  3.270   1.00 0.00 ? 72  ARG A CG   4  
ATOM 7552  C CD   . ARG A 1 72  ? 13.335  -9.506  4.368   1.00 0.00 ? 72  ARG A CD   4  
ATOM 7553  N NE   . ARG A 1 72  ? 14.507  -10.330 3.999   1.00 0.00 ? 72  ARG A NE   4  
ATOM 7554  C CZ   . ARG A 1 72  ? 15.129  -11.170 4.839   1.00 0.00 ? 72  ARG A CZ   4  
ATOM 7555  N NH1  . ARG A 1 72  ? 14.695  -11.301 6.099   1.00 0.00 ? 72  ARG A NH1  4  
ATOM 7556  N NH2  . ARG A 1 72  ? 16.186  -11.878 4.417   1.00 0.00 ? 72  ARG A NH2  4  
ATOM 7557  H H    . ARG A 1 72  ? 15.035  -4.802  3.014   1.00 0.00 ? 72  ARG A H    4  
ATOM 7558  H HA   . ARG A 1 72  ? 13.706  -6.797  1.360   1.00 0.00 ? 72  ARG A HA   4  
ATOM 7559  H HB2  . ARG A 1 72  ? 14.933  -7.474  3.590   1.00 0.00 ? 72  ARG A HB2  4  
ATOM 7560  H HB3  . ARG A 1 72  ? 13.576  -6.719  4.401   1.00 0.00 ? 72  ARG A HB3  4  
ATOM 7561  H HG2  . ARG A 1 72  ? 11.991  -8.227  3.267   1.00 0.00 ? 72  ARG A HG2  4  
ATOM 7562  H HG3  . ARG A 1 72  ? 13.279  -8.911  2.295   1.00 0.00 ? 72  ARG A HG3  4  
ATOM 7563  H HD2  . ARG A 1 72  ? 13.521  -8.997  5.314   1.00 0.00 ? 72  ARG A HD2  4  
ATOM 7564  H HD3  . ARG A 1 72  ? 12.463  -10.143 4.515   1.00 0.00 ? 72  ARG A HD3  4  
ATOM 7565  H HE   . ARG A 1 72  ? 14.857  -10.256 3.066   1.00 0.00 ? 72  ARG A HE   4  
ATOM 7566  H HH11 . ARG A 1 72  ? 13.906  -10.772 6.414   1.00 0.00 ? 72  ARG A HH11 4  
ATOM 7567  H HH12 . ARG A 1 72  ? 15.159  -11.927 6.726   1.00 0.00 ? 72  ARG A HH12 4  
ATOM 7568  H HH21 . ARG A 1 72  ? 16.510  -11.780 3.476   1.00 0.00 ? 72  ARG A HH21 4  
ATOM 7569  H HH22 . ARG A 1 72  ? 16.650  -12.504 5.043   1.00 0.00 ? 72  ARG A HH22 4  
ATOM 7570  N N    . TYR A 1 73  ? 11.505  -5.646  1.547   1.00 0.00 ? 73  TYR A N    4  
ATOM 7571  C CA   . TYR A 1 73  ? 10.227  -4.955  1.593   1.00 0.00 ? 73  TYR A CA   4  
ATOM 7572  C C    . TYR A 1 73  ? 9.066   -5.951  1.621   1.00 0.00 ? 73  TYR A C    4  
ATOM 7573  O O    . TYR A 1 73  ? 9.250   -7.133  1.337   1.00 0.00 ? 73  TYR A O    4  
ATOM 7574  C CB   . TYR A 1 73  ? 10.147  -4.132  0.305   1.00 0.00 ? 73  TYR A CB   4  
ATOM 7575  C CG   . TYR A 1 73  ? 11.196  -3.023  0.209   1.00 0.00 ? 73  TYR A CG   4  
ATOM 7576  C CD1  . TYR A 1 73  ? 12.537  -3.344  0.154   1.00 0.00 ? 73  TYR A CD1  4  
ATOM 7577  C CD2  . TYR A 1 73  ? 10.801  -1.701  0.178   1.00 0.00 ? 73  TYR A CD2  4  
ATOM 7578  C CE1  . TYR A 1 73  ? 13.524  -2.299  0.064   1.00 0.00 ? 73  TYR A CE1  4  
ATOM 7579  C CE2  . TYR A 1 73  ? 11.788  -0.656  0.088   1.00 0.00 ? 73  TYR A CE2  4  
ATOM 7580  C CZ   . TYR A 1 73  ? 13.101  -1.007  0.035   1.00 0.00 ? 73  TYR A CZ   4  
ATOM 7581  O OH   . TYR A 1 73  ? 14.033  -0.021  -0.050  1.00 0.00 ? 73  TYR A OH   4  
ATOM 7582  H H    . TYR A 1 73  ? 11.624  -6.263  0.769   1.00 0.00 ? 73  TYR A H    4  
ATOM 7583  H HA   . TYR A 1 73  ? 10.203  -4.353  2.501   1.00 0.00 ? 73  TYR A HA   4  
ATOM 7584  H HB2  . TYR A 1 73  ? 10.261  -4.800  -0.548  1.00 0.00 ? 73  TYR A HB2  4  
ATOM 7585  H HB3  . TYR A 1 73  ? 9.155   -3.688  0.232   1.00 0.00 ? 73  TYR A HB3  4  
ATOM 7586  H HD1  . TYR A 1 73  ? 12.849  -4.388  0.179   1.00 0.00 ? 73  TYR A HD1  4  
ATOM 7587  H HD2  . TYR A 1 73  ? 9.742   -1.447  0.222   1.00 0.00 ? 73  TYR A HD2  4  
ATOM 7588  H HE1  . TYR A 1 73  ? 14.587  -2.539  0.020   1.00 0.00 ? 73  TYR A HE1  4  
ATOM 7589  H HE2  . TYR A 1 73  ? 11.490  0.392   0.062   1.00 0.00 ? 73  TYR A HE2  4  
ATOM 7590  H HH   . TYR A 1 73  ? 13.586  0.874   -0.044  1.00 0.00 ? 73  TYR A HH   4  
ATOM 7591  N N    . TRP A 1 74  ? 7.895   -5.435  1.966   1.00 0.00 ? 74  TRP A N    4  
ATOM 7592  C CA   . TRP A 1 74  ? 6.704   -6.264  2.036   1.00 0.00 ? 74  TRP A CA   4  
ATOM 7593  C C    . TRP A 1 74  ? 5.553   -5.493  1.387   1.00 0.00 ? 74  TRP A C    4  
ATOM 7594  O O    . TRP A 1 74  ? 5.566   -4.264  1.352   1.00 0.00 ? 74  TRP A O    4  
ATOM 7595  C CB   . TRP A 1 74  ? 6.407   -6.679  3.478   1.00 0.00 ? 74  TRP A CB   4  
ATOM 7596  C CG   . TRP A 1 74  ? 7.501   -7.539  4.116   1.00 0.00 ? 74  TRP A CG   4  
ATOM 7597  C CD1  . TRP A 1 74  ? 7.492   -8.862  4.326   1.00 0.00 ? 74  TRP A CD1  4  
ATOM 7598  C CD2  . TRP A 1 74  ? 8.772   -7.078  4.621   1.00 0.00 ? 74  TRP A CD2  4  
ATOM 7599  N NE1  . TRP A 1 74  ? 8.659   -9.287  4.927   1.00 0.00 ? 74  TRP A NE1  4  
ATOM 7600  C CE2  . TRP A 1 74  ? 9.462   -8.167  5.112   1.00 0.00 ? 74  TRP A CE2  4  
ATOM 7601  C CE3  . TRP A 1 74  ? 9.320   -5.784  4.661   1.00 0.00 ? 74  TRP A CE3  4  
ATOM 7602  C CZ2  . TRP A 1 74  ? 10.739  -8.073  5.679   1.00 0.00 ? 74  TRP A CZ2  4  
ATOM 7603  C CZ3  . TRP A 1 74  ? 10.596  -5.707  5.231   1.00 0.00 ? 74  TRP A CZ3  4  
ATOM 7604  C CH2  . TRP A 1 74  ? 11.305  -6.794  5.730   1.00 0.00 ? 74  TRP A CH2  4  
ATOM 7605  H H    . TRP A 1 74  ? 7.754   -4.472  2.196   1.00 0.00 ? 74  TRP A H    4  
ATOM 7606  H HA   . TRP A 1 74  ? 6.902   -7.179  1.477   1.00 0.00 ? 74  TRP A HA   4  
ATOM 7607  H HB2  . TRP A 1 74  ? 6.267   -5.782  4.082   1.00 0.00 ? 74  TRP A HB2  4  
ATOM 7608  H HB3  . TRP A 1 74  ? 5.467   -7.229  3.501   1.00 0.00 ? 74  TRP A HB3  4  
ATOM 7609  H HD1  . TRP A 1 74  ? 6.666   -9.521  4.056   1.00 0.00 ? 74  TRP A HD1  4  
ATOM 7610  H HE1  . TRP A 1 74  ? 8.906   -10.311 5.206   1.00 0.00 ? 74  TRP A HE1  4  
ATOM 7611  H HE3  . TRP A 1 74  ? 8.794   -4.908  4.280   1.00 0.00 ? 74  TRP A HE3  4  
ATOM 7612  H HZ2  . TRP A 1 74  ? 11.264  -8.949  6.060   1.00 0.00 ? 74  TRP A HZ2  4  
ATOM 7613  H HZ3  . TRP A 1 74  ? 11.068  -4.726  5.287   1.00 0.00 ? 74  TRP A HZ3  4  
ATOM 7614  H HH2  . TRP A 1 74  ? 12.296  -6.650  6.159   1.00 0.00 ? 74  TRP A HH2  4  
ATOM 7615  N N    . ILE A 1 75  ? 4.584   -6.247  0.888   1.00 0.00 ? 75  ILE A N    4  
ATOM 7616  C CA   . ILE A 1 75  ? 3.428   -5.650  0.242   1.00 0.00 ? 75  ILE A CA   4  
ATOM 7617  C C    . ILE A 1 75  ? 2.162   -6.044  1.007   1.00 0.00 ? 75  ILE A C    4  
ATOM 7618  O O    . ILE A 1 75  ? 1.669   -7.162  0.864   1.00 0.00 ? 75  ILE A O    4  
ATOM 7619  C CB   . ILE A 1 75  ? 3.391   -6.022  -1.241  1.00 0.00 ? 75  ILE A CB   4  
ATOM 7620  C CG1  . ILE A 1 75  ? 4.481   -5.282  -2.019  1.00 0.00 ? 75  ILE A CG1  4  
ATOM 7621  C CG2  . ILE A 1 75  ? 2.001   -5.781  -1.833  1.00 0.00 ? 75  ILE A CG2  4  
ATOM 7622  C CD1  . ILE A 1 75  ? 3.982   -3.918  -2.500  1.00 0.00 ? 75  ILE A CD1  4  
ATOM 7623  H H    . ILE A 1 75  ? 4.581   -7.247  0.921   1.00 0.00 ? 75  ILE A H    4  
ATOM 7624  H HA   . ILE A 1 75  ? 3.544   -4.568  0.301   1.00 0.00 ? 75  ILE A HA   4  
ATOM 7625  H HB   . ILE A 1 75  ? 3.599   -7.088  -1.331  1.00 0.00 ? 75  ILE A HB   4  
ATOM 7626  H HG12 . ILE A 1 75  ? 5.358   -5.149  -1.386  1.00 0.00 ? 75  ILE A HG12 4  
ATOM 7627  H HG13 . ILE A 1 75  ? 4.793   -5.882  -2.874  1.00 0.00 ? 75  ILE A HG13 4  
ATOM 7628  H HG21 . ILE A 1 75  ? 1.398   -6.683  -1.724  1.00 0.00 ? 75  ILE A HG21 4  
ATOM 7629  H HG22 . ILE A 1 75  ? 1.520   -4.957  -1.306  1.00 0.00 ? 75  ILE A HG22 4  
ATOM 7630  H HG23 . ILE A 1 75  ? 2.094   -5.532  -2.890  1.00 0.00 ? 75  ILE A HG23 4  
ATOM 7631  H HD11 . ILE A 1 75  ? 3.127   -3.611  -1.898  1.00 0.00 ? 75  ILE A HD11 4  
ATOM 7632  H HD12 . ILE A 1 75  ? 4.780   -3.183  -2.400  1.00 0.00 ? 75  ILE A HD12 4  
ATOM 7633  H HD13 . ILE A 1 75  ? 3.682   -3.989  -3.546  1.00 0.00 ? 75  ILE A HD13 4  
ATOM 7634  N N    . PHE A 1 76  ? 1.672   -5.103  1.801   1.00 0.00 ? 76  PHE A N    4  
ATOM 7635  C CA   . PHE A 1 76  ? 0.473   -5.338  2.588   1.00 0.00 ? 76  PHE A CA   4  
ATOM 7636  C C    . PHE A 1 76  ? -0.781  -4.938  1.808   1.00 0.00 ? 76  PHE A C    4  
ATOM 7637  O O    . PHE A 1 76  ? -0.792  -3.916  1.124   1.00 0.00 ? 76  PHE A O    4  
ATOM 7638  C CB   . PHE A 1 76  ? 0.582   -4.464  3.839   1.00 0.00 ? 76  PHE A CB   4  
ATOM 7639  C CG   . PHE A 1 76  ? -0.602  -4.602  4.798   1.00 0.00 ? 76  PHE A CG   4  
ATOM 7640  C CD1  . PHE A 1 76  ? -0.589  -5.562  5.762   1.00 0.00 ? 76  PHE A CD1  4  
ATOM 7641  C CD2  . PHE A 1 76  ? -1.668  -3.765  4.688   1.00 0.00 ? 76  PHE A CD2  4  
ATOM 7642  C CE1  . PHE A 1 76  ? -1.688  -5.690  6.652   1.00 0.00 ? 76  PHE A CE1  4  
ATOM 7643  C CE2  . PHE A 1 76  ? -2.767  -3.893  5.578   1.00 0.00 ? 76  PHE A CE2  4  
ATOM 7644  C CZ   . PHE A 1 76  ? -2.753  -4.853  6.542   1.00 0.00 ? 76  PHE A CZ   4  
ATOM 7645  H H    . PHE A 1 76  ? 2.079   -4.196  1.911   1.00 0.00 ? 76  PHE A H    4  
ATOM 7646  H HA   . PHE A 1 76  ? 0.436   -6.404  2.810   1.00 0.00 ? 76  PHE A HA   4  
ATOM 7647  H HB2  . PHE A 1 76  ? 1.498   -4.721  4.370   1.00 0.00 ? 76  PHE A HB2  4  
ATOM 7648  H HB3  . PHE A 1 76  ? 0.670   -3.421  3.535   1.00 0.00 ? 76  PHE A HB3  4  
ATOM 7649  H HD1  . PHE A 1 76  ? 0.265   -6.233  5.850   1.00 0.00 ? 76  PHE A HD1  4  
ATOM 7650  H HD2  . PHE A 1 76  ? -1.679  -2.995  3.916   1.00 0.00 ? 76  PHE A HD2  4  
ATOM 7651  H HE1  . PHE A 1 76  ? -1.677  -6.460  7.424   1.00 0.00 ? 76  PHE A HE1  4  
ATOM 7652  H HE2  . PHE A 1 76  ? -3.621  -3.221  5.490   1.00 0.00 ? 76  PHE A HE2  4  
ATOM 7653  H HZ   . PHE A 1 76  ? -3.597  -4.951  7.225   1.00 0.00 ? 76  PHE A HZ   4  
ATOM 7654  N N    . ARG A 1 77  ? -1.808  -5.765  1.938   1.00 0.00 ? 77  ARG A N    4  
ATOM 7655  C CA   . ARG A 1 77  ? -3.065  -5.510  1.255   1.00 0.00 ? 77  ARG A CA   4  
ATOM 7656  C C    . ARG A 1 77  ? -4.239  -6.005  2.101   1.00 0.00 ? 77  ARG A C    4  
ATOM 7657  O O    . ARG A 1 77  ? -4.381  -7.205  2.331   1.00 0.00 ? 77  ARG A O    4  
ATOM 7658  C CB   . ARG A 1 77  ? -3.100  -6.203  -0.109  1.00 0.00 ? 77  ARG A CB   4  
ATOM 7659  C CG   . ARG A 1 77  ? -1.698  -6.639  -0.539  1.00 0.00 ? 77  ARG A CG   4  
ATOM 7660  C CD   . ARG A 1 77  ? -1.755  -7.498  -1.804  1.00 0.00 ? 77  ARG A CD   4  
ATOM 7661  N NE   . ARG A 1 77  ? -0.526  -8.315  -1.916  1.00 0.00 ? 77  ARG A NE   4  
ATOM 7662  C CZ   . ARG A 1 77  ? -0.206  -9.047  -2.992  1.00 0.00 ? 77  ARG A CZ   4  
ATOM 7663  N NH1  . ARG A 1 77  ? -1.022  -9.069  -4.054  1.00 0.00 ? 77  ARG A NH1  4  
ATOM 7664  N NH2  . ARG A 1 77  ? 0.930   -9.757  -3.005  1.00 0.00 ? 77  ARG A NH2  4  
ATOM 7665  H H    . ARG A 1 77  ? -1.792  -6.594  2.497   1.00 0.00 ? 77  ARG A H    4  
ATOM 7666  H HA   . ARG A 1 77  ? -3.100  -4.428  1.130   1.00 0.00 ? 77  ARG A HA   4  
ATOM 7667  H HB2  . ARG A 1 77  ? -3.757  -7.072  -0.063  1.00 0.00 ? 77  ARG A HB2  4  
ATOM 7668  H HB3  . ARG A 1 77  ? -3.519  -5.526  -0.854  1.00 0.00 ? 77  ARG A HB3  4  
ATOM 7669  H HG2  . ARG A 1 77  ? -1.080  -5.759  -0.720  1.00 0.00 ? 77  ARG A HG2  4  
ATOM 7670  H HG3  . ARG A 1 77  ? -1.225  -7.201  0.266   1.00 0.00 ? 77  ARG A HG3  4  
ATOM 7671  H HD2  . ARG A 1 77  ? -2.631  -8.146  -1.774  1.00 0.00 ? 77  ARG A HD2  4  
ATOM 7672  H HD3  . ARG A 1 77  ? -1.859  -6.861  -2.682  1.00 0.00 ? 77  ARG A HD3  4  
ATOM 7673  H HE   . ARG A 1 77  ? 0.106   -8.321  -1.140  1.00 0.00 ? 77  ARG A HE   4  
ATOM 7674  H HH11 . ARG A 1 77  ? -1.870  -8.539  -4.044  1.00 0.00 ? 77  ARG A HH11 4  
ATOM 7675  H HH12 . ARG A 1 77  ? -0.784  -9.615  -4.857  1.00 0.00 ? 77  ARG A HH12 4  
ATOM 7676  H HH21 . ARG A 1 77  ? 1.539   -9.741  -2.212  1.00 0.00 ? 77  ARG A HH21 4  
ATOM 7677  H HH22 . ARG A 1 77  ? 1.169   -10.304 -3.808  1.00 0.00 ? 77  ARG A HH22 4  
ATOM 7678  N N    . SER A 1 78  ? -5.052  -5.056  2.541   1.00 0.00 ? 78  SER A N    4  
ATOM 7679  C CA   . SER A 1 78  ? -6.210  -5.380  3.357   1.00 0.00 ? 78  SER A CA   4  
ATOM 7680  C C    . SER A 1 78  ? -7.487  -5.263  2.523   1.00 0.00 ? 78  SER A C    4  
ATOM 7681  O O    . SER A 1 78  ? -7.642  -4.322  1.747   1.00 0.00 ? 78  SER A O    4  
ATOM 7682  C CB   . SER A 1 78  ? -6.291  -4.470  4.584   1.00 0.00 ? 78  SER A CB   4  
ATOM 7683  O OG   . SER A 1 78  ? -6.727  -3.156  4.246   1.00 0.00 ? 78  SER A OG   4  
ATOM 7684  H H    . SER A 1 78  ? -4.930  -4.082  2.350   1.00 0.00 ? 78  SER A H    4  
ATOM 7685  H HA   . SER A 1 78  ? -6.056  -6.410  3.679   1.00 0.00 ? 78  SER A HA   4  
ATOM 7686  H HB2  . SER A 1 78  ? -6.977  -4.904  5.312   1.00 0.00 ? 78  SER A HB2  4  
ATOM 7687  H HB3  . SER A 1 78  ? -5.313  -4.416  5.061   1.00 0.00 ? 78  SER A HB3  4  
ATOM 7688  H HG   . SER A 1 78  ? -6.095  -2.744  3.590   1.00 0.00 ? 78  SER A HG   4  
ATOM 7689  N N    . TRP A 1 79  ? -8.370  -6.233  2.712   1.00 0.00 ? 79  TRP A N    4  
ATOM 7690  C CA   . TRP A 1 79  ? -9.629  -6.251  1.987   1.00 0.00 ? 79  TRP A CA   4  
ATOM 7691  C C    . TRP A 1 79  ? -10.672 -6.942  2.867   1.00 0.00 ? 79  TRP A C    4  
ATOM 7692  O O    . TRP A 1 79  ? -10.331 -7.796  3.685   1.00 0.00 ? 79  TRP A O    4  
ATOM 7693  C CB   . TRP A 1 79  ? -9.464  -6.916  0.619   1.00 0.00 ? 79  TRP A CB   4  
ATOM 7694  C CG   . TRP A 1 79  ? -9.162  -8.414  0.689   1.00 0.00 ? 79  TRP A CG   4  
ATOM 7695  C CD1  . TRP A 1 79  ? -10.017 -9.419  0.924   1.00 0.00 ? 79  TRP A CD1  4  
ATOM 7696  C CD2  . TRP A 1 79  ? -7.873  -9.040  0.511   1.00 0.00 ? 79  TRP A CD2  4  
ATOM 7697  N NE1  . TRP A 1 79  ? -9.376  -10.642 0.910   1.00 0.00 ? 79  TRP A NE1  4  
ATOM 7698  C CE2  . TRP A 1 79  ? -8.032  -10.404 0.651   1.00 0.00 ? 79  TRP A CE2  4  
ATOM 7699  C CE3  . TRP A 1 79  ? -6.616  -8.473  0.240   1.00 0.00 ? 79  TRP A CE3  4  
ATOM 7700  C CZ2  . TRP A 1 79  ? -6.974  -11.314 0.538   1.00 0.00 ? 79  TRP A CZ2  4  
ATOM 7701  C CZ3  . TRP A 1 79  ? -5.569  -9.396  0.130   1.00 0.00 ? 79  TRP A CZ3  4  
ATOM 7702  C CH2  . TRP A 1 79  ? -5.712  -10.772 0.268   1.00 0.00 ? 79  TRP A CH2  4  
ATOM 7703  H H    . TRP A 1 79  ? -8.236  -6.995  3.345   1.00 0.00 ? 79  TRP A H    4  
ATOM 7704  H HA   . TRP A 1 79  ? -9.922  -5.217  1.804   1.00 0.00 ? 79  TRP A HA   4  
ATOM 7705  H HB2  . TRP A 1 79  ? -10.377 -6.767  0.042   1.00 0.00 ? 79  TRP A HB2  4  
ATOM 7706  H HB3  . TRP A 1 79  ? -8.660  -6.418  0.078   1.00 0.00 ? 79  TRP A HB3  4  
ATOM 7707  H HD1  . TRP A 1 79  ? -11.084 -9.287  1.103   1.00 0.00 ? 79  TRP A HD1  4  
ATOM 7708  H HE1  . TRP A 1 79  ? -9.840  -11.615 1.073   1.00 0.00 ? 79  TRP A HE1  4  
ATOM 7709  H HE3  . TRP A 1 79  ? -6.465  -7.399  0.125   1.00 0.00 ? 79  TRP A HE3  4  
ATOM 7710  H HZ2  . TRP A 1 79  ? -7.125  -12.387 0.653   1.00 0.00 ? 79  TRP A HZ2  4  
ATOM 7711  H HZ3  . TRP A 1 79  ? -4.572  -9.009  -0.080  1.00 0.00 ? 79  TRP A HZ3  4  
ATOM 7712  H HH2  . TRP A 1 79  ? -4.845  -11.425 0.168   1.00 0.00 ? 79  TRP A HH2  4  
ATOM 7713  N N    . GLY A 1 80  ? -11.921 -6.548  2.670   1.00 0.00 ? 80  GLY A N    4  
ATOM 7714  C CA   . GLY A 1 80  ? -13.016 -7.119  3.435   1.00 0.00 ? 80  GLY A CA   4  
ATOM 7715  C C    . GLY A 1 80  ? -14.051 -6.051  3.794   1.00 0.00 ? 80  GLY A C    4  
ATOM 7716  O O    . GLY A 1 80  ? -13.723 -4.868  3.879   1.00 0.00 ? 80  GLY A O    4  
ATOM 7717  H H    . GLY A 1 80  ? -12.189 -5.853  2.002   1.00 0.00 ? 80  GLY A H    4  
ATOM 7718  H HA2  . GLY A 1 80  ? -13.492 -7.913  2.859   1.00 0.00 ? 80  GLY A HA2  4  
ATOM 7719  H HA3  . GLY A 1 80  ? -12.628 -7.575  4.346   1.00 0.00 ? 80  GLY A HA3  4  
ATOM 7720  N N    . ARG A 1 81  ? -15.279 -6.506  3.993   1.00 0.00 ? 81  ARG A N    4  
ATOM 7721  C CA   . ARG A 1 81  ? -16.364 -5.603  4.340   1.00 0.00 ? 81  ARG A CA   4  
ATOM 7722  C C    . ARG A 1 81  ? -15.962 -4.720  5.523   1.00 0.00 ? 81  ARG A C    4  
ATOM 7723  O O    . ARG A 1 81  ? -15.150 -5.123  6.355   1.00 0.00 ? 81  ARG A O    4  
ATOM 7724  C CB   . ARG A 1 81  ? -17.632 -6.380  4.700   1.00 0.00 ? 81  ARG A CB   4  
ATOM 7725  C CG   . ARG A 1 81  ? -18.754 -6.090  3.701   1.00 0.00 ? 81  ARG A CG   4  
ATOM 7726  C CD   . ARG A 1 81  ? -18.888 -7.223  2.682   1.00 0.00 ? 81  ARG A CD   4  
ATOM 7727  N NE   . ARG A 1 81  ? -19.865 -8.225  3.165   1.00 0.00 ? 81  ARG A NE   4  
ATOM 7728  C CZ   . ARG A 1 81  ? -20.453 -9.139  2.381   1.00 0.00 ? 81  ARG A CZ   4  
ATOM 7729  N NH1  . ARG A 1 81  ? -20.167 -9.183  1.073   1.00 0.00 ? 81  ARG A NH1  4  
ATOM 7730  N NH2  . ARG A 1 81  ? -21.327 -10.009 2.906   1.00 0.00 ? 81  ARG A NH2  4  
ATOM 7731  H H    . ARG A 1 81  ? -15.537 -7.469  3.921   1.00 0.00 ? 81  ARG A H    4  
ATOM 7732  H HA   . ARG A 1 81  ? -16.528 -5.006  3.443   1.00 0.00 ? 81  ARG A HA   4  
ATOM 7733  H HB2  . ARG A 1 81  ? -17.418 -7.448  4.711   1.00 0.00 ? 81  ARG A HB2  4  
ATOM 7734  H HB3  . ARG A 1 81  ? -17.956 -6.109  5.705   1.00 0.00 ? 81  ARG A HB3  4  
ATOM 7735  H HG2  . ARG A 1 81  ? -19.697 -5.962  4.234   1.00 0.00 ? 81  ARG A HG2  4  
ATOM 7736  H HG3  . ARG A 1 81  ? -18.552 -5.152  3.183   1.00 0.00 ? 81  ARG A HG3  4  
ATOM 7737  H HD2  . ARG A 1 81  ? -19.210 -6.823  1.721   1.00 0.00 ? 81  ARG A HD2  4  
ATOM 7738  H HD3  . ARG A 1 81  ? -17.919 -7.696  2.522   1.00 0.00 ? 81  ARG A HD3  4  
ATOM 7739  H HE   . ARG A 1 81  ? -20.100 -8.220  4.137   1.00 0.00 ? 81  ARG A HE   4  
ATOM 7740  H HH11 . ARG A 1 81  ? -19.515 -8.534  0.681   1.00 0.00 ? 81  ARG A HH11 4  
ATOM 7741  H HH12 . ARG A 1 81  ? -20.606 -9.866  0.488   1.00 0.00 ? 81  ARG A HH12 4  
ATOM 7742  H HH21 . ARG A 1 81  ? -21.540 -9.976  3.882   1.00 0.00 ? 81  ARG A HH21 4  
ATOM 7743  H HH22 . ARG A 1 81  ? -21.765 -10.691 2.321   1.00 0.00 ? 81  ARG A HH22 4  
ATOM 7744  N N    . VAL A 1 82  ? -16.549 -3.533  5.561   1.00 0.00 ? 82  VAL A N    4  
ATOM 7745  C CA   . VAL A 1 82  ? -16.262 -2.590  6.628   1.00 0.00 ? 82  VAL A CA   4  
ATOM 7746  C C    . VAL A 1 82  ? -16.684 -3.198  7.967   1.00 0.00 ? 82  VAL A C    4  
ATOM 7747  O O    . VAL A 1 82  ? -15.846 -3.440  8.835   1.00 0.00 ? 82  VAL A O    4  
ATOM 7748  C CB   . VAL A 1 82  ? -16.942 -1.250  6.339   1.00 0.00 ? 82  VAL A CB   4  
ATOM 7749  C CG1  . VAL A 1 82  ? -17.024 -0.393  7.604   1.00 0.00 ? 82  VAL A CG1  4  
ATOM 7750  C CG2  . VAL A 1 82  ? -16.223 -0.502  5.215   1.00 0.00 ? 82  VAL A CG2  4  
ATOM 7751  H H    . VAL A 1 82  ? -17.208 -3.214  4.880   1.00 0.00 ? 82  VAL A H    4  
ATOM 7752  H HA   . VAL A 1 82  ? -15.185 -2.426  6.641   1.00 0.00 ? 82  VAL A HA   4  
ATOM 7753  H HB   . VAL A 1 82  ? -17.960 -1.455  6.008   1.00 0.00 ? 82  VAL A HB   4  
ATOM 7754  H HG11 . VAL A 1 82  ? -17.504 -0.963  8.399   1.00 0.00 ? 82  VAL A HG11 4  
ATOM 7755  H HG12 . VAL A 1 82  ? -16.018 -0.109  7.916   1.00 0.00 ? 82  VAL A HG12 4  
ATOM 7756  H HG13 . VAL A 1 82  ? -17.606 0.505   7.397   1.00 0.00 ? 82  VAL A HG13 4  
ATOM 7757  H HG21 . VAL A 1 82  ? -15.250 -0.162  5.568   1.00 0.00 ? 82  VAL A HG21 4  
ATOM 7758  H HG22 . VAL A 1 82  ? -16.088 -1.169  4.363   1.00 0.00 ? 82  VAL A HG22 4  
ATOM 7759  H HG23 . VAL A 1 82  ? -16.820 0.358   4.911   1.00 0.00 ? 82  VAL A HG23 4  
ATOM 7760  N N    . GLY A 1 83  ? -17.983 -3.427  8.094   1.00 0.00 ? 83  GLY A N    4  
ATOM 7761  C CA   . GLY A 1 83  ? -18.526 -4.002  9.312   1.00 0.00 ? 83  GLY A CA   4  
ATOM 7762  C C    . GLY A 1 83  ? -19.315 -5.278  9.012   1.00 0.00 ? 83  GLY A C    4  
ATOM 7763  O O    . GLY A 1 83  ? -20.542 -5.290  9.101   1.00 0.00 ? 83  GLY A O    4  
ATOM 7764  H H    . GLY A 1 83  ? -18.658 -3.227  7.383   1.00 0.00 ? 83  GLY A H    4  
ATOM 7765  H HA2  . GLY A 1 83  ? -17.716 -4.226  10.006  1.00 0.00 ? 83  GLY A HA2  4  
ATOM 7766  H HA3  . GLY A 1 83  ? -19.175 -3.277  9.803   1.00 0.00 ? 83  GLY A HA3  4  
ATOM 7767  N N    . THR A 1 84  ? -18.578 -6.323  8.664   1.00 0.00 ? 84  THR A N    4  
ATOM 7768  C CA   . THR A 1 84  ? -19.193 -7.601  8.350   1.00 0.00 ? 84  THR A CA   4  
ATOM 7769  C C    . THR A 1 84  ? -18.292 -8.752  8.802   1.00 0.00 ? 84  THR A C    4  
ATOM 7770  O O    . THR A 1 84  ? -17.335 -8.541  9.546   1.00 0.00 ? 84  THR A O    4  
ATOM 7771  C CB   . THR A 1 84  ? -19.501 -7.623  6.851   1.00 0.00 ? 84  THR A CB   4  
ATOM 7772  O OG1  . THR A 1 84  ? -19.993 -6.314  6.579   1.00 0.00 ? 84  THR A OG1  4  
ATOM 7773  C CG2  . THR A 1 84  ? -20.676 -8.541  6.508   1.00 0.00 ? 84  THR A CG2  4  
ATOM 7774  H H    . THR A 1 84  ? -17.581 -6.306  8.594   1.00 0.00 ? 84  THR A H    4  
ATOM 7775  H HA   . THR A 1 84  ? -20.123 -7.683  8.914   1.00 0.00 ? 84  THR A HA   4  
ATOM 7776  H HB   . THR A 1 84  ? -18.615 -7.892  6.276   1.00 0.00 ? 84  THR A HB   4  
ATOM 7777  H HG1  . THR A 1 84  ? -20.897 -6.195  6.990   1.00 0.00 ? 84  THR A HG1  4  
ATOM 7778  H HG21 . THR A 1 84  ? -20.334 -9.336  5.845   1.00 0.00 ? 84  THR A HG21 4  
ATOM 7779  H HG22 . THR A 1 84  ? -21.075 -8.978  7.424   1.00 0.00 ? 84  THR A HG22 4  
ATOM 7780  H HG23 . THR A 1 84  ? -21.455 -7.963  6.011   1.00 0.00 ? 84  THR A HG23 4  
ATOM 7781  N N    . VAL A 1 85  ? -18.629 -9.945  8.333   1.00 0.00 ? 85  VAL A N    4  
ATOM 7782  C CA   . VAL A 1 85  ? -17.862 -11.129 8.680   1.00 0.00 ? 85  VAL A CA   4  
ATOM 7783  C C    . VAL A 1 85  ? -16.590 -11.174 7.831   1.00 0.00 ? 85  VAL A C    4  
ATOM 7784  O O    . VAL A 1 85  ? -15.567 -11.700 8.267   1.00 0.00 ? 85  VAL A O    4  
ATOM 7785  C CB   . VAL A 1 85  ? -18.730 -12.379 8.523   1.00 0.00 ? 85  VAL A CB   4  
ATOM 7786  C CG1  . VAL A 1 85  ? -19.999 -12.276 9.371   1.00 0.00 ? 85  VAL A CG1  4  
ATOM 7787  C CG2  . VAL A 1 85  ? -19.072 -12.628 7.052   1.00 0.00 ? 85  VAL A CG2  4  
ATOM 7788  H H    . VAL A 1 85  ? -19.409 -10.108 7.729   1.00 0.00 ? 85  VAL A H    4  
ATOM 7789  H HA   . VAL A 1 85  ? -17.581 -11.043 9.729   1.00 0.00 ? 85  VAL A HA   4  
ATOM 7790  H HB   . VAL A 1 85  ? -18.156 -13.233 8.882   1.00 0.00 ? 85  VAL A HB   4  
ATOM 7791  H HG11 . VAL A 1 85  ? -20.719 -13.025 9.041   1.00 0.00 ? 85  VAL A HG11 4  
ATOM 7792  H HG12 . VAL A 1 85  ? -19.751 -12.446 10.418  1.00 0.00 ? 85  VAL A HG12 4  
ATOM 7793  H HG13 . VAL A 1 85  ? -20.432 -11.282 9.257   1.00 0.00 ? 85  VAL A HG13 4  
ATOM 7794  H HG21 . VAL A 1 85  ? -18.598 -13.551 6.720   1.00 0.00 ? 85  VAL A HG21 4  
ATOM 7795  H HG22 . VAL A 1 85  ? -20.153 -12.714 6.940   1.00 0.00 ? 85  VAL A HG22 4  
ATOM 7796  H HG23 . VAL A 1 85  ? -18.709 -11.795 6.449   1.00 0.00 ? 85  VAL A HG23 4  
ATOM 7797  N N    . ILE A 1 86  ? -16.695 -10.615 6.634   1.00 0.00 ? 86  ILE A N    4  
ATOM 7798  C CA   . ILE A 1 86  ? -15.566 -10.585 5.721   1.00 0.00 ? 86  ILE A CA   4  
ATOM 7799  C C    . ILE A 1 86  ? -14.473 -9.682  6.297   1.00 0.00 ? 86  ILE A C    4  
ATOM 7800  O O    . ILE A 1 86  ? -14.766 -8.630  6.863   1.00 0.00 ? 86  ILE A O    4  
ATOM 7801  C CB   . ILE A 1 86  ? -16.022 -10.179 4.318   1.00 0.00 ? 86  ILE A CB   4  
ATOM 7802  C CG1  . ILE A 1 86  ? -17.109 -11.123 3.801   1.00 0.00 ? 86  ILE A CG1  4  
ATOM 7803  C CG2  . ILE A 1 86  ? -14.834 -10.093 3.358   1.00 0.00 ? 86  ILE A CG2  4  
ATOM 7804  C CD1  . ILE A 1 86  ? -17.611 -10.680 2.425   1.00 0.00 ? 86  ILE A CD1  4  
ATOM 7805  H H    . ILE A 1 86  ? -17.531 -10.189 6.288   1.00 0.00 ? 86  ILE A H    4  
ATOM 7806  H HA   . ILE A 1 86  ? -15.174 -11.600 5.651   1.00 0.00 ? 86  ILE A HA   4  
ATOM 7807  H HB   . ILE A 1 86  ? -16.462 -9.183  4.377   1.00 0.00 ? 86  ILE A HB   4  
ATOM 7808  H HG12 . ILE A 1 86  ? -16.716 -12.138 3.739   1.00 0.00 ? 86  ILE A HG12 4  
ATOM 7809  H HG13 . ILE A 1 86  ? -17.941 -11.146 4.505   1.00 0.00 ? 86  ILE A HG13 4  
ATOM 7810  H HG21 . ILE A 1 86  ? -15.123 -9.528  2.472   1.00 0.00 ? 86  ILE A HG21 4  
ATOM 7811  H HG22 . ILE A 1 86  ? -14.003 -9.590  3.853   1.00 0.00 ? 86  ILE A HG22 4  
ATOM 7812  H HG23 . ILE A 1 86  ? -14.529 -11.097 3.066   1.00 0.00 ? 86  ILE A HG23 4  
ATOM 7813  H HD11 . ILE A 1 86  ? -17.155 -11.302 1.654   1.00 0.00 ? 86  ILE A HD11 4  
ATOM 7814  H HD12 . ILE A 1 86  ? -18.695 -10.785 2.382   1.00 0.00 ? 86  ILE A HD12 4  
ATOM 7815  H HD13 . ILE A 1 86  ? -17.340 -9.637  2.258   1.00 0.00 ? 86  ILE A HD13 4  
ATOM 7816  N N    . GLY A 1 87  ? -13.236 -10.127 6.134   1.00 0.00 ? 87  GLY A N    4  
ATOM 7817  C CA   . GLY A 1 87  ? -12.098 -9.372  6.631   1.00 0.00 ? 87  GLY A CA   4  
ATOM 7818  C C    . GLY A 1 87  ? -10.829 -10.228 6.628   1.00 0.00 ? 87  GLY A C    4  
ATOM 7819  O O    . GLY A 1 87  ? -10.705 -11.162 7.418   1.00 0.00 ? 87  GLY A O    4  
ATOM 7820  H H    . GLY A 1 87  ? -13.006 -10.984 5.672   1.00 0.00 ? 87  GLY A H    4  
ATOM 7821  H HA2  . GLY A 1 87  ? -11.945 -8.487  6.012   1.00 0.00 ? 87  GLY A HA2  4  
ATOM 7822  H HA3  . GLY A 1 87  ? -12.303 -9.022  7.643   1.00 0.00 ? 87  GLY A HA3  4  
ATOM 7823  N N    . SER A 1 88  ? -9.919  -9.877  5.731   1.00 0.00 ? 88  SER A N    4  
ATOM 7824  C CA   . SER A 1 88  ? -8.665  -10.601 5.615   1.00 0.00 ? 88  SER A CA   4  
ATOM 7825  C C    . SER A 1 88  ? -7.571  -9.671  5.088   1.00 0.00 ? 88  SER A C    4  
ATOM 7826  O O    . SER A 1 88  ? -7.861  -8.583  4.592   1.00 0.00 ? 88  SER A O    4  
ATOM 7827  C CB   . SER A 1 88  ? -8.814  -11.818 4.700   1.00 0.00 ? 88  SER A CB   4  
ATOM 7828  O OG   . SER A 1 88  ? -9.116  -13.003 5.431   1.00 0.00 ? 88  SER A OG   4  
ATOM 7829  H H    . SER A 1 88  ? -10.028 -9.115  5.092   1.00 0.00 ? 88  SER A H    4  
ATOM 7830  H HA   . SER A 1 88  ? -8.430  -10.934 6.626   1.00 0.00 ? 88  SER A HA   4  
ATOM 7831  H HB2  . SER A 1 88  ? -9.603  -11.630 3.972   1.00 0.00 ? 88  SER A HB2  4  
ATOM 7832  H HB3  . SER A 1 88  ? -7.891  -11.964 4.138   1.00 0.00 ? 88  SER A HB3  4  
ATOM 7833  H HG   . SER A 1 88  ? -10.017 -13.347 5.168   1.00 0.00 ? 88  SER A HG   4  
ATOM 7834  N N    . ASN A 1 89  ? -6.335  -10.133 5.212   1.00 0.00 ? 89  ASN A N    4  
ATOM 7835  C CA   . ASN A 1 89  ? -5.196  -9.356  4.754   1.00 0.00 ? 89  ASN A CA   4  
ATOM 7836  C C    . ASN A 1 89  ? -4.190  -10.286 4.074   1.00 0.00 ? 89  ASN A C    4  
ATOM 7837  O O    . ASN A 1 89  ? -4.401  -11.496 4.013   1.00 0.00 ? 89  ASN A O    4  
ATOM 7838  C CB   . ASN A 1 89  ? -4.490  -8.670  5.926   1.00 0.00 ? 89  ASN A CB   4  
ATOM 7839  C CG   . ASN A 1 89  ? -3.932  -9.701  6.909   1.00 0.00 ? 89  ASN A CG   4  
ATOM 7840  O OD1  . ASN A 1 89  ? -2.734  -9.901  7.026   1.00 0.00 ? 89  ASN A OD1  4  
ATOM 7841  N ND2  . ASN A 1 89  ? -4.865  -10.343 7.606   1.00 0.00 ? 89  ASN A ND2  4  
ATOM 7842  H H    . ASN A 1 89  ? -6.107  -11.019 5.616   1.00 0.00 ? 89  ASN A H    4  
ATOM 7843  H HA   . ASN A 1 89  ? -5.610  -8.617  4.068   1.00 0.00 ? 89  ASN A HA   4  
ATOM 7844  H HB2  . ASN A 1 89  ? -3.680  -8.044  5.551   1.00 0.00 ? 89  ASN A HB2  4  
ATOM 7845  H HB3  . ASN A 1 89  ? -5.189  -8.012  6.441   1.00 0.00 ? 89  ASN A HB3  4  
ATOM 7846  H HD21 . ASN A 1 89  ? -5.831  -10.132 7.462   1.00 0.00 ? 89  ASN A HD21 4  
ATOM 7847  H HD22 . ASN A 1 89  ? -4.599  -11.038 8.276   1.00 0.00 ? 89  ASN A HD22 4  
ATOM 7848  N N    . LYS A 1 90  ? -3.117  -9.686  3.581   1.00 0.00 ? 90  LYS A N    4  
ATOM 7849  C CA   . LYS A 1 90  ? -2.077  -10.445 2.908   1.00 0.00 ? 90  LYS A CA   4  
ATOM 7850  C C    . LYS A 1 90  ? -0.730  -9.748  3.109   1.00 0.00 ? 90  LYS A C    4  
ATOM 7851  O O    . LYS A 1 90  ? -0.643  -8.523  3.030   1.00 0.00 ? 90  LYS A O    4  
ATOM 7852  C CB   . LYS A 1 90  ? -2.441  -10.667 1.438   1.00 0.00 ? 90  LYS A CB   4  
ATOM 7853  C CG   . LYS A 1 90  ? -1.236  -11.177 0.646   1.00 0.00 ? 90  LYS A CG   4  
ATOM 7854  C CD   . LYS A 1 90  ? -1.654  -12.258 -0.353  1.00 0.00 ? 90  LYS A CD   4  
ATOM 7855  C CE   . LYS A 1 90  ? -1.967  -11.649 -1.721  1.00 0.00 ? 90  LYS A CE   4  
ATOM 7856  N NZ   . LYS A 1 90  ? -2.462  -12.689 -2.651  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 7857  H H    . LYS A 1 90  ? -2.952  -8.701  3.635   1.00 0.00 ? 90  LYS A H    4  
ATOM 7858  H HA   . LYS A 1 90  ? -2.032  -11.427 3.380   1.00 0.00 ? 90  LYS A HA   4  
ATOM 7859  H HB2  . LYS A 1 90  ? -3.258  -11.384 1.366   1.00 0.00 ? 90  LYS A HB2  4  
ATOM 7860  H HB3  . LYS A 1 90  ? -2.798  -9.733  1.004   1.00 0.00 ? 90  LYS A HB3  4  
ATOM 7861  H HG2  . LYS A 1 90  ? -0.768  -10.348 0.115   1.00 0.00 ? 90  LYS A HG2  4  
ATOM 7862  H HG3  . LYS A 1 90  ? -0.489  -11.579 1.331   1.00 0.00 ? 90  LYS A HG3  4  
ATOM 7863  H HD2  . LYS A 1 90  ? -0.857  -12.995 -0.453  1.00 0.00 ? 90  LYS A HD2  4  
ATOM 7864  H HD3  . LYS A 1 90  ? -2.531  -12.786 0.023   1.00 0.00 ? 90  LYS A HD3  4  
ATOM 7865  H HE2  . LYS A 1 90  ? -2.715  -10.863 -1.614  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 7866  H HE3  . LYS A 1 90  ? -1.071  -11.183 -2.132  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 7867  H HZ1  . LYS A 1 90  ? -2.192  -13.591 -2.316  1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 7868  H HZ2  . LYS A 1 90  ? -3.459  -12.639 -2.706  1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 7869  H HZ3  . LYS A 1 90  ? -2.070  -12.539 -3.558  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 7870  N N    . LEU A 1 91  ? 0.287   -10.557 3.366   1.00 0.00 ? 91  LEU A N    4  
ATOM 7871  C CA   . LEU A 1 91  ? 1.625   -10.033 3.579   1.00 0.00 ? 91  LEU A CA   4  
ATOM 7872  C C    . LEU A 1 91  ? 2.632   -10.889 2.808   1.00 0.00 ? 91  LEU A C    4  
ATOM 7873  O O    . LEU A 1 91  ? 2.822   -12.063 3.120   1.00 0.00 ? 91  LEU A O    4  
ATOM 7874  C CB   . LEU A 1 91  ? 1.927   -9.927  5.076   1.00 0.00 ? 91  LEU A CB   4  
ATOM 7875  C CG   . LEU A 1 91  ? 3.252   -9.259  5.447   1.00 0.00 ? 91  LEU A CG   4  
ATOM 7876  C CD1  . LEU A 1 91  ? 3.150   -7.737  5.333   1.00 0.00 ? 91  LEU A CD1  4  
ATOM 7877  C CD2  . LEU A 1 91  ? 3.718   -9.700  6.836   1.00 0.00 ? 91  LEU A CD2  4  
ATOM 7878  H H    . LEU A 1 91  ? 0.208   -11.552 3.429   1.00 0.00 ? 91  LEU A H    4  
ATOM 7879  H HA   . LEU A 1 91  ? 1.649   -9.022  3.173   1.00 0.00 ? 91  LEU A HA   4  
ATOM 7880  H HB2  . LEU A 1 91  ? 1.118   -9.372  5.551   1.00 0.00 ? 91  LEU A HB2  4  
ATOM 7881  H HB3  . LEU A 1 91  ? 1.917   -10.931 5.500   1.00 0.00 ? 91  LEU A HB3  4  
ATOM 7882  H HG   . LEU A 1 91  ? 4.010   -9.585  4.735   1.00 0.00 ? 91  LEU A HG   4  
ATOM 7883  H HD11 . LEU A 1 91  ? 3.007   -7.307  6.324   1.00 0.00 ? 91  LEU A HD11 4  
ATOM 7884  H HD12 . LEU A 1 91  ? 4.068   -7.343  4.895   1.00 0.00 ? 91  LEU A HD12 4  
ATOM 7885  H HD13 . LEU A 1 91  ? 2.304   -7.476  4.698   1.00 0.00 ? 91  LEU A HD13 4  
ATOM 7886  H HD21 . LEU A 1 91  ? 4.799   -9.583  6.911   1.00 0.00 ? 91  LEU A HD21 4  
ATOM 7887  H HD22 . LEU A 1 91  ? 3.233   -9.085  7.594   1.00 0.00 ? 91  LEU A HD22 4  
ATOM 7888  H HD23 . LEU A 1 91  ? 3.454   -10.746 6.993   1.00 0.00 ? 91  LEU A HD23 4  
ATOM 7889  N N    . GLU A 1 92  ? 3.252   -10.267 1.816   1.00 0.00 ? 92  GLU A N    4  
ATOM 7890  C CA   . GLU A 1 92  ? 4.235   -10.956 0.998   1.00 0.00 ? 92  GLU A CA   4  
ATOM 7891  C C    . GLU A 1 92  ? 5.564   -10.200 1.015   1.00 0.00 ? 92  GLU A C    4  
ATOM 7892  O O    . GLU A 1 92  ? 5.583   -8.971  1.069   1.00 0.00 ? 92  GLU A O    4  
ATOM 7893  C CB   . GLU A 1 92  ? 3.726   -11.139 -0.433  1.00 0.00 ? 92  GLU A CB   4  
ATOM 7894  C CG   . GLU A 1 92  ? 2.670   -12.243 -0.503  1.00 0.00 ? 92  GLU A CG   4  
ATOM 7895  C CD   . GLU A 1 92  ? 3.031   -13.281 -1.568  1.00 0.00 ? 92  GLU A CD   4  
ATOM 7896  O OE1  . GLU A 1 92  ? 4.130   -13.863 -1.443  1.00 0.00 ? 92  GLU A OE1  4  
ATOM 7897  O OE2  . GLU A 1 92  ? 2.200   -13.469 -2.483  1.00 0.00 ? 92  GLU A OE2  4  
ATOM 7898  H H    . GLU A 1 92  ? 3.092   -9.311  1.569   1.00 0.00 ? 92  GLU A H    4  
ATOM 7899  H HA   . GLU A 1 92  ? 4.360   -11.936 1.460   1.00 0.00 ? 92  GLU A HA   4  
ATOM 7900  H HB2  . GLU A 1 92  ? 3.302   -10.202 -0.795  1.00 0.00 ? 92  GLU A HB2  4  
ATOM 7901  H HB3  . GLU A 1 92  ? 4.559   -11.386 -1.091  1.00 0.00 ? 92  GLU A HB3  4  
ATOM 7902  H HG2  . GLU A 1 92  ? 2.582   -12.729 0.468   1.00 0.00 ? 92  GLU A HG2  4  
ATOM 7903  H HG3  . GLU A 1 92  ? 1.697   -11.807 -0.731  1.00 0.00 ? 92  GLU A HG3  4  
ATOM 7904  N N    . GLN A 1 93  ? 6.645   -10.965 0.967   1.00 0.00 ? 93  GLN A N    4  
ATOM 7905  C CA   . GLN A 1 93  ? 7.976   -10.383 0.977   1.00 0.00 ? 93  GLN A CA   4  
ATOM 7906  C C    . GLN A 1 93  ? 8.477   -10.181 -0.455  1.00 0.00 ? 93  GLN A C    4  
ATOM 7907  O O    . GLN A 1 93  ? 8.631   -11.144 -1.204  1.00 0.00 ? 93  GLN A O    4  
ATOM 7908  C CB   . GLN A 1 93  ? 8.948   -11.248 1.781   1.00 0.00 ? 93  GLN A CB   4  
ATOM 7909  C CG   . GLN A 1 93  ? 10.291  -10.539 1.964   1.00 0.00 ? 93  GLN A CG   4  
ATOM 7910  C CD   . GLN A 1 93  ? 11.453  -11.455 1.573   1.00 0.00 ? 93  GLN A CD   4  
ATOM 7911  O OE1  . GLN A 1 93  ? 11.928  -11.452 0.450   1.00 0.00 ? 93  GLN A OE1  4  
ATOM 7912  N NE2  . GLN A 1 93  ? 11.881  -12.236 2.561   1.00 0.00 ? 93  GLN A NE2  4  
ATOM 7913  H H    . GLN A 1 93  ? 6.621   -11.964 0.923   1.00 0.00 ? 93  GLN A H    4  
ATOM 7914  H HA   . GLN A 1 93  ? 7.866   -9.417  1.470   1.00 0.00 ? 93  GLN A HA   4  
ATOM 7915  H HB2  . GLN A 1 93  ? 8.516   -11.476 2.756   1.00 0.00 ? 93  GLN A HB2  4  
ATOM 7916  H HB3  . GLN A 1 93  ? 9.101   -12.199 1.271   1.00 0.00 ? 93  GLN A HB3  4  
ATOM 7917  H HG2  . GLN A 1 93  ? 10.315  -9.635  1.356   1.00 0.00 ? 93  GLN A HG2  4  
ATOM 7918  H HG3  . GLN A 1 93  ? 10.403  -10.227 3.003   1.00 0.00 ? 93  GLN A HG3  4  
ATOM 7919  H HE21 . GLN A 1 93  ? 11.447  -12.189 3.460   1.00 0.00 ? 93  GLN A HE21 4  
ATOM 7920  H HE22 . GLN A 1 93  ? 12.638  -12.871 2.403   1.00 0.00 ? 93  GLN A HE22 4  
ATOM 7921  N N    . MET A 1 94  ? 8.717   -8.922  -0.792  1.00 0.00 ? 94  MET A N    4  
ATOM 7922  C CA   . MET A 1 94  ? 9.198   -8.582  -2.120  1.00 0.00 ? 94  MET A CA   4  
ATOM 7923  C C    . MET A 1 94  ? 10.701  -8.842  -2.243  1.00 0.00 ? 94  MET A C    4  
ATOM 7924  O O    . MET A 1 94  ? 11.427  -8.784  -1.253  1.00 0.00 ? 94  MET A O    4  
ATOM 7925  C CB   . MET A 1 94  ? 8.910   -7.107  -2.405  1.00 0.00 ? 94  MET A CB   4  
ATOM 7926  C CG   . MET A 1 94  ? 7.475   -6.913  -2.899  1.00 0.00 ? 94  MET A CG   4  
ATOM 7927  S SD   . MET A 1 94  ? 7.390   -7.207  -4.657  1.00 0.00 ? 94  MET A SD   4  
ATOM 7928  C CE   . MET A 1 94  ? 5.946   -8.255  -4.726  1.00 0.00 ? 94  MET A CE   4  
ATOM 7929  H H    . MET A 1 94  ? 8.589   -8.144  -0.177  1.00 0.00 ? 94  MET A H    4  
ATOM 7930  H HA   . MET A 1 94  ? 8.652   -9.232  -2.804  1.00 0.00 ? 94  MET A HA   4  
ATOM 7931  H HB2  . MET A 1 94  ? 9.070   -6.520  -1.500  1.00 0.00 ? 94  MET A HB2  4  
ATOM 7932  H HB3  . MET A 1 94  ? 9.610   -6.734  -3.153  1.00 0.00 ? 94  MET A HB3  4  
ATOM 7933  H HG2  . MET A 1 94  ? 6.806   -7.595  -2.374  1.00 0.00 ? 94  MET A HG2  4  
ATOM 7934  H HG3  . MET A 1 94  ? 7.138   -5.901  -2.674  1.00 0.00 ? 94  MET A HG3  4  
ATOM 7935  H HE1  . MET A 1 94  ? 5.161   -7.755  -5.293  1.00 0.00 ? 94  MET A HE1  4  
ATOM 7936  H HE2  . MET A 1 94  ? 6.203   -9.196  -5.213  1.00 0.00 ? 94  MET A HE2  4  
ATOM 7937  H HE3  . MET A 1 94  ? 5.593   -8.454  -3.714  1.00 0.00 ? 94  MET A HE3  4  
ATOM 7938  N N    . PRO A 1 95  ? 11.133  -9.132  -3.500  1.00 0.00 ? 95  PRO A N    4  
ATOM 7939  C CA   . PRO A 1 95  ? 12.536  -9.402  -3.765  1.00 0.00 ? 95  PRO A CA   4  
ATOM 7940  C C    . PRO A 1 95  ? 13.356  -8.110  -3.743  1.00 0.00 ? 95  PRO A C    4  
ATOM 7941  O O    . PRO A 1 95  ? 14.330  -8.002  -3.000  1.00 0.00 ? 95  PRO A O    4  
ATOM 7942  C CB   . PRO A 1 95  ? 12.554  -10.094 -5.118  1.00 0.00 ? 95  PRO A CB   4  
ATOM 7943  C CG   . PRO A 1 95  ? 11.219  -9.772  -5.769  1.00 0.00 ? 95  PRO A CG   4  
ATOM 7944  C CD   . PRO A 1 95  ? 10.301  -9.210  -4.697  1.00 0.00 ? 95  PRO A CD   4  
ATOM 7945  H HA   . PRO A 1 95  ? 12.920  -9.981  -3.046  1.00 0.00 ? 95  PRO A HA   4  
ATOM 7946  H HB2  . PRO A 1 95  ? 13.383  -9.736  -5.728  1.00 0.00 ? 95  PRO A HB2  4  
ATOM 7947  H HB3  . PRO A 1 95  ? 12.684  -11.170 -5.004  1.00 0.00 ? 95  PRO A HB3  4  
ATOM 7948  H HG2  . PRO A 1 95  ? 11.352  -9.050  -6.575  1.00 0.00 ? 95  PRO A HG2  4  
ATOM 7949  H HG3  . PRO A 1 95  ? 10.785  -10.668 -6.213  1.00 0.00 ? 95  PRO A HG3  4  
ATOM 7950  H HD2  . PRO A 1 95  ? 9.918   -8.229  -4.977  1.00 0.00 ? 95  PRO A HD2  4  
ATOM 7951  H HD3  . PRO A 1 95  ? 9.437   -9.856  -4.537  1.00 0.00 ? 95  PRO A HD3  4  
ATOM 7952  N N    . SER A 1 96  ? 12.932  -7.163  -4.567  1.00 0.00 ? 96  SER A N    4  
ATOM 7953  C CA   . SER A 1 96  ? 13.615  -5.884  -4.652  1.00 0.00 ? 96  SER A CA   4  
ATOM 7954  C C    . SER A 1 96  ? 12.673  -4.759  -4.218  1.00 0.00 ? 96  SER A C    4  
ATOM 7955  O O    . SER A 1 96  ? 11.463  -4.958  -4.125  1.00 0.00 ? 96  SER A O    4  
ATOM 7956  C CB   . SER A 1 96  ? 14.130  -5.627  -6.070  1.00 0.00 ? 96  SER A CB   4  
ATOM 7957  O OG   . SER A 1 96  ? 15.393  -4.967  -6.067  1.00 0.00 ? 96  SER A OG   4  
ATOM 7958  H H    . SER A 1 96  ? 12.139  -7.260  -5.169  1.00 0.00 ? 96  SER A H    4  
ATOM 7959  H HA   . SER A 1 96  ? 14.459  -5.962  -3.967  1.00 0.00 ? 96  SER A HA   4  
ATOM 7960  H HB2  . SER A 1 96  ? 14.217  -6.575  -6.601  1.00 0.00 ? 96  SER A HB2  4  
ATOM 7961  H HB3  . SER A 1 96  ? 13.406  -5.022  -6.615  1.00 0.00 ? 96  SER A HB3  4  
ATOM 7962  H HG   . SER A 1 96  ? 15.320  -4.090  -5.592  1.00 0.00 ? 96  SER A HG   4  
ATOM 7963  N N    . LYS A 1 97  ? 13.265  -3.601  -3.962  1.00 0.00 ? 97  LYS A N    4  
ATOM 7964  C CA   . LYS A 1 97  ? 12.494  -2.444  -3.540  1.00 0.00 ? 97  LYS A CA   4  
ATOM 7965  C C    . LYS A 1 97  ? 11.528  -2.044  -4.657  1.00 0.00 ? 97  LYS A C    4  
ATOM 7966  O O    . LYS A 1 97  ? 10.402  -1.629  -4.389  1.00 0.00 ? 97  LYS A O    4  
ATOM 7967  C CB   . LYS A 1 97  ? 13.425  -1.312  -3.098  1.00 0.00 ? 97  LYS A CB   4  
ATOM 7968  C CG   . LYS A 1 97  ? 12.658  0.004   -2.955  1.00 0.00 ? 97  LYS A CG   4  
ATOM 7969  C CD   . LYS A 1 97  ? 13.351  1.129   -3.727  1.00 0.00 ? 97  LYS A CD   4  
ATOM 7970  C CE   . LYS A 1 97  ? 14.137  2.039   -2.781  1.00 0.00 ? 97  LYS A CE   4  
ATOM 7971  N NZ   . LYS A 1 97  ? 15.270  2.672   -3.493  1.00 0.00 ? 97  LYS A NZ   4  
ATOM 7972  H H    . LYS A 1 97  ? 14.250  -3.447  -4.040  1.00 0.00 ? 97  LYS A H    4  
ATOM 7973  H HA   . LYS A 1 97  ? 11.911  -2.740  -2.668  1.00 0.00 ? 97  LYS A HA   4  
ATOM 7974  H HB2  . LYS A 1 97  ? 13.892  -1.570  -2.147  1.00 0.00 ? 97  LYS A HB2  4  
ATOM 7975  H HB3  . LYS A 1 97  ? 14.228  -1.193  -3.825  1.00 0.00 ? 97  LYS A HB3  4  
ATOM 7976  H HG2  . LYS A 1 97  ? 11.641  -0.122  -3.325  1.00 0.00 ? 97  LYS A HG2  4  
ATOM 7977  H HG3  . LYS A 1 97  ? 12.584  0.273   -1.902  1.00 0.00 ? 97  LYS A HG3  4  
ATOM 7978  H HD2  . LYS A 1 97  ? 14.025  0.703   -4.471  1.00 0.00 ? 97  LYS A HD2  4  
ATOM 7979  H HD3  . LYS A 1 97  ? 12.609  1.715   -4.268  1.00 0.00 ? 97  LYS A HD3  4  
ATOM 7980  H HE2  . LYS A 1 97  ? 13.479  2.808   -2.377  1.00 0.00 ? 97  LYS A HE2  4  
ATOM 7981  H HE3  . LYS A 1 97  ? 14.509  1.461   -1.935  1.00 0.00 ? 97  LYS A HE3  4  
ATOM 7982  H HZ1  . LYS A 1 97  ? 15.971  2.939   -2.832  1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 7983  H HZ2  . LYS A 1 97  ? 15.658  2.021   -4.146  1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 7984  H HZ3  . LYS A 1 97  ? 14.946  3.482   -3.982  1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 7985  N N    . GLU A 1 98  ? 12.004  -2.184  -5.885  1.00 0.00 ? 98  GLU A N    4  
ATOM 7986  C CA   . GLU A 1 98  ? 11.196  -1.843  -7.044  1.00 0.00 ? 98  GLU A CA   4  
ATOM 7987  C C    . GLU A 1 98  ? 10.020  -2.813  -7.175  1.00 0.00 ? 98  GLU A C    4  
ATOM 7988  O O    . GLU A 1 98  ? 8.865   -2.392  -7.204  1.00 0.00 ? 98  GLU A O    4  
ATOM 7989  C CB   . GLU A 1 98  ? 12.043  -1.832  -8.319  1.00 0.00 ? 98  GLU A CB   4  
ATOM 7990  C CG   . GLU A 1 98  ? 13.203  -0.842  -8.198  1.00 0.00 ? 98  GLU A CG   4  
ATOM 7991  C CD   . GLU A 1 98  ? 13.323  0.019   -9.457  1.00 0.00 ? 98  GLU A CD   4  
ATOM 7992  O OE1  . GLU A 1 98  ? 12.259  0.442   -9.958  1.00 0.00 ? 98  GLU A OE1  4  
ATOM 7993  O OE2  . GLU A 1 98  ? 14.476  0.235   -9.889  1.00 0.00 ? 98  GLU A OE2  4  
ATOM 7994  H H    . GLU A 1 98  ? 12.921  -2.523  -6.095  1.00 0.00 ? 98  GLU A H    4  
ATOM 7995  H HA   . GLU A 1 98  ? 10.826  -0.836  -6.853  1.00 0.00 ? 98  GLU A HA   4  
ATOM 7996  H HB2  . GLU A 1 98  ? 12.432  -2.832  -8.510  1.00 0.00 ? 98  GLU A HB2  4  
ATOM 7997  H HB3  . GLU A 1 98  ? 11.419  -1.565  -9.172  1.00 0.00 ? 98  GLU A HB3  4  
ATOM 7998  H HG2  . GLU A 1 98  ? 13.051  -0.203  -7.328  1.00 0.00 ? 98  GLU A HG2  4  
ATOM 7999  H HG3  . GLU A 1 98  ? 14.134  -1.386  -8.035  1.00 0.00 ? 98  GLU A HG3  4  
ATOM 8000  N N    . ASP A 1 99  ? 10.355  -4.092  -7.251  1.00 0.00 ? 99  ASP A N    4  
ATOM 8001  C CA   . ASP A 1 99  ? 9.342   -5.125  -7.379  1.00 0.00 ? 99  ASP A CA   4  
ATOM 8002  C C    . ASP A 1 99  ? 8.190   -4.825  -6.417  1.00 0.00 ? 99  ASP A C    4  
ATOM 8003  O O    . ASP A 1 99  ? 7.032   -5.108  -6.722  1.00 0.00 ? 99  ASP A O    4  
ATOM 8004  C CB   . ASP A 1 99  ? 9.909   -6.501  -7.023  1.00 0.00 ? 99  ASP A CB   4  
ATOM 8005  C CG   . ASP A 1 99  ? 10.970  -7.032  -7.987  1.00 0.00 ? 99  ASP A CG   4  
ATOM 8006  O OD1  . ASP A 1 99  ? 10.607  -7.259  -9.162  1.00 0.00 ? 99  ASP A OD1  4  
ATOM 8007  O OD2  . ASP A 1 99  ? 12.121  -7.200  -7.529  1.00 0.00 ? 99  ASP A OD2  4  
ATOM 8008  H H    . ASP A 1 99  ? 11.298  -4.426  -7.227  1.00 0.00 ? 99  ASP A H    4  
ATOM 8009  H HA   . ASP A 1 99  ? 9.031   -5.095  -8.423  1.00 0.00 ? 99  ASP A HA   4  
ATOM 8010  H HB2  . ASP A 1 99  ? 10.340  -6.451  -6.023  1.00 0.00 ? 99  ASP A HB2  4  
ATOM 8011  H HB3  . ASP A 1 99  ? 9.087   -7.216  -6.980  1.00 0.00 ? 99  ASP A HB3  4  
ATOM 8012  N N    . ALA A 1 100 ? 8.548   -4.256  -5.276  1.00 0.00 ? 100 ALA A N    4  
ATOM 8013  C CA   . ALA A 1 100 ? 7.559   -3.914  -4.267  1.00 0.00 ? 100 ALA A CA   4  
ATOM 8014  C C    . ALA A 1 100 ? 6.831   -2.635  -4.686  1.00 0.00 ? 100 ALA A C    4  
ATOM 8015  O O    . ALA A 1 100 ? 5.611   -2.541  -4.560  1.00 0.00 ? 100 ALA A O    4  
ATOM 8016  C CB   . ALA A 1 100 ? 8.244   -3.776  -2.906  1.00 0.00 ? 100 ALA A CB   4  
ATOM 8017  H H    . ALA A 1 100 ? 9.492   -4.029  -5.036  1.00 0.00 ? 100 ALA A H    4  
ATOM 8018  H HA   . ALA A 1 100 ? 6.840   -4.732  -4.217  1.00 0.00 ? 100 ALA A HA   4  
ATOM 8019  H HB1  . ALA A 1 100 ? 7.500   -3.863  -2.115  1.00 0.00 ? 100 ALA A HB1  4  
ATOM 8020  H HB2  . ALA A 1 100 ? 8.989   -4.564  -2.793  1.00 0.00 ? 100 ALA A HB2  4  
ATOM 8021  H HB3  . ALA A 1 100 ? 8.731   -2.804  -2.842  1.00 0.00 ? 100 ALA A HB3  4  
ATOM 8022  N N    . ILE A 1 101 ? 7.611   -1.682  -5.176  1.00 0.00 ? 101 ILE A N    4  
ATOM 8023  C CA   . ILE A 1 101 ? 7.055   -0.413  -5.614  1.00 0.00 ? 101 ILE A CA   4  
ATOM 8024  C C    . ILE A 1 101 ? 6.188   -0.641  -6.853  1.00 0.00 ? 101 ILE A C    4  
ATOM 8025  O O    . ILE A 1 101 ? 5.040   -0.201  -6.901  1.00 0.00 ? 101 ILE A O    4  
ATOM 8026  C CB   . ILE A 1 101 ? 8.169   0.615   -5.824  1.00 0.00 ? 101 ILE A CB   4  
ATOM 8027  C CG1  . ILE A 1 101 ? 8.723   1.104   -4.484  1.00 0.00 ? 101 ILE A CG1  4  
ATOM 8028  C CG2  . ILE A 1 101 ? 7.689   1.772   -6.703  1.00 0.00 ? 101 ILE A CG2  4  
ATOM 8029  C CD1  . ILE A 1 101 ? 10.102  1.743   -4.662  1.00 0.00 ? 101 ILE A CD1  4  
ATOM 8030  H H    . ILE A 1 101 ? 8.602   -1.767  -5.276  1.00 0.00 ? 101 ILE A H    4  
ATOM 8031  H HA   . ILE A 1 101 ? 6.420   -0.040  -4.811  1.00 0.00 ? 101 ILE A HA   4  
ATOM 8032  H HB   . ILE A 1 101 ? 8.988   0.128   -6.353  1.00 0.00 ? 101 ILE A HB   4  
ATOM 8033  H HG12 . ILE A 1 101 ? 8.037   1.828   -4.045  1.00 0.00 ? 101 ILE A HG12 4  
ATOM 8034  H HG13 . ILE A 1 101 ? 8.793   0.269   -3.788  1.00 0.00 ? 101 ILE A HG13 4  
ATOM 8035  H HG21 . ILE A 1 101 ? 7.050   1.385   -7.496  1.00 0.00 ? 101 ILE A HG21 4  
ATOM 8036  H HG22 . ILE A 1 101 ? 7.126   2.480   -6.095  1.00 0.00 ? 101 ILE A HG22 4  
ATOM 8037  H HG23 . ILE A 1 101 ? 8.550   2.275   -7.143  1.00 0.00 ? 101 ILE A HG23 4  
ATOM 8038  H HD11 . ILE A 1 101 ? 10.623  1.259   -5.487  1.00 0.00 ? 101 ILE A HD11 4  
ATOM 8039  H HD12 . ILE A 1 101 ? 9.986   2.805   -4.878  1.00 0.00 ? 101 ILE A HD12 4  
ATOM 8040  H HD13 . ILE A 1 101 ? 10.680  1.621   -3.745  1.00 0.00 ? 101 ILE A HD13 4  
ATOM 8041  N N    . GLU A 1 102 ? 6.770   -1.328  -7.826  1.00 0.00 ? 102 GLU A N    4  
ATOM 8042  C CA   . GLU A 1 102 ? 6.064   -1.620  -9.062  1.00 0.00 ? 102 GLU A CA   4  
ATOM 8043  C C    . GLU A 1 102 ? 4.733   -2.312  -8.762  1.00 0.00 ? 102 GLU A C    4  
ATOM 8044  O O    . GLU A 1 102 ? 3.692   -1.917  -9.284  1.00 0.00 ? 102 GLU A O    4  
ATOM 8045  C CB   . GLU A 1 102 ? 6.926   -2.469  -9.998  1.00 0.00 ? 102 GLU A CB   4  
ATOM 8046  C CG   . GLU A 1 102 ? 8.336   -1.890  -10.121 1.00 0.00 ? 102 GLU A CG   4  
ATOM 8047  C CD   . GLU A 1 102 ? 8.784   -1.843  -11.583 1.00 0.00 ? 102 GLU A CD   4  
ATOM 8048  O OE1  . GLU A 1 102 ? 7.896   -1.652  -12.443 1.00 0.00 ? 102 GLU A OE1  4  
ATOM 8049  O OE2  . GLU A 1 102 ? 10.003  -1.999  -11.809 1.00 0.00 ? 102 GLU A OE2  4  
ATOM 8050  H H    . GLU A 1 102 ? 7.704   -1.682  -7.779  1.00 0.00 ? 102 GLU A H    4  
ATOM 8051  H HA   . GLU A 1 102 ? 5.880   -0.651  -9.526  1.00 0.00 ? 102 GLU A HA   4  
ATOM 8052  H HB2  . GLU A 1 102 ? 6.980   -3.491  -9.621  1.00 0.00 ? 102 GLU A HB2  4  
ATOM 8053  H HB3  . GLU A 1 102 ? 6.461   -2.517  -10.983 1.00 0.00 ? 102 GLU A HB3  4  
ATOM 8054  H HG2  . GLU A 1 102 ? 8.359   -0.886  -9.697  1.00 0.00 ? 102 GLU A HG2  4  
ATOM 8055  H HG3  . GLU A 1 102 ? 9.034   -2.496  -9.543  1.00 0.00 ? 102 GLU A HG3  4  
ATOM 8056  N N    . HIS A 1 103 ? 4.810   -3.335  -7.923  1.00 0.00 ? 103 HIS A N    4  
ATOM 8057  C CA   . HIS A 1 103 ? 3.624   -4.086  -7.547  1.00 0.00 ? 103 HIS A CA   4  
ATOM 8058  C C    . HIS A 1 103 ? 2.595   -3.142  -6.922  1.00 0.00 ? 103 HIS A C    4  
ATOM 8059  O O    . HIS A 1 103 ? 1.453   -3.077  -7.372  1.00 0.00 ? 103 HIS A O    4  
ATOM 8060  C CB   . HIS A 1 103 ? 3.990   -5.256  -6.632  1.00 0.00 ? 103 HIS A CB   4  
ATOM 8061  C CG   . HIS A 1 103 ? 2.895   -6.285  -6.484  1.00 0.00 ? 103 HIS A CG   4  
ATOM 8062  N ND1  . HIS A 1 103 ? 2.151   -6.748  -7.555  1.00 0.00 ? 103 HIS A ND1  4  
ATOM 8063  C CD2  . HIS A 1 103 ? 2.427   -6.936  -5.380  1.00 0.00 ? 103 HIS A CD2  4  
ATOM 8064  C CE1  . HIS A 1 103 ? 1.277   -7.637  -7.105  1.00 0.00 ? 103 HIS A CE1  4  
ATOM 8065  N NE2  . HIS A 1 103 ? 1.449   -7.751  -5.757  1.00 0.00 ? 103 HIS A NE2  4  
ATOM 8066  H H    . HIS A 1 103 ? 5.661   -3.650  -7.502  1.00 0.00 ? 103 HIS A H    4  
ATOM 8067  H HA   . HIS A 1 103 ? 3.212   -4.500  -8.468  1.00 0.00 ? 103 HIS A HA   4  
ATOM 8068  H HB2  . HIS A 1 103 ? 4.883   -5.744  -7.022  1.00 0.00 ? 103 HIS A HB2  4  
ATOM 8069  H HB3  . HIS A 1 103 ? 4.244   -4.867  -5.646  1.00 0.00 ? 103 HIS A HB3  4  
ATOM 8070  H HD1  . HIS A 1 103 ? 2.256   -6.461  -8.507  1.00 0.00 ? 103 HIS A HD1  4  
ATOM 8071  H HD2  . HIS A 1 103 ? 2.793   -6.808  -4.362  1.00 0.00 ? 103 HIS A HD2  4  
ATOM 8072  H HE1  . HIS A 1 103 ? 0.549   -8.180  -7.707  1.00 0.00 ? 103 HIS A HE1  4  
ATOM 8073  N N    . PHE A 1 104 ? 3.038   -2.434  -5.893  1.00 0.00 ? 104 PHE A N    4  
ATOM 8074  C CA   . PHE A 1 104 ? 2.170   -1.497  -5.200  1.00 0.00 ? 104 PHE A CA   4  
ATOM 8075  C C    . PHE A 1 104 ? 1.390   -0.635  -6.195  1.00 0.00 ? 104 PHE A C    4  
ATOM 8076  O O    . PHE A 1 104 ? 0.164   -0.559  -6.129  1.00 0.00 ? 104 PHE A O    4  
ATOM 8077  C CB   . PHE A 1 104 ? 3.070   -0.593  -4.356  1.00 0.00 ? 104 PHE A CB   4  
ATOM 8078  C CG   . PHE A 1 104 ? 2.322   0.525   -3.628  1.00 0.00 ? 104 PHE A CG   4  
ATOM 8079  C CD1  . PHE A 1 104 ? 2.073   1.702   -4.262  1.00 0.00 ? 104 PHE A CD1  4  
ATOM 8080  C CD2  . PHE A 1 104 ? 1.906   0.342   -2.346  1.00 0.00 ? 104 PHE A CD2  4  
ATOM 8081  C CE1  . PHE A 1 104 ? 1.379   2.740   -3.586  1.00 0.00 ? 104 PHE A CE1  4  
ATOM 8082  C CE2  . PHE A 1 104 ? 1.211   1.379   -1.670  1.00 0.00 ? 104 PHE A CE2  4  
ATOM 8083  C CZ   . PHE A 1 104 ? 0.963   2.557   -2.304  1.00 0.00 ? 104 PHE A CZ   4  
ATOM 8084  H H    . PHE A 1 104 ? 3.969   -2.493  -5.533  1.00 0.00 ? 104 PHE A H    4  
ATOM 8085  H HA   . PHE A 1 104 ? 1.471   -2.084  -4.605  1.00 0.00 ? 104 PHE A HA   4  
ATOM 8086  H HB2  . PHE A 1 104 ? 3.595   -1.204  -3.621  1.00 0.00 ? 104 PHE A HB2  4  
ATOM 8087  H HB3  . PHE A 1 104 ? 3.829   -0.149  -5.001  1.00 0.00 ? 104 PHE A HB3  4  
ATOM 8088  H HD1  . PHE A 1 104 ? 2.407   1.849   -5.289  1.00 0.00 ? 104 PHE A HD1  4  
ATOM 8089  H HD2  . PHE A 1 104 ? 2.105   -0.602  -1.838  1.00 0.00 ? 104 PHE A HD2  4  
ATOM 8090  H HE1  . PHE A 1 104 ? 1.179   3.683   -4.094  1.00 0.00 ? 104 PHE A HE1  4  
ATOM 8091  H HE2  . PHE A 1 104 ? 0.878   1.233   -0.642  1.00 0.00 ? 104 PHE A HE2  4  
ATOM 8092  H HZ   . PHE A 1 104 ? 0.430   3.353   -1.785  1.00 0.00 ? 104 PHE A HZ   4  
ATOM 8093  N N    . MET A 1 105 ? 2.133   -0.006  -7.094  1.00 0.00 ? 105 MET A N    4  
ATOM 8094  C CA   . MET A 1 105 ? 1.527   0.848   -8.101  1.00 0.00 ? 105 MET A CA   4  
ATOM 8095  C C    . MET A 1 105 ? 0.446   0.096   -8.879  1.00 0.00 ? 105 MET A C    4  
ATOM 8096  O O    . MET A 1 105 ? -0.563  0.681   -9.271  1.00 0.00 ? 105 MET A O    4  
ATOM 8097  C CB   . MET A 1 105 ? 2.605   1.340   -9.069  1.00 0.00 ? 105 MET A CB   4  
ATOM 8098  C CG   . MET A 1 105 ? 2.901   2.825   -8.850  1.00 0.00 ? 105 MET A CG   4  
ATOM 8099  S SD   . MET A 1 105 ? 3.370   3.110   -7.152  1.00 0.00 ? 105 MET A SD   4  
ATOM 8100  C CE   . MET A 1 105 ? 5.077   2.593   -7.210  1.00 0.00 ? 105 MET A CE   4  
ATOM 8101  H H    . MET A 1 105 ? 3.130   -0.073  -7.141  1.00 0.00 ? 105 MET A H    4  
ATOM 8102  H HA   . MET A 1 105 ? 1.079   1.676   -7.551  1.00 0.00 ? 105 MET A HA   4  
ATOM 8103  H HB2  . MET A 1 105 ? 3.516   0.759   -8.930  1.00 0.00 ? 105 MET A HB2  4  
ATOM 8104  H HB3  . MET A 1 105 ? 2.277   1.179   -10.096 1.00 0.00 ? 105 MET A HB3  4  
ATOM 8105  H HG2  . MET A 1 105 ? 3.703   3.146   -9.516  1.00 0.00 ? 105 MET A HG2  4  
ATOM 8106  H HG3  . MET A 1 105 ? 2.023   3.421   -9.099  1.00 0.00 ? 105 MET A HG3  4  
ATOM 8107  H HE1  . MET A 1 105 ? 5.279   2.112   -8.167  1.00 0.00 ? 105 MET A HE1  4  
ATOM 8108  H HE2  . MET A 1 105 ? 5.724   3.463   -7.097  1.00 0.00 ? 105 MET A HE2  4  
ATOM 8109  H HE3  . MET A 1 105 ? 5.271   1.889   -6.401  1.00 0.00 ? 105 MET A HE3  4  
ATOM 8110  N N    . LYS A 1 106 ? 0.693   -1.190  -9.080  1.00 0.00 ? 106 LYS A N    4  
ATOM 8111  C CA   . LYS A 1 106 ? -0.247  -2.029  -9.804  1.00 0.00 ? 106 LYS A CA   4  
ATOM 8112  C C    . LYS A 1 106 ? -1.445  -2.340  -8.905  1.00 0.00 ? 106 LYS A C    4  
ATOM 8113  O O    . LYS A 1 106 ? -2.592  -2.252  -9.340  1.00 0.00 ? 106 LYS A O    4  
ATOM 8114  C CB   . LYS A 1 106 ? 0.455   -3.276  -10.346 1.00 0.00 ? 106 LYS A CB   4  
ATOM 8115  C CG   . LYS A 1 106 ? -0.478  -4.488  -10.312 1.00 0.00 ? 106 LYS A CG   4  
ATOM 8116  C CD   . LYS A 1 106 ? 0.249   -5.752  -10.778 1.00 0.00 ? 106 LYS A CD   4  
ATOM 8117  C CE   . LYS A 1 106 ? -0.212  -6.164  -12.177 1.00 0.00 ? 106 LYS A CE   4  
ATOM 8118  N NZ   . LYS A 1 106 ? 0.457   -5.339  -13.207 1.00 0.00 ? 106 LYS A NZ   4  
ATOM 8119  H H    . LYS A 1 106 ? 1.516   -1.659  -8.758  1.00 0.00 ? 106 LYS A H    4  
ATOM 8120  H HA   . LYS A 1 106 ? -0.599  -1.458  -10.663 1.00 0.00 ? 106 LYS A HA   4  
ATOM 8121  H HB2  . LYS A 1 106 ? 0.786   -3.096  -11.369 1.00 0.00 ? 106 LYS A HB2  4  
ATOM 8122  H HB3  . LYS A 1 106 ? 1.347   -3.481  -9.754  1.00 0.00 ? 106 LYS A HB3  4  
ATOM 8123  H HG2  . LYS A 1 106 ? -0.854  -4.633  -9.299  1.00 0.00 ? 106 LYS A HG2  4  
ATOM 8124  H HG3  . LYS A 1 106 ? -1.342  -4.305  -10.950 1.00 0.00 ? 106 LYS A HG3  4  
ATOM 8125  H HD2  . LYS A 1 106 ? 1.325   -5.577  -10.782 1.00 0.00 ? 106 LYS A HD2  4  
ATOM 8126  H HD3  . LYS A 1 106 ? 0.061   -6.564  -10.075 1.00 0.00 ? 106 LYS A HD3  4  
ATOM 8127  H HE2  . LYS A 1 106 ? 0.013   -7.218  -12.344 1.00 0.00 ? 106 LYS A HE2  4  
ATOM 8128  H HE3  . LYS A 1 106 ? -1.293  -6.052  -12.258 1.00 0.00 ? 106 LYS A HE3  4  
ATOM 8129  H HZ1  . LYS A 1 106 ? 1.361   -5.719  -13.404 1.00 0.00 ? 106 LYS A HZ1  4  
ATOM 8130  H HZ2  . LYS A 1 106 ? -0.093  -5.338  -14.042 1.00 0.00 ? 106 LYS A HZ2  4  
ATOM 8131  H HZ3  . LYS A 1 106 ? 0.555   -4.402  -12.872 1.00 0.00 ? 106 LYS A HZ3  4  
ATOM 8132  N N    . LEU A 1 107 ? -1.138  -2.697  -7.666  1.00 0.00 ? 107 LEU A N    4  
ATOM 8133  C CA   . LEU A 1 107 ? -2.175  -3.021  -6.702  1.00 0.00 ? 107 LEU A CA   4  
ATOM 8134  C C    . LEU A 1 107 ? -3.188  -1.876  -6.644  1.00 0.00 ? 107 LEU A C    4  
ATOM 8135  O O    . LEU A 1 107 ? -4.380  -2.085  -6.866  1.00 0.00 ? 107 LEU A O    4  
ATOM 8136  C CB   . LEU A 1 107 ? -1.557  -3.364  -5.345  1.00 0.00 ? 107 LEU A CB   4  
ATOM 8137  C CG   . LEU A 1 107 ? -1.164  -4.828  -5.138  1.00 0.00 ? 107 LEU A CG   4  
ATOM 8138  C CD1  . LEU A 1 107 ? -0.658  -5.063  -3.713  1.00 0.00 ? 107 LEU A CD1  4  
ATOM 8139  C CD2  . LEU A 1 107 ? -2.321  -5.762  -5.497  1.00 0.00 ? 107 LEU A CD2  4  
ATOM 8140  H H    . LEU A 1 107 ? -0.202  -2.766  -7.320  1.00 0.00 ? 107 LEU A H    4  
ATOM 8141  H HA   . LEU A 1 107 ? -2.685  -3.916  -7.059  1.00 0.00 ? 107 LEU A HA   4  
ATOM 8142  H HB2  . LEU A 1 107 ? -0.669  -2.747  -5.206  1.00 0.00 ? 107 LEU A HB2  4  
ATOM 8143  H HB3  . LEU A 1 107 ? -2.264  -3.084  -4.565  1.00 0.00 ? 107 LEU A HB3  4  
ATOM 8144  H HG   . LEU A 1 107 ? -0.341  -5.060  -5.814  1.00 0.00 ? 107 LEU A HG   4  
ATOM 8145  H HD11 . LEU A 1 107 ? -0.285  -6.084  -3.624  1.00 0.00 ? 107 LEU A HD11 4  
ATOM 8146  H HD12 . LEU A 1 107 ? 0.147   -4.362  -3.493  1.00 0.00 ? 107 LEU A HD12 4  
ATOM 8147  H HD13 . LEU A 1 107 ? -1.475  -4.912  -3.008  1.00 0.00 ? 107 LEU A HD13 4  
ATOM 8148  H HD21 . LEU A 1 107 ? -2.480  -6.472  -4.685  1.00 0.00 ? 107 LEU A HD21 4  
ATOM 8149  H HD22 . LEU A 1 107 ? -3.227  -5.176  -5.649  1.00 0.00 ? 107 LEU A HD22 4  
ATOM 8150  H HD23 . LEU A 1 107 ? -2.080  -6.304  -6.411  1.00 0.00 ? 107 LEU A HD23 4  
ATOM 8151  N N    . TYR A 1 108 ? -2.677  -0.690  -6.346  1.00 0.00 ? 108 TYR A N    4  
ATOM 8152  C CA   . TYR A 1 108 ? -3.522  0.488   -6.256  1.00 0.00 ? 108 TYR A CA   4  
ATOM 8153  C C    . TYR A 1 108 ? -4.095  0.857   -7.626  1.00 0.00 ? 108 TYR A C    4  
ATOM 8154  O O    . TYR A 1 108 ? -4.934  1.750   -7.732  1.00 0.00 ? 108 TYR A O    4  
ATOM 8155  C CB   . TYR A 1 108 ? -2.615  1.622   -5.774  1.00 0.00 ? 108 TYR A CB   4  
ATOM 8156  C CG   . TYR A 1 108 ? -3.350  2.938   -5.511  1.00 0.00 ? 108 TYR A CG   4  
ATOM 8157  C CD1  . TYR A 1 108 ? -3.622  3.797   -6.557  1.00 0.00 ? 108 TYR A CD1  4  
ATOM 8158  C CD2  . TYR A 1 108 ? -3.740  3.266   -4.229  1.00 0.00 ? 108 TYR A CD2  4  
ATOM 8159  C CE1  . TYR A 1 108 ? -4.314  5.035   -6.309  1.00 0.00 ? 108 TYR A CE1  4  
ATOM 8160  C CE2  . TYR A 1 108 ? -4.432  4.504   -3.982  1.00 0.00 ? 108 TYR A CE2  4  
ATOM 8161  C CZ   . TYR A 1 108 ? -4.684  5.328   -5.034  1.00 0.00 ? 108 TYR A CZ   4  
ATOM 8162  O OH   . TYR A 1 108 ? -5.338  6.498   -4.800  1.00 0.00 ? 108 TYR A OH   4  
ATOM 8163  H H    . TYR A 1 108 ? -1.706  -0.529  -6.167  1.00 0.00 ? 108 TYR A H    4  
ATOM 8164  H HA   . TYR A 1 108 ? -4.343  0.262   -5.576  1.00 0.00 ? 108 TYR A HA   4  
ATOM 8165  H HB2  . TYR A 1 108 ? -2.114  1.308   -4.858  1.00 0.00 ? 108 TYR A HB2  4  
ATOM 8166  H HB3  . TYR A 1 108 ? -1.838  1.794   -6.519  1.00 0.00 ? 108 TYR A HB3  4  
ATOM 8167  H HD1  . TYR A 1 108 ? -3.313  3.538   -7.570  1.00 0.00 ? 108 TYR A HD1  4  
ATOM 8168  H HD2  . TYR A 1 108 ? -3.525  2.587   -3.403  1.00 0.00 ? 108 TYR A HD2  4  
ATOM 8169  H HE1  . TYR A 1 108 ? -4.535  5.723   -7.126  1.00 0.00 ? 108 TYR A HE1  4  
ATOM 8170  H HE2  . TYR A 1 108 ? -4.746  4.776   -2.974  1.00 0.00 ? 108 TYR A HE2  4  
ATOM 8171  H HH   . TYR A 1 108 ? -4.970  7.218   -5.388  1.00 0.00 ? 108 TYR A HH   4  
ATOM 8172  N N    . GLU A 1 109 ? -3.619  0.150   -8.641  1.00 0.00 ? 109 GLU A N    4  
ATOM 8173  C CA   . GLU A 1 109 ? -4.074  0.392   -10.000 1.00 0.00 ? 109 GLU A CA   4  
ATOM 8174  C C    . GLU A 1 109 ? -5.079  -0.681  -10.422 1.00 0.00 ? 109 GLU A C    4  
ATOM 8175  O O    . GLU A 1 109 ? -5.830  -0.492  -11.378 1.00 0.00 ? 109 GLU A O    4  
ATOM 8176  C CB   . GLU A 1 109 ? -2.893  0.450   -10.971 1.00 0.00 ? 109 GLU A CB   4  
ATOM 8177  C CG   . GLU A 1 109 ? -3.378  0.516   -12.420 1.00 0.00 ? 109 GLU A CG   4  
ATOM 8178  C CD   . GLU A 1 109 ? -2.203  0.697   -13.384 1.00 0.00 ? 109 GLU A CD   4  
ATOM 8179  O OE1  . GLU A 1 109 ? -1.248  1.399   -12.988 1.00 0.00 ? 109 GLU A OE1  4  
ATOM 8180  O OE2  . GLU A 1 109 ? -2.287  0.129   -14.494 1.00 0.00 ? 109 GLU A OE2  4  
ATOM 8181  H H    . GLU A 1 109 ? -2.937  -0.574  -8.546  1.00 0.00 ? 109 GLU A H    4  
ATOM 8182  H HA   . GLU A 1 109 ? -4.562  1.366   -9.973  1.00 0.00 ? 109 GLU A HA   4  
ATOM 8183  H HB2  . GLU A 1 109 ? -2.278  1.322   -10.749 1.00 0.00 ? 109 GLU A HB2  4  
ATOM 8184  H HB3  . GLU A 1 109 ? -2.262  -0.428  -10.834 1.00 0.00 ? 109 GLU A HB3  4  
ATOM 8185  H HG2  . GLU A 1 109 ? -3.919  -0.397  -12.668 1.00 0.00 ? 109 GLU A HG2  4  
ATOM 8186  H HG3  . GLU A 1 109 ? -4.078  1.344   -12.536 1.00 0.00 ? 109 GLU A HG3  4  
ATOM 8187  N N    . GLU A 1 110 ? -5.061  -1.785  -9.689  1.00 0.00 ? 110 GLU A N    4  
ATOM 8188  C CA   . GLU A 1 110 ? -5.961  -2.888  -9.976  1.00 0.00 ? 110 GLU A CA   4  
ATOM 8189  C C    . GLU A 1 110 ? -7.328  -2.639  -9.334  1.00 0.00 ? 110 GLU A C    4  
ATOM 8190  O O    . GLU A 1 110 ? -8.353  -3.064  -9.864  1.00 0.00 ? 110 GLU A O    4  
ATOM 8191  C CB   . GLU A 1 110 ? -5.368  -4.217  -9.503  1.00 0.00 ? 110 GLU A CB   4  
ATOM 8192  C CG   . GLU A 1 110 ? -5.867  -4.572  -8.101  1.00 0.00 ? 110 GLU A CG   4  
ATOM 8193  C CD   . GLU A 1 110 ? -5.349  -5.945  -7.666  1.00 0.00 ? 110 GLU A CD   4  
ATOM 8194  O OE1  . GLU A 1 110 ? -4.134  -6.175  -7.845  1.00 0.00 ? 110 GLU A OE1  4  
ATOM 8195  O OE2  . GLU A 1 110 ? -6.180  -6.732  -7.165  1.00 0.00 ? 110 GLU A OE2  4  
ATOM 8196  H H    . GLU A 1 110 ? -4.447  -1.931  -8.913  1.00 0.00 ? 110 GLU A H    4  
ATOM 8197  H HA   . GLU A 1 110 ? -6.060  -2.907  -11.061 1.00 0.00 ? 110 GLU A HA   4  
ATOM 8198  H HB2  . GLU A 1 110 ? -5.639  -5.009  -10.201 1.00 0.00 ? 110 GLU A HB2  4  
ATOM 8199  H HB3  . GLU A 1 110 ? -4.280  -4.153  -9.500  1.00 0.00 ? 110 GLU A HB3  4  
ATOM 8200  H HG2  . GLU A 1 110 ? -5.538  -3.814  -7.391  1.00 0.00 ? 110 GLU A HG2  4  
ATOM 8201  H HG3  . GLU A 1 110 ? -6.957  -4.570  -8.088  1.00 0.00 ? 110 GLU A HG3  4  
ATOM 8202  N N    . LYS A 1 111 ? -7.298  -1.950  -8.203  1.00 0.00 ? 111 LYS A N    4  
ATOM 8203  C CA   . LYS A 1 111 ? -8.521  -1.639  -7.483  1.00 0.00 ? 111 LYS A CA   4  
ATOM 8204  C C    . LYS A 1 111 ? -9.169  -0.398  -8.100  1.00 0.00 ? 111 LYS A C    4  
ATOM 8205  O O    . LYS A 1 111 ? -10.223 -0.490  -8.728  1.00 0.00 ? 111 LYS A O    4  
ATOM 8206  C CB   . LYS A 1 111 ? -8.243  -1.507  -5.985  1.00 0.00 ? 111 LYS A CB   4  
ATOM 8207  C CG   . LYS A 1 111 ? -7.647  -2.799  -5.422  1.00 0.00 ? 111 LYS A CG   4  
ATOM 8208  C CD   . LYS A 1 111 ? -8.712  -3.892  -5.312  1.00 0.00 ? 111 LYS A CD   4  
ATOM 8209  C CE   . LYS A 1 111 ? -8.070  -5.279  -5.259  1.00 0.00 ? 111 LYS A CE   4  
ATOM 8210  N NZ   . LYS A 1 111 ? -8.808  -6.157  -4.323  1.00 0.00 ? 111 LYS A NZ   4  
ATOM 8211  H H    . LYS A 1 111 ? -6.460  -1.608  -7.778  1.00 0.00 ? 111 LYS A H    4  
ATOM 8212  H HA   . LYS A 1 111 ? -9.200  -2.482  -7.612  1.00 0.00 ? 111 LYS A HA   4  
ATOM 8213  H HB2  . LYS A 1 111 ? -7.556  -0.679  -5.810  1.00 0.00 ? 111 LYS A HB2  4  
ATOM 8214  H HB3  . LYS A 1 111 ? -9.168  -1.269  -5.459  1.00 0.00 ? 111 LYS A HB3  4  
ATOM 8215  H HG2  . LYS A 1 111 ? -6.836  -3.139  -6.065  1.00 0.00 ? 111 LYS A HG2  4  
ATOM 8216  H HG3  . LYS A 1 111 ? -7.216  -2.606  -4.439  1.00 0.00 ? 111 LYS A HG3  4  
ATOM 8217  H HD2  . LYS A 1 111 ? -9.313  -3.731  -4.417  1.00 0.00 ? 111 LYS A HD2  4  
ATOM 8218  H HD3  . LYS A 1 111 ? -9.388  -3.832  -6.165  1.00 0.00 ? 111 LYS A HD3  4  
ATOM 8219  H HE2  . LYS A 1 111 ? -8.065  -5.723  -6.255  1.00 0.00 ? 111 LYS A HE2  4  
ATOM 8220  H HE3  . LYS A 1 111 ? -7.030  -5.194  -4.944  1.00 0.00 ? 111 LYS A HE3  4  
ATOM 8221  H HZ1  . LYS A 1 111 ? -8.622  -5.871  -3.383  1.00 0.00 ? 111 LYS A HZ1  4  
ATOM 8222  H HZ2  . LYS A 1 111 ? -9.789  -6.088  -4.505  1.00 0.00 ? 111 LYS A HZ2  4  
ATOM 8223  H HZ3  . LYS A 1 111 ? -8.511  -7.103  -4.449  1.00 0.00 ? 111 LYS A HZ3  4  
ATOM 8224  N N    . THR A 1 112 ? -8.511  0.735   -7.901  1.00 0.00 ? 112 THR A N    4  
ATOM 8225  C CA   . THR A 1 112 ? -9.009  1.993   -8.430  1.00 0.00 ? 112 THR A CA   4  
ATOM 8226  C C    . THR A 1 112 ? -9.085  1.937   -9.957  1.00 0.00 ? 112 THR A C    4  
ATOM 8227  O O    . THR A 1 112 ? -9.939  2.581   -10.564 1.00 0.00 ? 112 THR A O    4  
ATOM 8228  C CB   . THR A 1 112 ? -8.111  3.115   -7.906  1.00 0.00 ? 112 THR A CB   4  
ATOM 8229  O OG1  . THR A 1 112 ? -6.875  2.916   -8.587  1.00 0.00 ? 112 THR A OG1  4  
ATOM 8230  C CG2  . THR A 1 112 ? -7.754  2.939   -6.429  1.00 0.00 ? 112 THR A CG2  4  
ATOM 8231  H H    . THR A 1 112 ? -7.654  0.801   -7.389  1.00 0.00 ? 112 THR A H    4  
ATOM 8232  H HA   . THR A 1 112 ? -10.026 2.141   -8.065  1.00 0.00 ? 112 THR A HA   4  
ATOM 8233  H HB   . THR A 1 112 ? -8.562  4.091   -8.084  1.00 0.00 ? 112 THR A HB   4  
ATOM 8234  H HG1  . THR A 1 112 ? -6.489  2.026   -8.344  1.00 0.00 ? 112 THR A HG1  4  
ATOM 8235  H HG21 . THR A 1 112 ? -8.330  2.113   -6.012  1.00 0.00 ? 112 THR A HG21 4  
ATOM 8236  H HG22 . THR A 1 112 ? -6.690  2.724   -6.335  1.00 0.00 ? 112 THR A HG22 4  
ATOM 8237  H HG23 . THR A 1 112 ? -7.989  3.855   -5.887  1.00 0.00 ? 112 THR A HG23 4  
ATOM 8238  N N    . GLY A 1 113 ? -8.179  1.162   -10.534 1.00 0.00 ? 113 GLY A N    4  
ATOM 8239  C CA   . GLY A 1 113 ? -8.132  1.013   -11.979 1.00 0.00 ? 113 GLY A CA   4  
ATOM 8240  C C    . GLY A 1 113 ? -7.252  2.093   -12.612 1.00 0.00 ? 113 GLY A C    4  
ATOM 8241  O O    . GLY A 1 113 ? -6.840  1.966   -13.764 1.00 0.00 ? 113 GLY A O    4  
ATOM 8242  H H    . GLY A 1 113 ? -7.487  0.641   -10.033 1.00 0.00 ? 113 GLY A H    4  
ATOM 8243  H HA2  . GLY A 1 113 ? -7.744  0.027   -12.234 1.00 0.00 ? 113 GLY A HA2  4  
ATOM 8244  H HA3  . GLY A 1 113 ? -9.140  1.074   -12.387 1.00 0.00 ? 113 GLY A HA3  4  
ATOM 8245  N N    . ASN A 1 114 ? -6.992  3.132   -11.832 1.00 0.00 ? 114 ASN A N    4  
ATOM 8246  C CA   . ASN A 1 114 ? -6.169  4.233   -12.303 1.00 0.00 ? 114 ASN A CA   4  
ATOM 8247  C C    . ASN A 1 114 ? -4.750  4.075   -11.754 1.00 0.00 ? 114 ASN A C    4  
ATOM 8248  O O    . ASN A 1 114 ? -4.543  3.412   -10.739 1.00 0.00 ? 114 ASN A O    4  
ATOM 8249  C CB   . ASN A 1 114 ? -6.716  5.577   -11.816 1.00 0.00 ? 114 ASN A CB   4  
ATOM 8250  C CG   . ASN A 1 114 ? -8.160  5.437   -11.330 1.00 0.00 ? 114 ASN A CG   4  
ATOM 8251  O OD1  . ASN A 1 114 ? -8.446  4.801   -10.328 1.00 0.00 ? 114 ASN A OD1  4  
ATOM 8252  N ND2  . ASN A 1 114 ? -9.051  6.064   -12.092 1.00 0.00 ? 114 ASN A ND2  4  
ATOM 8253  H H    . ASN A 1 114 ? -7.331  3.228   -10.897 1.00 0.00 ? 114 ASN A H    4  
ATOM 8254  H HA   . ASN A 1 114 ? -6.205  4.173   -13.391 1.00 0.00 ? 114 ASN A HA   4  
ATOM 8255  H HB2  . ASN A 1 114 ? -6.092  5.957   -11.008 1.00 0.00 ? 114 ASN A HB2  4  
ATOM 8256  H HB3  . ASN A 1 114 ? -6.671  6.307   -12.625 1.00 0.00 ? 114 ASN A HB3  4  
ATOM 8257  H HD21 . ASN A 1 114 ? -8.750  6.568   -12.901 1.00 0.00 ? 114 ASN A HD21 4  
ATOM 8258  H HD22 . ASN A 1 114 ? -10.023 6.031   -11.856 1.00 0.00 ? 114 ASN A HD22 4  
ATOM 8259  N N    . ALA A 1 115 ? -3.808  4.695   -12.450 1.00 0.00 ? 115 ALA A N    4  
ATOM 8260  C CA   . ALA A 1 115 ? -2.414  4.630   -12.046 1.00 0.00 ? 115 ALA A CA   4  
ATOM 8261  C C    . ALA A 1 115 ? -2.208  5.496   -10.801 1.00 0.00 ? 115 ALA A C    4  
ATOM 8262  O O    . ALA A 1 115 ? -2.968  6.432   -10.559 1.00 0.00 ? 115 ALA A O    4  
ATOM 8263  C CB   . ALA A 1 115 ? -1.523  5.065   -13.211 1.00 0.00 ? 115 ALA A CB   4  
ATOM 8264  H H    . ALA A 1 115 ? -3.984  5.232   -13.275 1.00 0.00 ? 115 ALA A H    4  
ATOM 8265  H HA   . ALA A 1 115 ? -2.187  3.593   -11.799 1.00 0.00 ? 115 ALA A HA   4  
ATOM 8266  H HB1  . ALA A 1 115 ? -1.133  6.064   -13.017 1.00 0.00 ? 115 ALA A HB1  4  
ATOM 8267  H HB2  . ALA A 1 115 ? -0.694  4.365   -13.316 1.00 0.00 ? 115 ALA A HB2  4  
ATOM 8268  H HB3  . ALA A 1 115 ? -2.108  5.076   -14.131 1.00 0.00 ? 115 ALA A HB3  4  
ATOM 8269  N N    . TRP A 1 116 ? -1.177  5.151   -10.043 1.00 0.00 ? 116 TRP A N    4  
ATOM 8270  C CA   . TRP A 1 116 ? -0.862  5.885   -8.829  1.00 0.00 ? 116 TRP A CA   4  
ATOM 8271  C C    . TRP A 1 116 ? -0.745  7.367   -9.190  1.00 0.00 ? 116 TRP A C    4  
ATOM 8272  O O    . TRP A 1 116 ? -1.470  8.201   -8.649  1.00 0.00 ? 116 TRP A O    4  
ATOM 8273  C CB   . TRP A 1 116 ? 0.399   5.330   -8.165  1.00 0.00 ? 116 TRP A CB   4  
ATOM 8274  C CG   . TRP A 1 116 ? 0.948   6.208   -7.039  1.00 0.00 ? 116 TRP A CG   4  
ATOM 8275  C CD1  . TRP A 1 116 ? 1.845   7.200   -7.128  1.00 0.00 ? 116 TRP A CD1  4  
ATOM 8276  C CD2  . TRP A 1 116 ? 0.595   6.134   -5.641  1.00 0.00 ? 116 TRP A CD2  4  
ATOM 8277  N NE1  . TRP A 1 116 ? 2.096   7.767   -5.895  1.00 0.00 ? 116 TRP A NE1  4  
ATOM 8278  C CE2  . TRP A 1 116 ? 1.312   7.099   -4.962  1.00 0.00 ? 116 TRP A CE2  4  
ATOM 8279  C CE3  . TRP A 1 116 ? -0.299  5.279   -4.972  1.00 0.00 ? 116 TRP A CE3  4  
ATOM 8280  C CZ2  . TRP A 1 116 ? 1.208   7.300   -3.581  1.00 0.00 ? 116 TRP A CZ2  4  
ATOM 8281  C CZ3  . TRP A 1 116 ? -0.391  5.494   -3.592  1.00 0.00 ? 116 TRP A CZ3  4  
ATOM 8282  C CH2  . TRP A 1 116 ? 0.323   6.461   -2.894  1.00 0.00 ? 116 TRP A CH2  4  
ATOM 8283  H H    . TRP A 1 116 ? -0.564  4.388   -10.247 1.00 0.00 ? 116 TRP A H    4  
ATOM 8284  H HA   . TRP A 1 116 ? -1.682  5.736   -8.127  1.00 0.00 ? 116 TRP A HA   4  
ATOM 8285  H HB2  . TRP A 1 116 ? 0.181   4.339   -7.766  1.00 0.00 ? 116 TRP A HB2  4  
ATOM 8286  H HB3  . TRP A 1 116 ? 1.172   5.205   -8.923  1.00 0.00 ? 116 TRP A HB3  4  
ATOM 8287  H HD1  . TRP A 1 116 ? 2.317   7.518   -8.057  1.00 0.00 ? 116 TRP A HD1  4  
ATOM 8288  H HE1  . TRP A 1 116 ? 2.782   8.589   -5.691  1.00 0.00 ? 116 TRP A HE1  4  
ATOM 8289  H HE3  . TRP A 1 116 ? -0.876  4.510   -5.486  1.00 0.00 ? 116 TRP A HE3  4  
ATOM 8290  H HZ2  . TRP A 1 116 ? 1.785   8.070   -3.068  1.00 0.00 ? 116 TRP A HZ2  4  
ATOM 8291  H HZ3  . TRP A 1 116 ? -1.071  4.858   -3.025  1.00 0.00 ? 116 TRP A HZ3  4  
ATOM 8292  H HH2  . TRP A 1 116 ? 0.195   6.565   -1.817  1.00 0.00 ? 116 TRP A HH2  4  
ATOM 8293  N N    . HIS A 1 117 ? 0.174   7.651   -10.101 1.00 0.00 ? 117 HIS A N    4  
ATOM 8294  C CA   . HIS A 1 117 ? 0.395   9.019   -10.540 1.00 0.00 ? 117 HIS A CA   4  
ATOM 8295  C C    . HIS A 1 117 ? -0.043  9.167   -11.998 1.00 0.00 ? 117 HIS A C    4  
ATOM 8296  O O    . HIS A 1 117 ? 0.769   9.026   -12.912 1.00 0.00 ? 117 HIS A O    4  
ATOM 8297  C CB   . HIS A 1 117 ? 1.850   9.433   -10.313 1.00 0.00 ? 117 HIS A CB   4  
ATOM 8298  C CG   . HIS A 1 117 ? 2.036   10.440  -9.203  1.00 0.00 ? 117 HIS A CG   4  
ATOM 8299  N ND1  . HIS A 1 117 ? 3.229   10.589  -8.518  1.00 0.00 ? 117 HIS A ND1  4  
ATOM 8300  C CD2  . HIS A 1 117 ? 1.169   11.346  -8.668  1.00 0.00 ? 117 HIS A CD2  4  
ATOM 8301  C CE1  . HIS A 1 117 ? 3.075   11.543  -7.612  1.00 0.00 ? 117 HIS A CE1  4  
ATOM 8302  N NE2  . HIS A 1 117 ? 1.797   12.012  -7.706  1.00 0.00 ? 117 HIS A NE2  4  
ATOM 8303  H H    . HIS A 1 117 ? 0.760   6.968   -10.536 1.00 0.00 ? 117 HIS A H    4  
ATOM 8304  H HA   . HIS A 1 117 ? -0.233  9.653   -9.915  1.00 0.00 ? 117 HIS A HA   4  
ATOM 8305  H HB2  . HIS A 1 117 ? 2.439   8.545   -10.086 1.00 0.00 ? 117 HIS A HB2  4  
ATOM 8306  H HB3  . HIS A 1 117 ? 2.247   9.851   -11.238 1.00 0.00 ? 117 HIS A HB3  4  
ATOM 8307  H HD1  . HIS A 1 117 ? 4.065   10.064  -8.678  1.00 0.00 ? 117 HIS A HD1  4  
ATOM 8308  H HD2  . HIS A 1 117 ? 0.135   11.498  -8.977  1.00 0.00 ? 117 HIS A HD2  4  
ATOM 8309  H HE1  . HIS A 1 117 ? 3.836   11.894  -6.915  1.00 0.00 ? 117 HIS A HE1  4  
ATOM 8310  N N    . SER A 1 118 ? -1.326  9.449   -12.172 1.00 0.00 ? 118 SER A N    4  
ATOM 8311  C CA   . SER A 1 118 ? -1.882  9.618   -13.504 1.00 0.00 ? 118 SER A CA   4  
ATOM 8312  C C    . SER A 1 118 ? -2.612  10.959  -13.600 1.00 0.00 ? 118 SER A C    4  
ATOM 8313  O O    . SER A 1 118 ? -3.800  11.001  -13.915 1.00 0.00 ? 118 SER A O    4  
ATOM 8314  C CB   . SER A 1 118 ? -2.831  8.470   -13.854 1.00 0.00 ? 118 SER A CB   4  
ATOM 8315  O OG   . SER A 1 118 ? -2.701  8.066   -15.214 1.00 0.00 ? 118 SER A OG   4  
ATOM 8316  H H    . SER A 1 118 ? -1.979  9.562   -11.424 1.00 0.00 ? 118 SER A H    4  
ATOM 8317  H HA   . SER A 1 118 ? -1.025  9.599   -14.178 1.00 0.00 ? 118 SER A HA   4  
ATOM 8318  H HB2  . SER A 1 118 ? -2.628  7.620   -13.202 1.00 0.00 ? 118 SER A HB2  4  
ATOM 8319  H HB3  . SER A 1 118 ? -3.859  8.779   -13.664 1.00 0.00 ? 118 SER A HB3  4  
ATOM 8320  H HG   . SER A 1 118 ? -3.173  7.197   -15.359 1.00 0.00 ? 118 SER A HG   4  
ATOM 8321  N N    . LYS A 1 119 ? -1.871  12.021  -13.323 1.00 0.00 ? 119 LYS A N    4  
ATOM 8322  C CA   . LYS A 1 119 ? -2.433  13.360  -13.374 1.00 0.00 ? 119 LYS A CA   4  
ATOM 8323  C C    . LYS A 1 119 ? -3.498  13.503  -12.285 1.00 0.00 ? 119 LYS A C    4  
ATOM 8324  O O    . LYS A 1 119 ? -3.188  13.866  -11.152 1.00 0.00 ? 119 LYS A O    4  
ATOM 8325  C CB   . LYS A 1 119 ? -2.946  13.672  -14.781 1.00 0.00 ? 119 LYS A CB   4  
ATOM 8326  C CG   . LYS A 1 119 ? -1.891  14.426  -15.594 1.00 0.00 ? 119 LYS A CG   4  
ATOM 8327  C CD   . LYS A 1 119 ? -1.105  13.470  -16.494 1.00 0.00 ? 119 LYS A CD   4  
ATOM 8328  C CE   . LYS A 1 119 ? 0.258   14.059  -16.861 1.00 0.00 ? 119 LYS A CE   4  
ATOM 8329  N NZ   . LYS A 1 119 ? 1.267   13.707  -15.836 1.00 0.00 ? 119 LYS A NZ   4  
ATOM 8330  H H    . LYS A 1 119 ? -0.905  11.978  -13.068 1.00 0.00 ? 119 LYS A H    4  
ATOM 8331  H HA   . LYS A 1 119 ? -1.626  14.062  -13.162 1.00 0.00 ? 119 LYS A HA   4  
ATOM 8332  H HB2  . LYS A 1 119 ? -3.209  12.746  -15.291 1.00 0.00 ? 119 LYS A HB2  4  
ATOM 8333  H HB3  . LYS A 1 119 ? -3.855  14.269  -14.717 1.00 0.00 ? 119 LYS A HB3  4  
ATOM 8334  H HG2  . LYS A 1 119 ? -2.375  15.190  -16.204 1.00 0.00 ? 119 LYS A HG2  4  
ATOM 8335  H HG3  . LYS A 1 119 ? -1.208  14.942  -14.921 1.00 0.00 ? 119 LYS A HG3  4  
ATOM 8336  H HD2  . LYS A 1 119 ? -0.969  12.516  -15.984 1.00 0.00 ? 119 LYS A HD2  4  
ATOM 8337  H HD3  . LYS A 1 119 ? -1.674  13.268  -17.401 1.00 0.00 ? 119 LYS A HD3  4  
ATOM 8338  H HE2  . LYS A 1 119 ? 0.573   13.683  -17.834 1.00 0.00 ? 119 LYS A HE2  4  
ATOM 8339  H HE3  . LYS A 1 119 ? 0.182   15.142  -16.947 1.00 0.00 ? 119 LYS A HE3  4  
ATOM 8340  H HZ1  . LYS A 1 119 ? 1.016   12.840  -15.405 1.00 0.00 ? 119 LYS A HZ1  4  
ATOM 8341  H HZ2  . LYS A 1 119 ? 2.164   13.616  -16.269 1.00 0.00 ? 119 LYS A HZ2  4  
ATOM 8342  H HZ3  . LYS A 1 119 ? 1.303   14.426  -15.143 1.00 0.00 ? 119 LYS A HZ3  4  
ATOM 8343  N N    . ASN A 1 120 ? -4.733  13.211  -12.668 1.00 0.00 ? 120 ASN A N    4  
ATOM 8344  C CA   . ASN A 1 120 ? -5.846  13.302  -11.739 1.00 0.00 ? 120 ASN A CA   4  
ATOM 8345  C C    . ASN A 1 120 ? -6.442  11.910  -11.526 1.00 0.00 ? 120 ASN A C    4  
ATOM 8346  O O    . ASN A 1 120 ? -5.851  10.909  -11.928 1.00 0.00 ? 120 ASN A O    4  
ATOM 8347  C CB   . ASN A 1 120 ? -6.948  14.210  -12.287 1.00 0.00 ? 120 ASN A CB   4  
ATOM 8348  C CG   . ASN A 1 120 ? -7.481  15.145  -11.199 1.00 0.00 ? 120 ASN A CG   4  
ATOM 8349  O OD1  . ASN A 1 120 ? -6.810  16.058  -10.746 1.00 0.00 ? 120 ASN A OD1  4  
ATOM 8350  N ND2  . ASN A 1 120 ? -8.721  14.867  -10.807 1.00 0.00 ? 120 ASN A ND2  4  
ATOM 8351  H H    . ASN A 1 120 ? -4.977  12.916  -13.592 1.00 0.00 ? 120 ASN A H    4  
ATOM 8352  H HA   . ASN A 1 120 ? -5.422  13.719  -10.825 1.00 0.00 ? 120 ASN A HA   4  
ATOM 8353  H HB2  . ASN A 1 120 ? -6.560  14.798  -13.119 1.00 0.00 ? 120 ASN A HB2  4  
ATOM 8354  H HB3  . ASN A 1 120 ? -7.763  13.602  -12.680 1.00 0.00 ? 120 ASN A HB3  4  
ATOM 8355  H HD21 . ASN A 1 120 ? -9.216  14.103  -11.220 1.00 0.00 ? 120 ASN A HD21 4  
ATOM 8356  H HD22 . ASN A 1 120 ? -9.157  15.423  -10.099 1.00 0.00 ? 120 ASN A HD22 4  
ATOM 8357  N N    . PHE A 1 121 ? -7.607  11.890  -10.894 1.00 0.00 ? 121 PHE A N    4  
ATOM 8358  C CA   . PHE A 1 121 ? -8.290  10.637  -10.622 1.00 0.00 ? 121 PHE A CA   4  
ATOM 8359  C C    . PHE A 1 121 ? -9.600  10.546  -11.407 1.00 0.00 ? 121 PHE A C    4  
ATOM 8360  O O    . PHE A 1 121 ? -10.238 11.562  -11.678 1.00 0.00 ? 121 PHE A O    4  
ATOM 8361  C CB   . PHE A 1 121 ? -8.604  10.613  -9.125  1.00 0.00 ? 121 PHE A CB   4  
ATOM 8362  C CG   . PHE A 1 121 ? -9.104  9.260   -8.615  1.00 0.00 ? 121 PHE A CG   4  
ATOM 8363  C CD1  . PHE A 1 121 ? -8.306  8.163   -8.703  1.00 0.00 ? 121 PHE A CD1  4  
ATOM 8364  C CD2  . PHE A 1 121 ? -10.347 9.155   -8.074  1.00 0.00 ? 121 PHE A CD2  4  
ATOM 8365  C CE1  . PHE A 1 121 ? -8.770  6.907   -8.230  1.00 0.00 ? 121 PHE A CE1  4  
ATOM 8366  C CE2  . PHE A 1 121 ? -10.812 7.899   -7.601  1.00 0.00 ? 121 PHE A CE2  4  
ATOM 8367  C CZ   . PHE A 1 121 ? -10.014 6.802   -7.690  1.00 0.00 ? 121 PHE A CZ   4  
ATOM 8368  H H    . PHE A 1 121 ? -8.081  12.709  -10.570 1.00 0.00 ? 121 PHE A H    4  
ATOM 8369  H HA   . PHE A 1 121 ? -7.625  9.832   -10.934 1.00 0.00 ? 121 PHE A HA   4  
ATOM 8370  H HB2  . PHE A 1 121 ? -7.706  10.889  -8.572  1.00 0.00 ? 121 PHE A HB2  4  
ATOM 8371  H HB3  . PHE A 1 121 ? -9.356  11.372  -8.910  1.00 0.00 ? 121 PHE A HB3  4  
ATOM 8372  H HD1  . PHE A 1 121 ? -7.309  8.247   -9.137  1.00 0.00 ? 121 PHE A HD1  4  
ATOM 8373  H HD2  . PHE A 1 121 ? -10.987 10.034  -8.004  1.00 0.00 ? 121 PHE A HD2  4  
ATOM 8374  H HE1  . PHE A 1 121 ? -8.130  6.027   -8.301  1.00 0.00 ? 121 PHE A HE1  4  
ATOM 8375  H HE2  . PHE A 1 121 ? -11.809 7.815   -7.168  1.00 0.00 ? 121 PHE A HE2  4  
ATOM 8376  H HZ   . PHE A 1 121 ? -10.370 5.838   -7.326  1.00 0.00 ? 121 PHE A HZ   4  
ATOM 8377  N N    . THR A 1 122 ? -9.963  9.318   -11.750 1.00 0.00 ? 122 THR A N    4  
ATOM 8378  C CA   . THR A 1 122 ? -11.186 9.081   -12.499 1.00 0.00 ? 122 THR A CA   4  
ATOM 8379  C C    . THR A 1 122 ? -12.086 8.096   -11.751 1.00 0.00 ? 122 THR A C    4  
ATOM 8380  O O    . THR A 1 122 ? -11.812 6.897   -11.722 1.00 0.00 ? 122 THR A O    4  
ATOM 8381  C CB   . THR A 1 122 ? -10.797 8.606   -13.900 1.00 0.00 ? 122 THR A CB   4  
ATOM 8382  O OG1  . THR A 1 122 ? -10.156 9.736   -14.485 1.00 0.00 ? 122 THR A OG1  4  
ATOM 8383  C CG2  . THR A 1 122 ? -12.015 8.365   -14.795 1.00 0.00 ? 122 THR A CG2  4  
ATOM 8384  H H    . THR A 1 122 ? -9.439  8.497   -11.526 1.00 0.00 ? 122 THR A H    4  
ATOM 8385  H HA   . THR A 1 122 ? -11.732 10.022  -12.572 1.00 0.00 ? 122 THR A HA   4  
ATOM 8386  H HB   . THR A 1 122 ? -10.169 7.717   -13.850 1.00 0.00 ? 122 THR A HB   4  
ATOM 8387  H HG1  . THR A 1 122 ? -10.754 10.535  -14.430 1.00 0.00 ? 122 THR A HG1  4  
ATOM 8388  H HG21 . THR A 1 122 ? -12.438 9.322   -15.099 1.00 0.00 ? 122 THR A HG21 4  
ATOM 8389  H HG22 . THR A 1 122 ? -11.711 7.805   -15.679 1.00 0.00 ? 122 THR A HG22 4  
ATOM 8390  H HG23 . THR A 1 122 ? -12.764 7.795   -14.244 1.00 0.00 ? 122 THR A HG23 4  
ATOM 8391  N N    . LYS A 1 123 ? -13.143 8.638   -11.164 1.00 0.00 ? 123 LYS A N    4  
ATOM 8392  C CA   . LYS A 1 123 ? -14.086 7.822   -10.418 1.00 0.00 ? 123 LYS A CA   4  
ATOM 8393  C C    . LYS A 1 123 ? -14.839 6.907   -11.386 1.00 0.00 ? 123 LYS A C    4  
ATOM 8394  O O    . LYS A 1 123 ? -15.491 7.381   -12.314 1.00 0.00 ? 123 LYS A O    4  
ATOM 8395  C CB   . LYS A 1 123 ? -15.002 8.704   -9.567  1.00 0.00 ? 123 LYS A CB   4  
ATOM 8396  C CG   . LYS A 1 123 ? -15.131 8.150   -8.146  1.00 0.00 ? 123 LYS A CG   4  
ATOM 8397  C CD   . LYS A 1 123 ? -16.596 7.885   -7.792  1.00 0.00 ? 123 LYS A CD   4  
ATOM 8398  C CE   . LYS A 1 123 ? -16.710 6.857   -6.665  1.00 0.00 ? 123 LYS A CE   4  
ATOM 8399  N NZ   . LYS A 1 123 ? -18.027 6.962   -5.999  1.00 0.00 ? 123 LYS A NZ   4  
ATOM 8400  H H    . LYS A 1 123 ? -13.359 9.614   -11.192 1.00 0.00 ? 123 LYS A H    4  
ATOM 8401  H HA   . LYS A 1 123 ? -13.509 7.200   -9.733  1.00 0.00 ? 123 LYS A HA   4  
ATOM 8402  H HB2  . LYS A 1 123 ? -14.606 9.718   -9.531  1.00 0.00 ? 123 LYS A HB2  4  
ATOM 8403  H HB3  . LYS A 1 123 ? -15.987 8.763   -10.029 1.00 0.00 ? 123 LYS A HB3  4  
ATOM 8404  H HG2  . LYS A 1 123 ? -14.559 7.226   -8.059  1.00 0.00 ? 123 LYS A HG2  4  
ATOM 8405  H HG3  . LYS A 1 123 ? -14.703 8.858   -7.436  1.00 0.00 ? 123 LYS A HG3  4  
ATOM 8406  H HD2  . LYS A 1 123 ? -17.075 8.816   -7.490  1.00 0.00 ? 123 LYS A HD2  4  
ATOM 8407  H HD3  . LYS A 1 123 ? -17.127 7.524   -8.673  1.00 0.00 ? 123 LYS A HD3  4  
ATOM 8408  H HE2  . LYS A 1 123 ? -16.577 5.852   -7.065  1.00 0.00 ? 123 LYS A HE2  4  
ATOM 8409  H HE3  . LYS A 1 123 ? -15.914 7.018   -5.937  1.00 0.00 ? 123 LYS A HE3  4  
ATOM 8410  H HZ1  . LYS A 1 123 ? -18.731 7.161   -6.682  1.00 0.00 ? 123 LYS A HZ1  4  
ATOM 8411  H HZ2  . LYS A 1 123 ? -18.240 6.098   -5.544  1.00 0.00 ? 123 LYS A HZ2  4  
ATOM 8412  H HZ3  . LYS A 1 123 ? -18.002 7.698   -5.323  1.00 0.00 ? 123 LYS A HZ3  4  
ATOM 8413  N N    . TYR A 1 124 ? -14.723 5.611   -11.135 1.00 0.00 ? 124 TYR A N    4  
ATOM 8414  C CA   . TYR A 1 124 ? -15.385 4.625   -11.972 1.00 0.00 ? 124 TYR A CA   4  
ATOM 8415  C C    . TYR A 1 124 ? -16.308 3.731   -11.142 1.00 0.00 ? 124 TYR A C    4  
ATOM 8416  O O    . TYR A 1 124 ? -16.244 3.736   -9.914  1.00 0.00 ? 124 TYR A O    4  
ATOM 8417  C CB   . TYR A 1 124 ? -14.271 3.767   -12.574 1.00 0.00 ? 124 TYR A CB   4  
ATOM 8418  C CG   . TYR A 1 124 ? -13.750 4.277   -13.920 1.00 0.00 ? 124 TYR A CG   4  
ATOM 8419  C CD1  . TYR A 1 124 ? -14.626 4.477   -14.967 1.00 0.00 ? 124 TYR A CD1  4  
ATOM 8420  C CD2  . TYR A 1 124 ? -12.405 4.536   -14.086 1.00 0.00 ? 124 TYR A CD2  4  
ATOM 8421  C CE1  . TYR A 1 124 ? -14.137 4.957   -16.234 1.00 0.00 ? 124 TYR A CE1  4  
ATOM 8422  C CE2  . TYR A 1 124 ? -11.915 5.016   -15.352 1.00 0.00 ? 124 TYR A CE2  4  
ATOM 8423  C CZ   . TYR A 1 124 ? -12.806 5.203   -16.364 1.00 0.00 ? 124 TYR A CZ   4  
ATOM 8424  O OH   . TYR A 1 124 ? -12.343 5.656   -17.560 1.00 0.00 ? 124 TYR A OH   4  
ATOM 8425  H H    . TYR A 1 124 ? -14.191 5.233   -10.377 1.00 0.00 ? 124 TYR A H    4  
ATOM 8426  H HA   . TYR A 1 124 ? -15.979 5.158   -12.715 1.00 0.00 ? 124 TYR A HA   4  
ATOM 8427  H HB2  . TYR A 1 124 ? -13.440 3.721   -11.870 1.00 0.00 ? 124 TYR A HB2  4  
ATOM 8428  H HB3  . TYR A 1 124 ? -14.638 2.748   -12.701 1.00 0.00 ? 124 TYR A HB3  4  
ATOM 8429  H HD1  . TYR A 1 124 ? -15.689 4.272   -14.836 1.00 0.00 ? 124 TYR A HD1  4  
ATOM 8430  H HD2  . TYR A 1 124 ? -11.713 4.378   -13.259 1.00 0.00 ? 124 TYR A HD2  4  
ATOM 8431  H HE1  . TYR A 1 124 ? -14.818 5.119   -17.069 1.00 0.00 ? 124 TYR A HE1  4  
ATOM 8432  H HE2  . TYR A 1 124 ? -10.856 5.225   -15.497 1.00 0.00 ? 124 TYR A HE2  4  
ATOM 8433  H HH   . TYR A 1 124 ? -11.594 6.303   -17.414 1.00 0.00 ? 124 TYR A HH   4  
ATOM 8434  N N    . PRO A 1 125 ? -17.169 2.965   -11.864 1.00 0.00 ? 125 PRO A N    4  
ATOM 8435  C CA   . PRO A 1 125 ? -18.104 2.067   -11.208 1.00 0.00 ? 125 PRO A CA   4  
ATOM 8436  C C    . PRO A 1 125 ? -17.389 0.824   -10.675 1.00 0.00 ? 125 PRO A C    4  
ATOM 8437  O O    . PRO A 1 125 ? -16.740 0.105   -11.433 1.00 0.00 ? 125 PRO A O    4  
ATOM 8438  C CB   . PRO A 1 125 ? -19.149 1.746   -12.264 1.00 0.00 ? 125 PRO A CB   4  
ATOM 8439  C CG   . PRO A 1 125 ? -18.513 2.097   -13.599 1.00 0.00 ? 125 PRO A CG   4  
ATOM 8440  C CD   . PRO A 1 125 ? -17.274 2.932   -13.320 1.00 0.00 ? 125 PRO A CD   4  
ATOM 8441  H HA   . PRO A 1 125 ? -18.510 2.512   -10.409 1.00 0.00 ? 125 PRO A HA   4  
ATOM 8442  H HB2  . PRO A 1 125 ? -19.428 0.693   -12.230 1.00 0.00 ? 125 PRO A HB2  4  
ATOM 8443  H HB3  . PRO A 1 125 ? -20.059 2.322   -12.102 1.00 0.00 ? 125 PRO A HB3  4  
ATOM 8444  H HG2  . PRO A 1 125 ? -18.248 1.192   -14.146 1.00 0.00 ? 125 PRO A HG2  4  
ATOM 8445  H HG3  . PRO A 1 125 ? -19.214 2.651   -14.222 1.00 0.00 ? 125 PRO A HG3  4  
ATOM 8446  H HD2  . PRO A 1 125 ? -16.386 2.488   -13.771 1.00 0.00 ? 125 PRO A HD2  4  
ATOM 8447  H HD3  . PRO A 1 125 ? -17.372 3.936   -13.733 1.00 0.00 ? 125 PRO A HD3  4  
ATOM 8448  N N    . LYS A 1 126 ? -17.533 0.608   -9.376  1.00 0.00 ? 126 LYS A N    4  
ATOM 8449  C CA   . LYS A 1 126 ? -16.910 -0.536  -8.734  1.00 0.00 ? 126 LYS A CA   4  
ATOM 8450  C C    . LYS A 1 126 ? -15.483 -0.169  -8.322  1.00 0.00 ? 126 LYS A C    4  
ATOM 8451  O O    . LYS A 1 126 ? -15.030 -0.539  -7.239  1.00 0.00 ? 126 LYS A O    4  
ATOM 8452  C CB   . LYS A 1 126 ? -16.991 -1.768  -9.637  1.00 0.00 ? 126 LYS A CB   4  
ATOM 8453  C CG   . LYS A 1 126 ? -18.380 -1.895  -10.267 1.00 0.00 ? 126 LYS A CG   4  
ATOM 8454  C CD   . LYS A 1 126 ? -18.665 -3.341  -10.678 1.00 0.00 ? 126 LYS A CD   4  
ATOM 8455  C CE   . LYS A 1 126 ? -18.363 -3.558  -12.162 1.00 0.00 ? 126 LYS A CE   4  
ATOM 8456  N NZ   . LYS A 1 126 ? -18.783 -4.913  -12.584 1.00 0.00 ? 126 LYS A NZ   4  
ATOM 8457  H H    . LYS A 1 126 ? -18.064 1.198   -8.767  1.00 0.00 ? 126 LYS A H    4  
ATOM 8458  H HA   . LYS A 1 126 ? -17.483 -0.758  -7.833  1.00 0.00 ? 126 LYS A HA   4  
ATOM 8459  H HB2  . LYS A 1 126 ? -16.237 -1.700  -10.421 1.00 0.00 ? 126 LYS A HB2  4  
ATOM 8460  H HB3  . LYS A 1 126 ? -16.767 -2.664  -9.058  1.00 0.00 ? 126 LYS A HB3  4  
ATOM 8461  H HG2  . LYS A 1 126 ? -19.136 -1.559  -9.558  1.00 0.00 ? 126 LYS A HG2  4  
ATOM 8462  H HG3  . LYS A 1 126 ? -18.449 -1.245  -11.139 1.00 0.00 ? 126 LYS A HG3  4  
ATOM 8463  H HD2  . LYS A 1 126 ? -18.060 -4.020  -10.077 1.00 0.00 ? 126 LYS A HD2  4  
ATOM 8464  H HD3  . LYS A 1 126 ? -19.708 -3.581  -10.477 1.00 0.00 ? 126 LYS A HD3  4  
ATOM 8465  H HE2  . LYS A 1 126 ? -18.881 -2.808  -12.759 1.00 0.00 ? 126 LYS A HE2  4  
ATOM 8466  H HE3  . LYS A 1 126 ? -17.296 -3.429  -12.345 1.00 0.00 ? 126 LYS A HE3  4  
ATOM 8467  H HZ1  . LYS A 1 126 ? -19.192 -5.392  -11.807 1.00 0.00 ? 126 LYS A HZ1  4  
ATOM 8468  H HZ2  . LYS A 1 126 ? -19.455 -4.839  -13.321 1.00 0.00 ? 126 LYS A HZ2  4  
ATOM 8469  H HZ3  . LYS A 1 126 ? -17.987 -5.423  -12.909 1.00 0.00 ? 126 LYS A HZ3  4  
ATOM 8470  N N    . LYS A 1 127 ? -14.813 0.555   -9.207  1.00 0.00 ? 127 LYS A N    4  
ATOM 8471  C CA   . LYS A 1 127 ? -13.446 0.976   -8.949  1.00 0.00 ? 127 LYS A CA   4  
ATOM 8472  C C    . LYS A 1 127 ? -13.360 1.580   -7.545  1.00 0.00 ? 127 LYS A C    4  
ATOM 8473  O O    . LYS A 1 127 ? -14.249 2.320   -7.128  1.00 0.00 ? 127 LYS A O    4  
ATOM 8474  C CB   . LYS A 1 127 ? -12.958 1.916   -10.053 1.00 0.00 ? 127 LYS A CB   4  
ATOM 8475  C CG   . LYS A 1 127 ? -12.870 1.186   -11.395 1.00 0.00 ? 127 LYS A CG   4  
ATOM 8476  C CD   . LYS A 1 127 ? -11.741 0.153   -11.385 1.00 0.00 ? 127 LYS A CD   4  
ATOM 8477  C CE   . LYS A 1 127 ? -11.596 -0.514  -12.754 1.00 0.00 ? 127 LYS A CE   4  
ATOM 8478  N NZ   . LYS A 1 127 ? -12.471 -1.705  -12.845 1.00 0.00 ? 127 LYS A NZ   4  
ATOM 8479  H H    . LYS A 1 127 ? -15.188 0.852   -10.085 1.00 0.00 ? 127 LYS A H    4  
ATOM 8480  H HA   . LYS A 1 127 ? -12.818 0.086   -8.981  1.00 0.00 ? 127 LYS A HA   4  
ATOM 8481  H HB2  . LYS A 1 127 ? -13.636 2.765   -10.140 1.00 0.00 ? 127 LYS A HB2  4  
ATOM 8482  H HB3  . LYS A 1 127 ? -11.979 2.316   -9.788  1.00 0.00 ? 127 LYS A HB3  4  
ATOM 8483  H HG2  . LYS A 1 127 ? -13.818 0.691   -11.606 1.00 0.00 ? 127 LYS A HG2  4  
ATOM 8484  H HG3  . LYS A 1 127 ? -12.701 1.907   -12.195 1.00 0.00 ? 127 LYS A HG3  4  
ATOM 8485  H HD2  . LYS A 1 127 ? -10.804 0.637   -11.110 1.00 0.00 ? 127 LYS A HD2  4  
ATOM 8486  H HD3  . LYS A 1 127 ? -11.943 -0.604  -10.627 1.00 0.00 ? 127 LYS A HD3  4  
ATOM 8487  H HE2  . LYS A 1 127 ? -11.854 0.195   -13.540 1.00 0.00 ? 127 LYS A HE2  4  
ATOM 8488  H HE3  . LYS A 1 127 ? -10.558 -0.805  -12.915 1.00 0.00 ? 127 LYS A HE3  4  
ATOM 8489  H HZ1  . LYS A 1 127 ? -12.961 -1.692  -13.717 1.00 0.00 ? 127 LYS A HZ1  4  
ATOM 8490  H HZ2  . LYS A 1 127 ? -11.914 -2.533  -12.788 1.00 0.00 ? 127 LYS A HZ2  4  
ATOM 8491  H HZ3  . LYS A 1 127 ? -13.129 -1.693  -12.092 1.00 0.00 ? 127 LYS A HZ3  4  
ATOM 8492  N N    . PHE A 1 128 ? -12.281 1.240   -6.856  1.00 0.00 ? 128 PHE A N    4  
ATOM 8493  C CA   . PHE A 1 128 ? -12.066 1.739   -5.508  1.00 0.00 ? 128 PHE A CA   4  
ATOM 8494  C C    . PHE A 1 128 ? -11.436 3.133   -5.533  1.00 0.00 ? 128 PHE A C    4  
ATOM 8495  O O    . PHE A 1 128 ? -10.487 3.376   -6.277  1.00 0.00 ? 128 PHE A O    4  
ATOM 8496  C CB   . PHE A 1 128 ? -11.104 0.769   -4.820  1.00 0.00 ? 128 PHE A CB   4  
ATOM 8497  C CG   . PHE A 1 128 ? -11.731 -0.579  -4.459  1.00 0.00 ? 128 PHE A CG   4  
ATOM 8498  C CD1  . PHE A 1 128 ? -12.411 -0.721  -3.289  1.00 0.00 ? 128 PHE A CD1  4  
ATOM 8499  C CD2  . PHE A 1 128 ? -11.609 -1.634  -5.307  1.00 0.00 ? 128 PHE A CD2  4  
ATOM 8500  C CE1  . PHE A 1 128 ? -12.994 -1.972  -2.954  1.00 0.00 ? 128 PHE A CE1  4  
ATOM 8501  C CE2  . PHE A 1 128 ? -12.192 -2.885  -4.972  1.00 0.00 ? 128 PHE A CE2  4  
ATOM 8502  C CZ   . PHE A 1 128 ? -12.872 -3.028  -3.803  1.00 0.00 ? 128 PHE A CZ   4  
ATOM 8503  H H    . PHE A 1 128 ? -11.562 0.638   -7.202  1.00 0.00 ? 128 PHE A H    4  
ATOM 8504  H HA   . PHE A 1 128 ? -13.041 1.793   -5.024  1.00 0.00 ? 128 PHE A HA   4  
ATOM 8505  H HB2  . PHE A 1 128 ? -10.249 0.597   -5.473  1.00 0.00 ? 128 PHE A HB2  4  
ATOM 8506  H HB3  . PHE A 1 128 ? -10.722 1.236   -3.911  1.00 0.00 ? 128 PHE A HB3  4  
ATOM 8507  H HD1  . PHE A 1 128 ? -12.509 0.125   -2.609  1.00 0.00 ? 128 PHE A HD1  4  
ATOM 8508  H HD2  . PHE A 1 128 ? -11.064 -1.520  -6.244  1.00 0.00 ? 128 PHE A HD2  4  
ATOM 8509  H HE1  . PHE A 1 128 ? -13.539 -2.086  -2.017  1.00 0.00 ? 128 PHE A HE1  4  
ATOM 8510  H HE2  . PHE A 1 128 ? -12.094 -3.732  -5.652  1.00 0.00 ? 128 PHE A HE2  4  
ATOM 8511  H HZ   . PHE A 1 128 ? -13.319 -3.988  -3.546  1.00 0.00 ? 128 PHE A HZ   4  
ATOM 8512  N N    . TYR A 1 129 ? -11.988 4.013   -4.711  1.00 0.00 ? 129 TYR A N    4  
ATOM 8513  C CA   . TYR A 1 129 ? -11.492 5.376   -4.629  1.00 0.00 ? 129 TYR A CA   4  
ATOM 8514  C C    . TYR A 1 129 ? -10.888 5.658   -3.252  1.00 0.00 ? 129 TYR A C    4  
ATOM 8515  O O    . TYR A 1 129 ? -11.129 4.916   -2.301  1.00 0.00 ? 129 TYR A O    4  
ATOM 8516  C CB   . TYR A 1 129 ? -12.708 6.281   -4.835  1.00 0.00 ? 129 TYR A CB   4  
ATOM 8517  C CG   . TYR A 1 129 ? -13.864 5.998   -3.873  1.00 0.00 ? 129 TYR A CG   4  
ATOM 8518  C CD1  . TYR A 1 129 ? -13.760 6.356   -2.544  1.00 0.00 ? 129 TYR A CD1  4  
ATOM 8519  C CD2  . TYR A 1 129 ? -15.010 5.383   -4.334  1.00 0.00 ? 129 TYR A CD2  4  
ATOM 8520  C CE1  . TYR A 1 129 ? -14.848 6.090   -1.639  1.00 0.00 ? 129 TYR A CE1  4  
ATOM 8521  C CE2  . TYR A 1 129 ? -16.098 5.117   -3.429  1.00 0.00 ? 129 TYR A CE2  4  
ATOM 8522  C CZ   . TYR A 1 129 ? -15.963 5.483   -2.126  1.00 0.00 ? 129 TYR A CZ   4  
ATOM 8523  O OH   . TYR A 1 129 ? -16.991 5.231   -1.271  1.00 0.00 ? 129 TYR A OH   4  
ATOM 8524  H H    . TYR A 1 129 ? -12.760 3.807   -4.109  1.00 0.00 ? 129 TYR A H    4  
ATOM 8525  H HA   . TYR A 1 129 ? -10.719 5.498   -5.388  1.00 0.00 ? 129 TYR A HA   4  
ATOM 8526  H HB2  . TYR A 1 129 ? -12.399 7.320   -4.719  1.00 0.00 ? 129 TYR A HB2  4  
ATOM 8527  H HB3  . TYR A 1 129 ? -13.064 6.167   -5.858  1.00 0.00 ? 129 TYR A HB3  4  
ATOM 8528  H HD1  . TYR A 1 129 ? -12.854 6.841   -2.180  1.00 0.00 ? 129 TYR A HD1  4  
ATOM 8529  H HD2  . TYR A 1 129 ? -15.092 5.100   -5.384  1.00 0.00 ? 129 TYR A HD2  4  
ATOM 8530  H HE1  . TYR A 1 129 ? -14.779 6.368   -0.588  1.00 0.00 ? 129 TYR A HE1  4  
ATOM 8531  H HE2  . TYR A 1 129 ? -17.009 4.632   -3.780  1.00 0.00 ? 129 TYR A HE2  4  
ATOM 8532  H HH   . TYR A 1 129 ? -17.309 6.084   -0.859  1.00 0.00 ? 129 TYR A HH   4  
ATOM 8533  N N    . PRO A 1 130 ? -10.094 6.760   -3.187  1.00 0.00 ? 130 PRO A N    4  
ATOM 8534  C CA   . PRO A 1 130 ? -9.454  7.150   -1.943  1.00 0.00 ? 130 PRO A CA   4  
ATOM 8535  C C    . PRO A 1 130 ? -10.463 7.778   -0.980  1.00 0.00 ? 130 PRO A C    4  
ATOM 8536  O O    . PRO A 1 130 ? -11.107 8.772   -1.311  1.00 0.00 ? 130 PRO A O    4  
ATOM 8537  C CB   . PRO A 1 130 ? -8.348  8.109   -2.352  1.00 0.00 ? 130 PRO A CB   4  
ATOM 8538  C CG   . PRO A 1 130 ? -8.703  8.581   -3.753  1.00 0.00 ? 130 PRO A CG   4  
ATOM 8539  C CD   . PRO A 1 130 ? -9.786  7.662   -4.294  1.00 0.00 ? 130 PRO A CD   4  
ATOM 8540  H HA   . PRO A 1 130 ? -9.091  6.345   -1.472  1.00 0.00 ? 130 PRO A HA   4  
ATOM 8541  H HB2  . PRO A 1 130 ? -8.283  8.949   -1.661  1.00 0.00 ? 130 PRO A HB2  4  
ATOM 8542  H HB3  . PRO A 1 130 ? -7.377  7.613   -2.342  1.00 0.00 ? 130 PRO A HB3  4  
ATOM 8543  H HG2  . PRO A 1 130 ? -9.054  9.613   -3.730  1.00 0.00 ? 130 PRO A HG2  4  
ATOM 8544  H HG3  . PRO A 1 130 ? -7.825  8.557   -4.398  1.00 0.00 ? 130 PRO A HG3  4  
ATOM 8545  H HD2  . PRO A 1 130 ? -10.667 8.226   -4.602  1.00 0.00 ? 130 PRO A HD2  4  
ATOM 8546  H HD3  . PRO A 1 130 ? -9.438  7.112   -5.168  1.00 0.00 ? 130 PRO A HD3  4  
ATOM 8547  N N    . LEU A 1 131 ? -10.570 7.171   0.193   1.00 0.00 ? 131 LEU A N    4  
ATOM 8548  C CA   . LEU A 1 131 ? -11.491 7.659   1.206   1.00 0.00 ? 131 LEU A CA   4  
ATOM 8549  C C    . LEU A 1 131 ? -11.005 9.015   1.721   1.00 0.00 ? 131 LEU A C    4  
ATOM 8550  O O    . LEU A 1 131 ? -11.335 10.054  1.151   1.00 0.00 ? 131 LEU A O    4  
ATOM 8551  C CB   . LEU A 1 131 ? -11.677 6.614   2.309   1.00 0.00 ? 131 LEU A CB   4  
ATOM 8552  C CG   . LEU A 1 131 ? -12.251 5.267   1.866   1.00 0.00 ? 131 LEU A CG   4  
ATOM 8553  C CD1  . LEU A 1 131 ? -12.241 4.261   3.019   1.00 0.00 ? 131 LEU A CD1  4  
ATOM 8554  C CD2  . LEU A 1 131 ? -13.648 5.437   1.265   1.00 0.00 ? 131 LEU A CD2  4  
ATOM 8555  H H    . LEU A 1 131 ? -10.043 6.363   0.455   1.00 0.00 ? 131 LEU A H    4  
ATOM 8556  H HA   . LEU A 1 131 ? -12.460 7.798   0.727   1.00 0.00 ? 131 LEU A HA   4  
ATOM 8557  H HB2  . LEU A 1 131 ? -10.710 6.437   2.781   1.00 0.00 ? 131 LEU A HB2  4  
ATOM 8558  H HB3  . LEU A 1 131 ? -12.332 7.033   3.072   1.00 0.00 ? 131 LEU A HB3  4  
ATOM 8559  H HG   . LEU A 1 131 ? -11.610 4.863   1.082   1.00 0.00 ? 131 LEU A HG   4  
ATOM 8560  H HD11 . LEU A 1 131 ? -12.974 4.561   3.768   1.00 0.00 ? 131 LEU A HD11 4  
ATOM 8561  H HD12 . LEU A 1 131 ? -12.494 3.271   2.639   1.00 0.00 ? 131 LEU A HD12 4  
ATOM 8562  H HD13 . LEU A 1 131 ? -11.249 4.235   3.470   1.00 0.00 ? 131 LEU A HD13 4  
ATOM 8563  H HD21 . LEU A 1 131 ? -13.881 6.498   1.184   1.00 0.00 ? 131 LEU A HD21 4  
ATOM 8564  H HD22 . LEU A 1 131 ? -13.676 4.982   0.275   1.00 0.00 ? 131 LEU A HD22 4  
ATOM 8565  H HD23 . LEU A 1 131 ? -14.382 4.952   1.909   1.00 0.00 ? 131 LEU A HD23 4  
ATOM 8566  N N    . GLU A 1 132 ? -10.228 8.962   2.792   1.00 0.00 ? 132 GLU A N    4  
ATOM 8567  C CA   . GLU A 1 132 ? -9.693  10.174  3.390   1.00 0.00 ? 132 GLU A CA   4  
ATOM 8568  C C    . GLU A 1 132 ? -9.115  11.088  2.308   1.00 0.00 ? 132 GLU A C    4  
ATOM 8569  O O    . GLU A 1 132 ? -8.363  10.637  1.445   1.00 0.00 ? 132 GLU A O    4  
ATOM 8570  C CB   . GLU A 1 132 ? -8.639  9.844   4.449   1.00 0.00 ? 132 GLU A CB   4  
ATOM 8571  C CG   . GLU A 1 132 ? -8.629  10.898  5.558   1.00 0.00 ? 132 GLU A CG   4  
ATOM 8572  C CD   . GLU A 1 132 ? -8.637  10.239  6.940   1.00 0.00 ? 132 GLU A CD   4  
ATOM 8573  O OE1  . GLU A 1 132 ? -7.593  9.649   7.293   1.00 0.00 ? 132 GLU A OE1  4  
ATOM 8574  O OE2  . GLU A 1 132 ? -9.686  10.342  7.611   1.00 0.00 ? 132 GLU A OE2  4  
ATOM 8575  H H    . GLU A 1 132 ? -9.963  8.113   3.250   1.00 0.00 ? 132 GLU A H    4  
ATOM 8576  H HA   . GLU A 1 132 ? -10.542 10.659  3.870   1.00 0.00 ? 132 GLU A HA   4  
ATOM 8577  H HB2  . GLU A 1 132 ? -8.843  8.863   4.877   1.00 0.00 ? 132 GLU A HB2  4  
ATOM 8578  H HB3  . GLU A 1 132 ? -7.655  9.791   3.984   1.00 0.00 ? 132 GLU A HB3  4  
ATOM 8579  H HG2  . GLU A 1 132 ? -7.746  11.529  5.457   1.00 0.00 ? 132 GLU A HG2  4  
ATOM 8580  H HG3  . GLU A 1 132 ? -9.498  11.547  5.456   1.00 0.00 ? 132 GLU A HG3  4  
ATOM 8581  N N    . ILE A 1 133 ? -9.488  12.357  2.389   1.00 0.00 ? 133 ILE A N    4  
ATOM 8582  C CA   . ILE A 1 133 ? -9.016  13.339  1.428   1.00 0.00 ? 133 ILE A CA   4  
ATOM 8583  C C    . ILE A 1 133 ? -8.143  14.370  2.145   1.00 0.00 ? 133 ILE A C    4  
ATOM 8584  O O    . ILE A 1 133 ? -8.570  14.974  3.128   1.00 0.00 ? 133 ILE A O    4  
ATOM 8585  C CB   . ILE A 1 133 ? -10.193 13.953  0.667   1.00 0.00 ? 133 ILE A CB   4  
ATOM 8586  C CG1  . ILE A 1 133 ? -10.797 12.947  -0.314  1.00 0.00 ? 133 ILE A CG1  4  
ATOM 8587  C CG2  . ILE A 1 133 ? -9.780  15.253  -0.026  1.00 0.00 ? 133 ILE A CG2  4  
ATOM 8588  C CD1  . ILE A 1 133 ? -9.799  12.593  -1.419  1.00 0.00 ? 133 ILE A CD1  4  
ATOM 8589  H H    . ILE A 1 133 ? -10.100 12.716  3.094   1.00 0.00 ? 133 ILE A H    4  
ATOM 8590  H HA   . ILE A 1 133 ? -8.401  12.813  0.698   1.00 0.00 ? 133 ILE A HA   4  
ATOM 8591  H HB   . ILE A 1 133 ? -10.971 14.206  1.388   1.00 0.00 ? 133 ILE A HB   4  
ATOM 8592  H HG12 . ILE A 1 133 ? -11.089 12.043  0.220   1.00 0.00 ? 133 ILE A HG12 4  
ATOM 8593  H HG13 . ILE A 1 133 ? -11.702 13.362  -0.756  1.00 0.00 ? 133 ILE A HG13 4  
ATOM 8594  H HG21 . ILE A 1 133 ? -10.079 15.217  -1.074  1.00 0.00 ? 133 ILE A HG21 4  
ATOM 8595  H HG22 . ILE A 1 133 ? -10.269 16.096  0.462   1.00 0.00 ? 133 ILE A HG22 4  
ATOM 8596  H HG23 . ILE A 1 133 ? -8.699  15.372  0.040   1.00 0.00 ? 133 ILE A HG23 4  
ATOM 8597  H HD11 . ILE A 1 133 ? -10.340 12.376  -2.341  1.00 0.00 ? 133 ILE A HD11 4  
ATOM 8598  H HD12 . ILE A 1 133 ? -9.125  13.433  -1.583  1.00 0.00 ? 133 ILE A HD12 4  
ATOM 8599  H HD13 . ILE A 1 133 ? -9.223  11.717  -1.121  1.00 0.00 ? 133 ILE A HD13 4  
ATOM 8600  N N    . SER A 1 134 ? -6.936  14.540  1.626   1.00 0.00 ? 134 SER A N    4  
ATOM 8601  C CA   . SER A 1 134 ? -5.998  15.487  2.205   1.00 0.00 ? 134 SER A CA   4  
ATOM 8602  C C    . SER A 1 134 ? -4.814  15.697  1.259   1.00 0.00 ? 134 SER A C    4  
ATOM 8603  O O    . SER A 1 134 ? -4.409  14.775  0.552   1.00 0.00 ? 134 SER A O    4  
ATOM 8604  C CB   . SER A 1 134 ? -5.506  15.009  3.573   1.00 0.00 ? 134 SER A CB   4  
ATOM 8605  O OG   . SER A 1 134 ? -4.888  16.058  4.314   1.00 0.00 ? 134 SER A OG   4  
ATOM 8606  H H    . SER A 1 134 ? -6.596  14.044  0.827   1.00 0.00 ? 134 SER A H    4  
ATOM 8607  H HA   . SER A 1 134 ? -6.561  16.413  2.325   1.00 0.00 ? 134 SER A HA   4  
ATOM 8608  H HB2  . SER A 1 134 ? -6.347  14.611  4.142   1.00 0.00 ? 134 SER A HB2  4  
ATOM 8609  H HB3  . SER A 1 134 ? -4.797  14.193  3.438   1.00 0.00 ? 134 SER A HB3  4  
ATOM 8610  H HG   . SER A 1 134 ? -3.963  15.788  4.581   1.00 0.00 ? 134 SER A HG   4  
ATOM 8611  N N    . GLY A 1 135 ? -4.293  16.914  1.276   1.00 0.00 ? 135 GLY A N    4  
ATOM 8612  C CA   . GLY A 1 135 ? -3.163  17.257  0.428   1.00 0.00 ? 135 GLY A CA   4  
ATOM 8613  C C    . GLY A 1 135 ? -1.879  17.381  1.250   1.00 0.00 ? 135 GLY A C    4  
ATOM 8614  O O    . GLY A 1 135 ? -1.929  17.636  2.452   1.00 0.00 ? 135 GLY A O    4  
ATOM 8615  H H    . GLY A 1 135 ? -4.628  17.658  1.854   1.00 0.00 ? 135 GLY A H    4  
ATOM 8616  H HA2  . GLY A 1 135 ? -3.036  16.493  -0.340  1.00 0.00 ? 135 GLY A HA2  4  
ATOM 8617  H HA3  . GLY A 1 135 ? -3.362  18.197  -0.087  1.00 0.00 ? 135 GLY A HA3  4  
ATOM 8618  N N    . PRO A 1 136 ? -0.728  17.189  0.550   1.00 0.00 ? 136 PRO A N    4  
ATOM 8619  C CA   . PRO A 1 136 ? 0.567   17.277  1.202   1.00 0.00 ? 136 PRO A CA   4  
ATOM 8620  C C    . PRO A 1 136 ? 0.941   18.733  1.485   1.00 0.00 ? 136 PRO A C    4  
ATOM 8621  O O    . PRO A 1 136 ? 1.290   19.477  0.570   1.00 0.00 ? 136 PRO A O    4  
ATOM 8622  C CB   . PRO A 1 136 ? 1.533   16.589  0.251   1.00 0.00 ? 136 PRO A CB   4  
ATOM 8623  C CG   . PRO A 1 136 ? 0.836   16.555  -1.099  1.00 0.00 ? 136 PRO A CG   4  
ATOM 8624  C CD   . PRO A 1 136 ? -0.631  16.885  -0.874  1.00 0.00 ? 136 PRO A CD   4  
ATOM 8625  H HA   . PRO A 1 136 ? 0.539   16.824  2.093   1.00 0.00 ? 136 PRO A HA   4  
ATOM 8626  H HB2  . PRO A 1 136 ? 2.476   17.134  0.190   1.00 0.00 ? 136 PRO A HB2  4  
ATOM 8627  H HB3  . PRO A 1 136 ? 1.770   15.582  0.594   1.00 0.00 ? 136 PRO A HB3  4  
ATOM 8628  H HG2  . PRO A 1 136 ? 1.289   17.274  -1.781  1.00 0.00 ? 136 PRO A HG2  4  
ATOM 8629  H HG3  . PRO A 1 136 ? 0.940   15.572  -1.558  1.00 0.00 ? 136 PRO A HG3  4  
ATOM 8630  H HD2  . PRO A 1 136 ? -0.944  17.733  -1.483  1.00 0.00 ? 136 PRO A HD2  4  
ATOM 8631  H HD3  . PRO A 1 136 ? -1.272  16.045  -1.145  1.00 0.00 ? 136 PRO A HD3  4  
ATOM 8632  N N    . SER A 1 137 ? 0.856   19.096  2.756   1.00 0.00 ? 137 SER A N    4  
ATOM 8633  C CA   . SER A 1 137 ? 1.181   20.450  3.171   1.00 0.00 ? 137 SER A CA   4  
ATOM 8634  C C    . SER A 1 137 ? 0.974   20.599  4.680   1.00 0.00 ? 137 SER A C    4  
ATOM 8635  O O    . SER A 1 137 ? -0.077  21.060  5.123   1.00 0.00 ? 137 SER A O    4  
ATOM 8636  C CB   . SER A 1 137 ? 0.335   21.476  2.415   1.00 0.00 ? 137 SER A CB   4  
ATOM 8637  O OG   . SER A 1 137 ? -1.059  21.288  2.641   1.00 0.00 ? 137 SER A OG   4  
ATOM 8638  H H    . SER A 1 137 ? 0.572   18.484  3.495   1.00 0.00 ? 137 SER A H    4  
ATOM 8639  H HA   . SER A 1 137 ? 2.232   20.586  2.915   1.00 0.00 ? 137 SER A HA   4  
ATOM 8640  H HB2  . SER A 1 137 ? 0.621   22.481  2.726   1.00 0.00 ? 137 SER A HB2  4  
ATOM 8641  H HB3  . SER A 1 137 ? 0.543   21.401  1.348   1.00 0.00 ? 137 SER A HB3  4  
ATOM 8642  H HG   . SER A 1 137 ? -1.499  20.954  1.807   1.00 0.00 ? 137 SER A HG   4  
ATOM 8643  N N    . SER A 1 138 ? 1.992   20.200  5.427   1.00 0.00 ? 138 SER A N    4  
ATOM 8644  C CA   . SER A 1 138 ? 1.934   20.283  6.877   1.00 0.00 ? 138 SER A CA   4  
ATOM 8645  C C    . SER A 1 138 ? 3.249   19.786  7.483   1.00 0.00 ? 138 SER A C    4  
ATOM 8646  O O    . SER A 1 138 ? 4.024   19.103  6.816   1.00 0.00 ? 138 SER A O    4  
ATOM 8647  C CB   . SER A 1 138 ? 0.757   19.477  7.429   1.00 0.00 ? 138 SER A CB   4  
ATOM 8648  O OG   . SER A 1 138 ? 0.999   18.073  7.373   1.00 0.00 ? 138 SER A OG   4  
ATOM 8649  H H    . SER A 1 138 ? 2.843   19.826  5.059   1.00 0.00 ? 138 SER A H    4  
ATOM 8650  H HA   . SER A 1 138 ? 1.786   21.340  7.100   1.00 0.00 ? 138 SER A HA   4  
ATOM 8651  H HB2  . SER A 1 138 ? 0.568   19.771  8.461   1.00 0.00 ? 138 SER A HB2  4  
ATOM 8652  H HB3  . SER A 1 138 ? -0.142  19.712  6.860   1.00 0.00 ? 138 SER A HB3  4  
ATOM 8653  H HG   . SER A 1 138 ? 1.668   17.869  6.659   1.00 0.00 ? 138 SER A HG   4  
ATOM 8654  N N    . GLY A 1 139 ? 3.459   20.149  8.739   1.00 0.00 ? 139 GLY A N    4  
ATOM 8655  C CA   . GLY A 1 139 ? 4.666   19.749  9.442   1.00 0.00 ? 139 GLY A CA   4  
ATOM 8656  C C    . GLY A 1 139 ? 4.334   18.838  10.626  1.00 0.00 ? 139 GLY A C    4  
ATOM 8657  O O    . GLY A 1 139 ? 4.690   17.661  10.627  1.00 0.00 ? 139 GLY A O    4  
ATOM 8658  H H    . GLY A 1 139 ? 2.823   20.705  9.274   1.00 0.00 ? 139 GLY A H    4  
ATOM 8659  H HA2  . GLY A 1 139 ? 5.335   19.230  8.756   1.00 0.00 ? 139 GLY A HA2  4  
ATOM 8660  H HA3  . GLY A 1 139 ? 5.195   20.633  9.796   1.00 0.00 ? 139 GLY A HA3  4  
ATOM 8661  N N    . GLY A 1 1   ? 4.836   14.351  14.971  1.00 0.00 ? 1   GLY A N    5  
ATOM 8662  C CA   . GLY A 1 1   ? 3.455   14.286  15.418  1.00 0.00 ? 1   GLY A CA   5  
ATOM 8663  C C    . GLY A 1 1   ? 3.348   14.581  16.915  1.00 0.00 ? 1   GLY A C    5  
ATOM 8664  O O    . GLY A 1 1   ? 4.132   14.065  17.711  1.00 0.00 ? 1   GLY A O    5  
ATOM 8665  H H1   . GLY A 1 1   ? 5.457   14.835  15.588  1.00 0.00 ? 1   GLY A H1   5  
ATOM 8666  H HA2  . GLY A 1 1   ? 2.854   15.002  14.858  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 8667  H HA3  . GLY A 1 1   ? 3.048   13.296  15.208  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 8668  N N    . SER A 1 2   ? 2.371   15.410  17.254  1.00 0.00 ? 2   SER A N    5  
ATOM 8669  C CA   . SER A 1 2   ? 2.151   15.779  18.642  1.00 0.00 ? 2   SER A CA   5  
ATOM 8670  C C    . SER A 1 2   ? 0.697   16.209  18.845  1.00 0.00 ? 2   SER A C    5  
ATOM 8671  O O    . SER A 1 2   ? -0.019  15.623  19.656  1.00 0.00 ? 2   SER A O    5  
ATOM 8672  C CB   . SER A 1 2   ? 3.100   16.901  19.070  1.00 0.00 ? 2   SER A CB   5  
ATOM 8673  O OG   . SER A 1 2   ? 3.570   16.723  20.403  1.00 0.00 ? 2   SER A OG   5  
ATOM 8674  H H    . SER A 1 2   ? 1.738   15.824  16.601  1.00 0.00 ? 2   SER A H    5  
ATOM 8675  H HA   . SER A 1 2   ? 2.369   14.880  19.218  1.00 0.00 ? 2   SER A HA   5  
ATOM 8676  H HB2  . SER A 1 2   ? 3.950   16.937  18.388  1.00 0.00 ? 2   SER A HB2  5  
ATOM 8677  H HB3  . SER A 1 2   ? 2.588   17.859  18.991  1.00 0.00 ? 2   SER A HB3  5  
ATOM 8678  H HG   . SER A 1 2   ? 4.505   16.367  20.392  1.00 0.00 ? 2   SER A HG   5  
ATOM 8679  N N    . SER A 1 3   ? 0.304   17.227  18.094  1.00 0.00 ? 3   SER A N    5  
ATOM 8680  C CA   . SER A 1 3   ? -1.053  17.741  18.182  1.00 0.00 ? 3   SER A CA   5  
ATOM 8681  C C    . SER A 1 3   ? -1.627  17.943  16.779  1.00 0.00 ? 3   SER A C    5  
ATOM 8682  O O    . SER A 1 3   ? -0.885  17.969  15.798  1.00 0.00 ? 3   SER A O    5  
ATOM 8683  C CB   . SER A 1 3   ? -1.094  19.054  18.967  1.00 0.00 ? 3   SER A CB   5  
ATOM 8684  O OG   . SER A 1 3   ? -0.486  18.929  20.249  1.00 0.00 ? 3   SER A OG   5  
ATOM 8685  H H    . SER A 1 3   ? 0.892   17.698  17.437  1.00 0.00 ? 3   SER A H    5  
ATOM 8686  H HA   . SER A 1 3   ? -1.616  16.979  18.720  1.00 0.00 ? 3   SER A HA   5  
ATOM 8687  H HB2  . SER A 1 3   ? -0.585  19.832  18.398  1.00 0.00 ? 3   SER A HB2  5  
ATOM 8688  H HB3  . SER A 1 3   ? -2.130  19.373  19.085  1.00 0.00 ? 3   SER A HB3  5  
ATOM 8689  H HG   . SER A 1 3   ? -0.965  18.236  20.789  1.00 0.00 ? 3   SER A HG   5  
ATOM 8690  N N    . GLY A 1 4   ? -2.944  18.081  16.727  1.00 0.00 ? 4   GLY A N    5  
ATOM 8691  C CA   . GLY A 1 4   ? -3.627  18.280  15.460  1.00 0.00 ? 4   GLY A CA   5  
ATOM 8692  C C    . GLY A 1 4   ? -4.343  19.632  15.430  1.00 0.00 ? 4   GLY A C    5  
ATOM 8693  O O    . GLY A 1 4   ? -4.381  20.341  16.434  1.00 0.00 ? 4   GLY A O    5  
ATOM 8694  H H    . GLY A 1 4   ? -3.540  18.059  17.530  1.00 0.00 ? 4   GLY A H    5  
ATOM 8695  H HA2  . GLY A 1 4   ? -2.907  18.227  14.643  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 8696  H HA3  . GLY A 1 4   ? -4.348  17.478  15.302  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 8697  N N    . SER A 1 5   ? -4.894  19.947  14.267  1.00 0.00 ? 5   SER A N    5  
ATOM 8698  C CA   . SER A 1 5   ? -5.608  21.201  14.092  1.00 0.00 ? 5   SER A CA   5  
ATOM 8699  C C    . SER A 1 5   ? -6.804  20.997  13.161  1.00 0.00 ? 5   SER A C    5  
ATOM 8700  O O    . SER A 1 5   ? -6.643  20.551  12.026  1.00 0.00 ? 5   SER A O    5  
ATOM 8701  C CB   . SER A 1 5   ? -4.684  22.288  13.539  1.00 0.00 ? 5   SER A CB   5  
ATOM 8702  O OG   . SER A 1 5   ? -4.573  23.397  14.428  1.00 0.00 ? 5   SER A OG   5  
ATOM 8703  H H    . SER A 1 5   ? -4.859  19.364  13.455  1.00 0.00 ? 5   SER A H    5  
ATOM 8704  H HA   . SER A 1 5   ? -5.943  21.483  15.090  1.00 0.00 ? 5   SER A HA   5  
ATOM 8705  H HB2  . SER A 1 5   ? -3.695  21.866  13.360  1.00 0.00 ? 5   SER A HB2  5  
ATOM 8706  H HB3  . SER A 1 5   ? -5.063  22.631  12.577  1.00 0.00 ? 5   SER A HB3  5  
ATOM 8707  H HG   . SER A 1 5   ? -5.285  24.069  14.227  1.00 0.00 ? 5   SER A HG   5  
ATOM 8708  N N    . SER A 1 6   ? -7.978  21.333  13.675  1.00 0.00 ? 6   SER A N    5  
ATOM 8709  C CA   . SER A 1 6   ? -9.201  21.193  12.903  1.00 0.00 ? 6   SER A CA   5  
ATOM 8710  C C    . SER A 1 6   ? -9.248  22.251  11.799  1.00 0.00 ? 6   SER A C    5  
ATOM 8711  O O    . SER A 1 6   ? -9.875  23.297  11.963  1.00 0.00 ? 6   SER A O    5  
ATOM 8712  C CB   . SER A 1 6   ? -10.435 21.306  13.801  1.00 0.00 ? 6   SER A CB   5  
ATOM 8713  O OG   . SER A 1 6   ? -11.188 20.097  13.829  1.00 0.00 ? 6   SER A OG   5  
ATOM 8714  H H    . SER A 1 6   ? -8.101  21.695  14.599  1.00 0.00 ? 6   SER A H    5  
ATOM 8715  H HA   . SER A 1 6   ? -9.157  20.193  12.472  1.00 0.00 ? 6   SER A HA   5  
ATOM 8716  H HB2  . SER A 1 6   ? -10.124 21.564  14.813  1.00 0.00 ? 6   SER A HB2  5  
ATOM 8717  H HB3  . SER A 1 6   ? -11.068 22.120  13.445  1.00 0.00 ? 6   SER A HB3  5  
ATOM 8718  H HG   . SER A 1 6   ? -11.449 19.879  14.769  1.00 0.00 ? 6   SER A HG   5  
ATOM 8719  N N    . GLY A 1 7   ? -8.576  21.944  10.700  1.00 0.00 ? 7   GLY A N    5  
ATOM 8720  C CA   . GLY A 1 7   ? -8.533  22.856  9.569   1.00 0.00 ? 7   GLY A CA   5  
ATOM 8721  C C    . GLY A 1 7   ? -7.728  22.259  8.413   1.00 0.00 ? 7   GLY A C    5  
ATOM 8722  O O    . GLY A 1 7   ? -6.507  22.398  8.367   1.00 0.00 ? 7   GLY A O    5  
ATOM 8723  H H    . GLY A 1 7   ? -8.068  21.092  10.574  1.00 0.00 ? 7   GLY A H    5  
ATOM 8724  H HA2  . GLY A 1 7   ? -9.548  23.075  9.236   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 8725  H HA3  . GLY A 1 7   ? -8.088  23.802  9.877   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 8726  N N    . LYS A 1 8   ? -8.445  21.608  7.509   1.00 0.00 ? 8   LYS A N    5  
ATOM 8727  C CA   . LYS A 1 8   ? -7.812  20.990  6.356   1.00 0.00 ? 8   LYS A CA   5  
ATOM 8728  C C    . LYS A 1 8   ? -8.582  21.372  5.091   1.00 0.00 ? 8   LYS A C    5  
ATOM 8729  O O    . LYS A 1 8   ? -8.043  22.039  4.209   1.00 0.00 ? 8   LYS A O    5  
ATOM 8730  C CB   . LYS A 1 8   ? -7.680  19.480  6.563   1.00 0.00 ? 8   LYS A CB   5  
ATOM 8731  C CG   . LYS A 1 8   ? -6.374  19.137  7.282   1.00 0.00 ? 8   LYS A CG   5  
ATOM 8732  C CD   . LYS A 1 8   ? -6.220  17.624  7.447   1.00 0.00 ? 8   LYS A CD   5  
ATOM 8733  C CE   . LYS A 1 8   ? -5.699  17.275  8.843   1.00 0.00 ? 8   LYS A CE   5  
ATOM 8734  N NZ   . LYS A 1 8   ? -6.351  16.045  9.347   1.00 0.00 ? 8   LYS A NZ   5  
ATOM 8735  H H    . LYS A 1 8   ? -9.438  21.501  7.554   1.00 0.00 ? 8   LYS A H    5  
ATOM 8736  H HA   . LYS A 1 8   ? -6.802  21.394  6.282   1.00 0.00 ? 8   LYS A HA   5  
ATOM 8737  H HB2  . LYS A 1 8   ? -8.526  19.113  7.145   1.00 0.00 ? 8   LYS A HB2  5  
ATOM 8738  H HB3  . LYS A 1 8   ? -7.713  18.973  5.599   1.00 0.00 ? 8   LYS A HB3  5  
ATOM 8739  H HG2  . LYS A 1 8   ? -5.529  19.532  6.718   1.00 0.00 ? 8   LYS A HG2  5  
ATOM 8740  H HG3  . LYS A 1 8   ? -6.356  19.617  8.261   1.00 0.00 ? 8   LYS A HG3  5  
ATOM 8741  H HD2  . LYS A 1 8   ? -7.181  17.136  7.281   1.00 0.00 ? 8   LYS A HD2  5  
ATOM 8742  H HD3  . LYS A 1 8   ? -5.533  17.240  6.693   1.00 0.00 ? 8   LYS A HD3  5  
ATOM 8743  H HE2  . LYS A 1 8   ? -4.619  17.134  8.810   1.00 0.00 ? 8   LYS A HE2  5  
ATOM 8744  H HE3  . LYS A 1 8   ? -5.892  18.101  9.527   1.00 0.00 ? 8   LYS A HE3  5  
ATOM 8745  H HZ1  . LYS A 1 8   ? -6.843  16.251  10.192  1.00 0.00 ? 8   LYS A HZ1  5  
ATOM 8746  H HZ2  . LYS A 1 8   ? -6.993  15.703  8.661   1.00 0.00 ? 8   LYS A HZ2  5  
ATOM 8747  H HZ3  . LYS A 1 8   ? -5.655  15.349  9.528   1.00 0.00 ? 8   LYS A HZ3  5  
ATOM 8748  N N    . SER A 1 9   ? -9.832  20.934  5.042   1.00 0.00 ? 9   SER A N    5  
ATOM 8749  C CA   . SER A 1 9   ? -10.682 21.222  3.899   1.00 0.00 ? 9   SER A CA   5  
ATOM 8750  C C    . SER A 1 9   ? -10.134 20.527  2.651   1.00 0.00 ? 9   SER A C    5  
ATOM 8751  O O    . SER A 1 9   ? -8.937  20.260  2.560   1.00 0.00 ? 9   SER A O    5  
ATOM 8752  C CB   . SER A 1 9   ? -10.793 22.729  3.662   1.00 0.00 ? 9   SER A CB   5  
ATOM 8753  O OG   . SER A 1 9   ? -12.063 23.240  4.056   1.00 0.00 ? 9   SER A OG   5  
ATOM 8754  H H    . SER A 1 9   ? -10.263 20.393  5.764   1.00 0.00 ? 9   SER A H    5  
ATOM 8755  H HA   . SER A 1 9   ? -11.662 20.823  4.161   1.00 0.00 ? 9   SER A HA   5  
ATOM 8756  H HB2  . SER A 1 9   ? -10.008 23.243  4.217   1.00 0.00 ? 9   SER A HB2  5  
ATOM 8757  H HB3  . SER A 1 9   ? -10.628 22.943  2.605   1.00 0.00 ? 9   SER A HB3  5  
ATOM 8758  H HG   . SER A 1 9   ? -12.709 23.174  3.295   1.00 0.00 ? 9   SER A HG   5  
ATOM 8759  N N    . GLU A 1 10  ? -11.036 20.254  1.721   1.00 0.00 ? 10  GLU A N    5  
ATOM 8760  C CA   . GLU A 1 10  ? -10.659 19.595  0.482   1.00 0.00 ? 10  GLU A CA   5  
ATOM 8761  C C    . GLU A 1 10  ? -11.763 19.758  -0.564  1.00 0.00 ? 10  GLU A C    5  
ATOM 8762  O O    . GLU A 1 10  ? -12.942 19.833  -0.221  1.00 0.00 ? 10  GLU A O    5  
ATOM 8763  C CB   . GLU A 1 10  ? -10.344 18.117  0.721   1.00 0.00 ? 10  GLU A CB   5  
ATOM 8764  C CG   . GLU A 1 10  ? -11.609 17.339  1.089   1.00 0.00 ? 10  GLU A CG   5  
ATOM 8765  C CD   . GLU A 1 10  ? -11.260 15.973  1.683   1.00 0.00 ? 10  GLU A CD   5  
ATOM 8766  O OE1  . GLU A 1 10  ? -10.636 15.968  2.766   1.00 0.00 ? 10  GLU A OE1  5  
ATOM 8767  O OE2  . GLU A 1 10  ? -11.624 14.965  1.040   1.00 0.00 ? 10  GLU A OE2  5  
ATOM 8768  H H    . GLU A 1 10  ? -12.008 20.474  1.802   1.00 0.00 ? 10  GLU A H    5  
ATOM 8769  H HA   . GLU A 1 10  ? -9.754  20.103  0.148   1.00 0.00 ? 10  GLU A HA   5  
ATOM 8770  H HB2  . GLU A 1 10  ? -9.896  17.687  -0.175  1.00 0.00 ? 10  GLU A HB2  5  
ATOM 8771  H HB3  . GLU A 1 10  ? -9.609  18.022  1.521   1.00 0.00 ? 10  GLU A HB3  5  
ATOM 8772  H HG2  . GLU A 1 10  ? -12.196 17.912  1.807   1.00 0.00 ? 10  GLU A HG2  5  
ATOM 8773  H HG3  . GLU A 1 10  ? -12.229 17.206  0.203   1.00 0.00 ? 10  GLU A HG3  5  
ATOM 8774  N N    . LYS A 1 11  ? -11.342 19.807  -1.820  1.00 0.00 ? 11  LYS A N    5  
ATOM 8775  C CA   . LYS A 1 11  ? -12.281 19.959  -2.918  1.00 0.00 ? 11  LYS A CA   5  
ATOM 8776  C C    . LYS A 1 11  ? -11.876 19.027  -4.062  1.00 0.00 ? 11  LYS A C    5  
ATOM 8777  O O    . LYS A 1 11  ? -12.581 18.065  -4.362  1.00 0.00 ? 11  LYS A O    5  
ATOM 8778  C CB   . LYS A 1 11  ? -12.389 21.428  -3.331  1.00 0.00 ? 11  LYS A CB   5  
ATOM 8779  C CG   . LYS A 1 11  ? -13.806 21.959  -3.104  1.00 0.00 ? 11  LYS A CG   5  
ATOM 8780  C CD   . LYS A 1 11  ? -13.928 22.628  -1.733  1.00 0.00 ? 11  LYS A CD   5  
ATOM 8781  C CE   . LYS A 1 11  ? -15.377 23.025  -1.444  1.00 0.00 ? 11  LYS A CE   5  
ATOM 8782  N NZ   . LYS A 1 11  ? -15.776 22.580  -0.090  1.00 0.00 ? 11  LYS A NZ   5  
ATOM 8783  H H    . LYS A 1 11  ? -10.382 19.744  -2.090  1.00 0.00 ? 11  LYS A H    5  
ATOM 8784  H HA   . LYS A 1 11  ? -13.262 19.654  -2.554  1.00 0.00 ? 11  LYS A HA   5  
ATOM 8785  H HB2  . LYS A 1 11  ? -11.677 22.024  -2.759  1.00 0.00 ? 11  LYS A HB2  5  
ATOM 8786  H HB3  . LYS A 1 11  ? -12.120 21.535  -4.382  1.00 0.00 ? 11  LYS A HB3  5  
ATOM 8787  H HG2  . LYS A 1 11  ? -14.059 22.676  -3.886  1.00 0.00 ? 11  LYS A HG2  5  
ATOM 8788  H HG3  . LYS A 1 11  ? -14.521 21.140  -3.178  1.00 0.00 ? 11  LYS A HG3  5  
ATOM 8789  H HD2  . LYS A 1 11  ? -13.573 21.946  -0.959  1.00 0.00 ? 11  LYS A HD2  5  
ATOM 8790  H HD3  . LYS A 1 11  ? -13.290 23.511  -1.697  1.00 0.00 ? 11  LYS A HD3  5  
ATOM 8791  H HE2  . LYS A 1 11  ? -15.486 24.107  -1.525  1.00 0.00 ? 11  LYS A HE2  5  
ATOM 8792  H HE3  . LYS A 1 11  ? -16.037 22.582  -2.189  1.00 0.00 ? 11  LYS A HE3  5  
ATOM 8793  H HZ1  . LYS A 1 11  ? -15.005 22.122  0.351   1.00 0.00 ? 11  LYS A HZ1  5  
ATOM 8794  H HZ2  . LYS A 1 11  ? -16.049 23.373  0.454   1.00 0.00 ? 11  LYS A HZ2  5  
ATOM 8795  H HZ3  . LYS A 1 11  ? -16.545 21.945  -0.162  1.00 0.00 ? 11  LYS A HZ3  5  
ATOM 8796  N N    . ARG A 1 12  ? -10.743 19.346  -4.670  1.00 0.00 ? 12  ARG A N    5  
ATOM 8797  C CA   . ARG A 1 12  ? -10.236 18.549  -5.774  1.00 0.00 ? 12  ARG A CA   5  
ATOM 8798  C C    . ARG A 1 12  ? -8.709  18.630  -5.830  1.00 0.00 ? 12  ARG A C    5  
ATOM 8799  O O    . ARG A 1 12  ? -8.139  19.717  -5.758  1.00 0.00 ? 12  ARG A O    5  
ATOM 8800  C CB   . ARG A 1 12  ? -10.815 19.026  -7.108  1.00 0.00 ? 12  ARG A CB   5  
ATOM 8801  C CG   . ARG A 1 12  ? -11.896 18.067  -7.610  1.00 0.00 ? 12  ARG A CG   5  
ATOM 8802  C CD   . ARG A 1 12  ? -13.288 18.543  -7.191  1.00 0.00 ? 12  ARG A CD   5  
ATOM 8803  N NE   . ARG A 1 12  ? -13.858 19.424  -8.236  1.00 0.00 ? 12  ARG A NE   5  
ATOM 8804  C CZ   . ARG A 1 12  ? -15.070 19.989  -8.163  1.00 0.00 ? 12  ARG A CZ   5  
ATOM 8805  N NH1  . ARG A 1 12  ? -15.849 19.769  -7.094  1.00 0.00 ? 12  ARG A NH1  5  
ATOM 8806  N NH2  . ARG A 1 12  ? -15.505 20.774  -9.158  1.00 0.00 ? 12  ARG A NH2  5  
ATOM 8807  H H    . ARG A 1 12  ? -10.176 20.130  -4.420  1.00 0.00 ? 12  ARG A H    5  
ATOM 8808  H HA   . ARG A 1 12  ? -10.567 17.533  -5.560  1.00 0.00 ? 12  ARG A HA   5  
ATOM 8809  H HB2  . ARG A 1 12  ? -11.235 20.024  -6.990  1.00 0.00 ? 12  ARG A HB2  5  
ATOM 8810  H HB3  . ARG A 1 12  ? -10.018 19.101  -7.848  1.00 0.00 ? 12  ARG A HB3  5  
ATOM 8811  H HG2  . ARG A 1 12  ? -11.845 17.992  -8.697  1.00 0.00 ? 12  ARG A HG2  5  
ATOM 8812  H HG3  . ARG A 1 12  ? -11.715 17.068  -7.213  1.00 0.00 ? 12  ARG A HG3  5  
ATOM 8813  H HD2  . ARG A 1 12  ? -13.942 17.686  -7.031  1.00 0.00 ? 12  ARG A HD2  5  
ATOM 8814  H HD3  . ARG A 1 12  ? -13.229 19.080  -6.245  1.00 0.00 ? 12  ARG A HD3  5  
ATOM 8815  H HE   . ARG A 1 12  ? -13.303 19.608  -9.047  1.00 0.00 ? 12  ARG A HE   5  
ATOM 8816  H HH11 . ARG A 1 12  ? -15.525 19.183  -6.352  1.00 0.00 ? 12  ARG A HH11 5  
ATOM 8817  H HH12 . ARG A 1 12  ? -16.754 20.191  -7.040  1.00 0.00 ? 12  ARG A HH12 5  
ATOM 8818  H HH21 . ARG A 1 12  ? -14.924 20.938  -9.955  1.00 0.00 ? 12  ARG A HH21 5  
ATOM 8819  H HH22 . ARG A 1 12  ? -16.410 21.196  -9.104  1.00 0.00 ? 12  ARG A HH22 5  
ATOM 8820  N N    . MET A 1 13  ? -8.091  17.465  -5.958  1.00 0.00 ? 13  MET A N    5  
ATOM 8821  C CA   . MET A 1 13  ? -6.642  17.390  -6.025  1.00 0.00 ? 13  MET A CA   5  
ATOM 8822  C C    . MET A 1 13  ? -6.000  18.141  -4.857  1.00 0.00 ? 13  MET A C    5  
ATOM 8823  O O    . MET A 1 13  ? -5.896  19.367  -4.884  1.00 0.00 ? 13  MET A O    5  
ATOM 8824  C CB   . MET A 1 13  ? -6.159  17.993  -7.346  1.00 0.00 ? 13  MET A CB   5  
ATOM 8825  C CG   . MET A 1 13  ? -5.484  16.932  -8.218  1.00 0.00 ? 13  MET A CG   5  
ATOM 8826  S SD   . MET A 1 13  ? -6.587  16.426  -9.527  1.00 0.00 ? 13  MET A SD   5  
ATOM 8827  C CE   . MET A 1 13  ? -6.661  14.671  -9.209  1.00 0.00 ? 13  MET A CE   5  
ATOM 8828  H H    . MET A 1 13  ? -8.563  16.585  -6.016  1.00 0.00 ? 13  MET A H    5  
ATOM 8829  H HA   . MET A 1 13  ? -6.400  16.329  -5.961  1.00 0.00 ? 13  MET A HA   5  
ATOM 8830  H HB2  . MET A 1 13  ? -7.004  18.426  -7.882  1.00 0.00 ? 13  MET A HB2  5  
ATOM 8831  H HB3  . MET A 1 13  ? -5.459  18.804  -7.146  1.00 0.00 ? 13  MET A HB3  5  
ATOM 8832  H HG2  . MET A 1 13  ? -4.563  17.330  -8.642  1.00 0.00 ? 13  MET A HG2  5  
ATOM 8833  H HG3  . MET A 1 13  ? -5.209  16.070  -7.610  1.00 0.00 ? 13  MET A HG3  5  
ATOM 8834  H HE1  . MET A 1 13  ? -7.411  14.216  -9.856  1.00 0.00 ? 13  MET A HE1  5  
ATOM 8835  H HE2  . MET A 1 13  ? -5.688  14.224  -9.411  1.00 0.00 ? 13  MET A HE2  5  
ATOM 8836  H HE3  . MET A 1 13  ? -6.930  14.502  -8.167  1.00 0.00 ? 13  MET A HE3  5  
ATOM 8837  N N    . LYS A 1 14  ? -5.586  17.375  -3.858  1.00 0.00 ? 14  LYS A N    5  
ATOM 8838  C CA   . LYS A 1 14  ? -4.957  17.953  -2.683  1.00 0.00 ? 14  LYS A CA   5  
ATOM 8839  C C    . LYS A 1 14  ? -3.975  16.942  -2.086  1.00 0.00 ? 14  LYS A C    5  
ATOM 8840  O O    . LYS A 1 14  ? -4.331  15.786  -1.860  1.00 0.00 ? 14  LYS A O    5  
ATOM 8841  C CB   . LYS A 1 14  ? -6.017  18.440  -1.693  1.00 0.00 ? 14  LYS A CB   5  
ATOM 8842  C CG   . LYS A 1 14  ? -6.195  19.957  -1.782  1.00 0.00 ? 14  LYS A CG   5  
ATOM 8843  C CD   . LYS A 1 14  ? -7.665  20.325  -1.989  1.00 0.00 ? 14  LYS A CD   5  
ATOM 8844  C CE   . LYS A 1 14  ? -7.864  21.841  -1.933  1.00 0.00 ? 14  LYS A CE   5  
ATOM 8845  N NZ   . LYS A 1 14  ? -8.552  22.319  -3.153  1.00 0.00 ? 14  LYS A NZ   5  
ATOM 8846  H H    . LYS A 1 14  ? -5.674  16.379  -3.844  1.00 0.00 ? 14  LYS A H    5  
ATOM 8847  H HA   . LYS A 1 14  ? -4.395  18.828  -3.010  1.00 0.00 ? 14  LYS A HA   5  
ATOM 8848  H HB2  . LYS A 1 14  ? -6.966  17.946  -1.898  1.00 0.00 ? 14  LYS A HB2  5  
ATOM 8849  H HB3  . LYS A 1 14  ? -5.727  18.163  -0.679  1.00 0.00 ? 14  LYS A HB3  5  
ATOM 8850  H HG2  . LYS A 1 14  ? -5.824  20.424  -0.869  1.00 0.00 ? 14  LYS A HG2  5  
ATOM 8851  H HG3  . LYS A 1 14  ? -5.598  20.349  -2.605  1.00 0.00 ? 14  LYS A HG3  5  
ATOM 8852  H HD2  . LYS A 1 14  ? -8.006  19.945  -2.952  1.00 0.00 ? 14  LYS A HD2  5  
ATOM 8853  H HD3  . LYS A 1 14  ? -8.275  19.846  -1.223  1.00 0.00 ? 14  LYS A HD3  5  
ATOM 8854  H HE2  . LYS A 1 14  ? -8.448  22.105  -1.051  1.00 0.00 ? 14  LYS A HE2  5  
ATOM 8855  H HE3  . LYS A 1 14  ? -6.898  22.337  -1.835  1.00 0.00 ? 14  LYS A HE3  5  
ATOM 8856  H HZ1  . LYS A 1 14  ? -8.203  21.824  -3.948  1.00 0.00 ? 14  LYS A HZ1  5  
ATOM 8857  H HZ2  . LYS A 1 14  ? -9.535  22.158  -3.065  1.00 0.00 ? 14  LYS A HZ2  5  
ATOM 8858  H HZ3  . LYS A 1 14  ? -8.383  23.298  -3.269  1.00 0.00 ? 14  LYS A HZ3  5  
ATOM 8859  N N    . LEU A 1 15  ? -2.761  17.414  -1.848  1.00 0.00 ? 15  LEU A N    5  
ATOM 8860  C CA   . LEU A 1 15  ? -1.726  16.566  -1.282  1.00 0.00 ? 15  LEU A CA   5  
ATOM 8861  C C    . LEU A 1 15  ? -1.816  16.609  0.245   1.00 0.00 ? 15  LEU A C    5  
ATOM 8862  O O    . LEU A 1 15  ? -2.540  17.430  0.805   1.00 0.00 ? 15  LEU A O    5  
ATOM 8863  C CB   . LEU A 1 15  ? -0.352  16.959  -1.828  1.00 0.00 ? 15  LEU A CB   5  
ATOM 8864  C CG   . LEU A 1 15  ? -0.107  16.657  -3.308  1.00 0.00 ? 15  LEU A CG   5  
ATOM 8865  C CD1  . LEU A 1 15  ? 0.218   15.177  -3.518  1.00 0.00 ? 15  LEU A CD1  5  
ATOM 8866  C CD2  . LEU A 1 15  ? -1.291  17.111  -4.164  1.00 0.00 ? 15  LEU A CD2  5  
ATOM 8867  H H    . LEU A 1 15  ? -2.480  18.355  -2.035  1.00 0.00 ? 15  LEU A H    5  
ATOM 8868  H HA   . LEU A 1 15  ? -1.923  15.546  -1.611  1.00 0.00 ? 15  LEU A HA   5  
ATOM 8869  H HB2  . LEU A 1 15  ? -0.212  18.028  -1.668  1.00 0.00 ? 15  LEU A HB2  5  
ATOM 8870  H HB3  . LEU A 1 15  ? 0.411   16.447  -1.242  1.00 0.00 ? 15  LEU A HB3  5  
ATOM 8871  H HG   . LEU A 1 15  ? 0.763   17.227  -3.633  1.00 0.00 ? 15  LEU A HG   5  
ATOM 8872  H HD11 . LEU A 1 15  ? 1.284   15.013  -3.361  1.00 0.00 ? 15  LEU A HD11 5  
ATOM 8873  H HD12 . LEU A 1 15  ? -0.350  14.575  -2.809  1.00 0.00 ? 15  LEU A HD12 5  
ATOM 8874  H HD13 . LEU A 1 15  ? -0.048  14.887  -4.535  1.00 0.00 ? 15  LEU A HD13 5  
ATOM 8875  H HD21 . LEU A 1 15  ? -1.006  17.097  -5.216  1.00 0.00 ? 15  LEU A HD21 5  
ATOM 8876  H HD22 . LEU A 1 15  ? -2.133  16.437  -4.006  1.00 0.00 ? 15  LEU A HD22 5  
ATOM 8877  H HD23 . LEU A 1 15  ? -1.578  18.123  -3.879  1.00 0.00 ? 15  LEU A HD23 5  
ATOM 8878  N N    . THR A 1 16  ? -1.069  15.714  0.876   1.00 0.00 ? 16  THR A N    5  
ATOM 8879  C CA   . THR A 1 16  ? -1.055  15.640  2.327   1.00 0.00 ? 16  THR A CA   5  
ATOM 8880  C C    . THR A 1 16  ? 0.302   16.090  2.871   1.00 0.00 ? 16  THR A C    5  
ATOM 8881  O O    . THR A 1 16  ? 0.379   16.669  3.953   1.00 0.00 ? 16  THR A O    5  
ATOM 8882  C CB   . THR A 1 16  ? -1.429  14.212  2.730   1.00 0.00 ? 16  THR A CB   5  
ATOM 8883  O OG1  . THR A 1 16  ? -1.497  14.260  4.153   1.00 0.00 ? 16  THR A OG1  5  
ATOM 8884  C CG2  . THR A 1 16  ? -0.309  13.210  2.444   1.00 0.00 ? 16  THR A CG2  5  
ATOM 8885  H H    . THR A 1 16  ? -0.482  15.050  0.413   1.00 0.00 ? 16  THR A H    5  
ATOM 8886  H HA   . THR A 1 16  ? -1.801  16.334  2.713   1.00 0.00 ? 16  THR A HA   5  
ATOM 8887  H HB   . THR A 1 16  ? -2.359  13.903  2.253   1.00 0.00 ? 16  THR A HB   5  
ATOM 8888  H HG1  . THR A 1 16  ? -2.413  14.538  4.443   1.00 0.00 ? 16  THR A HG1  5  
ATOM 8889  H HG21 . THR A 1 16  ? 0.410   13.656  1.756   1.00 0.00 ? 16  THR A HG21 5  
ATOM 8890  H HG22 . THR A 1 16  ? 0.194   12.951  3.376   1.00 0.00 ? 16  THR A HG22 5  
ATOM 8891  H HG23 . THR A 1 16  ? -0.731  12.311  1.997   1.00 0.00 ? 16  THR A HG23 5  
ATOM 8892  N N    . LEU A 1 17  ? 1.338   15.806  2.096   1.00 0.00 ? 17  LEU A N    5  
ATOM 8893  C CA   . LEU A 1 17  ? 2.688   16.174  2.486   1.00 0.00 ? 17  LEU A CA   5  
ATOM 8894  C C    . LEU A 1 17  ? 2.871   15.910  3.982   1.00 0.00 ? 17  LEU A C    5  
ATOM 8895  O O    . LEU A 1 17  ? 3.264   16.805  4.730   1.00 0.00 ? 17  LEU A O    5  
ATOM 8896  C CB   . LEU A 1 17  ? 2.991   17.616  2.074   1.00 0.00 ? 17  LEU A CB   5  
ATOM 8897  C CG   . LEU A 1 17  ? 4.068   17.796  1.003   1.00 0.00 ? 17  LEU A CG   5  
ATOM 8898  C CD1  . LEU A 1 17  ? 3.463   17.730  -0.400  1.00 0.00 ? 17  LEU A CD1  5  
ATOM 8899  C CD2  . LEU A 1 17  ? 4.855   19.089  1.228   1.00 0.00 ? 17  LEU A CD2  5  
ATOM 8900  H H    . LEU A 1 17  ? 1.266   15.334  1.217   1.00 0.00 ? 17  LEU A H    5  
ATOM 8901  H HA   . LEU A 1 17  ? 3.375   15.531  1.936   1.00 0.00 ? 17  LEU A HA   5  
ATOM 8902  H HB2  . LEU A 1 17  ? 2.068   18.071  1.714   1.00 0.00 ? 17  LEU A HB2  5  
ATOM 8903  H HB3  . LEU A 1 17  ? 3.293   18.171  2.963   1.00 0.00 ? 17  LEU A HB3  5  
ATOM 8904  H HG   . LEU A 1 17  ? 4.775   16.970  1.088   1.00 0.00 ? 17  LEU A HG   5  
ATOM 8905  H HD11 . LEU A 1 17  ? 2.409   18.005  -0.354  1.00 0.00 ? 17  LEU A HD11 5  
ATOM 8906  H HD12 . LEU A 1 17  ? 3.991   18.421  -1.057  1.00 0.00 ? 17  LEU A HD12 5  
ATOM 8907  H HD13 . LEU A 1 17  ? 3.557   16.716  -0.789  1.00 0.00 ? 17  LEU A HD13 5  
ATOM 8908  H HD21 . LEU A 1 17  ? 4.223   19.944  0.989   1.00 0.00 ? 17  LEU A HD21 5  
ATOM 8909  H HD22 . LEU A 1 17  ? 5.167   19.148  2.270   1.00 0.00 ? 17  LEU A HD22 5  
ATOM 8910  H HD23 . LEU A 1 17  ? 5.734   19.095  0.584   1.00 0.00 ? 17  LEU A HD23 5  
ATOM 8911  N N    . LYS A 1 18  ? 2.578   14.679  4.374   1.00 0.00 ? 18  LYS A N    5  
ATOM 8912  C CA   . LYS A 1 18  ? 2.706   14.286  5.767   1.00 0.00 ? 18  LYS A CA   5  
ATOM 8913  C C    . LYS A 1 18  ? 4.085   13.665  5.993   1.00 0.00 ? 18  LYS A C    5  
ATOM 8914  O O    . LYS A 1 18  ? 4.633   13.018  5.102   1.00 0.00 ? 18  LYS A O    5  
ATOM 8915  C CB   . LYS A 1 18  ? 1.546   13.375  6.175   1.00 0.00 ? 18  LYS A CB   5  
ATOM 8916  C CG   . LYS A 1 18  ? 0.465   14.162  6.917   1.00 0.00 ? 18  LYS A CG   5  
ATOM 8917  C CD   . LYS A 1 18  ? 0.405   13.756  8.391   1.00 0.00 ? 18  LYS A CD   5  
ATOM 8918  C CE   . LYS A 1 18  ? -1.012  13.913  8.946   1.00 0.00 ? 18  LYS A CE   5  
ATOM 8919  N NZ   . LYS A 1 18  ? -0.980  14.571  10.272  1.00 0.00 ? 18  LYS A NZ   5  
ATOM 8920  H H    . LYS A 1 18  ? 2.260   13.958  3.759   1.00 0.00 ? 18  LYS A H    5  
ATOM 8921  H HA   . LYS A 1 18  ? 2.631   15.192  6.370   1.00 0.00 ? 18  LYS A HA   5  
ATOM 8922  H HB2  . LYS A 1 18  ? 1.117   12.907  5.289   1.00 0.00 ? 18  LYS A HB2  5  
ATOM 8923  H HB3  . LYS A 1 18  ? 1.917   12.571  6.811   1.00 0.00 ? 18  LYS A HB3  5  
ATOM 8924  H HG2  . LYS A 1 18  ? 0.669   15.230  6.839   1.00 0.00 ? 18  LYS A HG2  5  
ATOM 8925  H HG3  . LYS A 1 18  ? -0.504  13.988  6.449   1.00 0.00 ? 18  LYS A HG3  5  
ATOM 8926  H HD2  . LYS A 1 18  ? 0.730   12.721  8.500   1.00 0.00 ? 18  LYS A HD2  5  
ATOM 8927  H HD3  . LYS A 1 18  ? 1.096   14.370  8.970   1.00 0.00 ? 18  LYS A HD3  5  
ATOM 8928  H HE2  . LYS A 1 18  ? -1.616  14.502  8.256   1.00 0.00 ? 18  LYS A HE2  5  
ATOM 8929  H HE3  . LYS A 1 18  ? -1.486  12.935  9.030   1.00 0.00 ? 18  LYS A HE3  5  
ATOM 8930  H HZ1  . LYS A 1 18  ? -0.780  15.544  10.157  1.00 0.00 ? 18  LYS A HZ1  5  
ATOM 8931  H HZ2  . LYS A 1 18  ? -1.868  14.463  10.719  1.00 0.00 ? 18  LYS A HZ2  5  
ATOM 8932  H HZ3  . LYS A 1 18  ? -0.270  14.149  10.836  1.00 0.00 ? 18  LYS A HZ3  5  
ATOM 8933  N N    . GLY A 1 19  ? 4.608   13.884  7.191   1.00 0.00 ? 19  GLY A N    5  
ATOM 8934  C CA   . GLY A 1 19  ? 5.914   13.354  7.546   1.00 0.00 ? 19  GLY A CA   5  
ATOM 8935  C C    . GLY A 1 19  ? 5.869   11.830  7.677   1.00 0.00 ? 19  GLY A C    5  
ATOM 8936  O O    . GLY A 1 19  ? 5.802   11.301  8.786   1.00 0.00 ? 19  GLY A O    5  
ATOM 8937  H H    . GLY A 1 19  ? 4.157   14.411  7.911   1.00 0.00 ? 19  GLY A H    5  
ATOM 8938  H HA2  . GLY A 1 19  ? 6.643   13.635  6.786   1.00 0.00 ? 19  GLY A HA2  5  
ATOM 8939  H HA3  . GLY A 1 19  ? 6.246   13.794  8.486   1.00 0.00 ? 19  GLY A HA3  5  
ATOM 8940  N N    . GLY A 1 20  ? 5.908   11.167  6.531   1.00 0.00 ? 20  GLY A N    5  
ATOM 8941  C CA   . GLY A 1 20  ? 5.873   9.715   6.504   1.00 0.00 ? 20  GLY A CA   5  
ATOM 8942  C C    . GLY A 1 20  ? 4.557   9.188   7.079   1.00 0.00 ? 20  GLY A C    5  
ATOM 8943  O O    . GLY A 1 20  ? 3.709   9.966   7.512   1.00 0.00 ? 20  GLY A O    5  
ATOM 8944  H H    . GLY A 1 20  ? 5.963   11.605  5.633   1.00 0.00 ? 20  GLY A H    5  
ATOM 8945  H HA2  . GLY A 1 20  ? 5.993   9.364   5.479   1.00 0.00 ? 20  GLY A HA2  5  
ATOM 8946  H HA3  . GLY A 1 20  ? 6.710   9.317   7.077   1.00 0.00 ? 20  GLY A HA3  5  
ATOM 8947  N N    . ALA A 1 21  ? 4.429   7.869   7.065   1.00 0.00 ? 21  ALA A N    5  
ATOM 8948  C CA   . ALA A 1 21  ? 3.230   7.228   7.580   1.00 0.00 ? 21  ALA A CA   5  
ATOM 8949  C C    . ALA A 1 21  ? 3.626   6.177   8.619   1.00 0.00 ? 21  ALA A C    5  
ATOM 8950  O O    . ALA A 1 21  ? 4.775   5.742   8.660   1.00 0.00 ? 21  ALA A O    5  
ATOM 8951  C CB   . ALA A 1 21  ? 2.432   6.631   6.420   1.00 0.00 ? 21  ALA A CB   5  
ATOM 8952  H H    . ALA A 1 21  ? 5.123   7.243   6.711   1.00 0.00 ? 21  ALA A H    5  
ATOM 8953  H HA   . ALA A 1 21  ? 2.626   7.996   8.064   1.00 0.00 ? 21  ALA A HA   5  
ATOM 8954  H HB1  . ALA A 1 21  ? 1.530   6.155   6.806   1.00 0.00 ? 21  ALA A HB1  5  
ATOM 8955  H HB2  . ALA A 1 21  ? 2.155   7.423   5.724   1.00 0.00 ? 21  ALA A HB2  5  
ATOM 8956  H HB3  . ALA A 1 21  ? 3.041   5.890   5.903   1.00 0.00 ? 21  ALA A HB3  5  
ATOM 8957  N N    . ALA A 1 22  ? 2.650   5.798   9.432   1.00 0.00 ? 22  ALA A N    5  
ATOM 8958  C CA   . ALA A 1 22  ? 2.882   4.806   10.467  1.00 0.00 ? 22  ALA A CA   5  
ATOM 8959  C C    . ALA A 1 22  ? 2.499   3.423   9.937   1.00 0.00 ? 22  ALA A C    5  
ATOM 8960  O O    . ALA A 1 22  ? 1.409   3.241   9.396   1.00 0.00 ? 22  ALA A O    5  
ATOM 8961  C CB   . ALA A 1 22  ? 2.097   5.186   11.724  1.00 0.00 ? 22  ALA A CB   5  
ATOM 8962  H H    . ALA A 1 22  ? 1.718   6.157   9.391   1.00 0.00 ? 22  ALA A H    5  
ATOM 8963  H HA   . ALA A 1 22  ? 3.946   4.814   10.703  1.00 0.00 ? 22  ALA A HA   5  
ATOM 8964  H HB1  . ALA A 1 22  ? 1.029   5.071   11.534  1.00 0.00 ? 22  ALA A HB1  5  
ATOM 8965  H HB2  . ALA A 1 22  ? 2.392   4.536   12.548  1.00 0.00 ? 22  ALA A HB2  5  
ATOM 8966  H HB3  . ALA A 1 22  ? 2.309   6.223   11.986  1.00 0.00 ? 22  ALA A HB3  5  
ATOM 8967  N N    . VAL A 1 23  ? 3.417   2.483   10.110  1.00 0.00 ? 23  VAL A N    5  
ATOM 8968  C CA   . VAL A 1 23  ? 3.189   1.122   9.656   1.00 0.00 ? 23  VAL A CA   5  
ATOM 8969  C C    . VAL A 1 23  ? 2.135   0.461   10.546  1.00 0.00 ? 23  VAL A C    5  
ATOM 8970  O O    . VAL A 1 23  ? 2.008   0.802   11.721  1.00 0.00 ? 23  VAL A O    5  
ATOM 8971  C CB   . VAL A 1 23  ? 4.512   0.353   9.623   1.00 0.00 ? 23  VAL A CB   5  
ATOM 8972  C CG1  . VAL A 1 23  ? 4.268   -1.152  9.491   1.00 0.00 ? 23  VAL A CG1  5  
ATOM 8973  C CG2  . VAL A 1 23  ? 5.415   0.863   8.498   1.00 0.00 ? 23  VAL A CG2  5  
ATOM 8974  H H    . VAL A 1 23  ? 4.301   2.639   10.551  1.00 0.00 ? 23  VAL A H    5  
ATOM 8975  H HA   . VAL A 1 23  ? 2.805   1.175   8.637   1.00 0.00 ? 23  VAL A HA   5  
ATOM 8976  H HB   . VAL A 1 23  ? 5.024   0.527   10.569  1.00 0.00 ? 23  VAL A HB   5  
ATOM 8977  H HG11 . VAL A 1 23  ? 4.127   -1.585  10.481  1.00 0.00 ? 23  VAL A HG11 5  
ATOM 8978  H HG12 . VAL A 1 23  ? 3.376   -1.324  8.889   1.00 0.00 ? 23  VAL A HG12 5  
ATOM 8979  H HG13 . VAL A 1 23  ? 5.127   -1.618  9.009   1.00 0.00 ? 23  VAL A HG13 5  
ATOM 8980  H HG21 . VAL A 1 23  ? 4.881   0.805   7.549   1.00 0.00 ? 23  VAL A HG21 5  
ATOM 8981  H HG22 . VAL A 1 23  ? 5.692   1.898   8.696   1.00 0.00 ? 23  VAL A HG22 5  
ATOM 8982  H HG23 . VAL A 1 23  ? 6.314   0.249   8.447   1.00 0.00 ? 23  VAL A HG23 5  
ATOM 8983  N N    . ASP A 1 24  ? 1.407   -0.474  9.953   1.00 0.00 ? 24  ASP A N    5  
ATOM 8984  C CA   . ASP A 1 24  ? 0.368   -1.185  10.678  1.00 0.00 ? 24  ASP A CA   5  
ATOM 8985  C C    . ASP A 1 24  ? 1.011   -2.257  11.561  1.00 0.00 ? 24  ASP A C    5  
ATOM 8986  O O    . ASP A 1 24  ? 2.031   -2.839  11.193  1.00 0.00 ? 24  ASP A O    5  
ATOM 8987  C CB   . ASP A 1 24  ? -0.596  -1.882  9.716   1.00 0.00 ? 24  ASP A CB   5  
ATOM 8988  C CG   . ASP A 1 24  ? -2.065  -1.484  9.873   1.00 0.00 ? 24  ASP A CG   5  
ATOM 8989  O OD1  . ASP A 1 24  ? -2.465  -0.509  9.201   1.00 0.00 ? 24  ASP A OD1  5  
ATOM 8990  O OD2  . ASP A 1 24  ? -2.756  -2.165  10.662  1.00 0.00 ? 24  ASP A OD2  5  
ATOM 8991  H H    . ASP A 1 24  ? 1.517   -0.745  8.997   1.00 0.00 ? 24  ASP A H    5  
ATOM 8992  H HA   . ASP A 1 24  ? -0.150  -0.422  11.259  1.00 0.00 ? 24  ASP A HA   5  
ATOM 8993  H HB2  . ASP A 1 24  ? -0.285  -1.667  8.694   1.00 0.00 ? 24  ASP A HB2  5  
ATOM 8994  H HB3  . ASP A 1 24  ? -0.510  -2.959  9.855   1.00 0.00 ? 24  ASP A HB3  5  
ATOM 8995  N N    . PRO A 1 25  ? 0.373   -2.491  12.738  1.00 0.00 ? 25  PRO A N    5  
ATOM 8996  C CA   . PRO A 1 25  ? 0.872   -3.482  13.676  1.00 0.00 ? 25  PRO A CA   5  
ATOM 8997  C C    . PRO A 1 25  ? 0.566   -4.900  13.189  1.00 0.00 ? 25  PRO A C    5  
ATOM 8998  O O    . PRO A 1 25  ? 1.184   -5.863  13.642  1.00 0.00 ? 25  PRO A O    5  
ATOM 8999  C CB   . PRO A 1 25  ? 0.196   -3.150  14.996  1.00 0.00 ? 25  PRO A CB   5  
ATOM 9000  C CG   . PRO A 1 25  ? -1.002  -2.282  14.645  1.00 0.00 ? 25  PRO A CG   5  
ATOM 9001  C CD   . PRO A 1 25  ? -0.837  -1.821  13.206  1.00 0.00 ? 25  PRO A CD   5  
ATOM 9002  H HA   . PRO A 1 25  ? 1.867   -3.425  13.745  1.00 0.00 ? 25  PRO A HA   5  
ATOM 9003  H HB2  . PRO A 1 25  ? -0.117  -4.056  15.515  1.00 0.00 ? 25  PRO A HB2  5  
ATOM 9004  H HB3  . PRO A 1 25  ? 0.879   -2.621  15.662  1.00 0.00 ? 25  PRO A HB3  5  
ATOM 9005  H HG2  . PRO A 1 25  ? -1.928  -2.845  14.761  1.00 0.00 ? 25  PRO A HG2  5  
ATOM 9006  H HG3  . PRO A 1 25  ? -1.063  -1.426  15.316  1.00 0.00 ? 25  PRO A HG3  5  
ATOM 9007  H HD2  . PRO A 1 25  ? -1.701  -2.094  12.601  1.00 0.00 ? 25  PRO A HD2  5  
ATOM 9008  H HD3  . PRO A 1 25  ? -0.737  -0.737  13.147  1.00 0.00 ? 25  PRO A HD3  5  
ATOM 9009  N N    . ASP A 1 26  ? -0.386  -4.985  12.272  1.00 0.00 ? 26  ASP A N    5  
ATOM 9010  C CA   . ASP A 1 26  ? -0.781  -6.269  11.719  1.00 0.00 ? 26  ASP A CA   5  
ATOM 9011  C C    . ASP A 1 26  ? 0.327   -6.784  10.798  1.00 0.00 ? 26  ASP A C    5  
ATOM 9012  O O    . ASP A 1 26  ? 0.401   -7.980  10.519  1.00 0.00 ? 26  ASP A O    5  
ATOM 9013  C CB   . ASP A 1 26  ? -2.062  -6.142  10.892  1.00 0.00 ? 26  ASP A CB   5  
ATOM 9014  C CG   . ASP A 1 26  ? -2.829  -7.450  10.685  1.00 0.00 ? 26  ASP A CG   5  
ATOM 9015  O OD1  . ASP A 1 26  ? -2.182  -8.424  10.243  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 9016  O OD2  . ASP A 1 26  ? -4.046  -7.445  10.971  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 9017  H H    . ASP A 1 26  ? -0.884  -4.197  11.909  1.00 0.00 ? 26  ASP A H    5  
ATOM 9018  H HA   . ASP A 1 26  ? -0.940  -6.916  12.581  1.00 0.00 ? 26  ASP A HA   5  
ATOM 9019  H HB2  . ASP A 1 26  ? -2.722  -5.425  11.381  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 9020  H HB3  . ASP A 1 26  ? -1.808  -5.729  9.917   1.00 0.00 ? 26  ASP A HB3  5  
ATOM 9021  N N    . SER A 1 27  ? 1.160   -5.856  10.350  1.00 0.00 ? 27  SER A N    5  
ATOM 9022  C CA   . SER A 1 27  ? 2.260   -6.202  9.466   1.00 0.00 ? 27  SER A CA   5  
ATOM 9023  C C    . SER A 1 27  ? 3.426   -6.768  10.278  1.00 0.00 ? 27  SER A C    5  
ATOM 9024  O O    . SER A 1 27  ? 4.191   -7.593  9.781   1.00 0.00 ? 27  SER A O    5  
ATOM 9025  C CB   . SER A 1 27  ? 2.718   -4.988  8.655   1.00 0.00 ? 27  SER A CB   5  
ATOM 9026  O OG   . SER A 1 27  ? 1.996   -3.810  9.005   1.00 0.00 ? 27  SER A OG   5  
ATOM 9027  H H    . SER A 1 27  ? 1.092   -4.886  10.581  1.00 0.00 ? 27  SER A H    5  
ATOM 9028  H HA   . SER A 1 27  ? 1.861   -6.959  8.791   1.00 0.00 ? 27  SER A HA   5  
ATOM 9029  H HB2  . SER A 1 27  ? 3.783   -4.823  8.820   1.00 0.00 ? 27  SER A HB2  5  
ATOM 9030  H HB3  . SER A 1 27  ? 2.587   -5.191  7.593   1.00 0.00 ? 27  SER A HB3  5  
ATOM 9031  H HG   . SER A 1 27  ? 2.480   -3.314  9.726   1.00 0.00 ? 27  SER A HG   5  
ATOM 9032  N N    . GLY A 1 28  ? 3.526   -6.302  11.515  1.00 0.00 ? 28  GLY A N    5  
ATOM 9033  C CA   . GLY A 1 28  ? 4.586   -6.751  12.401  1.00 0.00 ? 28  GLY A CA   5  
ATOM 9034  C C    . GLY A 1 28  ? 5.861   -5.933  12.189  1.00 0.00 ? 28  GLY A C    5  
ATOM 9035  O O    . GLY A 1 28  ? 6.771   -5.970  13.016  1.00 0.00 ? 28  GLY A O    5  
ATOM 9036  H H    . GLY A 1 28  ? 2.900   -5.631  11.911  1.00 0.00 ? 28  GLY A H    5  
ATOM 9037  H HA2  . GLY A 1 28  ? 4.260   -6.663  13.437  1.00 0.00 ? 28  GLY A HA2  5  
ATOM 9038  H HA3  . GLY A 1 28  ? 4.793   -7.806  12.221  1.00 0.00 ? 28  GLY A HA3  5  
ATOM 9039  N N    . LEU A 1 29  ? 5.887   -5.213  11.077  1.00 0.00 ? 29  LEU A N    5  
ATOM 9040  C CA   . LEU A 1 29  ? 7.035   -4.387  10.746  1.00 0.00 ? 29  LEU A CA   5  
ATOM 9041  C C    . LEU A 1 29  ? 6.827   -2.981  11.313  1.00 0.00 ? 29  LEU A C    5  
ATOM 9042  O O    . LEU A 1 29  ? 7.582   -2.063  10.997  1.00 0.00 ? 29  LEU A O    5  
ATOM 9043  C CB   . LEU A 1 29  ? 7.296   -4.410  9.239   1.00 0.00 ? 29  LEU A CB   5  
ATOM 9044  C CG   . LEU A 1 29  ? 7.488   -5.793  8.613   1.00 0.00 ? 29  LEU A CG   5  
ATOM 9045  C CD1  . LEU A 1 29  ? 7.843   -6.833  9.677   1.00 0.00 ? 29  LEU A CD1  5  
ATOM 9046  C CD2  . LEU A 1 29  ? 6.258   -6.202  7.799   1.00 0.00 ? 29  LEU A CD2  5  
ATOM 9047  H H    . LEU A 1 29  ? 5.142   -5.189  10.410  1.00 0.00 ? 29  LEU A H    5  
ATOM 9048  H HA   . LEU A 1 29  ? 7.906   -4.829  11.231  1.00 0.00 ? 29  LEU A HA   5  
ATOM 9049  H HB2  . LEU A 1 29  ? 6.461   -3.919  8.738   1.00 0.00 ? 29  LEU A HB2  5  
ATOM 9050  H HB3  . LEU A 1 29  ? 8.185   -3.814  9.035   1.00 0.00 ? 29  LEU A HB3  5  
ATOM 9051  H HG   . LEU A 1 29  ? 8.329   -5.741  7.921   1.00 0.00 ? 29  LEU A HG   5  
ATOM 9052  H HD11 . LEU A 1 29  ? 8.621   -6.434  10.329  1.00 0.00 ? 29  LEU A HD11 5  
ATOM 9053  H HD12 . LEU A 1 29  ? 6.957   -7.064  10.269  1.00 0.00 ? 29  LEU A HD12 5  
ATOM 9054  H HD13 . LEU A 1 29  ? 8.204   -7.740  9.193   1.00 0.00 ? 29  LEU A HD13 5  
ATOM 9055  H HD21 . LEU A 1 29  ? 5.899   -7.171  8.146   1.00 0.00 ? 29  LEU A HD21 5  
ATOM 9056  H HD22 . LEU A 1 29  ? 5.474   -5.457  7.927   1.00 0.00 ? 29  LEU A HD22 5  
ATOM 9057  H HD23 . LEU A 1 29  ? 6.526   -6.270  6.745   1.00 0.00 ? 29  LEU A HD23 5  
ATOM 9058  N N    . GLU A 1 30  ? 5.800   -2.857  12.140  1.00 0.00 ? 30  GLU A N    5  
ATOM 9059  C CA   . GLU A 1 30  ? 5.483   -1.579  12.754  1.00 0.00 ? 30  GLU A CA   5  
ATOM 9060  C C    . GLU A 1 30  ? 6.664   -1.084  13.591  1.00 0.00 ? 30  GLU A C    5  
ATOM 9061  O O    . GLU A 1 30  ? 6.856   0.120   13.749  1.00 0.00 ? 30  GLU A O    5  
ATOM 9062  C CB   . GLU A 1 30  ? 4.213   -1.678  13.602  1.00 0.00 ? 30  GLU A CB   5  
ATOM 9063  C CG   . GLU A 1 30  ? 4.219   -2.949  14.453  1.00 0.00 ? 30  GLU A CG   5  
ATOM 9064  C CD   . GLU A 1 30  ? 3.344   -2.781  15.696  1.00 0.00 ? 30  GLU A CD   5  
ATOM 9065  O OE1  . GLU A 1 30  ? 2.870   -1.644  15.907  1.00 0.00 ? 30  GLU A OE1  5  
ATOM 9066  O OE2  . GLU A 1 30  ? 3.169   -3.793  16.408  1.00 0.00 ? 30  GLU A OE2  5  
ATOM 9067  H H    . GLU A 1 30  ? 5.191   -3.610  12.392  1.00 0.00 ? 30  GLU A H    5  
ATOM 9068  H HA   . GLU A 1 30  ? 5.305   -0.895  11.923  1.00 0.00 ? 30  GLU A HA   5  
ATOM 9069  H HB2  . GLU A 1 30  ? 4.134   -0.804  14.248  1.00 0.00 ? 30  GLU A HB2  5  
ATOM 9070  H HB3  . GLU A 1 30  ? 3.337   -1.674  12.953  1.00 0.00 ? 30  GLU A HB3  5  
ATOM 9071  H HG2  . GLU A 1 30  ? 3.857   -3.789  13.860  1.00 0.00 ? 30  GLU A HG2  5  
ATOM 9072  H HG3  . GLU A 1 30  ? 5.240   -3.186  14.751  1.00 0.00 ? 30  GLU A HG3  5  
ATOM 9073  N N    . HIS A 1 31  ? 7.424   -2.040  14.105  1.00 0.00 ? 31  HIS A N    5  
ATOM 9074  C CA   . HIS A 1 31  ? 8.582   -1.716  14.922  1.00 0.00 ? 31  HIS A CA   5  
ATOM 9075  C C    . HIS A 1 31  ? 9.846   -2.272  14.264  1.00 0.00 ? 31  HIS A C    5  
ATOM 9076  O O    . HIS A 1 31  ? 10.909  -2.306  14.883  1.00 0.00 ? 31  HIS A O    5  
ATOM 9077  C CB   . HIS A 1 31  ? 8.391   -2.215  16.356  1.00 0.00 ? 31  HIS A CB   5  
ATOM 9078  C CG   . HIS A 1 31  ? 7.834   -3.616  16.450  1.00 0.00 ? 31  HIS A CG   5  
ATOM 9079  N ND1  . HIS A 1 31  ? 7.986   -4.552  15.442  1.00 0.00 ? 31  HIS A ND1  5  
ATOM 9080  C CD2  . HIS A 1 31  ? 7.125   -4.228  17.441  1.00 0.00 ? 31  HIS A CD2  5  
ATOM 9081  C CE1  . HIS A 1 31  ? 7.391   -5.674  15.821  1.00 0.00 ? 31  HIS A CE1  5  
ATOM 9082  N NE2  . HIS A 1 31  ? 6.857   -5.471  17.060  1.00 0.00 ? 31  HIS A NE2  5  
ATOM 9083  H H    . HIS A 1 31  ? 7.261   -3.017  13.972  1.00 0.00 ? 31  HIS A H    5  
ATOM 9084  H HA   . HIS A 1 31  ? 8.647   -0.629  14.955  1.00 0.00 ? 31  HIS A HA   5  
ATOM 9085  H HB2  . HIS A 1 31  ? 9.351   -2.182  16.872  1.00 0.00 ? 31  HIS A HB2  5  
ATOM 9086  H HB3  . HIS A 1 31  ? 7.723   -1.533  16.882  1.00 0.00 ? 31  HIS A HB3  5  
ATOM 9087  H HD1  . HIS A 1 31  ? 8.464   -4.407  14.576  1.00 0.00 ? 31  HIS A HD1  5  
ATOM 9088  H HD2  . HIS A 1 31  ? 6.829   -3.774  18.387  1.00 0.00 ? 31  HIS A HD2  5  
ATOM 9089  H HE1  . HIS A 1 31  ? 7.337   -6.597  15.243  1.00 0.00 ? 31  HIS A HE1  5  
ATOM 9090  N N    . SER A 1 32  ? 9.689   -2.694  13.018  1.00 0.00 ? 32  SER A N    5  
ATOM 9091  C CA   . SER A 1 32  ? 10.805  -3.246  12.269  1.00 0.00 ? 32  SER A CA   5  
ATOM 9092  C C    . SER A 1 32  ? 11.057  -2.410  11.013  1.00 0.00 ? 32  SER A C    5  
ATOM 9093  O O    . SER A 1 32  ? 12.165  -1.919  10.802  1.00 0.00 ? 32  SER A O    5  
ATOM 9094  C CB   . SER A 1 32  ? 10.546  -4.706  11.892  1.00 0.00 ? 32  SER A CB   5  
ATOM 9095  O OG   . SER A 1 32  ? 11.748  -5.472  11.866  1.00 0.00 ? 32  SER A OG   5  
ATOM 9096  H H    . SER A 1 32  ? 8.822   -2.662  12.522  1.00 0.00 ? 32  SER A H    5  
ATOM 9097  H HA   . SER A 1 32  ? 11.660  -3.192  12.943  1.00 0.00 ? 32  SER A HA   5  
ATOM 9098  H HB2  . SER A 1 32  ? 9.850   -5.147  12.606  1.00 0.00 ? 32  SER A HB2  5  
ATOM 9099  H HB3  . SER A 1 32  ? 10.068  -4.749  10.913  1.00 0.00 ? 32  SER A HB3  5  
ATOM 9100  H HG   . SER A 1 32  ? 12.372  -5.106  11.177  1.00 0.00 ? 32  SER A HG   5  
ATOM 9101  N N    . ALA A 1 33  ? 10.011  -2.275  10.211  1.00 0.00 ? 33  ALA A N    5  
ATOM 9102  C CA   . ALA A 1 33  ? 10.105  -1.507  8.981   1.00 0.00 ? 33  ALA A CA   5  
ATOM 9103  C C    . ALA A 1 33  ? 9.230   -0.258  9.096   1.00 0.00 ? 33  ALA A C    5  
ATOM 9104  O O    . ALA A 1 33  ? 8.572   -0.048  10.115  1.00 0.00 ? 33  ALA A O    5  
ATOM 9105  C CB   . ALA A 1 33  ? 9.708   -2.390  7.796   1.00 0.00 ? 33  ALA A CB   5  
ATOM 9106  H H    . ALA A 1 33  ? 9.114   -2.678  10.389  1.00 0.00 ? 33  ALA A H    5  
ATOM 9107  H HA   . ALA A 1 33  ? 11.145  -1.202  8.859   1.00 0.00 ? 33  ALA A HA   5  
ATOM 9108  H HB1  . ALA A 1 33  ? 8.638   -2.296  7.616   1.00 0.00 ? 33  ALA A HB1  5  
ATOM 9109  H HB2  . ALA A 1 33  ? 10.255  -2.073  6.908   1.00 0.00 ? 33  ALA A HB2  5  
ATOM 9110  H HB3  . ALA A 1 33  ? 9.950   -3.429  8.020   1.00 0.00 ? 33  ALA A HB3  5  
ATOM 9111  N N    . HIS A 1 34  ? 9.249   0.540   8.039   1.00 0.00 ? 34  HIS A N    5  
ATOM 9112  C CA   . HIS A 1 34  ? 8.465   1.763   8.009   1.00 0.00 ? 34  HIS A CA   5  
ATOM 9113  C C    . HIS A 1 34  ? 7.807   1.917   6.636   1.00 0.00 ? 34  HIS A C    5  
ATOM 9114  O O    . HIS A 1 34  ? 8.246   1.308   5.661   1.00 0.00 ? 34  HIS A O    5  
ATOM 9115  C CB   . HIS A 1 34  ? 9.325   2.969   8.392   1.00 0.00 ? 34  HIS A CB   5  
ATOM 9116  C CG   . HIS A 1 34  ? 10.451  3.253   7.427   1.00 0.00 ? 34  HIS A CG   5  
ATOM 9117  N ND1  . HIS A 1 34  ? 11.726  2.740   7.590   1.00 0.00 ? 34  HIS A ND1  5  
ATOM 9118  C CD2  . HIS A 1 34  ? 10.479  4.000   6.286   1.00 0.00 ? 34  HIS A CD2  5  
ATOM 9119  C CE1  . HIS A 1 34  ? 12.479  3.167   6.587   1.00 0.00 ? 34  HIS A CE1  5  
ATOM 9120  N NE2  . HIS A 1 34  ? 11.705  3.948   5.780   1.00 0.00 ? 34  HIS A NE2  5  
ATOM 9121  H H    . HIS A 1 34  ? 9.787   0.362   7.214   1.00 0.00 ? 34  HIS A H    5  
ATOM 9122  H HA   . HIS A 1 34  ? 7.688   1.654   8.765   1.00 0.00 ? 34  HIS A HA   5  
ATOM 9123  H HB2  . HIS A 1 34  ? 8.687   3.850   8.460   1.00 0.00 ? 34  HIS A HB2  5  
ATOM 9124  H HB3  . HIS A 1 34  ? 9.745   2.802   9.384   1.00 0.00 ? 34  HIS A HB3  5  
ATOM 9125  H HD1  . HIS A 1 34  ? 12.027  2.148   8.337   1.00 0.00 ? 34  HIS A HD1  5  
ATOM 9126  H HD2  . HIS A 1 34  ? 9.637   4.547   5.862   1.00 0.00 ? 34  HIS A HD2  5  
ATOM 9127  H HE1  . HIS A 1 34  ? 13.533  2.935   6.433   1.00 0.00 ? 34  HIS A HE1  5  
ATOM 9128  N N    . VAL A 1 35  ? 6.765   2.734   6.604   1.00 0.00 ? 35  VAL A N    5  
ATOM 9129  C CA   . VAL A 1 35  ? 6.042   2.976   5.367   1.00 0.00 ? 35  VAL A CA   5  
ATOM 9130  C C    . VAL A 1 35  ? 7.021   3.454   4.293   1.00 0.00 ? 35  VAL A C    5  
ATOM 9131  O O    . VAL A 1 35  ? 7.637   4.509   4.436   1.00 0.00 ? 35  VAL A O    5  
ATOM 9132  C CB   . VAL A 1 35  ? 4.897   3.961   5.614   1.00 0.00 ? 35  VAL A CB   5  
ATOM 9133  C CG1  . VAL A 1 35  ? 4.149   4.269   4.315   1.00 0.00 ? 35  VAL A CG1  5  
ATOM 9134  C CG2  . VAL A 1 35  ? 3.942   3.434   6.686   1.00 0.00 ? 35  VAL A CG2  5  
ATOM 9135  H H    . VAL A 1 35  ? 6.415   3.226   7.401   1.00 0.00 ? 35  VAL A H    5  
ATOM 9136  H HA   . VAL A 1 35  ? 5.608   2.028   5.049   1.00 0.00 ? 35  VAL A HA   5  
ATOM 9137  H HB   . VAL A 1 35  ? 5.330   4.892   5.980   1.00 0.00 ? 35  VAL A HB   5  
ATOM 9138  H HG11 . VAL A 1 35  ? 3.075   4.239   4.499   1.00 0.00 ? 35  VAL A HG11 5  
ATOM 9139  H HG12 . VAL A 1 35  ? 4.430   5.261   3.961   1.00 0.00 ? 35  VAL A HG12 5  
ATOM 9140  H HG13 . VAL A 1 35  ? 4.410   3.526   3.561   1.00 0.00 ? 35  VAL A HG13 5  
ATOM 9141  H HG21 . VAL A 1 35  ? 4.502   2.850   7.416   1.00 0.00 ? 35  VAL A HG21 5  
ATOM 9142  H HG22 . VAL A 1 35  ? 3.458   4.273   7.186   1.00 0.00 ? 35  VAL A HG22 5  
ATOM 9143  H HG23 . VAL A 1 35  ? 3.185   2.803   6.219   1.00 0.00 ? 35  VAL A HG23 5  
ATOM 9144  N N    . LEU A 1 36  ? 7.135   2.655   3.243   1.00 0.00 ? 36  LEU A N    5  
ATOM 9145  C CA   . LEU A 1 36  ? 8.029   2.984   2.146   1.00 0.00 ? 36  LEU A CA   5  
ATOM 9146  C C    . LEU A 1 36  ? 7.654   4.355   1.581   1.00 0.00 ? 36  LEU A C    5  
ATOM 9147  O O    . LEU A 1 36  ? 6.541   4.547   1.094   1.00 0.00 ? 36  LEU A O    5  
ATOM 9148  C CB   . LEU A 1 36  ? 8.027   1.867   1.100   1.00 0.00 ? 36  LEU A CB   5  
ATOM 9149  C CG   . LEU A 1 36  ? 9.133   1.934   0.045   1.00 0.00 ? 36  LEU A CG   5  
ATOM 9150  C CD1  . LEU A 1 36  ? 8.568   2.339   -1.318  1.00 0.00 ? 36  LEU A CD1  5  
ATOM 9151  C CD2  . LEU A 1 36  ? 10.264  2.861   0.495   1.00 0.00 ? 36  LEU A CD2  5  
ATOM 9152  H H    . LEU A 1 36  ? 6.630   1.799   3.135   1.00 0.00 ? 36  LEU A H    5  
ATOM 9153  H HA   . LEU A 1 36  ? 9.038   3.042   2.553   1.00 0.00 ? 36  LEU A HA   5  
ATOM 9154  H HB2  . LEU A 1 36  ? 8.104   0.911   1.618   1.00 0.00 ? 36  LEU A HB2  5  
ATOM 9155  H HB3  . LEU A 1 36  ? 7.064   1.876   0.589   1.00 0.00 ? 36  LEU A HB3  5  
ATOM 9156  H HG   . LEU A 1 36  ? 9.560   0.937   -0.067  1.00 0.00 ? 36  LEU A HG   5  
ATOM 9157  H HD11 . LEU A 1 36  ? 9.386   2.476   -2.024  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 9158  H HD12 . LEU A 1 36  ? 7.901   1.557   -1.681  1.00 0.00 ? 36  LEU A HD12 5  
ATOM 9159  H HD13 . LEU A 1 36  ? 8.014   3.272   -1.218  1.00 0.00 ? 36  LEU A HD13 5  
ATOM 9160  H HD21 . LEU A 1 36  ? 10.599  2.570   1.491   1.00 0.00 ? 36  LEU A HD21 5  
ATOM 9161  H HD22 . LEU A 1 36  ? 11.097  2.784   -0.205  1.00 0.00 ? 36  LEU A HD22 5  
ATOM 9162  H HD23 . LEU A 1 36  ? 9.904   3.889   0.519   1.00 0.00 ? 36  LEU A HD23 5  
ATOM 9163  N N    . GLU A 1 37  ? 8.605   5.274   1.666   1.00 0.00 ? 37  GLU A N    5  
ATOM 9164  C CA   . GLU A 1 37  ? 8.389   6.623   1.169   1.00 0.00 ? 37  GLU A CA   5  
ATOM 9165  C C    . GLU A 1 37  ? 9.237   6.871   -0.079  1.00 0.00 ? 37  GLU A C    5  
ATOM 9166  O O    . GLU A 1 37  ? 10.303  6.279   -0.238  1.00 0.00 ? 37  GLU A O    5  
ATOM 9167  C CB   . GLU A 1 37  ? 8.690   7.661   2.253   1.00 0.00 ? 37  GLU A CB   5  
ATOM 9168  C CG   . GLU A 1 37  ? 7.447   7.947   3.098   1.00 0.00 ? 37  GLU A CG   5  
ATOM 9169  C CD   . GLU A 1 37  ? 7.746   7.774   4.588   1.00 0.00 ? 37  GLU A CD   5  
ATOM 9170  O OE1  . GLU A 1 37  ? 8.825   8.244   5.009   1.00 0.00 ? 37  GLU A OE1  5  
ATOM 9171  O OE2  . GLU A 1 37  ? 6.888   7.176   5.273   1.00 0.00 ? 37  GLU A OE2  5  
ATOM 9172  H H    . GLU A 1 37  ? 9.508   5.110   2.063   1.00 0.00 ? 37  GLU A H    5  
ATOM 9173  H HA   . GLU A 1 37  ? 7.330   6.671   0.913   1.00 0.00 ? 37  GLU A HA   5  
ATOM 9174  H HB2  . GLU A 1 37  ? 9.494   7.300   2.893   1.00 0.00 ? 37  GLU A HB2  5  
ATOM 9175  H HB3  . GLU A 1 37  ? 9.040   8.583   1.790   1.00 0.00 ? 37  GLU A HB3  5  
ATOM 9176  H HG2  . GLU A 1 37  ? 7.100   8.963   2.908   1.00 0.00 ? 37  GLU A HG2  5  
ATOM 9177  H HG3  . GLU A 1 37  ? 6.640   7.275   2.804   1.00 0.00 ? 37  GLU A HG3  5  
ATOM 9178  N N    . LYS A 1 38  ? 8.732   7.749   -0.934  1.00 0.00 ? 38  LYS A N    5  
ATOM 9179  C CA   . LYS A 1 38  ? 9.431   8.083   -2.163  1.00 0.00 ? 38  LYS A CA   5  
ATOM 9180  C C    . LYS A 1 38  ? 8.951   9.447   -2.663  1.00 0.00 ? 38  LYS A C    5  
ATOM 9181  O O    . LYS A 1 38  ? 7.812   9.839   -2.411  1.00 0.00 ? 38  LYS A O    5  
ATOM 9182  C CB   . LYS A 1 38  ? 9.273   6.961   -3.191  1.00 0.00 ? 38  LYS A CB   5  
ATOM 9183  C CG   . LYS A 1 38  ? 10.519  6.845   -4.071  1.00 0.00 ? 38  LYS A CG   5  
ATOM 9184  C CD   . LYS A 1 38  ? 10.678  5.421   -4.610  1.00 0.00 ? 38  LYS A CD   5  
ATOM 9185  C CE   . LYS A 1 38  ? 11.477  5.415   -5.915  1.00 0.00 ? 38  LYS A CE   5  
ATOM 9186  N NZ   . LYS A 1 38  ? 12.863  5.877   -5.676  1.00 0.00 ? 38  LYS A NZ   5  
ATOM 9187  H H    . LYS A 1 38  ? 7.865   8.227   -0.797  1.00 0.00 ? 38  LYS A H    5  
ATOM 9188  H HA   . LYS A 1 38  ? 10.492  8.156   -1.927  1.00 0.00 ? 38  LYS A HA   5  
ATOM 9189  H HB2  . LYS A 1 38  ? 9.095   6.016   -2.679  1.00 0.00 ? 38  LYS A HB2  5  
ATOM 9190  H HB3  . LYS A 1 38  ? 8.400   7.155   -3.815  1.00 0.00 ? 38  LYS A HB3  5  
ATOM 9191  H HG2  . LYS A 1 38  ? 10.448  7.546   -4.903  1.00 0.00 ? 38  LYS A HG2  5  
ATOM 9192  H HG3  . LYS A 1 38  ? 11.402  7.120   -3.496  1.00 0.00 ? 38  LYS A HG3  5  
ATOM 9193  H HD2  . LYS A 1 38  ? 11.182  4.802   -3.868  1.00 0.00 ? 38  LYS A HD2  5  
ATOM 9194  H HD3  . LYS A 1 38  ? 9.696   4.980   -4.779  1.00 0.00 ? 38  LYS A HD3  5  
ATOM 9195  H HE2  . LYS A 1 38  ? 11.491  4.410   -6.335  1.00 0.00 ? 38  LYS A HE2  5  
ATOM 9196  H HE3  . LYS A 1 38  ? 10.994  6.061   -6.648  1.00 0.00 ? 38  LYS A HE3  5  
ATOM 9197  H HZ1  . LYS A 1 38  ? 13.493  5.352   -6.248  1.00 0.00 ? 38  LYS A HZ1  5  
ATOM 9198  H HZ2  . LYS A 1 38  ? 12.935  6.848   -5.905  1.00 0.00 ? 38  LYS A HZ2  5  
ATOM 9199  H HZ3  . LYS A 1 38  ? 13.097  5.744   -4.713  1.00 0.00 ? 38  LYS A HZ3  5  
ATOM 9200  N N    . GLY A 1 39  ? 9.843   10.134  -3.362  1.00 0.00 ? 39  GLY A N    5  
ATOM 9201  C CA   . GLY A 1 39  ? 9.524   11.445  -3.899  1.00 0.00 ? 39  GLY A CA   5  
ATOM 9202  C C    . GLY A 1 39  ? 8.764   12.288  -2.873  1.00 0.00 ? 39  GLY A C    5  
ATOM 9203  O O    . GLY A 1 39  ? 7.787   12.954  -3.213  1.00 0.00 ? 39  GLY A O    5  
ATOM 9204  H H    . GLY A 1 39  ? 10.767  9.808   -3.563  1.00 0.00 ? 39  GLY A H    5  
ATOM 9205  H HA2  . GLY A 1 39  ? 10.442  11.957  -4.187  1.00 0.00 ? 39  GLY A HA2  5  
ATOM 9206  H HA3  . GLY A 1 39  ? 8.924   11.337  -4.803  1.00 0.00 ? 39  GLY A HA3  5  
ATOM 9207  N N    . GLY A 1 40  ? 9.240   12.231  -1.638  1.00 0.00 ? 40  GLY A N    5  
ATOM 9208  C CA   . GLY A 1 40  ? 8.617   12.981  -0.561  1.00 0.00 ? 40  GLY A CA   5  
ATOM 9209  C C    . GLY A 1 40  ? 7.137   12.617  -0.424  1.00 0.00 ? 40  GLY A C    5  
ATOM 9210  O O    . GLY A 1 40  ? 6.318   13.461  -0.065  1.00 0.00 ? 40  GLY A O    5  
ATOM 9211  H H    . GLY A 1 40  ? 10.035  11.687  -1.370  1.00 0.00 ? 40  GLY A H    5  
ATOM 9212  H HA2  . GLY A 1 40  ? 9.134   12.774  0.377   1.00 0.00 ? 40  GLY A HA2  5  
ATOM 9213  H HA3  . GLY A 1 40  ? 8.717   14.049  -0.751  1.00 0.00 ? 40  GLY A HA3  5  
ATOM 9214  N N    . LYS A 1 41  ? 6.840   11.360  -0.718  1.00 0.00 ? 41  LYS A N    5  
ATOM 9215  C CA   . LYS A 1 41  ? 5.473   10.875  -0.632  1.00 0.00 ? 41  LYS A CA   5  
ATOM 9216  C C    . LYS A 1 41  ? 5.425   9.659   0.295   1.00 0.00 ? 41  LYS A C    5  
ATOM 9217  O O    . LYS A 1 41  ? 6.452   9.236   0.823   1.00 0.00 ? 41  LYS A O    5  
ATOM 9218  C CB   . LYS A 1 41  ? 4.912   10.604  -2.030  1.00 0.00 ? 41  LYS A CB   5  
ATOM 9219  C CG   . LYS A 1 41  ? 4.419   11.897  -2.682  1.00 0.00 ? 41  LYS A CG   5  
ATOM 9220  C CD   . LYS A 1 41  ? 2.907   12.057  -2.508  1.00 0.00 ? 41  LYS A CD   5  
ATOM 9221  C CE   . LYS A 1 41  ? 2.150   11.426  -3.679  1.00 0.00 ? 41  LYS A CE   5  
ATOM 9222  N NZ   . LYS A 1 41  ? 0.751   11.907  -3.711  1.00 0.00 ? 41  LYS A NZ   5  
ATOM 9223  H H    . LYS A 1 41  ? 7.512   10.680  -1.009  1.00 0.00 ? 41  LYS A H    5  
ATOM 9224  H HA   . LYS A 1 41  ? 4.871   11.670  -0.192  1.00 0.00 ? 41  LYS A HA   5  
ATOM 9225  H HB2  . LYS A 1 41  ? 5.681   10.149  -2.653  1.00 0.00 ? 41  LYS A HB2  5  
ATOM 9226  H HB3  . LYS A 1 41  ? 4.091   9.890   -1.964  1.00 0.00 ? 41  LYS A HB3  5  
ATOM 9227  H HG2  . LYS A 1 41  ? 4.932   12.751  -2.239  1.00 0.00 ? 41  LYS A HG2  5  
ATOM 9228  H HG3  . LYS A 1 41  ? 4.667   11.891  -3.743  1.00 0.00 ? 41  LYS A HG3  5  
ATOM 9229  H HD2  . LYS A 1 41  ? 2.594   11.591  -1.574  1.00 0.00 ? 41  LYS A HD2  5  
ATOM 9230  H HD3  . LYS A 1 41  ? 2.656   13.116  -2.436  1.00 0.00 ? 41  LYS A HD3  5  
ATOM 9231  H HE2  . LYS A 1 41  ? 2.648   11.674  -4.616  1.00 0.00 ? 41  LYS A HE2  5  
ATOM 9232  H HE3  . LYS A 1 41  ? 2.166   10.340  -3.586  1.00 0.00 ? 41  LYS A HE3  5  
ATOM 9233  H HZ1  . LYS A 1 41  ? 0.278   11.504  -4.494  1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 9234  H HZ2  . LYS A 1 41  ? 0.287   11.638  -2.867  1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 9235  H HZ3  . LYS A 1 41  ? 0.743   12.904  -3.792  1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 9236  N N    . VAL A 1 42  ? 4.222   9.132   0.466   1.00 0.00 ? 42  VAL A N    5  
ATOM 9237  C CA   . VAL A 1 42  ? 4.027   7.973   1.320   1.00 0.00 ? 42  VAL A CA   5  
ATOM 9238  C C    . VAL A 1 42  ? 3.162   6.945   0.589   1.00 0.00 ? 42  VAL A C    5  
ATOM 9239  O O    . VAL A 1 42  ? 2.182   7.303   -0.062  1.00 0.00 ? 42  VAL A O    5  
ATOM 9240  C CB   . VAL A 1 42  ? 3.433   8.407   2.662   1.00 0.00 ? 42  VAL A CB   5  
ATOM 9241  C CG1  . VAL A 1 42  ? 2.974   7.195   3.476   1.00 0.00 ? 42  VAL A CG1  5  
ATOM 9242  C CG2  . VAL A 1 42  ? 4.430   9.253   3.455   1.00 0.00 ? 42  VAL A CG2  5  
ATOM 9243  H H    . VAL A 1 42  ? 3.391   9.482   0.033   1.00 0.00 ? 42  VAL A H    5  
ATOM 9244  H HA   . VAL A 1 42  ? 5.007   7.536   1.511   1.00 0.00 ? 42  VAL A HA   5  
ATOM 9245  H HB   . VAL A 1 42  ? 2.558   9.024   2.458   1.00 0.00 ? 42  VAL A HB   5  
ATOM 9246  H HG11 . VAL A 1 42  ? 3.582   7.110   4.376   1.00 0.00 ? 42  VAL A HG11 5  
ATOM 9247  H HG12 . VAL A 1 42  ? 1.927   7.320   3.755   1.00 0.00 ? 42  VAL A HG12 5  
ATOM 9248  H HG13 . VAL A 1 42  ? 3.084   6.292   2.876   1.00 0.00 ? 42  VAL A HG13 5  
ATOM 9249  H HG21 . VAL A 1 42  ? 4.800   10.063  2.826   1.00 0.00 ? 42  VAL A HG21 5  
ATOM 9250  H HG22 . VAL A 1 42  ? 3.936   9.671   4.332   1.00 0.00 ? 42  VAL A HG22 5  
ATOM 9251  H HG23 . VAL A 1 42  ? 5.266   8.629   3.772   1.00 0.00 ? 42  VAL A HG23 5  
ATOM 9252  N N    . PHE A 1 43  ? 3.556   5.686   0.720   1.00 0.00 ? 43  PHE A N    5  
ATOM 9253  C CA   . PHE A 1 43  ? 2.830   4.604   0.079   1.00 0.00 ? 43  PHE A CA   5  
ATOM 9254  C C    . PHE A 1 43  ? 1.685   4.111   0.966   1.00 0.00 ? 43  PHE A C    5  
ATOM 9255  O O    . PHE A 1 43  ? 1.458   2.908   1.083   1.00 0.00 ? 43  PHE A O    5  
ATOM 9256  C CB   . PHE A 1 43  ? 3.824   3.460   -0.131  1.00 0.00 ? 43  PHE A CB   5  
ATOM 9257  C CG   . PHE A 1 43  ? 4.769   3.667   -1.316  1.00 0.00 ? 43  PHE A CG   5  
ATOM 9258  C CD1  . PHE A 1 43  ? 5.495   4.812   -1.416  1.00 0.00 ? 43  PHE A CD1  5  
ATOM 9259  C CD2  . PHE A 1 43  ? 4.883   2.704   -2.271  1.00 0.00 ? 43  PHE A CD2  5  
ATOM 9260  C CE1  . PHE A 1 43  ? 6.372   5.004   -2.516  1.00 0.00 ? 43  PHE A CE1  5  
ATOM 9261  C CE2  . PHE A 1 43  ? 5.760   2.896   -3.371  1.00 0.00 ? 43  PHE A CE2  5  
ATOM 9262  C CZ   . PHE A 1 43  ? 6.486   4.042   -3.471  1.00 0.00 ? 43  PHE A CZ   5  
ATOM 9263  H H    . PHE A 1 43  ? 4.355   5.403   1.251   1.00 0.00 ? 43  PHE A H    5  
ATOM 9264  H HA   . PHE A 1 43  ? 2.422   4.995   -0.853  1.00 0.00 ? 43  PHE A HA   5  
ATOM 9265  H HB2  . PHE A 1 43  ? 4.417   3.337   0.776   1.00 0.00 ? 43  PHE A HB2  5  
ATOM 9266  H HB3  . PHE A 1 43  ? 3.271   2.533   -0.278  1.00 0.00 ? 43  PHE A HB3  5  
ATOM 9267  H HD1  . PHE A 1 43  ? 5.404   5.583   -0.651  1.00 0.00 ? 43  PHE A HD1  5  
ATOM 9268  H HD2  . PHE A 1 43  ? 4.301   1.786   -2.191  1.00 0.00 ? 43  PHE A HD2  5  
ATOM 9269  H HE1  . PHE A 1 43  ? 6.954   5.922   -2.596  1.00 0.00 ? 43  PHE A HE1  5  
ATOM 9270  H HE2  . PHE A 1 43  ? 5.851   2.125   -4.136  1.00 0.00 ? 43  PHE A HE2  5  
ATOM 9271  H HZ   . PHE A 1 43  ? 7.159   4.189   -4.315  1.00 0.00 ? 43  PHE A HZ   5  
ATOM 9272  N N    . SER A 1 44  ? 0.993   5.067   1.569   1.00 0.00 ? 44  SER A N    5  
ATOM 9273  C CA   . SER A 1 44  ? -0.123  4.746   2.442   1.00 0.00 ? 44  SER A CA   5  
ATOM 9274  C C    . SER A 1 44  ? -1.408  5.380   1.904   1.00 0.00 ? 44  SER A C    5  
ATOM 9275  O O    . SER A 1 44  ? -1.664  6.561   2.131   1.00 0.00 ? 44  SER A O    5  
ATOM 9276  C CB   . SER A 1 44  ? 0.143   5.219   3.873   1.00 0.00 ? 44  SER A CB   5  
ATOM 9277  O OG   . SER A 1 44  ? -0.860  4.768   4.779   1.00 0.00 ? 44  SER A OG   5  
ATOM 9278  H H    . SER A 1 44  ? 1.184   6.044   1.469   1.00 0.00 ? 44  SER A H    5  
ATOM 9279  H HA   . SER A 1 44  ? -0.198  3.659   2.427   1.00 0.00 ? 44  SER A HA   5  
ATOM 9280  H HB2  . SER A 1 44  ? 1.117   4.854   4.200   1.00 0.00 ? 44  SER A HB2  5  
ATOM 9281  H HB3  . SER A 1 44  ? 0.187   6.307   3.893   1.00 0.00 ? 44  SER A HB3  5  
ATOM 9282  H HG   . SER A 1 44  ? -1.012  5.455   5.490   1.00 0.00 ? 44  SER A HG   5  
ATOM 9283  N N    . ALA A 1 45  ? -2.182  4.566   1.201   1.00 0.00 ? 45  ALA A N    5  
ATOM 9284  C CA   . ALA A 1 45  ? -3.434  5.032   0.629   1.00 0.00 ? 45  ALA A CA   5  
ATOM 9285  C C    . ALA A 1 45  ? -4.577  4.143   1.122   1.00 0.00 ? 45  ALA A C    5  
ATOM 9286  O O    . ALA A 1 45  ? -4.484  2.918   1.066   1.00 0.00 ? 45  ALA A O    5  
ATOM 9287  C CB   . ALA A 1 45  ? -3.323  5.048   -0.897  1.00 0.00 ? 45  ALA A CB   5  
ATOM 9288  H H    . ALA A 1 45  ? -1.967  3.606   1.021   1.00 0.00 ? 45  ALA A H    5  
ATOM 9289  H HA   . ALA A 1 45  ? -3.600  6.051   0.980   1.00 0.00 ? 45  ALA A HA   5  
ATOM 9290  H HB1  . ALA A 1 45  ? -2.499  5.697   -1.195  1.00 0.00 ? 45  ALA A HB1  5  
ATOM 9291  H HB2  . ALA A 1 45  ? -3.138  4.037   -1.258  1.00 0.00 ? 45  ALA A HB2  5  
ATOM 9292  H HB3  . ALA A 1 45  ? -4.253  5.422   -1.324  1.00 0.00 ? 45  ALA A HB3  5  
ATOM 9293  N N    . THR A 1 46  ? -5.630  4.795   1.593   1.00 0.00 ? 46  THR A N    5  
ATOM 9294  C CA   . THR A 1 46  ? -6.790  4.078   2.095   1.00 0.00 ? 46  THR A CA   5  
ATOM 9295  C C    . THR A 1 46  ? -7.950  4.179   1.102   1.00 0.00 ? 46  THR A C    5  
ATOM 9296  O O    . THR A 1 46  ? -8.632  5.200   1.041   1.00 0.00 ? 46  THR A O    5  
ATOM 9297  C CB   . THR A 1 46  ? -7.126  4.634   3.480   1.00 0.00 ? 46  THR A CB   5  
ATOM 9298  O OG1  . THR A 1 46  ? -6.016  4.251   4.287   1.00 0.00 ? 46  THR A OG1  5  
ATOM 9299  C CG2  . THR A 1 46  ? -8.318  3.922   4.124   1.00 0.00 ? 46  THR A CG2  5  
ATOM 9300  H H    . THR A 1 46  ? -5.698  5.791   1.635   1.00 0.00 ? 46  THR A H    5  
ATOM 9301  H HA   . THR A 1 46  ? -6.532  3.023   2.179   1.00 0.00 ? 46  THR A HA   5  
ATOM 9302  H HB   . THR A 1 46  ? -7.292  5.711   3.438   1.00 0.00 ? 46  THR A HB   5  
ATOM 9303  H HG1  . THR A 1 46  ? -5.282  4.925   4.202   1.00 0.00 ? 46  THR A HG1  5  
ATOM 9304  H HG21 . THR A 1 46  ? -9.208  4.082   3.516   1.00 0.00 ? 46  THR A HG21 5  
ATOM 9305  H HG22 . THR A 1 46  ? -8.110  2.854   4.191   1.00 0.00 ? 46  THR A HG22 5  
ATOM 9306  H HG23 . THR A 1 46  ? -8.484  4.323   5.124   1.00 0.00 ? 46  THR A HG23 5  
ATOM 9307  N N    . LEU A 1 47  ? -8.137  3.105   0.349   1.00 0.00 ? 47  LEU A N    5  
ATOM 9308  C CA   . LEU A 1 47  ? -9.202  3.060   -0.638  1.00 0.00 ? 47  LEU A CA   5  
ATOM 9309  C C    . LEU A 1 47  ? -10.486 2.559   0.026   1.00 0.00 ? 47  LEU A C    5  
ATOM 9310  O O    . LEU A 1 47  ? -10.435 1.875   1.048   1.00 0.00 ? 47  LEU A O    5  
ATOM 9311  C CB   . LEU A 1 47  ? -8.774  2.232   -1.851  1.00 0.00 ? 47  LEU A CB   5  
ATOM 9312  C CG   . LEU A 1 47  ? -7.545  2.739   -2.609  1.00 0.00 ? 47  LEU A CG   5  
ATOM 9313  C CD1  . LEU A 1 47  ? -7.257  1.865   -3.832  1.00 0.00 ? 47  LEU A CD1  5  
ATOM 9314  C CD2  . LEU A 1 47  ? -7.701  4.214   -2.982  1.00 0.00 ? 47  LEU A CD2  5  
ATOM 9315  H H    . LEU A 1 47  ? -7.577  2.279   0.405   1.00 0.00 ? 47  LEU A H    5  
ATOM 9316  H HA   . LEU A 1 47  ? -9.369  4.079   -0.986  1.00 0.00 ? 47  LEU A HA   5  
ATOM 9317  H HB2  . LEU A 1 47  ? -8.576  1.213   -1.519  1.00 0.00 ? 47  LEU A HB2  5  
ATOM 9318  H HB3  . LEU A 1 47  ? -9.611  2.184   -2.547  1.00 0.00 ? 47  LEU A HB3  5  
ATOM 9319  H HG   . LEU A 1 47  ? -6.681  2.663   -1.949  1.00 0.00 ? 47  LEU A HG   5  
ATOM 9320  H HD11 . LEU A 1 47  ? -8.196  1.590   -4.311  1.00 0.00 ? 47  LEU A HD11 5  
ATOM 9321  H HD12 . LEU A 1 47  ? -6.638  2.421   -4.537  1.00 0.00 ? 47  LEU A HD12 5  
ATOM 9322  H HD13 . LEU A 1 47  ? -6.730  0.964   -3.518  1.00 0.00 ? 47  LEU A HD13 5  
ATOM 9323  H HD21 . LEU A 1 47  ? -7.742  4.816   -2.075  1.00 0.00 ? 47  LEU A HD21 5  
ATOM 9324  H HD22 . LEU A 1 47  ? -6.851  4.527   -3.588  1.00 0.00 ? 47  LEU A HD22 5  
ATOM 9325  H HD23 . LEU A 1 47  ? -8.622  4.350   -3.550  1.00 0.00 ? 47  LEU A HD23 5  
ATOM 9326  N N    . GLY A 1 48  ? -11.608 2.918   -0.581  1.00 0.00 ? 48  GLY A N    5  
ATOM 9327  C CA   . GLY A 1 48  ? -12.903 2.513   -0.061  1.00 0.00 ? 48  GLY A CA   5  
ATOM 9328  C C    . GLY A 1 48  ? -13.909 2.306   -1.195  1.00 0.00 ? 48  GLY A C    5  
ATOM 9329  O O    . GLY A 1 48  ? -14.151 3.215   -1.988  1.00 0.00 ? 48  GLY A O    5  
ATOM 9330  H H    . GLY A 1 48  ? -11.641 3.474   -1.411  1.00 0.00 ? 48  GLY A H    5  
ATOM 9331  H HA2  . GLY A 1 48  ? -12.797 1.590   0.509   1.00 0.00 ? 48  GLY A HA2  5  
ATOM 9332  H HA3  . GLY A 1 48  ? -13.276 3.272   0.627   1.00 0.00 ? 48  GLY A HA3  5  
ATOM 9333  N N    . LEU A 1 49  ? -14.467 1.106   -1.236  1.00 0.00 ? 49  LEU A N    5  
ATOM 9334  C CA   . LEU A 1 49  ? -15.441 0.768   -2.260  1.00 0.00 ? 49  LEU A CA   5  
ATOM 9335  C C    . LEU A 1 49  ? -16.717 0.250   -1.593  1.00 0.00 ? 49  LEU A C    5  
ATOM 9336  O O    . LEU A 1 49  ? -16.653 -0.481  -0.606  1.00 0.00 ? 49  LEU A O    5  
ATOM 9337  C CB   . LEU A 1 49  ? -14.837 -0.207  -3.274  1.00 0.00 ? 49  LEU A CB   5  
ATOM 9338  C CG   . LEU A 1 49  ? -15.540 -0.284  -4.631  1.00 0.00 ? 49  LEU A CG   5  
ATOM 9339  C CD1  . LEU A 1 49  ? -16.686 -1.296  -4.598  1.00 0.00 ? 49  LEU A CD1  5  
ATOM 9340  C CD2  . LEU A 1 49  ? -16.009 1.100   -5.084  1.00 0.00 ? 49  LEU A CD2  5  
ATOM 9341  H H    . LEU A 1 49  ? -14.264 0.372   -0.588  1.00 0.00 ? 49  LEU A H    5  
ATOM 9342  H HA   . LEU A 1 49  ? -15.681 1.685   -2.799  1.00 0.00 ? 49  LEU A HA   5  
ATOM 9343  H HB2  . LEU A 1 49  ? -13.797 0.072   -3.440  1.00 0.00 ? 49  LEU A HB2  5  
ATOM 9344  H HB3  . LEU A 1 49  ? -14.834 -1.203  -2.832  1.00 0.00 ? 49  LEU A HB3  5  
ATOM 9345  H HG   . LEU A 1 49  ? -14.819 -0.637  -5.369  1.00 0.00 ? 49  LEU A HG   5  
ATOM 9346  H HD11 . LEU A 1 49  ? -16.301 -2.271  -4.301  1.00 0.00 ? 49  LEU A HD11 5  
ATOM 9347  H HD12 . LEU A 1 49  ? -17.440 -0.969  -3.882  1.00 0.00 ? 49  LEU A HD12 5  
ATOM 9348  H HD13 . LEU A 1 49  ? -17.135 -1.369  -5.589  1.00 0.00 ? 49  LEU A HD13 5  
ATOM 9349  H HD21 . LEU A 1 49  ? -16.999 1.300   -4.675  1.00 0.00 ? 49  LEU A HD21 5  
ATOM 9350  H HD22 . LEU A 1 49  ? -15.309 1.856   -4.728  1.00 0.00 ? 49  LEU A HD22 5  
ATOM 9351  H HD23 . LEU A 1 49  ? -16.054 1.130   -6.173  1.00 0.00 ? 49  LEU A HD23 5  
ATOM 9352  N N    . VAL A 1 50  ? -17.846 0.648   -2.160  1.00 0.00 ? 50  VAL A N    5  
ATOM 9353  C CA   . VAL A 1 50  ? -19.135 0.233   -1.632  1.00 0.00 ? 50  VAL A CA   5  
ATOM 9354  C C    . VAL A 1 50  ? -20.035 -0.209  -2.788  1.00 0.00 ? 50  VAL A C    5  
ATOM 9355  O O    . VAL A 1 50  ? -20.024 0.399   -3.857  1.00 0.00 ? 50  VAL A O    5  
ATOM 9356  C CB   . VAL A 1 50  ? -19.746 1.360   -0.796  1.00 0.00 ? 50  VAL A CB   5  
ATOM 9357  C CG1  . VAL A 1 50  ? -21.084 0.930   -0.192  1.00 0.00 ? 50  VAL A CG1  5  
ATOM 9358  C CG2  . VAL A 1 50  ? -18.775 1.822   0.292   1.00 0.00 ? 50  VAL A CG2  5  
ATOM 9359  H H    . VAL A 1 50  ? -17.890 1.243   -2.963  1.00 0.00 ? 50  VAL A H    5  
ATOM 9360  H HA   . VAL A 1 50  ? -18.962 -0.619  -0.975  1.00 0.00 ? 50  VAL A HA   5  
ATOM 9361  H HB   . VAL A 1 50  ? -19.933 2.205   -1.459  1.00 0.00 ? 50  VAL A HB   5  
ATOM 9362  H HG11 . VAL A 1 50  ? -21.571 0.217   -0.857  1.00 0.00 ? 50  VAL A HG11 5  
ATOM 9363  H HG12 . VAL A 1 50  ? -20.911 0.463   0.778   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 9364  H HG13 . VAL A 1 50  ? -21.723 1.804   -0.066  1.00 0.00 ? 50  VAL A HG13 5  
ATOM 9365  H HG21 . VAL A 1 50  ? -19.338 2.240   1.127   1.00 0.00 ? 50  VAL A HG21 5  
ATOM 9366  H HG22 . VAL A 1 50  ? -18.187 0.973   0.640   1.00 0.00 ? 50  VAL A HG22 5  
ATOM 9367  H HG23 . VAL A 1 50  ? -18.109 2.583   -0.114  1.00 0.00 ? 50  VAL A HG23 5  
ATOM 9368  N N    . ASP A 1 51  ? -20.794 -1.265  -2.533  1.00 0.00 ? 51  ASP A N    5  
ATOM 9369  C CA   . ASP A 1 51  ? -21.699 -1.796  -3.539  1.00 0.00 ? 51  ASP A CA   5  
ATOM 9370  C C    . ASP A 1 51  ? -23.031 -1.047  -3.467  1.00 0.00 ? 51  ASP A C    5  
ATOM 9371  O O    . ASP A 1 51  ? -23.528 -0.761  -2.379  1.00 0.00 ? 51  ASP A O    5  
ATOM 9372  C CB   . ASP A 1 51  ? -21.978 -3.281  -3.299  1.00 0.00 ? 51  ASP A CB   5  
ATOM 9373  C CG   . ASP A 1 51  ? -21.920 -4.160  -4.550  1.00 0.00 ? 51  ASP A CG   5  
ATOM 9374  O OD1  . ASP A 1 51  ? -22.592 -3.789  -5.536  1.00 0.00 ? 51  ASP A OD1  5  
ATOM 9375  O OD2  . ASP A 1 51  ? -21.205 -5.184  -4.491  1.00 0.00 ? 51  ASP A OD2  5  
ATOM 9376  H H    . ASP A 1 51  ? -20.798 -1.754  -1.661  1.00 0.00 ? 51  ASP A H    5  
ATOM 9377  H HA   . ASP A 1 51  ? -21.188 -1.649  -4.490  1.00 0.00 ? 51  ASP A HA   5  
ATOM 9378  H HB2  . ASP A 1 51  ? -21.258 -3.659  -2.574  1.00 0.00 ? 51  ASP A HB2  5  
ATOM 9379  H HB3  . ASP A 1 51  ? -22.966 -3.382  -2.848  1.00 0.00 ? 51  ASP A HB3  5  
ATOM 9380  N N    . ILE A 1 52  ? -23.571 -0.751  -4.640  1.00 0.00 ? 52  ILE A N    5  
ATOM 9381  C CA   . ILE A 1 52  ? -24.836 -0.040  -4.723  1.00 0.00 ? 52  ILE A CA   5  
ATOM 9382  C C    . ILE A 1 52  ? -25.984 -1.051  -4.724  1.00 0.00 ? 52  ILE A C    5  
ATOM 9383  O O    . ILE A 1 52  ? -27.049 -0.787  -4.166  1.00 0.00 ? 52  ILE A O    5  
ATOM 9384  C CB   . ILE A 1 52  ? -24.843 0.900   -5.931  1.00 0.00 ? 52  ILE A CB   5  
ATOM 9385  C CG1  . ILE A 1 52  ? -26.176 1.643   -6.038  1.00 0.00 ? 52  ILE A CG1  5  
ATOM 9386  C CG2  . ILE A 1 52  ? -24.503 0.143   -7.216  1.00 0.00 ? 52  ILE A CG2  5  
ATOM 9387  C CD1  . ILE A 1 52  ? -25.952 3.144   -6.239  1.00 0.00 ? 52  ILE A CD1  5  
ATOM 9388  H H    . ILE A 1 52  ? -23.160 -0.987  -5.520  1.00 0.00 ? 52  ILE A H    5  
ATOM 9389  H HA   . ILE A 1 52  ? -24.922 0.580   -3.831  1.00 0.00 ? 52  ILE A HA   5  
ATOM 9390  H HB   . ILE A 1 52  ? -24.067 1.650   -5.784  1.00 0.00 ? 52  ILE A HB   5  
ATOM 9391  H HG12 . ILE A 1 52  ? -26.753 1.243   -6.872  1.00 0.00 ? 52  ILE A HG12 5  
ATOM 9392  H HG13 . ILE A 1 52  ? -26.763 1.477   -5.135  1.00 0.00 ? 52  ILE A HG13 5  
ATOM 9393  H HG21 . ILE A 1 52  ? -23.535 0.477   -7.589  1.00 0.00 ? 52  ILE A HG21 5  
ATOM 9394  H HG22 . ILE A 1 52  ? -24.464 -0.926  -7.010  1.00 0.00 ? 52  ILE A HG22 5  
ATOM 9395  H HG23 . ILE A 1 52  ? -25.269 0.341   -7.967  1.00 0.00 ? 52  ILE A HG23 5  
ATOM 9396  H HD11 . ILE A 1 52  ? -26.894 3.618   -6.514  1.00 0.00 ? 52  ILE A HD11 5  
ATOM 9397  H HD12 . ILE A 1 52  ? -25.582 3.583   -5.312  1.00 0.00 ? 52  ILE A HD12 5  
ATOM 9398  H HD13 . ILE A 1 52  ? -25.222 3.299   -7.032  1.00 0.00 ? 52  ILE A HD13 5  
ATOM 9399  N N    . VAL A 1 53  ? -25.730 -2.188  -5.355  1.00 0.00 ? 53  VAL A N    5  
ATOM 9400  C CA   . VAL A 1 53  ? -26.730 -3.239  -5.436  1.00 0.00 ? 53  VAL A CA   5  
ATOM 9401  C C    . VAL A 1 53  ? -26.679 -4.083  -4.160  1.00 0.00 ? 53  VAL A C    5  
ATOM 9402  O O    . VAL A 1 53  ? -27.671 -4.184  -3.439  1.00 0.00 ? 53  VAL A O    5  
ATOM 9403  C CB   . VAL A 1 53  ? -26.521 -4.064  -6.707  1.00 0.00 ? 53  VAL A CB   5  
ATOM 9404  C CG1  . VAL A 1 53  ? -27.199 -5.430  -6.592  1.00 0.00 ? 53  VAL A CG1  5  
ATOM 9405  C CG2  . VAL A 1 53  ? -27.018 -3.307  -7.940  1.00 0.00 ? 53  VAL A CG2  5  
ATOM 9406  H H    . VAL A 1 53  ? -24.862 -2.395  -5.806  1.00 0.00 ? 53  VAL A H    5  
ATOM 9407  H HA   . VAL A 1 53  ? -27.707 -2.760  -5.501  1.00 0.00 ? 53  VAL A HA   5  
ATOM 9408  H HB   . VAL A 1 53  ? -25.450 -4.231  -6.826  1.00 0.00 ? 53  VAL A HB   5  
ATOM 9409  H HG11 . VAL A 1 53  ? -28.132 -5.327  -6.037  1.00 0.00 ? 53  VAL A HG11 5  
ATOM 9410  H HG12 . VAL A 1 53  ? -27.411 -5.816  -7.589  1.00 0.00 ? 53  VAL A HG12 5  
ATOM 9411  H HG13 . VAL A 1 53  ? -26.539 -6.121  -6.067  1.00 0.00 ? 53  VAL A HG13 5  
ATOM 9412  H HG21 . VAL A 1 53  ? -28.040 -3.612  -8.166  1.00 0.00 ? 53  VAL A HG21 5  
ATOM 9413  H HG22 . VAL A 1 53  ? -26.994 -2.235  -7.742  1.00 0.00 ? 53  VAL A HG22 5  
ATOM 9414  H HG23 . VAL A 1 53  ? -26.375 -3.534  -8.790  1.00 0.00 ? 53  VAL A HG23 5  
ATOM 9415  N N    . LYS A 1 54  ? -25.514 -4.667  -3.921  1.00 0.00 ? 54  LYS A N    5  
ATOM 9416  C CA   . LYS A 1 54  ? -25.322 -5.499  -2.745  1.00 0.00 ? 54  LYS A CA   5  
ATOM 9417  C C    . LYS A 1 54  ? -25.433 -4.633  -1.489  1.00 0.00 ? 54  LYS A C    5  
ATOM 9418  O O    . LYS A 1 54  ? -25.616 -5.150  -0.388  1.00 0.00 ? 54  LYS A O    5  
ATOM 9419  C CB   . LYS A 1 54  ? -24.004 -6.271  -2.845  1.00 0.00 ? 54  LYS A CB   5  
ATOM 9420  C CG   . LYS A 1 54  ? -24.044 -7.277  -3.997  1.00 0.00 ? 54  LYS A CG   5  
ATOM 9421  C CD   . LYS A 1 54  ? -24.087 -8.713  -3.469  1.00 0.00 ? 54  LYS A CD   5  
ATOM 9422  C CE   . LYS A 1 54  ? -23.327 -9.661  -4.398  1.00 0.00 ? 54  LYS A CE   5  
ATOM 9423  N NZ   . LYS A 1 54  ? -24.154 -10.847 -4.718  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 9424  H H    . LYS A 1 54  ? -24.713 -4.579  -4.513  1.00 0.00 ? 54  LYS A H    5  
ATOM 9425  H HA   . LYS A 1 54  ? -26.126 -6.235  -2.731  1.00 0.00 ? 54  LYS A HA   5  
ATOM 9426  H HB2  . LYS A 1 54  ? -23.180 -5.573  -2.995  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 9427  H HB3  . LYS A 1 54  ? -23.813 -6.793  -1.908  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 9428  H HG2  . LYS A 1 54  ? -24.919 -7.089  -4.619  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 9429  H HG3  . LYS A 1 54  ? -23.168 -7.145  -4.631  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 9430  H HD2  . LYS A 1 54  ? -23.652 -8.750  -2.470  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 9431  H HD3  . LYS A 1 54  ? -25.123 -9.040  -3.378  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 9432  H HE2  . LYS A 1 54  ? -23.057 -9.141  -5.317  1.00 0.00 ? 54  LYS A HE2  5  
ATOM 9433  H HE3  . LYS A 1 54  ? -22.397 -9.976  -3.925  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 9434  H HZ1  . LYS A 1 54  ? -24.203 -10.961 -5.710  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 9435  H HZ2  . LYS A 1 54  ? -23.741 -11.660 -4.308  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 9436  H HZ3  . LYS A 1 54  ? -25.075 -10.719 -4.351  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 9437  N N    . GLY A 1 55  ? -25.319 -3.329  -1.696  1.00 0.00 ? 55  GLY A N    5  
ATOM 9438  C CA   . GLY A 1 55  ? -25.404 -2.386  -0.594  1.00 0.00 ? 55  GLY A CA   5  
ATOM 9439  C C    . GLY A 1 55  ? -24.401 -2.737  0.507   1.00 0.00 ? 55  GLY A C    5  
ATOM 9440  O O    . GLY A 1 55  ? -24.653 -2.486  1.685   1.00 0.00 ? 55  GLY A O    5  
ATOM 9441  H H    . GLY A 1 55  ? -25.170 -2.916  -2.595  1.00 0.00 ? 55  GLY A H    5  
ATOM 9442  H HA2  . GLY A 1 55  ? -25.212 -1.377  -0.958  1.00 0.00 ? 55  GLY A HA2  5  
ATOM 9443  H HA3  . GLY A 1 55  ? -26.415 -2.390  -0.185  1.00 0.00 ? 55  GLY A HA3  5  
ATOM 9444  N N    . THR A 1 56  ? -23.285 -3.312  0.085   1.00 0.00 ? 56  THR A N    5  
ATOM 9445  C CA   . THR A 1 56  ? -22.243 -3.700  1.020   1.00 0.00 ? 56  THR A CA   5  
ATOM 9446  C C    . THR A 1 56  ? -21.121 -2.659  1.030   1.00 0.00 ? 56  THR A C    5  
ATOM 9447  O O    . THR A 1 56  ? -21.033 -1.828  0.128   1.00 0.00 ? 56  THR A O    5  
ATOM 9448  C CB   . THR A 1 56  ? -21.766 -5.104  0.642   1.00 0.00 ? 56  THR A CB   5  
ATOM 9449  O OG1  . THR A 1 56  ? -21.651 -5.060  -0.778  1.00 0.00 ? 56  THR A OG1  5  
ATOM 9450  C CG2  . THR A 1 56  ? -22.832 -6.172  0.896   1.00 0.00 ? 56  THR A CG2  5  
ATOM 9451  H H    . THR A 1 56  ? -23.088 -3.513  -0.875  1.00 0.00 ? 56  THR A H    5  
ATOM 9452  H HA   . THR A 1 56  ? -22.670 -3.719  2.023   1.00 0.00 ? 56  THR A HA   5  
ATOM 9453  H HB   . THR A 1 56  ? -20.837 -5.350  1.155   1.00 0.00 ? 56  THR A HB   5  
ATOM 9454  H HG1  . THR A 1 56  ? -20.934 -5.687  -1.082  1.00 0.00 ? 56  THR A HG1  5  
ATOM 9455  H HG21 . THR A 1 56  ? -23.810 -5.698  0.975   1.00 0.00 ? 56  THR A HG21 5  
ATOM 9456  H HG22 . THR A 1 56  ? -22.837 -6.883  0.071   1.00 0.00 ? 56  THR A HG22 5  
ATOM 9457  H HG23 . THR A 1 56  ? -22.606 -6.696  1.826   1.00 0.00 ? 56  THR A HG23 5  
ATOM 9458  N N    . ASN A 1 57  ? -20.292 -2.740  2.060   1.00 0.00 ? 57  ASN A N    5  
ATOM 9459  C CA   . ASN A 1 57  ? -19.179 -1.816  2.200   1.00 0.00 ? 57  ASN A CA   5  
ATOM 9460  C C    . ASN A 1 57  ? -17.863 -2.583  2.058   1.00 0.00 ? 57  ASN A C    5  
ATOM 9461  O O    . ASN A 1 57  ? -17.740 -3.707  2.543   1.00 0.00 ? 57  ASN A O    5  
ATOM 9462  C CB   . ASN A 1 57  ? -19.189 -1.145  3.575   1.00 0.00 ? 57  ASN A CB   5  
ATOM 9463  C CG   . ASN A 1 57  ? -20.277 -0.072  3.653   1.00 0.00 ? 57  ASN A CG   5  
ATOM 9464  O OD1  . ASN A 1 57  ? -21.236 -0.067  2.900   1.00 0.00 ? 57  ASN A OD1  5  
ATOM 9465  N ND2  . ASN A 1 57  ? -20.074 0.835   4.605   1.00 0.00 ? 57  ASN A ND2  5  
ATOM 9466  H H    . ASN A 1 57  ? -20.370 -3.420  2.790   1.00 0.00 ? 57  ASN A H    5  
ATOM 9467  H HA   . ASN A 1 57  ? -19.319 -1.078  1.409   1.00 0.00 ? 57  ASN A HA   5  
ATOM 9468  H HB2  . ASN A 1 57  ? -19.357 -1.895  4.348   1.00 0.00 ? 57  ASN A HB2  5  
ATOM 9469  H HB3  . ASN A 1 57  ? -18.215 -0.696  3.771   1.00 0.00 ? 57  ASN A HB3  5  
ATOM 9470  H HD21 . ASN A 1 57  ? -19.265 0.773   5.190   1.00 0.00 ? 57  ASN A HD21 5  
ATOM 9471  H HD22 . ASN A 1 57  ? -20.731 1.578   4.736   1.00 0.00 ? 57  ASN A HD22 5  
ATOM 9472  N N    . SER A 1 58  ? -16.913 -1.946  1.390   1.00 0.00 ? 58  SER A N    5  
ATOM 9473  C CA   . SER A 1 58  ? -15.611 -2.555  1.178   1.00 0.00 ? 58  SER A CA   5  
ATOM 9474  C C    . SER A 1 58  ? -14.513 -1.494  1.283   1.00 0.00 ? 58  SER A C    5  
ATOM 9475  O O    . SER A 1 58  ? -14.703 -0.356  0.857   1.00 0.00 ? 58  SER A O    5  
ATOM 9476  C CB   . SER A 1 58  ? -15.544 -3.254  -0.182  1.00 0.00 ? 58  SER A CB   5  
ATOM 9477  O OG   . SER A 1 58  ? -16.653 -4.125  -0.389  1.00 0.00 ? 58  SER A OG   5  
ATOM 9478  H H    . SER A 1 58  ? -17.021 -1.033  0.998   1.00 0.00 ? 58  SER A H    5  
ATOM 9479  H HA   . SER A 1 58  ? -15.505 -3.295  1.971   1.00 0.00 ? 58  SER A HA   5  
ATOM 9480  H HB2  . SER A 1 58  ? -15.518 -2.505  -0.974  1.00 0.00 ? 58  SER A HB2  5  
ATOM 9481  H HB3  . SER A 1 58  ? -14.618 -3.823  -0.252  1.00 0.00 ? 58  SER A HB3  5  
ATOM 9482  H HG   . SER A 1 58  ? -17.122 -3.885  -1.240  1.00 0.00 ? 58  SER A HG   5  
ATOM 9483  N N    . TYR A 1 59  ? -13.390 -1.905  1.853   1.00 0.00 ? 59  TYR A N    5  
ATOM 9484  C CA   . TYR A 1 59  ? -12.263 -1.004  2.020   1.00 0.00 ? 59  TYR A CA   5  
ATOM 9485  C C    . TYR A 1 59  ? -10.944 -1.712  1.704   1.00 0.00 ? 59  TYR A C    5  
ATOM 9486  O O    . TYR A 1 59  ? -10.616 -2.725  2.319   1.00 0.00 ? 59  TYR A O    5  
ATOM 9487  C CB   . TYR A 1 59  ? -12.266 -0.592  3.494   1.00 0.00 ? 59  TYR A CB   5  
ATOM 9488  C CG   . TYR A 1 59  ? -11.656 -1.635  4.432   1.00 0.00 ? 59  TYR A CG   5  
ATOM 9489  C CD1  . TYR A 1 59  ? -12.444 -2.643  4.951   1.00 0.00 ? 59  TYR A CD1  5  
ATOM 9490  C CD2  . TYR A 1 59  ? -10.317 -1.568  4.761   1.00 0.00 ? 59  TYR A CD2  5  
ATOM 9491  C CE1  . TYR A 1 59  ? -11.869 -3.624  5.834   1.00 0.00 ? 59  TYR A CE1  5  
ATOM 9492  C CE2  . TYR A 1 59  ? -9.742  -2.550  5.644   1.00 0.00 ? 59  TYR A CE2  5  
ATOM 9493  C CZ   . TYR A 1 59  ? -10.547 -3.529  6.137   1.00 0.00 ? 59  TYR A CZ   5  
ATOM 9494  O OH   . TYR A 1 59  ? -10.004 -4.456  6.972   1.00 0.00 ? 59  TYR A OH   5  
ATOM 9495  H H    . TYR A 1 59  ? -13.244 -2.833  2.197   1.00 0.00 ? 59  TYR A H    5  
ATOM 9496  H HA   . TYR A 1 59  ? -12.393 -0.170  1.331   1.00 0.00 ? 59  TYR A HA   5  
ATOM 9497  H HB2  . TYR A 1 59  ? -11.717 0.343   3.601   1.00 0.00 ? 59  TYR A HB2  5  
ATOM 9498  H HB3  . TYR A 1 59  ? -13.293 -0.397  3.803   1.00 0.00 ? 59  TYR A HB3  5  
ATOM 9499  H HD1  . TYR A 1 59  ? -13.501 -2.695  4.691   1.00 0.00 ? 59  TYR A HD1  5  
ATOM 9500  H HD2  . TYR A 1 59  ? -9.694  -0.772  4.351   1.00 0.00 ? 59  TYR A HD2  5  
ATOM 9501  H HE1  . TYR A 1 59  ? -12.480 -4.425  6.250   1.00 0.00 ? 59  TYR A HE1  5  
ATOM 9502  H HE2  . TYR A 1 59  ? -8.686  -2.508  5.912   1.00 0.00 ? 59  TYR A HE2  5  
ATOM 9503  H HH   . TYR A 1 59  ? -9.006  -4.422  6.918   1.00 0.00 ? 59  TYR A HH   5  
ATOM 9504  N N    . TYR A 1 60  ? -10.223 -1.150  0.745   1.00 0.00 ? 60  TYR A N    5  
ATOM 9505  C CA   . TYR A 1 60  ? -8.947  -1.714  0.339   1.00 0.00 ? 60  TYR A CA   5  
ATOM 9506  C C    . TYR A 1 60  ? -7.788  -0.803  0.750   1.00 0.00 ? 60  TYR A C    5  
ATOM 9507  O O    . TYR A 1 60  ? -7.619  0.281   0.194   1.00 0.00 ? 60  TYR A O    5  
ATOM 9508  C CB   . TYR A 1 60  ? -8.992  -1.805  -1.187  1.00 0.00 ? 60  TYR A CB   5  
ATOM 9509  C CG   . TYR A 1 60  ? -7.707  -2.348  -1.817  1.00 0.00 ? 60  TYR A CG   5  
ATOM 9510  C CD1  . TYR A 1 60  ? -6.696  -1.482  -2.179  1.00 0.00 ? 60  TYR A CD1  5  
ATOM 9511  C CD2  . TYR A 1 60  ? -7.561  -3.705  -2.022  1.00 0.00 ? 60  TYR A CD2  5  
ATOM 9512  C CE1  . TYR A 1 60  ? -5.487  -1.994  -2.771  1.00 0.00 ? 60  TYR A CE1  5  
ATOM 9513  C CE2  . TYR A 1 60  ? -6.352  -4.217  -2.614  1.00 0.00 ? 60  TYR A CE2  5  
ATOM 9514  C CZ   . TYR A 1 60  ? -5.375  -3.336  -2.960  1.00 0.00 ? 60  TYR A CZ   5  
ATOM 9515  O OH   . TYR A 1 60  ? -4.233  -3.820  -3.519  1.00 0.00 ? 60  TYR A OH   5  
ATOM 9516  H H    . TYR A 1 60  ? -10.496 -0.325  0.249   1.00 0.00 ? 60  TYR A H    5  
ATOM 9517  H HA   . TYR A 1 60  ? -8.833  -2.679  0.834   1.00 0.00 ? 60  TYR A HA   5  
ATOM 9518  H HB2  . TYR A 1 60  ? -9.825  -2.443  -1.479  1.00 0.00 ? 60  TYR A HB2  5  
ATOM 9519  H HB3  . TYR A 1 60  ? -9.192  -0.813  -1.594  1.00 0.00 ? 60  TYR A HB3  5  
ATOM 9520  H HD1  . TYR A 1 60  ? -6.812  -0.411  -2.016  1.00 0.00 ? 60  TYR A HD1  5  
ATOM 9521  H HD2  . TYR A 1 60  ? -8.360  -4.389  -1.736  1.00 0.00 ? 60  TYR A HD2  5  
ATOM 9522  H HE1  . TYR A 1 60  ? -4.681  -1.321  -3.062  1.00 0.00 ? 60  TYR A HE1  5  
ATOM 9523  H HE2  . TYR A 1 60  ? -6.223  -5.286  -2.782  1.00 0.00 ? 60  TYR A HE2  5  
ATOM 9524  H HH   . TYR A 1 60  ? -4.439  -4.627  -4.072  1.00 0.00 ? 60  TYR A HH   5  
ATOM 9525  N N    . LYS A 1 61  ? -7.021  -1.276  1.722   1.00 0.00 ? 61  LYS A N    5  
ATOM 9526  C CA   . LYS A 1 61  ? -5.884  -0.517  2.214   1.00 0.00 ? 61  LYS A CA   5  
ATOM 9527  C C    . LYS A 1 61  ? -4.612  -1.004  1.516   1.00 0.00 ? 61  LYS A C    5  
ATOM 9528  O O    . LYS A 1 61  ? -4.440  -2.201  1.296   1.00 0.00 ? 61  LYS A O    5  
ATOM 9529  C CB   . LYS A 1 61  ? -5.813  -0.588  3.740   1.00 0.00 ? 61  LYS A CB   5  
ATOM 9530  C CG   . LYS A 1 61  ? -6.071  0.785   4.365   1.00 0.00 ? 61  LYS A CG   5  
ATOM 9531  C CD   . LYS A 1 61  ? -4.757  1.518   4.641   1.00 0.00 ? 61  LYS A CD   5  
ATOM 9532  C CE   . LYS A 1 61  ? -4.566  1.756   6.140   1.00 0.00 ? 61  LYS A CE   5  
ATOM 9533  N NZ   . LYS A 1 61  ? -4.302  0.477   6.839   1.00 0.00 ? 61  LYS A NZ   5  
ATOM 9534  H H    . LYS A 1 61  ? -7.166  -2.158  2.169   1.00 0.00 ? 61  LYS A H    5  
ATOM 9535  H HA   . LYS A 1 61  ? -6.047  0.527   1.946   1.00 0.00 ? 61  LYS A HA   5  
ATOM 9536  H HB2  . LYS A 1 61  ? -6.548  -1.303  4.110   1.00 0.00 ? 61  LYS A HB2  5  
ATOM 9537  H HB3  . LYS A 1 61  ? -4.833  -0.952  4.046   1.00 0.00 ? 61  LYS A HB3  5  
ATOM 9538  H HG2  . LYS A 1 61  ? -6.691  1.382   3.696   1.00 0.00 ? 61  LYS A HG2  5  
ATOM 9539  H HG3  . LYS A 1 61  ? -6.628  0.667   5.294   1.00 0.00 ? 61  LYS A HG3  5  
ATOM 9540  H HD2  . LYS A 1 61  ? -3.922  0.934   4.253   1.00 0.00 ? 61  LYS A HD2  5  
ATOM 9541  H HD3  . LYS A 1 61  ? -4.750  2.472   4.114   1.00 0.00 ? 61  LYS A HD3  5  
ATOM 9542  H HE2  . LYS A 1 61  ? -3.736  2.444   6.303   1.00 0.00 ? 61  LYS A HE2  5  
ATOM 9543  H HE3  . LYS A 1 61  ? -5.457  2.227   6.556   1.00 0.00 ? 61  LYS A HE3  5  
ATOM 9544  H HZ1  . LYS A 1 61  ? -4.170  0.652   7.814   1.00 0.00 ? 61  LYS A HZ1  5  
ATOM 9545  H HZ2  . LYS A 1 61  ? -5.080  -0.138  6.712   1.00 0.00 ? 61  LYS A HZ2  5  
ATOM 9546  H HZ3  . LYS A 1 61  ? -3.478  0.055   6.461   1.00 0.00 ? 61  LYS A HZ3  5  
ATOM 9547  N N    . LEU A 1 62  ? -3.753  -0.049  1.189   1.00 0.00 ? 62  LEU A N    5  
ATOM 9548  C CA   . LEU A 1 62  ? -2.502  -0.365  0.521   1.00 0.00 ? 62  LEU A CA   5  
ATOM 9549  C C    . LEU A 1 62  ? -1.352  0.341   1.241   1.00 0.00 ? 62  LEU A C    5  
ATOM 9550  O O    . LEU A 1 62  ? -1.319  1.569   1.310   1.00 0.00 ? 62  LEU A O    5  
ATOM 9551  C CB   . LEU A 1 62  ? -2.591  -0.032  -0.970  1.00 0.00 ? 62  LEU A CB   5  
ATOM 9552  C CG   . LEU A 1 62  ? -1.608  -0.769  -1.882  1.00 0.00 ? 62  LEU A CG   5  
ATOM 9553  C CD1  . LEU A 1 62  ? -2.062  -2.208  -2.129  1.00 0.00 ? 62  LEU A CD1  5  
ATOM 9554  C CD2  . LEU A 1 62  ? -1.393  -0.003  -3.189  1.00 0.00 ? 62  LEU A CD2  5  
ATOM 9555  H H    . LEU A 1 62  ? -3.901  0.923   1.372   1.00 0.00 ? 62  LEU A H    5  
ATOM 9556  H HA   . LEU A 1 62  ? -2.351  -1.442  0.602   1.00 0.00 ? 62  LEU A HA   5  
ATOM 9557  H HB2  . LEU A 1 62  ? -3.604  -0.249  -1.310  1.00 0.00 ? 62  LEU A HB2  5  
ATOM 9558  H HB3  . LEU A 1 62  ? -2.437  1.040   -1.092  1.00 0.00 ? 62  LEU A HB3  5  
ATOM 9559  H HG   . LEU A 1 62  ? -0.644  -0.818  -1.375  1.00 0.00 ? 62  LEU A HG   5  
ATOM 9560  H HD11 . LEU A 1 62  ? -2.352  -2.665  -1.183  1.00 0.00 ? 62  LEU A HD11 5  
ATOM 9561  H HD12 . LEU A 1 62  ? -2.915  -2.209  -2.809  1.00 0.00 ? 62  LEU A HD12 5  
ATOM 9562  H HD13 . LEU A 1 62  ? -1.244  -2.777  -2.572  1.00 0.00 ? 62  LEU A HD13 5  
ATOM 9563  H HD21 . LEU A 1 62  ? -0.336  -0.026  -3.454  1.00 0.00 ? 62  LEU A HD21 5  
ATOM 9564  H HD22 . LEU A 1 62  ? -1.978  -0.468  -3.983  1.00 0.00 ? 62  LEU A HD22 5  
ATOM 9565  H HD23 . LEU A 1 62  ? -1.713  1.031   -3.061  1.00 0.00 ? 62  LEU A HD23 5  
ATOM 9566  N N    . GLN A 1 63  ? -0.437  -0.464  1.760   1.00 0.00 ? 63  GLN A N    5  
ATOM 9567  C CA   . GLN A 1 63  ? 0.712   0.069   2.472   1.00 0.00 ? 63  GLN A CA   5  
ATOM 9568  C C    . GLN A 1 63  ? 1.977   -0.704  2.093   1.00 0.00 ? 63  GLN A C    5  
ATOM 9569  O O    . GLN A 1 63  ? 2.070   -1.906  2.334   1.00 0.00 ? 63  GLN A O    5  
ATOM 9570  C CB   . GLN A 1 63  ? 0.483   0.036   3.985   1.00 0.00 ? 63  GLN A CB   5  
ATOM 9571  C CG   . GLN A 1 63  ? -0.404  1.201   4.431   1.00 0.00 ? 63  GLN A CG   5  
ATOM 9572  C CD   . GLN A 1 63  ? -0.392  1.347   5.954   1.00 0.00 ? 63  GLN A CD   5  
ATOM 9573  O OE1  . GLN A 1 63  ? -1.122  0.685   6.672   1.00 0.00 ? 63  GLN A OE1  5  
ATOM 9574  N NE2  . GLN A 1 63  ? 0.476   2.249   6.404   1.00 0.00 ? 63  GLN A NE2  5  
ATOM 9575  H H    . GLN A 1 63  ? -0.471  -1.462  1.700   1.00 0.00 ? 63  GLN A H    5  
ATOM 9576  H HA   . GLN A 1 63  ? 0.799   1.105   2.147   1.00 0.00 ? 63  GLN A HA   5  
ATOM 9577  H HB2  . GLN A 1 63  ? 0.016   -0.909  4.265   1.00 0.00 ? 63  GLN A HB2  5  
ATOM 9578  H HB3  . GLN A 1 63  ? 1.441   0.084   4.503   1.00 0.00 ? 63  GLN A HB3  5  
ATOM 9579  H HG2  . GLN A 1 63  ? -0.054  2.125   3.970   1.00 0.00 ? 63  GLN A HG2  5  
ATOM 9580  H HG3  . GLN A 1 63  ? -1.425  1.038   4.085   1.00 0.00 ? 63  GLN A HG3  5  
ATOM 9581  H HE21 . GLN A 1 63  ? 1.047   2.759   5.760   1.00 0.00 ? 63  GLN A HE21 5  
ATOM 9582  H HE22 . GLN A 1 63  ? 0.558   2.417   7.386   1.00 0.00 ? 63  GLN A HE22 5  
ATOM 9583  N N    . LEU A 1 64  ? 2.919   0.019   1.505   1.00 0.00 ? 64  LEU A N    5  
ATOM 9584  C CA   . LEU A 1 64  ? 4.174   -0.583  1.089   1.00 0.00 ? 64  LEU A CA   5  
ATOM 9585  C C    . LEU A 1 64  ? 5.252   -0.273  2.130   1.00 0.00 ? 64  LEU A C    5  
ATOM 9586  O O    . LEU A 1 64  ? 5.773   0.840   2.176   1.00 0.00 ? 64  LEU A O    5  
ATOM 9587  C CB   . LEU A 1 64  ? 4.540   -0.136  -0.328  1.00 0.00 ? 64  LEU A CB   5  
ATOM 9588  C CG   . LEU A 1 64  ? 5.960   -0.469  -0.790  1.00 0.00 ? 64  LEU A CG   5  
ATOM 9589  C CD1  . LEU A 1 64  ? 6.432   -1.798  -0.198  1.00 0.00 ? 64  LEU A CD1  5  
ATOM 9590  C CD2  . LEU A 1 64  ? 6.056   -0.456  -2.317  1.00 0.00 ? 64  LEU A CD2  5  
ATOM 9591  H H    . LEU A 1 64  ? 2.835   0.997   1.312   1.00 0.00 ? 64  LEU A H    5  
ATOM 9592  H HA   . LEU A 1 64  ? 4.024   -1.662  1.058   1.00 0.00 ? 64  LEU A HA   5  
ATOM 9593  H HB2  . LEU A 1 64  ? 3.836   -0.592  -1.024  1.00 0.00 ? 64  LEU A HB2  5  
ATOM 9594  H HB3  . LEU A 1 64  ? 4.401   0.943   -0.394  1.00 0.00 ? 64  LEU A HB3  5  
ATOM 9595  H HG   . LEU A 1 64  ? 6.631   0.306   -0.419  1.00 0.00 ? 64  LEU A HG   5  
ATOM 9596  H HD11 . LEU A 1 64  ? 5.749   -2.106  0.593   1.00 0.00 ? 64  LEU A HD11 5  
ATOM 9597  H HD12 . LEU A 1 64  ? 6.451   -2.558  -0.979  1.00 0.00 ? 64  LEU A HD12 5  
ATOM 9598  H HD13 . LEU A 1 64  ? 7.434   -1.676  0.215   1.00 0.00 ? 64  LEU A HD13 5  
ATOM 9599  H HD21 . LEU A 1 64  ? 6.909   0.151   -2.622  1.00 0.00 ? 64  LEU A HD21 5  
ATOM 9600  H HD22 . LEU A 1 64  ? 6.186   -1.475  -2.682  1.00 0.00 ? 64  LEU A HD22 5  
ATOM 9601  H HD23 . LEU A 1 64  ? 5.142   -0.034  -2.735  1.00 0.00 ? 64  LEU A HD23 5  
ATOM 9602  N N    . LEU A 1 65  ? 5.556   -1.278  2.938   1.00 0.00 ? 65  LEU A N    5  
ATOM 9603  C CA   . LEU A 1 65  ? 6.562   -1.126  3.975   1.00 0.00 ? 65  LEU A CA   5  
ATOM 9604  C C    . LEU A 1 65  ? 7.954   -1.220  3.346   1.00 0.00 ? 65  LEU A C    5  
ATOM 9605  O O    . LEU A 1 65  ? 8.109   -1.762  2.253   1.00 0.00 ? 65  LEU A O    5  
ATOM 9606  C CB   . LEU A 1 65  ? 6.327   -2.135  5.102   1.00 0.00 ? 65  LEU A CB   5  
ATOM 9607  C CG   . LEU A 1 65  ? 4.867   -2.383  5.486   1.00 0.00 ? 65  LEU A CG   5  
ATOM 9608  C CD1  . LEU A 1 65  ? 4.758   -3.481  6.546   1.00 0.00 ? 65  LEU A CD1  5  
ATOM 9609  C CD2  . LEU A 1 65  ? 4.191   -1.085  5.934   1.00 0.00 ? 65  LEU A CD2  5  
ATOM 9610  H H    . LEU A 1 65  ? 5.127   -2.180  2.894   1.00 0.00 ? 65  LEU A H    5  
ATOM 9611  H HA   . LEU A 1 65  ? 6.443   -0.131  4.404   1.00 0.00 ? 65  LEU A HA   5  
ATOM 9612  H HB2  . LEU A 1 65  ? 6.772   -3.086  4.809   1.00 0.00 ? 65  LEU A HB2  5  
ATOM 9613  H HB3  . LEU A 1 65  ? 6.863   -1.792  5.987   1.00 0.00 ? 65  LEU A HB3  5  
ATOM 9614  H HG   . LEU A 1 65  ? 4.336   -2.734  4.602   1.00 0.00 ? 65  LEU A HG   5  
ATOM 9615  H HD11 . LEU A 1 65  ? 4.295   -3.074  7.445   1.00 0.00 ? 65  LEU A HD11 5  
ATOM 9616  H HD12 . LEU A 1 65  ? 4.148   -4.298  6.161   1.00 0.00 ? 65  LEU A HD12 5  
ATOM 9617  H HD13 . LEU A 1 65  ? 5.754   -3.853  6.787   1.00 0.00 ? 65  LEU A HD13 5  
ATOM 9618  H HD21 . LEU A 1 65  ? 3.272   -0.940  5.366   1.00 0.00 ? 65  LEU A HD21 5  
ATOM 9619  H HD22 . LEU A 1 65  ? 3.956   -1.146  6.997   1.00 0.00 ? 65  LEU A HD22 5  
ATOM 9620  H HD23 . LEU A 1 65  ? 4.863   -0.245  5.758   1.00 0.00 ? 65  LEU A HD23 5  
ATOM 9621  N N    . GLU A 1 66  ? 8.930   -0.684  4.064   1.00 0.00 ? 66  GLU A N    5  
ATOM 9622  C CA   . GLU A 1 66  ? 10.303  -0.701  3.590   1.00 0.00 ? 66  GLU A CA   5  
ATOM 9623  C C    . GLU A 1 66  ? 11.274  -0.701  4.773   1.00 0.00 ? 66  GLU A C    5  
ATOM 9624  O O    . GLU A 1 66  ? 11.290  0.239   5.567   1.00 0.00 ? 66  GLU A O    5  
ATOM 9625  C CB   . GLU A 1 66  ? 10.576  0.481   2.657   1.00 0.00 ? 66  GLU A CB   5  
ATOM 9626  C CG   . GLU A 1 66  ? 12.061  0.847   2.655   1.00 0.00 ? 66  GLU A CG   5  
ATOM 9627  C CD   . GLU A 1 66  ? 12.336  2.030   3.586   1.00 0.00 ? 66  GLU A CD   5  
ATOM 9628  O OE1  . GLU A 1 66  ? 11.598  3.031   3.464   1.00 0.00 ? 66  GLU A OE1  5  
ATOM 9629  O OE2  . GLU A 1 66  ? 13.278  1.906   4.399   1.00 0.00 ? 66  GLU A OE2  5  
ATOM 9630  H H    . GLU A 1 66  ? 8.795   -0.246  4.952   1.00 0.00 ? 66  GLU A H    5  
ATOM 9631  H HA   . GLU A 1 66  ? 10.405  -1.629  3.028   1.00 0.00 ? 66  GLU A HA   5  
ATOM 9632  H HB2  . GLU A 1 66  ? 10.258  0.231   1.645   1.00 0.00 ? 66  GLU A HB2  5  
ATOM 9633  H HB3  . GLU A 1 66  ? 9.986   1.342   2.973   1.00 0.00 ? 66  GLU A HB3  5  
ATOM 9634  H HG2  . GLU A 1 66  ? 12.652  -0.013  2.971   1.00 0.00 ? 66  GLU A HG2  5  
ATOM 9635  H HG3  . GLU A 1 66  ? 12.377  1.096   1.642   1.00 0.00 ? 66  GLU A HG3  5  
ATOM 9636  N N    . ASP A 1 67  ? 12.059  -1.765  4.853   1.00 0.00 ? 67  ASP A N    5  
ATOM 9637  C CA   . ASP A 1 67  ? 13.029  -1.899  5.926   1.00 0.00 ? 67  ASP A CA   5  
ATOM 9638  C C    . ASP A 1 67  ? 14.067  -0.781  5.812   1.00 0.00 ? 67  ASP A C    5  
ATOM 9639  O O    . ASP A 1 67  ? 14.487  -0.429  4.711   1.00 0.00 ? 67  ASP A O    5  
ATOM 9640  C CB   . ASP A 1 67  ? 13.765  -3.238  5.839   1.00 0.00 ? 67  ASP A CB   5  
ATOM 9641  C CG   . ASP A 1 67  ? 13.961  -3.957  7.175   1.00 0.00 ? 67  ASP A CG   5  
ATOM 9642  O OD1  . ASP A 1 67  ? 14.789  -3.461  7.970   1.00 0.00 ? 67  ASP A OD1  5  
ATOM 9643  O OD2  . ASP A 1 67  ? 13.279  -4.985  7.371   1.00 0.00 ? 67  ASP A OD2  5  
ATOM 9644  H H    . ASP A 1 67  ? 12.039  -2.524  4.203   1.00 0.00 ? 67  ASP A H    5  
ATOM 9645  H HA   . ASP A 1 67  ? 12.449  -1.838  6.847   1.00 0.00 ? 67  ASP A HA   5  
ATOM 9646  H HB2  . ASP A 1 67  ? 13.214  -3.895  5.167   1.00 0.00 ? 67  ASP A HB2  5  
ATOM 9647  H HB3  . ASP A 1 67  ? 14.743  -3.069  5.387   1.00 0.00 ? 67  ASP A HB3  5  
ATOM 9648  N N    . ASP A 1 68  ? 14.451  -0.253  6.966   1.00 0.00 ? 68  ASP A N    5  
ATOM 9649  C CA   . ASP A 1 68  ? 15.431  0.818   7.009   1.00 0.00 ? 68  ASP A CA   5  
ATOM 9650  C C    . ASP A 1 68  ? 16.808  0.231   7.326   1.00 0.00 ? 68  ASP A C    5  
ATOM 9651  O O    . ASP A 1 68  ? 17.736  0.348   6.527   1.00 0.00 ? 68  ASP A O    5  
ATOM 9652  C CB   . ASP A 1 68  ? 15.088  1.834   8.100   1.00 0.00 ? 68  ASP A CB   5  
ATOM 9653  C CG   . ASP A 1 68  ? 15.737  3.210   7.929   1.00 0.00 ? 68  ASP A CG   5  
ATOM 9654  O OD1  . ASP A 1 68  ? 16.984  3.243   7.853   1.00 0.00 ? 68  ASP A OD1  5  
ATOM 9655  O OD2  . ASP A 1 68  ? 14.971  4.196   7.879   1.00 0.00 ? 68  ASP A OD2  5  
ATOM 9656  H H    . ASP A 1 68  ? 14.104  -0.546  7.857   1.00 0.00 ? 68  ASP A H    5  
ATOM 9657  H HA   . ASP A 1 68  ? 15.393  1.282   6.024   1.00 0.00 ? 68  ASP A HA   5  
ATOM 9658  H HB2  . ASP A 1 68  ? 14.006  1.961   8.131   1.00 0.00 ? 68  ASP A HB2  5  
ATOM 9659  H HB3  . ASP A 1 68  ? 15.389  1.425   9.065   1.00 0.00 ? 68  ASP A HB3  5  
ATOM 9660  N N    . LYS A 1 69  ? 16.897  -0.388  8.494   1.00 0.00 ? 69  LYS A N    5  
ATOM 9661  C CA   . LYS A 1 69  ? 18.145  -0.994  8.927   1.00 0.00 ? 69  LYS A CA   5  
ATOM 9662  C C    . LYS A 1 69  ? 18.740  -1.805  7.774   1.00 0.00 ? 69  LYS A C    5  
ATOM 9663  O O    . LYS A 1 69  ? 19.844  -1.518  7.314   1.00 0.00 ? 69  LYS A O    5  
ATOM 9664  C CB   . LYS A 1 69  ? 17.931  -1.808  10.205  1.00 0.00 ? 69  LYS A CB   5  
ATOM 9665  C CG   . LYS A 1 69  ? 18.170  -0.950  11.448  1.00 0.00 ? 69  LYS A CG   5  
ATOM 9666  C CD   . LYS A 1 69  ? 19.011  -1.703  12.481  1.00 0.00 ? 69  LYS A CD   5  
ATOM 9667  C CE   . LYS A 1 69  ? 19.515  -0.757  13.573  1.00 0.00 ? 69  LYS A CE   5  
ATOM 9668  N NZ   . LYS A 1 69  ? 20.962  -0.494  13.404  1.00 0.00 ? 69  LYS A NZ   5  
ATOM 9669  H H    . LYS A 1 69  ? 16.138  -0.479  9.139   1.00 0.00 ? 69  LYS A H    5  
ATOM 9670  H HA   . LYS A 1 69  ? 18.833  -0.185  9.172   1.00 0.00 ? 69  LYS A HA   5  
ATOM 9671  H HB2  . LYS A 1 69  ? 16.916  -2.205  10.222  1.00 0.00 ? 69  LYS A HB2  5  
ATOM 9672  H HB3  . LYS A 1 69  ? 18.607  -2.663  10.213  1.00 0.00 ? 69  LYS A HB3  5  
ATOM 9673  H HG2  . LYS A 1 69  ? 18.676  -0.027  11.166  1.00 0.00 ? 69  LYS A HG2  5  
ATOM 9674  H HG3  . LYS A 1 69  ? 17.214  -0.667  11.889  1.00 0.00 ? 69  LYS A HG3  5  
ATOM 9675  H HD2  . LYS A 1 69  ? 18.416  -2.498  12.930  1.00 0.00 ? 69  LYS A HD2  5  
ATOM 9676  H HD3  . LYS A 1 69  ? 19.859  -2.179  11.988  1.00 0.00 ? 69  LYS A HD3  5  
ATOM 9677  H HE2  . LYS A 1 69  ? 18.962  0.181   13.533  1.00 0.00 ? 69  LYS A HE2  5  
ATOM 9678  H HE3  . LYS A 1 69  ? 19.331  -1.194  14.554  1.00 0.00 ? 69  LYS A HE3  5  
ATOM 9679  H HZ1  . LYS A 1 69  ? 21.427  -1.342  13.151  1.00 0.00 ? 69  LYS A HZ1  5  
ATOM 9680  H HZ2  . LYS A 1 69  ? 21.095  0.187   12.684  1.00 0.00 ? 69  LYS A HZ2  5  
ATOM 9681  H HZ3  . LYS A 1 69  ? 21.340  -0.149  14.263  1.00 0.00 ? 69  LYS A HZ3  5  
ATOM 9682  N N    . GLU A 1 70  ? 17.982  -2.801  7.340   1.00 0.00 ? 70  GLU A N    5  
ATOM 9683  C CA   . GLU A 1 70  ? 18.421  -3.655  6.249   1.00 0.00 ? 70  GLU A CA   5  
ATOM 9684  C C    . GLU A 1 70  ? 17.688  -3.286  4.958   1.00 0.00 ? 70  GLU A C    5  
ATOM 9685  O O    . GLU A 1 70  ? 17.028  -2.249  4.889   1.00 0.00 ? 70  GLU A O    5  
ATOM 9686  C CB   . GLU A 1 70  ? 18.216  -5.132  6.593   1.00 0.00 ? 70  GLU A CB   5  
ATOM 9687  C CG   . GLU A 1 70  ? 18.622  -5.420  8.040   1.00 0.00 ? 70  GLU A CG   5  
ATOM 9688  C CD   . GLU A 1 70  ? 18.223  -6.839  8.449   1.00 0.00 ? 70  GLU A CD   5  
ATOM 9689  O OE1  . GLU A 1 70  ? 18.963  -7.770  8.061   1.00 0.00 ? 70  GLU A OE1  5  
ATOM 9690  O OE2  . GLU A 1 70  ? 17.189  -6.961  9.140   1.00 0.00 ? 70  GLU A OE2  5  
ATOM 9691  H H    . GLU A 1 70  ? 17.085  -3.027  7.720   1.00 0.00 ? 70  GLU A H    5  
ATOM 9692  H HA   . GLU A 1 70  ? 19.487  -3.459  6.138   1.00 0.00 ? 70  GLU A HA   5  
ATOM 9693  H HB2  . GLU A 1 70  ? 17.170  -5.402  6.444   1.00 0.00 ? 70  GLU A HB2  5  
ATOM 9694  H HB3  . GLU A 1 70  ? 18.804  -5.751  5.916   1.00 0.00 ? 70  GLU A HB3  5  
ATOM 9695  H HG2  . GLU A 1 70  ? 19.699  -5.294  8.151   1.00 0.00 ? 70  GLU A HG2  5  
ATOM 9696  H HG3  . GLU A 1 70  ? 18.146  -4.699  8.705   1.00 0.00 ? 70  GLU A HG3  5  
ATOM 9697  N N    . ASN A 1 71  ? 17.827  -4.154  3.967   1.00 0.00 ? 71  ASN A N    5  
ATOM 9698  C CA   . ASN A 1 71  ? 17.187  -3.932  2.682   1.00 0.00 ? 71  ASN A CA   5  
ATOM 9699  C C    . ASN A 1 71  ? 16.073  -4.963  2.487   1.00 0.00 ? 71  ASN A C    5  
ATOM 9700  O O    . ASN A 1 71  ? 16.274  -5.980  1.824   1.00 0.00 ? 71  ASN A O    5  
ATOM 9701  C CB   . ASN A 1 71  ? 18.185  -4.091  1.534   1.00 0.00 ? 71  ASN A CB   5  
ATOM 9702  C CG   . ASN A 1 71  ? 17.578  -3.621  0.210   1.00 0.00 ? 71  ASN A CG   5  
ATOM 9703  O OD1  . ASN A 1 71  ? 17.005  -4.388  -0.546  1.00 0.00 ? 71  ASN A OD1  5  
ATOM 9704  N ND2  . ASN A 1 71  ? 17.736  -2.322  -0.027  1.00 0.00 ? 71  ASN A ND2  5  
ATOM 9705  H H    . ASN A 1 71  ? 18.365  -4.994  4.031   1.00 0.00 ? 71  ASN A H    5  
ATOM 9706  H HA   . ASN A 1 71  ? 16.807  -2.911  2.724   1.00 0.00 ? 71  ASN A HA   5  
ATOM 9707  H HB2  . ASN A 1 71  ? 19.086  -3.517  1.749   1.00 0.00 ? 71  ASN A HB2  5  
ATOM 9708  H HB3  . ASN A 1 71  ? 18.485  -5.135  1.450   1.00 0.00 ? 71  ASN A HB3  5  
ATOM 9709  H HD21 . ASN A 1 71  ? 18.217  -1.748  0.636   1.00 0.00 ? 71  ASN A HD21 5  
ATOM 9710  H HD22 . ASN A 1 71  ? 17.373  -1.919  -0.867  1.00 0.00 ? 71  ASN A HD22 5  
ATOM 9711  N N    . ARG A 1 72  ? 14.925  -4.666  3.076   1.00 0.00 ? 72  ARG A N    5  
ATOM 9712  C CA   . ARG A 1 72  ? 13.780  -5.555  2.976   1.00 0.00 ? 72  ARG A CA   5  
ATOM 9713  C C    . ARG A 1 72  ? 12.491  -4.744  2.822   1.00 0.00 ? 72  ARG A C    5  
ATOM 9714  O O    . ARG A 1 72  ? 12.463  -3.552  3.123   1.00 0.00 ? 72  ARG A O    5  
ATOM 9715  C CB   . ARG A 1 72  ? 13.667  -6.450  4.211   1.00 0.00 ? 72  ARG A CB   5  
ATOM 9716  C CG   . ARG A 1 72  ? 14.441  -7.755  4.015   1.00 0.00 ? 72  ARG A CG   5  
ATOM 9717  C CD   . ARG A 1 72  ? 14.457  -8.582  5.302   1.00 0.00 ? 72  ARG A CD   5  
ATOM 9718  N NE   . ARG A 1 72  ? 15.599  -9.523  5.285   1.00 0.00 ? 72  ARG A NE   5  
ATOM 9719  C CZ   . ARG A 1 72  ? 15.900  -10.357 6.289   1.00 0.00 ? 72  ARG A CZ   5  
ATOM 9720  N NH1  . ARG A 1 72  ? 15.146  -10.372 7.397   1.00 0.00 ? 72  ARG A NH1  5  
ATOM 9721  N NH2  . ARG A 1 72  ? 16.955  -11.177 6.186   1.00 0.00 ? 72  ARG A NH2  5  
ATOM 9722  H H    . ARG A 1 72  ? 14.770  -3.837  3.613   1.00 0.00 ? 72  ARG A H    5  
ATOM 9723  H HA   . ARG A 1 72  ? 13.972  -6.157  2.088   1.00 0.00 ? 72  ARG A HA   5  
ATOM 9724  H HB2  . ARG A 1 72  ? 14.053  -5.922  5.083   1.00 0.00 ? 72  ARG A HB2  5  
ATOM 9725  H HB3  . ARG A 1 72  ? 12.619  -6.671  4.410   1.00 0.00 ? 72  ARG A HB3  5  
ATOM 9726  H HG2  . ARG A 1 72  ? 13.986  -8.335  3.212   1.00 0.00 ? 72  ARG A HG2  5  
ATOM 9727  H HG3  . ARG A 1 72  ? 15.463  -7.533  3.708   1.00 0.00 ? 72  ARG A HG3  5  
ATOM 9728  H HD2  . ARG A 1 72  ? 14.532  -7.922  6.167   1.00 0.00 ? 72  ARG A HD2  5  
ATOM 9729  H HD3  . ARG A 1 72  ? 13.522  -9.133  5.402   1.00 0.00 ? 72  ARG A HD3  5  
ATOM 9730  H HE   . ARG A 1 72  ? 16.182  -9.538  4.473   1.00 0.00 ? 72  ARG A HE   5  
ATOM 9731  H HH11 . ARG A 1 72  ? 14.359  -9.761  7.474   1.00 0.00 ? 72  ARG A HH11 5  
ATOM 9732  H HH12 . ARG A 1 72  ? 15.371  -10.995 8.146   1.00 0.00 ? 72  ARG A HH12 5  
ATOM 9733  H HH21 . ARG A 1 72  ? 17.518  -11.166 5.359   1.00 0.00 ? 72  ARG A HH21 5  
ATOM 9734  H HH22 . ARG A 1 72  ? 17.180  -11.799 6.936   1.00 0.00 ? 72  ARG A HH22 5  
ATOM 9735  N N    . TYR A 1 73  ? 11.455  -5.424  2.354   1.00 0.00 ? 73  TYR A N    5  
ATOM 9736  C CA   . TYR A 1 73  ? 10.166  -4.783  2.157   1.00 0.00 ? 73  TYR A CA   5  
ATOM 9737  C C    . TYR A 1 73  ? 9.027   -5.799  2.256   1.00 0.00 ? 73  TYR A C    5  
ATOM 9738  O O    . TYR A 1 73  ? 9.260   -7.006  2.202   1.00 0.00 ? 73  TYR A O    5  
ATOM 9739  C CB   . TYR A 1 73  ? 10.195  -4.204  0.741   1.00 0.00 ? 73  TYR A CB   5  
ATOM 9740  C CG   . TYR A 1 73  ? 11.468  -3.419  0.416   1.00 0.00 ? 73  TYR A CG   5  
ATOM 9741  C CD1  . TYR A 1 73  ? 12.626  -4.091  0.081   1.00 0.00 ? 73  TYR A CD1  5  
ATOM 9742  C CD2  . TYR A 1 73  ? 11.457  -2.040  0.457   1.00 0.00 ? 73  TYR A CD2  5  
ATOM 9743  C CE1  . TYR A 1 73  ? 13.824  -3.353  -0.225  1.00 0.00 ? 73  TYR A CE1  5  
ATOM 9744  C CE2  . TYR A 1 73  ? 12.655  -1.301  0.151   1.00 0.00 ? 73  TYR A CE2  5  
ATOM 9745  C CZ   . TYR A 1 73  ? 13.779  -1.994  -0.175  1.00 0.00 ? 73  TYR A CZ   5  
ATOM 9746  O OH   . TYR A 1 73  ? 14.910  -1.297  -0.464  1.00 0.00 ? 73  TYR A OH   5  
ATOM 9747  H H    . TYR A 1 73  ? 11.485  -6.394  2.111   1.00 0.00 ? 73  TYR A H    5  
ATOM 9748  H HA   . TYR A 1 73  ? 10.041  -4.032  2.936   1.00 0.00 ? 73  TYR A HA   5  
ATOM 9749  H HB2  . TYR A 1 73  ? 10.090  -5.018  0.024   1.00 0.00 ? 73  TYR A HB2  5  
ATOM 9750  H HB3  . TYR A 1 73  ? 9.334   -3.550  0.609   1.00 0.00 ? 73  TYR A HB3  5  
ATOM 9751  H HD1  . TYR A 1 73  ? 12.634  -5.181  0.048   1.00 0.00 ? 73  TYR A HD1  5  
ATOM 9752  H HD2  . TYR A 1 73  ? 10.543  -1.510  0.721   1.00 0.00 ? 73  TYR A HD2  5  
ATOM 9753  H HE1  . TYR A 1 73  ? 14.745  -3.871  -0.491  1.00 0.00 ? 73  TYR A HE1  5  
ATOM 9754  H HE2  . TYR A 1 73  ? 12.661  -0.212  0.180   1.00 0.00 ? 73  TYR A HE2  5  
ATOM 9755  H HH   . TYR A 1 73  ? 14.706  -0.570  -1.120  1.00 0.00 ? 73  TYR A HH   5  
ATOM 9756  N N    . TRP A 1 74  ? 7.819   -5.274  2.398   1.00 0.00 ? 74  TRP A N    5  
ATOM 9757  C CA   . TRP A 1 74  ? 6.642   -6.121  2.505   1.00 0.00 ? 74  TRP A CA   5  
ATOM 9758  C C    . TRP A 1 74  ? 5.474   -5.394  1.836   1.00 0.00 ? 74  TRP A C    5  
ATOM 9759  O O    . TRP A 1 74  ? 5.465   -4.166  1.758   1.00 0.00 ? 74  TRP A O    5  
ATOM 9760  C CB   . TRP A 1 74  ? 6.362   -6.487  3.964   1.00 0.00 ? 74  TRP A CB   5  
ATOM 9761  C CG   . TRP A 1 74  ? 7.373   -7.465  4.565   1.00 0.00 ? 74  TRP A CG   5  
ATOM 9762  C CD1  . TRP A 1 74  ? 7.301   -8.803  4.611   1.00 0.00 ? 74  TRP A CD1  5  
ATOM 9763  C CD2  . TRP A 1 74  ? 8.619   -7.126  5.209   1.00 0.00 ? 74  TRP A CD2  5  
ATOM 9764  N NE1  . TRP A 1 74  ? 8.405   -9.348  5.235   1.00 0.00 ? 74  TRP A NE1  5  
ATOM 9765  C CE2  . TRP A 1 74  ? 9.232   -8.295  5.610   1.00 0.00 ? 74  TRP A CE2  5  
ATOM 9766  C CE3  . TRP A 1 74  ? 9.209   -5.871  5.445   1.00 0.00 ? 74  TRP A CE3  5  
ATOM 9767  C CZ2  . TRP A 1 74  ? 10.465  -8.327  6.271   1.00 0.00 ? 74  TRP A CZ2  5  
ATOM 9768  C CZ3  . TRP A 1 74  ? 10.442  -5.920  6.107   1.00 0.00 ? 74  TRP A CZ3  5  
ATOM 9769  C CH2  . TRP A 1 74  ? 11.072  -7.089  6.517   1.00 0.00 ? 74  TRP A CH2  5  
ATOM 9770  H H    . TRP A 1 74  ? 7.637   -4.292  2.441   1.00 0.00 ? 74  TRP A H    5  
ATOM 9771  H HA   . TRP A 1 74  ? 6.853   -7.052  1.979   1.00 0.00 ? 74  TRP A HA   5  
ATOM 9772  H HB2  . TRP A 1 74  ? 6.353   -5.576  4.562   1.00 0.00 ? 74  TRP A HB2  5  
ATOM 9773  H HB3  . TRP A 1 74  ? 5.365   -6.923  4.033   1.00 0.00 ? 74  TRP A HB3  5  
ATOM 9774  H HD1  . TRP A 1 74  ? 6.474   -9.387  4.206   1.00 0.00 ? 74  TRP A HD1  5  
ATOM 9775  H HE1  . TRP A 1 74  ? 8.593   -10.408 5.402   1.00 0.00 ? 74  TRP A HE1  5  
ATOM 9776  H HE3  . TRP A 1 74  ? 8.745   -4.934  5.139   1.00 0.00 ? 74  TRP A HE3  5  
ATOM 9777  H HZ2  . TRP A 1 74  ? 10.929  -9.265  6.577   1.00 0.00 ? 74  TRP A HZ2  5  
ATOM 9778  H HZ3  . TRP A 1 74  ? 10.943  -4.975  6.315   1.00 0.00 ? 74  TRP A HZ3  5  
ATOM 9779  H HH2  . TRP A 1 74  ? 12.034  -7.043  7.028   1.00 0.00 ? 74  TRP A HH2  5  
ATOM 9780  N N    . ILE A 1 75  ? 4.517   -6.182  1.370   1.00 0.00 ? 75  ILE A N    5  
ATOM 9781  C CA   . ILE A 1 75  ? 3.346   -5.629  0.710   1.00 0.00 ? 75  ILE A CA   5  
ATOM 9782  C C    . ILE A 1 75  ? 2.096   -5.981  1.519   1.00 0.00 ? 75  ILE A C    5  
ATOM 9783  O O    . ILE A 1 75  ? 1.556   -7.078  1.387   1.00 0.00 ? 75  ILE A O    5  
ATOM 9784  C CB   . ILE A 1 75  ? 3.286   -6.090  -0.748  1.00 0.00 ? 75  ILE A CB   5  
ATOM 9785  C CG1  . ILE A 1 75  ? 4.262   -5.293  -1.615  1.00 0.00 ? 75  ILE A CG1  5  
ATOM 9786  C CG2  . ILE A 1 75  ? 1.855   -6.022  -1.285  1.00 0.00 ? 75  ILE A CG2  5  
ATOM 9787  C CD1  . ILE A 1 75  ? 3.667   -3.939  -2.009  1.00 0.00 ? 75  ILE A CD1  5  
ATOM 9788  H H    . ILE A 1 75  ? 4.532   -7.180  1.438   1.00 0.00 ? 75  ILE A H    5  
ATOM 9789  H HA   . ILE A 1 75  ? 3.458   -4.545  0.701   1.00 0.00 ? 75  ILE A HA   5  
ATOM 9790  H HB   . ILE A 1 75  ? 3.596   -7.134  -0.789  1.00 0.00 ? 75  ILE A HB   5  
ATOM 9791  H HG12 . ILE A 1 75  ? 5.195   -5.141  -1.073  1.00 0.00 ? 75  ILE A HG12 5  
ATOM 9792  H HG13 . ILE A 1 75  ? 4.504   -5.863  -2.513  1.00 0.00 ? 75  ILE A HG13 5  
ATOM 9793  H HG21 . ILE A 1 75  ? 1.216   -5.523  -0.555  1.00 0.00 ? 75  ILE A HG21 5  
ATOM 9794  H HG22 . ILE A 1 75  ? 1.844   -5.462  -2.220  1.00 0.00 ? 75  ILE A HG22 5  
ATOM 9795  H HG23 . ILE A 1 75  ? 1.485   -7.032  -1.461  1.00 0.00 ? 75  ILE A HG23 5  
ATOM 9796  H HD11 . ILE A 1 75  ? 2.940   -3.630  -1.258  1.00 0.00 ? 75  ILE A HD11 5  
ATOM 9797  H HD12 . ILE A 1 75  ? 4.463   -3.197  -2.072  1.00 0.00 ? 75  ILE A HD12 5  
ATOM 9798  H HD13 . ILE A 1 75  ? 3.175   -4.027  -2.977  1.00 0.00 ? 75  ILE A HD13 5  
ATOM 9799  N N    . PHE A 1 76  ? 1.673   -5.029  2.338   1.00 0.00 ? 76  PHE A N    5  
ATOM 9800  C CA   . PHE A 1 76  ? 0.497   -5.225  3.168   1.00 0.00 ? 76  PHE A CA   5  
ATOM 9801  C C    . PHE A 1 76  ? -0.769  -4.764  2.442   1.00 0.00 ? 76  PHE A C    5  
ATOM 9802  O O    . PHE A 1 76  ? -0.965  -3.569  2.226   1.00 0.00 ? 76  PHE A O    5  
ATOM 9803  C CB   . PHE A 1 76  ? 0.689   -4.373  4.424   1.00 0.00 ? 76  PHE A CB   5  
ATOM 9804  C CG   . PHE A 1 76  ? -0.480  -4.444  5.409   1.00 0.00 ? 76  PHE A CG   5  
ATOM 9805  C CD1  . PHE A 1 76  ? -0.589  -5.498  6.261   1.00 0.00 ? 76  PHE A CD1  5  
ATOM 9806  C CD2  . PHE A 1 76  ? -1.411  -3.452  5.432   1.00 0.00 ? 76  PHE A CD2  5  
ATOM 9807  C CE1  . PHE A 1 76  ? -1.674  -5.564  7.175   1.00 0.00 ? 76  PHE A CE1  5  
ATOM 9808  C CE2  . PHE A 1 76  ? -2.496  -3.518  6.346   1.00 0.00 ? 76  PHE A CE2  5  
ATOM 9809  C CZ   . PHE A 1 76  ? -2.604  -4.572  7.198   1.00 0.00 ? 76  PHE A CZ   5  
ATOM 9810  H H    . PHE A 1 76  ? 2.118   -4.140  2.439   1.00 0.00 ? 76  PHE A H    5  
ATOM 9811  H HA   . PHE A 1 76  ? 0.424   -6.292  3.380   1.00 0.00 ? 76  PHE A HA   5  
ATOM 9812  H HB2  . PHE A 1 76  ? 1.598   -4.693  4.933   1.00 0.00 ? 76  PHE A HB2  5  
ATOM 9813  H HB3  . PHE A 1 76  ? 0.838   -3.335  4.127   1.00 0.00 ? 76  PHE A HB3  5  
ATOM 9814  H HD1  . PHE A 1 76  ? 0.157   -6.293  6.243   1.00 0.00 ? 76  PHE A HD1  5  
ATOM 9815  H HD2  . PHE A 1 76  ? -1.324  -2.607  4.749   1.00 0.00 ? 76  PHE A HD2  5  
ATOM 9816  H HE1  . PHE A 1 76  ? -1.761  -6.409  7.858   1.00 0.00 ? 76  PHE A HE1  5  
ATOM 9817  H HE2  . PHE A 1 76  ? -3.241  -2.723  6.364   1.00 0.00 ? 76  PHE A HE2  5  
ATOM 9818  H HZ   . PHE A 1 76  ? -3.437  -4.623  7.899   1.00 0.00 ? 76  PHE A HZ   5  
ATOM 9819  N N    . ARG A 1 77  ? -1.596  -5.736  2.086   1.00 0.00 ? 77  ARG A N    5  
ATOM 9820  C CA   . ARG A 1 77  ? -2.837  -5.446  1.390   1.00 0.00 ? 77  ARG A CA   5  
ATOM 9821  C C    . ARG A 1 77  ? -4.034  -5.912  2.221   1.00 0.00 ? 77  ARG A C    5  
ATOM 9822  O O    . ARG A 1 77  ? -4.208  -7.108  2.448   1.00 0.00 ? 77  ARG A O    5  
ATOM 9823  C CB   . ARG A 1 77  ? -2.876  -6.132  0.023   1.00 0.00 ? 77  ARG A CB   5  
ATOM 9824  C CG   . ARG A 1 77  ? -1.474  -6.226  -0.583  1.00 0.00 ? 77  ARG A CG   5  
ATOM 9825  C CD   . ARG A 1 77  ? -1.160  -4.992  -1.432  1.00 0.00 ? 77  ARG A CD   5  
ATOM 9826  N NE   . ARG A 1 77  ? -0.431  -3.992  -0.621  1.00 0.00 ? 77  ARG A NE   5  
ATOM 9827  C CZ   . ARG A 1 77  ? 0.567   -3.230  -1.088  1.00 0.00 ? 77  ARG A CZ   5  
ATOM 9828  N NH1  . ARG A 1 77  ? 0.961   -3.349  -2.363  1.00 0.00 ? 77  ARG A NH1  5  
ATOM 9829  N NH2  . ARG A 1 77  ? 1.172   -2.348  -0.280  1.00 0.00 ? 77  ARG A NH2  5  
ATOM 9830  H H    . ARG A 1 77  ? -1.429  -6.706  2.266   1.00 0.00 ? 77  ARG A H    5  
ATOM 9831  H HA   . ARG A 1 77  ? -2.842  -4.362  1.269   1.00 0.00 ? 77  ARG A HA   5  
ATOM 9832  H HB2  . ARG A 1 77  ? -3.299  -7.132  0.126   1.00 0.00 ? 77  ARG A HB2  5  
ATOM 9833  H HB3  . ARG A 1 77  ? -3.530  -5.577  -0.649  1.00 0.00 ? 77  ARG A HB3  5  
ATOM 9834  H HG2  . ARG A 1 77  ? -0.735  -6.322  0.212   1.00 0.00 ? 77  ARG A HG2  5  
ATOM 9835  H HG3  . ARG A 1 77  ? -1.399  -7.123  -1.198  1.00 0.00 ? 77  ARG A HG3  5  
ATOM 9836  H HD2  . ARG A 1 77  ? -0.562  -5.278  -2.297  1.00 0.00 ? 77  ARG A HD2  5  
ATOM 9837  H HD3  . ARG A 1 77  ? -2.085  -4.558  -1.814  1.00 0.00 ? 77  ARG A HD3  5  
ATOM 9838  H HE   . ARG A 1 77  ? -0.699  -3.878  0.336   1.00 0.00 ? 77  ARG A HE   5  
ATOM 9839  H HH11 . ARG A 1 77  ? 0.510   -4.006  -2.966  1.00 0.00 ? 77  ARG A HH11 5  
ATOM 9840  H HH12 . ARG A 1 77  ? 1.706   -2.780  -2.712  1.00 0.00 ? 77  ARG A HH12 5  
ATOM 9841  H HH21 . ARG A 1 77  ? 0.879   -2.260  0.672   1.00 0.00 ? 77  ARG A HH21 5  
ATOM 9842  H HH22 . ARG A 1 77  ? 1.917   -1.780  -0.628  1.00 0.00 ? 77  ARG A HH22 5  
ATOM 9843  N N    . SER A 1 78  ? -4.828  -4.943  2.652   1.00 0.00 ? 78  SER A N    5  
ATOM 9844  C CA   . SER A 1 78  ? -6.004  -5.239  3.453   1.00 0.00 ? 78  SER A CA   5  
ATOM 9845  C C    . SER A 1 78  ? -7.268  -5.078  2.606   1.00 0.00 ? 78  SER A C    5  
ATOM 9846  O O    . SER A 1 78  ? -7.330  -4.212  1.735   1.00 0.00 ? 78  SER A O    5  
ATOM 9847  C CB   . SER A 1 78  ? -6.072  -4.335  4.686   1.00 0.00 ? 78  SER A CB   5  
ATOM 9848  O OG   . SER A 1 78  ? -7.109  -3.364  4.579   1.00 0.00 ? 78  SER A OG   5  
ATOM 9849  H H    . SER A 1 78  ? -4.679  -3.972  2.463   1.00 0.00 ? 78  SER A H    5  
ATOM 9850  H HA   . SER A 1 78  ? -5.884  -6.275  3.769   1.00 0.00 ? 78  SER A HA   5  
ATOM 9851  H HB2  . SER A 1 78  ? -6.237  -4.945  5.574   1.00 0.00 ? 78  SER A HB2  5  
ATOM 9852  H HB3  . SER A 1 78  ? -5.115  -3.831  4.819   1.00 0.00 ? 78  SER A HB3  5  
ATOM 9853  H HG   . SER A 1 78  ? -8.001  -3.816  4.558   1.00 0.00 ? 78  SER A HG   5  
ATOM 9854  N N    . TRP A 1 79  ? -8.245  -5.927  2.892   1.00 0.00 ? 79  TRP A N    5  
ATOM 9855  C CA   . TRP A 1 79  ? -9.504  -5.890  2.168   1.00 0.00 ? 79  TRP A CA   5  
ATOM 9856  C C    . TRP A 1 79  ? -10.566 -6.573  3.031   1.00 0.00 ? 79  TRP A C    5  
ATOM 9857  O O    . TRP A 1 79  ? -10.256 -7.114  4.091   1.00 0.00 ? 79  TRP A O    5  
ATOM 9858  C CB   . TRP A 1 79  ? -9.359  -6.525  0.784   1.00 0.00 ? 79  TRP A CB   5  
ATOM 9859  C CG   . TRP A 1 79  ? -9.068  -8.027  0.816   1.00 0.00 ? 79  TRP A CG   5  
ATOM 9860  C CD1  . TRP A 1 79  ? -9.925  -9.028  1.061   1.00 0.00 ? 79  TRP A CD1  5  
ATOM 9861  C CD2  . TRP A 1 79  ? -7.793  -8.661  0.584   1.00 0.00 ? 79  TRP A CD2  5  
ATOM 9862  N NE1  . TRP A 1 79  ? -9.297  -10.256 1.004   1.00 0.00 ? 79  TRP A NE1  5  
ATOM 9863  C CE2  . TRP A 1 79  ? -7.959  -10.026 0.705   1.00 0.00 ? 79  TRP A CE2  5  
ATOM 9864  C CE3  . TRP A 1 79  ? -6.539  -8.100  0.282   1.00 0.00 ? 79  TRP A CE3  5  
ATOM 9865  C CZ2  . TRP A 1 79  ? -6.915  -10.943 0.540   1.00 0.00 ? 79  TRP A CZ2  5  
ATOM 9866  C CZ3  . TRP A 1 79  ? -5.506  -9.031  0.121   1.00 0.00 ? 79  TRP A CZ3  5  
ATOM 9867  C CH2  . TRP A 1 79  ? -5.657  -10.407 0.239   1.00 0.00 ? 79  TRP A CH2  5  
ATOM 9868  H H    . TRP A 1 79  ? -8.186  -6.628  3.602   1.00 0.00 ? 79  TRP A H    5  
ATOM 9869  H HA   . TRP A 1 79  ? -9.767  -4.844  2.011   1.00 0.00 ? 79  TRP A HA   5  
ATOM 9870  H HB2  . TRP A 1 79  ? -10.276 -6.355  0.219   1.00 0.00 ? 79  TRP A HB2  5  
ATOM 9871  H HB3  . TRP A 1 79  ? -8.555  -6.022  0.246   1.00 0.00 ? 79  TRP A HB3  5  
ATOM 9872  H HD1  . TRP A 1 79  ? -10.984 -8.890  1.277   1.00 0.00 ? 79  TRP A HD1  5  
ATOM 9873  H HE1  . TRP A 1 79  ? -9.765  -11.228 1.164   1.00 0.00 ? 79  TRP A HE1  5  
ATOM 9874  H HE3  . TRP A 1 79  ? -6.382  -7.026  0.182   1.00 0.00 ? 79  TRP A HE3  5  
ATOM 9875  H HZ2  . TRP A 1 79  ? -7.073  -12.017 0.641   1.00 0.00 ? 79  TRP A HZ2  5  
ATOM 9876  H HZ3  . TRP A 1 79  ? -4.512  -8.649  -0.114  1.00 0.00 ? 79  TRP A HZ3  5  
ATOM 9877  H HH2  . TRP A 1 79  ? -4.801  -11.067 0.098   1.00 0.00 ? 79  TRP A HH2  5  
ATOM 9878  N N    . GLY A 1 80  ? -11.798 -6.526  2.545   1.00 0.00 ? 80  GLY A N    5  
ATOM 9879  C CA   . GLY A 1 80  ? -12.908 -7.133  3.259   1.00 0.00 ? 80  GLY A CA   5  
ATOM 9880  C C    . GLY A 1 80  ? -13.951 -6.083  3.648   1.00 0.00 ? 80  GLY A C    5  
ATOM 9881  O O    . GLY A 1 80  ? -13.728 -4.887  3.469   1.00 0.00 ? 80  GLY A O    5  
ATOM 9882  H H    . GLY A 1 80  ? -12.042 -6.084  1.682   1.00 0.00 ? 80  GLY A H    5  
ATOM 9883  H HA2  . GLY A 1 80  ? -13.371 -7.898  2.636   1.00 0.00 ? 80  GLY A HA2  5  
ATOM 9884  H HA3  . GLY A 1 80  ? -12.539 -7.633  4.155   1.00 0.00 ? 80  GLY A HA3  5  
ATOM 9885  N N    . ARG A 1 81  ? -15.066 -6.569  4.172   1.00 0.00 ? 81  ARG A N    5  
ATOM 9886  C CA   . ARG A 1 81  ? -16.144 -5.687  4.588   1.00 0.00 ? 81  ARG A CA   5  
ATOM 9887  C C    . ARG A 1 81  ? -15.659 -4.738  5.685   1.00 0.00 ? 81  ARG A C    5  
ATOM 9888  O O    . ARG A 1 81  ? -14.606 -4.957  6.280   1.00 0.00 ? 81  ARG A O    5  
ATOM 9889  C CB   . ARG A 1 81  ? -17.341 -6.487  5.106   1.00 0.00 ? 81  ARG A CB   5  
ATOM 9890  C CG   . ARG A 1 81  ? -18.530 -6.375  4.151   1.00 0.00 ? 81  ARG A CG   5  
ATOM 9891  C CD   . ARG A 1 81  ? -18.455 -7.438  3.054   1.00 0.00 ? 81  ARG A CD   5  
ATOM 9892  N NE   . ARG A 1 81  ? -19.549 -8.420  3.225   1.00 0.00 ? 81  ARG A NE   5  
ATOM 9893  C CZ   . ARG A 1 81  ? -20.016 -9.204  2.243   1.00 0.00 ? 81  ARG A CZ   5  
ATOM 9894  N NH1  . ARG A 1 81  ? -19.487 -9.125  1.015   1.00 0.00 ? 81  ARG A NH1  5  
ATOM 9895  N NH2  . ARG A 1 81  ? -21.012 -10.066 2.490   1.00 0.00 ? 81  ARG A NH2  5  
ATOM 9896  H H    . ARG A 1 81  ? -15.239 -7.544  4.315   1.00 0.00 ? 81  ARG A H    5  
ATOM 9897  H HA   . ARG A 1 81  ? -16.417 -5.139  3.687   1.00 0.00 ? 81  ARG A HA   5  
ATOM 9898  H HB2  . ARG A 1 81  ? -17.060 -7.534  5.222   1.00 0.00 ? 81  ARG A HB2  5  
ATOM 9899  H HB3  . ARG A 1 81  ? -17.626 -6.122  6.093   1.00 0.00 ? 81  ARG A HB3  5  
ATOM 9900  H HG2  . ARG A 1 81  ? -19.461 -6.487  4.708   1.00 0.00 ? 81  ARG A HG2  5  
ATOM 9901  H HG3  . ARG A 1 81  ? -18.547 -5.382  3.700   1.00 0.00 ? 81  ARG A HG3  5  
ATOM 9902  H HD2  . ARG A 1 81  ? -18.528 -6.968  2.074   1.00 0.00 ? 81  ARG A HD2  5  
ATOM 9903  H HD3  . ARG A 1 81  ? -17.491 -7.945  3.093   1.00 0.00 ? 81  ARG A HD3  5  
ATOM 9904  H HE   . ARG A 1 81  ? -19.966 -8.504  4.130   1.00 0.00 ? 81  ARG A HE   5  
ATOM 9905  H HH11 . ARG A 1 81  ? -18.744 -8.482  0.830   1.00 0.00 ? 81  ARG A HH11 5  
ATOM 9906  H HH12 . ARG A 1 81  ? -19.836 -9.710  0.282   1.00 0.00 ? 81  ARG A HH12 5  
ATOM 9907  H HH21 . ARG A 1 81  ? -21.407 -10.125 3.407   1.00 0.00 ? 81  ARG A HH21 5  
ATOM 9908  H HH22 . ARG A 1 81  ? -21.360 -10.651 1.758   1.00 0.00 ? 81  ARG A HH22 5  
ATOM 9909  N N    . VAL A 1 82  ? -16.452 -3.702  5.920   1.00 0.00 ? 82  VAL A N    5  
ATOM 9910  C CA   . VAL A 1 82  ? -16.118 -2.719  6.935   1.00 0.00 ? 82  VAL A CA   5  
ATOM 9911  C C    . VAL A 1 82  ? -16.543 -3.244  8.308   1.00 0.00 ? 82  VAL A C    5  
ATOM 9912  O O    . VAL A 1 82  ? -15.702 -3.478  9.174   1.00 0.00 ? 82  VAL A O    5  
ATOM 9913  C CB   . VAL A 1 82  ? -16.753 -1.371  6.587   1.00 0.00 ? 82  VAL A CB   5  
ATOM 9914  C CG1  . VAL A 1 82  ? -16.898 -0.495  7.834   1.00 0.00 ? 82  VAL A CG1  5  
ATOM 9915  C CG2  . VAL A 1 82  ? -15.952 -0.650  5.501   1.00 0.00 ? 82  VAL A CG2  5  
ATOM 9916  H H    . VAL A 1 82  ? -17.308 -3.531  5.431   1.00 0.00 ? 82  VAL A H    5  
ATOM 9917  H HA   . VAL A 1 82  ? -15.035 -2.593  6.927   1.00 0.00 ? 82  VAL A HA   5  
ATOM 9918  H HB   . VAL A 1 82  ? -17.752 -1.563  6.195   1.00 0.00 ? 82  VAL A HB   5  
ATOM 9919  H HG11 . VAL A 1 82  ? -17.428 0.421   7.574   1.00 0.00 ? 82  VAL A HG11 5  
ATOM 9920  H HG12 . VAL A 1 82  ? -17.460 -1.037  8.595   1.00 0.00 ? 82  VAL A HG12 5  
ATOM 9921  H HG13 . VAL A 1 82  ? -15.910 -0.246  8.220   1.00 0.00 ? 82  VAL A HG13 5  
ATOM 9922  H HG21 . VAL A 1 82  ? -14.991 -0.335  5.908   1.00 0.00 ? 82  VAL A HG21 5  
ATOM 9923  H HG22 . VAL A 1 82  ? -15.787 -1.327  4.663   1.00 0.00 ? 82  VAL A HG22 5  
ATOM 9924  H HG23 . VAL A 1 82  ? -16.507 0.223   5.160   1.00 0.00 ? 82  VAL A HG23 5  
ATOM 9925  N N    . GLY A 1 83  ? -17.847 -3.413  8.463   1.00 0.00 ? 83  GLY A N    5  
ATOM 9926  C CA   . GLY A 1 83  ? -18.394 -3.907  9.716   1.00 0.00 ? 83  GLY A CA   5  
ATOM 9927  C C    . GLY A 1 83  ? -19.099 -5.250  9.515   1.00 0.00 ? 83  GLY A C    5  
ATOM 9928  O O    . GLY A 1 83  ? -20.311 -5.352  9.698   1.00 0.00 ? 83  GLY A O    5  
ATOM 9929  H H    . GLY A 1 83  ? -18.525 -3.220  7.753   1.00 0.00 ? 83  GLY A H    5  
ATOM 9930  H HA2  . GLY A 1 83  ? -17.594 -4.017  10.447  1.00 0.00 ? 83  GLY A HA2  5  
ATOM 9931  H HA3  . GLY A 1 83  ? -19.098 -3.179  10.121  1.00 0.00 ? 83  GLY A HA3  5  
ATOM 9932  N N    . THR A 1 84  ? -18.310 -6.246  9.141   1.00 0.00 ? 84  THR A N    5  
ATOM 9933  C CA   . THR A 1 84  ? -18.843 -7.578  8.914   1.00 0.00 ? 84  THR A CA   5  
ATOM 9934  C C    . THR A 1 84  ? -17.860 -8.639  9.414   1.00 0.00 ? 84  THR A C    5  
ATOM 9935  O O    . THR A 1 84  ? -16.853 -8.311  10.039  1.00 0.00 ? 84  THR A O    5  
ATOM 9936  C CB   . THR A 1 84  ? -19.172 -7.708  7.425   1.00 0.00 ? 84  THR A CB   5  
ATOM 9937  O OG1  . THR A 1 84  ? -19.855 -6.497  7.114   1.00 0.00 ? 84  THR A OG1  5  
ATOM 9938  C CG2  . THR A 1 84  ? -20.206 -8.801  7.147   1.00 0.00 ? 84  THR A CG2  5  
ATOM 9939  H H    . THR A 1 84  ? -17.325 -6.154  8.994   1.00 0.00 ? 84  THR A H    5  
ATOM 9940  H HA   . THR A 1 84  ? -19.756 -7.687  9.499   1.00 0.00 ? 84  THR A HA   5  
ATOM 9941  H HB   . THR A 1 84  ? -18.267 -7.870  6.840   1.00 0.00 ? 84  THR A HB   5  
ATOM 9942  H HG1  . THR A 1 84  ? -19.229 -5.721  7.193   1.00 0.00 ? 84  THR A HG1  5  
ATOM 9943  H HG21 . THR A 1 84  ? -19.707 -9.675  6.727   1.00 0.00 ? 84  THR A HG21 5  
ATOM 9944  H HG22 . THR A 1 84  ? -20.701 -9.078  8.078   1.00 0.00 ? 84  THR A HG22 5  
ATOM 9945  H HG23 . THR A 1 84  ? -20.946 -8.430  6.439   1.00 0.00 ? 84  THR A HG23 5  
ATOM 9946  N N    . VAL A 1 85  ? -18.187 -9.888  9.120   1.00 0.00 ? 85  VAL A N    5  
ATOM 9947  C CA   . VAL A 1 85  ? -17.345 -10.999 9.531   1.00 0.00 ? 85  VAL A CA   5  
ATOM 9948  C C    . VAL A 1 85  ? -16.098 -11.044 8.646   1.00 0.00 ? 85  VAL A C    5  
ATOM 9949  O O    . VAL A 1 85  ? -15.020 -11.419 9.105   1.00 0.00 ? 85  VAL A O    5  
ATOM 9950  C CB   . VAL A 1 85  ? -18.147 -12.302 9.502   1.00 0.00 ? 85  VAL A CB   5  
ATOM 9951  C CG1  . VAL A 1 85  ? -19.443 -12.167 10.304  1.00 0.00 ? 85  VAL A CG1  5  
ATOM 9952  C CG2  . VAL A 1 85  ? -18.436 -12.735 8.063   1.00 0.00 ? 85  VAL A CG2  5  
ATOM 9953  H H    . VAL A 1 85  ? -19.008 -10.147 8.611   1.00 0.00 ? 85  VAL A H    5  
ATOM 9954  H HA   . VAL A 1 85  ? -17.039 -10.815 10.561  1.00 0.00 ? 85  VAL A HA   5  
ATOM 9955  H HB   . VAL A 1 85  ? -17.542 -13.078 9.970   1.00 0.00 ? 85  VAL A HB   5  
ATOM 9956  H HG11 . VAL A 1 85  ? -20.139 -12.950 10.004  1.00 0.00 ? 85  VAL A HG11 5  
ATOM 9957  H HG12 . VAL A 1 85  ? -19.223 -12.264 11.368  1.00 0.00 ? 85  VAL A HG12 5  
ATOM 9958  H HG13 . VAL A 1 85  ? -19.889 -11.191 10.113  1.00 0.00 ? 85  VAL A HG13 5  
ATOM 9959  H HG21 . VAL A 1 85  ? -17.755 -13.539 7.782   1.00 0.00 ? 85  VAL A HG21 5  
ATOM 9960  H HG22 . VAL A 1 85  ? -19.465 -13.088 7.989   1.00 0.00 ? 85  VAL A HG22 5  
ATOM 9961  H HG23 . VAL A 1 85  ? -18.293 -11.888 7.393   1.00 0.00 ? 85  VAL A HG23 5  
ATOM 9962  N N    . ILE A 1 86  ? -16.287 -10.657 7.393   1.00 0.00 ? 86  ILE A N    5  
ATOM 9963  C CA   . ILE A 1 86  ? -15.191 -10.648 6.440   1.00 0.00 ? 86  ILE A CA   5  
ATOM 9964  C C    . ILE A 1 86  ? -14.083 -9.725  6.951   1.00 0.00 ? 86  ILE A C    5  
ATOM 9965  O O    . ILE A 1 86  ? -14.301 -8.938  7.871   1.00 0.00 ? 86  ILE A O    5  
ATOM 9966  C CB   . ILE A 1 86  ? -15.698 -10.284 5.043   1.00 0.00 ? 86  ILE A CB   5  
ATOM 9967  C CG1  . ILE A 1 86  ? -16.848 -11.201 4.621   1.00 0.00 ? 86  ILE A CG1  5  
ATOM 9968  C CG2  . ILE A 1 86  ? -14.556 -10.291 4.025   1.00 0.00 ? 86  ILE A CG2  5  
ATOM 9969  C CD1  . ILE A 1 86  ? -17.264 -10.928 3.175   1.00 0.00 ? 86  ILE A CD1  5  
ATOM 9970  H H    . ILE A 1 86  ? -17.167 -10.353 7.028   1.00 0.00 ? 86  ILE A H    5  
ATOM 9971  H HA   . ILE A 1 86  ? -14.797 -11.663 6.385   1.00 0.00 ? 86  ILE A HA   5  
ATOM 9972  H HB   . ILE A 1 86  ? -16.092 -9.268  5.077   1.00 0.00 ? 86  ILE A HB   5  
ATOM 9973  H HG12 . ILE A 1 86  ? -16.544 -12.243 4.726   1.00 0.00 ? 86  ILE A HG12 5  
ATOM 9974  H HG13 . ILE A 1 86  ? -17.700 -11.050 5.284   1.00 0.00 ? 86  ILE A HG13 5  
ATOM 9975  H HG21 . ILE A 1 86  ? -13.855 -9.490  4.260   1.00 0.00 ? 86  ILE A HG21 5  
ATOM 9976  H HG22 . ILE A 1 86  ? -14.039 -11.250 4.067   1.00 0.00 ? 86  ILE A HG22 5  
ATOM 9977  H HG23 . ILE A 1 86  ? -14.960 -10.140 3.025   1.00 0.00 ? 86  ILE A HG23 5  
ATOM 9978  H HD11 . ILE A 1 86  ? -18.341 -11.067 3.074   1.00 0.00 ? 86  ILE A HD11 5  
ATOM 9979  H HD12 . ILE A 1 86  ? -17.004 -9.904  2.909   1.00 0.00 ? 86  ILE A HD12 5  
ATOM 9980  H HD13 . ILE A 1 86  ? -16.745 -11.619 2.510   1.00 0.00 ? 86  ILE A HD13 5  
ATOM 9981  N N    . GLY A 1 87  ? -12.918 -9.853  6.333   1.00 0.00 ? 87  GLY A N    5  
ATOM 9982  C CA   . GLY A 1 87  ? -11.775 -9.040  6.714   1.00 0.00 ? 87  GLY A CA   5  
ATOM 9983  C C    . GLY A 1 87  ? -10.487 -9.865  6.703   1.00 0.00 ? 87  GLY A C    5  
ATOM 9984  O O    . GLY A 1 87  ? -10.326 -10.782 7.507   1.00 0.00 ? 87  GLY A O    5  
ATOM 9985  H H    . GLY A 1 87  ? -12.749 -10.495 5.586   1.00 0.00 ? 87  GLY A H    5  
ATOM 9986  H HA2  . GLY A 1 87  ? -11.678 -8.198  6.029   1.00 0.00 ? 87  GLY A HA2  5  
ATOM 9987  H HA3  . GLY A 1 87  ? -11.936 -8.624  7.709   1.00 0.00 ? 87  GLY A HA3  5  
ATOM 9988  N N    . SER A 1 88  ? -9.602  -9.509  5.783   1.00 0.00 ? 88  SER A N    5  
ATOM 9989  C CA   . SER A 1 88  ? -8.333  -10.206 5.656   1.00 0.00 ? 88  SER A CA   5  
ATOM 9990  C C    . SER A 1 88  ? -7.274  -9.263  5.081   1.00 0.00 ? 88  SER A C    5  
ATOM 9991  O O    . SER A 1 88  ? -7.596  -8.168  4.622   1.00 0.00 ? 88  SER A O    5  
ATOM 9992  C CB   . SER A 1 88  ? -8.473  -11.449 4.775   1.00 0.00 ? 88  SER A CB   5  
ATOM 9993  O OG   . SER A 1 88  ? -8.703  -12.626 5.545   1.00 0.00 ? 88  SER A OG   5  
ATOM 9994  H H    . SER A 1 88  ? -9.741  -8.762  5.133   1.00 0.00 ? 88  SER A H    5  
ATOM 9995  H HA   . SER A 1 88  ? -8.067  -10.507 6.669   1.00 0.00 ? 88  SER A HA   5  
ATOM 9996  H HB2  . SER A 1 88  ? -9.296  -11.306 4.075   1.00 0.00 ? 88  SER A HB2  5  
ATOM 9997  H HB3  . SER A 1 88  ? -7.567  -11.575 4.181   1.00 0.00 ? 88  SER A HB3  5  
ATOM 9998  H HG   . SER A 1 88  ? -8.035  -12.686 6.286   1.00 0.00 ? 88  SER A HG   5  
ATOM 9999  N N    . ASN A 1 89  ? -6.033  -9.723  5.124   1.00 0.00 ? 89  ASN A N    5  
ATOM 10000 C CA   . ASN A 1 89  ? -4.924  -8.934  4.613   1.00 0.00 ? 89  ASN A CA   5  
ATOM 10001 C C    . ASN A 1 89  ? -3.960  -9.849  3.855   1.00 0.00 ? 89  ASN A C    5  
ATOM 10002 O O    . ASN A 1 89  ? -4.206  -11.048 3.730   1.00 0.00 ? 89  ASN A O    5  
ATOM 10003 C CB   . ASN A 1 89  ? -4.149  -8.271  5.753   1.00 0.00 ? 89  ASN A CB   5  
ATOM 10004 C CG   . ASN A 1 89  ? -3.908  -9.255  6.899   1.00 0.00 ? 89  ASN A CG   5  
ATOM 10005 O OD1  . ASN A 1 89  ? -4.639  -9.304  7.874   1.00 0.00 ? 89  ASN A OD1  5  
ATOM 10006 N ND2  . ASN A 1 89  ? -2.844  -10.035 6.727   1.00 0.00 ? 89  ASN A ND2  5  
ATOM 10007 H H    . ASN A 1 89  ? -5.779  -10.615 5.499   1.00 0.00 ? 89  ASN A H    5  
ATOM 10008 H HA   . ASN A 1 89  ? -5.381  -8.183  3.968   1.00 0.00 ? 89  ASN A HA   5  
ATOM 10009 H HB2  . ASN A 1 89  ? -3.194  -7.900  5.380   1.00 0.00 ? 89  ASN A HB2  5  
ATOM 10010 H HB3  . ASN A 1 89  ? -4.704  -7.408  6.121   1.00 0.00 ? 89  ASN A HB3  5  
ATOM 10011 H HD21 . ASN A 1 89  ? -2.285  -9.944  5.903   1.00 0.00 ? 89  ASN A HD21 5  
ATOM 10012 H HD22 . ASN A 1 89  ? -2.603  -10.712 7.422   1.00 0.00 ? 89  ASN A HD22 5  
ATOM 10013 N N    . LYS A 1 90  ? -2.884  -9.248  3.369   1.00 0.00 ? 90  LYS A N    5  
ATOM 10014 C CA   . LYS A 1 90  ? -1.882  -9.994  2.627   1.00 0.00 ? 90  LYS A CA   5  
ATOM 10015 C C    . LYS A 1 90  ? -0.503  -9.383  2.884   1.00 0.00 ? 90  LYS A C    5  
ATOM 10016 O O    . LYS A 1 90  ? -0.256  -8.229  2.536   1.00 0.00 ? 90  LYS A O    5  
ATOM 10017 C CB   . LYS A 1 90  ? -2.256  -10.065 1.145   1.00 0.00 ? 90  LYS A CB   5  
ATOM 10018 C CG   . LYS A 1 90  ? -1.040  -10.427 0.289   1.00 0.00 ? 90  LYS A CG   5  
ATOM 10019 C CD   . LYS A 1 90  ? -1.382  -11.537 -0.707  1.00 0.00 ? 90  LYS A CD   5  
ATOM 10020 C CE   . LYS A 1 90  ? -0.484  -11.459 -1.943  1.00 0.00 ? 90  LYS A CE   5  
ATOM 10021 N NZ   . LYS A 1 90  ? 0.076   -12.792 -2.262  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 10022 H H    . LYS A 1 90  ? -2.692  -8.273  3.476   1.00 0.00 ? 90  LYS A H    5  
ATOM 10023 H HA   . LYS A 1 90  ? -1.884  -11.015 3.009   1.00 0.00 ? 90  LYS A HA   5  
ATOM 10024 H HB2  . LYS A 1 90  ? -3.041  -10.806 0.999   1.00 0.00 ? 90  LYS A HB2  5  
ATOM 10025 H HB3  . LYS A 1 90  ? -2.660  -9.106  0.822   1.00 0.00 ? 90  LYS A HB3  5  
ATOM 10026 H HG2  . LYS A 1 90  ? -0.694  -9.545  -0.249  1.00 0.00 ? 90  LYS A HG2  5  
ATOM 10027 H HG3  . LYS A 1 90  ? -0.222  -10.750 0.932   1.00 0.00 ? 90  LYS A HG3  5  
ATOM 10028 H HD2  . LYS A 1 90  ? -1.264  -12.509 -0.228  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 10029 H HD3  . LYS A 1 90  ? -2.427  -11.453 -1.006  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 10030 H HE2  . LYS A 1 90  ? -1.056  -11.086 -2.793  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 10031 H HE3  . LYS A 1 90  ? 0.325   -10.751 -1.768  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 10032 H HZ1  . LYS A 1 90  ? 0.530   -13.165 -1.453  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 10033 H HZ2  . LYS A 1 90  ? -0.663  -13.405 -2.542  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 10034 H HZ3  . LYS A 1 90  ? 0.738   -12.706 -3.007  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 10035 N N    . LEU A 1 91  ? 0.360   -10.184 3.493   1.00 0.00 ? 91  LEU A N    5  
ATOM 10036 C CA   . LEU A 1 91  ? 1.707   -9.736  3.801   1.00 0.00 ? 91  LEU A CA   5  
ATOM 10037 C C    . LEU A 1 91  ? 2.716   -10.655 3.108   1.00 0.00 ? 91  LEU A C    5  
ATOM 10038 O O    . LEU A 1 91  ? 2.807   -11.838 3.431   1.00 0.00 ? 91  LEU A O    5  
ATOM 10039 C CB   . LEU A 1 91  ? 1.905   -9.636  5.315   1.00 0.00 ? 91  LEU A CB   5  
ATOM 10040 C CG   . LEU A 1 91  ? 3.196   -8.959  5.779   1.00 0.00 ? 91  LEU A CG   5  
ATOM 10041 C CD1  . LEU A 1 91  ? 3.102   -7.439  5.630   1.00 0.00 ? 91  LEU A CD1  5  
ATOM 10042 C CD2  . LEU A 1 91  ? 3.550   -9.374  7.209   1.00 0.00 ? 91  LEU A CD2  5  
ATOM 10043 H H    . LEU A 1 91  ? 0.151   -11.121 3.773   1.00 0.00 ? 91  LEU A H    5  
ATOM 10044 H HA   . LEU A 1 91  ? 1.819   -8.731  3.394   1.00 0.00 ? 91  LEU A HA   5  
ATOM 10045 H HB2  . LEU A 1 91  ? 1.060   -9.092  5.737   1.00 0.00 ? 91  LEU A HB2  5  
ATOM 10046 H HB3  . LEU A 1 91  ? 1.876   -10.643 5.733   1.00 0.00 ? 91  LEU A HB3  5  
ATOM 10047 H HG   . LEU A 1 91  ? 4.009   -9.296  5.136   1.00 0.00 ? 91  LEU A HG   5  
ATOM 10048 H HD11 . LEU A 1 91  ? 2.579   -7.021  6.491   1.00 0.00 ? 91  LEU A HD11 5  
ATOM 10049 H HD12 . LEU A 1 91  ? 4.105   -7.017  5.574   1.00 0.00 ? 91  LEU A HD12 5  
ATOM 10050 H HD13 . LEU A 1 91  ? 2.554   -7.196  4.720   1.00 0.00 ? 91  LEU A HD13 5  
ATOM 10051 H HD21 . LEU A 1 91  ? 4.597   -9.673  7.252   1.00 0.00 ? 91  LEU A HD21 5  
ATOM 10052 H HD22 . LEU A 1 91  ? 3.384   -8.533  7.883   1.00 0.00 ? 91  LEU A HD22 5  
ATOM 10053 H HD23 . LEU A 1 91  ? 2.920   -10.211 7.510   1.00 0.00 ? 91  LEU A HD23 5  
ATOM 10054 N N    . GLU A 1 92  ? 3.448   -10.075 2.169   1.00 0.00 ? 92  GLU A N    5  
ATOM 10055 C CA   . GLU A 1 92  ? 4.446   -10.826 1.428   1.00 0.00 ? 92  GLU A CA   5  
ATOM 10056 C C    . GLU A 1 92  ? 5.716   -9.991  1.251   1.00 0.00 ? 92  GLU A C    5  
ATOM 10057 O O    . GLU A 1 92  ? 5.645   -8.813  0.905   1.00 0.00 ? 92  GLU A O    5  
ATOM 10058 C CB   . GLU A 1 92  ? 3.897   -11.282 0.074   1.00 0.00 ? 92  GLU A CB   5  
ATOM 10059 C CG   . GLU A 1 92  ? 3.093   -12.576 0.217   1.00 0.00 ? 92  GLU A CG   5  
ATOM 10060 C CD   . GLU A 1 92  ? 3.708   -13.699 -0.620  1.00 0.00 ? 92  GLU A CD   5  
ATOM 10061 O OE1  . GLU A 1 92  ? 3.702   -13.551 -1.861  1.00 0.00 ? 92  GLU A OE1  5  
ATOM 10062 O OE2  . GLU A 1 92  ? 4.171   -14.681 0.000   1.00 0.00 ? 92  GLU A OE2  5  
ATOM 10063 H H    . GLU A 1 92  ? 3.367   -9.112  1.912   1.00 0.00 ? 92  GLU A H    5  
ATOM 10064 H HA   . GLU A 1 92  ? 4.662   -11.702 2.039   1.00 0.00 ? 92  GLU A HA   5  
ATOM 10065 H HB2  . GLU A 1 92  ? 3.264   -10.501 -0.347  1.00 0.00 ? 92  GLU A HB2  5  
ATOM 10066 H HB3  . GLU A 1 92  ? 4.720   -11.437 -0.623  1.00 0.00 ? 92  GLU A HB3  5  
ATOM 10067 H HG2  . GLU A 1 92  ? 3.060   -12.874 1.265   1.00 0.00 ? 92  GLU A HG2  5  
ATOM 10068 H HG3  . GLU A 1 92  ? 2.063   -12.405 -0.098  1.00 0.00 ? 92  GLU A HG3  5  
ATOM 10069 N N    . GLN A 1 93  ? 6.848   -10.634 1.496   1.00 0.00 ? 93  GLN A N    5  
ATOM 10070 C CA   . GLN A 1 93  ? 8.132   -9.965  1.368   1.00 0.00 ? 93  GLN A CA   5  
ATOM 10071 C C    . GLN A 1 93  ? 8.521   -9.841  -0.107  1.00 0.00 ? 93  GLN A C    5  
ATOM 10072 O O    . GLN A 1 93  ? 8.640   -10.844 -0.808  1.00 0.00 ? 93  GLN A O    5  
ATOM 10073 C CB   . GLN A 1 93  ? 9.214   -10.700 2.160   1.00 0.00 ? 93  GLN A CB   5  
ATOM 10074 C CG   . GLN A 1 93  ? 10.536  -9.930  2.128   1.00 0.00 ? 93  GLN A CG   5  
ATOM 10075 C CD   . GLN A 1 93  ? 11.621  -10.733 1.407   1.00 0.00 ? 93  GLN A CD   5  
ATOM 10076 O OE1  . GLN A 1 93  ? 11.657  -10.826 0.192   1.00 0.00 ? 93  GLN A OE1  5  
ATOM 10077 N NE2  . GLN A 1 93  ? 12.502  -11.305 2.223   1.00 0.00 ? 93  GLN A NE2  5  
ATOM 10078 H H    . GLN A 1 93  ? 6.897   -11.593 1.776   1.00 0.00 ? 93  GLN A H    5  
ATOM 10079 H HA   . GLN A 1 93  ? 7.986   -8.974  1.797   1.00 0.00 ? 93  GLN A HA   5  
ATOM 10080 H HB2  . GLN A 1 93  ? 8.890   -10.829 3.193   1.00 0.00 ? 93  GLN A HB2  5  
ATOM 10081 H HB3  . GLN A 1 93  ? 9.361   -11.697 1.745   1.00 0.00 ? 93  GLN A HB3  5  
ATOM 10082 H HG2  . GLN A 1 93  ? 10.391  -8.974  1.624   1.00 0.00 ? 93  GLN A HG2  5  
ATOM 10083 H HG3  . GLN A 1 93  ? 10.857  -9.708  3.145   1.00 0.00 ? 93  GLN A HG3  5  
ATOM 10084 H HE21 . GLN A 1 93  ? 12.416  -11.189 3.213   1.00 0.00 ? 93  GLN A HE21 5  
ATOM 10085 H HE22 . GLN A 1 93  ? 13.250  -11.852 1.847   1.00 0.00 ? 93  GLN A HE22 5  
ATOM 10086 N N    . MET A 1 94  ? 8.708   -8.600  -0.534  1.00 0.00 ? 94  MET A N    5  
ATOM 10087 C CA   . MET A 1 94  ? 9.081   -8.332  -1.912  1.00 0.00 ? 94  MET A CA   5  
ATOM 10088 C C    . MET A 1 94  ? 10.575  -8.577  -2.134  1.00 0.00 ? 94  MET A C    5  
ATOM 10089 O O    . MET A 1 94  ? 11.383  -8.358  -1.233  1.00 0.00 ? 94  MET A O    5  
ATOM 10090 C CB   . MET A 1 94  ? 8.744   -6.880  -2.259  1.00 0.00 ? 94  MET A CB   5  
ATOM 10091 C CG   . MET A 1 94  ? 7.373   -6.488  -1.705  1.00 0.00 ? 94  MET A CG   5  
ATOM 10092 S SD   . MET A 1 94  ? 6.185   -7.774  -2.048  1.00 0.00 ? 94  MET A SD   5  
ATOM 10093 C CE   . MET A 1 94  ? 6.079   -7.632  -3.825  1.00 0.00 ? 94  MET A CE   5  
ATOM 10094 H H    . MET A 1 94  ? 8.609   -7.790  0.043   1.00 0.00 ? 94  MET A H    5  
ATOM 10095 H HA   . MET A 1 94  ? 8.498   -9.029  -2.515  1.00 0.00 ? 94  MET A HA   5  
ATOM 10096 H HB2  . MET A 1 94  ? 9.509   -6.219  -1.851  1.00 0.00 ? 94  MET A HB2  5  
ATOM 10097 H HB3  . MET A 1 94  ? 8.754   -6.749  -3.341  1.00 0.00 ? 94  MET A HB3  5  
ATOM 10098 H HG2  . MET A 1 94  ? 7.441   -6.321  -0.629  1.00 0.00 ? 94  MET A HG2  5  
ATOM 10099 H HG3  . MET A 1 94  ? 7.046   -5.549  -2.152  1.00 0.00 ? 94  MET A HG3  5  
ATOM 10100 H HE1  . MET A 1 94  ? 5.646   -6.666  -4.086  1.00 0.00 ? 94  MET A HE1  5  
ATOM 10101 H HE2  . MET A 1 94  ? 7.076   -7.712  -4.256  1.00 0.00 ? 94  MET A HE2  5  
ATOM 10102 H HE3  . MET A 1 94  ? 5.448   -8.430  -4.216  1.00 0.00 ? 94  MET A HE3  5  
ATOM 10103 N N    . PRO A 1 95  ? 10.904  -9.040  -3.369  1.00 0.00 ? 95  PRO A N    5  
ATOM 10104 C CA   . PRO A 1 95  ? 12.287  -9.317  -3.720  1.00 0.00 ? 95  PRO A CA   5  
ATOM 10105 C C    . PRO A 1 95  ? 13.062  -8.020  -3.962  1.00 0.00 ? 95  PRO A C    5  
ATOM 10106 O O    . PRO A 1 95  ? 14.061  -7.756  -3.295  1.00 0.00 ? 95  PRO A O    5  
ATOM 10107 C CB   . PRO A 1 95  ? 12.210  -10.201 -4.954  1.00 0.00 ? 95  PRO A CB   5  
ATOM 10108 C CG   . PRO A 1 95  ? 10.812  -10.006 -5.520  1.00 0.00 ? 95  PRO A CG   5  
ATOM 10109 C CD   . PRO A 1 95  ? 9.973   -9.311  -4.461  1.00 0.00 ? 95  PRO A CD   5  
ATOM 10110 H HA   . PRO A 1 95  ? 12.752  -9.776  -2.963  1.00 0.00 ? 95  PRO A HA   5  
ATOM 10111 H HB2  . PRO A 1 95  ? 12.969  -9.921  -5.684  1.00 0.00 ? 95  PRO A HB2  5  
ATOM 10112 H HB3  . PRO A 1 95  ? 12.385  -11.246 -4.697  1.00 0.00 ? 95  PRO A HB3  5  
ATOM 10113 H HG2  . PRO A 1 95  ? 10.849  -9.409  -6.431  1.00 0.00 ? 95  PRO A HG2  5  
ATOM 10114 H HG3  . PRO A 1 95  ? 10.371  -10.967 -5.787  1.00 0.00 ? 95  PRO A HG3  5  
ATOM 10115 H HD2  . PRO A 1 95  ? 9.534   -8.390  -4.844  1.00 0.00 ? 95  PRO A HD2  5  
ATOM 10116 H HD3  . PRO A 1 95  ? 9.149   -9.944  -4.130  1.00 0.00 ? 95  PRO A HD3  5  
ATOM 10117 N N    . SER A 1 96  ? 12.571  -7.245  -4.918  1.00 0.00 ? 96  SER A N    5  
ATOM 10118 C CA   . SER A 1 96  ? 13.205  -5.982  -5.256  1.00 0.00 ? 96  SER A CA   5  
ATOM 10119 C C    . SER A 1 96  ? 12.240  -4.824  -4.991  1.00 0.00 ? 96  SER A C    5  
ATOM 10120 O O    . SER A 1 96  ? 11.059  -4.907  -5.324  1.00 0.00 ? 96  SER A O    5  
ATOM 10121 C CB   . SER A 1 96  ? 13.662  -5.968  -6.716  1.00 0.00 ? 96  SER A CB   5  
ATOM 10122 O OG   . SER A 1 96  ? 15.022  -5.563  -6.846  1.00 0.00 ? 96  SER A OG   5  
ATOM 10123 H H    . SER A 1 96  ? 11.758  -7.467  -5.456  1.00 0.00 ? 96  SER A H    5  
ATOM 10124 H HA   . SER A 1 96  ? 14.075  -5.912  -4.603  1.00 0.00 ? 96  SER A HA   5  
ATOM 10125 H HB2  . SER A 1 96  ? 13.537  -6.963  -7.144  1.00 0.00 ? 96  SER A HB2  5  
ATOM 10126 H HB3  . SER A 1 96  ? 13.026  -5.292  -7.288  1.00 0.00 ? 96  SER A HB3  5  
ATOM 10127 H HG   . SER A 1 96  ? 15.303  -5.612  -7.805  1.00 0.00 ? 96  SER A HG   5  
ATOM 10128 N N    . LYS A 1 97  ? 12.779  -3.772  -4.393  1.00 0.00 ? 97  LYS A N    5  
ATOM 10129 C CA   . LYS A 1 97  ? 11.981  -2.599  -4.079  1.00 0.00 ? 97  LYS A CA   5  
ATOM 10130 C C    . LYS A 1 97  ? 11.015  -2.322  -5.233  1.00 0.00 ? 97  LYS A C    5  
ATOM 10131 O O    . LYS A 1 97  ? 9.801   -2.282  -5.036  1.00 0.00 ? 97  LYS A O    5  
ATOM 10132 C CB   . LYS A 1 97  ? 12.883  -1.413  -3.734  1.00 0.00 ? 97  LYS A CB   5  
ATOM 10133 C CG   . LYS A 1 97  ? 12.057  -0.213  -3.266  1.00 0.00 ? 97  LYS A CG   5  
ATOM 10134 C CD   . LYS A 1 97  ? 11.153  -0.594  -2.092  1.00 0.00 ? 97  LYS A CD   5  
ATOM 10135 C CE   . LYS A 1 97  ? 9.676   -0.482  -2.478  1.00 0.00 ? 97  LYS A CE   5  
ATOM 10136 N NZ   . LYS A 1 97  ? 8.823   -1.132  -1.459  1.00 0.00 ? 97  LYS A NZ   5  
ATOM 10137 H H    . LYS A 1 97  ? 13.741  -3.712  -4.125  1.00 0.00 ? 97  LYS A H    5  
ATOM 10138 H HA   . LYS A 1 97  ? 11.397  -2.830  -3.188  1.00 0.00 ? 97  LYS A HA   5  
ATOM 10139 H HB2  . LYS A 1 97  ? 13.587  -1.701  -2.953  1.00 0.00 ? 97  LYS A HB2  5  
ATOM 10140 H HB3  . LYS A 1 97  ? 13.474  -1.134  -4.607  1.00 0.00 ? 97  LYS A HB3  5  
ATOM 10141 H HG2  . LYS A 1 97  ? 12.722  0.597   -2.969  1.00 0.00 ? 97  LYS A HG2  5  
ATOM 10142 H HG3  . LYS A 1 97  ? 11.450  0.159   -4.092  1.00 0.00 ? 97  LYS A HG3  5  
ATOM 10143 H HD2  . LYS A 1 97  ? 11.373  -1.614  -1.775  1.00 0.00 ? 97  LYS A HD2  5  
ATOM 10144 H HD3  . LYS A 1 97  ? 11.361  0.056   -1.242  1.00 0.00 ? 97  LYS A HD3  5  
ATOM 10145 H HE2  . LYS A 1 97  ? 9.399   0.568   -2.577  1.00 0.00 ? 97  LYS A HE2  5  
ATOM 10146 H HE3  . LYS A 1 97  ? 9.512   -0.947  -3.450  1.00 0.00 ? 97  LYS A HE3  5  
ATOM 10147 H HZ1  . LYS A 1 97  ? 8.455   -0.438  -0.840  1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 10148 H HZ2  . LYS A 1 97  ? 8.069   -1.610  -1.911  1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 10149 H HZ3  . LYS A 1 97  ? 9.368   -1.789  -0.938  1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 10150 N N    . GLU A 1 98  ? 11.590  -2.137  -6.412  1.00 0.00 ? 98  GLU A N    5  
ATOM 10151 C CA   . GLU A 1 98  ? 10.795  -1.864  -7.598  1.00 0.00 ? 98  GLU A CA   5  
ATOM 10152 C C    . GLU A 1 98  ? 9.621   -2.841  -7.686  1.00 0.00 ? 98  GLU A C    5  
ATOM 10153 O O    . GLU A 1 98  ? 8.481   -2.431  -7.900  1.00 0.00 ? 98  GLU A O    5  
ATOM 10154 C CB   . GLU A 1 98  ? 11.656  -1.925  -8.861  1.00 0.00 ? 98  GLU A CB   5  
ATOM 10155 C CG   . GLU A 1 98  ? 12.690  -0.798  -8.875  1.00 0.00 ? 98  GLU A CG   5  
ATOM 10156 C CD   . GLU A 1 98  ? 12.701  -0.080  -10.226 1.00 0.00 ? 98  GLU A CD   5  
ATOM 10157 O OE1  . GLU A 1 98  ? 13.458  -0.541  -11.107 1.00 0.00 ? 98  GLU A OE1  5  
ATOM 10158 O OE2  . GLU A 1 98  ? 11.952  0.913   -10.347 1.00 0.00 ? 98  GLU A OE2  5  
ATOM 10159 H H    . GLU A 1 98  ? 12.577  -2.171  -6.565  1.00 0.00 ? 98  GLU A H    5  
ATOM 10160 H HA   . GLU A 1 98  ? 10.422  -0.848  -7.469  1.00 0.00 ? 98  GLU A HA   5  
ATOM 10161 H HB2  . GLU A 1 98  ? 12.162  -2.889  -8.914  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 10162 H HB3  . GLU A 1 98  ? 11.020  -1.850  -9.743  1.00 0.00 ? 98  GLU A HB3  5  
ATOM 10163 H HG2  . GLU A 1 98  ? 12.466  -0.085  -8.082  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 10164 H HG3  . GLU A 1 98  ? 13.680  -1.205  -8.667  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 10165 N N    . ASP A 1 99  ? 9.940   -4.116  -7.518  1.00 0.00 ? 99  ASP A N    5  
ATOM 10166 C CA   . ASP A 1 99  ? 8.926   -5.155  -7.576  1.00 0.00 ? 99  ASP A CA   5  
ATOM 10167 C C    . ASP A 1 99  ? 7.891   -4.914  -6.476  1.00 0.00 ? 99  ASP A C    5  
ATOM 10168 O O    . ASP A 1 99  ? 6.738   -5.324  -6.602  1.00 0.00 ? 99  ASP A O    5  
ATOM 10169 C CB   . ASP A 1 99  ? 9.541   -6.538  -7.351  1.00 0.00 ? 99  ASP A CB   5  
ATOM 10170 C CG   . ASP A 1 99  ? 10.462  -7.026  -8.471  1.00 0.00 ? 99  ASP A CG   5  
ATOM 10171 O OD1  . ASP A 1 99  ? 11.053  -6.152  -9.141  1.00 0.00 ? 99  ASP A OD1  5  
ATOM 10172 O OD2  . ASP A 1 99  ? 10.556  -8.262  -8.631  1.00 0.00 ? 99  ASP A OD2  5  
ATOM 10173 H H    . ASP A 1 99  ? 10.869  -4.442  -7.344  1.00 0.00 ? 99  ASP A H    5  
ATOM 10174 H HA   . ASP A 1 99  ? 8.497   -5.082  -8.575  1.00 0.00 ? 99  ASP A HA   5  
ATOM 10175 H HB2  . ASP A 1 99  ? 10.105  -6.521  -6.418  1.00 0.00 ? 99  ASP A HB2  5  
ATOM 10176 H HB3  . ASP A 1 99  ? 8.735   -7.261  -7.223  1.00 0.00 ? 99  ASP A HB3  5  
ATOM 10177 N N    . ALA A 1 100 ? 8.339   -4.249  -5.421  1.00 0.00 ? 100 ALA A N    5  
ATOM 10178 C CA   . ALA A 1 100 ? 7.466   -3.948  -4.299  1.00 0.00 ? 100 ALA A CA   5  
ATOM 10179 C C    . ALA A 1 100 ? 6.598   -2.737  -4.645  1.00 0.00 ? 100 ALA A C    5  
ATOM 10180 O O    . ALA A 1 100 ? 5.409   -2.710  -4.331  1.00 0.00 ? 100 ALA A O    5  
ATOM 10181 C CB   . ALA A 1 100 ? 8.309   -3.722  -3.042  1.00 0.00 ? 100 ALA A CB   5  
ATOM 10182 H H    . ALA A 1 100 ? 9.279   -3.919  -5.326  1.00 0.00 ? 100 ALA A H    5  
ATOM 10183 H HA   . ALA A 1 100 ? 6.822   -4.813  -4.139  1.00 0.00 ? 100 ALA A HA   5  
ATOM 10184 H HB1  . ALA A 1 100 ? 7.652   -3.611  -2.179  1.00 0.00 ? 100 ALA A HB1  5  
ATOM 10185 H HB2  . ALA A 1 100 ? 8.969   -4.576  -2.889  1.00 0.00 ? 100 ALA A HB2  5  
ATOM 10186 H HB3  . ALA A 1 100 ? 8.906   -2.819  -3.163  1.00 0.00 ? 100 ALA A HB3  5  
ATOM 10187 N N    . ILE A 1 101 ? 7.227   -1.763  -5.287  1.00 0.00 ? 101 ILE A N    5  
ATOM 10188 C CA   . ILE A 1 101 ? 6.526   -0.551  -5.679  1.00 0.00 ? 101 ILE A CA   5  
ATOM 10189 C C    . ILE A 1 101 ? 5.457   -0.898  -6.717  1.00 0.00 ? 101 ILE A C    5  
ATOM 10190 O O    . ILE A 1 101 ? 4.294   -0.529  -6.562  1.00 0.00 ? 101 ILE A O    5  
ATOM 10191 C CB   . ILE A 1 101 ? 7.519   0.513   -6.151  1.00 0.00 ? 101 ILE A CB   5  
ATOM 10192 C CG1  . ILE A 1 101 ? 8.286   1.110   -4.969  1.00 0.00 ? 101 ILE A CG1  5  
ATOM 10193 C CG2  . ILE A 1 101 ? 6.817   1.589   -6.981  1.00 0.00 ? 101 ILE A CG2  5  
ATOM 10194 C CD1  . ILE A 1 101 ? 9.757   1.334   -5.326  1.00 0.00 ? 101 ILE A CD1  5  
ATOM 10195 H H    . ILE A 1 101 ? 8.194   -1.792  -5.538  1.00 0.00 ? 101 ILE A H    5  
ATOM 10196 H HA   . ILE A 1 101 ? 6.031   -0.159  -4.791  1.00 0.00 ? 101 ILE A HA   5  
ATOM 10197 H HB   . ILE A 1 101 ? 8.252   0.032   -6.800  1.00 0.00 ? 101 ILE A HB   5  
ATOM 10198 H HG12 . ILE A 1 101 ? 7.831   2.056   -4.677  1.00 0.00 ? 101 ILE A HG12 5  
ATOM 10199 H HG13 . ILE A 1 101 ? 8.214   0.443   -4.110  1.00 0.00 ? 101 ILE A HG13 5  
ATOM 10200 H HG21 . ILE A 1 101 ? 7.437   2.484   -7.014  1.00 0.00 ? 101 ILE A HG21 5  
ATOM 10201 H HG22 . ILE A 1 101 ? 6.657   1.219   -7.994  1.00 0.00 ? 101 ILE A HG22 5  
ATOM 10202 H HG23 . ILE A 1 101 ? 5.856   1.829   -6.526  1.00 0.00 ? 101 ILE A HG23 5  
ATOM 10203 H HD11 . ILE A 1 101 ? 9.827   2.046   -6.148  1.00 0.00 ? 101 ILE A HD11 5  
ATOM 10204 H HD12 . ILE A 1 101 ? 10.286  1.728   -4.458  1.00 0.00 ? 101 ILE A HD12 5  
ATOM 10205 H HD13 . ILE A 1 101 ? 10.206  0.387   -5.626  1.00 0.00 ? 101 ILE A HD13 5  
ATOM 10206 N N    . GLU A 1 102 ? 5.890   -1.604  -7.751  1.00 0.00 ? 102 GLU A N    5  
ATOM 10207 C CA   . GLU A 1 102 ? 4.984   -2.005  -8.814  1.00 0.00 ? 102 GLU A CA   5  
ATOM 10208 C C    . GLU A 1 102 ? 3.756   -2.705  -8.230  1.00 0.00 ? 102 GLU A C    5  
ATOM 10209 O O    . GLU A 1 102 ? 2.623   -2.368  -8.572  1.00 0.00 ? 102 GLU A O    5  
ATOM 10210 C CB   . GLU A 1 102 ? 5.694   -2.901  -9.831  1.00 0.00 ? 102 GLU A CB   5  
ATOM 10211 C CG   . GLU A 1 102 ? 6.973   -2.239  -10.347 1.00 0.00 ? 102 GLU A CG   5  
ATOM 10212 C CD   . GLU A 1 102 ? 7.024   -2.263  -11.876 1.00 0.00 ? 102 GLU A CD   5  
ATOM 10213 O OE1  . GLU A 1 102 ? 6.482   -1.310  -12.477 1.00 0.00 ? 102 GLU A OE1  5  
ATOM 10214 O OE2  . GLU A 1 102 ? 7.603   -3.233  -12.410 1.00 0.00 ? 102 GLU A OE2  5  
ATOM 10215 H H    . GLU A 1 102 ? 6.837   -1.900  -7.869  1.00 0.00 ? 102 GLU A H    5  
ATOM 10216 H HA   . GLU A 1 102 ? 4.684   -1.078  -9.304  1.00 0.00 ? 102 GLU A HA   5  
ATOM 10217 H HB2  . GLU A 1 102 ? 5.937   -3.859  -9.369  1.00 0.00 ? 102 GLU A HB2  5  
ATOM 10218 H HB3  . GLU A 1 102 ? 5.026   -3.111  -10.666 1.00 0.00 ? 102 GLU A HB3  5  
ATOM 10219 H HG2  . GLU A 1 102 ? 7.021   -1.209  -9.994  1.00 0.00 ? 102 GLU A HG2  5  
ATOM 10220 H HG3  . GLU A 1 102 ? 7.843   -2.755  -9.943  1.00 0.00 ? 102 GLU A HG3  5  
ATOM 10221 N N    . HIS A 1 103 ? 4.021   -3.667  -7.358  1.00 0.00 ? 103 HIS A N    5  
ATOM 10222 C CA   . HIS A 1 103 ? 2.952   -4.417  -6.722  1.00 0.00 ? 103 HIS A CA   5  
ATOM 10223 C C    . HIS A 1 103 ? 2.043   -3.460  -5.949  1.00 0.00 ? 103 HIS A C    5  
ATOM 10224 O O    . HIS A 1 103 ? 0.891   -3.786  -5.664  1.00 0.00 ? 103 HIS A O    5  
ATOM 10225 C CB   . HIS A 1 103 ? 3.519   -5.535  -5.845  1.00 0.00 ? 103 HIS A CB   5  
ATOM 10226 C CG   . HIS A 1 103 ? 2.602   -6.725  -5.697  1.00 0.00 ? 103 HIS A CG   5  
ATOM 10227 N ND1  . HIS A 1 103 ? 2.225   -7.519  -6.767  1.00 0.00 ? 103 HIS A ND1  5  
ATOM 10228 C CD2  . HIS A 1 103 ? 1.992   -7.249  -4.596  1.00 0.00 ? 103 HIS A CD2  5  
ATOM 10229 C CE1  . HIS A 1 103 ? 1.424   -8.473  -6.318  1.00 0.00 ? 103 HIS A CE1  5  
ATOM 10230 N NE2  . HIS A 1 103 ? 1.280   -8.304  -4.972  1.00 0.00 ? 103 HIS A NE2  5  
ATOM 10231 H H    . HIS A 1 103 ? 4.946   -3.935  -7.085  1.00 0.00 ? 103 HIS A H    5  
ATOM 10232 H HA   . HIS A 1 103 ? 2.378   -4.883  -7.523  1.00 0.00 ? 103 HIS A HA   5  
ATOM 10233 H HB2  . HIS A 1 103 ? 4.467   -5.869  -6.268  1.00 0.00 ? 103 HIS A HB2  5  
ATOM 10234 H HB3  . HIS A 1 103 ? 3.737   -5.132  -4.856  1.00 0.00 ? 103 HIS A HB3  5  
ATOM 10235 H HD1  . HIS A 1 103 ? 2.510   -7.393  -7.717  1.00 0.00 ? 103 HIS A HD1  5  
ATOM 10236 H HD2  . HIS A 1 103 ? 2.075   -6.866  -3.579  1.00 0.00 ? 103 HIS A HD2  5  
ATOM 10237 H HE1  . HIS A 1 103 ? 0.961   -9.256  -6.918  1.00 0.00 ? 103 HIS A HE1  5  
ATOM 10238 N N    . PHE A 1 104 ? 2.594   -2.298  -5.631  1.00 0.00 ? 104 PHE A N    5  
ATOM 10239 C CA   . PHE A 1 104 ? 1.847   -1.292  -4.896  1.00 0.00 ? 104 PHE A CA   5  
ATOM 10240 C C    . PHE A 1 104 ? 1.289   -0.225  -5.841  1.00 0.00 ? 104 PHE A C    5  
ATOM 10241 O O    . PHE A 1 104 ? 0.283   0.414   -5.535  1.00 0.00 ? 104 PHE A O    5  
ATOM 10242 C CB   . PHE A 1 104 ? 2.825   -0.632  -3.922  1.00 0.00 ? 104 PHE A CB   5  
ATOM 10243 C CG   . PHE A 1 104 ? 2.301   0.662   -3.295  1.00 0.00 ? 104 PHE A CG   5  
ATOM 10244 C CD1  . PHE A 1 104 ? 1.523   0.611   -2.180  1.00 0.00 ? 104 PHE A CD1  5  
ATOM 10245 C CD2  . PHE A 1 104 ? 2.613   1.863   -3.852  1.00 0.00 ? 104 PHE A CD2  5  
ATOM 10246 C CE1  . PHE A 1 104 ? 1.037   1.811   -1.599  1.00 0.00 ? 104 PHE A CE1  5  
ATOM 10247 C CE2  . PHE A 1 104 ? 2.126   3.063   -3.270  1.00 0.00 ? 104 PHE A CE2  5  
ATOM 10248 C CZ   . PHE A 1 104 ? 1.349   3.012   -2.156  1.00 0.00 ? 104 PHE A CZ   5  
ATOM 10249 H H    . PHE A 1 104 ? 3.531   -2.041  -5.867  1.00 0.00 ? 104 PHE A H    5  
ATOM 10250 H HA   . PHE A 1 104 ? 1.022   -1.801  -4.398  1.00 0.00 ? 104 PHE A HA   5  
ATOM 10251 H HB2  . PHE A 1 104 ? 3.063   -1.338  -3.127  1.00 0.00 ? 104 PHE A HB2  5  
ATOM 10252 H HB3  . PHE A 1 104 ? 3.756   -0.417  -4.447  1.00 0.00 ? 104 PHE A HB3  5  
ATOM 10253 H HD1  . PHE A 1 104 ? 1.274   -0.352  -1.734  1.00 0.00 ? 104 PHE A HD1  5  
ATOM 10254 H HD2  . PHE A 1 104 ? 3.236   1.904   -4.746  1.00 0.00 ? 104 PHE A HD2  5  
ATOM 10255 H HE1  . PHE A 1 104 ? 0.414   1.770   -0.705  1.00 0.00 ? 104 PHE A HE1  5  
ATOM 10256 H HE2  . PHE A 1 104 ? 2.376   4.026   -3.717  1.00 0.00 ? 104 PHE A HE2  5  
ATOM 10257 H HZ   . PHE A 1 104 ? 0.975   3.934   -1.709  1.00 0.00 ? 104 PHE A HZ   5  
ATOM 10258 N N    . MET A 1 105 ? 1.966   -0.066  -6.969  1.00 0.00 ? 105 MET A N    5  
ATOM 10259 C CA   . MET A 1 105 ? 1.550   0.912   -7.959  1.00 0.00 ? 105 MET A CA   5  
ATOM 10260 C C    . MET A 1 105 ? 0.493   0.326   -8.898  1.00 0.00 ? 105 MET A C    5  
ATOM 10261 O O    . MET A 1 105 ? -0.438  1.021   -9.302  1.00 0.00 ? 105 MET A O    5  
ATOM 10262 C CB   . MET A 1 105 ? 2.764   1.361   -8.775  1.00 0.00 ? 105 MET A CB   5  
ATOM 10263 C CG   . MET A 1 105 ? 3.334   2.673   -8.231  1.00 0.00 ? 105 MET A CG   5  
ATOM 10264 S SD   . MET A 1 105 ? 3.760   3.759   -9.582  1.00 0.00 ? 105 MET A SD   5  
ATOM 10265 C CE   . MET A 1 105 ? 4.764   2.656   -10.562 1.00 0.00 ? 105 MET A CE   5  
ATOM 10266 H H    . MET A 1 105 ? 2.782   -0.590  -7.209  1.00 0.00 ? 105 MET A H    5  
ATOM 10267 H HA   . MET A 1 105 ? 1.124   1.740   -7.393  1.00 0.00 ? 105 MET A HA   5  
ATOM 10268 H HB2  . MET A 1 105 ? 3.531   0.587   -8.747  1.00 0.00 ? 105 MET A HB2  5  
ATOM 10269 H HB3  . MET A 1 105 ? 2.478   1.489   -9.819  1.00 0.00 ? 105 MET A HB3  5  
ATOM 10270 H HG2  . MET A 1 105 ? 2.603   3.155   -7.582  1.00 0.00 ? 105 MET A HG2  5  
ATOM 10271 H HG3  . MET A 1 105 ? 4.216   2.471   -7.624  1.00 0.00 ? 105 MET A HG3  5  
ATOM 10272 H HE1  . MET A 1 105 ? 5.761   2.587   -10.126 1.00 0.00 ? 105 MET A HE1  5  
ATOM 10273 H HE2  . MET A 1 105 ? 4.307   1.667   -10.580 1.00 0.00 ? 105 MET A HE2  5  
ATOM 10274 H HE3  . MET A 1 105 ? 4.839   3.040   -11.580 1.00 0.00 ? 105 MET A HE3  5  
ATOM 10275 N N    . LYS A 1 106 ? 0.672   -0.947  -9.218  1.00 0.00 ? 106 LYS A N    5  
ATOM 10276 C CA   . LYS A 1 106 ? -0.255  -1.634  -10.101 1.00 0.00 ? 106 LYS A CA   5  
ATOM 10277 C C    . LYS A 1 106 ? -1.525  -1.987  -9.326  1.00 0.00 ? 106 LYS A C    5  
ATOM 10278 O O    . LYS A 1 106 ? -2.634  -1.746  -9.801  1.00 0.00 ? 106 LYS A O    5  
ATOM 10279 C CB   . LYS A 1 106 ? 0.423   -2.841  -10.754 1.00 0.00 ? 106 LYS A CB   5  
ATOM 10280 C CG   . LYS A 1 106 ? -0.579  -3.976  -10.979 1.00 0.00 ? 106 LYS A CG   5  
ATOM 10281 C CD   . LYS A 1 106 ? 0.121   -5.225  -11.520 1.00 0.00 ? 106 LYS A CD   5  
ATOM 10282 C CE   . LYS A 1 106 ? -0.357  -5.550  -12.937 1.00 0.00 ? 106 LYS A CE   5  
ATOM 10283 N NZ   . LYS A 1 106 ? -0.014  -6.946  -13.292 1.00 0.00 ? 106 LYS A NZ   5  
ATOM 10284 H H    . LYS A 1 106 ? 1.432   -1.506  -8.885  1.00 0.00 ? 106 LYS A H    5  
ATOM 10285 H HA   . LYS A 1 106 ? -0.519  -0.942  -10.901 1.00 0.00 ? 106 LYS A HA   5  
ATOM 10286 H HB2  . LYS A 1 106 ? 0.863   -2.546  -11.706 1.00 0.00 ? 106 LYS A HB2  5  
ATOM 10287 H HB3  . LYS A 1 106 ? 1.238   -3.191  -10.122 1.00 0.00 ? 106 LYS A HB3  5  
ATOM 10288 H HG2  . LYS A 1 106 ? -1.081  -4.214  -10.042 1.00 0.00 ? 106 LYS A HG2  5  
ATOM 10289 H HG3  . LYS A 1 106 ? -1.348  -3.653  -11.680 1.00 0.00 ? 106 LYS A HG3  5  
ATOM 10290 H HD2  . LYS A 1 106 ? 1.200   -5.069  -11.523 1.00 0.00 ? 106 LYS A HD2  5  
ATOM 10291 H HD3  . LYS A 1 106 ? -0.077  -6.071  -10.863 1.00 0.00 ? 106 LYS A HD3  5  
ATOM 10292 H HE2  . LYS A 1 106 ? -1.435  -5.405  -13.006 1.00 0.00 ? 106 LYS A HE2  5  
ATOM 10293 H HE3  . LYS A 1 106 ? 0.103   -4.865  -13.649 1.00 0.00 ? 106 LYS A HE3  5  
ATOM 10294 H HZ1  . LYS A 1 106 ? 0.965   -7.010  -13.483 1.00 0.00 ? 106 LYS A HZ1  5  
ATOM 10295 H HZ2  . LYS A 1 106 ? -0.246  -7.550  -12.529 1.00 0.00 ? 106 LYS A HZ2  5  
ATOM 10296 H HZ3  . LYS A 1 106 ? -0.531  -7.220  -14.103 1.00 0.00 ? 106 LYS A HZ3  5  
ATOM 10297 N N    . LEU A 1 107 ? -1.322  -2.554  -8.145  1.00 0.00 ? 107 LEU A N    5  
ATOM 10298 C CA   . LEU A 1 107 ? -2.437  -2.942  -7.299  1.00 0.00 ? 107 LEU A CA   5  
ATOM 10299 C C    . LEU A 1 107 ? -3.395  -1.758  -7.150  1.00 0.00 ? 107 LEU A C    5  
ATOM 10300 O O    . LEU A 1 107 ? -4.586  -1.879  -7.430  1.00 0.00 ? 107 LEU A O    5  
ATOM 10301 C CB   . LEU A 1 107 ? -1.931  -3.496  -5.966  1.00 0.00 ? 107 LEU A CB   5  
ATOM 10302 C CG   . LEU A 1 107 ? -1.504  -4.965  -5.969  1.00 0.00 ? 107 LEU A CG   5  
ATOM 10303 C CD1  . LEU A 1 107 ? -1.156  -5.438  -4.557  1.00 0.00 ? 107 LEU A CD1  5  
ATOM 10304 C CD2  . LEU A 1 107 ? -2.572  -5.846  -6.622  1.00 0.00 ? 107 LEU A CD2  5  
ATOM 10305 H H    . LEU A 1 107 ? -0.417  -2.747  -7.766  1.00 0.00 ? 107 LEU A H    5  
ATOM 10306 H HA   . LEU A 1 107 ? -2.965  -3.751  -7.805  1.00 0.00 ? 107 LEU A HA   5  
ATOM 10307 H HB2  . LEU A 1 107 ? -1.083  -2.892  -5.643  1.00 0.00 ? 107 LEU A HB2  5  
ATOM 10308 H HB3  . LEU A 1 107 ? -2.716  -3.368  -5.221  1.00 0.00 ? 107 LEU A HB3  5  
ATOM 10309 H HG   . LEU A 1 107 ? -0.600  -5.057  -6.571  1.00 0.00 ? 107 LEU A HG   5  
ATOM 10310 H HD11 . LEU A 1 107 ? -1.328  -6.512  -4.480  1.00 0.00 ? 107 LEU A HD11 5  
ATOM 10311 H HD12 . LEU A 1 107 ? -0.108  -5.222  -4.349  1.00 0.00 ? 107 LEU A HD12 5  
ATOM 10312 H HD13 . LEU A 1 107 ? -1.784  -4.917  -3.834  1.00 0.00 ? 107 LEU A HD13 5  
ATOM 10313 H HD21 . LEU A 1 107 ? -2.245  -6.132  -7.622  1.00 0.00 ? 107 LEU A HD21 5  
ATOM 10314 H HD22 . LEU A 1 107 ? -2.723  -6.741  -6.019  1.00 0.00 ? 107 LEU A HD22 5  
ATOM 10315 H HD23 . LEU A 1 107 ? -3.508  -5.291  -6.690  1.00 0.00 ? 107 LEU A HD23 5  
ATOM 10316 N N    . TYR A 1 108 ? -2.838  -0.640  -6.707  1.00 0.00 ? 108 TYR A N    5  
ATOM 10317 C CA   . TYR A 1 108 ? -3.627  0.565   -6.517  1.00 0.00 ? 108 TYR A CA   5  
ATOM 10318 C C    . TYR A 1 108 ? -4.180  1.075   -7.849  1.00 0.00 ? 108 TYR A C    5  
ATOM 10319 O O    . TYR A 1 108 ? -5.021  1.972   -7.874  1.00 0.00 ? 108 TYR A O    5  
ATOM 10320 C CB   . TYR A 1 108 ? -2.669  1.610   -5.942  1.00 0.00 ? 108 TYR A CB   5  
ATOM 10321 C CG   . TYR A 1 108 ? -3.346  2.924   -5.547  1.00 0.00 ? 108 TYR A CG   5  
ATOM 10322 C CD1  . TYR A 1 108 ? -3.895  3.066   -4.288  1.00 0.00 ? 108 TYR A CD1  5  
ATOM 10323 C CD2  . TYR A 1 108 ? -3.409  3.967   -6.448  1.00 0.00 ? 108 TYR A CD2  5  
ATOM 10324 C CE1  . TYR A 1 108 ? -4.532  4.302   -3.916  1.00 0.00 ? 108 TYR A CE1  5  
ATOM 10325 C CE2  . TYR A 1 108 ? -4.046  5.203   -6.076  1.00 0.00 ? 108 TYR A CE2  5  
ATOM 10326 C CZ   . TYR A 1 108 ? -4.576  5.310   -4.828  1.00 0.00 ? 108 TYR A CZ   5  
ATOM 10327 O OH   . TYR A 1 108 ? -5.178  6.478   -4.476  1.00 0.00 ? 108 TYR A OH   5  
ATOM 10328 H H    . TYR A 1 108 ? -1.868  -0.550  -6.481  1.00 0.00 ? 108 TYR A H    5  
ATOM 10329 H HA   . TYR A 1 108 ? -4.459  0.321   -5.856  1.00 0.00 ? 108 TYR A HA   5  
ATOM 10330 H HB2  . TYR A 1 108 ? -2.173  1.191   -5.067  1.00 0.00 ? 108 TYR A HB2  5  
ATOM 10331 H HB3  . TYR A 1 108 ? -1.893  1.820   -6.678  1.00 0.00 ? 108 TYR A HB3  5  
ATOM 10332 H HD1  . TYR A 1 108 ? -3.846  2.242   -3.576  1.00 0.00 ? 108 TYR A HD1  5  
ATOM 10333 H HD2  . TYR A 1 108 ? -2.975  3.855   -7.442  1.00 0.00 ? 108 TYR A HD2  5  
ATOM 10334 H HE1  . TYR A 1 108 ? -4.969  4.428   -2.925  1.00 0.00 ? 108 TYR A HE1  5  
ATOM 10335 H HE2  . TYR A 1 108 ? -4.102  6.035   -6.778  1.00 0.00 ? 108 TYR A HE2  5  
ATOM 10336 H HH   . TYR A 1 108 ? -6.076  6.293   -4.078  1.00 0.00 ? 108 TYR A HH   5  
ATOM 10337 N N    . GLU A 1 109 ? -3.685  0.480   -8.925  1.00 0.00 ? 109 GLU A N    5  
ATOM 10338 C CA   . GLU A 1 109 ? -4.119  0.863   -10.258 1.00 0.00 ? 109 GLU A CA   5  
ATOM 10339 C C    . GLU A 1 109 ? -5.229  -0.072  -10.743 1.00 0.00 ? 109 GLU A C    5  
ATOM 10340 O O    . GLU A 1 109 ? -5.998  0.283   -11.636 1.00 0.00 ? 109 GLU A O    5  
ATOM 10341 C CB   . GLU A 1 109 ? -2.942  0.871   -11.236 1.00 0.00 ? 109 GLU A CB   5  
ATOM 10342 C CG   . GLU A 1 109 ? -3.431  1.000   -12.680 1.00 0.00 ? 109 GLU A CG   5  
ATOM 10343 C CD   . GLU A 1 109 ? -2.259  0.954   -13.662 1.00 0.00 ? 109 GLU A CD   5  
ATOM 10344 O OE1  . GLU A 1 109 ? -1.334  1.776   -13.481 1.00 0.00 ? 109 GLU A OE1  5  
ATOM 10345 O OE2  . GLU A 1 109 ? -2.313  0.098   -14.571 1.00 0.00 ? 109 GLU A OE2  5  
ATOM 10346 H H    . GLU A 1 109 ? -3.001  -0.249  -8.896  1.00 0.00 ? 109 GLU A H    5  
ATOM 10347 H HA   . GLU A 1 109 ? -4.506  1.876   -10.157 1.00 0.00 ? 109 GLU A HA   5  
ATOM 10348 H HB2  . GLU A 1 109 ? -2.274  1.698   -10.999 1.00 0.00 ? 109 GLU A HB2  5  
ATOM 10349 H HB3  . GLU A 1 109 ? -2.365  -0.047  -11.125 1.00 0.00 ? 109 GLU A HB3  5  
ATOM 10350 H HG2  . GLU A 1 109 ? -4.130  0.195   -12.905 1.00 0.00 ? 109 GLU A HG2  5  
ATOM 10351 H HG3  . GLU A 1 109 ? -3.975  1.937   -12.801 1.00 0.00 ? 109 GLU A HG3  5  
ATOM 10352 N N    . GLU A 1 110 ? -5.278  -1.247  -10.134 1.00 0.00 ? 110 GLU A N    5  
ATOM 10353 C CA   . GLU A 1 110 ? -6.281  -2.235  -10.493 1.00 0.00 ? 110 GLU A CA   5  
ATOM 10354 C C    . GLU A 1 110 ? -7.591  -1.955  -9.753  1.00 0.00 ? 110 GLU A C    5  
ATOM 10355 O O    . GLU A 1 110 ? -8.670  -2.060  -10.333 1.00 0.00 ? 110 GLU A O    5  
ATOM 10356 C CB   . GLU A 1 110 ? -5.782  -3.653  -10.207 1.00 0.00 ? 110 GLU A CB   5  
ATOM 10357 C CG   . GLU A 1 110 ? -6.270  -4.141  -8.842  1.00 0.00 ? 110 GLU A CG   5  
ATOM 10358 C CD   . GLU A 1 110 ? -5.842  -5.588  -8.592  1.00 0.00 ? 110 GLU A CD   5  
ATOM 10359 O OE1  . GLU A 1 110 ? -4.819  -5.988  -9.187  1.00 0.00 ? 110 GLU A OE1  5  
ATOM 10360 O OE2  . GLU A 1 110 ? -6.549  -6.262  -7.811  1.00 0.00 ? 110 GLU A OE2  5  
ATOM 10361 H H    . GLU A 1 110 ? -4.649  -1.528  -9.409  1.00 0.00 ? 110 GLU A H    5  
ATOM 10362 H HA   . GLU A 1 110 ? -6.431  -2.119  -11.567 1.00 0.00 ? 110 GLU A HA   5  
ATOM 10363 H HB2  . GLU A 1 110 ? -6.133  -4.330  -10.986 1.00 0.00 ? 110 GLU A HB2  5  
ATOM 10364 H HB3  . GLU A 1 110 ? -4.692  -3.671  -10.236 1.00 0.00 ? 110 GLU A HB3  5  
ATOM 10365 H HG2  . GLU A 1 110 ? -5.869  -3.499  -8.058  1.00 0.00 ? 110 GLU A HG2  5  
ATOM 10366 H HG3  . GLU A 1 110 ? -7.356  -4.065  -8.792  1.00 0.00 ? 110 GLU A HG3  5  
ATOM 10367 N N    . LYS A 1 111 ? -7.452  -1.604  -8.483  1.00 0.00 ? 111 LYS A N    5  
ATOM 10368 C CA   . LYS A 1 111 ? -8.610  -1.308  -7.657  1.00 0.00 ? 111 LYS A CA   5  
ATOM 10369 C C    . LYS A 1 111 ? -9.308  -0.057  -8.195  1.00 0.00 ? 111 LYS A C    5  
ATOM 10370 O O    . LYS A 1 111 ? -10.457 -0.120  -8.628  1.00 0.00 ? 111 LYS A O    5  
ATOM 10371 C CB   . LYS A 1 111 ? -8.206  -1.203  -6.186  1.00 0.00 ? 111 LYS A CB   5  
ATOM 10372 C CG   . LYS A 1 111 ? -7.639  -2.529  -5.676  1.00 0.00 ? 111 LYS A CG   5  
ATOM 10373 C CD   . LYS A 1 111 ? -8.756  -3.547  -5.435  1.00 0.00 ? 111 LYS A CD   5  
ATOM 10374 C CE   . LYS A 1 111 ? -8.180  -4.934  -5.145  1.00 0.00 ? 111 LYS A CE   5  
ATOM 10375 N NZ   . LYS A 1 111 ? -9.052  -5.670  -4.202  1.00 0.00 ? 111 LYS A NZ   5  
ATOM 10376 H H    . LYS A 1 111 ? -6.570  -1.521  -8.019  1.00 0.00 ? 111 LYS A H    5  
ATOM 10377 H HA   . LYS A 1 111 ? -9.297  -2.150  -7.744  1.00 0.00 ? 111 LYS A HA   5  
ATOM 10378 H HB2  . LYS A 1 111 ? -7.463  -0.415  -6.063  1.00 0.00 ? 111 LYS A HB2  5  
ATOM 10379 H HB3  . LYS A 1 111 ? -9.072  -0.919  -5.587  1.00 0.00 ? 111 LYS A HB3  5  
ATOM 10380 H HG2  . LYS A 1 111 ? -6.930  -2.928  -6.402  1.00 0.00 ? 111 LYS A HG2  5  
ATOM 10381 H HG3  . LYS A 1 111 ? -7.088  -2.362  -4.751  1.00 0.00 ? 111 LYS A HG3  5  
ATOM 10382 H HD2  . LYS A 1 111 ? -9.373  -3.223  -4.597  1.00 0.00 ? 111 LYS A HD2  5  
ATOM 10383 H HD3  . LYS A 1 111 ? -9.405  -3.594  -6.309  1.00 0.00 ? 111 LYS A HD3  5  
ATOM 10384 H HE2  . LYS A 1 111 ? -8.084  -5.496  -6.074  1.00 0.00 ? 111 LYS A HE2  5  
ATOM 10385 H HE3  . LYS A 1 111 ? -7.179  -4.839  -4.725  1.00 0.00 ? 111 LYS A HE3  5  
ATOM 10386 H HZ1  . LYS A 1 111 ? -8.643  -6.559  -3.995  1.00 0.00 ? 111 LYS A HZ1  5  
ATOM 10387 H HZ2  . LYS A 1 111 ? -9.149  -5.143  -3.358  1.00 0.00 ? 111 LYS A HZ2  5  
ATOM 10388 H HZ3  . LYS A 1 111 ? -9.952  -5.805  -4.616  1.00 0.00 ? 111 LYS A HZ3  5  
ATOM 10389 N N    . THR A 1 112 ? -8.583  1.051   -8.149  1.00 0.00 ? 112 THR A N    5  
ATOM 10390 C CA   . THR A 1 112 ? -9.118  2.316   -8.626  1.00 0.00 ? 112 THR A CA   5  
ATOM 10391 C C    . THR A 1 112 ? -9.254  2.296   -10.150 1.00 0.00 ? 112 THR A C    5  
ATOM 10392 O O    . THR A 1 112 ? -10.223 2.821   -10.697 1.00 0.00 ? 112 THR A O    5  
ATOM 10393 C CB   . THR A 1 112 ? -8.213  3.436   -8.110  1.00 0.00 ? 112 THR A CB   5  
ATOM 10394 O OG1  . THR A 1 112 ? -7.034  3.322   -8.901  1.00 0.00 ? 112 THR A OG1  5  
ATOM 10395 C CG2  . THR A 1 112 ? -7.729  3.187   -6.680  1.00 0.00 ? 112 THR A CG2  5  
ATOM 10396 H H    . THR A 1 112 ? -7.649  1.095   -7.795  1.00 0.00 ? 112 THR A H    5  
ATOM 10397 H HA   . THR A 1 112 ? -10.121 2.440   -8.217  1.00 0.00 ? 112 THR A HA   5  
ATOM 10398 H HB   . THR A 1 112 ? -8.708  4.404   -8.191  1.00 0.00 ? 112 THR A HB   5  
ATOM 10399 H HG1  . THR A 1 112 ? -6.712  2.375   -8.901  1.00 0.00 ? 112 THR A HG1  5  
ATOM 10400 H HG21 . THR A 1 112 ? -8.331  2.401   -6.225  1.00 0.00 ? 112 THR A HG21 5  
ATOM 10401 H HG22 . THR A 1 112 ? -6.684  2.880   -6.699  1.00 0.00 ? 112 THR A HG22 5  
ATOM 10402 H HG23 . THR A 1 112 ? -7.828  4.103   -6.098  1.00 0.00 ? 112 THR A HG23 5  
ATOM 10403 N N    . GLY A 1 113 ? -8.268  1.686   -10.792 1.00 0.00 ? 113 GLY A N    5  
ATOM 10404 C CA   . GLY A 1 113 ? -8.265  1.592   -12.242 1.00 0.00 ? 113 GLY A CA   5  
ATOM 10405 C C    . GLY A 1 113 ? -7.319  2.625   -12.856 1.00 0.00 ? 113 GLY A C    5  
ATOM 10406 O O    . GLY A 1 113 ? -6.869  2.464   -13.990 1.00 0.00 ? 113 GLY A O    5  
ATOM 10407 H H    . GLY A 1 113 ? -7.484  1.262   -10.339 1.00 0.00 ? 113 GLY A H    5  
ATOM 10408 H HA2  . GLY A 1 113 ? -7.961  0.590   -12.544 1.00 0.00 ? 113 GLY A HA2  5  
ATOM 10409 H HA3  . GLY A 1 113 ? -9.275  1.747   -12.622 1.00 0.00 ? 113 GLY A HA3  5  
ATOM 10410 N N    . ASN A 1 114 ? -7.045  3.665   -12.082 1.00 0.00 ? 114 ASN A N    5  
ATOM 10411 C CA   . ASN A 1 114 ? -6.161  4.724   -12.536 1.00 0.00 ? 114 ASN A CA   5  
ATOM 10412 C C    . ASN A 1 114 ? -4.774  4.522   -11.923 1.00 0.00 ? 114 ASN A C    5  
ATOM 10413 O O    . ASN A 1 114 ? -4.646  3.954   -10.839 1.00 0.00 ? 114 ASN A O    5  
ATOM 10414 C CB   . ASN A 1 114 ? -6.676  6.097   -12.098 1.00 0.00 ? 114 ASN A CB   5  
ATOM 10415 C CG   . ASN A 1 114 ? -8.103  6.000   -11.555 1.00 0.00 ? 114 ASN A CG   5  
ATOM 10416 O OD1  . ASN A 1 114 ? -8.346  6.063   -10.361 1.00 0.00 ? 114 ASN A OD1  5  
ATOM 10417 N ND2  . ASN A 1 114 ? -9.030  5.842   -12.496 1.00 0.00 ? 114 ASN A ND2  5  
ATOM 10418 H H    . ASN A 1 114 ? -7.415  3.789   -11.161 1.00 0.00 ? 114 ASN A H    5  
ATOM 10419 H HA   . ASN A 1 114 ? -6.152  4.644   -13.623 1.00 0.00 ? 114 ASN A HA   5  
ATOM 10420 H HB2  . ASN A 1 114 ? -6.019  6.508   -11.332 1.00 0.00 ? 114 ASN A HB2  5  
ATOM 10421 H HB3  . ASN A 1 114 ? -6.650  6.785   -12.943 1.00 0.00 ? 114 ASN A HB3  5  
ATOM 10422 H HD21 . ASN A 1 114 ? -8.763  5.798   -13.459 1.00 0.00 ? 114 ASN A HD21 5  
ATOM 10423 H HD22 . ASN A 1 114 ? -9.994  5.768   -12.241 1.00 0.00 ? 114 ASN A HD22 5  
ATOM 10424 N N    . ALA A 1 115 ? -3.769  4.999   -12.643 1.00 0.00 ? 115 ALA A N    5  
ATOM 10425 C CA   . ALA A 1 115 ? -2.395  4.878   -12.184 1.00 0.00 ? 115 ALA A CA   5  
ATOM 10426 C C    . ALA A 1 115 ? -2.235  5.634   -10.864 1.00 0.00 ? 115 ALA A C    5  
ATOM 10427 O O    . ALA A 1 115 ? -2.992  6.561   -10.580 1.00 0.00 ? 115 ALA A O    5  
ATOM 10428 C CB   . ALA A 1 115 ? -1.447  5.391   -13.269 1.00 0.00 ? 115 ALA A CB   5  
ATOM 10429 H H    . ALA A 1 115 ? -3.881  5.459   -13.524 1.00 0.00 ? 115 ALA A H    5  
ATOM 10430 H HA   . ALA A 1 115 ? -2.194  3.820   -12.014 1.00 0.00 ? 115 ALA A HA   5  
ATOM 10431 H HB1  . ALA A 1 115 ? -1.179  6.426   -13.057 1.00 0.00 ? 115 ALA A HB1  5  
ATOM 10432 H HB2  . ALA A 1 115 ? -0.546  4.778   -13.284 1.00 0.00 ? 115 ALA A HB2  5  
ATOM 10433 H HB3  . ALA A 1 115 ? -1.940  5.335   -14.239 1.00 0.00 ? 115 ALA A HB3  5  
ATOM 10434 N N    . TRP A 1 116 ? -1.246  5.210   -10.092 1.00 0.00 ? 116 TRP A N    5  
ATOM 10435 C CA   . TRP A 1 116 ? -0.977  5.835   -8.808  1.00 0.00 ? 116 TRP A CA   5  
ATOM 10436 C C    . TRP A 1 116 ? -0.278  7.171   -9.070  1.00 0.00 ? 116 TRP A C    5  
ATOM 10437 O O    . TRP A 1 116 ? -0.518  8.150   -8.366  1.00 0.00 ? 116 TRP A O    5  
ATOM 10438 C CB   . TRP A 1 116 ? -0.166  4.905   -7.904  1.00 0.00 ? 116 TRP A CB   5  
ATOM 10439 C CG   . TRP A 1 116 ? 0.679   5.634   -6.858  1.00 0.00 ? 116 TRP A CG   5  
ATOM 10440 C CD1  . TRP A 1 116 ? 1.805   6.335   -7.050  1.00 0.00 ? 116 TRP A CD1  5  
ATOM 10441 C CD2  . TRP A 1 116 ? 0.418   5.706   -5.440  1.00 0.00 ? 116 TRP A CD2  5  
ATOM 10442 N NE1  . TRP A 1 116 ? 2.287   6.851   -5.864  1.00 0.00 ? 116 TRP A NE1  5  
ATOM 10443 C CE2  . TRP A 1 116 ? 1.417   6.457   -4.854  1.00 0.00 ? 116 TRP A CE2  5  
ATOM 10444 C CE3  . TRP A 1 116 ? -0.627  5.156   -4.678  1.00 0.00 ? 116 TRP A CE3  5  
ATOM 10445 C CZ2  . TRP A 1 116 ? 1.470   6.726   -3.481  1.00 0.00 ? 116 TRP A CZ2  5  
ATOM 10446 C CZ3  . TRP A 1 116 ? -0.560  5.433   -3.307  1.00 0.00 ? 116 TRP A CZ3  5  
ATOM 10447 C CH2  . TRP A 1 116 ? 0.439   6.187   -2.702  1.00 0.00 ? 116 TRP A CH2  5  
ATOM 10448 H H    . TRP A 1 116 ? -0.635  4.454   -10.330 1.00 0.00 ? 116 TRP A H    5  
ATOM 10449 H HA   . TRP A 1 116 ? -1.933  6.006   -8.314  1.00 0.00 ? 116 TRP A HA   5  
ATOM 10450 H HB2  . TRP A 1 116 ? -0.850  4.225   -7.394  1.00 0.00 ? 116 TRP A HB2  5  
ATOM 10451 H HB3  . TRP A 1 116 ? 0.489   4.292   -8.523  1.00 0.00 ? 116 TRP A HB3  5  
ATOM 10452 H HD1  . TRP A 1 116 ? 2.280   6.478   -8.020  1.00 0.00 ? 116 TRP A HD1  5  
ATOM 10453 H HE1  . TRP A 1 116 ? 3.185   7.457   -5.742  1.00 0.00 ? 116 TRP A HE1  5  
ATOM 10454 H HE3  . TRP A 1 116 ? -1.427  4.559   -5.116  1.00 0.00 ? 116 TRP A HE3  5  
ATOM 10455 H HZ2  . TRP A 1 116 ? 2.270   7.322   -3.043  1.00 0.00 ? 116 TRP A HZ2  5  
ATOM 10456 H HZ3  . TRP A 1 116 ? -1.347  5.030   -2.669  1.00 0.00 ? 116 TRP A HZ3  5  
ATOM 10457 H HH2  . TRP A 1 116 ? 0.419   6.359   -1.626  1.00 0.00 ? 116 TRP A HH2  5  
ATOM 10458 N N    . HIS A 1 117 ? 0.573   7.168   -10.086 1.00 0.00 ? 117 HIS A N    5  
ATOM 10459 C CA   . HIS A 1 117 ? 1.308   8.367   -10.450 1.00 0.00 ? 117 HIS A CA   5  
ATOM 10460 C C    . HIS A 1 117 ? 0.661   9.013   -11.677 1.00 0.00 ? 117 HIS A C    5  
ATOM 10461 O O    . HIS A 1 117 ? 1.316   9.207   -12.700 1.00 0.00 ? 117 HIS A O    5  
ATOM 10462 C CB   . HIS A 1 117 ? 2.791   8.054   -10.658 1.00 0.00 ? 117 HIS A CB   5  
ATOM 10463 C CG   . HIS A 1 117 ? 3.712   8.788   -9.714  1.00 0.00 ? 117 HIS A CG   5  
ATOM 10464 N ND1  . HIS A 1 117 ? 3.321   9.195   -8.450  1.00 0.00 ? 117 HIS A ND1  5  
ATOM 10465 C CD2  . HIS A 1 117 ? 5.009   9.183   -9.862  1.00 0.00 ? 117 HIS A CD2  5  
ATOM 10466 C CE1  . HIS A 1 117 ? 4.344   9.807   -7.873  1.00 0.00 ? 117 HIS A CE1  5  
ATOM 10467 N NE2  . HIS A 1 117 ? 5.389   9.799   -8.749  1.00 0.00 ? 117 HIS A NE2  5  
ATOM 10468 H H    . HIS A 1 117 ? 0.762   6.367   -10.655 1.00 0.00 ? 117 HIS A H    5  
ATOM 10469 H HA   . HIS A 1 117 ? 1.228   9.052   -9.606  1.00 0.00 ? 117 HIS A HA   5  
ATOM 10470 H HB2  . HIS A 1 117 ? 2.945   6.981   -10.539 1.00 0.00 ? 117 HIS A HB2  5  
ATOM 10471 H HB3  . HIS A 1 117 ? 3.064   8.303   -11.684 1.00 0.00 ? 117 HIS A HB3  5  
ATOM 10472 H HD1  . HIS A 1 117 ? 2.419   9.052   -8.043  1.00 0.00 ? 117 HIS A HD1  5  
ATOM 10473 H HD2  . HIS A 1 117 ? 5.628   9.020   -10.744 1.00 0.00 ? 117 HIS A HD2  5  
ATOM 10474 H HE1  . HIS A 1 117 ? 4.350   10.241  -6.873  1.00 0.00 ? 117 HIS A HE1  5  
ATOM 10475 N N    . SER A 1 118 ? -0.619  9.328   -11.535 1.00 0.00 ? 118 SER A N    5  
ATOM 10476 C CA   . SER A 1 118 ? -1.362  9.948   -12.619 1.00 0.00 ? 118 SER A CA   5  
ATOM 10477 C C    . SER A 1 118 ? -2.110  11.179  -12.103 1.00 0.00 ? 118 SER A C    5  
ATOM 10478 O O    . SER A 1 118 ? -2.265  11.355  -10.895 1.00 0.00 ? 118 SER A O    5  
ATOM 10479 C CB   . SER A 1 118 ? -2.341  8.958   -13.252 1.00 0.00 ? 118 SER A CB   5  
ATOM 10480 O OG   . SER A 1 118 ? -1.974  8.626   -14.588 1.00 0.00 ? 118 SER A OG   5  
ATOM 10481 H H    . SER A 1 118 ? -1.145  9.167   -10.700 1.00 0.00 ? 118 SER A H    5  
ATOM 10482 H HA   . SER A 1 118 ? -0.611  10.237  -13.355 1.00 0.00 ? 118 SER A HA   5  
ATOM 10483 H HB2  . SER A 1 118 ? -2.379  8.050   -12.650 1.00 0.00 ? 118 SER A HB2  5  
ATOM 10484 H HB3  . SER A 1 118 ? -3.343  9.386   -13.247 1.00 0.00 ? 118 SER A HB3  5  
ATOM 10485 H HG   . SER A 1 118 ? -1.038  8.276   -14.610 1.00 0.00 ? 118 SER A HG   5  
ATOM 10486 N N    . LYS A 1 119 ? -2.555  11.999  -13.044 1.00 0.00 ? 119 LYS A N    5  
ATOM 10487 C CA   . LYS A 1 119 ? -3.284  13.208  -12.700 1.00 0.00 ? 119 LYS A CA   5  
ATOM 10488 C C    . LYS A 1 119 ? -4.764  13.021  -13.042 1.00 0.00 ? 119 LYS A C    5  
ATOM 10489 O O    . LYS A 1 119 ? -5.109  12.207  -13.897 1.00 0.00 ? 119 LYS A O    5  
ATOM 10490 C CB   . LYS A 1 119 ? -2.647  14.427  -13.370 1.00 0.00 ? 119 LYS A CB   5  
ATOM 10491 C CG   . LYS A 1 119 ? -1.405  14.887  -12.604 1.00 0.00 ? 119 LYS A CG   5  
ATOM 10492 C CD   . LYS A 1 119 ? -1.430  16.399  -12.377 1.00 0.00 ? 119 LYS A CD   5  
ATOM 10493 C CE   . LYS A 1 119 ? -0.892  16.754  -10.989 1.00 0.00 ? 119 LYS A CE   5  
ATOM 10494 N NZ   . LYS A 1 119 ? -1.985  17.249  -10.121 1.00 0.00 ? 119 LYS A NZ   5  
ATOM 10495 H H    . LYS A 1 119 ? -2.426  11.848  -14.024 1.00 0.00 ? 119 LYS A H    5  
ATOM 10496 H HA   . LYS A 1 119 ? -3.194  13.348  -11.623 1.00 0.00 ? 119 LYS A HA   5  
ATOM 10497 H HB2  . LYS A 1 119 ? -2.375  14.182  -14.397 1.00 0.00 ? 119 LYS A HB2  5  
ATOM 10498 H HB3  . LYS A 1 119 ? -3.371  15.240  -13.418 1.00 0.00 ? 119 LYS A HB3  5  
ATOM 10499 H HG2  . LYS A 1 119 ? -1.354  14.372  -11.644 1.00 0.00 ? 119 LYS A HG2  5  
ATOM 10500 H HG3  . LYS A 1 119 ? -0.508  14.613  -13.160 1.00 0.00 ? 119 LYS A HG3  5  
ATOM 10501 H HD2  . LYS A 1 119 ? -0.830  16.895  -13.140 1.00 0.00 ? 119 LYS A HD2  5  
ATOM 10502 H HD3  . LYS A 1 119 ? -2.449  16.770  -12.482 1.00 0.00 ? 119 LYS A HD3  5  
ATOM 10503 H HE2  . LYS A 1 119 ? -0.430  15.878  -10.536 1.00 0.00 ? 119 LYS A HE2  5  
ATOM 10504 H HE3  . LYS A 1 119 ? -0.117  17.515  -11.076 1.00 0.00 ? 119 LYS A HE3  5  
ATOM 10505 H HZ1  . LYS A 1 119 ? -1.606  17.548  -9.245  1.00 0.00 ? 119 LYS A HZ1  5  
ATOM 10506 H HZ2  . LYS A 1 119 ? -2.441  18.020  -10.567 1.00 0.00 ? 119 LYS A HZ2  5  
ATOM 10507 H HZ3  . LYS A 1 119 ? -2.646  16.515  -9.966  1.00 0.00 ? 119 LYS A HZ3  5  
ATOM 10508 N N    . ASN A 1 120 ? -5.598  13.790  -12.358 1.00 0.00 ? 120 ASN A N    5  
ATOM 10509 C CA   . ASN A 1 120 ? -7.032  13.720  -12.579 1.00 0.00 ? 120 ASN A CA   5  
ATOM 10510 C C    . ASN A 1 120 ? -7.528  12.313  -12.237 1.00 0.00 ? 120 ASN A C    5  
ATOM 10511 O O    . ASN A 1 120 ? -7.079  11.332  -12.827 1.00 0.00 ? 120 ASN A O    5  
ATOM 10512 C CB   . ASN A 1 120 ? -7.378  14.000  -14.043 1.00 0.00 ? 120 ASN A CB   5  
ATOM 10513 C CG   . ASN A 1 120 ? -8.892  14.113  -14.236 1.00 0.00 ? 120 ASN A CG   5  
ATOM 10514 O OD1  . ASN A 1 120 ? -9.614  13.131  -14.274 1.00 0.00 ? 120 ASN A OD1  5  
ATOM 10515 N ND2  . ASN A 1 120 ? -9.329  15.363  -14.357 1.00 0.00 ? 120 ASN A ND2  5  
ATOM 10516 H H    . ASN A 1 120 ? -5.309  14.450  -11.665 1.00 0.00 ? 120 ASN A H    5  
ATOM 10517 H HA   . ASN A 1 120 ? -7.460  14.482  -11.929 1.00 0.00 ? 120 ASN A HA   5  
ATOM 10518 H HB2  . ASN A 1 120 ? -6.897  14.924  -14.364 1.00 0.00 ? 120 ASN A HB2  5  
ATOM 10519 H HB3  . ASN A 1 120 ? -6.986  13.201  -14.672 1.00 0.00 ? 120 ASN A HB3  5  
ATOM 10520 H HD21 . ASN A 1 120 ? -8.683  16.125  -14.317 1.00 0.00 ? 120 ASN A HD21 5  
ATOM 10521 H HD22 . ASN A 1 120 ? -10.305 15.541  -14.487 1.00 0.00 ? 120 ASN A HD22 5  
ATOM 10522 N N    . PHE A 1 121 ? -8.448  12.260  -11.284 1.00 0.00 ? 121 PHE A N    5  
ATOM 10523 C CA   . PHE A 1 121 ? -9.010  10.990  -10.857 1.00 0.00 ? 121 PHE A CA   5  
ATOM 10524 C C    . PHE A 1 121 ? -10.468 10.858  -11.303 1.00 0.00 ? 121 PHE A C    5  
ATOM 10525 O O    . PHE A 1 121 ? -11.251 11.796  -11.165 1.00 0.00 ? 121 PHE A O    5  
ATOM 10526 C CB   . PHE A 1 121 ? -8.953  10.968  -9.328  1.00 0.00 ? 121 PHE A CB   5  
ATOM 10527 C CG   . PHE A 1 121 ? -9.313  9.615   -8.711  1.00 0.00 ? 121 PHE A CG   5  
ATOM 10528 C CD1  . PHE A 1 121 ? -8.425  8.587   -8.762  1.00 0.00 ? 121 PHE A CD1  5  
ATOM 10529 C CD2  . PHE A 1 121 ? -10.522 9.441   -8.113  1.00 0.00 ? 121 PHE A CD2  5  
ATOM 10530 C CE1  . PHE A 1 121 ? -8.759  7.331   -8.189  1.00 0.00 ? 121 PHE A CE1  5  
ATOM 10531 C CE2  . PHE A 1 121 ? -10.856 8.185   -7.540  1.00 0.00 ? 121 PHE A CE2  5  
ATOM 10532 C CZ   . PHE A 1 121 ? -9.968  7.157   -7.591  1.00 0.00 ? 121 PHE A CZ   5  
ATOM 10533 H H    . PHE A 1 121 ? -8.808  13.063  -10.809 1.00 0.00 ? 121 PHE A H    5  
ATOM 10534 H HA   . PHE A 1 121 ? -8.417  10.202  -11.320 1.00 0.00 ? 121 PHE A HA   5  
ATOM 10535 H HB2  . PHE A 1 121 ? -7.949  11.246  -9.008  1.00 0.00 ? 121 PHE A HB2  5  
ATOM 10536 H HB3  . PHE A 1 121 ? -9.633  11.726  -8.938  1.00 0.00 ? 121 PHE A HB3  5  
ATOM 10537 H HD1  . PHE A 1 121 ? -7.456  8.726   -9.241  1.00 0.00 ? 121 PHE A HD1  5  
ATOM 10538 H HD2  . PHE A 1 121 ? -11.234 10.265  -8.072  1.00 0.00 ? 121 PHE A HD2  5  
ATOM 10539 H HE1  . PHE A 1 121 ? -8.047  6.507   -8.230  1.00 0.00 ? 121 PHE A HE1  5  
ATOM 10540 H HE2  . PHE A 1 121 ? -11.825 8.046   -7.060  1.00 0.00 ? 121 PHE A HE2  5  
ATOM 10541 H HZ   . PHE A 1 121 ? -10.225 6.193   -7.151  1.00 0.00 ? 121 PHE A HZ   5  
ATOM 10542 N N    . THR A 1 122 ? -10.787 9.685   -11.829 1.00 0.00 ? 122 THR A N    5  
ATOM 10543 C CA   . THR A 1 122 ? -12.137 9.417   -12.297 1.00 0.00 ? 122 THR A CA   5  
ATOM 10544 C C    . THR A 1 122 ? -12.795 8.337   -11.436 1.00 0.00 ? 122 THR A C    5  
ATOM 10545 O O    . THR A 1 122 ? -12.344 7.193   -11.417 1.00 0.00 ? 122 THR A O    5  
ATOM 10546 C CB   . THR A 1 122 ? -12.059 9.049   -13.779 1.00 0.00 ? 122 THR A CB   5  
ATOM 10547 O OG1  . THR A 1 122 ? -12.013 10.306  -14.448 1.00 0.00 ? 122 THR A OG1  5  
ATOM 10548 C CG2  . THR A 1 122 ? -13.349 8.403   -14.291 1.00 0.00 ? 122 THR A CG2  5  
ATOM 10549 H H    . THR A 1 122 ? -10.144 8.926   -11.938 1.00 0.00 ? 122 THR A H    5  
ATOM 10550 H HA   . THR A 1 122 ? -12.728 10.325  -12.177 1.00 0.00 ? 122 THR A HA   5  
ATOM 10551 H HB   . THR A 1 122 ? -11.199 8.410   -13.977 1.00 0.00 ? 122 THR A HB   5  
ATOM 10552 H HG1  . THR A 1 122 ? -12.782 10.876  -14.158 1.00 0.00 ? 122 THR A HG1  5  
ATOM 10553 H HG21 . THR A 1 122 ? -14.177 8.678   -13.637 1.00 0.00 ? 122 THR A HG21 5  
ATOM 10554 H HG22 . THR A 1 122 ? -13.554 8.752   -15.303 1.00 0.00 ? 122 THR A HG22 5  
ATOM 10555 H HG23 . THR A 1 122 ? -13.235 7.319   -14.296 1.00 0.00 ? 122 THR A HG23 5  
ATOM 10556 N N    . LYS A 1 123 ? -13.851 8.738   -10.744 1.00 0.00 ? 123 LYS A N    5  
ATOM 10557 C CA   . LYS A 1 123 ? -14.576 7.819   -9.883  1.00 0.00 ? 123 LYS A CA   5  
ATOM 10558 C C    . LYS A 1 123 ? -15.417 6.875   -10.746 1.00 0.00 ? 123 LYS A C    5  
ATOM 10559 O O    . LYS A 1 123 ? -16.546 7.202   -11.110 1.00 0.00 ? 123 LYS A O    5  
ATOM 10560 C CB   . LYS A 1 123 ? -15.390 8.589   -8.841  1.00 0.00 ? 123 LYS A CB   5  
ATOM 10561 C CG   . LYS A 1 123 ? -15.059 8.112   -7.426  1.00 0.00 ? 123 LYS A CG   5  
ATOM 10562 C CD   . LYS A 1 123 ? -15.869 6.866   -7.064  1.00 0.00 ? 123 LYS A CD   5  
ATOM 10563 C CE   . LYS A 1 123 ? -16.918 7.184   -5.997  1.00 0.00 ? 123 LYS A CE   5  
ATOM 10564 N NZ   . LYS A 1 123 ? -16.301 7.911   -4.865  1.00 0.00 ? 123 LYS A NZ   5  
ATOM 10565 H H    . LYS A 1 123 ? -14.212 9.671   -10.765 1.00 0.00 ? 123 LYS A H    5  
ATOM 10566 H HA   . LYS A 1 123 ? -13.838 7.227   -9.343  1.00 0.00 ? 123 LYS A HA   5  
ATOM 10567 H HB2  . LYS A 1 123 ? -15.182 9.656   -8.927  1.00 0.00 ? 123 LYS A HB2  5  
ATOM 10568 H HB3  . LYS A 1 123 ? -16.454 8.456   -9.035  1.00 0.00 ? 123 LYS A HB3  5  
ATOM 10569 H HG2  . LYS A 1 123 ? -13.994 7.893   -7.352  1.00 0.00 ? 123 LYS A HG2  5  
ATOM 10570 H HG3  . LYS A 1 123 ? -15.271 8.908   -6.711  1.00 0.00 ? 123 LYS A HG3  5  
ATOM 10571 H HD2  . LYS A 1 123 ? -16.359 6.475   -7.956  1.00 0.00 ? 123 LYS A HD2  5  
ATOM 10572 H HD3  . LYS A 1 123 ? -15.200 6.086   -6.701  1.00 0.00 ? 123 LYS A HD3  5  
ATOM 10573 H HE2  . LYS A 1 123 ? -17.717 7.785   -6.431  1.00 0.00 ? 123 LYS A HE2  5  
ATOM 10574 H HE3  . LYS A 1 123 ? -17.373 6.260   -5.638  1.00 0.00 ? 123 LYS A HE3  5  
ATOM 10575 H HZ1  . LYS A 1 123 ? -16.410 8.896   -5.002  1.00 0.00 ? 123 LYS A HZ1  5  
ATOM 10576 H HZ2  . LYS A 1 123 ? -16.749 7.641   -4.012  1.00 0.00 ? 123 LYS A HZ2  5  
ATOM 10577 H HZ3  . LYS A 1 123 ? -15.328 7.687   -4.815  1.00 0.00 ? 123 LYS A HZ3  5  
ATOM 10578 N N    . TYR A 1 124 ? -14.835 5.724   -11.047 1.00 0.00 ? 124 TYR A N    5  
ATOM 10579 C CA   . TYR A 1 124 ? -15.516 4.731   -11.860 1.00 0.00 ? 124 TYR A CA   5  
ATOM 10580 C C    . TYR A 1 124 ? -16.369 3.804   -10.992 1.00 0.00 ? 124 TYR A C    5  
ATOM 10581 O O    . TYR A 1 124 ? -16.183 3.740   -9.777  1.00 0.00 ? 124 TYR A O    5  
ATOM 10582 C CB   . TYR A 1 124 ? -14.415 3.909   -12.533 1.00 0.00 ? 124 TYR A CB   5  
ATOM 10583 C CG   . TYR A 1 124 ? -14.028 4.411   -13.926 1.00 0.00 ? 124 TYR A CG   5  
ATOM 10584 C CD1  . TYR A 1 124 ? -15.010 4.774   -14.826 1.00 0.00 ? 124 TYR A CD1  5  
ATOM 10585 C CD2  . TYR A 1 124 ? -12.698 4.499   -14.283 1.00 0.00 ? 124 TYR A CD2  5  
ATOM 10586 C CE1  . TYR A 1 124 ? -14.646 5.246   -16.137 1.00 0.00 ? 124 TYR A CE1  5  
ATOM 10587 C CE2  . TYR A 1 124 ? -12.334 4.971   -15.594 1.00 0.00 ? 124 TYR A CE2  5  
ATOM 10588 C CZ   . TYR A 1 124 ? -13.326 5.321   -16.456 1.00 0.00 ? 124 TYR A CZ   5  
ATOM 10589 O OH   . TYR A 1 124 ? -12.982 5.767   -17.694 1.00 0.00 ? 124 TYR A OH   5  
ATOM 10590 H H    . TYR A 1 124 ? -13.916 5.466   -10.747 1.00 0.00 ? 124 TYR A H    5  
ATOM 10591 H HA   . TYR A 1 124 ? -16.164 5.257   -12.561 1.00 0.00 ? 124 TYR A HA   5  
ATOM 10592 H HB2  . TYR A 1 124 ? -13.530 3.916   -11.897 1.00 0.00 ? 124 TYR A HB2  5  
ATOM 10593 H HB3  . TYR A 1 124 ? -14.744 2.873   -12.610 1.00 0.00 ? 124 TYR A HB3  5  
ATOM 10594 H HD1  . TYR A 1 124 ? -16.061 4.704   -14.544 1.00 0.00 ? 124 TYR A HD1  5  
ATOM 10595 H HD2  . TYR A 1 124 ? -11.923 4.212   -13.572 1.00 0.00 ? 124 TYR A HD2  5  
ATOM 10596 H HE1  . TYR A 1 124 ? -15.411 5.536   -16.857 1.00 0.00 ? 124 TYR A HE1  5  
ATOM 10597 H HE2  . TYR A 1 124 ? -11.287 5.046   -15.888 1.00 0.00 ? 124 TYR A HE2  5  
ATOM 10598 H HH   . TYR A 1 124 ? -12.886 4.994   -18.321 1.00 0.00 ? 124 TYR A HH   5  
ATOM 10599 N N    . PRO A 1 125 ? -17.311 3.090   -11.666 1.00 0.00 ? 125 PRO A N    5  
ATOM 10600 C CA   . PRO A 1 125 ? -18.193 2.170   -10.969 1.00 0.00 ? 125 PRO A CA   5  
ATOM 10601 C C    . PRO A 1 125 ? -17.452 0.889   -10.579 1.00 0.00 ? 125 PRO A C    5  
ATOM 10602 O O    . PRO A 1 125 ? -16.901 0.201   -11.437 1.00 0.00 ? 125 PRO A O    5  
ATOM 10603 C CB   . PRO A 1 125 ? -19.342 1.921   -11.932 1.00 0.00 ? 125 PRO A CB   5  
ATOM 10604 C CG   . PRO A 1 125 ? -18.835 2.339   -13.303 1.00 0.00 ? 125 PRO A CG   5  
ATOM 10605 C CD   . PRO A 1 125 ? -17.559 3.141   -13.103 1.00 0.00 ? 125 PRO A CD   5  
ATOM 10606 H HA   . PRO A 1 125 ? -18.509 2.574   -10.111 1.00 0.00 ? 125 PRO A HA   5  
ATOM 10607 H HB2  . PRO A 1 125 ? -19.635 0.871   -11.928 1.00 0.00 ? 125 PRO A HB2  5  
ATOM 10608 H HB3  . PRO A 1 125 ? -20.221 2.499   -11.649 1.00 0.00 ? 125 PRO A HB3  5  
ATOM 10609 H HG2  . PRO A 1 125 ? -18.641 1.462   -13.922 1.00 0.00 ? 125 PRO A HG2  5  
ATOM 10610 H HG3  . PRO A 1 125 ? -19.584 2.936   -13.822 1.00 0.00 ? 125 PRO A HG3  5  
ATOM 10611 H HD2  . PRO A 1 125 ? -16.729 2.711   -13.664 1.00 0.00 ? 125 PRO A HD2  5  
ATOM 10612 H HD3  . PRO A 1 125 ? -17.679 4.168   -13.449 1.00 0.00 ? 125 PRO A HD3  5  
ATOM 10613 N N    . LYS A 1 126 ? -17.461 0.609   -9.284  1.00 0.00 ? 126 LYS A N    5  
ATOM 10614 C CA   . LYS A 1 126 ? -16.797 -0.576  -8.770  1.00 0.00 ? 126 LYS A CA   5  
ATOM 10615 C C    . LYS A 1 126 ? -15.312 -0.272  -8.558  1.00 0.00 ? 126 LYS A C    5  
ATOM 10616 O O    . LYS A 1 126 ? -14.589 -1.073  -7.966  1.00 0.00 ? 126 LYS A O    5  
ATOM 10617 C CB   . LYS A 1 126 ? -17.054 -1.775  -9.686  1.00 0.00 ? 126 LYS A CB   5  
ATOM 10618 C CG   . LYS A 1 126 ? -18.526 -1.841  -10.101 1.00 0.00 ? 126 LYS A CG   5  
ATOM 10619 C CD   . LYS A 1 126 ? -18.908 -3.256  -10.540 1.00 0.00 ? 126 LYS A CD   5  
ATOM 10620 C CE   . LYS A 1 126 ? -19.067 -3.335  -12.059 1.00 0.00 ? 126 LYS A CE   5  
ATOM 10621 N NZ   . LYS A 1 126 ? -18.837 -4.718  -12.533 1.00 0.00 ? 126 LYS A NZ   5  
ATOM 10622 H H    . LYS A 1 126 ? -17.911 1.175   -8.593  1.00 0.00 ? 126 LYS A H    5  
ATOM 10623 H HA   . LYS A 1 126 ? -17.243 -0.808  -7.803  1.00 0.00 ? 126 LYS A HA   5  
ATOM 10624 H HB2  . LYS A 1 126 ? -16.426 -1.701  -10.573 1.00 0.00 ? 126 LYS A HB2  5  
ATOM 10625 H HB3  . LYS A 1 126 ? -16.775 -2.695  -9.174  1.00 0.00 ? 126 LYS A HB3  5  
ATOM 10626 H HG2  . LYS A 1 126 ? -19.156 -1.532  -9.268  1.00 0.00 ? 126 LYS A HG2  5  
ATOM 10627 H HG3  . LYS A 1 126 ? -18.709 -1.142  -10.916 1.00 0.00 ? 126 LYS A HG3  5  
ATOM 10628 H HD2  . LYS A 1 126 ? -18.143 -3.961  -10.213 1.00 0.00 ? 126 LYS A HD2  5  
ATOM 10629 H HD3  . LYS A 1 126 ? -19.840 -3.551  -10.057 1.00 0.00 ? 126 LYS A HD3  5  
ATOM 10630 H HE2  . LYS A 1 126 ? -20.067 -3.008  -12.344 1.00 0.00 ? 126 LYS A HE2  5  
ATOM 10631 H HE3  . LYS A 1 126 ? -18.361 -2.658  -12.540 1.00 0.00 ? 126 LYS A HE3  5  
ATOM 10632 H HZ1  . LYS A 1 126 ? -19.316 -4.857  -13.400 1.00 0.00 ? 126 LYS A HZ1  5  
ATOM 10633 H HZ2  . LYS A 1 126 ? -17.857 -4.867  -12.666 1.00 0.00 ? 126 LYS A HZ2  5  
ATOM 10634 H HZ3  . LYS A 1 126 ? -19.183 -5.365  -11.854 1.00 0.00 ? 126 LYS A HZ3  5  
ATOM 10635 N N    . LYS A 1 127 ? -14.902 0.886   -9.053  1.00 0.00 ? 127 LYS A N    5  
ATOM 10636 C CA   . LYS A 1 127 ? -13.517 1.306   -8.925  1.00 0.00 ? 127 LYS A CA   5  
ATOM 10637 C C    . LYS A 1 127 ? -13.291 1.888   -7.528  1.00 0.00 ? 127 LYS A C    5  
ATOM 10638 O O    . LYS A 1 127 ? -14.089 2.693   -7.051  1.00 0.00 ? 127 LYS A O    5  
ATOM 10639 C CB   . LYS A 1 127 ? -13.140 2.263   -10.058 1.00 0.00 ? 127 LYS A CB   5  
ATOM 10640 C CG   . LYS A 1 127 ? -12.990 1.512   -11.383 1.00 0.00 ? 127 LYS A CG   5  
ATOM 10641 C CD   . LYS A 1 127 ? -12.077 0.295   -11.224 1.00 0.00 ? 127 LYS A CD   5  
ATOM 10642 C CE   . LYS A 1 127 ? -11.558 -0.182  -12.581 1.00 0.00 ? 127 LYS A CE   5  
ATOM 10643 N NZ   . LYS A 1 127 ? -11.279 -1.635  -12.547 1.00 0.00 ? 127 LYS A NZ   5  
ATOM 10644 H H    . LYS A 1 127 ? -15.496 1.531   -9.533  1.00 0.00 ? 127 LYS A H    5  
ATOM 10645 H HA   . LYS A 1 127 ? -12.895 0.417   -9.034  1.00 0.00 ? 127 LYS A HA   5  
ATOM 10646 H HB2  . LYS A 1 127 ? -13.904 3.034   -10.157 1.00 0.00 ? 127 LYS A HB2  5  
ATOM 10647 H HB3  . LYS A 1 127 ? -12.206 2.770   -9.815  1.00 0.00 ? 127 LYS A HB3  5  
ATOM 10648 H HG2  . LYS A 1 127 ? -13.971 1.192   -11.736 1.00 0.00 ? 127 LYS A HG2  5  
ATOM 10649 H HG3  . LYS A 1 127 ? -12.582 2.182   -12.140 1.00 0.00 ? 127 LYS A HG3  5  
ATOM 10650 H HD2  . LYS A 1 127 ? -11.236 0.549   -10.578 1.00 0.00 ? 127 LYS A HD2  5  
ATOM 10651 H HD3  . LYS A 1 127 ? -12.622 -0.512  -10.734 1.00 0.00 ? 127 LYS A HD3  5  
ATOM 10652 H HE2  . LYS A 1 127 ? -12.295 0.034   -13.355 1.00 0.00 ? 127 LYS A HE2  5  
ATOM 10653 H HE3  . LYS A 1 127 ? -10.651 0.363   -12.843 1.00 0.00 ? 127 LYS A HE3  5  
ATOM 10654 H HZ1  . LYS A 1 127 ? -11.521 -2.042  -13.428 1.00 0.00 ? 127 LYS A HZ1  5  
ATOM 10655 H HZ2  . LYS A 1 127 ? -10.306 -1.783  -12.368 1.00 0.00 ? 127 LYS A HZ2  5  
ATOM 10656 H HZ3  . LYS A 1 127 ? -11.820 -2.062  -11.823 1.00 0.00 ? 127 LYS A HZ3  5  
ATOM 10657 N N    . PHE A 1 128 ? -12.200 1.457   -6.912  1.00 0.00 ? 128 PHE A N    5  
ATOM 10658 C CA   . PHE A 1 128 ? -11.860 1.925   -5.579  1.00 0.00 ? 128 PHE A CA   5  
ATOM 10659 C C    . PHE A 1 128 ? -11.332 3.360   -5.620  1.00 0.00 ? 128 PHE A C    5  
ATOM 10660 O O    . PHE A 1 128 ? -10.630 3.741   -6.556  1.00 0.00 ? 128 PHE A O    5  
ATOM 10661 C CB   . PHE A 1 128 ? -10.759 1.004   -5.049  1.00 0.00 ? 128 PHE A CB   5  
ATOM 10662 C CG   . PHE A 1 128 ? -11.277 -0.311  -4.462  1.00 0.00 ? 128 PHE A CG   5  
ATOM 10663 C CD1  . PHE A 1 128 ? -11.463 -1.389  -5.270  1.00 0.00 ? 128 PHE A CD1  5  
ATOM 10664 C CD2  . PHE A 1 128 ? -11.551 -0.401  -3.133  1.00 0.00 ? 128 PHE A CD2  5  
ATOM 10665 C CE1  . PHE A 1 128 ? -11.944 -2.609  -4.725  1.00 0.00 ? 128 PHE A CE1  5  
ATOM 10666 C CE2  . PHE A 1 128 ? -12.031 -1.621  -2.589  1.00 0.00 ? 128 PHE A CE2  5  
ATOM 10667 C CZ   . PHE A 1 128 ? -12.218 -2.700  -3.396  1.00 0.00 ? 128 PHE A CZ   5  
ATOM 10668 H H    . PHE A 1 128 ? -11.556 0.802   -7.307  1.00 0.00 ? 128 PHE A H    5  
ATOM 10669 H HA   . PHE A 1 128 ? -12.771 1.892   -4.982  1.00 0.00 ? 128 PHE A HA   5  
ATOM 10670 H HB2  . PHE A 1 128 ? -10.065 0.780   -5.859  1.00 0.00 ? 128 PHE A HB2  5  
ATOM 10671 H HB3  . PHE A 1 128 ? -10.194 1.534   -4.283  1.00 0.00 ? 128 PHE A HB3  5  
ATOM 10672 H HD1  . PHE A 1 128 ? -11.244 -1.317  -6.335  1.00 0.00 ? 128 PHE A HD1  5  
ATOM 10673 H HD2  . PHE A 1 128 ? -11.401 0.463   -2.486  1.00 0.00 ? 128 PHE A HD2  5  
ATOM 10674 H HE1  . PHE A 1 128 ? -12.093 -3.474  -5.373  1.00 0.00 ? 128 PHE A HE1  5  
ATOM 10675 H HE2  . PHE A 1 128 ? -12.251 -1.694  -1.523  1.00 0.00 ? 128 PHE A HE2  5  
ATOM 10676 H HZ   . PHE A 1 128 ? -12.587 -3.636  -2.978  1.00 0.00 ? 128 PHE A HZ   5  
ATOM 10677 N N    . TYR A 1 129 ? -11.689 4.118   -4.594  1.00 0.00 ? 129 TYR A N    5  
ATOM 10678 C CA   . TYR A 1 129 ? -11.259 5.503   -4.501  1.00 0.00 ? 129 TYR A CA   5  
ATOM 10679 C C    . TYR A 1 129 ? -10.704 5.813   -3.109  1.00 0.00 ? 129 TYR A C    5  
ATOM 10680 O O    . TYR A 1 129 ? -10.919 5.052   -2.167  1.00 0.00 ? 129 TYR A O    5  
ATOM 10681 C CB   . TYR A 1 129 ? -12.512 6.350   -4.737  1.00 0.00 ? 129 TYR A CB   5  
ATOM 10682 C CG   . TYR A 1 129 ? -13.554 6.244   -3.622  1.00 0.00 ? 129 TYR A CG   5  
ATOM 10683 C CD1  . TYR A 1 129 ? -13.324 6.851   -2.404  1.00 0.00 ? 129 TYR A CD1  5  
ATOM 10684 C CD2  . TYR A 1 129 ? -14.723 5.543   -3.834  1.00 0.00 ? 129 TYR A CD2  5  
ATOM 10685 C CE1  . TYR A 1 129 ? -14.305 6.752   -1.354  1.00 0.00 ? 129 TYR A CE1  5  
ATOM 10686 C CE2  . TYR A 1 129 ? -15.704 5.444   -2.785  1.00 0.00 ? 129 TYR A CE2  5  
ATOM 10687 C CZ   . TYR A 1 129 ? -15.446 6.053   -1.596  1.00 0.00 ? 129 TYR A CZ   5  
ATOM 10688 O OH   . TYR A 1 129 ? -16.373 5.960   -0.605  1.00 0.00 ? 129 TYR A OH   5  
ATOM 10689 H H    . TYR A 1 129 ? -12.260 3.801   -3.837  1.00 0.00 ? 129 TYR A H    5  
ATOM 10690 H HA   . TYR A 1 129 ? -10.475 5.663   -5.241  1.00 0.00 ? 129 TYR A HA   5  
ATOM 10691 H HB2  . TYR A 1 129 ? -12.217 7.393   -4.848  1.00 0.00 ? 129 TYR A HB2  5  
ATOM 10692 H HB3  . TYR A 1 129 ? -12.970 6.047   -5.679  1.00 0.00 ? 129 TYR A HB3  5  
ATOM 10693 H HD1  . TYR A 1 129 ? -12.400 7.404   -2.236  1.00 0.00 ? 129 TYR A HD1  5  
ATOM 10694 H HD2  . TYR A 1 129 ? -14.905 5.064   -4.797  1.00 0.00 ? 129 TYR A HD2  5  
ATOM 10695 H HE1  . TYR A 1 129 ? -14.136 7.226   -0.387  1.00 0.00 ? 129 TYR A HE1  5  
ATOM 10696 H HE2  . TYR A 1 129 ? -16.632 4.894   -2.939  1.00 0.00 ? 129 TYR A HE2  5  
ATOM 10697 H HH   . TYR A 1 129 ? -16.280 5.083   -0.132  1.00 0.00 ? 129 TYR A HH   5  
ATOM 10698 N N    . PRO A 1 130 ? -9.982  6.962   -3.021  1.00 0.00 ? 130 PRO A N    5  
ATOM 10699 C CA   . PRO A 1 130 ? -9.394  7.382   -1.761  1.00 0.00 ? 130 PRO A CA   5  
ATOM 10700 C C    . PRO A 1 130 ? -10.462 7.940   -0.817  1.00 0.00 ? 130 PRO A C    5  
ATOM 10701 O O    . PRO A 1 130 ? -11.154 8.899   -1.155  1.00 0.00 ? 130 PRO A O    5  
ATOM 10702 C CB   . PRO A 1 130 ? -8.341  8.410   -2.141  1.00 0.00 ? 130 PRO A CB   5  
ATOM 10703 C CG   . PRO A 1 130 ? -8.695  8.869   -3.546  1.00 0.00 ? 130 PRO A CG   5  
ATOM 10704 C CD   . PRO A 1 130 ? -9.707  7.888   -4.116  1.00 0.00 ? 130 PRO A CD   5  
ATOM 10705 H HA   . PRO A 1 130 ? -8.993  6.598   -1.287  1.00 0.00 ? 130 PRO A HA   5  
ATOM 10706 H HB2  . PRO A 1 130 ? -8.345  9.248   -1.444  1.00 0.00 ? 130 PRO A HB2  5  
ATOM 10707 H HB3  . PRO A 1 130 ? -7.342  7.975   -2.111  1.00 0.00 ? 130 PRO A HB3  5  
ATOM 10708 H HG2  . PRO A 1 130 ? -9.109  9.877   -3.526  1.00 0.00 ? 130 PRO A HG2  5  
ATOM 10709 H HG3  . PRO A 1 130 ? -7.803  8.904   -4.172  1.00 0.00 ? 130 PRO A HG3  5  
ATOM 10710 H HD2  . PRO A 1 130 ? -10.614 8.399   -4.440  1.00 0.00 ? 130 PRO A HD2  5  
ATOM 10711 H HD3  . PRO A 1 130 ? -9.307  7.367   -4.985  1.00 0.00 ? 130 PRO A HD3  5  
ATOM 10712 N N    . LEU A 1 131 ? -10.562 7.315   0.347   1.00 0.00 ? 131 LEU A N    5  
ATOM 10713 C CA   . LEU A 1 131 ? -11.533 7.738   1.342   1.00 0.00 ? 131 LEU A CA   5  
ATOM 10714 C C    . LEU A 1 131 ? -11.116 9.095   1.912   1.00 0.00 ? 131 LEU A C    5  
ATOM 10715 O O    . LEU A 1 131 ? -11.534 10.137  1.410   1.00 0.00 ? 131 LEU A O    5  
ATOM 10716 C CB   . LEU A 1 131 ? -11.716 6.654   2.406   1.00 0.00 ? 131 LEU A CB   5  
ATOM 10717 C CG   . LEU A 1 131 ? -12.261 5.313   1.911   1.00 0.00 ? 131 LEU A CG   5  
ATOM 10718 C CD1  . LEU A 1 131 ? -12.249 4.269   3.030   1.00 0.00 ? 131 LEU A CD1  5  
ATOM 10719 C CD2  . LEU A 1 131 ? -13.654 5.480   1.299   1.00 0.00 ? 131 LEU A CD2  5  
ATOM 10720 H H    . LEU A 1 131 ? -9.995  6.536   0.614   1.00 0.00 ? 131 LEU A H    5  
ATOM 10721 H HA   . LEU A 1 131 ? -12.490 7.855   0.834   1.00 0.00 ? 131 LEU A HA   5  
ATOM 10722 H HB2  . LEU A 1 131 ? -10.752 6.477   2.885   1.00 0.00 ? 131 LEU A HB2  5  
ATOM 10723 H HB3  . LEU A 1 131 ? -12.388 7.036   3.174   1.00 0.00 ? 131 LEU A HB3  5  
ATOM 10724 H HG   . LEU A 1 131 ? -11.605 4.947   1.122   1.00 0.00 ? 131 LEU A HG   5  
ATOM 10725 H HD11 . LEU A 1 131 ? -12.637 3.324   2.650   1.00 0.00 ? 131 LEU A HD11 5  
ATOM 10726 H HD12 . LEU A 1 131 ? -11.227 4.126   3.382   1.00 0.00 ? 131 LEU A HD12 5  
ATOM 10727 H HD13 . LEU A 1 131 ? -12.873 4.613   3.855   1.00 0.00 ? 131 LEU A HD13 5  
ATOM 10728 H HD21 . LEU A 1 131 ? -13.985 6.511   1.426   1.00 0.00 ? 131 LEU A HD21 5  
ATOM 10729 H HD22 . LEU A 1 131 ? -13.615 5.239   0.237   1.00 0.00 ? 131 LEU A HD22 5  
ATOM 10730 H HD23 . LEU A 1 131 ? -14.353 4.809   1.798   1.00 0.00 ? 131 LEU A HD23 5  
ATOM 10731 N N    . GLU A 1 132 ? -10.297 9.038   2.952   1.00 0.00 ? 132 GLU A N    5  
ATOM 10732 C CA   . GLU A 1 132 ? -9.819  10.250  3.595   1.00 0.00 ? 132 GLU A CA   5  
ATOM 10733 C C    . GLU A 1 132 ? -8.841  10.987  2.678   1.00 0.00 ? 132 GLU A C    5  
ATOM 10734 O O    . GLU A 1 132 ? -8.019  10.361  2.010   1.00 0.00 ? 132 GLU A O    5  
ATOM 10735 C CB   . GLU A 1 132 ? -9.174  9.935   4.946   1.00 0.00 ? 132 GLU A CB   5  
ATOM 10736 C CG   . GLU A 1 132 ? -8.719  11.217  5.648   1.00 0.00 ? 132 GLU A CG   5  
ATOM 10737 C CD   . GLU A 1 132 ? -7.207  11.407  5.517   1.00 0.00 ? 132 GLU A CD   5  
ATOM 10738 O OE1  . GLU A 1 132 ? -6.755  11.578  4.364   1.00 0.00 ? 132 GLU A OE1  5  
ATOM 10739 O OE2  . GLU A 1 132 ? -6.537  11.377  6.572   1.00 0.00 ? 132 GLU A OE2  5  
ATOM 10740 H H    . GLU A 1 132 ? -9.962  8.186   3.354   1.00 0.00 ? 132 GLU A H    5  
ATOM 10741 H HA   . GLU A 1 132 ? -10.707 10.861  3.757   1.00 0.00 ? 132 GLU A HA   5  
ATOM 10742 H HB2  . GLU A 1 132 ? -9.885  9.403   5.578   1.00 0.00 ? 132 GLU A HB2  5  
ATOM 10743 H HB3  . GLU A 1 132 ? -8.320  9.274   4.801   1.00 0.00 ? 132 GLU A HB3  5  
ATOM 10744 H HG2  . GLU A 1 132 ? -9.236  12.074  5.218   1.00 0.00 ? 132 GLU A HG2  5  
ATOM 10745 H HG3  . GLU A 1 132 ? -8.994  11.175  6.702   1.00 0.00 ? 132 GLU A HG3  5  
ATOM 10746 N N    . ILE A 1 133 ? -8.961  12.306  2.677   1.00 0.00 ? 133 ILE A N    5  
ATOM 10747 C CA   . ILE A 1 133 ? -8.097  13.135  1.853   1.00 0.00 ? 133 ILE A CA   5  
ATOM 10748 C C    . ILE A 1 133 ? -7.659  14.362  2.655   1.00 0.00 ? 133 ILE A C    5  
ATOM 10749 O O    . ILE A 1 133 ? -8.367  14.802  3.560   1.00 0.00 ? 133 ILE A O    5  
ATOM 10750 C CB   . ILE A 1 133 ? -8.786  13.478  0.531   1.00 0.00 ? 133 ILE A CB   5  
ATOM 10751 C CG1  . ILE A 1 133 ? -8.800  12.271  -0.410  1.00 0.00 ? 133 ILE A CG1  5  
ATOM 10752 C CG2  . ILE A 1 133 ? -8.143  14.705  -0.120  1.00 0.00 ? 133 ILE A CG2  5  
ATOM 10753 C CD1  . ILE A 1 133 ? -10.215 11.988  -0.917  1.00 0.00 ? 133 ILE A CD1  5  
ATOM 10754 H H    . ILE A 1 133 ? -9.631  12.808  3.223   1.00 0.00 ? 133 ILE A H    5  
ATOM 10755 H HA   . ILE A 1 133 ? -7.212  12.546  1.612   1.00 0.00 ? 133 ILE A HA   5  
ATOM 10756 H HB   . ILE A 1 133 ? -9.824  13.734  0.743   1.00 0.00 ? 133 ILE A HB   5  
ATOM 10757 H HG12 . ILE A 1 133 ? -8.137  12.456  -1.255  1.00 0.00 ? 133 ILE A HG12 5  
ATOM 10758 H HG13 . ILE A 1 133 ? -8.415  11.395  0.112   1.00 0.00 ? 133 ILE A HG13 5  
ATOM 10759 H HG21 . ILE A 1 133 ? -8.427  14.749  -1.172  1.00 0.00 ? 133 ILE A HG21 5  
ATOM 10760 H HG22 . ILE A 1 133 ? -8.486  15.607  0.387   1.00 0.00 ? 133 ILE A HG22 5  
ATOM 10761 H HG23 . ILE A 1 133 ? -7.058  14.632  -0.040  1.00 0.00 ? 133 ILE A HG23 5  
ATOM 10762 H HD11 . ILE A 1 133 ? -10.650 11.170  -0.344  1.00 0.00 ? 133 ILE A HD11 5  
ATOM 10763 H HD12 . ILE A 1 133 ? -10.829 12.881  -0.799  1.00 0.00 ? 133 ILE A HD12 5  
ATOM 10764 H HD13 . ILE A 1 133 ? -10.175 11.713  -1.971  1.00 0.00 ? 133 ILE A HD13 5  
ATOM 10765 N N    . SER A 1 134 ? -6.495  14.881  2.294   1.00 0.00 ? 134 SER A N    5  
ATOM 10766 C CA   . SER A 1 134 ? -5.954  16.049  2.968   1.00 0.00 ? 134 SER A CA   5  
ATOM 10767 C C    . SER A 1 134 ? -5.356  17.015  1.944   1.00 0.00 ? 134 SER A C    5  
ATOM 10768 O O    . SER A 1 134 ? -5.130  16.643  0.793   1.00 0.00 ? 134 SER A O    5  
ATOM 10769 C CB   . SER A 1 134 ? -4.899  15.649  4.001   1.00 0.00 ? 134 SER A CB   5  
ATOM 10770 O OG   . SER A 1 134 ? -4.390  16.777  4.708   1.00 0.00 ? 134 SER A OG   5  
ATOM 10771 H H    . SER A 1 134 ? -5.925  14.518  1.556   1.00 0.00 ? 134 SER A H    5  
ATOM 10772 H HA   . SER A 1 134 ? -6.803  16.508  3.476   1.00 0.00 ? 134 SER A HA   5  
ATOM 10773 H HB2  . SER A 1 134 ? -5.333  14.943  4.709   1.00 0.00 ? 134 SER A HB2  5  
ATOM 10774 H HB3  . SER A 1 134 ? -4.079  15.135  3.501   1.00 0.00 ? 134 SER A HB3  5  
ATOM 10775 H HG   . SER A 1 134 ? -3.433  16.931  4.463   1.00 0.00 ? 134 SER A HG   5  
ATOM 10776 N N    . GLY A 1 135 ? -5.115  18.236  2.399   1.00 0.00 ? 135 GLY A N    5  
ATOM 10777 C CA   . GLY A 1 135 ? -4.546  19.257  1.536   1.00 0.00 ? 135 GLY A CA   5  
ATOM 10778 C C    . GLY A 1 135 ? -3.309  19.890  2.177   1.00 0.00 ? 135 GLY A C    5  
ATOM 10779 O O    . GLY A 1 135 ? -3.139  19.835  3.394   1.00 0.00 ? 135 GLY A O    5  
ATOM 10780 H H    . GLY A 1 135 ? -5.301  18.530  3.337   1.00 0.00 ? 135 GLY A H    5  
ATOM 10781 H HA2  . GLY A 1 135 ? -4.279  18.819  0.575   1.00 0.00 ? 135 GLY A HA2  5  
ATOM 10782 H HA3  . GLY A 1 135 ? -5.292  20.028  1.339   1.00 0.00 ? 135 GLY A HA3  5  
ATOM 10783 N N    . PRO A 1 136 ? -2.455  20.492  1.306   1.00 0.00 ? 136 PRO A N    5  
ATOM 10784 C CA   . PRO A 1 136 ? -1.239  21.134  1.774   1.00 0.00 ? 136 PRO A CA   5  
ATOM 10785 C C    . PRO A 1 136 ? -1.550  22.472  2.448   1.00 0.00 ? 136 PRO A C    5  
ATOM 10786 O O    . PRO A 1 136 ? -2.700  22.748  2.787   1.00 0.00 ? 136 PRO A O    5  
ATOM 10787 C CB   . PRO A 1 136 ? -0.370  21.281  0.536   1.00 0.00 ? 136 PRO A CB   5  
ATOM 10788 C CG   . PRO A 1 136 ? -1.309  21.143  -0.651  1.00 0.00 ? 136 PRO A CG   5  
ATOM 10789 C CD   . PRO A 1 136 ? -2.625  20.577  -0.141  1.00 0.00 ? 136 PRO A CD   5  
ATOM 10790 H HA   . PRO A 1 136 ? -0.797  20.572  2.473   1.00 0.00 ? 136 PRO A HA   5  
ATOM 10791 H HB2  . PRO A 1 136 ? 0.134   22.247  0.525   1.00 0.00 ? 136 PRO A HB2  5  
ATOM 10792 H HB3  . PRO A 1 136 ? 0.406   20.516  0.511   1.00 0.00 ? 136 PRO A HB3  5  
ATOM 10793 H HG2  . PRO A 1 136 ? -1.469  22.110  -1.126  1.00 0.00 ? 136 PRO A HG2  5  
ATOM 10794 H HG3  . PRO A 1 136 ? -0.877  20.485  -1.405  1.00 0.00 ? 136 PRO A HG3  5  
ATOM 10795 H HD2  . PRO A 1 136 ? -3.462  21.223  -0.405  1.00 0.00 ? 136 PRO A HD2  5  
ATOM 10796 H HD3  . PRO A 1 136 ? -2.829  19.597  -0.574  1.00 0.00 ? 136 PRO A HD3  5  
ATOM 10797 N N    . SER A 1 137 ? -0.504  23.267  2.624   1.00 0.00 ? 137 SER A N    5  
ATOM 10798 C CA   . SER A 1 137 ? -0.651  24.569  3.251   1.00 0.00 ? 137 SER A CA   5  
ATOM 10799 C C    . SER A 1 137 ? 0.375   25.547  2.674   1.00 0.00 ? 137 SER A C    5  
ATOM 10800 O O    . SER A 1 137 ? 0.009   26.594  2.143   1.00 0.00 ? 137 SER A O    5  
ATOM 10801 C CB   . SER A 1 137 ? -0.494  24.470  4.770   1.00 0.00 ? 137 SER A CB   5  
ATOM 10802 O OG   . SER A 1 137 ? -0.721  25.721  5.413   1.00 0.00 ? 137 SER A OG   5  
ATOM 10803 H H    . SER A 1 137 ? 0.428   23.035  2.345   1.00 0.00 ? 137 SER A H    5  
ATOM 10804 H HA   . SER A 1 137 ? -1.664  24.892  3.012   1.00 0.00 ? 137 SER A HA   5  
ATOM 10805 H HB2  . SER A 1 137 ? -1.194  23.730  5.159   1.00 0.00 ? 137 SER A HB2  5  
ATOM 10806 H HB3  . SER A 1 137 ? 0.509   24.116  5.008   1.00 0.00 ? 137 SER A HB3  5  
ATOM 10807 H HG   . SER A 1 137 ? -0.229  26.447  4.932   1.00 0.00 ? 137 SER A HG   5  
ATOM 10808 N N    . SER A 1 138 ? 1.639   25.170  2.799   1.00 0.00 ? 138 SER A N    5  
ATOM 10809 C CA   . SER A 1 138 ? 2.720   26.000  2.296   1.00 0.00 ? 138 SER A CA   5  
ATOM 10810 C C    . SER A 1 138 ? 3.445   25.282  1.156   1.00 0.00 ? 138 SER A C    5  
ATOM 10811 O O    . SER A 1 138 ? 3.183   24.111  0.890   1.00 0.00 ? 138 SER A O    5  
ATOM 10812 C CB   . SER A 1 138 ? 3.706   26.355  3.411   1.00 0.00 ? 138 SER A CB   5  
ATOM 10813 O OG   . SER A 1 138 ? 4.009   27.748  3.433   1.00 0.00 ? 138 SER A OG   5  
ATOM 10814 H H    . SER A 1 138 ? 1.928   24.317  3.232   1.00 0.00 ? 138 SER A H    5  
ATOM 10815 H HA   . SER A 1 138 ? 2.241   26.909  1.933   1.00 0.00 ? 138 SER A HA   5  
ATOM 10816 H HB2  . SER A 1 138 ? 3.286   26.060  4.373   1.00 0.00 ? 138 SER A HB2  5  
ATOM 10817 H HB3  . SER A 1 138 ? 4.625   25.786  3.277   1.00 0.00 ? 138 SER A HB3  5  
ATOM 10818 H HG   . SER A 1 138 ? 3.366   28.228  4.030   1.00 0.00 ? 138 SER A HG   5  
ATOM 10819 N N    . GLY A 1 139 ? 4.342   26.015  0.514   1.00 0.00 ? 139 GLY A N    5  
ATOM 10820 C CA   . GLY A 1 139 ? 5.107   25.463  -0.592  1.00 0.00 ? 139 GLY A CA   5  
ATOM 10821 C C    . GLY A 1 139 ? 6.368   26.289  -0.853  1.00 0.00 ? 139 GLY A C    5  
ATOM 10822 O O    . GLY A 1 139 ? 6.896   26.289  -1.964  1.00 0.00 ? 139 GLY A O    5  
ATOM 10823 H H    . GLY A 1 139 ? 4.550   26.968  0.737   1.00 0.00 ? 139 GLY A H    5  
ATOM 10824 H HA2  . GLY A 1 139 ? 5.382   24.433  -0.369  1.00 0.00 ? 139 GLY A HA2  5  
ATOM 10825 H HA3  . GLY A 1 139 ? 4.490   25.441  -1.490  1.00 0.00 ? 139 GLY A HA3  5  
ATOM 10826 N N    . GLY A 1 1   ? -13.976 65.203  -11.793 1.00 0.00 ? 1   GLY A N    6  
ATOM 10827 C CA   . GLY A 1 1   ? -14.760 64.062  -11.351 1.00 0.00 ? 1   GLY A CA   6  
ATOM 10828 C C    . GLY A 1 1   ? -14.199 62.757  -11.921 1.00 0.00 ? 1   GLY A C    6  
ATOM 10829 O O    . GLY A 1 1   ? -13.952 62.656  -13.121 1.00 0.00 ? 1   GLY A O    6  
ATOM 10830 H H1   . GLY A 1 1   ? -13.391 65.032  -12.586 1.00 0.00 ? 1   GLY A H1   6  
ATOM 10831 H HA2  . GLY A 1 1   ? -14.760 64.017  -10.262 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 10832 H HA3  . GLY A 1 1   ? -15.796 64.184  -11.665 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 10833 N N    . SER A 1 2   ? -14.015 61.792  -11.032 1.00 0.00 ? 2   SER A N    6  
ATOM 10834 C CA   . SER A 1 2   ? -13.488 60.498  -11.432 1.00 0.00 ? 2   SER A CA   6  
ATOM 10835 C C    . SER A 1 2   ? -13.677 59.484  -10.301 1.00 0.00 ? 2   SER A C    6  
ATOM 10836 O O    . SER A 1 2   ? -14.073 59.849  -9.196  1.00 0.00 ? 2   SER A O    6  
ATOM 10837 C CB   . SER A 1 2   ? -12.009 60.599  -11.812 1.00 0.00 ? 2   SER A CB   6  
ATOM 10838 O OG   . SER A 1 2   ? -11.157 60.503  -10.674 1.00 0.00 ? 2   SER A OG   6  
ATOM 10839 H H    . SER A 1 2   ? -14.218 61.882  -10.057 1.00 0.00 ? 2   SER A H    6  
ATOM 10840 H HA   . SER A 1 2   ? -14.069 60.208  -12.307 1.00 0.00 ? 2   SER A HA   6  
ATOM 10841 H HB2  . SER A 1 2   ? -11.762 59.806  -12.518 1.00 0.00 ? 2   SER A HB2  6  
ATOM 10842 H HB3  . SER A 1 2   ? -11.830 61.546  -12.321 1.00 0.00 ? 2   SER A HB3  6  
ATOM 10843 H HG   . SER A 1 2   ? -10.327 59.998  -10.910 1.00 0.00 ? 2   SER A HG   6  
ATOM 10844 N N    . SER A 1 3   ? -13.384 58.231  -10.618 1.00 0.00 ? 3   SER A N    6  
ATOM 10845 C CA   . SER A 1 3   ? -13.517 57.162  -9.643  1.00 0.00 ? 3   SER A CA   6  
ATOM 10846 C C    . SER A 1 3   ? -12.804 55.905  -10.144 1.00 0.00 ? 3   SER A C    6  
ATOM 10847 O O    . SER A 1 3   ? -12.499 55.791  -11.331 1.00 0.00 ? 3   SER A O    6  
ATOM 10848 C CB   . SER A 1 3   ? -14.989 56.859  -9.355  1.00 0.00 ? 3   SER A CB   6  
ATOM 10849 O OG   . SER A 1 3   ? -15.751 56.730  -10.552 1.00 0.00 ? 3   SER A OG   6  
ATOM 10850 H H    . SER A 1 3   ? -13.062 57.943  -11.520 1.00 0.00 ? 3   SER A H    6  
ATOM 10851 H HA   . SER A 1 3   ? -13.040 57.537  -8.737  1.00 0.00 ? 3   SER A HA   6  
ATOM 10852 H HB2  . SER A 1 3   ? -15.063 55.938  -8.777  1.00 0.00 ? 3   SER A HB2  6  
ATOM 10853 H HB3  . SER A 1 3   ? -15.410 57.655  -8.741  1.00 0.00 ? 3   SER A HB3  6  
ATOM 10854 H HG   . SER A 1 3   ? -15.209 57.029  -11.337 1.00 0.00 ? 3   SER A HG   6  
ATOM 10855 N N    . GLY A 1 4   ? -12.560 54.992  -9.216  1.00 0.00 ? 4   GLY A N    6  
ATOM 10856 C CA   . GLY A 1 4   ? -11.888 53.747  -9.549  1.00 0.00 ? 4   GLY A CA   6  
ATOM 10857 C C    . GLY A 1 4   ? -10.681 53.514  -8.638  1.00 0.00 ? 4   GLY A C    6  
ATOM 10858 O O    . GLY A 1 4   ? -9.947  54.450  -8.323  1.00 0.00 ? 4   GLY A O    6  
ATOM 10859 H H    . GLY A 1 4   ? -12.811 55.092  -8.253  1.00 0.00 ? 4   GLY A H    6  
ATOM 10860 H HA2  . GLY A 1 4   ? -12.587 52.916  -9.452  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 10861 H HA3  . GLY A 1 4   ? -11.564 53.772  -10.589 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 10862 N N    . SER A 1 5   ? -10.513 52.262  -8.241  1.00 0.00 ? 5   SER A N    6  
ATOM 10863 C CA   . SER A 1 5   ? -9.408  51.894  -7.372  1.00 0.00 ? 5   SER A CA   6  
ATOM 10864 C C    . SER A 1 5   ? -9.468  50.399  -7.052  1.00 0.00 ? 5   SER A C    6  
ATOM 10865 O O    . SER A 1 5   ? -10.502 49.761  -7.245  1.00 0.00 ? 5   SER A O    6  
ATOM 10866 C CB   . SER A 1 5   ? -9.425  52.715  -6.081  1.00 0.00 ? 5   SER A CB   6  
ATOM 10867 O OG   . SER A 1 5   ? -8.449  52.261  -5.147  1.00 0.00 ? 5   SER A OG   6  
ATOM 10868 H H    . SER A 1 5   ? -11.115 51.507  -8.501  1.00 0.00 ? 5   SER A H    6  
ATOM 10869 H HA   . SER A 1 5   ? -8.506  52.128  -7.938  1.00 0.00 ? 5   SER A HA   6  
ATOM 10870 H HB2  . SER A 1 5   ? -9.243  53.764  -6.315  1.00 0.00 ? 5   SER A HB2  6  
ATOM 10871 H HB3  . SER A 1 5   ? -10.415 52.656  -5.628  1.00 0.00 ? 5   SER A HB3  6  
ATOM 10872 H HG   . SER A 1 5   ? -8.571  51.285  -4.971  1.00 0.00 ? 5   SER A HG   6  
ATOM 10873 N N    . SER A 1 6   ? -8.347  49.884  -6.569  1.00 0.00 ? 6   SER A N    6  
ATOM 10874 C CA   . SER A 1 6   ? -8.260  48.476  -6.220  1.00 0.00 ? 6   SER A CA   6  
ATOM 10875 C C    . SER A 1 6   ? -6.884  48.169  -5.627  1.00 0.00 ? 6   SER A C    6  
ATOM 10876 O O    . SER A 1 6   ? -5.967  48.983  -5.722  1.00 0.00 ? 6   SER A O    6  
ATOM 10877 C CB   . SER A 1 6   ? -8.523  47.590  -7.439  1.00 0.00 ? 6   SER A CB   6  
ATOM 10878 O OG   . SER A 1 6   ? -9.914  47.354  -7.638  1.00 0.00 ? 6   SER A OG   6  
ATOM 10879 H H    . SER A 1 6   ? -7.511  50.410  -6.415  1.00 0.00 ? 6   SER A H    6  
ATOM 10880 H HA   . SER A 1 6   ? -9.042  48.314  -5.478  1.00 0.00 ? 6   SER A HA   6  
ATOM 10881 H HB2  . SER A 1 6   ? -8.104  48.062  -8.328  1.00 0.00 ? 6   SER A HB2  6  
ATOM 10882 H HB3  . SER A 1 6   ? -8.008  46.638  -7.313  1.00 0.00 ? 6   SER A HB3  6  
ATOM 10883 H HG   . SER A 1 6   ? -10.047 46.689  -8.373  1.00 0.00 ? 6   SER A HG   6  
ATOM 10884 N N    . GLY A 1 7   ? -6.783  46.991  -5.028  1.00 0.00 ? 7   GLY A N    6  
ATOM 10885 C CA   . GLY A 1 7   ? -5.534  46.566  -4.419  1.00 0.00 ? 7   GLY A CA   6  
ATOM 10886 C C    . GLY A 1 7   ? -5.659  45.156  -3.838  1.00 0.00 ? 7   GLY A C    6  
ATOM 10887 O O    . GLY A 1 7   ? -6.272  44.965  -2.789  1.00 0.00 ? 7   GLY A O    6  
ATOM 10888 H H    . GLY A 1 7   ? -7.533  46.334  -4.955  1.00 0.00 ? 7   GLY A H    6  
ATOM 10889 H HA2  . GLY A 1 7   ? -4.737  46.587  -5.163  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 10890 H HA3  . GLY A 1 7   ? -5.253  47.264  -3.631  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 10891 N N    . LYS A 1 8   ? -5.069  44.204  -4.546  1.00 0.00 ? 8   LYS A N    6  
ATOM 10892 C CA   . LYS A 1 8   ? -5.107  42.817  -4.114  1.00 0.00 ? 8   LYS A CA   6  
ATOM 10893 C C    . LYS A 1 8   ? -3.834  42.497  -3.328  1.00 0.00 ? 8   LYS A C    6  
ATOM 10894 O O    . LYS A 1 8   ? -2.957  43.348  -3.188  1.00 0.00 ? 8   LYS A O    6  
ATOM 10895 C CB   . LYS A 1 8   ? -5.343  41.890  -5.308  1.00 0.00 ? 8   LYS A CB   6  
ATOM 10896 C CG   . LYS A 1 8   ? -6.836  41.626  -5.511  1.00 0.00 ? 8   LYS A CG   6  
ATOM 10897 C CD   . LYS A 1 8   ? -7.357  42.352  -6.753  1.00 0.00 ? 8   LYS A CD   6  
ATOM 10898 C CE   . LYS A 1 8   ? -8.883  42.462  -6.725  1.00 0.00 ? 8   LYS A CE   6  
ATOM 10899 N NZ   . LYS A 1 8   ? -9.423  42.530  -8.102  1.00 0.00 ? 8   LYS A NZ   6  
ATOM 10900 H H    . LYS A 1 8   ? -4.573  44.367  -5.399  1.00 0.00 ? 8   LYS A H    6  
ATOM 10901 H HA   . LYS A 1 8   ? -5.962  42.706  -3.446  1.00 0.00 ? 8   LYS A HA   6  
ATOM 10902 H HB2  . LYS A 1 8   ? -4.923  42.337  -6.209  1.00 0.00 ? 8   LYS A HB2  6  
ATOM 10903 H HB3  . LYS A 1 8   ? -4.822  40.946  -5.148  1.00 0.00 ? 8   LYS A HB3  6  
ATOM 10904 H HG2  . LYS A 1 8   ? -7.009  40.555  -5.613  1.00 0.00 ? 8   LYS A HG2  6  
ATOM 10905 H HG3  . LYS A 1 8   ? -7.391  41.957  -4.633  1.00 0.00 ? 8   LYS A HG3  6  
ATOM 10906 H HD2  . LYS A 1 8   ? -6.918  43.349  -6.807  1.00 0.00 ? 8   LYS A HD2  6  
ATOM 10907 H HD3  . LYS A 1 8   ? -7.043  41.818  -7.650  1.00 0.00 ? 8   LYS A HD3  6  
ATOM 10908 H HE2  . LYS A 1 8   ? -9.305  41.602  -6.205  1.00 0.00 ? 8   LYS A HE2  6  
ATOM 10909 H HE3  . LYS A 1 8   ? -9.179  43.350  -6.168  1.00 0.00 ? 8   LYS A HE3  6  
ATOM 10910 H HZ1  . LYS A 1 8   ? -10.354 42.167  -8.113  1.00 0.00 ? 8   LYS A HZ1  6  
ATOM 10911 H HZ2  . LYS A 1 8   ? -9.432  43.481  -8.409  1.00 0.00 ? 8   LYS A HZ2  6  
ATOM 10912 H HZ3  . LYS A 1 8   ? -8.846  41.987  -8.713  1.00 0.00 ? 8   LYS A HZ3  6  
ATOM 10913 N N    . SER A 1 9   ? -3.773  41.268  -2.837  1.00 0.00 ? 9   SER A N    6  
ATOM 10914 C CA   . SER A 1 9   ? -2.622  40.826  -2.069  1.00 0.00 ? 9   SER A CA   6  
ATOM 10915 C C    . SER A 1 9   ? -2.197  39.427  -2.522  1.00 0.00 ? 9   SER A C    6  
ATOM 10916 O O    . SER A 1 9   ? -2.936  38.751  -3.236  1.00 0.00 ? 9   SER A O    6  
ATOM 10917 C CB   . SER A 1 9   ? -2.925  40.829  -0.570  1.00 0.00 ? 9   SER A CB   6  
ATOM 10918 O OG   . SER A 1 9   ? -1.750  41.021  0.213   1.00 0.00 ? 9   SER A OG   6  
ATOM 10919 H H    . SER A 1 9   ? -4.491  40.582  -2.956  1.00 0.00 ? 9   SER A H    6  
ATOM 10920 H HA   . SER A 1 9   ? -1.837  41.551  -2.282  1.00 0.00 ? 9   SER A HA   6  
ATOM 10921 H HB2  . SER A 1 9   ? -3.642  41.619  -0.347  1.00 0.00 ? 9   SER A HB2  6  
ATOM 10922 H HB3  . SER A 1 9   ? -3.394  39.885  -0.293  1.00 0.00 ? 9   SER A HB3  6  
ATOM 10923 H HG   . SER A 1 9   ? -1.994  41.132  1.176   1.00 0.00 ? 9   SER A HG   6  
ATOM 10924 N N    . GLU A 1 10  ? -1.009  39.035  -2.088  1.00 0.00 ? 10  GLU A N    6  
ATOM 10925 C CA   . GLU A 1 10  ? -0.477  37.729  -2.439  1.00 0.00 ? 10  GLU A CA   6  
ATOM 10926 C C    . GLU A 1 10  ? 0.643   37.335  -1.475  1.00 0.00 ? 10  GLU A C    6  
ATOM 10927 O O    . GLU A 1 10  ? 1.102   38.155  -0.682  1.00 0.00 ? 10  GLU A O    6  
ATOM 10928 C CB   . GLU A 1 10  ? 0.013   37.709  -3.888  1.00 0.00 ? 10  GLU A CB   6  
ATOM 10929 C CG   . GLU A 1 10  ? 1.213   38.640  -4.074  1.00 0.00 ? 10  GLU A CG   6  
ATOM 10930 C CD   . GLU A 1 10  ? 0.841   39.849  -4.935  1.00 0.00 ? 10  GLU A CD   6  
ATOM 10931 O OE1  . GLU A 1 10  ? 0.572   39.629  -6.136  1.00 0.00 ? 10  GLU A OE1  6  
ATOM 10932 O OE2  . GLU A 1 10  ? 0.833   40.965  -4.372  1.00 0.00 ? 10  GLU A OE2  6  
ATOM 10933 H H    . GLU A 1 10  ? -0.414  39.590  -1.507  1.00 0.00 ? 10  GLU A H    6  
ATOM 10934 H HA   . GLU A 1 10  ? -1.314  37.038  -2.336  1.00 0.00 ? 10  GLU A HA   6  
ATOM 10935 H HB2  . GLU A 1 10  ? 0.291   36.692  -4.168  1.00 0.00 ? 10  GLU A HB2  6  
ATOM 10936 H HB3  . GLU A 1 10  ? -0.794  38.013  -4.554  1.00 0.00 ? 10  GLU A HB3  6  
ATOM 10937 H HG2  . GLU A 1 10  ? 1.570   38.978  -3.101  1.00 0.00 ? 10  GLU A HG2  6  
ATOM 10938 H HG3  . GLU A 1 10  ? 2.033   38.094  -4.542  1.00 0.00 ? 10  GLU A HG3  6  
ATOM 10939 N N    . LYS A 1 11  ? 1.052   36.078  -1.576  1.00 0.00 ? 11  LYS A N    6  
ATOM 10940 C CA   . LYS A 1 11  ? 2.111   35.565  -0.722  1.00 0.00 ? 11  LYS A CA   6  
ATOM 10941 C C    . LYS A 1 11  ? 2.274   34.064  -0.966  1.00 0.00 ? 11  LYS A C    6  
ATOM 10942 O O    . LYS A 1 11  ? 1.303   33.371  -1.266  1.00 0.00 ? 11  LYS A O    6  
ATOM 10943 C CB   . LYS A 1 11  ? 1.842   35.925  0.740   1.00 0.00 ? 11  LYS A CB   6  
ATOM 10944 C CG   . LYS A 1 11  ? 2.821   36.993  1.231   1.00 0.00 ? 11  LYS A CG   6  
ATOM 10945 C CD   . LYS A 1 11  ? 2.145   37.941  2.225   1.00 0.00 ? 11  LYS A CD   6  
ATOM 10946 C CE   . LYS A 1 11  ? 2.384   37.485  3.666   1.00 0.00 ? 11  LYS A CE   6  
ATOM 10947 N NZ   . LYS A 1 11  ? 1.099   37.356  4.389   1.00 0.00 ? 11  LYS A NZ   6  
ATOM 10948 H H    . LYS A 1 11  ? 0.674   35.417  -2.224  1.00 0.00 ? 11  LYS A H    6  
ATOM 10949 H HA   . LYS A 1 11  ? 3.035   36.065  -1.012  1.00 0.00 ? 11  LYS A HA   6  
ATOM 10950 H HB2  . LYS A 1 11  ? 0.819   36.287  0.848   1.00 0.00 ? 11  LYS A HB2  6  
ATOM 10951 H HB3  . LYS A 1 11  ? 1.930   35.033  1.360   1.00 0.00 ? 11  LYS A HB3  6  
ATOM 10952 H HG2  . LYS A 1 11  ? 3.679   36.516  1.704   1.00 0.00 ? 11  LYS A HG2  6  
ATOM 10953 H HG3  . LYS A 1 11  ? 3.200   37.562  0.382   1.00 0.00 ? 11  LYS A HG3  6  
ATOM 10954 H HD2  . LYS A 1 11  ? 2.532   38.951  2.090   1.00 0.00 ? 11  LYS A HD2  6  
ATOM 10955 H HD3  . LYS A 1 11  ? 1.074   37.980  2.025   1.00 0.00 ? 11  LYS A HD3  6  
ATOM 10956 H HE2  . LYS A 1 11  ? 2.908   36.529  3.669   1.00 0.00 ? 11  LYS A HE2  6  
ATOM 10957 H HE3  . LYS A 1 11  ? 3.026   38.202  4.178   1.00 0.00 ? 11  LYS A HE3  6  
ATOM 10958 H HZ1  . LYS A 1 11  ? 0.559   38.187  4.260   1.00 0.00 ? 11  LYS A HZ1  6  
ATOM 10959 H HZ2  . LYS A 1 11  ? 0.594   36.571  4.031   1.00 0.00 ? 11  LYS A HZ2  6  
ATOM 10960 H HZ3  . LYS A 1 11  ? 1.277   37.222  5.364   1.00 0.00 ? 11  LYS A HZ3  6  
ATOM 10961 N N    . ARG A 1 12  ? 3.510   33.606  -0.829  1.00 0.00 ? 12  ARG A N    6  
ATOM 10962 C CA   . ARG A 1 12  ? 3.813   32.199  -1.031  1.00 0.00 ? 12  ARG A CA   6  
ATOM 10963 C C    . ARG A 1 12  ? 5.122   31.832  -0.330  1.00 0.00 ? 12  ARG A C    6  
ATOM 10964 O O    . ARG A 1 12  ? 5.879   32.711  0.079   1.00 0.00 ? 12  ARG A O    6  
ATOM 10965 C CB   . ARG A 1 12  ? 3.930   31.869  -2.521  1.00 0.00 ? 12  ARG A CB   6  
ATOM 10966 C CG   . ARG A 1 12  ? 3.022   30.696  -2.896  1.00 0.00 ? 12  ARG A CG   6  
ATOM 10967 C CD   . ARG A 1 12  ? 3.792   29.374  -2.861  1.00 0.00 ? 12  ARG A CD   6  
ATOM 10968 N NE   . ARG A 1 12  ? 3.793   28.754  -4.205  1.00 0.00 ? 12  ARG A NE   6  
ATOM 10969 C CZ   . ARG A 1 12  ? 4.365   27.575  -4.488  1.00 0.00 ? 12  ARG A CZ   6  
ATOM 10970 N NH1  . ARG A 1 12  ? 4.985   26.883  -3.523  1.00 0.00 ? 12  ARG A NH1  6  
ATOM 10971 N NH2  . ARG A 1 12  ? 4.316   27.090  -5.736  1.00 0.00 ? 12  ARG A NH2  6  
ATOM 10972 H H    . ARG A 1 12  ? 4.294   34.176  -0.586  1.00 0.00 ? 12  ARG A H    6  
ATOM 10973 H HA   . ARG A 1 12  ? 2.970   31.666  -0.591  1.00 0.00 ? 12  ARG A HA   6  
ATOM 10974 H HB2  . ARG A 1 12  ? 3.663   32.744  -3.113  1.00 0.00 ? 12  ARG A HB2  6  
ATOM 10975 H HB3  . ARG A 1 12  ? 4.965   31.625  -2.762  1.00 0.00 ? 12  ARG A HB3  6  
ATOM 10976 H HG2  . ARG A 1 12  ? 2.180   30.648  -2.206  1.00 0.00 ? 12  ARG A HG2  6  
ATOM 10977 H HG3  . ARG A 1 12  ? 2.610   30.854  -3.892  1.00 0.00 ? 12  ARG A HG3  6  
ATOM 10978 H HD2  . ARG A 1 12  ? 4.816   29.549  -2.531  1.00 0.00 ? 12  ARG A HD2  6  
ATOM 10979 H HD3  . ARG A 1 12  ? 3.336   28.697  -2.139  1.00 0.00 ? 12  ARG A HD3  6  
ATOM 10980 H HE   . ARG A 1 12  ? 3.339   29.245  -4.948  1.00 0.00 ? 12  ARG A HE   6  
ATOM 10981 H HH11 . ARG A 1 12  ? 5.022   27.245  -2.592  1.00 0.00 ? 12  ARG A HH11 6  
ATOM 10982 H HH12 . ARG A 1 12  ? 5.412   26.003  -3.734  1.00 0.00 ? 12  ARG A HH12 6  
ATOM 10983 H HH21 . ARG A 1 12  ? 3.853   27.606  -6.456  1.00 0.00 ? 12  ARG A HH21 6  
ATOM 10984 H HH22 . ARG A 1 12  ? 4.743   26.210  -5.947  1.00 0.00 ? 12  ARG A HH22 6  
ATOM 10985 N N    . MET A 1 13  ? 5.350   30.532  -0.213  1.00 0.00 ? 13  MET A N    6  
ATOM 10986 C CA   . MET A 1 13  ? 6.554   30.038  0.432   1.00 0.00 ? 13  MET A CA   6  
ATOM 10987 C C    . MET A 1 13  ? 6.733   28.539  0.184   1.00 0.00 ? 13  MET A C    6  
ATOM 10988 O O    . MET A 1 13  ? 5.825   27.875  -0.312  1.00 0.00 ? 13  MET A O    6  
ATOM 10989 C CB   . MET A 1 13  ? 6.473   30.301  1.937   1.00 0.00 ? 13  MET A CB   6  
ATOM 10990 C CG   . MET A 1 13  ? 7.364   31.479  2.337   1.00 0.00 ? 13  MET A CG   6  
ATOM 10991 S SD   . MET A 1 13  ? 6.478   32.567  3.439   1.00 0.00 ? 13  MET A SD   6  
ATOM 10992 C CE   . MET A 1 13  ? 7.626   32.627  4.805   1.00 0.00 ? 13  MET A CE   6  
ATOM 10993 H H    . MET A 1 13  ? 4.729   29.823  -0.549  1.00 0.00 ? 13  MET A H    6  
ATOM 10994 H HA   . MET A 1 13  ? 7.377   30.590  -0.023  1.00 0.00 ? 13  MET A HA   6  
ATOM 10995 H HB2  . MET A 1 13  ? 5.440   30.509  2.218   1.00 0.00 ? 13  MET A HB2  6  
ATOM 10996 H HB3  . MET A 1 13  ? 6.777   29.408  2.483   1.00 0.00 ? 13  MET A HB3  6  
ATOM 10997 H HG2  . MET A 1 13  ? 8.268   31.113  2.823   1.00 0.00 ? 13  MET A HG2  6  
ATOM 10998 H HG3  . MET A 1 13  ? 7.679   32.025  1.448   1.00 0.00 ? 13  MET A HG3  6  
ATOM 10999 H HE1  . MET A 1 13  ? 8.632   32.417  4.443   1.00 0.00 ? 13  MET A HE1  6  
ATOM 11000 H HE2  . MET A 1 13  ? 7.602   33.619  5.257   1.00 0.00 ? 13  MET A HE2  6  
ATOM 11001 H HE3  . MET A 1 13  ? 7.344   31.882  5.549   1.00 0.00 ? 13  MET A HE3  6  
ATOM 11002 N N    . LYS A 1 14  ? 7.911   28.049  0.542   1.00 0.00 ? 14  LYS A N    6  
ATOM 11003 C CA   . LYS A 1 14  ? 8.221   26.641  0.365   1.00 0.00 ? 14  LYS A CA   6  
ATOM 11004 C C    . LYS A 1 14  ? 8.346   25.974  1.736   1.00 0.00 ? 14  LYS A C    6  
ATOM 11005 O O    . LYS A 1 14  ? 8.548   26.650  2.743   1.00 0.00 ? 14  LYS A O    6  
ATOM 11006 C CB   . LYS A 1 14  ? 9.461   26.471  -0.516  1.00 0.00 ? 14  LYS A CB   6  
ATOM 11007 C CG   . LYS A 1 14  ? 9.078   25.977  -1.913  1.00 0.00 ? 14  LYS A CG   6  
ATOM 11008 C CD   . LYS A 1 14  ? 9.433   27.016  -2.978  1.00 0.00 ? 14  LYS A CD   6  
ATOM 11009 C CE   . LYS A 1 14  ? 9.191   26.464  -4.384  1.00 0.00 ? 14  LYS A CE   6  
ATOM 11010 N NZ   . LYS A 1 14  ? 10.431  26.532  -5.189  1.00 0.00 ? 14  LYS A NZ   6  
ATOM 11011 H H    . LYS A 1 14  ? 8.645   28.596  0.945   1.00 0.00 ? 14  LYS A H    6  
ATOM 11012 H HA   . LYS A 1 14  ? 7.385   26.186  -0.166  1.00 0.00 ? 14  LYS A HA   6  
ATOM 11013 H HB2  . LYS A 1 14  ? 9.989   27.422  -0.595  1.00 0.00 ? 14  LYS A HB2  6  
ATOM 11014 H HB3  . LYS A 1 14  ? 10.148  25.764  -0.051  1.00 0.00 ? 14  LYS A HB3  6  
ATOM 11015 H HG2  . LYS A 1 14  ? 9.595   25.041  -2.125  1.00 0.00 ? 14  LYS A HG2  6  
ATOM 11016 H HG3  . LYS A 1 14  ? 8.010   25.766  -1.947  1.00 0.00 ? 14  LYS A HG3  6  
ATOM 11017 H HD2  . LYS A 1 14  ? 8.836   27.915  -2.829  1.00 0.00 ? 14  LYS A HD2  6  
ATOM 11018 H HD3  . LYS A 1 14  ? 10.479  27.307  -2.873  1.00 0.00 ? 14  LYS A HD3  6  
ATOM 11019 H HE2  . LYS A 1 14  ? 8.847   25.431  -4.322  1.00 0.00 ? 14  LYS A HE2  6  
ATOM 11020 H HE3  . LYS A 1 14  ? 8.401   27.033  -4.874  1.00 0.00 ? 14  LYS A HE3  6  
ATOM 11021 H HZ1  . LYS A 1 14  ? 10.432  25.794  -5.863  1.00 0.00 ? 14  LYS A HZ1  6  
ATOM 11022 H HZ2  . LYS A 1 14  ? 10.474  27.414  -5.660  1.00 0.00 ? 14  LYS A HZ2  6  
ATOM 11023 H HZ3  . LYS A 1 14  ? 11.224  26.436  -4.588  1.00 0.00 ? 14  LYS A HZ3  6  
ATOM 11024 N N    . LEU A 1 15  ? 8.220   24.655  1.731   1.00 0.00 ? 15  LEU A N    6  
ATOM 11025 C CA   . LEU A 1 15  ? 8.315   23.889  2.962   1.00 0.00 ? 15  LEU A CA   6  
ATOM 11026 C C    . LEU A 1 15  ? 8.278   22.395  2.633   1.00 0.00 ? 15  LEU A C    6  
ATOM 11027 O O    . LEU A 1 15  ? 7.507   21.964  1.777   1.00 0.00 ? 15  LEU A O    6  
ATOM 11028 C CB   . LEU A 1 15  ? 7.234   24.328  3.951   1.00 0.00 ? 15  LEU A CB   6  
ATOM 11029 C CG   . LEU A 1 15  ? 7.199   23.576  5.284   1.00 0.00 ? 15  LEU A CG   6  
ATOM 11030 C CD1  . LEU A 1 15  ? 8.279   24.095  6.234   1.00 0.00 ? 15  LEU A CD1  6  
ATOM 11031 C CD2  . LEU A 1 15  ? 5.805   23.638  5.912   1.00 0.00 ? 15  LEU A CD2  6  
ATOM 11032 H H    . LEU A 1 15  ? 8.056   24.112  0.907   1.00 0.00 ? 15  LEU A H    6  
ATOM 11033 H HA   . LEU A 1 15  ? 9.280   24.119  3.416   1.00 0.00 ? 15  LEU A HA   6  
ATOM 11034 H HB2  . LEU A 1 15  ? 7.369   25.389  4.159   1.00 0.00 ? 15  LEU A HB2  6  
ATOM 11035 H HB3  . LEU A 1 15  ? 6.263   24.218  3.469   1.00 0.00 ? 15  LEU A HB3  6  
ATOM 11036 H HG   . LEU A 1 15  ? 7.418   22.526  5.089   1.00 0.00 ? 15  LEU A HG   6  
ATOM 11037 H HD11 . LEU A 1 15  ? 8.520   23.324  6.966   1.00 0.00 ? 15  LEU A HD11 6  
ATOM 11038 H HD12 . LEU A 1 15  ? 9.174   24.347  5.665   1.00 0.00 ? 15  LEU A HD12 6  
ATOM 11039 H HD13 . LEU A 1 15  ? 7.914   24.983  6.749   1.00 0.00 ? 15  LEU A HD13 6  
ATOM 11040 H HD21 . LEU A 1 15  ? 5.056   23.734  5.125   1.00 0.00 ? 15  LEU A HD21 6  
ATOM 11041 H HD22 . LEU A 1 15  ? 5.621   22.726  6.479   1.00 0.00 ? 15  LEU A HD22 6  
ATOM 11042 H HD23 . LEU A 1 15  ? 5.745   24.499  6.577   1.00 0.00 ? 15  LEU A HD23 6  
ATOM 11043 N N    . THR A 1 16  ? 9.121   21.647  3.329   1.00 0.00 ? 16  THR A N    6  
ATOM 11044 C CA   . THR A 1 16  ? 9.194   20.211  3.122   1.00 0.00 ? 16  THR A CA   6  
ATOM 11045 C C    . THR A 1 16  ? 8.511   19.470  4.273   1.00 0.00 ? 16  THR A C    6  
ATOM 11046 O O    . THR A 1 16  ? 8.541   19.927  5.414   1.00 0.00 ? 16  THR A O    6  
ATOM 11047 C CB   . THR A 1 16  ? 10.666  19.833  2.945   1.00 0.00 ? 16  THR A CB   6  
ATOM 11048 O OG1  . THR A 1 16  ? 10.649  18.412  2.835   1.00 0.00 ? 16  THR A OG1  6  
ATOM 11049 C CG2  . THR A 1 16  ? 11.494  20.100  4.203   1.00 0.00 ? 16  THR A CG2  6  
ATOM 11050 H H    . THR A 1 16  ? 9.745   22.006  4.023   1.00 0.00 ? 16  THR A H    6  
ATOM 11051 H HA   . THR A 1 16  ? 8.644   19.967  2.213   1.00 0.00 ? 16  THR A HA   6  
ATOM 11052 H HB   . THR A 1 16  ? 11.096  20.339  2.080   1.00 0.00 ? 16  THR A HB   6  
ATOM 11053 H HG1  . THR A 1 16  ? 10.880  18.138  1.902   1.00 0.00 ? 16  THR A HG1  6  
ATOM 11054 H HG21 . THR A 1 16  ? 11.867  19.156  4.600   1.00 0.00 ? 16  THR A HG21 6  
ATOM 11055 H HG22 . THR A 1 16  ? 12.336  20.746  3.953   1.00 0.00 ? 16  THR A HG22 6  
ATOM 11056 H HG23 . THR A 1 16  ? 10.871  20.588  4.952   1.00 0.00 ? 16  THR A HG23 6  
ATOM 11057 N N    . LEU A 1 17  ? 7.910   18.339  3.933   1.00 0.00 ? 17  LEU A N    6  
ATOM 11058 C CA   . LEU A 1 17  ? 7.220   17.531  4.924   1.00 0.00 ? 17  LEU A CA   6  
ATOM 11059 C C    . LEU A 1 17  ? 7.876   16.150  4.995   1.00 0.00 ? 17  LEU A C    6  
ATOM 11060 O O    . LEU A 1 17  ? 8.306   15.610  3.977   1.00 0.00 ? 17  LEU A O    6  
ATOM 11061 C CB   . LEU A 1 17  ? 5.720   17.485  4.627   1.00 0.00 ? 17  LEU A CB   6  
ATOM 11062 C CG   . LEU A 1 17  ? 4.793   17.746  5.817   1.00 0.00 ? 17  LEU A CG   6  
ATOM 11063 C CD1  . LEU A 1 17  ? 5.263   16.981  7.056   1.00 0.00 ? 17  LEU A CD1  6  
ATOM 11064 C CD2  . LEU A 1 17  ? 4.656   19.246  6.086   1.00 0.00 ? 17  LEU A CD2  6  
ATOM 11065 H H    . LEU A 1 17  ? 7.890   17.975  3.002   1.00 0.00 ? 17  LEU A H    6  
ATOM 11066 H HA   . LEU A 1 17  ? 7.343   18.022  5.889   1.00 0.00 ? 17  LEU A HA   6  
ATOM 11067 H HB2  . LEU A 1 17  ? 5.500   18.219  3.853   1.00 0.00 ? 17  LEU A HB2  6  
ATOM 11068 H HB3  . LEU A 1 17  ? 5.481   16.505  4.214   1.00 0.00 ? 17  LEU A HB3  6  
ATOM 11069 H HG   . LEU A 1 17  ? 3.801   17.372  5.565   1.00 0.00 ? 17  LEU A HG   6  
ATOM 11070 H HD11 . LEU A 1 17  ? 5.414   15.932  6.800   1.00 0.00 ? 17  LEU A HD11 6  
ATOM 11071 H HD12 . LEU A 1 17  ? 6.202   17.407  7.411   1.00 0.00 ? 17  LEU A HD12 6  
ATOM 11072 H HD13 . LEU A 1 17  ? 4.509   17.060  7.839   1.00 0.00 ? 17  LEU A HD13 6  
ATOM 11073 H HD21 . LEU A 1 17  ? 4.906   19.801  5.182   1.00 0.00 ? 17  LEU A HD21 6  
ATOM 11074 H HD22 . LEU A 1 17  ? 3.631   19.470  6.379   1.00 0.00 ? 17  LEU A HD22 6  
ATOM 11075 H HD23 . LEU A 1 17  ? 5.335   19.534  6.889   1.00 0.00 ? 17  LEU A HD23 6  
ATOM 11076 N N    . LYS A 1 18  ? 7.931   15.618  6.207   1.00 0.00 ? 18  LYS A N    6  
ATOM 11077 C CA   . LYS A 1 18  ? 8.527   14.311  6.424   1.00 0.00 ? 18  LYS A CA   6  
ATOM 11078 C C    . LYS A 1 18  ? 7.856   13.643  7.626   1.00 0.00 ? 18  LYS A C    6  
ATOM 11079 O O    . LYS A 1 18  ? 7.246   14.317  8.455   1.00 0.00 ? 18  LYS A O    6  
ATOM 11080 C CB   . LYS A 1 18  ? 10.046  14.430  6.556   1.00 0.00 ? 18  LYS A CB   6  
ATOM 11081 C CG   . LYS A 1 18  ? 10.743  13.176  6.022   1.00 0.00 ? 18  LYS A CG   6  
ATOM 11082 C CD   . LYS A 1 18  ? 11.698  13.524  4.879   1.00 0.00 ? 18  LYS A CD   6  
ATOM 11083 C CE   . LYS A 1 18  ? 13.003  12.734  4.996   1.00 0.00 ? 18  LYS A CE   6  
ATOM 11084 N NZ   . LYS A 1 18  ? 13.853  13.293  6.072   1.00 0.00 ? 18  LYS A NZ   6  
ATOM 11085 H H    . LYS A 1 18  ? 7.579   16.064  7.030   1.00 0.00 ? 18  LYS A H    6  
ATOM 11086 H HA   . LYS A 1 18  ? 8.326   13.709  5.538   1.00 0.00 ? 18  LYS A HA   6  
ATOM 11087 H HB2  . LYS A 1 18  ? 10.396  15.305  6.008   1.00 0.00 ? 18  LYS A HB2  6  
ATOM 11088 H HB3  . LYS A 1 18  ? 10.314  14.581  7.601   1.00 0.00 ? 18  LYS A HB3  6  
ATOM 11089 H HG2  . LYS A 1 18  ? 11.294  12.691  6.827   1.00 0.00 ? 18  LYS A HG2  6  
ATOM 11090 H HG3  . LYS A 1 18  ? 9.996   12.462  5.672   1.00 0.00 ? 18  LYS A HG3  6  
ATOM 11091 H HD2  . LYS A 1 18  ? 11.222  13.307  3.923   1.00 0.00 ? 18  LYS A HD2  6  
ATOM 11092 H HD3  . LYS A 1 18  ? 11.913  14.593  4.893   1.00 0.00 ? 18  LYS A HD3  6  
ATOM 11093 H HE2  . LYS A 1 18  ? 12.784  11.687  5.205   1.00 0.00 ? 18  LYS A HE2  6  
ATOM 11094 H HE3  . LYS A 1 18  ? 13.540  12.765  4.048   1.00 0.00 ? 18  LYS A HE3  6  
ATOM 11095 H HZ1  . LYS A 1 18  ? 14.791  13.390  5.739   1.00 0.00 ? 18  LYS A HZ1  6  
ATOM 11096 H HZ2  . LYS A 1 18  ? 13.501  14.189  6.343   1.00 0.00 ? 18  LYS A HZ2  6  
ATOM 11097 H HZ3  . LYS A 1 18  ? 13.840  12.678  6.860   1.00 0.00 ? 18  LYS A HZ3  6  
ATOM 11098 N N    . GLY A 1 19  ? 7.992   12.326  7.683   1.00 0.00 ? 19  GLY A N    6  
ATOM 11099 C CA   . GLY A 1 19  ? 7.406   11.560  8.770   1.00 0.00 ? 19  GLY A CA   6  
ATOM 11100 C C    . GLY A 1 19  ? 6.775   10.266  8.251   1.00 0.00 ? 19  GLY A C    6  
ATOM 11101 O O    . GLY A 1 19  ? 5.586   10.233  7.939   1.00 0.00 ? 19  GLY A O    6  
ATOM 11102 H H    . GLY A 1 19  ? 8.489   11.786  7.005   1.00 0.00 ? 19  GLY A H    6  
ATOM 11103 H HA2  . GLY A 1 19  ? 8.173   11.324  9.508   1.00 0.00 ? 19  GLY A HA2  6  
ATOM 11104 H HA3  . GLY A 1 19  ? 6.650   12.160  9.277   1.00 0.00 ? 19  GLY A HA3  6  
ATOM 11105 N N    . GLY A 1 20  ? 7.600   9.233   8.173   1.00 0.00 ? 20  GLY A N    6  
ATOM 11106 C CA   . GLY A 1 20  ? 7.138   7.940   7.697   1.00 0.00 ? 20  GLY A CA   6  
ATOM 11107 C C    . GLY A 1 20  ? 5.802   7.564   8.342   1.00 0.00 ? 20  GLY A C    6  
ATOM 11108 O O    . GLY A 1 20  ? 5.549   7.902   9.497   1.00 0.00 ? 20  GLY A O    6  
ATOM 11109 H H    . GLY A 1 20  ? 8.566   9.268   8.429   1.00 0.00 ? 20  GLY A H    6  
ATOM 11110 H HA2  . GLY A 1 20  ? 7.028   7.966   6.613   1.00 0.00 ? 20  GLY A HA2  6  
ATOM 11111 H HA3  . GLY A 1 20  ? 7.883   7.177   7.925   1.00 0.00 ? 20  GLY A HA3  6  
ATOM 11112 N N    . ALA A 1 21  ? 4.982   6.870   7.566   1.00 0.00 ? 21  ALA A N    6  
ATOM 11113 C CA   . ALA A 1 21  ? 3.678   6.445   8.047   1.00 0.00 ? 21  ALA A CA   6  
ATOM 11114 C C    . ALA A 1 21  ? 3.856   5.293   9.038   1.00 0.00 ? 21  ALA A C    6  
ATOM 11115 O O    . ALA A 1 21  ? 4.926   4.691   9.111   1.00 0.00 ? 21  ALA A O    6  
ATOM 11116 C CB   . ALA A 1 21  ? 2.796   6.060   6.857   1.00 0.00 ? 21  ALA A CB   6  
ATOM 11117 H H    . ALA A 1 21  ? 5.195   6.599   6.627   1.00 0.00 ? 21  ALA A H    6  
ATOM 11118 H HA   . ALA A 1 21  ? 3.223   7.290   8.563   1.00 0.00 ? 21  ALA A HA   6  
ATOM 11119 H HB1  . ALA A 1 21  ? 2.597   6.944   6.252   1.00 0.00 ? 21  ALA A HB1  6  
ATOM 11120 H HB2  . ALA A 1 21  ? 3.309   5.313   6.252   1.00 0.00 ? 21  ALA A HB2  6  
ATOM 11121 H HB3  . ALA A 1 21  ? 1.855   5.649   7.221   1.00 0.00 ? 21  ALA A HB3  6  
ATOM 11122 N N    . ALA A 1 22  ? 2.790   5.020   9.776   1.00 0.00 ? 22  ALA A N    6  
ATOM 11123 C CA   . ALA A 1 22  ? 2.815   3.951   10.760  1.00 0.00 ? 22  ALA A CA   6  
ATOM 11124 C C    . ALA A 1 22  ? 2.520   2.619   10.067  1.00 0.00 ? 22  ALA A C    6  
ATOM 11125 O O    . ALA A 1 22  ? 1.679   2.554   9.171   1.00 0.00 ? 22  ALA A O    6  
ATOM 11126 C CB   . ALA A 1 22  ? 1.815   4.261   11.876  1.00 0.00 ? 22  ALA A CB   6  
ATOM 11127 H H    . ALA A 1 22  ? 1.923   5.514   9.711   1.00 0.00 ? 22  ALA A H    6  
ATOM 11128 H HA   . ALA A 1 22  ? 3.817   3.915   11.186  1.00 0.00 ? 22  ALA A HA   6  
ATOM 11129 H HB1  . ALA A 1 22  ? 2.011   3.611   12.729  1.00 0.00 ? 22  ALA A HB1  6  
ATOM 11130 H HB2  . ALA A 1 22  ? 1.922   5.302   12.180  1.00 0.00 ? 22  ALA A HB2  6  
ATOM 11131 H HB3  . ALA A 1 22  ? 0.802   4.090   11.514  1.00 0.00 ? 22  ALA A HB3  6  
ATOM 11132 N N    . VAL A 1 23  ? 3.229   1.590   10.507  1.00 0.00 ? 23  VAL A N    6  
ATOM 11133 C CA   . VAL A 1 23  ? 3.053   0.264   9.940   1.00 0.00 ? 23  VAL A CA   6  
ATOM 11134 C C    . VAL A 1 23  ? 2.097   -0.541  10.822  1.00 0.00 ? 23  VAL A C    6  
ATOM 11135 O O    . VAL A 1 23  ? 1.924   -0.231  11.999  1.00 0.00 ? 23  VAL A O    6  
ATOM 11136 C CB   . VAL A 1 23  ? 4.414   -0.413  9.761   1.00 0.00 ? 23  VAL A CB   6  
ATOM 11137 C CG1  . VAL A 1 23  ? 4.253   -1.920  9.553   1.00 0.00 ? 23  VAL A CG1  6  
ATOM 11138 C CG2  . VAL A 1 23  ? 5.194   0.220   8.607   1.00 0.00 ? 23  VAL A CG2  6  
ATOM 11139 H H    . VAL A 1 23  ? 3.911   1.651   11.235  1.00 0.00 ? 23  VAL A H    6  
ATOM 11140 H HA   . VAL A 1 23  ? 2.604   0.384   8.954   1.00 0.00 ? 23  VAL A HA   6  
ATOM 11141 H HB   . VAL A 1 23  ? 4.987   -0.260  10.676  1.00 0.00 ? 23  VAL A HB   6  
ATOM 11142 H HG11 . VAL A 1 23  ? 5.206   -2.347  9.240   1.00 0.00 ? 23  VAL A HG11 6  
ATOM 11143 H HG12 . VAL A 1 23  ? 3.936   -2.384  10.487  1.00 0.00 ? 23  VAL A HG12 6  
ATOM 11144 H HG13 . VAL A 1 23  ? 3.503   -2.103  8.783   1.00 0.00 ? 23  VAL A HG13 6  
ATOM 11145 H HG21 . VAL A 1 23  ? 5.540   1.210   8.903   1.00 0.00 ? 23  VAL A HG21 6  
ATOM 11146 H HG22 . VAL A 1 23  ? 6.051   -0.407  8.361   1.00 0.00 ? 23  VAL A HG22 6  
ATOM 11147 H HG23 . VAL A 1 23  ? 4.545   0.307   7.735   1.00 0.00 ? 23  VAL A HG23 6  
ATOM 11148 N N    . ASP A 1 24  ? 1.500   -1.558  10.218  1.00 0.00 ? 24  ASP A N    6  
ATOM 11149 C CA   . ASP A 1 24  ? 0.565   -2.410  10.934  1.00 0.00 ? 24  ASP A CA   6  
ATOM 11150 C C    . ASP A 1 24  ? 1.337   -3.526  11.640  1.00 0.00 ? 24  ASP A C    6  
ATOM 11151 O O    . ASP A 1 24  ? 2.366   -3.983  11.145  1.00 0.00 ? 24  ASP A O    6  
ATOM 11152 C CB   . ASP A 1 24  ? -0.434  -3.060  9.974   1.00 0.00 ? 24  ASP A CB   6  
ATOM 11153 C CG   . ASP A 1 24  ? -1.840  -2.457  9.999   1.00 0.00 ? 24  ASP A CG   6  
ATOM 11154 O OD1  . ASP A 1 24  ? -2.476  -2.544  11.071  1.00 0.00 ? 24  ASP A OD1  6  
ATOM 11155 O OD2  . ASP A 1 24  ? -2.247  -1.923  8.944   1.00 0.00 ? 24  ASP A OD2  6  
ATOM 11156 H H    . ASP A 1 24  ? 1.646   -1.804  9.259   1.00 0.00 ? 24  ASP A H    6  
ATOM 11157 H HA   . ASP A 1 24  ? 0.054   -1.749  11.633  1.00 0.00 ? 24  ASP A HA   6  
ATOM 11158 H HB2  . ASP A 1 24  ? -0.041  -2.987  8.960   1.00 0.00 ? 24  ASP A HB2  6  
ATOM 11159 H HB3  . ASP A 1 24  ? -0.505  -4.121  10.212  1.00 0.00 ? 24  ASP A HB3  6  
ATOM 11160 N N    . PRO A 1 25  ? 0.796   -3.944  12.816  1.00 0.00 ? 25  PRO A N    6  
ATOM 11161 C CA   . PRO A 1 25  ? 1.423   -4.998  13.595  1.00 0.00 ? 25  PRO A CA   6  
ATOM 11162 C C    . PRO A 1 25  ? 1.182   -6.368  12.958  1.00 0.00 ? 25  PRO A C    6  
ATOM 11163 O O    . PRO A 1 25  ? 1.908   -7.322  13.235  1.00 0.00 ? 25  PRO A O    6  
ATOM 11164 C CB   . PRO A 1 25  ? 0.817   -4.874  14.984  1.00 0.00 ? 25  PRO A CB   6  
ATOM 11165 C CG   . PRO A 1 25  ? -0.458  -4.064  14.811  1.00 0.00 ? 25  PRO A CG   6  
ATOM 11166 C CD   . PRO A 1 25  ? -0.421  -3.426  13.432  1.00 0.00 ? 25  PRO A CD   6  
ATOM 11167 H HA   . PRO A 1 25  ? 2.415   -4.875  13.611  1.00 0.00 ? 25  PRO A HA   6  
ATOM 11168 H HB2  . PRO A 1 25  ? 0.602   -5.856  15.405  1.00 0.00 ? 25  PRO A HB2  6  
ATOM 11169 H HB3  . PRO A 1 25  ? 1.506   -4.378  15.668  1.00 0.00 ? 25  PRO A HB3  6  
ATOM 11170 H HG2  . PRO A 1 25  ? -1.334  -4.704  14.913  1.00 0.00 ? 25  PRO A HG2  6  
ATOM 11171 H HG3  . PRO A 1 25  ? -0.531  -3.299  15.584  1.00 0.00 ? 25  PRO A HG3  6  
ATOM 11172 H HD2  . PRO A 1 25  ? -1.304  -3.691  12.850  1.00 0.00 ? 25  PRO A HD2  6  
ATOM 11173 H HD3  . PRO A 1 25  ? -0.399  -2.338  13.500  1.00 0.00 ? 25  PRO A HD3  6  
ATOM 11174 N N    . ASP A 1 26  ? 0.160   -6.422  12.117  1.00 0.00 ? 26  ASP A N    6  
ATOM 11175 C CA   . ASP A 1 26  ? -0.186  -7.660  11.438  1.00 0.00 ? 26  ASP A CA   6  
ATOM 11176 C C    . ASP A 1 26  ? 0.831   -7.928  10.327  1.00 0.00 ? 26  ASP A C    6  
ATOM 11177 O O    . ASP A 1 26  ? 0.901   -9.037  9.799   1.00 0.00 ? 26  ASP A O    6  
ATOM 11178 C CB   . ASP A 1 26  ? -1.573  -7.568  10.798  1.00 0.00 ? 26  ASP A CB   6  
ATOM 11179 C CG   . ASP A 1 26  ? -2.710  -8.161  11.631  1.00 0.00 ? 26  ASP A CG   6  
ATOM 11180 O OD1  . ASP A 1 26  ? -2.393  -8.750  12.687  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 11181 O OD2  . ASP A 1 26  ? -3.872  -8.011  11.194  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 11182 H H    . ASP A 1 26  ? -0.426  -5.642  11.898  1.00 0.00 ? 26  ASP A H    6  
ATOM 11183 H HA   . ASP A 1 26  ? -0.169  -8.426  12.213  1.00 0.00 ? 26  ASP A HA   6  
ATOM 11184 H HB2  . ASP A 1 26  ? -1.796  -6.520  10.599  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 11185 H HB3  . ASP A 1 26  ? -1.545  -8.076  9.834   1.00 0.00 ? 26  ASP A HB3  6  
ATOM 11186 N N    . SER A 1 27  ? 1.594   -6.894  10.005  1.00 0.00 ? 27  SER A N    6  
ATOM 11187 C CA   . SER A 1 27  ? 2.604   -7.005  8.966   1.00 0.00 ? 27  SER A CA   6  
ATOM 11188 C C    . SER A 1 27  ? 3.847   -7.708  9.517   1.00 0.00 ? 27  SER A C    6  
ATOM 11189 O O    . SER A 1 27  ? 4.534   -8.423  8.789   1.00 0.00 ? 27  SER A O    6  
ATOM 11190 C CB   . SER A 1 27  ? 2.976   -5.628  8.411   1.00 0.00 ? 27  SER A CB   6  
ATOM 11191 O OG   . SER A 1 27  ? 3.705   -4.850  9.356   1.00 0.00 ? 27  SER A OG   6  
ATOM 11192 H H    . SER A 1 27  ? 1.531   -5.996  10.439  1.00 0.00 ? 27  SER A H    6  
ATOM 11193 H HA   . SER A 1 27  ? 2.144   -7.602  8.179   1.00 0.00 ? 27  SER A HA   6  
ATOM 11194 H HB2  . SER A 1 27  ? 3.572   -5.751  7.506   1.00 0.00 ? 27  SER A HB2  6  
ATOM 11195 H HB3  . SER A 1 27  ? 2.069   -5.096  8.125   1.00 0.00 ? 27  SER A HB3  6  
ATOM 11196 H HG   . SER A 1 27  ? 3.137   -4.096  9.688   1.00 0.00 ? 27  SER A HG   6  
ATOM 11197 N N    . GLY A 1 28  ? 4.097   -7.480  10.798  1.00 0.00 ? 28  GLY A N    6  
ATOM 11198 C CA   . GLY A 1 28  ? 5.245   -8.083  11.455  1.00 0.00 ? 28  GLY A CA   6  
ATOM 11199 C C    . GLY A 1 28  ? 6.482   -7.192  11.325  1.00 0.00 ? 28  GLY A C    6  
ATOM 11200 O O    . GLY A 1 28  ? 7.471   -7.390  12.028  1.00 0.00 ? 28  GLY A O    6  
ATOM 11201 H H    . GLY A 1 28  ? 3.534   -6.897  11.383  1.00 0.00 ? 28  GLY A H    6  
ATOM 11202 H HA2  . GLY A 1 28  ? 5.020   -8.248  12.508  1.00 0.00 ? 28  GLY A HA2  6  
ATOM 11203 H HA3  . GLY A 1 28  ? 5.448   -9.060  11.015  1.00 0.00 ? 28  GLY A HA3  6  
ATOM 11204 N N    . LEU A 1 29  ? 6.385   -6.228  10.420  1.00 0.00 ? 29  LEU A N    6  
ATOM 11205 C CA   . LEU A 1 29  ? 7.484   -5.306  10.189  1.00 0.00 ? 29  LEU A CA   6  
ATOM 11206 C C    . LEU A 1 29  ? 7.175   -3.971  10.870  1.00 0.00 ? 29  LEU A C    6  
ATOM 11207 O O    . LEU A 1 29  ? 7.824   -2.964  10.592  1.00 0.00 ? 29  LEU A O    6  
ATOM 11208 C CB   . LEU A 1 29  ? 7.772   -5.180  8.692   1.00 0.00 ? 29  LEU A CB   6  
ATOM 11209 C CG   . LEU A 1 29  ? 7.690   -6.476  7.882   1.00 0.00 ? 29  LEU A CG   6  
ATOM 11210 C CD1  . LEU A 1 29  ? 7.929   -7.696  8.774   1.00 0.00 ? 29  LEU A CD1  6  
ATOM 11211 C CD2  . LEU A 1 29  ? 6.361   -6.568  7.129   1.00 0.00 ? 29  LEU A CD2  6  
ATOM 11212 H H    . LEU A 1 29  ? 5.577   -6.073  9.852   1.00 0.00 ? 29  LEU A H    6  
ATOM 11213 H HA   . LEU A 1 29  ? 8.372   -5.733  10.654  1.00 0.00 ? 29  LEU A HA   6  
ATOM 11214 H HB2  . LEU A 1 29  ? 7.070   -4.464  8.265   1.00 0.00 ? 29  LEU A HB2  6  
ATOM 11215 H HB3  . LEU A 1 29  ? 8.770   -4.761  8.568   1.00 0.00 ? 29  LEU A HB3  6  
ATOM 11216 H HG   . LEU A 1 29  ? 8.483   -6.463  7.135   1.00 0.00 ? 29  LEU A HG   6  
ATOM 11217 H HD11 . LEU A 1 29  ? 8.410   -8.483  8.192   1.00 0.00 ? 29  LEU A HD11 6  
ATOM 11218 H HD12 . LEU A 1 29  ? 8.573   -7.416  9.608   1.00 0.00 ? 29  LEU A HD12 6  
ATOM 11219 H HD13 . LEU A 1 29  ? 6.975   -8.059  9.157   1.00 0.00 ? 29  LEU A HD13 6  
ATOM 11220 H HD21 . LEU A 1 29  ? 5.904   -7.540  7.316   1.00 0.00 ? 29  LEU A HD21 6  
ATOM 11221 H HD22 . LEU A 1 29  ? 5.693   -5.780  7.473   1.00 0.00 ? 29  LEU A HD22 6  
ATOM 11222 H HD23 . LEU A 1 29  ? 6.541   -6.451  6.060   1.00 0.00 ? 29  LEU A HD23 6  
ATOM 11223 N N    . GLU A 1 30  ? 6.183   -4.006  11.748  1.00 0.00 ? 30  GLU A N    6  
ATOM 11224 C CA   . GLU A 1 30  ? 5.780   -2.811  12.470  1.00 0.00 ? 30  GLU A CA   6  
ATOM 11225 C C    . GLU A 1 30  ? 6.948   -2.273  13.298  1.00 0.00 ? 30  GLU A C    6  
ATOM 11226 O O    . GLU A 1 30  ? 7.051   -1.068  13.523  1.00 0.00 ? 30  GLU A O    6  
ATOM 11227 C CB   . GLU A 1 30  ? 4.563   -3.090  13.354  1.00 0.00 ? 30  GLU A CB   6  
ATOM 11228 C CG   . GLU A 1 30  ? 4.757   -4.371  14.168  1.00 0.00 ? 30  GLU A CG   6  
ATOM 11229 C CD   . GLU A 1 30  ? 3.997   -4.299  15.494  1.00 0.00 ? 30  GLU A CD   6  
ATOM 11230 O OE1  . GLU A 1 30  ? 3.566   -3.178  15.840  1.00 0.00 ? 30  GLU A OE1  6  
ATOM 11231 O OE2  . GLU A 1 30  ? 3.866   -5.366  16.131  1.00 0.00 ? 30  GLU A OE2  6  
ATOM 11232 H H    . GLU A 1 30  ? 5.660   -4.829  11.967  1.00 0.00 ? 30  GLU A H    6  
ATOM 11233 H HA   . GLU A 1 30  ? 5.506   -2.087  11.702  1.00 0.00 ? 30  GLU A HA   6  
ATOM 11234 H HB2  . GLU A 1 30  ? 4.398   -2.248  14.027  1.00 0.00 ? 30  GLU A HB2  6  
ATOM 11235 H HB3  . GLU A 1 30  ? 3.671   -3.181  12.734  1.00 0.00 ? 30  GLU A HB3  6  
ATOM 11236 H HG2  . GLU A 1 30  ? 4.410   -5.228  13.591  1.00 0.00 ? 30  GLU A HG2  6  
ATOM 11237 H HG3  . GLU A 1 30  ? 5.819   -4.525  14.361  1.00 0.00 ? 30  GLU A HG3  6  
ATOM 11238 N N    . HIS A 1 31  ? 7.799   -3.192  13.731  1.00 0.00 ? 31  HIS A N    6  
ATOM 11239 C CA   . HIS A 1 31  ? 8.955   -2.824  14.530  1.00 0.00 ? 31  HIS A CA   6  
ATOM 11240 C C    . HIS A 1 31  ? 10.236  -3.217  13.790  1.00 0.00 ? 31  HIS A C    6  
ATOM 11241 O O    . HIS A 1 31  ? 11.321  -3.199  14.368  1.00 0.00 ? 31  HIS A O    6  
ATOM 11242 C CB   . HIS A 1 31  ? 8.867   -3.438  15.928  1.00 0.00 ? 31  HIS A CB   6  
ATOM 11243 C CG   . HIS A 1 31  ? 8.456   -4.891  15.937  1.00 0.00 ? 31  HIS A CG   6  
ATOM 11244 N ND1  . HIS A 1 31  ? 8.646   -5.730  14.853  1.00 0.00 ? 31  HIS A ND1  6  
ATOM 11245 C CD2  . HIS A 1 31  ? 7.863   -5.644  16.908  1.00 0.00 ? 31  HIS A CD2  6  
ATOM 11246 C CE1  . HIS A 1 31  ? 8.185   -6.932  15.168  1.00 0.00 ? 31  HIS A CE1  6  
ATOM 11247 N NE2  . HIS A 1 31  ? 7.700   -6.876  16.442  1.00 0.00 ? 31  HIS A NE2  6  
ATOM 11248 H H    . HIS A 1 31  ? 7.708   -4.170  13.544  1.00 0.00 ? 31  HIS A H    6  
ATOM 11249 H HA   . HIS A 1 31  ? 8.928   -1.740  14.640  1.00 0.00 ? 31  HIS A HA   6  
ATOM 11250 H HB2  . HIS A 1 31  ? 9.836   -3.342  16.418  1.00 0.00 ? 31  HIS A HB2  6  
ATOM 11251 H HB3  . HIS A 1 31  ? 8.153   -2.865  16.520  1.00 0.00 ? 31  HIS A HB3  6  
ATOM 11252 H HD1  . HIS A 1 31  ? 9.062   -5.474  13.980  1.00 0.00 ? 31  HIS A HD1  6  
ATOM 11253 H HD2  . HIS A 1 31  ? 7.573   -5.293  17.898  1.00 0.00 ? 31  HIS A HD2  6  
ATOM 11254 H HE1  . HIS A 1 31  ? 8.192   -7.810  14.523  1.00 0.00 ? 31  HIS A HE1  6  
ATOM 11255 N N    . SER A 1 32  ? 10.066  -3.563  12.522  1.00 0.00 ? 32  SER A N    6  
ATOM 11256 C CA   . SER A 1 32  ? 11.195  -3.960  11.697  1.00 0.00 ? 32  SER A CA   6  
ATOM 11257 C C    . SER A 1 32  ? 11.307  -3.034  10.484  1.00 0.00 ? 32  SER A C    6  
ATOM 11258 O O    . SER A 1 32  ? 12.345  -2.409  10.270  1.00 0.00 ? 32  SER A O    6  
ATOM 11259 C CB   . SER A 1 32  ? 11.061  -5.415  11.244  1.00 0.00 ? 32  SER A CB   6  
ATOM 11260 O OG   . SER A 1 32  ? 12.319  -5.978  10.880  1.00 0.00 ? 32  SER A OG   6  
ATOM 11261 H H    . SER A 1 32  ? 9.180   -3.575  12.059  1.00 0.00 ? 32  SER A H    6  
ATOM 11262 H HA   . SER A 1 32  ? 12.070  -3.858  12.338  1.00 0.00 ? 32  SER A HA   6  
ATOM 11263 H HB2  . SER A 1 32  ? 10.618  -6.005  12.046  1.00 0.00 ? 32  SER A HB2  6  
ATOM 11264 H HB3  . SER A 1 32  ? 10.380  -5.469  10.395  1.00 0.00 ? 32  SER A HB3  6  
ATOM 11265 H HG   . SER A 1 32  ? 12.647  -6.580  11.608  1.00 0.00 ? 32  SER A HG   6  
ATOM 11266 N N    . ALA A 1 33  ? 10.225  -2.975  9.722   1.00 0.00 ? 33  ALA A N    6  
ATOM 11267 C CA   . ALA A 1 33  ? 10.189  -2.136  8.537   1.00 0.00 ? 33  ALA A CA   6  
ATOM 11268 C C    . ALA A 1 33  ? 9.266   -0.942  8.789   1.00 0.00 ? 33  ALA A C    6  
ATOM 11269 O O    . ALA A 1 33  ? 8.650   -0.843  9.849   1.00 0.00 ? 33  ALA A O    6  
ATOM 11270 C CB   . ALA A 1 33  ? 9.745   -2.971  7.334   1.00 0.00 ? 33  ALA A CB   6  
ATOM 11271 H H    . ALA A 1 33  ? 9.385   -3.487  9.904   1.00 0.00 ? 33  ALA A H    6  
ATOM 11272 H HA   . ALA A 1 33  ? 11.200  -1.772  8.357   1.00 0.00 ? 33  ALA A HA   6  
ATOM 11273 H HB1  . ALA A 1 33  ? 10.054  -2.476  6.413   1.00 0.00 ? 33  ALA A HB1  6  
ATOM 11274 H HB2  . ALA A 1 33  ? 10.206  -3.958  7.387   1.00 0.00 ? 33  ALA A HB2  6  
ATOM 11275 H HB3  . ALA A 1 33  ? 8.660   -3.075  7.344   1.00 0.00 ? 33  ALA A HB3  6  
ATOM 11276 N N    . HIS A 1 34  ? 9.200   -0.066  7.798   1.00 0.00 ? 34  HIS A N    6  
ATOM 11277 C CA   . HIS A 1 34  ? 8.363   1.117   7.900   1.00 0.00 ? 34  HIS A CA   6  
ATOM 11278 C C    . HIS A 1 34  ? 7.771   1.447   6.528   1.00 0.00 ? 34  HIS A C    6  
ATOM 11279 O O    . HIS A 1 34  ? 8.304   1.028   5.501   1.00 0.00 ? 34  HIS A O    6  
ATOM 11280 C CB   . HIS A 1 34  ? 9.144   2.285   8.504   1.00 0.00 ? 34  HIS A CB   6  
ATOM 11281 C CG   . HIS A 1 34  ? 10.332  2.722   7.680   1.00 0.00 ? 34  HIS A CG   6  
ATOM 11282 N ND1  . HIS A 1 34  ? 11.572  2.989   8.235   1.00 0.00 ? 34  HIS A ND1  6  
ATOM 11283 C CD2  . HIS A 1 34  ? 10.457  2.933   6.339   1.00 0.00 ? 34  HIS A CD2  6  
ATOM 11284 C CE1  . HIS A 1 34  ? 12.397  3.345   7.262   1.00 0.00 ? 34  HIS A CE1  6  
ATOM 11285 N NE2  . HIS A 1 34  ? 11.704  3.311   6.087   1.00 0.00 ? 34  HIS A NE2  6  
ATOM 11286 H H    . HIS A 1 34  ? 9.704   -0.154  6.939   1.00 0.00 ? 34  HIS A H    6  
ATOM 11287 H HA   . HIS A 1 34  ? 7.552   0.869   8.585   1.00 0.00 ? 34  HIS A HA   6  
ATOM 11288 H HB2  . HIS A 1 34  ? 8.471   3.133   8.630   1.00 0.00 ? 34  HIS A HB2  6  
ATOM 11289 H HB3  . HIS A 1 34  ? 9.489   2.002   9.499   1.00 0.00 ? 34  HIS A HB3  6  
ATOM 11290 H HD1  . HIS A 1 34  ? 11.805  2.924   9.205   1.00 0.00 ? 34  HIS A HD1  6  
ATOM 11291 H HD2  . HIS A 1 34  ? 9.666   2.812   5.598   1.00 0.00 ? 34  HIS A HD2  6  
ATOM 11292 H HE1  . HIS A 1 34  ? 13.446  3.618   7.379   1.00 0.00 ? 34  HIS A HE1  6  
ATOM 11293 N N    . VAL A 1 35  ? 6.678   2.194   6.554   1.00 0.00 ? 35  VAL A N    6  
ATOM 11294 C CA   . VAL A 1 35  ? 6.008   2.585   5.326   1.00 0.00 ? 35  VAL A CA   6  
ATOM 11295 C C    . VAL A 1 35  ? 7.031   3.190   4.362   1.00 0.00 ? 35  VAL A C    6  
ATOM 11296 O O    . VAL A 1 35  ? 7.816   4.054   4.748   1.00 0.00 ? 35  VAL A O    6  
ATOM 11297 C CB   . VAL A 1 35  ? 4.849   3.533   5.640   1.00 0.00 ? 35  VAL A CB   6  
ATOM 11298 C CG1  . VAL A 1 35  ? 4.094   3.918   4.366   1.00 0.00 ? 35  VAL A CG1  6  
ATOM 11299 C CG2  . VAL A 1 35  ? 3.903   2.919   6.674   1.00 0.00 ? 35  VAL A CG2  6  
ATOM 11300 H H    . VAL A 1 35  ? 6.251   2.531   7.394   1.00 0.00 ? 35  VAL A H    6  
ATOM 11301 H HA   . VAL A 1 35  ? 5.593   1.683   4.876   1.00 0.00 ? 35  VAL A HA   6  
ATOM 11302 H HB   . VAL A 1 35  ? 5.268   4.444   6.069   1.00 0.00 ? 35  VAL A HB   6  
ATOM 11303 H HG11 . VAL A 1 35  ? 3.899   4.990   4.369   1.00 0.00 ? 35  VAL A HG11 6  
ATOM 11304 H HG12 . VAL A 1 35  ? 4.697   3.661   3.495   1.00 0.00 ? 35  VAL A HG12 6  
ATOM 11305 H HG13 . VAL A 1 35  ? 3.149   3.377   4.326   1.00 0.00 ? 35  VAL A HG13 6  
ATOM 11306 H HG21 . VAL A 1 35  ? 2.888   3.272   6.492   1.00 0.00 ? 35  VAL A HG21 6  
ATOM 11307 H HG22 . VAL A 1 35  ? 3.930   1.833   6.591   1.00 0.00 ? 35  VAL A HG22 6  
ATOM 11308 H HG23 . VAL A 1 35  ? 4.217   3.216   7.675   1.00 0.00 ? 35  VAL A HG23 6  
ATOM 11309 N N    . LEU A 1 36  ? 6.988   2.711   3.128   1.00 0.00 ? 36  LEU A N    6  
ATOM 11310 C CA   . LEU A 1 36  ? 7.902   3.194   2.106   1.00 0.00 ? 36  LEU A CA   6  
ATOM 11311 C C    . LEU A 1 36  ? 7.602   4.666   1.814   1.00 0.00 ? 36  LEU A C    6  
ATOM 11312 O O    . LEU A 1 36  ? 6.487   5.132   2.041   1.00 0.00 ? 36  LEU A O    6  
ATOM 11313 C CB   . LEU A 1 36  ? 7.844   2.297   0.868   1.00 0.00 ? 36  LEU A CB   6  
ATOM 11314 C CG   . LEU A 1 36  ? 8.559   2.825   -0.377  1.00 0.00 ? 36  LEU A CG   6  
ATOM 11315 C CD1  . LEU A 1 36  ? 10.047  3.049   -0.101  1.00 0.00 ? 36  LEU A CD1  6  
ATOM 11316 C CD2  . LEU A 1 36  ? 8.331   1.900   -1.574  1.00 0.00 ? 36  LEU A CD2  6  
ATOM 11317 H H    . LEU A 1 36  ? 6.346   2.008   2.822   1.00 0.00 ? 36  LEU A H    6  
ATOM 11318 H HA   . LEU A 1 36  ? 8.912   3.121   2.510   1.00 0.00 ? 36  LEU A HA   6  
ATOM 11319 H HB2  . LEU A 1 36  ? 8.273   1.328   1.125   1.00 0.00 ? 36  LEU A HB2  6  
ATOM 11320 H HB3  . LEU A 1 36  ? 6.798   2.126   0.617   1.00 0.00 ? 36  LEU A HB3  6  
ATOM 11321 H HG   . LEU A 1 36  ? 8.130   3.794   -0.633  1.00 0.00 ? 36  LEU A HG   6  
ATOM 11322 H HD11 . LEU A 1 36  ? 10.636  2.346   -0.690  1.00 0.00 ? 36  LEU A HD11 6  
ATOM 11323 H HD12 . LEU A 1 36  ? 10.318  4.069   -0.376  1.00 0.00 ? 36  LEU A HD12 6  
ATOM 11324 H HD13 . LEU A 1 36  ? 10.248  2.894   0.959   1.00 0.00 ? 36  LEU A HD13 6  
ATOM 11325 H HD21 . LEU A 1 36  ? 7.261   1.756   -1.724  1.00 0.00 ? 36  LEU A HD21 6  
ATOM 11326 H HD22 . LEU A 1 36  ? 8.766   2.348   -2.468  1.00 0.00 ? 36  LEU A HD22 6  
ATOM 11327 H HD23 . LEU A 1 36  ? 8.804   0.937   -1.384  1.00 0.00 ? 36  LEU A HD23 6  
ATOM 11328 N N    . GLU A 1 37  ? 8.616   5.356   1.314   1.00 0.00 ? 37  GLU A N    6  
ATOM 11329 C CA   . GLU A 1 37  ? 8.475   6.765   0.988   1.00 0.00 ? 37  GLU A CA   6  
ATOM 11330 C C    . GLU A 1 37  ? 9.287   7.104   -0.263  1.00 0.00 ? 37  GLU A C    6  
ATOM 11331 O O    . GLU A 1 37  ? 10.471  6.780   -0.346  1.00 0.00 ? 37  GLU A O    6  
ATOM 11332 C CB   . GLU A 1 37  ? 8.892   7.645   2.168   1.00 0.00 ? 37  GLU A CB   6  
ATOM 11333 C CG   . GLU A 1 37  ? 7.683   8.014   3.030   1.00 0.00 ? 37  GLU A CG   6  
ATOM 11334 C CD   . GLU A 1 37  ? 8.101   8.263   4.481   1.00 0.00 ? 37  GLU A CD   6  
ATOM 11335 O OE1  . GLU A 1 37  ? 8.828   7.400   5.018   1.00 0.00 ? 37  GLU A OE1  6  
ATOM 11336 O OE2  . GLU A 1 37  ? 7.683   9.311   5.020   1.00 0.00 ? 37  GLU A OE2  6  
ATOM 11337 H H    . GLU A 1 37  ? 9.520   4.968   1.132   1.00 0.00 ? 37  GLU A H    6  
ATOM 11338 H HA   . GLU A 1 37  ? 7.413   6.911   0.791   1.00 0.00 ? 37  GLU A HA   6  
ATOM 11339 H HB2  . GLU A 1 37  ? 9.630   7.120   2.775   1.00 0.00 ? 37  GLU A HB2  6  
ATOM 11340 H HB3  . GLU A 1 37  ? 9.371   8.552   1.798   1.00 0.00 ? 37  GLU A HB3  6  
ATOM 11341 H HG2  . GLU A 1 37  ? 7.204   8.907   2.628   1.00 0.00 ? 37  GLU A HG2  6  
ATOM 11342 H HG3  . GLU A 1 37  ? 6.947   7.212   2.992   1.00 0.00 ? 37  GLU A HG3  6  
ATOM 11343 N N    . LYS A 1 38  ? 8.619   7.752   -1.206  1.00 0.00 ? 38  LYS A N    6  
ATOM 11344 C CA   . LYS A 1 38  ? 9.264   8.139   -2.449  1.00 0.00 ? 38  LYS A CA   6  
ATOM 11345 C C    . LYS A 1 38  ? 8.685   9.473   -2.926  1.00 0.00 ? 38  LYS A C    6  
ATOM 11346 O O    . LYS A 1 38  ? 7.500   9.741   -2.738  1.00 0.00 ? 38  LYS A O    6  
ATOM 11347 C CB   . LYS A 1 38  ? 9.153   7.016   -3.483  1.00 0.00 ? 38  LYS A CB   6  
ATOM 11348 C CG   . LYS A 1 38  ? 10.047  7.295   -4.693  1.00 0.00 ? 38  LYS A CG   6  
ATOM 11349 C CD   . LYS A 1 38  ? 10.314  6.012   -5.484  1.00 0.00 ? 38  LYS A CD   6  
ATOM 11350 C CE   . LYS A 1 38  ? 11.201  6.292   -6.698  1.00 0.00 ? 38  LYS A CE   6  
ATOM 11351 N NZ   . LYS A 1 38  ? 10.462  7.081   -7.709  1.00 0.00 ? 38  LYS A NZ   6  
ATOM 11352 H H    . LYS A 1 38  ? 7.656   8.012   -1.131  1.00 0.00 ? 38  LYS A H    6  
ATOM 11353 H HA   . LYS A 1 38  ? 10.324  8.279   -2.238  1.00 0.00 ? 38  LYS A HA   6  
ATOM 11354 H HB2  . LYS A 1 38  ? 9.437   6.068   -3.027  1.00 0.00 ? 38  LYS A HB2  6  
ATOM 11355 H HB3  . LYS A 1 38  ? 8.117   6.916   -3.806  1.00 0.00 ? 38  LYS A HB3  6  
ATOM 11356 H HG2  . LYS A 1 38  ? 9.570   8.032   -5.339  1.00 0.00 ? 38  LYS A HG2  6  
ATOM 11357 H HG3  . LYS A 1 38  ? 10.991  7.725   -4.361  1.00 0.00 ? 38  LYS A HG3  6  
ATOM 11358 H HD2  . LYS A 1 38  ? 10.795  5.277   -4.839  1.00 0.00 ? 38  LYS A HD2  6  
ATOM 11359 H HD3  . LYS A 1 38  ? 9.369   5.579   -5.811  1.00 0.00 ? 38  LYS A HD3  6  
ATOM 11360 H HE2  . LYS A 1 38  ? 12.094  6.835   -6.387  1.00 0.00 ? 38  LYS A HE2  6  
ATOM 11361 H HE3  . LYS A 1 38  ? 11.536  5.352   -7.136  1.00 0.00 ? 38  LYS A HE3  6  
ATOM 11362 H HZ1  . LYS A 1 38  ? 10.750  6.802   -8.626  1.00 0.00 ? 38  LYS A HZ1  6  
ATOM 11363 H HZ2  . LYS A 1 38  ? 9.481   6.920   -7.605  1.00 0.00 ? 38  LYS A HZ2  6  
ATOM 11364 H HZ3  . LYS A 1 38  ? 10.656  8.053   -7.581  1.00 0.00 ? 38  LYS A HZ3  6  
ATOM 11365 N N    . GLY A 1 39  ? 9.548   10.273  -3.534  1.00 0.00 ? 39  GLY A N    6  
ATOM 11366 C CA   . GLY A 1 39  ? 9.138   11.572  -4.039  1.00 0.00 ? 39  GLY A CA   6  
ATOM 11367 C C    . GLY A 1 39  ? 8.367   12.355  -2.974  1.00 0.00 ? 39  GLY A C    6  
ATOM 11368 O O    . GLY A 1 39  ? 7.281   12.868  -3.240  1.00 0.00 ? 39  GLY A O    6  
ATOM 11369 H H    . GLY A 1 39  ? 10.511  10.047  -3.683  1.00 0.00 ? 39  GLY A H    6  
ATOM 11370 H HA2  . GLY A 1 39  ? 10.015  12.139  -4.350  1.00 0.00 ? 39  GLY A HA2  6  
ATOM 11371 H HA3  . GLY A 1 39  ? 8.513   11.441  -4.922  1.00 0.00 ? 39  GLY A HA3  6  
ATOM 11372 N N    . GLY A 1 40  ? 8.960   12.424  -1.791  1.00 0.00 ? 40  GLY A N    6  
ATOM 11373 C CA   . GLY A 1 40  ? 8.343   13.136  -0.685  1.00 0.00 ? 40  GLY A CA   6  
ATOM 11374 C C    . GLY A 1 40  ? 6.880   12.723  -0.514  1.00 0.00 ? 40  GLY A C    6  
ATOM 11375 O O    . GLY A 1 40  ? 6.021   13.562  -0.247  1.00 0.00 ? 40  GLY A O    6  
ATOM 11376 H H    . GLY A 1 40  ? 9.844   12.004  -1.583  1.00 0.00 ? 40  GLY A H    6  
ATOM 11377 H HA2  . GLY A 1 40  ? 8.892   12.933  0.234   1.00 0.00 ? 40  GLY A HA2  6  
ATOM 11378 H HA3  . GLY A 1 40  ? 8.403   14.210  -0.861  1.00 0.00 ? 40  GLY A HA3  6  
ATOM 11379 N N    . LYS A 1 41  ? 6.641   11.429  -0.675  1.00 0.00 ? 41  LYS A N    6  
ATOM 11380 C CA   . LYS A 1 41  ? 5.297   10.894  -0.542  1.00 0.00 ? 41  LYS A CA   6  
ATOM 11381 C C    . LYS A 1 41  ? 5.340   9.627   0.314   1.00 0.00 ? 41  LYS A C    6  
ATOM 11382 O O    . LYS A 1 41  ? 6.414   9.098   0.593   1.00 0.00 ? 41  LYS A O    6  
ATOM 11383 C CB   . LYS A 1 41  ? 4.665   10.685  -1.920  1.00 0.00 ? 41  LYS A CB   6  
ATOM 11384 C CG   . LYS A 1 41  ? 3.951   11.952  -2.394  1.00 0.00 ? 41  LYS A CG   6  
ATOM 11385 C CD   . LYS A 1 41  ? 2.480   11.944  -1.970  1.00 0.00 ? 41  LYS A CD   6  
ATOM 11386 C CE   . LYS A 1 41  ? 1.591   11.397  -3.088  1.00 0.00 ? 41  LYS A CE   6  
ATOM 11387 N NZ   . LYS A 1 41  ? 0.325   12.160  -3.164  1.00 0.00 ? 41  LYS A NZ   6  
ATOM 11388 H H    . LYS A 1 41  ? 7.346   10.753  -0.892  1.00 0.00 ? 41  LYS A H    6  
ATOM 11389 H HA   . LYS A 1 41  ? 4.698   11.642  -0.023  1.00 0.00 ? 41  LYS A HA   6  
ATOM 11390 H HB2  . LYS A 1 41  ? 5.435   10.407  -2.639  1.00 0.00 ? 41  LYS A HB2  6  
ATOM 11391 H HB3  . LYS A 1 41  ? 3.956   9.858   -1.877  1.00 0.00 ? 41  LYS A HB3  6  
ATOM 11392 H HG2  . LYS A 1 41  ? 4.447   12.830  -1.980  1.00 0.00 ? 41  LYS A HG2  6  
ATOM 11393 H HG3  . LYS A 1 41  ? 4.020   12.029  -3.479  1.00 0.00 ? 41  LYS A HG3  6  
ATOM 11394 H HD2  . LYS A 1 41  ? 2.360   11.335  -1.074  1.00 0.00 ? 41  LYS A HD2  6  
ATOM 11395 H HD3  . LYS A 1 41  ? 2.166   12.956  -1.713  1.00 0.00 ? 41  LYS A HD3  6  
ATOM 11396 H HE2  . LYS A 1 41  ? 2.116   11.456  -4.041  1.00 0.00 ? 41  LYS A HE2  6  
ATOM 11397 H HE3  . LYS A 1 41  ? 1.377   10.343  -2.908  1.00 0.00 ? 41  LYS A HE3  6  
ATOM 11398 H HZ1  . LYS A 1 41  ? 0.527   13.139  -3.192  1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 11399 H HZ2  . LYS A 1 41  ? -0.173  11.898  -3.991  1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 11400 H HZ3  . LYS A 1 41  ? -0.234  11.958  -2.360  1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 11401 N N    . VAL A 1 42  ? 4.157   9.177   0.707   1.00 0.00 ? 42  VAL A N    6  
ATOM 11402 C CA   . VAL A 1 42  ? 4.046   7.982   1.525   1.00 0.00 ? 42  VAL A CA   6  
ATOM 11403 C C    . VAL A 1 42  ? 3.184   6.948   0.797   1.00 0.00 ? 42  VAL A C    6  
ATOM 11404 O O    . VAL A 1 42  ? 2.146   7.288   0.231   1.00 0.00 ? 42  VAL A O    6  
ATOM 11405 C CB   . VAL A 1 42  ? 3.503   8.344   2.909   1.00 0.00 ? 42  VAL A CB   6  
ATOM 11406 C CG1  . VAL A 1 42  ? 3.038   7.094   3.660   1.00 0.00 ? 42  VAL A CG1  6  
ATOM 11407 C CG2  . VAL A 1 42  ? 4.544   9.117   3.722   1.00 0.00 ? 42  VAL A CG2  6  
ATOM 11408 H H    . VAL A 1 42  ? 3.288   9.613   0.476   1.00 0.00 ? 42  VAL A H    6  
ATOM 11409 H HA   . VAL A 1 42  ? 5.049   7.575   1.652   1.00 0.00 ? 42  VAL A HA   6  
ATOM 11410 H HB   . VAL A 1 42  ? 2.638   8.992   2.771   1.00 0.00 ? 42  VAL A HB   6  
ATOM 11411 H HG11 . VAL A 1 42  ? 3.642   6.965   4.559   1.00 0.00 ? 42  VAL A HG11 6  
ATOM 11412 H HG12 . VAL A 1 42  ? 1.990   7.206   3.939   1.00 0.00 ? 42  VAL A HG12 6  
ATOM 11413 H HG13 . VAL A 1 42  ? 3.152   6.221   3.018   1.00 0.00 ? 42  VAL A HG13 6  
ATOM 11414 H HG21 . VAL A 1 42  ? 4.969   8.463   4.483   1.00 0.00 ? 42  VAL A HG21 6  
ATOM 11415 H HG22 . VAL A 1 42  ? 5.336   9.466   3.059   1.00 0.00 ? 42  VAL A HG22 6  
ATOM 11416 H HG23 . VAL A 1 42  ? 4.068   9.972   4.202   1.00 0.00 ? 42  VAL A HG23 6  
ATOM 11417 N N    . PHE A 1 43  ? 3.647   5.707   0.835   1.00 0.00 ? 43  PHE A N    6  
ATOM 11418 C CA   . PHE A 1 43  ? 2.931   4.622   0.185   1.00 0.00 ? 43  PHE A CA   6  
ATOM 11419 C C    . PHE A 1 43  ? 1.806   4.095   1.078   1.00 0.00 ? 43  PHE A C    6  
ATOM 11420 O O    . PHE A 1 43  ? 1.730   2.896   1.344   1.00 0.00 ? 43  PHE A O    6  
ATOM 11421 C CB   . PHE A 1 43  ? 3.943   3.500   -0.056  1.00 0.00 ? 43  PHE A CB   6  
ATOM 11422 C CG   . PHE A 1 43  ? 4.913   3.773   -1.208  1.00 0.00 ? 43  PHE A CG   6  
ATOM 11423 C CD1  . PHE A 1 43  ? 5.633   4.926   -1.232  1.00 0.00 ? 43  PHE A CD1  6  
ATOM 11424 C CD2  . PHE A 1 43  ? 5.053   2.862   -2.208  1.00 0.00 ? 43  PHE A CD2  6  
ATOM 11425 C CE1  . PHE A 1 43  ? 6.533   5.179   -2.301  1.00 0.00 ? 43  PHE A CE1  6  
ATOM 11426 C CE2  . PHE A 1 43  ? 5.953   3.115   -3.277  1.00 0.00 ? 43  PHE A CE2  6  
ATOM 11427 C CZ   . PHE A 1 43  ? 6.674   4.268   -3.301  1.00 0.00 ? 43  PHE A CZ   6  
ATOM 11428 H H    . PHE A 1 43  ? 4.492   5.439   1.297   1.00 0.00 ? 43  PHE A H    6  
ATOM 11429 H HA   . PHE A 1 43  ? 2.505   5.021   -0.736  1.00 0.00 ? 43  PHE A HA   6  
ATOM 11430 H HB2  . PHE A 1 43  ? 4.517   3.339   0.858   1.00 0.00 ? 43  PHE A HB2  6  
ATOM 11431 H HB3  . PHE A 1 43  ? 3.404   2.575   -0.260  1.00 0.00 ? 43  PHE A HB3  6  
ATOM 11432 H HD1  . PHE A 1 43  ? 5.520   5.656   -0.430  1.00 0.00 ? 43  PHE A HD1  6  
ATOM 11433 H HD2  . PHE A 1 43  ? 4.476   1.938   -2.188  1.00 0.00 ? 43  PHE A HD2  6  
ATOM 11434 H HE1  . PHE A 1 43  ? 7.110   6.103   -2.320  1.00 0.00 ? 43  PHE A HE1  6  
ATOM 11435 H HE2  . PHE A 1 43  ? 6.066   2.385   -4.078  1.00 0.00 ? 43  PHE A HE2  6  
ATOM 11436 H HZ   . PHE A 1 43  ? 7.364   4.462   -4.122  1.00 0.00 ? 43  PHE A HZ   6  
ATOM 11437 N N    . SER A 1 44  ? 0.961   5.016   1.517   1.00 0.00 ? 44  SER A N    6  
ATOM 11438 C CA   . SER A 1 44  ? -0.156  4.660   2.374   1.00 0.00 ? 44  SER A CA   6  
ATOM 11439 C C    . SER A 1 44  ? -1.450  5.265   1.827   1.00 0.00 ? 44  SER A C    6  
ATOM 11440 O O    . SER A 1 44  ? -1.737  6.439   2.059   1.00 0.00 ? 44  SER A O    6  
ATOM 11441 C CB   . SER A 1 44  ? 0.082   5.126   3.812   1.00 0.00 ? 44  SER A CB   6  
ATOM 11442 O OG   . SER A 1 44  ? -0.991  4.761   4.676   1.00 0.00 ? 44  SER A OG   6  
ATOM 11443 H H    . SER A 1 44  ? 1.031   5.989   1.296   1.00 0.00 ? 44  SER A H    6  
ATOM 11444 H HA   . SER A 1 44  ? -0.203  3.571   2.349   1.00 0.00 ? 44  SER A HA   6  
ATOM 11445 H HB2  . SER A 1 44  ? 1.011   4.694   4.184   1.00 0.00 ? 44  SER A HB2  6  
ATOM 11446 H HB3  . SER A 1 44  ? 0.206   6.209   3.826   1.00 0.00 ? 44  SER A HB3  6  
ATOM 11447 H HG   . SER A 1 44  ? -1.565  4.071   4.236   1.00 0.00 ? 44  SER A HG   6  
ATOM 11448 N N    . ALA A 1 45  ? -2.196  4.438   1.110   1.00 0.00 ? 45  ALA A N    6  
ATOM 11449 C CA   . ALA A 1 45  ? -3.453  4.877   0.528   1.00 0.00 ? 45  ALA A CA   6  
ATOM 11450 C C    . ALA A 1 45  ? -4.592  4.011   1.069   1.00 0.00 ? 45  ALA A C    6  
ATOM 11451 O O    . ALA A 1 45  ? -4.529  2.784   1.002   1.00 0.00 ? 45  ALA A O    6  
ATOM 11452 C CB   . ALA A 1 45  ? -3.355  4.824   -0.998  1.00 0.00 ? 45  ALA A CB   6  
ATOM 11453 H H    . ALA A 1 45  ? -1.956  3.485   0.926   1.00 0.00 ? 45  ALA A H    6  
ATOM 11454 H HA   . ALA A 1 45  ? -3.617  5.911   0.833   1.00 0.00 ? 45  ALA A HA   6  
ATOM 11455 H HB1  . ALA A 1 45  ? -2.403  5.249   -1.316  1.00 0.00 ? 45  ALA A HB1  6  
ATOM 11456 H HB2  . ALA A 1 45  ? -3.420  3.788   -1.331  1.00 0.00 ? 45  ALA A HB2  6  
ATOM 11457 H HB3  . ALA A 1 45  ? -4.173  5.398   -1.435  1.00 0.00 ? 45  ALA A HB3  6  
ATOM 11458 N N    . THR A 1 46  ? -5.606  4.683   1.595   1.00 0.00 ? 46  THR A N    6  
ATOM 11459 C CA   . THR A 1 46  ? -6.757  3.989   2.147   1.00 0.00 ? 46  THR A CA   6  
ATOM 11460 C C    . THR A 1 46  ? -7.906  3.974   1.137   1.00 0.00 ? 46  THR A C    6  
ATOM 11461 O O    . THR A 1 46  ? -8.576  4.986   0.938   1.00 0.00 ? 46  THR A O    6  
ATOM 11462 C CB   . THR A 1 46  ? -7.122  4.661   3.473   1.00 0.00 ? 46  THR A CB   6  
ATOM 11463 O OG1  . THR A 1 46  ? -6.011  4.382   4.321   1.00 0.00 ? 46  THR A OG1  6  
ATOM 11464 C CG2  . THR A 1 46  ? -8.303  3.981   4.168   1.00 0.00 ? 46  THR A CG2  6  
ATOM 11465 H H    . THR A 1 46  ? -5.649  5.680   1.646   1.00 0.00 ? 46  THR A H    6  
ATOM 11466 H HA   . THR A 1 46  ? -6.478  2.952   2.330   1.00 0.00 ? 46  THR A HA   6  
ATOM 11467 H HB   . THR A 1 46  ? -7.314  5.725   3.330   1.00 0.00 ? 46  THR A HB   6  
ATOM 11468 H HG1  . THR A 1 46  ? -5.248  4.987   4.096   1.00 0.00 ? 46  THR A HG1  6  
ATOM 11469 H HG21 . THR A 1 46  ? -9.173  4.003   3.512   1.00 0.00 ? 46  THR A HG21 6  
ATOM 11470 H HG22 . THR A 1 46  ? -8.044  2.946   4.394   1.00 0.00 ? 46  THR A HG22 6  
ATOM 11471 H HG23 . THR A 1 46  ? -8.532  4.509   5.094   1.00 0.00 ? 46  THR A HG23 6  
ATOM 11472 N N    . LEU A 1 47  ? -8.098  2.814   0.526   1.00 0.00 ? 47  LEU A N    6  
ATOM 11473 C CA   . LEU A 1 47  ? -9.155  2.653   -0.458  1.00 0.00 ? 47  LEU A CA   6  
ATOM 11474 C C    . LEU A 1 47  ? -10.476 2.367   0.259   1.00 0.00 ? 47  LEU A C    6  
ATOM 11475 O O    . LEU A 1 47  ? -10.480 1.881   1.389   1.00 0.00 ? 47  LEU A O    6  
ATOM 11476 C CB   . LEU A 1 47  ? -8.771  1.588   -1.487  1.00 0.00 ? 47  LEU A CB   6  
ATOM 11477 C CG   . LEU A 1 47  ? -8.241  2.108   -2.825  1.00 0.00 ? 47  LEU A CG   6  
ATOM 11478 C CD1  . LEU A 1 47  ? -7.415  3.382   -2.630  1.00 0.00 ? 47  LEU A CD1  6  
ATOM 11479 C CD2  . LEU A 1 47  ? -7.454  1.023   -3.563  1.00 0.00 ? 47  LEU A CD2  6  
ATOM 11480 H H    . LEU A 1 47  ? -7.549  1.996   0.694   1.00 0.00 ? 47  LEU A H    6  
ATOM 11481 H HA   . LEU A 1 47  ? -9.250  3.599   -0.993  1.00 0.00 ? 47  LEU A HA   6  
ATOM 11482 H HB2  . LEU A 1 47  ? -8.013  0.941   -1.046  1.00 0.00 ? 47  LEU A HB2  6  
ATOM 11483 H HB3  . LEU A 1 47  ? -9.645  0.968   -1.682  1.00 0.00 ? 47  LEU A HB3  6  
ATOM 11484 H HG   . LEU A 1 47  ? -9.093  2.370   -3.452  1.00 0.00 ? 47  LEU A HG   6  
ATOM 11485 H HD11 . LEU A 1 47  ? -6.758  3.260   -1.770  1.00 0.00 ? 47  LEU A HD11 6  
ATOM 11486 H HD12 . LEU A 1 47  ? -6.817  3.567   -3.522  1.00 0.00 ? 47  LEU A HD12 6  
ATOM 11487 H HD13 . LEU A 1 47  ? -8.084  4.226   -2.460  1.00 0.00 ? 47  LEU A HD13 6  
ATOM 11488 H HD21 . LEU A 1 47  ? -7.026  0.330   -2.839  1.00 0.00 ? 47  LEU A HD21 6  
ATOM 11489 H HD22 . LEU A 1 47  ? -8.123  0.482   -4.232  1.00 0.00 ? 47  LEU A HD22 6  
ATOM 11490 H HD23 . LEU A 1 47  ? -6.654  1.484   -4.142  1.00 0.00 ? 47  LEU A HD23 6  
ATOM 11491 N N    . GLY A 1 48  ? -11.565 2.681   -0.427  1.00 0.00 ? 48  GLY A N    6  
ATOM 11492 C CA   . GLY A 1 48  ? -12.889 2.464   0.131   1.00 0.00 ? 48  GLY A CA   6  
ATOM 11493 C C    . GLY A 1 48  ? -13.939 2.355   -0.976  1.00 0.00 ? 48  GLY A C    6  
ATOM 11494 O O    . GLY A 1 48  ? -14.238 3.339   -1.652  1.00 0.00 ? 48  GLY A O    6  
ATOM 11495 H H    . GLY A 1 48  ? -11.553 3.076   -1.345  1.00 0.00 ? 48  GLY A H    6  
ATOM 11496 H HA2  . GLY A 1 48  ? -12.890 1.553   0.729   1.00 0.00 ? 48  GLY A HA2  6  
ATOM 11497 H HA3  . GLY A 1 48  ? -13.145 3.285   0.800   1.00 0.00 ? 48  GLY A HA3  6  
ATOM 11498 N N    . LEU A 1 49  ? -14.470 1.151   -1.128  1.00 0.00 ? 49  LEU A N    6  
ATOM 11499 C CA   . LEU A 1 49  ? -15.481 0.901   -2.142  1.00 0.00 ? 49  LEU A CA   6  
ATOM 11500 C C    . LEU A 1 49  ? -16.769 0.427   -1.466  1.00 0.00 ? 49  LEU A C    6  
ATOM 11501 O O    . LEU A 1 49  ? -16.725 -0.355  -0.517  1.00 0.00 ? 49  LEU A O    6  
ATOM 11502 C CB   . LEU A 1 49  ? -14.950 -0.068  -3.200  1.00 0.00 ? 49  LEU A CB   6  
ATOM 11503 C CG   . LEU A 1 49  ? -15.820 -0.243  -4.447  1.00 0.00 ? 49  LEU A CG   6  
ATOM 11504 C CD1  . LEU A 1 49  ? -16.973 -1.212  -4.179  1.00 0.00 ? 49  LEU A CD1  6  
ATOM 11505 C CD2  . LEU A 1 49  ? -16.316 1.110   -4.963  1.00 0.00 ? 49  LEU A CD2  6  
ATOM 11506 H H    . LEU A 1 49  ? -14.221 0.356   -0.574  1.00 0.00 ? 49  LEU A H    6  
ATOM 11507 H HA   . LEU A 1 49  ? -15.682 1.847   -2.643  1.00 0.00 ? 49  LEU A HA   6  
ATOM 11508 H HB2  . LEU A 1 49  ? -13.963 0.274   -3.515  1.00 0.00 ? 49  LEU A HB2  6  
ATOM 11509 H HB3  . LEU A 1 49  ? -14.815 -1.045  -2.735  1.00 0.00 ? 49  LEU A HB3  6  
ATOM 11510 H HG   . LEU A 1 49  ? -15.206 -0.682  -5.233  1.00 0.00 ? 49  LEU A HG   6  
ATOM 11511 H HD11 . LEU A 1 49  ? -16.601 -2.076  -3.628  1.00 0.00 ? 49  LEU A HD11 6  
ATOM 11512 H HD12 . LEU A 1 49  ? -17.741 -0.710  -3.591  1.00 0.00 ? 49  LEU A HD12 6  
ATOM 11513 H HD13 . LEU A 1 49  ? -17.398 -1.541  -5.127  1.00 0.00 ? 49  LEU A HD13 6  
ATOM 11514 H HD21 . LEU A 1 49  ? -16.351 1.092   -6.052  1.00 0.00 ? 49  LEU A HD21 6  
ATOM 11515 H HD22 . LEU A 1 49  ? -17.314 1.305   -4.570  1.00 0.00 ? 49  LEU A HD22 6  
ATOM 11516 H HD23 . LEU A 1 49  ? -15.636 1.896   -4.634  1.00 0.00 ? 49  LEU A HD23 6  
ATOM 11517 N N    . VAL A 1 50  ? -17.886 0.921   -1.980  1.00 0.00 ? 50  VAL A N    6  
ATOM 11518 C CA   . VAL A 1 50  ? -19.184 0.558   -1.438  1.00 0.00 ? 50  VAL A CA   6  
ATOM 11519 C C    . VAL A 1 50  ? -20.202 0.475   -2.576  1.00 0.00 ? 50  VAL A C    6  
ATOM 11520 O O    . VAL A 1 50  ? -20.255 1.358   -3.432  1.00 0.00 ? 50  VAL A O    6  
ATOM 11521 C CB   . VAL A 1 50  ? -19.589 1.547   -0.343  1.00 0.00 ? 50  VAL A CB   6  
ATOM 11522 C CG1  . VAL A 1 50  ? -18.691 2.786   -0.364  1.00 0.00 ? 50  VAL A CG1  6  
ATOM 11523 C CG2  . VAL A 1 50  ? -21.063 1.936   -0.475  1.00 0.00 ? 50  VAL A CG2  6  
ATOM 11524 H H    . VAL A 1 50  ? -17.913 1.557   -2.751  1.00 0.00 ? 50  VAL A H    6  
ATOM 11525 H HA   . VAL A 1 50  ? -19.086 -0.428  -0.982  1.00 0.00 ? 50  VAL A HA   6  
ATOM 11526 H HB   . VAL A 1 50  ? -19.458 1.054   0.620   1.00 0.00 ? 50  VAL A HB   6  
ATOM 11527 H HG11 . VAL A 1 50  ? -17.648 2.480   -0.285  1.00 0.00 ? 50  VAL A HG11 6  
ATOM 11528 H HG12 . VAL A 1 50  ? -18.841 3.328   -1.298  1.00 0.00 ? 50  VAL A HG12 6  
ATOM 11529 H HG13 . VAL A 1 50  ? -18.945 3.433   0.476   1.00 0.00 ? 50  VAL A HG13 6  
ATOM 11530 H HG21 . VAL A 1 50  ? -21.654 1.049   -0.701  1.00 0.00 ? 50  VAL A HG21 6  
ATOM 11531 H HG22 . VAL A 1 50  ? -21.408 2.374   0.462   1.00 0.00 ? 50  VAL A HG22 6  
ATOM 11532 H HG23 . VAL A 1 50  ? -21.177 2.663   -1.279  1.00 0.00 ? 50  VAL A HG23 6  
ATOM 11533 N N    . ASP A 1 51  ? -20.986 -0.593  -2.551  1.00 0.00 ? 51  ASP A N    6  
ATOM 11534 C CA   . ASP A 1 51  ? -22.000 -0.802  -3.570  1.00 0.00 ? 51  ASP A CA   6  
ATOM 11535 C C    . ASP A 1 51  ? -23.299 -0.119  -3.139  1.00 0.00 ? 51  ASP A C    6  
ATOM 11536 O O    . ASP A 1 51  ? -23.696 -0.210  -1.978  1.00 0.00 ? 51  ASP A O    6  
ATOM 11537 C CB   . ASP A 1 51  ? -22.