data_2CRA
# 
_entry.id   2CRA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2CRA         pdb_00002cra 10.2210/pdb2cra/pdb 
RCSB  RCSB024537   ?            ?                   
WWPDB D_1000024537 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001001085.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CRA 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Seimiya, K.'                                            1 
'Hayashi, F.'                                            2 
'Nagashima, T.'                                          3 
'Yoshida, M.'                                            4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the homeobox domain of human homeo box B13' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Seimiya, K.'   1 ? 
primary 'Hayashi, F.'   2 ? 
primary 'Nagashima, T.' 3 ? 
primary 'Yoshida, M.'   4 ? 
primary 'Yokoyama, S.'  5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Homeobox protein Hox-B13' 
_entity.formula_weight             7991.122 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'homeobox (residues 1-70)' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001001085.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  ARG n 
1 9  LYS n 
1 10 LYS n 
1 11 ARG n 
1 12 ILE n 
1 13 PRO n 
1 14 TYR n 
1 15 SER n 
1 16 LYS n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 ARG n 
1 21 GLU n 
1 22 LEU n 
1 23 GLU n 
1 24 ARG n 
1 25 GLU n 
1 26 TYR n 
1 27 ALA n 
1 28 ALA n 
1 29 ASN n 
1 30 LYS n 
1 31 PHE n 
1 32 ILE n 
1 33 THR n 
1 34 LYS n 
1 35 ASP n 
1 36 LYS n 
1 37 ARG n 
1 38 ARG n 
1 39 LYS n 
1 40 ILE n 
1 41 SER n 
1 42 ALA n 
1 43 ALA n 
1 44 THR n 
1 45 SER n 
1 46 LEU n 
1 47 SER n 
1 48 GLU n 
1 49 ARG n 
1 50 GLN n 
1 51 ILE n 
1 52 THR n 
1 53 ILE n 
1 54 TRP n 
1 55 PHE n 
1 56 GLN n 
1 57 ASN n 
1 58 ARG n 
1 59 ARG n 
1 60 VAL n 
1 61 LYS n 
1 62 GLU n 
1 63 LYS n 
1 64 LYS n 
1 65 SER n 
1 66 GLY n 
1 67 PRO n 
1 68 SER n 
1 69 SER n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 HOXB13 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040607-07 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HXB13_HUMAN 
_struct_ref.pdbx_db_accession          Q92826 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 
_struct_ref.pdbx_align_begin           217 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CRA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q92826 
_struct_ref_seq.db_align_beg                  217 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  273 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CRA GLY A 1  ? UNP Q92826 ? ? 'cloning artifact' 1  1  
1 2CRA SER A 2  ? UNP Q92826 ? ? 'cloning artifact' 2  2  
1 2CRA SER A 3  ? UNP Q92826 ? ? 'cloning artifact' 3  3  
1 2CRA GLY A 4  ? UNP Q92826 ? ? 'cloning artifact' 4  4  
1 2CRA SER A 5  ? UNP Q92826 ? ? 'cloning artifact' 5  5  
1 2CRA SER A 6  ? UNP Q92826 ? ? 'cloning artifact' 6  6  
1 2CRA GLY A 7  ? UNP Q92826 ? ? 'cloning artifact' 7  7  
1 2CRA SER A 65 ? UNP Q92826 ? ? 'cloning artifact' 65 8  
1 2CRA GLY A 66 ? UNP Q92826 ? ? 'cloning artifact' 66 9  
1 2CRA PRO A 67 ? UNP Q92826 ? ? 'cloning artifact' 67 10 
1 2CRA SER A 68 ? UNP Q92826 ? ? 'cloning artifact' 68 11 
1 2CRA SER A 69 ? UNP Q92826 ? ? 'cloning artifact' 69 12 
1 2CRA GLY A 70 ? UNP Q92826 ? ? 'cloning artifact' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         288 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.06mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_ensemble.entry_id                                      2CRA 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CRA 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian           1 
processing           NMRPipe 20031121 'Delaglio, F.'   2 
'data analysis'      NMRView 5.0.4    'Johnson, B. A.' 3 
'data analysis'      KUJIRA  0.9295   'Kobayashi, N.'  4 
'structure solution' CYANA   2.0      'Guntert, P.'    5 
refinement           CYANA   2.0      'Guntert, P.'    6 
# 
_exptl.entry_id          2CRA 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CRA 
_struct.title                     'Solution structure of the homeobox domain of human homeo box B13' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CRA 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            
;DNA-binding, Transcription regulation, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 15 ? ASN A 29 ? SER A 15 ASN A 29 1 ? 15 
HELX_P HELX_P2 2 THR A 33 ? THR A 44 ? THR A 33 THR A 44 1 ? 12 
HELX_P HELX_P3 3 SER A 47 ? LYS A 61 ? SER A 47 LYS A 61 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2CRA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CRA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -27.434 8.447   9.927   1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -26.718 9.648   10.314  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -26.425 9.695   11.801  1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -25.301 9.988   12.210  1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -27.001 7.786   9.348   1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? -25.785 9.688   9.772   1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? -27.313 10.510  10.049  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? -27.439 9.409   12.611  1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? -27.286 9.425   14.061  1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? -27.829 8.140   14.679  1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? -27.174 7.513   15.511  1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? -28.006 10.636  14.658  1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? -27.325 11.839  14.345  1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? -28.311 9.183   12.225  1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? -26.231 9.499   14.283  1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? -29.007 10.689  14.258  1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? -28.052 10.531  15.732  1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? -27.261 11.932  13.392  1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? -29.033 7.756   14.267  1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? -29.668 6.549   14.782  1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? -30.366 5.782   13.662  1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? -30.586 6.313   12.575  1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? -30.676 6.905   15.877  1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? -31.959 7.151   15.328  1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? -29.506 8.299   13.602  1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? -28.897 5.923   15.205  1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? -30.748 6.086   16.576  1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? -30.342 7.792   16.395  1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? -32.585 6.513   15.678  1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? -30.712 4.528   13.939  1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? -31.380 3.707   12.946  1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? -30.432 3.204   11.876  1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? -30.853 2.884   10.764  1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? -30.511 4.157   14.823  1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? -31.832 2.860   13.440  1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? -32.157 4.293   12.476  1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? -29.148 3.134   12.211  1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? -28.136 2.671   11.268  1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? -27.566 1.324   11.701  1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? -27.099 1.169   12.830  1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? -27.010 3.700   11.149  1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? -25.987 3.239   10.284  1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? -28.874 3.403   13.113  1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? -28.609 2.555   10.304  1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? -27.409 4.622   10.756  1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? -26.586 3.879   12.126  1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? -25.245 3.847   10.313  1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? -27.607 0.352   10.796  1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? -27.098 -0.984  11.085  1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? -25.658 -0.920  11.583  1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? -25.268 -1.659  12.487  1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? -27.179 -1.864  9.836   1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? -26.175 -1.516  8.900   1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? -27.991 0.537   9.913   1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? -27.716 -1.414  11.859  1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? -27.048 -2.898  10.118  1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? -28.147 -1.738  9.372   1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? -25.771 -2.314  8.551   1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? -24.870 -0.031  10.985  1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? -23.481 0.113   11.381  1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? -22.541 0.150   10.192  1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? -21.854 -0.831  9.905   1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? -25.235 0.531   10.270  1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? -23.371 1.029   11.942  1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? -23.210 -0.720  12.013  1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8  ? -22.510 1.283   9.499   1.00 0.00 ? 8  ARG A N    1  
ATOM 67    C CA   . ARG A 1 8  ? -21.649 1.442   8.333   1.00 0.00 ? 8  ARG A CA   1  
ATOM 68    C C    . ARG A 1 8  ? -20.521 2.429   8.621   1.00 0.00 ? 8  ARG A C    1  
ATOM 69    O O    . ARG A 1 8  ? -20.098 3.179   7.741   1.00 0.00 ? 8  ARG A O    1  
ATOM 70    C CB   . ARG A 1 8  ? -22.465 1.921   7.131   1.00 0.00 ? 8  ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8  ? -23.256 0.814   6.453   1.00 0.00 ? 8  ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8  ? -24.425 1.373   5.656   1.00 0.00 ? 8  ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8  ? -24.254 1.171   4.220   1.00 0.00 ? 8  ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8  ? -23.505 1.955   3.452   1.00 0.00 ? 8  ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8  ? -22.861 2.987   3.980   1.00 0.00 ? 8  ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8  ? -23.399 1.707   2.153   1.00 0.00 ? 8  ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8  ? -23.080 2.030   9.777   1.00 0.00 ? 8  ARG A H    1  
ATOM 78    H HA   . ARG A 1 8  ? -21.218 0.479   8.104   1.00 0.00 ? 8  ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8  ? -23.160 2.679   7.461   1.00 0.00 ? 8  ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8  ? -21.793 2.351   6.404   1.00 0.00 ? 8  ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8  ? -22.603 0.276   5.783   1.00 0.00 ? 8  ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8  ? -23.635 0.141   7.208   1.00 0.00 ? 8  ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8  ? -25.330 0.877   5.974   1.00 0.00 ? 8  ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8  ? -24.505 2.431   5.855   1.00 0.00 ? 8  ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8  ? -24.721 0.414   3.809   1.00 0.00 ? 8  ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8  ? -22.939 3.175   4.959   1.00 0.00 ? 8  ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8  ? -22.297 3.575   3.399   1.00 0.00 ? 8  ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8  ? -23.883 0.930   1.751   1.00 0.00 ? 8  ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8  ? -22.836 2.297   1.576   1.00 0.00 ? 8  ARG A HH22 1  
ATOM 90    N N    . LYS A 1 9  ? -20.038 2.423   9.859   1.00 0.00 ? 9  LYS A N    1  
ATOM 91    C CA   . LYS A 1 9  ? -18.959 3.316   10.264  1.00 0.00 ? 9  LYS A CA   1  
ATOM 92    C C    . LYS A 1 9  ? -17.679 2.533   10.539  1.00 0.00 ? 9  LYS A C    1  
ATOM 93    O O    . LYS A 1 9  ? -17.694 1.304   10.611  1.00 0.00 ? 9  LYS A O    1  
ATOM 94    C CB   . LYS A 1 9  ? -19.364 4.106   11.510  1.00 0.00 ? 9  LYS A CB   1  
ATOM 95    C CG   . LYS A 1 9  ? -19.512 3.246   12.754  1.00 0.00 ? 9  LYS A CG   1  
ATOM 96    C CD   . LYS A 1 9  ? -20.330 3.950   13.824  1.00 0.00 ? 9  LYS A CD   1  
ATOM 97    C CE   . LYS A 1 9  ? -19.520 5.030   14.524  1.00 0.00 ? 9  LYS A CE   1  
ATOM 98    N NZ   . LYS A 1 9  ? -18.657 4.467   15.599  1.00 0.00 ? 9  LYS A NZ   1  
ATOM 99    H H    . LYS A 1 9  ? -20.416 1.801   10.516  1.00 0.00 ? 9  LYS A H    1  
ATOM 100   H HA   . LYS A 1 9  ? -18.778 4.006   9.454   1.00 0.00 ? 9  LYS A HA   1  
ATOM 101   H HB2  . LYS A 1 9  ? -18.613 4.858   11.705  1.00 0.00 ? 9  LYS A HB2  1  
ATOM 102   H HB3  . LYS A 1 9  ? -20.309 4.594   11.321  1.00 0.00 ? 9  LYS A HB3  1  
ATOM 103   H HG2  . LYS A 1 9  ? -20.006 2.324   12.486  1.00 0.00 ? 9  LYS A HG2  1  
ATOM 104   H HG3  . LYS A 1 9  ? -18.530 3.029   13.149  1.00 0.00 ? 9  LYS A HG3  1  
ATOM 105   H HD2  . LYS A 1 9  ? -21.194 4.405   13.363  1.00 0.00 ? 9  LYS A HD2  1  
ATOM 106   H HD3  . LYS A 1 9  ? -20.652 3.222   14.555  1.00 0.00 ? 9  LYS A HD3  1  
ATOM 107   H HE2  . LYS A 1 9  ? -18.896 5.523   13.795  1.00 0.00 ? 9  LYS A HE2  1  
ATOM 108   H HE3  . LYS A 1 9  ? -20.201 5.747   14.959  1.00 0.00 ? 9  LYS A HE3  1  
ATOM 109   H HZ1  . LYS A 1 9  ? -18.334 5.227   16.232  1.00 0.00 ? 9  LYS A HZ1  1  
ATOM 110   H HZ2  . LYS A 1 9  ? -17.826 4.001   15.183  1.00 0.00 ? 9  LYS A HZ2  1  
ATOM 111   H HZ3  . LYS A 1 9  ? -19.190 3.769   16.157  1.00 0.00 ? 9  LYS A HZ3  1  
ATOM 112   N N    . LYS A 1 10 ? -16.572 3.253   10.693  1.00 0.00 ? 10 LYS A N    1  
ATOM 113   C CA   . LYS A 1 10 ? -15.284 2.626   10.963  1.00 0.00 ? 10 LYS A CA   1  
ATOM 114   C C    . LYS A 1 10 ? -14.945 1.595   9.891   1.00 0.00 ? 10 LYS A C    1  
ATOM 115   O O    . LYS A 1 10 ? -14.328 0.569   10.178  1.00 0.00 ? 10 LYS A O    1  
ATOM 116   C CB   . LYS A 1 10 ? -15.295 1.961   12.341  1.00 0.00 ? 10 LYS A CB   1  
ATOM 117   C CG   . LYS A 1 10 ? -15.254 2.950   13.494  1.00 0.00 ? 10 LYS A CG   1  
ATOM 118   C CD   . LYS A 1 10 ? -15.139 2.240   14.832  1.00 0.00 ? 10 LYS A CD   1  
ATOM 119   C CE   . LYS A 1 10 ? -14.579 3.161   15.905  1.00 0.00 ? 10 LYS A CE   1  
ATOM 120   N NZ   . LYS A 1 10 ? -14.683 2.559   17.263  1.00 0.00 ? 10 LYS A NZ   1  
ATOM 121   H H    . LYS A 1 10 ? -16.624 4.230   10.624  1.00 0.00 ? 10 LYS A H    1  
ATOM 122   H HA   . LYS A 1 10 ? -14.530 3.400   10.952  1.00 0.00 ? 10 LYS A HA   1  
ATOM 123   H HB2  . LYS A 1 10 ? -16.194 1.369   12.434  1.00 0.00 ? 10 LYS A HB2  1  
ATOM 124   H HB3  . LYS A 1 10 ? -14.436 1.311   12.421  1.00 0.00 ? 10 LYS A HB3  1  
ATOM 125   H HG2  . LYS A 1 10 ? -14.400 3.599   13.368  1.00 0.00 ? 10 LYS A HG2  1  
ATOM 126   H HG3  . LYS A 1 10 ? -16.160 3.538   13.484  1.00 0.00 ? 10 LYS A HG3  1  
ATOM 127   H HD2  . LYS A 1 10 ? -16.119 1.905   15.138  1.00 0.00 ? 10 LYS A HD2  1  
ATOM 128   H HD3  . LYS A 1 10 ? -14.483 1.388   14.723  1.00 0.00 ? 10 LYS A HD3  1  
ATOM 129   H HE2  . LYS A 1 10 ? -13.540 3.357   15.686  1.00 0.00 ? 10 LYS A HE2  1  
ATOM 130   H HE3  . LYS A 1 10 ? -15.132 4.089   15.889  1.00 0.00 ? 10 LYS A HE3  1  
ATOM 131   H HZ1  . LYS A 1 10 ? -14.911 1.547   17.188  1.00 0.00 ? 10 LYS A HZ1  1  
ATOM 132   H HZ2  . LYS A 1 10 ? -15.432 3.032   17.807  1.00 0.00 ? 10 LYS A HZ2  1  
ATOM 133   H HZ3  . LYS A 1 10 ? -13.781 2.663   17.771  1.00 0.00 ? 10 LYS A HZ3  1  
ATOM 134   N N    . ARG A 1 11 ? -15.351 1.875   8.657   1.00 0.00 ? 11 ARG A N    1  
ATOM 135   C CA   . ARG A 1 11 ? -15.090 0.971   7.544   1.00 0.00 ? 11 ARG A CA   1  
ATOM 136   C C    . ARG A 1 11 ? -13.592 0.859   7.274   1.00 0.00 ? 11 ARG A C    1  
ATOM 137   O O    . ARG A 1 11 ? -12.775 1.398   8.021   1.00 0.00 ? 11 ARG A O    1  
ATOM 138   C CB   . ARG A 1 11 ? -15.810 1.457   6.285   1.00 0.00 ? 11 ARG A CB   1  
ATOM 139   C CG   . ARG A 1 11 ? -17.320 1.534   6.439   1.00 0.00 ? 11 ARG A CG   1  
ATOM 140   C CD   . ARG A 1 11 ? -18.010 1.690   5.093   1.00 0.00 ? 11 ARG A CD   1  
ATOM 141   N NE   . ARG A 1 11 ? -17.690 0.594   4.183   1.00 0.00 ? 11 ARG A NE   1  
ATOM 142   C CZ   . ARG A 1 11 ? -17.836 0.666   2.865   1.00 0.00 ? 11 ARG A CZ   1  
ATOM 143   N NH1  . ARG A 1 11 ? -18.294 1.778   2.305   1.00 0.00 ? 11 ARG A NH1  1  
ATOM 144   N NH2  . ARG A 1 11 ? -17.523 -0.374  2.103   1.00 0.00 ? 11 ARG A NH2  1  
ATOM 145   H H    . ARG A 1 11 ? -15.838 2.709   8.492   1.00 0.00 ? 11 ARG A H    1  
ATOM 146   H HA   . ARG A 1 11 ? -15.469 -0.004  7.811   1.00 0.00 ? 11 ARG A HA   1  
ATOM 147   H HB2  . ARG A 1 11 ? -15.445 2.442   6.033   1.00 0.00 ? 11 ARG A HB2  1  
ATOM 148   H HB3  . ARG A 1 11 ? -15.587 0.781   5.473   1.00 0.00 ? 11 ARG A HB3  1  
ATOM 149   H HG2  . ARG A 1 11 ? -17.672 0.627   6.908   1.00 0.00 ? 11 ARG A HG2  1  
ATOM 150   H HG3  . ARG A 1 11 ? -17.566 2.382   7.061   1.00 0.00 ? 11 ARG A HG3  1  
ATOM 151   H HD2  . ARG A 1 11 ? -19.078 1.713   5.251   1.00 0.00 ? 11 ARG A HD2  1  
ATOM 152   H HD3  . ARG A 1 11 ? -17.693 2.621   4.647   1.00 0.00 ? 11 ARG A HD3  1  
ATOM 153   H HE   . ARG A 1 11 ? -17.350 -0.237  4.575   1.00 0.00 ? 11 ARG A HE   1  
ATOM 154   H HH11 . ARG A 1 11 ? -18.530 2.563   2.877   1.00 0.00 ? 11 ARG A HH11 1  
ATOM 155   H HH12 . ARG A 1 11 ? -18.402 1.830   1.312   1.00 0.00 ? 11 ARG A HH12 1  
ATOM 156   H HH21 . ARG A 1 11 ? -17.177 -1.214  2.521   1.00 0.00 ? 11 ARG A HH21 1  
ATOM 157   H HH22 . ARG A 1 11 ? -17.633 -0.319  1.111   1.00 0.00 ? 11 ARG A HH22 1  
ATOM 158   N N    . ILE A 1 12 ? -13.240 0.155   6.204   1.00 0.00 ? 12 ILE A N    1  
ATOM 159   C CA   . ILE A 1 12 ? -11.841 -0.027  5.836   1.00 0.00 ? 12 ILE A CA   1  
ATOM 160   C C    . ILE A 1 12 ? -11.112 1.311   5.765   1.00 0.00 ? 12 ILE A C    1  
ATOM 161   O O    . ILE A 1 12 ? -11.612 2.289   5.209   1.00 0.00 ? 12 ILE A O    1  
ATOM 162   C CB   . ILE A 1 12 ? -11.704 -0.745  4.480   1.00 0.00 ? 12 ILE A CB   1  
ATOM 163   C CG1  . ILE A 1 12 ? -12.433 -2.090  4.515   1.00 0.00 ? 12 ILE A CG1  1  
ATOM 164   C CG2  . ILE A 1 12 ? -10.237 -0.941  4.130   1.00 0.00 ? 12 ILE A CG2  1  
ATOM 165   C CD1  . ILE A 1 12 ? -11.913 -3.032  5.578   1.00 0.00 ? 12 ILE A CD1  1  
ATOM 166   H H    . ILE A 1 12 ? -13.937 -0.251  5.648   1.00 0.00 ? 12 ILE A H    1  
ATOM 167   H HA   . ILE A 1 12 ? -11.374 -0.640  6.594   1.00 0.00 ? 12 ILE A HA   1  
ATOM 168   H HB   . ILE A 1 12 ? -12.150 -0.121  3.721   1.00 0.00 ? 12 ILE A HB   1  
ATOM 169   H HG12 . ILE A 1 12 ? -13.481 -1.920  4.707   1.00 0.00 ? 12 ILE A HG12 1  
ATOM 170   H HG13 . ILE A 1 12 ? -12.322 -2.576  3.556   1.00 0.00 ? 12 ILE A HG13 1  
ATOM 171   H HG21 . ILE A 1 12 ? -9.728  0.011   4.166   1.00 0.00 ? 12 ILE A HG21 1  
ATOM 172   H HG22 . ILE A 1 12 ? -9.784  -1.616  4.842   1.00 0.00 ? 12 ILE A HG22 1  
ATOM 173   H HG23 . ILE A 1 12 ? -10.155 -1.356  3.137   1.00 0.00 ? 12 ILE A HG23 1  
ATOM 174   H HD11 . ILE A 1 12 ? -11.054 -2.591  6.061   1.00 0.00 ? 12 ILE A HD11 1  
ATOM 175   H HD12 . ILE A 1 12 ? -12.686 -3.212  6.310   1.00 0.00 ? 12 ILE A HD12 1  
ATOM 176   H HD13 . ILE A 1 12 ? -11.626 -3.968  5.120   1.00 0.00 ? 12 ILE A HD13 1  
ATOM 177   N N    . PRO A 1 13 ? -9.902  1.356   6.341   1.00 0.00 ? 13 PRO A N    1  
ATOM 178   C CA   . PRO A 1 13 ? -9.077  2.568   6.355   1.00 0.00 ? 13 PRO A CA   1  
ATOM 179   C C    . PRO A 1 13 ? -8.338  2.781   5.038   1.00 0.00 ? 13 PRO A C    1  
ATOM 180   O O    . PRO A 1 13 ? -8.600  2.096   4.050   1.00 0.00 ? 13 PRO A O    1  
ATOM 181   C CB   . PRO A 1 13 ? -8.083  2.307   7.490   1.00 0.00 ? 13 PRO A CB   1  
ATOM 182   C CG   . PRO A 1 13 ? -7.986  0.823   7.575   1.00 0.00 ? 13 PRO A CG   1  
ATOM 183   C CD   . PRO A 1 13 ? -9.245  0.228   7.022   1.00 0.00 ? 13 PRO A CD   1  
ATOM 184   H HA   . PRO A 1 13 ? -9.664  3.445   6.583   1.00 0.00 ? 13 PRO A HA   1  
ATOM 185   H HB2  . PRO A 1 13 ? -7.129  2.753   7.246   1.00 0.00 ? 13 PRO A HB2  1  
ATOM 186   H HB3  . PRO A 1 13 ? -8.460  2.731   8.408   1.00 0.00 ? 13 PRO A HB3  1  
ATOM 187   H HG2  . PRO A 1 13 ? -7.151  0.475   6.987   1.00 0.00 ? 13 PRO A HG2  1  
ATOM 188   H HG3  . PRO A 1 13 ? -7.872  0.522   8.606   1.00 0.00 ? 13 PRO A HG3  1  
ATOM 189   H HD2  . PRO A 1 13 ? -8.979  -0.546  6.317   1.00 0.00 ? 13 PRO A HD2  1  
ATOM 190   H HD3  . PRO A 1 13 ? -9.875  -0.171  7.803   1.00 0.00 ? 13 PRO A HD3  1  
ATOM 191   N N    . TYR A 1 14 ? -7.413  3.734   5.032   1.00 0.00 ? 14 TYR A N    1  
ATOM 192   C CA   . TYR A 1 14 ? -6.637  4.039   3.836   1.00 0.00 ? 14 TYR A CA   1  
ATOM 193   C C    . TYR A 1 14 ? -7.538  4.564   2.722   1.00 0.00 ? 14 TYR A C    1  
ATOM 194   O O    . TYR A 1 14 ? -8.347  3.825   2.162   1.00 0.00 ? 14 TYR A O    1  
ATOM 195   C CB   . TYR A 1 14 ? -5.888  2.794   3.358   1.00 0.00 ? 14 TYR A CB   1  
ATOM 196   C CG   . TYR A 1 14 ? -5.114  2.095   4.452   1.00 0.00 ? 14 TYR A CG   1  
ATOM 197   C CD1  . TYR A 1 14 ? -4.009  2.697   5.041   1.00 0.00 ? 14 TYR A CD1  1  
ATOM 198   C CD2  . TYR A 1 14 ? -5.487  0.833   4.897   1.00 0.00 ? 14 TYR A CD2  1  
ATOM 199   C CE1  . TYR A 1 14 ? -3.298  2.062   6.041   1.00 0.00 ? 14 TYR A CE1  1  
ATOM 200   C CE2  . TYR A 1 14 ? -4.783  0.191   5.897   1.00 0.00 ? 14 TYR A CE2  1  
ATOM 201   C CZ   . TYR A 1 14 ? -3.689  0.810   6.466   1.00 0.00 ? 14 TYR A CZ   1  
ATOM 202   O OH   . TYR A 1 14 ? -2.985  0.173   7.462   1.00 0.00 ? 14 TYR A OH   1  
ATOM 203   H H    . TYR A 1 14 ? -7.249  4.247   5.851   1.00 0.00 ? 14 TYR A H    1  
ATOM 204   H HA   . TYR A 1 14 ? -5.918  4.803   4.092   1.00 0.00 ? 14 TYR A HA   1  
ATOM 205   H HB2  . TYR A 1 14 ? -6.597  2.089   2.952   1.00 0.00 ? 14 TYR A HB2  1  
ATOM 206   H HB3  . TYR A 1 14 ? -5.188  3.078   2.585   1.00 0.00 ? 14 TYR A HB3  1  
ATOM 207   H HD1  . TYR A 1 14 ? -3.705  3.679   4.707   1.00 0.00 ? 14 TYR A HD1  1  
ATOM 208   H HD2  . TYR A 1 14 ? -6.344  0.351   4.448   1.00 0.00 ? 14 TYR A HD2  1  
ATOM 209   H HE1  . TYR A 1 14 ? -2.442  2.546   6.488   1.00 0.00 ? 14 TYR A HE1  1  
ATOM 210   H HE2  . TYR A 1 14 ? -5.089  -0.790  6.230   1.00 0.00 ? 14 TYR A HE2  1  
ATOM 211   H HH   . TYR A 1 14 ? -3.253  -0.748  7.505   1.00 0.00 ? 14 TYR A HH   1  
ATOM 212   N N    . SER A 1 15 ? -7.390  5.847   2.405   1.00 0.00 ? 15 SER A N    1  
ATOM 213   C CA   . SER A 1 15 ? -8.191  6.473   1.360   1.00 0.00 ? 15 SER A CA   1  
ATOM 214   C C    . SER A 1 15 ? -7.770  5.975   -0.019  1.00 0.00 ? 15 SER A C    1  
ATOM 215   O O    . SER A 1 15 ? -6.732  5.331   -0.170  1.00 0.00 ? 15 SER A O    1  
ATOM 216   C CB   . SER A 1 15 ? -8.055  7.996   1.429   1.00 0.00 ? 15 SER A CB   1  
ATOM 217   O OG   . SER A 1 15 ? -8.555  8.498   2.656   1.00 0.00 ? 15 SER A OG   1  
ATOM 218   H H    . SER A 1 15 ? -6.727  6.385   2.888   1.00 0.00 ? 15 SER A H    1  
ATOM 219   H HA   . SER A 1 15 ? -9.223  6.204   1.528   1.00 0.00 ? 15 SER A HA   1  
ATOM 220   H HB2  . SER A 1 15 ? -7.014  8.266   1.340   1.00 0.00 ? 15 SER A HB2  1  
ATOM 221   H HB3  . SER A 1 15 ? -8.613  8.441   0.617   1.00 0.00 ? 15 SER A HB3  1  
ATOM 222   H HG   . SER A 1 15 ? -9.490  8.696   2.564   1.00 0.00 ? 15 SER A HG   1  
ATOM 223   N N    . LYS A 1 16 ? -8.584  6.279   -1.024  1.00 0.00 ? 16 LYS A N    1  
ATOM 224   C CA   . LYS A 1 16 ? -8.298  5.865   -2.393  1.00 0.00 ? 16 LYS A CA   1  
ATOM 225   C C    . LYS A 1 16 ? -6.924  6.359   -2.835  1.00 0.00 ? 16 LYS A C    1  
ATOM 226   O O    . LYS A 1 16 ? -6.222  5.681   -3.584  1.00 0.00 ? 16 LYS A O    1  
ATOM 227   C CB   . LYS A 1 16 ? -9.373  6.397   -3.343  1.00 0.00 ? 16 LYS A CB   1  
ATOM 228   C CG   . LYS A 1 16 ? -9.549  7.904   -3.280  1.00 0.00 ? 16 LYS A CG   1  
ATOM 229   C CD   . LYS A 1 16 ? -10.713 8.366   -4.141  1.00 0.00 ? 16 LYS A CD   1  
ATOM 230   C CE   . LYS A 1 16 ? -10.670 9.868   -4.378  1.00 0.00 ? 16 LYS A CE   1  
ATOM 231   N NZ   . LYS A 1 16 ? -10.942 10.635  -3.131  1.00 0.00 ? 16 LYS A NZ   1  
ATOM 232   H H    . LYS A 1 16 ? -9.397  6.796   -0.841  1.00 0.00 ? 16 LYS A H    1  
ATOM 233   H HA   . LYS A 1 16 ? -8.306  4.786   -2.421  1.00 0.00 ? 16 LYS A HA   1  
ATOM 234   H HB2  . LYS A 1 16 ? -9.107  6.128   -4.355  1.00 0.00 ? 16 LYS A HB2  1  
ATOM 235   H HB3  . LYS A 1 16 ? -10.318 5.934   -3.094  1.00 0.00 ? 16 LYS A HB3  1  
ATOM 236   H HG2  . LYS A 1 16 ? -9.735  8.193   -2.257  1.00 0.00 ? 16 LYS A HG2  1  
ATOM 237   H HG3  . LYS A 1 16 ? -8.644  8.378   -3.632  1.00 0.00 ? 16 LYS A HG3  1  
ATOM 238   H HD2  . LYS A 1 16 ? -10.668 7.861   -5.094  1.00 0.00 ? 16 LYS A HD2  1  
ATOM 239   H HD3  . LYS A 1 16 ? -11.640 8.116   -3.642  1.00 0.00 ? 16 LYS A HD3  1  
ATOM 240   H HE2  . LYS A 1 16 ? -9.690  10.132  -4.747  1.00 0.00 ? 16 LYS A HE2  1  
ATOM 241   H HE3  . LYS A 1 16 ? -11.414 10.123  -5.118  1.00 0.00 ? 16 LYS A HE3  1  
ATOM 242   H HZ1  . LYS A 1 16 ? -10.331 10.294  -2.362  1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 243   H HZ2  . LYS A 1 16 ? -11.935 10.515  -2.848  1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 244   H HZ3  . LYS A 1 16 ? -10.756 11.646  -3.286  1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 245   N N    . GLY A 1 17 ? -6.547  7.544   -2.365  1.00 0.00 ? 17 GLY A N    1  
ATOM 246   C CA   . GLY A 1 17 ? -5.257  8.106   -2.722  1.00 0.00 ? 17 GLY A CA   1  
ATOM 247   C C    . GLY A 1 17 ? -4.103  7.369   -2.073  1.00 0.00 ? 17 GLY A C    1  
ATOM 248   O O    . GLY A 1 17 ? -3.000  7.328   -2.618  1.00 0.00 ? 17 GLY A O    1  
ATOM 249   H H    . GLY A 1 17 ? -7.148  8.040   -1.771  1.00 0.00 ? 17 GLY A H    1  
ATOM 250   H HA2  . GLY A 1 17 ? -5.142  8.062   -3.794  1.00 0.00 ? 17 GLY A HA2  1  
ATOM 251   H HA3  . GLY A 1 17 ? -5.230  9.140   -2.410  1.00 0.00 ? 17 GLY A HA3  1  
ATOM 252   N N    . GLN A 1 18 ? -4.357  6.787   -0.905  1.00 0.00 ? 18 GLN A N    1  
ATOM 253   C CA   . GLN A 1 18 ? -3.328  6.050   -0.180  1.00 0.00 ? 18 GLN A CA   1  
ATOM 254   C C    . GLN A 1 18 ? -3.180  4.636   -0.732  1.00 0.00 ? 18 GLN A C    1  
ATOM 255   O O    . GLN A 1 18 ? -2.073  4.188   -1.032  1.00 0.00 ? 18 GLN A O    1  
ATOM 256   C CB   . GLN A 1 18 ? -3.665  5.995   1.311   1.00 0.00 ? 18 GLN A CB   1  
ATOM 257   C CG   . GLN A 1 18 ? -3.671  7.358   1.984   1.00 0.00 ? 18 GLN A CG   1  
ATOM 258   C CD   . GLN A 1 18 ? -4.104  7.291   3.435   1.00 0.00 ? 18 GLN A CD   1  
ATOM 259   O OE1  . GLN A 1 18 ? -5.270  7.037   3.736   1.00 0.00 ? 18 GLN A OE1  1  
ATOM 260   N NE2  . GLN A 1 18 ? -3.163  7.518   4.345   1.00 0.00 ? 18 GLN A NE2  1  
ATOM 261   H H    . GLN A 1 18 ? -5.255  6.855   -0.522  1.00 0.00 ? 18 GLN A H    1  
ATOM 262   H HA   . GLN A 1 18 ? -2.393  6.573   -0.309  1.00 0.00 ? 18 GLN A HA   1  
ATOM 263   H HB2  . GLN A 1 18 ? -4.644  5.555   1.431   1.00 0.00 ? 18 GLN A HB2  1  
ATOM 264   H HB3  . GLN A 1 18 ? -2.936  5.374   1.810   1.00 0.00 ? 18 GLN A HB3  1  
ATOM 265   H HG2  . GLN A 1 18 ? -2.673  7.771   1.941   1.00 0.00 ? 18 GLN A HG2  1  
ATOM 266   H HG3  . GLN A 1 18 ? -4.350  8.006   1.450   1.00 0.00 ? 18 GLN A HG3  1  
ATOM 267   H HE21 . GLN A 1 18 ? -2.255  7.715   4.032   1.00 0.00 ? 18 GLN A HE21 1  
ATOM 268   H HE22 . GLN A 1 18 ? -3.416  7.482   5.290   1.00 0.00 ? 18 GLN A HE22 1  
ATOM 269   N N    . LEU A 1 19 ? -4.302  3.938   -0.864  1.00 0.00 ? 19 LEU A N    1  
ATOM 270   C CA   . LEU A 1 19 ? -4.298  2.573   -1.381  1.00 0.00 ? 19 LEU A CA   1  
ATOM 271   C C    . LEU A 1 19 ? -3.839  2.543   -2.835  1.00 0.00 ? 19 LEU A C    1  
ATOM 272   O O    . LEU A 1 19 ? -3.372  1.516   -3.327  1.00 0.00 ? 19 LEU A O    1  
ATOM 273   C CB   . LEU A 1 19 ? -5.693  1.958   -1.261  1.00 0.00 ? 19 LEU A CB   1  
ATOM 274   C CG   . LEU A 1 19 ? -6.294  1.924   0.144   1.00 0.00 ? 19 LEU A CG   1  
ATOM 275   C CD1  . LEU A 1 19 ? -7.813  1.887   0.075   1.00 0.00 ? 19 LEU A CD1  1  
ATOM 276   C CD2  . LEU A 1 19 ? -5.765  0.729   0.923   1.00 0.00 ? 19 LEU A CD2  1  
ATOM 277   H H    . LEU A 1 19 ? -5.154  4.348   -0.609  1.00 0.00 ? 19 LEU A H    1  
ATOM 278   H HA   . LEU A 1 19 ? -3.607  1.996   -0.785  1.00 0.00 ? 19 LEU A HA   1  
ATOM 279   H HB2  . LEU A 1 19 ? -6.360  2.525   -1.892  1.00 0.00 ? 19 LEU A HB2  1  
ATOM 280   H HB3  . LEU A 1 19 ? -5.637  0.940   -1.622  1.00 0.00 ? 19 LEU A HB3  1  
ATOM 281   H HG   . LEU A 1 19 ? -6.007  2.823   0.673   1.00 0.00 ? 19 LEU A HG   1  
ATOM 282   H HD11 . LEU A 1 19 ? -8.123  1.114   -0.611  1.00 0.00 ? 19 LEU A HD11 1  
ATOM 283   H HD12 . LEU A 1 19 ? -8.181  2.842   -0.269  1.00 0.00 ? 19 LEU A HD12 1  
ATOM 284   H HD13 . LEU A 1 19 ? -8.213  1.680   1.057   1.00 0.00 ? 19 LEU A HD13 1  
ATOM 285   H HD21 . LEU A 1 19 ? -5.704  -0.128  0.268   1.00 0.00 ? 19 LEU A HD21 1  
ATOM 286   H HD22 . LEU A 1 19 ? -6.434  0.508   1.742   1.00 0.00 ? 19 LEU A HD22 1  
ATOM 287   H HD23 . LEU A 1 19 ? -4.783  0.957   1.310   1.00 0.00 ? 19 LEU A HD23 1  
ATOM 288   N N    . ARG A 1 20 ? -3.973  3.676   -3.516  1.00 0.00 ? 20 ARG A N    1  
ATOM 289   C CA   . ARG A 1 20 ? -3.571  3.779   -4.914  1.00 0.00 ? 20 ARG A CA   1  
ATOM 290   C C    . ARG A 1 20 ? -2.092  3.445   -5.080  1.00 0.00 ? 20 ARG A C    1  
ATOM 291   O O    . ARG A 1 20 ? -1.698  2.792   -6.046  1.00 0.00 ? 20 ARG A O    1  
ATOM 292   C CB   . ARG A 1 20 ? -3.850  5.187   -5.444  1.00 0.00 ? 20 ARG A CB   1  
ATOM 293   C CG   . ARG A 1 20 ? -3.268  5.444   -6.824  1.00 0.00 ? 20 ARG A CG   1  
ATOM 294   C CD   . ARG A 1 20 ? -3.508  6.878   -7.272  1.00 0.00 ? 20 ARG A CD   1  
ATOM 295   N NE   . ARG A 1 20 ? -4.705  7.000   -8.099  1.00 0.00 ? 20 ARG A NE   1  
ATOM 296   C CZ   . ARG A 1 20 ? -5.004  8.085   -8.804  1.00 0.00 ? 20 ARG A CZ   1  
ATOM 297   N NH1  . ARG A 1 20 ? -4.196  9.136   -8.784  1.00 0.00 ? 20 ARG A NH1  1  
ATOM 298   N NH2  . ARG A 1 20 ? -6.112  8.120   -9.533  1.00 0.00 ? 20 ARG A NH2  1  
ATOM 299   H H    . ARG A 1 20 ? -4.352  4.461   -3.068  1.00 0.00 ? 20 ARG A H    1  
ATOM 300   H HA   . ARG A 1 20 ? -4.155  3.069   -5.480  1.00 0.00 ? 20 ARG A HA   1  
ATOM 301   H HB2  . ARG A 1 20 ? -4.918  5.336   -5.494  1.00 0.00 ? 20 ARG A HB2  1  
ATOM 302   H HB3  . ARG A 1 20 ? -3.426  5.907   -4.759  1.00 0.00 ? 20 ARG A HB3  1  
ATOM 303   H HG2  . ARG A 1 20 ? -2.204  5.261   -6.796  1.00 0.00 ? 20 ARG A HG2  1  
ATOM 304   H HG3  . ARG A 1 20 ? -3.733  4.773   -7.531  1.00 0.00 ? 20 ARG A HG3  1  
ATOM 305   H HD2  . ARG A 1 20 ? -3.622  7.500   -6.397  1.00 0.00 ? 20 ARG A HD2  1  
ATOM 306   H HD3  . ARG A 1 20 ? -2.653  7.210   -7.841  1.00 0.00 ? 20 ARG A HD3  1  
ATOM 307   H HE   . ARG A 1 20 ? -5.317  6.235   -8.128  1.00 0.00 ? 20 ARG A HE   1  
ATOM 308   H HH11 . ARG A 1 20 ? -3.360  9.112   -8.237  1.00 0.00 ? 20 ARG A HH11 1  
ATOM 309   H HH12 . ARG A 1 20 ? -4.422  9.951   -9.317  1.00 0.00 ? 20 ARG A HH12 1  
ATOM 310   H HH21 . ARG A 1 20 ? -6.724  7.329   -9.551  1.00 0.00 ? 20 ARG A HH21 1  
ATOM 311   H HH22 . ARG A 1 20 ? -6.336  8.937   -10.063 1.00 0.00 ? 20 ARG A HH22 1  
ATOM 312   N N    . GLU A 1 21 ? -1.277  3.898   -4.132  1.00 0.00 ? 21 GLU A N    1  
ATOM 313   C CA   . GLU A 1 21 ? 0.158   3.648   -4.175  1.00 0.00 ? 21 GLU A CA   1  
ATOM 314   C C    . GLU A 1 21 ? 0.483   2.252   -3.650  1.00 0.00 ? 21 GLU A C    1  
ATOM 315   O O    . GLU A 1 21 ? 1.395   1.587   -4.143  1.00 0.00 ? 21 GLU A O    1  
ATOM 316   C CB   . GLU A 1 21 ? 0.907   4.700   -3.355  1.00 0.00 ? 21 GLU A CB   1  
ATOM 317   C CG   . GLU A 1 21 ? 0.670   6.124   -3.830  1.00 0.00 ? 21 GLU A CG   1  
ATOM 318   C CD   . GLU A 1 21 ? 0.856   6.277   -5.327  1.00 0.00 ? 21 GLU A CD   1  
ATOM 319   O OE1  . GLU A 1 21 ? 1.887   5.802   -5.848  1.00 0.00 ? 21 GLU A OE1  1  
ATOM 320   O OE2  . GLU A 1 21 ? -0.028  6.873   -5.977  1.00 0.00 ? 21 GLU A OE2  1  
ATOM 321   H H    . GLU A 1 21 ? -1.651  4.413   -3.386  1.00 0.00 ? 21 GLU A H    1  
ATOM 322   H HA   . GLU A 1 21 ? 0.476   3.714   -5.204  1.00 0.00 ? 21 GLU A HA   1  
ATOM 323   H HB2  . GLU A 1 21 ? 0.590   4.629   -2.325  1.00 0.00 ? 21 GLU A HB2  1  
ATOM 324   H HB3  . GLU A 1 21 ? 1.966   4.496   -3.411  1.00 0.00 ? 21 GLU A HB3  1  
ATOM 325   H HG2  . GLU A 1 21 ? -0.339  6.411   -3.577  1.00 0.00 ? 21 GLU A HG2  1  
ATOM 326   H HG3  . GLU A 1 21 ? 1.366   6.778   -3.327  1.00 0.00 ? 21 GLU A HG3  1  
ATOM 327   N N    . LEU A 1 22 ? -0.269  1.814   -2.646  1.00 0.00 ? 22 LEU A N    1  
ATOM 328   C CA   . LEU A 1 22 ? -0.061  0.498   -2.052  1.00 0.00 ? 22 LEU A CA   1  
ATOM 329   C C    . LEU A 1 22 ? -0.375  -0.607  -3.055  1.00 0.00 ? 22 LEU A C    1  
ATOM 330   O O    . LEU A 1 22 ? 0.457   -1.476  -3.316  1.00 0.00 ? 22 LEU A O    1  
ATOM 331   C CB   . LEU A 1 22 ? -0.935  0.335   -0.807  1.00 0.00 ? 22 LEU A CB   1  
ATOM 332   C CG   . LEU A 1 22 ? -0.622  1.272   0.360   1.00 0.00 ? 22 LEU A CG   1  
ATOM 333   C CD1  . LEU A 1 22 ? -1.794  1.331   1.327   1.00 0.00 ? 22 LEU A CD1  1  
ATOM 334   C CD2  . LEU A 1 22 ? 0.642   0.825   1.079   1.00 0.00 ? 22 LEU A CD2  1  
ATOM 335   H H    . LEU A 1 22 ? -0.980  2.389   -2.295  1.00 0.00 ? 22 LEU A H    1  
ATOM 336   H HA   . LEU A 1 22 ? 0.977   0.424   -1.766  1.00 0.00 ? 22 LEU A HA   1  
ATOM 337   H HB2  . LEU A 1 22 ? -1.961  0.502   -1.099  1.00 0.00 ? 22 LEU A HB2  1  
ATOM 338   H HB3  . LEU A 1 22 ? -0.823  -0.681  -0.456  1.00 0.00 ? 22 LEU A HB3  1  
ATOM 339   H HG   . LEU A 1 22 ? -0.455  2.270   -0.023  1.00 0.00 ? 22 LEU A HG   1  
ATOM 340   H HD11 . LEU A 1 22 ? -2.417  2.180   1.087   1.00 0.00 ? 22 LEU A HD11 1  
ATOM 341   H HD12 . LEU A 1 22 ? -1.424  1.430   2.336   1.00 0.00 ? 22 LEU A HD12 1  
ATOM 342   H HD13 . LEU A 1 22 ? -2.375  0.423   1.244   1.00 0.00 ? 22 LEU A HD13 1  
ATOM 343   H HD21 . LEU A 1 22 ? 1.472   0.836   0.387   1.00 0.00 ? 22 LEU A HD21 1  
ATOM 344   H HD22 . LEU A 1 22 ? 0.505   -0.177  1.459   1.00 0.00 ? 22 LEU A HD22 1  
ATOM 345   H HD23 . LEU A 1 22 ? 0.848   1.497   1.898   1.00 0.00 ? 22 LEU A HD23 1  
ATOM 346   N N    . GLU A 1 23 ? -1.579  -0.566  -3.616  1.00 0.00 ? 23 GLU A N    1  
ATOM 347   C CA   . GLU A 1 23 ? -2.001  -1.564  -4.592  1.00 0.00 ? 23 GLU A CA   1  
ATOM 348   C C    . GLU A 1 23 ? -0.995  -1.667  -5.735  1.00 0.00 ? 23 GLU A C    1  
ATOM 349   O O    . GLU A 1 23 ? -0.600  -2.763  -6.132  1.00 0.00 ? 23 GLU A O    1  
ATOM 350   C CB   . GLU A 1 23 ? -3.384  -1.216  -5.146  1.00 0.00 ? 23 GLU A CB   1  
ATOM 351   C CG   . GLU A 1 23 ? -4.509  -1.421  -4.146  1.00 0.00 ? 23 GLU A CG   1  
ATOM 352   C CD   . GLU A 1 23 ? -5.858  -0.988  -4.687  1.00 0.00 ? 23 GLU A CD   1  
ATOM 353   O OE1  . GLU A 1 23 ? -5.900  -0.443  -5.810  1.00 0.00 ? 23 GLU A OE1  1  
ATOM 354   O OE2  . GLU A 1 23 ? -6.871  -1.193  -3.987  1.00 0.00 ? 23 GLU A OE2  1  
ATOM 355   H H    . GLU A 1 23 ? -2.199  0.151   -3.368  1.00 0.00 ? 23 GLU A H    1  
ATOM 356   H HA   . GLU A 1 23 ? -2.054  -2.518  -4.090  1.00 0.00 ? 23 GLU A HA   1  
ATOM 357   H HB2  . GLU A 1 23 ? -3.386  -0.180  -5.452  1.00 0.00 ? 23 GLU A HB2  1  
ATOM 358   H HB3  . GLU A 1 23 ? -3.580  -1.836  -6.008  1.00 0.00 ? 23 GLU A HB3  1  
ATOM 359   H HG2  . GLU A 1 23 ? -4.561  -2.469  -3.891  1.00 0.00 ? 23 GLU A HG2  1  
ATOM 360   H HG3  . GLU A 1 23 ? -4.293  -0.847  -3.257  1.00 0.00 ? 23 GLU A HG3  1  
ATOM 361   N N    . ARG A 1 24 ? -0.585  -0.516  -6.260  1.00 0.00 ? 24 ARG A N    1  
ATOM 362   C CA   . ARG A 1 24 ? 0.373   -0.476  -7.358  1.00 0.00 ? 24 ARG A CA   1  
ATOM 363   C C    . ARG A 1 24 ? 1.673   -1.175  -6.972  1.00 0.00 ? 24 ARG A C    1  
ATOM 364   O O    . ARG A 1 24 ? 2.140   -2.070  -7.676  1.00 0.00 ? 24 ARG A O    1  
ATOM 365   C CB   . ARG A 1 24 ? 0.660   0.972   -7.759  1.00 0.00 ? 24 ARG A CB   1  
ATOM 366   C CG   . ARG A 1 24 ? -0.318  1.527   -8.782  1.00 0.00 ? 24 ARG A CG   1  
ATOM 367   C CD   . ARG A 1 24 ? 0.350   2.540   -9.699  1.00 0.00 ? 24 ARG A CD   1  
ATOM 368   N NE   . ARG A 1 24 ? 1.098   1.895   -10.775 1.00 0.00 ? 24 ARG A NE   1  
ATOM 369   C CZ   . ARG A 1 24 ? 0.524   1.315   -11.823 1.00 0.00 ? 24 ARG A CZ   1  
ATOM 370   N NH1  . ARG A 1 24 ? -0.797  1.300   -11.937 1.00 0.00 ? 24 ARG A NH1  1  
ATOM 371   N NH2  . ARG A 1 24 ? 1.273   0.749   -12.761 1.00 0.00 ? 24 ARG A NH2  1  
ATOM 372   H H    . ARG A 1 24 ? -0.936  0.325   -5.901  1.00 0.00 ? 24 ARG A H    1  
ATOM 373   H HA   . ARG A 1 24 ? -0.064  -0.993  -8.199  1.00 0.00 ? 24 ARG A HA   1  
ATOM 374   H HB2  . ARG A 1 24 ? 0.615   1.594   -6.877  1.00 0.00 ? 24 ARG A HB2  1  
ATOM 375   H HB3  . ARG A 1 24 ? 1.654   1.027   -8.177  1.00 0.00 ? 24 ARG A HB3  1  
ATOM 376   H HG2  . ARG A 1 24 ? -0.699  0.712   -9.381  1.00 0.00 ? 24 ARG A HG2  1  
ATOM 377   H HG3  . ARG A 1 24 ? -1.134  2.007   -8.262  1.00 0.00 ? 24 ARG A HG3  1  
ATOM 378   H HD2  . ARG A 1 24 ? -0.412  3.171   -10.131 1.00 0.00 ? 24 ARG A HD2  1  
ATOM 379   H HD3  . ARG A 1 24 ? 1.027   3.143   -9.113  1.00 0.00 ? 24 ARG A HD3  1  
ATOM 380   H HE   . ARG A 1 24 ? 2.075   1.895   -10.711 1.00 0.00 ? 24 ARG A HE   1  
ATOM 381   H HH11 . ARG A 1 24 ? -1.363  1.726   -11.232 1.00 0.00 ? 24 ARG A HH11 1  
ATOM 382   H HH12 . ARG A 1 24 ? -1.226  0.863   -12.728 1.00 0.00 ? 24 ARG A HH12 1  
ATOM 383   H HH21 . ARG A 1 24 ? 2.269   0.759   -12.679 1.00 0.00 ? 24 ARG A HH21 1  
ATOM 384   H HH22 . ARG A 1 24 ? 0.841   0.313   -13.550 1.00 0.00 ? 24 ARG A HH22 1  
ATOM 385   N N    . GLU A 1 25 ? 2.251   -0.761  -5.849  1.00 0.00 ? 25 GLU A N    1  
ATOM 386   C CA   . GLU A 1 25 ? 3.497   -1.348  -5.370  1.00 0.00 ? 25 GLU A CA   1  
ATOM 387   C C    . GLU A 1 25 ? 3.338   -2.847  -5.138  1.00 0.00 ? 25 GLU A C    1  
ATOM 388   O O    . GLU A 1 25 ? 4.247   -3.629  -5.418  1.00 0.00 ? 25 GLU A O    1  
ATOM 389   C CB   . GLU A 1 25 ? 3.944   -0.664  -4.076  1.00 0.00 ? 25 GLU A CB   1  
ATOM 390   C CG   . GLU A 1 25 ? 4.891   0.503   -4.300  1.00 0.00 ? 25 GLU A CG   1  
ATOM 391   C CD   . GLU A 1 25 ? 4.461   1.390   -5.452  1.00 0.00 ? 25 GLU A CD   1  
ATOM 392   O OE1  . GLU A 1 25 ? 4.720   1.018   -6.616  1.00 0.00 ? 25 GLU A OE1  1  
ATOM 393   O OE2  . GLU A 1 25 ? 3.866   2.456   -5.190  1.00 0.00 ? 25 GLU A OE2  1  
ATOM 394   H H    . GLU A 1 25 ? 1.830   -0.044  -5.330  1.00 0.00 ? 25 GLU A H    1  
ATOM 395   H HA   . GLU A 1 25 ? 4.250   -1.191  -6.128  1.00 0.00 ? 25 GLU A HA   1  
ATOM 396   H HB2  . GLU A 1 25 ? 3.072   -0.299  -3.556  1.00 0.00 ? 25 GLU A HB2  1  
ATOM 397   H HB3  . GLU A 1 25 ? 4.445   -1.392  -3.454  1.00 0.00 ? 25 GLU A HB3  1  
ATOM 398   H HG2  . GLU A 1 25 ? 4.927   1.099   -3.401  1.00 0.00 ? 25 GLU A HG2  1  
ATOM 399   H HG3  . GLU A 1 25 ? 5.877   0.115   -4.512  1.00 0.00 ? 25 GLU A HG3  1  
ATOM 400   N N    . TYR A 1 26 ? 2.178   -3.241  -4.624  1.00 0.00 ? 26 TYR A N    1  
ATOM 401   C CA   . TYR A 1 26 ? 1.901   -4.646  -4.351  1.00 0.00 ? 26 TYR A CA   1  
ATOM 402   C C    . TYR A 1 26 ? 1.932   -5.467  -5.636  1.00 0.00 ? 26 TYR A C    1  
ATOM 403   O O    . TYR A 1 26 ? 2.601   -6.497  -5.712  1.00 0.00 ? 26 TYR A O    1  
ATOM 404   C CB   . TYR A 1 26 ? 0.540   -4.796  -3.669  1.00 0.00 ? 26 TYR A CB   1  
ATOM 405   C CG   . TYR A 1 26 ? 0.153   -6.232  -3.398  1.00 0.00 ? 26 TYR A CG   1  
ATOM 406   C CD1  . TYR A 1 26 ? 0.887   -7.016  -2.517  1.00 0.00 ? 26 TYR A CD1  1  
ATOM 407   C CD2  . TYR A 1 26 ? -0.948  -6.805  -4.023  1.00 0.00 ? 26 TYR A CD2  1  
ATOM 408   C CE1  . TYR A 1 26 ? 0.538   -8.329  -2.267  1.00 0.00 ? 26 TYR A CE1  1  
ATOM 409   C CE2  . TYR A 1 26 ? -1.306  -8.116  -3.778  1.00 0.00 ? 26 TYR A CE2  1  
ATOM 410   C CZ   . TYR A 1 26 ? -0.560  -8.874  -2.900  1.00 0.00 ? 26 TYR A CZ   1  
ATOM 411   O OH   . TYR A 1 26 ? -0.912  -10.181 -2.653  1.00 0.00 ? 26 TYR A OH   1  
ATOM 412   H H    . TYR A 1 26 ? 1.493   -2.571  -4.422  1.00 0.00 ? 26 TYR A H    1  
ATOM 413   H HA   . TYR A 1 26 ? 2.668   -5.012  -3.685  1.00 0.00 ? 26 TYR A HA   1  
ATOM 414   H HB2  . TYR A 1 26 ? 0.559   -4.274  -2.725  1.00 0.00 ? 26 TYR A HB2  1  
ATOM 415   H HB3  . TYR A 1 26 ? -0.221  -4.360  -4.300  1.00 0.00 ? 26 TYR A HB3  1  
ATOM 416   H HD1  . TYR A 1 26 ? 1.746   -6.585  -2.023  1.00 0.00 ? 26 TYR A HD1  1  
ATOM 417   H HD2  . TYR A 1 26 ? -1.531  -6.209  -4.710  1.00 0.00 ? 26 TYR A HD2  1  
ATOM 418   H HE1  . TYR A 1 26 ? 1.122   -8.922  -1.580  1.00 0.00 ? 26 TYR A HE1  1  
ATOM 419   H HE2  . TYR A 1 26 ? -2.166  -8.544  -4.273  1.00 0.00 ? 26 TYR A HE2  1  
ATOM 420   H HH   . TYR A 1 26 ? -1.860  -10.235 -2.506  1.00 0.00 ? 26 TYR A HH   1  
ATOM 421   N N    . ALA A 1 27 ? 1.202   -5.003  -6.645  1.00 0.00 ? 27 ALA A N    1  
ATOM 422   C CA   . ALA A 1 27 ? 1.146   -5.691  -7.929  1.00 0.00 ? 27 ALA A CA   1  
ATOM 423   C C    . ALA A 1 27 ? 2.547   -5.955  -8.471  1.00 0.00 ? 27 ALA A C    1  
ATOM 424   O O    . ALA A 1 27 ? 2.778   -6.945  -9.163  1.00 0.00 ? 27 ALA A O    1  
ATOM 425   C CB   . ALA A 1 27 ? 0.335   -4.881  -8.928  1.00 0.00 ? 27 ALA A CB   1  
ATOM 426   H H    . ALA A 1 27 ? 0.689   -4.176  -6.523  1.00 0.00 ? 27 ALA A H    1  
ATOM 427   H HA   . ALA A 1 27 ? 0.646   -6.637  -7.779  1.00 0.00 ? 27 ALA A HA   1  
ATOM 428   H HB1  . ALA A 1 27 ? -0.705  -5.167  -8.862  1.00 0.00 ? 27 ALA A HB1  1  
ATOM 429   H HB2  . ALA A 1 27 ? 0.434   -3.829  -8.703  1.00 0.00 ? 27 ALA A HB2  1  
ATOM 430   H HB3  . ALA A 1 27 ? 0.699   -5.072  -9.926  1.00 0.00 ? 27 ALA A HB3  1  
ATOM 431   N N    . ALA A 1 28 ? 3.477   -5.061  -8.153  1.00 0.00 ? 28 ALA A N    1  
ATOM 432   C CA   . ALA A 1 28 ? 4.855   -5.197  -8.608  1.00 0.00 ? 28 ALA A CA   1  
ATOM 433   C C    . ALA A 1 28 ? 5.623   -6.191  -7.743  1.00 0.00 ? 28 ALA A C    1  
ATOM 434   O O    . ALA A 1 28 ? 6.497   -6.906  -8.230  1.00 0.00 ? 28 ALA A O    1  
ATOM 435   C CB   . ALA A 1 28 ? 5.550   -3.843  -8.602  1.00 0.00 ? 28 ALA A CB   1  
ATOM 436   H H    . ALA A 1 28 ? 3.231   -4.292  -7.598  1.00 0.00 ? 28 ALA A H    1  
ATOM 437   H HA   . ALA A 1 28 ? 4.837   -5.561  -9.625  1.00 0.00 ? 28 ALA A HA   1  
ATOM 438   H HB1  . ALA A 1 28 ? 5.138   -3.232  -7.812  1.00 0.00 ? 28 ALA A HB1  1  
ATOM 439   H HB2  . ALA A 1 28 ? 6.608   -3.982  -8.437  1.00 0.00 ? 28 ALA A HB2  1  
ATOM 440   H HB3  . ALA A 1 28 ? 5.395   -3.356  -9.553  1.00 0.00 ? 28 ALA A HB3  1  
ATOM 441   N N    . ASN A 1 29 ? 5.290   -6.230  -6.456  1.00 0.00 ? 29 ASN A N    1  
ATOM 442   C CA   . ASN A 1 29 ? 5.950   -7.136  -5.523  1.00 0.00 ? 29 ASN A CA   1  
ATOM 443   C C    . ASN A 1 29 ? 5.106   -7.331  -4.267  1.00 0.00 ? 29 ASN A C    1  
ATOM 444   O O    . ASN A 1 29 ? 4.697   -6.364  -3.624  1.00 0.00 ? 29 ASN A O    1  
ATOM 445   C CB   . ASN A 1 29 ? 7.330   -6.595  -5.145  1.00 0.00 ? 29 ASN A CB   1  
ATOM 446   C CG   . ASN A 1 29 ? 7.354   -5.082  -5.054  1.00 0.00 ? 29 ASN A CG   1  
ATOM 447   O OD1  . ASN A 1 29 ? 7.938   -4.407  -5.902  1.00 0.00 ? 29 ASN A OD1  1  
ATOM 448   N ND2  . ASN A 1 29 ? 6.716   -4.541  -4.022  1.00 0.00 ? 29 ASN A ND2  1  
ATOM 449   H H    . ASN A 1 29 ? 4.584   -5.635  -6.127  1.00 0.00 ? 29 ASN A H    1  
ATOM 450   H HA   . ASN A 1 29 ? 6.068   -8.089  -6.015  1.00 0.00 ? 29 ASN A HA   1  
ATOM 451   H HB2  . ASN A 1 29 ? 7.617   -6.998  -4.184  1.00 0.00 ? 29 ASN A HB2  1  
ATOM 452   H HB3  . ASN A 1 29 ? 8.048   -6.904  -5.890  1.00 0.00 ? 29 ASN A HB3  1  
ATOM 453   H HD21 . ASN A 1 29 ? 6.272   -5.140  -3.386  1.00 0.00 ? 29 ASN A HD21 1  
ATOM 454   H HD22 . ASN A 1 29 ? 6.715   -3.564  -3.940  1.00 0.00 ? 29 ASN A HD22 1  
ATOM 455   N N    . LYS A 1 30 ? 4.850   -8.589  -3.922  1.00 0.00 ? 30 LYS A N    1  
ATOM 456   C CA   . LYS A 1 30 ? 4.057   -8.913  -2.743  1.00 0.00 ? 30 LYS A CA   1  
ATOM 457   C C    . LYS A 1 30 ? 4.720   -8.377  -1.477  1.00 0.00 ? 30 LYS A C    1  
ATOM 458   O O    . LYS A 1 30 ? 4.048   -8.084  -0.489  1.00 0.00 ? 30 LYS A O    1  
ATOM 459   C CB   . LYS A 1 30 ? 3.869   -10.428 -2.630  1.00 0.00 ? 30 LYS A CB   1  
ATOM 460   C CG   . LYS A 1 30 ? 3.305   -11.065 -3.888  1.00 0.00 ? 30 LYS A CG   1  
ATOM 461   C CD   . LYS A 1 30 ? 1.873   -10.625 -4.143  1.00 0.00 ? 30 LYS A CD   1  
ATOM 462   C CE   . LYS A 1 30 ? 1.192   -11.513 -5.173  1.00 0.00 ? 30 LYS A CE   1  
ATOM 463   N NZ   . LYS A 1 30 ? 1.987   -11.617 -6.428  1.00 0.00 ? 30 LYS A NZ   1  
ATOM 464   H H    . LYS A 1 30 ? 5.204   -9.317  -4.475  1.00 0.00 ? 30 LYS A H    1  
ATOM 465   H HA   . LYS A 1 30 ? 3.091   -8.446  -2.854  1.00 0.00 ? 30 LYS A HA   1  
ATOM 466   H HB2  . LYS A 1 30 ? 4.825   -10.883 -2.418  1.00 0.00 ? 30 LYS A HB2  1  
ATOM 467   H HB3  . LYS A 1 30 ? 3.193   -10.634 -1.813  1.00 0.00 ? 30 LYS A HB3  1  
ATOM 468   H HG2  . LYS A 1 30 ? 3.914   -10.776 -4.732  1.00 0.00 ? 30 LYS A HG2  1  
ATOM 469   H HG3  . LYS A 1 30 ? 3.328   -12.140 -3.777  1.00 0.00 ? 30 LYS A HG3  1  
ATOM 470   H HD2  . LYS A 1 30 ? 1.319   -10.678 -3.217  1.00 0.00 ? 30 LYS A HD2  1  
ATOM 471   H HD3  . LYS A 1 30 ? 1.878   -9.607  -4.505  1.00 0.00 ? 30 LYS A HD3  1  
ATOM 472   H HE2  . LYS A 1 30 ? 1.068   -12.500 -4.753  1.00 0.00 ? 30 LYS A HE2  1  
ATOM 473   H HE3  . LYS A 1 30 ? 0.223   -11.096 -5.404  1.00 0.00 ? 30 LYS A HE3  1  
ATOM 474   H HZ1  . LYS A 1 30 ? 1.438   -12.113 -7.158  1.00 0.00 ? 30 LYS A HZ1  1  
ATOM 475   H HZ2  . LYS A 1 30 ? 2.865   -12.146 -6.252  1.00 0.00 ? 30 LYS A HZ2  1  
ATOM 476   H HZ3  . LYS A 1 30 ? 2.230   -10.668 -6.777  1.00 0.00 ? 30 LYS A HZ3  1  
ATOM 477   N N    . PHE A 1 31 ? 6.042   -8.251  -1.516  1.00 0.00 ? 31 PHE A N    1  
ATOM 478   C CA   . PHE A 1 31 ? 6.796   -7.749  -0.373  1.00 0.00 ? 31 PHE A CA   1  
ATOM 479   C C    . PHE A 1 31 ? 7.750   -6.636  -0.796  1.00 0.00 ? 31 PHE A C    1  
ATOM 480   O O    . PHE A 1 31 ? 8.478   -6.769  -1.780  1.00 0.00 ? 31 PHE A O    1  
ATOM 481   C CB   . PHE A 1 31 ? 7.581   -8.886  0.286   1.00 0.00 ? 31 PHE A CB   1  
ATOM 482   C CG   . PHE A 1 31 ? 6.720   -10.041 0.712   1.00 0.00 ? 31 PHE A CG   1  
ATOM 483   C CD1  . PHE A 1 31 ? 6.319   -10.998 -0.206  1.00 0.00 ? 31 PHE A CD1  1  
ATOM 484   C CD2  . PHE A 1 31 ? 6.312   -10.168 2.030   1.00 0.00 ? 31 PHE A CD2  1  
ATOM 485   C CE1  . PHE A 1 31 ? 5.527   -12.062 0.183   1.00 0.00 ? 31 PHE A CE1  1  
ATOM 486   C CE2  . PHE A 1 31 ? 5.520   -11.230 2.424   1.00 0.00 ? 31 PHE A CE2  1  
ATOM 487   C CZ   . PHE A 1 31 ? 5.126   -12.178 1.500   1.00 0.00 ? 31 PHE A CZ   1  
ATOM 488   H H    . PHE A 1 31 ? 6.523   -8.501  -2.333  1.00 0.00 ? 31 PHE A H    1  
ATOM 489   H HA   . PHE A 1 31 ? 6.090   -7.351  0.340   1.00 0.00 ? 31 PHE A HA   1  
ATOM 490   H HB2  . PHE A 1 31 ? 8.314   -9.260  -0.413  1.00 0.00 ? 31 PHE A HB2  1  
ATOM 491   H HB3  . PHE A 1 31 ? 8.085   -8.505  1.161   1.00 0.00 ? 31 PHE A HB3  1  
ATOM 492   H HD1  . PHE A 1 31 ? 6.631   -10.909 -1.236  1.00 0.00 ? 31 PHE A HD1  1  
ATOM 493   H HD2  . PHE A 1 31 ? 6.618   -9.427  2.754   1.00 0.00 ? 31 PHE A HD2  1  
ATOM 494   H HE1  . PHE A 1 31 ? 5.220   -12.801 -0.542  1.00 0.00 ? 31 PHE A HE1  1  
ATOM 495   H HE2  . PHE A 1 31 ? 5.208   -11.318 3.455   1.00 0.00 ? 31 PHE A HE2  1  
ATOM 496   H HZ   . PHE A 1 31 ? 4.508   -13.008 1.806   1.00 0.00 ? 31 PHE A HZ   1  
ATOM 497   N N    . ILE A 1 32 ? 7.739   -5.539  -0.046  1.00 0.00 ? 32 ILE A N    1  
ATOM 498   C CA   . ILE A 1 32 ? 8.603   -4.403  -0.342  1.00 0.00 ? 32 ILE A CA   1  
ATOM 499   C C    . ILE A 1 32 ? 9.820   -4.384  0.576   1.00 0.00 ? 32 ILE A C    1  
ATOM 500   O O    . ILE A 1 32 ? 9.990   -5.265  1.419   1.00 0.00 ? 32 ILE A O    1  
ATOM 501   C CB   . ILE A 1 32 ? 7.846   -3.069  -0.201  1.00 0.00 ? 32 ILE A CB   1  
ATOM 502   C CG1  . ILE A 1 32 ? 7.423   -2.849  1.253   1.00 0.00 ? 32 ILE A CG1  1  
ATOM 503   C CG2  . ILE A 1 32 ? 6.634   -3.047  -1.120  1.00 0.00 ? 32 ILE A CG2  1  
ATOM 504   C CD1  . ILE A 1 32 ? 6.692   -1.544  1.478   1.00 0.00 ? 32 ILE A CD1  1  
ATOM 505   H H    . ILE A 1 32 ? 7.136   -5.493  0.725   1.00 0.00 ? 32 ILE A H    1  
ATOM 506   H HA   . ILE A 1 32 ? 8.938   -4.497  -1.365  1.00 0.00 ? 32 ILE A HA   1  
ATOM 507   H HB   . ILE A 1 32 ? 8.509   -2.271  -0.501  1.00 0.00 ? 32 ILE A HB   1  
ATOM 508   H HG12 . ILE A 1 32 ? 6.770   -3.651  1.556   1.00 0.00 ? 32 ILE A HG12 1  
ATOM 509   H HG13 . ILE A 1 32 ? 8.303   -2.850  1.880   1.00 0.00 ? 32 ILE A HG13 1  
ATOM 510   H HG21 . ILE A 1 32 ? 6.561   -3.990  -1.642  1.00 0.00 ? 32 ILE A HG21 1  
ATOM 511   H HG22 . ILE A 1 32 ? 5.741   -2.892  -0.534  1.00 0.00 ? 32 ILE A HG22 1  
ATOM 512   H HG23 . ILE A 1 32 ? 6.739   -2.247  -1.837  1.00 0.00 ? 32 ILE A HG23 1  
ATOM 513   H HD11 . ILE A 1 32 ? 6.700   -1.304  2.531   1.00 0.00 ? 32 ILE A HD11 1  
ATOM 514   H HD12 . ILE A 1 32 ? 7.181   -0.756  0.925   1.00 0.00 ? 32 ILE A HD12 1  
ATOM 515   H HD13 . ILE A 1 32 ? 5.671   -1.640  1.140   1.00 0.00 ? 32 ILE A HD13 1  
ATOM 516   N N    . THR A 1 33 ? 10.666  -3.372  0.407   1.00 0.00 ? 33 THR A N    1  
ATOM 517   C CA   . THR A 1 33 ? 11.867  -3.236  1.220   1.00 0.00 ? 33 THR A CA   1  
ATOM 518   C C    . THR A 1 33 ? 11.875  -1.911  1.974   1.00 0.00 ? 33 THR A C    1  
ATOM 519   O O    . THR A 1 33 ? 11.020  -1.054  1.752   1.00 0.00 ? 33 THR A O    1  
ATOM 520   C CB   . THR A 1 33 ? 13.142  -3.332  0.360   1.00 0.00 ? 33 THR A CB   1  
ATOM 521   O OG1  . THR A 1 33 ? 14.299  -3.371  1.202   1.00 0.00 ? 33 THR A OG1  1  
ATOM 522   C CG2  . THR A 1 33 ? 13.241  -2.151  -0.593  1.00 0.00 ? 33 THR A CG2  1  
ATOM 523   H H    . THR A 1 33 ? 10.475  -2.701  -0.282  1.00 0.00 ? 33 THR A H    1  
ATOM 524   H HA   . THR A 1 33 ? 11.879  -4.046  1.935   1.00 0.00 ? 33 THR A HA   1  
ATOM 525   H HB   . THR A 1 33 ? 13.098  -4.242  -0.221  1.00 0.00 ? 33 THR A HB   1  
ATOM 526   H HG1  . THR A 1 33 ? 14.394  -4.251  1.576   1.00 0.00 ? 33 THR A HG1  1  
ATOM 527   H HG21 . THR A 1 33 ? 14.005  -1.471  -0.246  1.00 0.00 ? 33 THR A HG21 1  
ATOM 528   H HG22 . THR A 1 33 ? 12.292  -1.637  -0.630  1.00 0.00 ? 33 THR A HG22 1  
ATOM 529   H HG23 . THR A 1 33 ? 13.497  -2.505  -1.580  1.00 0.00 ? 33 THR A HG23 1  
ATOM 530   N N    . LYS A 1 34 ? 12.846  -1.749  2.866   1.00 0.00 ? 34 LYS A N    1  
ATOM 531   C CA   . LYS A 1 34 ? 12.967  -0.527  3.653   1.00 0.00 ? 34 LYS A CA   1  
ATOM 532   C C    . LYS A 1 34 ? 12.951  0.703   2.751   1.00 0.00 ? 34 LYS A C    1  
ATOM 533   O O    . LYS A 1 34 ? 12.438  1.756   3.131   1.00 0.00 ? 34 LYS A O    1  
ATOM 534   C CB   . LYS A 1 34 ? 14.256  -0.552  4.477   1.00 0.00 ? 34 LYS A CB   1  
ATOM 535   C CG   . LYS A 1 34 ? 14.057  -1.032  5.904   1.00 0.00 ? 34 LYS A CG   1  
ATOM 536   C CD   . LYS A 1 34 ? 14.121  -2.547  5.997   1.00 0.00 ? 34 LYS A CD   1  
ATOM 537   C CE   . LYS A 1 34 ? 15.542  -3.057  5.807   1.00 0.00 ? 34 LYS A CE   1  
ATOM 538   N NZ   . LYS A 1 34 ? 15.625  -4.536  5.962   1.00 0.00 ? 34 LYS A NZ   1  
ATOM 539   H H    . LYS A 1 34 ? 13.498  -2.469  2.999   1.00 0.00 ? 34 LYS A H    1  
ATOM 540   H HA   . LYS A 1 34 ? 12.122  -0.479  4.323   1.00 0.00 ? 34 LYS A HA   1  
ATOM 541   H HB2  . LYS A 1 34 ? 14.965  -1.209  3.994   1.00 0.00 ? 34 LYS A HB2  1  
ATOM 542   H HB3  . LYS A 1 34 ? 14.668  0.447   4.509   1.00 0.00 ? 34 LYS A HB3  1  
ATOM 543   H HG2  . LYS A 1 34 ? 14.832  -0.610  6.527   1.00 0.00 ? 34 LYS A HG2  1  
ATOM 544   H HG3  . LYS A 1 34 ? 13.090  -0.699  6.254   1.00 0.00 ? 34 LYS A HG3  1  
ATOM 545   H HD2  . LYS A 1 34 ? 13.768  -2.855  6.970   1.00 0.00 ? 34 LYS A HD2  1  
ATOM 546   H HD3  . LYS A 1 34 ? 13.489  -2.973  5.231   1.00 0.00 ? 34 LYS A HD3  1  
ATOM 547   H HE2  . LYS A 1 34 ? 15.878  -2.788  4.817   1.00 0.00 ? 34 LYS A HE2  1  
ATOM 548   H HE3  . LYS A 1 34 ? 16.179  -2.590  6.543   1.00 0.00 ? 34 LYS A HE3  1  
ATOM 549   H HZ1  . LYS A 1 34 ? 14.972  -5.002  5.300   1.00 0.00 ? 34 LYS A HZ1  1  
ATOM 550   H HZ2  . LYS A 1 34 ? 15.370  -4.808  6.933   1.00 0.00 ? 34 LYS A HZ2  1  
ATOM 551   H HZ3  . LYS A 1 34 ? 16.593  -4.862  5.765   1.00 0.00 ? 34 LYS A HZ3  1  
ATOM 552   N N    . ASP A 1 35 ? 13.514  0.563   1.556   1.00 0.00 ? 35 ASP A N    1  
ATOM 553   C CA   . ASP A 1 35 ? 13.562  1.663   0.600   1.00 0.00 ? 35 ASP A CA   1  
ATOM 554   C C    . ASP A 1 35 ? 12.159  2.036   0.130   1.00 0.00 ? 35 ASP A C    1  
ATOM 555   O O    . ASP A 1 35 ? 11.663  3.125   0.423   1.00 0.00 ? 35 ASP A O    1  
ATOM 556   C CB   . ASP A 1 35 ? 14.431  1.286   -0.600  1.00 0.00 ? 35 ASP A CB   1  
ATOM 557   C CG   . ASP A 1 35 ? 14.924  2.500   -1.363  1.00 0.00 ? 35 ASP A CG   1  
ATOM 558   O OD1  . ASP A 1 35 ? 15.872  3.158   -0.883  1.00 0.00 ? 35 ASP A OD1  1  
ATOM 559   O OD2  . ASP A 1 35 ? 14.364  2.792   -2.439  1.00 0.00 ? 35 ASP A OD2  1  
ATOM 560   H H    . ASP A 1 35 ? 13.906  -0.301  1.311   1.00 0.00 ? 35 ASP A H    1  
ATOM 561   H HA   . ASP A 1 35 ? 14.000  2.515   1.096   1.00 0.00 ? 35 ASP A HA   1  
ATOM 562   H HB2  . ASP A 1 35 ? 15.289  0.728   -0.254  1.00 0.00 ? 35 ASP A HB2  1  
ATOM 563   H HB3  . ASP A 1 35 ? 13.855  0.669   -1.275  1.00 0.00 ? 35 ASP A HB3  1  
ATOM 564   N N    . LYS A 1 36 ? 11.524  1.126   -0.601  1.00 0.00 ? 36 LYS A N    1  
ATOM 565   C CA   . LYS A 1 36 ? 10.178  1.358   -1.111  1.00 0.00 ? 36 LYS A CA   1  
ATOM 566   C C    . LYS A 1 36 ? 9.224   1.731   0.019   1.00 0.00 ? 36 LYS A C    1  
ATOM 567   O O    . LYS A 1 36 ? 8.466   2.696   -0.088  1.00 0.00 ? 36 LYS A O    1  
ATOM 568   C CB   . LYS A 1 36 ? 9.664   0.113   -1.837  1.00 0.00 ? 36 LYS A CB   1  
ATOM 569   C CG   . LYS A 1 36 ? 8.226   0.236   -2.312  1.00 0.00 ? 36 LYS A CG   1  
ATOM 570   C CD   . LYS A 1 36 ? 8.085   1.290   -3.397  1.00 0.00 ? 36 LYS A CD   1  
ATOM 571   C CE   . LYS A 1 36 ? 8.427   0.728   -4.768  1.00 0.00 ? 36 LYS A CE   1  
ATOM 572   N NZ   . LYS A 1 36 ? 7.840   1.545   -5.865  1.00 0.00 ? 36 LYS A NZ   1  
ATOM 573   H H    . LYS A 1 36 ? 11.971  0.277   -0.801  1.00 0.00 ? 36 LYS A H    1  
ATOM 574   H HA   . LYS A 1 36 ? 10.225  2.179   -1.811  1.00 0.00 ? 36 LYS A HA   1  
ATOM 575   H HB2  . LYS A 1 36 ? 10.290  -0.072  -2.697  1.00 0.00 ? 36 LYS A HB2  1  
ATOM 576   H HB3  . LYS A 1 36 ? 9.728   -0.732  -1.166  1.00 0.00 ? 36 LYS A HB3  1  
ATOM 577   H HG2  . LYS A 1 36 ? 7.904   -0.717  -2.706  1.00 0.00 ? 36 LYS A HG2  1  
ATOM 578   H HG3  . LYS A 1 36 ? 7.602   0.509   -1.473  1.00 0.00 ? 36 LYS A HG3  1  
ATOM 579   H HD2  . LYS A 1 36 ? 7.066   1.646   -3.410  1.00 0.00 ? 36 LYS A HD2  1  
ATOM 580   H HD3  . LYS A 1 36 ? 8.753   2.111   -3.177  1.00 0.00 ? 36 LYS A HD3  1  
ATOM 581   H HE2  . LYS A 1 36 ? 9.501   0.711   -4.878  1.00 0.00 ? 36 LYS A HE2  1  
ATOM 582   H HE3  . LYS A 1 36 ? 8.043   -0.279  -4.836  1.00 0.00 ? 36 LYS A HE3  1  
ATOM 583   H HZ1  . LYS A 1 36 ? 8.508   2.289   -6.153  1.00 0.00 ? 36 LYS A HZ1  1  
ATOM 584   H HZ2  . LYS A 1 36 ? 6.958   1.993   -5.544  1.00 0.00 ? 36 LYS A HZ2  1  
ATOM 585   H HZ3  . LYS A 1 36 ? 7.631   0.944   -6.687  1.00 0.00 ? 36 LYS A HZ3  1  
ATOM 586   N N    . ARG A 1 37 ? 9.267   0.962   1.102   1.00 0.00 ? 37 ARG A N    1  
ATOM 587   C CA   . ARG A 1 37 ? 8.406   1.212   2.251   1.00 0.00 ? 37 ARG A CA   1  
ATOM 588   C C    . ARG A 1 37 ? 8.538   2.657   2.725   1.00 0.00 ? 37 ARG A C    1  
ATOM 589   O O    . ARG A 1 37 ? 7.556   3.281   3.127   1.00 0.00 ? 37 ARG A O    1  
ATOM 590   C CB   . ARG A 1 37 ? 8.754   0.256   3.394   1.00 0.00 ? 37 ARG A CB   1  
ATOM 591   C CG   . ARG A 1 37 ? 7.912   0.465   4.641   1.00 0.00 ? 37 ARG A CG   1  
ATOM 592   C CD   . ARG A 1 37 ? 7.594   -0.855  5.326   1.00 0.00 ? 37 ARG A CD   1  
ATOM 593   N NE   . ARG A 1 37 ? 8.199   -0.942  6.653   1.00 0.00 ? 37 ARG A NE   1  
ATOM 594   C CZ   . ARG A 1 37 ? 9.474   -1.250  6.860   1.00 0.00 ? 37 ARG A CZ   1  
ATOM 595   N NH1  . ARG A 1 37 ? 10.275  -1.499  5.833   1.00 0.00 ? 37 ARG A NH1  1  
ATOM 596   N NH2  . ARG A 1 37 ? 9.951   -1.310  8.097   1.00 0.00 ? 37 ARG A NH2  1  
ATOM 597   H H    . ARG A 1 37 ? 9.892   0.207   1.128   1.00 0.00 ? 37 ARG A H    1  
ATOM 598   H HA   . ARG A 1 37 ? 7.385   1.037   1.946   1.00 0.00 ? 37 ARG A HA   1  
ATOM 599   H HB2  . ARG A 1 37 ? 8.610   -0.759  3.055   1.00 0.00 ? 37 ARG A HB2  1  
ATOM 600   H HB3  . ARG A 1 37 ? 9.792   0.395   3.659   1.00 0.00 ? 37 ARG A HB3  1  
ATOM 601   H HG2  . ARG A 1 37 ? 8.455   1.094   5.331   1.00 0.00 ? 37 ARG A HG2  1  
ATOM 602   H HG3  . ARG A 1 37 ? 6.987   0.948   4.363   1.00 0.00 ? 37 ARG A HG3  1  
ATOM 603   H HD2  . ARG A 1 37 ? 6.522   -0.946  5.423   1.00 0.00 ? 37 ARG A HD2  1  
ATOM 604   H HD3  . ARG A 1 37 ? 7.970   -1.662  4.715   1.00 0.00 ? 37 ARG A HD3  1  
ATOM 605   H HE   . ARG A 1 37 ? 7.625   -0.763  7.426   1.00 0.00 ? 37 ARG A HE   1  
ATOM 606   H HH11 . ARG A 1 37 ? 9.919   -1.453  4.900   1.00 0.00 ? 37 ARG A HH11 1  
ATOM 607   H HH12 . ARG A 1 37 ? 11.235  -1.729  5.992   1.00 0.00 ? 37 ARG A HH12 1  
ATOM 608   H HH21 . ARG A 1 37 ? 9.350   -1.124  8.874   1.00 0.00 ? 37 ARG A HH21 1  
ATOM 609   H HH22 . ARG A 1 37 ? 10.911  -1.542  8.252   1.00 0.00 ? 37 ARG A HH22 1  
ATOM 610   N N    . ARG A 1 38 ? 9.758   3.182   2.675   1.00 0.00 ? 38 ARG A N    1  
ATOM 611   C CA   . ARG A 1 38 ? 10.018  4.552   3.100   1.00 0.00 ? 38 ARG A CA   1  
ATOM 612   C C    . ARG A 1 38 ? 9.384   5.550   2.136   1.00 0.00 ? 38 ARG A C    1  
ATOM 613   O O    . ARG A 1 38 ? 8.820   6.561   2.554   1.00 0.00 ? 38 ARG A O    1  
ATOM 614   C CB   . ARG A 1 38 ? 11.524  4.802   3.192   1.00 0.00 ? 38 ARG A CB   1  
ATOM 615   C CG   . ARG A 1 38 ? 12.146  4.309   4.489   1.00 0.00 ? 38 ARG A CG   1  
ATOM 616   C CD   . ARG A 1 38 ? 13.651  4.143   4.357   1.00 0.00 ? 38 ARG A CD   1  
ATOM 617   N NE   . ARG A 1 38 ? 14.348  5.426   4.375   1.00 0.00 ? 38 ARG A NE   1  
ATOM 618   C CZ   . ARG A 1 38 ? 15.617  5.579   4.012   1.00 0.00 ? 38 ARG A CZ   1  
ATOM 619   N NH1  . ARG A 1 38 ? 16.324  4.534   3.605   1.00 0.00 ? 38 ARG A NH1  1  
ATOM 620   N NH2  . ARG A 1 38 ? 16.180  6.780   4.056   1.00 0.00 ? 38 ARG A NH2  1  
ATOM 621   H H    . ARG A 1 38 ? 10.501  2.634   2.345   1.00 0.00 ? 38 ARG A H    1  
ATOM 622   H HA   . ARG A 1 38 ? 9.580   4.685   4.077   1.00 0.00 ? 38 ARG A HA   1  
ATOM 623   H HB2  . ARG A 1 38 ? 12.012  4.298   2.371   1.00 0.00 ? 38 ARG A HB2  1  
ATOM 624   H HB3  . ARG A 1 38 ? 11.706  5.863   3.111   1.00 0.00 ? 38 ARG A HB3  1  
ATOM 625   H HG2  . ARG A 1 38 ? 11.941  5.026   5.270   1.00 0.00 ? 38 ARG A HG2  1  
ATOM 626   H HG3  . ARG A 1 38 ? 11.708  3.357   4.747   1.00 0.00 ? 38 ARG A HG3  1  
ATOM 627   H HD2  . ARG A 1 38 ? 14.007  3.540   5.179   1.00 0.00 ? 38 ARG A HD2  1  
ATOM 628   H HD3  . ARG A 1 38 ? 13.864  3.641   3.425   1.00 0.00 ? 38 ARG A HD3  1  
ATOM 629   H HE   . ARG A 1 38 ? 13.844  6.212   4.672   1.00 0.00 ? 38 ARG A HE   1  
ATOM 630   H HH11 . ARG A 1 38 ? 15.901  3.629   3.571   1.00 0.00 ? 38 ARG A HH11 1  
ATOM 631   H HH12 . ARG A 1 38 ? 17.279  4.652   3.332   1.00 0.00 ? 38 ARG A HH12 1  
ATOM 632   H HH21 . ARG A 1 38 ? 15.650  7.570   4.362   1.00 0.00 ? 38 ARG A HH21 1  
ATOM 633   H HH22 . ARG A 1 38 ? 17.135  6.894   3.783   1.00 0.00 ? 38 ARG A HH22 1  
ATOM 634   N N    . LYS A 1 39 ? 9.480   5.259   0.843   1.00 0.00 ? 39 LYS A N    1  
ATOM 635   C CA   . LYS A 1 39 ? 8.915   6.130   -0.182  1.00 0.00 ? 39 LYS A CA   1  
ATOM 636   C C    . LYS A 1 39 ? 7.399   6.216   -0.046  1.00 0.00 ? 39 LYS A C    1  
ATOM 637   O O    . LYS A 1 39 ? 6.831   7.308   -0.010  1.00 0.00 ? 39 LYS A O    1  
ATOM 638   C CB   . LYS A 1 39 ? 9.285   5.617   -1.575  1.00 0.00 ? 39 LYS A CB   1  
ATOM 639   C CG   . LYS A 1 39 ? 10.779  5.628   -1.851  1.00 0.00 ? 39 LYS A CG   1  
ATOM 640   C CD   . LYS A 1 39 ? 11.288  7.036   -2.109  1.00 0.00 ? 39 LYS A CD   1  
ATOM 641   C CE   . LYS A 1 39 ? 11.082  7.446   -3.560  1.00 0.00 ? 39 LYS A CE   1  
ATOM 642   N NZ   . LYS A 1 39 ? 12.207  6.999   -4.427  1.00 0.00 ? 39 LYS A NZ   1  
ATOM 643   H H    . LYS A 1 39 ? 9.941   4.438   0.571   1.00 0.00 ? 39 LYS A H    1  
ATOM 644   H HA   . LYS A 1 39 ? 9.334   7.115   -0.047  1.00 0.00 ? 39 LYS A HA   1  
ATOM 645   H HB2  . LYS A 1 39 ? 8.928   4.603   -1.680  1.00 0.00 ? 39 LYS A HB2  1  
ATOM 646   H HB3  . LYS A 1 39 ? 8.800   6.239   -2.315  1.00 0.00 ? 39 LYS A HB3  1  
ATOM 647   H HG2  . LYS A 1 39 ? 11.297  5.222   -0.994  1.00 0.00 ? 39 LYS A HG2  1  
ATOM 648   H HG3  . LYS A 1 39 ? 10.980  5.017   -2.719  1.00 0.00 ? 39 LYS A HG3  1  
ATOM 649   H HD2  . LYS A 1 39 ? 10.754  7.726   -1.473  1.00 0.00 ? 39 LYS A HD2  1  
ATOM 650   H HD3  . LYS A 1 39 ? 12.344  7.076   -1.880  1.00 0.00 ? 39 LYS A HD3  1  
ATOM 651   H HE2  . LYS A 1 39 ? 10.165  7.003   -3.918  1.00 0.00 ? 39 LYS A HE2  1  
ATOM 652   H HE3  . LYS A 1 39 ? 11.006  8.522   -3.609  1.00 0.00 ? 39 LYS A HE3  1  
ATOM 653   H HZ1  . LYS A 1 39 ? 13.112  7.333   -4.038  1.00 0.00 ? 39 LYS A HZ1  1  
ATOM 654   H HZ2  . LYS A 1 39 ? 12.093  7.385   -5.386  1.00 0.00 ? 39 LYS A HZ2  1  
ATOM 655   H HZ3  . LYS A 1 39 ? 12.226  5.961   -4.482  1.00 0.00 ? 39 LYS A HZ3  1  
ATOM 656   N N    . ILE A 1 40 ? 6.749   5.060   0.029   1.00 0.00 ? 40 ILE A N    1  
ATOM 657   C CA   . ILE A 1 40 ? 5.298   5.006   0.163   1.00 0.00 ? 40 ILE A CA   1  
ATOM 658   C C    . ILE A 1 40 ? 4.826   5.822   1.362   1.00 0.00 ? 40 ILE A C    1  
ATOM 659   O O    . ILE A 1 40 ? 3.791   6.486   1.305   1.00 0.00 ? 40 ILE A O    1  
ATOM 660   C CB   . ILE A 1 40 ? 4.800   3.557   0.315   1.00 0.00 ? 40 ILE A CB   1  
ATOM 661   C CG1  . ILE A 1 40 ? 5.240   2.715   -0.885  1.00 0.00 ? 40 ILE A CG1  1  
ATOM 662   C CG2  . ILE A 1 40 ? 3.286   3.530   0.461   1.00 0.00 ? 40 ILE A CG2  1  
ATOM 663   C CD1  . ILE A 1 40 ? 5.013   1.231   -0.697  1.00 0.00 ? 40 ILE A CD1  1  
ATOM 664   H H    . ILE A 1 40 ? 7.257   4.223   -0.005  1.00 0.00 ? 40 ILE A H    1  
ATOM 665   H HA   . ILE A 1 40 ? 4.865   5.423   -0.735  1.00 0.00 ? 40 ILE A HA   1  
ATOM 666   H HB   . ILE A 1 40 ? 5.231   3.144   1.213   1.00 0.00 ? 40 ILE A HB   1  
ATOM 667   H HG12 . ILE A 1 40 ? 4.688   3.027   -1.757  1.00 0.00 ? 40 ILE A HG12 1  
ATOM 668   H HG13 . ILE A 1 40 ? 6.295   2.871   -1.056  1.00 0.00 ? 40 ILE A HG13 1  
ATOM 669   H HG21 . ILE A 1 40 ? 2.891   2.663   -0.047  1.00 0.00 ? 40 ILE A HG21 1  
ATOM 670   H HG22 . ILE A 1 40 ? 3.026   3.483   1.508   1.00 0.00 ? 40 ILE A HG22 1  
ATOM 671   H HG23 . ILE A 1 40 ? 2.866   4.424   0.025   1.00 0.00 ? 40 ILE A HG23 1  
ATOM 672   H HD11 . ILE A 1 40 ? 3.968   1.005   -0.850  1.00 0.00 ? 40 ILE A HD11 1  
ATOM 673   H HD12 . ILE A 1 40 ? 5.610   0.683   -1.410  1.00 0.00 ? 40 ILE A HD12 1  
ATOM 674   H HD13 . ILE A 1 40 ? 5.299   0.948   0.306   1.00 0.00 ? 40 ILE A HD13 1  
ATOM 675   N N    . SER A 1 41 ? 5.594   5.770   2.446   1.00 0.00 ? 41 SER A N    1  
ATOM 676   C CA   . SER A 1 41 ? 5.254   6.503   3.660   1.00 0.00 ? 41 SER A CA   1  
ATOM 677   C C    . SER A 1 41 ? 5.280   8.008   3.411   1.00 0.00 ? 41 SER A C    1  
ATOM 678   O O    . SER A 1 41 ? 4.623   8.776   4.113   1.00 0.00 ? 41 SER A O    1  
ATOM 679   C CB   . SER A 1 41 ? 6.225   6.144   4.786   1.00 0.00 ? 41 SER A CB   1  
ATOM 680   O OG   . SER A 1 41 ? 6.413   7.239   5.666   1.00 0.00 ? 41 SER A OG   1  
ATOM 681   H H    . SER A 1 41 ? 6.408   5.223   2.429   1.00 0.00 ? 41 SER A H    1  
ATOM 682   H HA   . SER A 1 41 ? 4.255   6.215   3.951   1.00 0.00 ? 41 SER A HA   1  
ATOM 683   H HB2  . SER A 1 41 ? 5.829   5.311   5.347   1.00 0.00 ? 41 SER A HB2  1  
ATOM 684   H HB3  . SER A 1 41 ? 7.180   5.870   4.361   1.00 0.00 ? 41 SER A HB3  1  
ATOM 685   H HG   . SER A 1 41 ? 5.564   7.516   6.018   1.00 0.00 ? 41 SER A HG   1  
ATOM 686   N N    . ALA A 1 42 ? 6.045   8.422   2.406   1.00 0.00 ? 42 ALA A N    1  
ATOM 687   C CA   . ALA A 1 42 ? 6.157   9.834   2.063   1.00 0.00 ? 42 ALA A CA   1  
ATOM 688   C C    . ALA A 1 42 ? 5.023   10.265  1.138   1.00 0.00 ? 42 ALA A C    1  
ATOM 689   O O    . ALA A 1 42 ? 4.653   11.438  1.100   1.00 0.00 ? 42 ALA A O    1  
ATOM 690   C CB   . ALA A 1 42 ? 7.505   10.115  1.415   1.00 0.00 ? 42 ALA A CB   1  
ATOM 691   H H    . ALA A 1 42 ? 6.546   7.762   1.883   1.00 0.00 ? 42 ALA A H    1  
ATOM 692   H HA   . ALA A 1 42 ? 6.099   10.406  2.978   1.00 0.00 ? 42 ALA A HA   1  
ATOM 693   H HB1  . ALA A 1 42 ? 7.969   9.181   1.133   1.00 0.00 ? 42 ALA A HB1  1  
ATOM 694   H HB2  . ALA A 1 42 ? 7.361   10.726  0.536   1.00 0.00 ? 42 ALA A HB2  1  
ATOM 695   H HB3  . ALA A 1 42 ? 8.139   10.635  2.116   1.00 0.00 ? 42 ALA A HB3  1  
ATOM 696   N N    . ALA A 1 43 ? 4.478   9.309   0.393   1.00 0.00 ? 43 ALA A N    1  
ATOM 697   C CA   . ALA A 1 43 ? 3.385   9.590   -0.530  1.00 0.00 ? 43 ALA A CA   1  
ATOM 698   C C    . ALA A 1 43 ? 2.032   9.427   0.154   1.00 0.00 ? 43 ALA A C    1  
ATOM 699   O O    . ALA A 1 43 ? 1.249   10.373  0.238   1.00 0.00 ? 43 ALA A O    1  
ATOM 700   C CB   . ALA A 1 43 ? 3.477   8.682   -1.748  1.00 0.00 ? 43 ALA A CB   1  
ATOM 701   H H    . ALA A 1 43 ? 4.817   8.393   0.468   1.00 0.00 ? 43 ALA A H    1  
ATOM 702   H HA   . ALA A 1 43 ? 3.487   10.613  -0.866  1.00 0.00 ? 43 ALA A HA   1  
ATOM 703   H HB1  . ALA A 1 43 ? 2.585   8.076   -1.811  1.00 0.00 ? 43 ALA A HB1  1  
ATOM 704   H HB2  . ALA A 1 43 ? 3.567   9.284   -2.639  1.00 0.00 ? 43 ALA A HB2  1  
ATOM 705   H HB3  . ALA A 1 43 ? 4.342   8.043   -1.655  1.00 0.00 ? 43 ALA A HB3  1  
ATOM 706   N N    . THR A 1 44 ? 1.762   8.220   0.641   1.00 0.00 ? 44 THR A N    1  
ATOM 707   C CA   . THR A 1 44 ? 0.503   7.932   1.316   1.00 0.00 ? 44 THR A CA   1  
ATOM 708   C C    . THR A 1 44 ? 0.470   8.555   2.707   1.00 0.00 ? 44 THR A C    1  
ATOM 709   O O    . THR A 1 44 ? -0.578  8.601   3.352   1.00 0.00 ? 44 THR A O    1  
ATOM 710   C CB   . THR A 1 44 ? 0.266   6.415   1.440   1.00 0.00 ? 44 THR A CB   1  
ATOM 711   O OG1  . THR A 1 44 ? 1.242   5.837   2.314   1.00 0.00 ? 44 THR A OG1  1  
ATOM 712   C CG2  . THR A 1 44 ? 0.337   5.743   0.077   1.00 0.00 ? 44 THR A CG2  1  
ATOM 713   H H    . THR A 1 44 ? 2.427   7.506   0.543   1.00 0.00 ? 44 THR A H    1  
ATOM 714   H HA   . THR A 1 44 ? -0.296  8.353   0.724   1.00 0.00 ? 44 THR A HA   1  
ATOM 715   H HB   . THR A 1 44 ? -0.718  6.252   1.854   1.00 0.00 ? 44 THR A HB   1  
ATOM 716   H HG1  . THR A 1 44 ? 2.108   5.883   1.902   1.00 0.00 ? 44 THR A HG1  1  
ATOM 717   H HG21 . THR A 1 44 ? 1.329   5.865   -0.333  1.00 0.00 ? 44 THR A HG21 1  
ATOM 718   H HG22 . THR A 1 44 ? -0.385  6.196   -0.585  1.00 0.00 ? 44 THR A HG22 1  
ATOM 719   H HG23 . THR A 1 44 ? 0.119   4.691   0.183   1.00 0.00 ? 44 THR A HG23 1  
ATOM 720   N N    . SER A 1 45 ? 1.622   9.036   3.163   1.00 0.00 ? 45 SER A N    1  
ATOM 721   C CA   . SER A 1 45 ? 1.725   9.655   4.479   1.00 0.00 ? 45 SER A CA   1  
ATOM 722   C C    . SER A 1 45 ? 1.412   8.646   5.580   1.00 0.00 ? 45 SER A C    1  
ATOM 723   O O    . SER A 1 45 ? 0.970   9.014   6.669   1.00 0.00 ? 45 SER A O    1  
ATOM 724   C CB   . SER A 1 45 ? 0.773   10.848  4.581   1.00 0.00 ? 45 SER A CB   1  
ATOM 725   O OG   . SER A 1 45 ? 0.837   11.652  3.415   1.00 0.00 ? 45 SER A OG   1  
ATOM 726   H H    . SER A 1 45 ? 2.423   8.971   2.601   1.00 0.00 ? 45 SER A H    1  
ATOM 727   H HA   . SER A 1 45 ? 2.739   10.003  4.604   1.00 0.00 ? 45 SER A HA   1  
ATOM 728   H HB2  . SER A 1 45 ? -0.238  10.490  4.701   1.00 0.00 ? 45 SER A HB2  1  
ATOM 729   H HB3  . SER A 1 45 ? 1.046   11.451  5.435   1.00 0.00 ? 45 SER A HB3  1  
ATOM 730   H HG   . SER A 1 45 ? 0.713   11.102  2.639   1.00 0.00 ? 45 SER A HG   1  
ATOM 731   N N    . LEU A 1 46 ? 1.644   7.371   5.287   1.00 0.00 ? 46 LEU A N    1  
ATOM 732   C CA   . LEU A 1 46 ? 1.387   6.306   6.251   1.00 0.00 ? 46 LEU A CA   1  
ATOM 733   C C    . LEU A 1 46 ? 2.671   5.898   6.966   1.00 0.00 ? 46 LEU A C    1  
ATOM 734   O O    . LEU A 1 46 ? 3.766   6.305   6.578   1.00 0.00 ? 46 LEU A O    1  
ATOM 735   C CB   . LEU A 1 46 ? 0.773   5.093   5.550   1.00 0.00 ? 46 LEU A CB   1  
ATOM 736   C CG   . LEU A 1 46 ? -0.643  5.280   5.003   1.00 0.00 ? 46 LEU A CG   1  
ATOM 737   C CD1  . LEU A 1 46 ? -0.933  4.259   3.914   1.00 0.00 ? 46 LEU A CD1  1  
ATOM 738   C CD2  . LEU A 1 46 ? -1.666  5.173   6.124   1.00 0.00 ? 46 LEU A CD2  1  
ATOM 739   H H    . LEU A 1 46 ? 1.996   7.139   4.403   1.00 0.00 ? 46 LEU A H    1  
ATOM 740   H HA   . LEU A 1 46 ? 0.687   6.682   6.982   1.00 0.00 ? 46 LEU A HA   1  
ATOM 741   H HB2  . LEU A 1 46 ? 1.414   4.830   4.723   1.00 0.00 ? 46 LEU A HB2  1  
ATOM 742   H HB3  . LEU A 1 46 ? 0.750   4.278   6.259   1.00 0.00 ? 46 LEU A HB3  1  
ATOM 743   H HG   . LEU A 1 46 ? -0.726  6.266   4.566   1.00 0.00 ? 46 LEU A HG   1  
ATOM 744   H HD11 . LEU A 1 46 ? -1.420  3.399   4.348   1.00 0.00 ? 46 LEU A HD11 1  
ATOM 745   H HD12 . LEU A 1 46 ? -0.007  3.953   3.451   1.00 0.00 ? 46 LEU A HD12 1  
ATOM 746   H HD13 . LEU A 1 46 ? -1.579  4.701   3.169   1.00 0.00 ? 46 LEU A HD13 1  
ATOM 747   H HD21 . LEU A 1 46 ? -1.633  6.068   6.728   1.00 0.00 ? 46 LEU A HD21 1  
ATOM 748   H HD22 . LEU A 1 46 ? -1.437  4.315   6.739   1.00 0.00 ? 46 LEU A HD22 1  
ATOM 749   H HD23 . LEU A 1 46 ? -2.653  5.060   5.700   1.00 0.00 ? 46 LEU A HD23 1  
ATOM 750   N N    . SER A 1 47 ? 2.529   5.089   8.011   1.00 0.00 ? 47 SER A N    1  
ATOM 751   C CA   . SER A 1 47 ? 3.678   4.627   8.782   1.00 0.00 ? 47 SER A CA   1  
ATOM 752   C C    . SER A 1 47 ? 4.280   3.371   8.158   1.00 0.00 ? 47 SER A C    1  
ATOM 753   O O    . SER A 1 47 ? 3.572   2.561   7.561   1.00 0.00 ? 47 SER A O    1  
ATOM 754   C CB   . SER A 1 47 ? 3.268   4.345   10.229  1.00 0.00 ? 47 SER A CB   1  
ATOM 755   O OG   . SER A 1 47 ? 3.445   5.492   11.041  1.00 0.00 ? 47 SER A OG   1  
ATOM 756   H H    . SER A 1 47 ? 1.630   4.799   8.272   1.00 0.00 ? 47 SER A H    1  
ATOM 757   H HA   . SER A 1 47 ? 4.420   5.411   8.773   1.00 0.00 ? 47 SER A HA   1  
ATOM 758   H HB2  . SER A 1 47 ? 2.228   4.057   10.256  1.00 0.00 ? 47 SER A HB2  1  
ATOM 759   H HB3  . SER A 1 47 ? 3.875   3.542   10.622  1.00 0.00 ? 47 SER A HB3  1  
ATOM 760   H HG   . SER A 1 47 ? 3.282   5.263   11.959  1.00 0.00 ? 47 SER A HG   1  
ATOM 761   N N    . GLU A 1 48 ? 5.593   3.218   8.303   1.00 0.00 ? 48 GLU A N    1  
ATOM 762   C CA   . GLU A 1 48 ? 6.291   2.062   7.753   1.00 0.00 ? 48 GLU A CA   1  
ATOM 763   C C    . GLU A 1 48 ? 5.622   0.762   8.193   1.00 0.00 ? 48 GLU A C    1  
ATOM 764   O O    . GLU A 1 48 ? 5.636   -0.232  7.467   1.00 0.00 ? 48 GLU A O    1  
ATOM 765   C CB   . GLU A 1 48 ? 7.757   2.067   8.191   1.00 0.00 ? 48 GLU A CB   1  
ATOM 766   C CG   . GLU A 1 48 ? 8.461   3.391   7.942   1.00 0.00 ? 48 GLU A CG   1  
ATOM 767   C CD   . GLU A 1 48 ? 9.963   3.297   8.130   1.00 0.00 ? 48 GLU A CD   1  
ATOM 768   O OE1  . GLU A 1 48 ? 10.614  2.565   7.356   1.00 0.00 ? 48 GLU A OE1  1  
ATOM 769   O OE2  . GLU A 1 48 ? 10.487  3.956   9.053   1.00 0.00 ? 48 GLU A OE2  1  
ATOM 770   H H    . GLU A 1 48 ? 6.103   3.898   8.790   1.00 0.00 ? 48 GLU A H    1  
ATOM 771   H HA   . GLU A 1 48 ? 6.246   2.128   6.676   1.00 0.00 ? 48 GLU A HA   1  
ATOM 772   H HB2  . GLU A 1 48 ? 7.805   1.850   9.248   1.00 0.00 ? 48 GLU A HB2  1  
ATOM 773   H HB3  . GLU A 1 48 ? 8.284   1.296   7.650   1.00 0.00 ? 48 GLU A HB3  1  
ATOM 774   H HG2  . GLU A 1 48 ? 8.260   3.706   6.929   1.00 0.00 ? 48 GLU A HG2  1  
ATOM 775   H HG3  . GLU A 1 48 ? 8.072   4.126   8.630   1.00 0.00 ? 48 GLU A HG3  1  
ATOM 776   N N    . ARG A 1 49 ? 5.039   0.779   9.387   1.00 0.00 ? 49 ARG A N    1  
ATOM 777   C CA   . ARG A 1 49 ? 4.367   -0.397  9.926   1.00 0.00 ? 49 ARG A CA   1  
ATOM 778   C C    . ARG A 1 49 ? 2.996   -0.583  9.281   1.00 0.00 ? 49 ARG A C    1  
ATOM 779   O O    . ARG A 1 49 ? 2.650   -1.680  8.843   1.00 0.00 ? 49 ARG A O    1  
ATOM 780   C CB   . ARG A 1 49 ? 4.216   -0.275  11.443  1.00 0.00 ? 49 ARG A CB   1  
ATOM 781   C CG   . ARG A 1 49 ? 3.658   -1.526  12.102  1.00 0.00 ? 49 ARG A CG   1  
ATOM 782   C CD   . ARG A 1 49 ? 4.672   -2.659  12.094  1.00 0.00 ? 49 ARG A CD   1  
ATOM 783   N NE   . ARG A 1 49 ? 5.866   -2.332  12.870  1.00 0.00 ? 49 ARG A NE   1  
ATOM 784   C CZ   . ARG A 1 49 ? 6.931   -3.120  12.947  1.00 0.00 ? 49 ARG A CZ   1  
ATOM 785   N NH1  . ARG A 1 49 ? 6.953   -4.277  12.299  1.00 0.00 ? 49 ARG A NH1  1  
ATOM 786   N NH2  . ARG A 1 49 ? 7.979   -2.753  13.674  1.00 0.00 ? 49 ARG A NH2  1  
ATOM 787   H H    . ARG A 1 49 ? 5.061   1.602   9.919   1.00 0.00 ? 49 ARG A H    1  
ATOM 788   H HA   . ARG A 1 49 ? 4.976   -1.260  9.701   1.00 0.00 ? 49 ARG A HA   1  
ATOM 789   H HB2  . ARG A 1 49 ? 5.185   -0.069  11.874  1.00 0.00 ? 49 ARG A HB2  1  
ATOM 790   H HB3  . ARG A 1 49 ? 3.552   0.547   11.661  1.00 0.00 ? 49 ARG A HB3  1  
ATOM 791   H HG2  . ARG A 1 49 ? 3.399   -1.297  13.126  1.00 0.00 ? 49 ARG A HG2  1  
ATOM 792   H HG3  . ARG A 1 49 ? 2.775   -1.840  11.567  1.00 0.00 ? 49 ARG A HG3  1  
ATOM 793   H HD2  . ARG A 1 49 ? 4.211   -3.540  12.516  1.00 0.00 ? 49 ARG A HD2  1  
ATOM 794   H HD3  . ARG A 1 49 ? 4.961   -2.858  11.073  1.00 0.00 ? 49 ARG A HD3  1  
ATOM 795   H HE   . ARG A 1 49 ? 5.871   -1.482  13.357  1.00 0.00 ? 49 ARG A HE   1  
ATOM 796   H HH11 . ARG A 1 49 ? 6.165   -4.556  11.750  1.00 0.00 ? 49 ARG A HH11 1  
ATOM 797   H HH12 . ARG A 1 49 ? 7.757   -4.868  12.358  1.00 0.00 ? 49 ARG A HH12 1  
ATOM 798   H HH21 . ARG A 1 49 ? 7.967   -1.882  14.164  1.00 0.00 ? 49 ARG A HH21 1  
ATOM 799   H HH22 . ARG A 1 49 ? 8.781   -3.347  13.731  1.00 0.00 ? 49 ARG A HH22 1  
ATOM 800   N N    . GLN A 1 50 ? 2.222   0.496   9.228   1.00 0.00 ? 50 GLN A N    1  
ATOM 801   C CA   . GLN A 1 50 ? 0.889   0.451   8.638   1.00 0.00 ? 50 GLN A CA   1  
ATOM 802   C C    . GLN A 1 50 ? 0.934   -0.146  7.236   1.00 0.00 ? 50 GLN A C    1  
ATOM 803   O O    . GLN A 1 50 ? 0.184   -1.070  6.920   1.00 0.00 ? 50 GLN A O    1  
ATOM 804   C CB   . GLN A 1 50 ? 0.282   1.854   8.588   1.00 0.00 ? 50 GLN A CB   1  
ATOM 805   C CG   . GLN A 1 50 ? -0.199  2.357   9.940   1.00 0.00 ? 50 GLN A CG   1  
ATOM 806   C CD   . GLN A 1 50 ? -1.403  3.272   9.827   1.00 0.00 ? 50 GLN A CD   1  
ATOM 807   O OE1  . GLN A 1 50 ? -1.298  4.482   10.028  1.00 0.00 ? 50 GLN A OE1  1  
ATOM 808   N NE2  . GLN A 1 50 ? -2.555  2.697   9.503   1.00 0.00 ? 50 GLN A NE2  1  
ATOM 809   H H    . GLN A 1 50 ? 2.554   1.341   9.594   1.00 0.00 ? 50 GLN A H    1  
ATOM 810   H HA   . GLN A 1 50 ? 0.271   -0.176  9.263   1.00 0.00 ? 50 GLN A HA   1  
ATOM 811   H HB2  . GLN A 1 50 ? 1.027   2.542   8.217   1.00 0.00 ? 50 GLN A HB2  1  
ATOM 812   H HB3  . GLN A 1 50 ? -0.559  1.846   7.911   1.00 0.00 ? 50 GLN A HB3  1  
ATOM 813   H HG2  . GLN A 1 50 ? -0.468  1.508   10.551  1.00 0.00 ? 50 GLN A HG2  1  
ATOM 814   H HG3  . GLN A 1 50 ? 0.605   2.900   10.414  1.00 0.00 ? 50 GLN A HG3  1  
ATOM 815   H HE21 . GLN A 1 50 ? -2.564  1.727   9.358   1.00 0.00 ? 50 GLN A HE21 1  
ATOM 816   H HE22 . GLN A 1 50 ? -3.349  3.265   9.424   1.00 0.00 ? 50 GLN A HE22 1  
ATOM 817   N N    . ILE A 1 51 ? 1.818   0.387   6.399   1.00 0.00 ? 51 ILE A N    1  
ATOM 818   C CA   . ILE A 1 51 ? 1.961   -0.094  5.030   1.00 0.00 ? 51 ILE A CA   1  
ATOM 819   C C    . ILE A 1 51 ? 2.244   -1.592  5.001   1.00 0.00 ? 51 ILE A C    1  
ATOM 820   O O    . ILE A 1 51 ? 1.668   -2.329  4.200   1.00 0.00 ? 51 ILE A O    1  
ATOM 821   C CB   . ILE A 1 51 ? 3.090   0.645   4.289   1.00 0.00 ? 51 ILE A CB   1  
ATOM 822   C CG1  . ILE A 1 51 ? 2.826   2.152   4.285   1.00 0.00 ? 51 ILE A CG1  1  
ATOM 823   C CG2  . ILE A 1 51 ? 3.221   0.121   2.867   1.00 0.00 ? 51 ILE A CG2  1  
ATOM 824   C CD1  . ILE A 1 51 ? 4.045   2.978   3.939   1.00 0.00 ? 51 ILE A CD1  1  
ATOM 825   H H    . ILE A 1 51 ? 2.387   1.121   6.709   1.00 0.00 ? 51 ILE A H    1  
ATOM 826   H HA   . ILE A 1 51 ? 1.032   0.096   4.512   1.00 0.00 ? 51 ILE A HA   1  
ATOM 827   H HB   . ILE A 1 51 ? 4.017   0.451   4.806   1.00 0.00 ? 51 ILE A HB   1  
ATOM 828   H HG12 . ILE A 1 51 ? 2.059   2.375   3.561   1.00 0.00 ? 51 ILE A HG12 1  
ATOM 829   H HG13 . ILE A 1 51 ? 2.488   2.454   5.266   1.00 0.00 ? 51 ILE A HG13 1  
ATOM 830   H HG21 . ILE A 1 51 ? 4.140   -0.440  2.773   1.00 0.00 ? 51 ILE A HG21 1  
ATOM 831   H HG22 . ILE A 1 51 ? 2.384   -0.522  2.642   1.00 0.00 ? 51 ILE A HG22 1  
ATOM 832   H HG23 . ILE A 1 51 ? 3.234   0.951   2.176   1.00 0.00 ? 51 ILE A HG23 1  
ATOM 833   H HD11 . ILE A 1 51 ? 3.733   3.926   3.526   1.00 0.00 ? 51 ILE A HD11 1  
ATOM 834   H HD12 . ILE A 1 51 ? 4.631   3.148   4.829   1.00 0.00 ? 51 ILE A HD12 1  
ATOM 835   H HD13 . ILE A 1 51 ? 4.643   2.449   3.210   1.00 0.00 ? 51 ILE A HD13 1  
ATOM 836   N N    . THR A 1 52 ? 3.134   -2.038  5.882   1.00 0.00 ? 52 THR A N    1  
ATOM 837   C CA   . THR A 1 52 ? 3.494   -3.448  5.958   1.00 0.00 ? 52 THR A CA   1  
ATOM 838   C C    . THR A 1 52 ? 2.282   -4.307  6.299   1.00 0.00 ? 52 THR A C    1  
ATOM 839   O O    . THR A 1 52 ? 1.991   -5.287  5.612   1.00 0.00 ? 52 THR A O    1  
ATOM 840   C CB   . THR A 1 52 ? 4.593   -3.691  7.010   1.00 0.00 ? 52 THR A CB   1  
ATOM 841   O OG1  . THR A 1 52 ? 5.765   -2.938  6.677   1.00 0.00 ? 52 THR A OG1  1  
ATOM 842   C CG2  . THR A 1 52 ? 4.942   -5.170  7.096   1.00 0.00 ? 52 THR A CG2  1  
ATOM 843   H H    . THR A 1 52 ? 3.559   -1.401  6.494   1.00 0.00 ? 52 THR A H    1  
ATOM 844   H HA   . THR A 1 52 ? 3.876   -3.748  4.993   1.00 0.00 ? 52 THR A HA   1  
ATOM 845   H HB   . THR A 1 52 ? 4.227   -3.366  7.973   1.00 0.00 ? 52 THR A HB   1  
ATOM 846   H HG1  . THR A 1 52 ? 6.499   -3.232  7.222   1.00 0.00 ? 52 THR A HG1  1  
ATOM 847   H HG21 . THR A 1 52 ? 4.419   -5.615  7.929   1.00 0.00 ? 52 THR A HG21 1  
ATOM 848   H HG22 . THR A 1 52 ? 6.006   -5.280  7.238   1.00 0.00 ? 52 THR A HG22 1  
ATOM 849   H HG23 . THR A 1 52 ? 4.647   -5.662  6.182   1.00 0.00 ? 52 THR A HG23 1  
ATOM 850   N N    . ILE A 1 53 ? 1.578   -3.933  7.362   1.00 0.00 ? 53 ILE A N    1  
ATOM 851   C CA   . ILE A 1 53 ? 0.395   -4.670  7.792   1.00 0.00 ? 53 ILE A CA   1  
ATOM 852   C C    . ILE A 1 53 ? -0.581  -4.865  6.637   1.00 0.00 ? 53 ILE A C    1  
ATOM 853   O O    . ILE A 1 53 ? -1.199  -5.922  6.505   1.00 0.00 ? 53 ILE A O    1  
ATOM 854   C CB   . ILE A 1 53 ? -0.329  -3.948  8.944   1.00 0.00 ? 53 ILE A CB   1  
ATOM 855   C CG1  . ILE A 1 53 ? 0.613   -3.773  10.137  1.00 0.00 ? 53 ILE A CG1  1  
ATOM 856   C CG2  . ILE A 1 53 ? -1.573  -4.722  9.354   1.00 0.00 ? 53 ILE A CG2  1  
ATOM 857   C CD1  . ILE A 1 53 ? 0.175   -2.691  11.100  1.00 0.00 ? 53 ILE A CD1  1  
ATOM 858   H H    . ILE A 1 53 ? 1.860   -3.144  7.869   1.00 0.00 ? 53 ILE A H    1  
ATOM 859   H HA   . ILE A 1 53 ? 0.717   -5.639  8.146   1.00 0.00 ? 53 ILE A HA   1  
ATOM 860   H HB   . ILE A 1 53 ? -0.638  -2.976  8.593   1.00 0.00 ? 53 ILE A HB   1  
ATOM 861   H HG12 . ILE A 1 53 ? 0.667   -4.701  10.685  1.00 0.00 ? 53 ILE A HG12 1  
ATOM 862   H HG13 . ILE A 1 53 ? 1.598   -3.516  9.774   1.00 0.00 ? 53 ILE A HG13 1  
ATOM 863   H HG21 . ILE A 1 53 ? -2.005  -4.268  10.234  1.00 0.00 ? 53 ILE A HG21 1  
ATOM 864   H HG22 . ILE A 1 53 ? -2.292  -4.699  8.549   1.00 0.00 ? 53 ILE A HG22 1  
ATOM 865   H HG23 . ILE A 1 53 ? -1.307  -5.745  9.571   1.00 0.00 ? 53 ILE A HG23 1  
ATOM 866   H HD11 . ILE A 1 53 ? 0.480   -2.955  12.102  1.00 0.00 ? 53 ILE A HD11 1  
ATOM 867   H HD12 . ILE A 1 53 ? 0.629   -1.753  10.819  1.00 0.00 ? 53 ILE A HD12 1  
ATOM 868   H HD13 . ILE A 1 53 ? -0.901  -2.594  11.066  1.00 0.00 ? 53 ILE A HD13 1  
ATOM 869   N N    . TRP A 1 54 ? -0.712  -3.841  5.802   1.00 0.00 ? 54 TRP A N    1  
ATOM 870   C CA   . TRP A 1 54 ? -1.612  -3.901  4.655   1.00 0.00 ? 54 TRP A CA   1  
ATOM 871   C C    . TRP A 1 54 ? -1.097  -4.885  3.610   1.00 0.00 ? 54 TRP A C    1  
ATOM 872   O O    . TRP A 1 54 ? -1.857  -5.693  3.076   1.00 0.00 ? 54 TRP A O    1  
ATOM 873   C CB   . TRP A 1 54 ? -1.772  -2.513  4.033   1.00 0.00 ? 54 TRP A CB   1  
ATOM 874   C CG   . TRP A 1 54 ? -2.827  -2.456  2.970   1.00 0.00 ? 54 TRP A CG   1  
ATOM 875   C CD1  . TRP A 1 54 ? -4.151  -2.173  3.145   1.00 0.00 ? 54 TRP A CD1  1  
ATOM 876   C CD2  . TRP A 1 54 ? -2.646  -2.691  1.569   1.00 0.00 ? 54 TRP A CD2  1  
ATOM 877   N NE1  . TRP A 1 54 ? -4.805  -2.217  1.937   1.00 0.00 ? 54 TRP A NE1  1  
ATOM 878   C CE2  . TRP A 1 54 ? -3.904  -2.532  0.955   1.00 0.00 ? 54 TRP A CE2  1  
ATOM 879   C CE3  . TRP A 1 54 ? -1.545  -3.017  0.774   1.00 0.00 ? 54 TRP A CE3  1  
ATOM 880   C CZ2  . TRP A 1 54 ? -4.087  -2.690  -0.416  1.00 0.00 ? 54 TRP A CZ2  1  
ATOM 881   C CZ3  . TRP A 1 54 ? -1.728  -3.174  -0.586  1.00 0.00 ? 54 TRP A CZ3  1  
ATOM 882   C CH2  . TRP A 1 54 ? -2.991  -3.010  -1.171  1.00 0.00 ? 54 TRP A CH2  1  
ATOM 883   H H    . TRP A 1 54 ? -0.193  -3.025  5.959   1.00 0.00 ? 54 TRP A H    1  
ATOM 884   H HA   . TRP A 1 54 ? -2.575  -4.240  5.008   1.00 0.00 ? 54 TRP A HA   1  
ATOM 885   H HB2  . TRP A 1 54 ? -2.038  -1.807  4.805   1.00 0.00 ? 54 TRP A HB2  1  
ATOM 886   H HB3  . TRP A 1 54 ? -0.833  -2.217  3.587   1.00 0.00 ? 54 TRP A HB3  1  
ATOM 887   H HD1  . TRP A 1 54 ? -4.605  -1.951  4.099   1.00 0.00 ? 54 TRP A HD1  1  
ATOM 888   H HE1  . TRP A 1 54 ? -5.761  -2.049  1.801   1.00 0.00 ? 54 TRP A HE1  1  
ATOM 889   H HE3  . TRP A 1 54 ? -0.563  -3.148  1.206   1.00 0.00 ? 54 TRP A HE3  1  
ATOM 890   H HZ2  . TRP A 1 54 ? -5.054  -2.566  -0.882  1.00 0.00 ? 54 TRP A HZ2  1  
ATOM 891   H HZ3  . TRP A 1 54 ? -0.888  -3.427  -1.217  1.00 0.00 ? 54 TRP A HZ3  1  
ATOM 892   H HH2  . TRP A 1 54 ? -3.088  -3.142  -2.237  1.00 0.00 ? 54 TRP A HH2  1  
ATOM 893   N N    . PHE A 1 55 ? 0.198   -4.811  3.321   1.00 0.00 ? 55 PHE A N    1  
ATOM 894   C CA   . PHE A 1 55 ? 0.814   -5.695  2.339   1.00 0.00 ? 55 PHE A CA   1  
ATOM 895   C C    . PHE A 1 55 ? 0.719   -7.151  2.783   1.00 0.00 ? 55 PHE A C    1  
ATOM 896   O O    . PHE A 1 55 ? 0.590   -8.055  1.957   1.00 0.00 ? 55 PHE A O    1  
ATOM 897   C CB   . PHE A 1 55 ? 2.279   -5.310  2.123   1.00 0.00 ? 55 PHE A CB   1  
ATOM 898   C CG   . PHE A 1 55 ? 2.491   -4.389  0.955   1.00 0.00 ? 55 PHE A CG   1  
ATOM 899   C CD1  . PHE A 1 55 ? 2.045   -3.078  0.999   1.00 0.00 ? 55 PHE A CD1  1  
ATOM 900   C CD2  . PHE A 1 55 ? 3.137   -4.835  -0.187  1.00 0.00 ? 55 PHE A CD2  1  
ATOM 901   C CE1  . PHE A 1 55 ? 2.238   -2.230  -0.075  1.00 0.00 ? 55 PHE A CE1  1  
ATOM 902   C CE2  . PHE A 1 55 ? 3.334   -3.991  -1.264  1.00 0.00 ? 55 PHE A CE2  1  
ATOM 903   C CZ   . PHE A 1 55 ? 2.884   -2.686  -1.207  1.00 0.00 ? 55 PHE A CZ   1  
ATOM 904   H H    . PHE A 1 55 ? 0.752   -4.145  3.780   1.00 0.00 ? 55 PHE A H    1  
ATOM 905   H HA   . PHE A 1 55 ? 0.279   -5.579  1.409   1.00 0.00 ? 55 PHE A HA   1  
ATOM 906   H HB2  . PHE A 1 55 ? 2.647   -4.812  3.007   1.00 0.00 ? 55 PHE A HB2  1  
ATOM 907   H HB3  . PHE A 1 55 ? 2.857   -6.205  1.951   1.00 0.00 ? 55 PHE A HB3  1  
ATOM 908   H HD1  . PHE A 1 55 ? 1.540   -2.720  1.884   1.00 0.00 ? 55 PHE A HD1  1  
ATOM 909   H HD2  . PHE A 1 55 ? 3.489   -5.856  -0.232  1.00 0.00 ? 55 PHE A HD2  1  
ATOM 910   H HE1  . PHE A 1 55 ? 1.886   -1.210  -0.028  1.00 0.00 ? 55 PHE A HE1  1  
ATOM 911   H HE2  . PHE A 1 55 ? 3.839   -4.351  -2.147  1.00 0.00 ? 55 PHE A HE2  1  
ATOM 912   H HZ   . PHE A 1 55 ? 3.036   -2.025  -2.047  1.00 0.00 ? 55 PHE A HZ   1  
ATOM 913   N N    . GLN A 1 56 ? 0.785   -7.370  4.092   1.00 0.00 ? 56 GLN A N    1  
ATOM 914   C CA   . GLN A 1 56 ? 0.708   -8.717  4.646   1.00 0.00 ? 56 GLN A CA   1  
ATOM 915   C C    . GLN A 1 56 ? -0.701  -9.284  4.505   1.00 0.00 ? 56 GLN A C    1  
ATOM 916   O O    . GLN A 1 56 ? -0.888  -10.388 3.995   1.00 0.00 ? 56 GLN A O    1  
ATOM 917   C CB   . GLN A 1 56 ? 1.123   -8.710  6.118   1.00 0.00 ? 56 GLN A CB   1  
ATOM 918   C CG   . GLN A 1 56 ? 2.626   -8.811  6.327   1.00 0.00 ? 56 GLN A CG   1  
ATOM 919   C CD   . GLN A 1 56 ? 3.168   -10.190 6.009   1.00 0.00 ? 56 GLN A CD   1  
ATOM 920   O OE1  . GLN A 1 56 ? 2.409   -11.145 5.840   1.00 0.00 ? 56 GLN A OE1  1  
ATOM 921   N NE2  . GLN A 1 56 ? 4.489   -10.302 5.926   1.00 0.00 ? 56 GLN A NE2  1  
ATOM 922   H H    . GLN A 1 56 ? 0.888   -6.609  4.699   1.00 0.00 ? 56 GLN A H    1  
ATOM 923   H HA   . GLN A 1 56 ? 1.391   -9.343  4.092   1.00 0.00 ? 56 GLN A HA   1  
ATOM 924   H HB2  . GLN A 1 56 ? 0.778   -7.794  6.573   1.00 0.00 ? 56 GLN A HB2  1  
ATOM 925   H HB3  . GLN A 1 56 ? 0.656   -9.548  6.615   1.00 0.00 ? 56 GLN A HB3  1  
ATOM 926   H HG2  . GLN A 1 56 ? 3.114   -8.092  5.685   1.00 0.00 ? 56 GLN A HG2  1  
ATOM 927   H HG3  . GLN A 1 56 ? 2.849   -8.581  7.358   1.00 0.00 ? 56 GLN A HG3  1  
ATOM 928   H HE21 . GLN A 1 56 ? 5.031   -9.499  6.074   1.00 0.00 ? 56 GLN A HE21 1  
ATOM 929   H HE22 . GLN A 1 56 ? 4.866   -11.183 5.723   1.00 0.00 ? 56 GLN A HE22 1  
ATOM 930   N N    . ASN A 1 57 ? -1.689  -8.520  4.961   1.00 0.00 ? 57 ASN A N    1  
ATOM 931   C CA   . ASN A 1 57 ? -3.081  -8.947  4.886   1.00 0.00 ? 57 ASN A CA   1  
ATOM 932   C C    . ASN A 1 57 ? -3.481  -9.249  3.446   1.00 0.00 ? 57 ASN A C    1  
ATOM 933   O O    . ASN A 1 57 ? -4.340  -10.095 3.193   1.00 0.00 ? 57 ASN A O    1  
ATOM 934   C CB   . ASN A 1 57 ? -3.999  -7.869  5.467   1.00 0.00 ? 57 ASN A CB   1  
ATOM 935   C CG   . ASN A 1 57 ? -4.248  -8.060  6.950   1.00 0.00 ? 57 ASN A CG   1  
ATOM 936   O OD1  . ASN A 1 57 ? -4.513  -9.171  7.409   1.00 0.00 ? 57 ASN A OD1  1  
ATOM 937   N ND2  . ASN A 1 57 ? -4.165  -6.973  7.709   1.00 0.00 ? 57 ASN A ND2  1  
ATOM 938   H H    . ASN A 1 57 ? -1.476  -7.649  5.357   1.00 0.00 ? 57 ASN A H    1  
ATOM 939   H HA   . ASN A 1 57 ? -3.183  -9.848  5.473   1.00 0.00 ? 57 ASN A HA   1  
ATOM 940   H HB2  . ASN A 1 57 ? -3.543  -6.900  5.320   1.00 0.00 ? 57 ASN A HB2  1  
ATOM 941   H HB3  . ASN A 1 57 ? -4.948  -7.897  4.954   1.00 0.00 ? 57 ASN A HB3  1  
ATOM 942   H HD21 . ASN A 1 57 ? -3.951  -6.121  7.275   1.00 0.00 ? 57 ASN A HD21 1  
ATOM 943   H HD22 . ASN A 1 57 ? -4.322  -7.068  8.672   1.00 0.00 ? 57 ASN A HD22 1  
ATOM 944   N N    . ARG A 1 58 ? -2.853  -8.553  2.504   1.00 0.00 ? 58 ARG A N    1  
ATOM 945   C CA   . ARG A 1 58 ? -3.143  -8.746  1.089   1.00 0.00 ? 58 ARG A CA   1  
ATOM 946   C C    . ARG A 1 58 ? -2.714  -10.137 0.630   1.00 0.00 ? 58 ARG A C    1  
ATOM 947   O O    . ARG A 1 58 ? -3.412  -10.789 -0.146  1.00 0.00 ? 58 ARG A O    1  
ATOM 948   C CB   . ARG A 1 58 ? -2.435  -7.680  0.251   1.00 0.00 ? 58 ARG A CB   1  
ATOM 949   C CG   . ARG A 1 58 ? -3.179  -7.314  -1.023  1.00 0.00 ? 58 ARG A CG   1  
ATOM 950   C CD   . ARG A 1 58 ? -4.527  -6.679  -0.719  1.00 0.00 ? 58 ARG A CD   1  
ATOM 951   N NE   . ARG A 1 58 ? -5.143  -6.103  -1.911  1.00 0.00 ? 58 ARG A NE   1  
ATOM 952   C CZ   . ARG A 1 58 ? -5.701  -6.829  -2.873  1.00 0.00 ? 58 ARG A CZ   1  
ATOM 953   N NH1  . ARG A 1 58 ? -5.722  -8.152  -2.783  1.00 0.00 ? 58 ARG A NH1  1  
ATOM 954   N NH2  . ARG A 1 58 ? -6.242  -6.232  -3.928  1.00 0.00 ? 58 ARG A NH2  1  
ATOM 955   H H    . ARG A 1 58 ? -2.178  -7.893  2.768   1.00 0.00 ? 58 ARG A H    1  
ATOM 956   H HA   . ARG A 1 58 ? -4.210  -8.649  0.953   1.00 0.00 ? 58 ARG A HA   1  
ATOM 957   H HB2  . ARG A 1 58 ? -2.324  -6.786  0.846   1.00 0.00 ? 58 ARG A HB2  1  
ATOM 958   H HB3  . ARG A 1 58 ? -1.456  -8.045  -0.022  1.00 0.00 ? 58 ARG A HB3  1  
ATOM 959   H HG2  . ARG A 1 58 ? -2.583  -6.612  -1.588  1.00 0.00 ? 58 ARG A HG2  1  
ATOM 960   H HG3  . ARG A 1 58 ? -3.336  -8.208  -1.607  1.00 0.00 ? 58 ARG A HG3  1  
ATOM 961   H HD2  . ARG A 1 58 ? -5.183  -7.435  -0.316  1.00 0.00 ? 58 ARG A HD2  1  
ATOM 962   H HD3  . ARG A 1 58 ? -4.384  -5.898  0.014   1.00 0.00 ? 58 ARG A HD3  1  
ATOM 963   H HE   . ARG A 1 58 ? -5.139  -5.127  -1.998  1.00 0.00 ? 58 ARG A HE   1  
ATOM 964   H HH11 . ARG A 1 58 ? -5.317  -8.604  -1.988  1.00 0.00 ? 58 ARG A HH11 1  
ATOM 965   H HH12 . ARG A 1 58 ? -6.145  -8.696  -3.508  1.00 0.00 ? 58 ARG A HH12 1  
ATOM 966   H HH21 . ARG A 1 58 ? -6.228  -5.235  -3.999  1.00 0.00 ? 58 ARG A HH21 1  
ATOM 967   H HH22 . ARG A 1 58 ? -6.662  -6.780  -4.651  1.00 0.00 ? 58 ARG A HH22 1  
ATOM 968   N N    . ARG A 1 59 ? -1.560  -10.584 1.115   1.00 0.00 ? 59 ARG A N    1  
ATOM 969   C CA   . ARG A 1 59 ? -1.036  -11.895 0.754   1.00 0.00 ? 59 ARG A CA   1  
ATOM 970   C C    . ARG A 1 59 ? -1.698  -12.992 1.582   1.00 0.00 ? 59 ARG A C    1  
ATOM 971   O O    . ARG A 1 59 ? -2.227  -13.962 1.039   1.00 0.00 ? 59 ARG A O    1  
ATOM 972   C CB   . ARG A 1 59 ? 0.480   -11.936 0.953   1.00 0.00 ? 59 ARG A CB   1  
ATOM 973   C CG   . ARG A 1 59 ? 1.269   -11.586 -0.298  1.00 0.00 ? 59 ARG A CG   1  
ATOM 974   C CD   . ARG A 1 59 ? 1.665   -12.833 -1.073  1.00 0.00 ? 59 ARG A CD   1  
ATOM 975   N NE   . ARG A 1 59 ? 2.607   -13.664 -0.328  1.00 0.00 ? 59 ARG A NE   1  
ATOM 976   C CZ   . ARG A 1 59 ? 3.054   -14.837 -0.762  1.00 0.00 ? 59 ARG A CZ   1  
ATOM 977   N NH1  . ARG A 1 59 ? 2.648   -15.314 -1.931  1.00 0.00 ? 59 ARG A NH1  1  
ATOM 978   N NH2  . ARG A 1 59 ? 3.910   -15.536 -0.027  1.00 0.00 ? 59 ARG A NH2  1  
ATOM 979   H H    . ARG A 1 59 ? -1.047  -10.017 1.729   1.00 0.00 ? 59 ARG A H    1  
ATOM 980   H HA   . ARG A 1 59 ? -1.257  -12.065 -0.289  1.00 0.00 ? 59 ARG A HA   1  
ATOM 981   H HB2  . ARG A 1 59 ? 0.748   -11.233 1.729   1.00 0.00 ? 59 ARG A HB2  1  
ATOM 982   H HB3  . ARG A 1 59 ? 0.764   -12.930 1.265   1.00 0.00 ? 59 ARG A HB3  1  
ATOM 983   H HG2  . ARG A 1 59 ? 0.660   -10.960 -0.933  1.00 0.00 ? 59 ARG A HG2  1  
ATOM 984   H HG3  . ARG A 1 59 ? 2.162   -11.051 -0.011  1.00 0.00 ? 59 ARG A HG3  1  
ATOM 985   H HD2  . ARG A 1 59 ? 0.776   -13.410 -1.280  1.00 0.00 ? 59 ARG A HD2  1  
ATOM 986   H HD3  . ARG A 1 59 ? 2.123   -12.531 -2.004  1.00 0.00 ? 59 ARG A HD3  1  
ATOM 987   H HE   . ARG A 1 59 ? 2.920   -13.331 0.538   1.00 0.00 ? 59 ARG A HE   1  
ATOM 988   H HH11 . ARG A 1 59 ? 2.004   -14.790 -2.488  1.00 0.00 ? 59 ARG A HH11 1  
ATOM 989   H HH12 . ARG A 1 59 ? 2.988   -16.197 -2.256  1.00 0.00 ? 59 ARG A HH12 1  
ATOM 990   H HH21 . ARG A 1 59 ? 4.218   -15.179 0.854   1.00 0.00 ? 59 ARG A HH21 1  
ATOM 991   H HH22 . ARG A 1 59 ? 4.246   -16.418 -0.354  1.00 0.00 ? 59 ARG A HH22 1  
ATOM 992   N N    . VAL A 1 60 ? -1.665  -12.832 2.902   1.00 0.00 ? 60 VAL A N    1  
ATOM 993   C CA   . VAL A 1 60 ? -2.263  -13.807 3.806   1.00 0.00 ? 60 VAL A CA   1  
ATOM 994   C C    . VAL A 1 60 ? -3.710  -14.095 3.425   1.00 0.00 ? 60 VAL A C    1  
ATOM 995   O O    . VAL A 1 60 ? -4.221  -15.190 3.662   1.00 0.00 ? 60 VAL A O    1  
ATOM 996   C CB   . VAL A 1 60 ? -2.214  -13.321 5.267   1.00 0.00 ? 60 VAL A CB   1  
ATOM 997   C CG1  . VAL A 1 60 ? -2.723  -14.404 6.206   1.00 0.00 ? 60 VAL A CG1  1  
ATOM 998   C CG2  . VAL A 1 60 ? -0.802  -12.900 5.641   1.00 0.00 ? 60 VAL A CG2  1  
ATOM 999   H H    . VAL A 1 60 ? -1.230  -12.037 3.275   1.00 0.00 ? 60 VAL A H    1  
ATOM 1000  H HA   . VAL A 1 60 ? -1.692  -14.722 3.734   1.00 0.00 ? 60 VAL A HA   1  
ATOM 1001  H HB   . VAL A 1 60 ? -2.861  -12.461 5.360   1.00 0.00 ? 60 VAL A HB   1  
ATOM 1002  H HG11 . VAL A 1 60 ? -2.230  -15.338 5.980   1.00 0.00 ? 60 VAL A HG11 1  
ATOM 1003  H HG12 . VAL A 1 60 ? -2.513  -14.122 7.228   1.00 0.00 ? 60 VAL A HG12 1  
ATOM 1004  H HG13 . VAL A 1 60 ? -3.789  -14.520 6.077   1.00 0.00 ? 60 VAL A HG13 1  
ATOM 1005  H HG21 . VAL A 1 60 ? -0.781  -11.836 5.825   1.00 0.00 ? 60 VAL A HG21 1  
ATOM 1006  H HG22 . VAL A 1 60 ? -0.493  -13.425 6.534   1.00 0.00 ? 60 VAL A HG22 1  
ATOM 1007  H HG23 . VAL A 1 60 ? -0.127  -13.139 4.832   1.00 0.00 ? 60 VAL A HG23 1  
ATOM 1008  N N    . LYS A 1 61 ? -4.369  -13.105 2.832   1.00 0.00 ? 61 LYS A N    1  
ATOM 1009  C CA   . LYS A 1 61 ? -5.758  -13.251 2.415   1.00 0.00 ? 61 LYS A CA   1  
ATOM 1010  C C    . LYS A 1 61 ? -5.939  -14.492 1.548   1.00 0.00 ? 61 LYS A C    1  
ATOM 1011  O O    . LYS A 1 61 ? -6.996  -15.122 1.564   1.00 0.00 ? 61 LYS A O    1  
ATOM 1012  C CB   . LYS A 1 61 ? -6.215  -12.008 1.647   1.00 0.00 ? 61 LYS A CB   1  
ATOM 1013  C CG   . LYS A 1 61 ? -7.614  -12.131 1.068   1.00 0.00 ? 61 LYS A CG   1  
ATOM 1014  C CD   . LYS A 1 61 ? -8.017  -10.875 0.314   1.00 0.00 ? 61 LYS A CD   1  
ATOM 1015  C CE   . LYS A 1 61 ? -9.512  -10.852 0.031   1.00 0.00 ? 61 LYS A CE   1  
ATOM 1016  N NZ   . LYS A 1 61 ? -9.910  -11.912 -0.936  1.00 0.00 ? 61 LYS A NZ   1  
ATOM 1017  H H    . LYS A 1 61 ? -3.908  -12.255 2.670   1.00 0.00 ? 61 LYS A H    1  
ATOM 1018  H HA   . LYS A 1 61 ? -6.362  -13.356 3.304   1.00 0.00 ? 61 LYS A HA   1  
ATOM 1019  H HB2  . LYS A 1 61 ? -6.198  -11.160 2.316   1.00 0.00 ? 61 LYS A HB2  1  
ATOM 1020  H HB3  . LYS A 1 61 ? -5.526  -11.829 0.835   1.00 0.00 ? 61 LYS A HB3  1  
ATOM 1021  H HG2  . LYS A 1 61 ? -7.639  -12.970 0.388   1.00 0.00 ? 61 LYS A HG2  1  
ATOM 1022  H HG3  . LYS A 1 61 ? -8.314  -12.297 1.874   1.00 0.00 ? 61 LYS A HG3  1  
ATOM 1023  H HD2  . LYS A 1 61 ? -7.762  -10.011 0.908   1.00 0.00 ? 61 LYS A HD2  1  
ATOM 1024  H HD3  . LYS A 1 61 ? -7.481  -10.841 -0.624  1.00 0.00 ? 61 LYS A HD3  1  
ATOM 1025  H HE2  . LYS A 1 61 ? -10.043 -11.004 0.958   1.00 0.00 ? 61 LYS A HE2  1  
ATOM 1026  H HE3  . LYS A 1 61 ? -9.772  -9.887  -0.379  1.00 0.00 ? 61 LYS A HE3  1  
ATOM 1027  H HZ1  . LYS A 1 61 ? -9.429  -12.805 -0.705  1.00 0.00 ? 61 LYS A HZ1  1  
ATOM 1028  H HZ2  . LYS A 1 61 ? -9.648  -11.630 -1.902  1.00 0.00 ? 61 LYS A HZ2  1  
ATOM 1029  H HZ3  . LYS A 1 61 ? -10.938 -12.064 -0.897  1.00 0.00 ? 61 LYS A HZ3  1  
ATOM 1030  N N    . GLU A 1 62 ? -4.900  -14.838 0.794   1.00 0.00 ? 62 GLU A N    1  
ATOM 1031  C CA   . GLU A 1 62 ? -4.946  -16.005 -0.079  1.00 0.00 ? 62 GLU A CA   1  
ATOM 1032  C C    . GLU A 1 62 ? -4.031  -17.110 0.442   1.00 0.00 ? 62 GLU A C    1  
ATOM 1033  O O    . GLU A 1 62 ? -3.518  -17.922 -0.328  1.00 0.00 ? 62 GLU A O    1  
ATOM 1034  C CB   . GLU A 1 62 ? -4.539  -15.621 -1.503  1.00 0.00 ? 62 GLU A CB   1  
ATOM 1035  C CG   . GLU A 1 62 ? -3.307  -14.734 -1.566  1.00 0.00 ? 62 GLU A CG   1  
ATOM 1036  C CD   . GLU A 1 62 ? -2.806  -14.531 -2.983  1.00 0.00 ? 62 GLU A CD   1  
ATOM 1037  O OE1  . GLU A 1 62 ? -2.653  -15.536 -3.708  1.00 0.00 ? 62 GLU A OE1  1  
ATOM 1038  O OE2  . GLU A 1 62 ? -2.568  -13.367 -3.366  1.00 0.00 ? 62 GLU A OE2  1  
ATOM 1039  H H    . GLU A 1 62 ? -4.085  -14.296 0.825   1.00 0.00 ? 62 GLU A H    1  
ATOM 1040  H HA   . GLU A 1 62 ? -5.961  -16.371 -0.090  1.00 0.00 ? 62 GLU A HA   1  
ATOM 1041  H HB2  . GLU A 1 62 ? -4.339  -16.523 -2.063  1.00 0.00 ? 62 GLU A HB2  1  
ATOM 1042  H HB3  . GLU A 1 62 ? -5.360  -15.095 -1.968  1.00 0.00 ? 62 GLU A HB3  1  
ATOM 1043  H HG2  . GLU A 1 62 ? -3.551  -13.770 -1.146  1.00 0.00 ? 62 GLU A HG2  1  
ATOM 1044  H HG3  . GLU A 1 62 ? -2.520  -15.191 -0.984  1.00 0.00 ? 62 GLU A HG3  1  
ATOM 1045  N N    . LYS A 1 63 ? -3.831  -17.134 1.755   1.00 0.00 ? 63 LYS A N    1  
ATOM 1046  C CA   . LYS A 1 63 ? -2.979  -18.138 2.382   1.00 0.00 ? 63 LYS A CA   1  
ATOM 1047  C C    . LYS A 1 63 ? -3.776  -18.993 3.362   1.00 0.00 ? 63 LYS A C    1  
ATOM 1048  O O    . LYS A 1 63 ? -3.623  -20.214 3.404   1.00 0.00 ? 63 LYS A O    1  
ATOM 1049  C CB   . LYS A 1 63 ? -1.812  -17.466 3.108   1.00 0.00 ? 63 LYS A CB   1  
ATOM 1050  C CG   . LYS A 1 63 ? -0.856  -16.738 2.179   1.00 0.00 ? 63 LYS A CG   1  
ATOM 1051  C CD   . LYS A 1 63 ? 0.255   -17.653 1.693   1.00 0.00 ? 63 LYS A CD   1  
ATOM 1052  C CE   . LYS A 1 63 ? -0.165  -18.431 0.455   1.00 0.00 ? 63 LYS A CE   1  
ATOM 1053  N NZ   . LYS A 1 63 ? 1.010   -18.890 -0.337  1.00 0.00 ? 63 LYS A NZ   1  
ATOM 1054  H H    . LYS A 1 63 ? -4.267  -16.460 2.318   1.00 0.00 ? 63 LYS A H    1  
ATOM 1055  H HA   . LYS A 1 63 ? -2.588  -18.775 1.602   1.00 0.00 ? 63 LYS A HA   1  
ATOM 1056  H HB2  . LYS A 1 63 ? -2.207  -16.752 3.816   1.00 0.00 ? 63 LYS A HB2  1  
ATOM 1057  H HB3  . LYS A 1 63 ? -1.254  -18.220 3.644   1.00 0.00 ? 63 LYS A HB3  1  
ATOM 1058  H HG2  . LYS A 1 63 ? -1.406  -16.373 1.325   1.00 0.00 ? 63 LYS A HG2  1  
ATOM 1059  H HG3  . LYS A 1 63 ? -0.417  -15.905 2.710   1.00 0.00 ? 63 LYS A HG3  1  
ATOM 1060  H HD2  . LYS A 1 63 ? 1.122   -17.056 1.452   1.00 0.00 ? 63 LYS A HD2  1  
ATOM 1061  H HD3  . LYS A 1 63 ? 0.504   -18.352 2.479   1.00 0.00 ? 63 LYS A HD3  1  
ATOM 1062  H HE2  . LYS A 1 63 ? -0.738  -19.292 0.764   1.00 0.00 ? 63 LYS A HE2  1  
ATOM 1063  H HE3  . LYS A 1 63 ? -0.779  -17.793 -0.164  1.00 0.00 ? 63 LYS A HE3  1  
ATOM 1064  H HZ1  . LYS A 1 63 ? 0.694   -19.468 -1.142  1.00 0.00 ? 63 LYS A HZ1  1  
ATOM 1065  H HZ2  . LYS A 1 63 ? 1.641   -19.462 0.259   1.00 0.00 ? 63 LYS A HZ2  1  
ATOM 1066  H HZ3  . LYS A 1 63 ? 1.540   -18.071 -0.698  1.00 0.00 ? 63 LYS A HZ3  1  
ATOM 1067  N N    . LYS A 1 64 ? -4.629  -18.345 4.147   1.00 0.00 ? 64 LYS A N    1  
ATOM 1068  C CA   . LYS A 1 64 ? -5.453  -19.045 5.125   1.00 0.00 ? 64 LYS A CA   1  
ATOM 1069  C C    . LYS A 1 64 ? -6.727  -19.581 4.479   1.00 0.00 ? 64 LYS A C    1  
ATOM 1070  O O    . LYS A 1 64 ? -7.060  -19.222 3.350   1.00 0.00 ? 64 LYS A O    1  
ATOM 1071  C CB   . LYS A 1 64 ? -5.810  -18.112 6.284   1.00 0.00 ? 64 LYS A CB   1  
ATOM 1072  C CG   . LYS A 1 64 ? -4.656  -17.858 7.238   1.00 0.00 ? 64 LYS A CG   1  
ATOM 1073  C CD   . LYS A 1 64 ? -4.527  -18.969 8.266   1.00 0.00 ? 64 LYS A CD   1  
ATOM 1074  C CE   . LYS A 1 64 ? -5.674  -18.940 9.265   1.00 0.00 ? 64 LYS A CE   1  
ATOM 1075  N NZ   . LYS A 1 64 ? -5.377  -19.756 10.475  1.00 0.00 ? 64 LYS A NZ   1  
ATOM 1076  H H    . LYS A 1 64 ? -4.707  -17.371 4.067   1.00 0.00 ? 64 LYS A H    1  
ATOM 1077  H HA   . LYS A 1 64 ? -4.881  -19.877 5.507   1.00 0.00 ? 64 LYS A HA   1  
ATOM 1078  H HB2  . LYS A 1 64 ? -6.132  -17.163 5.881   1.00 0.00 ? 64 LYS A HB2  1  
ATOM 1079  H HB3  . LYS A 1 64 ? -6.624  -18.549 6.845   1.00 0.00 ? 64 LYS A HB3  1  
ATOM 1080  H HG2  . LYS A 1 64 ? -3.738  -17.799 6.671   1.00 0.00 ? 64 LYS A HG2  1  
ATOM 1081  H HG3  . LYS A 1 64 ? -4.824  -16.922 7.752   1.00 0.00 ? 64 LYS A HG3  1  
ATOM 1082  H HD2  . LYS A 1 64 ? -4.532  -19.922 7.757   1.00 0.00 ? 64 LYS A HD2  1  
ATOM 1083  H HD3  . LYS A 1 64 ? -3.594  -18.849 8.799   1.00 0.00 ? 64 LYS A HD3  1  
ATOM 1084  H HE2  . LYS A 1 64 ? -5.848  -17.918 9.564   1.00 0.00 ? 64 LYS A HE2  1  
ATOM 1085  H HE3  . LYS A 1 64 ? -6.560  -19.331 8.786   1.00 0.00 ? 64 LYS A HE3  1  
ATOM 1086  H HZ1  . LYS A 1 64 ? -5.691  -19.253 11.330  1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 1087  H HZ2  . LYS A 1 64 ? -4.354  -19.931 10.545  1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 1088  H HZ3  . LYS A 1 64 ? -5.872  -20.669 10.421  1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 1089  N N    . SER A 1 65 ? -7.437  -20.439 5.204   1.00 0.00 ? 65 SER A N    1  
ATOM 1090  C CA   . SER A 1 65 ? -8.674  -21.026 4.701   1.00 0.00 ? 65 SER A CA   1  
ATOM 1091  C C    . SER A 1 65 ? -9.827  -20.033 4.804   1.00 0.00 ? 65 SER A C    1  
ATOM 1092  O O    . SER A 1 65 ? -10.455 -19.900 5.854   1.00 0.00 ? 65 SER A O    1  
ATOM 1093  C CB   . SER A 1 65 ? -9.012  -22.300 5.476   1.00 0.00 ? 65 SER A CB   1  
ATOM 1094  O OG   . SER A 1 65 ? -9.987  -23.069 4.794   1.00 0.00 ? 65 SER A OG   1  
ATOM 1095  H H    . SER A 1 65 ? -7.120  -20.686 6.098   1.00 0.00 ? 65 SER A H    1  
ATOM 1096  H HA   . SER A 1 65 ? -8.522  -21.277 3.661   1.00 0.00 ? 65 SER A HA   1  
ATOM 1097  H HB2  . SER A 1 65 ? -8.119  -22.895 5.593   1.00 0.00 ? 65 SER A HB2  1  
ATOM 1098  H HB3  . SER A 1 65 ? -9.396  -22.034 6.450   1.00 0.00 ? 65 SER A HB3  1  
ATOM 1099  H HG   . SER A 1 65 ? -9.933  -23.983 5.081   1.00 0.00 ? 65 SER A HG   1  
ATOM 1100  N N    . GLY A 1 66 ? -10.101 -19.337 3.705   1.00 0.00 ? 66 GLY A N    1  
ATOM 1101  C CA   . GLY A 1 66 ? -11.178 -18.364 3.691   1.00 0.00 ? 66 GLY A CA   1  
ATOM 1102  C C    . GLY A 1 66 ? -11.013 -17.331 2.595   1.00 0.00 ? 66 GLY A C    1  
ATOM 1103  O O    . GLY A 1 66 ? -10.697 -16.169 2.849   1.00 0.00 ? 66 GLY A O    1  
ATOM 1104  H H    . GLY A 1 66 ? -9.567  -19.485 2.896   1.00 0.00 ? 66 GLY A H    1  
ATOM 1105  H HA2  . GLY A 1 66 ? -12.114 -18.882 3.546   1.00 0.00 ? 66 GLY A HA2  1  
ATOM 1106  H HA3  . GLY A 1 66 ? -11.203 -17.858 4.646   1.00 0.00 ? 66 GLY A HA3  1  
ATOM 1107  N N    . PRO A 1 67 ? -11.230 -17.755 1.340   1.00 0.00 ? 67 PRO A N    1  
ATOM 1108  C CA   . PRO A 1 67 ? -11.108 -16.873 0.175   1.00 0.00 ? 67 PRO A CA   1  
ATOM 1109  C C    . PRO A 1 67 ? -12.218 -15.830 0.119   1.00 0.00 ? 67 PRO A C    1  
ATOM 1110  O O    . PRO A 1 67 ? -11.990 -14.687 -0.277  1.00 0.00 ? 67 PRO A O    1  
ATOM 1111  C CB   . PRO A 1 67 ? -11.217 -17.835 -1.010  1.00 0.00 ? 67 PRO A CB   1  
ATOM 1112  C CG   . PRO A 1 67 ? -11.990 -18.996 -0.486  1.00 0.00 ? 67 PRO A CG   1  
ATOM 1113  C CD   . PRO A 1 67 ? -11.610 -19.126 0.963   1.00 0.00 ? 67 PRO A CD   1  
ATOM 1114  H HA   . PRO A 1 67 ? -10.148 -16.377 0.152   1.00 0.00 ? 67 PRO A HA   1  
ATOM 1115  H HB2  . PRO A 1 67 ? -11.736 -17.349 -1.825  1.00 0.00 ? 67 PRO A HB2  1  
ATOM 1116  H HB3  . PRO A 1 67 ? -10.230 -18.131 -1.331  1.00 0.00 ? 67 PRO A HB3  1  
ATOM 1117  H HG2  . PRO A 1 67 ? -13.048 -18.805 -0.581  1.00 0.00 ? 67 PRO A HG2  1  
ATOM 1118  H HG3  . PRO A 1 67 ? -11.719 -19.891 -1.026  1.00 0.00 ? 67 PRO A HG3  1  
ATOM 1119  H HD2  . PRO A 1 67 ? -12.454 -19.466 1.545   1.00 0.00 ? 67 PRO A HD2  1  
ATOM 1120  H HD3  . PRO A 1 67 ? -10.775 -19.802 1.075   1.00 0.00 ? 67 PRO A HD3  1  
ATOM 1121  N N    . SER A 1 68 ? -13.421 -16.230 0.518   1.00 0.00 ? 68 SER A N    1  
ATOM 1122  C CA   . SER A 1 68 ? -14.568 -15.330 0.510   1.00 0.00 ? 68 SER A CA   1  
ATOM 1123  C C    . SER A 1 68 ? -15.144 -15.170 1.914   1.00 0.00 ? 68 SER A C    1  
ATOM 1124  O O    . SER A 1 68 ? -16.335 -15.384 2.137   1.00 0.00 ? 68 SER A O    1  
ATOM 1125  C CB   . SER A 1 68 ? -15.648 -15.855 -0.439  1.00 0.00 ? 68 SER A CB   1  
ATOM 1126  O OG   . SER A 1 68 ? -15.072 -16.421 -1.603  1.00 0.00 ? 68 SER A OG   1  
ATOM 1127  H H    . SER A 1 68 ? -13.540 -17.154 0.823   1.00 0.00 ? 68 SER A H    1  
ATOM 1128  H HA   . SER A 1 68 ? -14.231 -14.366 0.160   1.00 0.00 ? 68 SER A HA   1  
ATOM 1129  H HB2  . SER A 1 68 ? -16.230 -16.611 0.065   1.00 0.00 ? 68 SER A HB2  1  
ATOM 1130  H HB3  . SER A 1 68 ? -16.293 -15.039 -0.731  1.00 0.00 ? 68 SER A HB3  1  
ATOM 1131  H HG   . SER A 1 68 ? -15.539 -16.103 -2.379  1.00 0.00 ? 68 SER A HG   1  
ATOM 1132  N N    . SER A 1 69 ? -14.287 -14.793 2.858   1.00 0.00 ? 69 SER A N    1  
ATOM 1133  C CA   . SER A 1 69 ? -14.708 -14.608 4.242   1.00 0.00 ? 69 SER A CA   1  
ATOM 1134  C C    . SER A 1 69 ? -14.477 -13.168 4.691   1.00 0.00 ? 69 SER A C    1  
ATOM 1135  O O    . SER A 1 69 ? -13.363 -12.653 4.615   1.00 0.00 ? 69 SER A O    1  
ATOM 1136  C CB   . SER A 1 69 ? -13.951 -15.568 5.160   1.00 0.00 ? 69 SER A CB   1  
ATOM 1137  O OG   . SER A 1 69 ? -12.600 -15.168 5.315   1.00 0.00 ? 69 SER A OG   1  
ATOM 1138  H H    . SER A 1 69 ? -13.350 -14.638 2.618   1.00 0.00 ? 69 SER A H    1  
ATOM 1139  H HA   . SER A 1 69 ? -15.764 -14.825 4.299   1.00 0.00 ? 69 SER A HA   1  
ATOM 1140  H HB2  . SER A 1 69 ? -14.423 -15.582 6.131   1.00 0.00 ? 69 SER A HB2  1  
ATOM 1141  H HB3  . SER A 1 69 ? -13.973 -16.561 4.735   1.00 0.00 ? 69 SER A HB3  1  
ATOM 1142  H HG   . SER A 1 69 ? -12.128 -15.825 5.832   1.00 0.00 ? 69 SER A HG   1  
ATOM 1143  N N    . GLY A 1 70 ? -15.541 -12.524 5.161   1.00 0.00 ? 70 GLY A N    1  
ATOM 1144  C CA   . GLY A 1 70 ? -15.435 -11.150 5.616   1.00 0.00 ? 70 GLY A CA   1  
ATOM 1145  C C    . GLY A 1 70 ? -16.760 -10.595 6.100   1.00 0.00 ? 70 GLY A C    1  
ATOM 1146  O O    . GLY A 1 70 ? -16.851 -10.060 7.205   1.00 0.00 ? 70 GLY A O    1  
ATOM 1147  H H    . GLY A 1 70 ? -16.405 -12.985 5.199   1.00 0.00 ? 70 GLY A H    1  
ATOM 1148  H HA2  . GLY A 1 70 ? -14.721 -11.104 6.425   1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1149  H HA3  . GLY A 1 70 ? -15.079 -10.539 4.800   1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1150  N N    . GLY A 1 1  ? -6.725  22.195  11.874  1.00 0.00 ? 1  GLY A N    2  
ATOM 1151  C CA   . GLY A 1 1  ? -8.175  22.194  11.923  1.00 0.00 ? 1  GLY A CA   2  
ATOM 1152  C C    . GLY A 1 1  ? -8.762  20.813  11.714  1.00 0.00 ? 1  GLY A C    2  
ATOM 1153  O O    . GLY A 1 1  ? -8.176  19.980  11.022  1.00 0.00 ? 1  GLY A O    2  
ATOM 1154  H H1   . GLY A 1 1  ? -6.263  22.604  11.112  1.00 0.00 ? 1  GLY A H1   2  
ATOM 1155  H HA2  . GLY A 1 1  ? -8.492  22.567  12.886  1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1156  H HA3  . GLY A 1 1  ? -8.550  22.852  11.153  1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1157  N N    . SER A 1 2  ? -9.922  20.567  12.315  1.00 0.00 ? 2  SER A N    2  
ATOM 1158  C CA   . SER A 1 2  ? -10.586 19.274  12.195  1.00 0.00 ? 2  SER A CA   2  
ATOM 1159  C C    . SER A 1 2  ? -11.492 19.240  10.968  1.00 0.00 ? 2  SER A C    2  
ATOM 1160  O O    . SER A 1 2  ? -12.653 19.644  11.027  1.00 0.00 ? 2  SER A O    2  
ATOM 1161  C CB   . SER A 1 2  ? -11.404 18.979  13.454  1.00 0.00 ? 2  SER A CB   2  
ATOM 1162  O OG   . SER A 1 2  ? -12.514 18.150  13.158  1.00 0.00 ? 2  SER A OG   2  
ATOM 1163  H H    . SER A 1 2  ? -10.340 21.272  12.853  1.00 0.00 ? 2  SER A H    2  
ATOM 1164  H HA   . SER A 1 2  ? -9.823  18.518  12.086  1.00 0.00 ? 2  SER A HA   2  
ATOM 1165  H HB2  . SER A 1 2  ? -10.778 18.477  14.177  1.00 0.00 ? 2  SER A HB2  2  
ATOM 1166  H HB3  . SER A 1 2  ? -11.764 19.908  13.872  1.00 0.00 ? 2  SER A HB3  2  
ATOM 1167  H HG   . SER A 1 2  ? -12.678 17.558  13.896  1.00 0.00 ? 2  SER A HG   2  
ATOM 1168  N N    . SER A 1 3  ? -10.951 18.755  9.854   1.00 0.00 ? 3  SER A N    2  
ATOM 1169  C CA   . SER A 1 3  ? -11.707 18.671  8.611   1.00 0.00 ? 3  SER A CA   2  
ATOM 1170  C C    . SER A 1 3  ? -12.142 17.234  8.335   1.00 0.00 ? 3  SER A C    2  
ATOM 1171  O O    . SER A 1 3  ? -11.387 16.290  8.567   1.00 0.00 ? 3  SER A O    2  
ATOM 1172  C CB   . SER A 1 3  ? -10.869 19.195  7.443   1.00 0.00 ? 3  SER A CB   2  
ATOM 1173  O OG   . SER A 1 3  ? -11.430 18.811  6.200   1.00 0.00 ? 3  SER A OG   2  
ATOM 1174  H H    . SER A 1 3  ? -10.020 18.449  9.870   1.00 0.00 ? 3  SER A H    2  
ATOM 1175  H HA   . SER A 1 3  ? -12.588 19.287  8.716   1.00 0.00 ? 3  SER A HA   2  
ATOM 1176  H HB2  . SER A 1 3  ? -10.828 20.273  7.488   1.00 0.00 ? 3  SER A HB2  2  
ATOM 1177  H HB3  . SER A 1 3  ? -9.869  18.793  7.513   1.00 0.00 ? 3  SER A HB3  2  
ATOM 1178  H HG   . SER A 1 3  ? -10.894 18.118  5.807   1.00 0.00 ? 3  SER A HG   2  
ATOM 1179  N N    . GLY A 1 4  ? -13.365 17.077  7.838   1.00 0.00 ? 4  GLY A N    2  
ATOM 1180  C CA   . GLY A 1 4  ? -13.880 15.754  7.539   1.00 0.00 ? 4  GLY A CA   2  
ATOM 1181  C C    . GLY A 1 4  ? -14.809 15.236  8.619   1.00 0.00 ? 4  GLY A C    2  
ATOM 1182  O O    . GLY A 1 4  ? -15.390 16.015  9.374   1.00 0.00 ? 4  GLY A O    2  
ATOM 1183  H H    . GLY A 1 4  ? -13.922 17.867  7.674   1.00 0.00 ? 4  GLY A H    2  
ATOM 1184  H HA2  . GLY A 1 4  ? -14.418 15.792  6.604   1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1185  H HA3  . GLY A 1 4  ? -13.049 15.072  7.437   1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1186  N N    . SER A 1 5  ? -14.949 13.916  8.693   1.00 0.00 ? 5  SER A N    2  
ATOM 1187  C CA   . SER A 1 5  ? -15.819 13.294  9.685   1.00 0.00 ? 5  SER A CA   2  
ATOM 1188  C C    . SER A 1 5  ? -15.643 11.779  9.688   1.00 0.00 ? 5  SER A C    2  
ATOM 1189  O O    . SER A 1 5  ? -15.576 11.148  8.633   1.00 0.00 ? 5  SER A O    2  
ATOM 1190  C CB   . SER A 1 5  ? -17.281 13.649  9.407   1.00 0.00 ? 5  SER A CB   2  
ATOM 1191  O OG   . SER A 1 5  ? -18.123 13.198  10.454  1.00 0.00 ? 5  SER A OG   2  
ATOM 1192  H H    . SER A 1 5  ? -14.459 13.347  8.063   1.00 0.00 ? 5  SER A H    2  
ATOM 1193  H HA   . SER A 1 5  ? -15.542 13.679  10.656  1.00 0.00 ? 5  SER A HA   2  
ATOM 1194  H HB2  . SER A 1 5  ? -17.378 14.720  9.319   1.00 0.00 ? 5  SER A HB2  2  
ATOM 1195  H HB3  . SER A 1 5  ? -17.592 13.182  8.484   1.00 0.00 ? 5  SER A HB3  2  
ATOM 1196  H HG   . SER A 1 5  ? -17.868 12.308  10.709  1.00 0.00 ? 5  SER A HG   2  
ATOM 1197  N N    . SER A 1 6  ? -15.568 11.200  10.882  1.00 0.00 ? 6  SER A N    2  
ATOM 1198  C CA   . SER A 1 6  ? -15.396 9.759   11.024  1.00 0.00 ? 6  SER A CA   2  
ATOM 1199  C C    . SER A 1 6  ? -16.747 9.057   11.116  1.00 0.00 ? 6  SER A C    2  
ATOM 1200  O O    . SER A 1 6  ? -17.113 8.273   10.241  1.00 0.00 ? 6  SER A O    2  
ATOM 1201  C CB   . SER A 1 6  ? -14.559 9.444   12.266  1.00 0.00 ? 6  SER A CB   2  
ATOM 1202  O OG   . SER A 1 6  ? -14.409 8.045   12.438  1.00 0.00 ? 6  SER A OG   2  
ATOM 1203  H H    . SER A 1 6  ? -15.627 11.756  11.687  1.00 0.00 ? 6  SER A H    2  
ATOM 1204  H HA   . SER A 1 6  ? -14.875 9.400   10.149  1.00 0.00 ? 6  SER A HA   2  
ATOM 1205  H HB2  . SER A 1 6  ? -13.581 9.888   12.160  1.00 0.00 ? 6  SER A HB2  2  
ATOM 1206  H HB3  . SER A 1 6  ? -15.047 9.852   13.138  1.00 0.00 ? 6  SER A HB3  2  
ATOM 1207  H HG   . SER A 1 6  ? -14.791 7.784   13.279  1.00 0.00 ? 6  SER A HG   2  
ATOM 1208  N N    . GLY A 1 7  ? -17.485 9.345   12.184  1.00 0.00 ? 7  GLY A N    2  
ATOM 1209  C CA   . GLY A 1 7  ? -18.788 8.733   12.372  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1210  C C    . GLY A 1 7  ? -18.693 7.255   12.694  1.00 0.00 ? 7  GLY A C    2  
ATOM 1211  O O    . GLY A 1 7  ? -17.796 6.564   12.212  1.00 0.00 ? 7  GLY A O    2  
ATOM 1212  H H    . GLY A 1 7  ? -17.142 9.977   12.849  1.00 0.00 ? 7  GLY A H    2  
ATOM 1213  H HA2  . GLY A 1 7  ? -19.296 9.236   13.182  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1214  H HA3  . GLY A 1 7  ? -19.365 8.857   11.467  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1215  N N    . ARG A 1 8  ? -19.621 6.769   13.512  1.00 0.00 ? 8  ARG A N    2  
ATOM 1216  C CA   . ARG A 1 8  ? -19.637 5.364   13.900  1.00 0.00 ? 8  ARG A CA   2  
ATOM 1217  C C    . ARG A 1 8  ? -19.651 4.460   12.671  1.00 0.00 ? 8  ARG A C    2  
ATOM 1218  O O    . ARG A 1 8  ? -19.759 4.934   11.539  1.00 0.00 ? 8  ARG A O    2  
ATOM 1219  C CB   . ARG A 1 8  ? -20.854 5.069   14.778  1.00 0.00 ? 8  ARG A CB   2  
ATOM 1220  C CG   . ARG A 1 8  ? -20.696 5.536   16.216  1.00 0.00 ? 8  ARG A CG   2  
ATOM 1221  C CD   . ARG A 1 8  ? -21.571 4.729   17.163  1.00 0.00 ? 8  ARG A CD   2  
ATOM 1222  N NE   . ARG A 1 8  ? -21.862 5.459   18.394  1.00 0.00 ? 8  ARG A NE   2  
ATOM 1223  C CZ   . ARG A 1 8  ? -22.551 4.945   19.407  1.00 0.00 ? 8  ARG A CZ   2  
ATOM 1224  N NH1  . ARG A 1 8  ? -23.016 3.706   19.336  1.00 0.00 ? 8  ARG A NH1  2  
ATOM 1225  N NH2  . ARG A 1 8  ? -22.775 5.672   20.495  1.00 0.00 ? 8  ARG A NH2  2  
ATOM 1226  H H    . ARG A 1 8  ? -20.311 7.370   13.864  1.00 0.00 ? 8  ARG A H    2  
ATOM 1227  H HA   . ARG A 1 8  ? -18.739 5.166   14.467  1.00 0.00 ? 8  ARG A HA   2  
ATOM 1228  H HB2  . ARG A 1 8  ? -21.717 5.562   14.355  1.00 0.00 ? 8  ARG A HB2  2  
ATOM 1229  H HB3  . ARG A 1 8  ? -21.027 4.003   14.786  1.00 0.00 ? 8  ARG A HB3  2  
ATOM 1230  H HG2  . ARG A 1 8  ? -19.664 5.421   16.511  1.00 0.00 ? 8  ARG A HG2  2  
ATOM 1231  H HG3  . ARG A 1 8  ? -20.977 6.577   16.279  1.00 0.00 ? 8  ARG A HG3  2  
ATOM 1232  H HD2  . ARG A 1 8  ? -22.500 4.498   16.664  1.00 0.00 ? 8  ARG A HD2  2  
ATOM 1233  H HD3  . ARG A 1 8  ? -21.058 3.812   17.411  1.00 0.00 ? 8  ARG A HD3  2  
ATOM 1234  H HE   . ARG A 1 8  ? -21.527 6.376   18.468  1.00 0.00 ? 8  ARG A HE   2  
ATOM 1235  H HH11 . ARG A 1 8  ? -22.848 3.156   18.518  1.00 0.00 ? 8  ARG A HH11 2  
ATOM 1236  H HH12 . ARG A 1 8  ? -23.533 3.321   20.101  1.00 0.00 ? 8  ARG A HH12 2  
ATOM 1237  H HH21 . ARG A 1 8  ? -22.425 6.606   20.552  1.00 0.00 ? 8  ARG A HH21 2  
ATOM 1238  H HH22 . ARG A 1 8  ? -23.293 5.284   21.256  1.00 0.00 ? 8  ARG A HH22 2  
ATOM 1239  N N    . LYS A 1 9  ? -19.542 3.156   12.900  1.00 0.00 ? 9  LYS A N    2  
ATOM 1240  C CA   . LYS A 1 9  ? -19.544 2.185   11.812  1.00 0.00 ? 9  LYS A CA   2  
ATOM 1241  C C    . LYS A 1 9  ? -18.428 2.482   10.815  1.00 0.00 ? 9  LYS A C    2  
ATOM 1242  O O    . LYS A 1 9  ? -18.666 2.576   9.611   1.00 0.00 ? 9  LYS A O    2  
ATOM 1243  C CB   . LYS A 1 9  ? -20.897 2.192   11.097  1.00 0.00 ? 9  LYS A CB   2  
ATOM 1244  C CG   . LYS A 1 9  ? -21.176 0.922   10.311  1.00 0.00 ? 9  LYS A CG   2  
ATOM 1245  C CD   . LYS A 1 9  ? -22.545 0.963   9.654   1.00 0.00 ? 9  LYS A CD   2  
ATOM 1246  C CE   . LYS A 1 9  ? -22.621 0.018   8.465   1.00 0.00 ? 9  LYS A CE   2  
ATOM 1247  N NZ   . LYS A 1 9  ? -24.014 -0.445  8.212   1.00 0.00 ? 9  LYS A NZ   2  
ATOM 1248  H H    . LYS A 1 9  ? -19.460 2.839   13.824  1.00 0.00 ? 9  LYS A H    2  
ATOM 1249  H HA   . LYS A 1 9  ? -19.377 1.208   12.240  1.00 0.00 ? 9  LYS A HA   2  
ATOM 1250  H HB2  . LYS A 1 9  ? -21.678 2.315   11.832  1.00 0.00 ? 9  LYS A HB2  2  
ATOM 1251  H HB3  . LYS A 1 9  ? -20.924 3.027   10.412  1.00 0.00 ? 9  LYS A HB3  2  
ATOM 1252  H HG2  . LYS A 1 9  ? -20.424 0.812   9.544   1.00 0.00 ? 9  LYS A HG2  2  
ATOM 1253  H HG3  . LYS A 1 9  ? -21.134 0.077   10.983  1.00 0.00 ? 9  LYS A HG3  2  
ATOM 1254  H HD2  . LYS A 1 9  ? -23.291 0.672   10.378  1.00 0.00 ? 9  LYS A HD2  2  
ATOM 1255  H HD3  . LYS A 1 9  ? -22.743 1.970   9.316   1.00 0.00 ? 9  LYS A HD3  2  
ATOM 1256  H HE2  . LYS A 1 9  ? -22.257 0.532   7.589   1.00 0.00 ? 9  LYS A HE2  2  
ATOM 1257  H HE3  . LYS A 1 9  ? -21.996 -0.840  8.663   1.00 0.00 ? 9  LYS A HE3  2  
ATOM 1258  H HZ1  . LYS A 1 9  ? -24.640 -0.129  8.980   1.00 0.00 ? 9  LYS A HZ1  2  
ATOM 1259  H HZ2  . LYS A 1 9  ? -24.042 -1.483  8.163   1.00 0.00 ? 9  LYS A HZ2  2  
ATOM 1260  H HZ3  . LYS A 1 9  ? -24.362 -0.057  7.312   1.00 0.00 ? 9  LYS A HZ3  2  
ATOM 1261  N N    . LYS A 1 10 ? -17.210 2.628   11.325  1.00 0.00 ? 10 LYS A N    2  
ATOM 1262  C CA   . LYS A 1 10 ? -16.056 2.912   10.480  1.00 0.00 ? 10 LYS A CA   2  
ATOM 1263  C C    . LYS A 1 10 ? -15.858 1.812   9.441   1.00 0.00 ? 10 LYS A C    2  
ATOM 1264  O O    . LYS A 1 10 ? -16.212 0.656   9.673   1.00 0.00 ? 10 LYS A O    2  
ATOM 1265  C CB   . LYS A 1 10 ? -14.794 3.054   11.334  1.00 0.00 ? 10 LYS A CB   2  
ATOM 1266  C CG   . LYS A 1 10 ? -14.283 1.735   11.887  1.00 0.00 ? 10 LYS A CG   2  
ATOM 1267  C CD   . LYS A 1 10 ? -13.272 1.952   13.002  1.00 0.00 ? 10 LYS A CD   2  
ATOM 1268  C CE   . LYS A 1 10 ? -11.894 2.281   12.448  1.00 0.00 ? 10 LYS A CE   2  
ATOM 1269  N NZ   . LYS A 1 10 ? -11.127 3.170   13.364  1.00 0.00 ? 10 LYS A NZ   2  
ATOM 1270  H H    . LYS A 1 10 ? -17.083 2.542   12.293  1.00 0.00 ? 10 LYS A H    2  
ATOM 1271  H HA   . LYS A 1 10 ? -16.241 3.845   9.968   1.00 0.00 ? 10 LYS A HA   2  
ATOM 1272  H HB2  . LYS A 1 10 ? -14.014 3.495   10.732  1.00 0.00 ? 10 LYS A HB2  2  
ATOM 1273  H HB3  . LYS A 1 10 ? -15.010 3.710   12.166  1.00 0.00 ? 10 LYS A HB3  2  
ATOM 1274  H HG2  . LYS A 1 10 ? -15.117 1.171   12.277  1.00 0.00 ? 10 LYS A HG2  2  
ATOM 1275  H HG3  . LYS A 1 10 ? -13.811 1.180   11.089  1.00 0.00 ? 10 LYS A HG3  2  
ATOM 1276  H HD2  . LYS A 1 10 ? -13.604 2.772   13.622  1.00 0.00 ? 10 LYS A HD2  2  
ATOM 1277  H HD3  . LYS A 1 10 ? -13.207 1.052   13.596  1.00 0.00 ? 10 LYS A HD3  2  
ATOM 1278  H HE2  . LYS A 1 10 ? -11.347 1.361   12.311  1.00 0.00 ? 10 LYS A HE2  2  
ATOM 1279  H HE3  . LYS A 1 10 ? -12.012 2.776   11.495  1.00 0.00 ? 10 LYS A HE3  2  
ATOM 1280  H HZ1  . LYS A 1 10 ? -10.266 2.686   13.692  1.00 0.00 ? 10 LYS A HZ1  2  
ATOM 1281  H HZ2  . LYS A 1 10 ? -11.707 3.418   14.191  1.00 0.00 ? 10 LYS A HZ2  2  
ATOM 1282  H HZ3  . LYS A 1 10 ? -10.854 4.043   12.870  1.00 0.00 ? 10 LYS A HZ3  2  
ATOM 1283  N N    . ARG A 1 11 ? -15.289 2.180   8.298   1.00 0.00 ? 11 ARG A N    2  
ATOM 1284  C CA   . ARG A 1 11 ? -15.044 1.224   7.225   1.00 0.00 ? 11 ARG A CA   2  
ATOM 1285  C C    . ARG A 1 11 ? -13.549 1.089   6.947   1.00 0.00 ? 11 ARG A C    2  
ATOM 1286  O O    . ARG A 1 11 ? -12.721 1.620   7.687   1.00 0.00 ? 11 ARG A O    2  
ATOM 1287  C CB   . ARG A 1 11 ? -15.773 1.656   5.951   1.00 0.00 ? 11 ARG A CB   2  
ATOM 1288  C CG   . ARG A 1 11 ? -15.283 2.980   5.388   1.00 0.00 ? 11 ARG A CG   2  
ATOM 1289  C CD   . ARG A 1 11 ? -15.347 2.998   3.869   1.00 0.00 ? 11 ARG A CD   2  
ATOM 1290  N NE   . ARG A 1 11 ? -16.649 3.447   3.382   1.00 0.00 ? 11 ARG A NE   2  
ATOM 1291  C CZ   . ARG A 1 11 ? -16.921 3.656   2.099   1.00 0.00 ? 11 ARG A CZ   2  
ATOM 1292  N NH1  . ARG A 1 11 ? -15.987 3.457   1.179   1.00 0.00 ? 11 ARG A NH1  2  
ATOM 1293  N NH2  . ARG A 1 11 ? -18.129 4.065   1.733   1.00 0.00 ? 11 ARG A NH2  2  
ATOM 1294  H H    . ARG A 1 11 ? -15.028 3.116   8.172   1.00 0.00 ? 11 ARG A H    2  
ATOM 1295  H HA   . ARG A 1 11 ? -15.427 0.265   7.540   1.00 0.00 ? 11 ARG A HA   2  
ATOM 1296  H HB2  . ARG A 1 11 ? -15.636 0.896   5.196   1.00 0.00 ? 11 ARG A HB2  2  
ATOM 1297  H HB3  . ARG A 1 11 ? -16.826 1.750   6.169   1.00 0.00 ? 11 ARG A HB3  2  
ATOM 1298  H HG2  . ARG A 1 11 ? -15.903 3.776   5.773   1.00 0.00 ? 11 ARG A HG2  2  
ATOM 1299  H HG3  . ARG A 1 11 ? -14.260 3.136   5.699   1.00 0.00 ? 11 ARG A HG3  2  
ATOM 1300  H HD2  . ARG A 1 11 ? -14.585 3.665   3.497   1.00 0.00 ? 11 ARG A HD2  2  
ATOM 1301  H HD3  . ARG A 1 11 ? -15.161 1.999   3.503   1.00 0.00 ? 11 ARG A HD3  2  
ATOM 1302  H HE   . ARG A 1 11 ? -17.353 3.600   4.045   1.00 0.00 ? 11 ARG A HE   2  
ATOM 1303  H HH11 . ARG A 1 11 ? -15.076 3.148   1.451   1.00 0.00 ? 11 ARG A HH11 2  
ATOM 1304  H HH12 . ARG A 1 11 ? -16.195 3.614   0.213   1.00 0.00 ? 11 ARG A HH12 2  
ATOM 1305  H HH21 . ARG A 1 11 ? -18.836 4.216   2.424   1.00 0.00 ? 11 ARG A HH21 2  
ATOM 1306  H HH22 . ARG A 1 11 ? -18.333 4.222   0.768   1.00 0.00 ? 11 ARG A HH22 2  
ATOM 1307  N N    . ILE A 1 12 ? -13.213 0.377   5.877   1.00 0.00 ? 12 ILE A N    2  
ATOM 1308  C CA   . ILE A 1 12 ? -11.820 0.174   5.502   1.00 0.00 ? 12 ILE A CA   2  
ATOM 1309  C C    . ILE A 1 12 ? -11.072 1.500   5.426   1.00 0.00 ? 12 ILE A C    2  
ATOM 1310  O O    . ILE A 1 12 ? -11.560 2.485   4.871   1.00 0.00 ? 12 ILE A O    2  
ATOM 1311  C CB   . ILE A 1 12 ? -11.701 -0.549  4.147   1.00 0.00 ? 12 ILE A CB   2  
ATOM 1312  C CG1  . ILE A 1 12 ? -12.448 -1.884  4.189   1.00 0.00 ? 12 ILE A CG1  2  
ATOM 1313  C CG2  . ILE A 1 12 ? -10.238 -0.765  3.789   1.00 0.00 ? 12 ILE A CG2  2  
ATOM 1314  C CD1  . ILE A 1 12 ? -11.944 -2.825  5.260   1.00 0.00 ? 12 ILE A CD1  2  
ATOM 1315  H H    . ILE A 1 12 ? -13.919 -0.021  5.327   1.00 0.00 ? 12 ILE A H    2  
ATOM 1316  H HA   . ILE A 1 12 ? -11.358 -0.445  6.259   1.00 0.00 ? 12 ILE A HA   2  
ATOM 1317  H HB   . ILE A 1 12 ? -12.143 0.080   3.390   1.00 0.00 ? 12 ILE A HB   2  
ATOM 1318  H HG12 . ILE A 1 12 ? -13.494 -1.698  4.376   1.00 0.00 ? 12 ILE A HG12 2  
ATOM 1319  H HG13 . ILE A 1 12 ? -12.339 -2.378  3.234   1.00 0.00 ? 12 ILE A HG13 2  
ATOM 1320  H HG21 . ILE A 1 12 ? -9.791  -1.446  4.498   1.00 0.00 ? 12 ILE A HG21 2  
ATOM 1321  H HG22 . ILE A 1 12 ? -10.169 -1.184  2.796   1.00 0.00 ? 12 ILE A HG22 2  
ATOM 1322  H HG23 . ILE A 1 12 ? -9.716  0.180   3.819   1.00 0.00 ? 12 ILE A HG23 2  
ATOM 1323  H HD11 . ILE A 1 12 ? -11.057 -2.410  5.717   1.00 0.00 ? 12 ILE A HD11 2  
ATOM 1324  H HD12 . ILE A 1 12 ? -12.708 -2.958  6.012   1.00 0.00 ? 12 ILE A HD12 2  
ATOM 1325  H HD13 . ILE A 1 12 ? -11.705 -3.781  4.816   1.00 0.00 ? 12 ILE A HD13 2  
ATOM 1326  N N    . PRO A 1 13 ? -9.857  1.529   5.994   1.00 0.00 ? 13 PRO A N    2  
ATOM 1327  C CA   . PRO A 1 13 ? -9.014  2.728   6.002   1.00 0.00 ? 13 PRO A CA   2  
ATOM 1328  C C    . PRO A 1 13 ? -8.280  2.928   4.681   1.00 0.00 ? 13 PRO A C    2  
ATOM 1329  O O    . PRO A 1 13 ? -8.557  2.245   3.695   1.00 0.00 ? 13 PRO A O    2  
ATOM 1330  C CB   . PRO A 1 13 ? -8.019  2.455   7.132   1.00 0.00 ? 13 PRO A CB   2  
ATOM 1331  C CG   . PRO A 1 13 ? -7.942  0.969   7.218   1.00 0.00 ? 13 PRO A CG   2  
ATOM 1332  C CD   . PRO A 1 13 ? -9.213  0.392   6.673   1.00 0.00 ? 13 PRO A CD   2  
ATOM 1333  H HA   . PRO A 1 13 ? -9.588  3.614   6.231   1.00 0.00 ? 13 PRO A HA   2  
ATOM 1334  H HB2  . PRO A 1 13 ? -7.060  2.887   6.882   1.00 0.00 ? 13 PRO A HB2  2  
ATOM 1335  H HB3  . PRO A 1 13 ? -8.385  2.885   8.051   1.00 0.00 ? 13 PRO A HB3  2  
ATOM 1336  H HG2  . PRO A 1 13 ? -7.116  0.609   6.624   1.00 0.00 ? 13 PRO A HG2  2  
ATOM 1337  H HG3  . PRO A 1 13 ? -7.825  0.668   8.248   1.00 0.00 ? 13 PRO A HG3  2  
ATOM 1338  H HD2  . PRO A 1 13 ? -8.963  -0.387  5.968   1.00 0.00 ? 13 PRO A HD2  2  
ATOM 1339  H HD3  . PRO A 1 13 ? -9.845  0.004   7.459   1.00 0.00 ? 13 PRO A HD3  2  
ATOM 1340  N N    . TYR A 1 14 ? -7.341  3.868   4.668   1.00 0.00 ? 14 TYR A N    2  
ATOM 1341  C CA   . TYR A 1 14 ? -6.567  4.159   3.467   1.00 0.00 ? 14 TYR A CA   2  
ATOM 1342  C C    . TYR A 1 14 ? -7.466  4.694   2.356   1.00 0.00 ? 14 TYR A C    2  
ATOM 1343  O O    . TYR A 1 14 ? -8.281  3.961   1.795   1.00 0.00 ? 14 TYR A O    2  
ATOM 1344  C CB   . TYR A 1 14 ? -5.838  2.903   2.988   1.00 0.00 ? 14 TYR A CB   2  
ATOM 1345  C CG   . TYR A 1 14 ? -5.080  2.188   4.084   1.00 0.00 ? 14 TYR A CG   2  
ATOM 1346  C CD1  . TYR A 1 14 ? -3.986  2.782   4.700   1.00 0.00 ? 14 TYR A CD1  2  
ATOM 1347  C CD2  . TYR A 1 14 ? -5.458  0.919   4.503   1.00 0.00 ? 14 TYR A CD2  2  
ATOM 1348  C CE1  . TYR A 1 14 ? -3.290  2.132   5.701   1.00 0.00 ? 14 TYR A CE1  2  
ATOM 1349  C CE2  . TYR A 1 14 ? -4.769  0.262   5.504   1.00 0.00 ? 14 TYR A CE2  2  
ATOM 1350  C CZ   . TYR A 1 14 ? -3.686  0.873   6.099   1.00 0.00 ? 14 TYR A CZ   2  
ATOM 1351  O OH   . TYR A 1 14 ? -2.996  0.223   7.097   1.00 0.00 ? 14 TYR A OH   2  
ATOM 1352  H H    . TYR A 1 14 ? -7.165  4.380   5.485   1.00 0.00 ? 14 TYR A H    2  
ATOM 1353  H HA   . TYR A 1 14 ? -5.837  4.914   3.718   1.00 0.00 ? 14 TYR A HA   2  
ATOM 1354  H HB2  . TYR A 1 14 ? -6.557  2.211   2.578   1.00 0.00 ? 14 TYR A HB2  2  
ATOM 1355  H HB3  . TYR A 1 14 ? -5.130  3.177   2.219   1.00 0.00 ? 14 TYR A HB3  2  
ATOM 1356  H HD1  . TYR A 1 14 ? -3.679  3.769   4.386   1.00 0.00 ? 14 TYR A HD1  2  
ATOM 1357  H HD2  . TYR A 1 14 ? -6.308  0.443   4.034   1.00 0.00 ? 14 TYR A HD2  2  
ATOM 1358  H HE1  . TYR A 1 14 ? -2.441  2.611   6.168   1.00 0.00 ? 14 TYR A HE1  2  
ATOM 1359  H HE2  . TYR A 1 14 ? -5.079  -0.725  5.816   1.00 0.00 ? 14 TYR A HE2  2  
ATOM 1360  H HH   . TYR A 1 14 ? -3.557  0.138   7.871   1.00 0.00 ? 14 TYR A HH   2  
ATOM 1361  N N    . SER A 1 15 ? -7.311  5.976   2.044   1.00 0.00 ? 15 SER A N    2  
ATOM 1362  C CA   . SER A 1 15 ? -8.110  6.611   1.002   1.00 0.00 ? 15 SER A CA   2  
ATOM 1363  C C    . SER A 1 15 ? -7.730  6.078   -0.376  1.00 0.00 ? 15 SER A C    2  
ATOM 1364  O O    . SER A 1 15 ? -6.690  5.441   -0.543  1.00 0.00 ? 15 SER A O    2  
ATOM 1365  C CB   . SER A 1 15 ? -7.925  8.129   1.042   1.00 0.00 ? 15 SER A CB   2  
ATOM 1366  O OG   . SER A 1 15 ? -8.816  8.728   1.967   1.00 0.00 ? 15 SER A OG   2  
ATOM 1367  H H    . SER A 1 15 ? -6.645  6.508   2.527   1.00 0.00 ? 15 SER A H    2  
ATOM 1368  H HA   . SER A 1 15 ? -9.147  6.379   1.192   1.00 0.00 ? 15 SER A HA   2  
ATOM 1369  H HB2  . SER A 1 15 ? -6.912  8.358   1.338   1.00 0.00 ? 15 SER A HB2  2  
ATOM 1370  H HB3  . SER A 1 15 ? -8.115  8.539   0.061   1.00 0.00 ? 15 SER A HB3  2  
ATOM 1371  H HG   . SER A 1 15 ? -9.671  8.858   1.550   1.00 0.00 ? 15 SER A HG   2  
ATOM 1372  N N    . LYS A 1 16 ? -8.581  6.342   -1.361  1.00 0.00 ? 16 LYS A N    2  
ATOM 1373  C CA   . LYS A 1 16 ? -8.337  5.891   -2.726  1.00 0.00 ? 16 LYS A CA   2  
ATOM 1374  C C    . LYS A 1 16 ? -6.943  6.297   -3.192  1.00 0.00 ? 16 LYS A C    2  
ATOM 1375  O O    . LYS A 1 16 ? -6.272  5.549   -3.902  1.00 0.00 ? 16 LYS A O    2  
ATOM 1376  C CB   . LYS A 1 16 ? -9.391  6.468   -3.672  1.00 0.00 ? 16 LYS A CB   2  
ATOM 1377  C CG   . LYS A 1 16 ? -10.670 5.650   -3.730  1.00 0.00 ? 16 LYS A CG   2  
ATOM 1378  C CD   . LYS A 1 16 ? -11.505 5.830   -2.473  1.00 0.00 ? 16 LYS A CD   2  
ATOM 1379  C CE   . LYS A 1 16 ? -12.985 5.615   -2.752  1.00 0.00 ? 16 LYS A CE   2  
ATOM 1380  N NZ   . LYS A 1 16 ? -13.247 4.282   -3.360  1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1381  H H    . LYS A 1 16 ? -9.394  6.854   -1.165  1.00 0.00 ? 16 LYS A H    2  
ATOM 1382  H HA   . LYS A 1 16 ? -8.407  4.813   -2.736  1.00 0.00 ? 16 LYS A HA   2  
ATOM 1383  H HB2  . LYS A 1 16 ? -9.642  7.467   -3.346  1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1384  H HB3  . LYS A 1 16 ? -8.975  6.517   -4.668  1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1385  H HG2  . LYS A 1 16 ? -11.251 5.967   -4.584  1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1386  H HG3  . LYS A 1 16 ? -10.414 4.605   -3.835  1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1387  H HD2  . LYS A 1 16 ? -11.182 5.115   -1.732  1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1388  H HD3  . LYS A 1 16 ? -11.360 6.833   -2.096  1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1389  H HE2  . LYS A 1 16 ? -13.527 5.690   -1.822  1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1390  H HE3  . LYS A 1 16 ? -13.325 6.384   -3.429  1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1391  H HZ1  . LYS A 1 16 ? -12.470 3.627   -3.134  1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1392  H HZ2  . LYS A 1 16 ? -13.321 4.369   -4.394  1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1393  H HZ3  . LYS A 1 16 ? -14.136 3.889   -2.991  1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1394  N N    . GLY A 1 17 ? -6.512  7.488   -2.786  1.00 0.00 ? 17 GLY A N    2  
ATOM 1395  C CA   . GLY A 1 17 ? -5.199  7.973   -3.171  1.00 0.00 ? 17 GLY A CA   2  
ATOM 1396  C C    . GLY A 1 17 ? -4.078  7.210   -2.493  1.00 0.00 ? 17 GLY A C    2  
ATOM 1397  O O    . GLY A 1 17 ? -3.070  6.888   -3.122  1.00 0.00 ? 17 GLY A O    2  
ATOM 1398  H H    . GLY A 1 17 ? -7.090  8.042   -2.221  1.00 0.00 ? 17 GLY A H    2  
ATOM 1399  H HA2  . GLY A 1 17 ? -5.091  7.876   -4.241  1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1400  H HA3  . GLY A 1 17 ? -5.121  9.017   -2.905  1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1401  N N    . GLN A 1 18 ? -4.253  6.923   -1.207  1.00 0.00 ? 18 GLN A N    2  
ATOM 1402  C CA   . GLN A 1 18 ? -3.246  6.196   -0.444  1.00 0.00 ? 18 GLN A CA   2  
ATOM 1403  C C    . GLN A 1 18 ? -3.119  4.759   -0.940  1.00 0.00 ? 18 GLN A C    2  
ATOM 1404  O O    . GLN A 1 18 ? -2.012  4.247   -1.114  1.00 0.00 ? 18 GLN A O    2  
ATOM 1405  C CB   . GLN A 1 18 ? -3.599  6.204   1.044   1.00 0.00 ? 18 GLN A CB   2  
ATOM 1406  C CG   . GLN A 1 18 ? -3.382  7.552   1.713   1.00 0.00 ? 18 GLN A CG   2  
ATOM 1407  C CD   . GLN A 1 18 ? -3.837  7.566   3.160   1.00 0.00 ? 18 GLN A CD   2  
ATOM 1408  O OE1  . GLN A 1 18 ? -4.517  8.492   3.600   1.00 0.00 ? 18 GLN A OE1  2  
ATOM 1409  N NE2  . GLN A 1 18 ? -3.461  6.535   3.908   1.00 0.00 ? 18 GLN A NE2  2  
ATOM 1410  H H    . GLN A 1 18 ? -5.078  7.207   -0.762  1.00 0.00 ? 18 GLN A H    2  
ATOM 1411  H HA   . GLN A 1 18 ? -2.300  6.696   -0.583  1.00 0.00 ? 18 GLN A HA   2  
ATOM 1412  H HB2  . GLN A 1 18 ? -4.638  5.933   1.157   1.00 0.00 ? 18 GLN A HB2  2  
ATOM 1413  H HB3  . GLN A 1 18 ? -2.987  5.473   1.552   1.00 0.00 ? 18 GLN A HB3  2  
ATOM 1414  H HG2  . GLN A 1 18 ? -2.330  7.791   1.681   1.00 0.00 ? 18 GLN A HG2  2  
ATOM 1415  H HG3  . GLN A 1 18 ? -3.937  8.302   1.170   1.00 0.00 ? 18 GLN A HG3  2  
ATOM 1416  H HE21 . GLN A 1 18 ? -2.918  5.833   3.490   1.00 0.00 ? 18 GLN A HE21 2  
ATOM 1417  H HE22 . GLN A 1 18 ? -3.740  6.518   4.846   1.00 0.00 ? 18 GLN A HE22 2  
ATOM 1418  N N    . LEU A 1 19 ? -4.258  4.114   -1.166  1.00 0.00 ? 19 LEU A N    2  
ATOM 1419  C CA   . LEU A 1 19 ? -4.274  2.735   -1.642  1.00 0.00 ? 19 LEU A CA   2  
ATOM 1420  C C    . LEU A 1 19 ? -3.751  2.647   -3.072  1.00 0.00 ? 19 LEU A C    2  
ATOM 1421  O O    . LEU A 1 19 ? -3.262  1.601   -3.502  1.00 0.00 ? 19 LEU A O    2  
ATOM 1422  C CB   . LEU A 1 19 ? -5.692  2.167   -1.570  1.00 0.00 ? 19 LEU A CB   2  
ATOM 1423  C CG   . LEU A 1 19 ? -6.297  2.046   -0.171  1.00 0.00 ? 19 LEU A CG   2  
ATOM 1424  C CD1  . LEU A 1 19 ? -7.813  1.956   -0.250  1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1425  C CD2  . LEU A 1 19 ? -5.726  0.835   0.553   1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1426  H H    . LEU A 1 19 ? -5.108  4.574   -1.009  1.00 0.00 ? 19 LEU A H    2  
ATOM 1427  H HA   . LEU A 1 19 ? -3.629  2.155   -0.999  1.00 0.00 ? 19 LEU A HA   2  
ATOM 1428  H HB2  . LEU A 1 19 ? -6.335  2.808   -2.153  1.00 0.00 ? 19 LEU A HB2  2  
ATOM 1429  H HB3  . LEU A 1 19 ? -5.675  1.180   -2.011  1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1430  H HG   . LEU A 1 19 ? -6.044  2.928   0.401   1.00 0.00 ? 19 LEU A HG   2  
ATOM 1431  H HD11 . LEU A 1 19 ? -8.092  1.140   -0.898  1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1432  H HD12 . LEU A 1 19 ? -8.208  2.880   -0.644  1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1433  H HD13 . LEU A 1 19 ? -8.215  1.786   0.738   1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1434  H HD21 . LEU A 1 19 ? -5.731  -0.017  -0.111  1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1435  H HD22 . LEU A 1 19 ? -6.330  0.617   1.422   1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1436  H HD23 . LEU A 1 19 ? -4.713  1.044   0.862   1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1437  N N    . ARG A 1 20 ? -3.854  3.751   -3.804  1.00 0.00 ? 20 ARG A N    2  
ATOM 1438  C CA   . ARG A 1 20 ? -3.390  3.799   -5.185  1.00 0.00 ? 20 ARG A CA   2  
ATOM 1439  C C    . ARG A 1 20 ? -1.914  3.423   -5.276  1.00 0.00 ? 20 ARG A C    2  
ATOM 1440  O O    . ARG A 1 20 ? -1.481  2.802   -6.247  1.00 0.00 ? 20 ARG A O    2  
ATOM 1441  C CB   . ARG A 1 20 ? -3.609  5.195   -5.772  1.00 0.00 ? 20 ARG A CB   2  
ATOM 1442  C CG   . ARG A 1 20 ? -3.570  5.230   -7.291  1.00 0.00 ? 20 ARG A CG   2  
ATOM 1443  C CD   . ARG A 1 20 ? -3.737  6.646   -7.819  1.00 0.00 ? 20 ARG A CD   2  
ATOM 1444  N NE   . ARG A 1 20 ? -4.341  6.667   -9.149  1.00 0.00 ? 20 ARG A NE   2  
ATOM 1445  C CZ   . ARG A 1 20 ? -5.625  6.414   -9.376  1.00 0.00 ? 20 ARG A CZ   2  
ATOM 1446  N NH1  . ARG A 1 20 ? -6.436  6.123   -8.368  1.00 0.00 ? 20 ARG A NH1  2  
ATOM 1447  N NH2  . ARG A 1 20 ? -6.101  6.451   -10.615 1.00 0.00 ? 20 ARG A NH2  2  
ATOM 1448  H H    . ARG A 1 20 ? -4.252  4.553   -3.406  1.00 0.00 ? 20 ARG A H    2  
ATOM 1449  H HA   . ARG A 1 20 ? -3.967  3.085   -5.754  1.00 0.00 ? 20 ARG A HA   2  
ATOM 1450  H HB2  . ARG A 1 20 ? -4.573  5.560   -5.450  1.00 0.00 ? 20 ARG A HB2  2  
ATOM 1451  H HB3  . ARG A 1 20 ? -2.840  5.853   -5.398  1.00 0.00 ? 20 ARG A HB3  2  
ATOM 1452  H HG2  . ARG A 1 20 ? -2.619  4.843   -7.626  1.00 0.00 ? 20 ARG A HG2  2  
ATOM 1453  H HG3  . ARG A 1 20 ? -4.369  4.614   -7.677  1.00 0.00 ? 20 ARG A HG3  2  
ATOM 1454  H HD2  . ARG A 1 20 ? -4.369  7.198   -7.139  1.00 0.00 ? 20 ARG A HD2  2  
ATOM 1455  H HD3  . ARG A 1 20 ? -2.765  7.115   -7.868  1.00 0.00 ? 20 ARG A HD3  2  
ATOM 1456  H HE   . ARG A 1 20 ? -3.760  6.879   -9.908  1.00 0.00 ? 20 ARG A HE   2  
ATOM 1457  H HH11 . ARG A 1 20 ? -6.081  6.095   -7.434  1.00 0.00 ? 20 ARG A HH11 2  
ATOM 1458  H HH12 . ARG A 1 20 ? -7.403  5.934   -8.542  1.00 0.00 ? 20 ARG A HH12 2  
ATOM 1459  H HH21 . ARG A 1 20 ? -5.492  6.670   -11.377 1.00 0.00 ? 20 ARG A HH21 2  
ATOM 1460  H HH22 . ARG A 1 20 ? -7.067  6.261   -10.785 1.00 0.00 ? 20 ARG A HH22 2  
ATOM 1461  N N    . GLU A 1 21 ? -1.148  3.805   -4.260  1.00 0.00 ? 21 GLU A N    2  
ATOM 1462  C CA   . GLU A 1 21 ? 0.280   3.508   -4.226  1.00 0.00 ? 21 GLU A CA   2  
ATOM 1463  C C    . GLU A 1 21 ? 0.533   2.112   -3.665  1.00 0.00 ? 21 GLU A C    2  
ATOM 1464  O O    . GLU A 1 21 ? 1.439   1.406   -4.111  1.00 0.00 ? 21 GLU A O    2  
ATOM 1465  C CB   . GLU A 1 21 ? 1.020   4.550   -3.385  1.00 0.00 ? 21 GLU A CB   2  
ATOM 1466  C CG   . GLU A 1 21 ? 0.827   5.976   -3.873  1.00 0.00 ? 21 GLU A CG   2  
ATOM 1467  C CD   . GLU A 1 21 ? 1.010   6.109   -5.373  1.00 0.00 ? 21 GLU A CD   2  
ATOM 1468  O OE1  . GLU A 1 21 ? 1.941   5.477   -5.914  1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1469  O OE2  . GLU A 1 21 ? 0.223   6.844   -6.004  1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1470  H H    . GLU A 1 21 ? -1.551  4.297   -3.515  1.00 0.00 ? 21 GLU A H    2  
ATOM 1471  H HA   . GLU A 1 21 ? 0.650   3.549   -5.240  1.00 0.00 ? 21 GLU A HA   2  
ATOM 1472  H HB2  . GLU A 1 21 ? 0.667   4.489   -2.366  1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1473  H HB3  . GLU A 1 21 ? 2.076   4.326   -3.404  1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1474  H HG2  . GLU A 1 21 ? -0.171  6.298   -3.618  1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1475  H HG3  . GLU A 1 21 ? 1.547   6.613   -3.380  1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1476  N N    . LEU A 1 22 ? -0.273  1.720   -2.685  1.00 0.00 ? 22 LEU A N    2  
ATOM 1477  C CA   . LEU A 1 22 ? -0.137  0.409   -2.061  1.00 0.00 ? 22 LEU A CA   2  
ATOM 1478  C C    . LEU A 1 22 ? -0.471  -0.703  -3.051  1.00 0.00 ? 22 LEU A C    2  
ATOM 1479  O O    . LEU A 1 22 ? 0.338   -1.599  -3.288  1.00 0.00 ? 22 LEU A O    2  
ATOM 1480  C CB   . LEU A 1 22 ? -1.049  0.307   -0.837  1.00 0.00 ? 22 LEU A CB   2  
ATOM 1481  C CG   . LEU A 1 22 ? -0.691  1.211   0.344   1.00 0.00 ? 22 LEU A CG   2  
ATOM 1482  C CD1  . LEU A 1 22 ? -1.860  1.314   1.311   1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1483  C CD2  . LEU A 1 22 ? 0.549   0.692   1.056   1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1484  H H    . LEU A 1 22 ? -0.976  2.326   -2.372  1.00 0.00 ? 22 LEU A H    2  
ATOM 1485  H HA   . LEU A 1 22 ? 0.890   0.297   -1.745  1.00 0.00 ? 22 LEU A HA   2  
ATOM 1486  H HB2  . LEU A 1 22 ? -2.051  0.554   -1.150  1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1487  H HB3  . LEU A 1 22 ? -1.024  -0.716  -0.491  1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1488  H HG   . LEU A 1 22 ? -0.474  2.205   -0.025  1.00 0.00 ? 22 LEU A HG   2  
ATOM 1489  H HD11 . LEU A 1 22 ? -1.495  1.248   2.324   1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1490  H HD12 . LEU A 1 22 ? -2.553  0.507   1.124   1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1491  H HD13 . LEU A 1 22 ? -2.362  2.260   1.169   1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1492  H HD21 . LEU A 1 22 ? 0.340   -0.279  1.480   1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1493  H HD22 . LEU A 1 22 ? 0.825   1.377   1.845   1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1494  H HD23 . LEU A 1 22 ? 1.362   0.609   0.350   1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1495  N N    . GLU A 1 23 ? -1.667  -0.635  -3.628  1.00 0.00 ? 23 GLU A N    2  
ATOM 1496  C CA   . GLU A 1 23 ? -2.106  -1.635  -4.594  1.00 0.00 ? 23 GLU A CA   2  
ATOM 1497  C C    . GLU A 1 23 ? -1.081  -1.797  -5.713  1.00 0.00 ? 23 GLU A C    2  
ATOM 1498  O O    . GLU A 1 23 ? -0.718  -2.915  -6.078  1.00 0.00 ? 23 GLU A O    2  
ATOM 1499  C CB   . GLU A 1 23 ? -3.463  -1.245  -5.183  1.00 0.00 ? 23 GLU A CB   2  
ATOM 1500  C CG   . GLU A 1 23 ? -4.614  -1.375  -4.199  1.00 0.00 ? 23 GLU A CG   2  
ATOM 1501  C CD   . GLU A 1 23 ? -5.936  -0.919  -4.785  1.00 0.00 ? 23 GLU A CD   2  
ATOM 1502  O OE1  . GLU A 1 23 ? -6.462  -1.618  -5.677  1.00 0.00 ? 23 GLU A OE1  2  
ATOM 1503  O OE2  . GLU A 1 23 ? -6.445  0.136   -4.352  1.00 0.00 ? 23 GLU A OE2  2  
ATOM 1504  H H    . GLU A 1 23 ? -2.267  0.105   -3.398  1.00 0.00 ? 23 GLU A H    2  
ATOM 1505  H HA   . GLU A 1 23 ? -2.206  -2.576  -4.075  1.00 0.00 ? 23 GLU A HA   2  
ATOM 1506  H HB2  . GLU A 1 23 ? -3.416  -0.219  -5.518  1.00 0.00 ? 23 GLU A HB2  2  
ATOM 1507  H HB3  . GLU A 1 23 ? -3.669  -1.881  -6.031  1.00 0.00 ? 23 GLU A HB3  2  
ATOM 1508  H HG2  . GLU A 1 23 ? -4.705  -2.410  -3.907  1.00 0.00 ? 23 GLU A HG2  2  
ATOM 1509  H HG3  . GLU A 1 23 ? -4.396  -0.774  -3.329  1.00 0.00 ? 23 GLU A HG3  2  
ATOM 1510  N N    . ARG A 1 24 ? -0.620  -0.674  -6.253  1.00 0.00 ? 24 ARG A N    2  
ATOM 1511  C CA   . ARG A 1 24 ? 0.362   -0.691  -7.331  1.00 0.00 ? 24 ARG A CA   2  
ATOM 1512  C C    . ARG A 1 24 ? 1.657   -1.357  -6.876  1.00 0.00 ? 24 ARG A C    2  
ATOM 1513  O O    . ARG A 1 24 ? 2.123   -2.315  -7.492  1.00 0.00 ? 24 ARG A O    2  
ATOM 1514  C CB   . ARG A 1 24 ? 0.648   0.733   -7.811  1.00 0.00 ? 24 ARG A CB   2  
ATOM 1515  C CG   . ARG A 1 24 ? -0.379  1.262   -8.798  1.00 0.00 ? 24 ARG A CG   2  
ATOM 1516  C CD   . ARG A 1 24 ? 0.223   2.306   -9.724  1.00 0.00 ? 24 ARG A CD   2  
ATOM 1517  N NE   . ARG A 1 24 ? 1.070   1.705   -10.750 1.00 0.00 ? 24 ARG A NE   2  
ATOM 1518  C CZ   . ARG A 1 24 ? 1.636   2.396   -11.733 1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1519  N NH1  . ARG A 1 24 ? 1.447   3.705   -11.823 1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1520  N NH2  . ARG A 1 24 ? 2.394   1.777   -12.630 1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1521  H H    . ARG A 1 24 ? -0.948  0.187   -5.918  1.00 0.00 ? 24 ARG A H    2  
ATOM 1522  H HA   . ARG A 1 24 ? -0.054  -1.260  -8.149  1.00 0.00 ? 24 ARG A HA   2  
ATOM 1523  H HB2  . ARG A 1 24 ? 0.665   1.392   -6.955  1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1524  H HB3  . ARG A 1 24 ? 1.616   0.751   -8.288  1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1525  H HG2  . ARG A 1 24 ? -0.749  0.440   -9.393  1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1526  H HG3  . ARG A 1 24 ? -1.196  1.707   -8.249  1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1527  H HD2  . ARG A 1 24 ? -0.578  2.848   -10.204 1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1528  H HD3  . ARG A 1 24 ? 0.817   2.990   -9.135  1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1529  H HE   . ARG A 1 24 ? 1.224   0.739   -10.703 1.00 0.00 ? 24 ARG A HE   2  
ATOM 1530  H HH11 . ARG A 1 24 ? 0.877   4.174   -11.148 1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1531  H HH12 . ARG A 1 24 ? 1.875   4.223   -12.564 1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1532  H HH21 . ARG A 1 24 ? 2.540   0.790   -12.565 1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1533  H HH22 . ARG A 1 24 ? 2.820   2.298   -13.369 1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1534  N N    . GLU A 1 25 ? 2.234   -0.841  -5.795  1.00 0.00 ? 25 GLU A N    2  
ATOM 1535  C CA   . GLU A 1 25 ? 3.476   -1.385  -5.260  1.00 0.00 ? 25 GLU A CA   2  
ATOM 1536  C C    . GLU A 1 25 ? 3.336   -2.876  -4.968  1.00 0.00 ? 25 GLU A C    2  
ATOM 1537  O O    . GLU A 1 25 ? 4.270   -3.651  -5.179  1.00 0.00 ? 25 GLU A O    2  
ATOM 1538  C CB   . GLU A 1 25 ? 3.877   -0.641  -3.985  1.00 0.00 ? 25 GLU A CB   2  
ATOM 1539  C CG   . GLU A 1 25 ? 4.755   0.573   -4.239  1.00 0.00 ? 25 GLU A CG   2  
ATOM 1540  C CD   . GLU A 1 25 ? 4.283   1.397   -5.421  1.00 0.00 ? 25 GLU A CD   2  
ATOM 1541  O OE1  . GLU A 1 25 ? 4.543   0.988   -6.572  1.00 0.00 ? 25 GLU A OE1  2  
ATOM 1542  O OE2  . GLU A 1 25 ? 3.653   2.452   -5.195  1.00 0.00 ? 25 GLU A OE2  2  
ATOM 1543  H H    . GLU A 1 25 ? 1.814   -0.077  -5.348  1.00 0.00 ? 25 GLU A H    2  
ATOM 1544  H HA   . GLU A 1 25 ? 4.246   -1.247  -6.003  1.00 0.00 ? 25 GLU A HA   2  
ATOM 1545  H HB2  . GLU A 1 25 ? 2.983   -0.312  -3.477  1.00 0.00 ? 25 GLU A HB2  2  
ATOM 1546  H HB3  . GLU A 1 25 ? 4.417   -1.320  -3.341  1.00 0.00 ? 25 GLU A HB3  2  
ATOM 1547  H HG2  . GLU A 1 25 ? 4.747   1.198   -3.359  1.00 0.00 ? 25 GLU A HG2  2  
ATOM 1548  H HG3  . GLU A 1 25 ? 5.764   0.238   -4.432  1.00 0.00 ? 25 GLU A HG3  2  
ATOM 1549  N N    . TYR A 1 26 ? 2.164   -3.271  -4.483  1.00 0.00 ? 26 TYR A N    2  
ATOM 1550  C CA   . TYR A 1 26 ? 1.902   -4.668  -4.159  1.00 0.00 ? 26 TYR A CA   2  
ATOM 1551  C C    . TYR A 1 26 ? 1.892   -5.527  -5.420  1.00 0.00 ? 26 TYR A C    2  
ATOM 1552  O O    . TYR A 1 26 ? 2.528   -6.579  -5.473  1.00 0.00 ? 26 TYR A O    2  
ATOM 1553  C CB   . TYR A 1 26 ? 0.565   -4.802  -3.428  1.00 0.00 ? 26 TYR A CB   2  
ATOM 1554  C CG   . TYR A 1 26 ? 0.120   -6.234  -3.237  1.00 0.00 ? 26 TYR A CG   2  
ATOM 1555  C CD1  . TYR A 1 26 ? 0.886   -7.127  -2.498  1.00 0.00 ? 26 TYR A CD1  2  
ATOM 1556  C CD2  . TYR A 1 26 ? -1.065  -6.694  -3.796  1.00 0.00 ? 26 TYR A CD2  2  
ATOM 1557  C CE1  . TYR A 1 26 ? 0.484   -8.437  -2.321  1.00 0.00 ? 26 TYR A CE1  2  
ATOM 1558  C CE2  . TYR A 1 26 ? -1.476  -8.002  -3.623  1.00 0.00 ? 26 TYR A CE2  2  
ATOM 1559  C CZ   . TYR A 1 26 ? -0.698  -8.869  -2.886  1.00 0.00 ? 26 TYR A CZ   2  
ATOM 1560  O OH   . TYR A 1 26 ? -1.103  -10.173 -2.712  1.00 0.00 ? 26 TYR A OH   2  
ATOM 1561  H H    . TYR A 1 26 ? 1.459   -2.606  -4.337  1.00 0.00 ? 26 TYR A H    2  
ATOM 1562  H HA   . TYR A 1 26 ? 2.693   -5.012  -3.509  1.00 0.00 ? 26 TYR A HA   2  
ATOM 1563  H HB2  . TYR A 1 26 ? 0.650   -4.348  -2.452  1.00 0.00 ? 26 TYR A HB2  2  
ATOM 1564  H HB3  . TYR A 1 26 ? -0.199  -4.289  -3.993  1.00 0.00 ? 26 TYR A HB3  2  
ATOM 1565  H HD1  . TYR A 1 26 ? 1.811   -6.786  -2.057  1.00 0.00 ? 26 TYR A HD1  2  
ATOM 1566  H HD2  . TYR A 1 26 ? -1.672  -6.012  -4.374  1.00 0.00 ? 26 TYR A HD2  2  
ATOM 1567  H HE1  . TYR A 1 26 ? 1.092   -9.117  -1.743  1.00 0.00 ? 26 TYR A HE1  2  
ATOM 1568  H HE2  . TYR A 1 26 ? -2.402  -8.341  -4.066  1.00 0.00 ? 26 TYR A HE2  2  
ATOM 1569  H HH   . TYR A 1 26 ? -1.564  -10.256 -1.874  1.00 0.00 ? 26 TYR A HH   2  
ATOM 1570  N N    . ALA A 1 27 ? 1.166   -5.068  -6.435  1.00 0.00 ? 27 ALA A N    2  
ATOM 1571  C CA   . ALA A 1 27 ? 1.075   -5.792  -7.697  1.00 0.00 ? 27 ALA A CA   2  
ATOM 1572  C C    . ALA A 1 27 ? 2.432   -5.865  -8.387  1.00 0.00 ? 27 ALA A C    2  
ATOM 1573  O O    . ALA A 1 27 ? 2.718   -6.814  -9.116  1.00 0.00 ? 27 ALA A O    2  
ATOM 1574  C CB   . ALA A 1 27 ? 0.051   -5.133  -8.610  1.00 0.00 ? 27 ALA A CB   2  
ATOM 1575  H H    . ALA A 1 27 ? 0.681   -4.223  -6.332  1.00 0.00 ? 27 ALA A H    2  
ATOM 1576  H HA   . ALA A 1 27 ? 0.737   -6.796  -7.483  1.00 0.00 ? 27 ALA A HA   2  
ATOM 1577  H HB1  . ALA A 1 27 ? -0.608  -5.888  -9.014  1.00 0.00 ? 27 ALA A HB1  2  
ATOM 1578  H HB2  . ALA A 1 27 ? -0.526  -4.416  -8.045  1.00 0.00 ? 27 ALA A HB2  2  
ATOM 1579  H HB3  . ALA A 1 27 ? 0.560   -4.630  -9.418  1.00 0.00 ? 27 ALA A HB3  2  
ATOM 1580  N N    . ALA A 1 28 ? 3.265   -4.855  -8.153  1.00 0.00 ? 28 ALA A N    2  
ATOM 1581  C CA   . ALA A 1 28 ? 4.593   -4.806  -8.752  1.00 0.00 ? 28 ALA A CA   2  
ATOM 1582  C C    . ALA A 1 28 ? 5.569   -5.703  -7.998  1.00 0.00 ? 28 ALA A C    2  
ATOM 1583  O O    . ALA A 1 28 ? 6.557   -6.173  -8.561  1.00 0.00 ? 28 ALA A O    2  
ATOM 1584  C CB   . ALA A 1 28 ? 5.105   -3.374  -8.783  1.00 0.00 ? 28 ALA A CB   2  
ATOM 1585  H H    . ALA A 1 28 ? 2.979   -4.127  -7.563  1.00 0.00 ? 28 ALA A H    2  
ATOM 1586  H HA   . ALA A 1 28 ? 4.513   -5.156  -9.771  1.00 0.00 ? 28 ALA A HA   2  
ATOM 1587  H HB1  . ALA A 1 28 ? 4.776   -2.894  -9.693  1.00 0.00 ? 28 ALA A HB1  2  
ATOM 1588  H HB2  . ALA A 1 28 ? 4.718   -2.835  -7.931  1.00 0.00 ? 28 ALA A HB2  2  
ATOM 1589  H HB3  . ALA A 1 28 ? 6.184   -3.377  -8.747  1.00 0.00 ? 28 ALA A HB3  2  
ATOM 1590  N N    . ASN A 1 29 ? 5.285   -5.936  -6.720  1.00 0.00 ? 29 ASN A N    2  
ATOM 1591  C CA   . ASN A 1 29 ? 6.139   -6.776  -5.888  1.00 0.00 ? 29 ASN A CA   2  
ATOM 1592  C C    . ASN A 1 29 ? 5.461   -7.093  -4.559  1.00 0.00 ? 29 ASN A C    2  
ATOM 1593  O O    . ASN A 1 29 ? 5.233   -6.204  -3.738  1.00 0.00 ? 29 ASN A O    2  
ATOM 1594  C CB   . ASN A 1 29 ? 7.480   -6.085  -5.638  1.00 0.00 ? 29 ASN A CB   2  
ATOM 1595  C CG   . ASN A 1 29 ? 7.317   -4.717  -5.003  1.00 0.00 ? 29 ASN A CG   2  
ATOM 1596  O OD1  . ASN A 1 29 ? 7.351   -4.579  -3.781  1.00 0.00 ? 29 ASN A OD1  2  
ATOM 1597  N ND2  . ASN A 1 29 ? 7.136   -3.698  -5.835  1.00 0.00 ? 29 ASN A ND2  2  
ATOM 1598  H H    . ASN A 1 29 ? 4.482   -5.533  -6.328  1.00 0.00 ? 29 ASN A H    2  
ATOM 1599  H HA   . ASN A 1 29 ? 6.313   -7.700  -6.419  1.00 0.00 ? 29 ASN A HA   2  
ATOM 1600  H HB2  . ASN A 1 29 ? 8.076   -6.698  -4.976  1.00 0.00 ? 29 ASN A HB2  2  
ATOM 1601  H HB3  . ASN A 1 29 ? 7.999   -5.967  -6.577  1.00 0.00 ? 29 ASN A HB3  2  
ATOM 1602  H HD21 . ASN A 1 29 ? 7.119   -3.882  -6.797  1.00 0.00 ? 29 ASN A HD21 2  
ATOM 1603  H HD22 . ASN A 1 29 ? 7.028   -2.802  -5.452  1.00 0.00 ? 29 ASN A HD22 2  
ATOM 1604  N N    . LYS A 1 30 ? 5.141   -8.366  -4.353  1.00 0.00 ? 30 LYS A N    2  
ATOM 1605  C CA   . LYS A 1 30 ? 4.491   -8.803  -3.123  1.00 0.00 ? 30 LYS A CA   2  
ATOM 1606  C C    . LYS A 1 30 ? 5.260   -8.316  -1.899  1.00 0.00 ? 30 LYS A C    2  
ATOM 1607  O O    . LYS A 1 30 ? 4.673   -8.055  -0.848  1.00 0.00 ? 30 LYS A O    2  
ATOM 1608  C CB   . LYS A 1 30 ? 4.379   -10.329 -3.095  1.00 0.00 ? 30 LYS A CB   2  
ATOM 1609  C CG   . LYS A 1 30 ? 3.778   -10.918 -4.359  1.00 0.00 ? 30 LYS A CG   2  
ATOM 1610  C CD   . LYS A 1 30 ? 3.418   -12.383 -4.175  1.00 0.00 ? 30 LYS A CD   2  
ATOM 1611  C CE   . LYS A 1 30 ? 3.465   -13.138 -5.494  1.00 0.00 ? 30 LYS A CE   2  
ATOM 1612  N NZ   . LYS A 1 30 ? 2.567   -12.529 -6.514  1.00 0.00 ? 30 LYS A NZ   2  
ATOM 1613  H H    . LYS A 1 30 ? 5.348   -9.029  -5.045  1.00 0.00 ? 30 LYS A H    2  
ATOM 1614  H HA   . LYS A 1 30 ? 3.499   -8.377  -3.103  1.00 0.00 ? 30 LYS A HA   2  
ATOM 1615  H HB2  . LYS A 1 30 ? 5.366   -10.747 -2.961  1.00 0.00 ? 30 LYS A HB2  2  
ATOM 1616  H HB3  . LYS A 1 30 ? 3.759   -10.617 -2.258  1.00 0.00 ? 30 LYS A HB3  2  
ATOM 1617  H HG2  . LYS A 1 30 ? 2.884   -10.368 -4.612  1.00 0.00 ? 30 LYS A HG2  2  
ATOM 1618  H HG3  . LYS A 1 30 ? 4.496   -10.831 -5.162  1.00 0.00 ? 30 LYS A HG3  2  
ATOM 1619  H HD2  . LYS A 1 30 ? 4.120   -12.834 -3.490  1.00 0.00 ? 30 LYS A HD2  2  
ATOM 1620  H HD3  . LYS A 1 30 ? 2.419   -12.450 -3.766  1.00 0.00 ? 30 LYS A HD3  2  
ATOM 1621  H HE2  . LYS A 1 30 ? 4.478   -13.125 -5.866  1.00 0.00 ? 30 LYS A HE2  2  
ATOM 1622  H HE3  . LYS A 1 30 ? 3.158   -14.159 -5.320  1.00 0.00 ? 30 LYS A HE3  2  
ATOM 1623  H HZ1  . LYS A 1 30 ? 2.495   -13.152 -7.344  1.00 0.00 ? 30 LYS A HZ1  2  
ATOM 1624  H HZ2  . LYS A 1 30 ? 2.943   -11.608 -6.817  1.00 0.00 ? 30 LYS A HZ2  2  
ATOM 1625  H HZ3  . LYS A 1 30 ? 1.616   -12.389 -6.116  1.00 0.00 ? 30 LYS A HZ3  2  
ATOM 1626  N N    . PHE A 1 31 ? 6.575   -8.195  -2.042  1.00 0.00 ? 31 PHE A N    2  
ATOM 1627  C CA   . PHE A 1 31 ? 7.424   -7.739  -0.947  1.00 0.00 ? 31 PHE A CA   2  
ATOM 1628  C C    . PHE A 1 31 ? 8.244   -6.522  -1.366  1.00 0.00 ? 31 PHE A C    2  
ATOM 1629  O O    . PHE A 1 31 ? 9.094   -6.608  -2.252  1.00 0.00 ? 31 PHE A O    2  
ATOM 1630  C CB   . PHE A 1 31 ? 8.356   -8.864  -0.493  1.00 0.00 ? 31 PHE A CB   2  
ATOM 1631  C CG   . PHE A 1 31 ? 7.646   -10.162 -0.232  1.00 0.00 ? 31 PHE A CG   2  
ATOM 1632  C CD1  . PHE A 1 31 ? 7.395   -11.050 -1.265  1.00 0.00 ? 31 PHE A CD1  2  
ATOM 1633  C CD2  . PHE A 1 31 ? 7.230   -10.493 1.047   1.00 0.00 ? 31 PHE A CD2  2  
ATOM 1634  C CE1  . PHE A 1 31 ? 6.742   -12.245 -1.028  1.00 0.00 ? 31 PHE A CE1  2  
ATOM 1635  C CE2  . PHE A 1 31 ? 6.577   -11.687 1.291   1.00 0.00 ? 31 PHE A CE2  2  
ATOM 1636  C CZ   . PHE A 1 31 ? 6.332   -12.563 0.251   1.00 0.00 ? 31 PHE A CZ   2  
ATOM 1637  H H    . PHE A 1 31 ? 6.985   -8.418  -2.904  1.00 0.00 ? 31 PHE A H    2  
ATOM 1638  H HA   . PHE A 1 31 ? 6.783   -7.461  -0.125  1.00 0.00 ? 31 PHE A HA   2  
ATOM 1639  H HB2  . PHE A 1 31 ? 9.096   -9.040  -1.260  1.00 0.00 ? 31 PHE A HB2  2  
ATOM 1640  H HB3  . PHE A 1 31 ? 8.852   -8.566  0.418   1.00 0.00 ? 31 PHE A HB3  2  
ATOM 1641  H HD1  . PHE A 1 31 ? 7.716   -10.801 -2.267  1.00 0.00 ? 31 PHE A HD1  2  
ATOM 1642  H HD2  . PHE A 1 31 ? 7.420   -9.809  1.861   1.00 0.00 ? 31 PHE A HD2  2  
ATOM 1643  H HE1  . PHE A 1 31 ? 6.552   -12.928 -1.843  1.00 0.00 ? 31 PHE A HE1  2  
ATOM 1644  H HE2  . PHE A 1 31 ? 6.257   -11.933 2.292   1.00 0.00 ? 31 PHE A HE2  2  
ATOM 1645  H HZ   . PHE A 1 31 ? 5.822   -13.497 0.439   1.00 0.00 ? 31 PHE A HZ   2  
ATOM 1646  N N    . ILE A 1 32 ? 7.982   -5.390  -0.722  1.00 0.00 ? 32 ILE A N    2  
ATOM 1647  C CA   . ILE A 1 32 ? 8.695   -4.156  -1.026  1.00 0.00 ? 32 ILE A CA   2  
ATOM 1648  C C    . ILE A 1 32 ? 10.052  -4.119  -0.332  1.00 0.00 ? 32 ILE A C    2  
ATOM 1649  O O    . ILE A 1 32 ? 10.393  -5.018  0.438   1.00 0.00 ? 32 ILE A O    2  
ATOM 1650  C CB   . ILE A 1 32 ? 7.883   -2.917  -0.605  1.00 0.00 ? 32 ILE A CB   2  
ATOM 1651  C CG1  . ILE A 1 32 ? 7.713   -2.884  0.915   1.00 0.00 ? 32 ILE A CG1  2  
ATOM 1652  C CG2  . ILE A 1 32 ? 6.526   -2.914  -1.294  1.00 0.00 ? 32 ILE A CG2  2  
ATOM 1653  C CD1  . ILE A 1 32 ? 6.993   -1.652  1.417   1.00 0.00 ? 32 ILE A CD1  2  
ATOM 1654  H H    . ILE A 1 32 ? 7.294   -5.384  -0.025  1.00 0.00 ? 32 ILE A H    2  
ATOM 1655  H HA   . ILE A 1 32 ? 8.848   -4.114  -2.095  1.00 0.00 ? 32 ILE A HA   2  
ATOM 1656  H HB   . ILE A 1 32 ? 8.421   -2.036  -0.919  1.00 0.00 ? 32 ILE A HB   2  
ATOM 1657  H HG12 . ILE A 1 32 ? 7.148   -3.748  1.227   1.00 0.00 ? 32 ILE A HG12 2  
ATOM 1658  H HG13 . ILE A 1 32 ? 8.689   -2.911  1.379   1.00 0.00 ? 32 ILE A HG13 2  
ATOM 1659  H HG21 . ILE A 1 32 ? 6.389   -3.846  -1.822  1.00 0.00 ? 32 ILE A HG21 2  
ATOM 1660  H HG22 . ILE A 1 32 ? 5.748   -2.801  -0.555  1.00 0.00 ? 32 ILE A HG22 2  
ATOM 1661  H HG23 . ILE A 1 32 ? 6.480   -2.094  -1.995  1.00 0.00 ? 32 ILE A HG23 2  
ATOM 1662  H HD11 . ILE A 1 32 ? 5.930   -1.770  1.269   1.00 0.00 ? 32 ILE A HD11 2  
ATOM 1663  H HD12 . ILE A 1 32 ? 7.199   -1.516  2.468   1.00 0.00 ? 32 ILE A HD12 2  
ATOM 1664  H HD13 . ILE A 1 32 ? 7.337   -0.786  0.868   1.00 0.00 ? 32 ILE A HD13 2  
ATOM 1665  N N    . THR A 1 33 ? 10.825  -3.073  -0.607  1.00 0.00 ? 33 THR A N    2  
ATOM 1666  C CA   . THR A 1 33 ? 12.145  -2.918  -0.009  1.00 0.00 ? 33 THR A CA   2  
ATOM 1667  C C    . THR A 1 33 ? 12.163  -1.769  0.993   1.00 0.00 ? 33 THR A C    2  
ATOM 1668  O O    . THR A 1 33 ? 11.317  -0.876  0.945   1.00 0.00 ? 33 THR A O    2  
ATOM 1669  C CB   . THR A 1 33 ? 13.221  -2.666  -1.082  1.00 0.00 ? 33 THR A CB   2  
ATOM 1670  O OG1  . THR A 1 33 ? 14.450  -2.274  -0.460  1.00 0.00 ? 33 THR A OG1  2  
ATOM 1671  C CG2  . THR A 1 33 ? 12.773  -1.587  -2.056  1.00 0.00 ? 33 THR A CG2  2  
ATOM 1672  H H    . THR A 1 33 ? 10.497  -2.389  -1.229  1.00 0.00 ? 33 THR A H    2  
ATOM 1673  H HA   . THR A 1 33 ? 12.387  -3.836  0.506   1.00 0.00 ? 33 THR A HA   2  
ATOM 1674  H HB   . THR A 1 33 ? 13.381  -3.583  -1.632  1.00 0.00 ? 33 THR A HB   2  
ATOM 1675  H HG1  . THR A 1 33 ? 15.158  -2.297  -1.108  1.00 0.00 ? 33 THR A HG1  2  
ATOM 1676  H HG21 . THR A 1 33 ? 12.547  -2.036  -3.012  1.00 0.00 ? 33 THR A HG21 2  
ATOM 1677  H HG22 . THR A 1 33 ? 13.563  -0.861  -2.177  1.00 0.00 ? 33 THR A HG22 2  
ATOM 1678  H HG23 . THR A 1 33 ? 11.891  -1.099  -1.670  1.00 0.00 ? 33 THR A HG23 2  
ATOM 1679  N N    . LYS A 1 34 ? 13.134  -1.797  1.900   1.00 0.00 ? 34 LYS A N    2  
ATOM 1680  C CA   . LYS A 1 34 ? 13.265  -0.757  2.913   1.00 0.00 ? 34 LYS A CA   2  
ATOM 1681  C C    . LYS A 1 34 ? 13.261  0.628   2.274   1.00 0.00 ? 34 LYS A C    2  
ATOM 1682  O O    . LYS A 1 34 ? 12.808  1.600   2.880   1.00 0.00 ? 34 LYS A O    2  
ATOM 1683  C CB   . LYS A 1 34 ? 14.552  -0.957  3.715   1.00 0.00 ? 34 LYS A CB   2  
ATOM 1684  C CG   . LYS A 1 34 ? 14.355  -1.754  4.992   1.00 0.00 ? 34 LYS A CG   2  
ATOM 1685  C CD   . LYS A 1 34 ? 15.641  -1.844  5.798   1.00 0.00 ? 34 LYS A CD   2  
ATOM 1686  C CE   . LYS A 1 34 ? 15.429  -2.594  7.104   1.00 0.00 ? 34 LYS A CE   2  
ATOM 1687  N NZ   . LYS A 1 34 ? 16.671  -2.641  7.924   1.00 0.00 ? 34 LYS A NZ   2  
ATOM 1688  H H    . LYS A 1 34 ? 13.779  -2.535  1.886   1.00 0.00 ? 34 LYS A H    2  
ATOM 1689  H HA   . LYS A 1 34 ? 12.419  -0.835  3.580   1.00 0.00 ? 34 LYS A HA   2  
ATOM 1690  H HB2  . LYS A 1 34 ? 15.270  -1.476  3.098   1.00 0.00 ? 34 LYS A HB2  2  
ATOM 1691  H HB3  . LYS A 1 34 ? 14.952  0.012   3.979   1.00 0.00 ? 34 LYS A HB3  2  
ATOM 1692  H HG2  . LYS A 1 34 ? 13.599  -1.273  5.594   1.00 0.00 ? 34 LYS A HG2  2  
ATOM 1693  H HG3  . LYS A 1 34 ? 14.032  -2.753  4.736   1.00 0.00 ? 34 LYS A HG3  2  
ATOM 1694  H HD2  . LYS A 1 34 ? 16.386  -2.364  5.214   1.00 0.00 ? 34 LYS A HD2  2  
ATOM 1695  H HD3  . LYS A 1 34 ? 15.988  -0.844  6.019   1.00 0.00 ? 34 LYS A HD3  2  
ATOM 1696  H HE2  . LYS A 1 34 ? 14.655  -2.097  7.668   1.00 0.00 ? 34 LYS A HE2  2  
ATOM 1697  H HE3  . LYS A 1 34 ? 15.119  -3.603  6.878   1.00 0.00 ? 34 LYS A HE3  2  
ATOM 1698  H HZ1  . LYS A 1 34 ? 16.443  -2.908  8.903   1.00 0.00 ? 34 LYS A HZ1  2  
ATOM 1699  H HZ2  . LYS A 1 34 ? 17.131  -1.708  7.930   1.00 0.00 ? 34 LYS A HZ2  2  
ATOM 1700  H HZ3  . LYS A 1 34 ? 17.333  -3.340  7.531   1.00 0.00 ? 34 LYS A HZ3  2  
ATOM 1701  N N    . ASP A 1 35 ? 13.766  0.711   1.049   1.00 0.00 ? 35 ASP A N    2  
ATOM 1702  C CA   . ASP A 1 35 ? 13.819  1.977   0.327   1.00 0.00 ? 35 ASP A CA   2  
ATOM 1703  C C    . ASP A 1 35 ? 12.429  2.391   -0.146  1.00 0.00 ? 35 ASP A C    2  
ATOM 1704  O O    . ASP A 1 35 ? 12.085  3.574   -0.139  1.00 0.00 ? 35 ASP A O    2  
ATOM 1705  C CB   . ASP A 1 35 ? 14.766  1.868   -0.869  1.00 0.00 ? 35 ASP A CB   2  
ATOM 1706  C CG   . ASP A 1 35 ? 16.218  2.055   -0.476  1.00 0.00 ? 35 ASP A CG   2  
ATOM 1707  O OD1  . ASP A 1 35 ? 16.592  1.623   0.634   1.00 0.00 ? 35 ASP A OD1  2  
ATOM 1708  O OD2  . ASP A 1 35 ? 16.980  2.635   -1.278  1.00 0.00 ? 35 ASP A OD2  2  
ATOM 1709  H H    . ASP A 1 35 ? 14.112  -0.099  0.618   1.00 0.00 ? 35 ASP A H    2  
ATOM 1710  H HA   . ASP A 1 35 ? 14.194  2.730   1.004   1.00 0.00 ? 35 ASP A HA   2  
ATOM 1711  H HB2  . ASP A 1 35 ? 14.657  0.892   -1.319  1.00 0.00 ? 35 ASP A HB2  2  
ATOM 1712  H HB3  . ASP A 1 35 ? 14.507  2.625   -1.595  1.00 0.00 ? 35 ASP A HB3  2  
ATOM 1713  N N    . LYS A 1 36 ? 11.632  1.410   -0.557  1.00 0.00 ? 36 LYS A N    2  
ATOM 1714  C CA   . LYS A 1 36 ? 10.279  1.671   -1.033  1.00 0.00 ? 36 LYS A CA   2  
ATOM 1715  C C    . LYS A 1 36 ? 9.340   1.968   0.132   1.00 0.00 ? 36 LYS A C    2  
ATOM 1716  O O    . LYS A 1 36 ? 8.581   2.936   0.098   1.00 0.00 ? 36 LYS A O    2  
ATOM 1717  C CB   . LYS A 1 36 ? 9.757   0.474   -1.830  1.00 0.00 ? 36 LYS A CB   2  
ATOM 1718  C CG   . LYS A 1 36 ? 8.282   0.572   -2.180  1.00 0.00 ? 36 LYS A CG   2  
ATOM 1719  C CD   . LYS A 1 36 ? 7.996   1.779   -3.056  1.00 0.00 ? 36 LYS A CD   2  
ATOM 1720  C CE   . LYS A 1 36 ? 8.611   1.623   -4.439  1.00 0.00 ? 36 LYS A CE   2  
ATOM 1721  N NZ   . LYS A 1 36 ? 8.226   2.739   -5.346  1.00 0.00 ? 36 LYS A NZ   2  
ATOM 1722  H H    . LYS A 1 36 ? 11.963  0.487   -0.539  1.00 0.00 ? 36 LYS A H    2  
ATOM 1723  H HA   . LYS A 1 36 ? 10.316  2.535   -1.679  1.00 0.00 ? 36 LYS A HA   2  
ATOM 1724  H HB2  . LYS A 1 36 ? 10.319  0.396   -2.749  1.00 0.00 ? 36 LYS A HB2  2  
ATOM 1725  H HB3  . LYS A 1 36 ? 9.909   -0.424  -1.249  1.00 0.00 ? 36 LYS A HB3  2  
ATOM 1726  H HG2  . LYS A 1 36 ? 7.987   -0.322  -2.709  1.00 0.00 ? 36 LYS A HG2  2  
ATOM 1727  H HG3  . LYS A 1 36 ? 7.711   0.657   -1.267  1.00 0.00 ? 36 LYS A HG3  2  
ATOM 1728  H HD2  . LYS A 1 36 ? 6.927   1.892   -3.161  1.00 0.00 ? 36 LYS A HD2  2  
ATOM 1729  H HD3  . LYS A 1 36 ? 8.409   2.661   -2.586  1.00 0.00 ? 36 LYS A HD3  2  
ATOM 1730  H HE2  . LYS A 1 36 ? 9.685   1.605   -4.341  1.00 0.00 ? 36 LYS A HE2  2  
ATOM 1731  H HE3  . LYS A 1 36 ? 8.272   0.690   -4.865  1.00 0.00 ? 36 LYS A HE3  2  
ATOM 1732  H HZ1  . LYS A 1 36 ? 7.890   2.360   -6.255  1.00 0.00 ? 36 LYS A HZ1  2  
ATOM 1733  H HZ2  . LYS A 1 36 ? 9.044   3.355   -5.522  1.00 0.00 ? 36 LYS A HZ2  2  
ATOM 1734  H HZ3  . LYS A 1 36 ? 7.466   3.304   -4.917  1.00 0.00 ? 36 LYS A HZ3  2  
ATOM 1735  N N    . ARG A 1 37 ? 9.398   1.129   1.161   1.00 0.00 ? 37 ARG A N    2  
ATOM 1736  C CA   . ARG A 1 37 ? 8.553   1.302   2.337   1.00 0.00 ? 37 ARG A CA   2  
ATOM 1737  C C    . ARG A 1 37 ? 8.672   2.720   2.887   1.00 0.00 ? 37 ARG A C    2  
ATOM 1738  O O    . ARG A 1 37 ? 7.722   3.257   3.457   1.00 0.00 ? 37 ARG A O    2  
ATOM 1739  C CB   . ARG A 1 37 ? 8.934   0.290   3.418   1.00 0.00 ? 37 ARG A CB   2  
ATOM 1740  C CG   . ARG A 1 37 ? 7.918   0.191   4.545   1.00 0.00 ? 37 ARG A CG   2  
ATOM 1741  C CD   . ARG A 1 37 ? 7.884   -1.206  5.143   1.00 0.00 ? 37 ARG A CD   2  
ATOM 1742  N NE   . ARG A 1 37 ? 9.223   -1.711  5.433   1.00 0.00 ? 37 ARG A NE   2  
ATOM 1743  C CZ   . ARG A 1 37 ? 9.504   -2.999  5.596   1.00 0.00 ? 37 ARG A CZ   2  
ATOM 1744  N NH1  . ARG A 1 37 ? 8.544   -3.908  5.497   1.00 0.00 ? 37 ARG A NH1  2  
ATOM 1745  N NH2  . ARG A 1 37 ? 10.748  -3.380  5.858   1.00 0.00 ? 37 ARG A NH2  2  
ATOM 1746  H H    . ARG A 1 37 ? 10.024  0.375   1.129   1.00 0.00 ? 37 ARG A H    2  
ATOM 1747  H HA   . ARG A 1 37 ? 7.530   1.129   2.038   1.00 0.00 ? 37 ARG A HA   2  
ATOM 1748  H HB2  . ARG A 1 37 ? 9.030   -0.686  2.965   1.00 0.00 ? 37 ARG A HB2  2  
ATOM 1749  H HB3  . ARG A 1 37 ? 9.884   0.576   3.844   1.00 0.00 ? 37 ARG A HB3  2  
ATOM 1750  H HG2  . ARG A 1 37 ? 8.184   0.896   5.319   1.00 0.00 ? 37 ARG A HG2  2  
ATOM 1751  H HG3  . ARG A 1 37 ? 6.940   0.432   4.157   1.00 0.00 ? 37 ARG A HG3  2  
ATOM 1752  H HD2  . ARG A 1 37 ? 7.314   -1.177  6.060   1.00 0.00 ? 37 ARG A HD2  2  
ATOM 1753  H HD3  . ARG A 1 37 ? 7.402   -1.871  4.442   1.00 0.00 ? 37 ARG A HD3  2  
ATOM 1754  H HE   . ARG A 1 37 ? 9.948   -1.056  5.511   1.00 0.00 ? 37 ARG A HE   2  
ATOM 1755  H HH11 . ARG A 1 37 ? 7.606   -3.624  5.299   1.00 0.00 ? 37 ARG A HH11 2  
ATOM 1756  H HH12 . ARG A 1 37 ? 8.758   -4.877  5.619   1.00 0.00 ? 37 ARG A HH12 2  
ATOM 1757  H HH21 . ARG A 1 37 ? 11.474  -2.697  5.932   1.00 0.00 ? 37 ARG A HH21 2  
ATOM 1758  H HH22 . ARG A 1 37 ? 10.958  -4.349  5.980   1.00 0.00 ? 37 ARG A HH22 2  
ATOM 1759  N N    . ARG A 1 38 ? 9.844   3.321   2.713   1.00 0.00 ? 38 ARG A N    2  
ATOM 1760  C CA   . ARG A 1 38 ? 10.088  4.675   3.194   1.00 0.00 ? 38 ARG A CA   2  
ATOM 1761  C C    . ARG A 1 38 ? 9.434   5.704   2.276   1.00 0.00 ? 38 ARG A C    2  
ATOM 1762  O O    . ARG A 1 38 ? 8.942   6.736   2.732   1.00 0.00 ? 38 ARG A O    2  
ATOM 1763  C CB   . ARG A 1 38 ? 11.591  4.943   3.290   1.00 0.00 ? 38 ARG A CB   2  
ATOM 1764  C CG   . ARG A 1 38 ? 12.262  4.238   4.457   1.00 0.00 ? 38 ARG A CG   2  
ATOM 1765  C CD   . ARG A 1 38 ? 13.776  4.373   4.393   1.00 0.00 ? 38 ARG A CD   2  
ATOM 1766  N NE   . ARG A 1 38 ? 14.225  5.698   4.813   1.00 0.00 ? 38 ARG A NE   2  
ATOM 1767  C CZ   . ARG A 1 38 ? 14.287  6.085   6.082   1.00 0.00 ? 38 ARG A CZ   2  
ATOM 1768  N NH1  . ARG A 1 38 ? 13.932  5.253   7.051   1.00 0.00 ? 38 ARG A NH1  2  
ATOM 1769  N NH2  . ARG A 1 38 ? 14.707  7.307   6.384   1.00 0.00 ? 38 ARG A NH2  2  
ATOM 1770  H H    . ARG A 1 38 ? 10.563  2.842   2.251   1.00 0.00 ? 38 ARG A H    2  
ATOM 1771  H HA   . ARG A 1 38 ? 9.653   4.761   4.179   1.00 0.00 ? 38 ARG A HA   2  
ATOM 1772  H HB2  . ARG A 1 38 ? 12.063  4.610   2.377   1.00 0.00 ? 38 ARG A HB2  2  
ATOM 1773  H HB3  . ARG A 1 38 ? 11.748  6.005   3.400   1.00 0.00 ? 38 ARG A HB3  2  
ATOM 1774  H HG2  . ARG A 1 38 ? 11.911  4.675   5.380   1.00 0.00 ? 38 ARG A HG2  2  
ATOM 1775  H HG3  . ARG A 1 38 ? 12.001  3.191   4.430   1.00 0.00 ? 38 ARG A HG3  2  
ATOM 1776  H HD2  . ARG A 1 38 ? 14.217  3.632   5.042   1.00 0.00 ? 38 ARG A HD2  2  
ATOM 1777  H HD3  . ARG A 1 38 ? 14.097  4.199   3.377   1.00 0.00 ? 38 ARG A HD3  2  
ATOM 1778  H HE   . ARG A 1 38 ? 14.492  6.329   4.113   1.00 0.00 ? 38 ARG A HE   2  
ATOM 1779  H HH11 . ARG A 1 38 ? 13.616  4.331   6.826   1.00 0.00 ? 38 ARG A HH11 2  
ATOM 1780  H HH12 . ARG A 1 38 ? 13.981  5.547   8.006   1.00 0.00 ? 38 ARG A HH12 2  
ATOM 1781  H HH21 . ARG A 1 38 ? 14.976  7.938   5.656   1.00 0.00 ? 38 ARG A HH21 2  
ATOM 1782  H HH22 . ARG A 1 38 ? 14.753  7.598   7.339   1.00 0.00 ? 38 ARG A HH22 2  
ATOM 1783  N N    . LYS A 1 39 ? 9.433   5.416   0.979   1.00 0.00 ? 39 LYS A N    2  
ATOM 1784  C CA   . LYS A 1 39 ? 8.840   6.314   -0.005  1.00 0.00 ? 39 LYS A CA   2  
ATOM 1785  C C    . LYS A 1 39 ? 7.319   6.309   0.102   1.00 0.00 ? 39 LYS A C    2  
ATOM 1786  O O    . LYS A 1 39 ? 6.687   7.365   0.145   1.00 0.00 ? 39 LYS A O    2  
ATOM 1787  C CB   . LYS A 1 39 ? 9.265   5.908   -1.418  1.00 0.00 ? 39 LYS A CB   2  
ATOM 1788  C CG   . LYS A 1 39 ? 10.681  6.326   -1.771  1.00 0.00 ? 39 LYS A CG   2  
ATOM 1789  C CD   . LYS A 1 39 ? 10.750  7.795   -2.153  1.00 0.00 ? 39 LYS A CD   2  
ATOM 1790  C CE   . LYS A 1 39 ? 10.330  8.015   -3.598  1.00 0.00 ? 39 LYS A CE   2  
ATOM 1791  N NZ   . LYS A 1 39 ? 11.288  7.394   -4.555  1.00 0.00 ? 39 LYS A NZ   2  
ATOM 1792  H H    . LYS A 1 39 ? 9.841   4.577   0.676   1.00 0.00 ? 39 LYS A H    2  
ATOM 1793  H HA   . LYS A 1 39 ? 9.200   7.311   0.197   1.00 0.00 ? 39 LYS A HA   2  
ATOM 1794  H HB2  . LYS A 1 39 ? 9.196   4.834   -1.507  1.00 0.00 ? 39 LYS A HB2  2  
ATOM 1795  H HB3  . LYS A 1 39 ? 8.590   6.363   -2.128  1.00 0.00 ? 39 LYS A HB3  2  
ATOM 1796  H HG2  . LYS A 1 39 ? 11.321  6.157   -0.917  1.00 0.00 ? 39 LYS A HG2  2  
ATOM 1797  H HG3  . LYS A 1 39 ? 11.026  5.730   -2.604  1.00 0.00 ? 39 LYS A HG3  2  
ATOM 1798  H HD2  . LYS A 1 39 ? 10.091  8.357   -1.509  1.00 0.00 ? 39 LYS A HD2  2  
ATOM 1799  H HD3  . LYS A 1 39 ? 11.765  8.144   -2.025  1.00 0.00 ? 39 LYS A HD3  2  
ATOM 1800  H HE2  . LYS A 1 39 ? 9.354   7.580   -3.746  1.00 0.00 ? 39 LYS A HE2  2  
ATOM 1801  H HE3  . LYS A 1 39 ? 10.283  9.078   -3.788  1.00 0.00 ? 39 LYS A HE3  2  
ATOM 1802  H HZ1  . LYS A 1 39 ? 10.799  6.689   -5.143  1.00 0.00 ? 39 LYS A HZ1  2  
ATOM 1803  H HZ2  . LYS A 1 39 ? 12.056  6.923   -4.036  1.00 0.00 ? 39 LYS A HZ2  2  
ATOM 1804  H HZ3  . LYS A 1 39 ? 11.697  8.122   -5.174  1.00 0.00 ? 39 LYS A HZ3  2  
ATOM 1805  N N    . ILE A 1 40 ? 6.737   5.115   0.144   1.00 0.00 ? 40 ILE A N    2  
ATOM 1806  C CA   . ILE A 1 40 ? 5.290   4.974   0.248   1.00 0.00 ? 40 ILE A CA   2  
ATOM 1807  C C    . ILE A 1 40 ? 4.752   5.715   1.467   1.00 0.00 ? 40 ILE A C    2  
ATOM 1808  O O    . ILE A 1 40 ? 3.685   6.327   1.414   1.00 0.00 ? 40 ILE A O    2  
ATOM 1809  C CB   . ILE A 1 40 ? 4.873   3.494   0.336   1.00 0.00 ? 40 ILE A CB   2  
ATOM 1810  C CG1  . ILE A 1 40 ? 5.417   2.716   -0.864  1.00 0.00 ? 40 ILE A CG1  2  
ATOM 1811  C CG2  . ILE A 1 40 ? 3.359   3.373   0.411   1.00 0.00 ? 40 ILE A CG2  2  
ATOM 1812  C CD1  . ILE A 1 40 ? 5.154   1.228   -0.790  1.00 0.00 ? 40 ILE A CD1  2  
ATOM 1813  H H    . ILE A 1 40 ? 7.294   4.310   0.106   1.00 0.00 ? 40 ILE A H    2  
ATOM 1814  H HA   . ILE A 1 40 ? 4.849   5.399   -0.642  1.00 0.00 ? 40 ILE A HA   2  
ATOM 1815  H HB   . ILE A 1 40 ? 5.288   3.079   1.242   1.00 0.00 ? 40 ILE A HB   2  
ATOM 1816  H HG12 . ILE A 1 40 ? 4.956   3.089   -1.765  1.00 0.00 ? 40 ILE A HG12 2  
ATOM 1817  H HG13 . ILE A 1 40 ? 6.486   2.862   -0.924  1.00 0.00 ? 40 ILE A HG13 2  
ATOM 1818  H HG21 . ILE A 1 40 ? 3.014   3.753   1.361   1.00 0.00 ? 40 ILE A HG21 2  
ATOM 1819  H HG22 . ILE A 1 40 ? 2.913   3.947   -0.388  1.00 0.00 ? 40 ILE A HG22 2  
ATOM 1820  H HG23 . ILE A 1 40 ? 3.074   2.337   0.312   1.00 0.00 ? 40 ILE A HG23 2  
ATOM 1821  H HD11 . ILE A 1 40 ? 5.476   0.853   0.170   1.00 0.00 ? 40 ILE A HD11 2  
ATOM 1822  H HD12 . ILE A 1 40 ? 4.098   1.043   -0.914  1.00 0.00 ? 40 ILE A HD12 2  
ATOM 1823  H HD13 . ILE A 1 40 ? 5.702   0.727   -1.575  1.00 0.00 ? 40 ILE A HD13 2  
ATOM 1824  N N    . SER A 1 41 ? 5.498   5.658   2.566   1.00 0.00 ? 41 SER A N    2  
ATOM 1825  C CA   . SER A 1 41 ? 5.095   6.322   3.799   1.00 0.00 ? 41 SER A CA   2  
ATOM 1826  C C    . SER A 1 41 ? 5.004   7.832   3.599   1.00 0.00 ? 41 SER A C    2  
ATOM 1827  O O    . SER A 1 41 ? 4.257   8.517   4.296   1.00 0.00 ? 41 SER A O    2  
ATOM 1828  C CB   . SER A 1 41 ? 6.086   6.005   4.921   1.00 0.00 ? 41 SER A CB   2  
ATOM 1829  O OG   . SER A 1 41 ? 6.198   7.091   5.825   1.00 0.00 ? 41 SER A OG   2  
ATOM 1830  H H    . SER A 1 41 ? 6.339   5.154   2.546   1.00 0.00 ? 41 SER A H    2  
ATOM 1831  H HA   . SER A 1 41 ? 4.121   5.947   4.075   1.00 0.00 ? 41 SER A HA   2  
ATOM 1832  H HB2  . SER A 1 41 ? 5.746   5.135   5.463   1.00 0.00 ? 41 SER A HB2  2  
ATOM 1833  H HB3  . SER A 1 41 ? 7.058   5.805   4.494   1.00 0.00 ? 41 SER A HB3  2  
ATOM 1834  H HG   . SER A 1 41 ? 6.554   6.777   6.660   1.00 0.00 ? 41 SER A HG   2  
ATOM 1835  N N    . ALA A 1 42 ? 5.769   8.342   2.640   1.00 0.00 ? 42 ALA A N    2  
ATOM 1836  C CA   . ALA A 1 42 ? 5.774   9.770   2.345   1.00 0.00 ? 42 ALA A CA   2  
ATOM 1837  C C    . ALA A 1 42 ? 4.705   10.121  1.316   1.00 0.00 ? 42 ALA A C    2  
ATOM 1838  O O    . ALA A 1 42 ? 4.039   11.150  1.425   1.00 0.00 ? 42 ALA A O    2  
ATOM 1839  C CB   . ALA A 1 42 ? 7.147   10.202  1.852   1.00 0.00 ? 42 ALA A CB   2  
ATOM 1840  H H    . ALA A 1 42 ? 6.344   7.744   2.118   1.00 0.00 ? 42 ALA A H    2  
ATOM 1841  H HA   . ALA A 1 42 ? 5.564   10.301  3.262   1.00 0.00 ? 42 ALA A HA   2  
ATOM 1842  H HB1  . ALA A 1 42 ? 7.055   10.627  0.863   1.00 0.00 ? 42 ALA A HB1  2  
ATOM 1843  H HB2  . ALA A 1 42 ? 7.555   10.941  2.525   1.00 0.00 ? 42 ALA A HB2  2  
ATOM 1844  H HB3  . ALA A 1 42 ? 7.802   9.345   1.816   1.00 0.00 ? 42 ALA A HB3  2  
ATOM 1845  N N    . ALA A 1 43 ? 4.547   9.260   0.316   1.00 0.00 ? 43 ALA A N    2  
ATOM 1846  C CA   . ALA A 1 43 ? 3.558   9.479   -0.732  1.00 0.00 ? 43 ALA A CA   2  
ATOM 1847  C C    . ALA A 1 43 ? 2.140   9.353   -0.184  1.00 0.00 ? 43 ALA A C    2  
ATOM 1848  O O    . ALA A 1 43 ? 1.265   10.158  -0.504  1.00 0.00 ? 43 ALA A O    2  
ATOM 1849  C CB   . ALA A 1 43 ? 3.774   8.498   -1.875  1.00 0.00 ? 43 ALA A CB   2  
ATOM 1850  H H    . ALA A 1 43 ? 5.108   8.457   0.283   1.00 0.00 ? 43 ALA A H    2  
ATOM 1851  H HA   . ALA A 1 43 ? 3.696   10.479  -1.118  1.00 0.00 ? 43 ALA A HA   2  
ATOM 1852  H HB1  . ALA A 1 43 ? 2.861   7.947   -2.052  1.00 0.00 ? 43 ALA A HB1  2  
ATOM 1853  H HB2  . ALA A 1 43 ? 4.047   9.040   -2.768  1.00 0.00 ? 43 ALA A HB2  2  
ATOM 1854  H HB3  . ALA A 1 43 ? 4.564   7.811   -1.614  1.00 0.00 ? 43 ALA A HB3  2  
ATOM 1855  N N    . THR A 1 44 ? 1.919   8.335   0.643   1.00 0.00 ? 44 THR A N    2  
ATOM 1856  C CA   . THR A 1 44 ? 0.607   8.102   1.233   1.00 0.00 ? 44 THR A CA   2  
ATOM 1857  C C    . THR A 1 44 ? 0.542   8.641   2.658   1.00 0.00 ? 44 THR A C    2  
ATOM 1858  O O    . THR A 1 44 ? -0.455  8.457   3.356   1.00 0.00 ? 44 THR A O    2  
ATOM 1859  C CB   . THR A 1 44 ? 0.255   6.603   1.247   1.00 0.00 ? 44 THR A CB   2  
ATOM 1860  O OG1  . THR A 1 44 ? 1.121   5.905   2.149   1.00 0.00 ? 44 THR A OG1  2  
ATOM 1861  C CG2  . THR A 1 44 ? 0.379   6.006   -0.147  1.00 0.00 ? 44 THR A CG2  2  
ATOM 1862  H H    . THR A 1 44 ? 2.656   7.728   0.859   1.00 0.00 ? 44 THR A H    2  
ATOM 1863  H HA   . THR A 1 44 ? -0.127  8.617   0.630   1.00 0.00 ? 44 THR A HA   2  
ATOM 1864  H HB   . THR A 1 44 ? -0.766  6.491   1.581   1.00 0.00 ? 44 THR A HB   2  
ATOM 1865  H HG1  . THR A 1 44 ? 1.951   5.708   1.709   1.00 0.00 ? 44 THR A HG1  2  
ATOM 1866  H HG21 . THR A 1 44 ? 0.085   4.967   -0.121  1.00 0.00 ? 44 THR A HG21 2  
ATOM 1867  H HG22 . THR A 1 44 ? 1.403   6.081   -0.481  1.00 0.00 ? 44 THR A HG22 2  
ATOM 1868  H HG23 . THR A 1 44 ? -0.263  6.544   -0.827  1.00 0.00 ? 44 THR A HG23 2  
ATOM 1869  N N    . SER A 1 45 ? 1.611   9.307   3.083   1.00 0.00 ? 45 SER A N    2  
ATOM 1870  C CA   . SER A 1 45 ? 1.676   9.869   4.427   1.00 0.00 ? 45 SER A CA   2  
ATOM 1871  C C    . SER A 1 45 ? 1.336   8.814   5.475   1.00 0.00 ? 45 SER A C    2  
ATOM 1872  O O    . SER A 1 45 ? 0.742   9.118   6.510   1.00 0.00 ? 45 SER A O    2  
ATOM 1873  C CB   . SER A 1 45 ? 0.719   11.056  4.553   1.00 0.00 ? 45 SER A CB   2  
ATOM 1874  O OG   . SER A 1 45 ? 0.761   11.871  3.394   1.00 0.00 ? 45 SER A OG   2  
ATOM 1875  H H    . SER A 1 45 ? 2.375   9.420   2.480   1.00 0.00 ? 45 SER A H    2  
ATOM 1876  H HA   . SER A 1 45 ? 2.686   10.213  4.594   1.00 0.00 ? 45 SER A HA   2  
ATOM 1877  H HB2  . SER A 1 45 ? -0.288  10.691  4.684   1.00 0.00 ? 45 SER A HB2  2  
ATOM 1878  H HB3  . SER A 1 45 ? 1.000   11.653  5.409   1.00 0.00 ? 45 SER A HB3  2  
ATOM 1879  H HG   . SER A 1 45 ? -0.126  12.165  3.177   1.00 0.00 ? 45 SER A HG   2  
ATOM 1880  N N    . LEU A 1 46 ? 1.717   7.572   5.199   1.00 0.00 ? 46 LEU A N    2  
ATOM 1881  C CA   . LEU A 1 46 ? 1.454   6.469   6.117   1.00 0.00 ? 46 LEU A CA   2  
ATOM 1882  C C    . LEU A 1 46 ? 2.709   6.103   6.904   1.00 0.00 ? 46 LEU A C    2  
ATOM 1883  O O    . LEU A 1 46 ? 3.769   6.698   6.711   1.00 0.00 ? 46 LEU A O    2  
ATOM 1884  C CB   . LEU A 1 46 ? 0.947   5.248   5.347   1.00 0.00 ? 46 LEU A CB   2  
ATOM 1885  C CG   . LEU A 1 46 ? -0.495  5.323   4.846   1.00 0.00 ? 46 LEU A CG   2  
ATOM 1886  C CD1  . LEU A 1 46 ? -0.725  4.314   3.730   1.00 0.00 ? 46 LEU A CD1  2  
ATOM 1887  C CD2  . LEU A 1 46 ? -1.471  5.087   5.989   1.00 0.00 ? 46 LEU A CD2  2  
ATOM 1888  H H    . LEU A 1 46 ? 2.187   7.390   4.359   1.00 0.00 ? 46 LEU A H    2  
ATOM 1889  H HA   . LEU A 1 46 ? 0.691   6.790   6.810   1.00 0.00 ? 46 LEU A HA   2  
ATOM 1890  H HB2  . LEU A 1 46 ? 1.588   5.108   4.491   1.00 0.00 ? 46 LEU A HB2  2  
ATOM 1891  H HB3  . LEU A 1 46 ? 1.028   4.390   5.999   1.00 0.00 ? 46 LEU A HB3  2  
ATOM 1892  H HG   . LEU A 1 46 ? -0.680  6.310   4.445   1.00 0.00 ? 46 LEU A HG   2  
ATOM 1893  H HD11 . LEU A 1 46 ? -1.233  4.796   2.909   1.00 0.00 ? 46 LEU A HD11 2  
ATOM 1894  H HD12 . LEU A 1 46 ? -1.330  3.500   4.100   1.00 0.00 ? 46 LEU A HD12 2  
ATOM 1895  H HD13 . LEU A 1 46 ? 0.226   3.930   3.391   1.00 0.00 ? 46 LEU A HD13 2  
ATOM 1896  H HD21 . LEU A 1 46 ? -1.406  5.905   6.692   1.00 0.00 ? 46 LEU A HD21 2  
ATOM 1897  H HD22 . LEU A 1 46 ? -1.222  4.162   6.490   1.00 0.00 ? 46 LEU A HD22 2  
ATOM 1898  H HD23 . LEU A 1 46 ? -2.475  5.026   5.599   1.00 0.00 ? 46 LEU A HD23 2  
ATOM 1899  N N    . SER A 1 47 ? 2.581   5.120   7.789   1.00 0.00 ? 47 SER A N    2  
ATOM 1900  C CA   . SER A 1 47 ? 3.704   4.676   8.605   1.00 0.00 ? 47 SER A CA   2  
ATOM 1901  C C    . SER A 1 47 ? 4.381   3.458   7.983   1.00 0.00 ? 47 SER A C    2  
ATOM 1902  O O    . SER A 1 47 ? 3.768   2.722   7.210   1.00 0.00 ? 47 SER A O    2  
ATOM 1903  C CB   . SER A 1 47 ? 3.232   4.342   10.022  1.00 0.00 ? 47 SER A CB   2  
ATOM 1904  O OG   . SER A 1 47 ? 4.235   4.639   10.978  1.00 0.00 ? 47 SER A OG   2  
ATOM 1905  H H    . SER A 1 47 ? 1.709   4.685   7.896   1.00 0.00 ? 47 SER A H    2  
ATOM 1906  H HA   . SER A 1 47 ? 4.419   5.484   8.655   1.00 0.00 ? 47 SER A HA   2  
ATOM 1907  H HB2  . SER A 1 47 ? 2.351   4.921   10.250  1.00 0.00 ? 47 SER A HB2  2  
ATOM 1908  H HB3  . SER A 1 47 ? 2.996   3.289   10.081  1.00 0.00 ? 47 SER A HB3  2  
ATOM 1909  H HG   . SER A 1 47 ? 4.337   5.591   11.049  1.00 0.00 ? 47 SER A HG   2  
ATOM 1910  N N    . GLU A 1 48 ? 5.649   3.254   8.325   1.00 0.00 ? 48 GLU A N    2  
ATOM 1911  C CA   . GLU A 1 48 ? 6.410   2.127   7.799   1.00 0.00 ? 48 GLU A CA   2  
ATOM 1912  C C    . GLU A 1 48 ? 5.703   0.808   8.096   1.00 0.00 ? 48 GLU A C    2  
ATOM 1913  O O    . GLU A 1 48 ? 5.623   -0.073  7.239   1.00 0.00 ? 48 GLU A O    2  
ATOM 1914  C CB   . GLU A 1 48 ? 7.818   2.110   8.397   1.00 0.00 ? 48 GLU A CB   2  
ATOM 1915  C CG   . GLU A 1 48 ? 8.568   3.420   8.226   1.00 0.00 ? 48 GLU A CG   2  
ATOM 1916  C CD   . GLU A 1 48 ? 9.960   3.378   8.828   1.00 0.00 ? 48 GLU A CD   2  
ATOM 1917  O OE1  . GLU A 1 48 ? 10.899  2.956   8.123   1.00 0.00 ? 48 GLU A OE1  2  
ATOM 1918  O OE2  . GLU A 1 48 ? 10.108  3.769   10.005  1.00 0.00 ? 48 GLU A OE2  2  
ATOM 1919  H H    . GLU A 1 48 ? 6.083   3.876   8.946   1.00 0.00 ? 48 GLU A H    2  
ATOM 1920  H HA   . GLU A 1 48 ? 6.485   2.248   6.729   1.00 0.00 ? 48 GLU A HA   2  
ATOM 1921  H HB2  . GLU A 1 48 ? 7.745   1.895   9.453   1.00 0.00 ? 48 GLU A HB2  2  
ATOM 1922  H HB3  . GLU A 1 48 ? 8.389   1.327   7.919   1.00 0.00 ? 48 GLU A HB3  2  
ATOM 1923  H HG2  . GLU A 1 48 ? 8.655   3.635   7.172   1.00 0.00 ? 48 GLU A HG2  2  
ATOM 1924  H HG3  . GLU A 1 48 ? 8.007   4.207   8.708   1.00 0.00 ? 48 GLU A HG3  2  
ATOM 1925  N N    . ARG A 1 49 ? 5.192   0.678   9.316   1.00 0.00 ? 49 ARG A N    2  
ATOM 1926  C CA   . ARG A 1 49 ? 4.494   -0.534  9.727   1.00 0.00 ? 49 ARG A CA   2  
ATOM 1927  C C    . ARG A 1 49 ? 3.131   -0.632  9.049   1.00 0.00 ? 49 ARG A C    2  
ATOM 1928  O O    . ARG A 1 49 ? 2.733   -1.701  8.588   1.00 0.00 ? 49 ARG A O    2  
ATOM 1929  C CB   . ARG A 1 49 ? 4.322   -0.558  11.247  1.00 0.00 ? 49 ARG A CB   2  
ATOM 1930  C CG   . ARG A 1 49 ? 3.805   -1.884  11.781  1.00 0.00 ? 49 ARG A CG   2  
ATOM 1931  C CD   . ARG A 1 49 ? 4.943   -2.850  12.070  1.00 0.00 ? 49 ARG A CD   2  
ATOM 1932  N NE   . ARG A 1 49 ? 5.592   -3.313  10.846  1.00 0.00 ? 49 ARG A NE   2  
ATOM 1933  C CZ   . ARG A 1 49 ? 6.818   -3.824  10.813  1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1934  N NH1  . ARG A 1 49 ? 7.523   -3.936  11.929  1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1935  N NH2  . ARG A 1 49 ? 7.340   -4.223  9.660   1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1936  H H    . ARG A 1 49 ? 5.288   1.415   9.955   1.00 0.00 ? 49 ARG A H    2  
ATOM 1937  H HA   . ARG A 1 49 ? 5.094   -1.380  9.428   1.00 0.00 ? 49 ARG A HA   2  
ATOM 1938  H HB2  . ARG A 1 49 ? 5.278   -0.358  11.709  1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1939  H HB3  . ARG A 1 49 ? 3.625   0.216   11.531  1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1940  H HG2  . ARG A 1 49 ? 3.259   -1.705  12.695  1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1941  H HG3  . ARG A 1 49 ? 3.147   -2.324  11.046  1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1942  H HD2  . ARG A 1 49 ? 5.675   -2.350  12.687  1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1943  H HD3  . ARG A 1 49 ? 4.547   -3.702  12.602  1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1944  H HE   . ARG A 1 49 ? 5.088   -3.239  10.010  1.00 0.00 ? 49 ARG A HE   2  
ATOM 1945  H HH11 . ARG A 1 49 ? 7.132   -3.637  12.799  1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1946  H HH12 . ARG A 1 49 ? 8.446   -4.322  11.901  1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1947  H HH21 . ARG A 1 49 ? 6.810   -4.140  8.816   1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1948  H HH22 . ARG A 1 49 ? 8.262   -4.607  9.635   1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1949  N N    . GLN A 1 50 ? 2.420   0.490   8.994   1.00 0.00 ? 50 GLN A N    2  
ATOM 1950  C CA   . GLN A 1 50 ? 1.102   0.529   8.373   1.00 0.00 ? 50 GLN A CA   2  
ATOM 1951  C C    . GLN A 1 50 ? 1.143   -0.064  6.969   1.00 0.00 ? 50 GLN A C    2  
ATOM 1952  O O    . GLN A 1 50 ? 0.321   -0.911  6.618   1.00 0.00 ? 50 GLN A O    2  
ATOM 1953  C CB   . GLN A 1 50 ? 0.583   1.967   8.318   1.00 0.00 ? 50 GLN A CB   2  
ATOM 1954  C CG   . GLN A 1 50 ? 0.084   2.486   9.657   1.00 0.00 ? 50 GLN A CG   2  
ATOM 1955  C CD   . GLN A 1 50 ? -1.083  3.443   9.514   1.00 0.00 ? 50 GLN A CD   2  
ATOM 1956  O OE1  . GLN A 1 50 ? -2.235  3.074   9.739   1.00 0.00 ? 50 GLN A OE1  2  
ATOM 1957  N NE2  . GLN A 1 50 ? -0.789  4.683   9.137   1.00 0.00 ? 50 GLN A NE2  2  
ATOM 1958  H H    . GLN A 1 50 ? 2.792   1.310   9.379   1.00 0.00 ? 50 GLN A H    2  
ATOM 1959  H HA   . GLN A 1 50 ? 0.432   -0.062  8.980   1.00 0.00 ? 50 GLN A HA   2  
ATOM 1960  H HB2  . GLN A 1 50 ? 1.381   2.612   7.981   1.00 0.00 ? 50 GLN A HB2  2  
ATOM 1961  H HB3  . GLN A 1 50 ? -0.232  2.016   7.611   1.00 0.00 ? 50 GLN A HB3  2  
ATOM 1962  H HG2  . GLN A 1 50 ? -0.231  1.647   10.259  1.00 0.00 ? 50 GLN A HG2  2  
ATOM 1963  H HG3  . GLN A 1 50 ? 0.894   3.000   10.153  1.00 0.00 ? 50 GLN A HG3  2  
ATOM 1964  H HE21 . GLN A 1 50 ? 0.152   4.906   8.974   1.00 0.00 ? 50 GLN A HE21 2  
ATOM 1965  H HE22 . GLN A 1 50 ? -1.524  5.322   9.036   1.00 0.00 ? 50 GLN A HE22 2  
ATOM 1966  N N    . ILE A 1 51 ? 2.104   0.387   6.170   1.00 0.00 ? 51 ILE A N    2  
ATOM 1967  C CA   . ILE A 1 51 ? 2.253   -0.100  4.804   1.00 0.00 ? 51 ILE A CA   2  
ATOM 1968  C C    . ILE A 1 51 ? 2.614   -1.581  4.785   1.00 0.00 ? 51 ILE A C    2  
ATOM 1969  O O    . ILE A 1 51 ? 2.315   -2.292  3.825   1.00 0.00 ? 51 ILE A O    2  
ATOM 1970  C CB   . ILE A 1 51 ? 3.331   0.691   4.039   1.00 0.00 ? 51 ILE A CB   2  
ATOM 1971  C CG1  . ILE A 1 51 ? 2.971   2.177   3.996   1.00 0.00 ? 51 ILE A CG1  2  
ATOM 1972  C CG2  . ILE A 1 51 ? 3.492   0.139   2.630   1.00 0.00 ? 51 ILE A CG2  2  
ATOM 1973  C CD1  . ILE A 1 51 ? 4.164   3.082   3.787   1.00 0.00 ? 51 ILE A CD1  2  
ATOM 1974  H H    . ILE A 1 51 ? 2.729   1.062   6.507   1.00 0.00 ? 51 ILE A H    2  
ATOM 1975  H HA   . ILE A 1 51 ? 1.308   0.036   4.298   1.00 0.00 ? 51 ILE A HA   2  
ATOM 1976  H HB   . ILE A 1 51 ? 4.270   0.569   4.557   1.00 0.00 ? 51 ILE A HB   2  
ATOM 1977  H HG12 . ILE A 1 51 ? 2.278   2.351   3.188   1.00 0.00 ? 51 ILE A HG12 2  
ATOM 1978  H HG13 . ILE A 1 51 ? 2.504   2.453   4.931   1.00 0.00 ? 51 ILE A HG13 2  
ATOM 1979  H HG21 . ILE A 1 51 ? 2.631   -0.464  2.379   1.00 0.00 ? 51 ILE A HG21 2  
ATOM 1980  H HG22 . ILE A 1 51 ? 3.573   0.957   1.931   1.00 0.00 ? 51 ILE A HG22 2  
ATOM 1981  H HG23 . ILE A 1 51 ? 4.383   -0.468  2.581   1.00 0.00 ? 51 ILE A HG23 2  
ATOM 1982  H HD11 . ILE A 1 51 ? 4.877   2.595   3.138   1.00 0.00 ? 51 ILE A HD11 2  
ATOM 1983  H HD12 . ILE A 1 51 ? 3.840   4.008   3.337   1.00 0.00 ? 51 ILE A HD12 2  
ATOM 1984  H HD13 . ILE A 1 51 ? 4.630   3.289   4.740   1.00 0.00 ? 51 ILE A HD13 2  
ATOM 1985  N N    . THR A 1 52 ? 3.259   -2.041  5.852   1.00 0.00 ? 52 THR A N    2  
ATOM 1986  C CA   . THR A 1 52 ? 3.661   -3.438  5.959   1.00 0.00 ? 52 THR A CA   2  
ATOM 1987  C C    . THR A 1 52 ? 2.465   -4.333  6.265   1.00 0.00 ? 52 THR A C    2  
ATOM 1988  O O    . THR A 1 52 ? 2.230   -5.326  5.577   1.00 0.00 ? 52 THR A O    2  
ATOM 1989  C CB   . THR A 1 52 ? 4.727   -3.634  7.053   1.00 0.00 ? 52 THR A CB   2  
ATOM 1990  O OG1  . THR A 1 52 ? 5.894   -2.863  6.743   1.00 0.00 ? 52 THR A OG1  2  
ATOM 1991  C CG2  . THR A 1 52 ? 5.104   -5.102  7.185   1.00 0.00 ? 52 THR A CG2  2  
ATOM 1992  H H    . THR A 1 52 ? 3.469   -1.425  6.585   1.00 0.00 ? 52 THR A H    2  
ATOM 1993  H HA   . THR A 1 52 ? 4.088   -3.735  5.012   1.00 0.00 ? 52 THR A HA   2  
ATOM 1994  H HB   . THR A 1 52 ? 4.321   -3.295  7.995   1.00 0.00 ? 52 THR A HB   2  
ATOM 1995  H HG1  . THR A 1 52 ? 6.220   -2.442  7.542   1.00 0.00 ? 52 THR A HG1  2  
ATOM 1996  H HG21 . THR A 1 52 ? 4.560   -5.681  6.453   1.00 0.00 ? 52 THR A HG21 2  
ATOM 1997  H HG22 . THR A 1 52 ? 4.855   -5.449  8.177   1.00 0.00 ? 52 THR A HG22 2  
ATOM 1998  H HG23 . THR A 1 52 ? 6.164   -5.217  7.019   1.00 0.00 ? 52 THR A HG23 2  
ATOM 1999  N N    . ILE A 1 53 ? 1.713   -3.973  7.300   1.00 0.00 ? 53 ILE A N    2  
ATOM 2000  C CA   . ILE A 1 53 ? 0.540   -4.744  7.695   1.00 0.00 ? 53 ILE A CA   2  
ATOM 2001  C C    . ILE A 1 53 ? -0.401  -4.956  6.514   1.00 0.00 ? 53 ILE A C    2  
ATOM 2002  O O    . ILE A 1 53 ? -0.841  -6.075  6.251   1.00 0.00 ? 53 ILE A O    2  
ATOM 2003  C CB   . ILE A 1 53 ? -0.231  -4.050  8.834   1.00 0.00 ? 53 ILE A CB   2  
ATOM 2004  C CG1  . ILE A 1 53 ? 0.676   -3.861  10.051  1.00 0.00 ? 53 ILE A CG1  2  
ATOM 2005  C CG2  . ILE A 1 53 ? -1.465  -4.859  9.206   1.00 0.00 ? 53 ILE A CG2  2  
ATOM 2006  C CD1  . ILE A 1 53 ? 0.189   -2.794  11.007  1.00 0.00 ? 53 ILE A CD1  2  
ATOM 2007  H H    . ILE A 1 53 ? 1.952   -3.171  7.809   1.00 0.00 ? 53 ILE A H    2  
ATOM 2008  H HA   . ILE A 1 53 ? 0.878   -5.707  8.050   1.00 0.00 ? 53 ILE A HA   2  
ATOM 2009  H HB   . ILE A 1 53 ? -0.556  -3.083  8.482   1.00 0.00 ? 53 ILE A HB   2  
ATOM 2010  H HG12 . ILE A 1 53 ? 0.737   -4.790  10.595  1.00 0.00 ? 53 ILE A HG12 2  
ATOM 2011  H HG13 . ILE A 1 53 ? 1.664   -3.580  9.715   1.00 0.00 ? 53 ILE A HG13 2  
ATOM 2012  H HG21 . ILE A 1 53 ? -1.860  -4.500  10.145  1.00 0.00 ? 53 ILE A HG21 2  
ATOM 2013  H HG22 . ILE A 1 53 ? -2.213  -4.748  8.436   1.00 0.00 ? 53 ILE A HG22 2  
ATOM 2014  H HG23 . ILE A 1 53 ? -1.198  -5.900  9.302   1.00 0.00 ? 53 ILE A HG23 2  
ATOM 2015  H HD11 . ILE A 1 53 ? -0.300  -2.008  10.451  1.00 0.00 ? 53 ILE A HD11 2  
ATOM 2016  H HD12 . ILE A 1 53 ? -0.507  -3.229  11.708  1.00 0.00 ? 53 ILE A HD12 2  
ATOM 2017  H HD13 . ILE A 1 53 ? 1.031   -2.383  11.545  1.00 0.00 ? 53 ILE A HD13 2  
ATOM 2018  N N    . TRP A 1 54 ? -0.705  -3.874  5.806   1.00 0.00 ? 54 TRP A N    2  
ATOM 2019  C CA   . TRP A 1 54 ? -1.594  -3.943  4.651   1.00 0.00 ? 54 TRP A CA   2  
ATOM 2020  C C    . TRP A 1 54 ? -1.079  -4.948  3.627   1.00 0.00 ? 54 TRP A C    2  
ATOM 2021  O O    . TRP A 1 54 ? -1.841  -5.763  3.106   1.00 0.00 ? 54 TRP A O    2  
ATOM 2022  C CB   . TRP A 1 54 ? -1.731  -2.563  4.005   1.00 0.00 ? 54 TRP A CB   2  
ATOM 2023  C CG   . TRP A 1 54 ? -2.823  -2.492  2.981   1.00 0.00 ? 54 TRP A CG   2  
ATOM 2024  C CD1  . TRP A 1 54 ? -4.137  -2.191  3.203   1.00 0.00 ? 54 TRP A CD1  2  
ATOM 2025  C CD2  . TRP A 1 54 ? -2.696  -2.729  1.575   1.00 0.00 ? 54 TRP A CD2  2  
ATOM 2026  N NE1  . TRP A 1 54 ? -4.834  -2.227  2.020   1.00 0.00 ? 54 TRP A NE1  2  
ATOM 2027  C CE2  . TRP A 1 54 ? -3.973  -2.554  1.006   1.00 0.00 ? 54 TRP A CE2  2  
ATOM 2028  C CE3  . TRP A 1 54 ? -1.628  -3.071  0.741   1.00 0.00 ? 54 TRP A CE3  2  
ATOM 2029  C CZ2  . TRP A 1 54 ? -4.207  -2.710  -0.358  1.00 0.00 ? 54 TRP A CZ2  2  
ATOM 2030  C CZ3  . TRP A 1 54 ? -1.863  -3.226  -0.612  1.00 0.00 ? 54 TRP A CZ3  2  
ATOM 2031  C CH2  . TRP A 1 54 ? -3.144  -3.044  -1.151  1.00 0.00 ? 54 TRP A CH2  2  
ATOM 2032  H H    . TRP A 1 54 ? -0.324  -3.009  6.065   1.00 0.00 ? 54 TRP A H    2  
ATOM 2033  H HA   . TRP A 1 54 ? -2.564  -4.265  4.999   1.00 0.00 ? 54 TRP A HA   2  
ATOM 2034  H HB2  . TRP A 1 54 ? -1.945  -1.833  4.771   1.00 0.00 ? 54 TRP A HB2  2  
ATOM 2035  H HB3  . TRP A 1 54 ? -0.801  -2.307  3.519   1.00 0.00 ? 54 TRP A HB3  2  
ATOM 2036  H HD1  . TRP A 1 54 ? -4.553  -1.963  4.173   1.00 0.00 ? 54 TRP A HD1  2  
ATOM 2037  H HE1  . TRP A 1 54 ? -5.792  -2.046  1.918   1.00 0.00 ? 54 TRP A HE1  2  
ATOM 2038  H HE3  . TRP A 1 54 ? -0.634  -3.215  1.137   1.00 0.00 ? 54 TRP A HE3  2  
ATOM 2039  H HZ2  . TRP A 1 54 ? -5.189  -2.573  -0.788  1.00 0.00 ? 54 TRP A HZ2  2  
ATOM 2040  H HZ3  . TRP A 1 54 ? -1.050  -3.490  -1.272  1.00 0.00 ? 54 TRP A HZ3  2  
ATOM 2041  H HH2  . TRP A 1 54 ? -3.281  -3.176  -2.213  1.00 0.00 ? 54 TRP A HH2  2  
ATOM 2042  N N    . PHE A 1 55 ? 0.217   -4.885  3.342   1.00 0.00 ? 55 PHE A N    2  
ATOM 2043  C CA   . PHE A 1 55 ? 0.833   -5.790  2.379   1.00 0.00 ? 55 PHE A CA   2  
ATOM 2044  C C    . PHE A 1 55 ? 0.718   -7.239  2.843   1.00 0.00 ? 55 PHE A C    2  
ATOM 2045  O O    . PHE A 1 55 ? 0.679   -8.161  2.029   1.00 0.00 ? 55 PHE A O    2  
ATOM 2046  C CB   . PHE A 1 55 ? 2.304   -5.425  2.171   1.00 0.00 ? 55 PHE A CB   2  
ATOM 2047  C CG   . PHE A 1 55 ? 2.534   -4.501  1.010   1.00 0.00 ? 55 PHE A CG   2  
ATOM 2048  C CD1  . PHE A 1 55 ? 1.962   -3.239  0.988   1.00 0.00 ? 55 PHE A CD1  2  
ATOM 2049  C CD2  . PHE A 1 55 ? 3.323   -4.893  -0.059  1.00 0.00 ? 55 PHE A CD2  2  
ATOM 2050  C CE1  . PHE A 1 55 ? 2.172   -2.387  -0.080  1.00 0.00 ? 55 PHE A CE1  2  
ATOM 2051  C CE2  . PHE A 1 55 ? 3.537   -4.046  -1.130  1.00 0.00 ? 55 PHE A CE2  2  
ATOM 2052  C CZ   . PHE A 1 55 ? 2.961   -2.790  -1.140  1.00 0.00 ? 55 PHE A CZ   2  
ATOM 2053  H H    . PHE A 1 55 ? 0.773   -4.213  3.790   1.00 0.00 ? 55 PHE A H    2  
ATOM 2054  H HA   . PHE A 1 55 ? 0.309   -5.683  1.442   1.00 0.00 ? 55 PHE A HA   2  
ATOM 2055  H HB2  . PHE A 1 55 ? 2.675   -4.938  3.061   1.00 0.00 ? 55 PHE A HB2  2  
ATOM 2056  H HB3  . PHE A 1 55 ? 2.871   -6.327  1.997   1.00 0.00 ? 55 PHE A HB3  2  
ATOM 2057  H HD1  . PHE A 1 55 ? 1.346   -2.921  1.816   1.00 0.00 ? 55 PHE A HD1  2  
ATOM 2058  H HD2  . PHE A 1 55 ? 3.774   -5.876  -0.052  1.00 0.00 ? 55 PHE A HD2  2  
ATOM 2059  H HE1  . PHE A 1 55 ? 1.721   -1.406  -0.086  1.00 0.00 ? 55 PHE A HE1  2  
ATOM 2060  H HE2  . PHE A 1 55 ? 4.154   -4.365  -1.956  1.00 0.00 ? 55 PHE A HE2  2  
ATOM 2061  H HZ   . PHE A 1 55 ? 3.126   -2.127  -1.975  1.00 0.00 ? 55 PHE A HZ   2  
ATOM 2062  N N    . GLN A 1 56 ? 0.665   -7.430  4.157   1.00 0.00 ? 56 GLN A N    2  
ATOM 2063  C CA   . GLN A 1 56 ? 0.556   -8.767  4.731   1.00 0.00 ? 56 GLN A CA   2  
ATOM 2064  C C    . GLN A 1 56 ? -0.867  -9.301  4.599   1.00 0.00 ? 56 GLN A C    2  
ATOM 2065  O O    . GLN A 1 56 ? -1.085  -10.385 4.059   1.00 0.00 ? 56 GLN A O    2  
ATOM 2066  C CB   . GLN A 1 56 ? 0.972   -8.749  6.202   1.00 0.00 ? 56 GLN A CB   2  
ATOM 2067  C CG   . GLN A 1 56 ? 2.476   -8.670  6.408   1.00 0.00 ? 56 GLN A CG   2  
ATOM 2068  C CD   . GLN A 1 56 ? 2.944   -9.472  7.607   1.00 0.00 ? 56 GLN A CD   2  
ATOM 2069  O OE1  . GLN A 1 56 ? 3.250   -10.659 7.493   1.00 0.00 ? 56 GLN A OE1  2  
ATOM 2070  N NE2  . GLN A 1 56 ? 3.003   -8.825  8.765   1.00 0.00 ? 56 GLN A NE2  2  
ATOM 2071  H H    . GLN A 1 56 ? 0.700   -6.655  4.755   1.00 0.00 ? 56 GLN A H    2  
ATOM 2072  H HA   . GLN A 1 56 ? 1.223   -9.417  4.185   1.00 0.00 ? 56 GLN A HA   2  
ATOM 2073  H HB2  . GLN A 1 56 ? 0.519   -7.894  6.682   1.00 0.00 ? 56 GLN A HB2  2  
ATOM 2074  H HB3  . GLN A 1 56 ? 0.613   -9.650  6.677   1.00 0.00 ? 56 GLN A HB3  2  
ATOM 2075  H HG2  . GLN A 1 56 ? 2.968   -9.051  5.526   1.00 0.00 ? 56 GLN A HG2  2  
ATOM 2076  H HG3  . GLN A 1 56 ? 2.752   -7.636  6.555   1.00 0.00 ? 56 GLN A HG3  2  
ATOM 2077  H HE21 . GLN A 1 56 ? 2.743   -7.880  8.781   1.00 0.00 ? 56 GLN A HE21 2  
ATOM 2078  H HE22 . GLN A 1 56 ? 3.301   -9.319  9.556   1.00 0.00 ? 56 GLN A HE22 2  
ATOM 2079  N N    . ASN A 1 57 ? -1.831  -8.533  5.096   1.00 0.00 ? 57 ASN A N    2  
ATOM 2080  C CA   . ASN A 1 57 ? -3.233  -8.930  5.035   1.00 0.00 ? 57 ASN A CA   2  
ATOM 2081  C C    . ASN A 1 57 ? -3.652  -9.224  3.598   1.00 0.00 ? 57 ASN A C    2  
ATOM 2082  O O    . ASN A 1 57 ? -4.580  -9.997  3.357   1.00 0.00 ? 57 ASN A O    2  
ATOM 2083  C CB   . ASN A 1 57 ? -4.121  -7.832  5.623   1.00 0.00 ? 57 ASN A CB   2  
ATOM 2084  C CG   . ASN A 1 57 ? -4.375  -8.025  7.105   1.00 0.00 ? 57 ASN A CG   2  
ATOM 2085  O OD1  . ASN A 1 57 ? -4.554  -9.149  7.574   1.00 0.00 ? 57 ASN A OD1  2  
ATOM 2086  N ND2  . ASN A 1 57 ? -4.392  -6.927  7.851   1.00 0.00 ? 57 ASN A ND2  2  
ATOM 2087  H H    . ASN A 1 57 ? -1.594  -7.679  5.515   1.00 0.00 ? 57 ASN A H    2  
ATOM 2088  H HA   . ASN A 1 57 ? -3.349  -9.828  5.622   1.00 0.00 ? 57 ASN A HA   2  
ATOM 2089  H HB2  . ASN A 1 57 ? -3.641  -6.874  5.481   1.00 0.00 ? 57 ASN A HB2  2  
ATOM 2090  H HB3  . ASN A 1 57 ? -5.072  -7.833  5.110   1.00 0.00 ? 57 ASN A HB3  2  
ATOM 2091  H HD21 . ASN A 1 57 ? -4.241  -6.065  7.409   1.00 0.00 ? 57 ASN A HD21 2  
ATOM 2092  H HD22 . ASN A 1 57 ? -4.553  -7.023  8.813   1.00 0.00 ? 57 ASN A HD22 2  
ATOM 2093  N N    . ARG A 1 58 ? -2.962  -8.603  2.647   1.00 0.00 ? 58 ARG A N    2  
ATOM 2094  C CA   . ARG A 1 58 ? -3.263  -8.798  1.233   1.00 0.00 ? 58 ARG A CA   2  
ATOM 2095  C C    . ARG A 1 58 ? -2.956  -10.229 0.804   1.00 0.00 ? 58 ARG A C    2  
ATOM 2096  O O    . ARG A 1 58 ? -3.771  -10.880 0.150   1.00 0.00 ? 58 ARG A O    2  
ATOM 2097  C CB   . ARG A 1 58 ? -2.461  -7.815  0.379   1.00 0.00 ? 58 ARG A CB   2  
ATOM 2098  C CG   . ARG A 1 58 ? -3.190  -7.362  -0.876  1.00 0.00 ? 58 ARG A CG   2  
ATOM 2099  C CD   . ARG A 1 58 ? -4.451  -6.582  -0.537  1.00 0.00 ? 58 ARG A CD   2  
ATOM 2100  N NE   . ARG A 1 58 ? -5.014  -5.917  -1.708  1.00 0.00 ? 58 ARG A NE   2  
ATOM 2101  C CZ   . ARG A 1 58 ? -6.254  -5.444  -1.760  1.00 0.00 ? 58 ARG A CZ   2  
ATOM 2102  N NH1  . ARG A 1 58 ? -7.057  -5.563  -0.711  1.00 0.00 ? 58 ARG A NH1  2  
ATOM 2103  N NH2  . ARG A 1 58 ? -6.695  -4.851  -2.862  1.00 0.00 ? 58 ARG A NH2  2  
ATOM 2104  H H    . ARG A 1 58 ? -2.234  -7.999  2.901   1.00 0.00 ? 58 ARG A H    2  
ATOM 2105  H HA   . ARG A 1 58 ? -4.317  -8.609  1.089   1.00 0.00 ? 58 ARG A HA   2  
ATOM 2106  H HB2  . ARG A 1 58 ? -2.235  -6.940  0.972   1.00 0.00 ? 58 ARG A HB2  2  
ATOM 2107  H HB3  . ARG A 1 58 ? -1.536  -8.286  0.082   1.00 0.00 ? 58 ARG A HB3  2  
ATOM 2108  H HG2  . ARG A 1 58 ? -2.533  -6.729  -1.454  1.00 0.00 ? 58 ARG A HG2  2  
ATOM 2109  H HG3  . ARG A 1 58 ? -3.460  -8.231  -1.457  1.00 0.00 ? 58 ARG A HG3  2  
ATOM 2110  H HD2  . ARG A 1 58 ? -5.184  -7.266  -0.136  1.00 0.00 ? 58 ARG A HD2  2  
ATOM 2111  H HD3  . ARG A 1 58 ? -4.208  -5.838  0.207   1.00 0.00 ? 58 ARG A HD3  2  
ATOM 2112  H HE   . ARG A 1 58 ? -4.438  -5.818  -2.495  1.00 0.00 ? 58 ARG A HE   2  
ATOM 2113  H HH11 . ARG A 1 58 ? -6.727  -6.009  0.122   1.00 0.00 ? 58 ARG A HH11 2  
ATOM 2114  H HH12 . ARG A 1 58 ? -7.990  -5.206  -0.751  1.00 0.00 ? 58 ARG A HH12 2  
ATOM 2115  H HH21 . ARG A 1 58 ? -6.093  -4.759  -3.655  1.00 0.00 ? 58 ARG A HH21 2  
ATOM 2116  H HH22 . ARG A 1 58 ? -7.628  -4.496  -2.899  1.00 0.00 ? 58 ARG A HH22 2  
ATOM 2117  N N    . ARG A 1 59 ? -1.776  -10.713 1.177   1.00 0.00 ? 59 ARG A N    2  
ATOM 2118  C CA   . ARG A 1 59 ? -1.360  -12.066 0.829   1.00 0.00 ? 59 ARG A CA   2  
ATOM 2119  C C    . ARG A 1 59 ? -1.980  -13.086 1.780   1.00 0.00 ? 59 ARG A C    2  
ATOM 2120  O O    . ARG A 1 59 ? -2.556  -14.085 1.347   1.00 0.00 ? 59 ARG A O    2  
ATOM 2121  C CB   . ARG A 1 59 ? 0.165   -12.180 0.865   1.00 0.00 ? 59 ARG A CB   2  
ATOM 2122  C CG   . ARG A 1 59 ? 0.826   -11.932 -0.480  1.00 0.00 ? 59 ARG A CG   2  
ATOM 2123  C CD   . ARG A 1 59 ? 2.332   -12.133 -0.406  1.00 0.00 ? 59 ARG A CD   2  
ATOM 2124  N NE   . ARG A 1 59 ? 2.684   -13.404 0.221   1.00 0.00 ? 59 ARG A NE   2  
ATOM 2125  C CZ   . ARG A 1 59 ? 2.496   -14.586 -0.355  1.00 0.00 ? 59 ARG A CZ   2  
ATOM 2126  N NH1  . ARG A 1 59 ? 1.962   -14.658 -1.567  1.00 0.00 ? 59 ARG A NH1  2  
ATOM 2127  N NH2  . ARG A 1 59 ? 2.842   -15.698 0.280   1.00 0.00 ? 59 ARG A NH2  2  
ATOM 2128  H H    . ARG A 1 59 ? -1.169  -10.146 1.697   1.00 0.00 ? 59 ARG A H    2  
ATOM 2129  H HA   . ARG A 1 59 ? -1.704  -12.272 -0.174  1.00 0.00 ? 59 ARG A HA   2  
ATOM 2130  H HB2  . ARG A 1 59 ? 0.551   -11.458 1.570   1.00 0.00 ? 59 ARG A HB2  2  
ATOM 2131  H HB3  . ARG A 1 59 ? 0.432   -13.172 1.196   1.00 0.00 ? 59 ARG A HB3  2  
ATOM 2132  H HG2  . ARG A 1 59 ? 0.417   -12.621 -1.205  1.00 0.00 ? 59 ARG A HG2  2  
ATOM 2133  H HG3  . ARG A 1 59 ? 0.622   -10.918 -0.790  1.00 0.00 ? 59 ARG A HG3  2  
ATOM 2134  H HD2  . ARG A 1 59 ? 2.734   -12.114 -1.409  1.00 0.00 ? 59 ARG A HD2  2  
ATOM 2135  H HD3  . ARG A 1 59 ? 2.761   -11.327 0.169   1.00 0.00 ? 59 ARG A HD3  2  
ATOM 2136  H HE   . ARG A 1 59 ? 3.079   -13.373 1.117   1.00 0.00 ? 59 ARG A HE   2  
ATOM 2137  H HH11 . ARG A 1 59 ? 1.701   -13.822 -2.048  1.00 0.00 ? 59 ARG A HH11 2  
ATOM 2138  H HH12 . ARG A 1 59 ? 1.823   -15.549 -1.999  1.00 0.00 ? 59 ARG A HH12 2  
ATOM 2139  H HH21 . ARG A 1 59 ? 3.245   -15.647 1.193   1.00 0.00 ? 59 ARG A HH21 2  
ATOM 2140  H HH22 . ARG A 1 59 ? 2.700   -16.587 -0.155  1.00 0.00 ? 59 ARG A HH22 2  
ATOM 2141  N N    . VAL A 1 60 ? -1.857  -12.829 3.078   1.00 0.00 ? 60 VAL A N    2  
ATOM 2142  C CA   . VAL A 1 60 ? -2.405  -13.723 4.090   1.00 0.00 ? 60 VAL A CA   2  
ATOM 2143  C C    . VAL A 1 60 ? -3.879  -14.011 3.829   1.00 0.00 ? 60 VAL A C    2  
ATOM 2144  O O    . VAL A 1 60 ? -4.388  -15.075 4.184   1.00 0.00 ? 60 VAL A O    2  
ATOM 2145  C CB   . VAL A 1 60 ? -2.251  -13.132 5.504   1.00 0.00 ? 60 VAL A CB   2  
ATOM 2146  C CG1  . VAL A 1 60 ? -2.720  -14.129 6.554   1.00 0.00 ? 60 VAL A CG1  2  
ATOM 2147  C CG2  . VAL A 1 60 ? -0.809  -12.720 5.755   1.00 0.00 ? 60 VAL A CG2  2  
ATOM 2148  H H    . VAL A 1 60 ? -1.387  -12.017 3.362   1.00 0.00 ? 60 VAL A H    2  
ATOM 2149  H HA   . VAL A 1 60 ? -1.854  -14.652 4.049   1.00 0.00 ? 60 VAL A HA   2  
ATOM 2150  H HB   . VAL A 1 60 ? -2.872  -12.251 5.574   1.00 0.00 ? 60 VAL A HB   2  
ATOM 2151  H HG11 . VAL A 1 60 ? -2.515  -13.736 7.539   1.00 0.00 ? 60 VAL A HG11 2  
ATOM 2152  H HG12 . VAL A 1 60 ? -3.782  -14.294 6.445   1.00 0.00 ? 60 VAL A HG12 2  
ATOM 2153  H HG13 . VAL A 1 60 ? -2.195  -15.063 6.422   1.00 0.00 ? 60 VAL A HG13 2  
ATOM 2154  H HG21 . VAL A 1 60 ? -0.766  -11.659 5.947   1.00 0.00 ? 60 VAL A HG21 2  
ATOM 2155  H HG22 . VAL A 1 60 ? -0.425  -13.256 6.612   1.00 0.00 ? 60 VAL A HG22 2  
ATOM 2156  H HG23 . VAL A 1 60 ? -0.211  -12.954 4.887   1.00 0.00 ? 60 VAL A HG23 2  
ATOM 2157  N N    . LYS A 1 61 ? -4.561  -13.057 3.205   1.00 0.00 ? 61 LYS A N    2  
ATOM 2158  C CA   . LYS A 1 61 ? -5.978  -13.207 2.894   1.00 0.00 ? 61 LYS A CA   2  
ATOM 2159  C C    . LYS A 1 61 ? -6.237  -14.517 2.157   1.00 0.00 ? 61 LYS A C    2  
ATOM 2160  O O    . LYS A 1 61 ? -7.297  -15.123 2.305   1.00 0.00 ? 61 LYS A O    2  
ATOM 2161  C CB   . LYS A 1 61 ? -6.462  -12.029 2.047   1.00 0.00 ? 61 LYS A CB   2  
ATOM 2162  C CG   . LYS A 1 61 ? -7.866  -12.212 1.496   1.00 0.00 ? 61 LYS A CG   2  
ATOM 2163  C CD   . LYS A 1 61 ? -8.439  -10.902 0.982   1.00 0.00 ? 61 LYS A CD   2  
ATOM 2164  C CE   . LYS A 1 61 ? -9.654  -11.134 0.097   1.00 0.00 ? 61 LYS A CE   2  
ATOM 2165  N NZ   . LYS A 1 61 ? -10.842 -11.561 0.887   1.00 0.00 ? 61 LYS A NZ   2  
ATOM 2166  H H    . LYS A 1 61 ? -4.100  -12.231 2.947   1.00 0.00 ? 61 LYS A H    2  
ATOM 2167  H HA   . LYS A 1 61 ? -6.523  -13.218 3.825   1.00 0.00 ? 61 LYS A HA   2  
ATOM 2168  H HB2  . LYS A 1 61 ? -6.450  -11.135 2.653   1.00 0.00 ? 61 LYS A HB2  2  
ATOM 2169  H HB3  . LYS A 1 61 ? -5.786  -11.897 1.214   1.00 0.00 ? 61 LYS A HB3  2  
ATOM 2170  H HG2  . LYS A 1 61 ? -7.834  -12.922 0.683   1.00 0.00 ? 61 LYS A HG2  2  
ATOM 2171  H HG3  . LYS A 1 61 ? -8.504  -12.590 2.281   1.00 0.00 ? 61 LYS A HG3  2  
ATOM 2172  H HD2  . LYS A 1 61 ? -8.732  -10.292 1.823   1.00 0.00 ? 61 LYS A HD2  2  
ATOM 2173  H HD3  . LYS A 1 61 ? -7.680  -10.387 0.409   1.00 0.00 ? 61 LYS A HD3  2  
ATOM 2174  H HE2  . LYS A 1 61 ? -9.887  -10.216 -0.420  1.00 0.00 ? 61 LYS A HE2  2  
ATOM 2175  H HE3  . LYS A 1 61 ? -9.416  -11.903 -0.624  1.00 0.00 ? 61 LYS A HE3  2  
ATOM 2176  H HZ1  . LYS A 1 61 ? -11.624 -11.811 0.248   1.00 0.00 ? 61 LYS A HZ1  2  
ATOM 2177  H HZ2  . LYS A 1 61 ? -11.153 -10.789 1.510   1.00 0.00 ? 61 LYS A HZ2  2  
ATOM 2178  H HZ3  . LYS A 1 61 ? -10.605 -12.389 1.470   1.00 0.00 ? 61 LYS A HZ3  2  
ATOM 2179  N N    . GLU A 1 62 ? -5.260  -14.949 1.365   1.00 0.00 ? 62 GLU A N    2  
ATOM 2180  C CA   . GLU A 1 62 ? -5.384  -16.188 0.606   1.00 0.00 ? 62 GLU A CA   2  
ATOM 2181  C C    . GLU A 1 62 ? -4.448  -17.259 1.157   1.00 0.00 ? 62 GLU A C    2  
ATOM 2182  O O    . GLU A 1 62 ? -3.944  -18.102 0.414   1.00 0.00 ? 62 GLU A O    2  
ATOM 2183  C CB   . GLU A 1 62 ? -5.078  -15.939 -0.873  1.00 0.00 ? 62 GLU A CB   2  
ATOM 2184  C CG   . GLU A 1 62 ? -3.846  -15.080 -1.103  1.00 0.00 ? 62 GLU A CG   2  
ATOM 2185  C CD   . GLU A 1 62 ? -3.521  -14.909 -2.574  1.00 0.00 ? 62 GLU A CD   2  
ATOM 2186  O OE1  . GLU A 1 62 ? -4.444  -14.594 -3.354  1.00 0.00 ? 62 GLU A OE1  2  
ATOM 2187  O OE2  . GLU A 1 62 ? -2.342  -15.090 -2.946  1.00 0.00 ? 62 GLU A OE2  2  
ATOM 2188  H H    . GLU A 1 62 ? -4.438  -14.421 1.288   1.00 0.00 ? 62 GLU A H    2  
ATOM 2189  H HA   . GLU A 1 62 ? -6.402  -16.534 0.700   1.00 0.00 ? 62 GLU A HA   2  
ATOM 2190  H HB2  . GLU A 1 62 ? -4.925  -16.890 -1.361  1.00 0.00 ? 62 GLU A HB2  2  
ATOM 2191  H HB3  . GLU A 1 62 ? -5.925  -15.445 -1.325  1.00 0.00 ? 62 GLU A HB3  2  
ATOM 2192  H HG2  . GLU A 1 62 ? -4.018  -14.104 -0.672  1.00 0.00 ? 62 GLU A HG2  2  
ATOM 2193  H HG3  . GLU A 1 62 ? -3.002  -15.544 -0.615  1.00 0.00 ? 62 GLU A HG3  2  
ATOM 2194  N N    . LYS A 1 63 ? -4.219  -17.220 2.465   1.00 0.00 ? 63 LYS A N    2  
ATOM 2195  C CA   . LYS A 1 63 ? -3.344  -18.187 3.119   1.00 0.00 ? 63 LYS A CA   2  
ATOM 2196  C C    . LYS A 1 63 ? -4.131  -19.066 4.086   1.00 0.00 ? 63 LYS A C    2  
ATOM 2197  O O    . LYS A 1 63 ? -3.918  -20.276 4.154   1.00 0.00 ? 63 LYS A O    2  
ATOM 2198  C CB   . LYS A 1 63 ? -2.222  -17.465 3.868   1.00 0.00 ? 63 LYS A CB   2  
ATOM 2199  C CG   . LYS A 1 63 ? -0.979  -17.234 3.025   1.00 0.00 ? 63 LYS A CG   2  
ATOM 2200  C CD   . LYS A 1 63 ? 0.011   -18.377 3.166   1.00 0.00 ? 63 LYS A CD   2  
ATOM 2201  C CE   . LYS A 1 63 ? -0.429  -19.597 2.372   1.00 0.00 ? 63 LYS A CE   2  
ATOM 2202  N NZ   . LYS A 1 63 ? -1.271  -20.516 3.187   1.00 0.00 ? 63 LYS A NZ   2  
ATOM 2203  H H    . LYS A 1 63 ? -4.649  -16.524 3.005   1.00 0.00 ? 63 LYS A H    2  
ATOM 2204  H HA   . LYS A 1 63 ? -2.911  -18.812 2.354   1.00 0.00 ? 63 LYS A HA   2  
ATOM 2205  H HB2  . LYS A 1 63 ? -2.587  -16.506 4.203   1.00 0.00 ? 63 LYS A HB2  2  
ATOM 2206  H HB3  . LYS A 1 63 ? -1.942  -18.055 4.729   1.00 0.00 ? 63 LYS A HB3  2  
ATOM 2207  H HG2  . LYS A 1 63 ? -1.269  -17.149 1.988   1.00 0.00 ? 63 LYS A HG2  2  
ATOM 2208  H HG3  . LYS A 1 63 ? -0.504  -16.317 3.344   1.00 0.00 ? 63 LYS A HG3  2  
ATOM 2209  H HD2  . LYS A 1 63 ? 0.976   -18.054 2.803   1.00 0.00 ? 63 LYS A HD2  2  
ATOM 2210  H HD3  . LYS A 1 63 ? 0.090   -18.647 4.210   1.00 0.00 ? 63 LYS A HD3  2  
ATOM 2211  H HE2  . LYS A 1 63 ? -0.997  -19.267 1.515   1.00 0.00 ? 63 LYS A HE2  2  
ATOM 2212  H HE3  . LYS A 1 63 ? 0.450   -20.129 2.038   1.00 0.00 ? 63 LYS A HE3  2  
ATOM 2213  H HZ1  . LYS A 1 63 ? -1.477  -20.086 4.111   1.00 0.00 ? 63 LYS A HZ1  2  
ATOM 2214  H HZ2  . LYS A 1 63 ? -0.772  -21.416 3.340   1.00 0.00 ? 63 LYS A HZ2  2  
ATOM 2215  H HZ3  . LYS A 1 63 ? -2.168  -20.708 2.698   1.00 0.00 ? 63 LYS A HZ3  2  
ATOM 2216  N N    . LYS A 1 64 ? -5.043  -18.449 4.830   1.00 0.00 ? 64 LYS A N    2  
ATOM 2217  C CA   . LYS A 1 64 ? -5.864  -19.175 5.792   1.00 0.00 ? 64 LYS A CA   2  
ATOM 2218  C C    . LYS A 1 64 ? -6.967  -19.956 5.084   1.00 0.00 ? 64 LYS A C    2  
ATOM 2219  O O    . LYS A 1 64 ? -7.195  -21.130 5.376   1.00 0.00 ? 64 LYS A O    2  
ATOM 2220  C CB   . LYS A 1 64 ? -6.480  -18.206 6.803   1.00 0.00 ? 64 LYS A CB   2  
ATOM 2221  C CG   . LYS A 1 64 ? -5.591  -17.936 8.005   1.00 0.00 ? 64 LYS A CG   2  
ATOM 2222  C CD   . LYS A 1 64 ? -6.388  -17.382 9.174   1.00 0.00 ? 64 LYS A CD   2  
ATOM 2223  C CE   . LYS A 1 64 ? -5.611  -17.489 10.478  1.00 0.00 ? 64 LYS A CE   2  
ATOM 2224  N NZ   . LYS A 1 64 ? -6.088  -16.504 11.489  1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2225  H H    . LYS A 1 64 ? -5.167  -17.482 4.730   1.00 0.00 ? 64 LYS A H    2  
ATOM 2226  H HA   . LYS A 1 64 ? -5.226  -19.871 6.315   1.00 0.00 ? 64 LYS A HA   2  
ATOM 2227  H HB2  . LYS A 1 64 ? -6.677  -17.266 6.309   1.00 0.00 ? 64 LYS A HB2  2  
ATOM 2228  H HB3  . LYS A 1 64 ? -7.413  -18.619 7.157   1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2229  H HG2  . LYS A 1 64 ? -5.121  -18.859 8.309   1.00 0.00 ? 64 LYS A HG2  2  
ATOM 2230  H HG3  . LYS A 1 64 ? -4.832  -17.218 7.726   1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2231  H HD2  . LYS A 1 64 ? -6.613  -16.343 8.986   1.00 0.00 ? 64 LYS A HD2  2  
ATOM 2232  H HD3  . LYS A 1 64 ? -7.309  -17.940 9.267   1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2233  H HE2  . LYS A 1 64 ? -5.733  -18.485 10.874  1.00 0.00 ? 64 LYS A HE2  2  
ATOM 2234  H HE3  . LYS A 1 64 ? -4.566  -17.307 10.275  1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2235  H HZ1  . LYS A 1 64 ? -5.858  -15.538 11.182  1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2236  H HZ2  . LYS A 1 64 ? -5.629  -16.683 12.405  1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2237  H HZ3  . LYS A 1 64 ? -7.118  -16.583 11.608  1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2238  N N    . SER A 1 65 ? -7.648  -19.297 4.152   1.00 0.00 ? 65 SER A N    2  
ATOM 2239  C CA   . SER A 1 65 ? -8.729  -19.930 3.405   1.00 0.00 ? 65 SER A CA   2  
ATOM 2240  C C    . SER A 1 65 ? -8.708  -19.491 1.944   1.00 0.00 ? 65 SER A C    2  
ATOM 2241  O O    . SER A 1 65 ? -8.213  -18.415 1.614   1.00 0.00 ? 65 SER A O    2  
ATOM 2242  C CB   . SER A 1 65 ? -10.081 -19.586 4.033   1.00 0.00 ? 65 SER A CB   2  
ATOM 2243  O OG   . SER A 1 65 ? -11.130 -19.717 3.089   1.00 0.00 ? 65 SER A OG   2  
ATOM 2244  H H    . SER A 1 65 ? -7.420  -18.363 3.965   1.00 0.00 ? 65 SER A H    2  
ATOM 2245  H HA   . SER A 1 65 ? -8.582  -20.999 3.450   1.00 0.00 ? 65 SER A HA   2  
ATOM 2246  H HB2  . SER A 1 65 ? -10.272 -20.254 4.859   1.00 0.00 ? 65 SER A HB2  2  
ATOM 2247  H HB3  . SER A 1 65 ? -10.060 -18.567 4.391   1.00 0.00 ? 65 SER A HB3  2  
ATOM 2248  H HG   . SER A 1 65 ? -11.115 -18.968 2.488   1.00 0.00 ? 65 SER A HG   2  
ATOM 2249  N N    . GLY A 1 66 ? -9.250  -20.336 1.071   1.00 0.00 ? 66 GLY A N    2  
ATOM 2250  C CA   . GLY A 1 66 ? -9.284  -20.019 -0.345  1.00 0.00 ? 66 GLY A CA   2  
ATOM 2251  C C    . GLY A 1 66 ? -10.547 -19.283 -0.744  1.00 0.00 ? 66 GLY A C    2  
ATOM 2252  O O    . GLY A 1 66 ? -11.489 -19.152 0.038   1.00 0.00 ? 66 GLY A O    2  
ATOM 2253  H H    . GLY A 1 66 ? -9.630  -21.181 1.391   1.00 0.00 ? 66 GLY A H    2  
ATOM 2254  H HA2  . GLY A 1 66 ? -8.429  -19.404 -0.585  1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2255  H HA3  . GLY A 1 66 ? -9.223  -20.938 -0.909  1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2256  N N    . PRO A 1 67 ? -10.577 -18.785 -1.989  1.00 0.00 ? 67 PRO A N    2  
ATOM 2257  C CA   . PRO A 1 67 ? -11.728 -18.048 -2.519  1.00 0.00 ? 67 PRO A CA   2  
ATOM 2258  C C    . PRO A 1 67 ? -12.939 -18.947 -2.744  1.00 0.00 ? 67 PRO A C    2  
ATOM 2259  O O    . PRO A 1 67 ? -12.903 -20.140 -2.440  1.00 0.00 ? 67 PRO A O    2  
ATOM 2260  C CB   . PRO A 1 67 ? -11.215 -17.499 -3.853  1.00 0.00 ? 67 PRO A CB   2  
ATOM 2261  C CG   . PRO A 1 67 ? -10.128 -18.435 -4.255  1.00 0.00 ? 67 PRO A CG   2  
ATOM 2262  C CD   . PRO A 1 67 ? -9.490  -18.903 -2.976  1.00 0.00 ? 67 PRO A CD   2  
ATOM 2263  H HA   . PRO A 1 67 ? -12.006 -17.228 -1.873  1.00 0.00 ? 67 PRO A HA   2  
ATOM 2264  H HB2  . PRO A 1 67 ? -12.019 -17.491 -4.575  1.00 0.00 ? 67 PRO A HB2  2  
ATOM 2265  H HB3  . PRO A 1 67 ? -10.840 -16.496 -3.713  1.00 0.00 ? 67 PRO A HB3  2  
ATOM 2266  H HG2  . PRO A 1 67 ? -10.546 -19.272 -4.794  1.00 0.00 ? 67 PRO A HG2  2  
ATOM 2267  H HG3  . PRO A 1 67 ? -9.405  -17.916 -4.866  1.00 0.00 ? 67 PRO A HG3  2  
ATOM 2268  H HD2  . PRO A 1 67 ? -9.165  -19.928 -3.070  1.00 0.00 ? 67 PRO A HD2  2  
ATOM 2269  H HD3  . PRO A 1 67 ? -8.661  -18.264 -2.713  1.00 0.00 ? 67 PRO A HD3  2  
ATOM 2270  N N    . SER A 1 68 ? -14.009 -18.369 -3.280  1.00 0.00 ? 68 SER A N    2  
ATOM 2271  C CA   . SER A 1 68 ? -15.232 -19.118 -3.543  1.00 0.00 ? 68 SER A CA   2  
ATOM 2272  C C    . SER A 1 68 ? -16.206 -18.293 -4.379  1.00 0.00 ? 68 SER A C    2  
ATOM 2273  O O    . SER A 1 68 ? -16.064 -17.076 -4.496  1.00 0.00 ? 68 SER A O    2  
ATOM 2274  C CB   . SER A 1 68 ? -15.895 -19.531 -2.227  1.00 0.00 ? 68 SER A CB   2  
ATOM 2275  O OG   . SER A 1 68 ? -17.140 -20.167 -2.461  1.00 0.00 ? 68 SER A OG   2  
ATOM 2276  H H    . SER A 1 68 ? -13.976 -17.414 -3.501  1.00 0.00 ? 68 SER A H    2  
ATOM 2277  H HA   . SER A 1 68 ? -14.964 -20.006 -4.095  1.00 0.00 ? 68 SER A HA   2  
ATOM 2278  H HB2  . SER A 1 68 ? -15.248 -20.216 -1.700  1.00 0.00 ? 68 SER A HB2  2  
ATOM 2279  H HB3  . SER A 1 68 ? -16.061 -18.653 -1.620  1.00 0.00 ? 68 SER A HB3  2  
ATOM 2280  H HG   . SER A 1 68 ? -17.831 -19.703 -1.984  1.00 0.00 ? 68 SER A HG   2  
ATOM 2281  N N    . SER A 1 69 ? -17.195 -18.965 -4.959  1.00 0.00 ? 69 SER A N    2  
ATOM 2282  C CA   . SER A 1 69 ? -18.191 -18.296 -5.788  1.00 0.00 ? 69 SER A CA   2  
ATOM 2283  C C    . SER A 1 69 ? -19.294 -17.687 -4.927  1.00 0.00 ? 69 SER A C    2  
ATOM 2284  O O    . SER A 1 69 ? -20.231 -18.374 -4.523  1.00 0.00 ? 69 SER A O    2  
ATOM 2285  C CB   . SER A 1 69 ? -18.795 -19.281 -6.790  1.00 0.00 ? 69 SER A CB   2  
ATOM 2286  O OG   . SER A 1 69 ? -19.726 -18.635 -7.641  1.00 0.00 ? 69 SER A OG   2  
ATOM 2287  H H    . SER A 1 69 ? -17.255 -19.935 -4.828  1.00 0.00 ? 69 SER A H    2  
ATOM 2288  H HA   . SER A 1 69 ? -17.694 -17.505 -6.329  1.00 0.00 ? 69 SER A HA   2  
ATOM 2289  H HB2  . SER A 1 69 ? -18.008 -19.705 -7.394  1.00 0.00 ? 69 SER A HB2  2  
ATOM 2290  H HB3  . SER A 1 69 ? -19.303 -20.070 -6.254  1.00 0.00 ? 69 SER A HB3  2  
ATOM 2291  H HG   . SER A 1 69 ? -19.880 -19.178 -8.418  1.00 0.00 ? 69 SER A HG   2  
ATOM 2292  N N    . GLY A 1 70 ? -19.173 -16.392 -4.651  1.00 0.00 ? 70 GLY A N    2  
ATOM 2293  C CA   . GLY A 1 70 ? -20.166 -15.711 -3.840  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2294  C C    . GLY A 1 70 ? -21.070 -14.815 -4.662  1.00 0.00 ? 70 GLY A C    2  
ATOM 2295  O O    . GLY A 1 70 ? -21.001 -13.590 -4.559  1.00 0.00 ? 70 GLY A O    2  
ATOM 2296  H H    . GLY A 1 70 ? -18.404 -15.895 -5.001  1.00 0.00 ? 70 GLY A H    2  
ATOM 2297  H HA2  . GLY A 1 70 ? -20.771 -16.450 -3.335  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2298  H HA3  . GLY A 1 70 ? -19.658 -15.110 -3.100  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2299  N N    . GLY A 1 1  ? -5.821  15.266  -6.167  1.00 0.00 ? 1  GLY A N    3  
ATOM 2300  C CA   . GLY A 1 1  ? -5.895  16.529  -5.457  1.00 0.00 ? 1  GLY A CA   3  
ATOM 2301  C C    . GLY A 1 1  ? -6.793  16.458  -4.238  1.00 0.00 ? 1  GLY A C    3  
ATOM 2302  O O    . GLY A 1 1  ? -6.313  16.443  -3.104  1.00 0.00 ? 1  GLY A O    3  
ATOM 2303  H H1   . GLY A 1 1  ? -5.857  14.423  -5.668  1.00 0.00 ? 1  GLY A H1   3  
ATOM 2304  H HA2  . GLY A 1 1  ? -4.901  16.811  -5.143  1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2305  H HA3  . GLY A 1 1  ? -6.278  17.284  -6.128  1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2306  N N    . SER A 1 2  ? -8.101  16.415  -4.470  1.00 0.00 ? 2  SER A N    3  
ATOM 2307  C CA   . SER A 1 2  ? -9.069  16.351  -3.382  1.00 0.00 ? 2  SER A CA   3  
ATOM 2308  C C    . SER A 1 2  ? -9.669  14.952  -3.270  1.00 0.00 ? 2  SER A C    3  
ATOM 2309  O O    . SER A 1 2  ? -9.739  14.215  -4.253  1.00 0.00 ? 2  SER A O    3  
ATOM 2310  C CB   . SER A 1 2  ? -10.181 17.379  -3.598  1.00 0.00 ? 2  SER A CB   3  
ATOM 2311  O OG   . SER A 1 2  ? -9.652  18.616  -4.043  1.00 0.00 ? 2  SER A OG   3  
ATOM 2312  H H    . SER A 1 2  ? -8.423  16.430  -5.396  1.00 0.00 ? 2  SER A H    3  
ATOM 2313  H HA   . SER A 1 2  ? -8.551  16.582  -2.463  1.00 0.00 ? 2  SER A HA   3  
ATOM 2314  H HB2  . SER A 1 2  ? -10.871 17.008  -4.342  1.00 0.00 ? 2  SER A HB2  3  
ATOM 2315  H HB3  . SER A 1 2  ? -10.707 17.539  -2.668  1.00 0.00 ? 2  SER A HB3  3  
ATOM 2316  H HG   . SER A 1 2  ? -8.761  18.724  -3.703  1.00 0.00 ? 2  SER A HG   3  
ATOM 2317  N N    . SER A 1 3  ? -10.101 14.595  -2.065  1.00 0.00 ? 3  SER A N    3  
ATOM 2318  C CA   . SER A 1 3  ? -10.691 13.284  -1.822  1.00 0.00 ? 3  SER A CA   3  
ATOM 2319  C C    . SER A 1 3  ? -12.171 13.411  -1.471  1.00 0.00 ? 3  SER A C    3  
ATOM 2320  O O    . SER A 1 3  ? -13.030 12.833  -2.135  1.00 0.00 ? 3  SER A O    3  
ATOM 2321  C CB   . SER A 1 3  ? -9.948  12.567  -0.693  1.00 0.00 ? 3  SER A CB   3  
ATOM 2322  O OG   . SER A 1 3  ? -10.369 11.219  -0.580  1.00 0.00 ? 3  SER A OG   3  
ATOM 2323  H H    . SER A 1 3  ? -10.017 15.227  -1.321  1.00 0.00 ? 3  SER A H    3  
ATOM 2324  H HA   . SER A 1 3  ? -10.597 12.705  -2.729  1.00 0.00 ? 3  SER A HA   3  
ATOM 2325  H HB2  . SER A 1 3  ? -8.888  12.584  -0.897  1.00 0.00 ? 3  SER A HB2  3  
ATOM 2326  H HB3  . SER A 1 3  ? -10.143 13.073  0.241   1.00 0.00 ? 3  SER A HB3  3  
ATOM 2327  H HG   . SER A 1 3  ? -9.601  10.648  -0.509  1.00 0.00 ? 3  SER A HG   3  
ATOM 2328  N N    . GLY A 1 4  ? -12.460 14.173  -0.421  1.00 0.00 ? 4  GLY A N    3  
ATOM 2329  C CA   . GLY A 1 4  ? -13.835 14.363  0.002   1.00 0.00 ? 4  GLY A CA   3  
ATOM 2330  C C    . GLY A 1 4  ? -14.250 13.385  1.083   1.00 0.00 ? 4  GLY A C    3  
ATOM 2331  O O    . GLY A 1 4  ? -15.436 13.100  1.251   1.00 0.00 ? 4  GLY A O    3  
ATOM 2332  H H    . GLY A 1 4  ? -11.734 14.610  0.072   1.00 0.00 ? 4  GLY A H    3  
ATOM 2333  H HA2  . GLY A 1 4  ? -13.950 15.369  0.377   1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2334  H HA3  . GLY A 1 4  ? -14.483 14.232  -0.853  1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2335  N N    . SER A 1 5  ? -13.271 12.869  1.819   1.00 0.00 ? 5  SER A N    3  
ATOM 2336  C CA   . SER A 1 5  ? -13.540 11.913  2.887   1.00 0.00 ? 5  SER A CA   3  
ATOM 2337  C C    . SER A 1 5  ? -14.499 12.504  3.916   1.00 0.00 ? 5  SER A C    3  
ATOM 2338  O O    . SER A 1 5  ? -14.172 13.472  4.602   1.00 0.00 ? 5  SER A O    3  
ATOM 2339  C CB   . SER A 1 5  ? -12.235 11.498  3.569   1.00 0.00 ? 5  SER A CB   3  
ATOM 2340  O OG   . SER A 1 5  ? -11.204 11.295  2.618   1.00 0.00 ? 5  SER A OG   3  
ATOM 2341  H H    . SER A 1 5  ? -12.345 13.136  1.637   1.00 0.00 ? 5  SER A H    3  
ATOM 2342  H HA   . SER A 1 5  ? -13.998 11.042  2.444   1.00 0.00 ? 5  SER A HA   3  
ATOM 2343  H HB2  . SER A 1 5  ? -11.927 12.273  4.255   1.00 0.00 ? 5  SER A HB2  3  
ATOM 2344  H HB3  . SER A 1 5  ? -12.393 10.578  4.113   1.00 0.00 ? 5  SER A HB3  3  
ATOM 2345  H HG   . SER A 1 5  ? -10.359 11.533  3.005   1.00 0.00 ? 5  SER A HG   3  
ATOM 2346  N N    . SER A 1 6  ? -15.685 11.913  4.017   1.00 0.00 ? 6  SER A N    3  
ATOM 2347  C CA   . SER A 1 6  ? -16.695 12.382  4.959   1.00 0.00 ? 6  SER A CA   3  
ATOM 2348  C C    . SER A 1 6  ? -17.332 11.211  5.700   1.00 0.00 ? 6  SER A C    3  
ATOM 2349  O O    . SER A 1 6  ? -17.737 10.222  5.091   1.00 0.00 ? 6  SER A O    3  
ATOM 2350  C CB   . SER A 1 6  ? -17.772 13.184  4.227   1.00 0.00 ? 6  SER A CB   3  
ATOM 2351  O OG   . SER A 1 6  ? -18.363 12.418  3.192   1.00 0.00 ? 6  SER A OG   3  
ATOM 2352  H H    . SER A 1 6  ? -15.887 11.145  3.443   1.00 0.00 ? 6  SER A H    3  
ATOM 2353  H HA   . SER A 1 6  ? -16.206 13.024  5.677   1.00 0.00 ? 6  SER A HA   3  
ATOM 2354  H HB2  . SER A 1 6  ? -18.541 13.473  4.928   1.00 0.00 ? 6  SER A HB2  3  
ATOM 2355  H HB3  . SER A 1 6  ? -17.328 14.069  3.795   1.00 0.00 ? 6  SER A HB3  3  
ATOM 2356  H HG   . SER A 1 6  ? -17.681 11.928  2.727   1.00 0.00 ? 6  SER A HG   3  
ATOM 2357  N N    . GLY A 1 7  ? -17.418 11.331  7.022   1.00 0.00 ? 7  GLY A N    3  
ATOM 2358  C CA   . GLY A 1 7  ? -18.006 10.276  7.826   1.00 0.00 ? 7  GLY A CA   3  
ATOM 2359  C C    . GLY A 1 7  ? -16.967 9.322   8.382   1.00 0.00 ? 7  GLY A C    3  
ATOM 2360  O O    . GLY A 1 7  ? -16.177 8.749   7.632   1.00 0.00 ? 7  GLY A O    3  
ATOM 2361  H H    . GLY A 1 7  ? -17.078 12.142  7.454   1.00 0.00 ? 7  GLY A H    3  
ATOM 2362  H HA2  . GLY A 1 7  ? -18.546 10.723  8.647   1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2363  H HA3  . GLY A 1 7  ? -18.699 9.717   7.214   1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2364  N N    . ARG A 1 8  ? -16.967 9.153   9.700   1.00 0.00 ? 8  ARG A N    3  
ATOM 2365  C CA   . ARG A 1 8  ? -16.015 8.265   10.356  1.00 0.00 ? 8  ARG A CA   3  
ATOM 2366  C C    . ARG A 1 8  ? -16.738 7.138   11.088  1.00 0.00 ? 8  ARG A C    3  
ATOM 2367  O O    . ARG A 1 8  ? -17.241 7.325   12.196  1.00 0.00 ? 8  ARG A O    3  
ATOM 2368  C CB   . ARG A 1 8  ? -15.146 9.051   11.339  1.00 0.00 ? 8  ARG A CB   3  
ATOM 2369  C CG   . ARG A 1 8  ? -13.844 8.351   11.695  1.00 0.00 ? 8  ARG A CG   3  
ATOM 2370  C CD   . ARG A 1 8  ? -12.894 8.304   10.509  1.00 0.00 ? 8  ARG A CD   3  
ATOM 2371  N NE   . ARG A 1 8  ? -11.499 8.203   10.928  1.00 0.00 ? 8  ARG A NE   3  
ATOM 2372  C CZ   . ARG A 1 8  ? -10.474 8.219   10.083  1.00 0.00 ? 8  ARG A CZ   3  
ATOM 2373  N NH1  . ARG A 1 8  ? -10.688 8.333   8.779   1.00 0.00 ? 8  ARG A NH1  3  
ATOM 2374  N NH2  . ARG A 1 8  ? -9.233  8.122   10.541  1.00 0.00 ? 8  ARG A NH2  3  
ATOM 2375  H H    . ARG A 1 8  ? -17.622 9.638   10.245  1.00 0.00 ? 8  ARG A H    3  
ATOM 2376  H HA   . ARG A 1 8  ? -15.382 7.835   9.594   1.00 0.00 ? 8  ARG A HA   3  
ATOM 2377  H HB2  . ARG A 1 8  ? -14.906 10.009  10.904  1.00 0.00 ? 8  ARG A HB2  3  
ATOM 2378  H HB3  . ARG A 1 8  ? -15.705 9.208   12.249  1.00 0.00 ? 8  ARG A HB3  3  
ATOM 2379  H HG2  . ARG A 1 8  ? -13.367 8.887   12.503  1.00 0.00 ? 8  ARG A HG2  3  
ATOM 2380  H HG3  . ARG A 1 8  ? -14.063 7.342   12.010  1.00 0.00 ? 8  ARG A HG3  3  
ATOM 2381  H HD2  . ARG A 1 8  ? -13.141 7.447   9.901   1.00 0.00 ? 8  ARG A HD2  3  
ATOM 2382  H HD3  . ARG A 1 8  ? -13.021 9.206   9.928   1.00 0.00 ? 8  ARG A HD3  3  
ATOM 2383  H HE   . ARG A 1 8  ? -11.318 8.118   11.887  1.00 0.00 ? 8  ARG A HE   3  
ATOM 2384  H HH11 . ARG A 1 8  ? -11.622 8.407   8.431   1.00 0.00 ? 8  ARG A HH11 3  
ATOM 2385  H HH12 . ARG A 1 8  ? -9.915  8.346   8.145   1.00 0.00 ? 8  ARG A HH12 3  
ATOM 2386  H HH21 . ARG A 1 8  ? -9.068  8.036   11.524  1.00 0.00 ? 8  ARG A HH21 3  
ATOM 2387  H HH22 . ARG A 1 8  ? -8.463  8.134   9.905   1.00 0.00 ? 8  ARG A HH22 3  
ATOM 2388  N N    . LYS A 1 9  ? -16.787 5.967   10.461  1.00 0.00 ? 9  LYS A N    3  
ATOM 2389  C CA   . LYS A 1 9  ? -17.447 4.809   11.051  1.00 0.00 ? 9  LYS A CA   3  
ATOM 2390  C C    . LYS A 1 9  ? -16.608 3.550   10.862  1.00 0.00 ? 9  LYS A C    3  
ATOM 2391  O O    . LYS A 1 9  ? -15.541 3.588   10.248  1.00 0.00 ? 9  LYS A O    3  
ATOM 2392  C CB   . LYS A 1 9  ? -18.830 4.612   10.426  1.00 0.00 ? 9  LYS A CB   3  
ATOM 2393  C CG   . LYS A 1 9  ? -19.835 5.680   10.823  1.00 0.00 ? 9  LYS A CG   3  
ATOM 2394  C CD   . LYS A 1 9  ? -20.637 5.264   12.044  1.00 0.00 ? 9  LYS A CD   3  
ATOM 2395  C CE   . LYS A 1 9  ? -21.615 6.351   12.465  1.00 0.00 ? 9  LYS A CE   3  
ATOM 2396  N NZ   . LYS A 1 9  ? -22.881 6.292   11.683  1.00 0.00 ? 9  LYS A NZ   3  
ATOM 2397  H H    . LYS A 1 9  ? -16.367 5.880   9.579   1.00 0.00 ? 9  LYS A H    3  
ATOM 2398  H HA   . LYS A 1 9  ? -17.562 4.996   12.108  1.00 0.00 ? 9  LYS A HA   3  
ATOM 2399  H HB2  . LYS A 1 9  ? -18.731 4.622   9.351   1.00 0.00 ? 9  LYS A HB2  3  
ATOM 2400  H HB3  . LYS A 1 9  ? -19.217 3.651   10.735  1.00 0.00 ? 9  LYS A HB3  3  
ATOM 2401  H HG2  . LYS A 1 9  ? -19.305 6.594   11.048  1.00 0.00 ? 9  LYS A HG2  3  
ATOM 2402  H HG3  . LYS A 1 9  ? -20.512 5.848   9.998   1.00 0.00 ? 9  LYS A HG3  3  
ATOM 2403  H HD2  . LYS A 1 9  ? -21.192 4.367   11.812  1.00 0.00 ? 9  LYS A HD2  3  
ATOM 2404  H HD3  . LYS A 1 9  ? -19.957 5.068   12.861  1.00 0.00 ? 9  LYS A HD3  3  
ATOM 2405  H HE2  . LYS A 1 9  ? -21.843 6.226   13.512  1.00 0.00 ? 9  LYS A HE2  3  
ATOM 2406  H HE3  . LYS A 1 9  ? -21.151 7.314   12.310  1.00 0.00 ? 9  LYS A HE3  3  
ATOM 2407  H HZ1  . LYS A 1 9  ? -23.059 7.207   11.223  1.00 0.00 ? 9  LYS A HZ1  3  
ATOM 2408  H HZ2  . LYS A 1 9  ? -23.679 6.071   12.311  1.00 0.00 ? 9  LYS A HZ2  3  
ATOM 2409  H HZ3  . LYS A 1 9  ? -22.815 5.555   10.951  1.00 0.00 ? 9  LYS A HZ3  3  
ATOM 2410  N N    . LYS A 1 10 ? -17.097 2.433   11.391  1.00 0.00 ? 10 LYS A N    3  
ATOM 2411  C CA   . LYS A 1 10 ? -16.394 1.161   11.279  1.00 0.00 ? 10 LYS A CA   3  
ATOM 2412  C C    . LYS A 1 10 ? -16.293 0.722   9.822   1.00 0.00 ? 10 LYS A C    3  
ATOM 2413  O O    . LYS A 1 10 ? -17.288 0.329   9.212   1.00 0.00 ? 10 LYS A O    3  
ATOM 2414  C CB   . LYS A 1 10 ? -17.111 0.085   12.098  1.00 0.00 ? 10 LYS A CB   3  
ATOM 2415  C CG   . LYS A 1 10 ? -16.399 -1.257  12.094  1.00 0.00 ? 10 LYS A CG   3  
ATOM 2416  C CD   . LYS A 1 10 ? -15.388 -1.355  13.224  1.00 0.00 ? 10 LYS A CD   3  
ATOM 2417  C CE   . LYS A 1 10 ? -16.033 -1.855  14.508  1.00 0.00 ? 10 LYS A CE   3  
ATOM 2418  N NZ   . LYS A 1 10 ? -16.674 -0.751  15.273  1.00 0.00 ? 10 LYS A NZ   3  
ATOM 2419  H H    . LYS A 1 10 ? -17.953 2.466   11.869  1.00 0.00 ? 10 LYS A H    3  
ATOM 2420  H HA   . LYS A 1 10 ? -15.398 1.296   11.671  1.00 0.00 ? 10 LYS A HA   3  
ATOM 2421  H HB2  . LYS A 1 10 ? -17.192 0.423   13.121  1.00 0.00 ? 10 LYS A HB2  3  
ATOM 2422  H HB3  . LYS A 1 10 ? -18.103 -0.056  11.695  1.00 0.00 ? 10 LYS A HB3  3  
ATOM 2423  H HG2  . LYS A 1 10 ? -17.131 -2.043  12.211  1.00 0.00 ? 10 LYS A HG2  3  
ATOM 2424  H HG3  . LYS A 1 10 ? -15.885 -1.379  11.151  1.00 0.00 ? 10 LYS A HG3  3  
ATOM 2425  H HD2  . LYS A 1 10 ? -14.606 -2.042  12.937  1.00 0.00 ? 10 LYS A HD2  3  
ATOM 2426  H HD3  . LYS A 1 10 ? -14.964 -0.377  13.402  1.00 0.00 ? 10 LYS A HD3  3  
ATOM 2427  H HE2  . LYS A 1 10 ? -16.783 -2.590  14.256  1.00 0.00 ? 10 LYS A HE2  3  
ATOM 2428  H HE3  . LYS A 1 10 ? -15.272 -2.314  15.122  1.00 0.00 ? 10 LYS A HE3  3  
ATOM 2429  H HZ1  . LYS A 1 10 ? -16.646 -0.959  16.292  1.00 0.00 ? 10 LYS A HZ1  3  
ATOM 2430  H HZ2  . LYS A 1 10 ? -17.666 -0.642  14.980  1.00 0.00 ? 10 LYS A HZ2  3  
ATOM 2431  H HZ3  . LYS A 1 10 ? -16.172 0.143   15.099  1.00 0.00 ? 10 LYS A HZ3  3  
ATOM 2432  N N    . ARG A 1 11 ? -15.086 0.790   9.270   1.00 0.00 ? 11 ARG A N    3  
ATOM 2433  C CA   . ARG A 1 11 ? -14.856 0.399   7.885   1.00 0.00 ? 11 ARG A CA   3  
ATOM 2434  C C    . ARG A 1 11 ? -13.363 0.278   7.594   1.00 0.00 ? 11 ARG A C    3  
ATOM 2435  O O    . ARG A 1 11 ? -12.529 0.549   8.459   1.00 0.00 ? 11 ARG A O    3  
ATOM 2436  C CB   . ARG A 1 11 ? -15.491 1.415   6.933   1.00 0.00 ? 11 ARG A CB   3  
ATOM 2437  C CG   . ARG A 1 11 ? -16.084 0.790   5.681   1.00 0.00 ? 11 ARG A CG   3  
ATOM 2438  C CD   . ARG A 1 11 ? -17.113 1.704   5.036   1.00 0.00 ? 11 ARG A CD   3  
ATOM 2439  N NE   . ARG A 1 11 ? -16.630 3.077   4.920   1.00 0.00 ? 11 ARG A NE   3  
ATOM 2440  C CZ   . ARG A 1 11 ? -15.715 3.462   4.038   1.00 0.00 ? 11 ARG A CZ   3  
ATOM 2441  N NH1  . ARG A 1 11 ? -15.187 2.582   3.198   1.00 0.00 ? 11 ARG A NH1  3  
ATOM 2442  N NH2  . ARG A 1 11 ? -15.326 4.730   3.994   1.00 0.00 ? 11 ARG A NH2  3  
ATOM 2443  H H    . ARG A 1 11 ? -14.332 1.111   9.807   1.00 0.00 ? 11 ARG A H    3  
ATOM 2444  H HA   . ARG A 1 11 ? -15.320 -0.564  7.730   1.00 0.00 ? 11 ARG A HA   3  
ATOM 2445  H HB2  . ARG A 1 11 ? -16.279 1.937   7.456   1.00 0.00 ? 11 ARG A HB2  3  
ATOM 2446  H HB3  . ARG A 1 11 ? -14.737 2.127   6.632   1.00 0.00 ? 11 ARG A HB3  3  
ATOM 2447  H HG2  . ARG A 1 11 ? -15.290 0.603   4.973   1.00 0.00 ? 11 ARG A HG2  3  
ATOM 2448  H HG3  . ARG A 1 11 ? -16.559 -0.143  5.947   1.00 0.00 ? 11 ARG A HG3  3  
ATOM 2449  H HD2  . ARG A 1 11 ? -17.340 1.328   4.049   1.00 0.00 ? 11 ARG A HD2  3  
ATOM 2450  H HD3  . ARG A 1 11 ? -18.009 1.697   5.639   1.00 0.00 ? 11 ARG A HD3  3  
ATOM 2451  H HE   . ARG A 1 11 ? -17.006 3.744   5.531   1.00 0.00 ? 11 ARG A HE   3  
ATOM 2452  H HH11 . ARG A 1 11 ? -15.479 1.626   3.228   1.00 0.00 ? 11 ARG A HH11 3  
ATOM 2453  H HH12 . ARG A 1 11 ? -14.499 2.875   2.533   1.00 0.00 ? 11 ARG A HH12 3  
ATOM 2454  H HH21 . ARG A 1 11 ? -15.721 5.396   4.625   1.00 0.00 ? 11 ARG A HH21 3  
ATOM 2455  H HH22 . ARG A 1 11 ? -14.637 5.019   3.329   1.00 0.00 ? 11 ARG A HH22 3  
ATOM 2456  N N    . ILE A 1 12 ? -13.034 -0.130  6.374   1.00 0.00 ? 12 ILE A N    3  
ATOM 2457  C CA   . ILE A 1 12 ? -11.642 -0.286  5.970   1.00 0.00 ? 12 ILE A CA   3  
ATOM 2458  C C    . ILE A 1 12 ? -10.931 1.062   5.916   1.00 0.00 ? 12 ILE A C    3  
ATOM 2459  O O    . ILE A 1 12 ? -11.454 2.048   5.395   1.00 0.00 ? 12 ILE A O    3  
ATOM 2460  C CB   . ILE A 1 12 ? -11.527 -0.969  4.595   1.00 0.00 ? 12 ILE A CB   3  
ATOM 2461  C CG1  . ILE A 1 12 ? -12.239 -2.323  4.613   1.00 0.00 ? 12 ILE A CG1  3  
ATOM 2462  C CG2  . ILE A 1 12 ? -10.066 -1.138  4.207   1.00 0.00 ? 12 ILE A CG2  3  
ATOM 2463  C CD1  . ILE A 1 12 ? -11.687 -3.283  5.644   1.00 0.00 ? 12 ILE A CD1  3  
ATOM 2464  H H    . ILE A 1 12 ? -13.744 -0.331  5.729   1.00 0.00 ? 12 ILE A H    3  
ATOM 2465  H HA   . ILE A 1 12 ? -11.151 -0.911  6.702   1.00 0.00 ? 12 ILE A HA   3  
ATOM 2466  H HB   . ILE A 1 12 ? -11.998 -0.333  3.861   1.00 0.00 ? 12 ILE A HB   3  
ATOM 2467  H HG12 . ILE A 1 12 ? -13.285 -2.171  4.830   1.00 0.00 ? 12 ILE A HG12 3  
ATOM 2468  H HG13 . ILE A 1 12 ? -12.141 -2.786  3.642   1.00 0.00 ? 12 ILE A HG13 3  
ATOM 2469  H HG21 . ILE A 1 12 ? -9.568  -0.181  4.254   1.00 0.00 ? 12 ILE A HG21 3  
ATOM 2470  H HG22 . ILE A 1 12 ? -9.590  -1.824  4.892   1.00 0.00 ? 12 ILE A HG22 3  
ATOM 2471  H HG23 . ILE A 1 12 ? -10.002 -1.529  3.203   1.00 0.00 ? 12 ILE A HG23 3  
ATOM 2472  H HD11 . ILE A 1 12 ? -10.809 -2.853  6.103   1.00 0.00 ? 12 ILE A HD11 3  
ATOM 2473  H HD12 . ILE A 1 12 ? -12.435 -3.469  6.400   1.00 0.00 ? 12 ILE A HD12 3  
ATOM 2474  H HD13 . ILE A 1 12 ? -11.422 -4.214  5.164   1.00 0.00 ? 12 ILE A HD13 3  
ATOM 2475  N N    . PRO A 1 13 ? -9.708  1.109   6.465   1.00 0.00 ? 13 PRO A N    3  
ATOM 2476  C CA   . PRO A 1 13 ? -8.898  2.330   6.490   1.00 0.00 ? 13 PRO A CA   3  
ATOM 2477  C C    . PRO A 1 13 ? -8.190  2.583   5.163   1.00 0.00 ? 13 PRO A C    3  
ATOM 2478  O O    . PRO A 1 13 ? -8.467  1.919   4.164   1.00 0.00 ? 13 PRO A O    3  
ATOM 2479  C CB   . PRO A 1 13 ? -7.876  2.056   7.597   1.00 0.00 ? 13 PRO A CB   3  
ATOM 2480  C CG   . PRO A 1 13 ? -7.760  0.571   7.645   1.00 0.00 ? 13 PRO A CG   3  
ATOM 2481  C CD   . PRO A 1 13 ? -9.022  -0.027  7.104   1.00 0.00 ? 13 PRO A CD   3  
ATOM 2482  H HA   . PRO A 1 13 ? -9.490  3.195   6.751   1.00 0.00 ? 13 PRO A HA   3  
ATOM 2483  H HB2  . PRO A 1 13 ? -6.933  2.519   7.343   1.00 0.00 ? 13 PRO A HB2  3  
ATOM 2484  H HB3  . PRO A 1 13 ? -8.239  2.454   8.533   1.00 0.00 ? 13 PRO A HB3  3  
ATOM 2485  H HG2  . PRO A 1 13 ? -6.932  0.248   7.034   1.00 0.00 ? 13 PRO A HG2  3  
ATOM 2486  H HG3  . PRO A 1 13 ? -7.624  0.247   8.666   1.00 0.00 ? 13 PRO A HG3  3  
ATOM 2487  H HD2  . PRO A 1 13 ? -8.764  -0.781  6.375   1.00 0.00 ? 13 PRO A HD2  3  
ATOM 2488  H HD3  . PRO A 1 13 ? -9.630  -0.451  7.889   1.00 0.00 ? 13 PRO A HD3  3  
ATOM 2489  N N    . TYR A 1 14 ? -7.276  3.547   5.160   1.00 0.00 ? 14 TYR A N    3  
ATOM 2490  C CA   . TYR A 1 14 ? -6.530  3.889   3.955   1.00 0.00 ? 14 TYR A CA   3  
ATOM 2491  C C    . TYR A 1 14 ? -7.460  4.431   2.874   1.00 0.00 ? 14 TYR A C    3  
ATOM 2492  O O    . TYR A 1 14 ? -8.281  3.699   2.321   1.00 0.00 ? 14 TYR A O    3  
ATOM 2493  C CB   . TYR A 1 14 ? -5.779  2.665   3.430   1.00 0.00 ? 14 TYR A CB   3  
ATOM 2494  C CG   . TYR A 1 14 ? -4.967  1.953   4.489   1.00 0.00 ? 14 TYR A CG   3  
ATOM 2495  C CD1  . TYR A 1 14 ? -3.833  2.541   5.035   1.00 0.00 ? 14 TYR A CD1  3  
ATOM 2496  C CD2  . TYR A 1 14 ? -5.333  0.692   4.942   1.00 0.00 ? 14 TYR A CD2  3  
ATOM 2497  C CE1  . TYR A 1 14 ? -3.088  1.895   6.002   1.00 0.00 ? 14 TYR A CE1  3  
ATOM 2498  C CE2  . TYR A 1 14 ? -4.595  0.038   5.910   1.00 0.00 ? 14 TYR A CE2  3  
ATOM 2499  C CZ   . TYR A 1 14 ? -3.473  0.644   6.436   1.00 0.00 ? 14 TYR A CZ   3  
ATOM 2500  O OH   . TYR A 1 14 ? -2.735  -0.005  7.399   1.00 0.00 ? 14 TYR A OH   3  
ATOM 2501  H H    . TYR A 1 14 ? -7.100  4.042   5.987   1.00 0.00 ? 14 TYR A H    3  
ATOM 2502  H HA   . TYR A 1 14 ? -5.814  4.655   4.214   1.00 0.00 ? 14 TYR A HA   3  
ATOM 2503  H HB2  . TYR A 1 14 ? -6.490  1.960   3.028   1.00 0.00 ? 14 TYR A HB2  3  
ATOM 2504  H HB3  . TYR A 1 14 ? -5.103  2.974   2.646   1.00 0.00 ? 14 TYR A HB3  3  
ATOM 2505  H HD1  . TYR A 1 14 ? -3.534  3.522   4.693   1.00 0.00 ? 14 TYR A HD1  3  
ATOM 2506  H HD2  . TYR A 1 14 ? -6.213  0.220   4.527   1.00 0.00 ? 14 TYR A HD2  3  
ATOM 2507  H HE1  . TYR A 1 14 ? -2.210  2.368   6.415   1.00 0.00 ? 14 TYR A HE1  3  
ATOM 2508  H HE2  . TYR A 1 14 ? -4.896  -0.942  6.250   1.00 0.00 ? 14 TYR A HE2  3  
ATOM 2509  H HH   . TYR A 1 14 ? -1.813  -0.032  7.131   1.00 0.00 ? 14 TYR A HH   3  
ATOM 2510  N N    . SER A 1 15 ? -7.325  5.720   2.577   1.00 0.00 ? 15 SER A N    3  
ATOM 2511  C CA   . SER A 1 15 ? -8.154  6.362   1.564   1.00 0.00 ? 15 SER A CA   3  
ATOM 2512  C C    . SER A 1 15 ? -7.811  5.843   0.171   1.00 0.00 ? 15 SER A C    3  
ATOM 2513  O O    . SER A 1 15 ? -6.764  5.228   -0.035  1.00 0.00 ? 15 SER A O    3  
ATOM 2514  C CB   . SER A 1 15 ? -7.972  7.880   1.614   1.00 0.00 ? 15 SER A CB   3  
ATOM 2515  O OG   . SER A 1 15 ? -9.046  8.544   0.969   1.00 0.00 ? 15 SER A OG   3  
ATOM 2516  H H    . SER A 1 15 ? -6.652  6.251   3.052   1.00 0.00 ? 15 SER A H    3  
ATOM 2517  H HA   . SER A 1 15 ? -9.185  6.124   1.780   1.00 0.00 ? 15 SER A HA   3  
ATOM 2518  H HB2  . SER A 1 15 ? -7.933  8.202   2.643   1.00 0.00 ? 15 SER A HB2  3  
ATOM 2519  H HB3  . SER A 1 15 ? -7.050  8.146   1.117   1.00 0.00 ? 15 SER A HB3  3  
ATOM 2520  H HG   . SER A 1 15 ? -9.097  9.450   1.283   1.00 0.00 ? 15 SER A HG   3  
ATOM 2521  N N    . LYS A 1 16 ? -8.701  6.094   -0.783  1.00 0.00 ? 16 LYS A N    3  
ATOM 2522  C CA   . LYS A 1 16 ? -8.494  5.654   -2.158  1.00 0.00 ? 16 LYS A CA   3  
ATOM 2523  C C    . LYS A 1 16 ? -7.139  6.120   -2.680  1.00 0.00 ? 16 LYS A C    3  
ATOM 2524  O O    . LYS A 1 16 ? -6.472  5.405   -3.427  1.00 0.00 ? 16 LYS A O    3  
ATOM 2525  C CB   . LYS A 1 16 ? -9.610  6.188   -3.059  1.00 0.00 ? 16 LYS A CB   3  
ATOM 2526  C CG   . LYS A 1 16 ? -9.740  7.701   -3.035  1.00 0.00 ? 16 LYS A CG   3  
ATOM 2527  C CD   . LYS A 1 16 ? -10.919 8.173   -3.869  1.00 0.00 ? 16 LYS A CD   3  
ATOM 2528  C CE   . LYS A 1 16 ? -11.071 9.685   -3.815  1.00 0.00 ? 16 LYS A CE   3  
ATOM 2529  N NZ   . LYS A 1 16 ? -10.124 10.371  -4.737  1.00 0.00 ? 16 LYS A NZ   3  
ATOM 2530  H H    . LYS A 1 16 ? -9.517  6.589   -0.557  1.00 0.00 ? 16 LYS A H    3  
ATOM 2531  H HA   . LYS A 1 16 ? -8.520  4.575   -2.168  1.00 0.00 ? 16 LYS A HA   3  
ATOM 2532  H HB2  . LYS A 1 16 ? -9.414  5.880   -4.075  1.00 0.00 ? 16 LYS A HB2  3  
ATOM 2533  H HB3  . LYS A 1 16 ? -10.550 5.762   -2.738  1.00 0.00 ? 16 LYS A HB3  3  
ATOM 2534  H HG2  . LYS A 1 16 ? -9.882  8.025   -2.015  1.00 0.00 ? 16 LYS A HG2  3  
ATOM 2535  H HG3  . LYS A 1 16 ? -8.834  8.137   -3.430  1.00 0.00 ? 16 LYS A HG3  3  
ATOM 2536  H HD2  . LYS A 1 16 ? -10.766 7.874   -4.895  1.00 0.00 ? 16 LYS A HD2  3  
ATOM 2537  H HD3  . LYS A 1 16 ? -11.823 7.715   -3.490  1.00 0.00 ? 16 LYS A HD3  3  
ATOM 2538  H HE2  . LYS A 1 16 ? -12.081 9.943   -4.093  1.00 0.00 ? 16 LYS A HE2  3  
ATOM 2539  H HE3  . LYS A 1 16 ? -10.880 10.017  -2.805  1.00 0.00 ? 16 LYS A HE3  3  
ATOM 2540  H HZ1  . LYS A 1 16 ? -10.516 11.287  -5.035  1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 2541  H HZ2  . LYS A 1 16 ? -9.962  9.786   -5.582  1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 2542  H HZ3  . LYS A 1 16 ? -9.214  10.533  -4.261  1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 2543  N N    . GLY A 1 17 ? -6.736  7.322   -2.280  1.00 0.00 ? 17 GLY A N    3  
ATOM 2544  C CA   . GLY A 1 17 ? -5.461  7.861   -2.717  1.00 0.00 ? 17 GLY A CA   3  
ATOM 2545  C C    . GLY A 1 17 ? -4.283  7.123   -2.114  1.00 0.00 ? 17 GLY A C    3  
ATOM 2546  O O    . GLY A 1 17 ? -3.287  6.872   -2.792  1.00 0.00 ? 17 GLY A O    3  
ATOM 2547  H H    . GLY A 1 17 ? -7.310  7.848   -1.684  1.00 0.00 ? 17 GLY A H    3  
ATOM 2548  H HA2  . GLY A 1 17 ? -5.404  7.792   -3.793  1.00 0.00 ? 17 GLY A HA2  3  
ATOM 2549  H HA3  . GLY A 1 17 ? -5.405  8.901   -2.429  1.00 0.00 ? 17 GLY A HA3  3  
ATOM 2550  N N    . GLN A 1 18 ? -4.395  6.776   -0.836  1.00 0.00 ? 18 GLN A N    3  
ATOM 2551  C CA   . GLN A 1 18 ? -3.329  6.064   -0.141  1.00 0.00 ? 18 GLN A CA   3  
ATOM 2552  C C    . GLN A 1 18 ? -3.197  4.637   -0.663  1.00 0.00 ? 18 GLN A C    3  
ATOM 2553  O O    . GLN A 1 18 ? -2.090  4.150   -0.896  1.00 0.00 ? 18 GLN A O    3  
ATOM 2554  C CB   . GLN A 1 18 ? -3.595  6.047   1.365   1.00 0.00 ? 18 GLN A CB   3  
ATOM 2555  C CG   . GLN A 1 18 ? -3.487  7.415   2.018   1.00 0.00 ? 18 GLN A CG   3  
ATOM 2556  C CD   . GLN A 1 18 ? -4.046  7.435   3.427   1.00 0.00 ? 18 GLN A CD   3  
ATOM 2557  O OE1  . GLN A 1 18 ? -5.238  7.208   3.638   1.00 0.00 ? 18 GLN A OE1  3  
ATOM 2558  N NE2  . GLN A 1 18 ? -3.186  7.708   4.401   1.00 0.00 ? 18 GLN A NE2  3  
ATOM 2559  H H    . GLN A 1 18 ? -5.214  7.004   -0.349  1.00 0.00 ? 18 GLN A H    3  
ATOM 2560  H HA   . GLN A 1 18 ? -2.404  6.589   -0.328  1.00 0.00 ? 18 GLN A HA   3  
ATOM 2561  H HB2  . GLN A 1 18 ? -4.591  5.666   1.538   1.00 0.00 ? 18 GLN A HB2  3  
ATOM 2562  H HB3  . GLN A 1 18 ? -2.880  5.389   1.837   1.00 0.00 ? 18 GLN A HB3  3  
ATOM 2563  H HG2  . GLN A 1 18 ? -2.446  7.700   2.057   1.00 0.00 ? 18 GLN A HG2  3  
ATOM 2564  H HG3  . GLN A 1 18 ? -4.033  8.129   1.419   1.00 0.00 ? 18 GLN A HG3  3  
ATOM 2565  H HE21 . GLN A 1 18 ? -2.252  7.881   4.159   1.00 0.00 ? 18 GLN A HE21 3  
ATOM 2566  H HE22 . GLN A 1 18 ? -3.521  7.729   5.321   1.00 0.00 ? 18 GLN A HE22 3  
ATOM 2567  N N    . LEU A 1 19 ? -4.333  3.971   -0.844  1.00 0.00 ? 19 LEU A N    3  
ATOM 2568  C CA   . LEU A 1 19 ? -4.345  2.599   -1.338  1.00 0.00 ? 19 LEU A CA   3  
ATOM 2569  C C    . LEU A 1 19 ? -3.887  2.540   -2.792  1.00 0.00 ? 19 LEU A C    3  
ATOM 2570  O O    . LEU A 1 19 ? -3.408  1.507   -3.260  1.00 0.00 ? 19 LEU A O    3  
ATOM 2571  C CB   . LEU A 1 19 ? -5.747  2.001   -1.207  1.00 0.00 ? 19 LEU A CB   3  
ATOM 2572  C CG   . LEU A 1 19 ? -6.298  1.888   0.214   1.00 0.00 ? 19 LEU A CG   3  
ATOM 2573  C CD1  . LEU A 1 19 ? -7.816  1.787   0.192   1.00 0.00 ? 19 LEU A CD1  3  
ATOM 2574  C CD2  . LEU A 1 19 ? -5.693  0.687   0.927   1.00 0.00 ? 19 LEU A CD2  3  
ATOM 2575  H H    . LEU A 1 19 ? -5.183  4.412   -0.640  1.00 0.00 ? 19 LEU A H    3  
ATOM 2576  H HA   . LEU A 1 19 ? -3.659  2.023   -0.734  1.00 0.00 ? 19 LEU A HA   3  
ATOM 2577  H HB2  . LEU A 1 19 ? -6.424  2.619   -1.776  1.00 0.00 ? 19 LEU A HB2  3  
ATOM 2578  H HB3  . LEU A 1 19 ? -5.723  1.008   -1.634  1.00 0.00 ? 19 LEU A HB3  3  
ATOM 2579  H HG   . LEU A 1 19 ? -6.032  2.777   0.769   1.00 0.00 ? 19 LEU A HG   3  
ATOM 2580  H HD11 . LEU A 1 19 ? -8.175  1.545   1.180   1.00 0.00 ? 19 LEU A HD11 3  
ATOM 2581  H HD12 . LEU A 1 19 ? -8.115  1.014   -0.500  1.00 0.00 ? 19 LEU A HD12 3  
ATOM 2582  H HD13 . LEU A 1 19 ? -8.234  2.732   -0.123  1.00 0.00 ? 19 LEU A HD13 3  
ATOM 2583  H HD21 . LEU A 1 19 ? -5.639  -0.147  0.244   1.00 0.00 ? 19 LEU A HD21 3  
ATOM 2584  H HD22 . LEU A 1 19 ? -6.312  0.421   1.772   1.00 0.00 ? 19 LEU A HD22 3  
ATOM 2585  H HD23 . LEU A 1 19 ? -4.700  0.936   1.271   1.00 0.00 ? 19 LEU A HD23 3  
ATOM 2586  N N    . ARG A 1 20 ? -4.037  3.654   -3.499  1.00 0.00 ? 20 ARG A N    3  
ATOM 2587  C CA   . ARG A 1 20 ? -3.638  3.729   -4.900  1.00 0.00 ? 20 ARG A CA   3  
ATOM 2588  C C    . ARG A 1 20 ? -2.172  3.343   -5.069  1.00 0.00 ? 20 ARG A C    3  
ATOM 2589  O O    . ARG A 1 20 ? -1.801  2.693   -6.046  1.00 0.00 ? 20 ARG A O    3  
ATOM 2590  C CB   . ARG A 1 20 ? -3.871  5.140   -5.443  1.00 0.00 ? 20 ARG A CB   3  
ATOM 2591  C CG   . ARG A 1 20 ? -3.534  5.288   -6.918  1.00 0.00 ? 20 ARG A CG   3  
ATOM 2592  C CD   . ARG A 1 20 ? -3.575  6.744   -7.356  1.00 0.00 ? 20 ARG A CD   3  
ATOM 2593  N NE   . ARG A 1 20 ? -3.371  6.889   -8.795  1.00 0.00 ? 20 ARG A NE   3  
ATOM 2594  C CZ   . ARG A 1 20 ? -3.363  8.060   -9.422  1.00 0.00 ? 20 ARG A CZ   3  
ATOM 2595  N NH1  . ARG A 1 20 ? -3.548  9.182   -8.740  1.00 0.00 ? 20 ARG A NH1  3  
ATOM 2596  N NH2  . ARG A 1 20 ? -3.170  8.110   -10.734 1.00 0.00 ? 20 ARG A NH2  3  
ATOM 2597  H H    . ARG A 1 20 ? -4.425  4.445   -3.070  1.00 0.00 ? 20 ARG A H    3  
ATOM 2598  H HA   . ARG A 1 20 ? -4.248  3.034   -5.456  1.00 0.00 ? 20 ARG A HA   3  
ATOM 2599  H HB2  . ARG A 1 20 ? -4.910  5.400   -5.306  1.00 0.00 ? 20 ARG A HB2  3  
ATOM 2600  H HB3  . ARG A 1 20 ? -3.259  5.833   -4.886  1.00 0.00 ? 20 ARG A HB3  3  
ATOM 2601  H HG2  . ARG A 1 20 ? -2.542  4.899   -7.092  1.00 0.00 ? 20 ARG A HG2  3  
ATOM 2602  H HG3  . ARG A 1 20 ? -4.250  4.726   -7.499  1.00 0.00 ? 20 ARG A HG3  3  
ATOM 2603  H HD2  . ARG A 1 20 ? -4.538  7.157   -7.096  1.00 0.00 ? 20 ARG A HD2  3  
ATOM 2604  H HD3  . ARG A 1 20 ? -2.799  7.284   -6.835  1.00 0.00 ? 20 ARG A HD3  3  
ATOM 2605  H HE   . ARG A 1 20 ? -3.232  6.072   -9.318  1.00 0.00 ? 20 ARG A HE   3  
ATOM 2606  H HH11 . ARG A 1 20 ? -3.692  9.147   -7.751  1.00 0.00 ? 20 ARG A HH11 3  
ATOM 2607  H HH12 . ARG A 1 20 ? -3.540  10.062  -9.214  1.00 0.00 ? 20 ARG A HH12 3  
ATOM 2608  H HH21 . ARG A 1 20 ? -3.031  7.266   -11.251 1.00 0.00 ? 20 ARG A HH21 3  
ATOM 2609  H HH22 . ARG A 1 20 ? -3.165  8.991   -11.204 1.00 0.00 ? 20 ARG A HH22 3  
ATOM 2610  N N    . GLU A 1 21 ? -1.344  3.748   -4.112  1.00 0.00 ? 21 GLU A N    3  
ATOM 2611  C CA   . GLU A 1 21 ? 0.082   3.445   -4.157  1.00 0.00 ? 21 GLU A CA   3  
ATOM 2612  C C    . GLU A 1 21 ? 0.364   2.069   -3.561  1.00 0.00 ? 21 GLU A C    3  
ATOM 2613  O O    . GLU A 1 21 ? 1.236   1.340   -4.038  1.00 0.00 ? 21 GLU A O    3  
ATOM 2614  C CB   . GLU A 1 21 ? 0.877   4.512   -3.402  1.00 0.00 ? 21 GLU A CB   3  
ATOM 2615  C CG   . GLU A 1 21 ? 0.671   5.919   -3.939  1.00 0.00 ? 21 GLU A CG   3  
ATOM 2616  C CD   . GLU A 1 21 ? 0.959   6.024   -5.424  1.00 0.00 ? 21 GLU A CD   3  
ATOM 2617  O OE1  . GLU A 1 21 ? 2.121   5.800   -5.821  1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2618  O OE2  . GLU A 1 21 ? 0.020   6.331   -6.189  1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2619  H H    . GLU A 1 21 ? -1.700  4.264   -3.358  1.00 0.00 ? 21 GLU A H    3  
ATOM 2620  H HA   . GLU A 1 21 ? 0.389   3.446   -5.192  1.00 0.00 ? 21 GLU A HA   3  
ATOM 2621  H HB2  . GLU A 1 21 ? 0.580   4.498   -2.363  1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2622  H HB3  . GLU A 1 21 ? 1.928   4.275   -3.469  1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2623  H HG2  . GLU A 1 21 ? -0.355  6.210   -3.765  1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2624  H HG3  . GLU A 1 21 ? 1.329   6.592   -3.410  1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2625  N N    . LEU A 1 22 ? -0.378  1.719   -2.517  1.00 0.00 ? 22 LEU A N    3  
ATOM 2626  C CA   . LEU A 1 22 ? -0.208  0.430   -1.854  1.00 0.00 ? 22 LEU A CA   3  
ATOM 2627  C C    . LEU A 1 22 ? -0.514  -0.718  -2.811  1.00 0.00 ? 22 LEU A C    3  
ATOM 2628  O O    . LEU A 1 22 ? 0.241   -1.686  -2.895  1.00 0.00 ? 22 LEU A O    3  
ATOM 2629  C CB   . LEU A 1 22 ? -1.116  0.342   -0.626  1.00 0.00 ? 22 LEU A CB   3  
ATOM 2630  C CG   . LEU A 1 22 ? -0.738  1.239   0.554   1.00 0.00 ? 22 LEU A CG   3  
ATOM 2631  C CD1  . LEU A 1 22 ? -1.843  1.240   1.598   1.00 0.00 ? 22 LEU A CD1  3  
ATOM 2632  C CD2  . LEU A 1 22 ? 0.579   0.786   1.167   1.00 0.00 ? 22 LEU A CD2  3  
ATOM 2633  H H    . LEU A 1 22 ? -1.056  2.341   -2.182  1.00 0.00 ? 22 LEU A H    3  
ATOM 2634  H HA   . LEU A 1 22 ? 0.821   0.354   -1.537  1.00 0.00 ? 22 LEU A HA   3  
ATOM 2635  H HB2  . LEU A 1 22 ? -2.116  0.606   -0.935  1.00 0.00 ? 22 LEU A HB2  3  
ATOM 2636  H HB3  . LEU A 1 22 ? -1.106  -0.682  -0.281  1.00 0.00 ? 22 LEU A HB3  3  
ATOM 2637  H HG   . LEU A 1 22 ? -0.612  2.253   0.201   1.00 0.00 ? 22 LEU A HG   3  
ATOM 2638  H HD11 . LEU A 1 22 ? -2.539  0.443   1.387   1.00 0.00 ? 22 LEU A HD11 3  
ATOM 2639  H HD12 . LEU A 1 22 ? -2.361  2.187   1.573   1.00 0.00 ? 22 LEU A HD12 3  
ATOM 2640  H HD13 . LEU A 1 22 ? -1.412  1.092   2.578   1.00 0.00 ? 22 LEU A HD13 3  
ATOM 2641  H HD21 . LEU A 1 22 ? 0.829   1.429   1.998   1.00 0.00 ? 22 LEU A HD21 3  
ATOM 2642  H HD22 . LEU A 1 22 ? 1.360   0.839   0.423   1.00 0.00 ? 22 LEU A HD22 3  
ATOM 2643  H HD23 . LEU A 1 22 ? 0.482   -0.232  1.516   1.00 0.00 ? 22 LEU A HD23 3  
ATOM 2644  N N    . GLU A 1 23 ? -1.626  -0.601  -3.530  1.00 0.00 ? 23 GLU A N    3  
ATOM 2645  C CA   . GLU A 1 23 ? -2.031  -1.630  -4.482  1.00 0.00 ? 23 GLU A CA   3  
ATOM 2646  C C    . GLU A 1 23 ? -1.062  -1.693  -5.659  1.00 0.00 ? 23 GLU A C    3  
ATOM 2647  O O    . GLU A 1 23 ? -0.784  -2.768  -6.191  1.00 0.00 ? 23 GLU A O    3  
ATOM 2648  C CB   . GLU A 1 23 ? -3.449  -1.358  -4.988  1.00 0.00 ? 23 GLU A CB   3  
ATOM 2649  C CG   . GLU A 1 23 ? -4.501  -1.383  -3.893  1.00 0.00 ? 23 GLU A CG   3  
ATOM 2650  C CD   . GLU A 1 23 ? -5.818  -0.774  -4.335  1.00 0.00 ? 23 GLU A CD   3  
ATOM 2651  O OE1  . GLU A 1 23 ? -5.791  0.310   -4.955  1.00 0.00 ? 23 GLU A OE1  3  
ATOM 2652  O OE2  . GLU A 1 23 ? -6.874  -1.381  -4.062  1.00 0.00 ? 23 GLU A OE2  3  
ATOM 2653  H H    . GLU A 1 23 ? -2.187  0.194   -3.418  1.00 0.00 ? 23 GLU A H    3  
ATOM 2654  H HA   . GLU A 1 23 ? -2.017  -2.579  -3.969  1.00 0.00 ? 23 GLU A HA   3  
ATOM 2655  H HB2  . GLU A 1 23 ? -3.470  -0.385  -5.458  1.00 0.00 ? 23 GLU A HB2  3  
ATOM 2656  H HB3  . GLU A 1 23 ? -3.705  -2.107  -5.722  1.00 0.00 ? 23 GLU A HB3  3  
ATOM 2657  H HG2  . GLU A 1 23 ? -4.676  -2.408  -3.603  1.00 0.00 ? 23 GLU A HG2  3  
ATOM 2658  H HG3  . GLU A 1 23 ? -4.132  -0.828  -3.043  1.00 0.00 ? 23 GLU A HG3  3  
ATOM 2659  N N    . ARG A 1 24 ? -0.551  -0.534  -6.061  1.00 0.00 ? 24 ARG A N    3  
ATOM 2660  C CA   . ARG A 1 24 ? 0.385   -0.456  -7.176  1.00 0.00 ? 24 ARG A CA   3  
ATOM 2661  C C    . ARG A 1 24 ? 1.687   -1.180  -6.844  1.00 0.00 ? 24 ARG A C    3  
ATOM 2662  O O    . ARG A 1 24 ? 2.051   -2.154  -7.501  1.00 0.00 ? 24 ARG A O    3  
ATOM 2663  C CB   . ARG A 1 24 ? 0.675   1.004   -7.525  1.00 0.00 ? 24 ARG A CB   3  
ATOM 2664  C CG   . ARG A 1 24 ? 1.813   1.178   -8.517  1.00 0.00 ? 24 ARG A CG   3  
ATOM 2665  C CD   . ARG A 1 24 ? 1.494   2.249   -9.549  1.00 0.00 ? 24 ARG A CD   3  
ATOM 2666  N NE   . ARG A 1 24 ? 2.344   2.140   -10.732 1.00 0.00 ? 24 ARG A NE   3  
ATOM 2667  C CZ   . ARG A 1 24 ? 2.493   3.115   -11.622 1.00 0.00 ? 24 ARG A CZ   3  
ATOM 2668  N NH1  . ARG A 1 24 ? 1.853   4.266   -11.463 1.00 0.00 ? 24 ARG A NH1  3  
ATOM 2669  N NH2  . ARG A 1 24 ? 3.285   2.941   -12.672 1.00 0.00 ? 24 ARG A NH2  3  
ATOM 2670  H H    . ARG A 1 24 ? -0.811  0.290   -5.597  1.00 0.00 ? 24 ARG A H    3  
ATOM 2671  H HA   . ARG A 1 24 ? -0.073  -0.937  -8.027  1.00 0.00 ? 24 ARG A HA   3  
ATOM 2672  H HB2  . ARG A 1 24 ? -0.214  1.444   -7.951  1.00 0.00 ? 24 ARG A HB2  3  
ATOM 2673  H HB3  . ARG A 1 24 ? 0.931   1.534   -6.620  1.00 0.00 ? 24 ARG A HB3  3  
ATOM 2674  H HG2  . ARG A 1 24 ? 2.706   1.466   -7.981  1.00 0.00 ? 24 ARG A HG2  3  
ATOM 2675  H HG3  . ARG A 1 24 ? 1.983   0.240   -9.025  1.00 0.00 ? 24 ARG A HG3  3  
ATOM 2676  H HD2  . ARG A 1 24 ? 0.462   2.145   -9.849  1.00 0.00 ? 24 ARG A HD2  3  
ATOM 2677  H HD3  . ARG A 1 24 ? 1.642   3.219   -9.099  1.00 0.00 ? 24 ARG A HD3  3  
ATOM 2678  H HE   . ARG A 1 24 ? 2.827   1.299   -10.868 1.00 0.00 ? 24 ARG A HE   3  
ATOM 2679  H HH11 . ARG A 1 24 ? 1.257   4.400   -10.672 1.00 0.00 ? 24 ARG A HH11 3  
ATOM 2680  H HH12 . ARG A 1 24 ? 1.968   4.998   -12.134 1.00 0.00 ? 24 ARG A HH12 3  
ATOM 2681  H HH21 . ARG A 1 24 ? 3.769   2.075   -12.795 1.00 0.00 ? 24 ARG A HH21 3  
ATOM 2682  H HH22 . ARG A 1 24 ? 3.396   3.675   -13.341 1.00 0.00 ? 24 ARG A HH22 3  
ATOM 2683  N N    . GLU A 1 25 ? 2.383   -0.695  -5.820  1.00 0.00 ? 25 GLU A N    3  
ATOM 2684  C CA   . GLU A 1 25 ? 3.645   -1.295  -5.403  1.00 0.00 ? 25 GLU A CA   3  
ATOM 2685  C C    . GLU A 1 25 ? 3.484   -2.794  -5.172  1.00 0.00 ? 25 GLU A C    3  
ATOM 2686  O O    . GLU A 1 25 ? 4.384   -3.580  -5.470  1.00 0.00 ? 25 GLU A O    3  
ATOM 2687  C CB   . GLU A 1 25 ? 4.157   -0.623  -4.127  1.00 0.00 ? 25 GLU A CB   3  
ATOM 2688  C CG   . GLU A 1 25 ? 5.023   0.598   -4.388  1.00 0.00 ? 25 GLU A CG   3  
ATOM 2689  C CD   . GLU A 1 25 ? 4.467   1.485   -5.484  1.00 0.00 ? 25 GLU A CD   3  
ATOM 2690  O OE1  . GLU A 1 25 ? 4.761   1.219   -6.668  1.00 0.00 ? 25 GLU A OE1  3  
ATOM 2691  O OE2  . GLU A 1 25 ? 3.737   2.445   -5.159  1.00 0.00 ? 25 GLU A OE2  3  
ATOM 2692  H H    . GLU A 1 25 ? 2.041   0.085   -5.335  1.00 0.00 ? 25 GLU A H    3  
ATOM 2693  H HA   . GLU A 1 25 ? 4.363   -1.140  -6.193  1.00 0.00 ? 25 GLU A HA   3  
ATOM 2694  H HB2  . GLU A 1 25 ? 3.310   -0.317  -3.530  1.00 0.00 ? 25 GLU A HB2  3  
ATOM 2695  H HB3  . GLU A 1 25 ? 4.740   -1.339  -3.567  1.00 0.00 ? 25 GLU A HB3  3  
ATOM 2696  H HG2  . GLU A 1 25 ? 5.092   1.176   -3.478  1.00 0.00 ? 25 GLU A HG2  3  
ATOM 2697  H HG3  . GLU A 1 25 ? 6.010   0.268   -4.678  1.00 0.00 ? 25 GLU A HG3  3  
ATOM 2698  N N    . TYR A 1 26 ? 2.332   -3.184  -4.638  1.00 0.00 ? 26 TYR A N    3  
ATOM 2699  C CA   . TYR A 1 26 ? 2.053   -4.589  -4.363  1.00 0.00 ? 26 TYR A CA   3  
ATOM 2700  C C    . TYR A 1 26 ? 2.085   -5.412  -5.647  1.00 0.00 ? 26 TYR A C    3  
ATOM 2701  O O    . TYR A 1 26 ? 2.697   -6.478  -5.699  1.00 0.00 ? 26 TYR A O    3  
ATOM 2702  C CB   . TYR A 1 26 ? 0.690   -4.737  -3.684  1.00 0.00 ? 26 TYR A CB   3  
ATOM 2703  C CG   . TYR A 1 26 ? 0.240   -6.173  -3.536  1.00 0.00 ? 26 TYR A CG   3  
ATOM 2704  C CD1  . TYR A 1 26 ? 0.781   -6.993  -2.555  1.00 0.00 ? 26 TYR A CD1  3  
ATOM 2705  C CD2  . TYR A 1 26 ? -0.726  -6.709  -4.379  1.00 0.00 ? 26 TYR A CD2  3  
ATOM 2706  C CE1  . TYR A 1 26 ? 0.374   -8.306  -2.416  1.00 0.00 ? 26 TYR A CE1  3  
ATOM 2707  C CE2  . TYR A 1 26 ? -1.140  -8.020  -4.247  1.00 0.00 ? 26 TYR A CE2  3  
ATOM 2708  C CZ   . TYR A 1 26 ? -0.588  -8.814  -3.265  1.00 0.00 ? 26 TYR A CZ   3  
ATOM 2709  O OH   . TYR A 1 26 ? -0.997  -10.121 -3.131  1.00 0.00 ? 26 TYR A OH   3  
ATOM 2710  H H    . TYR A 1 26 ? 1.653   -2.512  -4.422  1.00 0.00 ? 26 TYR A H    3  
ATOM 2711  H HA   . TYR A 1 26 ? 2.819   -4.954  -3.695  1.00 0.00 ? 26 TYR A HA   3  
ATOM 2712  H HB2  . TYR A 1 26 ? 0.738   -4.302  -2.698  1.00 0.00 ? 26 TYR A HB2  3  
ATOM 2713  H HB3  . TYR A 1 26 ? -0.053  -4.214  -4.267  1.00 0.00 ? 26 TYR A HB3  3  
ATOM 2714  H HD1  . TYR A 1 26 ? 1.535   -6.592  -1.892  1.00 0.00 ? 26 TYR A HD1  3  
ATOM 2715  H HD2  . TYR A 1 26 ? -1.156  -6.083  -5.148  1.00 0.00 ? 26 TYR A HD2  3  
ATOM 2716  H HE1  . TYR A 1 26 ? 0.806   -8.929  -1.647  1.00 0.00 ? 26 TYR A HE1  3  
ATOM 2717  H HE2  . TYR A 1 26 ? -1.893  -8.418  -4.912  1.00 0.00 ? 26 TYR A HE2  3  
ATOM 2718  H HH   . TYR A 1 26 ? -1.662  -10.318 -3.795  1.00 0.00 ? 26 TYR A HH   3  
ATOM 2719  N N    . ALA A 1 27 ? 1.423   -4.907  -6.683  1.00 0.00 ? 27 ALA A N    3  
ATOM 2720  C CA   . ALA A 1 27 ? 1.377   -5.593  -7.969  1.00 0.00 ? 27 ALA A CA   3  
ATOM 2721  C C    . ALA A 1 27 ? 2.780   -5.796  -8.532  1.00 0.00 ? 27 ALA A C    3  
ATOM 2722  O O    . ALA A 1 27 ? 3.026   -6.740  -9.282  1.00 0.00 ? 27 ALA A O    3  
ATOM 2723  C CB   . ALA A 1 27 ? 0.519   -4.812  -8.953  1.00 0.00 ? 27 ALA A CB   3  
ATOM 2724  H H    . ALA A 1 27 ? 0.955   -4.052  -6.580  1.00 0.00 ? 27 ALA A H    3  
ATOM 2725  H HA   . ALA A 1 27 ? 0.918   -6.559  -7.816  1.00 0.00 ? 27 ALA A HA   3  
ATOM 2726  H HB1  . ALA A 1 27 ? 0.302   -3.835  -8.544  1.00 0.00 ? 27 ALA A HB1  3  
ATOM 2727  H HB2  . ALA A 1 27 ? 1.051   -4.702  -9.886  1.00 0.00 ? 27 ALA A HB2  3  
ATOM 2728  H HB3  . ALA A 1 27 ? -0.405  -5.343  -9.125  1.00 0.00 ? 27 ALA A HB3  3  
ATOM 2729  N N    . ALA A 1 28 ? 3.695   -4.905  -8.166  1.00 0.00 ? 28 ALA A N    3  
ATOM 2730  C CA   . ALA A 1 28 ? 5.073   -4.988  -8.634  1.00 0.00 ? 28 ALA A CA   3  
ATOM 2731  C C    . ALA A 1 28 ? 5.872   -5.994  -7.812  1.00 0.00 ? 28 ALA A C    3  
ATOM 2732  O O    . ALA A 1 28 ? 6.830   -6.588  -8.303  1.00 0.00 ? 28 ALA A O    3  
ATOM 2733  C CB   . ALA A 1 28 ? 5.732   -3.618  -8.581  1.00 0.00 ? 28 ALA A CB   3  
ATOM 2734  H H    . ALA A 1 28 ? 3.437   -4.175  -7.565  1.00 0.00 ? 28 ALA A H    3  
ATOM 2735  H HA   . ALA A 1 28 ? 5.056   -5.313  -9.664  1.00 0.00 ? 28 ALA A HA   3  
ATOM 2736  H HB1  . ALA A 1 28 ? 5.298   -3.042  -7.777  1.00 0.00 ? 28 ALA A HB1  3  
ATOM 2737  H HB2  . ALA A 1 28 ? 6.791   -3.735  -8.410  1.00 0.00 ? 28 ALA A HB2  3  
ATOM 2738  H HB3  . ALA A 1 28 ? 5.572   -3.106  -9.518  1.00 0.00 ? 28 ALA A HB3  3  
ATOM 2739  N N    . ASN A 1 29 ? 5.471   -6.179  -6.559  1.00 0.00 ? 29 ASN A N    3  
ATOM 2740  C CA   . ASN A 1 29 ? 6.151   -7.112  -5.668  1.00 0.00 ? 29 ASN A CA   3  
ATOM 2741  C C    . ASN A 1 29 ? 5.351   -7.323  -4.386  1.00 0.00 ? 29 ASN A C    3  
ATOM 2742  O O    . ASN A 1 29 ? 5.031   -6.369  -3.677  1.00 0.00 ? 29 ASN A O    3  
ATOM 2743  C CB   . ASN A 1 29 ? 7.551   -6.597  -5.329  1.00 0.00 ? 29 ASN A CB   3  
ATOM 2744  C CG   . ASN A 1 29 ? 7.600   -5.086  -5.214  1.00 0.00 ? 29 ASN A CG   3  
ATOM 2745  O OD1  . ASN A 1 29 ? 8.125   -4.402  -6.093  1.00 0.00 ? 29 ASN A OD1  3  
ATOM 2746  N ND2  . ASN A 1 29 ? 7.050   -4.558  -4.127  1.00 0.00 ? 29 ASN A ND2  3  
ATOM 2747  H H    . ASN A 1 29 ? 4.699   -5.676  -6.224  1.00 0.00 ? 29 ASN A H    3  
ATOM 2748  H HA   . ASN A 1 29 ? 6.239   -8.057  -6.183  1.00 0.00 ? 29 ASN A HA   3  
ATOM 2749  H HB2  . ASN A 1 29 ? 7.866   -7.021  -4.387  1.00 0.00 ? 29 ASN A HB2  3  
ATOM 2750  H HB3  . ASN A 1 29 ? 8.238   -6.904  -6.104  1.00 0.00 ? 29 ASN A HB3  3  
ATOM 2751  H HD21 . ASN A 1 29 ? 6.650   -5.164  -3.469  1.00 0.00 ? 29 ASN A HD21 3  
ATOM 2752  H HD22 . ASN A 1 29 ? 7.067   -3.583  -4.027  1.00 0.00 ? 29 ASN A HD22 3  
ATOM 2753  N N    . LYS A 1 30 ? 5.029   -8.579  -4.096  1.00 0.00 ? 30 LYS A N    3  
ATOM 2754  C CA   . LYS A 1 30 ? 4.268   -8.917  -2.899  1.00 0.00 ? 30 LYS A CA   3  
ATOM 2755  C C    . LYS A 1 30 ? 4.976   -8.415  -1.644  1.00 0.00 ? 30 LYS A C    3  
ATOM 2756  O O    . LYS A 1 30 ? 4.335   -8.103  -0.640  1.00 0.00 ? 30 LYS A O    3  
ATOM 2757  C CB   . LYS A 1 30 ? 4.063   -10.431 -2.811  1.00 0.00 ? 30 LYS A CB   3  
ATOM 2758  C CG   . LYS A 1 30 ? 3.419   -11.030 -4.049  1.00 0.00 ? 30 LYS A CG   3  
ATOM 2759  C CD   . LYS A 1 30 ? 1.935   -10.711 -4.115  1.00 0.00 ? 30 LYS A CD   3  
ATOM 2760  C CE   . LYS A 1 30 ? 1.214   -11.611 -5.107  1.00 0.00 ? 30 LYS A CE   3  
ATOM 2761  N NZ   . LYS A 1 30 ? 1.554   -11.269 -6.516  1.00 0.00 ? 30 LYS A NZ   3  
ATOM 2762  H H    . LYS A 1 30 ? 5.313   -9.297  -4.701  1.00 0.00 ? 30 LYS A H    3  
ATOM 2763  H HA   . LYS A 1 30 ? 3.305   -8.435  -2.971  1.00 0.00 ? 30 LYS A HA   3  
ATOM 2764  H HB2  . LYS A 1 30 ? 5.023   -10.904 -2.665  1.00 0.00 ? 30 LYS A HB2  3  
ATOM 2765  H HB3  . LYS A 1 30 ? 3.431   -10.648 -1.961  1.00 0.00 ? 30 LYS A HB3  3  
ATOM 2766  H HG2  . LYS A 1 30 ? 3.902   -10.627 -4.926  1.00 0.00 ? 30 LYS A HG2  3  
ATOM 2767  H HG3  . LYS A 1 30 ? 3.546   -12.103 -4.026  1.00 0.00 ? 30 LYS A HG3  3  
ATOM 2768  H HD2  . LYS A 1 30 ? 1.500   -10.852 -3.137  1.00 0.00 ? 30 LYS A HD2  3  
ATOM 2769  H HD3  . LYS A 1 30 ? 1.810   -9.681  -4.421  1.00 0.00 ? 30 LYS A HD3  3  
ATOM 2770  H HE2  . LYS A 1 30 ? 1.498   -12.635 -4.916  1.00 0.00 ? 30 LYS A HE2  3  
ATOM 2771  H HE3  . LYS A 1 30 ? 0.149   -11.501 -4.965  1.00 0.00 ? 30 LYS A HE3  3  
ATOM 2772  H HZ1  . LYS A 1 30 ? 1.240   -10.301 -6.733  1.00 0.00 ? 30 LYS A HZ1  3  
ATOM 2773  H HZ2  . LYS A 1 30 ? 1.082   -11.928 -7.167  1.00 0.00 ? 30 LYS A HZ2  3  
ATOM 2774  H HZ3  . LYS A 1 30 ? 2.582   -11.330 -6.661  1.00 0.00 ? 30 LYS A HZ3  3  
ATOM 2775  N N    . PHE A 1 31 ? 6.301   -8.339  -1.708  1.00 0.00 ? 31 PHE A N    3  
ATOM 2776  C CA   . PHE A 1 31 ? 7.096   -7.875  -0.577  1.00 0.00 ? 31 PHE A CA   3  
ATOM 2777  C C    . PHE A 1 31 ? 8.035   -6.749  -0.998  1.00 0.00 ? 31 PHE A C    3  
ATOM 2778  O O    . PHE A 1 31 ? 8.977   -6.965  -1.762  1.00 0.00 ? 31 PHE A O    3  
ATOM 2779  C CB   . PHE A 1 31 ? 7.902   -9.032  0.016   1.00 0.00 ? 31 PHE A CB   3  
ATOM 2780  C CG   . PHE A 1 31 ? 7.047   -10.125 0.591   1.00 0.00 ? 31 PHE A CG   3  
ATOM 2781  C CD1  . PHE A 1 31 ? 6.446   -11.060 -0.236  1.00 0.00 ? 31 PHE A CD1  3  
ATOM 2782  C CD2  . PHE A 1 31 ? 6.846   -10.219 1.959   1.00 0.00 ? 31 PHE A CD2  3  
ATOM 2783  C CE1  . PHE A 1 31 ? 5.658   -12.066 0.290   1.00 0.00 ? 31 PHE A CE1  3  
ATOM 2784  C CE2  . PHE A 1 31 ? 6.060   -11.224 2.491   1.00 0.00 ? 31 PHE A CE2  3  
ATOM 2785  C CZ   . PHE A 1 31 ? 5.466   -12.149 1.655   1.00 0.00 ? 31 PHE A CZ   3  
ATOM 2786  H H    . PHE A 1 31 ? 6.756   -8.602  -2.536  1.00 0.00 ? 31 PHE A H    3  
ATOM 2787  H HA   . PHE A 1 31 ? 6.416   -7.499  0.172   1.00 0.00 ? 31 PHE A HA   3  
ATOM 2788  H HB2  . PHE A 1 31 ? 8.519   -9.465  -0.756  1.00 0.00 ? 31 PHE A HB2  3  
ATOM 2789  H HB3  . PHE A 1 31 ? 8.534   -8.653  0.805   1.00 0.00 ? 31 PHE A HB3  3  
ATOM 2790  H HD1  . PHE A 1 31 ? 6.596   -10.997 -1.304  1.00 0.00 ? 31 PHE A HD1  3  
ATOM 2791  H HD2  . PHE A 1 31 ? 7.311   -9.495  2.614   1.00 0.00 ? 31 PHE A HD2  3  
ATOM 2792  H HE1  . PHE A 1 31 ? 5.195   -12.789 -0.366  1.00 0.00 ? 31 PHE A HE1  3  
ATOM 2793  H HE2  . PHE A 1 31 ? 5.912   -11.285 3.559   1.00 0.00 ? 31 PHE A HE2  3  
ATOM 2794  H HZ   . PHE A 1 31 ? 4.851   -12.934 2.069   1.00 0.00 ? 31 PHE A HZ   3  
ATOM 2795  N N    . ILE A 1 32 ? 7.772   -5.547  -0.495  1.00 0.00 ? 32 ILE A N    3  
ATOM 2796  C CA   . ILE A 1 32 ? 8.594   -4.388  -0.818  1.00 0.00 ? 32 ILE A CA   3  
ATOM 2797  C C    . ILE A 1 32 ? 9.898   -4.400  -0.028  1.00 0.00 ? 32 ILE A C    3  
ATOM 2798  O O    . ILE A 1 32 ? 10.200  -5.363  0.679   1.00 0.00 ? 32 ILE A O    3  
ATOM 2799  C CB   . ILE A 1 32 ? 7.847   -3.071  -0.533  1.00 0.00 ? 32 ILE A CB   3  
ATOM 2800  C CG1  . ILE A 1 32 ? 7.609   -2.910  0.970   1.00 0.00 ? 32 ILE A CG1  3  
ATOM 2801  C CG2  . ILE A 1 32 ? 6.528   -3.036  -1.290  1.00 0.00 ? 32 ILE A CG2  3  
ATOM 2802  C CD1  . ILE A 1 32 ? 6.894   -1.628  1.334   1.00 0.00 ? 32 ILE A CD1  3  
ATOM 2803  H H    . ILE A 1 32 ? 7.008   -5.439  0.108   1.00 0.00 ? 32 ILE A H    3  
ATOM 2804  H HA   . ILE A 1 32 ? 8.824   -4.426  -1.873  1.00 0.00 ? 32 ILE A HA   3  
ATOM 2805  H HB   . ILE A 1 32 ? 8.458   -2.254  -0.884  1.00 0.00 ? 32 ILE A HB   3  
ATOM 2806  H HG12 . ILE A 1 32 ? 7.012   -3.734  1.324   1.00 0.00 ? 32 ILE A HG12 3  
ATOM 2807  H HG13 . ILE A 1 32 ? 8.562   -2.915  1.480   1.00 0.00 ? 32 ILE A HG13 3  
ATOM 2808  H HG21 . ILE A 1 32 ? 5.714   -2.919  -0.590  1.00 0.00 ? 32 ILE A HG21 3  
ATOM 2809  H HG22 . ILE A 1 32 ? 6.531   -2.205  -1.979  1.00 0.00 ? 32 ILE A HG22 3  
ATOM 2810  H HG23 . ILE A 1 32 ? 6.402   -3.958  -1.837  1.00 0.00 ? 32 ILE A HG23 3  
ATOM 2811  H HD11 . ILE A 1 32 ? 7.366   -1.184  2.198   1.00 0.00 ? 32 ILE A HD11 3  
ATOM 2812  H HD12 . ILE A 1 32 ? 6.941   -0.940  0.503   1.00 0.00 ? 32 ILE A HD12 3  
ATOM 2813  H HD13 . ILE A 1 32 ? 5.860   -1.845  1.562   1.00 0.00 ? 32 ILE A HD13 3  
ATOM 2814  N N    . THR A 1 33 ? 10.669  -3.324  -0.151  1.00 0.00 ? 33 THR A N    3  
ATOM 2815  C CA   . THR A 1 33 ? 11.941  -3.211  0.552   1.00 0.00 ? 33 THR A CA   3  
ATOM 2816  C C    . THR A 1 33 ? 11.948  -2.004  1.483   1.00 0.00 ? 33 THR A C    3  
ATOM 2817  O O    . THR A 1 33 ? 11.158  -1.074  1.319   1.00 0.00 ? 33 THR A O    3  
ATOM 2818  C CB   . THR A 1 33 ? 13.118  -3.092  -0.434  1.00 0.00 ? 33 THR A CB   3  
ATOM 2819  O OG1  . THR A 1 33 ? 14.314  -2.739  0.272   1.00 0.00 ? 33 THR A OG1  3  
ATOM 2820  C CG2  . THR A 1 33 ? 12.827  -2.049  -1.502  1.00 0.00 ? 33 THR A CG2  3  
ATOM 2821  H H    . THR A 1 33 ? 10.374  -2.590  -0.729  1.00 0.00 ? 33 THR A H    3  
ATOM 2822  H HA   . THR A 1 33 ? 12.079  -4.107  1.139   1.00 0.00 ? 33 THR A HA   3  
ATOM 2823  H HB   . THR A 1 33 ? 13.263  -4.048  -0.915  1.00 0.00 ? 33 THR A HB   3  
ATOM 2824  H HG1  . THR A 1 33 ? 15.080  -2.981  -0.255  1.00 0.00 ? 33 THR A HG1  3  
ATOM 2825  H HG21 . THR A 1 33 ? 11.917  -1.523  -1.253  1.00 0.00 ? 33 THR A HG21 3  
ATOM 2826  H HG22 . THR A 1 33 ? 12.713  -2.535  -2.459  1.00 0.00 ? 33 THR A HG22 3  
ATOM 2827  H HG23 . THR A 1 33 ? 13.646  -1.346  -1.551  1.00 0.00 ? 33 THR A HG23 3  
ATOM 2828  N N    . LYS A 1 34 ? 12.847  -2.023  2.462   1.00 0.00 ? 34 LYS A N    3  
ATOM 2829  C CA   . LYS A 1 34 ? 12.960  -0.929  3.419   1.00 0.00 ? 34 LYS A CA   3  
ATOM 2830  C C    . LYS A 1 34 ? 13.064  0.413   2.702   1.00 0.00 ? 34 LYS A C    3  
ATOM 2831  O O    . LYS A 1 34 ? 12.614  1.438   3.214   1.00 0.00 ? 34 LYS A O    3  
ATOM 2832  C CB   . LYS A 1 34 ? 14.181  -1.135  4.319   1.00 0.00 ? 34 LYS A CB   3  
ATOM 2833  C CG   . LYS A 1 34 ? 13.844  -1.184  5.799   1.00 0.00 ? 34 LYS A CG   3  
ATOM 2834  C CD   . LYS A 1 34 ? 15.030  -0.770  6.654   1.00 0.00 ? 34 LYS A CD   3  
ATOM 2835  C CE   . LYS A 1 34 ? 14.614  -0.505  8.093   1.00 0.00 ? 34 LYS A CE   3  
ATOM 2836  N NZ   . LYS A 1 34 ? 14.255  0.924   8.312   1.00 0.00 ? 34 LYS A NZ   3  
ATOM 2837  H H    . LYS A 1 34 ? 13.450  -2.792  2.541   1.00 0.00 ? 34 LYS A H    3  
ATOM 2838  H HA   . LYS A 1 34 ? 12.069  -0.929  4.030   1.00 0.00 ? 34 LYS A HA   3  
ATOM 2839  H HB2  . LYS A 1 34 ? 14.659  -2.065  4.048   1.00 0.00 ? 34 LYS A HB2  3  
ATOM 2840  H HB3  . LYS A 1 34 ? 14.874  -0.323  4.155   1.00 0.00 ? 34 LYS A HB3  3  
ATOM 2841  H HG2  . LYS A 1 34 ? 13.021  -0.513  5.994   1.00 0.00 ? 34 LYS A HG2  3  
ATOM 2842  H HG3  . LYS A 1 34 ? 13.558  -2.193  6.061   1.00 0.00 ? 34 LYS A HG3  3  
ATOM 2843  H HD2  . LYS A 1 34 ? 15.764  -1.562  6.644   1.00 0.00 ? 34 LYS A HD2  3  
ATOM 2844  H HD3  . LYS A 1 34 ? 15.463  0.130   6.242   1.00 0.00 ? 34 LYS A HD3  3  
ATOM 2845  H HE2  . LYS A 1 34 ? 13.760  -1.122  8.326   1.00 0.00 ? 34 LYS A HE2  3  
ATOM 2846  H HE3  . LYS A 1 34 ? 15.435  -0.765  8.745   1.00 0.00 ? 34 LYS A HE3  3  
ATOM 2847  H HZ1  . LYS A 1 34 ? 13.512  1.211   7.643   1.00 0.00 ? 34 LYS A HZ1  3  
ATOM 2848  H HZ2  . LYS A 1 34 ? 15.089  1.528   8.167   1.00 0.00 ? 34 LYS A HZ2  3  
ATOM 2849  H HZ3  . LYS A 1 34 ? 13.905  1.060   9.282   1.00 0.00 ? 34 LYS A HZ3  3  
ATOM 2850  N N    . ASP A 1 35 ? 13.659  0.399   1.515   1.00 0.00 ? 35 ASP A N    3  
ATOM 2851  C CA   . ASP A 1 35 ? 13.820  1.615   0.726   1.00 0.00 ? 35 ASP A CA   3  
ATOM 2852  C C    . ASP A 1 35 ? 12.485  2.065   0.142   1.00 0.00 ? 35 ASP A C    3  
ATOM 2853  O O    . ASP A 1 35 ? 12.169  3.255   0.128   1.00 0.00 ? 35 ASP A O    3  
ATOM 2854  C CB   . ASP A 1 35 ? 14.833  1.389   -0.398  1.00 0.00 ? 35 ASP A CB   3  
ATOM 2855  C CG   . ASP A 1 35 ? 15.566  2.660   -0.781  1.00 0.00 ? 35 ASP A CG   3  
ATOM 2856  O OD1  . ASP A 1 35 ? 16.507  3.044   -0.054  1.00 0.00 ? 35 ASP A OD1  3  
ATOM 2857  O OD2  . ASP A 1 35 ? 15.199  3.271   -1.806  1.00 0.00 ? 35 ASP A OD2  3  
ATOM 2858  H H    . ASP A 1 35 ? 13.998  -0.449  1.159   1.00 0.00 ? 35 ASP A H    3  
ATOM 2859  H HA   . ASP A 1 35 ? 14.191  2.389   1.381   1.00 0.00 ? 35 ASP A HA   3  
ATOM 2860  H HB2  . ASP A 1 35 ? 15.561  0.659   -0.076  1.00 0.00 ? 35 ASP A HB2  3  
ATOM 2861  H HB3  . ASP A 1 35 ? 14.316  1.017   -1.270  1.00 0.00 ? 35 ASP A HB3  3  
ATOM 2862  N N    . LYS A 1 36 ? 11.704  1.105   -0.342  1.00 0.00 ? 36 LYS A N    3  
ATOM 2863  C CA   . LYS A 1 36 ? 10.402  1.400   -0.929  1.00 0.00 ? 36 LYS A CA   3  
ATOM 2864  C C    . LYS A 1 36 ? 9.396   1.793   0.149   1.00 0.00 ? 36 LYS A C    3  
ATOM 2865  O O    . LYS A 1 36 ? 8.589   2.703   -0.044  1.00 0.00 ? 36 LYS A O    3  
ATOM 2866  C CB   . LYS A 1 36 ? 9.883   0.189   -1.707  1.00 0.00 ? 36 LYS A CB   3  
ATOM 2867  C CG   . LYS A 1 36 ? 8.533   0.420   -2.364  1.00 0.00 ? 36 LYS A CG   3  
ATOM 2868  C CD   . LYS A 1 36 ? 8.656   1.300   -3.597  1.00 0.00 ? 36 LYS A CD   3  
ATOM 2869  C CE   . LYS A 1 36 ? 8.410   2.763   -3.265  1.00 0.00 ? 36 LYS A CE   3  
ATOM 2870  N NZ   . LYS A 1 36 ? 7.651   3.456   -4.342  1.00 0.00 ? 36 LYS A NZ   3  
ATOM 2871  H H    . LYS A 1 36 ? 12.010  0.174   -0.304  1.00 0.00 ? 36 LYS A H    3  
ATOM 2872  H HA   . LYS A 1 36 ? 10.525  2.229   -1.609  1.00 0.00 ? 36 LYS A HA   3  
ATOM 2873  H HB2  . LYS A 1 36 ? 10.597  -0.061  -2.478  1.00 0.00 ? 36 LYS A HB2  3  
ATOM 2874  H HB3  . LYS A 1 36 ? 9.792   -0.647  -1.029  1.00 0.00 ? 36 LYS A HB3  3  
ATOM 2875  H HG2  . LYS A 1 36 ? 8.117   -0.532  -2.655  1.00 0.00 ? 36 LYS A HG2  3  
ATOM 2876  H HG3  . LYS A 1 36 ? 7.876   0.901   -1.654  1.00 0.00 ? 36 LYS A HG3  3  
ATOM 2877  H HD2  . LYS A 1 36 ? 9.652   1.198   -4.004  1.00 0.00 ? 36 LYS A HD2  3  
ATOM 2878  H HD3  . LYS A 1 36 ? 7.931   0.979   -4.331  1.00 0.00 ? 36 LYS A HD3  3  
ATOM 2879  H HE2  . LYS A 1 36 ? 7.846   2.820   -2.346  1.00 0.00 ? 36 LYS A HE2  3  
ATOM 2880  H HE3  . LYS A 1 36 ? 9.363   3.254   -3.133  1.00 0.00 ? 36 LYS A HE3  3  
ATOM 2881  H HZ1  . LYS A 1 36 ? 7.491   4.451   -4.083  1.00 0.00 ? 36 LYS A HZ1  3  
ATOM 2882  H HZ2  . LYS A 1 36 ? 6.730   2.995   -4.485  1.00 0.00 ? 36 LYS A HZ2  3  
ATOM 2883  H HZ3  . LYS A 1 36 ? 8.185   3.423   -5.234  1.00 0.00 ? 36 LYS A HZ3  3  
ATOM 2884  N N    . ARG A 1 37 ? 9.452   1.104   1.284   1.00 0.00 ? 37 ARG A N    3  
ATOM 2885  C CA   . ARG A 1 37 ? 8.547   1.382   2.392   1.00 0.00 ? 37 ARG A CA   3  
ATOM 2886  C C    . ARG A 1 37 ? 8.564   2.865   2.749   1.00 0.00 ? 37 ARG A C    3  
ATOM 2887  O O    . ARG A 1 37 ? 7.514   3.479   2.942   1.00 0.00 ? 37 ARG A O    3  
ATOM 2888  C CB   . ARG A 1 37 ? 8.932   0.547   3.615   1.00 0.00 ? 37 ARG A CB   3  
ATOM 2889  C CG   . ARG A 1 37 ? 7.774   0.288   4.565   1.00 0.00 ? 37 ARG A CG   3  
ATOM 2890  C CD   . ARG A 1 37 ? 7.888   -1.078  5.223   1.00 0.00 ? 37 ARG A CD   3  
ATOM 2891  N NE   . ARG A 1 37 ? 9.229   -1.323  5.746   1.00 0.00 ? 37 ARG A NE   3  
ATOM 2892  C CZ   . ARG A 1 37 ? 9.698   -2.534  6.029   1.00 0.00 ? 37 ARG A CZ   3  
ATOM 2893  N NH1  . ARG A 1 37 ? 8.938   -3.604  5.838   1.00 0.00 ? 37 ARG A NH1  3  
ATOM 2894  N NH2  . ARG A 1 37 ? 10.929  -2.676  6.502   1.00 0.00 ? 37 ARG A NH2  3  
ATOM 2895  H H    . ARG A 1 37 ? 10.118  0.391   1.378   1.00 0.00 ? 37 ARG A H    3  
ATOM 2896  H HA   . ARG A 1 37 ? 7.549   1.110   2.082   1.00 0.00 ? 37 ARG A HA   3  
ATOM 2897  H HB2  . ARG A 1 37 ? 9.314   -0.406  3.280   1.00 0.00 ? 37 ARG A HB2  3  
ATOM 2898  H HB3  . ARG A 1 37 ? 9.707   1.065   4.159   1.00 0.00 ? 37 ARG A HB3  3  
ATOM 2899  H HG2  . ARG A 1 37 ? 7.775   1.047   5.334   1.00 0.00 ? 37 ARG A HG2  3  
ATOM 2900  H HG3  . ARG A 1 37 ? 6.848   0.336   4.011   1.00 0.00 ? 37 ARG A HG3  3  
ATOM 2901  H HD2  . ARG A 1 37 ? 7.179   -1.132  6.036   1.00 0.00 ? 37 ARG A HD2  3  
ATOM 2902  H HD3  . ARG A 1 37 ? 7.653   -1.836  4.490   1.00 0.00 ? 37 ARG A HD3  3  
ATOM 2903  H HE   . ARG A 1 37 ? 9.807   -0.547  5.894   1.00 0.00 ? 37 ARG A HE   3  
ATOM 2904  H HH11 . ARG A 1 37 ? 8.010   -3.499  5.481   1.00 0.00 ? 37 ARG A HH11 3  
ATOM 2905  H HH12 . ARG A 1 37 ? 9.294   -4.514  6.051   1.00 0.00 ? 37 ARG A HH12 3  
ATOM 2906  H HH21 . ARG A 1 37 ? 11.505  -1.872  6.647   1.00 0.00 ? 37 ARG A HH21 3  
ATOM 2907  H HH22 . ARG A 1 37 ? 11.281  -3.587  6.714   1.00 0.00 ? 37 ARG A HH22 3  
ATOM 2908  N N    . ARG A 1 38 ? 9.761   3.434   2.836   1.00 0.00 ? 38 ARG A N    3  
ATOM 2909  C CA   . ARG A 1 38 ? 9.915   4.844   3.171   1.00 0.00 ? 38 ARG A CA   3  
ATOM 2910  C C    . ARG A 1 38 ? 9.292   5.730   2.096   1.00 0.00 ? 38 ARG A C    3  
ATOM 2911  O O    . ARG A 1 38 ? 8.669   6.748   2.399   1.00 0.00 ? 38 ARG A O    3  
ATOM 2912  C CB   . ARG A 1 38 ? 11.395  5.192   3.339   1.00 0.00 ? 38 ARG A CB   3  
ATOM 2913  C CG   . ARG A 1 38 ? 12.029  4.579   4.577   1.00 0.00 ? 38 ARG A CG   3  
ATOM 2914  C CD   . ARG A 1 38 ? 13.544  4.532   4.463   1.00 0.00 ? 38 ARG A CD   3  
ATOM 2915  N NE   . ARG A 1 38 ? 14.132  5.868   4.424   1.00 0.00 ? 38 ARG A NE   3  
ATOM 2916  C CZ   . ARG A 1 38 ? 15.400  6.105   4.109   1.00 0.00 ? 38 ARG A CZ   3  
ATOM 2917  N NH1  . ARG A 1 38 ? 16.210  5.099   3.807   1.00 0.00 ? 38 ARG A NH1  3  
ATOM 2918  N NH2  . ARG A 1 38 ? 15.861  7.349   4.095   1.00 0.00 ? 38 ARG A NH2  3  
ATOM 2919  H H    . ARG A 1 38 ? 10.561  2.892   2.671   1.00 0.00 ? 38 ARG A H    3  
ATOM 2920  H HA   . ARG A 1 38 ? 9.405   5.020   4.106   1.00 0.00 ? 38 ARG A HA   3  
ATOM 2921  H HB2  . ARG A 1 38 ? 11.937  4.840   2.473   1.00 0.00 ? 38 ARG A HB2  3  
ATOM 2922  H HB3  . ARG A 1 38 ? 11.495  6.265   3.404   1.00 0.00 ? 38 ARG A HB3  3  
ATOM 2923  H HG2  . ARG A 1 38 ? 11.762  5.173   5.439   1.00 0.00 ? 38 ARG A HG2  3  
ATOM 2924  H HG3  . ARG A 1 38 ? 11.654  3.574   4.701   1.00 0.00 ? 38 ARG A HG3  3  
ATOM 2925  H HD2  . ARG A 1 38 ? 13.940  4.000   5.315   1.00 0.00 ? 38 ARG A HD2  3  
ATOM 2926  H HD3  . ARG A 1 38 ? 13.807  4.007   3.557   1.00 0.00 ? 38 ARG A HD3  3  
ATOM 2927  H HE   . ARG A 1 38 ? 13.551  6.626   4.644   1.00 0.00 ? 38 ARG A HE   3  
ATOM 2928  H HH11 . ARG A 1 38 ? 15.865  4.161   3.815   1.00 0.00 ? 38 ARG A HH11 3  
ATOM 2929  H HH12 . ARG A 1 38 ? 17.165  5.280   3.569   1.00 0.00 ? 38 ARG A HH12 3  
ATOM 2930  H HH21 . ARG A 1 38 ? 15.254  8.109   4.322   1.00 0.00 ? 38 ARG A HH21 3  
ATOM 2931  H HH22 . ARG A 1 38 ? 16.816  7.525   3.859   1.00 0.00 ? 38 ARG A HH22 3  
ATOM 2932  N N    . LYS A 1 39 ? 9.465   5.336   0.839   1.00 0.00 ? 39 LYS A N    3  
ATOM 2933  C CA   . LYS A 1 39 ? 8.920   6.092   -0.282  1.00 0.00 ? 39 LYS A CA   3  
ATOM 2934  C C    . LYS A 1 39 ? 7.398   6.158   -0.205  1.00 0.00 ? 39 LYS A C    3  
ATOM 2935  O O    . LYS A 1 39 ? 6.807   7.231   -0.331  1.00 0.00 ? 39 LYS A O    3  
ATOM 2936  C CB   . LYS A 1 39 ? 9.348   5.458   -1.608  1.00 0.00 ? 39 LYS A CB   3  
ATOM 2937  C CG   . LYS A 1 39 ? 10.696  5.945   -2.108  1.00 0.00 ? 39 LYS A CG   3  
ATOM 2938  C CD   . LYS A 1 39 ? 10.637  7.399   -2.545  1.00 0.00 ? 39 LYS A CD   3  
ATOM 2939  C CE   . LYS A 1 39 ? 11.968  7.864   -3.116  1.00 0.00 ? 39 LYS A CE   3  
ATOM 2940  N NZ   . LYS A 1 39 ? 12.340  7.107   -4.343  1.00 0.00 ? 39 LYS A NZ   3  
ATOM 2941  H H    . LYS A 1 39 ? 9.972   4.515   0.661   1.00 0.00 ? 39 LYS A H    3  
ATOM 2942  H HA   . LYS A 1 39 ? 9.315   7.096   -0.229  1.00 0.00 ? 39 LYS A HA   3  
ATOM 2943  H HB2  . LYS A 1 39 ? 9.400   4.387   -1.480  1.00 0.00 ? 39 LYS A HB2  3  
ATOM 2944  H HB3  . LYS A 1 39 ? 8.605   5.687   -2.358  1.00 0.00 ? 39 LYS A HB3  3  
ATOM 2945  H HG2  . LYS A 1 39 ? 11.421  5.849   -1.313  1.00 0.00 ? 39 LYS A HG2  3  
ATOM 2946  H HG3  . LYS A 1 39 ? 10.999  5.338   -2.949  1.00 0.00 ? 39 LYS A HG3  3  
ATOM 2947  H HD2  . LYS A 1 39 ? 9.876   7.508   -3.303  1.00 0.00 ? 39 LYS A HD2  3  
ATOM 2948  H HD3  . LYS A 1 39 ? 10.388  8.013   -1.691  1.00 0.00 ? 39 LYS A HD3  3  
ATOM 2949  H HE2  . LYS A 1 39 ? 11.894  8.913   -3.360  1.00 0.00 ? 39 LYS A HE2  3  
ATOM 2950  H HE3  . LYS A 1 39 ? 12.735  7.722   -2.369  1.00 0.00 ? 39 LYS A HE3  3  
ATOM 2951  H HZ1  . LYS A 1 39 ? 12.790  7.742   -5.032  1.00 0.00 ? 39 LYS A HZ1  3  
ATOM 2952  H HZ2  . LYS A 1 39 ? 11.492  6.690   -4.776  1.00 0.00 ? 39 LYS A HZ2  3  
ATOM 2953  H HZ3  . LYS A 1 39 ? 13.005  6.344   -4.105  1.00 0.00 ? 39 LYS A HZ3  3  
ATOM 2954  N N    . ILE A 1 40 ? 6.770   5.006   0.003   1.00 0.00 ? 40 ILE A N    3  
ATOM 2955  C CA   . ILE A 1 40 ? 5.318   4.934   0.099   1.00 0.00 ? 40 ILE A CA   3  
ATOM 2956  C C    . ILE A 1 40 ? 4.802   5.771   1.265   1.00 0.00 ? 40 ILE A C    3  
ATOM 2957  O O    . ILE A 1 40 ? 3.762   6.422   1.163   1.00 0.00 ? 40 ILE A O    3  
ATOM 2958  C CB   . ILE A 1 40 ? 4.836   3.482   0.272   1.00 0.00 ? 40 ILE A CB   3  
ATOM 2959  C CG1  . ILE A 1 40 ? 5.386   2.602   -0.853  1.00 0.00 ? 40 ILE A CG1  3  
ATOM 2960  C CG2  . ILE A 1 40 ? 3.316   3.428   0.298   1.00 0.00 ? 40 ILE A CG2  3  
ATOM 2961  C CD1  . ILE A 1 40 ? 5.098   1.129   -0.663  1.00 0.00 ? 40 ILE A CD1  3  
ATOM 2962  H H    . ILE A 1 40 ? 7.297   4.185   0.095   1.00 0.00 ? 40 ILE A H    3  
ATOM 2963  H HA   . ILE A 1 40 ? 4.904   5.323   -0.820  1.00 0.00 ? 40 ILE A HA   3  
ATOM 2964  H HB   . ILE A 1 40 ? 5.202   3.115   1.218   1.00 0.00 ? 40 ILE A HB   3  
ATOM 2965  H HG12 . ILE A 1 40 ? 4.946   2.907   -1.789  1.00 0.00 ? 40 ILE A HG12 3  
ATOM 2966  H HG13 . ILE A 1 40 ? 6.458   2.727   -0.906  1.00 0.00 ? 40 ILE A HG13 3  
ATOM 2967  H HG21 . ILE A 1 40 ? 2.979   3.266   1.312   1.00 0.00 ? 40 ILE A HG21 3  
ATOM 2968  H HG22 . ILE A 1 40 ? 2.916   4.362   -0.068  1.00 0.00 ? 40 ILE A HG22 3  
ATOM 2969  H HG23 . ILE A 1 40 ? 2.973   2.619   -0.328  1.00 0.00 ? 40 ILE A HG23 3  
ATOM 2970  H HD11 . ILE A 1 40 ? 5.428   0.821   0.318   1.00 0.00 ? 40 ILE A HD11 3  
ATOM 2971  H HD12 . ILE A 1 40 ? 4.037   0.954   -0.759  1.00 0.00 ? 40 ILE A HD12 3  
ATOM 2972  H HD13 . ILE A 1 40 ? 5.626   0.559   -1.415  1.00 0.00 ? 40 ILE A HD13 3  
ATOM 2973  N N    . SER A 1 41 ? 5.537   5.750   2.372   1.00 0.00 ? 41 SER A N    3  
ATOM 2974  C CA   . SER A 1 41 ? 5.153   6.506   3.559   1.00 0.00 ? 41 SER A CA   3  
ATOM 2975  C C    . SER A 1 41 ? 5.208   8.007   3.288   1.00 0.00 ? 41 SER A C    3  
ATOM 2976  O O    . SER A 1 41 ? 4.530   8.792   3.949   1.00 0.00 ? 41 SER A O    3  
ATOM 2977  C CB   . SER A 1 41 ? 6.070   6.154   4.732   1.00 0.00 ? 41 SER A CB   3  
ATOM 2978  O OG   . SER A 1 41 ? 6.227   7.258   5.605   1.00 0.00 ? 41 SER A OG   3  
ATOM 2979  H H    . SER A 1 41 ? 6.356   5.212   2.391   1.00 0.00 ? 41 SER A H    3  
ATOM 2980  H HA   . SER A 1 41 ? 4.139   6.234   3.811   1.00 0.00 ? 41 SER A HA   3  
ATOM 2981  H HB2  . SER A 1 41 ? 5.643   5.331   5.285   1.00 0.00 ? 41 SER A HB2  3  
ATOM 2982  H HB3  . SER A 1 41 ? 7.041   5.868   4.353   1.00 0.00 ? 41 SER A HB3  3  
ATOM 2983  H HG   . SER A 1 41 ? 6.461   6.943   6.482   1.00 0.00 ? 41 SER A HG   3  
ATOM 2984  N N    . ALA A 1 42 ? 6.021   8.396   2.312   1.00 0.00 ? 42 ALA A N    3  
ATOM 2985  C CA   . ALA A 1 42 ? 6.163   9.802   1.952   1.00 0.00 ? 42 ALA A CA   3  
ATOM 2986  C C    . ALA A 1 42 ? 5.021   10.256  1.050   1.00 0.00 ? 42 ALA A C    3  
ATOM 2987  O O    . ALA A 1 42 ? 4.681   11.438  1.011   1.00 0.00 ? 42 ALA A O    3  
ATOM 2988  C CB   . ALA A 1 42 ? 7.503   10.039  1.271   1.00 0.00 ? 42 ALA A CB   3  
ATOM 2989  H H    . ALA A 1 42 ? 6.536   7.723   1.821   1.00 0.00 ? 42 ALA A H    3  
ATOM 2990  H HA   . ALA A 1 42 ? 6.142   10.383  2.863   1.00 0.00 ? 42 ALA A HA   3  
ATOM 2991  H HB1  . ALA A 1 42 ? 7.339   10.283  0.231   1.00 0.00 ? 42 ALA A HB1  3  
ATOM 2992  H HB2  . ALA A 1 42 ? 8.014   10.856  1.757   1.00 0.00 ? 42 ALA A HB2  3  
ATOM 2993  H HB3  . ALA A 1 42 ? 8.105   9.145   1.341   1.00 0.00 ? 42 ALA A HB3  3  
ATOM 2994  N N    . ALA A 1 43 ? 4.434   9.309   0.325   1.00 0.00 ? 43 ALA A N    3  
ATOM 2995  C CA   . ALA A 1 43 ? 3.329   9.613   -0.577  1.00 0.00 ? 43 ALA A CA   3  
ATOM 2996  C C    . ALA A 1 43 ? 1.985   9.414   0.116   1.00 0.00 ? 43 ALA A C    3  
ATOM 2997  O O    . ALA A 1 43 ? 1.184   10.343  0.219   1.00 0.00 ? 43 ALA A O    3  
ATOM 2998  C CB   . ALA A 1 43 ? 3.415   8.748   -1.826  1.00 0.00 ? 43 ALA A CB   3  
ATOM 2999  H H    . ALA A 1 43 ? 4.750   8.385   0.399   1.00 0.00 ? 43 ALA A H    3  
ATOM 3000  H HA   . ALA A 1 43 ? 3.418   10.647  -0.878  1.00 0.00 ? 43 ALA A HA   3  
ATOM 3001  H HB1  . ALA A 1 43 ? 4.157   7.977   -1.679  1.00 0.00 ? 43 ALA A HB1  3  
ATOM 3002  H HB2  . ALA A 1 43 ? 2.454   8.292   -2.014  1.00 0.00 ? 43 ALA A HB2  3  
ATOM 3003  H HB3  . ALA A 1 43 ? 3.694   9.361   -2.669  1.00 0.00 ? 43 ALA A HB3  3  
ATOM 3004  N N    . THR A 1 44 ? 1.743   8.195   0.590   1.00 0.00 ? 44 THR A N    3  
ATOM 3005  C CA   . THR A 1 44 ? 0.496   7.874   1.271   1.00 0.00 ? 44 THR A CA   3  
ATOM 3006  C C    . THR A 1 44 ? 0.443   8.515   2.653   1.00 0.00 ? 44 THR A C    3  
ATOM 3007  O O    . THR A 1 44 ? -0.610  8.554   3.290   1.00 0.00 ? 44 THR A O    3  
ATOM 3008  C CB   . THR A 1 44 ? 0.310   6.352   1.416   1.00 0.00 ? 44 THR A CB   3  
ATOM 3009  O OG1  . THR A 1 44 ? 1.368   5.803   2.209   1.00 0.00 ? 44 THR A OG1  3  
ATOM 3010  C CG2  . THR A 1 44 ? 0.290   5.677   0.052   1.00 0.00 ? 44 THR A CG2  3  
ATOM 3011  H H    . THR A 1 44 ? 2.421   7.497   0.477   1.00 0.00 ? 44 THR A H    3  
ATOM 3012  H HA   . THR A 1 44 ? -0.319  8.260   0.674   1.00 0.00 ? 44 THR A HA   3  
ATOM 3013  H HB   . THR A 1 44 ? -0.633  6.165   1.908   1.00 0.00 ? 44 THR A HB   3  
ATOM 3014  H HG1  . THR A 1 44 ? 2.154   6.347   2.115   1.00 0.00 ? 44 THR A HG1  3  
ATOM 3015  H HG21 . THR A 1 44 ? -0.466  6.138   -0.566  1.00 0.00 ? 44 THR A HG21 3  
ATOM 3016  H HG22 . THR A 1 44 ? 0.065   4.628   0.173   1.00 0.00 ? 44 THR A HG22 3  
ATOM 3017  H HG23 . THR A 1 44 ? 1.255   5.787   -0.418  1.00 0.00 ? 44 THR A HG23 3  
ATOM 3018  N N    . SER A 1 45 ? 1.585   9.017   3.111   1.00 0.00 ? 45 SER A N    3  
ATOM 3019  C CA   . SER A 1 45 ? 1.669   9.654   4.420   1.00 0.00 ? 45 SER A CA   3  
ATOM 3020  C C    . SER A 1 45 ? 1.362   8.655   5.531   1.00 0.00 ? 45 SER A C    3  
ATOM 3021  O O    . SER A 1 45 ? 0.875   9.026   6.600   1.00 0.00 ? 45 SER A O    3  
ATOM 3022  C CB   . SER A 1 45 ? 0.700   10.835  4.499   1.00 0.00 ? 45 SER A CB   3  
ATOM 3023  O OG   . SER A 1 45 ? 1.098   11.755  5.501   1.00 0.00 ? 45 SER A OG   3  
ATOM 3024  H H    . SER A 1 45 ? 2.391   8.956   2.556   1.00 0.00 ? 45 SER A H    3  
ATOM 3025  H HA   . SER A 1 45 ? 2.678   10.018  4.548   1.00 0.00 ? 45 SER A HA   3  
ATOM 3026  H HB2  . SER A 1 45 ? 0.679   11.345  3.548   1.00 0.00 ? 45 SER A HB2  3  
ATOM 3027  H HB3  . SER A 1 45 ? -0.289  10.471  4.734   1.00 0.00 ? 45 SER A HB3  3  
ATOM 3028  H HG   . SER A 1 45 ? 2.054   11.848  5.489   1.00 0.00 ? 45 SER A HG   3  
ATOM 3029  N N    . LEU A 1 46 ? 1.651   7.384   5.272   1.00 0.00 ? 46 LEU A N    3  
ATOM 3030  C CA   . LEU A 1 46 ? 1.407   6.329   6.249   1.00 0.00 ? 46 LEU A CA   3  
ATOM 3031  C C    . LEU A 1 46 ? 2.695   5.946   6.971   1.00 0.00 ? 46 LEU A C    3  
ATOM 3032  O O    . LEU A 1 46 ? 3.765   6.478   6.676   1.00 0.00 ? 46 LEU A O    3  
ATOM 3033  C CB   . LEU A 1 46 ? 0.809   5.100   5.562   1.00 0.00 ? 46 LEU A CB   3  
ATOM 3034  C CG   . LEU A 1 46 ? -0.599  5.268   4.991   1.00 0.00 ? 46 LEU A CG   3  
ATOM 3035  C CD1  . LEU A 1 46 ? -0.849  4.260   3.881   1.00 0.00 ? 46 LEU A CD1  3  
ATOM 3036  C CD2  . LEU A 1 46 ? -1.642  5.123   6.090   1.00 0.00 ? 46 LEU A CD2  3  
ATOM 3037  H H    . LEU A 1 46 ? 2.038   7.149   4.403   1.00 0.00 ? 46 LEU A H    3  
ATOM 3038  H HA   . LEU A 1 46 ? 0.700   6.706   6.974   1.00 0.00 ? 46 LEU A HA   3  
ATOM 3039  H HB2  . LEU A 1 46 ? 1.464   4.823   4.751   1.00 0.00 ? 46 LEU A HB2  3  
ATOM 3040  H HB3  . LEU A 1 46 ? 0.779   4.299   6.288   1.00 0.00 ? 46 LEU A HB3  3  
ATOM 3041  H HG   . LEU A 1 46 ? -0.693  6.259   4.568   1.00 0.00 ? 46 LEU A HG   3  
ATOM 3042  H HD11 . LEU A 1 46 ? 0.082   4.032   3.385   1.00 0.00 ? 46 LEU A HD11 3  
ATOM 3043  H HD12 . LEU A 1 46 ? -1.545  4.675   3.167   1.00 0.00 ? 46 LEU A HD12 3  
ATOM 3044  H HD13 . LEU A 1 46 ? -1.264  3.356   4.302   1.00 0.00 ? 46 LEU A HD13 3  
ATOM 3045  H HD21 . LEU A 1 46 ? -1.435  4.234   6.667   1.00 0.00 ? 46 LEU A HD21 3  
ATOM 3046  H HD22 . LEU A 1 46 ? -2.624  5.045   5.647   1.00 0.00 ? 46 LEU A HD22 3  
ATOM 3047  H HD23 . LEU A 1 46 ? -1.606  5.988   6.737   1.00 0.00 ? 46 LEU A HD23 3  
ATOM 3048  N N    . SER A 1 47 ? 2.584   5.019   7.917   1.00 0.00 ? 47 SER A N    3  
ATOM 3049  C CA   . SER A 1 47 ? 3.739   4.566   8.682   1.00 0.00 ? 47 SER A CA   3  
ATOM 3050  C C    . SER A 1 47 ? 4.338   3.304   8.067   1.00 0.00 ? 47 SER A C    3  
ATOM 3051  O O    . SER A 1 47 ? 3.636   2.519   7.430   1.00 0.00 ? 47 SER A O    3  
ATOM 3052  C CB   . SER A 1 47 ? 3.343   4.300   10.135  1.00 0.00 ? 47 SER A CB   3  
ATOM 3053  O OG   . SER A 1 47 ? 4.413   4.591   11.017  1.00 0.00 ? 47 SER A OG   3  
ATOM 3054  H H    . SER A 1 47 ? 1.703   4.632   8.105   1.00 0.00 ? 47 SER A H    3  
ATOM 3055  H HA   . SER A 1 47 ? 4.481   5.350   8.658   1.00 0.00 ? 47 SER A HA   3  
ATOM 3056  H HB2  . SER A 1 47 ? 2.499   4.921   10.395  1.00 0.00 ? 47 SER A HB2  3  
ATOM 3057  H HB3  . SER A 1 47 ? 3.072   3.260   10.247  1.00 0.00 ? 47 SER A HB3  3  
ATOM 3058  H HG   . SER A 1 47 ? 4.148   5.285   11.625  1.00 0.00 ? 47 SER A HG   3  
ATOM 3059  N N    . GLU A 1 48 ? 5.639   3.117   8.263   1.00 0.00 ? 48 GLU A N    3  
ATOM 3060  C CA   . GLU A 1 48 ? 6.332   1.952   7.727   1.00 0.00 ? 48 GLU A CA   3  
ATOM 3061  C C    . GLU A 1 48 ? 5.614   0.664   8.119   1.00 0.00 ? 48 GLU A C    3  
ATOM 3062  O O    . GLU A 1 48 ? 5.429   -0.232  7.296   1.00 0.00 ? 48 GLU A O    3  
ATOM 3063  C CB   . GLU A 1 48 ? 7.778   1.916   8.227   1.00 0.00 ? 48 GLU A CB   3  
ATOM 3064  C CG   . GLU A 1 48 ? 8.553   3.191   7.942   1.00 0.00 ? 48 GLU A CG   3  
ATOM 3065  C CD   . GLU A 1 48 ? 9.981   3.132   8.449   1.00 0.00 ? 48 GLU A CD   3  
ATOM 3066  O OE1  . GLU A 1 48 ? 10.632  2.082   8.269   1.00 0.00 ? 48 GLU A OE1  3  
ATOM 3067  O OE2  . GLU A 1 48 ? 10.447  4.137   9.025   1.00 0.00 ? 48 GLU A OE2  3  
ATOM 3068  H H    . GLU A 1 48 ? 6.145   3.779   8.779   1.00 0.00 ? 48 GLU A H    3  
ATOM 3069  H HA   . GLU A 1 48 ? 6.336   2.034   6.651   1.00 0.00 ? 48 GLU A HA   3  
ATOM 3070  H HB2  . GLU A 1 48 ? 7.773   1.753   9.295   1.00 0.00 ? 48 GLU A HB2  3  
ATOM 3071  H HB3  . GLU A 1 48 ? 8.290   1.094   7.750   1.00 0.00 ? 48 GLU A HB3  3  
ATOM 3072  H HG2  . GLU A 1 48 ? 8.573   3.354   6.875   1.00 0.00 ? 48 GLU A HG2  3  
ATOM 3073  H HG3  . GLU A 1 48 ? 8.050   4.018   8.421   1.00 0.00 ? 48 GLU A HG3  3  
ATOM 3074  N N    . ARG A 1 49 ? 5.212   0.579   9.383   1.00 0.00 ? 49 ARG A N    3  
ATOM 3075  C CA   . ARG A 1 49 ? 4.516   -0.599  9.886   1.00 0.00 ? 49 ARG A CA   3  
ATOM 3076  C C    . ARG A 1 49 ? 3.144   -0.739  9.235   1.00 0.00 ? 49 ARG A C    3  
ATOM 3077  O O    . ARG A 1 49 ? 2.746   -1.833  8.834   1.00 0.00 ? 49 ARG A O    3  
ATOM 3078  C CB   . ARG A 1 49 ? 4.366   -0.519  11.407  1.00 0.00 ? 49 ARG A CB   3  
ATOM 3079  C CG   . ARG A 1 49 ? 3.939   -1.830  12.047  1.00 0.00 ? 49 ARG A CG   3  
ATOM 3080  C CD   . ARG A 1 49 ? 5.128   -2.751  12.275  1.00 0.00 ? 49 ARG A CD   3  
ATOM 3081  N NE   . ARG A 1 49 ? 6.051   -2.215  13.272  1.00 0.00 ? 49 ARG A NE   3  
ATOM 3082  C CZ   . ARG A 1 49 ? 7.267   -2.706  13.486  1.00 0.00 ? 49 ARG A CZ   3  
ATOM 3083  N NH1  . ARG A 1 49 ? 7.703   -3.738  12.777  1.00 0.00 ? 49 ARG A NH1  3  
ATOM 3084  N NH2  . ARG A 1 49 ? 8.049   -2.165  14.411  1.00 0.00 ? 49 ARG A NH2  3  
ATOM 3085  H H    . ARG A 1 49 ? 5.389   1.326   9.993   1.00 0.00 ? 49 ARG A H    3  
ATOM 3086  H HA   . ARG A 1 49 ? 5.110   -1.466  9.638   1.00 0.00 ? 49 ARG A HA   3  
ATOM 3087  H HB2  . ARG A 1 49 ? 5.312   -0.225  11.836  1.00 0.00 ? 49 ARG A HB2  3  
ATOM 3088  H HB3  . ARG A 1 49 ? 3.625   0.230   11.643  1.00 0.00 ? 49 ARG A HB3  3  
ATOM 3089  H HG2  . ARG A 1 49 ? 3.473   -1.620  12.998  1.00 0.00 ? 49 ARG A HG2  3  
ATOM 3090  H HG3  . ARG A 1 49 ? 3.232   -2.323  11.397  1.00 0.00 ? 49 ARG A HG3  3  
ATOM 3091  H HD2  . ARG A 1 49 ? 4.763   -3.709  12.614  1.00 0.00 ? 49 ARG A HD2  3  
ATOM 3092  H HD3  . ARG A 1 49 ? 5.654   -2.875  11.340  1.00 0.00 ? 49 ARG A HD3  3  
ATOM 3093  H HE   . ARG A 1 49 ? 5.749   -1.453  13.807  1.00 0.00 ? 49 ARG A HE   3  
ATOM 3094  H HH11 . ARG A 1 49 ? 7.116   -4.148  12.078  1.00 0.00 ? 49 ARG A HH11 3  
ATOM 3095  H HH12 . ARG A 1 49 ? 8.619   -4.105  12.939  1.00 0.00 ? 49 ARG A HH12 3  
ATOM 3096  H HH21 . ARG A 1 49 ? 7.723   -1.387  14.948  1.00 0.00 ? 49 ARG A HH21 3  
ATOM 3097  H HH22 . ARG A 1 49 ? 8.963   -2.535  14.572  1.00 0.00 ? 49 ARG A HH22 3  
ATOM 3098  N N    . GLN A 1 50 ? 2.426   0.375   9.134   1.00 0.00 ? 50 GLN A N    3  
ATOM 3099  C CA   . GLN A 1 50 ? 1.097   0.375   8.533   1.00 0.00 ? 50 GLN A CA   3  
ATOM 3100  C C    . GLN A 1 50 ? 1.143   -0.176  7.111   1.00 0.00 ? 50 GLN A C    3  
ATOM 3101  O O    . GLN A 1 50 ? 0.369   -1.064  6.755   1.00 0.00 ? 50 GLN A O    3  
ATOM 3102  C CB   . GLN A 1 50 ? 0.518   1.791   8.526   1.00 0.00 ? 50 GLN A CB   3  
ATOM 3103  C CG   . GLN A 1 50 ? 0.074   2.274   9.897   1.00 0.00 ? 50 GLN A CG   3  
ATOM 3104  C CD   . GLN A 1 50 ? -0.979  3.362   9.820   1.00 0.00 ? 50 GLN A CD   3  
ATOM 3105  O OE1  . GLN A 1 50 ? -0.679  4.544   9.989   1.00 0.00 ? 50 GLN A OE1  3  
ATOM 3106  N NE2  . GLN A 1 50 ? -2.220  2.968   9.562   1.00 0.00 ? 50 GLN A NE2  3  
ATOM 3107  H H    . GLN A 1 50 ? 2.798   1.215   9.473   1.00 0.00 ? 50 GLN A H    3  
ATOM 3108  H HA   . GLN A 1 50 ? 0.463   -0.260  9.131   1.00 0.00 ? 50 GLN A HA   3  
ATOM 3109  H HB2  . GLN A 1 50 ? 1.269   2.472   8.153   1.00 0.00 ? 50 GLN A HB2  3  
ATOM 3110  H HB3  . GLN A 1 50 ? -0.336  1.814   7.866   1.00 0.00 ? 50 GLN A HB3  3  
ATOM 3111  H HG2  . GLN A 1 50 ? -0.335  1.437   10.444  1.00 0.00 ? 50 GLN A HG2  3  
ATOM 3112  H HG3  . GLN A 1 50 ? 0.934   2.661   10.424  1.00 0.00 ? 50 GLN A HG3  3  
ATOM 3113  H HE21 . GLN A 1 50 ? -2.385  2.009   9.440   1.00 0.00 ? 50 GLN A HE21 3  
ATOM 3114  H HE22 . GLN A 1 50 ? -2.920  3.650   9.508   1.00 0.00 ? 50 GLN A HE22 3  
ATOM 3115  N N    . ILE A 1 51 ? 2.055   0.357   6.305   1.00 0.00 ? 51 ILE A N    3  
ATOM 3116  C CA   . ILE A 1 51 ? 2.201   -0.082  4.923   1.00 0.00 ? 51 ILE A CA   3  
ATOM 3117  C C    . ILE A 1 51 ? 2.562   -1.562  4.851   1.00 0.00 ? 51 ILE A C    3  
ATOM 3118  O O    . ILE A 1 51 ? 2.257   -2.241  3.871   1.00 0.00 ? 51 ILE A O    3  
ATOM 3119  C CB   . ILE A 1 51 ? 3.278   0.734   4.184   1.00 0.00 ? 51 ILE A CB   3  
ATOM 3120  C CG1  . ILE A 1 51 ? 2.924   2.223   4.204   1.00 0.00 ? 51 ILE A CG1  3  
ATOM 3121  C CG2  . ILE A 1 51 ? 3.429   0.239   2.753   1.00 0.00 ? 51 ILE A CG2  3  
ATOM 3122  C CD1  . ILE A 1 51 ? 4.101   3.127   3.913   1.00 0.00 ? 51 ILE A CD1  3  
ATOM 3123  H H    . ILE A 1 51 ? 2.643   1.062   6.647   1.00 0.00 ? 51 ILE A H    3  
ATOM 3124  H HA   . ILE A 1 51 ? 1.256   0.072   4.423   1.00 0.00 ? 51 ILE A HA   3  
ATOM 3125  H HB   . ILE A 1 51 ? 4.220   0.588   4.691   1.00 0.00 ? 51 ILE A HB   3  
ATOM 3126  H HG12 . ILE A 1 51 ? 2.167   2.416   3.461   1.00 0.00 ? 51 ILE A HG12 3  
ATOM 3127  H HG13 . ILE A 1 51 ? 2.540   2.481   5.180   1.00 0.00 ? 51 ILE A HG13 3  
ATOM 3128  H HG21 . ILE A 1 51 ? 2.558   -0.335  2.477   1.00 0.00 ? 51 ILE A HG21 3  
ATOM 3129  H HG22 . ILE A 1 51 ? 3.527   1.084   2.089   1.00 0.00 ? 51 ILE A HG22 3  
ATOM 3130  H HG23 . ILE A 1 51 ? 4.309   -0.382  2.678   1.00 0.00 ? 51 ILE A HG23 3  
ATOM 3131  H HD11 . ILE A 1 51 ? 3.790   3.923   3.252   1.00 0.00 ? 51 ILE A HD11 3  
ATOM 3132  H HD12 . ILE A 1 51 ? 4.469   3.549   4.836   1.00 0.00 ? 51 ILE A HD12 3  
ATOM 3133  H HD13 . ILE A 1 51 ? 4.887   2.555   3.440   1.00 0.00 ? 51 ILE A HD13 3  
ATOM 3134  N N    . THR A 1 52 ? 3.214   -2.057  5.899   1.00 0.00 ? 52 THR A N    3  
ATOM 3135  C CA   . THR A 1 52 ? 3.616   -3.457  5.956   1.00 0.00 ? 52 THR A CA   3  
ATOM 3136  C C    . THR A 1 52 ? 2.424   -4.360  6.249   1.00 0.00 ? 52 THR A C    3  
ATOM 3137  O O    . THR A 1 52 ? 2.174   -5.327  5.528   1.00 0.00 ? 52 THR A O    3  
ATOM 3138  C CB   . THR A 1 52 ? 4.696   -3.687  7.030   1.00 0.00 ? 52 THR A CB   3  
ATOM 3139  O OG1  . THR A 1 52 ? 5.801   -2.803  6.812   1.00 0.00 ? 52 THR A OG1  3  
ATOM 3140  C CG2  . THR A 1 52 ? 5.182   -5.129  7.009   1.00 0.00 ? 52 THR A CG2  3  
ATOM 3141  H H    . THR A 1 52 ? 3.429   -1.466  6.650   1.00 0.00 ? 52 THR A H    3  
ATOM 3142  H HA   . THR A 1 52 ? 4.031   -3.724  4.995   1.00 0.00 ? 52 THR A HA   3  
ATOM 3143  H HB   . THR A 1 52 ? 4.267   -3.482  8.001   1.00 0.00 ? 52 THR A HB   3  
ATOM 3144  H HG1  . THR A 1 52 ? 6.474   -2.959  7.479   1.00 0.00 ? 52 THR A HG1  3  
ATOM 3145  H HG21 . THR A 1 52 ? 4.590   -5.698  6.307   1.00 0.00 ? 52 THR A HG21 3  
ATOM 3146  H HG22 . THR A 1 52 ? 5.083   -5.557  7.995   1.00 0.00 ? 52 THR A HG22 3  
ATOM 3147  H HG23 . THR A 1 52 ? 6.219   -5.154  6.708   1.00 0.00 ? 52 THR A HG23 3  
ATOM 3148  N N    . ILE A 1 53 ? 1.691   -4.040  7.310   1.00 0.00 ? 53 ILE A N    3  
ATOM 3149  C CA   . ILE A 1 53 ? 0.524   -4.822  7.696   1.00 0.00 ? 53 ILE A CA   3  
ATOM 3150  C C    . ILE A 1 53 ? -0.426  -5.010  6.518   1.00 0.00 ? 53 ILE A C    3  
ATOM 3151  O O    . ILE A 1 53 ? -0.893  -6.119  6.254   1.00 0.00 ? 53 ILE A O    3  
ATOM 3152  C CB   . ILE A 1 53 ? -0.241  -4.158  8.856   1.00 0.00 ? 53 ILE A CB   3  
ATOM 3153  C CG1  . ILE A 1 53 ? 0.675   -3.992  10.070  1.00 0.00 ? 53 ILE A CG1  3  
ATOM 3154  C CG2  . ILE A 1 53 ? -1.468  -4.980  9.221   1.00 0.00 ? 53 ILE A CG2  3  
ATOM 3155  C CD1  . ILE A 1 53 ? 0.186   -2.958  11.059  1.00 0.00 ? 53 ILE A CD1  3  
ATOM 3156  H H    . ILE A 1 53 ? 1.941   -3.258  7.845   1.00 0.00 ? 53 ILE A H    3  
ATOM 3157  H HA   . ILE A 1 53 ? 0.867   -5.792  8.026   1.00 0.00 ? 53 ILE A HA   3  
ATOM 3158  H HB   . ILE A 1 53 ? -0.573  -3.185  8.529   1.00 0.00 ? 53 ILE A HB   3  
ATOM 3159  H HG12 . ILE A 1 53 ? 0.751   -4.935  10.588  1.00 0.00 ? 53 ILE A HG12 3  
ATOM 3160  H HG13 . ILE A 1 53 ? 1.657   -3.691  9.733   1.00 0.00 ? 53 ILE A HG13 3  
ATOM 3161  H HG21 . ILE A 1 53 ? -1.846  -4.657  10.180  1.00 0.00 ? 53 ILE A HG21 3  
ATOM 3162  H HG22 . ILE A 1 53 ? -2.231  -4.840  8.469   1.00 0.00 ? 53 ILE A HG22 3  
ATOM 3163  H HG23 . ILE A 1 53 ? -1.201  -6.025  9.272   1.00 0.00 ? 53 ILE A HG23 3  
ATOM 3164  H HD11 . ILE A 1 53 ? -0.816  -2.652  10.795  1.00 0.00 ? 53 ILE A HD11 3  
ATOM 3165  H HD12 . ILE A 1 53 ? 0.184   -3.381  12.052  1.00 0.00 ? 53 ILE A HD12 3  
ATOM 3166  H HD13 . ILE A 1 53 ? 0.842   -2.099  11.036  1.00 0.00 ? 53 ILE A HD13 3  
ATOM 3167  N N    . TRP A 1 54 ? -0.707  -3.921  5.812   1.00 0.00 ? 54 TRP A N    3  
ATOM 3168  C CA   . TRP A 1 54 ? -1.600  -3.966  4.660   1.00 0.00 ? 54 TRP A CA   3  
ATOM 3169  C C    . TRP A 1 54 ? -1.104  -4.970  3.625   1.00 0.00 ? 54 TRP A C    3  
ATOM 3170  O O    . TRP A 1 54 ? -1.874  -5.788  3.120   1.00 0.00 ? 54 TRP A O    3  
ATOM 3171  C CB   . TRP A 1 54 ? -1.718  -2.579  4.026   1.00 0.00 ? 54 TRP A CB   3  
ATOM 3172  C CG   . TRP A 1 54 ? -2.803  -2.487  2.996   1.00 0.00 ? 54 TRP A CG   3  
ATOM 3173  C CD1  . TRP A 1 54 ? -4.117  -2.186  3.214   1.00 0.00 ? 54 TRP A CD1  3  
ATOM 3174  C CD2  . TRP A 1 54 ? -2.667  -2.700  1.587   1.00 0.00 ? 54 TRP A CD2  3  
ATOM 3175  N NE1  . TRP A 1 54 ? -4.806  -2.199  2.026   1.00 0.00 ? 54 TRP A NE1  3  
ATOM 3176  C CE2  . TRP A 1 54 ? -3.939  -2.511  1.012   1.00 0.00 ? 54 TRP A CE2  3  
ATOM 3177  C CE3  . TRP A 1 54 ? -1.595  -3.031  0.754   1.00 0.00 ? 54 TRP A CE3  3  
ATOM 3178  C CZ2  . TRP A 1 54 ? -4.165  -2.643  -0.356  1.00 0.00 ? 54 TRP A CZ2  3  
ATOM 3179  C CZ3  . TRP A 1 54 ? -1.820  -3.161  -0.603  1.00 0.00 ? 54 TRP A CZ3  3  
ATOM 3180  C CH2  . TRP A 1 54 ? -3.097  -2.967  -1.147  1.00 0.00 ? 54 TRP A CH2  3  
ATOM 3181  H H    . TRP A 1 54 ? -0.304  -3.066  6.071   1.00 0.00 ? 54 TRP A H    3  
ATOM 3182  H HA   . TRP A 1 54 ? -2.574  -4.277  5.008   1.00 0.00 ? 54 TRP A HA   3  
ATOM 3183  H HB2  . TRP A 1 54 ? -1.929  -1.854  4.798   1.00 0.00 ? 54 TRP A HB2  3  
ATOM 3184  H HB3  . TRP A 1 54 ? -0.782  -2.328  3.548   1.00 0.00 ? 54 TRP A HB3  3  
ATOM 3185  H HD1  . TRP A 1 54 ? -4.539  -1.973  4.185   1.00 0.00 ? 54 TRP A HD1  3  
ATOM 3186  H HE1  . TRP A 1 54 ? -5.763  -2.013  1.921   1.00 0.00 ? 54 TRP A HE1  3  
ATOM 3187  H HE3  . TRP A 1 54 ? -0.604  -3.184  1.155   1.00 0.00 ? 54 TRP A HE3  3  
ATOM 3188  H HZ2  . TRP A 1 54 ? -5.143  -2.495  -0.790  1.00 0.00 ? 54 TRP A HZ2  3  
ATOM 3189  H HZ3  . TRP A 1 54 ? -1.004  -3.417  -1.262  1.00 0.00 ? 54 TRP A HZ3  3  
ATOM 3190  H HH2  . TRP A 1 54 ? -3.227  -3.079  -2.212  1.00 0.00 ? 54 TRP A HH2  3  
ATOM 3191  N N    . PHE A 1 55 ? 0.186   -4.904  3.314   1.00 0.00 ? 55 PHE A N    3  
ATOM 3192  C CA   . PHE A 1 55 ? 0.785   -5.808  2.338   1.00 0.00 ? 55 PHE A CA   3  
ATOM 3193  C C    . PHE A 1 55 ? 0.658   -7.259  2.793   1.00 0.00 ? 55 PHE A C    3  
ATOM 3194  O O    . PHE A 1 55 ? 0.581   -8.173  1.971   1.00 0.00 ? 55 PHE A O    3  
ATOM 3195  C CB   . PHE A 1 55 ? 2.258   -5.456  2.121   1.00 0.00 ? 55 PHE A CB   3  
ATOM 3196  C CG   . PHE A 1 55 ? 2.489   -4.540  0.954   1.00 0.00 ? 55 PHE A CG   3  
ATOM 3197  C CD1  . PHE A 1 55 ? 1.989   -3.248  0.959   1.00 0.00 ? 55 PHE A CD1  3  
ATOM 3198  C CD2  . PHE A 1 55 ? 3.208   -4.971  -0.150  1.00 0.00 ? 55 PHE A CD2  3  
ATOM 3199  C CE1  . PHE A 1 55 ? 2.200   -2.404  -0.115  1.00 0.00 ? 55 PHE A CE1  3  
ATOM 3200  C CE2  . PHE A 1 55 ? 3.423   -4.132  -1.226  1.00 0.00 ? 55 PHE A CE2  3  
ATOM 3201  C CZ   . PHE A 1 55 ? 2.919   -2.846  -1.208  1.00 0.00 ? 55 PHE A CZ   3  
ATOM 3202  H H    . PHE A 1 55 ? 0.750   -4.231  3.750   1.00 0.00 ? 55 PHE A H    3  
ATOM 3203  H HA   . PHE A 1 55 ? 0.253   -5.688  1.407   1.00 0.00 ? 55 PHE A HA   3  
ATOM 3204  H HB2  . PHE A 1 55 ? 2.638   -4.967  3.006   1.00 0.00 ? 55 PHE A HB2  3  
ATOM 3205  H HB3  . PHE A 1 55 ? 2.815   -6.364  1.949   1.00 0.00 ? 55 PHE A HB3  3  
ATOM 3206  H HD1  . PHE A 1 55 ? 1.427   -2.901  1.814   1.00 0.00 ? 55 PHE A HD1  3  
ATOM 3207  H HD2  . PHE A 1 55 ? 3.604   -5.978  -0.165  1.00 0.00 ? 55 PHE A HD2  3  
ATOM 3208  H HE1  . PHE A 1 55 ? 1.805   -1.400  -0.098  1.00 0.00 ? 55 PHE A HE1  3  
ATOM 3209  H HE2  . PHE A 1 55 ? 3.986   -4.480  -2.079  1.00 0.00 ? 55 PHE A HE2  3  
ATOM 3210  H HZ   . PHE A 1 55 ? 3.085   -2.188  -2.048  1.00 0.00 ? 55 PHE A HZ   3  
ATOM 3211  N N    . GLN A 1 56 ? 0.640   -7.462  4.106   1.00 0.00 ? 56 GLN A N    3  
ATOM 3212  C CA   . GLN A 1 56 ? 0.524   -8.802  4.670   1.00 0.00 ? 56 GLN A CA   3  
ATOM 3213  C C    . GLN A 1 56 ? -0.905  -9.321  4.553   1.00 0.00 ? 56 GLN A C    3  
ATOM 3214  O O    . GLN A 1 56 ? -1.141  -10.400 4.012   1.00 0.00 ? 56 GLN A O    3  
ATOM 3215  C CB   . GLN A 1 56 ? 0.961   -8.801  6.136   1.00 0.00 ? 56 GLN A CB   3  
ATOM 3216  C CG   . GLN A 1 56 ? 2.457   -8.611  6.325   1.00 0.00 ? 56 GLN A CG   3  
ATOM 3217  C CD   . GLN A 1 56 ? 2.804   -8.021  7.678   1.00 0.00 ? 56 GLN A CD   3  
ATOM 3218  O OE1  . GLN A 1 56 ? 2.956   -6.807  7.818   1.00 0.00 ? 56 GLN A OE1  3  
ATOM 3219  N NE2  . GLN A 1 56 ? 2.932   -8.879  8.683   1.00 0.00 ? 56 GLN A NE2  3  
ATOM 3220  H H    . GLN A 1 56 ? 0.705   -6.694  4.710   1.00 0.00 ? 56 GLN A H    3  
ATOM 3221  H HA   . GLN A 1 56 ? 1.178   -9.454  4.110   1.00 0.00 ? 56 GLN A HA   3  
ATOM 3222  H HB2  . GLN A 1 56 ? 0.450   -8.000  6.650   1.00 0.00 ? 56 GLN A HB2  3  
ATOM 3223  H HB3  . GLN A 1 56 ? 0.680   -9.743  6.584   1.00 0.00 ? 56 GLN A HB3  3  
ATOM 3224  H HG2  . GLN A 1 56 ? 2.943   -9.571  6.233   1.00 0.00 ? 56 GLN A HG2  3  
ATOM 3225  H HG3  . GLN A 1 56 ? 2.823   -7.949  5.555   1.00 0.00 ? 56 GLN A HG3  3  
ATOM 3226  H HE21 . GLN A 1 56 ? 2.797   -9.833  8.497   1.00 0.00 ? 56 GLN A HE21 3  
ATOM 3227  H HE22 . GLN A 1 56 ? 3.156   -8.525  9.568   1.00 0.00 ? 56 GLN A HE22 3  
ATOM 3228  N N    . ASN A 1 57 ? -1.855  -8.545  5.065   1.00 0.00 ? 57 ASN A N    3  
ATOM 3229  C CA   . ASN A 1 57 ? -3.261  -8.927  5.018   1.00 0.00 ? 57 ASN A CA   3  
ATOM 3230  C C    . ASN A 1 57 ? -3.708  -9.184  3.582   1.00 0.00 ? 57 ASN A C    3  
ATOM 3231  O O    . ASN A 1 57 ? -4.595  -10.001 3.335   1.00 0.00 ? 57 ASN A O    3  
ATOM 3232  C CB   . ASN A 1 57 ? -4.129  -7.834  5.646   1.00 0.00 ? 57 ASN A CB   3  
ATOM 3233  C CG   . ASN A 1 57 ? -4.329  -8.039  7.135   1.00 0.00 ? 57 ASN A CG   3  
ATOM 3234  O OD1  . ASN A 1 57 ? -4.570  -9.156  7.592   1.00 0.00 ? 57 ASN A OD1  3  
ATOM 3235  N ND2  . ASN A 1 57 ? -4.231  -6.957  7.900   1.00 0.00 ? 57 ASN A ND2  3  
ATOM 3236  H H    . ASN A 1 57 ? -1.604  -7.695  5.484   1.00 0.00 ? 57 ASN A H    3  
ATOM 3237  H HA   . ASN A 1 57 ? -3.377  -9.836  5.588   1.00 0.00 ? 57 ASN A HA   3  
ATOM 3238  H HB2  . ASN A 1 57 ? -3.655  -6.875  5.495   1.00 0.00 ? 57 ASN A HB2  3  
ATOM 3239  H HB3  . ASN A 1 57 ? -5.097  -7.831  5.168   1.00 0.00 ? 57 ASN A HB3  3  
ATOM 3240  H HD21 . ASN A 1 57 ? -4.038  -6.099  7.466   1.00 0.00 ? 57 ASN A HD21 3  
ATOM 3241  H HD22 . ASN A 1 57 ? -4.356  -7.061  8.866   1.00 0.00 ? 57 ASN A HD22 3  
ATOM 3242  N N    . ARG A 1 58 ? -3.087  -8.482  2.640   1.00 0.00 ? 58 ARG A N    3  
ATOM 3243  C CA   . ARG A 1 58 ? -3.421  -8.633  1.229   1.00 0.00 ? 58 ARG A CA   3  
ATOM 3244  C C    . ARG A 1 58 ? -3.155  -10.060 0.758   1.00 0.00 ? 58 ARG A C    3  
ATOM 3245  O O    . ARG A 1 58 ? -3.999  -10.678 0.110   1.00 0.00 ? 58 ARG A O    3  
ATOM 3246  C CB   . ARG A 1 58 ? -2.614  -7.647  0.383   1.00 0.00 ? 58 ARG A CB   3  
ATOM 3247  C CG   . ARG A 1 58 ? -3.333  -7.197  -0.878  1.00 0.00 ? 58 ARG A CG   3  
ATOM 3248  C CD   . ARG A 1 58 ? -4.562  -6.364  -0.553  1.00 0.00 ? 58 ARG A CD   3  
ATOM 3249  N NE   . ARG A 1 58 ? -5.117  -5.719  -1.740  1.00 0.00 ? 58 ARG A NE   3  
ATOM 3250  C CZ   . ARG A 1 58 ? -5.764  -6.374  -2.697  1.00 0.00 ? 58 ARG A CZ   3  
ATOM 3251  N NH1  . ARG A 1 58 ? -5.937  -7.685  -2.607  1.00 0.00 ? 58 ARG A NH1  3  
ATOM 3252  N NH2  . ARG A 1 58 ? -6.240  -5.717  -3.747  1.00 0.00 ? 58 ARG A NH2  3  
ATOM 3253  H H    . ARG A 1 58 ? -2.389  -7.845  2.900   1.00 0.00 ? 58 ARG A H    3  
ATOM 3254  H HA   . ARG A 1 58 ? -4.473  -8.419  1.112   1.00 0.00 ? 58 ARG A HA   3  
ATOM 3255  H HB2  . ARG A 1 58 ? -2.398  -6.772  0.979   1.00 0.00 ? 58 ARG A HB2  3  
ATOM 3256  H HB3  . ARG A 1 58 ? -1.685  -8.114  0.095   1.00 0.00 ? 58 ARG A HB3  3  
ATOM 3257  H HG2  . ARG A 1 58 ? -2.656  -6.602  -1.474  1.00 0.00 ? 58 ARG A HG2  3  
ATOM 3258  H HG3  . ARG A 1 58 ? -3.637  -8.069  -1.438  1.00 0.00 ? 58 ARG A HG3  3  
ATOM 3259  H HD2  . ARG A 1 58 ? -5.313  -7.008  -0.121  1.00 0.00 ? 58 ARG A HD2  3  
ATOM 3260  H HD3  . ARG A 1 58 ? -4.286  -5.604  0.163   1.00 0.00 ? 58 ARG A HD3  3  
ATOM 3261  H HE   . ARG A 1 58 ? -5.000  -4.750  -1.826  1.00 0.00 ? 58 ARG A HE   3  
ATOM 3262  H HH11 . ARG A 1 58 ? -5.581  -8.183  -1.817  1.00 0.00 ? 58 ARG A HH11 3  
ATOM 3263  H HH12 . ARG A 1 58 ? -6.426  -8.176  -3.329  1.00 0.00 ? 58 ARG A HH12 3  
ATOM 3264  H HH21 . ARG A 1 58 ? -6.111  -4.728  -3.818  1.00 0.00 ? 58 ARG A HH21 3  
ATOM 3265  H HH22 . ARG A 1 58 ? -6.727  -6.210  -4.467  1.00 0.00 ? 58 ARG A HH22 3  
ATOM 3266  N N    . ARG A 1 59 ? -1.976  -10.577 1.088   1.00 0.00 ? 59 ARG A N    3  
ATOM 3267  C CA   . ARG A 1 59 ? -1.598  -11.929 0.698   1.00 0.00 ? 59 ARG A CA   3  
ATOM 3268  C C    . ARG A 1 59 ? -2.251  -12.962 1.612   1.00 0.00 ? 59 ARG A C    3  
ATOM 3269  O O    . ARG A 1 59 ? -2.806  -13.956 1.145   1.00 0.00 ? 59 ARG A O    3  
ATOM 3270  C CB   . ARG A 1 59 ? -0.076  -12.088 0.737   1.00 0.00 ? 59 ARG A CB   3  
ATOM 3271  C CG   . ARG A 1 59 ? 0.602   -11.776 -0.587  1.00 0.00 ? 59 ARG A CG   3  
ATOM 3272  C CD   . ARG A 1 59 ? 1.860   -12.609 -0.778  1.00 0.00 ? 59 ARG A CD   3  
ATOM 3273  N NE   . ARG A 1 59 ? 1.576   -14.042 -0.761  1.00 0.00 ? 59 ARG A NE   3  
ATOM 3274  C CZ   . ARG A 1 59 ? 1.009   -14.690 -1.771  1.00 0.00 ? 59 ARG A CZ   3  
ATOM 3275  N NH1  . ARG A 1 59 ? 0.668   -14.038 -2.874  1.00 0.00 ? 59 ARG A NH1  3  
ATOM 3276  N NH2  . ARG A 1 59 ? 0.783   -15.995 -1.681  1.00 0.00 ? 59 ARG A NH2  3  
ATOM 3277  H H    . ARG A 1 59 ? -1.344  -10.035 1.607   1.00 0.00 ? 59 ARG A H    3  
ATOM 3278  H HA   . ARG A 1 59 ? -1.942  -12.091 -0.313  1.00 0.00 ? 59 ARG A HA   3  
ATOM 3279  H HB2  . ARG A 1 59 ? 0.324   -11.422 1.487   1.00 0.00 ? 59 ARG A HB2  3  
ATOM 3280  H HB3  . ARG A 1 59 ? 0.160   -13.106 1.007   1.00 0.00 ? 59 ARG A HB3  3  
ATOM 3281  H HG2  . ARG A 1 59 ? -0.084  -11.992 -1.393  1.00 0.00 ? 59 ARG A HG2  3  
ATOM 3282  H HG3  . ARG A 1 59 ? 0.867   -10.730 -0.607  1.00 0.00 ? 59 ARG A HG3  3  
ATOM 3283  H HD2  . ARG A 1 59 ? 2.306   -12.352 -1.727  1.00 0.00 ? 59 ARG A HD2  3  
ATOM 3284  H HD3  . ARG A 1 59 ? 2.552   -12.379 0.019   1.00 0.00 ? 59 ARG A HD3  3  
ATOM 3285  H HE   . ARG A 1 59 ? 1.820   -14.543 0.045   1.00 0.00 ? 59 ARG A HE   3  
ATOM 3286  H HH11 . ARG A 1 59 ? 0.838   -13.055 -2.946  1.00 0.00 ? 59 ARG A HH11 3  
ATOM 3287  H HH12 . ARG A 1 59 ? 0.242   -14.529 -3.634  1.00 0.00 ? 59 ARG A HH12 3  
ATOM 3288  H HH21 . ARG A 1 59 ? 1.039   -16.490 -0.851  1.00 0.00 ? 59 ARG A HH21 3  
ATOM 3289  H HH22 . ARG A 1 59 ? 0.356   -16.482 -2.442  1.00 0.00 ? 59 ARG A HH22 3  
ATOM 3290  N N    . VAL A 1 60 ? -2.180  -12.719 2.917   1.00 0.00 ? 60 VAL A N    3  
ATOM 3291  C CA   . VAL A 1 60 ? -2.764  -13.627 3.896   1.00 0.00 ? 60 VAL A CA   3  
ATOM 3292  C C    . VAL A 1 60 ? -4.260  -13.803 3.659   1.00 0.00 ? 60 VAL A C    3  
ATOM 3293  O O    . VAL A 1 60 ? -4.846  -14.815 4.043   1.00 0.00 ? 60 VAL A O    3  
ATOM 3294  C CB   . VAL A 1 60 ? -2.540  -13.121 5.334   1.00 0.00 ? 60 VAL A CB   3  
ATOM 3295  C CG1  . VAL A 1 60 ? -3.074  -14.126 6.343   1.00 0.00 ? 60 VAL A CG1  3  
ATOM 3296  C CG2  . VAL A 1 60 ? -1.065  -12.842 5.576   1.00 0.00 ? 60 VAL A CG2  3  
ATOM 3297  H H    . VAL A 1 60 ? -1.724  -11.909 3.228   1.00 0.00 ? 60 VAL A H    3  
ATOM 3298  H HA   . VAL A 1 60 ? -2.278  -14.586 3.795   1.00 0.00 ? 60 VAL A HA   3  
ATOM 3299  H HB   . VAL A 1 60 ? -3.085  -12.196 5.458   1.00 0.00 ? 60 VAL A HB   3  
ATOM 3300  H HG11 . VAL A 1 60 ? -2.946  -15.126 5.956   1.00 0.00 ? 60 VAL A HG11 3  
ATOM 3301  H HG12 . VAL A 1 60 ? -2.533  -14.026 7.272   1.00 0.00 ? 60 VAL A HG12 3  
ATOM 3302  H HG13 . VAL A 1 60 ? -4.124  -13.940 6.515   1.00 0.00 ? 60 VAL A HG13 3  
ATOM 3303  H HG21 . VAL A 1 60 ? -0.932  -11.799 5.821   1.00 0.00 ? 60 VAL A HG21 3  
ATOM 3304  H HG22 . VAL A 1 60 ? -0.713  -13.451 6.396   1.00 0.00 ? 60 VAL A HG22 3  
ATOM 3305  H HG23 . VAL A 1 60 ? -0.502  -13.078 4.686   1.00 0.00 ? 60 VAL A HG23 3  
ATOM 3306  N N    . LYS A 1 61 ? -4.873  -12.811 3.021   1.00 0.00 ? 61 LYS A N    3  
ATOM 3307  C CA   . LYS A 1 61 ? -6.301  -12.855 2.729   1.00 0.00 ? 61 LYS A CA   3  
ATOM 3308  C C    . LYS A 1 61 ? -6.664  -14.136 1.984   1.00 0.00 ? 61 LYS A C    3  
ATOM 3309  O O    . LYS A 1 61 ? -7.784  -14.633 2.097   1.00 0.00 ? 61 LYS A O    3  
ATOM 3310  C CB   . LYS A 1 61 ? -6.711  -11.636 1.900   1.00 0.00 ? 61 LYS A CB   3  
ATOM 3311  C CG   . LYS A 1 61 ? -8.132  -11.712 1.369   1.00 0.00 ? 61 LYS A CG   3  
ATOM 3312  C CD   . LYS A 1 61 ? -8.481  -10.491 0.534   1.00 0.00 ? 61 LYS A CD   3  
ATOM 3313  C CE   . LYS A 1 61 ? -8.111  -10.692 -0.928  1.00 0.00 ? 61 LYS A CE   3  
ATOM 3314  N NZ   . LYS A 1 61 ? -6.668  -10.420 -1.177  1.00 0.00 ? 61 LYS A NZ   3  
ATOM 3315  H H    . LYS A 1 61 ? -4.351  -12.030 2.740   1.00 0.00 ? 61 LYS A H    3  
ATOM 3316  H HA   . LYS A 1 61 ? -6.832  -12.837 3.669   1.00 0.00 ? 61 LYS A HA   3  
ATOM 3317  H HB2  . LYS A 1 61 ? -6.625  -10.752 2.515   1.00 0.00 ? 61 LYS A HB2  3  
ATOM 3318  H HB3  . LYS A 1 61 ? -6.039  -11.546 1.059   1.00 0.00 ? 61 LYS A HB3  3  
ATOM 3319  H HG2  . LYS A 1 61 ? -8.231  -12.595 0.755   1.00 0.00 ? 61 LYS A HG2  3  
ATOM 3320  H HG3  . LYS A 1 61 ? -8.816  -11.773 2.204   1.00 0.00 ? 61 LYS A HG3  3  
ATOM 3321  H HD2  . LYS A 1 61 ? -9.543  -10.310 0.603   1.00 0.00 ? 61 LYS A HD2  3  
ATOM 3322  H HD3  . LYS A 1 61 ? -7.942  -9.637  0.919   1.00 0.00 ? 61 LYS A HD3  3  
ATOM 3323  H HE2  . LYS A 1 61 ? -8.329  -11.711 -1.204  1.00 0.00 ? 61 LYS A HE2  3  
ATOM 3324  H HE3  . LYS A 1 61 ? -8.704  -10.020 -1.531  1.00 0.00 ? 61 LYS A HE3  3  
ATOM 3325  H HZ1  . LYS A 1 61 ? -6.518  -10.176 -2.177  1.00 0.00 ? 61 LYS A HZ1  3  
ATOM 3326  H HZ2  . LYS A 1 61 ? -6.101  -11.262 -0.948  1.00 0.00 ? 61 LYS A HZ2  3  
ATOM 3327  H HZ3  . LYS A 1 61 ? -6.345  -9.628  -0.585  1.00 0.00 ? 61 LYS A HZ3  3  
ATOM 3328  N N    . GLU A 1 62 ? -5.710  -14.664 1.224   1.00 0.00 ? 62 GLU A N    3  
ATOM 3329  C CA   . GLU A 1 62 ? -5.931  -15.887 0.461   1.00 0.00 ? 62 GLU A CA   3  
ATOM 3330  C C    . GLU A 1 62 ? -5.133  -17.047 1.049   1.00 0.00 ? 62 GLU A C    3  
ATOM 3331  O O    . GLU A 1 62 ? -4.753  -17.978 0.339   1.00 0.00 ? 62 GLU A O    3  
ATOM 3332  C CB   . GLU A 1 62 ? -5.543  -15.678 -1.004  1.00 0.00 ? 62 GLU A CB   3  
ATOM 3333  C CG   . GLU A 1 62 ? -4.217  -14.958 -1.186  1.00 0.00 ? 62 GLU A CG   3  
ATOM 3334  C CD   . GLU A 1 62 ? -3.714  -15.014 -2.616  1.00 0.00 ? 62 GLU A CD   3  
ATOM 3335  O OE1  . GLU A 1 62 ? -4.547  -15.172 -3.532  1.00 0.00 ? 62 GLU A OE1  3  
ATOM 3336  O OE2  . GLU A 1 62 ? -2.487  -14.898 -2.817  1.00 0.00 ? 62 GLU A OE2  3  
ATOM 3337  H H    . GLU A 1 62 ? -4.837  -14.221 1.174   1.00 0.00 ? 62 GLU A H    3  
ATOM 3338  H HA   . GLU A 1 62 ? -6.982  -16.125 0.515   1.00 0.00 ? 62 GLU A HA   3  
ATOM 3339  H HB2  . GLU A 1 62 ? -5.476  -16.641 -1.488  1.00 0.00 ? 62 GLU A HB2  3  
ATOM 3340  H HB3  . GLU A 1 62 ? -6.313  -15.095 -1.488  1.00 0.00 ? 62 GLU A HB3  3  
ATOM 3341  H HG2  . GLU A 1 62 ? -4.342  -13.923 -0.905  1.00 0.00 ? 62 GLU A HG2  3  
ATOM 3342  H HG3  . GLU A 1 62 ? -3.481  -15.418 -0.543  1.00 0.00 ? 62 GLU A HG3  3  
ATOM 3343  N N    . LYS A 1 63 ? -4.881  -16.983 2.352   1.00 0.00 ? 63 LYS A N    3  
ATOM 3344  C CA   . LYS A 1 63 ? -4.129  -18.027 3.039   1.00 0.00 ? 63 LYS A CA   3  
ATOM 3345  C C    . LYS A 1 63 ? -5.019  -18.784 4.019   1.00 0.00 ? 63 LYS A C    3  
ATOM 3346  O O    . LYS A 1 63 ? -4.952  -20.010 4.115   1.00 0.00 ? 63 LYS A O    3  
ATOM 3347  C CB   . LYS A 1 63 ? -2.936  -17.420 3.781   1.00 0.00 ? 63 LYS A CB   3  
ATOM 3348  C CG   . LYS A 1 63 ? -1.668  -17.360 2.948   1.00 0.00 ? 63 LYS A CG   3  
ATOM 3349  C CD   . LYS A 1 63 ? -0.819  -18.607 3.133   1.00 0.00 ? 63 LYS A CD   3  
ATOM 3350  C CE   . LYS A 1 63 ? -1.398  -19.792 2.376   1.00 0.00 ? 63 LYS A CE   3  
ATOM 3351  N NZ   . LYS A 1 63 ? -2.347  -20.576 3.215   1.00 0.00 ? 63 LYS A NZ   3  
ATOM 3352  H H    . LYS A 1 63 ? -5.210  -16.215 2.866   1.00 0.00 ? 63 LYS A H    3  
ATOM 3353  H HA   . LYS A 1 63 ? -3.765  -18.718 2.294   1.00 0.00 ? 63 LYS A HA   3  
ATOM 3354  H HB2  . LYS A 1 63 ? -3.190  -16.416 4.086   1.00 0.00 ? 63 LYS A HB2  3  
ATOM 3355  H HB3  . LYS A 1 63 ? -2.735  -18.014 4.661   1.00 0.00 ? 63 LYS A HB3  3  
ATOM 3356  H HG2  . LYS A 1 63 ? -1.936  -17.272 1.906   1.00 0.00 ? 63 LYS A HG2  3  
ATOM 3357  H HG3  . LYS A 1 63 ? -1.092  -16.496 3.248   1.00 0.00 ? 63 LYS A HG3  3  
ATOM 3358  H HD2  . LYS A 1 63 ? 0.177   -18.412 2.765   1.00 0.00 ? 63 LYS A HD2  3  
ATOM 3359  H HD3  . LYS A 1 63 ? -0.776  -18.849 4.185   1.00 0.00 ? 63 LYS A HD3  3  
ATOM 3360  H HE2  . LYS A 1 63 ? -1.919  -19.427 1.504   1.00 0.00 ? 63 LYS A HE2  3  
ATOM 3361  H HE3  . LYS A 1 63 ? -0.588  -20.436 2.067   1.00 0.00 ? 63 LYS A HE3  3  
ATOM 3362  H HZ1  . LYS A 1 63 ? -1.876  -21.423 3.590   1.00 0.00 ? 63 LYS A HZ1  3  
ATOM 3363  H HZ2  . LYS A 1 63 ? -3.166  -20.872 2.646   1.00 0.00 ? 63 LYS A HZ2  3  
ATOM 3364  H HZ3  . LYS A 1 63 ? -2.683  -19.997 4.011   1.00 0.00 ? 63 LYS A HZ3  3  
ATOM 3365  N N    . LYS A 1 64 ? -5.854  -18.048 4.743   1.00 0.00 ? 64 LYS A N    3  
ATOM 3366  C CA   . LYS A 1 64 ? -6.761  -18.649 5.714   1.00 0.00 ? 64 LYS A CA   3  
ATOM 3367  C C    . LYS A 1 64 ? -7.932  -19.332 5.014   1.00 0.00 ? 64 LYS A C    3  
ATOM 3368  O O    . LYS A 1 64 ? -8.423  -18.851 3.993   1.00 0.00 ? 64 LYS A O    3  
ATOM 3369  C CB   . LYS A 1 64 ? -7.282  -17.586 6.683   1.00 0.00 ? 64 LYS A CB   3  
ATOM 3370  C CG   . LYS A 1 64 ? -7.510  -18.106 8.092   1.00 0.00 ? 64 LYS A CG   3  
ATOM 3371  C CD   . LYS A 1 64 ? -7.095  -17.085 9.137   1.00 0.00 ? 64 LYS A CD   3  
ATOM 3372  C CE   . LYS A 1 64 ? -5.675  -17.330 9.623   1.00 0.00 ? 64 LYS A CE   3  
ATOM 3373  N NZ   . LYS A 1 64 ? -4.665  -16.726 8.710   1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3374  H H    . LYS A 1 64 ? -5.862  -17.074 4.621   1.00 0.00 ? 64 LYS A H    3  
ATOM 3375  H HA   . LYS A 1 64 ? -6.207  -19.390 6.270   1.00 0.00 ? 64 LYS A HA   3  
ATOM 3376  H HB2  . LYS A 1 64 ? -6.566  -16.778 6.731   1.00 0.00 ? 64 LYS A HB2  3  
ATOM 3377  H HB3  . LYS A 1 64 ? -8.220  -17.202 6.307   1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3378  H HG2  . LYS A 1 64 ? -8.560  -18.328 8.218   1.00 0.00 ? 64 LYS A HG2  3  
ATOM 3379  H HG3  . LYS A 1 64 ? -6.930  -19.007 8.231   1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3380  H HD2  . LYS A 1 64 ? -7.150  -16.097 8.705   1.00 0.00 ? 64 LYS A HD2  3  
ATOM 3381  H HD3  . LYS A 1 64 ? -7.770  -17.149 9.979   1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3382  H HE2  . LYS A 1 64 ? -5.564  -16.897 10.605  1.00 0.00 ? 64 LYS A HE2  3  
ATOM 3383  H HE3  . LYS A 1 64 ? -5.506  -18.395 9.678   1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3384  H HZ1  . LYS A 1 64 ? -4.402  -17.406 7.969   1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3385  H HZ2  . LYS A 1 64 ? -3.811  -16.466 9.244   1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3386  H HZ3  . LYS A 1 64 ? -5.053  -15.872 8.262   1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3387  N N    . SER A 1 65 ? -8.375  -20.455 5.571   1.00 0.00 ? 65 SER A N    3  
ATOM 3388  C CA   . SER A 1 65 ? -9.486  -21.205 5.000   1.00 0.00 ? 65 SER A CA   3  
ATOM 3389  C C    . SER A 1 65 ? -10.819 -20.700 5.544   1.00 0.00 ? 65 SER A C    3  
ATOM 3390  O O    . SER A 1 65 ? -10.878 -20.103 6.618   1.00 0.00 ? 65 SER A O    3  
ATOM 3391  C CB   . SER A 1 65 ? -9.332  -22.697 5.301   1.00 0.00 ? 65 SER A CB   3  
ATOM 3392  O OG   . SER A 1 65 ? -9.978  -23.486 4.317   1.00 0.00 ? 65 SER A OG   3  
ATOM 3393  H H    . SER A 1 65 ? -7.941  -20.788 6.385   1.00 0.00 ? 65 SER A H    3  
ATOM 3394  H HA   . SER A 1 65 ? -9.469  -21.059 3.930   1.00 0.00 ? 65 SER A HA   3  
ATOM 3395  H HB2  . SER A 1 65 ? -8.283  -22.951 5.318   1.00 0.00 ? 65 SER A HB2  3  
ATOM 3396  H HB3  . SER A 1 65 ? -9.770  -22.914 6.265   1.00 0.00 ? 65 SER A HB3  3  
ATOM 3397  H HG   . SER A 1 65 ? -9.349  -24.107 3.942   1.00 0.00 ? 65 SER A HG   3  
ATOM 3398  N N    . GLY A 1 66 ? -11.889 -20.945 4.792   1.00 0.00 ? 66 GLY A N    3  
ATOM 3399  C CA   . GLY A 1 66 ? -13.207 -20.508 5.214   1.00 0.00 ? 66 GLY A CA   3  
ATOM 3400  C C    . GLY A 1 66 ? -13.602 -19.179 4.602   1.00 0.00 ? 66 GLY A C    3  
ATOM 3401  O O    . GLY A 1 66 ? -12.830 -18.553 3.875   1.00 0.00 ? 66 GLY A O    3  
ATOM 3402  H H    . GLY A 1 66 ? -11.782 -21.425 3.945   1.00 0.00 ? 66 GLY A H    3  
ATOM 3403  H HA2  . GLY A 1 66 ? -13.931 -21.255 4.925   1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3404  H HA3  . GLY A 1 66 ? -13.215 -20.412 6.290   1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3405  N N    . PRO A 1 67 ? -14.831 -18.729 4.896   1.00 0.00 ? 67 PRO A N    3  
ATOM 3406  C CA   . PRO A 1 67 ? -15.354 -17.462 4.379   1.00 0.00 ? 67 PRO A CA   3  
ATOM 3407  C C    . PRO A 1 67 ? -14.658 -16.252 4.994   1.00 0.00 ? 67 PRO A C    3  
ATOM 3408  O O    . PRO A 1 67 ? -14.671 -16.070 6.211   1.00 0.00 ? 67 PRO A O    3  
ATOM 3409  C CB   . PRO A 1 67 ? -16.829 -17.494 4.787   1.00 0.00 ? 67 PRO A CB   3  
ATOM 3410  C CG   . PRO A 1 67 ? -16.873 -18.390 5.976   1.00 0.00 ? 67 PRO A CG   3  
ATOM 3411  C CD   . PRO A 1 67 ? -15.803 -19.423 5.757   1.00 0.00 ? 67 PRO A CD   3  
ATOM 3412  H HA   . PRO A 1 67 ? -15.278 -17.411 3.302   1.00 0.00 ? 67 PRO A HA   3  
ATOM 3413  H HB2  . PRO A 1 67 ? -17.160 -16.494 5.031   1.00 0.00 ? 67 PRO A HB2  3  
ATOM 3414  H HB3  . PRO A 1 67 ? -17.422 -17.887 3.975   1.00 0.00 ? 67 PRO A HB3  3  
ATOM 3415  H HG2  . PRO A 1 67 ? -16.669 -17.822 6.871   1.00 0.00 ? 67 PRO A HG2  3  
ATOM 3416  H HG3  . PRO A 1 67 ? -17.842 -18.863 6.043   1.00 0.00 ? 67 PRO A HG3  3  
ATOM 3417  H HD2  . PRO A 1 67 ? -15.354 -19.706 6.697   1.00 0.00 ? 67 PRO A HD2  3  
ATOM 3418  H HD3  . PRO A 1 67 ? -16.211 -20.289 5.256   1.00 0.00 ? 67 PRO A HD3  3  
ATOM 3419  N N    . SER A 1 68 ? -14.051 -15.429 4.145   1.00 0.00 ? 68 SER A N    3  
ATOM 3420  C CA   . SER A 1 68 ? -13.347 -14.239 4.606   1.00 0.00 ? 68 SER A CA   3  
ATOM 3421  C C    . SER A 1 68 ? -14.319 -13.085 4.830   1.00 0.00 ? 68 SER A C    3  
ATOM 3422  O O    . SER A 1 68 ? -14.397 -12.528 5.925   1.00 0.00 ? 68 SER A O    3  
ATOM 3423  C CB   . SER A 1 68 ? -12.276 -13.829 3.592   1.00 0.00 ? 68 SER A CB   3  
ATOM 3424  O OG   . SER A 1 68 ? -11.814 -12.513 3.842   1.00 0.00 ? 68 SER A OG   3  
ATOM 3425  H H    . SER A 1 68 ? -14.076 -15.629 3.185   1.00 0.00 ? 68 SER A H    3  
ATOM 3426  H HA   . SER A 1 68 ? -12.869 -14.479 5.544   1.00 0.00 ? 68 SER A HA   3  
ATOM 3427  H HB2  . SER A 1 68 ? -11.441 -14.510 3.660   1.00 0.00 ? 68 SER A HB2  3  
ATOM 3428  H HB3  . SER A 1 68 ? -12.693 -13.869 2.597   1.00 0.00 ? 68 SER A HB3  3  
ATOM 3429  H HG   . SER A 1 68 ? -11.127 -12.289 3.210   1.00 0.00 ? 68 SER A HG   3  
ATOM 3430  N N    . SER A 1 69 ? -15.059 -12.731 3.784   1.00 0.00 ? 69 SER A N    3  
ATOM 3431  C CA   . SER A 1 69 ? -16.024 -11.641 3.864   1.00 0.00 ? 69 SER A CA   3  
ATOM 3432  C C    . SER A 1 69 ? -17.421 -12.173 4.169   1.00 0.00 ? 69 SER A C    3  
ATOM 3433  O O    . SER A 1 69 ? -18.181 -12.509 3.263   1.00 0.00 ? 69 SER A O    3  
ATOM 3434  C CB   . SER A 1 69 ? -16.042 -10.851 2.554   1.00 0.00 ? 69 SER A CB   3  
ATOM 3435  O OG   . SER A 1 69 ? -14.736 -10.717 2.020   1.00 0.00 ? 69 SER A OG   3  
ATOM 3436  H H    . SER A 1 69 ? -14.951 -13.213 2.937   1.00 0.00 ? 69 SER A H    3  
ATOM 3437  H HA   . SER A 1 69 ? -15.718 -10.985 4.665   1.00 0.00 ? 69 SER A HA   3  
ATOM 3438  H HB2  . SER A 1 69 ? -16.661 -11.365 1.834   1.00 0.00 ? 69 SER A HB2  3  
ATOM 3439  H HB3  . SER A 1 69 ? -16.446 -9.865  2.736   1.00 0.00 ? 69 SER A HB3  3  
ATOM 3440  H HG   . SER A 1 69 ? -14.384 -9.854  2.247   1.00 0.00 ? 69 SER A HG   3  
ATOM 3441  N N    . GLY A 1 70 ? -17.751 -12.246 5.455   1.00 0.00 ? 70 GLY A N    3  
ATOM 3442  C CA   . GLY A 1 70 ? -19.055 -12.738 5.860   1.00 0.00 ? 70 GLY A CA   3  
ATOM 3443  C C    . GLY A 1 70 ? -20.190 -11.958 5.227   1.00 0.00 ? 70 GLY A C    3  
ATOM 3444  O O    . GLY A 1 70 ? -20.691 -10.996 5.810   1.00 0.00 ? 70 GLY A O    3  
ATOM 3445  H H    . GLY A 1 70 ? -17.103 -11.964 6.135   1.00 0.00 ? 70 GLY A H    3  
ATOM 3446  H HA2  . GLY A 1 70 ? -19.141 -13.776 5.573   1.00 0.00 ? 70 GLY A HA2  3  
ATOM 3447  H HA3  . GLY A 1 70 ? -19.138 -12.664 6.934   1.00 0.00 ? 70 GLY A HA3  3  
ATOM 3448  N N    . GLY A 1 1  ? -22.679 16.431  15.661  1.00 0.00 ? 1  GLY A N    4  
ATOM 3449  C CA   . GLY A 1 1  ? -23.739 16.475  14.670  1.00 0.00 ? 1  GLY A CA   4  
ATOM 3450  C C    . GLY A 1 1  ? -23.399 17.374  13.497  1.00 0.00 ? 1  GLY A C    4  
ATOM 3451  O O    . GLY A 1 1  ? -24.087 18.364  13.246  1.00 0.00 ? 1  GLY A O    4  
ATOM 3452  H H1   . GLY A 1 1  ? -22.888 16.589  16.605  1.00 0.00 ? 1  GLY A H1   4  
ATOM 3453  H HA2  . GLY A 1 1  ? -23.916 15.475  14.303  1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3454  H HA3  . GLY A 1 1  ? -24.640 16.840  15.139  1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3455  N N    . SER A 1 2  ? -22.335 17.031  12.779  1.00 0.00 ? 2  SER A N    4  
ATOM 3456  C CA   . SER A 1 2  ? -21.902 17.818  11.630  1.00 0.00 ? 2  SER A CA   4  
ATOM 3457  C C    . SER A 1 2  ? -21.771 16.940  10.389  1.00 0.00 ? 2  SER A C    4  
ATOM 3458  O O    . SER A 1 2  ? -22.333 17.246  9.337   1.00 0.00 ? 2  SER A O    4  
ATOM 3459  C CB   . SER A 1 2  ? -20.566 18.502  11.928  1.00 0.00 ? 2  SER A CB   4  
ATOM 3460  O OG   . SER A 1 2  ? -19.546 17.548  12.165  1.00 0.00 ? 2  SER A OG   4  
ATOM 3461  H H    . SER A 1 2  ? -21.827 16.231  13.030  1.00 0.00 ? 2  SER A H    4  
ATOM 3462  H HA   . SER A 1 2  ? -22.650 18.574  11.445  1.00 0.00 ? 2  SER A HA   4  
ATOM 3463  H HB2  . SER A 1 2  ? -20.282 19.114  11.085  1.00 0.00 ? 2  SER A HB2  4  
ATOM 3464  H HB3  . SER A 1 2  ? -20.672 19.125  12.805  1.00 0.00 ? 2  SER A HB3  4  
ATOM 3465  H HG   . SER A 1 2  ? -18.969 17.863  12.864  1.00 0.00 ? 2  SER A HG   4  
ATOM 3466  N N    . SER A 1 3  ? -21.024 15.849  10.520  1.00 0.00 ? 3  SER A N    4  
ATOM 3467  C CA   . SER A 1 3  ? -20.815 14.928  9.409   1.00 0.00 ? 3  SER A CA   4  
ATOM 3468  C C    . SER A 1 3  ? -21.928 13.885  9.351   1.00 0.00 ? 3  SER A C    4  
ATOM 3469  O O    . SER A 1 3  ? -22.417 13.543  8.275   1.00 0.00 ? 3  SER A O    4  
ATOM 3470  C CB   . SER A 1 3  ? -19.458 14.234  9.542   1.00 0.00 ? 3  SER A CB   4  
ATOM 3471  O OG   . SER A 1 3  ? -18.400 15.117  9.211   1.00 0.00 ? 3  SER A OG   4  
ATOM 3472  H H    . SER A 1 3  ? -20.602 15.660  11.384  1.00 0.00 ? 3  SER A H    4  
ATOM 3473  H HA   . SER A 1 3  ? -20.828 15.503  8.495   1.00 0.00 ? 3  SER A HA   4  
ATOM 3474  H HB2  . SER A 1 3  ? -19.326 13.899  10.559  1.00 0.00 ? 3  SER A HB2  4  
ATOM 3475  H HB3  . SER A 1 3  ? -19.424 13.385  8.876   1.00 0.00 ? 3  SER A HB3  4  
ATOM 3476  H HG   . SER A 1 3  ? -17.617 14.609  8.985   1.00 0.00 ? 3  SER A HG   4  
ATOM 3477  N N    . GLY A 1 4  ? -22.322 13.384  10.517  1.00 0.00 ? 4  GLY A N    4  
ATOM 3478  C CA   . GLY A 1 4  ? -23.374 12.386  10.578  1.00 0.00 ? 4  GLY A CA   4  
ATOM 3479  C C    . GLY A 1 4  ? -23.348 11.594  11.870  1.00 0.00 ? 4  GLY A C    4  
ATOM 3480  O O    . GLY A 1 4  ? -22.357 11.617  12.600  1.00 0.00 ? 4  GLY A O    4  
ATOM 3481  H H    . GLY A 1 4  ? -21.895 13.694  11.343  1.00 0.00 ? 4  GLY A H    4  
ATOM 3482  H HA2  . GLY A 1 4  ? -24.330 12.880  10.489  1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3483  H HA3  . GLY A 1 4  ? -23.254 11.703  9.749   1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3484  N N    . SER A 1 5  ? -24.441 10.893  12.155  1.00 0.00 ? 5  SER A N    4  
ATOM 3485  C CA   . SER A 1 5  ? -24.542 10.096  13.372  1.00 0.00 ? 5  SER A CA   4  
ATOM 3486  C C    . SER A 1 5  ? -24.452 8.606   13.054  1.00 0.00 ? 5  SER A C    4  
ATOM 3487  O O    . SER A 1 5  ? -25.452 7.970   12.720  1.00 0.00 ? 5  SER A O    4  
ATOM 3488  C CB   . SER A 1 5  ? -25.855 10.396  14.096  1.00 0.00 ? 5  SER A CB   4  
ATOM 3489  O OG   . SER A 1 5  ? -25.778 11.620  14.806  1.00 0.00 ? 5  SER A OG   4  
ATOM 3490  H H    . SER A 1 5  ? -25.198 10.916  11.534  1.00 0.00 ? 5  SER A H    4  
ATOM 3491  H HA   . SER A 1 5  ? -23.717 10.365  14.014  1.00 0.00 ? 5  SER A HA   4  
ATOM 3492  H HB2  . SER A 1 5  ? -26.655 10.462  13.374  1.00 0.00 ? 5  SER A HB2  4  
ATOM 3493  H HB3  . SER A 1 5  ? -26.067 9.601   14.796  1.00 0.00 ? 5  SER A HB3  4  
ATOM 3494  H HG   . SER A 1 5  ? -25.048 11.585  15.427  1.00 0.00 ? 5  SER A HG   4  
ATOM 3495  N N    . SER A 1 6  ? -23.247 8.056   13.160  1.00 0.00 ? 6  SER A N    4  
ATOM 3496  C CA   . SER A 1 6  ? -23.024 6.643   12.880  1.00 0.00 ? 6  SER A CA   4  
ATOM 3497  C C    . SER A 1 6  ? -22.788 5.864   14.171  1.00 0.00 ? 6  SER A C    4  
ATOM 3498  O O    . SER A 1 6  ? -22.442 6.439   15.202  1.00 0.00 ? 6  SER A O    4  
ATOM 3499  C CB   . SER A 1 6  ? -21.829 6.469   11.941  1.00 0.00 ? 6  SER A CB   4  
ATOM 3500  O OG   . SER A 1 6  ? -21.571 5.098   11.693  1.00 0.00 ? 6  SER A OG   4  
ATOM 3501  H H    . SER A 1 6  ? -22.489 8.616   13.431  1.00 0.00 ? 6  SER A H    4  
ATOM 3502  H HA   . SER A 1 6  ? -23.910 6.257   12.398  1.00 0.00 ? 6  SER A HA   4  
ATOM 3503  H HB2  . SER A 1 6  ? -22.038 6.959   11.002  1.00 0.00 ? 6  SER A HB2  4  
ATOM 3504  H HB3  . SER A 1 6  ? -20.953 6.912   12.392  1.00 0.00 ? 6  SER A HB3  4  
ATOM 3505  H HG   . SER A 1 6  ? -21.235 4.685   12.492  1.00 0.00 ? 6  SER A HG   4  
ATOM 3506  N N    . GLY A 1 7  ? -22.979 4.550   14.105  1.00 0.00 ? 7  GLY A N    4  
ATOM 3507  C CA   . GLY A 1 7  ? -22.784 3.712   15.274  1.00 0.00 ? 7  GLY A CA   4  
ATOM 3508  C C    . GLY A 1 7  ? -21.896 2.517   14.989  1.00 0.00 ? 7  GLY A C    4  
ATOM 3509  O O    . GLY A 1 7  ? -22.377 1.465   14.568  1.00 0.00 ? 7  GLY A O    4  
ATOM 3510  H H    . GLY A 1 7  ? -23.255 4.145   13.256  1.00 0.00 ? 7  GLY A H    4  
ATOM 3511  H HA2  . GLY A 1 7  ? -22.332 4.304   16.056  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3512  H HA3  . GLY A 1 7  ? -23.746 3.358   15.615  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3513  N N    . ARG A 1 8  ? -20.597 2.679   15.217  1.00 0.00 ? 8  ARG A N    4  
ATOM 3514  C CA   . ARG A 1 8  ? -19.640 1.605   14.979  1.00 0.00 ? 8  ARG A CA   4  
ATOM 3515  C C    . ARG A 1 8  ? -19.773 1.063   13.559  1.00 0.00 ? 8  ARG A C    4  
ATOM 3516  O O    . ARG A 1 8  ? -19.754 -0.148  13.340  1.00 0.00 ? 8  ARG A O    4  
ATOM 3517  C CB   . ARG A 1 8  ? -19.847 0.475   15.989  1.00 0.00 ? 8  ARG A CB   4  
ATOM 3518  C CG   . ARG A 1 8  ? -18.673 -0.485  16.079  1.00 0.00 ? 8  ARG A CG   4  
ATOM 3519  C CD   . ARG A 1 8  ? -19.051 -1.761  16.815  1.00 0.00 ? 8  ARG A CD   4  
ATOM 3520  N NE   . ARG A 1 8  ? -17.894 -2.622  17.047  1.00 0.00 ? 8  ARG A NE   4  
ATOM 3521  C CZ   . ARG A 1 8  ? -17.393 -3.442  16.129  1.00 0.00 ? 8  ARG A CZ   4  
ATOM 3522  N NH1  . ARG A 1 8  ? -17.943 -3.510  14.925  1.00 0.00 ? 8  ARG A NH1  4  
ATOM 3523  N NH2  . ARG A 1 8  ? -16.338 -4.194  16.415  1.00 0.00 ? 8  ARG A NH2  4  
ATOM 3524  H H    . ARG A 1 8  ? -20.274 3.541   15.552  1.00 0.00 ? 8  ARG A H    4  
ATOM 3525  H HA   . ARG A 1 8  ? -18.647 2.011   15.105  1.00 0.00 ? 8  ARG A HA   4  
ATOM 3526  H HB2  . ARG A 1 8  ? -20.007 0.906   16.967  1.00 0.00 ? 8  ARG A HB2  4  
ATOM 3527  H HB3  . ARG A 1 8  ? -20.724 -0.088  15.706  1.00 0.00 ? 8  ARG A HB3  4  
ATOM 3528  H HG2  . ARG A 1 8  ? -18.352 -0.741  15.080  1.00 0.00 ? 8  ARG A HG2  4  
ATOM 3529  H HG3  . ARG A 1 8  ? -17.864 -0.001  16.605  1.00 0.00 ? 8  ARG A HG3  4  
ATOM 3530  H HD2  . ARG A 1 8  ? -19.486 -1.495  17.767  1.00 0.00 ? 8  ARG A HD2  4  
ATOM 3531  H HD3  . ARG A 1 8  ? -19.777 -2.299  16.225  1.00 0.00 ? 8  ARG A HD3  4  
ATOM 3532  H HE   . ARG A 1 8  ? -17.472 -2.588  17.930  1.00 0.00 ? 8  ARG A HE   4  
ATOM 3533  H HH11 . ARG A 1 8  ? -18.737 -2.943  14.706  1.00 0.00 ? 8  ARG A HH11 4  
ATOM 3534  H HH12 . ARG A 1 8  ? -17.563 -4.127  14.235  1.00 0.00 ? 8  ARG A HH12 4  
ATOM 3535  H HH21 . ARG A 1 8  ? -15.920 -4.145  17.322  1.00 0.00 ? 8  ARG A HH21 4  
ATOM 3536  H HH22 . ARG A 1 8  ? -15.962 -4.811  15.724  1.00 0.00 ? 8  ARG A HH22 4  
ATOM 3537  N N    . LYS A 1 9  ? -19.909 1.969   12.596  1.00 0.00 ? 9  LYS A N    4  
ATOM 3538  C CA   . LYS A 1 9  ? -20.044 1.583   11.196  1.00 0.00 ? 9  LYS A CA   4  
ATOM 3539  C C    . LYS A 1 9  ? -18.799 1.967   10.403  1.00 0.00 ? 9  LYS A C    4  
ATOM 3540  O O    . LYS A 1 9  ? -18.889 2.368   9.242   1.00 0.00 ? 9  LYS A O    4  
ATOM 3541  C CB   . LYS A 1 9  ? -21.279 2.246   10.581  1.00 0.00 ? 9  LYS A CB   4  
ATOM 3542  C CG   . LYS A 1 9  ? -21.765 1.567   9.312   1.00 0.00 ? 9  LYS A CG   4  
ATOM 3543  C CD   . LYS A 1 9  ? -22.312 0.178   9.598   1.00 0.00 ? 9  LYS A CD   4  
ATOM 3544  C CE   . LYS A 1 9  ? -22.804 -0.499  8.328   1.00 0.00 ? 9  LYS A CE   4  
ATOM 3545  N NZ   . LYS A 1 9  ? -23.344 -1.860  8.598   1.00 0.00 ? 9  LYS A NZ   4  
ATOM 3546  H H    . LYS A 1 9  ? -19.917 2.920   12.833  1.00 0.00 ? 9  LYS A H    4  
ATOM 3547  H HA   . LYS A 1 9  ? -20.165 0.511   11.157  1.00 0.00 ? 9  LYS A HA   4  
ATOM 3548  H HB2  . LYS A 1 9  ? -22.080 2.228   11.304  1.00 0.00 ? 9  LYS A HB2  4  
ATOM 3549  H HB3  . LYS A 1 9  ? -21.041 3.274   10.345  1.00 0.00 ? 9  LYS A HB3  4  
ATOM 3550  H HG2  . LYS A 1 9  ? -22.547 2.166   8.871   1.00 0.00 ? 9  LYS A HG2  4  
ATOM 3551  H HG3  . LYS A 1 9  ? -20.939 1.483   8.620   1.00 0.00 ? 9  LYS A HG3  4  
ATOM 3552  H HD2  . LYS A 1 9  ? -21.530 -0.425  10.034  1.00 0.00 ? 9  LYS A HD2  4  
ATOM 3553  H HD3  . LYS A 1 9  ? -23.136 0.261   10.293  1.00 0.00 ? 9  LYS A HD3  4  
ATOM 3554  H HE2  . LYS A 1 9  ? -23.582 0.107   7.890   1.00 0.00 ? 9  LYS A HE2  4  
ATOM 3555  H HE3  . LYS A 1 9  ? -21.978 -0.579  7.636   1.00 0.00 ? 9  LYS A HE3  4  
ATOM 3556  H HZ1  . LYS A 1 9  ? -22.583 -2.566  8.528   1.00 0.00 ? 9  LYS A HZ1  4  
ATOM 3557  H HZ2  . LYS A 1 9  ? -24.084 -2.095  7.907   1.00 0.00 ? 9  LYS A HZ2  4  
ATOM 3558  H HZ3  . LYS A 1 9  ? -23.752 -1.900  9.554   1.00 0.00 ? 9  LYS A HZ3  4  
ATOM 3559  N N    . LYS A 1 10 ? -17.638 1.842   11.036  1.00 0.00 ? 10 LYS A N    4  
ATOM 3560  C CA   . LYS A 1 10 ? -16.374 2.173   10.389  1.00 0.00 ? 10 LYS A CA   4  
ATOM 3561  C C    . LYS A 1 10 ? -16.136 1.284   9.172   1.00 0.00 ? 10 LYS A C    4  
ATOM 3562  O O    . LYS A 1 10 ? -16.385 0.079   9.214   1.00 0.00 ? 10 LYS A O    4  
ATOM 3563  C CB   . LYS A 1 10 ? -15.216 2.021   11.379  1.00 0.00 ? 10 LYS A CB   4  
ATOM 3564  C CG   . LYS A 1 10 ? -15.108 0.630   11.980  1.00 0.00 ? 10 LYS A CG   4  
ATOM 3565  C CD   . LYS A 1 10 ? -13.860 0.488   12.835  1.00 0.00 ? 10 LYS A CD   4  
ATOM 3566  C CE   . LYS A 1 10 ? -14.072 -0.502  13.970  1.00 0.00 ? 10 LYS A CE   4  
ATOM 3567  N NZ   . LYS A 1 10 ? -13.065 -0.327  15.054  1.00 0.00 ? 10 LYS A NZ   4  
ATOM 3568  H H    . LYS A 1 10 ? -17.631 1.517   11.961  1.00 0.00 ? 10 LYS A H    4  
ATOM 3569  H HA   . LYS A 1 10 ? -16.426 3.201   10.065  1.00 0.00 ? 10 LYS A HA   4  
ATOM 3570  H HB2  . LYS A 1 10 ? -14.290 2.243   10.868  1.00 0.00 ? 10 LYS A HB2  4  
ATOM 3571  H HB3  . LYS A 1 10 ? -15.351 2.729   12.184  1.00 0.00 ? 10 LYS A HB3  4  
ATOM 3572  H HG2  . LYS A 1 10 ? -15.976 0.446   12.596  1.00 0.00 ? 10 LYS A HG2  4  
ATOM 3573  H HG3  . LYS A 1 10 ? -15.070 -0.096  11.180  1.00 0.00 ? 10 LYS A HG3  4  
ATOM 3574  H HD2  . LYS A 1 10 ? -13.047 0.139   12.215  1.00 0.00 ? 10 LYS A HD2  4  
ATOM 3575  H HD3  . LYS A 1 10 ? -13.608 1.453   13.252  1.00 0.00 ? 10 LYS A HD3  4  
ATOM 3576  H HE2  . LYS A 1 10 ? -15.059 -0.353  14.381  1.00 0.00 ? 10 LYS A HE2  4  
ATOM 3577  H HE3  . LYS A 1 10 ? -13.994 -1.504  13.576  1.00 0.00 ? 10 LYS A HE3  4  
ATOM 3578  H HZ1  . LYS A 1 10 ? -12.160 -0.753  14.771  1.00 0.00 ? 10 LYS A HZ1  4  
ATOM 3579  H HZ2  . LYS A 1 10 ? -13.395 -0.788  15.926  1.00 0.00 ? 10 LYS A HZ2  4  
ATOM 3580  H HZ3  . LYS A 1 10 ? -12.916 0.684   15.244  1.00 0.00 ? 10 LYS A HZ3  4  
ATOM 3581  N N    . ARG A 1 11 ? -15.652 1.886   8.091   1.00 0.00 ? 11 ARG A N    4  
ATOM 3582  C CA   . ARG A 1 11 ? -15.381 1.149   6.863   1.00 0.00 ? 11 ARG A CA   4  
ATOM 3583  C C    . ARG A 1 11 ? -13.879 0.993   6.643   1.00 0.00 ? 11 ARG A C    4  
ATOM 3584  O O    . ARG A 1 11 ? -13.072 1.486   7.432   1.00 0.00 ? 11 ARG A O    4  
ATOM 3585  C CB   . ARG A 1 11 ? -16.011 1.863   5.665   1.00 0.00 ? 11 ARG A CB   4  
ATOM 3586  C CG   . ARG A 1 11 ? -17.427 1.403   5.358   1.00 0.00 ? 11 ARG A CG   4  
ATOM 3587  C CD   . ARG A 1 11 ? -17.770 1.599   3.890   1.00 0.00 ? 11 ARG A CD   4  
ATOM 3588  N NE   . ARG A 1 11 ? -19.207 1.747   3.679   1.00 0.00 ? 11 ARG A NE   4  
ATOM 3589  C CZ   . ARG A 1 11 ? -20.060 0.728   3.684   1.00 0.00 ? 11 ARG A CZ   4  
ATOM 3590  N NH1  . ARG A 1 11 ? -19.622 -0.506  3.888   1.00 0.00 ? 11 ARG A NH1  4  
ATOM 3591  N NH2  . ARG A 1 11 ? -21.354 0.943   3.484   1.00 0.00 ? 11 ARG A NH2  4  
ATOM 3592  H H    . ARG A 1 11 ? -15.474 2.850   8.119   1.00 0.00 ? 11 ARG A H    4  
ATOM 3593  H HA   . ARG A 1 11 ? -15.823 0.169   6.960   1.00 0.00 ? 11 ARG A HA   4  
ATOM 3594  H HB2  . ARG A 1 11 ? -16.035 2.924   5.865   1.00 0.00 ? 11 ARG A HB2  4  
ATOM 3595  H HB3  . ARG A 1 11 ? -15.400 1.683   4.793   1.00 0.00 ? 11 ARG A HB3  4  
ATOM 3596  H HG2  . ARG A 1 11 ? -17.516 0.355   5.601   1.00 0.00 ? 11 ARG A HG2  4  
ATOM 3597  H HG3  . ARG A 1 11 ? -18.118 1.974   5.960   1.00 0.00 ? 11 ARG A HG3  4  
ATOM 3598  H HD2  . ARG A 1 11 ? -17.270 2.486   3.532   1.00 0.00 ? 11 ARG A HD2  4  
ATOM 3599  H HD3  . ARG A 1 11 ? -17.421 0.741   3.335   1.00 0.00 ? 11 ARG A HD3  4  
ATOM 3600  H HE   . ARG A 1 11 ? -19.553 2.651   3.526   1.00 0.00 ? 11 ARG A HE   4  
ATOM 3601  H HH11 . ARG A 1 11 ? -18.647 -0.671  4.040   1.00 0.00 ? 11 ARG A HH11 4  
ATOM 3602  H HH12 . ARG A 1 11 ? -20.266 -1.271  3.893   1.00 0.00 ? 11 ARG A HH12 4  
ATOM 3603  H HH21 . ARG A 1 11 ? -21.688 1.873   3.330   1.00 0.00 ? 11 ARG A HH21 4  
ATOM 3604  H HH22 . ARG A 1 11 ? -21.995 0.176   3.488   1.00 0.00 ? 11 ARG A HH22 4  
ATOM 3605  N N    . ILE A 1 12 ? -13.512 0.304   5.568   1.00 0.00 ? 12 ILE A N    4  
ATOM 3606  C CA   . ILE A 1 12 ? -12.108 0.083   5.245   1.00 0.00 ? 12 ILE A CA   4  
ATOM 3607  C C    . ILE A 1 12 ? -11.333 1.396   5.238   1.00 0.00 ? 12 ILE A C    4  
ATOM 3608  O O    . ILE A 1 12 ? -11.778 2.406   4.692   1.00 0.00 ? 12 ILE A O    4  
ATOM 3609  C CB   . ILE A 1 12 ? -11.946 -0.603  3.876   1.00 0.00 ? 12 ILE A CB   4  
ATOM 3610  C CG1  . ILE A 1 12 ? -12.720 -1.923  3.848   1.00 0.00 ? 12 ILE A CG1  4  
ATOM 3611  C CG2  . ILE A 1 12 ? -10.474 -0.839  3.572   1.00 0.00 ? 12 ILE A CG2  4  
ATOM 3612  C CD1  . ILE A 1 12 ? -12.295 -2.895  4.925   1.00 0.00 ? 12 ILE A CD1  4  
ATOM 3613  H H    . ILE A 1 12 ? -14.202 -0.064  4.978   1.00 0.00 ? 12 ILE A H    4  
ATOM 3614  H HA   . ILE A 1 12 ? -11.690 -0.565  6.002   1.00 0.00 ? 12 ILE A HA   4  
ATOM 3615  H HB   . ILE A 1 12 ? -12.344 0.056   3.119   1.00 0.00 ? 12 ILE A HB   4  
ATOM 3616  H HG12 . ILE A 1 12 ? -13.771 -1.720  3.981   1.00 0.00 ? 12 ILE A HG12 4  
ATOM 3617  H HG13 . ILE A 1 12 ? -12.568 -2.400  2.890   1.00 0.00 ? 12 ILE A HG13 4  
ATOM 3618  H HG21 . ILE A 1 12 ? -10.372 -1.230  2.571   1.00 0.00 ? 12 ILE A HG21 4  
ATOM 3619  H HG22 . ILE A 1 12 ? -9.937  0.095   3.650   1.00 0.00 ? 12 ILE A HG22 4  
ATOM 3620  H HG23 . ILE A 1 12 ? -10.070 -1.547  4.279   1.00 0.00 ? 12 ILE A HG23 4  
ATOM 3621  H HD11 . ILE A 1 12 ? -11.254 -3.149  4.791   1.00 0.00 ? 12 ILE A HD11 4  
ATOM 3622  H HD12 . ILE A 1 12 ? -12.434 -2.442  5.895   1.00 0.00 ? 12 ILE A HD12 4  
ATOM 3623  H HD13 . ILE A 1 12 ? -12.894 -3.792  4.858   1.00 0.00 ? 12 ILE A HD13 4  
ATOM 3624  N N    . PRO A 1 13 ? -10.143 1.385   5.857   1.00 0.00 ? 13 PRO A N    4  
ATOM 3625  C CA   . PRO A 1 13 ? -9.279  2.566   5.934   1.00 0.00 ? 13 PRO A CA   4  
ATOM 3626  C C    . PRO A 1 13 ? -8.485  2.788   4.652   1.00 0.00 ? 13 PRO A C    4  
ATOM 3627  O O    . PRO A 1 13 ? -8.733  2.137   3.636   1.00 0.00 ? 13 PRO A O    4  
ATOM 3628  C CB   . PRO A 1 13 ? -8.337  2.242   7.097   1.00 0.00 ? 13 PRO A CB   4  
ATOM 3629  C CG   . PRO A 1 13 ? -8.293  0.754   7.144   1.00 0.00 ? 13 PRO A CG   4  
ATOM 3630  C CD   . PRO A 1 13 ? -9.550  0.217   6.530   1.00 0.00 ? 13 PRO A CD   4  
ATOM 3631  H HA   . PRO A 1 13 ? -9.844  3.457   6.165   1.00 0.00 ? 13 PRO A HA   4  
ATOM 3632  H HB2  . PRO A 1 13 ? -7.361  2.661   6.900   1.00 0.00 ? 13 PRO A HB2  4  
ATOM 3633  H HB3  . PRO A 1 13 ? -8.734  2.654   8.012   1.00 0.00 ? 13 PRO A HB3  4  
ATOM 3634  H HG2  . PRO A 1 13 ? -7.448  0.393   6.578   1.00 0.00 ? 13 PRO A HG2  4  
ATOM 3635  H HG3  . PRO A 1 13 ? -8.228  0.421   8.170   1.00 0.00 ? 13 PRO A HG3  4  
ATOM 3636  H HD2  . PRO A 1 13 ? -9.284  -0.547  5.814   1.00 0.00 ? 13 PRO A HD2  4  
ATOM 3637  H HD3  . PRO A 1 13 ? -10.222 -0.181  7.276   1.00 0.00 ? 13 PRO A HD3  4  
ATOM 3638  N N    . TYR A 1 14 ? -7.529  3.709   4.705   1.00 0.00 ? 14 TYR A N    4  
ATOM 3639  C CA   . TYR A 1 14 ? -6.700  4.018   3.546   1.00 0.00 ? 14 TYR A CA   4  
ATOM 3640  C C    . TYR A 1 14 ? -7.542  4.593   2.411   1.00 0.00 ? 14 TYR A C    4  
ATOM 3641  O O    . TYR A 1 14 ? -8.314  3.879   1.772   1.00 0.00 ? 14 TYR A O    4  
ATOM 3642  C CB   . TYR A 1 14 ? -5.968  2.763   3.068   1.00 0.00 ? 14 TYR A CB   4  
ATOM 3643  C CG   . TYR A 1 14 ? -5.284  2.000   4.179   1.00 0.00 ? 14 TYR A CG   4  
ATOM 3644  C CD1  . TYR A 1 14 ? -4.217  2.555   4.875   1.00 0.00 ? 14 TYR A CD1  4  
ATOM 3645  C CD2  . TYR A 1 14 ? -5.705  0.724   4.534   1.00 0.00 ? 14 TYR A CD2  4  
ATOM 3646  C CE1  . TYR A 1 14 ? -3.589  1.861   5.891   1.00 0.00 ? 14 TYR A CE1  4  
ATOM 3647  C CE2  . TYR A 1 14 ? -5.083  0.024   5.549   1.00 0.00 ? 14 TYR A CE2  4  
ATOM 3648  C CZ   . TYR A 1 14 ? -4.026  0.596   6.225   1.00 0.00 ? 14 TYR A CZ   4  
ATOM 3649  O OH   . TYR A 1 14 ? -3.403  -0.099  7.236   1.00 0.00 ? 14 TYR A OH   4  
ATOM 3650  H H    . TYR A 1 14 ? -7.379  4.195   5.543   1.00 0.00 ? 14 TYR A H    4  
ATOM 3651  H HA   . TYR A 1 14 ? -5.970  4.756   3.847   1.00 0.00 ? 14 TYR A HA   4  
ATOM 3652  H HB2  . TYR A 1 14 ? -6.676  2.099   2.597   1.00 0.00 ? 14 TYR A HB2  4  
ATOM 3653  H HB3  . TYR A 1 14 ? -5.215  3.047   2.347   1.00 0.00 ? 14 TYR A HB3  4  
ATOM 3654  H HD1  . TYR A 1 14 ? -3.877  3.546   4.611   1.00 0.00 ? 14 TYR A HD1  4  
ATOM 3655  H HD2  . TYR A 1 14 ? -6.533  0.278   4.002   1.00 0.00 ? 14 TYR A HD2  4  
ATOM 3656  H HE1  . TYR A 1 14 ? -2.761  2.309   6.421   1.00 0.00 ? 14 TYR A HE1  4  
ATOM 3657  H HE2  . TYR A 1 14 ? -5.425  -0.967  5.810   1.00 0.00 ? 14 TYR A HE2  4  
ATOM 3658  H HH   . TYR A 1 14 ? -4.012  -0.746  7.601   1.00 0.00 ? 14 TYR A HH   4  
ATOM 3659  N N    . SER A 1 15 ? -7.386  5.891   2.166   1.00 0.00 ? 15 SER A N    4  
ATOM 3660  C CA   . SER A 1 15 ? -8.133  6.564   1.111   1.00 0.00 ? 15 SER A CA   4  
ATOM 3661  C C    . SER A 1 15 ? -7.741  6.025   -0.262  1.00 0.00 ? 15 SER A C    4  
ATOM 3662  O O    . SER A 1 15 ? -6.715  5.361   -0.412  1.00 0.00 ? 15 SER A O    4  
ATOM 3663  C CB   . SER A 1 15 ? -7.888  8.073   1.167   1.00 0.00 ? 15 SER A CB   4  
ATOM 3664  O OG   . SER A 1 15 ? -8.750  8.696   2.104   1.00 0.00 ? 15 SER A OG   4  
ATOM 3665  H H    . SER A 1 15 ? -6.755  6.407   2.710   1.00 0.00 ? 15 SER A H    4  
ATOM 3666  H HA   . SER A 1 15 ? -9.183  6.373   1.274   1.00 0.00 ? 15 SER A HA   4  
ATOM 3667  H HB2  . SER A 1 15 ? -6.865  8.259   1.459   1.00 0.00 ? 15 SER A HB2  4  
ATOM 3668  H HB3  . SER A 1 15 ? -8.067  8.501   0.191   1.00 0.00 ? 15 SER A HB3  4  
ATOM 3669  H HG   . SER A 1 15 ? -9.277  9.364   1.659   1.00 0.00 ? 15 SER A HG   4  
ATOM 3670  N N    . LYS A 1 16 ? -8.567  6.314   -1.262  1.00 0.00 ? 16 LYS A N    4  
ATOM 3671  C CA   . LYS A 1 16 ? -8.309  5.861   -2.623  1.00 0.00 ? 16 LYS A CA   4  
ATOM 3672  C C    . LYS A 1 16 ? -6.892  6.221   -3.057  1.00 0.00 ? 16 LYS A C    4  
ATOM 3673  O O    . LYS A 1 16 ? -6.196  5.412   -3.669  1.00 0.00 ? 16 LYS A O    4  
ATOM 3674  C CB   . LYS A 1 16 ? -9.322  6.479   -3.589  1.00 0.00 ? 16 LYS A CB   4  
ATOM 3675  C CG   . LYS A 1 16 ? -10.758 6.073   -3.306  1.00 0.00 ? 16 LYS A CG   4  
ATOM 3676  C CD   . LYS A 1 16 ? -11.738 7.153   -3.732  1.00 0.00 ? 16 LYS A CD   4  
ATOM 3677  C CE   . LYS A 1 16 ? -13.124 6.907   -3.158  1.00 0.00 ? 16 LYS A CE   4  
ATOM 3678  N NZ   . LYS A 1 16 ? -14.138 7.828   -3.742  1.00 0.00 ? 16 LYS A NZ   4  
ATOM 3679  H H    . LYS A 1 16 ? -9.370  6.847   -1.079  1.00 0.00 ? 16 LYS A H    4  
ATOM 3680  H HA   . LYS A 1 16 ? -8.416  4.787   -2.641  1.00 0.00 ? 16 LYS A HA   4  
ATOM 3681  H HB2  . LYS A 1 16 ? -9.255  7.555   -3.523  1.00 0.00 ? 16 LYS A HB2  4  
ATOM 3682  H HB3  . LYS A 1 16 ? -9.075  6.172   -4.595  1.00 0.00 ? 16 LYS A HB3  4  
ATOM 3683  H HG2  . LYS A 1 16 ? -10.981 5.166   -3.850  1.00 0.00 ? 16 LYS A HG2  4  
ATOM 3684  H HG3  . LYS A 1 16 ? -10.871 5.895   -2.246  1.00 0.00 ? 16 LYS A HG3  4  
ATOM 3685  H HD2  . LYS A 1 16 ? -11.380 8.110   -3.382  1.00 0.00 ? 16 LYS A HD2  4  
ATOM 3686  H HD3  . LYS A 1 16 ? -11.801 7.164   -4.811  1.00 0.00 ? 16 LYS A HD3  4  
ATOM 3687  H HE2  . LYS A 1 16 ? -13.412 5.889   -3.369  1.00 0.00 ? 16 LYS A HE2  4  
ATOM 3688  H HE3  . LYS A 1 16 ? -13.088 7.056   -2.088  1.00 0.00 ? 16 LYS A HE3  4  
ATOM 3689  H HZ1  . LYS A 1 16 ? -15.034 7.322   -3.895  1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 3690  H HZ2  . LYS A 1 16 ? -13.802 8.198   -4.653  1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 3691  H HZ3  . LYS A 1 16 ? -14.309 8.626   -3.098  1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 3692  N N    . GLY A 1 17 ? -6.471  7.440   -2.735  1.00 0.00 ? 17 GLY A N    4  
ATOM 3693  C CA   . GLY A 1 17 ? -5.138  7.884   -3.098  1.00 0.00 ? 17 GLY A CA   4  
ATOM 3694  C C    . GLY A 1 17 ? -4.051  7.095   -2.396  1.00 0.00 ? 17 GLY A C    4  
ATOM 3695  O O    . GLY A 1 17 ? -3.033  6.757   -2.999  1.00 0.00 ? 17 GLY A O    4  
ATOM 3696  H H    . GLY A 1 17 ? -7.070  8.042   -2.246  1.00 0.00 ? 17 GLY A H    4  
ATOM 3697  H HA2  . GLY A 1 17 ? -5.013  7.778   -4.166  1.00 0.00 ? 17 GLY A HA2  4  
ATOM 3698  H HA3  . GLY A 1 17 ? -5.035  8.927   -2.837  1.00 0.00 ? 17 GLY A HA3  4  
ATOM 3699  N N    . GLN A 1 18 ? -4.268  6.801   -1.118  1.00 0.00 ? 18 GLN A N    4  
ATOM 3700  C CA   . GLN A 1 18 ? -3.297  6.048   -0.333  1.00 0.00 ? 18 GLN A CA   4  
ATOM 3701  C C    . GLN A 1 18 ? -3.162  4.622   -0.856  1.00 0.00 ? 18 GLN A C    4  
ATOM 3702  O O    . GLN A 1 18 ? -2.053  4.128   -1.063  1.00 0.00 ? 18 GLN A O    4  
ATOM 3703  C CB   . GLN A 1 18 ? -3.708  6.027   1.141   1.00 0.00 ? 18 GLN A CB   4  
ATOM 3704  C CG   . GLN A 1 18 ? -3.457  7.342   1.861   1.00 0.00 ? 18 GLN A CG   4  
ATOM 3705  C CD   . GLN A 1 18 ? -3.830  7.283   3.330   1.00 0.00 ? 18 GLN A CD   4  
ATOM 3706  O OE1  . GLN A 1 18 ? -4.526  8.161   3.841   1.00 0.00 ? 18 GLN A OE1  4  
ATOM 3707  N NE2  . GLN A 1 18 ? -3.369  6.245   4.017   1.00 0.00 ? 18 GLN A NE2  4  
ATOM 3708  H H    . GLN A 1 18 ? -5.099  7.098   -0.693  1.00 0.00 ? 18 GLN A H    4  
ATOM 3709  H HA   . GLN A 1 18 ? -2.342  6.543   -0.423  1.00 0.00 ? 18 GLN A HA   4  
ATOM 3710  H HB2  . GLN A 1 18 ? -4.762  5.801   1.205   1.00 0.00 ? 18 GLN A HB2  4  
ATOM 3711  H HB3  . GLN A 1 18 ? -3.150  5.252   1.646   1.00 0.00 ? 18 GLN A HB3  4  
ATOM 3712  H HG2  . GLN A 1 18 ? -2.408  7.586   1.783   1.00 0.00 ? 18 GLN A HG2  4  
ATOM 3713  H HG3  . GLN A 1 18 ? -4.043  8.115   1.386   1.00 0.00 ? 18 GLN A HG3  4  
ATOM 3714  H HE21 . GLN A 1 18 ? -2.819  5.584   3.544   1.00 0.00 ? 18 GLN A HE21 4  
ATOM 3715  H HE22 . GLN A 1 18 ? -3.594  6.182   4.968   1.00 0.00 ? 18 GLN A HE22 4  
ATOM 3716  N N    . LEU A 1 19 ? -4.297  3.965   -1.067  1.00 0.00 ? 19 LEU A N    4  
ATOM 3717  C CA   . LEU A 1 19 ? -4.306  2.594   -1.566  1.00 0.00 ? 19 LEU A CA   4  
ATOM 3718  C C    . LEU A 1 19 ? -3.788  2.533   -3.000  1.00 0.00 ? 19 LEU A C    4  
ATOM 3719  O O    . LEU A 1 19 ? -3.314  1.493   -3.455  1.00 0.00 ? 19 LEU A O    4  
ATOM 3720  C CB   . LEU A 1 19 ? -5.720  2.015   -1.497  1.00 0.00 ? 19 LEU A CB   4  
ATOM 3721  C CG   . LEU A 1 19 ? -6.327  1.890   -0.099  1.00 0.00 ? 19 LEU A CG   4  
ATOM 3722  C CD1  . LEU A 1 19 ? -7.840  1.753   -0.184  1.00 0.00 ? 19 LEU A CD1  4  
ATOM 3723  C CD2  . LEU A 1 19 ? -5.724  0.705   0.640   1.00 0.00 ? 19 LEU A CD2  4  
ATOM 3724  H H    . LEU A 1 19 ? -5.150  4.411   -0.883  1.00 0.00 ? 19 LEU A H    4  
ATOM 3725  H HA   . LEU A 1 19 ? -3.655  2.008   -0.936  1.00 0.00 ? 19 LEU A HA   4  
ATOM 3726  H HB2  . LEU A 1 19 ? -6.367  2.650   -2.083  1.00 0.00 ? 19 LEU A HB2  4  
ATOM 3727  H HB3  . LEU A 1 19 ? -5.694  1.028   -1.937  1.00 0.00 ? 19 LEU A HB3  4  
ATOM 3728  H HG   . LEU A 1 19 ? -6.105  2.786   0.464   1.00 0.00 ? 19 LEU A HG   4  
ATOM 3729  H HD11 . LEU A 1 19 ? -8.252  2.620   -0.678  1.00 0.00 ? 19 LEU A HD11 4  
ATOM 3730  H HD12 . LEU A 1 19 ? -8.250  1.676   0.811   1.00 0.00 ? 19 LEU A HD12 4  
ATOM 3731  H HD13 . LEU A 1 19 ? -8.090  0.866   -0.746  1.00 0.00 ? 19 LEU A HD13 4  
ATOM 3732  H HD21 . LEU A 1 19 ? -5.697  -0.153  -0.016  1.00 0.00 ? 19 LEU A HD21 4  
ATOM 3733  H HD22 . LEU A 1 19 ? -6.327  0.476   1.507   1.00 0.00 ? 19 LEU A HD22 4  
ATOM 3734  H HD23 . LEU A 1 19 ? -4.720  0.950   0.954   1.00 0.00 ? 19 LEU A HD23 4  
ATOM 3735  N N    . ARG A 1 20 ? -3.882  3.656   -3.705  1.00 0.00 ? 20 ARG A N    4  
ATOM 3736  C CA   . ARG A 1 20 ? -3.422  3.730   -5.087  1.00 0.00 ? 20 ARG A CA   4  
ATOM 3737  C C    . ARG A 1 20 ? -1.958  3.313   -5.196  1.00 0.00 ? 20 ARG A C    4  
ATOM 3738  O O    . ARG A 1 20 ? -1.554  2.683   -6.172  1.00 0.00 ? 20 ARG A O    4  
ATOM 3739  C CB   . ARG A 1 20 ? -3.601  5.149   -5.630  1.00 0.00 ? 20 ARG A CB   4  
ATOM 3740  C CG   . ARG A 1 20 ? -3.581  5.226   -7.148  1.00 0.00 ? 20 ARG A CG   4  
ATOM 3741  C CD   . ARG A 1 20 ? -4.873  4.695   -7.750  1.00 0.00 ? 20 ARG A CD   4  
ATOM 3742  N NE   . ARG A 1 20 ? -5.126  5.249   -9.077  1.00 0.00 ? 20 ARG A NE   4  
ATOM 3743  C CZ   . ARG A 1 20 ? -6.268  5.085   -9.736  1.00 0.00 ? 20 ARG A CZ   4  
ATOM 3744  N NH1  . ARG A 1 20 ? -7.256  4.387   -9.194  1.00 0.00 ? 20 ARG A NH1  4  
ATOM 3745  N NH2  . ARG A 1 20 ? -6.423  5.620   -10.941 1.00 0.00 ? 20 ARG A NH2  4  
ATOM 3746  H H    . ARG A 1 20 ? -4.270  4.453   -3.287  1.00 0.00 ? 20 ARG A H    4  
ATOM 3747  H HA   . ARG A 1 20 ? -4.022  3.051   -5.673  1.00 0.00 ? 20 ARG A HA   4  
ATOM 3748  H HB2  . ARG A 1 20 ? -4.548  5.538   -5.285  1.00 0.00 ? 20 ARG A HB2  4  
ATOM 3749  H HB3  . ARG A 1 20 ? -2.805  5.770   -5.249  1.00 0.00 ? 20 ARG A HB3  4  
ATOM 3750  H HG2  . ARG A 1 20 ? -3.456  6.257   -7.445  1.00 0.00 ? 20 ARG A HG2  4  
ATOM 3751  H HG3  . ARG A 1 20 ? -2.753  4.640   -7.518  1.00 0.00 ? 20 ARG A HG3  4  
ATOM 3752  H HD2  . ARG A 1 20 ? -4.803  3.620   -7.827  1.00 0.00 ? 20 ARG A HD2  4  
ATOM 3753  H HD3  . ARG A 1 20 ? -5.692  4.957   -7.098  1.00 0.00 ? 20 ARG A HD3  4  
ATOM 3754  H HE   . ARG A 1 20 ? -4.410  5.768   -9.497  1.00 0.00 ? 20 ARG A HE   4  
ATOM 3755  H HH11 . ARG A 1 20 ? -7.142  3.984   -8.286  1.00 0.00 ? 20 ARG A HH11 4  
ATOM 3756  H HH12 . ARG A 1 20 ? -8.115  4.266   -9.691  1.00 0.00 ? 20 ARG A HH12 4  
ATOM 3757  H HH21 . ARG A 1 20 ? -5.681  6.147   -11.353 1.00 0.00 ? 20 ARG A HH21 4  
ATOM 3758  H HH22 . ARG A 1 20 ? -7.283  5.496   -11.436 1.00 0.00 ? 20 ARG A HH22 4  
ATOM 3759  N N    . GLU A 1 21 ? -1.170  3.670   -4.187  1.00 0.00 ? 21 GLU A N    4  
ATOM 3760  C CA   . GLU A 1 21 ? 0.249   3.334   -4.171  1.00 0.00 ? 21 GLU A CA   4  
ATOM 3761  C C    . GLU A 1 21 ? 0.472   1.944   -3.583  1.00 0.00 ? 21 GLU A C    4  
ATOM 3762  O O    . GLU A 1 21 ? 1.328   1.190   -4.049  1.00 0.00 ? 21 GLU A O    4  
ATOM 3763  C CB   . GLU A 1 21 ? 1.033   4.372   -3.365  1.00 0.00 ? 21 GLU A CB   4  
ATOM 3764  C CG   . GLU A 1 21 ? 0.907   5.786   -3.908  1.00 0.00 ? 21 GLU A CG   4  
ATOM 3765  C CD   . GLU A 1 21 ? 1.242   5.876   -5.384  1.00 0.00 ? 21 GLU A CD   4  
ATOM 3766  O OE1  . GLU A 1 21 ? 2.438   5.773   -5.729  1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3767  O OE2  . GLU A 1 21 ? 0.308   6.050   -6.195  1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3768  H H    . GLU A 1 21 ? -1.551  4.172   -3.436  1.00 0.00 ? 21 GLU A H    4  
ATOM 3769  H HA   . GLU A 1 21 ? 0.603   3.341   -5.191  1.00 0.00 ? 21 GLU A HA   4  
ATOM 3770  H HB2  . GLU A 1 21 ? 0.674   4.366   -2.347  1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3771  H HB3  . GLU A 1 21 ? 2.078   4.099   -3.371  1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3772  H HG2  . GLU A 1 21 ? -0.108  6.124   -3.764  1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3773  H HG3  . GLU A 1 21 ? 1.580   6.429   -3.361  1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3774  N N    . LEU A 1 22 ? -0.303  1.610   -2.557  1.00 0.00 ? 22 LEU A N    4  
ATOM 3775  C CA   . LEU A 1 22 ? -0.191  0.311   -1.904  1.00 0.00 ? 22 LEU A CA   4  
ATOM 3776  C C    . LEU A 1 22 ? -0.502  -0.818  -2.881  1.00 0.00 ? 22 LEU A C    4  
ATOM 3777  O O    . LEU A 1 22 ? 0.274   -1.764  -3.018  1.00 0.00 ? 22 LEU A O    4  
ATOM 3778  C CB   . LEU A 1 22 ? -1.138  0.238   -0.704  1.00 0.00 ? 22 LEU A CB   4  
ATOM 3779  C CG   . LEU A 1 22 ? -0.781  1.128   0.487   1.00 0.00 ? 22 LEU A CG   4  
ATOM 3780  C CD1  . LEU A 1 22 ? -1.928  1.167   1.485   1.00 0.00 ? 22 LEU A CD1  4  
ATOM 3781  C CD2  . LEU A 1 22 ? 0.495   0.638   1.156   1.00 0.00 ? 22 LEU A CD2  4  
ATOM 3782  H H    . LEU A 1 22 ? -0.967  2.253   -2.231  1.00 0.00 ? 22 LEU A H    4  
ATOM 3783  H HA   . LEU A 1 22 ? 0.826   0.201   -1.557  1.00 0.00 ? 22 LEU A HA   4  
ATOM 3784  H HB2  . LEU A 1 22 ? -2.123  0.518   -1.043  1.00 0.00 ? 22 LEU A HB2  4  
ATOM 3785  H HB3  . LEU A 1 22 ? -1.155  -0.787  -0.360  1.00 0.00 ? 22 LEU A HB3  4  
ATOM 3786  H HG   . LEU A 1 22 ? -0.610  2.136   0.136   1.00 0.00 ? 22 LEU A HG   4  
ATOM 3787  H HD11 . LEU A 1 22 ? -1.542  1.019   2.483   1.00 0.00 ? 22 LEU A HD11 4  
ATOM 3788  H HD12 . LEU A 1 22 ? -2.635  0.385   1.253   1.00 0.00 ? 22 LEU A HD12 4  
ATOM 3789  H HD13 . LEU A 1 22 ? -2.421  2.126   1.429   1.00 0.00 ? 22 LEU A HD13 4  
ATOM 3790  H HD21 . LEU A 1 22 ? 0.304   -0.305  1.647   1.00 0.00 ? 22 LEU A HD21 4  
ATOM 3791  H HD22 . LEU A 1 22 ? 0.820   1.365   1.887   1.00 0.00 ? 22 LEU A HD22 4  
ATOM 3792  H HD23 . LEU A 1 22 ? 1.264   0.507   0.410   1.00 0.00 ? 22 LEU A HD23 4  
ATOM 3793  N N    . GLU A 1 23 ? -1.640  -0.711  -3.559  1.00 0.00 ? 23 GLU A N    4  
ATOM 3794  C CA   . GLU A 1 23 ? -2.052  -1.723  -4.524  1.00 0.00 ? 23 GLU A CA   4  
ATOM 3795  C C    . GLU A 1 23 ? -1.068  -1.797  -5.688  1.00 0.00 ? 23 GLU A C    4  
ATOM 3796  O O    . GLU A 1 23 ? -0.773  -2.879  -6.198  1.00 0.00 ? 23 GLU A O    4  
ATOM 3797  C CB   . GLU A 1 23 ? -3.457  -1.418  -5.049  1.00 0.00 ? 23 GLU A CB   4  
ATOM 3798  C CG   . GLU A 1 23 ? -4.521  -1.398  -3.964  1.00 0.00 ? 23 GLU A CG   4  
ATOM 3799  C CD   . GLU A 1 23 ? -5.859  -0.893  -4.468  1.00 0.00 ? 23 GLU A CD   4  
ATOM 3800  O OE1  . GLU A 1 23 ? -5.897  0.214   -5.045  1.00 0.00 ? 23 GLU A OE1  4  
ATOM 3801  O OE2  . GLU A 1 23 ? -6.868  -1.606  -4.286  1.00 0.00 ? 23 GLU A OE2  4  
ATOM 3802  H H    . GLU A 1 23 ? -2.217  0.066   -3.406  1.00 0.00 ? 23 GLU A H    4  
ATOM 3803  H HA   . GLU A 1 23 ? -2.066  -2.677  -4.019  1.00 0.00 ? 23 GLU A HA   4  
ATOM 3804  H HB2  . GLU A 1 23 ? -3.446  -0.452  -5.532  1.00 0.00 ? 23 GLU A HB2  4  
ATOM 3805  H HB3  . GLU A 1 23 ? -3.728  -2.170  -5.775  1.00 0.00 ? 23 GLU A HB3  4  
ATOM 3806  H HG2  . GLU A 1 23 ? -4.651  -2.401  -3.587  1.00 0.00 ? 23 GLU A HG2  4  
ATOM 3807  H HG3  . GLU A 1 23 ? -4.188  -0.754  -3.163  1.00 0.00 ? 23 GLU A HG3  4  
ATOM 3808  N N    . ARG A 1 24 ? -0.564  -0.640  -6.103  1.00 0.00 ? 24 ARG A N    4  
ATOM 3809  C CA   . ARG A 1 24 ? 0.386   -0.573  -7.208  1.00 0.00 ? 24 ARG A CA   4  
ATOM 3810  C C    . ARG A 1 24 ? 1.695   -1.266  -6.842  1.00 0.00 ? 24 ARG A C    4  
ATOM 3811  O O    . ARG A 1 24 ? 2.090   -2.241  -7.480  1.00 0.00 ? 24 ARG A O    4  
ATOM 3812  C CB   . ARG A 1 24 ? 0.657   0.884   -7.587  1.00 0.00 ? 24 ARG A CB   4  
ATOM 3813  C CG   . ARG A 1 24 ? 1.793   1.053   -8.583  1.00 0.00 ? 24 ARG A CG   4  
ATOM 3814  C CD   . ARG A 1 24 ? 1.489   2.147   -9.594  1.00 0.00 ? 24 ARG A CD   4  
ATOM 3815  N NE   . ARG A 1 24 ? 0.850   1.619   -10.797 1.00 0.00 ? 24 ARG A NE   4  
ATOM 3816  C CZ   . ARG A 1 24 ? 1.480   0.871   -11.696 1.00 0.00 ? 24 ARG A CZ   4  
ATOM 3817  N NH1  . ARG A 1 24 ? 2.759   0.565   -11.529 1.00 0.00 ? 24 ARG A NH1  4  
ATOM 3818  N NH2  . ARG A 1 24 ? 0.831   0.428   -12.764 1.00 0.00 ? 24 ARG A NH2  4  
ATOM 3819  H H    . ARG A 1 24 ? -0.837  0.189   -5.657  1.00 0.00 ? 24 ARG A H    4  
ATOM 3820  H HA   . ARG A 1 24 ? -0.053  -1.080  -8.054  1.00 0.00 ? 24 ARG A HA   4  
ATOM 3821  H HB2  . ARG A 1 24 ? -0.239  1.303   -8.022  1.00 0.00 ? 24 ARG A HB2  4  
ATOM 3822  H HB3  . ARG A 1 24 ? 0.905   1.436   -6.693  1.00 0.00 ? 24 ARG A HB3  4  
ATOM 3823  H HG2  . ARG A 1 24 ? 2.693   1.314   -8.046  1.00 0.00 ? 24 ARG A HG2  4  
ATOM 3824  H HG3  . ARG A 1 24 ? 1.941   0.121   -9.107  1.00 0.00 ? 24 ARG A HG3  4  
ATOM 3825  H HD2  . ARG A 1 24 ? 0.831   2.870   -9.136  1.00 0.00 ? 24 ARG A HD2  4  
ATOM 3826  H HD3  . ARG A 1 24 ? 2.415   2.629   -9.871  1.00 0.00 ? 24 ARG A HD3  4  
ATOM 3827  H HE   . ARG A 1 24 ? -0.095  1.834   -10.940 1.00 0.00 ? 24 ARG A HE   4  
ATOM 3828  H HH11 . ARG A 1 24 ? 3.251   0.897   -10.724 1.00 0.00 ? 24 ARG A HH11 4  
ATOM 3829  H HH12 . ARG A 1 24 ? 3.231   0.001   -12.207 1.00 0.00 ? 24 ARG A HH12 4  
ATOM 3830  H HH21 . ARG A 1 24 ? -0.134  0.657   -12.893 1.00 0.00 ? 24 ARG A HH21 4  
ATOM 3831  H HH22 . ARG A 1 24 ? 1.306   -0.134  -13.440 1.00 0.00 ? 24 ARG A HH22 4  
ATOM 3832  N N    . GLU A 1 25 ? 2.362   -0.755  -5.812  1.00 0.00 ? 25 GLU A N    4  
ATOM 3833  C CA   . GLU A 1 25 ? 3.627   -1.325  -5.363  1.00 0.00 ? 25 GLU A CA   4  
ATOM 3834  C C    . GLU A 1 25 ? 3.484   -2.820  -5.090  1.00 0.00 ? 25 GLU A C    4  
ATOM 3835  O O    . GLU A 1 25 ? 4.398   -3.601  -5.355  1.00 0.00 ? 25 GLU A O    4  
ATOM 3836  C CB   . GLU A 1 25 ? 4.115   -0.610  -4.102  1.00 0.00 ? 25 GLU A CB   4  
ATOM 3837  C CG   . GLU A 1 25 ? 4.929   0.641   -4.389  1.00 0.00 ? 25 GLU A CG   4  
ATOM 3838  C CD   . GLU A 1 25 ? 4.334   1.482   -5.501  1.00 0.00 ? 25 GLU A CD   4  
ATOM 3839  O OE1  . GLU A 1 25 ? 4.675   1.236   -6.677  1.00 0.00 ? 25 GLU A OE1  4  
ATOM 3840  O OE2  . GLU A 1 25 ? 3.528   2.385   -5.196  1.00 0.00 ? 25 GLU A OE2  4  
ATOM 3841  H H    . GLU A 1 25 ? 1.995   0.023   -5.343  1.00 0.00 ? 25 GLU A H    4  
ATOM 3842  H HA   . GLU A 1 25 ? 4.352   -1.184  -6.150  1.00 0.00 ? 25 GLU A HA   4  
ATOM 3843  H HB2  . GLU A 1 25 ? 3.259   -0.329  -3.507  1.00 0.00 ? 25 GLU A HB2  4  
ATOM 3844  H HB3  . GLU A 1 25 ? 4.730   -1.291  -3.532  1.00 0.00 ? 25 GLU A HB3  4  
ATOM 3845  H HG2  . GLU A 1 25 ? 4.974   1.239   -3.491  1.00 0.00 ? 25 GLU A HG2  4  
ATOM 3846  H HG3  . GLU A 1 25 ? 5.928   0.347   -4.675  1.00 0.00 ? 25 GLU A HG3  4  
ATOM 3847  N N    . TYR A 1 26 ? 2.330   -3.210  -4.559  1.00 0.00 ? 26 TYR A N    4  
ATOM 3848  C CA   . TYR A 1 26 ? 2.067   -4.610  -4.247  1.00 0.00 ? 26 TYR A CA   4  
ATOM 3849  C C    . TYR A 1 26 ? 1.992   -5.447  -5.520  1.00 0.00 ? 26 TYR A C    4  
ATOM 3850  O O    . TYR A 1 26 ? 2.625   -6.497  -5.624  1.00 0.00 ? 26 TYR A O    4  
ATOM 3851  C CB   . TYR A 1 26 ? 0.764   -4.742  -3.458  1.00 0.00 ? 26 TYR A CB   4  
ATOM 3852  C CG   . TYR A 1 26 ? 0.327   -6.174  -3.246  1.00 0.00 ? 26 TYR A CG   4  
ATOM 3853  C CD1  . TYR A 1 26 ? 1.144   -7.079  -2.580  1.00 0.00 ? 26 TYR A CD1  4  
ATOM 3854  C CD2  . TYR A 1 26 ? -0.903  -6.623  -3.713  1.00 0.00 ? 26 TYR A CD2  4  
ATOM 3855  C CE1  . TYR A 1 26 ? 0.749   -8.388  -2.385  1.00 0.00 ? 26 TYR A CE1  4  
ATOM 3856  C CE2  . TYR A 1 26 ? -1.306  -7.930  -3.521  1.00 0.00 ? 26 TYR A CE2  4  
ATOM 3857  C CZ   . TYR A 1 26 ? -0.476  -8.809  -2.857  1.00 0.00 ? 26 TYR A CZ   4  
ATOM 3858  O OH   . TYR A 1 26 ? -0.874  -10.112 -2.664  1.00 0.00 ? 26 TYR A OH   4  
ATOM 3859  H H    . TYR A 1 26 ? 1.640   -2.541  -4.371  1.00 0.00 ? 26 TYR A H    4  
ATOM 3860  H HA   . TYR A 1 26 ? 2.883   -4.973  -3.639  1.00 0.00 ? 26 TYR A HA   4  
ATOM 3861  H HB2  . TYR A 1 26 ? 0.890   -4.288  -2.488  1.00 0.00 ? 26 TYR A HB2  4  
ATOM 3862  H HB3  . TYR A 1 26 ? -0.025  -4.230  -3.991  1.00 0.00 ? 26 TYR A HB3  4  
ATOM 3863  H HD1  . TYR A 1 26 ? 2.104   -6.747  -2.212  1.00 0.00 ? 26 TYR A HD1  4  
ATOM 3864  H HD2  . TYR A 1 26 ? -1.550  -5.932  -4.234  1.00 0.00 ? 26 TYR A HD2  4  
ATOM 3865  H HE1  . TYR A 1 26 ? 1.398   -9.077  -1.864  1.00 0.00 ? 26 TYR A HE1  4  
ATOM 3866  H HE2  . TYR A 1 26 ? -2.266  -8.259  -3.891  1.00 0.00 ? 26 TYR A HE2  4  
ATOM 3867  H HH   . TYR A 1 26 ? -1.257  -10.453 -3.476  1.00 0.00 ? 26 TYR A HH   4  
ATOM 3868  N N    . ALA A 1 27 ? 1.213   -4.973  -6.487  1.00 0.00 ? 27 ALA A N    4  
ATOM 3869  C CA   . ALA A 1 27 ? 1.056   -5.675  -7.755  1.00 0.00 ? 27 ALA A CA   4  
ATOM 3870  C C    . ALA A 1 27 ? 2.398   -5.843  -8.459  1.00 0.00 ? 27 ALA A C    4  
ATOM 3871  O O    . ALA A 1 27 ? 2.592   -6.783  -9.229  1.00 0.00 ? 27 ALA A O    4  
ATOM 3872  C CB   . ALA A 1 27 ? 0.076   -4.933  -8.651  1.00 0.00 ? 27 ALA A CB   4  
ATOM 3873  H H    . ALA A 1 27 ? 0.734   -4.131  -6.345  1.00 0.00 ? 27 ALA A H    4  
ATOM 3874  H HA   . ALA A 1 27 ? 0.645   -6.653  -7.546  1.00 0.00 ? 27 ALA A HA   4  
ATOM 3875  H HB1  . ALA A 1 27 ? 0.610   -4.500  -9.485  1.00 0.00 ? 27 ALA A HB1  4  
ATOM 3876  H HB2  . ALA A 1 27 ? -0.669  -5.622  -9.019  1.00 0.00 ? 27 ALA A HB2  4  
ATOM 3877  H HB3  . ALA A 1 27 ? -0.405  -4.149  -8.086  1.00 0.00 ? 27 ALA A HB3  4  
ATOM 3878  N N    . ALA A 1 28 ? 3.321   -4.926  -8.190  1.00 0.00 ? 28 ALA A N    4  
ATOM 3879  C CA   . ALA A 1 28 ? 4.645   -4.974  -8.797  1.00 0.00 ? 28 ALA A CA   4  
ATOM 3880  C C    . ALA A 1 28 ? 5.554   -5.949  -8.057  1.00 0.00 ? 28 ALA A C    4  
ATOM 3881  O O    . ALA A 1 28 ? 6.371   -6.637  -8.667  1.00 0.00 ? 28 ALA A O    4  
ATOM 3882  C CB   . ALA A 1 28 ? 5.266   -3.585  -8.821  1.00 0.00 ? 28 ALA A CB   4  
ATOM 3883  H H    . ALA A 1 28 ? 3.107   -4.201  -7.567  1.00 0.00 ? 28 ALA A H    4  
ATOM 3884  H HA   . ALA A 1 28 ? 4.532   -5.308  -9.819  1.00 0.00 ? 28 ALA A HA   4  
ATOM 3885  H HB1  . ALA A 1 28 ? 6.291   -3.655  -9.155  1.00 0.00 ? 28 ALA A HB1  4  
ATOM 3886  H HB2  . ALA A 1 28 ? 4.709   -2.953  -9.496  1.00 0.00 ? 28 ALA A HB2  4  
ATOM 3887  H HB3  . ALA A 1 28 ? 5.240   -3.163  -7.827  1.00 0.00 ? 28 ALA A HB3  4  
ATOM 3888  N N    . ASN A 1 29 ? 5.406   -6.003  -6.737  1.00 0.00 ? 29 ASN A N    4  
ATOM 3889  C CA   . ASN A 1 29 ? 6.215   -6.893  -5.913  1.00 0.00 ? 29 ASN A CA   4  
ATOM 3890  C C    . ASN A 1 29 ? 5.517   -7.194  -4.590  1.00 0.00 ? 29 ASN A C    4  
ATOM 3891  O O    . ASN A 1 29 ? 5.195   -6.286  -3.824  1.00 0.00 ? 29 ASN A O    4  
ATOM 3892  C CB   . ASN A 1 29 ? 7.587   -6.271  -5.648  1.00 0.00 ? 29 ASN A CB   4  
ATOM 3893  C CG   . ASN A 1 29 ? 7.520   -4.762  -5.503  1.00 0.00 ? 29 ASN A CG   4  
ATOM 3894  O OD1  . ASN A 1 29 ? 7.917   -4.023  -6.404  1.00 0.00 ? 29 ASN A OD1  4  
ATOM 3895  N ND2  . ASN A 1 29 ? 7.015   -4.299  -4.366  1.00 0.00 ? 29 ASN A ND2  4  
ATOM 3896  H H    . ASN A 1 29 ? 4.738   -5.429  -6.307  1.00 0.00 ? 29 ASN A H    4  
ATOM 3897  H HA   . ASN A 1 29 ? 6.348   -7.817  -6.455  1.00 0.00 ? 29 ASN A HA   4  
ATOM 3898  H HB2  . ASN A 1 29 ? 7.992   -6.682  -4.734  1.00 0.00 ? 29 ASN A HB2  4  
ATOM 3899  H HB3  . ASN A 1 29 ? 8.248   -6.507  -6.468  1.00 0.00 ? 29 ASN A HB3  4  
ATOM 3900  H HD21 . ASN A 1 29 ? 6.719   -4.947  -3.693  1.00 0.00 ? 29 ASN A HD21 4  
ATOM 3901  H HD22 . ASN A 1 29 ? 6.960   -3.328  -4.246  1.00 0.00 ? 29 ASN A HD22 4  
ATOM 3902  N N    . LYS A 1 30 ? 5.286   -8.476  -4.328  1.00 0.00 ? 30 LYS A N    4  
ATOM 3903  C CA   . LYS A 1 30 ? 4.628   -8.899  -3.097  1.00 0.00 ? 30 LYS A CA   4  
ATOM 3904  C C    . LYS A 1 30 ? 5.318   -8.299  -1.877  1.00 0.00 ? 30 LYS A C    4  
ATOM 3905  O O    . LYS A 1 30 ? 4.669   -7.965  -0.885  1.00 0.00 ? 30 LYS A O    4  
ATOM 3906  C CB   . LYS A 1 30 ? 4.624   -10.426 -2.995  1.00 0.00 ? 30 LYS A CB   4  
ATOM 3907  C CG   . LYS A 1 30 ? 3.983   -11.114 -4.189  1.00 0.00 ? 30 LYS A CG   4  
ATOM 3908  C CD   . LYS A 1 30 ? 2.497   -10.811 -4.274  1.00 0.00 ? 30 LYS A CD   4  
ATOM 3909  C CE   . LYS A 1 30 ? 1.933   -11.172 -5.640  1.00 0.00 ? 30 LYS A CE   4  
ATOM 3910  N NZ   . LYS A 1 30 ? 2.026   -12.633 -5.911  1.00 0.00 ? 30 LYS A NZ   4  
ATOM 3911  H H    . LYS A 1 30 ? 5.566   -9.155  -4.978  1.00 0.00 ? 30 LYS A H    4  
ATOM 3912  H HA   . LYS A 1 30 ? 3.608   -8.547  -3.128  1.00 0.00 ? 30 LYS A HA   4  
ATOM 3913  H HB2  . LYS A 1 30 ? 5.644   -10.772 -2.912  1.00 0.00 ? 30 LYS A HB2  4  
ATOM 3914  H HB3  . LYS A 1 30 ? 4.082   -10.714 -2.106  1.00 0.00 ? 30 LYS A HB3  4  
ATOM 3915  H HG2  . LYS A 1 30 ? 4.463   -10.768 -5.092  1.00 0.00 ? 30 LYS A HG2  4  
ATOM 3916  H HG3  . LYS A 1 30 ? 4.119   -12.182 -4.093  1.00 0.00 ? 30 LYS A HG3  4  
ATOM 3917  H HD2  . LYS A 1 30 ? 1.977   -11.384 -3.521  1.00 0.00 ? 30 LYS A HD2  4  
ATOM 3918  H HD3  . LYS A 1 30 ? 2.342   -9.756  -4.097  1.00 0.00 ? 30 LYS A HD3  4  
ATOM 3919  H HE2  . LYS A 1 30 ? 0.896   -10.873 -5.677  1.00 0.00 ? 30 LYS A HE2  4  
ATOM 3920  H HE3  . LYS A 1 30 ? 2.488   -10.637 -6.397  1.00 0.00 ? 30 LYS A HE3  4  
ATOM 3921  H HZ1  . LYS A 1 30 ? 1.546   -12.862 -6.805  1.00 0.00 ? 30 LYS A HZ1  4  
ATOM 3922  H HZ2  . LYS A 1 30 ? 1.575   -13.168 -5.142  1.00 0.00 ? 30 LYS A HZ2  4  
ATOM 3923  H HZ3  . LYS A 1 30 ? 3.023   -12.921 -5.981  1.00 0.00 ? 30 LYS A HZ3  4  
ATOM 3924  N N    . PHE A 1 31 ? 6.638   -8.165  -1.956  1.00 0.00 ? 31 PHE A N    4  
ATOM 3925  C CA   . PHE A 1 31 ? 7.417   -7.604  -0.858  1.00 0.00 ? 31 PHE A CA   4  
ATOM 3926  C C    . PHE A 1 31 ? 8.245   -6.413  -1.330  1.00 0.00 ? 31 PHE A C    4  
ATOM 3927  O O    . PHE A 1 31 ? 9.138   -6.557  -2.165  1.00 0.00 ? 31 PHE A O    4  
ATOM 3928  C CB   . PHE A 1 31 ? 8.335   -8.672  -0.258  1.00 0.00 ? 31 PHE A CB   4  
ATOM 3929  C CG   . PHE A 1 31 ? 7.601   -9.718  0.531   1.00 0.00 ? 31 PHE A CG   4  
ATOM 3930  C CD1  . PHE A 1 31 ? 7.260   -9.493  1.855   1.00 0.00 ? 31 PHE A CD1  4  
ATOM 3931  C CD2  . PHE A 1 31 ? 7.253   -10.927 -0.050  1.00 0.00 ? 31 PHE A CD2  4  
ATOM 3932  C CE1  . PHE A 1 31 ? 6.586   -10.455 2.584   1.00 0.00 ? 31 PHE A CE1  4  
ATOM 3933  C CE2  . PHE A 1 31 ? 6.579   -11.892 0.674   1.00 0.00 ? 31 PHE A CE2  4  
ATOM 3934  C CZ   . PHE A 1 31 ? 6.244   -11.655 1.992   1.00 0.00 ? 31 PHE A CZ   4  
ATOM 3935  H H    . PHE A 1 31 ? 7.099   -8.450  -2.773  1.00 0.00 ? 31 PHE A H    4  
ATOM 3936  H HA   . PHE A 1 31 ? 6.726   -7.269  -0.100  1.00 0.00 ? 31 PHE A HA   4  
ATOM 3937  H HB2  . PHE A 1 31 ? 8.864   -9.170  -1.056  1.00 0.00 ? 31 PHE A HB2  4  
ATOM 3938  H HB3  . PHE A 1 31 ? 9.047   -8.196  0.399   1.00 0.00 ? 31 PHE A HB3  4  
ATOM 3939  H HD1  . PHE A 1 31 ? 7.526   -8.555  2.319   1.00 0.00 ? 31 PHE A HD1  4  
ATOM 3940  H HD2  . PHE A 1 31 ? 7.514   -11.113 -1.083  1.00 0.00 ? 31 PHE A HD2  4  
ATOM 3941  H HE1  . PHE A 1 31 ? 6.325   -10.267 3.615   1.00 0.00 ? 31 PHE A HE1  4  
ATOM 3942  H HE2  . PHE A 1 31 ? 6.313   -12.829 0.208   1.00 0.00 ? 31 PHE A HE2  4  
ATOM 3943  H HZ   . PHE A 1 31 ? 5.718   -12.408 2.560   1.00 0.00 ? 31 PHE A HZ   4  
ATOM 3944  N N    . ILE A 1 32 ? 7.940   -5.237  -0.791  1.00 0.00 ? 32 ILE A N    4  
ATOM 3945  C CA   . ILE A 1 32 ? 8.656   -4.021  -1.156  1.00 0.00 ? 32 ILE A CA   4  
ATOM 3946  C C    . ILE A 1 32 ? 10.039  -3.984  -0.516  1.00 0.00 ? 32 ILE A C    4  
ATOM 3947  O O    . ILE A 1 32 ? 10.413  -4.886  0.235   1.00 0.00 ? 32 ILE A O    4  
ATOM 3948  C CB   . ILE A 1 32 ? 7.874   -2.761  -0.739  1.00 0.00 ? 32 ILE A CB   4  
ATOM 3949  C CG1  . ILE A 1 32 ? 7.736   -2.702  0.784   1.00 0.00 ? 32 ILE A CG1  4  
ATOM 3950  C CG2  . ILE A 1 32 ? 6.505   -2.743  -1.402  1.00 0.00 ? 32 ILE A CG2  4  
ATOM 3951  C CD1  . ILE A 1 32 ? 6.992   -1.480  1.276   1.00 0.00 ? 32 ILE A CD1  4  
ATOM 3952  H H    . ILE A 1 32 ? 7.218   -5.187  -0.131  1.00 0.00 ? 32 ILE A H    4  
ATOM 3953  H HA   . ILE A 1 32 ? 8.768   -4.011  -2.231  1.00 0.00 ? 32 ILE A HA   4  
ATOM 3954  H HB   . ILE A 1 32 ? 8.423   -1.896  -1.077  1.00 0.00 ? 32 ILE A HB   4  
ATOM 3955  H HG12 . ILE A 1 32 ? 7.202   -3.574  1.125   1.00 0.00 ? 32 ILE A HG12 4  
ATOM 3956  H HG13 . ILE A 1 32 ? 8.721   -2.692  1.227   1.00 0.00 ? 32 ILE A HG13 4  
ATOM 3957  H HG21 . ILE A 1 32 ? 5.739   -2.841  -0.647  1.00 0.00 ? 32 ILE A HG21 4  
ATOM 3958  H HG22 . ILE A 1 32 ? 6.373   -1.810  -1.928  1.00 0.00 ? 32 ILE A HG22 4  
ATOM 3959  H HG23 . ILE A 1 32 ? 6.431   -3.564  -2.099  1.00 0.00 ? 32 ILE A HG23 4  
ATOM 3960  H HD11 . ILE A 1 32 ? 7.086   -1.409  2.349   1.00 0.00 ? 32 ILE A HD11 4  
ATOM 3961  H HD12 . ILE A 1 32 ? 7.407   -0.596  0.817   1.00 0.00 ? 32 ILE A HD12 4  
ATOM 3962  H HD13 . ILE A 1 32 ? 5.947   -1.565  1.012   1.00 0.00 ? 32 ILE A HD13 4  
ATOM 3963  N N    . THR A 1 33 ? 10.795  -2.932  -0.815  1.00 0.00 ? 33 THR A N    4  
ATOM 3964  C CA   . THR A 1 33 ? 12.137  -2.776  -0.269  1.00 0.00 ? 33 THR A CA   4  
ATOM 3965  C C    . THR A 1 33 ? 12.185  -1.651  0.759   1.00 0.00 ? 33 THR A C    4  
ATOM 3966  O O    . THR A 1 33 ? 11.321  -0.773  0.775   1.00 0.00 ? 33 THR A O    4  
ATOM 3967  C CB   . THR A 1 33 ? 13.166  -2.486  -1.378  1.00 0.00 ? 33 THR A CB   4  
ATOM 3968  O OG1  . THR A 1 33 ? 14.418  -2.105  -0.798  1.00 0.00 ? 33 THR A OG1  4  
ATOM 3969  C CG2  . THR A 1 33 ? 12.671  -1.381  -2.299  1.00 0.00 ? 33 THR A CG2  4  
ATOM 3970  H H    . THR A 1 33 ? 10.441  -2.247  -1.419  1.00 0.00 ? 33 THR A H    4  
ATOM 3971  H HA   . THR A 1 33 ? 12.411  -3.703  0.214   1.00 0.00 ? 33 THR A HA   4  
ATOM 3972  H HB   . THR A 1 33 ? 13.306  -3.385  -1.962  1.00 0.00 ? 33 THR A HB   4  
ATOM 3973  H HG1  . THR A 1 33 ? 15.136  -2.412  -1.357  1.00 0.00 ? 33 THR A HG1  4  
ATOM 3974  H HG21 . THR A 1 33 ? 11.795  -0.919  -1.869  1.00 0.00 ? 33 THR A HG21 4  
ATOM 3975  H HG22 . THR A 1 33 ? 12.421  -1.800  -3.262  1.00 0.00 ? 33 THR A HG22 4  
ATOM 3976  H HG23 . THR A 1 33 ? 13.446  -0.639  -2.419  1.00 0.00 ? 33 THR A HG23 4  
ATOM 3977  N N    . LYS A 1 34 ? 13.199  -1.681  1.616   1.00 0.00 ? 34 LYS A N    4  
ATOM 3978  C CA   . LYS A 1 34 ? 13.361  -0.663  2.647   1.00 0.00 ? 34 LYS A CA   4  
ATOM 3979  C C    . LYS A 1 34 ? 13.303  0.737   2.044   1.00 0.00 ? 34 LYS A C    4  
ATOM 3980  O O    . LYS A 1 34 ? 12.842  1.681   2.685   1.00 0.00 ? 34 LYS A O    4  
ATOM 3981  C CB   . LYS A 1 34 ? 14.690  -0.858  3.382   1.00 0.00 ? 34 LYS A CB   4  
ATOM 3982  C CG   . LYS A 1 34 ? 14.574  -1.712  4.632   1.00 0.00 ? 34 LYS A CG   4  
ATOM 3983  C CD   . LYS A 1 34 ? 15.935  -1.986  5.249   1.00 0.00 ? 34 LYS A CD   4  
ATOM 3984  C CE   . LYS A 1 34 ? 16.673  -3.088  4.504   1.00 0.00 ? 34 LYS A CE   4  
ATOM 3985  N NZ   . LYS A 1 34 ? 17.915  -3.501  5.215   1.00 0.00 ? 34 LYS A NZ   4  
ATOM 3986  H H    . LYS A 1 34 ? 13.856  -2.407  1.554   1.00 0.00 ? 34 LYS A H    4  
ATOM 3987  H HA   . LYS A 1 34 ? 12.551  -0.772  3.352   1.00 0.00 ? 34 LYS A HA   4  
ATOM 3988  H HB2  . LYS A 1 34 ? 15.392  -1.332  2.711   1.00 0.00 ? 34 LYS A HB2  4  
ATOM 3989  H HB3  . LYS A 1 34 ? 15.075  0.110   3.667   1.00 0.00 ? 34 LYS A HB3  4  
ATOM 3990  H HG2  . LYS A 1 34 ? 13.960  -1.195  5.355   1.00 0.00 ? 34 LYS A HG2  4  
ATOM 3991  H HG3  . LYS A 1 34 ? 14.110  -2.654  4.372   1.00 0.00 ? 34 LYS A HG3  4  
ATOM 3992  H HD2  . LYS A 1 34 ? 16.526  -1.083  5.211   1.00 0.00 ? 34 LYS A HD2  4  
ATOM 3993  H HD3  . LYS A 1 34 ? 15.800  -2.286  6.278   1.00 0.00 ? 34 LYS A HD3  4  
ATOM 3994  H HE2  . LYS A 1 34 ? 16.020  -3.942  4.412   1.00 0.00 ? 34 LYS A HE2  4  
ATOM 3995  H HE3  . LYS A 1 34 ? 16.934  -2.727  3.521   1.00 0.00 ? 34 LYS A HE3  4  
ATOM 3996  H HZ1  . LYS A 1 34 ? 18.412  -4.233  4.667   1.00 0.00 ? 34 LYS A HZ1  4  
ATOM 3997  H HZ2  . LYS A 1 34 ? 17.680  -3.886  6.152   1.00 0.00 ? 34 LYS A HZ2  4  
ATOM 3998  H HZ3  . LYS A 1 34 ? 18.547  -2.684  5.335   1.00 0.00 ? 34 LYS A HZ3  4  
ATOM 3999  N N    . ASP A 1 35 ? 13.771  0.862   0.807   1.00 0.00 ? 35 ASP A N    4  
ATOM 4000  C CA   . ASP A 1 35 ? 13.770  2.146   0.115   1.00 0.00 ? 35 ASP A CA   4  
ATOM 4001  C C    . ASP A 1 35 ? 12.356  2.536   -0.305  1.00 0.00 ? 35 ASP A C    4  
ATOM 4002  O O    . ASP A 1 35 ? 11.992  3.712   -0.285  1.00 0.00 ? 35 ASP A O    4  
ATOM 4003  C CB   . ASP A 1 35 ? 14.682  2.091   -1.111  1.00 0.00 ? 35 ASP A CB   4  
ATOM 4004  C CG   . ASP A 1 35 ? 15.272  3.444   -1.456  1.00 0.00 ? 35 ASP A CG   4  
ATOM 4005  O OD1  . ASP A 1 35 ? 16.082  3.959   -0.658  1.00 0.00 ? 35 ASP A OD1  4  
ATOM 4006  O OD2  . ASP A 1 35 ? 14.921  3.989   -2.524  1.00 0.00 ? 35 ASP A OD2  4  
ATOM 4007  H H    . ASP A 1 35 ? 14.126  0.072   0.347   1.00 0.00 ? 35 ASP A H    4  
ATOM 4008  H HA   . ASP A 1 35 ? 14.147  2.892   0.799   1.00 0.00 ? 35 ASP A HA   4  
ATOM 4009  H HB2  . ASP A 1 35 ? 15.494  1.405   -0.916  1.00 0.00 ? 35 ASP A HB2  4  
ATOM 4010  H HB3  . ASP A 1 35 ? 14.114  1.738   -1.959  1.00 0.00 ? 35 ASP A HB3  4  
ATOM 4011  N N    . LYS A 1 36 ? 11.562  1.540   -0.686  1.00 0.00 ? 36 LYS A N    4  
ATOM 4012  C CA   . LYS A 1 36 ? 10.188  1.777   -1.111  1.00 0.00 ? 36 LYS A CA   4  
ATOM 4013  C C    . LYS A 1 36 ? 9.285   2.040   0.090   1.00 0.00 ? 36 LYS A C    4  
ATOM 4014  O O    . LYS A 1 36 ? 8.536   3.017   0.112   1.00 0.00 ? 36 LYS A O    4  
ATOM 4015  C CB   . LYS A 1 36 ? 9.664   0.578   -1.904  1.00 0.00 ? 36 LYS A CB   4  
ATOM 4016  C CG   . LYS A 1 36 ? 8.216   0.723   -2.341  1.00 0.00 ? 36 LYS A CG   4  
ATOM 4017  C CD   . LYS A 1 36 ? 8.005   1.987   -3.158  1.00 0.00 ? 36 LYS A CD   4  
ATOM 4018  C CE   . LYS A 1 36 ? 8.848   1.980   -4.424  1.00 0.00 ? 36 LYS A CE   4  
ATOM 4019  N NZ   . LYS A 1 36 ? 8.506   0.834   -5.311  1.00 0.00 ? 36 LYS A NZ   4  
ATOM 4020  H H    . LYS A 1 36 ? 11.910  0.623   -0.680  1.00 0.00 ? 36 LYS A H    4  
ATOM 4021  H HA   . LYS A 1 36 ? 10.183  2.649   -1.748  1.00 0.00 ? 36 LYS A HA   4  
ATOM 4022  H HB2  . LYS A 1 36 ? 10.274  0.450   -2.786  1.00 0.00 ? 36 LYS A HB2  4  
ATOM 4023  H HB3  . LYS A 1 36 ? 9.745   -0.308  -1.290  1.00 0.00 ? 36 LYS A HB3  4  
ATOM 4024  H HG2  . LYS A 1 36 ? 7.944   -0.131  -2.943  1.00 0.00 ? 36 LYS A HG2  4  
ATOM 4025  H HG3  . LYS A 1 36 ? 7.587   0.763   -1.463  1.00 0.00 ? 36 LYS A HG3  4  
ATOM 4026  H HD2  . LYS A 1 36 ? 6.963   2.058   -3.433  1.00 0.00 ? 36 LYS A HD2  4  
ATOM 4027  H HD3  . LYS A 1 36 ? 8.280   2.843   -2.557  1.00 0.00 ? 36 LYS A HD3  4  
ATOM 4028  H HE2  . LYS A 1 36 ? 8.677   2.902   -4.959  1.00 0.00 ? 36 LYS A HE2  4  
ATOM 4029  H HE3  . LYS A 1 36 ? 9.889   1.912   -4.147  1.00 0.00 ? 36 LYS A HE3  4  
ATOM 4030  H HZ1  . LYS A 1 36 ? 7.534   0.936   -5.667  1.00 0.00 ? 36 LYS A HZ1  4  
ATOM 4031  H HZ2  . LYS A 1 36 ? 8.578   -0.059  -4.784  1.00 0.00 ? 36 LYS A HZ2  4  
ATOM 4032  H HZ3  . LYS A 1 36 ? 9.158   0.801   -6.120  1.00 0.00 ? 36 LYS A HZ3  4  
ATOM 4033  N N    . ARG A 1 37 ? 9.362   1.164   1.086   1.00 0.00 ? 37 ARG A N    4  
ATOM 4034  C CA   . ARG A 1 37 ? 8.551   1.303   2.290   1.00 0.00 ? 37 ARG A CA   4  
ATOM 4035  C C    . ARG A 1 37 ? 8.699   2.699   2.887   1.00 0.00 ? 37 ARG A C    4  
ATOM 4036  O O    . ARG A 1 37 ? 7.774   3.219   3.510   1.00 0.00 ? 37 ARG A O    4  
ATOM 4037  C CB   . ARG A 1 37 ? 8.952   0.249   3.324   1.00 0.00 ? 37 ARG A CB   4  
ATOM 4038  C CG   . ARG A 1 37 ? 7.967   0.120   4.475   1.00 0.00 ? 37 ARG A CG   4  
ATOM 4039  C CD   . ARG A 1 37 ? 7.904   -1.307  4.996   1.00 0.00 ? 37 ARG A CD   4  
ATOM 4040  N NE   . ARG A 1 37 ? 9.235   -1.874  5.202   1.00 0.00 ? 37 ARG A NE   4  
ATOM 4041  C CZ   . ARG A 1 37 ? 9.981   -1.627  6.273   1.00 0.00 ? 37 ARG A CZ   4  
ATOM 4042  N NH1  . ARG A 1 37 ? 9.529   -0.829  7.231   1.00 0.00 ? 37 ARG A NH1  4  
ATOM 4043  N NH2  . ARG A 1 37 ? 11.181  -2.180  6.389   1.00 0.00 ? 37 ARG A NH2  4  
ATOM 4044  H H    . ARG A 1 37 ? 9.978   0.406   1.009   1.00 0.00 ? 37 ARG A H    4  
ATOM 4045  H HA   . ARG A 1 37 ? 7.519   1.149   2.014   1.00 0.00 ? 37 ARG A HA   4  
ATOM 4046  H HB2  . ARG A 1 37 ? 9.026   -0.710  2.833   1.00 0.00 ? 37 ARG A HB2  4  
ATOM 4047  H HB3  . ARG A 1 37 ? 9.916   0.511   3.732   1.00 0.00 ? 37 ARG A HB3  4  
ATOM 4048  H HG2  . ARG A 1 37 ? 8.279   0.771   5.278   1.00 0.00 ? 37 ARG A HG2  4  
ATOM 4049  H HG3  . ARG A 1 37 ? 6.986   0.412   4.131   1.00 0.00 ? 37 ARG A HG3  4  
ATOM 4050  H HD2  . ARG A 1 37 ? 7.373   -1.310  5.936   1.00 0.00 ? 37 ARG A HD2  4  
ATOM 4051  H HD3  . ARG A 1 37 ? 7.371   -1.915  4.280   1.00 0.00 ? 37 ARG A HD3  4  
ATOM 4052  H HE   . ARG A 1 37 ? 9.588   -2.467  4.507   1.00 0.00 ? 37 ARG A HE   4  
ATOM 4053  H HH11 . ARG A 1 37 ? 8.624   -0.412  7.147   1.00 0.00 ? 37 ARG A HH11 4  
ATOM 4054  H HH12 . ARG A 1 37 ? 10.092  -0.646  8.037   1.00 0.00 ? 37 ARG A HH12 4  
ATOM 4055  H HH21 . ARG A 1 37 ? 11.525  -2.783  5.669   1.00 0.00 ? 37 ARG A HH21 4  
ATOM 4056  H HH22 . ARG A 1 37 ? 11.742  -1.994  7.195   1.00 0.00 ? 37 ARG A HH22 4  
ATOM 4057  N N    . ARG A 1 38 ? 9.869   3.300   2.692   1.00 0.00 ? 38 ARG A N    4  
ATOM 4058  C CA   . ARG A 1 38 ? 10.138  4.634   3.213   1.00 0.00 ? 38 ARG A CA   4  
ATOM 4059  C C    . ARG A 1 38 ? 9.496   5.702   2.331   1.00 0.00 ? 38 ARG A C    4  
ATOM 4060  O O    . ARG A 1 38 ? 9.046   6.738   2.820   1.00 0.00 ? 38 ARG A O    4  
ATOM 4061  C CB   . ARG A 1 38 ? 11.646  4.874   3.306   1.00 0.00 ? 38 ARG A CB   4  
ATOM 4062  C CG   . ARG A 1 38 ? 12.315  4.115   4.441   1.00 0.00 ? 38 ARG A CG   4  
ATOM 4063  C CD   . ARG A 1 38 ? 13.827  4.264   4.395   1.00 0.00 ? 38 ARG A CD   4  
ATOM 4064  N NE   . ARG A 1 38 ? 14.257  5.610   4.764   1.00 0.00 ? 38 ARG A NE   4  
ATOM 4065  C CZ   . ARG A 1 38 ? 15.526  6.000   4.769   1.00 0.00 ? 38 ARG A CZ   4  
ATOM 4066  N NH1  . ARG A 1 38 ? 16.486  5.152   4.427   1.00 0.00 ? 38 ARG A NH1  4  
ATOM 4067  N NH2  . ARG A 1 38 ? 15.838  7.243   5.117   1.00 0.00 ? 38 ARG A NH2  4  
ATOM 4068  H H    . ARG A 1 38 ? 10.567  2.834   2.187   1.00 0.00 ? 38 ARG A H    4  
ATOM 4069  H HA   . ARG A 1 38 ? 9.711   4.697   4.203   1.00 0.00 ? 38 ARG A HA   4  
ATOM 4070  H HB2  . ARG A 1 38 ? 12.106  4.567   2.378   1.00 0.00 ? 38 ARG A HB2  4  
ATOM 4071  H HB3  . ARG A 1 38 ? 11.822  5.929   3.454   1.00 0.00 ? 38 ARG A HB3  4  
ATOM 4072  H HG2  . ARG A 1 38 ? 11.954  4.503   5.382   1.00 0.00 ? 38 ARG A HG2  4  
ATOM 4073  H HG3  . ARG A 1 38 ? 12.061  3.069   4.360   1.00 0.00 ? 38 ARG A HG3  4  
ATOM 4074  H HD2  . ARG A 1 38 ? 14.266  3.555   5.082   1.00 0.00 ? 38 ARG A HD2  4  
ATOM 4075  H HD3  . ARG A 1 38 ? 14.166  4.049   3.392   1.00 0.00 ? 38 ARG A HD3  4  
ATOM 4076  H HE   . ARG A 1 38 ? 13.564  6.253   5.020   1.00 0.00 ? 38 ARG A HE   4  
ATOM 4077  H HH11 . ARG A 1 38 ? 16.254  4.216   4.163   1.00 0.00 ? 38 ARG A HH11 4  
ATOM 4078  H HH12 . ARG A 1 38 ? 17.441  5.449   4.430   1.00 0.00 ? 38 ARG A HH12 4  
ATOM 4079  H HH21 . ARG A 1 38 ? 15.117  7.885   5.375   1.00 0.00 ? 38 ARG A HH21 4  
ATOM 4080  H HH22 . ARG A 1 38 ? 16.794  7.536   5.121   1.00 0.00 ? 38 ARG A HH22 4  
ATOM 4081  N N    . LYS A 1 39 ? 9.458   5.441   1.029   1.00 0.00 ? 39 LYS A N    4  
ATOM 4082  C CA   . LYS A 1 39 ? 8.871   6.378   0.078   1.00 0.00 ? 39 LYS A CA   4  
ATOM 4083  C C    . LYS A 1 39 ? 7.349   6.371   0.176   1.00 0.00 ? 39 LYS A C    4  
ATOM 4084  O O    . LYS A 1 39 ? 6.717   7.426   0.247   1.00 0.00 ? 39 LYS A O    4  
ATOM 4085  C CB   . LYS A 1 39 ? 9.302   6.026   -1.348  1.00 0.00 ? 39 LYS A CB   4  
ATOM 4086  C CG   . LYS A 1 39 ? 10.762  6.333   -1.635  1.00 0.00 ? 39 LYS A CG   4  
ATOM 4087  C CD   . LYS A 1 39 ? 10.968  7.801   -1.968  1.00 0.00 ? 39 LYS A CD   4  
ATOM 4088  C CE   . LYS A 1 39 ? 10.369  8.155   -3.320  1.00 0.00 ? 39 LYS A CE   4  
ATOM 4089  N NZ   . LYS A 1 39 ? 10.776  9.516   -3.768  1.00 0.00 ? 39 LYS A NZ   4  
ATOM 4090  H H    . LYS A 1 39 ? 9.834   4.598   0.699   1.00 0.00 ? 39 LYS A H    4  
ATOM 4091  H HA   . LYS A 1 39 ? 9.231   7.366   0.320   1.00 0.00 ? 39 LYS A HA   4  
ATOM 4092  H HB2  . LYS A 1 39 ? 9.139   4.971   -1.511  1.00 0.00 ? 39 LYS A HB2  4  
ATOM 4093  H HB3  . LYS A 1 39 ? 8.695   6.588   -2.043  1.00 0.00 ? 39 LYS A HB3  4  
ATOM 4094  H HG2  . LYS A 1 39 ? 11.350  6.087   -0.763  1.00 0.00 ? 39 LYS A HG2  4  
ATOM 4095  H HG3  . LYS A 1 39 ? 11.088  5.734   -2.473  1.00 0.00 ? 39 LYS A HG3  4  
ATOM 4096  H HD2  . LYS A 1 39 ? 10.494  8.404   -1.208  1.00 0.00 ? 39 LYS A HD2  4  
ATOM 4097  H HD3  . LYS A 1 39 ? 12.028  8.012   -1.987  1.00 0.00 ? 39 LYS A HD3  4  
ATOM 4098  H HE2  . LYS A 1 39 ? 10.703  7.432   -4.048  1.00 0.00 ? 39 LYS A HE2  4  
ATOM 4099  H HE3  . LYS A 1 39 ? 9.293   8.118   -3.243  1.00 0.00 ? 39 LYS A HE3  4  
ATOM 4100  H HZ1  . LYS A 1 39 ? 11.580  9.853   -3.200  1.00 0.00 ? 39 LYS A HZ1  4  
ATOM 4101  H HZ2  . LYS A 1 39 ? 9.985   10.181  -3.655  1.00 0.00 ? 39 LYS A HZ2  4  
ATOM 4102  H HZ3  . LYS A 1 39 ? 11.057  9.494   -4.769  1.00 0.00 ? 39 LYS A HZ3  4  
ATOM 4103  N N    . ILE A 1 40 ? 6.766   5.177   0.181   1.00 0.00 ? 40 ILE A N    4  
ATOM 4104  C CA   . ILE A 1 40 ? 5.319   5.034   0.274   1.00 0.00 ? 40 ILE A CA   4  
ATOM 4105  C C    . ILE A 1 40 ? 4.769   5.783   1.483   1.00 0.00 ? 40 ILE A C    4  
ATOM 4106  O O    . ILE A 1 40 ? 3.678   6.350   1.431   1.00 0.00 ? 40 ILE A O    4  
ATOM 4107  C CB   . ILE A 1 40 ? 4.904   3.554   0.369   1.00 0.00 ? 40 ILE A CB   4  
ATOM 4108  C CG1  . ILE A 1 40 ? 5.413   2.780   -0.849  1.00 0.00 ? 40 ILE A CG1  4  
ATOM 4109  C CG2  . ILE A 1 40 ? 3.392   3.434   0.486   1.00 0.00 ? 40 ILE A CG2  4  
ATOM 4110  C CD1  . ILE A 1 40 ? 5.122   1.297   -0.788  1.00 0.00 ? 40 ILE A CD1  4  
ATOM 4111  H H    . ILE A 1 40 ? 7.323   4.373   0.122   1.00 0.00 ? 40 ILE A H    4  
ATOM 4112  H HA   . ILE A 1 40 ? 4.885   5.452   -0.623  1.00 0.00 ? 40 ILE A HA   4  
ATOM 4113  H HB   . ILE A 1 40 ? 5.345   3.136   1.261   1.00 0.00 ? 40 ILE A HB   4  
ATOM 4114  H HG12 . ILE A 1 40 ? 4.945   3.172   -1.738  1.00 0.00 ? 40 ILE A HG12 4  
ATOM 4115  H HG13 . ILE A 1 40 ? 6.483   2.906   -0.925  1.00 0.00 ? 40 ILE A HG13 4  
ATOM 4116  H HG21 . ILE A 1 40 ? 2.925   3.946   -0.343  1.00 0.00 ? 40 ILE A HG21 4  
ATOM 4117  H HG22 . ILE A 1 40 ? 3.112   2.391   0.468   1.00 0.00 ? 40 ILE A HG22 4  
ATOM 4118  H HG23 . ILE A 1 40 ? 3.066   3.878   1.414   1.00 0.00 ? 40 ILE A HG23 4  
ATOM 4119  H HD11 . ILE A 1 40 ? 5.515   0.890   0.132   1.00 0.00 ? 40 ILE A HD11 4  
ATOM 4120  H HD12 . ILE A 1 40 ? 4.055   1.136   -0.826  1.00 0.00 ? 40 ILE A HD12 4  
ATOM 4121  H HD13 . ILE A 1 40 ? 5.590   0.803   -1.627  1.00 0.00 ? 40 ILE A HD13 4  
ATOM 4122  N N    . SER A 1 41 ? 5.532   5.781   2.571   1.00 0.00 ? 41 SER A N    4  
ATOM 4123  C CA   . SER A 1 41 ? 5.121   6.459   3.794   1.00 0.00 ? 41 SER A CA   4  
ATOM 4124  C C    . SER A 1 41 ? 4.959   7.958   3.557   1.00 0.00 ? 41 SER A C    4  
ATOM 4125  O O    . SER A 1 41 ? 4.198   8.629   4.254   1.00 0.00 ? 41 SER A O    4  
ATOM 4126  C CB   . SER A 1 41 ? 6.143   6.215   4.906   1.00 0.00 ? 41 SER A CB   4  
ATOM 4127  O OG   . SER A 1 41 ? 6.188   7.309   5.806   1.00 0.00 ? 41 SER A OG   4  
ATOM 4128  H H    . SER A 1 41 ? 6.392   5.311   2.550   1.00 0.00 ? 41 SER A H    4  
ATOM 4129  H HA   . SER A 1 41 ? 4.168   6.049   4.096   1.00 0.00 ? 41 SER A HA   4  
ATOM 4130  H HB2  . SER A 1 41 ? 5.870   5.326   5.454   1.00 0.00 ? 41 SER A HB2  4  
ATOM 4131  H HB3  . SER A 1 41 ? 7.122   6.083   4.469   1.00 0.00 ? 41 SER A HB3  4  
ATOM 4132  H HG   . SER A 1 41 ? 6.666   7.052   6.598   1.00 0.00 ? 41 SER A HG   4  
ATOM 4133  N N    . ALA A 1 42 ? 5.680   8.475   2.569   1.00 0.00 ? 42 ALA A N    4  
ATOM 4134  C CA   . ALA A 1 42 ? 5.616   9.893   2.237   1.00 0.00 ? 42 ALA A CA   4  
ATOM 4135  C C    . ALA A 1 42 ? 4.632   10.147  1.099   1.00 0.00 ? 42 ALA A C    4  
ATOM 4136  O O    . ALA A 1 42 ? 4.067   11.234  0.986   1.00 0.00 ? 42 ALA A O    4  
ATOM 4137  C CB   . ALA A 1 42 ? 6.997   10.412  1.869   1.00 0.00 ? 42 ALA A CB   4  
ATOM 4138  H H    . ALA A 1 42 ? 6.268   7.889   2.049   1.00 0.00 ? 42 ALA A H    4  
ATOM 4139  H HA   . ALA A 1 42 ? 5.280   10.426  3.115   1.00 0.00 ? 42 ALA A HA   4  
ATOM 4140  H HB1  . ALA A 1 42 ? 7.615   9.588   1.542   1.00 0.00 ? 42 ALA A HB1  4  
ATOM 4141  H HB2  . ALA A 1 42 ? 6.909   11.135  1.071   1.00 0.00 ? 42 ALA A HB2  4  
ATOM 4142  H HB3  . ALA A 1 42 ? 7.447   10.881  2.731   1.00 0.00 ? 42 ALA A HB3  4  
ATOM 4143  N N    . ALA A 1 43 ? 4.434   9.137   0.259   1.00 0.00 ? 43 ALA A N    4  
ATOM 4144  C CA   . ALA A 1 43 ? 3.518   9.251   -0.869  1.00 0.00 ? 43 ALA A CA   4  
ATOM 4145  C C    . ALA A 1 43 ? 2.073   9.042   -0.427  1.00 0.00 ? 43 ALA A C    4  
ATOM 4146  O O    . ALA A 1 43 ? 1.140   9.526   -1.068  1.00 0.00 ? 43 ALA A O    4  
ATOM 4147  C CB   . ALA A 1 43 ? 3.889   8.250   -1.954  1.00 0.00 ? 43 ALA A CB   4  
ATOM 4148  H H    . ALA A 1 43 ? 4.913   8.295   0.402   1.00 0.00 ? 43 ALA A H    4  
ATOM 4149  H HA   . ALA A 1 43 ? 3.617   10.245  -1.281  1.00 0.00 ? 43 ALA A HA   4  
ATOM 4150  H HB1  . ALA A 1 43 ? 4.833   7.787   -1.707  1.00 0.00 ? 43 ALA A HB1  4  
ATOM 4151  H HB2  . ALA A 1 43 ? 3.123   7.492   -2.022  1.00 0.00 ? 43 ALA A HB2  4  
ATOM 4152  H HB3  . ALA A 1 43 ? 3.975   8.762   -2.900  1.00 0.00 ? 43 ALA A HB3  4  
ATOM 4153  N N    . THR A 1 44 ? 1.895   8.318   0.674   1.00 0.00 ? 44 THR A N    4  
ATOM 4154  C CA   . THR A 1 44 ? 0.564   8.044   1.201   1.00 0.00 ? 44 THR A CA   4  
ATOM 4155  C C    . THR A 1 44 ? 0.423   8.555   2.631   1.00 0.00 ? 44 THR A C    4  
ATOM 4156  O O    . THR A 1 44 ? -0.631  8.410   3.250   1.00 0.00 ? 44 THR A O    4  
ATOM 4157  C CB   . THR A 1 44 ? 0.248   6.537   1.173   1.00 0.00 ? 44 THR A CB   4  
ATOM 4158  O OG1  . THR A 1 44 ? 1.181   5.825   1.994   1.00 0.00 ? 44 THR A OG1  4  
ATOM 4159  C CG2  . THR A 1 44 ? 0.303   5.999   -0.249  1.00 0.00 ? 44 THR A CG2  4  
ATOM 4160  H H    . THR A 1 44 ? 2.678   7.960   1.141   1.00 0.00 ? 44 THR A H    4  
ATOM 4161  H HA   . THR A 1 44 ? -0.154  8.553   0.575   1.00 0.00 ? 44 THR A HA   4  
ATOM 4162  H HB   . THR A 1 44 ? -0.749  6.386   1.561   1.00 0.00 ? 44 THR A HB   4  
ATOM 4163  H HG1  . THR A 1 44 ? 1.155   6.177   2.887   1.00 0.00 ? 44 THR A HG1  4  
ATOM 4164  H HG21 . THR A 1 44 ? 0.019   4.957   -0.251  1.00 0.00 ? 44 THR A HG21 4  
ATOM 4165  H HG22 . THR A 1 44 ? 1.307   6.099   -0.633  1.00 0.00 ? 44 THR A HG22 4  
ATOM 4166  H HG23 . THR A 1 44 ? -0.379  6.559   -0.872  1.00 0.00 ? 44 THR A HG23 4  
ATOM 4167  N N    . SER A 1 45 ? 1.491   9.153   3.148   1.00 0.00 ? 45 SER A N    4  
ATOM 4168  C CA   . SER A 1 45 ? 1.486   9.683   4.507   1.00 0.00 ? 45 SER A CA   4  
ATOM 4169  C C    . SER A 1 45 ? 1.192   8.580   5.519   1.00 0.00 ? 45 SER A C    4  
ATOM 4170  O O    . SER A 1 45 ? 0.544   8.815   6.540   1.00 0.00 ? 45 SER A O    4  
ATOM 4171  C CB   . SER A 1 45 ? 0.450   10.801  4.638   1.00 0.00 ? 45 SER A CB   4  
ATOM 4172  O OG   . SER A 1 45 ? 0.355   11.551  3.439   1.00 0.00 ? 45 SER A OG   4  
ATOM 4173  H H    . SER A 1 45 ? 2.302   9.238   2.604   1.00 0.00 ? 45 SER A H    4  
ATOM 4174  H HA   . SER A 1 45 ? 2.467   10.087  4.708   1.00 0.00 ? 45 SER A HA   4  
ATOM 4175  H HB2  . SER A 1 45 ? -0.515  10.370  4.857   1.00 0.00 ? 45 SER A HB2  4  
ATOM 4176  H HB3  . SER A 1 45 ? 0.740   11.464  5.440   1.00 0.00 ? 45 SER A HB3  4  
ATOM 4177  H HG   . SER A 1 45 ? 0.942   12.308  3.487   1.00 0.00 ? 45 SER A HG   4  
ATOM 4178  N N    . LEU A 1 46 ? 1.671   7.376   5.228   1.00 0.00 ? 46 LEU A N    4  
ATOM 4179  C CA   . LEU A 1 46 ? 1.460   6.235   6.112   1.00 0.00 ? 46 LEU A CA   4  
ATOM 4180  C C    . LEU A 1 46 ? 2.730   5.906   6.890   1.00 0.00 ? 46 LEU A C    4  
ATOM 4181  O O    . LEU A 1 46 ? 3.787   6.490   6.648   1.00 0.00 ? 46 LEU A O    4  
ATOM 4182  C CB   . LEU A 1 46 ? 1.013   5.015   5.305   1.00 0.00 ? 46 LEU A CB   4  
ATOM 4183  C CG   . LEU A 1 46 ? -0.443  5.018   4.835   1.00 0.00 ? 46 LEU A CG   4  
ATOM 4184  C CD1  . LEU A 1 46 ? -0.612  4.123   3.618   1.00 0.00 ? 46 LEU A CD1  4  
ATOM 4185  C CD2  . LEU A 1 46 ? -1.367  4.574   5.959   1.00 0.00 ? 46 LEU A CD2  4  
ATOM 4186  H H    . LEU A 1 46 ? 2.179   7.250   4.400   1.00 0.00 ? 46 LEU A H    4  
ATOM 4187  H HA   . LEU A 1 46 ? 0.682   6.498   6.813   1.00 0.00 ? 46 LEU A HA   4  
ATOM 4188  H HB2  . LEU A 1 46 ? 1.642   4.948   4.431   1.00 0.00 ? 46 LEU A HB2  4  
ATOM 4189  H HB3  . LEU A 1 46 ? 1.161   4.139   5.920   1.00 0.00 ? 46 LEU A HB3  4  
ATOM 4190  H HG   . LEU A 1 46 ? -0.720  6.024   4.550   1.00 0.00 ? 46 LEU A HG   4  
ATOM 4191  H HD11 . LEU A 1 46 ? -1.121  4.669   2.837   1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4192  H HD12 . LEU A 1 46 ? -1.195  3.254   3.888   1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4193  H HD13 . LEU A 1 46 ? 0.359   3.808   3.264   1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4194  H HD21 . LEU A 1 46 ? -1.171  3.539   6.198   1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4195  H HD22 . LEU A 1 46 ? -2.395  4.682   5.644   1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4196  H HD23 . LEU A 1 46 ? -1.191  5.185   6.832   1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4197  N N    . SER A 1 47 ? 2.621   4.965   7.822   1.00 0.00 ? 47 SER A N    4  
ATOM 4198  C CA   . SER A 1 47 ? 3.760   4.559   8.637   1.00 0.00 ? 47 SER A CA   4  
ATOM 4199  C C    . SER A 1 47 ? 4.457   3.346   8.029   1.00 0.00 ? 47 SER A C    4  
ATOM 4200  O O    . SER A 1 47 ? 3.829   2.529   7.356   1.00 0.00 ? 47 SER A O    4  
ATOM 4201  C CB   . SER A 1 47 ? 3.307   4.240   10.063  1.00 0.00 ? 47 SER A CB   4  
ATOM 4202  O OG   . SER A 1 47 ? 4.313   4.572   11.004  1.00 0.00 ? 47 SER A OG   4  
ATOM 4203  H H    . SER A 1 47 ? 1.751   4.536   7.968   1.00 0.00 ? 47 SER A H    4  
ATOM 4204  H HA   . SER A 1 47 ? 4.457   5.383   8.665   1.00 0.00 ? 47 SER A HA   4  
ATOM 4205  H HB2  . SER A 1 47 ? 2.417   4.807   10.290  1.00 0.00 ? 47 SER A HB2  4  
ATOM 4206  H HB3  . SER A 1 47 ? 3.091   3.185   10.141  1.00 0.00 ? 47 SER A HB3  4  
ATOM 4207  H HG   . SER A 1 47 ? 4.232   5.497   11.247  1.00 0.00 ? 47 SER A HG   4  
ATOM 4208  N N    . GLU A 1 48 ? 5.759   3.235   8.273   1.00 0.00 ? 48 GLU A N    4  
ATOM 4209  C CA   . GLU A 1 48 ? 6.542   2.122   7.749   1.00 0.00 ? 48 GLU A CA   4  
ATOM 4210  C C    . GLU A 1 48 ? 5.914   0.786   8.136   1.00 0.00 ? 48 GLU A C    4  
ATOM 4211  O O    . GLU A 1 48 ? 5.956   -0.176  7.368   1.00 0.00 ? 48 GLU A O    4  
ATOM 4212  C CB   . GLU A 1 48 ? 7.980   2.192   8.268   1.00 0.00 ? 48 GLU A CB   4  
ATOM 4213  C CG   . GLU A 1 48 ? 8.630   3.552   8.079   1.00 0.00 ? 48 GLU A CG   4  
ATOM 4214  C CD   . GLU A 1 48 ? 10.101  3.552   8.448   1.00 0.00 ? 48 GLU A CD   4  
ATOM 4215  O OE1  . GLU A 1 48 ? 10.763  2.512   8.251   1.00 0.00 ? 48 GLU A OE1  4  
ATOM 4216  O OE2  . GLU A 1 48 ? 10.590  4.594   8.934   1.00 0.00 ? 48 GLU A OE2  4  
ATOM 4217  H H    . GLU A 1 48 ? 6.204   3.919   8.817   1.00 0.00 ? 48 GLU A H    4  
ATOM 4218  H HA   . GLU A 1 48 ? 6.554   2.203   6.673   1.00 0.00 ? 48 GLU A HA   4  
ATOM 4219  H HB2  . GLU A 1 48 ? 7.981   1.959   9.323   1.00 0.00 ? 48 GLU A HB2  4  
ATOM 4220  H HB3  . GLU A 1 48 ? 8.574   1.457   7.746   1.00 0.00 ? 48 GLU A HB3  4  
ATOM 4221  H HG2  . GLU A 1 48 ? 8.535   3.842   7.043   1.00 0.00 ? 48 GLU A HG2  4  
ATOM 4222  H HG3  . GLU A 1 48 ? 8.118   4.271   8.701   1.00 0.00 ? 48 GLU A HG3  4  
ATOM 4223  N N    . ARG A 1 49 ? 5.335   0.735   9.330   1.00 0.00 ? 49 ARG A N    4  
ATOM 4224  C CA   . ARG A 1 49 ? 4.700   -0.483  9.820   1.00 0.00 ? 49 ARG A CA   4  
ATOM 4225  C C    . ARG A 1 49 ? 3.322   -0.668  9.192   1.00 0.00 ? 49 ARG A C    4  
ATOM 4226  O O    . ARG A 1 49 ? 2.961   -1.770  8.780   1.00 0.00 ? 49 ARG A O    4  
ATOM 4227  C CB   . ARG A 1 49 ? 4.576   -0.441  11.344  1.00 0.00 ? 49 ARG A CB   4  
ATOM 4228  C CG   . ARG A 1 49 ? 4.140   -1.762  11.956  1.00 0.00 ? 49 ARG A CG   4  
ATOM 4229  C CD   . ARG A 1 49 ? 5.302   -2.737  12.063  1.00 0.00 ? 49 ARG A CD   4  
ATOM 4230  N NE   . ARG A 1 49 ? 6.349   -2.246  12.954  1.00 0.00 ? 49 ARG A NE   4  
ATOM 4231  C CZ   . ARG A 1 49 ? 7.566   -2.773  13.019  1.00 0.00 ? 49 ARG A CZ   4  
ATOM 4232  N NH1  . ARG A 1 49 ? 7.888   -3.803  12.248  1.00 0.00 ? 49 ARG A NH1  4  
ATOM 4233  N NH2  . ARG A 1 49 ? 8.465   -2.271  13.856  1.00 0.00 ? 49 ARG A NH2  4  
ATOM 4234  H H    . ARG A 1 49 ? 5.334   1.535   9.896   1.00 0.00 ? 49 ARG A H    4  
ATOM 4235  H HA   . ARG A 1 49 ? 5.325   -1.318  9.541   1.00 0.00 ? 49 ARG A HA   4  
ATOM 4236  H HB2  . ARG A 1 49 ? 5.535   -0.174  11.765  1.00 0.00 ? 49 ARG A HB2  4  
ATOM 4237  H HB3  . ARG A 1 49 ? 3.851   0.312   11.614  1.00 0.00 ? 49 ARG A HB3  4  
ATOM 4238  H HG2  . ARG A 1 49 ? 3.748   -1.578  12.945  1.00 0.00 ? 49 ARG A HG2  4  
ATOM 4239  H HG3  . ARG A 1 49 ? 3.371   -2.198  11.337  1.00 0.00 ? 49 ARG A HG3  4  
ATOM 4240  H HD2  . ARG A 1 49 ? 4.932   -3.678  12.442  1.00 0.00 ? 49 ARG A HD2  4  
ATOM 4241  H HD3  . ARG A 1 49 ? 5.721   -2.886  11.078  1.00 0.00 ? 49 ARG A HD3  4  
ATOM 4242  H HE   . ARG A 1 49 ? 6.133   -1.486  13.533  1.00 0.00 ? 49 ARG A HE   4  
ATOM 4243  H HH11 . ARG A 1 49 ? 7.214   -4.183  11.616  1.00 0.00 ? 49 ARG A HH11 4  
ATOM 4244  H HH12 . ARG A 1 49 ? 8.806   -4.198  12.298  1.00 0.00 ? 49 ARG A HH12 4  
ATOM 4245  H HH21 . ARG A 1 49 ? 8.226   -1.494  14.439  1.00 0.00 ? 49 ARG A HH21 4  
ATOM 4246  H HH22 . ARG A 1 49 ? 9.381   -2.668  13.904  1.00 0.00 ? 49 ARG A HH22 4  
ATOM 4247  N N    . GLN A 1 50 ? 2.558   0.418   9.123   1.00 0.00 ? 50 GLN A N    4  
ATOM 4248  C CA   . GLN A 1 50 ? 1.219   0.374   8.547   1.00 0.00 ? 50 GLN A CA   4  
ATOM 4249  C C    . GLN A 1 50 ? 1.248   -0.240  7.151   1.00 0.00 ? 50 GLN A C    4  
ATOM 4250  O O    . GLN A 1 50 ? 0.529   -1.199  6.869   1.00 0.00 ? 50 GLN A O    4  
ATOM 4251  C CB   . GLN A 1 50 ? 0.621   1.780   8.487   1.00 0.00 ? 50 GLN A CB   4  
ATOM 4252  C CG   . GLN A 1 50 ? 0.182   2.313   9.841   1.00 0.00 ? 50 GLN A CG   4  
ATOM 4253  C CD   . GLN A 1 50 ? -0.993  3.265   9.741   1.00 0.00 ? 50 GLN A CD   4  
ATOM 4254  O OE1  . GLN A 1 50 ? -0.877  4.449   10.059  1.00 0.00 ? 50 GLN A OE1  4  
ATOM 4255  N NE2  . GLN A 1 50 ? -2.135  2.752   9.298   1.00 0.00 ? 50 GLN A NE2  4  
ATOM 4256  H H    . GLN A 1 50 ? 2.902   1.267   9.469   1.00 0.00 ? 50 GLN A H    4  
ATOM 4257  H HA   . GLN A 1 50 ? 0.604   -0.242  9.184   1.00 0.00 ? 50 GLN A HA   4  
ATOM 4258  H HB2  . GLN A 1 50 ? 1.358   2.455   8.079   1.00 0.00 ? 50 GLN A HB2  4  
ATOM 4259  H HB3  . GLN A 1 50 ? -0.240  1.764   7.835   1.00 0.00 ? 50 GLN A HB3  4  
ATOM 4260  H HG2  . GLN A 1 50 ? -0.102  1.480   10.467  1.00 0.00 ? 50 GLN A HG2  4  
ATOM 4261  H HG3  . GLN A 1 50 ? 1.012   2.835   10.294  1.00 0.00 ? 50 GLN A HG3  4  
ATOM 4262  H HE21 . GLN A 1 50 ? -2.154  1.799   9.064   1.00 0.00 ? 50 GLN A HE21 4  
ATOM 4263  H HE22 . GLN A 1 50 ? -2.911  3.344   9.224   1.00 0.00 ? 50 GLN A HE22 4  
ATOM 4264  N N    . ILE A 1 51 ? 2.082   0.320   6.281   1.00 0.00 ? 51 ILE A N    4  
ATOM 4265  C CA   . ILE A 1 51 ? 2.204   -0.173  4.915   1.00 0.00 ? 51 ILE A CA   4  
ATOM 4266  C C    . ILE A 1 51 ? 2.461   -1.676  4.893   1.00 0.00 ? 51 ILE A C    4  
ATOM 4267  O O    . ILE A 1 51 ? 1.864   -2.409  4.103   1.00 0.00 ? 51 ILE A O    4  
ATOM 4268  C CB   . ILE A 1 51 ? 3.339   0.541   4.158   1.00 0.00 ? 51 ILE A CB   4  
ATOM 4269  C CG1  . ILE A 1 51 ? 3.092   2.051   4.131   1.00 0.00 ? 51 ILE A CG1  4  
ATOM 4270  C CG2  . ILE A 1 51 ? 3.459   -0.006  2.743   1.00 0.00 ? 51 ILE A CG2  4  
ATOM 4271  C CD1  . ILE A 1 51 ? 4.331   2.860   3.816   1.00 0.00 ? 51 ILE A CD1  4  
ATOM 4272  H H    . ILE A 1 51 ? 2.629   1.082   6.565   1.00 0.00 ? 51 ILE A H    4  
ATOM 4273  H HA   . ILE A 1 51 ? 1.274   0.030   4.403   1.00 0.00 ? 51 ILE A HA   4  
ATOM 4274  H HB   . ILE A 1 51 ? 4.266   0.344   4.674   1.00 0.00 ? 51 ILE A HB   4  
ATOM 4275  H HG12 . ILE A 1 51 ? 2.351   2.276   3.381   1.00 0.00 ? 51 ILE A HG12 4  
ATOM 4276  H HG13 . ILE A 1 51 ? 2.727   2.366   5.098   1.00 0.00 ? 51 ILE A HG13 4  
ATOM 4277  H HG21 . ILE A 1 51 ? 2.675   -0.729  2.569   1.00 0.00 ? 51 ILE A HG21 4  
ATOM 4278  H HG22 . ILE A 1 51 ? 3.364   0.804   2.035   1.00 0.00 ? 51 ILE A HG22 4  
ATOM 4279  H HG23 . ILE A 1 51 ? 4.420   -0.481  2.621   1.00 0.00 ? 51 ILE A HG23 4  
ATOM 4280  H HD11 . ILE A 1 51 ? 4.865   3.073   4.731   1.00 0.00 ? 51 ILE A HD11 4  
ATOM 4281  H HD12 . ILE A 1 51 ? 4.967   2.300   3.148   1.00 0.00 ? 51 ILE A HD12 4  
ATOM 4282  H HD13 . ILE A 1 51 ? 4.044   3.789   3.344   1.00 0.00 ? 51 ILE A HD13 4  
ATOM 4283  N N    . THR A 1 52 ? 3.353   -2.131  5.768   1.00 0.00 ? 52 THR A N    4  
ATOM 4284  C CA   . THR A 1 52 ? 3.689   -3.546  5.851   1.00 0.00 ? 52 THR A CA   4  
ATOM 4285  C C    . THR A 1 52 ? 2.463   -4.383  6.196   1.00 0.00 ? 52 THR A C    4  
ATOM 4286  O O    . THR A 1 52 ? 2.180   -5.386  5.540   1.00 0.00 ? 52 THR A O    4  
ATOM 4287  C CB   . THR A 1 52 ? 4.784   -3.803  6.903   1.00 0.00 ? 52 THR A CB   4  
ATOM 4288  O OG1  . THR A 1 52 ? 5.974   -3.086  6.557   1.00 0.00 ? 52 THR A OG1  4  
ATOM 4289  C CG2  . THR A 1 52 ? 5.095   -5.288  7.010   1.00 0.00 ? 52 THR A CG2  4  
ATOM 4290  H H    . THR A 1 52 ? 3.795   -1.497  6.371   1.00 0.00 ? 52 THR A H    4  
ATOM 4291  H HA   . THR A 1 52 ? 4.065   -3.857  4.887   1.00 0.00 ? 52 THR A HA   4  
ATOM 4292  H HB   . THR A 1 52 ? 4.429   -3.455  7.863   1.00 0.00 ? 52 THR A HB   4  
ATOM 4293  H HG1  . THR A 1 52 ? 6.454   -2.857  7.357   1.00 0.00 ? 52 THR A HG1  4  
ATOM 4294  H HG21 . THR A 1 52 ? 4.747   -5.661  7.962   1.00 0.00 ? 52 THR A HG21 4  
ATOM 4295  H HG22 . THR A 1 52 ? 6.161   -5.440  6.931   1.00 0.00 ? 52 THR A HG22 4  
ATOM 4296  H HG23 . THR A 1 52 ? 4.596   -5.818  6.213   1.00 0.00 ? 52 THR A HG23 4  
ATOM 4297  N N    . ILE A 1 53 ? 1.738   -3.966  7.228   1.00 0.00 ? 53 ILE A N    4  
ATOM 4298  C CA   . ILE A 1 53 ? 0.541   -4.677  7.658   1.00 0.00 ? 53 ILE A CA   4  
ATOM 4299  C C    . ILE A 1 53 ? -0.410  -4.910  6.489   1.00 0.00 ? 53 ILE A C    4  
ATOM 4300  O O    . ILE A 1 53 ? -0.872  -6.029  6.266   1.00 0.00 ? 53 ILE A O    4  
ATOM 4301  C CB   . ILE A 1 53 ? -0.204  -3.907  8.765   1.00 0.00 ? 53 ILE A CB   4  
ATOM 4302  C CG1  . ILE A 1 53 ? 0.708   -3.701  9.976   1.00 0.00 ? 53 ILE A CG1  4  
ATOM 4303  C CG2  . ILE A 1 53 ? -1.469  -4.651  9.168   1.00 0.00 ? 53 ILE A CG2  4  
ATOM 4304  C CD1  . ILE A 1 53 ? 0.288   -2.547  10.859  1.00 0.00 ? 53 ILE A CD1  4  
ATOM 4305  H H    . ILE A 1 53 ? 2.015   -3.159  7.711   1.00 0.00 ? 53 ILE A H    4  
ATOM 4306  H HA   . ILE A 1 53 ? 0.847   -5.634  8.056   1.00 0.00 ? 53 ILE A HA   4  
ATOM 4307  H HB   . ILE A 1 53 ? -0.492  -2.944  8.372   1.00 0.00 ? 53 ILE A HB   4  
ATOM 4308  H HG12 . ILE A 1 53 ? 0.705   -4.596  10.577  1.00 0.00 ? 53 ILE A HG12 4  
ATOM 4309  H HG13 . ILE A 1 53 ? 1.713   -3.507  9.631   1.00 0.00 ? 53 ILE A HG13 4  
ATOM 4310  H HG21 . ILE A 1 53 ? -1.463  -5.636  8.725   1.00 0.00 ? 53 ILE A HG21 4  
ATOM 4311  H HG22 . ILE A 1 53 ? -1.506  -4.741  10.243  1.00 0.00 ? 53 ILE A HG22 4  
ATOM 4312  H HG23 . ILE A 1 53 ? -2.334  -4.105  8.822   1.00 0.00 ? 53 ILE A HG23 4  
ATOM 4313  H HD11 . ILE A 1 53 ? -0.417  -2.897  11.598  1.00 0.00 ? 53 ILE A HD11 4  
ATOM 4314  H HD12 . ILE A 1 53 ? 1.156   -2.137  11.354  1.00 0.00 ? 53 ILE A HD12 4  
ATOM 4315  H HD13 . ILE A 1 53 ? -0.176  -1.781  10.254  1.00 0.00 ? 53 ILE A HD13 4  
ATOM 4316  N N    . TRP A 1 54 ? -0.695  -3.848  5.745   1.00 0.00 ? 54 TRP A N    4  
ATOM 4317  C CA   . TRP A 1 54 ? -1.590  -3.938  4.596   1.00 0.00 ? 54 TRP A CA   4  
ATOM 4318  C C    . TRP A 1 54 ? -1.074  -4.953  3.583   1.00 0.00 ? 54 TRP A C    4  
ATOM 4319  O O    . TRP A 1 54 ? -1.839  -5.759  3.052   1.00 0.00 ? 54 TRP A O    4  
ATOM 4320  C CB   . TRP A 1 54 ? -1.740  -2.568  3.933   1.00 0.00 ? 54 TRP A CB   4  
ATOM 4321  C CG   . TRP A 1 54 ? -2.799  -2.534  2.873   1.00 0.00 ? 54 TRP A CG   4  
ATOM 4322  C CD1  . TRP A 1 54 ? -4.123  -2.246  3.046   1.00 0.00 ? 54 TRP A CD1  4  
ATOM 4323  C CD2  . TRP A 1 54 ? -2.624  -2.801  1.477   1.00 0.00 ? 54 TRP A CD2  4  
ATOM 4324  N NE1  . TRP A 1 54 ? -4.781  -2.317  1.842   1.00 0.00 ? 54 TRP A NE1  4  
ATOM 4325  C CE2  . TRP A 1 54 ? -3.884  -2.654  0.864   1.00 0.00 ? 54 TRP A CE2  4  
ATOM 4326  C CE3  . TRP A 1 54 ? -1.526  -3.146  0.686   1.00 0.00 ? 54 TRP A CE3  4  
ATOM 4327  C CZ2  . TRP A 1 54 ? -4.072  -2.843  -0.503  1.00 0.00 ? 54 TRP A CZ2  4  
ATOM 4328  C CZ3  . TRP A 1 54 ? -1.714  -3.334  -0.670  1.00 0.00 ? 54 TRP A CZ3  4  
ATOM 4329  C CH2  . TRP A 1 54 ? -2.979  -3.181  -1.254  1.00 0.00 ? 54 TRP A CH2  4  
ATOM 4330  H H    . TRP A 1 54 ? -0.296  -2.983  5.973   1.00 0.00 ? 54 TRP A H    4  
ATOM 4331  H HA   . TRP A 1 54 ? -2.556  -4.262  4.954   1.00 0.00 ? 54 TRP A HA   4  
ATOM 4332  H HB2  . TRP A 1 54 ? -1.997  -1.837  4.685   1.00 0.00 ? 54 TRP A HB2  4  
ATOM 4333  H HB3  . TRP A 1 54 ? -0.801  -2.293  3.475   1.00 0.00 ? 54 TRP A HB3  4  
ATOM 4334  H HD1  . TRP A 1 54 ? -4.573  -2.002  3.996   1.00 0.00 ? 54 TRP A HD1  4  
ATOM 4335  H HE1  . TRP A 1 54 ? -5.738  -2.150  1.706   1.00 0.00 ? 54 TRP A HE1  4  
ATOM 4336  H HE3  . TRP A 1 54 ? -0.543  -3.268  1.117   1.00 0.00 ? 54 TRP A HE3  4  
ATOM 4337  H HZ2  . TRP A 1 54 ? -5.041  -2.729  -0.967  1.00 0.00 ? 54 TRP A HZ2  4  
ATOM 4338  H HZ3  . TRP A 1 54 ? -0.877  -3.602  -1.298  1.00 0.00 ? 54 TRP A HZ3  4  
ATOM 4339  H HH2  . TRP A 1 54 ? -3.080  -3.338  -2.316  1.00 0.00 ? 54 TRP A HH2  4  
ATOM 4340  N N    . PHE A 1 55 ? 0.228   -4.910  3.318   1.00 0.00 ? 55 PHE A N    4  
ATOM 4341  C CA   . PHE A 1 55 ? 0.845   -5.827  2.367   1.00 0.00 ? 55 PHE A CA   4  
ATOM 4342  C C    . PHE A 1 55 ? 0.718   -7.271  2.843   1.00 0.00 ? 55 PHE A C    4  
ATOM 4343  O O    . PHE A 1 55 ? 0.686   -8.200  2.036   1.00 0.00 ? 55 PHE A O    4  
ATOM 4344  C CB   . PHE A 1 55 ? 2.320   -5.472  2.168   1.00 0.00 ? 55 PHE A CB   4  
ATOM 4345  C CG   . PHE A 1 55 ? 2.565   -4.560  0.999   1.00 0.00 ? 55 PHE A CG   4  
ATOM 4346  C CD1  . PHE A 1 55 ? 2.063   -3.269  0.994   1.00 0.00 ? 55 PHE A CD1  4  
ATOM 4347  C CD2  . PHE A 1 55 ? 3.296   -4.996  -0.094  1.00 0.00 ? 55 PHE A CD2  4  
ATOM 4348  C CE1  . PHE A 1 55 ? 2.287   -2.428  -0.079  1.00 0.00 ? 55 PHE A CE1  4  
ATOM 4349  C CE2  . PHE A 1 55 ? 3.523   -4.159  -1.170  1.00 0.00 ? 55 PHE A CE2  4  
ATOM 4350  C CZ   . PHE A 1 55 ? 3.017   -2.874  -1.164  1.00 0.00 ? 55 PHE A CZ   4  
ATOM 4351  H H    . PHE A 1 55 ? 0.786   -4.245  3.773   1.00 0.00 ? 55 PHE A H    4  
ATOM 4352  H HA   . PHE A 1 55 ? 0.329   -5.724  1.426   1.00 0.00 ? 55 PHE A HA   4  
ATOM 4353  H HB2  . PHE A 1 55 ? 2.687   -4.978  3.055   1.00 0.00 ? 55 PHE A HB2  4  
ATOM 4354  H HB3  . PHE A 1 55 ? 2.883   -6.379  2.007   1.00 0.00 ? 55 PHE A HB3  4  
ATOM 4355  H HD1  . PHE A 1 55 ? 1.491   -2.919  1.842   1.00 0.00 ? 55 PHE A HD1  4  
ATOM 4356  H HD2  . PHE A 1 55 ? 3.691   -6.001  -0.102  1.00 0.00 ? 55 PHE A HD2  4  
ATOM 4357  H HE1  . PHE A 1 55 ? 1.890   -1.423  -0.071  1.00 0.00 ? 55 PHE A HE1  4  
ATOM 4358  H HE2  . PHE A 1 55 ? 4.094   -4.510  -2.017  1.00 0.00 ? 55 PHE A HE2  4  
ATOM 4359  H HZ   . PHE A 1 55 ? 3.193   -2.218  -2.003  1.00 0.00 ? 55 PHE A HZ   4  
ATOM 4360  N N    . GLN A 1 56 ? 0.647   -7.451  4.158   1.00 0.00 ? 56 GLN A N    4  
ATOM 4361  C CA   . GLN A 1 56 ? 0.525   -8.782  4.741   1.00 0.00 ? 56 GLN A CA   4  
ATOM 4362  C C    . GLN A 1 56 ? -0.917  -9.275  4.673   1.00 0.00 ? 56 GLN A C    4  
ATOM 4363  O O    . GLN A 1 56 ? -1.175  -10.415 4.287   1.00 0.00 ? 56 GLN A O    4  
ATOM 4364  C CB   . GLN A 1 56 ? 1.005   -8.771  6.193   1.00 0.00 ? 56 GLN A CB   4  
ATOM 4365  C CG   . GLN A 1 56 ? 2.513   -8.898  6.337   1.00 0.00 ? 56 GLN A CG   4  
ATOM 4366  C CD   . GLN A 1 56 ? 3.022   -10.273 5.954   1.00 0.00 ? 56 GLN A CD   4  
ATOM 4367  O OE1  . GLN A 1 56 ? 2.248   -11.224 5.837   1.00 0.00 ? 56 GLN A OE1  4  
ATOM 4368  N NE2  . GLN A 1 56 ? 4.330   -10.387 5.757   1.00 0.00 ? 56 GLN A NE2  4  
ATOM 4369  H H    . GLN A 1 56 ? 0.677   -6.671  4.749   1.00 0.00 ? 56 GLN A H    4  
ATOM 4370  H HA   . GLN A 1 56 ? 1.149   -9.452  4.170   1.00 0.00 ? 56 GLN A HA   4  
ATOM 4371  H HB2  . GLN A 1 56 ? 0.697   -7.844  6.655   1.00 0.00 ? 56 GLN A HB2  4  
ATOM 4372  H HB3  . GLN A 1 56 ? 0.545   -9.595  6.718   1.00 0.00 ? 56 GLN A HB3  4  
ATOM 4373  H HG2  . GLN A 1 56 ? 2.985   -8.166  5.698   1.00 0.00 ? 56 GLN A HG2  4  
ATOM 4374  H HG3  . GLN A 1 56 ? 2.781   -8.703  7.365   1.00 0.00 ? 56 GLN A HG3  4  
ATOM 4375  H HE21 . GLN A 1 56 ? 4.886   -9.587  5.869   1.00 0.00 ? 56 GLN A HE21 4  
ATOM 4376  H HE22 . GLN A 1 56 ? 4.686   -11.265 5.509   1.00 0.00 ? 56 GLN A HE22 4  
ATOM 4377  N N    . ASN A 1 57 ? -1.852  -8.410  5.052   1.00 0.00 ? 57 ASN A N    4  
ATOM 4378  C CA   . ASN A 1 57 ? -3.268  -8.759  5.035   1.00 0.00 ? 57 ASN A CA   4  
ATOM 4379  C C    . ASN A 1 57 ? -3.752  -9.000  3.608   1.00 0.00 ? 57 ASN A C    4  
ATOM 4380  O O    . ASN A 1 57 ? -4.718  -9.729  3.384   1.00 0.00 ? 57 ASN A O    4  
ATOM 4381  C CB   . ASN A 1 57 ? -4.096  -7.649  5.685   1.00 0.00 ? 57 ASN A CB   4  
ATOM 4382  C CG   . ASN A 1 57 ? -4.256  -7.848  7.180   1.00 0.00 ? 57 ASN A CG   4  
ATOM 4383  O OD1  . ASN A 1 57 ? -5.029  -8.698  7.625   1.00 0.00 ? 57 ASN A OD1  4  
ATOM 4384  N ND2  . ASN A 1 57 ? -3.526  -7.063  7.963   1.00 0.00 ? 57 ASN A ND2  4  
ATOM 4385  H H    . ASN A 1 57 ? -1.584  -7.516  5.350   1.00 0.00 ? 57 ASN A H    4  
ATOM 4386  H HA   . ASN A 1 57 ? -3.392  -9.669  5.603   1.00 0.00 ? 57 ASN A HA   4  
ATOM 4387  H HB2  . ASN A 1 57 ? -3.608  -6.700  5.519   1.00 0.00 ? 57 ASN A HB2  4  
ATOM 4388  H HB3  . ASN A 1 57 ? -5.077  -7.629  5.236   1.00 0.00 ? 57 ASN A HB3  4  
ATOM 4389  H HD21 . ASN A 1 57 ? -2.932  -6.409  7.539   1.00 0.00 ? 57 ASN A HD21 4  
ATOM 4390  H HD22 . ASN A 1 57 ? -3.609  -7.171  8.934   1.00 0.00 ? 57 ASN A HD22 4  
ATOM 4391  N N    . ARG A 1 58 ? -3.072  -8.384  2.647   1.00 0.00 ? 58 ARG A N    4  
ATOM 4392  C CA   . ARG A 1 58 ? -3.433  -8.530  1.242   1.00 0.00 ? 58 ARG A CA   4  
ATOM 4393  C C    . ARG A 1 58 ? -3.041  -9.910  0.721   1.00 0.00 ? 58 ARG A C    4  
ATOM 4394  O O    . ARG A 1 58 ? -3.762  -10.512 -0.075  1.00 0.00 ? 58 ARG A O    4  
ATOM 4395  C CB   . ARG A 1 58 ? -2.754  -7.446  0.403   1.00 0.00 ? 58 ARG A CB   4  
ATOM 4396  C CG   . ARG A 1 58 ? -3.271  -7.367  -1.024  1.00 0.00 ? 58 ARG A CG   4  
ATOM 4397  C CD   . ARG A 1 58 ? -4.766  -7.096  -1.061  1.00 0.00 ? 58 ARG A CD   4  
ATOM 4398  N NE   . ARG A 1 58 ? -5.148  -6.009  -0.163  1.00 0.00 ? 58 ARG A NE   4  
ATOM 4399  C CZ   . ARG A 1 58 ? -6.386  -5.822  0.280   1.00 0.00 ? 58 ARG A CZ   4  
ATOM 4400  N NH1  . ARG A 1 58 ? -7.358  -6.646  -0.090  1.00 0.00 ? 58 ARG A NH1  4  
ATOM 4401  N NH2  . ARG A 1 58 ? -6.655  -4.810  1.095   1.00 0.00 ? 58 ARG A NH2  4  
ATOM 4402  H H    . ARG A 1 58 ? -2.311  -7.816  2.888   1.00 0.00 ? 58 ARG A H    4  
ATOM 4403  H HA   . ARG A 1 58 ? -4.503  -8.418  1.160   1.00 0.00 ? 58 ARG A HA   4  
ATOM 4404  H HB2  . ARG A 1 58 ? -2.917  -6.488  0.875   1.00 0.00 ? 58 ARG A HB2  4  
ATOM 4405  H HB3  . ARG A 1 58 ? -1.694  -7.645  0.368   1.00 0.00 ? 58 ARG A HB3  4  
ATOM 4406  H HG2  . ARG A 1 58 ? -2.759  -6.567  -1.539  1.00 0.00 ? 58 ARG A HG2  4  
ATOM 4407  H HG3  . ARG A 1 58 ? -3.071  -8.304  -1.522  1.00 0.00 ? 58 ARG A HG3  4  
ATOM 4408  H HD2  . ARG A 1 58 ? -5.046  -6.832  -2.070  1.00 0.00 ? 58 ARG A HD2  4  
ATOM 4409  H HD3  . ARG A 1 58 ? -5.288  -7.994  -0.767  1.00 0.00 ? 58 ARG A HD3  4  
ATOM 4410  H HE   . ARG A 1 58 ? -4.446  -5.389  0.122   1.00 0.00 ? 58 ARG A HE   4  
ATOM 4411  H HH11 . ARG A 1 58 ? -7.158  -7.410  -0.703  1.00 0.00 ? 58 ARG A HH11 4  
ATOM 4412  H HH12 . ARG A 1 58 ? -8.289  -6.504  0.246   1.00 0.00 ? 58 ARG A HH12 4  
ATOM 4413  H HH21 . ARG A 1 58 ? -5.926  -4.187  1.376   1.00 0.00 ? 58 ARG A HH21 4  
ATOM 4414  H HH22 . ARG A 1 58 ? -7.587  -4.671  1.427   1.00 0.00 ? 58 ARG A HH22 4  
ATOM 4415  N N    . ARG A 1 59 ? -1.894  -10.405 1.176   1.00 0.00 ? 59 ARG A N    4  
ATOM 4416  C CA   . ARG A 1 59 ? -1.406  -11.713 0.755   1.00 0.00 ? 59 ARG A CA   4  
ATOM 4417  C C    . ARG A 1 59 ? -2.054  -12.824 1.575   1.00 0.00 ? 59 ARG A C    4  
ATOM 4418  O O    . ARG A 1 59 ? -2.623  -13.767 1.023   1.00 0.00 ? 59 ARG A O    4  
ATOM 4419  C CB   . ARG A 1 59 ? 0.116   -11.782 0.894   1.00 0.00 ? 59 ARG A CB   4  
ATOM 4420  C CG   . ARG A 1 59 ? 0.862   -11.032 -0.197  1.00 0.00 ? 59 ARG A CG   4  
ATOM 4421  C CD   . ARG A 1 59 ? 2.261   -10.640 0.253   1.00 0.00 ? 59 ARG A CD   4  
ATOM 4422  N NE   . ARG A 1 59 ? 2.971   -11.757 0.869   1.00 0.00 ? 59 ARG A NE   4  
ATOM 4423  C CZ   . ARG A 1 59 ? 3.421   -12.807 0.191   1.00 0.00 ? 59 ARG A CZ   4  
ATOM 4424  N NH1  . ARG A 1 59 ? 3.236   -12.881 -1.120  1.00 0.00 ? 59 ARG A NH1  4  
ATOM 4425  N NH2  . ARG A 1 59 ? 4.058   -13.784 0.823   1.00 0.00 ? 59 ARG A NH2  4  
ATOM 4426  H H    . ARG A 1 59 ? -1.363  -9.878  1.809   1.00 0.00 ? 59 ARG A H    4  
ATOM 4427  H HA   . ARG A 1 59 ? -1.670  -11.847 -0.284  1.00 0.00 ? 59 ARG A HA   4  
ATOM 4428  H HB2  . ARG A 1 59 ? 0.398   -11.359 1.848   1.00 0.00 ? 59 ARG A HB2  4  
ATOM 4429  H HB3  . ARG A 1 59 ? 0.421   -12.817 0.864   1.00 0.00 ? 59 ARG A HB3  4  
ATOM 4430  H HG2  . ARG A 1 59 ? 0.941   -11.667 -1.068  1.00 0.00 ? 59 ARG A HG2  4  
ATOM 4431  H HG3  . ARG A 1 59 ? 0.310   -10.139 -0.449  1.00 0.00 ? 59 ARG A HG3  4  
ATOM 4432  H HD2  . ARG A 1 59 ? 2.820   -10.302 -0.607  1.00 0.00 ? 59 ARG A HD2  4  
ATOM 4433  H HD3  . ARG A 1 59 ? 2.181   -9.836  0.969   1.00 0.00 ? 59 ARG A HD3  4  
ATOM 4434  H HE   . ARG A 1 59 ? 3.118   -11.723 1.837   1.00 0.00 ? 59 ARG A HE   4  
ATOM 4435  H HH11 . ARG A 1 59 ? 2.758   -12.146 -1.599  1.00 0.00 ? 59 ARG A HH11 4  
ATOM 4436  H HH12 . ARG A 1 59 ? 3.578   -13.672 -1.629  1.00 0.00 ? 59 ARG A HH12 4  
ATOM 4437  H HH21 . ARG A 1 59 ? 4.199   -13.731 1.811   1.00 0.00 ? 59 ARG A HH21 4  
ATOM 4438  H HH22 . ARG A 1 59 ? 4.396   -14.573 0.311   1.00 0.00 ? 59 ARG A HH22 4  
ATOM 4439  N N    . VAL A 1 60 ? -1.963  -12.708 2.896   1.00 0.00 ? 60 VAL A N    4  
ATOM 4440  C CA   . VAL A 1 60 ? -2.540  -13.703 3.792   1.00 0.00 ? 60 VAL A CA   4  
ATOM 4441  C C    . VAL A 1 60 ? -4.013  -13.937 3.477   1.00 0.00 ? 60 VAL A C    4  
ATOM 4442  O O    . VAL A 1 60 ? -4.546  -15.022 3.714   1.00 0.00 ? 60 VAL A O    4  
ATOM 4443  C CB   . VAL A 1 60 ? -2.404  -13.277 5.266   1.00 0.00 ? 60 VAL A CB   4  
ATOM 4444  C CG1  . VAL A 1 60 ? -2.974  -14.345 6.186   1.00 0.00 ? 60 VAL A CG1  4  
ATOM 4445  C CG2  . VAL A 1 60 ? -0.948  -12.991 5.605   1.00 0.00 ? 60 VAL A CG2  4  
ATOM 4446  H H    . VAL A 1 60 ? -1.497  -11.935 3.277   1.00 0.00 ? 60 VAL A H    4  
ATOM 4447  H HA   . VAL A 1 60 ? -2.001  -14.629 3.655   1.00 0.00 ? 60 VAL A HA   4  
ATOM 4448  H HB   . VAL A 1 60 ? -2.970  -12.368 5.411   1.00 0.00 ? 60 VAL A HB   4  
ATOM 4449  H HG11 . VAL A 1 60 ? -3.990  -14.089 6.448   1.00 0.00 ? 60 VAL A HG11 4  
ATOM 4450  H HG12 . VAL A 1 60 ? -2.961  -15.300 5.681   1.00 0.00 ? 60 VAL A HG12 4  
ATOM 4451  H HG13 . VAL A 1 60 ? -2.375  -14.404 7.083   1.00 0.00 ? 60 VAL A HG13 4  
ATOM 4452  H HG21 . VAL A 1 60 ? -0.618  -13.672 6.374   1.00 0.00 ? 60 VAL A HG21 4  
ATOM 4453  H HG22 . VAL A 1 60 ? -0.340  -13.124 4.722   1.00 0.00 ? 60 VAL A HG22 4  
ATOM 4454  H HG23 . VAL A 1 60 ? -0.853  -11.975 5.957   1.00 0.00 ? 60 VAL A HG23 4  
ATOM 4455  N N    . LYS A 1 61 ? -4.668  -12.913 2.941   1.00 0.00 ? 61 LYS A N    4  
ATOM 4456  C CA   . LYS A 1 61 ? -6.081  -13.007 2.590   1.00 0.00 ? 61 LYS A CA   4  
ATOM 4457  C C    . LYS A 1 61 ? -6.342  -14.219 1.703   1.00 0.00 ? 61 LYS A C    4  
ATOM 4458  O O    . LYS A 1 61 ? -7.116  -15.106 2.061   1.00 0.00 ? 61 LYS A O    4  
ATOM 4459  C CB   . LYS A 1 61 ? -6.536  -11.732 1.877   1.00 0.00 ? 61 LYS A CB   4  
ATOM 4460  C CG   . LYS A 1 61 ? -7.933  -11.829 1.290   1.00 0.00 ? 61 LYS A CG   4  
ATOM 4461  C CD   . LYS A 1 61 ? -8.391  -10.498 0.716   1.00 0.00 ? 61 LYS A CD   4  
ATOM 4462  C CE   . LYS A 1 61 ? -7.947  -10.332 -0.729  1.00 0.00 ? 61 LYS A CE   4  
ATOM 4463  N NZ   . LYS A 1 61 ? -8.856  -11.041 -1.673  1.00 0.00 ? 61 LYS A NZ   4  
ATOM 4464  H H    . LYS A 1 61 ? -4.190  -12.073 2.776   1.00 0.00 ? 61 LYS A H    4  
ATOM 4465  H HA   . LYS A 1 61 ? -6.643  -13.117 3.505   1.00 0.00 ? 61 LYS A HA   4  
ATOM 4466  H HB2  . LYS A 1 61 ? -6.520  -10.914 2.582   1.00 0.00 ? 61 LYS A HB2  4  
ATOM 4467  H HB3  . LYS A 1 61 ? -5.845  -11.517 1.074   1.00 0.00 ? 61 LYS A HB3  4  
ATOM 4468  H HG2  . LYS A 1 61 ? -7.933  -12.567 0.502   1.00 0.00 ? 61 LYS A HG2  4  
ATOM 4469  H HG3  . LYS A 1 61 ? -8.620  -12.130 2.068   1.00 0.00 ? 61 LYS A HG3  4  
ATOM 4470  H HD2  . LYS A 1 61 ? -9.469  -10.449 0.758   1.00 0.00 ? 61 LYS A HD2  4  
ATOM 4471  H HD3  . LYS A 1 61 ? -7.969  -9.697  1.307   1.00 0.00 ? 61 LYS A HD3  4  
ATOM 4472  H HE2  . LYS A 1 61 ? -7.940  -9.281  -0.971  1.00 0.00 ? 61 LYS A HE2  4  
ATOM 4473  H HE3  . LYS A 1 61 ? -6.950  -10.733 -0.834  1.00 0.00 ? 61 LYS A HE3  4  
ATOM 4474  H HZ1  . LYS A 1 61 ? -8.885  -12.056 -1.446  1.00 0.00 ? 61 LYS A HZ1  4  
ATOM 4475  H HZ2  . LYS A 1 61 ? -8.517  -10.925 -2.649  1.00 0.00 ? 61 LYS A HZ2  4  
ATOM 4476  H HZ3  . LYS A 1 61 ? -9.818  -10.653 -1.602  1.00 0.00 ? 61 LYS A HZ3  4  
ATOM 4477  N N    . GLU A 1 62 ? -5.690  -14.251 0.545   1.00 0.00 ? 62 GLU A N    4  
ATOM 4478  C CA   . GLU A 1 62 ? -5.853  -15.356 -0.393  1.00 0.00 ? 62 GLU A CA   4  
ATOM 4479  C C    . GLU A 1 62 ? -5.309  -16.654 0.197   1.00 0.00 ? 62 GLU A C    4  
ATOM 4480  O O    . GLU A 1 62 ? -5.764  -17.745 -0.147  1.00 0.00 ? 62 GLU A O    4  
ATOM 4481  C CB   . GLU A 1 62 ? -5.142  -15.044 -1.711  1.00 0.00 ? 62 GLU A CB   4  
ATOM 4482  C CG   . GLU A 1 62 ? -3.681  -14.665 -1.540  1.00 0.00 ? 62 GLU A CG   4  
ATOM 4483  C CD   . GLU A 1 62 ? -2.879  -14.841 -2.815  1.00 0.00 ? 62 GLU A CD   4  
ATOM 4484  O OE1  . GLU A 1 62 ? -3.140  -14.103 -3.788  1.00 0.00 ? 62 GLU A OE1  4  
ATOM 4485  O OE2  . GLU A 1 62 ? -1.990  -15.718 -2.839  1.00 0.00 ? 62 GLU A OE2  4  
ATOM 4486  H H    . GLU A 1 62 ? -5.087  -13.514 0.315   1.00 0.00 ? 62 GLU A H    4  
ATOM 4487  H HA   . GLU A 1 62 ? -6.909  -15.477 -0.583  1.00 0.00 ? 62 GLU A HA   4  
ATOM 4488  H HB2  . GLU A 1 62 ? -5.195  -15.914 -2.349  1.00 0.00 ? 62 GLU A HB2  4  
ATOM 4489  H HB3  . GLU A 1 62 ? -5.651  -14.224 -2.195  1.00 0.00 ? 62 GLU A HB3  4  
ATOM 4490  H HG2  . GLU A 1 62 ? -3.624  -13.630 -1.238  1.00 0.00 ? 62 GLU A HG2  4  
ATOM 4491  H HG3  . GLU A 1 62 ? -3.248  -15.287 -0.771  1.00 0.00 ? 62 GLU A HG3  4  
ATOM 4492  N N    . LYS A 1 63 ? -4.330  -16.528 1.087   1.00 0.00 ? 63 LYS A N    4  
ATOM 4493  C CA   . LYS A 1 63 ? -3.722  -17.689 1.726   1.00 0.00 ? 63 LYS A CA   4  
ATOM 4494  C C    . LYS A 1 63 ? -4.733  -18.417 2.607   1.00 0.00 ? 63 LYS A C    4  
ATOM 4495  O O    . LYS A 1 63 ? -4.633  -19.626 2.817   1.00 0.00 ? 63 LYS A O    4  
ATOM 4496  C CB   . LYS A 1 63 ? -2.515  -17.262 2.564   1.00 0.00 ? 63 LYS A CB   4  
ATOM 4497  C CG   . LYS A 1 63 ? -1.312  -16.852 1.732   1.00 0.00 ? 63 LYS A CG   4  
ATOM 4498  C CD   . LYS A 1 63 ? -0.585  -18.062 1.168   1.00 0.00 ? 63 LYS A CD   4  
ATOM 4499  C CE   . LYS A 1 63 ? 0.844   -17.721 0.775   1.00 0.00 ? 63 LYS A CE   4  
ATOM 4500  N NZ   . LYS A 1 63 ? 1.474   -18.809 -0.023  1.00 0.00 ? 63 LYS A NZ   4  
ATOM 4501  H H    . LYS A 1 63 ? -4.009  -15.631 1.321   1.00 0.00 ? 63 LYS A H    4  
ATOM 4502  H HA   . LYS A 1 63 ? -3.391  -18.360 0.949   1.00 0.00 ? 63 LYS A HA   4  
ATOM 4503  H HB2  . LYS A 1 63 ? -2.800  -16.425 3.184   1.00 0.00 ? 63 LYS A HB2  4  
ATOM 4504  H HB3  . LYS A 1 63 ? -2.223  -18.086 3.199   1.00 0.00 ? 63 LYS A HB3  4  
ATOM 4505  H HG2  . LYS A 1 63 ? -1.646  -16.233 0.913   1.00 0.00 ? 63 LYS A HG2  4  
ATOM 4506  H HG3  . LYS A 1 63 ? -0.629  -16.292 2.354   1.00 0.00 ? 63 LYS A HG3  4  
ATOM 4507  H HD2  . LYS A 1 63 ? -0.565  -18.840 1.916   1.00 0.00 ? 63 LYS A HD2  4  
ATOM 4508  H HD3  . LYS A 1 63 ? -1.116  -18.414 0.294   1.00 0.00 ? 63 LYS A HD3  4  
ATOM 4509  H HE2  . LYS A 1 63 ? 0.836   -16.815 0.189   1.00 0.00 ? 63 LYS A HE2  4  
ATOM 4510  H HE3  . LYS A 1 63 ? 1.422   -17.563 1.674   1.00 0.00 ? 63 LYS A HE3  4  
ATOM 4511  H HZ1  . LYS A 1 63 ? 2.452   -18.551 -0.267  1.00 0.00 ? 63 LYS A HZ1  4  
ATOM 4512  H HZ2  . LYS A 1 63 ? 0.939   -18.964 -0.900  1.00 0.00 ? 63 LYS A HZ2  4  
ATOM 4513  H HZ3  . LYS A 1 63 ? 1.487   -19.693 0.525   1.00 0.00 ? 63 LYS A HZ3  4  
ATOM 4514  N N    . LYS A 1 64 ? -5.708  -17.673 3.119   1.00 0.00 ? 64 LYS A N    4  
ATOM 4515  C CA   . LYS A 1 64 ? -6.740  -18.247 3.975   1.00 0.00 ? 64 LYS A CA   4  
ATOM 4516  C C    . LYS A 1 64 ? -7.494  -19.356 3.248   1.00 0.00 ? 64 LYS A C    4  
ATOM 4517  O O    . LYS A 1 64 ? -7.920  -19.185 2.106   1.00 0.00 ? 64 LYS A O    4  
ATOM 4518  C CB   . LYS A 1 64 ? -7.718  -17.162 4.427   1.00 0.00 ? 64 LYS A CB   4  
ATOM 4519  C CG   . LYS A 1 64 ? -8.580  -17.573 5.609   1.00 0.00 ? 64 LYS A CG   4  
ATOM 4520  C CD   . LYS A 1 64 ? -7.892  -17.277 6.931   1.00 0.00 ? 64 LYS A CD   4  
ATOM 4521  C CE   . LYS A 1 64 ? -7.033  -18.446 7.387   1.00 0.00 ? 64 LYS A CE   4  
ATOM 4522  N NZ   . LYS A 1 64 ? -6.867  -18.469 8.866   1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4523  H H    . LYS A 1 64 ? -5.735  -16.714 2.915   1.00 0.00 ? 64 LYS A H    4  
ATOM 4524  H HA   . LYS A 1 64 ? -6.255  -18.668 4.843   1.00 0.00 ? 64 LYS A HA   4  
ATOM 4525  H HB2  . LYS A 1 64 ? -7.158  -16.282 4.706   1.00 0.00 ? 64 LYS A HB2  4  
ATOM 4526  H HB3  . LYS A 1 64 ? -8.371  -16.915 3.602   1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4527  H HG2  . LYS A 1 64 ? -9.512  -17.029 5.570   1.00 0.00 ? 64 LYS A HG2  4  
ATOM 4528  H HG3  . LYS A 1 64 ? -8.777  -18.634 5.546   1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4529  H HD2  . LYS A 1 64 ? -7.262  -16.407 6.812   1.00 0.00 ? 64 LYS A HD2  4  
ATOM 4530  H HD3  . LYS A 1 64 ? -8.644  -17.079 7.681   1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4531  H HE2  . LYS A 1 64 ? -7.503  -19.365 7.072   1.00 0.00 ? 64 LYS A HE2  4  
ATOM 4532  H HE3  . LYS A 1 64 ? -6.060  -18.363 6.925   1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4533  H HZ1  . LYS A 1 64 ? -7.593  -19.077 9.298   1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4534  H HZ2  . LYS A 1 64 ? -6.964  -17.508 9.251   1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4535  H HZ3  . LYS A 1 64 ? -5.928  -18.838 9.115   1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4536  N N    . SER A 1 65 ? -7.657  -20.492 3.918   1.00 0.00 ? 65 SER A N    4  
ATOM 4537  C CA   . SER A 1 65 ? -8.359  -21.630 3.335   1.00 0.00 ? 65 SER A CA   4  
ATOM 4538  C C    . SER A 1 65 ? -9.818  -21.283 3.055   1.00 0.00 ? 65 SER A C    4  
ATOM 4539  O O    . SER A 1 65 ? -10.460 -20.577 3.832   1.00 0.00 ? 65 SER A O    4  
ATOM 4540  C CB   . SER A 1 65 ? -8.281  -22.838 4.270   1.00 0.00 ? 65 SER A CB   4  
ATOM 4541  O OG   . SER A 1 65 ? -8.556  -24.041 3.573   1.00 0.00 ? 65 SER A OG   4  
ATOM 4542  H H    . SER A 1 65 ? -7.295  -20.568 4.826   1.00 0.00 ? 65 SER A H    4  
ATOM 4543  H HA   . SER A 1 65 ? -7.874  -21.876 2.402   1.00 0.00 ? 65 SER A HA   4  
ATOM 4544  H HB2  . SER A 1 65 ? -7.289  -22.900 4.693   1.00 0.00 ? 65 SER A HB2  4  
ATOM 4545  H HB3  . SER A 1 65 ? -9.004  -22.723 5.065   1.00 0.00 ? 65 SER A HB3  4  
ATOM 4546  H HG   . SER A 1 65 ? -8.393  -24.790 4.151   1.00 0.00 ? 65 SER A HG   4  
ATOM 4547  N N    . GLY A 1 66 ? -10.335 -21.785 1.938   1.00 0.00 ? 66 GLY A N    4  
ATOM 4548  C CA   . GLY A 1 66 ? -11.715 -21.518 1.574   1.00 0.00 ? 66 GLY A CA   4  
ATOM 4549  C C    . GLY A 1 66 ? -11.944 -20.068 1.197   1.00 0.00 ? 66 GLY A C    4  
ATOM 4550  O O    . GLY A 1 66 ? -11.062 -19.221 1.336   1.00 0.00 ? 66 GLY A O    4  
ATOM 4551  H H    . GLY A 1 66 ? -9.776  -22.342 1.356   1.00 0.00 ? 66 GLY A H    4  
ATOM 4552  H HA2  . GLY A 1 66 ? -11.982 -22.144 0.735   1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4553  H HA3  . GLY A 1 66 ? -12.350 -21.765 2.411   1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4554  N N    . PRO A 1 67 ? -13.155 -19.765 0.705   1.00 0.00 ? 67 PRO A N    4  
ATOM 4555  C CA   . PRO A 1 67 ? -13.525 -18.407 0.295   1.00 0.00 ? 67 PRO A CA   4  
ATOM 4556  C C    . PRO A 1 67 ? -13.662 -17.460 1.483   1.00 0.00 ? 67 PRO A C    4  
ATOM 4557  O O    . PRO A 1 67 ? -13.587 -17.882 2.637   1.00 0.00 ? 67 PRO A O    4  
ATOM 4558  C CB   . PRO A 1 67 ? -14.879 -18.601 -0.393  1.00 0.00 ? 67 PRO A CB   4  
ATOM 4559  C CG   . PRO A 1 67 ? -15.436 -19.843 0.212   1.00 0.00 ? 67 PRO A CG   4  
ATOM 4560  C CD   . PRO A 1 67 ? -14.255 -20.724 0.512   1.00 0.00 ? 67 PRO A CD   4  
ATOM 4561  H HA   . PRO A 1 67 ? -12.817 -17.998 -0.410  1.00 0.00 ? 67 PRO A HA   4  
ATOM 4562  H HB2  . PRO A 1 67 ? -15.511 -17.747 -0.196  1.00 0.00 ? 67 PRO A HB2  4  
ATOM 4563  H HB3  . PRO A 1 67 ? -14.733 -18.711 -1.457  1.00 0.00 ? 67 PRO A HB3  4  
ATOM 4564  H HG2  . PRO A 1 67 ? -15.966 -19.604 1.121   1.00 0.00 ? 67 PRO A HG2  4  
ATOM 4565  H HG3  . PRO A 1 67 ? -16.096 -20.329 -0.492  1.00 0.00 ? 67 PRO A HG3  4  
ATOM 4566  H HD2  . PRO A 1 67 ? -14.430 -21.297 1.411   1.00 0.00 ? 67 PRO A HD2  4  
ATOM 4567  H HD3  . PRO A 1 67 ? -14.052 -21.380 -0.322  1.00 0.00 ? 67 PRO A HD3  4  
ATOM 4568  N N    . SER A 1 68 ? -13.865 -16.179 1.192   1.00 0.00 ? 68 SER A N    4  
ATOM 4569  C CA   . SER A 1 68 ? -14.009 -15.172 2.237   1.00 0.00 ? 68 SER A CA   4  
ATOM 4570  C C    . SER A 1 68 ? -14.803 -13.972 1.729   1.00 0.00 ? 68 SER A C    4  
ATOM 4571  O O    . SER A 1 68 ? -14.948 -13.775 0.522   1.00 0.00 ? 68 SER A O    4  
ATOM 4572  C CB   . SER A 1 68 ? -12.634 -14.716 2.729   1.00 0.00 ? 68 SER A CB   4  
ATOM 4573  O OG   . SER A 1 68 ? -12.754 -13.798 3.801   1.00 0.00 ? 68 SER A OG   4  
ATOM 4574  H H    . SER A 1 68 ? -13.915 -15.905 0.253   1.00 0.00 ? 68 SER A H    4  
ATOM 4575  H HA   . SER A 1 68 ? -14.545 -15.622 3.059   1.00 0.00 ? 68 SER A HA   4  
ATOM 4576  H HB2  . SER A 1 68 ? -12.072 -15.574 3.066   1.00 0.00 ? 68 SER A HB2  4  
ATOM 4577  H HB3  . SER A 1 68 ? -12.105 -14.236 1.917   1.00 0.00 ? 68 SER A HB3  4  
ATOM 4578  H HG   . SER A 1 68 ? -12.589 -14.251 4.631   1.00 0.00 ? 68 SER A HG   4  
ATOM 4579  N N    . SER A 1 69 ? -15.317 -13.174 2.659   1.00 0.00 ? 69 SER A N    4  
ATOM 4580  C CA   . SER A 1 69 ? -16.101 -11.996 2.307   1.00 0.00 ? 69 SER A CA   4  
ATOM 4581  C C    . SER A 1 69 ? -15.606 -10.768 3.065   1.00 0.00 ? 69 SER A C    4  
ATOM 4582  O O    . SER A 1 69 ? -15.559 -10.760 4.295   1.00 0.00 ? 69 SER A O    4  
ATOM 4583  C CB   . SER A 1 69 ? -17.582 -12.233 2.610   1.00 0.00 ? 69 SER A CB   4  
ATOM 4584  O OG   . SER A 1 69 ? -18.396 -11.283 1.945   1.00 0.00 ? 69 SER A OG   4  
ATOM 4585  H H    . SER A 1 69 ? -15.168 -13.384 3.605   1.00 0.00 ? 69 SER A H    4  
ATOM 4586  H HA   . SER A 1 69 ? -15.981 -11.822 1.248   1.00 0.00 ? 69 SER A HA   4  
ATOM 4587  H HB2  . SER A 1 69 ? -17.860 -13.222 2.279   1.00 0.00 ? 69 SER A HB2  4  
ATOM 4588  H HB3  . SER A 1 69 ? -17.747 -12.149 3.674   1.00 0.00 ? 69 SER A HB3  4  
ATOM 4589  H HG   . SER A 1 69 ? -18.082 -10.397 2.143   1.00 0.00 ? 69 SER A HG   4  
ATOM 4590  N N    . GLY A 1 70 ? -15.236 -9.729  2.321   1.00 0.00 ? 70 GLY A N    4  
ATOM 4591  C CA   . GLY A 1 70 ? -14.749 -8.510  2.939   1.00 0.00 ? 70 GLY A CA   4  
ATOM 4592  C C    . GLY A 1 70 ? -15.290 -7.264  2.268   1.00 0.00 ? 70 GLY A C    4  
ATOM 4593  O O    . GLY A 1 70 ? -14.757 -6.815  1.253   1.00 0.00 ? 70 GLY A O    4  
ATOM 4594  H H    . GLY A 1 70 ? -15.295 -9.792  1.345   1.00 0.00 ? 70 GLY A H    4  
ATOM 4595  H HA2  . GLY A 1 70 ? -15.043 -8.503  3.978   1.00 0.00 ? 70 GLY A HA2  4  
ATOM 4596  H HA3  . GLY A 1 70 ? -13.670 -8.497  2.880   1.00 0.00 ? 70 GLY A HA3  4  
ATOM 4597  N N    . GLY A 1 1  ? -10.079 18.250  18.175  1.00 0.00 ? 1  GLY A N    5  
ATOM 4598  C CA   . GLY A 1 1  ? -10.893 17.317  17.416  1.00 0.00 ? 1  GLY A CA   5  
ATOM 4599  C C    . GLY A 1 1  ? -10.438 15.881  17.585  1.00 0.00 ? 1  GLY A C    5  
ATOM 4600  O O    . GLY A 1 1  ? -10.445 15.347  18.694  1.00 0.00 ? 1  GLY A O    5  
ATOM 4601  H H1   . GLY A 1 1  ? -9.342  18.723  17.736  1.00 0.00 ? 1  GLY A H1   5  
ATOM 4602  H HA2  . GLY A 1 1  ? -11.918 17.400  17.745  1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4603  H HA3  . GLY A 1 1  ? -10.839 17.579  16.370  1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4604  N N    . SER A 1 2  ? -10.042 15.254  16.482  1.00 0.00 ? 2  SER A N    5  
ATOM 4605  C CA   . SER A 1 2  ? -9.587  13.869  16.511  1.00 0.00 ? 2  SER A CA   5  
ATOM 4606  C C    . SER A 1 2  ? -10.614 12.974  17.198  1.00 0.00 ? 2  SER A C    5  
ATOM 4607  O O    . SER A 1 2  ? -10.276 12.185  18.080  1.00 0.00 ? 2  SER A O    5  
ATOM 4608  C CB   . SER A 1 2  ? -8.242  13.767  17.233  1.00 0.00 ? 2  SER A CB   5  
ATOM 4609  O OG   . SER A 1 2  ? -7.495  12.657  16.765  1.00 0.00 ? 2  SER A OG   5  
ATOM 4610  H H    . SER A 1 2  ? -10.059 15.734  15.627  1.00 0.00 ? 2  SER A H    5  
ATOM 4611  H HA   . SER A 1 2  ? -9.464  13.539  15.491  1.00 0.00 ? 2  SER A HA   5  
ATOM 4612  H HB2  . SER A 1 2  ? -7.673  14.668  17.058  1.00 0.00 ? 2  SER A HB2  5  
ATOM 4613  H HB3  . SER A 1 2  ? -8.413  13.650  18.293  1.00 0.00 ? 2  SER A HB3  5  
ATOM 4614  H HG   . SER A 1 2  ? -7.450  12.683  15.807  1.00 0.00 ? 2  SER A HG   5  
ATOM 4615  N N    . SER A 1 3  ? -11.872 13.103  16.786  1.00 0.00 ? 3  SER A N    5  
ATOM 4616  C CA   . SER A 1 3  ? -12.950 12.310  17.363  1.00 0.00 ? 3  SER A CA   5  
ATOM 4617  C C    . SER A 1 3  ? -13.811 11.686  16.269  1.00 0.00 ? 3  SER A C    5  
ATOM 4618  O O    . SER A 1 3  ? -14.350 12.387  15.413  1.00 0.00 ? 3  SER A O    5  
ATOM 4619  C CB   . SER A 1 3  ? -13.817 13.178  18.277  1.00 0.00 ? 3  SER A CB   5  
ATOM 4620  O OG   . SER A 1 3  ? -13.938 14.494  17.767  1.00 0.00 ? 3  SER A OG   5  
ATOM 4621  H H    . SER A 1 3  ? -12.078 13.750  16.079  1.00 0.00 ? 3  SER A H    5  
ATOM 4622  H HA   . SER A 1 3  ? -12.504 11.520  17.948  1.00 0.00 ? 3  SER A HA   5  
ATOM 4623  H HB2  . SER A 1 3  ? -14.802 12.743  18.355  1.00 0.00 ? 3  SER A HB2  5  
ATOM 4624  H HB3  . SER A 1 3  ? -13.366 13.225  19.258  1.00 0.00 ? 3  SER A HB3  5  
ATOM 4625  H HG   . SER A 1 3  ? -14.520 15.006  18.334  1.00 0.00 ? 3  SER A HG   5  
ATOM 4626  N N    . GLY A 1 4  ? -13.936 10.363  16.304  1.00 0.00 ? 4  GLY A N    5  
ATOM 4627  C CA   . GLY A 1 4  ? -14.732 9.666   15.311  1.00 0.00 ? 4  GLY A CA   5  
ATOM 4628  C C    . GLY A 1 4  ? -15.688 8.666   15.932  1.00 0.00 ? 4  GLY A C    5  
ATOM 4629  O O    . GLY A 1 4  ? -16.273 8.927   16.983  1.00 0.00 ? 4  GLY A O    5  
ATOM 4630  H H    . GLY A 1 4  ? -13.483 9.856   17.011  1.00 0.00 ? 4  GLY A H    5  
ATOM 4631  H HA2  . GLY A 1 4  ? -15.301 10.391  14.748  1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4632  H HA3  . GLY A 1 4  ? -14.069 9.142   14.638  1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4633  N N    . SER A 1 5  ? -15.847 7.519   15.279  1.00 0.00 ? 5  SER A N    5  
ATOM 4634  C CA   . SER A 1 5  ? -16.744 6.479   15.771  1.00 0.00 ? 5  SER A CA   5  
ATOM 4635  C C    . SER A 1 5  ? -16.041 5.125   15.797  1.00 0.00 ? 5  SER A C    5  
ATOM 4636  O O    . SER A 1 5  ? -15.461 4.695   14.801  1.00 0.00 ? 5  SER A O    5  
ATOM 4637  C CB   . SER A 1 5  ? -17.996 6.400   14.896  1.00 0.00 ? 5  SER A CB   5  
ATOM 4638  O OG   . SER A 1 5  ? -18.911 5.443   15.400  1.00 0.00 ? 5  SER A OG   5  
ATOM 4639  H H    . SER A 1 5  ? -15.353 7.370   14.446  1.00 0.00 ? 5  SER A H    5  
ATOM 4640  H HA   . SER A 1 5  ? -17.034 6.740   16.777  1.00 0.00 ? 5  SER A HA   5  
ATOM 4641  H HB2  . SER A 1 5  ? -18.478 7.365   14.874  1.00 0.00 ? 5  SER A HB2  5  
ATOM 4642  H HB3  . SER A 1 5  ? -17.713 6.116   13.892  1.00 0.00 ? 5  SER A HB3  5  
ATOM 4643  H HG   . SER A 1 5  ? -19.798 5.662   15.107  1.00 0.00 ? 5  SER A HG   5  
ATOM 4644  N N    . SER A 1 6  ? -16.099 4.458   16.945  1.00 0.00 ? 6  SER A N    5  
ATOM 4645  C CA   . SER A 1 6  ? -15.465 3.154   17.104  1.00 0.00 ? 6  SER A CA   5  
ATOM 4646  C C    . SER A 1 6  ? -16.500 2.086   17.446  1.00 0.00 ? 6  SER A C    5  
ATOM 4647  O O    . SER A 1 6  ? -16.444 1.469   18.509  1.00 0.00 ? 6  SER A O    5  
ATOM 4648  C CB   . SER A 1 6  ? -14.396 3.213   18.197  1.00 0.00 ? 6  SER A CB   5  
ATOM 4649  O OG   . SER A 1 6  ? -13.201 3.797   17.710  1.00 0.00 ? 6  SER A OG   5  
ATOM 4650  H H    . SER A 1 6  ? -16.577 4.853   17.704  1.00 0.00 ? 6  SER A H    5  
ATOM 4651  H HA   . SER A 1 6  ? -14.996 2.897   16.167  1.00 0.00 ? 6  SER A HA   5  
ATOM 4652  H HB2  . SER A 1 6  ? -14.761 3.804   19.023  1.00 0.00 ? 6  SER A HB2  5  
ATOM 4653  H HB3  . SER A 1 6  ? -14.180 2.211   18.539  1.00 0.00 ? 6  SER A HB3  5  
ATOM 4654  H HG   . SER A 1 6  ? -12.836 4.383   18.377  1.00 0.00 ? 6  SER A HG   5  
ATOM 4655  N N    . GLY A 1 7  ? -17.444 1.872   16.535  1.00 0.00 ? 7  GLY A N    5  
ATOM 4656  C CA   . GLY A 1 7  ? -18.478 0.879   16.757  1.00 0.00 ? 7  GLY A CA   5  
ATOM 4657  C C    . GLY A 1 7  ? -18.163 -0.446  16.090  1.00 0.00 ? 7  GLY A C    5  
ATOM 4658  O O    . GLY A 1 7  ? -16.996 -0.806  15.931  1.00 0.00 ? 7  GLY A O    5  
ATOM 4659  H H    . GLY A 1 7  ? -17.439 2.394   15.705  1.00 0.00 ? 7  GLY A H    5  
ATOM 4660  H HA2  . GLY A 1 7  ? -18.586 0.719   17.819  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4661  H HA3  . GLY A 1 7  ? -19.412 1.253   16.363  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4662  N N    . ARG A 1 8  ? -19.204 -1.174  15.702  1.00 0.00 ? 8  ARG A N    5  
ATOM 4663  C CA   . ARG A 1 8  ? -19.032 -2.468  15.052  1.00 0.00 ? 8  ARG A CA   5  
ATOM 4664  C C    . ARG A 1 8  ? -18.982 -2.312  13.535  1.00 0.00 ? 8  ARG A C    5  
ATOM 4665  O O    . ARG A 1 8  ? -19.241 -1.232  13.002  1.00 0.00 ? 8  ARG A O    5  
ATOM 4666  C CB   . ARG A 1 8  ? -20.170 -3.413  15.441  1.00 0.00 ? 8  ARG A CB   5  
ATOM 4667  C CG   . ARG A 1 8  ? -19.918 -4.171  16.734  1.00 0.00 ? 8  ARG A CG   5  
ATOM 4668  C CD   . ARG A 1 8  ? -18.833 -5.222  16.561  1.00 0.00 ? 8  ARG A CD   5  
ATOM 4669  N NE   . ARG A 1 8  ? -18.214 -5.585  17.833  1.00 0.00 ? 8  ARG A NE   5  
ATOM 4670  C CZ   . ARG A 1 8  ? -17.051 -6.219  17.931  1.00 0.00 ? 8  ARG A CZ   5  
ATOM 4671  N NH1  . ARG A 1 8  ? -16.383 -6.557  16.836  1.00 0.00 ? 8  ARG A NH1  5  
ATOM 4672  N NH2  . ARG A 1 8  ? -16.553 -6.515  19.124  1.00 0.00 ? 8  ARG A NH2  5  
ATOM 4673  H H    . ARG A 1 8  ? -20.110 -0.834  15.857  1.00 0.00 ? 8  ARG A H    5  
ATOM 4674  H HA   . ARG A 1 8  ? -18.096 -2.887  15.390  1.00 0.00 ? 8  ARG A HA   5  
ATOM 4675  H HB2  . ARG A 1 8  ? -21.077 -2.838  15.558  1.00 0.00 ? 8  ARG A HB2  5  
ATOM 4676  H HB3  . ARG A 1 8  ? -20.310 -4.133  14.649  1.00 0.00 ? 8  ARG A HB3  5  
ATOM 4677  H HG2  . ARG A 1 8  ? -19.607 -3.471  17.496  1.00 0.00 ? 8  ARG A HG2  5  
ATOM 4678  H HG3  . ARG A 1 8  ? -20.832 -4.656  17.040  1.00 0.00 ? 8  ARG A HG3  5  
ATOM 4679  H HD2  . ARG A 1 8  ? -19.272 -6.105  16.121  1.00 0.00 ? 8  ARG A HD2  5  
ATOM 4680  H HD3  . ARG A 1 8  ? -18.073 -4.831  15.901  1.00 0.00 ? 8  ARG A HD3  5  
ATOM 4681  H HE   . ARG A 1 8  ? -18.691 -5.345  18.655  1.00 0.00 ? 8  ARG A HE   5  
ATOM 4682  H HH11 . ARG A 1 8  ? -16.755 -6.334  15.936  1.00 0.00 ? 8  ARG A HH11 5  
ATOM 4683  H HH12 . ARG A 1 8  ? -15.506 -7.032  16.912  1.00 0.00 ? 8  ARG A HH12 5  
ATOM 4684  H HH21 . ARG A 1 8  ? -17.053 -6.261  19.952  1.00 0.00 ? 8  ARG A HH21 5  
ATOM 4685  H HH22 . ARG A 1 8  ? -15.677 -6.991  19.197  1.00 0.00 ? 8  ARG A HH22 5  
ATOM 4686  N N    . LYS A 1 9  ? -18.648 -3.396  12.844  1.00 0.00 ? 9  LYS A N    5  
ATOM 4687  C CA   . LYS A 1 9  ? -18.565 -3.382  11.389  1.00 0.00 ? 9  LYS A CA   5  
ATOM 4688  C C    . LYS A 1 9  ? -17.623 -2.282  10.909  1.00 0.00 ? 9  LYS A C    5  
ATOM 4689  O O    . LYS A 1 9  ? -17.929 -1.557  9.962   1.00 0.00 ? 9  LYS A O    5  
ATOM 4690  C CB   . LYS A 1 9  ? -19.954 -3.180  10.780  1.00 0.00 ? 9  LYS A CB   5  
ATOM 4691  C CG   . LYS A 1 9  ? -20.980 -4.195  11.254  1.00 0.00 ? 9  LYS A CG   5  
ATOM 4692  C CD   . LYS A 1 9  ? -22.188 -4.239  10.334  1.00 0.00 ? 9  LYS A CD   5  
ATOM 4693  C CE   . LYS A 1 9  ? -23.370 -4.928  10.999  1.00 0.00 ? 9  LYS A CE   5  
ATOM 4694  N NZ   . LYS A 1 9  ? -24.350 -5.435  9.999   1.00 0.00 ? 9  LYS A NZ   5  
ATOM 4695  H H    . LYS A 1 9  ? -18.454 -4.228  13.326  1.00 0.00 ? 9  LYS A H    5  
ATOM 4696  H HA   . LYS A 1 9  ? -18.176 -4.337  11.069  1.00 0.00 ? 9  LYS A HA   5  
ATOM 4697  H HB2  . LYS A 1 9  ? -20.308 -2.193  11.039  1.00 0.00 ? 9  LYS A HB2  5  
ATOM 4698  H HB3  . LYS A 1 9  ? -19.877 -3.254  9.704   1.00 0.00 ? 9  LYS A HB3  5  
ATOM 4699  H HG2  . LYS A 1 9  ? -20.522 -5.173  11.277  1.00 0.00 ? 9  LYS A HG2  5  
ATOM 4700  H HG3  . LYS A 1 9  ? -21.306 -3.925  12.249  1.00 0.00 ? 9  LYS A HG3  5  
ATOM 4701  H HD2  . LYS A 1 9  ? -22.472 -3.229  10.078  1.00 0.00 ? 9  LYS A HD2  5  
ATOM 4702  H HD3  . LYS A 1 9  ? -21.925 -4.780  9.436   1.00 0.00 ? 9  LYS A HD3  5  
ATOM 4703  H HE2  . LYS A 1 9  ? -23.004 -5.758  11.583  1.00 0.00 ? 9  LYS A HE2  5  
ATOM 4704  H HE3  . LYS A 1 9  ? -23.864 -4.220  11.648  1.00 0.00 ? 9  LYS A HE3  5  
ATOM 4705  H HZ1  . LYS A 1 9  ? -24.694 -6.375  10.281  1.00 0.00 ? 9  LYS A HZ1  5  
ATOM 4706  H HZ2  . LYS A 1 9  ? -23.901 -5.508  9.064   1.00 0.00 ? 9  LYS A HZ2  5  
ATOM 4707  H HZ3  . LYS A 1 9  ? -25.161 -4.787  9.933   1.00 0.00 ? 9  LYS A HZ3  5  
ATOM 4708  N N    . LYS A 1 10 ? -16.475 -2.164  11.567  1.00 0.00 ? 10 LYS A N    5  
ATOM 4709  C CA   . LYS A 1 10 ? -15.486 -1.155  11.206  1.00 0.00 ? 10 LYS A CA   5  
ATOM 4710  C C    . LYS A 1 10 ? -15.149 -1.230  9.720   1.00 0.00 ? 10 LYS A C    5  
ATOM 4711  O O    . LYS A 1 10 ? -14.786 -2.289  9.209   1.00 0.00 ? 10 LYS A O    5  
ATOM 4712  C CB   . LYS A 1 10 ? -14.214 -1.337  12.038  1.00 0.00 ? 10 LYS A CB   5  
ATOM 4713  C CG   . LYS A 1 10 ? -14.372 -0.921  13.490  1.00 0.00 ? 10 LYS A CG   5  
ATOM 4714  C CD   . LYS A 1 10 ? -13.072 -0.378  14.059  1.00 0.00 ? 10 LYS A CD   5  
ATOM 4715  C CE   . LYS A 1 10 ? -12.287 -1.461  14.784  1.00 0.00 ? 10 LYS A CE   5  
ATOM 4716  N NZ   . LYS A 1 10 ? -11.286 -2.111  13.894  1.00 0.00 ? 10 LYS A NZ   5  
ATOM 4717  H H    . LYS A 1 10 ? -16.287 -2.772  12.313  1.00 0.00 ? 10 LYS A H    5  
ATOM 4718  H HA   . LYS A 1 10 ? -15.909 -0.185  11.419  1.00 0.00 ? 10 LYS A HA   5  
ATOM 4719  H HB2  . LYS A 1 10 ? -13.928 -2.378  12.013  1.00 0.00 ? 10 LYS A HB2  5  
ATOM 4720  H HB3  . LYS A 1 10 ? -13.424 -0.745  11.599  1.00 0.00 ? 10 LYS A HB3  5  
ATOM 4721  H HG2  . LYS A 1 10 ? -15.129 -0.153  13.555  1.00 0.00 ? 10 LYS A HG2  5  
ATOM 4722  H HG3  . LYS A 1 10 ? -14.678 -1.780  14.070  1.00 0.00 ? 10 LYS A HG3  5  
ATOM 4723  H HD2  . LYS A 1 10 ? -12.468 0.008   13.251  1.00 0.00 ? 10 LYS A HD2  5  
ATOM 4724  H HD3  . LYS A 1 10 ? -13.298 0.418   14.755  1.00 0.00 ? 10 LYS A HD3  5  
ATOM 4725  H HE2  . LYS A 1 10 ? -11.774 -1.015  15.623  1.00 0.00 ? 10 LYS A HE2  5  
ATOM 4726  H HE3  . LYS A 1 10 ? -12.978 -2.209  15.142  1.00 0.00 ? 10 LYS A HE3  5  
ATOM 4727  H HZ1  . LYS A 1 10 ? -11.399 -1.766  12.919  1.00 0.00 ? 10 LYS A HZ1  5  
ATOM 4728  H HZ2  . LYS A 1 10 ? -11.418 -3.142  13.902  1.00 0.00 ? 10 LYS A HZ2  5  
ATOM 4729  H HZ3  . LYS A 1 10 ? -10.323 -1.892  14.219  1.00 0.00 ? 10 LYS A HZ3  5  
ATOM 4730  N N    . ARG A 1 11 ? -15.271 -0.099  9.033   1.00 0.00 ? 11 ARG A N    5  
ATOM 4731  C CA   . ARG A 1 11 ? -14.979 -0.037  7.606   1.00 0.00 ? 11 ARG A CA   5  
ATOM 4732  C C    . ARG A 1 11 ? -13.480 -0.165  7.352   1.00 0.00 ? 11 ARG A C    5  
ATOM 4733  O O    . ARG A 1 11 ? -12.678 -0.145  8.286   1.00 0.00 ? 11 ARG A O    5  
ATOM 4734  C CB   . ARG A 1 11 ? -15.496 1.276   7.014   1.00 0.00 ? 11 ARG A CB   5  
ATOM 4735  C CG   . ARG A 1 11 ? -15.872 1.175   5.545   1.00 0.00 ? 11 ARG A CG   5  
ATOM 4736  C CD   . ARG A 1 11 ? -16.881 2.243   5.154   1.00 0.00 ? 11 ARG A CD   5  
ATOM 4737  N NE   . ARG A 1 11 ? -17.342 2.082   3.777   1.00 0.00 ? 11 ARG A NE   5  
ATOM 4738  C CZ   . ARG A 1 11 ? -16.626 2.439   2.716   1.00 0.00 ? 11 ARG A CZ   5  
ATOM 4739  N NH1  . ARG A 1 11 ? -15.422 2.972   2.874   1.00 0.00 ? 11 ARG A NH1  5  
ATOM 4740  N NH2  . ARG A 1 11 ? -17.113 2.261   1.495   1.00 0.00 ? 11 ARG A NH2  5  
ATOM 4741  H H    . ARG A 1 11 ? -15.564 0.714   9.496   1.00 0.00 ? 11 ARG A H    5  
ATOM 4742  H HA   . ARG A 1 11 ? -15.485 -0.862  7.128   1.00 0.00 ? 11 ARG A HA   5  
ATOM 4743  H HB2  . ARG A 1 11 ? -16.372 1.585   7.566   1.00 0.00 ? 11 ARG A HB2  5  
ATOM 4744  H HB3  . ARG A 1 11 ? -14.731 2.029   7.117   1.00 0.00 ? 11 ARG A HB3  5  
ATOM 4745  H HG2  . ARG A 1 11 ? -14.982 1.300   4.946   1.00 0.00 ? 11 ARG A HG2  5  
ATOM 4746  H HG3  . ARG A 1 11 ? -16.300 0.201   5.359   1.00 0.00 ? 11 ARG A HG3  5  
ATOM 4747  H HD2  . ARG A 1 11 ? -17.731 2.177   5.817   1.00 0.00 ? 11 ARG A HD2  5  
ATOM 4748  H HD3  . ARG A 1 11 ? -16.418 3.212   5.258   1.00 0.00 ? 11 ARG A HD3  5  
ATOM 4749  H HE   . ARG A 1 11 ? -18.229 1.690   3.638   1.00 0.00 ? 11 ARG A HE   5  
ATOM 4750  H HH11 . ARG A 1 11 ? -15.052 3.106   3.793   1.00 0.00 ? 11 ARG A HH11 5  
ATOM 4751  H HH12 . ARG A 1 11 ? -14.885 3.238   2.073   1.00 0.00 ? 11 ARG A HH12 5  
ATOM 4752  H HH21 . ARG A 1 11 ? -18.020 1.859   1.373   1.00 0.00 ? 11 ARG A HH21 5  
ATOM 4753  H HH22 . ARG A 1 11 ? -16.574 2.529   0.698   1.00 0.00 ? 11 ARG A HH22 5  
ATOM 4754  N N    . ILE A 1 12 ? -13.109 -0.298  6.082   1.00 0.00 ? 12 ILE A N    5  
ATOM 4755  C CA   . ILE A 1 12 ? -11.707 -0.429  5.706   1.00 0.00 ? 12 ILE A CA   5  
ATOM 4756  C C    . ILE A 1 12 ? -11.024 0.933   5.648   1.00 0.00 ? 12 ILE A C    5  
ATOM 4757  O O    . ILE A 1 12 ? -11.558 1.901   5.107   1.00 0.00 ? 12 ILE A O    5  
ATOM 4758  C CB   . ILE A 1 12 ? -11.554 -1.126  4.341   1.00 0.00 ? 12 ILE A CB   5  
ATOM 4759  C CG1  . ILE A 1 12 ? -12.237 -2.496  4.364   1.00 0.00 ? 12 ILE A CG1  5  
ATOM 4760  C CG2  . ILE A 1 12 ? -10.083 -1.268  3.981   1.00 0.00 ? 12 ILE A CG2  5  
ATOM 4761  C CD1  . ILE A 1 12 ? -11.680 -3.431  5.413   1.00 0.00 ? 12 ILE A CD1  5  
ATOM 4762  H H    . ILE A 1 12 ? -13.795 -0.307  5.383   1.00 0.00 ? 12 ILE A H    5  
ATOM 4763  H HA   . ILE A 1 12 ? -11.217 -1.035  6.454   1.00 0.00 ? 12 ILE A HA   5  
ATOM 4764  H HB   . ILE A 1 12 ? -12.025 -0.509  3.592   1.00 0.00 ? 12 ILE A HB   5  
ATOM 4765  H HG12 . ILE A 1 12 ? -13.288 -2.363  4.563   1.00 0.00 ? 12 ILE A HG12 5  
ATOM 4766  H HG13 . ILE A 1 12 ? -12.114 -2.966  3.399   1.00 0.00 ? 12 ILE A HG13 5  
ATOM 4767  H HG21 . ILE A 1 12 ? -9.993  -1.668  2.982   1.00 0.00 ? 12 ILE A HG21 5  
ATOM 4768  H HG22 . ILE A 1 12 ? -9.607  -0.300  4.024   1.00 0.00 ? 12 ILE A HG22 5  
ATOM 4769  H HG23 . ILE A 1 12 ? -9.603  -1.936  4.681   1.00 0.00 ? 12 ILE A HG23 5  
ATOM 4770  H HD11 . ILE A 1 12 ? -12.213 -4.370  5.379   1.00 0.00 ? 12 ILE A HD11 5  
ATOM 4771  H HD12 . ILE A 1 12 ? -10.632 -3.604  5.223   1.00 0.00 ? 12 ILE A HD12 5  
ATOM 4772  H HD13 . ILE A 1 12 ? -11.799 -2.987  6.391   1.00 0.00 ? 12 ILE A HD13 5  
ATOM 4773  N N    . PRO A 1 13 ? -9.812  1.011   6.218   1.00 0.00 ? 13 PRO A N    5  
ATOM 4774  C CA   . PRO A 1 13 ? -9.028  2.249   6.243   1.00 0.00 ? 13 PRO A CA   5  
ATOM 4775  C C    . PRO A 1 13 ? -8.303  2.502   4.925   1.00 0.00 ? 13 PRO A C    5  
ATOM 4776  O O    . PRO A 1 13 ? -8.547  1.820   3.930   1.00 0.00 ? 13 PRO A O    5  
ATOM 4777  C CB   . PRO A 1 13 ? -8.020  2.008   7.369   1.00 0.00 ? 13 PRO A CB   5  
ATOM 4778  C CG   . PRO A 1 13 ? -7.874  0.527   7.437   1.00 0.00 ? 13 PRO A CG   5  
ATOM 4779  C CD   . PRO A 1 13 ? -9.114  -0.103  6.882   1.00 0.00 ? 13 PRO A CD   5  
ATOM 4780  H HA   . PRO A 1 13 ? -9.643  3.104   6.484   1.00 0.00 ? 13 PRO A HA   5  
ATOM 4781  H HB2  . PRO A 1 13 ? -7.083  2.488   7.126   1.00 0.00 ? 13 PRO A HB2  5  
ATOM 4782  H HB3  . PRO A 1 13 ? -8.407  2.409   8.295   1.00 0.00 ? 13 PRO A HB3  5  
ATOM 4783  H HG2  . PRO A 1 13 ? -7.030  0.214   6.841   1.00 0.00 ? 13 PRO A HG2  5  
ATOM 4784  H HG3  . PRO A 1 13 ? -7.745  0.218   8.463   1.00 0.00 ? 13 PRO A HG3  5  
ATOM 4785  H HD2  . PRO A 1 13 ? -8.827  -0.859  6.166   1.00 0.00 ? 13 PRO A HD2  5  
ATOM 4786  H HD3  . PRO A 1 13 ? -9.728  -0.532  7.661   1.00 0.00 ? 13 PRO A HD3  5  
ATOM 4787  N N    . TYR A 1 14 ? -7.410  3.486   4.926   1.00 0.00 ? 14 TYR A N    5  
ATOM 4788  C CA   . TYR A 1 14 ? -6.651  3.830   3.730   1.00 0.00 ? 14 TYR A CA   5  
ATOM 4789  C C    . TYR A 1 14 ? -7.574  4.335   2.625   1.00 0.00 ? 14 TYR A C    5  
ATOM 4790  O O    . TYR A 1 14 ? -8.355  3.572   2.056   1.00 0.00 ? 14 TYR A O    5  
ATOM 4791  C CB   . TYR A 1 14 ? -5.861  2.618   3.235   1.00 0.00 ? 14 TYR A CB   5  
ATOM 4792  C CG   . TYR A 1 14 ? -5.059  1.934   4.319   1.00 0.00 ? 14 TYR A CG   5  
ATOM 4793  C CD1  . TYR A 1 14 ? -3.979  2.572   4.918   1.00 0.00 ? 14 TYR A CD1  5  
ATOM 4794  C CD2  . TYR A 1 14 ? -5.379  0.651   4.744   1.00 0.00 ? 14 TYR A CD2  5  
ATOM 4795  C CE1  . TYR A 1 14 ? -3.243  1.952   5.909   1.00 0.00 ? 14 TYR A CE1  5  
ATOM 4796  C CE2  . TYR A 1 14 ? -4.649  0.024   5.735   1.00 0.00 ? 14 TYR A CE2  5  
ATOM 4797  C CZ   . TYR A 1 14 ? -3.582  0.678   6.314   1.00 0.00 ? 14 TYR A CZ   5  
ATOM 4798  O OH   . TYR A 1 14 ? -2.851  0.056   7.300   1.00 0.00 ? 14 TYR A OH   5  
ATOM 4799  H H    . TYR A 1 14 ? -7.259  3.994   5.750   1.00 0.00 ? 14 TYR A H    5  
ATOM 4800  H HA   . TYR A 1 14 ? -5.958  4.617   3.991   1.00 0.00 ? 14 TYR A HA   5  
ATOM 4801  H HB2  . TYR A 1 14 ? -6.547  1.893   2.824   1.00 0.00 ? 14 TYR A HB2  5  
ATOM 4802  H HB3  . TYR A 1 14 ? -5.175  2.934   2.463   1.00 0.00 ? 14 TYR A HB3  5  
ATOM 4803  H HD1  . TYR A 1 14 ? -3.716  3.570   4.599   1.00 0.00 ? 14 TYR A HD1  5  
ATOM 4804  H HD2  . TYR A 1 14 ? -6.215  0.141   4.288   1.00 0.00 ? 14 TYR A HD2  5  
ATOM 4805  H HE1  . TYR A 1 14 ? -2.407  2.464   6.363   1.00 0.00 ? 14 TYR A HE1  5  
ATOM 4806  H HE2  . TYR A 1 14 ? -4.914  -0.974  6.052   1.00 0.00 ? 14 TYR A HE2  5  
ATOM 4807  H HH   . TYR A 1 14 ? -2.591  0.702   7.961   1.00 0.00 ? 14 TYR A HH   5  
ATOM 4808  N N    . SER A 1 15 ? -7.478  5.627   2.326   1.00 0.00 ? 15 SER A N    5  
ATOM 4809  C CA   . SER A 1 15 ? -8.306  6.236   1.292   1.00 0.00 ? 15 SER A CA   5  
ATOM 4810  C C    . SER A 1 15 ? -7.920  5.715   -0.089  1.00 0.00 ? 15 SER A C    5  
ATOM 4811  O O    . SER A 1 15 ? -6.861  5.113   -0.266  1.00 0.00 ? 15 SER A O    5  
ATOM 4812  C CB   . SER A 1 15 ? -8.171  7.759   1.332   1.00 0.00 ? 15 SER A CB   5  
ATOM 4813  O OG   . SER A 1 15 ? -8.728  8.290   2.521   1.00 0.00 ? 15 SER A OG   5  
ATOM 4814  H H    . SER A 1 15 ? -6.837  6.183   2.815   1.00 0.00 ? 15 SER A H    5  
ATOM 4815  H HA   . SER A 1 15 ? -9.334  5.969   1.490   1.00 0.00 ? 15 SER A HA   5  
ATOM 4816  H HB2  . SER A 1 15 ? -7.126  8.026   1.288   1.00 0.00 ? 15 SER A HB2  5  
ATOM 4817  H HB3  . SER A 1 15 ? -8.687  8.186   0.484   1.00 0.00 ? 15 SER A HB3  5  
ATOM 4818  H HG   . SER A 1 15 ? -9.680  8.364   2.423   1.00 0.00 ? 15 SER A HG   5  
ATOM 4819  N N    . LYS A 1 16 ? -8.788  5.952   -1.067  1.00 0.00 ? 16 LYS A N    5  
ATOM 4820  C CA   . LYS A 1 16 ? -8.540  5.510   -2.434  1.00 0.00 ? 16 LYS A CA   5  
ATOM 4821  C C    . LYS A 1 16 ? -7.156  5.945   -2.905  1.00 0.00 ? 16 LYS A C    5  
ATOM 4822  O O    . LYS A 1 16 ? -6.456  5.195   -3.584  1.00 0.00 ? 16 LYS A O    5  
ATOM 4823  C CB   . LYS A 1 16 ? -9.610  6.069   -3.375  1.00 0.00 ? 16 LYS A CB   5  
ATOM 4824  C CG   . LYS A 1 16 ? -10.875 5.231   -3.425  1.00 0.00 ? 16 LYS A CG   5  
ATOM 4825  C CD   . LYS A 1 16 ? -11.834 5.602   -2.305  1.00 0.00 ? 16 LYS A CD   5  
ATOM 4826  C CE   . LYS A 1 16 ? -13.274 5.282   -2.676  1.00 0.00 ? 16 LYS A CE   5  
ATOM 4827  N NZ   . LYS A 1 16 ? -14.227 5.699   -1.610  1.00 0.00 ? 16 LYS A NZ   5  
ATOM 4828  H H    . LYS A 1 16 ? -9.616  6.438   -0.865  1.00 0.00 ? 16 LYS A H    5  
ATOM 4829  H HA   . LYS A 1 16 ? -8.589  4.432   -2.448  1.00 0.00 ? 16 LYS A HA   5  
ATOM 4830  H HB2  . LYS A 1 16 ? -9.874  7.064   -3.049  1.00 0.00 ? 16 LYS A HB2  5  
ATOM 4831  H HB3  . LYS A 1 16 ? -9.200  6.125   -4.374  1.00 0.00 ? 16 LYS A HB3  5  
ATOM 4832  H HG2  . LYS A 1 16 ? -11.367 5.392   -4.373  1.00 0.00 ? 16 LYS A HG2  5  
ATOM 4833  H HG3  . LYS A 1 16 ? -10.609 4.188   -3.328  1.00 0.00 ? 16 LYS A HG3  5  
ATOM 4834  H HD2  . LYS A 1 16 ? -11.571 5.045   -1.418  1.00 0.00 ? 16 LYS A HD2  5  
ATOM 4835  H HD3  . LYS A 1 16 ? -11.749 6.661   -2.106  1.00 0.00 ? 16 LYS A HD3  5  
ATOM 4836  H HE2  . LYS A 1 16 ? -13.520 5.802   -3.590  1.00 0.00 ? 16 LYS A HE2  5  
ATOM 4837  H HE3  . LYS A 1 16 ? -13.364 4.217   -2.832  1.00 0.00 ? 16 LYS A HE3  5  
ATOM 4838  H HZ1  . LYS A 1 16 ? -14.025 6.674   -1.312  1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 4839  H HZ2  . LYS A 1 16 ? -14.137 5.071   -0.786  1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 4840  H HZ3  . LYS A 1 16 ? -15.203 5.650   -1.964  1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 4841  N N    . GLY A 1 17 ? -6.767  7.163   -2.538  1.00 0.00 ? 17 GLY A N    5  
ATOM 4842  C CA   . GLY A 1 17 ? -5.467  7.676   -2.930  1.00 0.00 ? 17 GLY A CA   5  
ATOM 4843  C C    . GLY A 1 17 ? -4.326  6.940   -2.257  1.00 0.00 ? 17 GLY A C    5  
ATOM 4844  O O    . GLY A 1 17 ? -3.338  6.592   -2.903  1.00 0.00 ? 17 GLY A O    5  
ATOM 4845  H H    . GLY A 1 17 ? -7.367  7.717   -1.996  1.00 0.00 ? 17 GLY A H    5  
ATOM 4846  H HA2  . GLY A 1 17 ? -5.363  7.580   -4.001  1.00 0.00 ? 17 GLY A HA2  5  
ATOM 4847  H HA3  . GLY A 1 17 ? -5.411  8.722   -2.666  1.00 0.00 ? 17 GLY A HA3  5  
ATOM 4848  N N    . GLN A 1 18 ? -4.462  6.703   -0.956  1.00 0.00 ? 18 GLN A N    5  
ATOM 4849  C CA   . GLN A 1 18 ? -3.432  6.006   -0.196  1.00 0.00 ? 18 GLN A CA   5  
ATOM 4850  C C    . GLN A 1 18 ? -3.248  4.581   -0.707  1.00 0.00 ? 18 GLN A C    5  
ATOM 4851  O O    . GLN A 1 18 ? -2.122  4.111   -0.877  1.00 0.00 ? 18 GLN A O    5  
ATOM 4852  C CB   . GLN A 1 18 ? -3.792  5.984   1.291   1.00 0.00 ? 18 GLN A CB   5  
ATOM 4853  C CG   . GLN A 1 18 ? -3.647  7.336   1.971   1.00 0.00 ? 18 GLN A CG   5  
ATOM 4854  C CD   . GLN A 1 18 ? -4.211  7.344   3.379   1.00 0.00 ? 18 GLN A CD   5  
ATOM 4855  O OE1  . GLN A 1 18 ? -5.409  7.147   3.581   1.00 0.00 ? 18 GLN A OE1  5  
ATOM 4856  N NE2  . GLN A 1 18 ? -3.347  7.572   4.361   1.00 0.00 ? 18 GLN A NE2  5  
ATOM 4857  H H    . GLN A 1 18 ? -5.273  7.005   -0.498  1.00 0.00 ? 18 GLN A H    5  
ATOM 4858  H HA   . GLN A 1 18 ? -2.504  6.543   -0.324  1.00 0.00 ? 18 GLN A HA   5  
ATOM 4859  H HB2  . GLN A 1 18 ? -4.817  5.660   1.396   1.00 0.00 ? 18 GLN A HB2  5  
ATOM 4860  H HB3  . GLN A 1 18 ? -3.147  5.281   1.795   1.00 0.00 ? 18 GLN A HB3  5  
ATOM 4861  H HG2  . GLN A 1 18 ? -2.599  7.590   2.019   1.00 0.00 ? 18 GLN A HG2  5  
ATOM 4862  H HG3  . GLN A 1 18 ? -4.170  8.077   1.385   1.00 0.00 ? 18 GLN A HG3  5  
ATOM 4863  H HE21 . GLN A 1 18 ? -2.407  7.721   4.125   1.00 0.00 ? 18 GLN A HE21 5  
ATOM 4864  H HE22 . GLN A 1 18 ? -3.684  7.583   5.280   1.00 0.00 ? 18 GLN A HE22 5  
ATOM 4865  N N    . LEU A 1 19 ? -4.361  3.897   -0.951  1.00 0.00 ? 19 LEU A N    5  
ATOM 4866  C CA   . LEU A 1 19 ? -4.324  2.524   -1.443  1.00 0.00 ? 19 LEU A CA   5  
ATOM 4867  C C    . LEU A 1 19 ? -3.830  2.476   -2.885  1.00 0.00 ? 19 LEU A C    5  
ATOM 4868  O O    . LEU A 1 19 ? -3.322  1.453   -3.344  1.00 0.00 ? 19 LEU A O    5  
ATOM 4869  C CB   . LEU A 1 19 ? -5.712  1.889   -1.346  1.00 0.00 ? 19 LEU A CB   5  
ATOM 4870  C CG   . LEU A 1 19 ? -6.289  1.751   0.063   1.00 0.00 ? 19 LEU A CG   5  
ATOM 4871  C CD1  . LEU A 1 19 ? -7.801  1.591   0.007   1.00 0.00 ? 19 LEU A CD1  5  
ATOM 4872  C CD2  . LEU A 1 19 ? -5.653  0.573   0.787   1.00 0.00 ? 19 LEU A CD2  5  
ATOM 4873  H H    . LEU A 1 19 ? -5.229  4.325   -0.796  1.00 0.00 ? 19 LEU A H    5  
ATOM 4874  H HA   . LEU A 1 19 ? -3.638  1.968   -0.821  1.00 0.00 ? 19 LEU A HA   5  
ATOM 4875  H HB2  . LEU A 1 19 ? -6.393  2.493   -1.924  1.00 0.00 ? 19 LEU A HB2  5  
ATOM 4876  H HB3  . LEU A 1 19 ? -5.653  0.900   -1.779  1.00 0.00 ? 19 LEU A HB3  5  
ATOM 4877  H HG   . LEU A 1 19 ? -6.070  2.648   0.625   1.00 0.00 ? 19 LEU A HG   5  
ATOM 4878  H HD11 . LEU A 1 19 ? -8.175  1.361   0.993   1.00 0.00 ? 19 LEU A HD11 5  
ATOM 4879  H HD12 . LEU A 1 19 ? -8.053  0.788   -0.669  1.00 0.00 ? 19 LEU A HD12 5  
ATOM 4880  H HD13 . LEU A 1 19 ? -8.247  2.510   -0.343  1.00 0.00 ? 19 LEU A HD13 5  
ATOM 4881  H HD21 . LEU A 1 19 ? -4.655  0.841   1.101   1.00 0.00 ? 19 LEU A HD21 5  
ATOM 4882  H HD22 . LEU A 1 19 ? -5.606  -0.276  0.121   1.00 0.00 ? 19 LEU A HD22 5  
ATOM 4883  H HD23 . LEU A 1 19 ? -6.247  0.319   1.653   1.00 0.00 ? 19 LEU A HD23 5  
ATOM 4884  N N    . ARG A 1 20 ? -3.980  3.590   -3.594  1.00 0.00 ? 20 ARG A N    5  
ATOM 4885  C CA   . ARG A 1 20 ? -3.549  3.676   -4.984  1.00 0.00 ? 20 ARG A CA   5  
ATOM 4886  C C    . ARG A 1 20 ? -2.060  3.365   -5.111  1.00 0.00 ? 20 ARG A C    5  
ATOM 4887  O O    . ARG A 1 20 ? -1.624  2.764   -6.092  1.00 0.00 ? 20 ARG A O    5  
ATOM 4888  C CB   . ARG A 1 20 ? -3.840  5.068   -5.546  1.00 0.00 ? 20 ARG A CB   5  
ATOM 4889  C CG   . ARG A 1 20 ? -3.733  5.148   -7.060  1.00 0.00 ? 20 ARG A CG   5  
ATOM 4890  C CD   . ARG A 1 20 ? -4.030  6.551   -7.566  1.00 0.00 ? 20 ARG A CD   5  
ATOM 4891  N NE   . ARG A 1 20 ? -4.033  6.617   -9.025  1.00 0.00 ? 20 ARG A NE   5  
ATOM 4892  C CZ   . ARG A 1 20 ? -4.547  7.631   -9.714  1.00 0.00 ? 20 ARG A CZ   5  
ATOM 4893  N NH1  . ARG A 1 20 ? -5.096  8.657   -9.079  1.00 0.00 ? 20 ARG A NH1  5  
ATOM 4894  N NH2  . ARG A 1 20 ? -4.513  7.619   -11.040 1.00 0.00 ? 20 ARG A NH2  5  
ATOM 4895  H H    . ARG A 1 20 ? -4.392  4.374   -3.173  1.00 0.00 ? 20 ARG A H    5  
ATOM 4896  H HA   . ARG A 1 20 ? -4.106  2.945   -5.550  1.00 0.00 ? 20 ARG A HA   5  
ATOM 4897  H HB2  . ARG A 1 20 ? -4.841  5.356   -5.262  1.00 0.00 ? 20 ARG A HB2  5  
ATOM 4898  H HB3  . ARG A 1 20 ? -3.138  5.769   -5.120  1.00 0.00 ? 20 ARG A HB3  5  
ATOM 4899  H HG2  . ARG A 1 20 ? -2.731  4.875   -7.357  1.00 0.00 ? 20 ARG A HG2  5  
ATOM 4900  H HG3  . ARG A 1 20 ? -4.441  4.460   -7.498  1.00 0.00 ? 20 ARG A HG3  5  
ATOM 4901  H HD2  . ARG A 1 20 ? -4.999  6.854   -7.199  1.00 0.00 ? 20 ARG A HD2  5  
ATOM 4902  H HD3  . ARG A 1 20 ? -3.275  7.223   -7.186  1.00 0.00 ? 20 ARG A HD3  5  
ATOM 4903  H HE   . ARG A 1 20 ? -3.633  5.869   -9.515  1.00 0.00 ? 20 ARG A HE   5  
ATOM 4904  H HH11 . ARG A 1 20 ? -5.122  8.669   -8.079  1.00 0.00 ? 20 ARG A HH11 5  
ATOM 4905  H HH12 . ARG A 1 20 ? -5.481  9.419   -9.599  1.00 0.00 ? 20 ARG A HH12 5  
ATOM 4906  H HH21 . ARG A 1 20 ? -4.100  6.847   -11.522 1.00 0.00 ? 20 ARG A HH21 5  
ATOM 4907  H HH22 . ARG A 1 20 ? -4.900  8.381   -11.557 1.00 0.00 ? 20 ARG A HH22 5  
ATOM 4908  N N    . GLU A 1 21 ? -1.287  3.780   -4.112  1.00 0.00 ? 21 GLU A N    5  
ATOM 4909  C CA   . GLU A 1 21 ? 0.153   3.547   -4.114  1.00 0.00 ? 21 GLU A CA   5  
ATOM 4910  C C    . GLU A 1 21 ? 0.480   2.159   -3.571  1.00 0.00 ? 21 GLU A C    5  
ATOM 4911  O O    . GLU A 1 21 ? 1.380   1.481   -4.069  1.00 0.00 ? 21 GLU A O    5  
ATOM 4912  C CB   . GLU A 1 21 ? 0.865   4.614   -3.280  1.00 0.00 ? 21 GLU A CB   5  
ATOM 4913  C CG   . GLU A 1 21 ? 0.630   6.031   -3.775  1.00 0.00 ? 21 GLU A CG   5  
ATOM 4914  C CD   . GLU A 1 21 ? 0.865   6.175   -5.266  1.00 0.00 ? 21 GLU A CD   5  
ATOM 4915  O OE1  . GLU A 1 21 ? 2.039   6.136   -5.689  1.00 0.00 ? 21 GLU A OE1  5  
ATOM 4916  O OE2  . GLU A 1 21 ? -0.127  6.326   -6.010  1.00 0.00 ? 21 GLU A OE2  5  
ATOM 4917  H H    . GLU A 1 21 ? -1.694  4.254   -3.358  1.00 0.00 ? 21 GLU A H    5  
ATOM 4918  H HA   . GLU A 1 21 ? 0.498   3.611   -5.135  1.00 0.00 ? 21 GLU A HA   5  
ATOM 4919  H HB2  . GLU A 1 21 ? 0.518   4.548   -2.260  1.00 0.00 ? 21 GLU A HB2  5  
ATOM 4920  H HB3  . GLU A 1 21 ? 1.928   4.419   -3.302  1.00 0.00 ? 21 GLU A HB3  5  
ATOM 4921  H HG2  . GLU A 1 21 ? -0.391  6.309   -3.559  1.00 0.00 ? 21 GLU A HG2  5  
ATOM 4922  H HG3  . GLU A 1 21 ? 1.302   6.697   -3.254  1.00 0.00 ? 21 GLU A HG3  5  
ATOM 4923  N N    . LEU A 1 22 ? -0.257  1.742   -2.547  1.00 0.00 ? 22 LEU A N    5  
ATOM 4924  C CA   . LEU A 1 22 ? -0.046  0.435   -1.935  1.00 0.00 ? 22 LEU A CA   5  
ATOM 4925  C C    . LEU A 1 22 ? -0.332  -0.685  -2.930  1.00 0.00 ? 22 LEU A C    5  
ATOM 4926  O O    . LEU A 1 22 ? 0.478   -1.595  -3.105  1.00 0.00 ? 22 LEU A O    5  
ATOM 4927  C CB   . LEU A 1 22 ? -0.938  0.277   -0.702  1.00 0.00 ? 22 LEU A CB   5  
ATOM 4928  C CG   . LEU A 1 22 ? -0.633  1.209   0.471   1.00 0.00 ? 22 LEU A CG   5  
ATOM 4929  C CD1  . LEU A 1 22 ? -1.785  1.213   1.463   1.00 0.00 ? 22 LEU A CD1  5  
ATOM 4930  C CD2  . LEU A 1 22 ? 0.662   0.797   1.156   1.00 0.00 ? 22 LEU A CD2  5  
ATOM 4931  H H    . LEU A 1 22 ? -0.960  2.326   -2.194  1.00 0.00 ? 22 LEU A H    5  
ATOM 4932  H HA   . LEU A 1 22 ? 0.988   0.374   -1.631  1.00 0.00 ? 22 LEU A HA   5  
ATOM 4933  H HB2  . LEU A 1 22 ? -1.958  0.454   -1.008  1.00 0.00 ? 22 LEU A HB2  5  
ATOM 4934  H HB3  . LEU A 1 22 ? -0.840  -0.741  -0.352  1.00 0.00 ? 22 LEU A HB3  5  
ATOM 4935  H HG   . LEU A 1 22 ? -0.510  2.217   0.099   1.00 0.00 ? 22 LEU A HG   5  
ATOM 4936  H HD11 . LEU A 1 22 ? -1.394  1.214   2.469   1.00 0.00 ? 22 LEU A HD11 5  
ATOM 4937  H HD12 . LEU A 1 22 ? -2.392  0.333   1.314   1.00 0.00 ? 22 LEU A HD12 5  
ATOM 4938  H HD13 . LEU A 1 22 ? -2.389  2.096   1.310   1.00 0.00 ? 22 LEU A HD13 5  
ATOM 4939  H HD21 . LEU A 1 22 ? 1.470   0.816   0.439   1.00 0.00 ? 22 LEU A HD21 5  
ATOM 4940  H HD22 . LEU A 1 22 ? 0.557   -0.202  1.553   1.00 0.00 ? 22 LEU A HD22 5  
ATOM 4941  H HD23 . LEU A 1 22 ? 0.878   1.485   1.960   1.00 0.00 ? 22 LEU A HD23 5  
ATOM 4942  N N    . GLU A 1 23 ? -1.489  -0.610  -3.582  1.00 0.00 ? 23 GLU A N    5  
ATOM 4943  C CA   . GLU A 1 23 ? -1.880  -1.618  -4.560  1.00 0.00 ? 23 GLU A CA   5  
ATOM 4944  C C    . GLU A 1 23 ? -0.876  -1.681  -5.707  1.00 0.00 ? 23 GLU A C    5  
ATOM 4945  O O    . GLU A 1 23 ? -0.539  -2.761  -6.193  1.00 0.00 ? 23 GLU A O    5  
ATOM 4946  C CB   . GLU A 1 23 ? -3.277  -1.314  -5.107  1.00 0.00 ? 23 GLU A CB   5  
ATOM 4947  C CG   . GLU A 1 23 ? -4.388  -1.535  -4.095  1.00 0.00 ? 23 GLU A CG   5  
ATOM 4948  C CD   . GLU A 1 23 ? -5.768  -1.322  -4.688  1.00 0.00 ? 23 GLU A CD   5  
ATOM 4949  O OE1  . GLU A 1 23 ? -5.868  -0.624  -5.719  1.00 0.00 ? 23 GLU A OE1  5  
ATOM 4950  O OE2  . GLU A 1 23 ? -6.746  -1.852  -4.121  1.00 0.00 ? 23 GLU A OE2  5  
ATOM 4951  H H    . GLU A 1 23 ? -2.093  0.139   -3.399  1.00 0.00 ? 23 GLU A H    5  
ATOM 4952  H HA   . GLU A 1 23 ? -1.900  -2.575  -4.062  1.00 0.00 ? 23 GLU A HA   5  
ATOM 4953  H HB2  . GLU A 1 23 ? -3.308  -0.283  -5.428  1.00 0.00 ? 23 GLU A HB2  5  
ATOM 4954  H HB3  . GLU A 1 23 ? -3.462  -1.952  -5.959  1.00 0.00 ? 23 GLU A HB3  5  
ATOM 4955  H HG2  . GLU A 1 23 ? -4.325  -2.547  -3.725  1.00 0.00 ? 23 GLU A HG2  5  
ATOM 4956  H HG3  . GLU A 1 23 ? -4.254  -0.844  -3.276  1.00 0.00 ? 23 GLU A HG3  5  
ATOM 4957  N N    . ARG A 1 24 ? -0.401  -0.516  -6.136  1.00 0.00 ? 24 ARG A N    5  
ATOM 4958  C CA   . ARG A 1 24 ? 0.563   -0.438  -7.226  1.00 0.00 ? 24 ARG A CA   5  
ATOM 4959  C C    . ARG A 1 24 ? 1.837   -1.203  -6.881  1.00 0.00 ? 24 ARG A C    5  
ATOM 4960  O O    . ARG A 1 24 ? 2.238   -2.117  -7.601  1.00 0.00 ? 24 ARG A O    5  
ATOM 4961  C CB   . ARG A 1 24 ? 0.900   1.022   -7.534  1.00 0.00 ? 24 ARG A CB   5  
ATOM 4962  C CG   . ARG A 1 24 ? 0.068   1.614   -8.661  1.00 0.00 ? 24 ARG A CG   5  
ATOM 4963  C CD   . ARG A 1 24 ? 0.803   2.748   -9.359  1.00 0.00 ? 24 ARG A CD   5  
ATOM 4964  N NE   . ARG A 1 24 ? 1.922   2.262   -10.161 1.00 0.00 ? 24 ARG A NE   5  
ATOM 4965  C CZ   . ARG A 1 24 ? 2.858   3.054   -10.674 1.00 0.00 ? 24 ARG A CZ   5  
ATOM 4966  N NH1  . ARG A 1 24 ? 2.808   4.363   -10.469 1.00 0.00 ? 24 ARG A NH1  5  
ATOM 4967  N NH2  . ARG A 1 24 ? 3.845   2.537   -11.393 1.00 0.00 ? 24 ARG A NH2  5  
ATOM 4968  H H    . ARG A 1 24 ? -0.708  0.312   -5.709  1.00 0.00 ? 24 ARG A H    5  
ATOM 4969  H HA   . ARG A 1 24 ? 0.114   -0.886  -8.099  1.00 0.00 ? 24 ARG A HA   5  
ATOM 4970  H HB2  . ARG A 1 24 ? 0.734   1.613   -6.646  1.00 0.00 ? 24 ARG A HB2  5  
ATOM 4971  H HB3  . ARG A 1 24 ? 1.941   1.088   -7.812  1.00 0.00 ? 24 ARG A HB3  5  
ATOM 4972  H HG2  . ARG A 1 24 ? -0.146  0.840   -9.383  1.00 0.00 ? 24 ARG A HG2  5  
ATOM 4973  H HG3  . ARG A 1 24 ? -0.856  1.994   -8.252  1.00 0.00 ? 24 ARG A HG3  5  
ATOM 4974  H HD2  . ARG A 1 24 ? 0.109   3.266   -10.004 1.00 0.00 ? 24 ARG A HD2  5  
ATOM 4975  H HD3  . ARG A 1 24 ? 1.177   3.431   -8.611  1.00 0.00 ? 24 ARG A HD3  5  
ATOM 4976  H HE   . ARG A 1 24 ? 1.978   1.298   -10.326 1.00 0.00 ? 24 ARG A HE   5  
ATOM 4977  H HH11 . ARG A 1 24 ? 2.065   4.755   -9.926  1.00 0.00 ? 24 ARG A HH11 5  
ATOM 4978  H HH12 . ARG A 1 24 ? 3.514   4.957   -10.855 1.00 0.00 ? 24 ARG A HH12 5  
ATOM 4979  H HH21 . ARG A 1 24 ? 3.886   1.551   -11.550 1.00 0.00 ? 24 ARG A HH21 5  
ATOM 4980  H HH22 . ARG A 1 24 ? 4.548   3.134   -11.779 1.00 0.00 ? 24 ARG A HH22 5  
ATOM 4981  N N    . GLU A 1 25 ? 2.469   -0.821  -5.775  1.00 0.00 ? 25 GLU A N    5  
ATOM 4982  C CA   . GLU A 1 25 ? 3.699   -1.471  -5.336  1.00 0.00 ? 25 GLU A CA   5  
ATOM 4983  C C    . GLU A 1 25 ? 3.490   -2.973  -5.166  1.00 0.00 ? 25 GLU A C    5  
ATOM 4984  O O    . GLU A 1 25 ? 4.371   -3.773  -5.482  1.00 0.00 ? 25 GLU A O    5  
ATOM 4985  C CB   . GLU A 1 25 ? 4.182   -0.860  -4.018  1.00 0.00 ? 25 GLU A CB   5  
ATOM 4986  C CG   . GLU A 1 25 ? 5.146   0.300   -4.202  1.00 0.00 ? 25 GLU A CG   5  
ATOM 4987  C CD   . GLU A 1 25 ? 4.715   1.247   -5.305  1.00 0.00 ? 25 GLU A CD   5  
ATOM 4988  O OE1  . GLU A 1 25 ? 4.934   0.919   -6.490  1.00 0.00 ? 25 GLU A OE1  5  
ATOM 4989  O OE2  . GLU A 1 25 ? 4.158   2.318   -4.982  1.00 0.00 ? 25 GLU A OE2  5  
ATOM 4990  H H    . GLU A 1 25 ? 2.100   -0.086  -5.243  1.00 0.00 ? 25 GLU A H    5  
ATOM 4991  H HA   . GLU A 1 25 ? 4.449   -1.307  -6.094  1.00 0.00 ? 25 GLU A HA   5  
ATOM 4992  H HB2  . GLU A 1 25 ? 3.325   -0.505  -3.464  1.00 0.00 ? 25 GLU A HB2  5  
ATOM 4993  H HB3  . GLU A 1 25 ? 4.679   -1.626  -3.442  1.00 0.00 ? 25 GLU A HB3  5  
ATOM 4994  H HG2  . GLU A 1 25 ? 5.205   0.852   -3.277  1.00 0.00 ? 25 GLU A HG2  5  
ATOM 4995  H HG3  . GLU A 1 25 ? 6.121   -0.095  -4.448  1.00 0.00 ? 25 GLU A HG3  5  
ATOM 4996  N N    . TYR A 1 26 ? 2.318   -3.348  -4.665  1.00 0.00 ? 26 TYR A N    5  
ATOM 4997  C CA   . TYR A 1 26 ? 1.994   -4.754  -4.450  1.00 0.00 ? 26 TYR A CA   5  
ATOM 4998  C C    . TYR A 1 26 ? 1.976   -5.517  -5.771  1.00 0.00 ? 26 TYR A C    5  
ATOM 4999  O O    . TYR A 1 26 ? 2.580   -6.581  -5.894  1.00 0.00 ? 26 TYR A O    5  
ATOM 5000  C CB   . TYR A 1 26 ? 0.638   -4.885  -3.754  1.00 0.00 ? 26 TYR A CB   5  
ATOM 5001  C CG   . TYR A 1 26 ? 0.202   -6.318  -3.544  1.00 0.00 ? 26 TYR A CG   5  
ATOM 5002  C CD1  . TYR A 1 26 ? 0.789   -7.107  -2.563  1.00 0.00 ? 26 TYR A CD1  5  
ATOM 5003  C CD2  . TYR A 1 26 ? -0.797  -6.882  -4.328  1.00 0.00 ? 26 TYR A CD2  5  
ATOM 5004  C CE1  . TYR A 1 26 ? 0.394   -8.416  -2.368  1.00 0.00 ? 26 TYR A CE1  5  
ATOM 5005  C CE2  . TYR A 1 26 ? -1.199  -8.190  -4.139  1.00 0.00 ? 26 TYR A CE2  5  
ATOM 5006  C CZ   . TYR A 1 26 ? -0.601  -8.953  -3.158  1.00 0.00 ? 26 TYR A CZ   5  
ATOM 5007  O OH   . TYR A 1 26 ? -0.998  -10.257 -2.968  1.00 0.00 ? 26 TYR A OH   5  
ATOM 5008  H H    . TYR A 1 26 ? 1.656   -2.665  -4.433  1.00 0.00 ? 26 TYR A H    5  
ATOM 5009  H HA   . TYR A 1 26 ? 2.757   -5.177  -3.814  1.00 0.00 ? 26 TYR A HA   5  
ATOM 5010  H HB2  . TYR A 1 26 ? 0.690   -4.410  -2.787  1.00 0.00 ? 26 TYR A HB2  5  
ATOM 5011  H HB3  . TYR A 1 26 ? -0.115  -4.393  -4.352  1.00 0.00 ? 26 TYR A HB3  5  
ATOM 5012  H HD1  . TYR A 1 26 ? 1.568   -6.683  -1.945  1.00 0.00 ? 26 TYR A HD1  5  
ATOM 5013  H HD2  . TYR A 1 26 ? -1.263  -6.282  -5.096  1.00 0.00 ? 26 TYR A HD2  5  
ATOM 5014  H HE1  . TYR A 1 26 ? 0.862   -9.014  -1.600  1.00 0.00 ? 26 TYR A HE1  5  
ATOM 5015  H HE2  . TYR A 1 26 ? -1.977  -8.611  -4.759  1.00 0.00 ? 26 TYR A HE2  5  
ATOM 5016  H HH   . TYR A 1 26 ? -1.582  -10.521 -3.683  1.00 0.00 ? 26 TYR A HH   5  
ATOM 5017  N N    . ALA A 1 27 ? 1.278   -4.963  -6.758  1.00 0.00 ? 27 ALA A N    5  
ATOM 5018  C CA   . ALA A 1 27 ? 1.183   -5.588  -8.071  1.00 0.00 ? 27 ALA A CA   5  
ATOM 5019  C C    . ALA A 1 27 ? 2.565   -5.807  -8.676  1.00 0.00 ? 27 ALA A C    5  
ATOM 5020  O O    . ALA A 1 27 ? 2.754   -6.692  -9.510  1.00 0.00 ? 27 ALA A O    5  
ATOM 5021  C CB   . ALA A 1 27 ? 0.326   -4.739  -8.999  1.00 0.00 ? 27 ALA A CB   5  
ATOM 5022  H H    . ALA A 1 27 ? 0.818   -4.113  -6.598  1.00 0.00 ? 27 ALA A H    5  
ATOM 5023  H HA   . ALA A 1 27 ? 0.698   -6.546  -7.950  1.00 0.00 ? 27 ALA A HA   5  
ATOM 5024  H HB1  . ALA A 1 27 ? 0.559   -3.695  -8.847  1.00 0.00 ? 27 ALA A HB1  5  
ATOM 5025  H HB2  . ALA A 1 27 ? 0.530   -5.009  -10.024 1.00 0.00 ? 27 ALA A HB2  5  
ATOM 5026  H HB3  . ALA A 1 27 ? -0.718  -4.911  -8.781  1.00 0.00 ? 27 ALA A HB3  5  
ATOM 5027  N N    . ALA A 1 28 ? 3.527   -4.995  -8.252  1.00 0.00 ? 28 ALA A N    5  
ATOM 5028  C CA   . ALA A 1 28 ? 4.892   -5.101  -8.752  1.00 0.00 ? 28 ALA A CA   5  
ATOM 5029  C C    . ALA A 1 28 ? 5.705   -6.089  -7.923  1.00 0.00 ? 28 ALA A C    5  
ATOM 5030  O O    . ALA A 1 28 ? 6.564   -6.796  -8.448  1.00 0.00 ? 28 ALA A O    5  
ATOM 5031  C CB   . ALA A 1 28 ? 5.561   -3.734  -8.754  1.00 0.00 ? 28 ALA A CB   5  
ATOM 5032  H H    . ALA A 1 28 ? 3.314   -4.309  -7.586  1.00 0.00 ? 28 ALA A H    5  
ATOM 5033  H HA   . ALA A 1 28 ? 4.847   -5.454  -9.772  1.00 0.00 ? 28 ALA A HA   5  
ATOM 5034  H HB1  . ALA A 1 28 ? 5.184   -3.149  -7.928  1.00 0.00 ? 28 ALA A HB1  5  
ATOM 5035  H HB2  . ALA A 1 28 ? 6.629   -3.857  -8.650  1.00 0.00 ? 28 ALA A HB2  5  
ATOM 5036  H HB3  . ALA A 1 28 ? 5.344   -3.229  -9.683  1.00 0.00 ? 28 ALA A HB3  5  
ATOM 5037  N N    . ASN A 1 29 ? 5.429   -6.132  -6.623  1.00 0.00 ? 29 ASN A N    5  
ATOM 5038  C CA   . ASN A 1 29 ? 6.136   -7.033  -5.721  1.00 0.00 ? 29 ASN A CA   5  
ATOM 5039  C C    . ASN A 1 29 ? 5.334   -7.265  -4.444  1.00 0.00 ? 29 ASN A C    5  
ATOM 5040  O O    . ASN A 1 29 ? 4.906   -6.317  -3.786  1.00 0.00 ? 29 ASN A O    5  
ATOM 5041  C CB   . ASN A 1 29 ? 7.514   -6.464  -5.374  1.00 0.00 ? 29 ASN A CB   5  
ATOM 5042  C CG   . ASN A 1 29 ? 7.502   -4.952  -5.261  1.00 0.00 ? 29 ASN A CG   5  
ATOM 5043  O OD1  . ASN A 1 29 ? 8.054   -4.250  -6.109  1.00 0.00 ? 29 ASN A OD1  5  
ATOM 5044  N ND2  . ASN A 1 29 ? 6.872   -4.442  -4.208  1.00 0.00 ? 29 ASN A ND2  5  
ATOM 5045  H H    . ASN A 1 29 ? 4.733   -5.543  -6.262  1.00 0.00 ? 29 ASN A H    5  
ATOM 5046  H HA   . ASN A 1 29 ? 6.264   -7.977  -6.228  1.00 0.00 ? 29 ASN A HA   5  
ATOM 5047  H HB2  . ASN A 1 29 ? 7.838   -6.874  -4.429  1.00 0.00 ? 29 ASN A HB2  5  
ATOM 5048  H HB3  . ASN A 1 29 ? 8.217   -6.744  -6.144  1.00 0.00 ? 29 ASN A HB3  5  
ATOM 5049  H HD21 . ASN A 1 29 ? 6.456   -5.062  -3.573  1.00 0.00 ? 29 ASN A HD21 5  
ATOM 5050  H HD22 . ASN A 1 29 ? 6.849   -3.467  -4.111  1.00 0.00 ? 29 ASN A HD22 5  
ATOM 5051  N N    . LYS A 1 30 ? 5.134   -8.532  -4.099  1.00 0.00 ? 30 LYS A N    5  
ATOM 5052  C CA   . LYS A 1 30 ? 4.385   -8.891  -2.901  1.00 0.00 ? 30 LYS A CA   5  
ATOM 5053  C C    . LYS A 1 30 ? 5.092   -8.388  -1.647  1.00 0.00 ? 30 LYS A C    5  
ATOM 5054  O O    . LYS A 1 30 ? 4.456   -8.130  -0.625  1.00 0.00 ? 30 LYS A O    5  
ATOM 5055  C CB   . LYS A 1 30 ? 4.203   -10.409 -2.823  1.00 0.00 ? 30 LYS A CB   5  
ATOM 5056  C CG   . LYS A 1 30 ? 3.720   -11.031 -4.122  1.00 0.00 ? 30 LYS A CG   5  
ATOM 5057  C CD   . LYS A 1 30 ? 3.401   -12.506 -3.949  1.00 0.00 ? 30 LYS A CD   5  
ATOM 5058  C CE   . LYS A 1 30 ? 3.497   -13.256 -5.269  1.00 0.00 ? 30 LYS A CE   5  
ATOM 5059  N NZ   . LYS A 1 30 ? 4.910   -13.434 -5.704  1.00 0.00 ? 30 LYS A NZ   5  
ATOM 5060  H H    . LYS A 1 30 ? 5.500   -9.245  -4.665  1.00 0.00 ? 30 LYS A H    5  
ATOM 5061  H HA   . LYS A 1 30 ? 3.414   -8.424  -2.964  1.00 0.00 ? 30 LYS A HA   5  
ATOM 5062  H HB2  . LYS A 1 30 ? 5.149   -10.859 -2.562  1.00 0.00 ? 30 LYS A HB2  5  
ATOM 5063  H HB3  . LYS A 1 30 ? 3.482   -10.634 -2.051  1.00 0.00 ? 30 LYS A HB3  5  
ATOM 5064  H HG2  . LYS A 1 30 ? 2.828   -10.517 -4.447  1.00 0.00 ? 30 LYS A HG2  5  
ATOM 5065  H HG3  . LYS A 1 30 ? 4.492   -10.924 -4.871  1.00 0.00 ? 30 LYS A HG3  5  
ATOM 5066  H HD2  . LYS A 1 30 ? 4.103   -12.938 -3.251  1.00 0.00 ? 30 LYS A HD2  5  
ATOM 5067  H HD3  . LYS A 1 30 ? 2.398   -12.606 -3.560  1.00 0.00 ? 30 LYS A HD3  5  
ATOM 5068  H HE2  . LYS A 1 30 ? 3.041   -14.227 -5.150  1.00 0.00 ? 30 LYS A HE2  5  
ATOM 5069  H HE3  . LYS A 1 30 ? 2.964   -12.698 -6.024  1.00 0.00 ? 30 LYS A HE3  5  
ATOM 5070  H HZ1  . LYS A 1 30 ? 4.986   -14.251 -6.343  1.00 0.00 ? 30 LYS A HZ1  5  
ATOM 5071  H HZ2  . LYS A 1 30 ? 5.521   -13.595 -4.879  1.00 0.00 ? 30 LYS A HZ2  5  
ATOM 5072  H HZ3  . LYS A 1 30 ? 5.239   -12.584 -6.205  1.00 0.00 ? 30 LYS A HZ3  5  
ATOM 5073  N N    . PHE A 1 31 ? 6.411   -8.250  -1.732  1.00 0.00 ? 31 PHE A N    5  
ATOM 5074  C CA   . PHE A 1 31 ? 7.204   -7.777  -0.603  1.00 0.00 ? 31 PHE A CA   5  
ATOM 5075  C C    . PHE A 1 31 ? 8.091   -6.605  -1.014  1.00 0.00 ? 31 PHE A C    5  
ATOM 5076  O O    . PHE A 1 31 ? 9.130   -6.791  -1.648  1.00 0.00 ? 31 PHE A O    5  
ATOM 5077  C CB   . PHE A 1 31 ? 8.066   -8.912  -0.047  1.00 0.00 ? 31 PHE A CB   5  
ATOM 5078  C CG   . PHE A 1 31 ? 7.273   -10.116 0.375   1.00 0.00 ? 31 PHE A CG   5  
ATOM 5079  C CD1  . PHE A 1 31 ? 6.980   -11.122 -0.532  1.00 0.00 ? 31 PHE A CD1  5  
ATOM 5080  C CD2  . PHE A 1 31 ? 6.820   -10.241 1.678   1.00 0.00 ? 31 PHE A CD2  5  
ATOM 5081  C CE1  . PHE A 1 31 ? 6.250   -12.230 -0.146  1.00 0.00 ? 31 PHE A CE1  5  
ATOM 5082  C CE2  . PHE A 1 31 ? 6.089   -11.347 2.070   1.00 0.00 ? 31 PHE A CE2  5  
ATOM 5083  C CZ   . PHE A 1 31 ? 5.805   -12.343 1.157   1.00 0.00 ? 31 PHE A CZ   5  
ATOM 5084  H H    . PHE A 1 31 ? 6.861   -8.471  -2.574  1.00 0.00 ? 31 PHE A H    5  
ATOM 5085  H HA   . PHE A 1 31 ? 6.522   -7.445  0.164   1.00 0.00 ? 31 PHE A HA   5  
ATOM 5086  H HB2  . PHE A 1 31 ? 8.767   -9.227  -0.805  1.00 0.00 ? 31 PHE A HB2  5  
ATOM 5087  H HB3  . PHE A 1 31 ? 8.610   -8.553  0.814   1.00 0.00 ? 31 PHE A HB3  5  
ATOM 5088  H HD1  . PHE A 1 31 ? 7.328   -11.035 -1.550  1.00 0.00 ? 31 PHE A HD1  5  
ATOM 5089  H HD2  . PHE A 1 31 ? 7.042   -9.462  2.394   1.00 0.00 ? 31 PHE A HD2  5  
ATOM 5090  H HE1  . PHE A 1 31 ? 6.029   -13.007 -0.862  1.00 0.00 ? 31 PHE A HE1  5  
ATOM 5091  H HE2  . PHE A 1 31 ? 5.743   -11.432 3.089   1.00 0.00 ? 31 PHE A HE2  5  
ATOM 5092  H HZ   . PHE A 1 31 ? 5.234   -13.208 1.460   1.00 0.00 ? 31 PHE A HZ   5  
ATOM 5093  N N    . ILE A 1 32 ? 7.671   -5.398  -0.650  1.00 0.00 ? 32 ILE A N    5  
ATOM 5094  C CA   . ILE A 1 32 ? 8.427   -4.196  -0.981  1.00 0.00 ? 32 ILE A CA   5  
ATOM 5095  C C    . ILE A 1 32 ? 9.785   -4.192  -0.289  1.00 0.00 ? 32 ILE A C    5  
ATOM 5096  O O    . ILE A 1 32 ? 10.092  -5.081  0.507   1.00 0.00 ? 32 ILE A O    5  
ATOM 5097  C CB   . ILE A 1 32 ? 7.658   -2.921  -0.584  1.00 0.00 ? 32 ILE A CB   5  
ATOM 5098  C CG1  . ILE A 1 32 ? 7.411   -2.897  0.925   1.00 0.00 ? 32 ILE A CG1  5  
ATOM 5099  C CG2  . ILE A 1 32 ? 6.342   -2.838  -1.344  1.00 0.00 ? 32 ILE A CG2  5  
ATOM 5100  C CD1  . ILE A 1 32 ? 6.797   -1.605  1.417   1.00 0.00 ? 32 ILE A CD1  5  
ATOM 5101  H H    . ILE A 1 32 ? 6.835   -5.313  -0.147  1.00 0.00 ? 32 ILE A H    5  
ATOM 5102  H HA   . ILE A 1 32 ? 8.579   -4.182  -2.051  1.00 0.00 ? 32 ILE A HA   5  
ATOM 5103  H HB   . ILE A 1 32 ? 8.258   -2.066  -0.857  1.00 0.00 ? 32 ILE A HB   5  
ATOM 5104  H HG12 . ILE A 1 32 ? 6.742   -3.702  1.187   1.00 0.00 ? 32 ILE A HG12 5  
ATOM 5105  H HG13 . ILE A 1 32 ? 8.352   -3.035  1.439   1.00 0.00 ? 32 ILE A HG13 5  
ATOM 5106  H HG21 . ILE A 1 32 ? 6.344   -1.960  -1.972  1.00 0.00 ? 32 ILE A HG21 5  
ATOM 5107  H HG22 . ILE A 1 32 ? 6.225   -3.719  -1.957  1.00 0.00 ? 32 ILE A HG22 5  
ATOM 5108  H HG23 . ILE A 1 32 ? 5.525   -2.776  -0.642  1.00 0.00 ? 32 ILE A HG23 5  
ATOM 5109  H HD11 . ILE A 1 32 ? 7.013   -1.480  2.468   1.00 0.00 ? 32 ILE A HD11 5  
ATOM 5110  H HD12 . ILE A 1 32 ? 7.209   -0.776  0.862   1.00 0.00 ? 32 ILE A HD12 5  
ATOM 5111  H HD13 . ILE A 1 32 ? 5.726   -1.638  1.272   1.00 0.00 ? 32 ILE A HD13 5  
ATOM 5112  N N    . THR A 1 33 ? 10.598  -3.186  -0.596  1.00 0.00 ? 33 THR A N    5  
ATOM 5113  C CA   . THR A 1 33 ? 11.924  -3.066  -0.003  1.00 0.00 ? 33 THR A CA   5  
ATOM 5114  C C    . THR A 1 33 ? 11.982  -1.904  0.982   1.00 0.00 ? 33 THR A C    5  
ATOM 5115  O O    . THR A 1 33 ? 11.161  -0.989  0.930   1.00 0.00 ? 33 THR A O    5  
ATOM 5116  C CB   . THR A 1 33 ? 13.005  -2.864  -1.082  1.00 0.00 ? 33 THR A CB   5  
ATOM 5117  O OG1  . THR A 1 33 ? 14.250  -2.512  -0.468  1.00 0.00 ? 33 THR A OG1  5  
ATOM 5118  C CG2  . THR A 1 33 ? 12.593  -1.777  -2.064  1.00 0.00 ? 33 THR A CG2  5  
ATOM 5119  H H    . THR A 1 33 ? 10.297  -2.509  -1.237  1.00 0.00 ? 33 THR A H    5  
ATOM 5120  H HA   . THR A 1 33 ? 12.138  -3.984  0.524   1.00 0.00 ? 33 THR A HA   5  
ATOM 5121  H HB   . THR A 1 33 ? 13.128  -3.791  -1.624  1.00 0.00 ? 33 THR A HB   5  
ATOM 5122  H HG1  . THR A 1 33 ? 14.855  -2.184  -1.137  1.00 0.00 ? 33 THR A HG1  5  
ATOM 5123  H HG21 . THR A 1 33 ? 11.723  -1.262  -1.686  1.00 0.00 ? 33 THR A HG21 5  
ATOM 5124  H HG22 . THR A 1 33 ? 12.361  -2.225  -3.019  1.00 0.00 ? 33 THR A HG22 5  
ATOM 5125  H HG23 . THR A 1 33 ? 13.404  -1.075  -2.183  1.00 0.00 ? 33 THR A HG23 5  
ATOM 5126  N N    . LYS A 1 34 ? 12.960  -1.946  1.881   1.00 0.00 ? 34 LYS A N    5  
ATOM 5127  C CA   . LYS A 1 34 ? 13.128  -0.896  2.879   1.00 0.00 ? 34 LYS A CA   5  
ATOM 5128  C C    . LYS A 1 34 ? 13.167  0.479   2.220   1.00 0.00 ? 34 LYS A C    5  
ATOM 5129  O O    . LYS A 1 34 ? 12.747  1.473   2.813   1.00 0.00 ? 34 LYS A O    5  
ATOM 5130  C CB   . LYS A 1 34 ? 14.412  -1.126  3.680   1.00 0.00 ? 34 LYS A CB   5  
ATOM 5131  C CG   . LYS A 1 34 ? 14.194  -1.902  4.968   1.00 0.00 ? 34 LYS A CG   5  
ATOM 5132  C CD   . LYS A 1 34 ? 14.003  -3.386  4.699   1.00 0.00 ? 34 LYS A CD   5  
ATOM 5133  C CE   . LYS A 1 34 ? 15.334  -4.087  4.476   1.00 0.00 ? 34 LYS A CE   5  
ATOM 5134  N NZ   . LYS A 1 34 ? 16.019  -4.400  5.760   1.00 0.00 ? 34 LYS A NZ   5  
ATOM 5135  H H    . LYS A 1 34 ? 13.585  -2.702  1.873   1.00 0.00 ? 34 LYS A H    5  
ATOM 5136  H HA   . LYS A 1 34 ? 12.283  -0.937  3.550   1.00 0.00 ? 34 LYS A HA   5  
ATOM 5137  H HB2  . LYS A 1 34 ? 15.111  -1.675  3.067   1.00 0.00 ? 34 LYS A HB2  5  
ATOM 5138  H HB3  . LYS A 1 34 ? 14.842  -0.167  3.931   1.00 0.00 ? 34 LYS A HB3  5  
ATOM 5139  H HG2  . LYS A 1 34 ? 15.055  -1.771  5.606   1.00 0.00 ? 34 LYS A HG2  5  
ATOM 5140  H HG3  . LYS A 1 34 ? 13.314  -1.519  5.464   1.00 0.00 ? 34 LYS A HG3  5  
ATOM 5141  H HD2  . LYS A 1 34 ? 13.510  -3.836  5.548   1.00 0.00 ? 34 LYS A HD2  5  
ATOM 5142  H HD3  . LYS A 1 34 ? 13.390  -3.507  3.818   1.00 0.00 ? 34 LYS A HD3  5  
ATOM 5143  H HE2  . LYS A 1 34 ? 15.156  -5.007  3.940   1.00 0.00 ? 34 LYS A HE2  5  
ATOM 5144  H HE3  . LYS A 1 34 ? 15.970  -3.444  3.885   1.00 0.00 ? 34 LYS A HE3  5  
ATOM 5145  H HZ1  . LYS A 1 34 ? 16.825  -3.757  5.900   1.00 0.00 ? 34 LYS A HZ1  5  
ATOM 5146  H HZ2  . LYS A 1 34 ? 16.369  -5.379  5.750   1.00 0.00 ? 34 LYS A HZ2  5  
ATOM 5147  H HZ3  . LYS A 1 34 ? 15.358  -4.288  6.555   1.00 0.00 ? 34 LYS A HZ3  5  
ATOM 5148  N N    . ASP A 1 35 ? 13.672  0.528   0.993   1.00 0.00 ? 35 ASP A N    5  
ATOM 5149  C CA   . ASP A 1 35 ? 13.763  1.781   0.252   1.00 0.00 ? 35 ASP A CA   5  
ATOM 5150  C C    . ASP A 1 35 ? 12.389  2.219   -0.246  1.00 0.00 ? 35 ASP A C    5  
ATOM 5151  O O    . ASP A 1 35 ? 12.086  3.411   -0.297  1.00 0.00 ? 35 ASP A O    5  
ATOM 5152  C CB   . ASP A 1 35 ? 14.724  1.632   -0.928  1.00 0.00 ? 35 ASP A CB   5  
ATOM 5153  C CG   . ASP A 1 35 ? 15.432  2.929   -1.265  1.00 0.00 ? 35 ASP A CG   5  
ATOM 5154  O OD1  . ASP A 1 35 ? 15.745  3.694   -0.329  1.00 0.00 ? 35 ASP A OD1  5  
ATOM 5155  O OD2  . ASP A 1 35 ? 15.673  3.180   -2.465  1.00 0.00 ? 35 ASP A OD2  5  
ATOM 5156  H H    . ASP A 1 35 ? 13.990  -0.299  0.574   1.00 0.00 ? 35 ASP A H    5  
ATOM 5157  H HA   . ASP A 1 35 ? 14.145  2.535   0.923   1.00 0.00 ? 35 ASP A HA   5  
ATOM 5158  H HB2  . ASP A 1 35 ? 15.469  0.889   -0.686  1.00 0.00 ? 35 ASP A HB2  5  
ATOM 5159  H HB3  . ASP A 1 35 ? 14.169  1.310   -1.797  1.00 0.00 ? 35 ASP A HB3  5  
ATOM 5160  N N    . LYS A 1 36 ? 11.561  1.246   -0.614  1.00 0.00 ? 36 LYS A N    5  
ATOM 5161  C CA   . LYS A 1 36 ? 10.219  1.530   -1.108  1.00 0.00 ? 36 LYS A CA   5  
ATOM 5162  C C    . LYS A 1 36 ? 9.279   1.883   0.040   1.00 0.00 ? 36 LYS A C    5  
ATOM 5163  O O    . LYS A 1 36 ? 8.520   2.849   -0.041  1.00 0.00 ? 36 LYS A O    5  
ATOM 5164  C CB   . LYS A 1 36 ? 9.672   0.325   -1.877  1.00 0.00 ? 36 LYS A CB   5  
ATOM 5165  C CG   . LYS A 1 36 ? 8.308   0.570   -2.500  1.00 0.00 ? 36 LYS A CG   5  
ATOM 5166  C CD   . LYS A 1 36 ? 8.404   1.490   -3.706  1.00 0.00 ? 36 LYS A CD   5  
ATOM 5167  C CE   . LYS A 1 36 ? 8.154   2.940   -3.321  1.00 0.00 ? 36 LYS A CE   5  
ATOM 5168  N NZ   . LYS A 1 36 ? 7.278   3.633   -4.306  1.00 0.00 ? 36 LYS A NZ   5  
ATOM 5169  H H    . LYS A 1 36 ? 11.860  0.315   -0.550  1.00 0.00 ? 36 LYS A H    5  
ATOM 5170  H HA   . LYS A 1 36 ? 10.283  2.374   -1.777  1.00 0.00 ? 36 LYS A HA   5  
ATOM 5171  H HB2  . LYS A 1 36 ? 10.365  0.071   -2.665  1.00 0.00 ? 36 LYS A HB2  5  
ATOM 5172  H HB3  . LYS A 1 36 ? 9.589   -0.512  -1.198  1.00 0.00 ? 36 LYS A HB3  5  
ATOM 5173  H HG2  . LYS A 1 36 ? 7.891   -0.375  -2.815  1.00 0.00 ? 36 LYS A HG2  5  
ATOM 5174  H HG3  . LYS A 1 36 ? 7.661   1.023   -1.763  1.00 0.00 ? 36 LYS A HG3  5  
ATOM 5175  H HD2  . LYS A 1 36 ? 9.392   1.409   -4.133  1.00 0.00 ? 36 LYS A HD2  5  
ATOM 5176  H HD3  . LYS A 1 36 ? 7.667   1.189   -4.437  1.00 0.00 ? 36 LYS A HD3  5  
ATOM 5177  H HE2  . LYS A 1 36 ? 7.680   2.965   -2.351  1.00 0.00 ? 36 LYS A HE2  5  
ATOM 5178  H HE3  . LYS A 1 36 ? 9.102   3.454   -3.271  1.00 0.00 ? 36 LYS A HE3  5  
ATOM 5179  H HZ1  . LYS A 1 36 ? 6.539   4.171   -3.810  1.00 0.00 ? 36 LYS A HZ1  5  
ATOM 5180  H HZ2  . LYS A 1 36 ? 6.823   2.937   -4.931  1.00 0.00 ? 36 LYS A HZ2  5  
ATOM 5181  H HZ3  . LYS A 1 36 ? 7.840   4.288   -4.885  1.00 0.00 ? 36 LYS A HZ3  5  
ATOM 5182  N N    . ARG A 1 37 ? 9.337   1.096   1.110   1.00 0.00 ? 37 ARG A N    5  
ATOM 5183  C CA   . ARG A 1 37 ? 8.492   1.327   2.275   1.00 0.00 ? 37 ARG A CA   5  
ATOM 5184  C C    . ARG A 1 37 ? 8.609   2.771   2.755   1.00 0.00 ? 37 ARG A C    5  
ATOM 5185  O O    . ARG A 1 37 ? 7.643   3.351   3.250   1.00 0.00 ? 37 ARG A O    5  
ATOM 5186  C CB   . ARG A 1 37 ? 8.873   0.370   3.406   1.00 0.00 ? 37 ARG A CB   5  
ATOM 5187  C CG   . ARG A 1 37 ? 8.003   0.514   4.644   1.00 0.00 ? 37 ARG A CG   5  
ATOM 5188  C CD   . ARG A 1 37 ? 7.739   -0.833  5.299   1.00 0.00 ? 37 ARG A CD   5  
ATOM 5189  N NE   . ARG A 1 37 ? 8.330   -0.920  6.631   1.00 0.00 ? 37 ARG A NE   5  
ATOM 5190  C CZ   . ARG A 1 37 ? 9.613   -1.186  6.850   1.00 0.00 ? 37 ARG A CZ   5  
ATOM 5191  N NH1  . ARG A 1 37 ? 10.434  -1.390  5.830   1.00 0.00 ? 37 ARG A NH1  5  
ATOM 5192  N NH2  . ARG A 1 37 ? 10.076  -1.248  8.092   1.00 0.00 ? 37 ARG A NH2  5  
ATOM 5193  H H    . ARG A 1 37 ? 9.963   0.342   1.115   1.00 0.00 ? 37 ARG A H    5  
ATOM 5194  H HA   . ARG A 1 37 ? 7.469   1.138   1.985   1.00 0.00 ? 37 ARG A HA   5  
ATOM 5195  H HB2  . ARG A 1 37 ? 8.785   -0.646  3.047   1.00 0.00 ? 37 ARG A HB2  5  
ATOM 5196  H HB3  . ARG A 1 37 ? 9.898   0.556   3.688   1.00 0.00 ? 37 ARG A HB3  5  
ATOM 5197  H HG2  . ARG A 1 37 ? 8.507   1.153   5.354   1.00 0.00 ? 37 ARG A HG2  5  
ATOM 5198  H HG3  . ARG A 1 37 ? 7.061   0.959   4.361   1.00 0.00 ? 37 ARG A HG3  5  
ATOM 5199  H HD2  . ARG A 1 37 ? 6.671   -0.976  5.379   1.00 0.00 ? 37 ARG A HD2  5  
ATOM 5200  H HD3  . ARG A 1 37 ? 8.159   -1.609  4.677   1.00 0.00 ? 37 ARG A HD3  5  
ATOM 5201  H HE   . ARG A 1 37 ? 7.741   -0.772  7.400   1.00 0.00 ? 37 ARG A HE   5  
ATOM 5202  H HH11 . ARG A 1 37 ? 10.088  -1.343  4.893   1.00 0.00 ? 37 ARG A HH11 5  
ATOM 5203  H HH12 . ARG A 1 37 ? 11.400  -1.590  5.997   1.00 0.00 ? 37 ARG A HH12 5  
ATOM 5204  H HH21 . ARG A 1 37 ? 9.460   -1.095  8.864   1.00 0.00 ? 37 ARG A HH21 5  
ATOM 5205  H HH22 . ARG A 1 37 ? 11.041  -1.449  8.256   1.00 0.00 ? 37 ARG A HH22 5  
ATOM 5206  N N    . ARG A 1 38 ? 9.799   3.344   2.604   1.00 0.00 ? 38 ARG A N    5  
ATOM 5207  C CA   . ARG A 1 38 ? 10.043  4.719   3.024   1.00 0.00 ? 38 ARG A CA   5  
ATOM 5208  C C    . ARG A 1 38 ? 9.436   5.706   2.031   1.00 0.00 ? 38 ARG A C    5  
ATOM 5209  O O    . ARG A 1 38 ? 8.987   6.788   2.410   1.00 0.00 ? 38 ARG A O    5  
ATOM 5210  C CB   . ARG A 1 38 ? 11.545  4.974   3.160   1.00 0.00 ? 38 ARG A CB   5  
ATOM 5211  C CG   . ARG A 1 38 ? 12.190  4.216   4.309   1.00 0.00 ? 38 ARG A CG   5  
ATOM 5212  C CD   . ARG A 1 38 ? 13.705  4.339   4.276   1.00 0.00 ? 38 ARG A CD   5  
ATOM 5213  N NE   . ARG A 1 38 ? 14.143  5.730   4.352   1.00 0.00 ? 38 ARG A NE   5  
ATOM 5214  C CZ   . ARG A 1 38 ? 14.218  6.417   5.486   1.00 0.00 ? 38 ARG A CZ   5  
ATOM 5215  N NH1  . ARG A 1 38 ? 13.885  5.844   6.635   1.00 0.00 ? 38 ARG A NH1  5  
ATOM 5216  N NH2  . ARG A 1 38 ? 14.626  7.679   5.474   1.00 0.00 ? 38 ARG A NH2  5  
ATOM 5217  H H    . ARG A 1 38 ? 10.530  2.830   2.202   1.00 0.00 ? 38 ARG A H    5  
ATOM 5218  H HA   . ARG A 1 38 ? 9.574   4.860   3.986   1.00 0.00 ? 38 ARG A HA   5  
ATOM 5219  H HB2  . ARG A 1 38 ? 12.033  4.677   2.243   1.00 0.00 ? 38 ARG A HB2  5  
ATOM 5220  H HB3  . ARG A 1 38 ? 11.705  6.029   3.318   1.00 0.00 ? 38 ARG A HB3  5  
ATOM 5221  H HG2  . ARG A 1 38 ? 11.827  4.620   5.243   1.00 0.00 ? 38 ARG A HG2  5  
ATOM 5222  H HG3  . ARG A 1 38 ? 11.919  3.173   4.237   1.00 0.00 ? 38 ARG A HG3  5  
ATOM 5223  H HD2  . ARG A 1 38 ? 14.115  3.797   5.115   1.00 0.00 ? 38 ARG A HD2  5  
ATOM 5224  H HD3  . ARG A 1 38 ? 14.068  3.906   3.356   1.00 0.00 ? 38 ARG A HD3  5  
ATOM 5225  H HE   . ARG A 1 38 ? 14.394  6.173   3.515   1.00 0.00 ? 38 ARG A HE   5  
ATOM 5226  H HH11 . ARG A 1 38 ? 13.578  4.893   6.647   1.00 0.00 ? 38 ARG A HH11 5  
ATOM 5227  H HH12 . ARG A 1 38 ? 13.943  6.363   7.488   1.00 0.00 ? 38 ARG A HH12 5  
ATOM 5228  H HH21 . ARG A 1 38 ? 14.878  8.114   4.610   1.00 0.00 ? 38 ARG A HH21 5  
ATOM 5229  H HH22 . ARG A 1 38 ? 14.681  8.195   6.328   1.00 0.00 ? 38 ARG A HH22 5  
ATOM 5230  N N    . LYS A 1 39 ? 9.427   5.326   0.758   1.00 0.00 ? 39 LYS A N    5  
ATOM 5231  C CA   . LYS A 1 39 ? 8.876   6.176   -0.291  1.00 0.00 ? 39 LYS A CA   5  
ATOM 5232  C C    . LYS A 1 39 ? 7.355   6.247   -0.191  1.00 0.00 ? 39 LYS A C    5  
ATOM 5233  O O    . LYS A 1 39 ? 6.763   7.315   -0.346  1.00 0.00 ? 39 LYS A O    5  
ATOM 5234  C CB   . LYS A 1 39 ? 9.282   5.650   -1.669  1.00 0.00 ? 39 LYS A CB   5  
ATOM 5235  C CG   . LYS A 1 39 ? 10.628  6.169   -2.146  1.00 0.00 ? 39 LYS A CG   5  
ATOM 5236  C CD   . LYS A 1 39 ? 10.597  7.671   -2.372  1.00 0.00 ? 39 LYS A CD   5  
ATOM 5237  C CE   . LYS A 1 39 ? 11.799  8.138   -3.179  1.00 0.00 ? 39 LYS A CE   5  
ATOM 5238  N NZ   . LYS A 1 39 ? 11.614  9.521   -3.700  1.00 0.00 ? 39 LYS A NZ   5  
ATOM 5239  H H    . LYS A 1 39 ? 9.800   4.452   0.517   1.00 0.00 ? 39 LYS A H    5  
ATOM 5240  H HA   . LYS A 1 39 ? 9.280   7.168   -0.160  1.00 0.00 ? 39 LYS A HA   5  
ATOM 5241  H HB2  . LYS A 1 39 ? 9.329   4.571   -1.630  1.00 0.00 ? 39 LYS A HB2  5  
ATOM 5242  H HB3  . LYS A 1 39 ? 8.531   5.943   -2.389  1.00 0.00 ? 39 LYS A HB3  5  
ATOM 5243  H HG2  . LYS A 1 39 ? 11.376  5.943   -1.401  1.00 0.00 ? 39 LYS A HG2  5  
ATOM 5244  H HG3  . LYS A 1 39 ? 10.883  5.679   -3.075  1.00 0.00 ? 39 LYS A HG3  5  
ATOM 5245  H HD2  . LYS A 1 39 ? 9.696   7.928   -2.908  1.00 0.00 ? 39 LYS A HD2  5  
ATOM 5246  H HD3  . LYS A 1 39 ? 10.603  8.171   -1.413  1.00 0.00 ? 39 LYS A HD3  5  
ATOM 5247  H HE2  . LYS A 1 39 ? 12.673  8.115   -2.546  1.00 0.00 ? 39 LYS A HE2  5  
ATOM 5248  H HE3  . LYS A 1 39 ? 11.940  7.464   -4.012  1.00 0.00 ? 39 LYS A HE3  5  
ATOM 5249  H HZ1  . LYS A 1 39 ? 10.603  9.714   -3.848  1.00 0.00 ? 39 LYS A HZ1  5  
ATOM 5250  H HZ2  . LYS A 1 39 ? 12.112  9.631   -4.606  1.00 0.00 ? 39 LYS A HZ2  5  
ATOM 5251  H HZ3  . LYS A 1 39 ? 11.993  10.212  -3.022  1.00 0.00 ? 39 LYS A HZ3  5  
ATOM 5252  N N    . ILE A 1 40 ? 6.730   5.104   0.072   1.00 0.00 ? 40 ILE A N    5  
ATOM 5253  C CA   . ILE A 1 40 ? 5.279   5.039   0.195   1.00 0.00 ? 40 ILE A CA   5  
ATOM 5254  C C    . ILE A 1 40 ? 4.791   5.863   1.382   1.00 0.00 ? 40 ILE A C    5  
ATOM 5255  O O    . ILE A 1 40 ? 3.737   6.495   1.319   1.00 0.00 ? 40 ILE A O    5  
ATOM 5256  C CB   . ILE A 1 40 ? 4.794   3.586   0.359   1.00 0.00 ? 40 ILE A CB   5  
ATOM 5257  C CG1  . ILE A 1 40 ? 5.244   2.737   -0.831  1.00 0.00 ? 40 ILE A CG1  5  
ATOM 5258  C CG2  . ILE A 1 40 ? 3.279   3.547   0.501   1.00 0.00 ? 40 ILE A CG2  5  
ATOM 5259  C CD1  . ILE A 1 40 ? 4.825   1.287   -0.733  1.00 0.00 ? 40 ILE A CD1  5  
ATOM 5260  H H    . ILE A 1 40 ? 7.257   4.286   0.185   1.00 0.00 ? 40 ILE A H    5  
ATOM 5261  H HA   . ILE A 1 40 ? 4.849   5.441   -0.711  1.00 0.00 ? 40 ILE A HA   5  
ATOM 5262  H HB   . ILE A 1 40 ? 5.226   3.185   1.263   1.00 0.00 ? 40 ILE A HB   5  
ATOM 5263  H HG12 . ILE A 1 40 ? 4.821   3.144   -1.736  1.00 0.00 ? 40 ILE A HG12 5  
ATOM 5264  H HG13 . ILE A 1 40 ? 6.322   2.768   -0.898  1.00 0.00 ? 40 ILE A HG13 5  
ATOM 5265  H HG21 . ILE A 1 40 ? 2.860   2.929   -0.279  1.00 0.00 ? 40 ILE A HG21 5  
ATOM 5266  H HG22 . ILE A 1 40 ? 3.019   3.134   1.464   1.00 0.00 ? 40 ILE A HG22 5  
ATOM 5267  H HG23 . ILE A 1 40 ? 2.884   4.548   0.419   1.00 0.00 ? 40 ILE A HG23 5  
ATOM 5268  H HD11 . ILE A 1 40 ? 3.939   1.127   -1.330  1.00 0.00 ? 40 ILE A HD11 5  
ATOM 5269  H HD12 . ILE A 1 40 ? 5.622   0.656   -1.094  1.00 0.00 ? 40 ILE A HD12 5  
ATOM 5270  H HD13 . ILE A 1 40 ? 4.612   1.044   0.298   1.00 0.00 ? 40 ILE A HD13 5  
ATOM 5271  N N    . SER A 1 41 ? 5.566   5.853   2.462   1.00 0.00 ? 41 SER A N    5  
ATOM 5272  C CA   . SER A 1 41 ? 5.212   6.598   3.664   1.00 0.00 ? 41 SER A CA   5  
ATOM 5273  C C    . SER A 1 41 ? 5.241   8.101   3.400   1.00 0.00 ? 41 SER A C    5  
ATOM 5274  O O    . SER A 1 41 ? 4.607   8.879   4.111   1.00 0.00 ? 41 SER A O    5  
ATOM 5275  C CB   . SER A 1 41 ? 6.169   6.251   4.805   1.00 0.00 ? 41 SER A CB   5  
ATOM 5276  O OG   . SER A 1 41 ? 6.336   7.350   5.684   1.00 0.00 ? 41 SER A OG   5  
ATOM 5277  H H    . SER A 1 41 ? 6.395   5.329   2.450   1.00 0.00 ? 41 SER A H    5  
ATOM 5278  H HA   . SER A 1 41 ? 4.209   6.314   3.946   1.00 0.00 ? 41 SER A HA   5  
ATOM 5279  H HB2  . SER A 1 41 ? 5.771   5.417   5.364   1.00 0.00 ? 41 SER A HB2  5  
ATOM 5280  H HB3  . SER A 1 41 ? 7.132   5.983   4.395   1.00 0.00 ? 41 SER A HB3  5  
ATOM 5281  H HG   . SER A 1 41 ? 6.738   7.049   6.501   1.00 0.00 ? 41 SER A HG   5  
ATOM 5282  N N    . ALA A 1 42 ? 5.983   8.500   2.372   1.00 0.00 ? 42 ALA A N    5  
ATOM 5283  C CA   . ALA A 1 42 ? 6.095   9.908   2.012   1.00 0.00 ? 42 ALA A CA   5  
ATOM 5284  C C    . ALA A 1 42 ? 4.938   10.339  1.117   1.00 0.00 ? 42 ALA A C    5  
ATOM 5285  O O    . ALA A 1 42 ? 4.583   11.516  1.069   1.00 0.00 ? 42 ALA A O    5  
ATOM 5286  C CB   . ALA A 1 42 ? 7.426   10.173  1.323   1.00 0.00 ? 42 ALA A CB   5  
ATOM 5287  H H    . ALA A 1 42 ? 6.466   7.832   1.843   1.00 0.00 ? 42 ALA A H    5  
ATOM 5288  H HA   . ALA A 1 42 ? 6.068   10.489  2.923   1.00 0.00 ? 42 ALA A HA   5  
ATOM 5289  H HB1  . ALA A 1 42 ? 8.086   10.690  2.004   1.00 0.00 ? 42 ALA A HB1  5  
ATOM 5290  H HB2  . ALA A 1 42 ? 7.872   9.234   1.031   1.00 0.00 ? 42 ALA A HB2  5  
ATOM 5291  H HB3  . ALA A 1 42 ? 7.262   10.782  0.447   1.00 0.00 ? 42 ALA A HB3  5  
ATOM 5292  N N    . ALA A 1 43 ? 4.355   9.378   0.407   1.00 0.00 ? 43 ALA A N    5  
ATOM 5293  C CA   . ALA A 1 43 ? 3.238   9.659   -0.486  1.00 0.00 ? 43 ALA A CA   5  
ATOM 5294  C C    . ALA A 1 43 ? 1.904   9.437   0.218   1.00 0.00 ? 43 ALA A C    5  
ATOM 5295  O O    . ALA A 1 43 ? 1.089   10.353  0.331   1.00 0.00 ? 43 ALA A O    5  
ATOM 5296  C CB   . ALA A 1 43 ? 3.329   8.793   -1.733  1.00 0.00 ? 43 ALA A CB   5  
ATOM 5297  H H    . ALA A 1 43 ? 4.684   8.458   0.488   1.00 0.00 ? 43 ALA A H    5  
ATOM 5298  H HA   . ALA A 1 43 ? 3.306   10.693  -0.790  1.00 0.00 ? 43 ALA A HA   5  
ATOM 5299  H HB1  . ALA A 1 43 ? 2.345   8.432   -1.993  1.00 0.00 ? 43 ALA A HB1  5  
ATOM 5300  H HB2  . ALA A 1 43 ? 3.726   9.378   -2.549  1.00 0.00 ? 43 ALA A HB2  5  
ATOM 5301  H HB3  . ALA A 1 43 ? 3.981   7.954   -1.542  1.00 0.00 ? 43 ALA A HB3  5  
ATOM 5302  N N    . THR A 1 44 ? 1.685   8.213   0.690   1.00 0.00 ? 44 THR A N    5  
ATOM 5303  C CA   . THR A 1 44 ? 0.448   7.871   1.381   1.00 0.00 ? 44 THR A CA   5  
ATOM 5304  C C    . THR A 1 44 ? 0.410   8.485   2.776   1.00 0.00 ? 44 THR A C    5  
ATOM 5305  O O    . THR A 1 44 ? -0.635  8.504   3.427   1.00 0.00 ? 44 THR A O    5  
ATOM 5306  C CB   . THR A 1 44 ? 0.276   6.344   1.500   1.00 0.00 ? 44 THR A CB   5  
ATOM 5307  O OG1  . THR A 1 44 ? 1.357   5.787   2.256   1.00 0.00 ? 44 THR A OG1  5  
ATOM 5308  C CG2  . THR A 1 44 ? 0.224   5.697   0.125   1.00 0.00 ? 44 THR A CG2  5  
ATOM 5309  H H    . THR A 1 44 ? 2.373   7.526   0.569   1.00 0.00 ? 44 THR A H    5  
ATOM 5310  H HA   . THR A 1 44 ? -0.376  8.261   0.803   1.00 0.00 ? 44 THR A HA   5  
ATOM 5311  H HB   . THR A 1 44 ? -0.654  6.141   2.013   1.00 0.00 ? 44 THR A HB   5  
ATOM 5312  H HG1  . THR A 1 44 ? 1.497   4.875   1.989   1.00 0.00 ? 44 THR A HG1  5  
ATOM 5313  H HG21 . THR A 1 44 ? 1.181   5.812   -0.364  1.00 0.00 ? 44 THR A HG21 5  
ATOM 5314  H HG22 . THR A 1 44 ? -0.542  6.172   -0.468  1.00 0.00 ? 44 THR A HG22 5  
ATOM 5315  H HG23 . THR A 1 44 ? -0.001  4.647   0.230   1.00 0.00 ? 44 THR A HG23 5  
ATOM 5316  N N    . SER A 1 45 ? 1.554   8.988   3.228   1.00 0.00 ? 45 SER A N    5  
ATOM 5317  C CA   . SER A 1 45 ? 1.651   9.601   4.548   1.00 0.00 ? 45 SER A CA   5  
ATOM 5318  C C    . SER A 1 45 ? 1.364   8.579   5.644   1.00 0.00 ? 45 SER A C    5  
ATOM 5319  O O    . SER A 1 45 ? 0.906   8.930   6.732   1.00 0.00 ? 45 SER A O    5  
ATOM 5320  C CB   . SER A 1 45 ? 0.676   10.774  4.661   1.00 0.00 ? 45 SER A CB   5  
ATOM 5321  O OG   . SER A 1 45 ? 0.686   11.562  3.483   1.00 0.00 ? 45 SER A OG   5  
ATOM 5322  H H    . SER A 1 45 ? 2.352   8.943   2.662   1.00 0.00 ? 45 SER A H    5  
ATOM 5323  H HA   . SER A 1 45 ? 2.659   9.968   4.669   1.00 0.00 ? 45 SER A HA   5  
ATOM 5324  H HB2  . SER A 1 45 ? -0.323  10.396  4.818   1.00 0.00 ? 45 SER A HB2  5  
ATOM 5325  H HB3  . SER A 1 45 ? 0.961   11.396  5.498   1.00 0.00 ? 45 SER A HB3  5  
ATOM 5326  H HG   . SER A 1 45 ? 1.572   11.899  3.331   1.00 0.00 ? 45 SER A HG   5  
ATOM 5327  N N    . LEU A 1 46 ? 1.637   7.313   5.349   1.00 0.00 ? 46 LEU A N    5  
ATOM 5328  C CA   . LEU A 1 46 ? 1.409   6.238   6.309   1.00 0.00 ? 46 LEU A CA   5  
ATOM 5329  C C    . LEU A 1 46 ? 2.707   5.849   7.010   1.00 0.00 ? 46 LEU A C    5  
ATOM 5330  O O    . LEU A 1 46 ? 3.788   6.296   6.627   1.00 0.00 ? 46 LEU A O    5  
ATOM 5331  C CB   . LEU A 1 46 ? 0.811   5.018   5.606   1.00 0.00 ? 46 LEU A CB   5  
ATOM 5332  C CG   . LEU A 1 46 ? -0.625  5.171   5.102   1.00 0.00 ? 46 LEU A CG   5  
ATOM 5333  C CD1  . LEU A 1 46 ? -0.891  4.213   3.951   1.00 0.00 ? 46 LEU A CD1  5  
ATOM 5334  C CD2  . LEU A 1 46 ? -1.615  4.937   6.233   1.00 0.00 ? 46 LEU A CD2  5  
ATOM 5335  H H    . LEU A 1 46 ? 2.001   7.094   4.466   1.00 0.00 ? 46 LEU A H    5  
ATOM 5336  H HA   . LEU A 1 46 ? 0.708   6.597   7.048   1.00 0.00 ? 46 LEU A HA   5  
ATOM 5337  H HB2  . LEU A 1 46 ? 1.436   4.786   4.757   1.00 0.00 ? 46 LEU A HB2  5  
ATOM 5338  H HB3  . LEU A 1 46 ? 0.832   4.192   6.303   1.00 0.00 ? 46 LEU A HB3  5  
ATOM 5339  H HG   . LEU A 1 46 ? -0.766  6.179   4.736   1.00 0.00 ? 46 LEU A HG   5  
ATOM 5340  H HD11 . LEU A 1 46 ? -1.605  4.656   3.272   1.00 0.00 ? 46 LEU A HD11 5  
ATOM 5341  H HD12 . LEU A 1 46 ? -1.288  3.287   4.338   1.00 0.00 ? 46 LEU A HD12 5  
ATOM 5342  H HD13 . LEU A 1 46 ? 0.032   4.017   3.425   1.00 0.00 ? 46 LEU A HD13 5  
ATOM 5343  H HD21 . LEU A 1 46 ? -1.707  5.837   6.822   1.00 0.00 ? 46 LEU A HD21 5  
ATOM 5344  H HD22 . LEU A 1 46 ? -1.261  4.131   6.860   1.00 0.00 ? 46 LEU A HD22 5  
ATOM 5345  H HD23 . LEU A 1 46 ? -2.578  4.675   5.820   1.00 0.00 ? 46 LEU A HD23 5  
ATOM 5346  N N    . SER A 1 47 ? 2.591   5.013   8.037   1.00 0.00 ? 47 SER A N    5  
ATOM 5347  C CA   . SER A 1 47 ? 3.755   4.565   8.792   1.00 0.00 ? 47 SER A CA   5  
ATOM 5348  C C    . SER A 1 47 ? 4.376   3.328   8.151   1.00 0.00 ? 47 SER A C    5  
ATOM 5349  O O    . SER A 1 47 ? 3.680   2.519   7.539   1.00 0.00 ? 47 SER A O    5  
ATOM 5350  C CB   . SER A 1 47 ? 3.364   4.262   10.240  1.00 0.00 ? 47 SER A CB   5  
ATOM 5351  O OG   . SER A 1 47 ? 4.427   4.562   11.129  1.00 0.00 ? 47 SER A OG   5  
ATOM 5352  H H    . SER A 1 47 ? 1.702   4.692   8.294   1.00 0.00 ? 47 SER A H    5  
ATOM 5353  H HA   . SER A 1 47 ? 4.483   5.363   8.785   1.00 0.00 ? 47 SER A HA   5  
ATOM 5354  H HB2  . SER A 1 47 ? 2.506   4.858   10.511  1.00 0.00 ? 47 SER A HB2  5  
ATOM 5355  H HB3  . SER A 1 47 ? 3.119   3.214   10.331  1.00 0.00 ? 47 SER A HB3  5  
ATOM 5356  H HG   . SER A 1 47 ? 4.111   4.511   12.034  1.00 0.00 ? 47 SER A HG   5  
ATOM 5357  N N    . GLU A 1 48 ? 5.690   3.189   8.298   1.00 0.00 ? 48 GLU A N    5  
ATOM 5358  C CA   . GLU A 1 48 ? 6.405   2.051   7.732   1.00 0.00 ? 48 GLU A CA   5  
ATOM 5359  C C    . GLU A 1 48 ? 5.760   0.736   8.161   1.00 0.00 ? 48 GLU A C    5  
ATOM 5360  O O    . GLU A 1 48 ? 5.704   -0.221  7.389   1.00 0.00 ? 48 GLU A O    5  
ATOM 5361  C CB   . GLU A 1 48 ? 7.872   2.076   8.164   1.00 0.00 ? 48 GLU A CB   5  
ATOM 5362  C CG   . GLU A 1 48 ? 8.549   3.418   7.941   1.00 0.00 ? 48 GLU A CG   5  
ATOM 5363  C CD   . GLU A 1 48 ? 10.043  3.367   8.192   1.00 0.00 ? 48 GLU A CD   5  
ATOM 5364  O OE1  . GLU A 1 48 ? 10.601  2.251   8.232   1.00 0.00 ? 48 GLU A OE1  5  
ATOM 5365  O OE2  . GLU A 1 48 ? 10.656  4.445   8.347   1.00 0.00 ? 48 GLU A OE2  5  
ATOM 5366  H H    . GLU A 1 48 ? 6.190   3.868   8.797   1.00 0.00 ? 48 GLU A H    5  
ATOM 5367  H HA   . GLU A 1 48 ? 6.354   2.128   6.657   1.00 0.00 ? 48 GLU A HA   5  
ATOM 5368  H HB2  . GLU A 1 48 ? 7.930   1.837   9.215   1.00 0.00 ? 48 GLU A HB2  5  
ATOM 5369  H HB3  . GLU A 1 48 ? 8.413   1.328   7.603   1.00 0.00 ? 48 GLU A HB3  5  
ATOM 5370  H HG2  . GLU A 1 48 ? 8.381   3.727   6.920   1.00 0.00 ? 48 GLU A HG2  5  
ATOM 5371  H HG3  . GLU A 1 48 ? 8.111   4.143   8.611   1.00 0.00 ? 48 GLU A HG3  5  
ATOM 5372  N N    . ARG A 1 49 ? 5.275   0.697   9.398   1.00 0.00 ? 49 ARG A N    5  
ATOM 5373  C CA   . ARG A 1 49 ? 4.636   -0.500  9.931   1.00 0.00 ? 49 ARG A CA   5  
ATOM 5374  C C    . ARG A 1 49 ? 3.246   -0.687  9.331   1.00 0.00 ? 49 ARG A C    5  
ATOM 5375  O O    . ARG A 1 49 ? 2.879   -1.788  8.924   1.00 0.00 ? 49 ARG A O    5  
ATOM 5376  C CB   . ARG A 1 49 ? 4.539   -0.416  11.455  1.00 0.00 ? 49 ARG A CB   5  
ATOM 5377  C CG   . ARG A 1 49 ? 4.221   -1.746  12.120  1.00 0.00 ? 49 ARG A CG   5  
ATOM 5378  C CD   . ARG A 1 49 ? 5.370   -2.731  11.972  1.00 0.00 ? 49 ARG A CD   5  
ATOM 5379  N NE   . ARG A 1 49 ? 6.612   -2.212  12.539  1.00 0.00 ? 49 ARG A NE   5  
ATOM 5380  C CZ   . ARG A 1 49 ? 6.854   -2.147  13.843  1.00 0.00 ? 49 ARG A CZ   5  
ATOM 5381  N NH1  . ARG A 1 49 ? 5.944   -2.567  14.711  1.00 0.00 ? 49 ARG A NH1  5  
ATOM 5382  N NH2  . ARG A 1 49 ? 8.009   -1.662  14.282  1.00 0.00 ? 49 ARG A NH2  5  
ATOM 5383  H H    . ARG A 1 49 ? 5.350   1.492   9.966   1.00 0.00 ? 49 ARG A H    5  
ATOM 5384  H HA   . ARG A 1 49 ? 5.247   -1.349  9.664   1.00 0.00 ? 49 ARG A HA   5  
ATOM 5385  H HB2  . ARG A 1 49 ? 5.481   -0.060  11.846  1.00 0.00 ? 49 ARG A HB2  5  
ATOM 5386  H HB3  . ARG A 1 49 ? 3.762   0.286   11.716  1.00 0.00 ? 49 ARG A HB3  5  
ATOM 5387  H HG2  . ARG A 1 49 ? 4.038   -1.578  13.171  1.00 0.00 ? 49 ARG A HG2  5  
ATOM 5388  H HG3  . ARG A 1 49 ? 3.338   -2.165  11.660  1.00 0.00 ? 49 ARG A HG3  5  
ATOM 5389  H HD2  . ARG A 1 49 ? 5.109   -3.647  12.481  1.00 0.00 ? 49 ARG A HD2  5  
ATOM 5390  H HD3  . ARG A 1 49 ? 5.521   -2.933  10.922  1.00 0.00 ? 49 ARG A HD3  5  
ATOM 5391  H HE   . ARG A 1 49 ? 7.298   -1.896  11.915  1.00 0.00 ? 49 ARG A HE   5  
ATOM 5392  H HH11 . ARG A 1 49 ? 5.074   -2.934  14.384  1.00 0.00 ? 49 ARG A HH11 5  
ATOM 5393  H HH12 . ARG A 1 49 ? 6.130   -2.519  15.693  1.00 0.00 ? 49 ARG A HH12 5  
ATOM 5394  H HH21 . ARG A 1 49 ? 8.697   -1.344  13.630  1.00 0.00 ? 49 ARG A HH21 5  
ATOM 5395  H HH22 . ARG A 1 49 ? 8.190   -1.613  15.263  1.00 0.00 ? 49 ARG A HH22 5  
ATOM 5396  N N    . GLN A 1 50 ? 2.478   0.397   9.282   1.00 0.00 ? 50 GLN A N    5  
ATOM 5397  C CA   . GLN A 1 50 ? 1.127   0.351   8.734   1.00 0.00 ? 50 GLN A CA   5  
ATOM 5398  C C    . GLN A 1 50 ? 1.131   -0.237  7.327   1.00 0.00 ? 50 GLN A C    5  
ATOM 5399  O O    . GLN A 1 50 ? 0.402   -1.186  7.038   1.00 0.00 ? 50 GLN A O    5  
ATOM 5400  C CB   . GLN A 1 50 ? 0.515   1.753   8.712   1.00 0.00 ? 50 GLN A CB   5  
ATOM 5401  C CG   . GLN A 1 50 ? 0.102   2.258   10.085  1.00 0.00 ? 50 GLN A CG   5  
ATOM 5402  C CD   . GLN A 1 50 ? -1.099  3.181   10.030  1.00 0.00 ? 50 GLN A CD   5  
ATOM 5403  O OE1  . GLN A 1 50 ? -0.955  4.401   9.938   1.00 0.00 ? 50 GLN A OE1  5  
ATOM 5404  N NE2  . GLN A 1 50 ? -2.293  2.604   10.085  1.00 0.00 ? 50 GLN A NE2  5  
ATOM 5405  H H    . GLN A 1 50 ? 2.827   1.246   9.623   1.00 0.00 ? 50 GLN A H    5  
ATOM 5406  H HA   . GLN A 1 50 ? 0.531   -0.282  9.373   1.00 0.00 ? 50 GLN A HA   5  
ATOM 5407  H HB2  . GLN A 1 50 ? 1.238   2.442   8.301   1.00 0.00 ? 50 GLN A HB2  5  
ATOM 5408  H HB3  . GLN A 1 50 ? -0.359  1.741   8.078   1.00 0.00 ? 50 GLN A HB3  5  
ATOM 5409  H HG2  . GLN A 1 50 ? -0.144  1.410   10.707  1.00 0.00 ? 50 GLN A HG2  5  
ATOM 5410  H HG3  . GLN A 1 50 ? 0.931   2.795   10.521  1.00 0.00 ? 50 GLN A HG3  5  
ATOM 5411  H HE21 . GLN A 1 50 ? -2.332  1.627   10.159  1.00 0.00 ? 50 GLN A HE21 5  
ATOM 5412  H HE22 . GLN A 1 50 ? -3.087  3.177   10.052  1.00 0.00 ? 50 GLN A HE22 5  
ATOM 5413  N N    . ILE A 1 51 ? 1.956   0.333   6.455   1.00 0.00 ? 51 ILE A N    5  
ATOM 5414  C CA   . ILE A 1 51 ? 2.054   -0.136  5.078   1.00 0.00 ? 51 ILE A CA   5  
ATOM 5415  C C    . ILE A 1 51 ? 2.328   -1.635  5.026   1.00 0.00 ? 51 ILE A C    5  
ATOM 5416  O O    . ILE A 1 51 ? 1.719   -2.363  4.241   1.00 0.00 ? 51 ILE A O    5  
ATOM 5417  C CB   . ILE A 1 51 ? 3.164   0.605   4.309   1.00 0.00 ? 51 ILE A CB   5  
ATOM 5418  C CG1  . ILE A 1 51 ? 2.901   2.112   4.315   1.00 0.00 ? 51 ILE A CG1  5  
ATOM 5419  C CG2  . ILE A 1 51 ? 3.259   0.084   2.883   1.00 0.00 ? 51 ILE A CG2  5  
ATOM 5420  C CD1  . ILE A 1 51 ? 4.102   2.937   3.909   1.00 0.00 ? 51 ILE A CD1  5  
ATOM 5421  H H    . ILE A 1 51 ? 2.512   1.086   6.744   1.00 0.00 ? 51 ILE A H    5  
ATOM 5422  H HA   . ILE A 1 51 ? 1.111   0.064   4.590   1.00 0.00 ? 51 ILE A HA   5  
ATOM 5423  H HB   . ILE A 1 51 ? 4.105   0.409   4.802   1.00 0.00 ? 51 ILE A HB   5  
ATOM 5424  H HG12 . ILE A 1 51 ? 2.100   2.334   3.629   1.00 0.00 ? 51 ILE A HG12 5  
ATOM 5425  H HG13 . ILE A 1 51 ? 2.611   2.415   5.311   1.00 0.00 ? 51 ILE A HG13 5  
ATOM 5426  H HG21 . ILE A 1 51 ? 3.192   0.911   2.192   1.00 0.00 ? 51 ILE A HG21 5  
ATOM 5427  H HG22 . ILE A 1 51 ? 4.203   -0.422  2.747   1.00 0.00 ? 51 ILE A HG22 5  
ATOM 5428  H HG23 . ILE A 1 51 ? 2.450   -0.607  2.697   1.00 0.00 ? 51 ILE A HG23 5  
ATOM 5429  H HD11 . ILE A 1 51 ? 4.731   3.107   4.771   1.00 0.00 ? 51 ILE A HD11 5  
ATOM 5430  H HD12 . ILE A 1 51 ? 4.663   2.410   3.152   1.00 0.00 ? 51 ILE A HD12 5  
ATOM 5431  H HD13 . ILE A 1 51 ? 3.770   3.886   3.514   1.00 0.00 ? 51 ILE A HD13 5  
ATOM 5432  N N    . THR A 1 52 ? 3.249   -2.092  5.869   1.00 0.00 ? 52 THR A N    5  
ATOM 5433  C CA   . THR A 1 52 ? 3.604   -3.505  5.920   1.00 0.00 ? 52 THR A CA   5  
ATOM 5434  C C    . THR A 1 52 ? 2.393   -4.364  6.266   1.00 0.00 ? 52 THR A C    5  
ATOM 5435  O O    . THR A 1 52 ? 2.106   -5.350  5.587   1.00 0.00 ? 52 THR A O    5  
ATOM 5436  C CB   . THR A 1 52 ? 4.718   -3.767  6.952   1.00 0.00 ? 52 THR A CB   5  
ATOM 5437  O OG1  . THR A 1 52 ? 5.890   -3.020  6.608   1.00 0.00 ? 52 THR A OG1  5  
ATOM 5438  C CG2  . THR A 1 52 ? 5.056   -5.249  7.018   1.00 0.00 ? 52 THR A CG2  5  
ATOM 5439  H H    . THR A 1 52 ? 3.700   -1.463  6.469   1.00 0.00 ? 52 THR A H    5  
ATOM 5440  H HA   . THR A 1 52 ? 3.971   -3.792  4.945   1.00 0.00 ? 52 THR A HA   5  
ATOM 5441  H HB   . THR A 1 52 ? 4.369   -3.449  7.924   1.00 0.00 ? 52 THR A HB   5  
ATOM 5442  H HG1  . THR A 1 52 ? 6.470   -2.966  7.371   1.00 0.00 ? 52 THR A HG1  5  
ATOM 5443  H HG21 . THR A 1 52 ? 6.108   -5.387  6.817   1.00 0.00 ? 52 THR A HG21 5  
ATOM 5444  H HG22 . THR A 1 52 ? 4.475   -5.784  6.281   1.00 0.00 ? 52 THR A HG22 5  
ATOM 5445  H HG23 . THR A 1 52 ? 4.825   -5.627  8.002   1.00 0.00 ? 52 THR A HG23 5  
ATOM 5446  N N    . ILE A 1 53 ? 1.687   -3.983  7.325   1.00 0.00 ? 53 ILE A N    5  
ATOM 5447  C CA   . ILE A 1 53 ? 0.506   -4.718  7.760   1.00 0.00 ? 53 ILE A CA   5  
ATOM 5448  C C    . ILE A 1 53 ? -0.467  -4.927  6.604   1.00 0.00 ? 53 ILE A C    5  
ATOM 5449  O O    . ILE A 1 53 ? -0.976  -6.029  6.400   1.00 0.00 ? 53 ILE A O    5  
ATOM 5450  C CB   . ILE A 1 53 ? -0.222  -3.988  8.904   1.00 0.00 ? 53 ILE A CB   5  
ATOM 5451  C CG1  . ILE A 1 53 ? 0.713   -3.810  10.101  1.00 0.00 ? 53 ILE A CG1  5  
ATOM 5452  C CG2  . ILE A 1 53 ? -1.472  -4.755  9.310   1.00 0.00 ? 53 ILE A CG2  5  
ATOM 5453  C CD1  . ILE A 1 53 ? 0.315   -2.672  11.015  1.00 0.00 ? 53 ILE A CD1  5  
ATOM 5454  H H    . ILE A 1 53 ? 1.967   -3.188  7.826   1.00 0.00 ? 53 ILE A H    5  
ATOM 5455  H HA   . ILE A 1 53 ? 0.829   -5.683  8.123   1.00 0.00 ? 53 ILE A HA   5  
ATOM 5456  H HB   . ILE A 1 53 ? -0.526  -3.017  8.545   1.00 0.00 ? 53 ILE A HB   5  
ATOM 5457  H HG12 . ILE A 1 53 ? 0.718   -4.717  10.685  1.00 0.00 ? 53 ILE A HG12 5  
ATOM 5458  H HG13 . ILE A 1 53 ? 1.713   -3.613  9.741   1.00 0.00 ? 53 ILE A HG13 5  
ATOM 5459  H HG21 . ILE A 1 53 ? -1.202  -5.765  9.584   1.00 0.00 ? 53 ILE A HG21 5  
ATOM 5460  H HG22 . ILE A 1 53 ? -1.935  -4.267  10.155  1.00 0.00 ? 53 ILE A HG22 5  
ATOM 5461  H HG23 . ILE A 1 53 ? -2.165  -4.780  8.483   1.00 0.00 ? 53 ILE A HG23 5  
ATOM 5462  H HD11 . ILE A 1 53 ? -0.576  -2.197  10.632  1.00 0.00 ? 53 ILE A HD11 5  
ATOM 5463  H HD12 . ILE A 1 53 ? 0.122   -3.056  12.005  1.00 0.00 ? 53 ILE A HD12 5  
ATOM 5464  H HD13 . ILE A 1 53 ? 1.117   -1.949  11.059  1.00 0.00 ? 53 ILE A HD13 5  
ATOM 5465  N N    . TRP A 1 54 ? -0.720  -3.863  5.851   1.00 0.00 ? 54 TRP A N    5  
ATOM 5466  C CA   . TRP A 1 54 ? -1.631  -3.930  4.714   1.00 0.00 ? 54 TRP A CA   5  
ATOM 5467  C C    . TRP A 1 54 ? -1.136  -4.934  3.679   1.00 0.00 ? 54 TRP A C    5  
ATOM 5468  O O    . TRP A 1 54 ? -1.890  -5.795  3.225   1.00 0.00 ? 54 TRP A O    5  
ATOM 5469  C CB   . TRP A 1 54 ? -1.781  -2.550  4.073   1.00 0.00 ? 54 TRP A CB   5  
ATOM 5470  C CG   . TRP A 1 54 ? -2.818  -2.507  2.991   1.00 0.00 ? 54 TRP A CG   5  
ATOM 5471  C CD1  . TRP A 1 54 ? -4.145  -2.218  3.139   1.00 0.00 ? 54 TRP A CD1  5  
ATOM 5472  C CD2  . TRP A 1 54 ? -2.614  -2.764  1.598   1.00 0.00 ? 54 TRP A CD2  5  
ATOM 5473  N NE1  . TRP A 1 54 ? -4.778  -2.280  1.921   1.00 0.00 ? 54 TRP A NE1  5  
ATOM 5474  C CE2  . TRP A 1 54 ? -3.861  -2.612  0.959   1.00 0.00 ? 54 TRP A CE2  5  
ATOM 5475  C CE3  . TRP A 1 54 ? -1.500  -3.106  0.827   1.00 0.00 ? 54 TRP A CE3  5  
ATOM 5476  C CZ2  . TRP A 1 54 ? -4.021  -2.791  -0.412  1.00 0.00 ? 54 TRP A CZ2  5  
ATOM 5477  C CZ3  . TRP A 1 54 ? -1.661  -3.284  -0.534  1.00 0.00 ? 54 TRP A CZ3  5  
ATOM 5478  C CH2  . TRP A 1 54 ? -2.914  -3.126  -1.142  1.00 0.00 ? 54 TRP A CH2  5  
ATOM 5479  H H    . TRP A 1 54 ? -0.283  -3.012  6.064   1.00 0.00 ? 54 TRP A H    5  
ATOM 5480  H HA   . TRP A 1 54 ? -2.594  -4.254  5.081   1.00 0.00 ? 54 TRP A HA   5  
ATOM 5481  H HB2  . TRP A 1 54 ? -2.062  -1.836  4.832   1.00 0.00 ? 54 TRP A HB2  5  
ATOM 5482  H HB3  . TRP A 1 54 ? -0.835  -2.257  3.640   1.00 0.00 ? 54 TRP A HB3  5  
ATOM 5483  H HD1  . TRP A 1 54 ? -4.614  -1.980  4.081   1.00 0.00 ? 54 TRP A HD1  5  
ATOM 5484  H HE1  . TRP A 1 54 ? -5.731  -2.111  1.767   1.00 0.00 ? 54 TRP A HE1  5  
ATOM 5485  H HE3  . TRP A 1 54 ? -0.527  -3.232  1.277   1.00 0.00 ? 54 TRP A HE3  5  
ATOM 5486  H HZ2  . TRP A 1 54 ? -4.980  -2.672  -0.896  1.00 0.00 ? 54 TRP A HZ2  5  
ATOM 5487  H HZ3  . TRP A 1 54 ? -0.811  -3.549  -1.146  1.00 0.00 ? 54 TRP A HZ3  5  
ATOM 5488  H HH2  . TRP A 1 54 ? -2.993  -3.275  -2.208  1.00 0.00 ? 54 TRP A HH2  5  
ATOM 5489  N N    . PHE A 1 55 ? 0.135   -4.819  3.309   1.00 0.00 ? 55 PHE A N    5  
ATOM 5490  C CA   . PHE A 1 55 ? 0.730   -5.717  2.326   1.00 0.00 ? 55 PHE A CA   5  
ATOM 5491  C C    . PHE A 1 55 ? 0.599   -7.171  2.768   1.00 0.00 ? 55 PHE A C    5  
ATOM 5492  O O    . PHE A 1 55 ? 0.450   -8.070  1.941   1.00 0.00 ? 55 PHE A O    5  
ATOM 5493  C CB   . PHE A 1 55 ? 2.204   -5.368  2.111   1.00 0.00 ? 55 PHE A CB   5  
ATOM 5494  C CG   . PHE A 1 55 ? 2.438   -4.432  0.960   1.00 0.00 ? 55 PHE A CG   5  
ATOM 5495  C CD1  . PHE A 1 55 ? 2.080   -3.097  1.052   1.00 0.00 ? 55 PHE A CD1  5  
ATOM 5496  C CD2  . PHE A 1 55 ? 3.015   -4.888  -0.214  1.00 0.00 ? 55 PHE A CD2  5  
ATOM 5497  C CE1  . PHE A 1 55 ? 2.294   -2.233  -0.005  1.00 0.00 ? 55 PHE A CE1  5  
ATOM 5498  C CE2  . PHE A 1 55 ? 3.231   -4.028  -1.275  1.00 0.00 ? 55 PHE A CE2  5  
ATOM 5499  C CZ   . PHE A 1 55 ? 2.869   -2.699  -1.170  1.00 0.00 ? 55 PHE A CZ   5  
ATOM 5500  H H    . PHE A 1 55 ? 0.686   -4.112  3.706   1.00 0.00 ? 55 PHE A H    5  
ATOM 5501  H HA   . PHE A 1 55 ? 0.199   -5.587  1.395   1.00 0.00 ? 55 PHE A HA   5  
ATOM 5502  H HB2  . PHE A 1 55 ? 2.589   -4.898  3.004   1.00 0.00 ? 55 PHE A HB2  5  
ATOM 5503  H HB3  . PHE A 1 55 ? 2.757   -6.275  1.921   1.00 0.00 ? 55 PHE A HB3  5  
ATOM 5504  H HD1  . PHE A 1 55 ? 1.629   -2.730  1.964   1.00 0.00 ? 55 PHE A HD1  5  
ATOM 5505  H HD2  . PHE A 1 55 ? 3.297   -5.927  -0.298  1.00 0.00 ? 55 PHE A HD2  5  
ATOM 5506  H HE1  . PHE A 1 55 ? 2.009   -1.194  0.080   1.00 0.00 ? 55 PHE A HE1  5  
ATOM 5507  H HE2  . PHE A 1 55 ? 3.681   -4.396  -2.185  1.00 0.00 ? 55 PHE A HE2  5  
ATOM 5508  H HZ   . PHE A 1 55 ? 3.038   -2.026  -1.997  1.00 0.00 ? 55 PHE A HZ   5  
ATOM 5509  N N    . GLN A 1 56 ? 0.655   -7.393  4.077   1.00 0.00 ? 56 GLN A N    5  
ATOM 5510  C CA   . GLN A 1 56 ? 0.544   -8.738  4.630   1.00 0.00 ? 56 GLN A CA   5  
ATOM 5511  C C    . GLN A 1 56 ? -0.880  -9.266  4.493   1.00 0.00 ? 56 GLN A C    5  
ATOM 5512  O O    . GLN A 1 56 ? -1.106  -10.328 3.915   1.00 0.00 ? 56 GLN A O    5  
ATOM 5513  C CB   . GLN A 1 56 ? 0.965   -8.744  6.100   1.00 0.00 ? 56 GLN A CB   5  
ATOM 5514  C CG   . GLN A 1 56 ? 2.466   -8.863  6.303   1.00 0.00 ? 56 GLN A CG   5  
ATOM 5515  C CD   . GLN A 1 56 ? 2.988   -10.254 6.001   1.00 0.00 ? 56 GLN A CD   5  
ATOM 5516  O OE1  . GLN A 1 56 ? 2.214   -11.196 5.832   1.00 0.00 ? 56 GLN A OE1  5  
ATOM 5517  N NE2  . GLN A 1 56 ? 4.307   -10.389 5.930   1.00 0.00 ? 56 GLN A NE2  5  
ATOM 5518  H H    . GLN A 1 56 ? 0.775   -6.634  4.686   1.00 0.00 ? 56 GLN A H    5  
ATOM 5519  H HA   . GLN A 1 56 ? 1.208   -9.381  4.072   1.00 0.00 ? 56 GLN A HA   5  
ATOM 5520  H HB2  . GLN A 1 56 ? 0.632   -7.826  6.562   1.00 0.00 ? 56 GLN A HB2  5  
ATOM 5521  H HB3  . GLN A 1 56 ? 0.490   -9.579  6.594   1.00 0.00 ? 56 GLN A HB3  5  
ATOM 5522  H HG2  . GLN A 1 56 ? 2.962   -8.160  5.650   1.00 0.00 ? 56 GLN A HG2  5  
ATOM 5523  H HG3  . GLN A 1 56 ? 2.698   -8.622  7.330   1.00 0.00 ? 56 GLN A HG3  5  
ATOM 5524  H HE21 . GLN A 1 56 ? 4.862   -9.594  6.077   1.00 0.00 ? 56 GLN A HE21 5  
ATOM 5525  H HE22 . GLN A 1 56 ? 4.672   -11.277 5.737   1.00 0.00 ? 56 GLN A HE22 5  
ATOM 5526  N N    . ASN A 1 57 ? -1.838  -8.517  5.031   1.00 0.00 ? 57 ASN A N    5  
ATOM 5527  C CA   . ASN A 1 57 ? -3.241  -8.911  4.970   1.00 0.00 ? 57 ASN A CA   5  
ATOM 5528  C C    . ASN A 1 57 ? -3.656  -9.224  3.536   1.00 0.00 ? 57 ASN A C    5  
ATOM 5529  O O    . ASN A 1 57 ? -4.465  -10.121 3.295   1.00 0.00 ? 57 ASN A O    5  
ATOM 5530  C CB   . ASN A 1 57 ? -4.128  -7.802  5.539   1.00 0.00 ? 57 ASN A CB   5  
ATOM 5531  C CG   . ASN A 1 57 ? -4.354  -7.951  7.031   1.00 0.00 ? 57 ASN A CG   5  
ATOM 5532  O OD1  . ASN A 1 57 ? -5.288  -8.626  7.465   1.00 0.00 ? 57 ASN A OD1  5  
ATOM 5533  N ND2  . ASN A 1 57 ? -3.498  -7.318  7.825   1.00 0.00 ? 57 ASN A ND2  5  
ATOM 5534  H H    . ASN A 1 57 ? -1.596  -7.680  5.479   1.00 0.00 ? 57 ASN A H    5  
ATOM 5535  H HA   . ASN A 1 57 ? -3.362  -9.800  5.570   1.00 0.00 ? 57 ASN A HA   5  
ATOM 5536  H HB2  . ASN A 1 57 ? -3.659  -6.846  5.359   1.00 0.00 ? 57 ASN A HB2  5  
ATOM 5537  H HB3  . ASN A 1 57 ? -5.087  -7.827  5.044   1.00 0.00 ? 57 ASN A HB3  5  
ATOM 5538  H HD21 . ASN A 1 57 ? -2.778  -6.798  7.409   1.00 0.00 ? 57 ASN A HD21 5  
ATOM 5539  H HD22 . ASN A 1 57 ? -3.620  -7.398  8.794   1.00 0.00 ? 57 ASN A HD22 5  
ATOM 5540  N N    . ARG A 1 58 ? -3.096  -8.481  2.587   1.00 0.00 ? 58 ARG A N    5  
ATOM 5541  C CA   . ARG A 1 58 ? -3.408  -8.679  1.177   1.00 0.00 ? 58 ARG A CA   5  
ATOM 5542  C C    . ARG A 1 58 ? -3.086  -10.106 0.744   1.00 0.00 ? 58 ARG A C    5  
ATOM 5543  O O    . ARG A 1 58 ? -3.845  -10.726 -0.001  1.00 0.00 ? 58 ARG A O    5  
ATOM 5544  C CB   . ARG A 1 58 ? -2.628  -7.684  0.316   1.00 0.00 ? 58 ARG A CB   5  
ATOM 5545  C CG   . ARG A 1 58 ? -3.352  -7.284  -0.959  1.00 0.00 ? 58 ARG A CG   5  
ATOM 5546  C CD   . ARG A 1 58 ? -4.645  -6.543  -0.656  1.00 0.00 ? 58 ARG A CD   5  
ATOM 5547  N NE   . ARG A 1 58 ? -5.227  -5.944  -1.855  1.00 0.00 ? 58 ARG A NE   5  
ATOM 5548  C CZ   . ARG A 1 58 ? -6.386  -5.295  -1.864  1.00 0.00 ? 58 ARG A CZ   5  
ATOM 5549  N NH1  . ARG A 1 58 ? -7.084  -5.163  -0.744  1.00 0.00 ? 58 ARG A NH1  5  
ATOM 5550  N NH2  . ARG A 1 58 ? -6.849  -4.777  -2.994  1.00 0.00 ? 58 ARG A NH2  5  
ATOM 5551  H H    . ARG A 1 58 ? -2.459  -7.781  2.842   1.00 0.00 ? 58 ARG A H    5  
ATOM 5552  H HA   . ARG A 1 58 ? -4.466  -8.505  1.044   1.00 0.00 ? 58 ARG A HA   5  
ATOM 5553  H HB2  . ARG A 1 58 ? -2.444  -6.791  0.894   1.00 0.00 ? 58 ARG A HB2  5  
ATOM 5554  H HB3  . ARG A 1 58 ? -1.683  -8.128  0.042   1.00 0.00 ? 58 ARG A HB3  5  
ATOM 5555  H HG2  . ARG A 1 58 ? -2.709  -6.639  -1.541  1.00 0.00 ? 58 ARG A HG2  5  
ATOM 5556  H HG3  . ARG A 1 58 ? -3.581  -8.173  -1.527  1.00 0.00 ? 58 ARG A HG3  5  
ATOM 5557  H HD2  . ARG A 1 58 ? -5.354  -7.240  -0.235  1.00 0.00 ? 58 ARG A HD2  5  
ATOM 5558  H HD3  . ARG A 1 58 ? -4.438  -5.763  0.061   1.00 0.00 ? 58 ARG A HD3  5  
ATOM 5559  H HE   . ARG A 1 58 ? -4.727  -6.030  -2.693  1.00 0.00 ? 58 ARG A HE   5  
ATOM 5560  H HH11 . ARG A 1 58 ? -6.737  -5.551  0.109   1.00 0.00 ? 58 ARG A HH11 5  
ATOM 5561  H HH12 . ARG A 1 58 ? -7.956  -4.673  -0.754  1.00 0.00 ? 58 ARG A HH12 5  
ATOM 5562  H HH21 . ARG A 1 58 ? -6.325  -4.875  -3.840  1.00 0.00 ? 58 ARG A HH21 5  
ATOM 5563  H HH22 . ARG A 1 58 ? -7.721  -4.290  -3.000  1.00 0.00 ? 58 ARG A HH22 5  
ATOM 5564  N N    . ARG A 1 59 ? -1.955  -10.620 1.215   1.00 0.00 ? 59 ARG A N    5  
ATOM 5565  C CA   . ARG A 1 59 ? -1.531  -11.973 0.875   1.00 0.00 ? 59 ARG A CA   5  
ATOM 5566  C C    . ARG A 1 59 ? -2.139  -12.991 1.836   1.00 0.00 ? 59 ARG A C    5  
ATOM 5567  O O    . ARG A 1 59 ? -2.284  -14.167 1.502   1.00 0.00 ? 59 ARG A O    5  
ATOM 5568  C CB   . ARG A 1 59 ? -0.005  -12.075 0.906   1.00 0.00 ? 59 ARG A CB   5  
ATOM 5569  C CG   . ARG A 1 59 ? 0.653   -11.767 -0.429  1.00 0.00 ? 59 ARG A CG   5  
ATOM 5570  C CD   . ARG A 1 59 ? 1.932   -12.568 -0.618  1.00 0.00 ? 59 ARG A CD   5  
ATOM 5571  N NE   . ARG A 1 59 ? 1.671   -14.002 -0.709  1.00 0.00 ? 59 ARG A NE   5  
ATOM 5572  C CZ   . ARG A 1 59 ? 2.629   -14.921 -0.766  1.00 0.00 ? 59 ARG A CZ   5  
ATOM 5573  N NH1  . ARG A 1 59 ? 3.904   -14.557 -0.741  1.00 0.00 ? 59 ARG A NH1  5  
ATOM 5574  N NH2  . ARG A 1 59 ? 2.312   -16.207 -0.848  1.00 0.00 ? 59 ARG A NH2  5  
ATOM 5575  H H    . ARG A 1 59 ? -1.391  -10.077 1.805   1.00 0.00 ? 59 ARG A H    5  
ATOM 5576  H HA   . ARG A 1 59 ? -1.877  -12.188 -0.124  1.00 0.00 ? 59 ARG A HA   5  
ATOM 5577  H HB2  . ARG A 1 59 ? 0.376   -11.380 1.639   1.00 0.00 ? 59 ARG A HB2  5  
ATOM 5578  H HB3  . ARG A 1 59 ? 0.271   -13.078 1.196   1.00 0.00 ? 59 ARG A HB3  5  
ATOM 5579  H HG2  . ARG A 1 59 ? -0.034  -12.014 -1.224  1.00 0.00 ? 59 ARG A HG2  5  
ATOM 5580  H HG3  . ARG A 1 59 ? 0.889   -10.714 -0.469  1.00 0.00 ? 59 ARG A HG3  5  
ATOM 5581  H HD2  . ARG A 1 59 ? 2.415   -12.241 -1.527  1.00 0.00 ? 59 ARG A HD2  5  
ATOM 5582  H HD3  . ARG A 1 59 ? 2.584   -12.382 0.223   1.00 0.00 ? 59 ARG A HD3  5  
ATOM 5583  H HE   . ARG A 1 59 ? 0.736   -14.293 -0.729  1.00 0.00 ? 59 ARG A HE   5  
ATOM 5584  H HH11 . ARG A 1 59 ? 4.145   -13.589 -0.678  1.00 0.00 ? 59 ARG A HH11 5  
ATOM 5585  H HH12 . ARG A 1 59 ? 4.623   -15.251 -0.782  1.00 0.00 ? 59 ARG A HH12 5  
ATOM 5586  H HH21 . ARG A 1 59 ? 1.352   -16.485 -0.867  1.00 0.00 ? 59 ARG A HH21 5  
ATOM 5587  H HH22 . ARG A 1 59 ? 3.033   -16.897 -0.891  1.00 0.00 ? 59 ARG A HH22 5  
ATOM 5588  N N    . VAL A 1 60 ? -2.492  -12.530 3.032   1.00 0.00 ? 60 VAL A N    5  
ATOM 5589  C CA   . VAL A 1 60 ? -3.084  -13.400 4.042   1.00 0.00 ? 60 VAL A CA   5  
ATOM 5590  C C    . VAL A 1 60 ? -4.560  -13.651 3.753   1.00 0.00 ? 60 VAL A C    5  
ATOM 5591  O O    . VAL A 1 60 ? -5.140  -14.627 4.228   1.00 0.00 ? 60 VAL A O    5  
ATOM 5592  C CB   . VAL A 1 60 ? -2.944  -12.799 5.453   1.00 0.00 ? 60 VAL A CB   5  
ATOM 5593  C CG1  . VAL A 1 60 ? -3.566  -13.721 6.490   1.00 0.00 ? 60 VAL A CG1  5  
ATOM 5594  C CG2  . VAL A 1 60 ? -1.481  -12.531 5.774   1.00 0.00 ? 60 VAL A CG2  5  
ATOM 5595  H H    . VAL A 1 60 ? -2.351  -11.583 3.240   1.00 0.00 ? 60 VAL A H    5  
ATOM 5596  H HA   . VAL A 1 60 ? -2.558  -14.343 4.021   1.00 0.00 ? 60 VAL A HA   5  
ATOM 5597  H HB   . VAL A 1 60 ? -3.474  -11.858 5.476   1.00 0.00 ? 60 VAL A HB   5  
ATOM 5598  H HG11 . VAL A 1 60 ? -3.146  -14.711 6.390   1.00 0.00 ? 60 VAL A HG11 5  
ATOM 5599  H HG12 . VAL A 1 60 ? -3.360  -13.340 7.480   1.00 0.00 ? 60 VAL A HG12 5  
ATOM 5600  H HG13 . VAL A 1 60 ? -4.634  -13.766 6.337   1.00 0.00 ? 60 VAL A HG13 5  
ATOM 5601  H HG21 . VAL A 1 60 ? -1.209  -13.057 6.677   1.00 0.00 ? 60 VAL A HG21 5  
ATOM 5602  H HG22 . VAL A 1 60 ? -0.864  -12.875 4.957   1.00 0.00 ? 60 VAL A HG22 5  
ATOM 5603  H HG23 . VAL A 1 60 ? -1.332  -11.471 5.915   1.00 0.00 ? 60 VAL A HG23 5  
ATOM 5604  N N    . LYS A 1 61 ? -5.164  -12.763 2.970   1.00 0.00 ? 61 LYS A N    5  
ATOM 5605  C CA   . LYS A 1 61 ? -6.572  -12.887 2.615   1.00 0.00 ? 61 LYS A CA   5  
ATOM 5606  C C    . LYS A 1 61 ? -6.745  -13.752 1.370   1.00 0.00 ? 61 LYS A C    5  
ATOM 5607  O O    . LYS A 1 61 ? -7.795  -14.362 1.169   1.00 0.00 ? 61 LYS A O    5  
ATOM 5608  C CB   . LYS A 1 61 ? -7.184  -11.505 2.377   1.00 0.00 ? 61 LYS A CB   5  
ATOM 5609  C CG   . LYS A 1 61 ? -8.655  -11.418 2.745   1.00 0.00 ? 61 LYS A CG   5  
ATOM 5610  C CD   . LYS A 1 61 ? -9.083  -9.983  2.999   1.00 0.00 ? 61 LYS A CD   5  
ATOM 5611  C CE   . LYS A 1 61 ? -10.587 -9.814  2.847   1.00 0.00 ? 61 LYS A CE   5  
ATOM 5612  N NZ   . LYS A 1 61 ? -10.971 -8.385  2.684   1.00 0.00 ? 61 LYS A NZ   5  
ATOM 5613  H H    . LYS A 1 61 ? -4.648  -12.005 2.621   1.00 0.00 ? 61 LYS A H    5  
ATOM 5614  H HA   . LYS A 1 61 ? -7.082  -13.360 3.441   1.00 0.00 ? 61 LYS A HA   5  
ATOM 5615  H HB2  . LYS A 1 61 ? -6.643  -10.779 2.967   1.00 0.00 ? 61 LYS A HB2  5  
ATOM 5616  H HB3  . LYS A 1 61 ? -7.081  -11.254 1.331   1.00 0.00 ? 61 LYS A HB3  5  
ATOM 5617  H HG2  . LYS A 1 61 ? -9.244  -11.820 1.935   1.00 0.00 ? 61 LYS A HG2  5  
ATOM 5618  H HG3  . LYS A 1 61 ? -8.827  -11.999 3.640   1.00 0.00 ? 61 LYS A HG3  5  
ATOM 5619  H HD2  . LYS A 1 61 ? -8.801  -9.704  4.004   1.00 0.00 ? 61 LYS A HD2  5  
ATOM 5620  H HD3  . LYS A 1 61 ? -8.583  -9.337  2.291   1.00 0.00 ? 61 LYS A HD3  5  
ATOM 5621  H HE2  . LYS A 1 61 ? -10.911 -10.367 1.978   1.00 0.00 ? 61 LYS A HE2  5  
ATOM 5622  H HE3  . LYS A 1 61 ? -11.071 -10.211 3.727   1.00 0.00 ? 61 LYS A HE3  5  
ATOM 5623  H HZ1  . LYS A 1 61 ? -11.402 -8.236  1.749   1.00 0.00 ? 61 LYS A HZ1  5  
ATOM 5624  H HZ2  . LYS A 1 61 ? -10.131 -7.777  2.766   1.00 0.00 ? 61 LYS A HZ2  5  
ATOM 5625  H HZ3  . LYS A 1 61 ? -11.656 -8.113  3.417   1.00 0.00 ? 61 LYS A HZ3  5  
ATOM 5626  N N    . GLU A 1 62 ? -5.708  -13.801 0.540   1.00 0.00 ? 62 GLU A N    5  
ATOM 5627  C CA   . GLU A 1 62 ? -5.747  -14.592 -0.684  1.00 0.00 ? 62 GLU A CA   5  
ATOM 5628  C C    . GLU A 1 62 ? -5.211  -16.000 -0.439  1.00 0.00 ? 62 GLU A C    5  
ATOM 5629  O O    . GLU A 1 62 ? -5.526  -16.934 -1.177  1.00 0.00 ? 62 GLU A O    5  
ATOM 5630  C CB   . GLU A 1 62 ? -4.933  -13.910 -1.785  1.00 0.00 ? 62 GLU A CB   5  
ATOM 5631  C CG   . GLU A 1 62 ? -3.444  -13.841 -1.488  1.00 0.00 ? 62 GLU A CG   5  
ATOM 5632  C CD   . GLU A 1 62 ? -2.715  -12.856 -2.381  1.00 0.00 ? 62 GLU A CD   5  
ATOM 5633  O OE1  . GLU A 1 62 ? -3.267  -11.764 -2.633  1.00 0.00 ? 62 GLU A OE1  5  
ATOM 5634  O OE2  . GLU A 1 62 ? -1.595  -13.177 -2.828  1.00 0.00 ? 62 GLU A OE2  5  
ATOM 5635  H H    . GLU A 1 62 ? -4.898  -13.293 0.756   1.00 0.00 ? 62 GLU A H    5  
ATOM 5636  H HA   . GLU A 1 62 ? -6.776  -14.662 -1.001  1.00 0.00 ? 62 GLU A HA   5  
ATOM 5637  H HB2  . GLU A 1 62 ? -5.070  -14.454 -2.708  1.00 0.00 ? 62 GLU A HB2  5  
ATOM 5638  H HB3  . GLU A 1 62 ? -5.299  -12.902 -1.914  1.00 0.00 ? 62 GLU A HB3  5  
ATOM 5639  H HG2  . GLU A 1 62 ? -3.309  -13.539 -0.460  1.00 0.00 ? 62 GLU A HG2  5  
ATOM 5640  H HG3  . GLU A 1 62 ? -3.015  -14.822 -1.633  1.00 0.00 ? 62 GLU A HG3  5  
ATOM 5641  N N    . LYS A 1 63 ? -4.399  -16.145 0.603   1.00 0.00 ? 63 LYS A N    5  
ATOM 5642  C CA   . LYS A 1 63 ? -3.819  -17.437 0.947   1.00 0.00 ? 63 LYS A CA   5  
ATOM 5643  C C    . LYS A 1 63 ? -4.901  -18.419 1.386   1.00 0.00 ? 63 LYS A C    5  
ATOM 5644  O O    . LYS A 1 63 ? -4.746  -19.633 1.248   1.00 0.00 ? 63 LYS A O    5  
ATOM 5645  C CB   . LYS A 1 63 ? -2.782  -17.273 2.061   1.00 0.00 ? 63 LYS A CB   5  
ATOM 5646  C CG   . LYS A 1 63 ? -3.393  -17.023 3.429   1.00 0.00 ? 63 LYS A CG   5  
ATOM 5647  C CD   . LYS A 1 63 ? -3.506  -18.308 4.232   1.00 0.00 ? 63 LYS A CD   5  
ATOM 5648  C CE   . LYS A 1 63 ? -2.249  -18.568 5.048   1.00 0.00 ? 63 LYS A CE   5  
ATOM 5649  N NZ   . LYS A 1 63 ? -1.214  -19.289 4.257   1.00 0.00 ? 63 LYS A NZ   5  
ATOM 5650  H H    . LYS A 1 63 ? -4.185  -15.362 1.154   1.00 0.00 ? 63 LYS A H    5  
ATOM 5651  H HA   . LYS A 1 63 ? -3.331  -17.827 0.067   1.00 0.00 ? 63 LYS A HA   5  
ATOM 5652  H HB2  . LYS A 1 63 ? -2.185  -18.171 2.115   1.00 0.00 ? 63 LYS A HB2  5  
ATOM 5653  H HB3  . LYS A 1 63 ? -2.140  -16.438 1.818   1.00 0.00 ? 63 LYS A HB3  5  
ATOM 5654  H HG2  . LYS A 1 63 ? -2.770  -16.327 3.970   1.00 0.00 ? 63 LYS A HG2  5  
ATOM 5655  H HG3  . LYS A 1 63 ? -4.380  -16.601 3.301   1.00 0.00 ? 63 LYS A HG3  5  
ATOM 5656  H HD2  . LYS A 1 63 ? -4.348  -18.229 4.905   1.00 0.00 ? 63 LYS A HD2  5  
ATOM 5657  H HD3  . LYS A 1 63 ? -3.662  -19.134 3.553   1.00 0.00 ? 63 LYS A HD3  5  
ATOM 5658  H HE2  . LYS A 1 63 ? -1.845  -17.622 5.374   1.00 0.00 ? 63 LYS A HE2  5  
ATOM 5659  H HE3  . LYS A 1 63 ? -2.512  -19.163 5.910   1.00 0.00 ? 63 LYS A HE3  5  
ATOM 5660  H HZ1  . LYS A 1 63 ? -0.617  -19.861 4.888   1.00 0.00 ? 63 LYS A HZ1  5  
ATOM 5661  H HZ2  . LYS A 1 63 ? -0.612  -18.609 3.752   1.00 0.00 ? 63 LYS A HZ2  5  
ATOM 5662  H HZ3  . LYS A 1 63 ? -1.667  -19.917 3.563   1.00 0.00 ? 63 LYS A HZ3  5  
ATOM 5663  N N    . LYS A 1 64 ? -5.997  -17.887 1.915   1.00 0.00 ? 64 LYS A N    5  
ATOM 5664  C CA   . LYS A 1 64 ? -7.107  -18.716 2.372   1.00 0.00 ? 64 LYS A CA   5  
ATOM 5665  C C    . LYS A 1 64 ? -7.825  -19.362 1.192   1.00 0.00 ? 64 LYS A C    5  
ATOM 5666  O O    . LYS A 1 64 ? -8.498  -18.684 0.415   1.00 0.00 ? 64 LYS A O    5  
ATOM 5667  C CB   . LYS A 1 64 ? -8.095  -17.877 3.186   1.00 0.00 ? 64 LYS A CB   5  
ATOM 5668  C CG   . LYS A 1 64 ? -7.821  -17.897 4.680   1.00 0.00 ? 64 LYS A CG   5  
ATOM 5669  C CD   . LYS A 1 64 ? -6.905  -16.758 5.095   1.00 0.00 ? 64 LYS A CD   5  
ATOM 5670  C CE   . LYS A 1 64 ? -6.692  -16.733 6.600   1.00 0.00 ? 64 LYS A CE   5  
ATOM 5671  N NZ   . LYS A 1 64 ? -5.863  -17.881 7.062   1.00 0.00 ? 64 LYS A NZ   5  
ATOM 5672  H H    . LYS A 1 64 ? -6.063  -16.912 1.999   1.00 0.00 ? 64 LYS A H    5  
ATOM 5673  H HA   . LYS A 1 64 ? -6.703  -19.493 3.002   1.00 0.00 ? 64 LYS A HA   5  
ATOM 5674  H HB2  . LYS A 1 64 ? -8.046  -16.854 2.846   1.00 0.00 ? 64 LYS A HB2  5  
ATOM 5675  H HB3  . LYS A 1 64 ? -9.093  -18.256 3.019   1.00 0.00 ? 64 LYS A HB3  5  
ATOM 5676  H HG2  . LYS A 1 64 ? -8.758  -17.802 5.210   1.00 0.00 ? 64 LYS A HG2  5  
ATOM 5677  H HG3  . LYS A 1 64 ? -7.353  -18.836 4.939   1.00 0.00 ? 64 LYS A HG3  5  
ATOM 5678  H HD2  . LYS A 1 64 ? -5.948  -16.883 4.609   1.00 0.00 ? 64 LYS A HD2  5  
ATOM 5679  H HD3  . LYS A 1 64 ? -7.347  -15.821 4.787   1.00 0.00 ? 64 LYS A HD3  5  
ATOM 5680  H HE2  . LYS A 1 64 ? -6.196  -15.812 6.866   1.00 0.00 ? 64 LYS A HE2  5  
ATOM 5681  H HE3  . LYS A 1 64 ? -7.655  -16.776 7.087   1.00 0.00 ? 64 LYS A HE3  5  
ATOM 5682  H HZ1  . LYS A 1 64 ? -6.072  -18.725 6.492   1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 5683  H HZ2  . LYS A 1 64 ? -6.069  -18.091 8.060   1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 5684  H HZ3  . LYS A 1 64 ? -4.853  -17.653 6.968   1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 5685  N N    . SER A 1 65 ? -7.678  -20.677 1.063   1.00 0.00 ? 65 SER A N    5  
ATOM 5686  C CA   . SER A 1 65 ? -8.311  -21.414 -0.024  1.00 0.00 ? 65 SER A CA   5  
ATOM 5687  C C    . SER A 1 65 ? -9.462  -22.270 0.498   1.00 0.00 ? 65 SER A C    5  
ATOM 5688  O O    . SER A 1 65 ? -9.261  -23.173 1.309   1.00 0.00 ? 65 SER A O    5  
ATOM 5689  C CB   . SER A 1 65 ? -7.284  -22.299 -0.734  1.00 0.00 ? 65 SER A CB   5  
ATOM 5690  O OG   . SER A 1 65 ? -7.681  -22.571 -2.067  1.00 0.00 ? 65 SER A OG   5  
ATOM 5691  H H    . SER A 1 65 ? -7.129  -21.162 1.714   1.00 0.00 ? 65 SER A H    5  
ATOM 5692  H HA   . SER A 1 65 ? -8.703  -20.696 -0.728  1.00 0.00 ? 65 SER A HA   5  
ATOM 5693  H HB2  . SER A 1 65 ? -6.330  -21.796 -0.750  1.00 0.00 ? 65 SER A HB2  5  
ATOM 5694  H HB3  . SER A 1 65 ? -7.190  -23.234 -0.201  1.00 0.00 ? 65 SER A HB3  5  
ATOM 5695  H HG   . SER A 1 65 ? -7.511  -23.494 -2.270  1.00 0.00 ? 65 SER A HG   5  
ATOM 5696  N N    . GLY A 1 66 ? -10.670 -21.977 0.025   1.00 0.00 ? 66 GLY A N    5  
ATOM 5697  C CA   . GLY A 1 66 ? -11.836 -22.727 0.454   1.00 0.00 ? 66 GLY A CA   5  
ATOM 5698  C C    . GLY A 1 66 ? -13.131 -22.123 -0.051  1.00 0.00 ? 66 GLY A C    5  
ATOM 5699  O O    . GLY A 1 66 ? -13.758 -22.633 -0.981  1.00 0.00 ? 66 GLY A O    5  
ATOM 5700  H H    . GLY A 1 66 ? -10.770 -21.246 -0.620  1.00 0.00 ? 66 GLY A H    5  
ATOM 5701  H HA2  . GLY A 1 66 ? -11.755 -23.739 0.086   1.00 0.00 ? 66 GLY A HA2  5  
ATOM 5702  H HA3  . GLY A 1 66 ? -11.859 -22.748 1.534   1.00 0.00 ? 66 GLY A HA3  5  
ATOM 5703  N N    . PRO A 1 67 ? -13.553 -21.012 0.571   1.00 0.00 ? 67 PRO A N    5  
ATOM 5704  C CA   . PRO A 1 67 ? -14.787 -20.315 0.197   1.00 0.00 ? 67 PRO A CA   5  
ATOM 5705  C C    . PRO A 1 67 ? -14.677 -19.631 -1.162  1.00 0.00 ? 67 PRO A C    5  
ATOM 5706  O O    . PRO A 1 67 ? -13.633 -19.079 -1.506  1.00 0.00 ? 67 PRO A O    5  
ATOM 5707  C CB   . PRO A 1 67 ? -14.958 -19.275 1.307   1.00 0.00 ? 67 PRO A CB   5  
ATOM 5708  C CG   . PRO A 1 67 ? -13.579 -19.038 1.819   1.00 0.00 ? 67 PRO A CG   5  
ATOM 5709  C CD   . PRO A 1 67 ? -12.857 -20.350 1.687   1.00 0.00 ? 67 PRO A CD   5  
ATOM 5710  H HA   . PRO A 1 67 ? -15.635 -20.984 0.194   1.00 0.00 ? 67 PRO A HA   5  
ATOM 5711  H HB2  . PRO A 1 67 ? -15.388 -18.373 0.895   1.00 0.00 ? 67 PRO A HB2  5  
ATOM 5712  H HB3  . PRO A 1 67 ? -15.603 -19.669 2.078   1.00 0.00 ? 67 PRO A HB3  5  
ATOM 5713  H HG2  . PRO A 1 67 ? -13.092 -18.280 1.224   1.00 0.00 ? 67 PRO A HG2  5  
ATOM 5714  H HG3  . PRO A 1 67 ? -13.620 -18.736 2.855   1.00 0.00 ? 67 PRO A HG3  5  
ATOM 5715  H HD2  . PRO A 1 67 ? -11.816 -20.186 1.450   1.00 0.00 ? 67 PRO A HD2  5  
ATOM 5716  H HD3  . PRO A 1 67 ? -12.952 -20.926 2.596   1.00 0.00 ? 67 PRO A HD3  5  
ATOM 5717  N N    . SER A 1 68 ? -15.762 -19.672 -1.929  1.00 0.00 ? 68 SER A N    5  
ATOM 5718  C CA   . SER A 1 68 ? -15.786 -19.059 -3.252  1.00 0.00 ? 68 SER A CA   5  
ATOM 5719  C C    . SER A 1 68 ? -17.220 -18.849 -3.727  1.00 0.00 ? 68 SER A C    5  
ATOM 5720  O O    . SER A 1 68 ? -18.174 -19.131 -3.002  1.00 0.00 ? 68 SER A O    5  
ATOM 5721  C CB   . SER A 1 68 ? -15.027 -19.930 -4.255  1.00 0.00 ? 68 SER A CB   5  
ATOM 5722  O OG   . SER A 1 68 ? -15.834 -21.000 -4.714  1.00 0.00 ? 68 SER A OG   5  
ATOM 5723  H H    . SER A 1 68 ? -16.564 -20.128 -1.598  1.00 0.00 ? 68 SER A H    5  
ATOM 5724  H HA   . SER A 1 68 ? -15.298 -18.098 -3.181  1.00 0.00 ? 68 SER A HA   5  
ATOM 5725  H HB2  . SER A 1 68 ? -14.733 -19.327 -5.101  1.00 0.00 ? 68 SER A HB2  5  
ATOM 5726  H HB3  . SER A 1 68 ? -14.146 -20.336 -3.780  1.00 0.00 ? 68 SER A HB3  5  
ATOM 5727  H HG   . SER A 1 68 ? -15.272 -21.709 -5.036  1.00 0.00 ? 68 SER A HG   5  
ATOM 5728  N N    . SER A 1 69 ? -17.365 -18.350 -4.951  1.00 0.00 ? 69 SER A N    5  
ATOM 5729  C CA   . SER A 1 69 ? -18.682 -18.098 -5.523  1.00 0.00 ? 69 SER A CA   5  
ATOM 5730  C C    . SER A 1 69 ? -18.625 -18.117 -7.048  1.00 0.00 ? 69 SER A C    5  
ATOM 5731  O O    . SER A 1 69 ? -17.764 -17.483 -7.656  1.00 0.00 ? 69 SER A O    5  
ATOM 5732  C CB   . SER A 1 69 ? -19.222 -16.751 -5.039  1.00 0.00 ? 69 SER A CB   5  
ATOM 5733  O OG   . SER A 1 69 ? -18.356 -15.692 -5.407  1.00 0.00 ? 69 SER A OG   5  
ATOM 5734  H H    . SER A 1 69 ? -16.566 -18.145 -5.480  1.00 0.00 ? 69 SER A H    5  
ATOM 5735  H HA   . SER A 1 69 ? -19.344 -18.883 -5.189  1.00 0.00 ? 69 SER A HA   5  
ATOM 5736  H HB2  . SER A 1 69 ? -20.192 -16.576 -5.478  1.00 0.00 ? 69 SER A HB2  5  
ATOM 5737  H HB3  . SER A 1 69 ? -19.312 -16.769 -3.962  1.00 0.00 ? 69 SER A HB3  5  
ATOM 5738  H HG   . SER A 1 69 ? -17.466 -15.885 -5.103  1.00 0.00 ? 69 SER A HG   5  
ATOM 5739  N N    . GLY A 1 70 ? -19.550 -18.851 -7.659  1.00 0.00 ? 70 GLY A N    5  
ATOM 5740  C CA   . GLY A 1 70 ? -19.588 -18.940 -9.107  1.00 0.00 ? 70 GLY A CA   5  
ATOM 5741  C C    . GLY A 1 70 ? -20.416 -17.836 -9.735  1.00 0.00 ? 70 GLY A C    5  
ATOM 5742  O O    . GLY A 1 70 ? -20.188 -17.456 -10.883 1.00 0.00 ? 70 GLY A O    5  
ATOM 5743  H H    . GLY A 1 70 ? -20.212 -19.335 -7.123  1.00 0.00 ? 70 GLY A H    5  
ATOM 5744  H HA2  . GLY A 1 70 ? -18.579 -18.879 -9.487  1.00 0.00 ? 70 GLY A HA2  5  
ATOM 5745  H HA3  . GLY A 1 70 ? -20.010 -19.894 -9.387  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 5746  N N    . GLY A 1 1  ? -15.739 1.988   -10.698 1.00 0.00 ? 1  GLY A N    6  
ATOM 5747  C CA   . GLY A 1 1  ? -14.518 2.612   -10.224 1.00 0.00 ? 1  GLY A CA   6  
ATOM 5748  C C    . GLY A 1 1  ? -14.666 4.109   -10.038 1.00 0.00 ? 1  GLY A C    6  
ATOM 5749  O O    . GLY A 1 1  ? -14.294 4.890   -10.913 1.00 0.00 ? 1  GLY A O    6  
ATOM 5750  H H1   . GLY A 1 1  ? -16.236 2.390   -11.441 1.00 0.00 ? 1  GLY A H1   6  
ATOM 5751  H HA2  . GLY A 1 1  ? -14.242 2.167   -9.279  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 5752  H HA3  . GLY A 1 1  ? -13.731 2.426   -10.940 1.00 0.00 ? 1  GLY A HA3  6  
ATOM 5753  N N    . SER A 1 2  ? -15.212 4.510   -8.894  1.00 0.00 ? 2  SER A N    6  
ATOM 5754  C CA   . SER A 1 2  ? -15.414 5.924   -8.598  1.00 0.00 ? 2  SER A CA   6  
ATOM 5755  C C    . SER A 1 2  ? -15.343 6.180   -7.096  1.00 0.00 ? 2  SER A C    6  
ATOM 5756  O O    . SER A 1 2  ? -15.822 5.377   -6.295  1.00 0.00 ? 2  SER A O    6  
ATOM 5757  C CB   . SER A 1 2  ? -16.764 6.393   -9.144  1.00 0.00 ? 2  SER A CB   6  
ATOM 5758  O OG   . SER A 1 2  ? -17.826 5.983   -8.300  1.00 0.00 ? 2  SER A OG   6  
ATOM 5759  H H    . SER A 1 2  ? -15.488 3.839   -8.235  1.00 0.00 ? 2  SER A H    6  
ATOM 5760  H HA   . SER A 1 2  ? -14.626 6.480   -9.084  1.00 0.00 ? 2  SER A HA   6  
ATOM 5761  H HB2  . SER A 1 2  ? -16.768 7.471   -9.209  1.00 0.00 ? 2  SER A HB2  6  
ATOM 5762  H HB3  . SER A 1 2  ? -16.918 5.972   -10.127 1.00 0.00 ? 2  SER A HB3  6  
ATOM 5763  H HG   . SER A 1 2  ? -17.801 6.489   -7.485  1.00 0.00 ? 2  SER A HG   6  
ATOM 5764  N N    . SER A 1 3  ? -14.742 7.305   -6.721  1.00 0.00 ? 3  SER A N    6  
ATOM 5765  C CA   . SER A 1 3  ? -14.604 7.666   -5.315  1.00 0.00 ? 3  SER A CA   6  
ATOM 5766  C C    . SER A 1 3  ? -15.972 7.863   -4.669  1.00 0.00 ? 3  SER A C    6  
ATOM 5767  O O    . SER A 1 3  ? -16.903 8.363   -5.299  1.00 0.00 ? 3  SER A O    6  
ATOM 5768  C CB   . SER A 1 3  ? -13.772 8.942   -5.174  1.00 0.00 ? 3  SER A CB   6  
ATOM 5769  O OG   . SER A 1 3  ? -12.451 8.744   -5.645  1.00 0.00 ? 3  SER A OG   6  
ATOM 5770  H H    . SER A 1 3  ? -14.381 7.904   -7.407  1.00 0.00 ? 3  SER A H    6  
ATOM 5771  H HA   . SER A 1 3  ? -14.095 6.857   -4.814  1.00 0.00 ? 3  SER A HA   6  
ATOM 5772  H HB2  . SER A 1 3  ? -14.231 9.733   -5.748  1.00 0.00 ? 3  SER A HB2  6  
ATOM 5773  H HB3  . SER A 1 3  ? -13.732 9.229   -4.133  1.00 0.00 ? 3  SER A HB3  6  
ATOM 5774  H HG   . SER A 1 3  ? -11.844 8.735   -4.901  1.00 0.00 ? 3  SER A HG   6  
ATOM 5775  N N    . GLY A 1 4  ? -16.085 7.465   -3.405  1.00 0.00 ? 4  GLY A N    6  
ATOM 5776  C CA   . GLY A 1 4  ? -17.342 7.606   -2.692  1.00 0.00 ? 4  GLY A CA   6  
ATOM 5777  C C    . GLY A 1 4  ? -17.594 6.461   -1.731  1.00 0.00 ? 4  GLY A C    6  
ATOM 5778  O O    . GLY A 1 4  ? -16.774 5.551   -1.610  1.00 0.00 ? 4  GLY A O    6  
ATOM 5779  H H    . GLY A 1 4  ? -15.309 7.073   -2.953  1.00 0.00 ? 4  GLY A H    6  
ATOM 5780  H HA2  . GLY A 1 4  ? -17.327 8.532   -2.138  1.00 0.00 ? 4  GLY A HA2  6  
ATOM 5781  H HA3  . GLY A 1 4  ? -18.147 7.641   -3.411  1.00 0.00 ? 4  GLY A HA3  6  
ATOM 5782  N N    . SER A 1 5  ? -18.730 6.508   -1.043  1.00 0.00 ? 5  SER A N    6  
ATOM 5783  C CA   . SER A 1 5  ? -19.085 5.470   -0.082  1.00 0.00 ? 5  SER A CA   6  
ATOM 5784  C C    . SER A 1 5  ? -17.951 5.238   0.911   1.00 0.00 ? 5  SER A C    6  
ATOM 5785  O O    . SER A 1 5  ? -17.691 4.106   1.320   1.00 0.00 ? 5  SER A O    6  
ATOM 5786  C CB   . SER A 1 5  ? -19.417 4.166   -0.809  1.00 0.00 ? 5  SER A CB   6  
ATOM 5787  O OG   . SER A 1 5  ? -18.239 3.451   -1.139  1.00 0.00 ? 5  SER A OG   6  
ATOM 5788  H H    . SER A 1 5  ? -19.343 7.261   -1.183  1.00 0.00 ? 5  SER A H    6  
ATOM 5789  H HA   . SER A 1 5  ? -19.959 5.804   0.459   1.00 0.00 ? 5  SER A HA   6  
ATOM 5790  H HB2  . SER A 1 5  ? -20.031 3.548   -0.171  1.00 0.00 ? 5  SER A HB2  6  
ATOM 5791  H HB3  . SER A 1 5  ? -19.955 4.390   -1.718  1.00 0.00 ? 5  SER A HB3  6  
ATOM 5792  H HG   . SER A 1 5  ? -18.470 2.667   -1.642  1.00 0.00 ? 5  SER A HG   6  
ATOM 5793  N N    . SER A 1 6  ? -17.278 6.318   1.295   1.00 0.00 ? 6  SER A N    6  
ATOM 5794  C CA   . SER A 1 6  ? -16.168 6.233   2.237   1.00 0.00 ? 6  SER A CA   6  
ATOM 5795  C C    . SER A 1 6  ? -16.183 7.414   3.202   1.00 0.00 ? 6  SER A C    6  
ATOM 5796  O O    . SER A 1 6  ? -16.209 8.571   2.785   1.00 0.00 ? 6  SER A O    6  
ATOM 5797  C CB   . SER A 1 6  ? -14.836 6.190   1.486   1.00 0.00 ? 6  SER A CB   6  
ATOM 5798  O OG   . SER A 1 6  ? -14.837 5.169   0.504   1.00 0.00 ? 6  SER A OG   6  
ATOM 5799  H H    . SER A 1 6  ? -17.533 7.193   0.933   1.00 0.00 ? 6  SER A H    6  
ATOM 5800  H HA   . SER A 1 6  ? -16.283 5.320   2.802   1.00 0.00 ? 6  SER A HA   6  
ATOM 5801  H HB2  . SER A 1 6  ? -14.669 7.140   1.001   1.00 0.00 ? 6  SER A HB2  6  
ATOM 5802  H HB3  . SER A 1 6  ? -14.037 5.999   2.187   1.00 0.00 ? 6  SER A HB3  6  
ATOM 5803  H HG   . SER A 1 6  ? -15.180 4.358   0.885   1.00 0.00 ? 6  SER A HG   6  
ATOM 5804  N N    . GLY A 1 7  ? -16.167 7.113   4.497   1.00 0.00 ? 7  GLY A N    6  
ATOM 5805  C CA   . GLY A 1 7  ? -16.180 8.159   5.503   1.00 0.00 ? 7  GLY A CA   6  
ATOM 5806  C C    . GLY A 1 7  ? -15.925 7.625   6.898   1.00 0.00 ? 7  GLY A C    6  
ATOM 5807  O O    . GLY A 1 7  ? -15.525 6.473   7.066   1.00 0.00 ? 7  GLY A O    6  
ATOM 5808  H H    . GLY A 1 7  ? -16.147 6.172   4.772   1.00 0.00 ? 7  GLY A H    6  
ATOM 5809  H HA2  . GLY A 1 7  ? -15.417 8.884   5.261   1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5810  H HA3  . GLY A 1 7  ? -17.144 8.646   5.487   1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5811  N N    . ARG A 1 8  ? -16.154 8.465   7.903   1.00 0.00 ? 8  ARG A N    6  
ATOM 5812  C CA   . ARG A 1 8  ? -15.944 8.071   9.291   1.00 0.00 ? 8  ARG A CA   6  
ATOM 5813  C C    . ARG A 1 8  ? -16.961 7.017   9.717   1.00 0.00 ? 8  ARG A C    6  
ATOM 5814  O O    . ARG A 1 8  ? -18.074 7.343   10.130  1.00 0.00 ? 8  ARG A O    6  
ATOM 5815  C CB   . ARG A 1 8  ? -16.042 9.291   10.209  1.00 0.00 ? 8  ARG A CB   6  
ATOM 5816  C CG   . ARG A 1 8  ? -15.259 9.143   11.503  1.00 0.00 ? 8  ARG A CG   6  
ATOM 5817  C CD   . ARG A 1 8  ? -14.747 10.486  12.001  1.00 0.00 ? 8  ARG A CD   6  
ATOM 5818  N NE   . ARG A 1 8  ? -13.541 10.908  11.295  1.00 0.00 ? 8  ARG A NE   6  
ATOM 5819  C CZ   . ARG A 1 8  ? -12.888 12.033  11.563  1.00 0.00 ? 8  ARG A CZ   6  
ATOM 5820  N NH1  . ARG A 1 8  ? -13.322 12.844  12.517  1.00 0.00 ? 8  ARG A NH1  6  
ATOM 5821  N NH2  . ARG A 1 8  ? -11.797 12.348  10.876  1.00 0.00 ? 8  ARG A NH2  6  
ATOM 5822  H H    . ARG A 1 8  ? -16.472 9.371   7.706   1.00 0.00 ? 8  ARG A H    6  
ATOM 5823  H HA   . ARG A 1 8  ? -14.952 7.651   9.370   1.00 0.00 ? 8  ARG A HA   6  
ATOM 5824  H HB2  . ARG A 1 8  ? -15.665 10.155  9.682   1.00 0.00 ? 8  ARG A HB2  6  
ATOM 5825  H HB3  . ARG A 1 8  ? -17.079 9.456   10.458  1.00 0.00 ? 8  ARG A HB3  6  
ATOM 5826  H HG2  . ARG A 1 8  ? -15.904 8.715   12.256  1.00 0.00 ? 8  ARG A HG2  6  
ATOM 5827  H HG3  . ARG A 1 8  ? -14.418 8.488   11.331  1.00 0.00 ? 8  ARG A HG3  6  
ATOM 5828  H HD2  . ARG A 1 8  ? -15.518 11.227  11.852  1.00 0.00 ? 8  ARG A HD2  6  
ATOM 5829  H HD3  . ARG A 1 8  ? -14.527 10.403  13.055  1.00 0.00 ? 8  ARG A HD3  6  
ATOM 5830  H HE   . ARG A 1 8  ? -13.202 10.323  10.585  1.00 0.00 ? 8  ARG A HE   6  
ATOM 5831  H HH11 . ARG A 1 8  ? -14.144 12.609  13.037  1.00 0.00 ? 8  ARG A HH11 6  
ATOM 5832  H HH12 . ARG A 1 8  ? -12.828 13.690  12.718  1.00 0.00 ? 8  ARG A HH12 6  
ATOM 5833  H HH21 . ARG A 1 8  ? -11.466 11.739  10.156  1.00 0.00 ? 8  ARG A HH21 6  
ATOM 5834  H HH22 . ARG A 1 8  ? -11.306 13.195  11.079  1.00 0.00 ? 8  ARG A HH22 6  
ATOM 5835  N N    . LYS A 1 9  ? -16.572 5.751   9.613   1.00 0.00 ? 9  LYS A N    6  
ATOM 5836  C CA   . LYS A 1 9  ? -17.448 4.647   9.988   1.00 0.00 ? 9  LYS A CA   6  
ATOM 5837  C C    . LYS A 1 9  ? -16.704 3.317   9.927   1.00 0.00 ? 9  LYS A C    6  
ATOM 5838  O O    . LYS A 1 9  ? -15.654 3.209   9.292   1.00 0.00 ? 9  LYS A O    6  
ATOM 5839  C CB   . LYS A 1 9  ? -18.669 4.603   9.067   1.00 0.00 ? 9  LYS A CB   6  
ATOM 5840  C CG   . LYS A 1 9  ? -19.931 4.110   9.754   1.00 0.00 ? 9  LYS A CG   6  
ATOM 5841  C CD   . LYS A 1 9  ? -20.455 5.128   10.754  1.00 0.00 ? 9  LYS A CD   6  
ATOM 5842  C CE   . LYS A 1 9  ? -21.322 6.179   10.077  1.00 0.00 ? 9  LYS A CE   6  
ATOM 5843  N NZ   . LYS A 1 9  ? -21.928 7.116   11.063  1.00 0.00 ? 9  LYS A NZ   6  
ATOM 5844  H H    . LYS A 1 9  ? -15.672 5.554   9.277   1.00 0.00 ? 9  LYS A H    6  
ATOM 5845  H HA   . LYS A 1 9  ? -17.777 4.815   11.002  1.00 0.00 ? 9  LYS A HA   6  
ATOM 5846  H HB2  . LYS A 1 9  ? -18.855 5.597   8.688   1.00 0.00 ? 9  LYS A HB2  6  
ATOM 5847  H HB3  . LYS A 1 9  ? -18.456 3.945   8.238   1.00 0.00 ? 9  LYS A HB3  6  
ATOM 5848  H HG2  . LYS A 1 9  ? -20.690 3.931   9.008   1.00 0.00 ? 9  LYS A HG2  6  
ATOM 5849  H HG3  . LYS A 1 9  ? -19.711 3.189   10.274  1.00 0.00 ? 9  LYS A HG3  6  
ATOM 5850  H HD2  . LYS A 1 9  ? -21.046 4.616   11.499  1.00 0.00 ? 9  LYS A HD2  6  
ATOM 5851  H HD3  . LYS A 1 9  ? -19.617 5.617   11.230  1.00 0.00 ? 9  LYS A HD3  6  
ATOM 5852  H HE2  . LYS A 1 9  ? -20.711 6.741   9.388   1.00 0.00 ? 9  LYS A HE2  6  
ATOM 5853  H HE3  . LYS A 1 9  ? -22.111 5.680   9.534   1.00 0.00 ? 9  LYS A HE3  6  
ATOM 5854  H HZ1  . LYS A 1 9  ? -22.334 7.938   10.571  1.00 0.00 ? 9  LYS A HZ1  6  
ATOM 5855  H HZ2  . LYS A 1 9  ? -21.205 7.449   11.731  1.00 0.00 ? 9  LYS A HZ2  6  
ATOM 5856  H HZ3  . LYS A 1 9  ? -22.682 6.637   11.595  1.00 0.00 ? 9  LYS A HZ3  6  
ATOM 5857  N N    . LYS A 1 10 ? -17.254 2.305   10.590  1.00 0.00 ? 10 LYS A N    6  
ATOM 5858  C CA   . LYS A 1 10 ? -16.645 0.981   10.609  1.00 0.00 ? 10 LYS A CA   6  
ATOM 5859  C C    . LYS A 1 10 ? -16.489 0.433   9.194   1.00 0.00 ? 10 LYS A C    6  
ATOM 5860  O O    . LYS A 1 10 ? -17.461 0.001   8.575   1.00 0.00 ? 10 LYS A O    6  
ATOM 5861  C CB   . LYS A 1 10 ? -17.490 0.020   11.448  1.00 0.00 ? 10 LYS A CB   6  
ATOM 5862  C CG   . LYS A 1 10 ? -17.113 0.006   12.920  1.00 0.00 ? 10 LYS A CG   6  
ATOM 5863  C CD   . LYS A 1 10 ? -17.439 1.329   13.591  1.00 0.00 ? 10 LYS A CD   6  
ATOM 5864  C CE   . LYS A 1 10 ? -16.956 1.356   15.034  1.00 0.00 ? 10 LYS A CE   6  
ATOM 5865  N NZ   . LYS A 1 10 ? -17.982 0.823   15.972  1.00 0.00 ? 10 LYS A NZ   6  
ATOM 5866  H H    . LYS A 1 10 ? -18.092 2.453   11.078  1.00 0.00 ? 10 LYS A H    6  
ATOM 5867  H HA   . LYS A 1 10 ? -15.667 1.072   11.056  1.00 0.00 ? 10 LYS A HA   6  
ATOM 5868  H HB2  . LYS A 1 10 ? -18.528 0.307   11.367  1.00 0.00 ? 10 LYS A HB2  6  
ATOM 5869  H HB3  . LYS A 1 10 ? -17.370 -0.980  11.058  1.00 0.00 ? 10 LYS A HB3  6  
ATOM 5870  H HG2  . LYS A 1 10 ? -17.662 -0.781  13.415  1.00 0.00 ? 10 LYS A HG2  6  
ATOM 5871  H HG3  . LYS A 1 10 ? -16.052 -0.181  13.009  1.00 0.00 ? 10 LYS A HG3  6  
ATOM 5872  H HD2  . LYS A 1 10 ? -16.956 2.128   13.048  1.00 0.00 ? 10 LYS A HD2  6  
ATOM 5873  H HD3  . LYS A 1 10 ? -18.509 1.477   13.577  1.00 0.00 ? 10 LYS A HD3  6  
ATOM 5874  H HE2  . LYS A 1 10 ? -16.062 0.756   15.112  1.00 0.00 ? 10 LYS A HE2  6  
ATOM 5875  H HE3  . LYS A 1 10 ? -16.728 2.377   15.304  1.00 0.00 ? 10 LYS A HE3  6  
ATOM 5876  H HZ1  . LYS A 1 10 ? -18.720 1.537   16.136  1.00 0.00 ? 10 LYS A HZ1  6  
ATOM 5877  H HZ2  . LYS A 1 10 ? -17.542 0.581   16.882  1.00 0.00 ? 10 LYS A HZ2  6  
ATOM 5878  H HZ3  . LYS A 1 10 ? -18.422 -0.031  15.574  1.00 0.00 ? 10 LYS A HZ3  6  
ATOM 5879  N N    . ARG A 1 11 ? -15.260 0.453   8.688   1.00 0.00 ? 11 ARG A N    6  
ATOM 5880  C CA   . ARG A 1 11 ? -14.977 -0.041  7.346   1.00 0.00 ? 11 ARG A CA   6  
ATOM 5881  C C    . ARG A 1 11 ? -13.474 -0.087  7.089   1.00 0.00 ? 11 ARG A C    6  
ATOM 5882  O O    . ARG A 1 11 ? -12.675 0.268   7.956   1.00 0.00 ? 11 ARG A O    6  
ATOM 5883  C CB   . ARG A 1 11 ? -15.658 0.843   6.300   1.00 0.00 ? 11 ARG A CB   6  
ATOM 5884  C CG   . ARG A 1 11 ? -16.253 0.063   5.139   1.00 0.00 ? 11 ARG A CG   6  
ATOM 5885  C CD   . ARG A 1 11 ? -17.391 0.827   4.480   1.00 0.00 ? 11 ARG A CD   6  
ATOM 5886  N NE   . ARG A 1 11 ? -18.234 -0.042  3.663   1.00 0.00 ? 11 ARG A NE   6  
ATOM 5887  C CZ   . ARG A 1 11 ? -19.316 0.379   3.018   1.00 0.00 ? 11 ARG A CZ   6  
ATOM 5888  N NH1  . ARG A 1 11 ? -19.685 1.650   3.094   1.00 0.00 ? 11 ARG A NH1  6  
ATOM 5889  N NH2  . ARG A 1 11 ? -20.032 -0.473  2.294   1.00 0.00 ? 11 ARG A NH2  6  
ATOM 5890  H H    . ARG A 1 11 ? -14.525 0.810   9.230   1.00 0.00 ? 11 ARG A H    6  
ATOM 5891  H HA   . ARG A 1 11 ? -15.374 -1.043  7.272   1.00 0.00 ? 11 ARG A HA   6  
ATOM 5892  H HB2  . ARG A 1 11 ? -16.453 1.398   6.776   1.00 0.00 ? 11 ARG A HB2  6  
ATOM 5893  H HB3  . ARG A 1 11 ? -14.932 1.536   5.905   1.00 0.00 ? 11 ARG A HB3  6  
ATOM 5894  H HG2  . ARG A 1 11 ? -15.482 -0.115  4.404   1.00 0.00 ? 11 ARG A HG2  6  
ATOM 5895  H HG3  . ARG A 1 11 ? -16.629 -0.880  5.506   1.00 0.00 ? 11 ARG A HG3  6  
ATOM 5896  H HD2  . ARG A 1 11 ? -17.998 1.279   5.251   1.00 0.00 ? 11 ARG A HD2  6  
ATOM 5897  H HD3  . ARG A 1 11 ? -16.972 1.600   3.853   1.00 0.00 ? 11 ARG A HD3  6  
ATOM 5898  H HE   . ARG A 1 11 ? -17.979 -0.985  3.593   1.00 0.00 ? 11 ARG A HE   6  
ATOM 5899  H HH11 . ARG A 1 11 ? -19.148 2.294   3.637   1.00 0.00 ? 11 ARG A HH11 6  
ATOM 5900  H HH12 . ARG A 1 11 ? -20.500 1.964   2.606   1.00 0.00 ? 11 ARG A HH12 6  
ATOM 5901  H HH21 . ARG A 1 11 ? -19.756 -1.432  2.235   1.00 0.00 ? 11 ARG A HH21 6  
ATOM 5902  H HH22 . ARG A 1 11 ? -20.846 -0.156  1.809   1.00 0.00 ? 11 ARG A HH22 6  
ATOM 5903  N N    . ILE A 1 12 ? -13.097 -0.526  5.893   1.00 0.00 ? 12 ILE A N    6  
ATOM 5904  C CA   . ILE A 1 12 ? -11.690 -0.617  5.522   1.00 0.00 ? 12 ILE A CA   6  
ATOM 5905  C C    . ILE A 1 12 ? -11.042 0.763   5.482   1.00 0.00 ? 12 ILE A C    6  
ATOM 5906  O O    . ILE A 1 12 ? -11.598 1.722   4.947   1.00 0.00 ? 12 ILE A O    6  
ATOM 5907  C CB   . ILE A 1 12 ? -11.512 -1.295  4.151   1.00 0.00 ? 12 ILE A CB   6  
ATOM 5908  C CG1  . ILE A 1 12 ? -12.161 -2.681  4.155   1.00 0.00 ? 12 ILE A CG1  6  
ATOM 5909  C CG2  . ILE A 1 12 ? -10.036 -1.396  3.797   1.00 0.00 ? 12 ILE A CG2  6  
ATOM 5910  C CD1  . ILE A 1 12 ? -11.608 -3.603  5.219   1.00 0.00 ? 12 ILE A CD1  6  
ATOM 5911  H H    . ILE A 1 12 ? -13.780 -0.794  5.245   1.00 0.00 ? 12 ILE A H    6  
ATOM 5912  H HA   . ILE A 1 12 ? -11.188 -1.218  6.266   1.00 0.00 ? 12 ILE A HA   6  
ATOM 5913  H HB   . ILE A 1 12 ? -11.995 -0.682  3.405   1.00 0.00 ? 12 ILE A HB   6  
ATOM 5914  H HG12 . ILE A 1 12 ? -13.220 -2.575  4.326   1.00 0.00 ? 12 ILE A HG12 6  
ATOM 5915  H HG13 . ILE A 1 12 ? -12.000 -3.148  3.194   1.00 0.00 ? 12 ILE A HG13 6  
ATOM 5916  H HG21 . ILE A 1 12 ? -9.584  -0.417  3.854   1.00 0.00 ? 12 ILE A HG21 6  
ATOM 5917  H HG22 . ILE A 1 12 ? -9.544  -2.059  4.493   1.00 0.00 ? 12 ILE A HG22 6  
ATOM 5918  H HG23 . ILE A 1 12 ? -9.931  -1.783  2.795   1.00 0.00 ? 12 ILE A HG23 6  
ATOM 5919  H HD11 . ILE A 1 12 ? -10.772 -3.128  5.710   1.00 0.00 ? 12 ILE A HD11 6  
ATOM 5920  H HD12 . ILE A 1 12 ? -12.378 -3.819  5.944   1.00 0.00 ? 12 ILE A HD12 6  
ATOM 5921  H HD13 . ILE A 1 12 ? -11.278 -4.525  4.760   1.00 0.00 ? 12 ILE A HD13 6  
ATOM 5922  N N    . PRO A 1 13 ? -9.835  0.867   6.059   1.00 0.00 ? 13 PRO A N    6  
ATOM 5923  C CA   . PRO A 1 13 ? -9.083  2.124   6.101   1.00 0.00 ? 13 PRO A CA   6  
ATOM 5924  C C    . PRO A 1 13 ? -8.358  2.409   4.790   1.00 0.00 ? 13 PRO A C    6  
ATOM 5925  O O    . PRO A 1 13 ? -8.578  1.730   3.787   1.00 0.00 ? 13 PRO A O    6  
ATOM 5926  C CB   . PRO A 1 13 ? -8.076  1.898   7.231   1.00 0.00 ? 13 PRO A CB   6  
ATOM 5927  C CG   . PRO A 1 13 ? -7.888  0.421   7.281   1.00 0.00 ? 13 PRO A CG   6  
ATOM 5928  C CD   . PRO A 1 13 ? -9.113  -0.236  6.716   1.00 0.00 ? 13 PRO A CD   6  
ATOM 5929  H HA   . PRO A 1 13 ? -9.722  2.960   6.347   1.00 0.00 ? 13 PRO A HA   6  
ATOM 5930  H HB2  . PRO A 1 13 ? -7.151  2.407   7.000   1.00 0.00 ? 13 PRO A HB2  6  
ATOM 5931  H HB3  . PRO A 1 13 ? -8.480  2.276   8.159   1.00 0.00 ? 13 PRO A HB3  6  
ATOM 5932  H HG2  . PRO A 1 13 ? -7.040  0.138   6.677   1.00 0.00 ? 13 PRO A HG2  6  
ATOM 5933  H HG3  . PRO A 1 13 ? -7.745  0.104   8.304   1.00 0.00 ? 13 PRO A HG3  6  
ATOM 5934  H HD2  . PRO A 1 13 ? -8.803  -0.977  5.994   1.00 0.00 ? 13 PRO A HD2  6  
ATOM 5935  H HD3  . PRO A 1 13 ? -9.719  -0.688  7.487   1.00 0.00 ? 13 PRO A HD3  6  
ATOM 5936  N N    . TYR A 1 14 ? -7.492  3.417   4.806   1.00 0.00 ? 14 TYR A N    6  
ATOM 5937  C CA   . TYR A 1 14 ? -6.735  3.793   3.618   1.00 0.00 ? 14 TYR A CA   6  
ATOM 5938  C C    . TYR A 1 14 ? -7.665  4.287   2.514   1.00 0.00 ? 14 TYR A C    6  
ATOM 5939  O O    . TYR A 1 14 ? -8.436  3.515   1.944   1.00 0.00 ? 14 TYR A O    6  
ATOM 5940  C CB   . TYR A 1 14 ? -5.913  2.605   3.114   1.00 0.00 ? 14 TYR A CB   6  
ATOM 5941  C CG   . TYR A 1 14 ? -5.100  1.930   4.195   1.00 0.00 ? 14 TYR A CG   6  
ATOM 5942  C CD1  . TYR A 1 14 ? -4.046  2.590   4.813   1.00 0.00 ? 14 TYR A CD1  6  
ATOM 5943  C CD2  . TYR A 1 14 ? -5.386  0.631   4.598   1.00 0.00 ? 14 TYR A CD2  6  
ATOM 5944  C CE1  . TYR A 1 14 ? -3.299  1.977   5.801   1.00 0.00 ? 14 TYR A CE1  6  
ATOM 5945  C CE2  . TYR A 1 14 ? -4.646  0.010   5.586   1.00 0.00 ? 14 TYR A CE2  6  
ATOM 5946  C CZ   . TYR A 1 14 ? -3.604  0.687   6.184   1.00 0.00 ? 14 TYR A CZ   6  
ATOM 5947  O OH   . TYR A 1 14 ? -2.863  0.073   7.168   1.00 0.00 ? 14 TYR A OH   6  
ATOM 5948  H H    . TYR A 1 14 ? -7.360  3.921   5.636   1.00 0.00 ? 14 TYR A H    6  
ATOM 5949  H HA   . TYR A 1 14 ? -6.063  4.592   3.892   1.00 0.00 ? 14 TYR A HA   6  
ATOM 5950  H HB2  . TYR A 1 14 ? -6.579  1.868   2.692   1.00 0.00 ? 14 TYR A HB2  6  
ATOM 5951  H HB3  . TYR A 1 14 ? -5.231  2.947   2.349   1.00 0.00 ? 14 TYR A HB3  6  
ATOM 5952  H HD1  . TYR A 1 14 ? -3.810  3.600   4.511   1.00 0.00 ? 14 TYR A HD1  6  
ATOM 5953  H HD2  . TYR A 1 14 ? -6.204  0.104   4.128   1.00 0.00 ? 14 TYR A HD2  6  
ATOM 5954  H HE1  . TYR A 1 14 ? -2.483  2.506   6.269   1.00 0.00 ? 14 TYR A HE1  6  
ATOM 5955  H HE2  . TYR A 1 14 ? -4.884  -1.000  5.886   1.00 0.00 ? 14 TYR A HE2  6  
ATOM 5956  H HH   . TYR A 1 14 ? -2.048  -0.265  6.791   1.00 0.00 ? 14 TYR A HH   6  
ATOM 5957  N N    . SER A 1 15 ? -7.585  5.580   2.217   1.00 0.00 ? 15 SER A N    6  
ATOM 5958  C CA   . SER A 1 15 ? -8.421  6.180   1.183   1.00 0.00 ? 15 SER A CA   6  
ATOM 5959  C C    . SER A 1 15 ? -7.983  5.720   -0.204  1.00 0.00 ? 15 SER A C    6  
ATOM 5960  O O    . SER A 1 15 ? -6.945  5.077   -0.359  1.00 0.00 ? 15 SER A O    6  
ATOM 5961  C CB   . SER A 1 15 ? -8.359  7.706   1.270   1.00 0.00 ? 15 SER A CB   6  
ATOM 5962  O OG   . SER A 1 15 ? -9.370  8.304   0.476   1.00 0.00 ? 15 SER A OG   6  
ATOM 5963  H H    . SER A 1 15 ? -6.951  6.144   2.707   1.00 0.00 ? 15 SER A H    6  
ATOM 5964  H HA   . SER A 1 15 ? -9.438  5.859   1.352   1.00 0.00 ? 15 SER A HA   6  
ATOM 5965  H HB2  . SER A 1 15 ? -8.497  8.012   2.296   1.00 0.00 ? 15 SER A HB2  6  
ATOM 5966  H HB3  . SER A 1 15 ? -7.395  8.045   0.920   1.00 0.00 ? 15 SER A HB3  6  
ATOM 5967  H HG   . SER A 1 15 ? -9.008  8.536   -0.382  1.00 0.00 ? 15 SER A HG   6  
ATOM 5968  N N    . LYS A 1 16 ? -8.783  6.055   -1.211  1.00 0.00 ? 16 LYS A N    6  
ATOM 5969  C CA   . LYS A 1 16 ? -8.480  5.679   -2.587  1.00 0.00 ? 16 LYS A CA   6  
ATOM 5970  C C    . LYS A 1 16 ? -7.148  6.273   -3.032  1.00 0.00 ? 16 LYS A C    6  
ATOM 5971  O O    . LYS A 1 16 ? -6.530  5.794   -3.982  1.00 0.00 ? 16 LYS A O    6  
ATOM 5972  C CB   . LYS A 1 16 ? -9.597  6.146   -3.522  1.00 0.00 ? 16 LYS A CB   6  
ATOM 5973  C CG   . LYS A 1 16 ? -9.774  5.265   -4.747  1.00 0.00 ? 16 LYS A CG   6  
ATOM 5974  C CD   . LYS A 1 16 ? -11.212 5.271   -5.236  1.00 0.00 ? 16 LYS A CD   6  
ATOM 5975  C CE   . LYS A 1 16 ? -11.543 4.005   -6.011  1.00 0.00 ? 16 LYS A CE   6  
ATOM 5976  N NZ   . LYS A 1 16 ? -11.565 2.805   -5.130  1.00 0.00 ? 16 LYS A NZ   6  
ATOM 5977  H H    . LYS A 1 16 ? -9.597  6.569   -1.024  1.00 0.00 ? 16 LYS A H    6  
ATOM 5978  H HA   . LYS A 1 16 ? -8.413  4.603   -2.629  1.00 0.00 ? 16 LYS A HA   6  
ATOM 5979  H HB2  . LYS A 1 16 ? -10.528 6.157   -2.975  1.00 0.00 ? 16 LYS A HB2  6  
ATOM 5980  H HB3  . LYS A 1 16 ? -9.375  7.150   -3.856  1.00 0.00 ? 16 LYS A HB3  6  
ATOM 5981  H HG2  . LYS A 1 16 ? -9.135  5.630   -5.537  1.00 0.00 ? 16 LYS A HG2  6  
ATOM 5982  H HG3  . LYS A 1 16 ? -9.493  4.252   -4.493  1.00 0.00 ? 16 LYS A HG3  6  
ATOM 5983  H HD2  . LYS A 1 16 ? -11.873 5.340   -4.384  1.00 0.00 ? 16 LYS A HD2  6  
ATOM 5984  H HD3  . LYS A 1 16 ? -11.361 6.126   -5.879  1.00 0.00 ? 16 LYS A HD3  6  
ATOM 5985  H HE2  . LYS A 1 16 ? -12.513 4.122   -6.470  1.00 0.00 ? 16 LYS A HE2  6  
ATOM 5986  H HE3  . LYS A 1 16 ? -10.796 3.864   -6.779  1.00 0.00 ? 16 LYS A HE3  6  
ATOM 5987  H HZ1  . LYS A 1 16 ? -10.627 2.655   -4.707  1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 5988  H HZ2  . LYS A 1 16 ? -11.823 1.962   -5.682  1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 5989  H HZ3  . LYS A 1 16 ? -12.261 2.933   -4.368  1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 5990  N N    . GLY A 1 17 ? -6.709  7.319   -2.338  1.00 0.00 ? 17 GLY A N    6  
ATOM 5991  C CA   . GLY A 1 17 ? -5.452  7.960   -2.677  1.00 0.00 ? 17 GLY A CA   6  
ATOM 5992  C C    . GLY A 1 17 ? -4.262  7.280   -2.030  1.00 0.00 ? 17 GLY A C    6  
ATOM 5993  O O    . GLY A 1 17 ? -3.163  7.279   -2.584  1.00 0.00 ? 17 GLY A O    6  
ATOM 5994  H H    . GLY A 1 17 ? -7.244  7.659   -1.590  1.00 0.00 ? 17 GLY A H    6  
ATOM 5995  H HA2  . GLY A 1 17 ? -5.327  7.938   -3.749  1.00 0.00 ? 17 GLY A HA2  6  
ATOM 5996  H HA3  . GLY A 1 17 ? -5.486  8.989   -2.350  1.00 0.00 ? 17 GLY A HA3  6  
ATOM 5997  N N    . GLN A 1 18 ? -4.481  6.702   -0.853  1.00 0.00 ? 18 GLN A N    6  
ATOM 5998  C CA   . GLN A 1 18 ? -3.416  6.019   -0.129  1.00 0.00 ? 18 GLN A CA   6  
ATOM 5999  C C    . GLN A 1 18 ? -3.260  4.582   -0.618  1.00 0.00 ? 18 GLN A C    6  
ATOM 6000  O O    . GLN A 1 18 ? -2.166  4.017   -0.577  1.00 0.00 ? 18 GLN A O    6  
ATOM 6001  C CB   . GLN A 1 18 ? -3.704  6.029   1.374   1.00 0.00 ? 18 GLN A CB   6  
ATOM 6002  C CG   . GLN A 1 18 ? -3.720  7.423   1.980   1.00 0.00 ? 18 GLN A CG   6  
ATOM 6003  C CD   . GLN A 1 18 ? -4.176  7.426   3.426   1.00 0.00 ? 18 GLN A CD   6  
ATOM 6004  O OE1  . GLN A 1 18 ? -5.373  7.368   3.711   1.00 0.00 ? 18 GLN A OE1  6  
ATOM 6005  N NE2  . GLN A 1 18 ? -3.223  7.493   4.348   1.00 0.00 ? 18 GLN A NE2  6  
ATOM 6006  H H    . GLN A 1 18 ? -5.378  6.737   -0.463  1.00 0.00 ? 18 GLN A H    6  
ATOM 6007  H HA   . GLN A 1 18 ? -2.495  6.551   -0.313  1.00 0.00 ? 18 GLN A HA   6  
ATOM 6008  H HB2  . GLN A 1 18 ? -4.667  5.573   1.547   1.00 0.00 ? 18 GLN A HB2  6  
ATOM 6009  H HB3  . GLN A 1 18 ? -2.944  5.450   1.878   1.00 0.00 ? 18 GLN A HB3  6  
ATOM 6010  H HG2  . GLN A 1 18 ? -2.722  7.834   1.933   1.00 0.00 ? 18 GLN A HG2  6  
ATOM 6011  H HG3  . GLN A 1 18 ? -4.390  8.044   1.404   1.00 0.00 ? 18 GLN A HG3  6  
ATOM 6012  H HE21 . GLN A 1 18 ? -2.291  7.537   4.046   1.00 0.00 ? 18 GLN A HE21 6  
ATOM 6013  H HE22 . GLN A 1 18 ? -3.489  7.497   5.290   1.00 0.00 ? 18 GLN A HE22 6  
ATOM 6014  N N    . LEU A 1 19 ? -4.359  3.997   -1.080  1.00 0.00 ? 19 LEU A N    6  
ATOM 6015  C CA   . LEU A 1 19 ? -4.345  2.626   -1.577  1.00 0.00 ? 19 LEU A CA   6  
ATOM 6016  C C    . LEU A 1 19 ? -3.814  2.571   -3.006  1.00 0.00 ? 19 LEU A C    6  
ATOM 6017  O O    . LEU A 1 19 ? -3.420  1.511   -3.492  1.00 0.00 ? 19 LEU A O    6  
ATOM 6018  C CB   . LEU A 1 19 ? -5.751  2.027   -1.520  1.00 0.00 ? 19 LEU A CB   6  
ATOM 6019  C CG   . LEU A 1 19 ? -6.345  1.841   -0.123  1.00 0.00 ? 19 LEU A CG   6  
ATOM 6020  C CD1  . LEU A 1 19 ? -7.848  1.624   -0.206  1.00 0.00 ? 19 LEU A CD1  6  
ATOM 6021  C CD2  . LEU A 1 19 ? -5.675  0.675   0.590   1.00 0.00 ? 19 LEU A CD2  6  
ATOM 6022  H H    . LEU A 1 19 ? -5.201  4.498   -1.087  1.00 0.00 ? 19 LEU A H    6  
ATOM 6023  H HA   . LEU A 1 19 ? -3.690  2.050   -0.941  1.00 0.00 ? 19 LEU A HA   6  
ATOM 6024  H HB2  . LEU A 1 19 ? -6.410  2.677   -2.075  1.00 0.00 ? 19 LEU A HB2  6  
ATOM 6025  H HB3  . LEU A 1 19 ? -5.717  1.058   -1.998  1.00 0.00 ? 19 LEU A HB3  6  
ATOM 6026  H HG   . LEU A 1 19 ? -6.168  2.736   0.458   1.00 0.00 ? 19 LEU A HG   6  
ATOM 6027  H HD11 . LEU A 1 19 ? -8.248  1.491   0.788   1.00 0.00 ? 19 LEU A HD11 6  
ATOM 6028  H HD12 . LEU A 1 19 ? -8.052  0.744   -0.798  1.00 0.00 ? 19 LEU A HD12 6  
ATOM 6029  H HD13 . LEU A 1 19 ? -8.310  2.484   -0.669  1.00 0.00 ? 19 LEU A HD13 6  
ATOM 6030  H HD21 . LEU A 1 19 ? -5.558  -0.148  -0.099  1.00 0.00 ? 19 LEU A HD21 6  
ATOM 6031  H HD22 . LEU A 1 19 ? -6.288  0.363   1.423   1.00 0.00 ? 19 LEU A HD22 6  
ATOM 6032  H HD23 . LEU A 1 19 ? -4.705  0.984   0.951   1.00 0.00 ? 19 LEU A HD23 6  
ATOM 6033  N N    . ARG A 1 20 ? -3.806  3.720   -3.674  1.00 0.00 ? 20 ARG A N    6  
ATOM 6034  C CA   . ARG A 1 20 ? -3.323  3.802   -5.047  1.00 0.00 ? 20 ARG A CA   6  
ATOM 6035  C C    . ARG A 1 20 ? -1.847  3.424   -5.128  1.00 0.00 ? 20 ARG A C    6  
ATOM 6036  O O    . ARG A 1 20 ? -1.402  2.833   -6.111  1.00 0.00 ? 20 ARG A O    6  
ATOM 6037  C CB   . ARG A 1 20 ? -3.530  5.214   -5.599  1.00 0.00 ? 20 ARG A CB   6  
ATOM 6038  C CG   . ARG A 1 20 ? -3.915  5.243   -7.069  1.00 0.00 ? 20 ARG A CG   6  
ATOM 6039  C CD   . ARG A 1 20 ? -4.295  6.645   -7.518  1.00 0.00 ? 20 ARG A CD   6  
ATOM 6040  N NE   . ARG A 1 20 ? -4.252  6.786   -8.971  1.00 0.00 ? 20 ARG A NE   6  
ATOM 6041  C CZ   . ARG A 1 20 ? -4.193  7.957   -9.595  1.00 0.00 ? 20 ARG A CZ   6  
ATOM 6042  N NH1  . ARG A 1 20 ? -4.169  9.084   -8.896  1.00 0.00 ? 20 ARG A NH1  6  
ATOM 6043  N NH2  . ARG A 1 20 ? -4.157  8.003   -10.920 1.00 0.00 ? 20 ARG A NH2  6  
ATOM 6044  H H    . ARG A 1 20 ? -4.134  4.532   -3.233  1.00 0.00 ? 20 ARG A H    6  
ATOM 6045  H HA   . ARG A 1 20 ? -3.895  3.106   -5.642  1.00 0.00 ? 20 ARG A HA   6  
ATOM 6046  H HB2  . ARG A 1 20 ? -4.314  5.698   -5.035  1.00 0.00 ? 20 ARG A HB2  6  
ATOM 6047  H HB3  . ARG A 1 20 ? -2.613  5.772   -5.478  1.00 0.00 ? 20 ARG A HB3  6  
ATOM 6048  H HG2  . ARG A 1 20 ? -3.076  4.904   -7.658  1.00 0.00 ? 20 ARG A HG2  6  
ATOM 6049  H HG3  . ARG A 1 20 ? -4.756  4.584   -7.224  1.00 0.00 ? 20 ARG A HG3  6  
ATOM 6050  H HD2  . ARG A 1 20 ? -5.296  6.860   -7.175  1.00 0.00 ? 20 ARG A HD2  6  
ATOM 6051  H HD3  . ARG A 1 20 ? -3.605  7.349   -7.077  1.00 0.00 ? 20 ARG A HD3  6  
ATOM 6052  H HE   . ARG A 1 20 ? -4.269  5.966   -9.507  1.00 0.00 ? 20 ARG A HE   6  
ATOM 6053  H HH11 . ARG A 1 20 ? -4.195  9.052   -7.897  1.00 0.00 ? 20 ARG A HH11 6  
ATOM 6054  H HH12 . ARG A 1 20 ? -4.123  9.964   -9.368  1.00 0.00 ? 20 ARG A HH12 6  
ATOM 6055  H HH21 . ARG A 1 20 ? -4.174  7.156   -11.450 1.00 0.00 ? 20 ARG A HH21 6  
ATOM 6056  H HH22 . ARG A 1 20 ? -4.112  8.885   -11.389 1.00 0.00 ? 20 ARG A HH22 6  
ATOM 6057  N N    . GLU A 1 21 ? -1.095  3.769   -4.087  1.00 0.00 ? 21 GLU A N    6  
ATOM 6058  C CA   . GLU A 1 21 ? 0.330   3.467   -4.042  1.00 0.00 ? 21 GLU A CA   6  
ATOM 6059  C C    . GLU A 1 21 ? 0.574   2.078   -3.458  1.00 0.00 ? 21 GLU A C    6  
ATOM 6060  O O    . GLU A 1 21 ? 1.468   1.355   -3.898  1.00 0.00 ? 21 GLU A O    6  
ATOM 6061  C CB   . GLU A 1 21 ? 1.072   4.518   -3.213  1.00 0.00 ? 21 GLU A CB   6  
ATOM 6062  C CG   . GLU A 1 21 ? 0.762   5.947   -3.625  1.00 0.00 ? 21 GLU A CG   6  
ATOM 6063  C CD   . GLU A 1 21 ? -0.396  6.540   -2.846  1.00 0.00 ? 21 GLU A CD   6  
ATOM 6064  O OE1  . GLU A 1 21 ? -1.104  5.773   -2.160  1.00 0.00 ? 21 GLU A OE1  6  
ATOM 6065  O OE2  . GLU A 1 21 ? -0.594  7.771   -2.922  1.00 0.00 ? 21 GLU A OE2  6  
ATOM 6066  H H    . GLU A 1 21 ? -1.509  4.239   -3.333  1.00 0.00 ? 21 GLU A H    6  
ATOM 6067  H HA   . GLU A 1 21 ? 0.706   3.489   -5.054  1.00 0.00 ? 21 GLU A HA   6  
ATOM 6068  H HB2  . GLU A 1 21 ? 0.800   4.397   -2.175  1.00 0.00 ? 21 GLU A HB2  6  
ATOM 6069  H HB3  . GLU A 1 21 ? 2.134   4.357   -3.319  1.00 0.00 ? 21 GLU A HB3  6  
ATOM 6070  H HG2  . GLU A 1 21 ? 1.638   6.555   -3.456  1.00 0.00 ? 21 GLU A HG2  6  
ATOM 6071  H HG3  . GLU A 1 21 ? 0.513   5.960   -4.676  1.00 0.00 ? 21 GLU A HG3  6  
ATOM 6072  N N    . LEU A 1 22 ? -0.229  1.712   -2.464  1.00 0.00 ? 22 LEU A N    6  
ATOM 6073  C CA   . LEU A 1 22 ? -0.102  0.410   -1.818  1.00 0.00 ? 22 LEU A CA   6  
ATOM 6074  C C    . LEU A 1 22 ? -0.450  -0.715  -2.787  1.00 0.00 ? 22 LEU A C    6  
ATOM 6075  O O    . LEU A 1 22 ? 0.264   -1.713  -2.877  1.00 0.00 ? 22 LEU A O    6  
ATOM 6076  C CB   . LEU A 1 22 ? -1.008  0.339   -0.588  1.00 0.00 ? 22 LEU A CB   6  
ATOM 6077  C CG   . LEU A 1 22 ? -0.691  1.325   0.537   1.00 0.00 ? 22 LEU A CG   6  
ATOM 6078  C CD1  . LEU A 1 22 ? -1.864  1.433   1.498   1.00 0.00 ? 22 LEU A CD1  6  
ATOM 6079  C CD2  . LEU A 1 22 ? 0.570   0.902   1.278   1.00 0.00 ? 22 LEU A CD2  6  
ATOM 6080  H H    . LEU A 1 22 ? -0.923  2.331   -2.157  1.00 0.00 ? 22 LEU A H    6  
ATOM 6081  H HA   . LEU A 1 22 ? 0.926   0.295   -1.506  1.00 0.00 ? 22 LEU A HA   6  
ATOM 6082  H HB2  . LEU A 1 22 ? -2.021  0.523   -0.912  1.00 0.00 ? 22 LEU A HB2  6  
ATOM 6083  H HB3  . LEU A 1 22 ? -0.937  -0.661  -0.183  1.00 0.00 ? 22 LEU A HB3  6  
ATOM 6084  H HG   . LEU A 1 22 ? -0.517  2.304   0.112   1.00 0.00 ? 22 LEU A HG   6  
ATOM 6085  H HD11 . LEU A 1 22 ? -1.506  1.361   2.514   1.00 0.00 ? 22 LEU A HD11 6  
ATOM 6086  H HD12 . LEU A 1 22 ? -2.563  0.633   1.305   1.00 0.00 ? 22 LEU A HD12 6  
ATOM 6087  H HD13 . LEU A 1 22 ? -2.358  2.384   1.357   1.00 0.00 ? 22 LEU A HD13 6  
ATOM 6088  H HD21 . LEU A 1 22 ? 0.373   -0.002  1.835   1.00 0.00 ? 22 LEU A HD21 6  
ATOM 6089  H HD22 . LEU A 1 22 ? 0.868   1.686   1.958   1.00 0.00 ? 22 LEU A HD22 6  
ATOM 6090  H HD23 . LEU A 1 22 ? 1.361   0.721   0.566   1.00 0.00 ? 22 LEU A HD23 6  
ATOM 6091  N N    . GLU A 1 23 ? -1.552  -0.545  -3.511  1.00 0.00 ? 23 GLU A N    6  
ATOM 6092  C CA   . GLU A 1 23 ? -1.995  -1.546  -4.474  1.00 0.00 ? 23 GLU A CA   6  
ATOM 6093  C C    . GLU A 1 23 ? -0.983  -1.695  -5.607  1.00 0.00 ? 23 GLU A C    6  
ATOM 6094  O O    . GLU A 1 23 ? -0.663  -2.808  -6.026  1.00 0.00 ? 23 GLU A O    6  
ATOM 6095  C CB   . GLU A 1 23 ? -3.363  -1.169  -5.044  1.00 0.00 ? 23 GLU A CB   6  
ATOM 6096  C CG   . GLU A 1 23 ? -4.497  -1.294  -4.040  1.00 0.00 ? 23 GLU A CG   6  
ATOM 6097  C CD   . GLU A 1 23 ? -5.789  -0.678  -4.539  1.00 0.00 ? 23 GLU A CD   6  
ATOM 6098  O OE1  . GLU A 1 23 ? -5.727  0.395   -5.174  1.00 0.00 ? 23 GLU A OE1  6  
ATOM 6099  O OE2  . GLU A 1 23 ? -6.862  -1.268  -4.293  1.00 0.00 ? 23 GLU A OE2  6  
ATOM 6100  H H    . GLU A 1 23 ? -2.080  0.272   -3.394  1.00 0.00 ? 23 GLU A H    6  
ATOM 6101  H HA   . GLU A 1 23 ? -2.079  -2.490  -3.957  1.00 0.00 ? 23 GLU A HA   6  
ATOM 6102  H HB2  . GLU A 1 23 ? -3.327  -0.146  -5.389  1.00 0.00 ? 23 GLU A HB2  6  
ATOM 6103  H HB3  . GLU A 1 23 ? -3.581  -1.814  -5.883  1.00 0.00 ? 23 GLU A HB3  6  
ATOM 6104  H HG2  . GLU A 1 23 ? -4.669  -2.341  -3.840  1.00 0.00 ? 23 GLU A HG2  6  
ATOM 6105  H HG3  . GLU A 1 23 ? -4.207  -0.797  -3.126  1.00 0.00 ? 23 GLU A HG3  6  
ATOM 6106  N N    . ARG A 1 24 ? -0.484  -0.566  -6.099  1.00 0.00 ? 24 ARG A N    6  
ATOM 6107  C CA   . ARG A 1 24 ? 0.489   -0.570  -7.185  1.00 0.00 ? 24 ARG A CA   6  
ATOM 6108  C C    . ARG A 1 24 ? 1.758   -1.312  -6.775  1.00 0.00 ? 24 ARG A C    6  
ATOM 6109  O O    . ARG A 1 24 ? 2.134   -2.306  -7.394  1.00 0.00 ? 24 ARG A O    6  
ATOM 6110  C CB   . ARG A 1 24 ? 0.833   0.863   -7.595  1.00 0.00 ? 24 ARG A CB   6  
ATOM 6111  C CG   . ARG A 1 24 ? -0.064  1.415   -8.691  1.00 0.00 ? 24 ARG A CG   6  
ATOM 6112  C CD   . ARG A 1 24 ? 0.617   2.540   -9.454  1.00 0.00 ? 24 ARG A CD   6  
ATOM 6113  N NE   . ARG A 1 24 ? 1.480   2.035   -10.519 1.00 0.00 ? 24 ARG A NE   6  
ATOM 6114  C CZ   . ARG A 1 24 ? 2.084   2.816   -11.407 1.00 0.00 ? 24 ARG A CZ   6  
ATOM 6115  N NH1  . ARG A 1 24 ? 1.922   4.131   -11.358 1.00 0.00 ? 24 ARG A NH1  6  
ATOM 6116  N NH2  . ARG A 1 24 ? 2.854   2.282   -12.347 1.00 0.00 ? 24 ARG A NH2  6  
ATOM 6117  H H    . ARG A 1 24 ? -0.778  0.290   -5.724  1.00 0.00 ? 24 ARG A H    6  
ATOM 6118  H HA   . ARG A 1 24 ? 0.045   -1.079  -8.027  1.00 0.00 ? 24 ARG A HA   6  
ATOM 6119  H HB2  . ARG A 1 24 ? 0.744   1.504   -6.730  1.00 0.00 ? 24 ARG A HB2  6  
ATOM 6120  H HB3  . ARG A 1 24 ? 1.853   0.888   -7.948  1.00 0.00 ? 24 ARG A HB3  6  
ATOM 6121  H HG2  . ARG A 1 24 ? -0.304  0.620   -9.381  1.00 0.00 ? 24 ARG A HG2  6  
ATOM 6122  H HG3  . ARG A 1 24 ? -0.971  1.792   -8.244  1.00 0.00 ? 24 ARG A HG3  6  
ATOM 6123  H HD2  . ARG A 1 24 ? -0.142  3.173   -9.889  1.00 0.00 ? 24 ARG A HD2  6  
ATOM 6124  H HD3  . ARG A 1 24 ? 1.214   3.116   -8.763  1.00 0.00 ? 24 ARG A HD3  6  
ATOM 6125  H HE   . ARG A 1 24 ? 1.614   1.066   -10.574 1.00 0.00 ? 24 ARG A HE   6  
ATOM 6126  H HH11 . ARG A 1 24 ? 1.344   4.536   -10.651 1.00 0.00 ? 24 ARG A HH11 6  
ATOM 6127  H HH12 . ARG A 1 24 ? 2.380   4.717   -12.028 1.00 0.00 ? 24 ARG A HH12 6  
ATOM 6128  H HH21 . ARG A 1 24 ? 2.979   1.291   -12.387 1.00 0.00 ? 24 ARG A HH21 6  
ATOM 6129  H HH22 . ARG A 1 24 ? 3.309   2.870   -13.015 1.00 0.00 ? 24 ARG A HH22 6  
ATOM 6130  N N    . GLU A 1 25 ? 2.412   -0.820  -5.727  1.00 0.00 ? 25 GLU A N    6  
ATOM 6131  C CA   . GLU A 1 25 ? 3.639   -1.436  -5.235  1.00 0.00 ? 25 GLU A CA   6  
ATOM 6132  C C    . GLU A 1 25 ? 3.430   -2.923  -4.964  1.00 0.00 ? 25 GLU A C    6  
ATOM 6133  O O    . GLU A 1 25 ? 4.321   -3.740  -5.200  1.00 0.00 ? 25 GLU A O    6  
ATOM 6134  C CB   . GLU A 1 25 ? 4.113   -0.735  -3.961  1.00 0.00 ? 25 GLU A CB   6  
ATOM 6135  C CG   . GLU A 1 25 ? 5.030   0.447   -4.222  1.00 0.00 ? 25 GLU A CG   6  
ATOM 6136  C CD   . GLU A 1 25 ? 4.555   1.311   -5.374  1.00 0.00 ? 25 GLU A CD   6  
ATOM 6137  O OE1  . GLU A 1 25 ? 4.796   0.931   -6.539  1.00 0.00 ? 25 GLU A OE1  6  
ATOM 6138  O OE2  . GLU A 1 25 ? 3.943   2.367   -5.110  1.00 0.00 ? 25 GLU A OE2  6  
ATOM 6139  H H    . GLU A 1 25 ? 2.062   -0.025  -5.274  1.00 0.00 ? 25 GLU A H    6  
ATOM 6140  H HA   . GLU A 1 25 ? 4.394   -1.325  -5.998  1.00 0.00 ? 25 GLU A HA   6  
ATOM 6141  H HB2  . GLU A 1 25 ? 3.250   -0.382  -3.416  1.00 0.00 ? 25 GLU A HB2  6  
ATOM 6142  H HB3  . GLU A 1 25 ? 4.645   -1.449  -3.349  1.00 0.00 ? 25 GLU A HB3  6  
ATOM 6143  H HG2  . GLU A 1 25 ? 5.074   1.056   -3.331  1.00 0.00 ? 25 GLU A HG2  6  
ATOM 6144  H HG3  . GLU A 1 25 ? 6.018   0.076   -4.452  1.00 0.00 ? 25 GLU A HG3  6  
ATOM 6145  N N    . TYR A 1 26 ? 2.248   -3.267  -4.465  1.00 0.00 ? 26 TYR A N    6  
ATOM 6146  C CA   . TYR A 1 26 ? 1.922   -4.655  -4.158  1.00 0.00 ? 26 TYR A CA   6  
ATOM 6147  C C    . TYR A 1 26 ? 1.898   -5.502  -5.426  1.00 0.00 ? 26 TYR A C    6  
ATOM 6148  O O    . TYR A 1 26 ? 2.496   -6.577  -5.479  1.00 0.00 ? 26 TYR A O    6  
ATOM 6149  C CB   . TYR A 1 26 ? 0.569   -4.738  -3.450  1.00 0.00 ? 26 TYR A CB   6  
ATOM 6150  C CG   . TYR A 1 26 ? 0.062   -6.152  -3.278  1.00 0.00 ? 26 TYR A CG   6  
ATOM 6151  C CD1  . TYR A 1 26 ? 0.785   -7.086  -2.546  1.00 0.00 ? 26 TYR A CD1  6  
ATOM 6152  C CD2  . TYR A 1 26 ? -1.140  -6.555  -3.847  1.00 0.00 ? 26 TYR A CD2  6  
ATOM 6153  C CE1  . TYR A 1 26 ? 0.326   -8.379  -2.387  1.00 0.00 ? 26 TYR A CE1  6  
ATOM 6154  C CE2  . TYR A 1 26 ? -1.607  -7.845  -3.692  1.00 0.00 ? 26 TYR A CE2  6  
ATOM 6155  C CZ   . TYR A 1 26 ? -0.871  -8.754  -2.961  1.00 0.00 ? 26 TYR A CZ   6  
ATOM 6156  O OH   . TYR A 1 26 ? -1.332  -10.041 -2.805  1.00 0.00 ? 26 TYR A OH   6  
ATOM 6157  H H    . TYR A 1 26 ? 1.578   -2.571  -4.298  1.00 0.00 ? 26 TYR A H    6  
ATOM 6158  H HA   . TYR A 1 26 ? 2.687   -5.037  -3.498  1.00 0.00 ? 26 TYR A HA   6  
ATOM 6159  H HB2  . TYR A 1 26 ? 0.655   -4.296  -2.470  1.00 0.00 ? 26 TYR A HB2  6  
ATOM 6160  H HB3  . TYR A 1 26 ? -0.164  -4.190  -4.024  1.00 0.00 ? 26 TYR A HB3  6  
ATOM 6161  H HD1  . TYR A 1 26 ? 1.722   -6.790  -2.098  1.00 0.00 ? 26 TYR A HD1  6  
ATOM 6162  H HD2  . TYR A 1 26 ? -1.714  -5.840  -4.420  1.00 0.00 ? 26 TYR A HD2  6  
ATOM 6163  H HE1  . TYR A 1 26 ? 0.903   -9.091  -1.814  1.00 0.00 ? 26 TYR A HE1  6  
ATOM 6164  H HE2  . TYR A 1 26 ? -2.544  -8.139  -4.142  1.00 0.00 ? 26 TYR A HE2  6  
ATOM 6165  H HH   . TYR A 1 26 ? -2.288  -10.029 -2.715  1.00 0.00 ? 26 TYR A HH   6  
ATOM 6166  N N    . ALA A 1 27 ? 1.204   -5.010  -6.446  1.00 0.00 ? 27 ALA A N    6  
ATOM 6167  C CA   . ALA A 1 27 ? 1.103   -5.719  -7.716  1.00 0.00 ? 27 ALA A CA   6  
ATOM 6168  C C    . ALA A 1 27 ? 2.466   -5.831  -8.392  1.00 0.00 ? 27 ALA A C    6  
ATOM 6169  O O    . ALA A 1 27 ? 2.721   -6.772  -9.143  1.00 0.00 ? 27 ALA A O    6  
ATOM 6170  C CB   . ALA A 1 27 ? 0.112   -5.020  -8.634  1.00 0.00 ? 27 ALA A CB   6  
ATOM 6171  H H    . ALA A 1 27 ? 0.749   -4.148  -6.343  1.00 0.00 ? 27 ALA A H    6  
ATOM 6172  H HA   . ALA A 1 27 ? 0.730   -6.713  -7.514  1.00 0.00 ? 27 ALA A HA   6  
ATOM 6173  H HB1  . ALA A 1 27 ? 0.645   -4.563  -9.456  1.00 0.00 ? 27 ALA A HB1  6  
ATOM 6174  H HB2  . ALA A 1 27 ? -0.593  -5.741  -9.019  1.00 0.00 ? 27 ALA A HB2  6  
ATOM 6175  H HB3  . ALA A 1 27 ? -0.416  -4.259  -8.080  1.00 0.00 ? 27 ALA A HB3  6  
ATOM 6176  N N    . ALA A 1 28 ? 3.337   -4.865  -8.120  1.00 0.00 ? 28 ALA A N    6  
ATOM 6177  C CA   . ALA A 1 28 ? 4.674   -4.856  -8.701  1.00 0.00 ? 28 ALA A CA   6  
ATOM 6178  C C    . ALA A 1 28 ? 5.614   -5.774  -7.927  1.00 0.00 ? 28 ALA A C    6  
ATOM 6179  O O    . ALA A 1 28 ? 6.553   -6.334  -8.492  1.00 0.00 ? 28 ALA A O    6  
ATOM 6180  C CB   . ALA A 1 28 ? 5.225   -3.438  -8.734  1.00 0.00 ? 28 ALA A CB   6  
ATOM 6181  H H    . ALA A 1 28 ? 3.074   -4.142  -7.513  1.00 0.00 ? 28 ALA A H    6  
ATOM 6182  H HA   . ALA A 1 28 ? 4.598   -5.210  -9.719  1.00 0.00 ? 28 ALA A HA   6  
ATOM 6183  H HB1  . ALA A 1 28 ? 4.932   -2.961  -9.657  1.00 0.00 ? 28 ALA A HB1  6  
ATOM 6184  H HB2  . ALA A 1 28 ? 4.831   -2.879  -7.898  1.00 0.00 ? 28 ALA A HB2  6  
ATOM 6185  H HB3  . ALA A 1 28 ? 6.303   -3.470  -8.670  1.00 0.00 ? 28 ALA A HB3  6  
ATOM 6186  N N    . ASN A 1 29 ? 5.356   -5.922  -6.632  1.00 0.00 ? 29 ASN A N    6  
ATOM 6187  C CA   . ASN A 1 29 ? 6.181   -6.772  -5.781  1.00 0.00 ? 29 ASN A CA   6  
ATOM 6188  C C    . ASN A 1 29 ? 5.485   -7.052  -4.453  1.00 0.00 ? 29 ASN A C    6  
ATOM 6189  O O    . ASN A 1 29 ? 5.244   -6.140  -3.661  1.00 0.00 ? 29 ASN A O    6  
ATOM 6190  C CB   . ASN A 1 29 ? 7.538   -6.112  -5.528  1.00 0.00 ? 29 ASN A CB   6  
ATOM 6191  C CG   . ASN A 1 29 ? 7.404   -4.712  -4.960  1.00 0.00 ? 29 ASN A CG   6  
ATOM 6192  O OD1  . ASN A 1 29 ? 7.573   -4.499  -3.759  1.00 0.00 ? 29 ASN A OD1  6  
ATOM 6193  N ND2  . ASN A 1 29 ? 7.098   -3.750  -5.822  1.00 0.00 ? 29 ASN A ND2  6  
ATOM 6194  H H    . ASN A 1 29 ? 4.593   -5.450  -6.239  1.00 0.00 ? 29 ASN A H    6  
ATOM 6195  H HA   . ASN A 1 29 ? 6.336   -7.707  -6.297  1.00 0.00 ? 29 ASN A HA   6  
ATOM 6196  H HB2  . ASN A 1 29 ? 8.099   -6.712  -4.827  1.00 0.00 ? 29 ASN A HB2  6  
ATOM 6197  H HB3  . ASN A 1 29 ? 8.082   -6.052  -6.459  1.00 0.00 ? 29 ASN A HB3  6  
ATOM 6198  H HD21 . ASN A 1 29 ? 6.978   -3.994  -6.764  1.00 0.00 ? 29 ASN A HD21 6  
ATOM 6199  H HD22 . ASN A 1 29 ? 7.006   -2.836  -5.482  1.00 0.00 ? 29 ASN A HD22 6  
ATOM 6200  N N    . LYS A 1 30 ? 5.164   -8.319  -4.215  1.00 0.00 ? 30 LYS A N    6  
ATOM 6201  C CA   . LYS A 1 30 ? 4.497   -8.721  -2.982  1.00 0.00 ? 30 LYS A CA   6  
ATOM 6202  C C    . LYS A 1 30 ? 5.289   -8.267  -1.761  1.00 0.00 ? 30 LYS A C    6  
ATOM 6203  O O    . LYS A 1 30 ? 4.724   -8.040  -0.691  1.00 0.00 ? 30 LYS A O    6  
ATOM 6204  C CB   . LYS A 1 30 ? 4.315   -10.241 -2.949  1.00 0.00 ? 30 LYS A CB   6  
ATOM 6205  C CG   . LYS A 1 30 ? 3.574   -10.791 -4.155  1.00 0.00 ? 30 LYS A CG   6  
ATOM 6206  C CD   . LYS A 1 30 ? 2.101   -10.420 -4.121  1.00 0.00 ? 30 LYS A CD   6  
ATOM 6207  C CE   . LYS A 1 30 ? 1.264   -11.383 -4.950  1.00 0.00 ? 30 LYS A CE   6  
ATOM 6208  N NZ   . LYS A 1 30 ? 1.009   -12.660 -4.227  1.00 0.00 ? 30 LYS A NZ   6  
ATOM 6209  H H    . LYS A 1 30 ? 5.382   -9.001  -4.885  1.00 0.00 ? 30 LYS A H    6  
ATOM 6210  H HA   . LYS A 1 30 ? 3.525   -8.251  -2.962  1.00 0.00 ? 30 LYS A HA   6  
ATOM 6211  H HB2  . LYS A 1 30 ? 5.289   -10.707 -2.907  1.00 0.00 ? 30 LYS A HB2  6  
ATOM 6212  H HB3  . LYS A 1 30 ? 3.760   -10.505 -2.060  1.00 0.00 ? 30 LYS A HB3  6  
ATOM 6213  H HG2  . LYS A 1 30 ? 4.015   -10.386 -5.054  1.00 0.00 ? 30 LYS A HG2  6  
ATOM 6214  H HG3  . LYS A 1 30 ? 3.664   -11.868 -4.161  1.00 0.00 ? 30 LYS A HG3  6  
ATOM 6215  H HD2  . LYS A 1 30 ? 1.754   -10.449 -3.099  1.00 0.00 ? 30 LYS A HD2  6  
ATOM 6216  H HD3  . LYS A 1 30 ? 1.981   -9.421  -4.516  1.00 0.00 ? 30 LYS A HD3  6  
ATOM 6217  H HE2  . LYS A 1 30 ? 0.320   -10.914 -5.179  1.00 0.00 ? 30 LYS A HE2  6  
ATOM 6218  H HE3  . LYS A 1 30 ? 1.791   -11.598 -5.868  1.00 0.00 ? 30 LYS A HE3  6  
ATOM 6219  H HZ1  . LYS A 1 30 ? 1.354   -12.591 -3.249  1.00 0.00 ? 30 LYS A HZ1  6  
ATOM 6220  H HZ2  . LYS A 1 30 ? 1.500   -13.444 -4.702  1.00 0.00 ? 30 LYS A HZ2  6  
ATOM 6221  H HZ3  . LYS A 1 30 ? -0.011  -12.863 -4.211  1.00 0.00 ? 30 LYS A HZ3  6  
ATOM 6222  N N    . PHE A 1 31 ? 6.601   -8.134  -1.928  1.00 0.00 ? 31 PHE A N    6  
ATOM 6223  C CA   . PHE A 1 31 ? 7.471   -7.705  -0.839  1.00 0.00 ? 31 PHE A CA   6  
ATOM 6224  C C    . PHE A 1 31 ? 8.304   -6.495  -1.253  1.00 0.00 ? 31 PHE A C    6  
ATOM 6225  O O    . PHE A 1 31 ? 9.134   -6.580  -2.158  1.00 0.00 ? 31 PHE A O    6  
ATOM 6226  C CB   . PHE A 1 31 ? 8.391   -8.851  -0.413  1.00 0.00 ? 31 PHE A CB   6  
ATOM 6227  C CG   . PHE A 1 31 ? 7.652   -10.076 0.043   1.00 0.00 ? 31 PHE A CG   6  
ATOM 6228  C CD1  . PHE A 1 31 ? 7.156   -10.162 1.334   1.00 0.00 ? 31 PHE A CD1  6  
ATOM 6229  C CD2  . PHE A 1 31 ? 7.452   -11.142 -0.820  1.00 0.00 ? 31 PHE A CD2  6  
ATOM 6230  C CE1  . PHE A 1 31 ? 6.476   -11.289 1.756   1.00 0.00 ? 31 PHE A CE1  6  
ATOM 6231  C CE2  . PHE A 1 31 ? 6.773   -12.271 -0.403  1.00 0.00 ? 31 PHE A CE2  6  
ATOM 6232  C CZ   . PHE A 1 31 ? 6.283   -12.344 0.886   1.00 0.00 ? 31 PHE A CZ   6  
ATOM 6233  H H    . PHE A 1 31 ? 6.993   -8.329  -2.805  1.00 0.00 ? 31 PHE A H    6  
ATOM 6234  H HA   . PHE A 1 31 ? 6.845   -7.428  -0.005  1.00 0.00 ? 31 PHE A HA   6  
ATOM 6235  H HB2  . PHE A 1 31 ? 9.015   -9.132  -1.248  1.00 0.00 ? 31 PHE A HB2  6  
ATOM 6236  H HB3  . PHE A 1 31 ? 9.016   -8.516  0.401   1.00 0.00 ? 31 PHE A HB3  6  
ATOM 6237  H HD1  . PHE A 1 31 ? 7.305   -9.337  2.015   1.00 0.00 ? 31 PHE A HD1  6  
ATOM 6238  H HD2  . PHE A 1 31 ? 7.835   -11.085 -1.829  1.00 0.00 ? 31 PHE A HD2  6  
ATOM 6239  H HE1  . PHE A 1 31 ? 6.094   -11.343 2.764   1.00 0.00 ? 31 PHE A HE1  6  
ATOM 6240  H HE2  . PHE A 1 31 ? 6.624   -13.094 -1.087  1.00 0.00 ? 31 PHE A HE2  6  
ATOM 6241  H HZ   . PHE A 1 31 ? 5.752   -13.225 1.213   1.00 0.00 ? 31 PHE A HZ   6  
ATOM 6242  N N    . ILE A 1 32 ? 8.075   -5.371  -0.583  1.00 0.00 ? 32 ILE A N    6  
ATOM 6243  C CA   . ILE A 1 32 ? 8.804   -4.144  -0.880  1.00 0.00 ? 32 ILE A CA   6  
ATOM 6244  C C    . ILE A 1 32 ? 10.131  -4.098  -0.130  1.00 0.00 ? 32 ILE A C    6  
ATOM 6245  O O    . ILE A 1 32 ? 10.437  -4.983  0.670   1.00 0.00 ? 32 ILE A O    6  
ATOM 6246  C CB   . ILE A 1 32 ? 7.978   -2.896  -0.515  1.00 0.00 ? 32 ILE A CB   6  
ATOM 6247  C CG1  . ILE A 1 32 ? 7.780   -2.814  1.000   1.00 0.00 ? 32 ILE A CG1  6  
ATOM 6248  C CG2  . ILE A 1 32 ? 6.635   -2.922  -1.230  1.00 0.00 ? 32 ILE A CG2  6  
ATOM 6249  C CD1  . ILE A 1 32 ? 6.994   -1.599  1.442   1.00 0.00 ? 32 ILE A CD1  6  
ATOM 6250  H H    . ILE A 1 32 ? 7.401   -5.366  0.128   1.00 0.00 ? 32 ILE A H    6  
ATOM 6251  H HA   . ILE A 1 32 ? 9.001   -4.122  -1.942  1.00 0.00 ? 32 ILE A HA   6  
ATOM 6252  H HB   . ILE A 1 32 ? 8.519   -2.024  -0.848  1.00 0.00 ? 32 ILE A HB   6  
ATOM 6253  H HG12 . ILE A 1 32 ? 7.249   -3.691  1.335   1.00 0.00 ? 32 ILE A HG12 6  
ATOM 6254  H HG13 . ILE A 1 32 ? 8.747   -2.777  1.480   1.00 0.00 ? 32 ILE A HG13 6  
ATOM 6255  H HG21 . ILE A 1 32 ? 6.552   -3.832  -1.805  1.00 0.00 ? 32 ILE A HG21 6  
ATOM 6256  H HG22 . ILE A 1 32 ? 5.839   -2.884  -0.501  1.00 0.00 ? 32 ILE A HG22 6  
ATOM 6257  H HG23 . ILE A 1 32 ? 6.562   -2.071  -1.889  1.00 0.00 ? 32 ILE A HG23 6  
ATOM 6258  H HD11 . ILE A 1 32 ? 7.254   -0.756  0.819   1.00 0.00 ? 32 ILE A HD11 6  
ATOM 6259  H HD12 . ILE A 1 32 ? 5.937   -1.801  1.352   1.00 0.00 ? 32 ILE A HD12 6  
ATOM 6260  H HD13 . ILE A 1 32 ? 7.231   -1.372  2.471   1.00 0.00 ? 32 ILE A HD13 6  
ATOM 6261  N N    . THR A 1 33 ? 10.918  -3.059  -0.394  1.00 0.00 ? 33 THR A N    6  
ATOM 6262  C CA   . THR A 1 33 ? 12.212  -2.897  0.256   1.00 0.00 ? 33 THR A CA   6  
ATOM 6263  C C    . THR A 1 33 ? 12.189  -1.738  1.246   1.00 0.00 ? 33 THR A C    6  
ATOM 6264  O O    . THR A 1 33 ? 11.343  -0.848  1.158   1.00 0.00 ? 33 THR A O    6  
ATOM 6265  C CB   . THR A 1 33 ? 13.331  -2.653  -0.775  1.00 0.00 ? 33 THR A CB   6  
ATOM 6266  O OG1  . THR A 1 33 ? 14.535  -2.259  -0.107  1.00 0.00 ? 33 THR A OG1  6  
ATOM 6267  C CG2  . THR A 1 33 ? 12.924  -1.580  -1.772  1.00 0.00 ? 33 THR A CG2  6  
ATOM 6268  H H    . THR A 1 33 ? 10.619  -2.387  -1.041  1.00 0.00 ? 33 THR A H    6  
ATOM 6269  H HA   . THR A 1 33 ? 12.435  -3.809  0.789   1.00 0.00 ? 33 THR A HA   6  
ATOM 6270  H HB   . THR A 1 33 ? 13.511  -3.574  -1.312  1.00 0.00 ? 33 THR A HB   6  
ATOM 6271  H HG1  . THR A 1 33 ? 15.107  -3.024  -0.001  1.00 0.00 ? 33 THR A HG1  6  
ATOM 6272  H HG21 . THR A 1 33 ? 13.721  -0.857  -1.869  1.00 0.00 ? 33 THR A HG21 6  
ATOM 6273  H HG22 . THR A 1 33 ? 12.030  -1.085  -1.424  1.00 0.00 ? 33 THR A HG22 6  
ATOM 6274  H HG23 . THR A 1 33 ? 12.733  -2.035  -2.732  1.00 0.00 ? 33 THR A HG23 6  
ATOM 6275  N N    . LYS A 1 34 ? 13.124  -1.754  2.190   1.00 0.00 ? 34 LYS A N    6  
ATOM 6276  C CA   . LYS A 1 34 ? 13.213  -0.704  3.198   1.00 0.00 ? 34 LYS A CA   6  
ATOM 6277  C C    . LYS A 1 34 ? 13.230  0.675   2.546   1.00 0.00 ? 34 LYS A C    6  
ATOM 6278  O O    . LYS A 1 34 ? 12.721  1.645   3.109   1.00 0.00 ? 34 LYS A O    6  
ATOM 6279  C CB   . LYS A 1 34 ? 14.469  -0.892  4.051   1.00 0.00 ? 34 LYS A CB   6  
ATOM 6280  C CG   . LYS A 1 34 ? 14.222  -1.666  5.335   1.00 0.00 ? 34 LYS A CG   6  
ATOM 6281  C CD   . LYS A 1 34 ? 15.523  -1.979  6.056   1.00 0.00 ? 34 LYS A CD   6  
ATOM 6282  C CE   . LYS A 1 34 ? 16.245  -3.155  5.417   1.00 0.00 ? 34 LYS A CE   6  
ATOM 6283  N NZ   . LYS A 1 34 ? 15.728  -4.460  5.915   1.00 0.00 ? 34 LYS A NZ   6  
ATOM 6284  H H    . LYS A 1 34 ? 13.771  -2.491  2.209   1.00 0.00 ? 34 LYS A H    6  
ATOM 6285  H HA   . LYS A 1 34 ? 12.343  -0.778  3.832   1.00 0.00 ? 34 LYS A HA   6  
ATOM 6286  H HB2  . LYS A 1 34 ? 15.208  -1.425  3.470   1.00 0.00 ? 34 LYS A HB2  6  
ATOM 6287  H HB3  . LYS A 1 34 ? 14.862  0.080   4.311   1.00 0.00 ? 34 LYS A HB3  6  
ATOM 6288  H HG2  . LYS A 1 34 ? 13.596  -1.075  5.986   1.00 0.00 ? 34 LYS A HG2  6  
ATOM 6289  H HG3  . LYS A 1 34 ? 13.722  -2.593  5.095   1.00 0.00 ? 34 LYS A HG3  6  
ATOM 6290  H HD2  . LYS A 1 34 ? 16.165  -1.112  6.015   1.00 0.00 ? 34 LYS A HD2  6  
ATOM 6291  H HD3  . LYS A 1 34 ? 15.304  -2.218  7.087   1.00 0.00 ? 34 LYS A HD3  6  
ATOM 6292  H HE2  . LYS A 1 34 ? 16.107  -3.108  4.348   1.00 0.00 ? 34 LYS A HE2  6  
ATOM 6293  H HE3  . LYS A 1 34 ? 17.298  -3.083  5.648   1.00 0.00 ? 34 LYS A HE3  6  
ATOM 6294  H HZ1  . LYS A 1 34 ? 15.799  -5.181  5.168   1.00 0.00 ? 34 LYS A HZ1  6  
ATOM 6295  H HZ2  . LYS A 1 34 ? 14.731  -4.365  6.196   1.00 0.00 ? 34 LYS A HZ2  6  
ATOM 6296  H HZ3  . LYS A 1 34 ? 16.281  -4.773  6.738   1.00 0.00 ? 34 LYS A HZ3  6  
ATOM 6297  N N    . ASP A 1 35 ? 13.816  0.755   1.357   1.00 0.00 ? 35 ASP A N    6  
ATOM 6298  C CA   . ASP A 1 35 ? 13.897  2.015   0.627   1.00 0.00 ? 35 ASP A CA   6  
ATOM 6299  C C    . ASP A 1 35 ? 12.531  2.414   0.078   1.00 0.00 ? 35 ASP A C    6  
ATOM 6300  O O    . ASP A 1 35 ? 12.187  3.595   0.037   1.00 0.00 ? 35 ASP A O    6  
ATOM 6301  C CB   . ASP A 1 35 ? 14.907  1.903   -0.516  1.00 0.00 ? 35 ASP A CB   6  
ATOM 6302  C CG   . ASP A 1 35 ? 15.522  3.241   -0.878  1.00 0.00 ? 35 ASP A CG   6  
ATOM 6303  O OD1  . ASP A 1 35 ? 14.801  4.259   -0.825  1.00 0.00 ? 35 ASP A OD1  6  
ATOM 6304  O OD2  . ASP A 1 35 ? 16.725  3.269   -1.216  1.00 0.00 ? 35 ASP A OD2  6  
ATOM 6305  H H    . ASP A 1 35 ? 14.204  -0.053  0.960   1.00 0.00 ? 35 ASP A H    6  
ATOM 6306  H HA   . ASP A 1 35 ? 14.230  2.776   1.316   1.00 0.00 ? 35 ASP A HA   6  
ATOM 6307  H HB2  . ASP A 1 35 ? 15.700  1.231   -0.223  1.00 0.00 ? 35 ASP A HB2  6  
ATOM 6308  H HB3  . ASP A 1 35 ? 14.410  1.508   -1.390  1.00 0.00 ? 35 ASP A HB3  6  
ATOM 6309  N N    . LYS A 1 36 ? 11.755  1.421   -0.343  1.00 0.00 ? 36 LYS A N    6  
ATOM 6310  C CA   . LYS A 1 36 ? 10.426  1.666   -0.889  1.00 0.00 ? 36 LYS A CA   6  
ATOM 6311  C C    . LYS A 1 36 ? 9.438   2.016   0.219   1.00 0.00 ? 36 LYS A C    6  
ATOM 6312  O O    . LYS A 1 36 ? 8.652   2.954   0.090   1.00 0.00 ? 36 LYS A O    6  
ATOM 6313  C CB   . LYS A 1 36 ? 9.933   0.438   -1.658  1.00 0.00 ? 36 LYS A CB   6  
ATOM 6314  C CG   . LYS A 1 36 ? 8.475   0.525   -2.073  1.00 0.00 ? 36 LYS A CG   6  
ATOM 6315  C CD   . LYS A 1 36 ? 8.237   1.674   -3.038  1.00 0.00 ? 36 LYS A CD   6  
ATOM 6316  C CE   . LYS A 1 36 ? 8.743   1.343   -4.434  1.00 0.00 ? 36 LYS A CE   6  
ATOM 6317  N NZ   . LYS A 1 36 ? 10.173  1.718   -4.609  1.00 0.00 ? 36 LYS A NZ   6  
ATOM 6318  H H    . LYS A 1 36 ? 12.085  0.499   -0.284  1.00 0.00 ? 36 LYS A H    6  
ATOM 6319  H HA   . LYS A 1 36 ? 10.496  2.502   -1.569  1.00 0.00 ? 36 LYS A HA   6  
ATOM 6320  H HB2  . LYS A 1 36 ? 10.533  0.321   -2.548  1.00 0.00 ? 36 LYS A HB2  6  
ATOM 6321  H HB3  . LYS A 1 36 ? 10.056  -0.435  -1.034  1.00 0.00 ? 36 LYS A HB3  6  
ATOM 6322  H HG2  . LYS A 1 36 ? 8.191   -0.399  -2.554  1.00 0.00 ? 36 LYS A HG2  6  
ATOM 6323  H HG3  . LYS A 1 36 ? 7.867   0.676   -1.191  1.00 0.00 ? 36 LYS A HG3  6  
ATOM 6324  H HD2  . LYS A 1 36 ? 7.178   1.877   -3.090  1.00 0.00 ? 36 LYS A HD2  6  
ATOM 6325  H HD3  . LYS A 1 36 ? 8.756   2.551   -2.675  1.00 0.00 ? 36 LYS A HD3  6  
ATOM 6326  H HE2  . LYS A 1 36 ? 8.635   0.283   -4.599  1.00 0.00 ? 36 LYS A HE2  6  
ATOM 6327  H HE3  . LYS A 1 36 ? 8.147   1.883   -5.155  1.00 0.00 ? 36 LYS A HE3  6  
ATOM 6328  H HZ1  . LYS A 1 36 ? 10.275  2.374   -5.410  1.00 0.00 ? 36 LYS A HZ1  6  
ATOM 6329  H HZ2  . LYS A 1 36 ? 10.745  0.870   -4.796  1.00 0.00 ? 36 LYS A HZ2  6  
ATOM 6330  H HZ3  . LYS A 1 36 ? 10.530  2.181   -3.749  1.00 0.00 ? 36 LYS A HZ3  6  
ATOM 6331  N N    . ARG A 1 37 ? 9.485   1.256   1.308   1.00 0.00 ? 37 ARG A N    6  
ATOM 6332  C CA   . ARG A 1 37 ? 8.594   1.486   2.439   1.00 0.00 ? 37 ARG A CA   6  
ATOM 6333  C C    . ARG A 1 37 ? 8.651   2.943   2.888   1.00 0.00 ? 37 ARG A C    6  
ATOM 6334  O O    . ARG A 1 37 ? 7.666   3.488   3.388   1.00 0.00 ? 37 ARG A O    6  
ATOM 6335  C CB   . ARG A 1 37 ? 8.966   0.567   3.604   1.00 0.00 ? 37 ARG A CB   6  
ATOM 6336  C CG   . ARG A 1 37 ? 7.808   0.278   4.546   1.00 0.00 ? 37 ARG A CG   6  
ATOM 6337  C CD   . ARG A 1 37 ? 7.909   -1.119  5.139   1.00 0.00 ? 37 ARG A CD   6  
ATOM 6338  N NE   . ARG A 1 37 ? 9.243   -1.396  5.663   1.00 0.00 ? 37 ARG A NE   6  
ATOM 6339  C CZ   . ARG A 1 37 ? 9.711   -2.622  5.871   1.00 0.00 ? 37 ARG A CZ   6  
ATOM 6340  N NH1  . ARG A 1 37 ? 8.956   -3.678  5.600   1.00 0.00 ? 37 ARG A NH1  6  
ATOM 6341  N NH2  . ARG A 1 37 ? 10.936  -2.794  6.350   1.00 0.00 ? 37 ARG A NH2  6  
ATOM 6342  H H    . ARG A 1 37 ? 10.133  0.522   1.352   1.00 0.00 ? 37 ARG A H    6  
ATOM 6343  H HA   . ARG A 1 37 ? 7.588   1.259   2.121   1.00 0.00 ? 37 ARG A HA   6  
ATOM 6344  H HB2  . ARG A 1 37 ? 9.322   -0.372  3.207   1.00 0.00 ? 37 ARG A HB2  6  
ATOM 6345  H HB3  . ARG A 1 37 ? 9.758   1.031   4.174   1.00 0.00 ? 37 ARG A HB3  6  
ATOM 6346  H HG2  . ARG A 1 37 ? 7.820   1.000   5.349   1.00 0.00 ? 37 ARG A HG2  6  
ATOM 6347  H HG3  . ARG A 1 37 ? 6.882   0.361   3.998   1.00 0.00 ? 37 ARG A HG3  6  
ATOM 6348  H HD2  . ARG A 1 37 ? 7.192   -1.206  5.942   1.00 0.00 ? 37 ARG A HD2  6  
ATOM 6349  H HD3  . ARG A 1 37 ? 7.677   -1.839  4.370   1.00 0.00 ? 37 ARG A HD3  6  
ATOM 6350  H HE   . ARG A 1 37 ? 9.818   -0.630  5.870   1.00 0.00 ? 37 ARG A HE   6  
ATOM 6351  H HH11 . ARG A 1 37 ? 8.033   -3.551  5.238   1.00 0.00 ? 37 ARG A HH11 6  
ATOM 6352  H HH12 . ARG A 1 37 ? 9.311   -4.600  5.756   1.00 0.00 ? 37 ARG A HH12 6  
ATOM 6353  H HH21 . ARG A 1 37 ? 11.509  -2.000  6.555   1.00 0.00 ? 37 ARG A HH21 6  
ATOM 6354  H HH22 . ARG A 1 37 ? 11.287  -3.716  6.506   1.00 0.00 ? 37 ARG A HH22 6  
ATOM 6355  N N    . ARG A 1 38 ? 9.810   3.568   2.708   1.00 0.00 ? 38 ARG A N    6  
ATOM 6356  C CA   . ARG A 1 38 ? 9.996   4.961   3.096   1.00 0.00 ? 38 ARG A CA   6  
ATOM 6357  C C    . ARG A 1 38 ? 9.325   5.898   2.096   1.00 0.00 ? 38 ARG A C    6  
ATOM 6358  O O    . ARG A 1 38 ? 8.764   6.927   2.472   1.00 0.00 ? 38 ARG A O    6  
ATOM 6359  C CB   . ARG A 1 38 ? 11.487  5.289   3.199   1.00 0.00 ? 38 ARG A CB   6  
ATOM 6360  C CG   . ARG A 1 38 ? 12.182  4.607   4.365   1.00 0.00 ? 38 ARG A CG   6  
ATOM 6361  C CD   . ARG A 1 38 ? 13.689  4.798   4.305   1.00 0.00 ? 38 ARG A CD   6  
ATOM 6362  N NE   . ARG A 1 38 ? 14.317  4.612   5.610   1.00 0.00 ? 38 ARG A NE   6  
ATOM 6363  C CZ   . ARG A 1 38 ? 15.625  4.456   5.780   1.00 0.00 ? 38 ARG A CZ   6  
ATOM 6364  N NH1  . ARG A 1 38 ? 16.439  4.463   4.734   1.00 0.00 ? 38 ARG A NH1  6  
ATOM 6365  N NH2  . ARG A 1 38 ? 16.122  4.292   7.000   1.00 0.00 ? 38 ARG A NH2  6  
ATOM 6366  H H    . ARG A 1 38 ? 10.558  3.080   2.305   1.00 0.00 ? 38 ARG A H    6  
ATOM 6367  H HA   . ARG A 1 38 ? 9.538   5.099   4.064   1.00 0.00 ? 38 ARG A HA   6  
ATOM 6368  H HB2  . ARG A 1 38 ? 11.975  4.980   2.286   1.00 0.00 ? 38 ARG A HB2  6  
ATOM 6369  H HB3  . ARG A 1 38 ? 11.600  6.357   3.315   1.00 0.00 ? 38 ARG A HB3  6  
ATOM 6370  H HG2  . ARG A 1 38 ? 11.813  5.028   5.289   1.00 0.00 ? 38 ARG A HG2  6  
ATOM 6371  H HG3  . ARG A 1 38 ? 11.960  3.550   4.336   1.00 0.00 ? 38 ARG A HG3  6  
ATOM 6372  H HD2  . ARG A 1 38 ? 14.102  4.080   3.612   1.00 0.00 ? 38 ARG A HD2  6  
ATOM 6373  H HD3  . ARG A 1 38 ? 13.897  5.798   3.954   1.00 0.00 ? 38 ARG A HD3  6  
ATOM 6374  H HE   . ARG A 1 38 ? 13.734  4.603   6.397   1.00 0.00 ? 38 ARG A HE   6  
ATOM 6375  H HH11 . ARG A 1 38 ? 16.068  4.587   3.814   1.00 0.00 ? 38 ARG A HH11 6  
ATOM 6376  H HH12 . ARG A 1 38 ? 17.424  4.346   4.865   1.00 0.00 ? 38 ARG A HH12 6  
ATOM 6377  H HH21 . ARG A 1 38 ? 15.511  4.286   7.791   1.00 0.00 ? 38 ARG A HH21 6  
ATOM 6378  H HH22 . ARG A 1 38 ? 17.106  4.174   7.127   1.00 0.00 ? 38 ARG A HH22 6  
ATOM 6379  N N    . LYS A 1 39 ? 9.388   5.535   0.819   1.00 0.00 ? 39 LYS A N    6  
ATOM 6380  C CA   . LYS A 1 39 ? 8.787   6.342   -0.236  1.00 0.00 ? 39 LYS A CA   6  
ATOM 6381  C C    . LYS A 1 39 ? 7.264   6.293   -0.158  1.00 0.00 ? 39 LYS A C    6  
ATOM 6382  O O    . LYS A 1 39 ? 6.594   7.320   -0.270  1.00 0.00 ? 39 LYS A O    6  
ATOM 6383  C CB   . LYS A 1 39 ? 9.254   5.852   -1.609  1.00 0.00 ? 39 LYS A CB   6  
ATOM 6384  C CG   . LYS A 1 39 ? 10.760  5.909   -1.795  1.00 0.00 ? 39 LYS A CG   6  
ATOM 6385  C CD   . LYS A 1 39 ? 11.206  7.262   -2.324  1.00 0.00 ? 39 LYS A CD   6  
ATOM 6386  C CE   . LYS A 1 39 ? 11.055  7.347   -3.835  1.00 0.00 ? 39 LYS A CE   6  
ATOM 6387  N NZ   . LYS A 1 39 ? 10.982  8.757   -4.306  1.00 0.00 ? 39 LYS A NZ   6  
ATOM 6388  H H    . LYS A 1 39 ? 9.849   4.703   0.581   1.00 0.00 ? 39 LYS A H    6  
ATOM 6389  H HA   . LYS A 1 39 ? 9.109   7.363   -0.098  1.00 0.00 ? 39 LYS A HA   6  
ATOM 6390  H HB2  . LYS A 1 39 ? 8.934   4.830   -1.741  1.00 0.00 ? 39 LYS A HB2  6  
ATOM 6391  H HB3  . LYS A 1 39 ? 8.795   6.466   -2.371  1.00 0.00 ? 39 LYS A HB3  6  
ATOM 6392  H HG2  . LYS A 1 39 ? 11.238  5.731   -0.843  1.00 0.00 ? 39 LYS A HG2  6  
ATOM 6393  H HG3  . LYS A 1 39 ? 11.056  5.142   -2.497  1.00 0.00 ? 39 LYS A HG3  6  
ATOM 6394  H HD2  . LYS A 1 39 ? 10.604  8.033   -1.869  1.00 0.00 ? 39 LYS A HD2  6  
ATOM 6395  H HD3  . LYS A 1 39 ? 12.245  7.415   -2.066  1.00 0.00 ? 39 LYS A HD3  6  
ATOM 6396  H HE2  . LYS A 1 39 ? 11.903  6.865   -4.296  1.00 0.00 ? 39 LYS A HE2  6  
ATOM 6397  H HE3  . LYS A 1 39 ? 10.149  6.833   -4.122  1.00 0.00 ? 39 LYS A HE3  6  
ATOM 6398  H HZ1  . LYS A 1 39 ? 10.903  8.784   -5.343  1.00 0.00 ? 39 LYS A HZ1  6  
ATOM 6399  H HZ2  . LYS A 1 39 ? 11.839  9.274   -4.022  1.00 0.00 ? 39 LYS A HZ2  6  
ATOM 6400  H HZ3  . LYS A 1 39 ? 10.153  9.230   -3.894  1.00 0.00 ? 39 LYS A HZ3  6  
ATOM 6401  N N    . ILE A 1 40 ? 6.725   5.094   0.036   1.00 0.00 ? 40 ILE A N    6  
ATOM 6402  C CA   . ILE A 1 40 ? 5.281   4.912   0.131   1.00 0.00 ? 40 ILE A CA   6  
ATOM 6403  C C    . ILE A 1 40 ? 4.709   5.675   1.321   1.00 0.00 ? 40 ILE A C    6  
ATOM 6404  O O    . ILE A 1 40 ? 3.591   6.187   1.264   1.00 0.00 ? 40 ILE A O    6  
ATOM 6405  C CB   . ILE A 1 40 ? 4.909   3.424   0.262   1.00 0.00 ? 40 ILE A CB   6  
ATOM 6406  C CG1  . ILE A 1 40 ? 5.528   2.618   -0.881  1.00 0.00 ? 40 ILE A CG1  6  
ATOM 6407  C CG2  . ILE A 1 40 ? 3.396   3.256   0.277   1.00 0.00 ? 40 ILE A CG2  6  
ATOM 6408  C CD1  . ILE A 1 40 ? 5.342   1.124   -0.737  1.00 0.00 ? 40 ILE A CD1  6  
ATOM 6409  H H    . ILE A 1 40 ? 7.311   4.313   0.117   1.00 0.00 ? 40 ILE A H    6  
ATOM 6410  H HA   . ILE A 1 40 ? 4.837   5.296   -0.776  1.00 0.00 ? 40 ILE A HA   6  
ATOM 6411  H HB   . ILE A 1 40 ? 5.296   3.060   1.201   1.00 0.00 ? 40 ILE A HB   6  
ATOM 6412  H HG12 . ILE A 1 40 ? 5.076   2.919   -1.813  1.00 0.00 ? 40 ILE A HG12 6  
ATOM 6413  H HG13 . ILE A 1 40 ? 6.589   2.819   -0.919  1.00 0.00 ? 40 ILE A HG13 6  
ATOM 6414  H HG21 . ILE A 1 40 ? 2.971   3.747   -0.586  1.00 0.00 ? 40 ILE A HG21 6  
ATOM 6415  H HG22 . ILE A 1 40 ? 3.151   2.205   0.249   1.00 0.00 ? 40 ILE A HG22 6  
ATOM 6416  H HG23 . ILE A 1 40 ? 2.994   3.697   1.176   1.00 0.00 ? 40 ILE A HG23 6  
ATOM 6417  H HD11 . ILE A 1 40 ? 5.712   0.806   0.227   1.00 0.00 ? 40 ILE A HD11 6  
ATOM 6418  H HD12 . ILE A 1 40 ? 4.294   0.881   -0.820  1.00 0.00 ? 40 ILE A HD12 6  
ATOM 6419  H HD13 . ILE A 1 40 ? 5.892   0.616   -1.517  1.00 0.00 ? 40 ILE A HD13 6  
ATOM 6420  N N    . SER A 1 41 ? 5.484   5.748   2.398   1.00 0.00 ? 41 SER A N    6  
ATOM 6421  C CA   . SER A 1 41 ? 5.054   6.447   3.604   1.00 0.00 ? 41 SER A CA   6  
ATOM 6422  C C    . SER A 1 41 ? 5.014   7.954   3.373   1.00 0.00 ? 41 SER A C    6  
ATOM 6423  O O    . SER A 1 41 ? 4.267   8.675   4.034   1.00 0.00 ? 41 SER A O    6  
ATOM 6424  C CB   . SER A 1 41 ? 5.991   6.123   4.769   1.00 0.00 ? 41 SER A CB   6  
ATOM 6425  O OG   . SER A 1 41 ? 6.098   7.221   5.658   1.00 0.00 ? 41 SER A OG   6  
ATOM 6426  H H    . SER A 1 41 ? 6.366   5.319   2.383   1.00 0.00 ? 41 SER A H    6  
ATOM 6427  H HA   . SER A 1 41 ? 4.059   6.105   3.848   1.00 0.00 ? 41 SER A HA   6  
ATOM 6428  H HB2  . SER A 1 41 ? 5.607   5.272   5.311   1.00 0.00 ? 41 SER A HB2  6  
ATOM 6429  H HB3  . SER A 1 41 ? 6.973   5.890   4.383   1.00 0.00 ? 41 SER A HB3  6  
ATOM 6430  H HG   . SER A 1 41 ? 6.472   6.923   6.491   1.00 0.00 ? 41 SER A HG   6  
ATOM 6431  N N    . ALA A 1 42 ? 5.824   8.424   2.429   1.00 0.00 ? 42 ALA A N    6  
ATOM 6432  C CA   . ALA A 1 42 ? 5.881   9.844   2.109   1.00 0.00 ? 42 ALA A CA   6  
ATOM 6433  C C    . ALA A 1 42 ? 4.854   10.208  1.041   1.00 0.00 ? 42 ALA A C    6  
ATOM 6434  O O    . ALA A 1 42 ? 4.414   11.354  0.954   1.00 0.00 ? 42 ALA A O    6  
ATOM 6435  C CB   . ALA A 1 42 ? 7.280   10.226  1.650   1.00 0.00 ? 42 ALA A CB   6  
ATOM 6436  H H    . ALA A 1 42 ? 6.396   7.799   1.937   1.00 0.00 ? 42 ALA A H    6  
ATOM 6437  H HA   . ALA A 1 42 ? 5.660   10.399  3.010   1.00 0.00 ? 42 ALA A HA   6  
ATOM 6438  H HB1  . ALA A 1 42 ? 7.242   11.174  1.132   1.00 0.00 ? 42 ALA A HB1  6  
ATOM 6439  H HB2  . ALA A 1 42 ? 7.930   10.310  2.508   1.00 0.00 ? 42 ALA A HB2  6  
ATOM 6440  H HB3  . ALA A 1 42 ? 7.660   9.467   0.983   1.00 0.00 ? 42 ALA A HB3  6  
ATOM 6441  N N    . ALA A 1 43 ? 4.477   9.224   0.231   1.00 0.00 ? 43 ALA A N    6  
ATOM 6442  C CA   . ALA A 1 43 ? 3.501   9.441   -0.830  1.00 0.00 ? 43 ALA A CA   6  
ATOM 6443  C C    . ALA A 1 43 ? 2.083   9.182   -0.333  1.00 0.00 ? 43 ALA A C    6  
ATOM 6444  O O    . ALA A 1 43 ? 1.118   9.738   -0.859  1.00 0.00 ? 43 ALA A O    6  
ATOM 6445  C CB   . ALA A 1 43 ? 3.814   8.551   -2.025  1.00 0.00 ? 43 ALA A CB   6  
ATOM 6446  H H    . ALA A 1 43 ? 4.864   8.332   0.350   1.00 0.00 ? 43 ALA A H    6  
ATOM 6447  H HA   . ALA A 1 43 ? 3.578   10.470  -1.149  1.00 0.00 ? 43 ALA A HA   6  
ATOM 6448  H HB1  . ALA A 1 43 ? 3.994   9.168   -2.894  1.00 0.00 ? 43 ALA A HB1  6  
ATOM 6449  H HB2  . ALA A 1 43 ? 4.693   7.961   -1.813  1.00 0.00 ? 43 ALA A HB2  6  
ATOM 6450  H HB3  . ALA A 1 43 ? 2.977   7.896   -2.214  1.00 0.00 ? 43 ALA A HB3  6  
ATOM 6451  N N    . THR A 1 44 ? 1.963   8.334   0.684   1.00 0.00 ? 44 THR A N    6  
ATOM 6452  C CA   . THR A 1 44 ? 0.663   8.000   1.251   1.00 0.00 ? 44 THR A CA   6  
ATOM 6453  C C    . THR A 1 44 ? 0.508   8.582   2.651   1.00 0.00 ? 44 THR A C    6  
ATOM 6454  O O    . THR A 1 44 ? -0.579  8.555   3.229   1.00 0.00 ? 44 THR A O    6  
ATOM 6455  C CB   . THR A 1 44 ? 0.452   6.475   1.315   1.00 0.00 ? 44 THR A CB   6  
ATOM 6456  O OG1  . THR A 1 44 ? 1.224   5.918   2.385   1.00 0.00 ? 44 THR A OG1  6  
ATOM 6457  C CG2  . THR A 1 44 ? 0.849   5.819   0.001   1.00 0.00 ? 44 THR A CG2  6  
ATOM 6458  H H    . THR A 1 44 ? 2.769   7.923   1.060   1.00 0.00 ? 44 THR A H    6  
ATOM 6459  H HA   . THR A 1 44 ? -0.099  8.421   0.610   1.00 0.00 ? 44 THR A HA   6  
ATOM 6460  H HB   . THR A 1 44 ? -0.595  6.279   1.496   1.00 0.00 ? 44 THR A HB   6  
ATOM 6461  H HG1  . THR A 1 44 ? 2.081   6.350   2.419   1.00 0.00 ? 44 THR A HG1  6  
ATOM 6462  H HG21 . THR A 1 44 ? 0.080   5.125   -0.302  1.00 0.00 ? 44 THR A HG21 6  
ATOM 6463  H HG22 . THR A 1 44 ? 1.781   5.289   0.131   1.00 0.00 ? 44 THR A HG22 6  
ATOM 6464  H HG23 . THR A 1 44 ? 0.969   6.577   -0.758  1.00 0.00 ? 44 THR A HG23 6  
ATOM 6465  N N    . SER A 1 45 ? 1.602   9.108   3.193   1.00 0.00 ? 45 SER A N    6  
ATOM 6466  C CA   . SER A 1 45 ? 1.588   9.694   4.528   1.00 0.00 ? 45 SER A CA   6  
ATOM 6467  C C    . SER A 1 45 ? 1.260   8.640   5.581   1.00 0.00 ? 45 SER A C    6  
ATOM 6468  O O    . SER A 1 45 ? 0.613   8.931   6.588   1.00 0.00 ? 45 SER A O    6  
ATOM 6469  C CB   . SER A 1 45 ? 0.570   10.834  4.597   1.00 0.00 ? 45 SER A CB   6  
ATOM 6470  O OG   . SER A 1 45 ? 0.637   11.649  3.440   1.00 0.00 ? 45 SER A OG   6  
ATOM 6471  H H    . SER A 1 45 ? 2.439   9.100   2.683   1.00 0.00 ? 45 SER A H    6  
ATOM 6472  H HA   . SER A 1 45 ? 2.573   10.090  4.727   1.00 0.00 ? 45 SER A HA   6  
ATOM 6473  H HB2  . SER A 1 45 ? -0.425  10.421  4.674   1.00 0.00 ? 45 SER A HB2  6  
ATOM 6474  H HB3  . SER A 1 45 ? 0.775   11.444  5.465   1.00 0.00 ? 45 SER A HB3  6  
ATOM 6475  H HG   . SER A 1 45 ? 1.089   12.469  3.651   1.00 0.00 ? 45 SER A HG   6  
ATOM 6476  N N    . LEU A 1 46 ? 1.711   7.413   5.341   1.00 0.00 ? 46 LEU A N    6  
ATOM 6477  C CA   . LEU A 1 46 ? 1.466   6.313   6.267   1.00 0.00 ? 46 LEU A CA   6  
ATOM 6478  C C    . LEU A 1 46 ? 2.742   5.936   7.013   1.00 0.00 ? 46 LEU A C    6  
ATOM 6479  O O    . LEU A 1 46 ? 3.799   6.527   6.794   1.00 0.00 ? 46 LEU A O    6  
ATOM 6480  C CB   . LEU A 1 46 ? 0.923   5.098   5.515   1.00 0.00 ? 46 LEU A CB   6  
ATOM 6481  C CG   . LEU A 1 46 ? -0.487  5.240   4.939   1.00 0.00 ? 46 LEU A CG   6  
ATOM 6482  C CD1  . LEU A 1 46 ? -0.728  4.200   3.856   1.00 0.00 ? 46 LEU A CD1  6  
ATOM 6483  C CD2  . LEU A 1 46 ? -1.528  5.115   6.042   1.00 0.00 ? 46 LEU A CD2  6  
ATOM 6484  H H    . LEU A 1 46 ? 2.220   7.242   4.522   1.00 0.00 ? 46 LEU A H    6  
ATOM 6485  H HA   . LEU A 1 46 ? 0.729   6.642   6.984   1.00 0.00 ? 46 LEU A HA   6  
ATOM 6486  H HB2  . LEU A 1 46 ? 1.594   4.889   4.696   1.00 0.00 ? 46 LEU A HB2  6  
ATOM 6487  H HB3  . LEU A 1 46 ? 0.920   4.261   6.198   1.00 0.00 ? 46 LEU A HB3  6  
ATOM 6488  H HG   . LEU A 1 46 ? -0.589  6.218   4.491   1.00 0.00 ? 46 LEU A HG   6  
ATOM 6489  H HD11 . LEU A 1 46 ? -1.131  3.303   4.301   1.00 0.00 ? 46 LEU A HD11 6  
ATOM 6490  H HD12 . LEU A 1 46 ? 0.205   3.970   3.364   1.00 0.00 ? 46 LEU A HD12 6  
ATOM 6491  H HD13 . LEU A 1 46 ? -1.430  4.590   3.133   1.00 0.00 ? 46 LEU A HD13 6  
ATOM 6492  H HD21 . LEU A 1 46 ? -1.425  5.942   6.729   1.00 0.00 ? 46 LEU A HD21 6  
ATOM 6493  H HD22 . LEU A 1 46 ? -1.380  4.186   6.573   1.00 0.00 ? 46 LEU A HD22 6  
ATOM 6494  H HD23 . LEU A 1 46 ? -2.516  5.129   5.607   1.00 0.00 ? 46 LEU A HD23 6  
ATOM 6495  N N    . SER A 1 47 ? 2.636   4.945   7.893   1.00 0.00 ? 47 SER A N    6  
ATOM 6496  C CA   . SER A 1 47 ? 3.781   4.489   8.672   1.00 0.00 ? 47 SER A CA   6  
ATOM 6497  C C    . SER A 1 47 ? 4.385   3.227   8.062   1.00 0.00 ? 47 SER A C    6  
ATOM 6498  O O    . SER A 1 47 ? 3.687   2.436   7.429   1.00 0.00 ? 47 SER A O    6  
ATOM 6499  C CB   . SER A 1 47 ? 3.365   4.220   10.119  1.00 0.00 ? 47 SER A CB   6  
ATOM 6500  O OG   . SER A 1 47 ? 3.540   5.374   10.923  1.00 0.00 ? 47 SER A OG   6  
ATOM 6501  H H    . SER A 1 47 ? 1.766   4.512   8.022   1.00 0.00 ? 47 SER A H    6  
ATOM 6502  H HA   . SER A 1 47 ? 4.524   5.272   8.659   1.00 0.00 ? 47 SER A HA   6  
ATOM 6503  H HB2  . SER A 1 47 ? 2.325   3.933   10.145  1.00 0.00 ? 47 SER A HB2  6  
ATOM 6504  H HB3  . SER A 1 47 ? 3.970   3.420   10.522  1.00 0.00 ? 47 SER A HB3  6  
ATOM 6505  H HG   . SER A 1 47 ? 2.684   5.690   11.221  1.00 0.00 ? 47 SER A HG   6  
ATOM 6506  N N    . GLU A 1 48 ? 5.688   3.048   8.258   1.00 0.00 ? 48 GLU A N    6  
ATOM 6507  C CA   . GLU A 1 48 ? 6.387   1.884   7.727   1.00 0.00 ? 48 GLU A CA   6  
ATOM 6508  C C    . GLU A 1 48 ? 5.676   0.594   8.126   1.00 0.00 ? 48 GLU A C    6  
ATOM 6509  O O    . GLU A 1 48 ? 5.560   -0.336  7.327   1.00 0.00 ? 48 GLU A O    6  
ATOM 6510  C CB   . GLU A 1 48 ? 7.833   1.858   8.227   1.00 0.00 ? 48 GLU A CB   6  
ATOM 6511  C CG   . GLU A 1 48 ? 8.604   3.132   7.926   1.00 0.00 ? 48 GLU A CG   6  
ATOM 6512  C CD   . GLU A 1 48 ? 10.040  3.073   8.410   1.00 0.00 ? 48 GLU A CD   6  
ATOM 6513  O OE1  . GLU A 1 48 ? 10.597  1.957   8.478   1.00 0.00 ? 48 GLU A OE1  6  
ATOM 6514  O OE2  . GLU A 1 48 ? 10.606  4.141   8.721   1.00 0.00 ? 48 GLU A OE2  6  
ATOM 6515  H H    . GLU A 1 48 ? 6.190   3.715   8.772   1.00 0.00 ? 48 GLU A H    6  
ATOM 6516  H HA   . GLU A 1 48 ? 6.389   1.961   6.650   1.00 0.00 ? 48 GLU A HA   6  
ATOM 6517  H HB2  . GLU A 1 48 ? 7.829   1.707   9.296   1.00 0.00 ? 48 GLU A HB2  6  
ATOM 6518  H HB3  . GLU A 1 48 ? 8.347   1.031   7.758   1.00 0.00 ? 48 GLU A HB3  6  
ATOM 6519  H HG2  . GLU A 1 48 ? 8.607   3.292   6.858   1.00 0.00 ? 48 GLU A HG2  6  
ATOM 6520  H HG3  . GLU A 1 48 ? 8.109   3.960   8.411   1.00 0.00 ? 48 GLU A HG3  6  
ATOM 6521  N N    . ARG A 1 49 ? 5.202   0.545   9.366   1.00 0.00 ? 49 ARG A N    6  
ATOM 6522  C CA   . ARG A 1 49 ? 4.504   -0.631  9.872   1.00 0.00 ? 49 ARG A CA   6  
ATOM 6523  C C    . ARG A 1 49 ? 3.142   -0.785  9.202   1.00 0.00 ? 49 ARG A C    6  
ATOM 6524  O O    . ARG A 1 49 ? 2.765   -1.880  8.786   1.00 0.00 ? 49 ARG A O    6  
ATOM 6525  C CB   . ARG A 1 49 ? 4.330   -0.533  11.389  1.00 0.00 ? 49 ARG A CB   6  
ATOM 6526  C CG   . ARG A 1 49 ? 3.940   -1.849  12.043  1.00 0.00 ? 49 ARG A CG   6  
ATOM 6527  C CD   . ARG A 1 49 ? 5.129   -2.791  12.151  1.00 0.00 ? 49 ARG A CD   6  
ATOM 6528  N NE   . ARG A 1 49 ? 6.055   -2.385  13.205  1.00 0.00 ? 49 ARG A NE   6  
ATOM 6529  C CZ   . ARG A 1 49 ? 7.184   -3.030  13.480  1.00 0.00 ? 49 ARG A CZ   6  
ATOM 6530  N NH1  . ARG A 1 49 ? 7.525   -4.104  12.781  1.00 0.00 ? 49 ARG A NH1  6  
ATOM 6531  N NH2  . ARG A 1 49 ? 7.975   -2.599  14.454  1.00 0.00 ? 49 ARG A NH2  6  
ATOM 6532  H H    . ARG A 1 49 ? 5.326   1.318   9.956   1.00 0.00 ? 49 ARG A H    6  
ATOM 6533  H HA   . ARG A 1 49 ? 5.105   -1.498  9.643   1.00 0.00 ? 49 ARG A HA   6  
ATOM 6534  H HB2  . ARG A 1 49 ? 5.261   -0.202  11.826  1.00 0.00 ? 49 ARG A HB2  6  
ATOM 6535  H HB3  . ARG A 1 49 ? 3.562   0.193   11.605  1.00 0.00 ? 49 ARG A HB3  6  
ATOM 6536  H HG2  . ARG A 1 49 ? 3.562   -1.649  13.035  1.00 0.00 ? 49 ARG A HG2  6  
ATOM 6537  H HG3  . ARG A 1 49 ? 3.171   -2.320  11.450  1.00 0.00 ? 49 ARG A HG3  6  
ATOM 6538  H HD2  . ARG A 1 49 ? 4.765   -3.785  12.368  1.00 0.00 ? 49 ARG A HD2  6  
ATOM 6539  H HD3  . ARG A 1 49 ? 5.653   -2.798  11.207  1.00 0.00 ? 49 ARG A HD3  6  
ATOM 6540  H HE   . ARG A 1 49 ? 5.822   -1.594  13.734  1.00 0.00 ? 49 ARG A HE   6  
ATOM 6541  H HH11 . ARG A 1 49 ? 6.931   -4.430  12.045  1.00 0.00 ? 49 ARG A HH11 6  
ATOM 6542  H HH12 . ARG A 1 49 ? 8.376   -4.586  12.989  1.00 0.00 ? 49 ARG A HH12 6  
ATOM 6543  H HH21 . ARG A 1 49 ? 7.721   -1.789  14.983  1.00 0.00 ? 49 ARG A HH21 6  
ATOM 6544  H HH22 . ARG A 1 49 ? 8.824   -3.084  14.660  1.00 0.00 ? 49 ARG A HH22 6  
ATOM 6545  N N    . GLN A 1 50 ? 2.409   0.320   9.103   1.00 0.00 ? 50 GLN A N    6  
ATOM 6546  C CA   . GLN A 1 50 ? 1.089   0.306   8.485   1.00 0.00 ? 50 GLN A CA   6  
ATOM 6547  C C    . GLN A 1 50 ? 1.156   -0.256  7.069   1.00 0.00 ? 50 GLN A C    6  
ATOM 6548  O O    . GLN A 1 50 ? 0.409   -1.169  6.717   1.00 0.00 ? 50 GLN A O    6  
ATOM 6549  C CB   . GLN A 1 50 ? 0.500   1.718   8.458   1.00 0.00 ? 50 GLN A CB   6  
ATOM 6550  C CG   . GLN A 1 50 ? -0.032  2.181   9.805   1.00 0.00 ? 50 GLN A CG   6  
ATOM 6551  C CD   . GLN A 1 50 ? -1.220  3.113   9.674   1.00 0.00 ? 50 GLN A CD   6  
ATOM 6552  O OE1  . GLN A 1 50 ? -1.133  4.297   10.001  1.00 0.00 ? 50 GLN A OE1  6  
ATOM 6553  N NE2  . GLN A 1 50 ? -2.339  2.584   9.193   1.00 0.00 ? 50 GLN A NE2  6  
ATOM 6554  H H    . GLN A 1 50 ? 2.764   1.162   9.454   1.00 0.00 ? 50 GLN A H    6  
ATOM 6555  H HA   . GLN A 1 50 ? 0.450   -0.328  9.080   1.00 0.00 ? 50 GLN A HA   6  
ATOM 6556  H HB2  . GLN A 1 50 ? 1.267   2.409   8.141   1.00 0.00 ? 50 GLN A HB2  6  
ATOM 6557  H HB3  . GLN A 1 50 ? -0.312  1.744   7.747   1.00 0.00 ? 50 GLN A HB3  6  
ATOM 6558  H HG2  . GLN A 1 50 ? -0.335  1.315   10.375  1.00 0.00 ? 50 GLN A HG2  6  
ATOM 6559  H HG3  . GLN A 1 50 ? 0.757   2.698   10.331  1.00 0.00 ? 50 GLN A HG3  6  
ATOM 6560  H HE21 . GLN A 1 50 ? -2.334  1.632   8.955   1.00 0.00 ? 50 GLN A HE21 6  
ATOM 6561  H HE22 . GLN A 1 50 ? -3.122  3.163   9.099   1.00 0.00 ? 50 GLN A HE22 6  
ATOM 6562  N N    . ILE A 1 51 ? 2.055   0.296   6.261   1.00 0.00 ? 51 ILE A N    6  
ATOM 6563  C CA   . ILE A 1 51 ? 2.220   -0.151  4.883   1.00 0.00 ? 51 ILE A CA   6  
ATOM 6564  C C    . ILE A 1 51 ? 2.567   -1.635  4.825   1.00 0.00 ? 51 ILE A C    6  
ATOM 6565  O O    . ILE A 1 51 ? 2.236   -2.324  3.859   1.00 0.00 ? 51 ILE A O    6  
ATOM 6566  C CB   . ILE A 1 51 ? 3.318   0.650   4.159   1.00 0.00 ? 51 ILE A CB   6  
ATOM 6567  C CG1  . ILE A 1 51 ? 2.990   2.144   4.183   1.00 0.00 ? 51 ILE A CG1  6  
ATOM 6568  C CG2  . ILE A 1 51 ? 3.474   0.160   2.727   1.00 0.00 ? 51 ILE A CG2  6  
ATOM 6569  C CD1  . ILE A 1 51 ? 4.171   3.028   3.849   1.00 0.00 ? 51 ILE A CD1  6  
ATOM 6570  H H    . ILE A 1 51 ? 2.622   1.020   6.599   1.00 0.00 ? 51 ILE A H    6  
ATOM 6571  H HA   . ILE A 1 51 ? 1.285   0.010   4.367   1.00 0.00 ? 51 ILE A HA   6  
ATOM 6572  H HB   . ILE A 1 51 ? 4.252   0.485   4.674   1.00 0.00 ? 51 ILE A HB   6  
ATOM 6573  H HG12 . ILE A 1 51 ? 2.211   2.347   3.466   1.00 0.00 ? 51 ILE A HG12 6  
ATOM 6574  H HG13 . ILE A 1 51 ? 2.643   2.412   5.171   1.00 0.00 ? 51 ILE A HG13 6  
ATOM 6575  H HG21 . ILE A 1 51 ? 2.613   -0.432  2.453   1.00 0.00 ? 51 ILE A HG21 6  
ATOM 6576  H HG22 . ILE A 1 51 ? 3.553   1.008   2.063   1.00 0.00 ? 51 ILE A HG22 6  
ATOM 6577  H HG23 . ILE A 1 51 ? 4.365   -0.444  2.648   1.00 0.00 ? 51 ILE A HG23 6  
ATOM 6578  H HD11 . ILE A 1 51 ? 3.843   3.851   3.232   1.00 0.00 ? 51 ILE A HD11 6  
ATOM 6579  H HD12 . ILE A 1 51 ? 4.605   3.410   4.761   1.00 0.00 ? 51 ILE A HD12 6  
ATOM 6580  H HD13 . ILE A 1 51 ? 4.912   2.451   3.314   1.00 0.00 ? 51 ILE A HD13 6  
ATOM 6581  N N    . THR A 1 52 ? 3.235   -2.123  5.866   1.00 0.00 ? 52 THR A N    6  
ATOM 6582  C CA   . THR A 1 52 ? 3.626   -3.525  5.934   1.00 0.00 ? 52 THR A CA   6  
ATOM 6583  C C    . THR A 1 52 ? 2.426   -4.417  6.233   1.00 0.00 ? 52 THR A C    6  
ATOM 6584  O O    . THR A 1 52 ? 2.175   -5.392  5.524   1.00 0.00 ? 52 THR A O    6  
ATOM 6585  C CB   . THR A 1 52 ? 4.703   -3.756  7.011   1.00 0.00 ? 52 THR A CB   6  
ATOM 6586  O OG1  . THR A 1 52 ? 5.810   -2.873  6.794   1.00 0.00 ? 52 THR A OG1  6  
ATOM 6587  C CG2  . THR A 1 52 ? 5.187   -5.198  6.992   1.00 0.00 ? 52 THR A CG2  6  
ATOM 6588  H H    . THR A 1 52 ? 3.470   -1.524  6.605   1.00 0.00 ? 52 THR A H    6  
ATOM 6589  H HA   . THR A 1 52 ? 4.039   -3.803  4.976   1.00 0.00 ? 52 THR A HA   6  
ATOM 6590  H HB   . THR A 1 52 ? 4.272   -3.549  7.980   1.00 0.00 ? 52 THR A HB   6  
ATOM 6591  H HG1  . THR A 1 52 ? 5.982   -2.373  7.595   1.00 0.00 ? 52 THR A HG1  6  
ATOM 6592  H HG21 . THR A 1 52 ? 4.633   -5.754  6.250   1.00 0.00 ? 52 THR A HG21 6  
ATOM 6593  H HG22 . THR A 1 52 ? 5.033   -5.642  7.964   1.00 0.00 ? 52 THR A HG22 6  
ATOM 6594  H HG23 . THR A 1 52 ? 6.238   -5.222  6.747   1.00 0.00 ? 52 THR A HG23 6  
ATOM 6595  N N    . ILE A 1 53 ? 1.688   -4.076  7.284   1.00 0.00 ? 53 ILE A N    6  
ATOM 6596  C CA   . ILE A 1 53 ? 0.513   -4.845  7.674   1.00 0.00 ? 53 ILE A CA   6  
ATOM 6597  C C    . ILE A 1 53 ? -0.429  -5.047  6.492   1.00 0.00 ? 53 ILE A C    6  
ATOM 6598  O O    . ILE A 1 53 ? -0.911  -6.154  6.251   1.00 0.00 ? 53 ILE A O    6  
ATOM 6599  C CB   . ILE A 1 53 ? -0.256  -4.158  8.818   1.00 0.00 ? 53 ILE A CB   6  
ATOM 6600  C CG1  . ILE A 1 53 ? 0.654   -3.973  10.034  1.00 0.00 ? 53 ILE A CG1  6  
ATOM 6601  C CG2  . ILE A 1 53 ? -1.488  -4.969  9.189   1.00 0.00 ? 53 ILE A CG2  6  
ATOM 6602  C CD1  . ILE A 1 53 ? 0.149   -2.937  11.014  1.00 0.00 ? 53 ILE A CD1  6  
ATOM 6603  H H    . ILE A 1 53 ? 1.940   -3.288  7.809   1.00 0.00 ? 53 ILE A H    6  
ATOM 6604  H HA   . ILE A 1 53 ? 0.849   -5.812  8.022   1.00 0.00 ? 53 ILE A HA   6  
ATOM 6605  H HB   . ILE A 1 53 ? -0.582  -3.190  8.471   1.00 0.00 ? 53 ILE A HB   6  
ATOM 6606  H HG12 . ILE A 1 53 ? 0.738   -4.912  10.559  1.00 0.00 ? 53 ILE A HG12 6  
ATOM 6607  H HG13 . ILE A 1 53 ? 1.633   -3.664  9.698   1.00 0.00 ? 53 ILE A HG13 6  
ATOM 6608  H HG21 . ILE A 1 53 ? -2.253  -4.824  8.440   1.00 0.00 ? 53 ILE A HG21 6  
ATOM 6609  H HG22 . ILE A 1 53 ? -1.228  -6.015  9.240   1.00 0.00 ? 53 ILE A HG22 6  
ATOM 6610  H HG23 . ILE A 1 53 ? -1.858  -4.642  10.149  1.00 0.00 ? 53 ILE A HG23 6  
ATOM 6611  H HD11 . ILE A 1 53 ? -0.354  -2.148  10.476  1.00 0.00 ? 53 ILE A HD11 6  
ATOM 6612  H HD12 . ILE A 1 53 ? -0.539  -3.400  11.705  1.00 0.00 ? 53 ILE A HD12 6  
ATOM 6613  H HD13 . ILE A 1 53 ? 0.984   -2.523  11.561  1.00 0.00 ? 53 ILE A HD13 6  
ATOM 6614  N N    . TRP A 1 54 ? -0.686  -3.971  5.757   1.00 0.00 ? 54 TRP A N    6  
ATOM 6615  C CA   . TRP A 1 54 ? -1.569  -4.030  4.598   1.00 0.00 ? 54 TRP A CA   6  
ATOM 6616  C C    . TRP A 1 54 ? -1.056  -5.035  3.573   1.00 0.00 ? 54 TRP A C    6  
ATOM 6617  O O    . TRP A 1 54 ? -1.821  -5.840  3.042   1.00 0.00 ? 54 TRP A O    6  
ATOM 6618  C CB   . TRP A 1 54 ? -1.696  -2.647  3.957   1.00 0.00 ? 54 TRP A CB   6  
ATOM 6619  C CG   . TRP A 1 54 ? -2.777  -2.570  2.922   1.00 0.00 ? 54 TRP A CG   6  
ATOM 6620  C CD1  . TRP A 1 54 ? -4.101  -2.311  3.138   1.00 0.00 ? 54 TRP A CD1  6  
ATOM 6621  C CD2  . TRP A 1 54 ? -2.627  -2.754  1.510   1.00 0.00 ? 54 TRP A CD2  6  
ATOM 6622  N NE1  . TRP A 1 54 ? -4.783  -2.323  1.945   1.00 0.00 ? 54 TRP A NE1  6  
ATOM 6623  C CE2  . TRP A 1 54 ? -3.901  -2.592  0.931   1.00 0.00 ? 54 TRP A CE2  6  
ATOM 6624  C CE3  . TRP A 1 54 ? -1.541  -3.038  0.678   1.00 0.00 ? 54 TRP A CE3  6  
ATOM 6625  C CZ2  . TRP A 1 54 ? -4.116  -2.706  -0.440  1.00 0.00 ? 54 TRP A CZ2  6  
ATOM 6626  C CZ3  . TRP A 1 54 ? -1.755  -3.151  -0.682  1.00 0.00 ? 54 TRP A CZ3  6  
ATOM 6627  C CH2  . TRP A 1 54 ? -3.034  -2.985  -1.230  1.00 0.00 ? 54 TRP A CH2  6  
ATOM 6628  H H    . TRP A 1 54 ? -0.272  -3.116  6.000   1.00 0.00 ? 54 TRP A H    6  
ATOM 6629  H HA   . TRP A 1 54 ? -2.543  -4.348  4.941   1.00 0.00 ? 54 TRP A HA   6  
ATOM 6630  H HB2  . TRP A 1 54 ? -1.916  -1.920  4.724   1.00 0.00 ? 54 TRP A HB2  6  
ATOM 6631  H HB3  . TRP A 1 54 ? -0.760  -2.392  3.482   1.00 0.00 ? 54 TRP A HB3  6  
ATOM 6632  H HD1  . TRP A 1 54 ? -4.534  -2.127  4.109   1.00 0.00 ? 54 TRP A HD1  6  
ATOM 6633  H HE1  . TRP A 1 54 ? -5.744  -2.164  1.837   1.00 0.00 ? 54 TRP A HE1  6  
ATOM 6634  H HE3  . TRP A 1 54 ? -0.548  -3.170  1.082   1.00 0.00 ? 54 TRP A HE3  6  
ATOM 6635  H HZ2  . TRP A 1 54 ? -5.095  -2.580  -0.878  1.00 0.00 ? 54 TRP A HZ2  6  
ATOM 6636  H HZ3  . TRP A 1 54 ? -0.928  -3.371  -1.340  1.00 0.00 ? 54 TRP A HZ3  6  
ATOM 6637  H HH2  . TRP A 1 54 ? -3.155  -3.083  -2.298  1.00 0.00 ? 54 TRP A HH2  6  
ATOM 6638  N N    . PHE A 1 55 ? 0.243   -4.983  3.299   1.00 0.00 ? 55 PHE A N    6  
ATOM 6639  C CA   . PHE A 1 55 ? 0.859   -5.889  2.336   1.00 0.00 ? 55 PHE A CA   6  
ATOM 6640  C C    . PHE A 1 55 ? 0.722   -7.339  2.790   1.00 0.00 ? 55 PHE A C    6  
ATOM 6641  O O    . PHE A 1 55 ? 0.647   -8.252  1.968   1.00 0.00 ? 55 PHE A O    6  
ATOM 6642  C CB   . PHE A 1 55 ? 2.336   -5.539  2.147   1.00 0.00 ? 55 PHE A CB   6  
ATOM 6643  C CG   . PHE A 1 55 ? 2.590   -4.615  0.991   1.00 0.00 ? 55 PHE A CG   6  
ATOM 6644  C CD1  . PHE A 1 55 ? 2.044   -3.342  0.971   1.00 0.00 ? 55 PHE A CD1  6  
ATOM 6645  C CD2  . PHE A 1 55 ? 3.376   -5.020  -0.077  1.00 0.00 ? 55 PHE A CD2  6  
ATOM 6646  C CE1  . PHE A 1 55 ? 2.275   -2.490  -0.092  1.00 0.00 ? 55 PHE A CE1  6  
ATOM 6647  C CE2  . PHE A 1 55 ? 3.611   -4.172  -1.143  1.00 0.00 ? 55 PHE A CE2  6  
ATOM 6648  C CZ   . PHE A 1 55 ? 3.061   -2.905  -1.150  1.00 0.00 ? 55 PHE A CZ   6  
ATOM 6649  H H    . PHE A 1 55 ? 0.802   -4.319  3.756   1.00 0.00 ? 55 PHE A H    6  
ATOM 6650  H HA   . PHE A 1 55 ? 0.346   -5.769  1.395   1.00 0.00 ? 55 PHE A HA   6  
ATOM 6651  H HB2  . PHE A 1 55 ? 2.702   -5.059  3.042   1.00 0.00 ? 55 PHE A HB2  6  
ATOM 6652  H HB3  . PHE A 1 55 ? 2.894   -6.448  1.977   1.00 0.00 ? 55 PHE A HB3  6  
ATOM 6653  H HD1  . PHE A 1 55 ? 1.430   -3.016  1.798   1.00 0.00 ? 55 PHE A HD1  6  
ATOM 6654  H HD2  . PHE A 1 55 ? 3.807   -6.011  -0.072  1.00 0.00 ? 55 PHE A HD2  6  
ATOM 6655  H HE1  . PHE A 1 55 ? 1.844   -1.500  -0.095  1.00 0.00 ? 55 PHE A HE1  6  
ATOM 6656  H HE2  . PHE A 1 55 ? 4.226   -4.500  -1.968  1.00 0.00 ? 55 PHE A HE2  6  
ATOM 6657  H HZ   . PHE A 1 55 ? 3.243   -2.242  -1.982  1.00 0.00 ? 55 PHE A HZ   6  
ATOM 6658  N N    . GLN A 1 56 ? 0.690   -7.542  4.103   1.00 0.00 ? 56 GLN A N    6  
ATOM 6659  C CA   . GLN A 1 56 ? 0.563   -8.881  4.666   1.00 0.00 ? 56 GLN A CA   6  
ATOM 6660  C C    . GLN A 1 56 ? -0.869  -9.390  4.544   1.00 0.00 ? 56 GLN A C    6  
ATOM 6661  O O    . GLN A 1 56 ? -1.111  -10.469 4.006   1.00 0.00 ? 56 GLN A O    6  
ATOM 6662  C CB   . GLN A 1 56 ? 0.995   -8.883  6.134   1.00 0.00 ? 56 GLN A CB   6  
ATOM 6663  C CG   . GLN A 1 56 ? 2.502   -8.931  6.325   1.00 0.00 ? 56 GLN A CG   6  
ATOM 6664  C CD   . GLN A 1 56 ? 3.096   -10.274 5.949   1.00 0.00 ? 56 GLN A CD   6  
ATOM 6665  O OE1  . GLN A 1 56 ? 2.377   -11.263 5.797   1.00 0.00 ? 56 GLN A OE1  6  
ATOM 6666  N NE2  . GLN A 1 56 ? 4.414   -10.318 5.798   1.00 0.00 ? 56 GLN A NE2  6  
ATOM 6667  H H    . GLN A 1 56 ? 0.754   -6.774  4.707   1.00 0.00 ? 56 GLN A H    6  
ATOM 6668  H HA   . GLN A 1 56 ? 1.214   -9.538  4.108   1.00 0.00 ? 56 GLN A HA   6  
ATOM 6669  H HB2  . GLN A 1 56 ? 0.621   -7.988  6.608   1.00 0.00 ? 56 GLN A HB2  6  
ATOM 6670  H HB3  . GLN A 1 56 ? 0.565   -9.746  6.621   1.00 0.00 ? 56 GLN A HB3  6  
ATOM 6671  H HG2  . GLN A 1 56 ? 2.955   -8.170  5.707   1.00 0.00 ? 56 GLN A HG2  6  
ATOM 6672  H HG3  . GLN A 1 56 ? 2.727   -8.731  7.362   1.00 0.00 ? 56 GLN A HG3  6  
ATOM 6673  H HE21 . GLN A 1 56 ? 4.923   -9.491  5.936   1.00 0.00 ? 56 GLN A HE21 6  
ATOM 6674  H HE22 . GLN A 1 56 ? 4.824   -11.173 5.556   1.00 0.00 ? 56 GLN A HE22 6  
ATOM 6675  N N    . ASN A 1 57 ? -1.816  -8.604  5.048   1.00 0.00 ? 57 ASN A N    6  
ATOM 6676  C CA   . ASN A 1 57 ? -3.225  -8.976  4.996   1.00 0.00 ? 57 ASN A CA   6  
ATOM 6677  C C    . ASN A 1 57 ? -3.669  -9.227  3.558   1.00 0.00 ? 57 ASN A C    6  
ATOM 6678  O O    . ASN A 1 57 ? -4.522  -10.077 3.301   1.00 0.00 ? 57 ASN A O    6  
ATOM 6679  C CB   . ASN A 1 57 ? -4.087  -7.879  5.624   1.00 0.00 ? 57 ASN A CB   6  
ATOM 6680  C CG   . ASN A 1 57 ? -4.259  -8.063  7.119   1.00 0.00 ? 57 ASN A CG   6  
ATOM 6681  O OD1  . ASN A 1 57 ? -4.715  -9.110  7.578   1.00 0.00 ? 57 ASN A OD1  6  
ATOM 6682  N ND2  . ASN A 1 57 ? -3.894  -7.042  7.886   1.00 0.00 ? 57 ASN A ND2  6  
ATOM 6683  H H    . ASN A 1 57 ? -1.561  -7.755  5.465   1.00 0.00 ? 57 ASN A H    6  
ATOM 6684  H HA   . ASN A 1 57 ? -3.348  -9.887  5.563   1.00 0.00 ? 57 ASN A HA   6  
ATOM 6685  H HB2  . ASN A 1 57 ? -3.620  -6.920  5.450   1.00 0.00 ? 57 ASN A HB2  6  
ATOM 6686  H HB3  . ASN A 1 57 ? -5.063  -7.888  5.163   1.00 0.00 ? 57 ASN A HB3  6  
ATOM 6687  H HD21 . ASN A 1 57 ? -3.539  -6.239  7.451   1.00 0.00 ? 57 ASN A HD21 6  
ATOM 6688  H HD22 . ASN A 1 57 ? -3.994  -7.134  8.857   1.00 0.00 ? 57 ASN A HD22 6  
ATOM 6689  N N    . ARG A 1 58 ? -3.084  -8.483  2.626   1.00 0.00 ? 58 ARG A N    6  
ATOM 6690  C CA   . ARG A 1 58 ? -3.419  -8.624  1.214   1.00 0.00 ? 58 ARG A CA   6  
ATOM 6691  C C    . ARG A 1 58 ? -3.185  -10.055 0.740   1.00 0.00 ? 58 ARG A C    6  
ATOM 6692  O O    . ARG A 1 58 ? -4.021  -10.635 0.047   1.00 0.00 ? 58 ARG A O    6  
ATOM 6693  C CB   . ARG A 1 58 ? -2.589  -7.654  0.371   1.00 0.00 ? 58 ARG A CB   6  
ATOM 6694  C CG   . ARG A 1 58 ? -3.315  -7.145  -0.863  1.00 0.00 ? 58 ARG A CG   6  
ATOM 6695  C CD   . ARG A 1 58 ? -4.519  -6.294  -0.491  1.00 0.00 ? 58 ARG A CD   6  
ATOM 6696  N NE   . ARG A 1 58 ? -5.088  -5.613  -1.651  1.00 0.00 ? 58 ARG A NE   6  
ATOM 6697  C CZ   . ARG A 1 58 ? -6.267  -5.000  -1.638  1.00 0.00 ? 58 ARG A CZ   6  
ATOM 6698  N NH1  . ARG A 1 58 ? -6.997  -4.983  -0.531  1.00 0.00 ? 58 ARG A NH1  6  
ATOM 6699  N NH2  . ARG A 1 58 ? -6.717  -4.403  -2.734  1.00 0.00 ? 58 ARG A NH2  6  
ATOM 6700  H H    . ARG A 1 58 ? -2.411  -7.822  2.893   1.00 0.00 ? 58 ARG A H    6  
ATOM 6701  H HA   . ARG A 1 58 ? -4.466  -8.385  1.096   1.00 0.00 ? 58 ARG A HA   6  
ATOM 6702  H HB2  . ARG A 1 58 ? -2.322  -6.803  0.981   1.00 0.00 ? 58 ARG A HB2  6  
ATOM 6703  H HB3  . ARG A 1 58 ? -1.688  -8.154  0.052   1.00 0.00 ? 58 ARG A HB3  6  
ATOM 6704  H HG2  . ARG A 1 58 ? -2.633  -6.546  -1.449  1.00 0.00 ? 58 ARG A HG2  6  
ATOM 6705  H HG3  . ARG A 1 58 ? -3.648  -7.990  -1.447  1.00 0.00 ? 58 ARG A HG3  6  
ATOM 6706  H HD2  . ARG A 1 58 ? -5.273  -6.932  -0.055  1.00 0.00 ? 58 ARG A HD2  6  
ATOM 6707  H HD3  . ARG A 1 58 ? -4.211  -5.555  0.233   1.00 0.00 ? 58 ARG A HD3  6  
ATOM 6708  H HE   . ARG A 1 58 ? -4.566  -5.614  -2.479  1.00 0.00 ? 58 ARG A HE   6  
ATOM 6709  H HH11 . ARG A 1 58 ? -6.659  -5.431  0.296   1.00 0.00 ? 58 ARG A HH11 6  
ATOM 6710  H HH12 . ARG A 1 58 ? -7.883  -4.519  -0.524  1.00 0.00 ? 58 ARG A HH12 6  
ATOM 6711  H HH21 . ARG A 1 58 ? -6.170  -4.414  -3.570  1.00 0.00 ? 58 ARG A HH21 6  
ATOM 6712  H HH22 . ARG A 1 58 ? -7.604  -3.942  -2.723  1.00 0.00 ? 58 ARG A HH22 6  
ATOM 6713  N N    . ARG A 1 59 ? -2.042  -10.618 1.118   1.00 0.00 ? 59 ARG A N    6  
ATOM 6714  C CA   . ARG A 1 59 ? -1.697  -11.981 0.730   1.00 0.00 ? 59 ARG A CA   6  
ATOM 6715  C C    . ARG A 1 59 ? -2.370  -12.995 1.650   1.00 0.00 ? 59 ARG A C    6  
ATOM 6716  O O    . ARG A 1 59 ? -2.993  -13.951 1.188   1.00 0.00 ? 59 ARG A O    6  
ATOM 6717  C CB   . ARG A 1 59 ? -0.180  -12.174 0.763   1.00 0.00 ? 59 ARG A CB   6  
ATOM 6718  C CG   . ARG A 1 59 ? 0.499   -11.894 -0.568  1.00 0.00 ? 59 ARG A CG   6  
ATOM 6719  C CD   . ARG A 1 59 ? 1.998   -11.705 -0.400  1.00 0.00 ? 59 ARG A CD   6  
ATOM 6720  N NE   . ARG A 1 59 ? 2.764   -12.668 -1.187  1.00 0.00 ? 59 ARG A NE   6  
ATOM 6721  C CZ   . ARG A 1 59 ? 2.958   -13.929 -0.818  1.00 0.00 ? 59 ARG A CZ   6  
ATOM 6722  N NH1  . ARG A 1 59 ? 2.446   -14.377 0.320   1.00 0.00 ? 59 ARG A NH1  6  
ATOM 6723  N NH2  . ARG A 1 59 ? 3.666   -14.745 -1.588  1.00 0.00 ? 59 ARG A NH2  6  
ATOM 6724  H H    . ARG A 1 59 ? -1.415  -10.105 1.670   1.00 0.00 ? 59 ARG A H    6  
ATOM 6725  H HA   . ARG A 1 59 ? -2.049  -12.138 -0.278  1.00 0.00 ? 59 ARG A HA   6  
ATOM 6726  H HB2  . ARG A 1 59 ? 0.241   -11.509 1.503   1.00 0.00 ? 59 ARG A HB2  6  
ATOM 6727  H HB3  . ARG A 1 59 ? 0.035   -13.194 1.044   1.00 0.00 ? 59 ARG A HB3  6  
ATOM 6728  H HG2  . ARG A 1 59 ? 0.325   -12.728 -1.233  1.00 0.00 ? 59 ARG A HG2  6  
ATOM 6729  H HG3  . ARG A 1 59 ? 0.077   -10.997 -0.995  1.00 0.00 ? 59 ARG A HG3  6  
ATOM 6730  H HD2  . ARG A 1 59 ? 2.260   -10.706 -0.718  1.00 0.00 ? 59 ARG A HD2  6  
ATOM 6731  H HD3  . ARG A 1 59 ? 2.248   -11.827 0.644   1.00 0.00 ? 59 ARG A HD3  6  
ATOM 6732  H HE   . ARG A 1 59 ? 3.151   -12.358 -2.031  1.00 0.00 ? 59 ARG A HE   6  
ATOM 6733  H HH11 . ARG A 1 59 ? 1.911   -13.764 0.902   1.00 0.00 ? 59 ARG A HH11 6  
ATOM 6734  H HH12 . ARG A 1 59 ? 2.593   -15.327 0.595   1.00 0.00 ? 59 ARG A HH12 6  
ATOM 6735  H HH21 . ARG A 1 59 ? 4.054   -14.411 -2.447  1.00 0.00 ? 59 ARG A HH21 6  
ATOM 6736  H HH22 . ARG A 1 59 ? 3.812   -15.694 -1.309  1.00 0.00 ? 59 ARG A HH22 6  
ATOM 6737  N N    . VAL A 1 60 ? -2.239  -12.780 2.956   1.00 0.00 ? 60 VAL A N    6  
ATOM 6738  C CA   . VAL A 1 60 ? -2.834  -13.675 3.941   1.00 0.00 ? 60 VAL A CA   6  
ATOM 6739  C C    . VAL A 1 60 ? -4.337  -13.812 3.721   1.00 0.00 ? 60 VAL A C    6  
ATOM 6740  O O    . VAL A 1 60 ? -4.942  -14.814 4.104   1.00 0.00 ? 60 VAL A O    6  
ATOM 6741  C CB   . VAL A 1 60 ? -2.580  -13.177 5.376   1.00 0.00 ? 60 VAL A CB   6  
ATOM 6742  C CG1  . VAL A 1 60 ? -3.116  -14.176 6.390   1.00 0.00 ? 60 VAL A CG1  6  
ATOM 6743  C CG2  . VAL A 1 60 ? -1.096  -12.926 5.597   1.00 0.00 ? 60 VAL A CG2  6  
ATOM 6744  H H    . VAL A 1 60 ? -1.730  -12.001 3.263   1.00 0.00 ? 60 VAL A H    6  
ATOM 6745  H HA   . VAL A 1 60 ? -2.374  -14.646 3.832   1.00 0.00 ? 60 VAL A HA   6  
ATOM 6746  H HB   . VAL A 1 60 ? -3.106  -12.244 5.511   1.00 0.00 ? 60 VAL A HB   6  
ATOM 6747  H HG11 . VAL A 1 60 ? -4.190  -14.249 6.291   1.00 0.00 ? 60 VAL A HG11 6  
ATOM 6748  H HG12 . VAL A 1 60 ? -2.670  -15.144 6.214   1.00 0.00 ? 60 VAL A HG12 6  
ATOM 6749  H HG13 . VAL A 1 60 ? -2.871  -13.843 7.388   1.00 0.00 ? 60 VAL A HG13 6  
ATOM 6750  H HG21 . VAL A 1 60 ? -0.741  -13.553 6.401   1.00 0.00 ? 60 VAL A HG21 6  
ATOM 6751  H HG22 . VAL A 1 60 ? -0.552  -13.158 4.693   1.00 0.00 ? 60 VAL A HG22 6  
ATOM 6752  H HG23 . VAL A 1 60 ? -0.941  -11.888 5.854   1.00 0.00 ? 60 VAL A HG23 6  
ATOM 6753  N N    . LYS A 1 61 ? -4.934  -12.800 3.102   1.00 0.00 ? 61 LYS A N    6  
ATOM 6754  C CA   . LYS A 1 61 ? -6.366  -12.807 2.828   1.00 0.00 ? 61 LYS A CA   6  
ATOM 6755  C C    . LYS A 1 61 ? -6.770  -14.070 2.074   1.00 0.00 ? 61 LYS A C    6  
ATOM 6756  O O    . LYS A 1 61 ? -7.884  -14.566 2.231   1.00 0.00 ? 61 LYS A O    6  
ATOM 6757  C CB   . LYS A 1 61 ? -6.757  -11.569 2.018   1.00 0.00 ? 61 LYS A CB   6  
ATOM 6758  C CG   . LYS A 1 61 ? -8.187  -11.604 1.507   1.00 0.00 ? 61 LYS A CG   6  
ATOM 6759  C CD   . LYS A 1 61 ? -8.605  -10.263 0.928   1.00 0.00 ? 61 LYS A CD   6  
ATOM 6760  C CE   . LYS A 1 61 ? -10.117 -10.153 0.810   1.00 0.00 ? 61 LYS A CE   6  
ATOM 6761  N NZ   . LYS A 1 61 ? -10.777 -10.128 2.145   1.00 0.00 ? 61 LYS A NZ   6  
ATOM 6762  H H    . LYS A 1 61 ? -4.397  -12.028 2.821   1.00 0.00 ? 61 LYS A H    6  
ATOM 6763  H HA   . LYS A 1 61 ? -6.884  -12.786 3.775   1.00 0.00 ? 61 LYS A HA   6  
ATOM 6764  H HB2  . LYS A 1 61 ? -6.641  -10.694 2.641   1.00 0.00 ? 61 LYS A HB2  6  
ATOM 6765  H HB3  . LYS A 1 61 ? -6.095  -11.486 1.168   1.00 0.00 ? 61 LYS A HB3  6  
ATOM 6766  H HG2  . LYS A 1 61 ? -8.266  -12.357 0.737   1.00 0.00 ? 61 LYS A HG2  6  
ATOM 6767  H HG3  . LYS A 1 61 ? -8.847  -11.853 2.326   1.00 0.00 ? 61 LYS A HG3  6  
ATOM 6768  H HD2  . LYS A 1 61 ? -8.247  -9.474  1.573   1.00 0.00 ? 61 LYS A HD2  6  
ATOM 6769  H HD3  . LYS A 1 61 ? -8.167  -10.152 -0.055  1.00 0.00 ? 61 LYS A HD3  6  
ATOM 6770  H HE2  . LYS A 1 61 ? -10.360 -9.244  0.282   1.00 0.00 ? 61 LYS A HE2  6  
ATOM 6771  H HE3  . LYS A 1 61 ? -10.484 -11.002 0.253   1.00 0.00 ? 61 LYS A HE3  6  
ATOM 6772  H HZ1  . LYS A 1 61 ? -11.637 -9.545  2.108   1.00 0.00 ? 61 LYS A HZ1  6  
ATOM 6773  H HZ2  . LYS A 1 61 ? -10.131 -9.727  2.855   1.00 0.00 ? 61 LYS A HZ2  6  
ATOM 6774  H HZ3  . LYS A 1 61 ? -11.037 -11.092 2.434   1.00 0.00 ? 61 LYS A HZ3  6  
ATOM 6775  N N    . GLU A 1 62 ? -5.855  -14.584 1.258   1.00 0.00 ? 62 GLU A N    6  
ATOM 6776  C CA   . GLU A 1 62 ? -6.117  -15.789 0.481   1.00 0.00 ? 62 GLU A CA   6  
ATOM 6777  C C    . GLU A 1 62 ? -5.316  -16.970 1.021   1.00 0.00 ? 62 GLU A C    6  
ATOM 6778  O O    . GLU A 1 62 ? -4.986  -17.900 0.285   1.00 0.00 ? 62 GLU A O    6  
ATOM 6779  C CB   . GLU A 1 62 ? -5.775  -15.558 -0.993  1.00 0.00 ? 62 GLU A CB   6  
ATOM 6780  C CG   . GLU A 1 62 ? -4.438  -14.869 -1.206  1.00 0.00 ? 62 GLU A CG   6  
ATOM 6781  C CD   . GLU A 1 62 ? -3.955  -14.962 -2.640  1.00 0.00 ? 62 GLU A CD   6  
ATOM 6782  O OE1  . GLU A 1 62 ? -4.098  -16.045 -3.246  1.00 0.00 ? 62 GLU A OE1  6  
ATOM 6783  O OE2  . GLU A 1 62 ? -3.434  -13.952 -3.157  1.00 0.00 ? 62 GLU A OE2  6  
ATOM 6784  H H    . GLU A 1 62 ? -4.984  -14.142 1.176   1.00 0.00 ? 62 GLU A H    6  
ATOM 6785  H HA   . GLU A 1 62 ? -7.170  -16.016 0.565   1.00 0.00 ? 62 GLU A HA   6  
ATOM 6786  H HB2  . GLU A 1 62 ? -5.750  -16.512 -1.498  1.00 0.00 ? 62 GLU A HB2  6  
ATOM 6787  H HB3  . GLU A 1 62 ? -6.546  -14.945 -1.436  1.00 0.00 ? 62 GLU A HB3  6  
ATOM 6788  H HG2  . GLU A 1 62 ? -4.538  -13.826 -0.944  1.00 0.00 ? 62 GLU A HG2  6  
ATOM 6789  H HG3  . GLU A 1 62 ? -3.703  -15.331 -0.563  1.00 0.00 ? 62 GLU A HG3  6  
ATOM 6790  N N    . LYS A 1 63 ? -5.005  -16.925 2.312   1.00 0.00 ? 63 LYS A N    6  
ATOM 6791  C CA   . LYS A 1 63 ? -4.243  -17.990 2.953   1.00 0.00 ? 63 LYS A CA   6  
ATOM 6792  C C    . LYS A 1 63 ? -5.104  -18.743 3.963   1.00 0.00 ? 63 LYS A C    6  
ATOM 6793  O O    . LYS A 1 63 ? -4.858  -19.914 4.253   1.00 0.00 ? 63 LYS A O    6  
ATOM 6794  C CB   . LYS A 1 63 ? -3.008  -17.413 3.649   1.00 0.00 ? 63 LYS A CB   6  
ATOM 6795  C CG   . LYS A 1 63 ? -1.872  -17.082 2.697   1.00 0.00 ? 63 LYS A CG   6  
ATOM 6796  C CD   . LYS A 1 63 ? -1.272  -18.338 2.087   1.00 0.00 ? 63 LYS A CD   6  
ATOM 6797  C CE   . LYS A 1 63 ? 0.073   -18.053 1.436   1.00 0.00 ? 63 LYS A CE   6  
ATOM 6798  N NZ   . LYS A 1 63 ? 1.143   -17.830 2.446   1.00 0.00 ? 63 LYS A NZ   6  
ATOM 6799  H H    . LYS A 1 63 ? -5.297  -16.157 2.847   1.00 0.00 ? 63 LYS A H    6  
ATOM 6800  H HA   . LYS A 1 63 ? -3.924  -18.679 2.186   1.00 0.00 ? 63 LYS A HA   6  
ATOM 6801  H HB2  . LYS A 1 63 ? -3.291  -16.509 4.167   1.00 0.00 ? 63 LYS A HB2  6  
ATOM 6802  H HB3  . LYS A 1 63 ? -2.647  -18.133 4.370   1.00 0.00 ? 63 LYS A HB3  6  
ATOM 6803  H HG2  . LYS A 1 63 ? -2.251  -16.456 1.903   1.00 0.00 ? 63 LYS A HG2  6  
ATOM 6804  H HG3  . LYS A 1 63 ? -1.102  -16.553 3.240   1.00 0.00 ? 63 LYS A HG3  6  
ATOM 6805  H HD2  . LYS A 1 63 ? -1.133  -19.075 2.865   1.00 0.00 ? 63 LYS A HD2  6  
ATOM 6806  H HD3  . LYS A 1 63 ? -1.950  -18.725 1.340   1.00 0.00 ? 63 LYS A HD3  6  
ATOM 6807  H HE2  . LYS A 1 63 ? 0.344   -18.895 0.817   1.00 0.00 ? 63 LYS A HE2  6  
ATOM 6808  H HE3  . LYS A 1 63 ? -0.020  -17.170 0.821   1.00 0.00 ? 63 LYS A HE3  6  
ATOM 6809  H HZ1  . LYS A 1 63 ? 0.822   -17.146 3.161   1.00 0.00 ? 63 LYS A HZ1  6  
ATOM 6810  H HZ2  . LYS A 1 63 ? 1.997   -17.457 1.986   1.00 0.00 ? 63 LYS A HZ2  6  
ATOM 6811  H HZ3  . LYS A 1 63 ? 1.380   -18.725 2.920   1.00 0.00 ? 63 LYS A HZ3  6  
ATOM 6812  N N    . LYS A 1 64 ? -6.114  -18.064 4.495   1.00 0.00 ? 64 LYS A N    6  
ATOM 6813  C CA   . LYS A 1 64 ? -7.014  -18.668 5.470   1.00 0.00 ? 64 LYS A CA   6  
ATOM 6814  C C    . LYS A 1 64 ? -8.304  -19.135 4.805   1.00 0.00 ? 64 LYS A C    6  
ATOM 6815  O O    . LYS A 1 64 ? -8.571  -18.807 3.648   1.00 0.00 ? 64 LYS A O    6  
ATOM 6816  C CB   . LYS A 1 64 ? -7.334  -17.671 6.586   1.00 0.00 ? 64 LYS A CB   6  
ATOM 6817  C CG   . LYS A 1 64 ? -6.363  -17.729 7.752   1.00 0.00 ? 64 LYS A CG   6  
ATOM 6818  C CD   . LYS A 1 64 ? -6.945  -17.081 8.996   1.00 0.00 ? 64 LYS A CD   6  
ATOM 6819  C CE   . LYS A 1 64 ? -5.961  -17.115 10.156  1.00 0.00 ? 64 LYS A CE   6  
ATOM 6820  N NZ   . LYS A 1 64 ? -5.896  -18.462 10.788  1.00 0.00 ? 64 LYS A NZ   6  
ATOM 6821  H H    . LYS A 1 64 ? -6.259  -17.132 4.224   1.00 0.00 ? 64 LYS A H    6  
ATOM 6822  H HA   . LYS A 1 64 ? -6.513  -19.524 5.897   1.00 0.00 ? 64 LYS A HA   6  
ATOM 6823  H HB2  . LYS A 1 64 ? -7.313  -16.672 6.176   1.00 0.00 ? 64 LYS A HB2  6  
ATOM 6824  H HB3  . LYS A 1 64 ? -8.327  -17.876 6.961   1.00 0.00 ? 64 LYS A HB3  6  
ATOM 6825  H HG2  . LYS A 1 64 ? -6.137  -18.763 7.970   1.00 0.00 ? 64 LYS A HG2  6  
ATOM 6826  H HG3  . LYS A 1 64 ? -5.455  -17.211 7.478   1.00 0.00 ? 64 LYS A HG3  6  
ATOM 6827  H HD2  . LYS A 1 64 ? -7.188  -16.052 8.776   1.00 0.00 ? 64 LYS A HD2  6  
ATOM 6828  H HD3  . LYS A 1 64 ? -7.843  -17.612 9.282   1.00 0.00 ? 64 LYS A HD3  6  
ATOM 6829  H HE2  . LYS A 1 64 ? -4.982  -16.852 9.787   1.00 0.00 ? 64 LYS A HE2  6  
ATOM 6830  H HE3  . LYS A 1 64 ? -6.273  -16.394 10.896  1.00 0.00 ? 64 LYS A HE3  6  
ATOM 6831  H HZ1  . LYS A 1 64 ? -6.248  -19.184 10.127  1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 6832  H HZ2  . LYS A 1 64 ? -6.480  -18.481 11.648  1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 6833  H HZ3  . LYS A 1 64 ? -4.914  -18.690 11.043  1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 6834  N N    . SER A 1 65 ? -9.103  -19.900 5.542   1.00 0.00 ? 65 SER A N    6  
ATOM 6835  C CA   . SER A 1 65 ? -10.364 -20.413 5.022   1.00 0.00 ? 65 SER A CA   6  
ATOM 6836  C C    . SER A 1 65 ? -11.534 -19.549 5.485   1.00 0.00 ? 65 SER A C    6  
ATOM 6837  O O    . SER A 1 65 ? -12.218 -19.878 6.453   1.00 0.00 ? 65 SER A O    6  
ATOM 6838  C CB   . SER A 1 65 ? -10.575 -21.860 5.471   1.00 0.00 ? 65 SER A CB   6  
ATOM 6839  O OG   . SER A 1 65 ? -11.569 -22.497 4.688   1.00 0.00 ? 65 SER A OG   6  
ATOM 6840  H H    . SER A 1 65 ? -8.835  -20.126 6.458   1.00 0.00 ? 65 SER A H    6  
ATOM 6841  H HA   . SER A 1 65 ? -10.315 -20.383 3.944   1.00 0.00 ? 65 SER A HA   6  
ATOM 6842  H HB2  . SER A 1 65 ? -9.649  -22.405 5.368   1.00 0.00 ? 65 SER A HB2  6  
ATOM 6843  H HB3  . SER A 1 65 ? -10.886 -21.871 6.506   1.00 0.00 ? 65 SER A HB3  6  
ATOM 6844  H HG   . SER A 1 65 ? -12.365 -22.614 5.213   1.00 0.00 ? 65 SER A HG   6  
ATOM 6845  N N    . GLY A 1 66 ? -11.757 -18.441 4.784   1.00 0.00 ? 66 GLY A N    6  
ATOM 6846  C CA   . GLY A 1 66 ? -12.844 -17.547 5.138   1.00 0.00 ? 66 GLY A CA   6  
ATOM 6847  C C    . GLY A 1 66 ? -13.491 -16.912 3.923   1.00 0.00 ? 66 GLY A C    6  
ATOM 6848  O O    . GLY A 1 66 ? -13.001 -17.030 2.799   1.00 0.00 ? 66 GLY A O    6  
ATOM 6849  H H    . GLY A 1 66 ? -11.179 -18.230 4.022   1.00 0.00 ? 66 GLY A H    6  
ATOM 6850  H HA2  . GLY A 1 66 ? -13.592 -18.104 5.681   1.00 0.00 ? 66 GLY A HA2  6  
ATOM 6851  H HA3  . GLY A 1 66 ? -12.458 -16.765 5.775   1.00 0.00 ? 66 GLY A HA3  6  
ATOM 6852  N N    . PRO A 1 67 ? -14.620 -16.222 4.141   1.00 0.00 ? 67 PRO A N    6  
ATOM 6853  C CA   . PRO A 1 67 ? -15.359 -15.553 3.066   1.00 0.00 ? 67 PRO A CA   6  
ATOM 6854  C C    . PRO A 1 67 ? -14.612 -14.345 2.513   1.00 0.00 ? 67 PRO A C    6  
ATOM 6855  O O    . PRO A 1 67 ? -13.974 -13.602 3.259   1.00 0.00 ? 67 PRO A O    6  
ATOM 6856  C CB   . PRO A 1 67 ? -16.657 -15.113 3.749   1.00 0.00 ? 67 PRO A CB   6  
ATOM 6857  C CG   . PRO A 1 67 ? -16.302 -14.987 5.191   1.00 0.00 ? 67 PRO A CG   6  
ATOM 6858  C CD   . PRO A 1 67 ? -15.261 -16.040 5.454   1.00 0.00 ? 67 PRO A CD   6  
ATOM 6859  H HA   . PRO A 1 67 ? -15.589 -16.234 2.260   1.00 0.00 ? 67 PRO A HA   6  
ATOM 6860  H HB2  . PRO A 1 67 ? -16.980 -14.167 3.338   1.00 0.00 ? 67 PRO A HB2  6  
ATOM 6861  H HB3  . PRO A 1 67 ? -17.421 -15.859 3.595   1.00 0.00 ? 67 PRO A HB3  6  
ATOM 6862  H HG2  . PRO A 1 67 ? -15.900 -14.005 5.386   1.00 0.00 ? 67 PRO A HG2  6  
ATOM 6863  H HG3  . PRO A 1 67 ? -17.176 -15.165 5.800   1.00 0.00 ? 67 PRO A HG3  6  
ATOM 6864  H HD2  . PRO A 1 67 ? -14.548 -15.691 6.186   1.00 0.00 ? 67 PRO A HD2  6  
ATOM 6865  H HD3  . PRO A 1 67 ? -15.726 -16.957 5.785   1.00 0.00 ? 67 PRO A HD3  6  
ATOM 6866  N N    . SER A 1 68 ? -14.695 -14.154 1.200   1.00 0.00 ? 68 SER A N    6  
ATOM 6867  C CA   . SER A 1 68 ? -14.024 -13.037 0.546   1.00 0.00 ? 68 SER A CA   6  
ATOM 6868  C C    . SER A 1 68 ? -14.997 -12.257 -0.332  1.00 0.00 ? 68 SER A C    6  
ATOM 6869  O O    . SER A 1 68 ? -15.735 -12.837 -1.128  1.00 0.00 ? 68 SER A O    6  
ATOM 6870  C CB   . SER A 1 68 ? -12.852 -13.543 -0.297  1.00 0.00 ? 68 SER A CB   6  
ATOM 6871  O OG   . SER A 1 68 ? -13.113 -14.838 -0.809  1.00 0.00 ? 68 SER A OG   6  
ATOM 6872  H H    . SER A 1 68 ? -15.219 -14.781 0.658   1.00 0.00 ? 68 SER A H    6  
ATOM 6873  H HA   . SER A 1 68 ? -13.646 -12.381 1.315   1.00 0.00 ? 68 SER A HA   6  
ATOM 6874  H HB2  . SER A 1 68 ? -12.689 -12.868 -1.124  1.00 0.00 ? 68 SER A HB2  6  
ATOM 6875  H HB3  . SER A 1 68 ? -11.962 -13.583 0.315   1.00 0.00 ? 68 SER A HB3  6  
ATOM 6876  H HG   . SER A 1 68 ? -13.100 -15.475 -0.091  1.00 0.00 ? 68 SER A HG   6  
ATOM 6877  N N    . SER A 1 69 ? -14.992 -10.936 -0.181  1.00 0.00 ? 69 SER A N    6  
ATOM 6878  C CA   . SER A 1 69 ? -15.877 -10.075 -0.956  1.00 0.00 ? 69 SER A CA   6  
ATOM 6879  C C    . SER A 1 69 ? -15.328 -9.858  -2.363  1.00 0.00 ? 69 SER A C    6  
ATOM 6880  O O    . SER A 1 69 ? -14.288 -9.228  -2.546  1.00 0.00 ? 69 SER A O    6  
ATOM 6881  C CB   . SER A 1 69 ? -16.057 -8.728  -0.254  1.00 0.00 ? 69 SER A CB   6  
ATOM 6882  O OG   . SER A 1 69 ? -16.727 -8.884  0.985   1.00 0.00 ? 69 SER A OG   6  
ATOM 6883  H H    . SER A 1 69 ? -14.381 -10.532 0.470   1.00 0.00 ? 69 SER A H    6  
ATOM 6884  H HA   . SER A 1 69 ? -16.837 -10.564 -1.028  1.00 0.00 ? 69 SER A HA   6  
ATOM 6885  H HB2  . SER A 1 69 ? -15.088 -8.287  -0.072  1.00 0.00 ? 69 SER A HB2  6  
ATOM 6886  H HB3  . SER A 1 69 ? -16.638 -8.071  -0.884  1.00 0.00 ? 69 SER A HB3  6  
ATOM 6887  H HG   . SER A 1 69 ? -16.832 -8.026  1.403   1.00 0.00 ? 69 SER A HG   6  
ATOM 6888  N N    . GLY A 1 70 ? -16.038 -10.386 -3.356  1.00 0.00 ? 70 GLY A N    6  
ATOM 6889  C CA   . GLY A 1 70 ? -15.607 -10.241 -4.734  1.00 0.00 ? 70 GLY A CA   6  
ATOM 6890  C C    . GLY A 1 70 ? -14.595 -11.295 -5.140  1.00 0.00 ? 70 GLY A C    6  
ATOM 6891  O O    . GLY A 1 70 ? -14.960 -12.431 -5.441  1.00 0.00 ? 70 GLY A O    6  
ATOM 6892  H H    . GLY A 1 70 ? -16.860 -10.879 -3.151  1.00 0.00 ? 70 GLY A H    6  
ATOM 6893  H HA2  . GLY A 1 70 ? -16.469 -10.317 -5.380  1.00 0.00 ? 70 GLY A HA2  6  
ATOM 6894  H HA3  . GLY A 1 70 ? -15.162 -9.265  -4.859  1.00 0.00 ? 70 GLY A HA3  6  
ATOM 6895  N N    . GLY A 1 1  ? -3.850  22.179  24.956  1.00 0.00 ? 1  GLY A N    7  
ATOM 6896  C CA   . GLY A 1 1  ? -4.000  20.746  25.132  1.00 0.00 ? 1  GLY A CA   7  
ATOM 6897  C C    . GLY A 1 1  ? -4.735  20.093  23.978  1.00 0.00 ? 1  GLY A C    7  
ATOM 6898  O O    . GLY A 1 1  ? -5.112  20.762  23.016  1.00 0.00 ? 1  GLY A O    7  
ATOM 6899  H H1   . GLY A 1 1  ? -3.000  22.544  24.630  1.00 0.00 ? 1  GLY A H1   7  
ATOM 6900  H HA2  . GLY A 1 1  ? -3.020  20.300  25.220  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 6901  H HA3  . GLY A 1 1  ? -4.550  20.563  26.044  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 6902  N N    . SER A 1 2  ? -4.936  18.783  24.073  1.00 0.00 ? 2  SER A N    7  
ATOM 6903  C CA   . SER A 1 2  ? -5.626  18.039  23.025  1.00 0.00 ? 2  SER A CA   7  
ATOM 6904  C C    . SER A 1 2  ? -6.531  16.967  23.626  1.00 0.00 ? 2  SER A C    7  
ATOM 6905  O O    . SER A 1 2  ? -6.095  16.160  24.447  1.00 0.00 ? 2  SER A O    7  
ATOM 6906  C CB   . SER A 1 2  ? -4.613  17.394  22.077  1.00 0.00 ? 2  SER A CB   7  
ATOM 6907  O OG   . SER A 1 2  ? -3.967  16.293  22.693  1.00 0.00 ? 2  SER A OG   7  
ATOM 6908  H H    . SER A 1 2  ? -4.611  18.305  24.864  1.00 0.00 ? 2  SER A H    7  
ATOM 6909  H HA   . SER A 1 2  ? -6.234  18.736  22.469  1.00 0.00 ? 2  SER A HA   7  
ATOM 6910  H HB2  . SER A 1 2  ? -5.123  17.046  21.192  1.00 0.00 ? 2  SER A HB2  7  
ATOM 6911  H HB3  . SER A 1 2  ? -3.867  18.125  21.800  1.00 0.00 ? 2  SER A HB3  7  
ATOM 6912  H HG   . SER A 1 2  ? -3.761  15.630  22.030  1.00 0.00 ? 2  SER A HG   7  
ATOM 6913  N N    . SER A 1 3  ? -7.793  16.967  23.211  1.00 0.00 ? 3  SER A N    7  
ATOM 6914  C CA   . SER A 1 3  ? -8.762  15.998  23.710  1.00 0.00 ? 3  SER A CA   7  
ATOM 6915  C C    . SER A 1 3  ? -9.114  14.977  22.632  1.00 0.00 ? 3  SER A C    7  
ATOM 6916  O O    . SER A 1 3  ? -8.703  15.107  21.480  1.00 0.00 ? 3  SER A O    7  
ATOM 6917  C CB   . SER A 1 3  ? -10.029 16.711  24.187  1.00 0.00 ? 3  SER A CB   7  
ATOM 6918  O OG   . SER A 1 3  ? -9.785  17.446  25.373  1.00 0.00 ? 3  SER A OG   7  
ATOM 6919  H H    . SER A 1 3  ? -8.080  17.636  22.555  1.00 0.00 ? 3  SER A H    7  
ATOM 6920  H HA   . SER A 1 3  ? -8.314  15.481  24.546  1.00 0.00 ? 3  SER A HA   7  
ATOM 6921  H HB2  . SER A 1 3  ? -10.366 17.391  23.420  1.00 0.00 ? 3  SER A HB2  7  
ATOM 6922  H HB3  . SER A 1 3  ? -10.799 15.978  24.383  1.00 0.00 ? 3  SER A HB3  7  
ATOM 6923  H HG   . SER A 1 3  ? -10.618 17.753  25.738  1.00 0.00 ? 3  SER A HG   7  
ATOM 6924  N N    . GLY A 1 4  ? -9.879  13.960  23.017  1.00 0.00 ? 4  GLY A N    7  
ATOM 6925  C CA   . GLY A 1 4  ? -10.275 12.931  22.073  1.00 0.00 ? 4  GLY A CA   7  
ATOM 6926  C C    . GLY A 1 4  ? -11.312 11.986  22.646  1.00 0.00 ? 4  GLY A C    7  
ATOM 6927  O O    . GLY A 1 4  ? -11.500 11.922  23.861  1.00 0.00 ? 4  GLY A O    7  
ATOM 6928  H H    . GLY A 1 4  ? -10.178 13.908  23.949  1.00 0.00 ? 4  GLY A H    7  
ATOM 6929  H HA2  . GLY A 1 4  ? -10.681 13.403  21.191  1.00 0.00 ? 4  GLY A HA2  7  
ATOM 6930  H HA3  . GLY A 1 4  ? -9.401  12.360  21.793  1.00 0.00 ? 4  GLY A HA3  7  
ATOM 6931  N N    . SER A 1 5  ? -11.989 11.250  21.770  1.00 0.00 ? 5  SER A N    7  
ATOM 6932  C CA   . SER A 1 5  ? -13.017 10.308  22.196  1.00 0.00 ? 5  SER A CA   7  
ATOM 6933  C C    . SER A 1 5  ? -13.218 9.214   21.151  1.00 0.00 ? 5  SER A C    7  
ATOM 6934  O O    . SER A 1 5  ? -13.093 9.457   19.951  1.00 0.00 ? 5  SER A O    7  
ATOM 6935  C CB   . SER A 1 5  ? -14.338 11.040  22.444  1.00 0.00 ? 5  SER A CB   7  
ATOM 6936  O OG   . SER A 1 5  ? -14.402 11.539  23.769  1.00 0.00 ? 5  SER A OG   7  
ATOM 6937  H H    . SER A 1 5  ? -11.794 11.346  20.814  1.00 0.00 ? 5  SER A H    7  
ATOM 6938  H HA   . SER A 1 5  ? -12.689 9.853   23.118  1.00 0.00 ? 5  SER A HA   7  
ATOM 6939  H HB2  . SER A 1 5  ? -14.423 11.867  21.756  1.00 0.00 ? 5  SER A HB2  7  
ATOM 6940  H HB3  . SER A 1 5  ? -15.160 10.356  22.290  1.00 0.00 ? 5  SER A HB3  7  
ATOM 6941  H HG   . SER A 1 5  ? -14.774 10.868  24.347  1.00 0.00 ? 5  SER A HG   7  
ATOM 6942  N N    . SER A 1 6  ? -13.530 8.009   21.617  1.00 0.00 ? 6  SER A N    7  
ATOM 6943  C CA   . SER A 1 6  ? -13.744 6.876   20.725  1.00 0.00 ? 6  SER A CA   7  
ATOM 6944  C C    . SER A 1 6  ? -15.071 6.188   21.030  1.00 0.00 ? 6  SER A C    7  
ATOM 6945  O O    . SER A 1 6  ? -15.838 6.642   21.878  1.00 0.00 ? 6  SER A O    7  
ATOM 6946  C CB   . SER A 1 6  ? -12.595 5.874   20.854  1.00 0.00 ? 6  SER A CB   7  
ATOM 6947  O OG   . SER A 1 6  ? -12.527 5.343   22.166  1.00 0.00 ? 6  SER A OG   7  
ATOM 6948  H H    . SER A 1 6  ? -13.615 7.879   22.585  1.00 0.00 ? 6  SER A H    7  
ATOM 6949  H HA   . SER A 1 6  ? -13.771 7.252   19.713  1.00 0.00 ? 6  SER A HA   7  
ATOM 6950  H HB2  . SER A 1 6  ? -12.748 5.064   20.158  1.00 0.00 ? 6  SER A HB2  7  
ATOM 6951  H HB3  . SER A 1 6  ? -11.662 6.370   20.629  1.00 0.00 ? 6  SER A HB3  7  
ATOM 6952  H HG   . SER A 1 6  ? -12.604 4.387   22.128  1.00 0.00 ? 6  SER A HG   7  
ATOM 6953  N N    . GLY A 1 7  ? -15.335 5.088   20.330  1.00 0.00 ? 7  GLY A N    7  
ATOM 6954  C CA   . GLY A 1 7  ? -16.569 4.354   20.540  1.00 0.00 ? 7  GLY A CA   7  
ATOM 6955  C C    . GLY A 1 7  ? -17.317 4.098   19.247  1.00 0.00 ? 7  GLY A C    7  
ATOM 6956  O O    . GLY A 1 7  ? -17.995 3.080   19.105  1.00 0.00 ? 7  GLY A O    7  
ATOM 6957  H H    . GLY A 1 7  ? -14.686 4.773   19.667  1.00 0.00 ? 7  GLY A H    7  
ATOM 6958  H HA2  . GLY A 1 7  ? -16.338 3.407   21.003  1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6959  H HA3  . GLY A 1 7  ? -17.204 4.923   21.203  1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6960  N N    . ARG A 1 8  ? -17.196 5.024   18.301  1.00 0.00 ? 8  ARG A N    7  
ATOM 6961  C CA   . ARG A 1 8  ? -17.869 4.895   17.014  1.00 0.00 ? 8  ARG A CA   7  
ATOM 6962  C C    . ARG A 1 8  ? -17.150 3.886   16.123  1.00 0.00 ? 8  ARG A C    7  
ATOM 6963  O O    . ARG A 1 8  ? -16.014 3.498   16.397  1.00 0.00 ? 8  ARG A O    7  
ATOM 6964  C CB   . ARG A 1 8  ? -17.940 6.252   16.313  1.00 0.00 ? 8  ARG A CB   7  
ATOM 6965  C CG   . ARG A 1 8  ? -18.901 7.229   16.971  1.00 0.00 ? 8  ARG A CG   7  
ATOM 6966  C CD   . ARG A 1 8  ? -18.756 8.628   16.392  1.00 0.00 ? 8  ARG A CD   7  
ATOM 6967  N NE   . ARG A 1 8  ? -18.811 8.624   14.933  1.00 0.00 ? 8  ARG A NE   7  
ATOM 6968  C CZ   . ARG A 1 8  ? -18.634 9.710   14.188  1.00 0.00 ? 8  ARG A CZ   7  
ATOM 6969  N NH1  . ARG A 1 8  ? -18.391 10.880  14.763  1.00 0.00 ? 8  ARG A NH1  7  
ATOM 6970  N NH2  . ARG A 1 8  ? -18.698 9.627   12.865  1.00 0.00 ? 8  ARG A NH2  7  
ATOM 6971  H H    . ARG A 1 8  ? -16.642 5.814   18.473  1.00 0.00 ? 8  ARG A H    7  
ATOM 6972  H HA   . ARG A 1 8  ? -18.873 4.542   17.199  1.00 0.00 ? 8  ARG A HA   7  
ATOM 6973  H HB2  . ARG A 1 8  ? -16.955 6.696   16.312  1.00 0.00 ? 8  ARG A HB2  7  
ATOM 6974  H HB3  . ARG A 1 8  ? -18.258 6.100   15.292  1.00 0.00 ? 8  ARG A HB3  7  
ATOM 6975  H HG2  . ARG A 1 8  ? -19.913 6.887   16.810  1.00 0.00 ? 8  ARG A HG2  7  
ATOM 6976  H HG3  . ARG A 1 8  ? -18.694 7.264   18.030  1.00 0.00 ? 8  ARG A HG3  7  
ATOM 6977  H HD2  . ARG A 1 8  ? -19.558 9.244   16.771  1.00 0.00 ? 8  ARG A HD2  7  
ATOM 6978  H HD3  . ARG A 1 8  ? -17.808 9.037   16.707  1.00 0.00 ? 8  ARG A HD3  7  
ATOM 6979  H HE   . ARG A 1 8  ? -18.989 7.771   14.487  1.00 0.00 ? 8  ARG A HE   7  
ATOM 6980  H HH11 . ARG A 1 8  ? -18.341 10.945  15.760  1.00 0.00 ? 8  ARG A HH11 7  
ATOM 6981  H HH12 . ARG A 1 8  ? -18.256 11.696  14.200  1.00 0.00 ? 8  ARG A HH12 7  
ATOM 6982  H HH21 . ARG A 1 8  ? -18.881 8.747   12.428  1.00 0.00 ? 8  ARG A HH21 7  
ATOM 6983  H HH22 . ARG A 1 8  ? -18.565 10.445  12.306  1.00 0.00 ? 8  ARG A HH22 7  
ATOM 6984  N N    . LYS A 1 9  ? -17.819 3.465   15.056  1.00 0.00 ? 9  LYS A N    7  
ATOM 6985  C CA   . LYS A 1 9  ? -17.245 2.502   14.123  1.00 0.00 ? 9  LYS A CA   7  
ATOM 6986  C C    . LYS A 1 9  ? -17.066 3.123   12.742  1.00 0.00 ? 9  LYS A C    7  
ATOM 6987  O O    . LYS A 1 9  ? -17.783 4.052   12.369  1.00 0.00 ? 9  LYS A O    7  
ATOM 6988  C CB   . LYS A 1 9  ? -18.137 1.262   14.025  1.00 0.00 ? 9  LYS A CB   7  
ATOM 6989  C CG   . LYS A 1 9  ? -19.532 1.556   13.501  1.00 0.00 ? 9  LYS A CG   7  
ATOM 6990  C CD   . LYS A 1 9  ? -20.503 1.845   14.633  1.00 0.00 ? 9  LYS A CD   7  
ATOM 6991  C CE   . LYS A 1 9  ? -21.934 1.512   14.239  1.00 0.00 ? 9  LYS A CE   7  
ATOM 6992  N NZ   . LYS A 1 9  ? -22.289 0.106   14.577  1.00 0.00 ? 9  LYS A NZ   7  
ATOM 6993  H H    . LYS A 1 9  ? -18.722 3.810   14.890  1.00 0.00 ? 9  LYS A H    7  
ATOM 6994  H HA   . LYS A 1 9  ? -16.277 2.210   14.502  1.00 0.00 ? 9  LYS A HA   7  
ATOM 6995  H HB2  . LYS A 1 9  ? -17.669 0.549   13.362  1.00 0.00 ? 9  LYS A HB2  7  
ATOM 6996  H HB3  . LYS A 1 9  ? -18.229 0.821   15.007  1.00 0.00 ? 9  LYS A HB3  7  
ATOM 6997  H HG2  . LYS A 1 9  ? -19.488 2.417   12.850  1.00 0.00 ? 9  LYS A HG2  7  
ATOM 6998  H HG3  . LYS A 1 9  ? -19.885 0.699   12.945  1.00 0.00 ? 9  LYS A HG3  7  
ATOM 6999  H HD2  . LYS A 1 9  ? -20.230 1.249   15.491  1.00 0.00 ? 9  LYS A HD2  7  
ATOM 7000  H HD3  . LYS A 1 9  ? -20.444 2.894   14.887  1.00 0.00 ? 9  LYS A HD3  7  
ATOM 7001  H HE2  . LYS A 1 9  ? -22.602 2.179   14.761  1.00 0.00 ? 9  LYS A HE2  7  
ATOM 7002  H HE3  . LYS A 1 9  ? -22.042 1.656   13.174  1.00 0.00 ? 9  LYS A HE3  7  
ATOM 7003  H HZ1  . LYS A 1 9  ? -22.811 -0.329  13.789  1.00 0.00 ? 9  LYS A HZ1  7  
ATOM 7004  H HZ2  . LYS A 1 9  ? -22.886 0.084   15.428  1.00 0.00 ? 9  LYS A HZ2  7  
ATOM 7005  H HZ3  . LYS A 1 9  ? -21.427 -0.447  14.756  1.00 0.00 ? 9  LYS A HZ3  7  
ATOM 7006  N N    . LYS A 1 10 ? -16.105 2.604   11.985  1.00 0.00 ? 10 LYS A N    7  
ATOM 7007  C CA   . LYS A 1 10 ? -15.832 3.106   10.643  1.00 0.00 ? 10 LYS A CA   7  
ATOM 7008  C C    . LYS A 1 10 ? -15.566 1.956   9.676   1.00 0.00 ? 10 LYS A C    7  
ATOM 7009  O O    . LYS A 1 10 ? -15.484 0.797   10.083  1.00 0.00 ? 10 LYS A O    7  
ATOM 7010  C CB   . LYS A 1 10 ? -14.632 4.055   10.665  1.00 0.00 ? 10 LYS A CB   7  
ATOM 7011  C CG   . LYS A 1 10 ? -13.359 3.415   11.191  1.00 0.00 ? 10 LYS A CG   7  
ATOM 7012  C CD   . LYS A 1 10 ? -12.121 4.107   10.646  1.00 0.00 ? 10 LYS A CD   7  
ATOM 7013  C CE   . LYS A 1 10 ? -11.968 5.507   11.219  1.00 0.00 ? 10 LYS A CE   7  
ATOM 7014  N NZ   . LYS A 1 10 ? -12.747 6.512   10.444  1.00 0.00 ? 10 LYS A NZ   7  
ATOM 7015  H H    . LYS A 1 10 ? -15.566 1.865   12.337  1.00 0.00 ? 10 LYS A H    7  
ATOM 7016  H HA   . LYS A 1 10 ? -16.704 3.648   10.308  1.00 0.00 ? 10 LYS A HA   7  
ATOM 7017  H HB2  . LYS A 1 10 ? -14.447 4.404   9.660   1.00 0.00 ? 10 LYS A HB2  7  
ATOM 7018  H HB3  . LYS A 1 10 ? -14.870 4.902   11.293  1.00 0.00 ? 10 LYS A HB3  7  
ATOM 7019  H HG2  . LYS A 1 10 ? -13.351 3.483   12.268  1.00 0.00 ? 10 LYS A HG2  7  
ATOM 7020  H HG3  . LYS A 1 10 ? -13.341 2.376   10.893  1.00 0.00 ? 10 LYS A HG3  7  
ATOM 7021  H HD2  . LYS A 1 10 ? -11.250 3.526   10.908  1.00 0.00 ? 10 LYS A HD2  7  
ATOM 7022  H HD3  . LYS A 1 10 ? -12.201 4.174   9.570   1.00 0.00 ? 10 LYS A HD3  7  
ATOM 7023  H HE2  . LYS A 1 10 ? -12.316 5.504   12.240  1.00 0.00 ? 10 LYS A HE2  7  
ATOM 7024  H HE3  . LYS A 1 10 ? -10.923 5.779   11.195  1.00 0.00 ? 10 LYS A HE3  7  
ATOM 7025  H HZ1  . LYS A 1 10 ? -13.116 6.082   9.571   1.00 0.00 ? 10 LYS A HZ1  7  
ATOM 7026  H HZ2  . LYS A 1 10 ? -12.140 7.317   10.190  1.00 0.00 ? 10 LYS A HZ2  7  
ATOM 7027  H HZ3  . LYS A 1 10 ? -13.546 6.860   11.011  1.00 0.00 ? 10 LYS A HZ3  7  
ATOM 7028  N N    . ARG A 1 11 ? -15.432 2.285   8.396   1.00 0.00 ? 11 ARG A N    7  
ATOM 7029  C CA   . ARG A 1 11 ? -15.175 1.279   7.372   1.00 0.00 ? 11 ARG A CA   7  
ATOM 7030  C C    . ARG A 1 11 ? -13.677 1.122   7.128   1.00 0.00 ? 11 ARG A C    7  
ATOM 7031  O O    . ARG A 1 11 ? -12.857 1.652   7.878   1.00 0.00 ? 11 ARG A O    7  
ATOM 7032  C CB   . ARG A 1 11 ? -15.878 1.658   6.067   1.00 0.00 ? 11 ARG A CB   7  
ATOM 7033  C CG   . ARG A 1 11 ? -17.335 2.048   6.251   1.00 0.00 ? 11 ARG A CG   7  
ATOM 7034  C CD   . ARG A 1 11 ? -18.046 2.194   4.915   1.00 0.00 ? 11 ARG A CD   7  
ATOM 7035  N NE   . ARG A 1 11 ? -17.611 3.385   4.191   1.00 0.00 ? 11 ARG A NE   7  
ATOM 7036  C CZ   . ARG A 1 11 ? -18.053 4.609   4.457   1.00 0.00 ? 11 ARG A CZ   7  
ATOM 7037  N NH1  . ARG A 1 11 ? -18.937 4.802   5.426   1.00 0.00 ? 11 ARG A NH1  7  
ATOM 7038  N NH2  . ARG A 1 11 ? -17.610 5.644   3.754   1.00 0.00 ? 11 ARG A NH2  7  
ATOM 7039  H H    . ARG A 1 11 ? -15.508 3.226   8.133   1.00 0.00 ? 11 ARG A H    7  
ATOM 7040  H HA   . ARG A 1 11 ? -15.571 0.338   7.723   1.00 0.00 ? 11 ARG A HA   7  
ATOM 7041  H HB2  . ARG A 1 11 ? -15.358 2.494   5.621   1.00 0.00 ? 11 ARG A HB2  7  
ATOM 7042  H HB3  . ARG A 1 11 ? -15.835 0.817   5.392   1.00 0.00 ? 11 ARG A HB3  7  
ATOM 7043  H HG2  . ARG A 1 11 ? -17.833 1.283   6.829   1.00 0.00 ? 11 ARG A HG2  7  
ATOM 7044  H HG3  . ARG A 1 11 ? -17.382 2.989   6.779   1.00 0.00 ? 11 ARG A HG3  7  
ATOM 7045  H HD2  . ARG A 1 11 ? -17.836 1.322   4.313   1.00 0.00 ? 11 ARG A HD2  7  
ATOM 7046  H HD3  . ARG A 1 11 ? -19.109 2.260   5.093   1.00 0.00 ? 11 ARG A HD3  7  
ATOM 7047  H HE   . ARG A 1 11 ? -16.958 3.266   3.470   1.00 0.00 ? 11 ARG A HE   7  
ATOM 7048  H HH11 . ARG A 1 11 ? -19.272 4.025   5.958   1.00 0.00 ? 11 ARG A HH11 7  
ATOM 7049  H HH12 . ARG A 1 11 ? -19.268 5.725   5.625   1.00 0.00 ? 11 ARG A HH12 7  
ATOM 7050  H HH21 . ARG A 1 11 ? -16.943 5.502   3.023   1.00 0.00 ? 11 ARG A HH21 7  
ATOM 7051  H HH22 . ARG A 1 11 ? -17.943 6.564   3.955   1.00 0.00 ? 11 ARG A HH22 7  
ATOM 7052  N N    . ILE A 1 12 ? -13.328 0.390   6.076   1.00 0.00 ? 12 ILE A N    7  
ATOM 7053  C CA   . ILE A 1 12 ? -11.929 0.164   5.733   1.00 0.00 ? 12 ILE A CA   7  
ATOM 7054  C C    . ILE A 1 12 ? -11.161 1.479   5.660   1.00 0.00 ? 12 ILE A C    7  
ATOM 7055  O O    . ILE A 1 12 ? -11.622 2.464   5.084   1.00 0.00 ? 12 ILE A O    7  
ATOM 7056  C CB   . ILE A 1 12 ? -11.791 -0.574  4.388   1.00 0.00 ? 12 ILE A CB   7  
ATOM 7057  C CG1  . ILE A 1 12 ? -12.556 -1.899  4.427   1.00 0.00 ? 12 ILE A CG1  7  
ATOM 7058  C CG2  . ILE A 1 12 ? -10.324 -0.813  4.064   1.00 0.00 ? 12 ILE A CG2  7  
ATOM 7059  C CD1  . ILE A 1 12 ? -12.078 -2.841  5.510   1.00 0.00 ? 12 ILE A CD1  7  
ATOM 7060  H H    . ILE A 1 12 ? -14.027 -0.007  5.516   1.00 0.00 ? 12 ILE A H    7  
ATOM 7061  H HA   . ILE A 1 12 ? -11.493 -0.453  6.506   1.00 0.00 ? 12 ILE A HA   7  
ATOM 7062  H HB   . ILE A 1 12 ? -12.209 0.052   3.615   1.00 0.00 ? 12 ILE A HB   7  
ATOM 7063  H HG12 . ILE A 1 12 ? -13.602 -1.698  4.600   1.00 0.00 ? 12 ILE A HG12 7  
ATOM 7064  H HG13 . ILE A 1 12 ? -12.442 -2.399  3.477   1.00 0.00 ? 12 ILE A HG13 7  
ATOM 7065  H HG21 . ILE A 1 12 ? -10.239 -1.238  3.074   1.00 0.00 ? 12 ILE A HG21 7  
ATOM 7066  H HG22 . ILE A 1 12 ? -9.791  0.125   4.098   1.00 0.00 ? 12 ILE A HG22 7  
ATOM 7067  H HG23 . ILE A 1 12 ? -9.901  -1.495  4.786   1.00 0.00 ? 12 ILE A HG23 7  
ATOM 7068  H HD11 . ILE A 1 12 ? -12.664 -3.748  5.482   1.00 0.00 ? 12 ILE A HD11 7  
ATOM 7069  H HD12 . ILE A 1 12 ? -11.038 -3.077  5.349   1.00 0.00 ? 12 ILE A HD12 7  
ATOM 7070  H HD13 . ILE A 1 12 ? -12.195 -2.368  6.475   1.00 0.00 ? 12 ILE A HD13 7  
ATOM 7071  N N    . PRO A 1 13 ? -9.960  1.497   6.256   1.00 0.00 ? 13 PRO A N    7  
ATOM 7072  C CA   . PRO A 1 13 ? -9.101  2.684   6.270   1.00 0.00 ? 13 PRO A CA   7  
ATOM 7073  C C    . PRO A 1 13 ? -8.340  2.865   4.961   1.00 0.00 ? 13 PRO A C    7  
ATOM 7074  O O    . PRO A 1 13 ? -8.609  2.178   3.976   1.00 0.00 ? 13 PRO A O    7  
ATOM 7075  C CB   . PRO A 1 13 ? -8.129  2.406   7.420   1.00 0.00 ? 13 PRO A CB   7  
ATOM 7076  C CG   . PRO A 1 13 ? -8.076  0.920   7.519   1.00 0.00 ? 13 PRO A CG   7  
ATOM 7077  C CD   . PRO A 1 13 ? -9.347  0.359   6.962   1.00 0.00 ? 13 PRO A CD   7  
ATOM 7078  H HA   . PRO A 1 13 ? -9.666  3.580   6.483   1.00 0.00 ? 13 PRO A HA   7  
ATOM 7079  H HB2  . PRO A 1 13 ? -7.160  2.822   7.184   1.00 0.00 ? 13 PRO A HB2  7  
ATOM 7080  H HB3  . PRO A 1 13 ? -8.506  2.849   8.330   1.00 0.00 ? 13 PRO A HB3  7  
ATOM 7081  H HG2  . PRO A 1 13 ? -7.250  0.543   6.937   1.00 0.00 ? 13 PRO A HG2  7  
ATOM 7082  H HG3  . PRO A 1 13 ? -7.974  0.625   8.553   1.00 0.00 ? 13 PRO A HG3  7  
ATOM 7083  H HD2  . PRO A 1 13 ? -9.101  -0.435  6.272   1.00 0.00 ? 13 PRO A HD2  7  
ATOM 7084  H HD3  . PRO A 1 13 ? -9.999  -0.006  7.742   1.00 0.00 ? 13 PRO A HD3  7  
ATOM 7085  N N    . TYR A 1 14 ? -7.388  3.792   4.959   1.00 0.00 ? 14 TYR A N    7  
ATOM 7086  C CA   . TYR A 1 14 ? -6.589  4.064   3.770   1.00 0.00 ? 14 TYR A CA   7  
ATOM 7087  C C    . TYR A 1 14 ? -7.459  4.609   2.642   1.00 0.00 ? 14 TYR A C    7  
ATOM 7088  O O    . TYR A 1 14 ? -8.294  3.895   2.086   1.00 0.00 ? 14 TYR A O    7  
ATOM 7089  C CB   . TYR A 1 14 ? -5.874  2.792   3.309   1.00 0.00 ? 14 TYR A CB   7  
ATOM 7090  C CG   . TYR A 1 14 ? -5.159  2.062   4.423   1.00 0.00 ? 14 TYR A CG   7  
ATOM 7091  C CD1  . TYR A 1 14 ? -4.070  2.635   5.069   1.00 0.00 ? 14 TYR A CD1  7  
ATOM 7092  C CD2  . TYR A 1 14 ? -5.572  0.799   4.830   1.00 0.00 ? 14 TYR A CD2  7  
ATOM 7093  C CE1  . TYR A 1 14 ? -3.413  1.971   6.087   1.00 0.00 ? 14 TYR A CE1  7  
ATOM 7094  C CE2  . TYR A 1 14 ? -4.922  0.128   5.847   1.00 0.00 ? 14 TYR A CE2  7  
ATOM 7095  C CZ   . TYR A 1 14 ? -3.843  0.718   6.473   1.00 0.00 ? 14 TYR A CZ   7  
ATOM 7096  O OH   . TYR A 1 14 ? -3.192  0.054   7.487   1.00 0.00 ? 14 TYR A OH   7  
ATOM 7097  H H    . TYR A 1 14 ? -7.220  4.307   5.775   1.00 0.00 ? 14 TYR A H    7  
ATOM 7098  H HA   . TYR A 1 14 ? -5.849  4.807   4.030   1.00 0.00 ? 14 TYR A HA   7  
ATOM 7099  H HB2  . TYR A 1 14 ? -6.598  2.116   2.881   1.00 0.00 ? 14 TYR A HB2  7  
ATOM 7100  H HB3  . TYR A 1 14 ? -5.142  3.051   2.558   1.00 0.00 ? 14 TYR A HB3  7  
ATOM 7101  H HD1  . TYR A 1 14 ? -3.737  3.617   4.765   1.00 0.00 ? 14 TYR A HD1  7  
ATOM 7102  H HD2  . TYR A 1 14 ? -6.417  0.340   4.338   1.00 0.00 ? 14 TYR A HD2  7  
ATOM 7103  H HE1  . TYR A 1 14 ? -2.569  2.432   6.577   1.00 0.00 ? 14 TYR A HE1  7  
ATOM 7104  H HE2  . TYR A 1 14 ? -5.258  -0.853  6.150   1.00 0.00 ? 14 TYR A HE2  7  
ATOM 7105  H HH   . TYR A 1 14 ? -2.623  0.667   7.957   1.00 0.00 ? 14 TYR A HH   7  
ATOM 7106  N N    . SER A 1 15 ? -7.256  5.880   2.308   1.00 0.00 ? 15 SER A N    7  
ATOM 7107  C CA   . SER A 1 15 ? -8.024  6.524   1.249   1.00 0.00 ? 15 SER A CA   7  
ATOM 7108  C C    . SER A 1 15 ? -7.564  6.042   -0.124  1.00 0.00 ? 15 SER A C    7  
ATOM 7109  O O    . SER A 1 15 ? -6.488  5.460   -0.263  1.00 0.00 ? 15 SER A O    7  
ATOM 7110  C CB   . SER A 1 15 ? -7.885  8.044   1.341   1.00 0.00 ? 15 SER A CB   7  
ATOM 7111  O OG   . SER A 1 15 ? -8.740  8.575   2.339   1.00 0.00 ? 15 SER A OG   7  
ATOM 7112  H H    . SER A 1 15 ? -6.576  6.397   2.789   1.00 0.00 ? 15 SER A H    7  
ATOM 7113  H HA   . SER A 1 15 ? -9.061  6.257   1.382   1.00 0.00 ? 15 SER A HA   7  
ATOM 7114  H HB2  . SER A 1 15 ? -6.865  8.296   1.588   1.00 0.00 ? 15 SER A HB2  7  
ATOM 7115  H HB3  . SER A 1 15 ? -8.144  8.485   0.390   1.00 0.00 ? 15 SER A HB3  7  
ATOM 7116  H HG   . SER A 1 15 ? -9.468  9.041   1.922   1.00 0.00 ? 15 SER A HG   7  
ATOM 7117  N N    . LYS A 1 16 ? -8.387  6.290   -1.137  1.00 0.00 ? 16 LYS A N    7  
ATOM 7118  C CA   . LYS A 1 16 ? -8.067  5.884   -2.501  1.00 0.00 ? 16 LYS A CA   7  
ATOM 7119  C C    . LYS A 1 16 ? -6.677  6.369   -2.900  1.00 0.00 ? 16 LYS A C    7  
ATOM 7120  O O    . LYS A 1 16 ? -5.964  5.694   -3.642  1.00 0.00 ? 16 LYS A O    7  
ATOM 7121  C CB   . LYS A 1 16 ? -9.110  6.434   -3.476  1.00 0.00 ? 16 LYS A CB   7  
ATOM 7122  C CG   . LYS A 1 16 ? -10.441 5.705   -3.418  1.00 0.00 ? 16 LYS A CG   7  
ATOM 7123  C CD   . LYS A 1 16 ? -11.438 6.283   -4.408  1.00 0.00 ? 16 LYS A CD   7  
ATOM 7124  C CE   . LYS A 1 16 ? -11.166 5.794   -5.823  1.00 0.00 ? 16 LYS A CE   7  
ATOM 7125  N NZ   . LYS A 1 16 ? -11.996 6.514   -6.828  1.00 0.00 ? 16 LYS A NZ   7  
ATOM 7126  H H    . LYS A 1 16 ? -9.231  6.758   -0.964  1.00 0.00 ? 16 LYS A H    7  
ATOM 7127  H HA   . LYS A 1 16 ? -8.084  4.806   -2.539  1.00 0.00 ? 16 LYS A HA   7  
ATOM 7128  H HB2  . LYS A 1 16 ? -9.284  7.475   -3.250  1.00 0.00 ? 16 LYS A HB2  7  
ATOM 7129  H HB3  . LYS A 1 16 ? -8.723  6.352   -4.482  1.00 0.00 ? 16 LYS A HB3  7  
ATOM 7130  H HG2  . LYS A 1 16 ? -10.282 4.662   -3.652  1.00 0.00 ? 16 LYS A HG2  7  
ATOM 7131  H HG3  . LYS A 1 16 ? -10.847 5.794   -2.420  1.00 0.00 ? 16 LYS A HG3  7  
ATOM 7132  H HD2  . LYS A 1 16 ? -12.434 5.981   -4.121  1.00 0.00 ? 16 LYS A HD2  7  
ATOM 7133  H HD3  . LYS A 1 16 ? -11.367 7.361   -4.389  1.00 0.00 ? 16 LYS A HD3  7  
ATOM 7134  H HE2  . LYS A 1 16 ? -10.123 5.953   -6.050  1.00 0.00 ? 16 LYS A HE2  7  
ATOM 7135  H HE3  . LYS A 1 16 ? -11.388 4.738   -5.874  1.00 0.00 ? 16 LYS A HE3  7  
ATOM 7136  H HZ1  . LYS A 1 16 ? -12.348 5.846   -7.543  1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 7137  H HZ2  . LYS A 1 16 ? -11.429 7.245   -7.302  1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 7138  H HZ3  . LYS A 1 16 ? -12.808 6.967   -6.362  1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 7139  N N    . GLY A 1 17 ? -6.298  7.541   -2.402  1.00 0.00 ? 17 GLY A N    7  
ATOM 7140  C CA   . GLY A 1 17 ? -4.994  8.095   -2.718  1.00 0.00 ? 17 GLY A CA   7  
ATOM 7141  C C    . GLY A 1 17 ? -3.863  7.314   -2.079  1.00 0.00 ? 17 GLY A C    7  
ATOM 7142  O O    . GLY A 1 17 ? -2.778  7.201   -2.650  1.00 0.00 ? 17 GLY A O    7  
ATOM 7143  H H    . GLY A 1 17 ? -6.909  8.035   -1.816  1.00 0.00 ? 17 GLY A H    7  
ATOM 7144  H HA2  . GLY A 1 17 ? -4.862  8.088   -3.789  1.00 0.00 ? 17 GLY A HA2  7  
ATOM 7145  H HA3  . GLY A 1 17 ? -4.954  9.116   -2.366  1.00 0.00 ? 17 GLY A HA3  7  
ATOM 7146  N N    . GLN A 1 18 ? -4.115  6.775   -0.890  1.00 0.00 ? 18 GLN A N    7  
ATOM 7147  C CA   . GLN A 1 18 ? -3.108  6.003   -0.172  1.00 0.00 ? 18 GLN A CA   7  
ATOM 7148  C C    . GLN A 1 18 ? -3.021  4.581   -0.718  1.00 0.00 ? 18 GLN A C    7  
ATOM 7149  O O    . GLN A 1 18 ? -1.929  4.061   -0.954  1.00 0.00 ? 18 GLN A O    7  
ATOM 7150  C CB   . GLN A 1 18 ? -3.430  5.969   1.322   1.00 0.00 ? 18 GLN A CB   7  
ATOM 7151  C CG   . GLN A 1 18 ? -3.382  7.336   1.986   1.00 0.00 ? 18 GLN A CG   7  
ATOM 7152  C CD   . GLN A 1 18 ? -3.733  7.282   3.460   1.00 0.00 ? 18 GLN A CD   7  
ATOM 7153  O OE1  . GLN A 1 18 ? -4.534  8.079   3.948   1.00 0.00 ? 18 GLN A OE1  7  
ATOM 7154  N NE2  . GLN A 1 18 ? -3.135  6.338   4.177   1.00 0.00 ? 18 GLN A NE2  7  
ATOM 7155  H H    . GLN A 1 18 ? -4.999  6.900   -0.487  1.00 0.00 ? 18 GLN A H    7  
ATOM 7156  H HA   . GLN A 1 18 ? -2.154  6.488   -0.315  1.00 0.00 ? 18 GLN A HA   7  
ATOM 7157  H HB2  . GLN A 1 18 ? -4.421  5.562   1.456   1.00 0.00 ? 18 GLN A HB2  7  
ATOM 7158  H HB3  . GLN A 1 18 ? -2.716  5.327   1.818   1.00 0.00 ? 18 GLN A HB3  7  
ATOM 7159  H HG2  . GLN A 1 18 ? -2.384  7.736   1.885   1.00 0.00 ? 18 GLN A HG2  7  
ATOM 7160  H HG3  . GLN A 1 18 ? -4.082  7.989   1.487   1.00 0.00 ? 18 GLN A HG3  7  
ATOM 7161  H HE21 . GLN A 1 18 ? -2.507  5.739   3.721   1.00 0.00 ? 18 GLN A HE21 7  
ATOM 7162  H HE22 . GLN A 1 18 ? -3.343  6.281   5.132   1.00 0.00 ? 18 GLN A HE22 7  
ATOM 7163  N N    . LEU A 1 19 ? -4.177  3.957   -0.916  1.00 0.00 ? 19 LEU A N    7  
ATOM 7164  C CA   . LEU A 1 19 ? -4.232  2.594   -1.434  1.00 0.00 ? 19 LEU A CA   7  
ATOM 7165  C C    . LEU A 1 19 ? -3.744  2.540   -2.878  1.00 0.00 ? 19 LEU A C    7  
ATOM 7166  O O    . LEU A 1 19 ? -3.271  1.504   -3.345  1.00 0.00 ? 19 LEU A O    7  
ATOM 7167  C CB   . LEU A 1 19 ? -5.659  2.051   -1.345  1.00 0.00 ? 19 LEU A CB   7  
ATOM 7168  C CG   . LEU A 1 19 ? -6.274  2.006   0.054   1.00 0.00 ? 19 LEU A CG   7  
ATOM 7169  C CD1  . LEU A 1 19 ? -7.792  1.980   -0.031  1.00 0.00 ? 19 LEU A CD1  7  
ATOM 7170  C CD2  . LEU A 1 19 ? -5.760  0.798   0.824   1.00 0.00 ? 19 LEU A CD2  7  
ATOM 7171  H H    . LEU A 1 19 ? -5.013  4.423   -0.709  1.00 0.00 ? 19 LEU A H    7  
ATOM 7172  H HA   . LEU A 1 19 ? -3.584  1.982   -0.824  1.00 0.00 ? 19 LEU A HA   7  
ATOM 7173  H HB2  . LEU A 1 19 ? -6.288  2.673   -1.963  1.00 0.00 ? 19 LEU A HB2  7  
ATOM 7174  H HB3  . LEU A 1 19 ? -5.654  1.044   -1.738  1.00 0.00 ? 19 LEU A HB3  7  
ATOM 7175  H HG   . LEU A 1 19 ? -5.986  2.897   0.596   1.00 0.00 ? 19 LEU A HG   7  
ATOM 7176  H HD11 . LEU A 1 19 ? -8.103  1.159   -0.659  1.00 0.00 ? 19 LEU A HD11 7  
ATOM 7177  H HD12 . LEU A 1 19 ? -8.145  2.910   -0.452  1.00 0.00 ? 19 LEU A HD12 7  
ATOM 7178  H HD13 . LEU A 1 19 ? -8.206  1.853   0.959   1.00 0.00 ? 19 LEU A HD13 7  
ATOM 7179  H HD21 . LEU A 1 19 ? -4.783  1.019   1.228   1.00 0.00 ? 19 LEU A HD21 7  
ATOM 7180  H HD22 . LEU A 1 19 ? -5.692  -0.050  0.159   1.00 0.00 ? 19 LEU A HD22 7  
ATOM 7181  H HD23 . LEU A 1 19 ? -6.440  0.570   1.631   1.00 0.00 ? 19 LEU A HD23 7  
ATOM 7182  N N    . ARG A 1 20 ? -3.860  3.664   -3.578  1.00 0.00 ? 20 ARG A N    7  
ATOM 7183  C CA   . ARG A 1 20 ? -3.430  3.745   -4.969  1.00 0.00 ? 20 ARG A CA   7  
ATOM 7184  C C    . ARG A 1 20 ? -1.949  3.401   -5.101  1.00 0.00 ? 20 ARG A C    7  
ATOM 7185  O O    . ARG A 1 20 ? -1.522  2.833   -6.106  1.00 0.00 ? 20 ARG A O    7  
ATOM 7186  C CB   . ARG A 1 20 ? -3.690  5.146   -5.525  1.00 0.00 ? 20 ARG A CB   7  
ATOM 7187  C CG   . ARG A 1 20 ? -3.099  5.373   -6.907  1.00 0.00 ? 20 ARG A CG   7  
ATOM 7188  C CD   . ARG A 1 20 ? -3.292  6.809   -7.366  1.00 0.00 ? 20 ARG A CD   7  
ATOM 7189  N NE   . ARG A 1 20 ? -4.490  6.965   -8.187  1.00 0.00 ? 20 ARG A NE   7  
ATOM 7190  C CZ   . ARG A 1 20 ? -4.544  6.647   -9.475  1.00 0.00 ? 20 ARG A CZ   7  
ATOM 7191  N NH1  . ARG A 1 20 ? -3.475  6.156   -10.086 1.00 0.00 ? 20 ARG A NH1  7  
ATOM 7192  N NH2  . ARG A 1 20 ? -5.671  6.817   -10.155 1.00 0.00 ? 20 ARG A NH2  7  
ATOM 7193  H H    . ARG A 1 20 ? -4.245  4.457   -3.150  1.00 0.00 ? 20 ARG A H    7  
ATOM 7194  H HA   . ARG A 1 20 ? -4.005  3.029   -5.537  1.00 0.00 ? 20 ARG A HA   7  
ATOM 7195  H HB2  . ARG A 1 20 ? -4.757  5.305   -5.584  1.00 0.00 ? 20 ARG A HB2  7  
ATOM 7196  H HB3  . ARG A 1 20 ? -3.263  5.873   -4.851  1.00 0.00 ? 20 ARG A HB3  7  
ATOM 7197  H HG2  . ARG A 1 20 ? -2.042  5.155   -6.876  1.00 0.00 ? 20 ARG A HG2  7  
ATOM 7198  H HG3  . ARG A 1 20 ? -3.584  4.711   -7.608  1.00 0.00 ? 20 ARG A HG3  7  
ATOM 7199  H HD2  . ARG A 1 20 ? -3.379  7.443   -6.496  1.00 0.00 ? 20 ARG A HD2  7  
ATOM 7200  H HD3  . ARG A 1 20 ? -2.429  7.107   -7.944  1.00 0.00 ? 20 ARG A HD3  7  
ATOM 7201  H HE   . ARG A 1 20 ? -5.292  7.326   -7.756  1.00 0.00 ? 20 ARG A HE   7  
ATOM 7202  H HH11 . ARG A 1 20 ? -2.625  6.026   -9.576  1.00 0.00 ? 20 ARG A HH11 7  
ATOM 7203  H HH12 . ARG A 1 20 ? -3.519  5.916   -11.056 1.00 0.00 ? 20 ARG A HH12 7  
ATOM 7204  H HH21 . ARG A 1 20 ? -6.480  7.186   -9.698  1.00 0.00 ? 20 ARG A HH21 7  
ATOM 7205  H HH22 . ARG A 1 20 ? -5.711  6.577   -11.125 1.00 0.00 ? 20 ARG A HH22 7  
ATOM 7206  N N    . GLU A 1 21 ? -1.172  3.749   -4.080  1.00 0.00 ? 21 GLU A N    7  
ATOM 7207  C CA   . GLU A 1 21 ? 0.260   3.478   -4.083  1.00 0.00 ? 21 GLU A CA   7  
ATOM 7208  C C    . GLU A 1 21 ? 0.550   2.077   -3.554  1.00 0.00 ? 21 GLU A C    7  
ATOM 7209  O O    . GLU A 1 21 ? 1.440   1.384   -4.050  1.00 0.00 ? 21 GLU A O    7  
ATOM 7210  C CB   . GLU A 1 21 ? 1.001   4.517   -3.239  1.00 0.00 ? 21 GLU A CB   7  
ATOM 7211  C CG   . GLU A 1 21 ? 0.788   5.947   -3.709  1.00 0.00 ? 21 GLU A CG   7  
ATOM 7212  C CD   . GLU A 1 21 ? 1.022   6.112   -5.198  1.00 0.00 ? 21 GLU A CD   7  
ATOM 7213  O OE1  . GLU A 1 21 ? 2.045   5.602   -5.699  1.00 0.00 ? 21 GLU A OE1  7  
ATOM 7214  O OE2  . GLU A 1 21 ? 0.180   6.753   -5.863  1.00 0.00 ? 21 GLU A OE2  7  
ATOM 7215  H H    . GLU A 1 21 ? -1.572  4.199   -3.307  1.00 0.00 ? 21 GLU A H    7  
ATOM 7216  H HA   . GLU A 1 21 ? 0.608   3.543   -5.104  1.00 0.00 ? 21 GLU A HA   7  
ATOM 7217  H HB2  . GLU A 1 21 ? 0.661   4.441   -2.217  1.00 0.00 ? 21 GLU A HB2  7  
ATOM 7218  H HB3  . GLU A 1 21 ? 2.059   4.304   -3.274  1.00 0.00 ? 21 GLU A HB3  7  
ATOM 7219  H HG2  . GLU A 1 21 ? -0.228  6.238   -3.486  1.00 0.00 ? 21 GLU A HG2  7  
ATOM 7220  H HG3  . GLU A 1 21 ? 1.471   6.592   -3.178  1.00 0.00 ? 21 GLU A HG3  7  
ATOM 7221  N N    . LEU A 1 22 ? -0.206  1.665   -2.542  1.00 0.00 ? 22 LEU A N    7  
ATOM 7222  C CA   . LEU A 1 22 ? -0.031  0.346   -1.943  1.00 0.00 ? 22 LEU A CA   7  
ATOM 7223  C C    . LEU A 1 22 ? -0.366  -0.755  -2.944  1.00 0.00 ? 22 LEU A C    7  
ATOM 7224  O O    . LEU A 1 22 ? 0.403   -1.699  -3.122  1.00 0.00 ? 22 LEU A O    7  
ATOM 7225  C CB   . LEU A 1 22 ? -0.913  0.208   -0.701  1.00 0.00 ? 22 LEU A CB   7  
ATOM 7226  C CG   . LEU A 1 22 ? -0.591  1.150   0.459   1.00 0.00 ? 22 LEU A CG   7  
ATOM 7227  C CD1  . LEU A 1 22 ? -1.749  1.201   1.443   1.00 0.00 ? 22 LEU A CD1  7  
ATOM 7228  C CD2  . LEU A 1 22 ? 0.688   0.716   1.160   1.00 0.00 ? 22 LEU A CD2  7  
ATOM 7229  H H    . LEU A 1 22 ? -0.899  2.261   -2.189  1.00 0.00 ? 22 LEU A H    7  
ATOM 7230  H HA   . LEU A 1 22 ? 1.004   0.249   -1.653  1.00 0.00 ? 22 LEU A HA   7  
ATOM 7231  H HB2  . LEU A 1 22 ? -1.934  0.387   -0.999  1.00 0.00 ? 22 LEU A HB2  7  
ATOM 7232  H HB3  . LEU A 1 22 ? -0.818  -0.807  -0.340  1.00 0.00 ? 22 LEU A HB3  7  
ATOM 7233  H HG   . LEU A 1 22 ? -0.439  2.148   0.072   1.00 0.00 ? 22 LEU A HG   7  
ATOM 7234  H HD11 . LEU A 1 22 ? -2.466  0.432   1.196   1.00 0.00 ? 22 LEU A HD11 7  
ATOM 7235  H HD12 . LEU A 1 22 ? -2.226  2.169   1.388   1.00 0.00 ? 22 LEU A HD12 7  
ATOM 7236  H HD13 . LEU A 1 22 ? -1.378  1.040   2.445   1.00 0.00 ? 22 LEU A HD13 7  
ATOM 7237  H HD21 . LEU A 1 22 ? 0.536   -0.250  1.619   1.00 0.00 ? 22 LEU A HD21 7  
ATOM 7238  H HD22 . LEU A 1 22 ? 0.945   1.439   1.921   1.00 0.00 ? 22 LEU A HD22 7  
ATOM 7239  H HD23 . LEU A 1 22 ? 1.489   0.651   0.439   1.00 0.00 ? 22 LEU A HD23 7  
ATOM 7240  N N    . GLU A 1 23 ? -1.518  -0.626  -3.595  1.00 0.00 ? 23 GLU A N    7  
ATOM 7241  C CA   . GLU A 1 23 ? -1.953  -1.610  -4.579  1.00 0.00 ? 23 GLU A CA   7  
ATOM 7242  C C    . GLU A 1 23 ? -0.995  -1.653  -5.766  1.00 0.00 ? 23 GLU A C    7  
ATOM 7243  O O    . GLU A 1 23 ? -0.598  -2.727  -6.219  1.00 0.00 ? 23 GLU A O    7  
ATOM 7244  C CB   . GLU A 1 23 ? -3.369  -1.288  -5.063  1.00 0.00 ? 23 GLU A CB   7  
ATOM 7245  C CG   . GLU A 1 23 ? -4.421  -1.378  -3.971  1.00 0.00 ? 23 GLU A CG   7  
ATOM 7246  C CD   . GLU A 1 23 ? -5.766  -0.833  -4.410  1.00 0.00 ? 23 GLU A CD   7  
ATOM 7247  O OE1  . GLU A 1 23 ? -5.792  0.020   -5.322  1.00 0.00 ? 23 GLU A OE1  7  
ATOM 7248  O OE2  . GLU A 1 23 ? -6.793  -1.259  -3.841  1.00 0.00 ? 23 GLU A OE2  7  
ATOM 7249  H H    . GLU A 1 23 ? -2.088  0.149   -3.409  1.00 0.00 ? 23 GLU A H    7  
ATOM 7250  H HA   . GLU A 1 23 ? -1.958  -2.577  -4.101  1.00 0.00 ? 23 GLU A HA   7  
ATOM 7251  H HB2  . GLU A 1 23 ? -3.380  -0.285  -5.464  1.00 0.00 ? 23 GLU A HB2  7  
ATOM 7252  H HB3  . GLU A 1 23 ? -3.634  -1.982  -5.847  1.00 0.00 ? 23 GLU A HB3  7  
ATOM 7253  H HG2  . GLU A 1 23 ? -4.544  -2.413  -3.691  1.00 0.00 ? 23 GLU A HG2  7  
ATOM 7254  H HG3  . GLU A 1 23 ? -4.082  -0.813  -3.115  1.00 0.00 ? 23 GLU A HG3  7  
ATOM 7255  N N    . ARG A 1 24 ? -0.629  -0.477  -6.266  1.00 0.00 ? 24 ARG A N    7  
ATOM 7256  C CA   . ARG A 1 24 ? 0.280   -0.379  -7.402  1.00 0.00 ? 24 ARG A CA   7  
ATOM 7257  C C    . ARG A 1 24 ? 1.598   -1.090  -7.105  1.00 0.00 ? 24 ARG A C    7  
ATOM 7258  O O    . ARG A 1 24 ? 2.050   -1.928  -7.884  1.00 0.00 ? 24 ARG A O    7  
ATOM 7259  C CB   . ARG A 1 24 ? 0.545   1.087   -7.746  1.00 0.00 ? 24 ARG A CB   7  
ATOM 7260  C CG   . ARG A 1 24 ? -0.400  1.647   -8.796  1.00 0.00 ? 24 ARG A CG   7  
ATOM 7261  C CD   . ARG A 1 24 ? 0.291   2.678   -9.675  1.00 0.00 ? 24 ARG A CD   7  
ATOM 7262  N NE   . ARG A 1 24 ? 0.910   2.069   -10.849 1.00 0.00 ? 24 ARG A NE   7  
ATOM 7263  C CZ   . ARG A 1 24 ? 0.220   1.582   -11.874 1.00 0.00 ? 24 ARG A CZ   7  
ATOM 7264  N NH1  . ARG A 1 24 ? -1.105  1.633   -11.870 1.00 0.00 ? 24 ARG A NH1  7  
ATOM 7265  N NH2  . ARG A 1 24 ? 0.855   1.043   -12.907 1.00 0.00 ? 24 ARG A NH2  7  
ATOM 7266  H H    . ARG A 1 24 ? -0.979  0.345   -5.863  1.00 0.00 ? 24 ARG A H    7  
ATOM 7267  H HA   . ARG A 1 24 ? -0.191  -0.859  -8.247  1.00 0.00 ? 24 ARG A HA   7  
ATOM 7268  H HB2  . ARG A 1 24 ? 0.443   1.680   -6.848  1.00 0.00 ? 24 ARG A HB2  7  
ATOM 7269  H HB3  . ARG A 1 24 ? 1.555   1.181   -8.115  1.00 0.00 ? 24 ARG A HB3  7  
ATOM 7270  H HG2  . ARG A 1 24 ? -0.752  0.838   -9.418  1.00 0.00 ? 24 ARG A HG2  7  
ATOM 7271  H HG3  . ARG A 1 24 ? -1.239  2.113   -8.299  1.00 0.00 ? 24 ARG A HG3  7  
ATOM 7272  H HD2  . ARG A 1 24 ? -0.441  3.402   -10.001 1.00 0.00 ? 24 ARG A HD2  7  
ATOM 7273  H HD3  . ARG A 1 24 ? 1.053   3.174   -9.093  1.00 0.00 ? 24 ARG A HD3  7  
ATOM 7274  H HE   . ARG A 1 24 ? 1.888   2.021   -10.873 1.00 0.00 ? 24 ARG A HE   7  
ATOM 7275  H HH11 . ARG A 1 24 ? -1.586  2.039   -11.094 1.00 0.00 ? 24 ARG A HH11 7  
ATOM 7276  H HH12 . ARG A 1 24 ? -1.622  1.266   -12.644 1.00 0.00 ? 24 ARG A HH12 7  
ATOM 7277  H HH21 . ARG A 1 24 ? 1.854   1.003   -12.914 1.00 0.00 ? 24 ARG A HH21 7  
ATOM 7278  H HH22 . ARG A 1 24 ? 0.336   0.676   -13.678 1.00 0.00 ? 24 ARG A HH22 7  
ATOM 7279  N N    . GLU A 1 25 ? 2.208   -0.746  -5.975  1.00 0.00 ? 25 GLU A N    7  
ATOM 7280  C CA   . GLU A 1 25 ? 3.475   -1.350  -5.578  1.00 0.00 ? 25 GLU A CA   7  
ATOM 7281  C C    . GLU A 1 25 ? 3.337   -2.864  -5.444  1.00 0.00 ? 25 GLU A C    7  
ATOM 7282  O O    . GLU A 1 25 ? 4.219   -3.617  -5.859  1.00 0.00 ? 25 GLU A O    7  
ATOM 7283  C CB   . GLU A 1 25 ? 3.957   -0.752  -4.255  1.00 0.00 ? 25 GLU A CB   7  
ATOM 7284  C CG   . GLU A 1 25 ? 4.905   0.423   -4.427  1.00 0.00 ? 25 GLU A CG   7  
ATOM 7285  C CD   . GLU A 1 25 ? 4.474   1.361   -5.538  1.00 0.00 ? 25 GLU A CD   7  
ATOM 7286  O OE1  . GLU A 1 25 ? 4.815   1.089   -6.709  1.00 0.00 ? 25 GLU A OE1  7  
ATOM 7287  O OE2  . GLU A 1 25 ? 3.798   2.366   -5.237  1.00 0.00 ? 25 GLU A OE2  7  
ATOM 7288  H H    . GLU A 1 25 ? 1.798   -0.071  -5.396  1.00 0.00 ? 25 GLU A H    7  
ATOM 7289  H HA   . GLU A 1 25 ? 4.201   -1.133  -6.346  1.00 0.00 ? 25 GLU A HA   7  
ATOM 7290  H HB2  . GLU A 1 25 ? 3.099   -0.417  -3.691  1.00 0.00 ? 25 GLU A HB2  7  
ATOM 7291  H HB3  . GLU A 1 25 ? 4.469   -1.520  -3.692  1.00 0.00 ? 25 GLU A HB3  7  
ATOM 7292  H HG2  . GLU A 1 25 ? 4.942   0.978   -3.502  1.00 0.00 ? 25 GLU A HG2  7  
ATOM 7293  H HG3  . GLU A 1 25 ? 5.890   0.044   -4.657  1.00 0.00 ? 25 GLU A HG3  7  
ATOM 7294  N N    . TYR A 1 26 ? 2.226   -3.302  -4.863  1.00 0.00 ? 26 TYR A N    7  
ATOM 7295  C CA   . TYR A 1 26 ? 1.973   -4.725  -4.672  1.00 0.00 ? 26 TYR A CA   7  
ATOM 7296  C C    . TYR A 1 26 ? 2.086   -5.481  -5.992  1.00 0.00 ? 26 TYR A C    7  
ATOM 7297  O O    . TYR A 1 26 ? 2.776   -6.495  -6.083  1.00 0.00 ? 26 TYR A O    7  
ATOM 7298  C CB   . TYR A 1 26 ? 0.587   -4.941  -4.064  1.00 0.00 ? 26 TYR A CB   7  
ATOM 7299  C CG   . TYR A 1 26 ? 0.353   -6.353  -3.575  1.00 0.00 ? 26 TYR A CG   7  
ATOM 7300  C CD1  . TYR A 1 26 ? 0.202   -7.404  -4.471  1.00 0.00 ? 26 TYR A CD1  7  
ATOM 7301  C CD2  . TYR A 1 26 ? 0.284   -6.636  -2.216  1.00 0.00 ? 26 TYR A CD2  7  
ATOM 7302  C CE1  . TYR A 1 26 ? -0.013  -8.695  -4.029  1.00 0.00 ? 26 TYR A CE1  7  
ATOM 7303  C CE2  . TYR A 1 26 ? 0.072   -7.924  -1.765  1.00 0.00 ? 26 TYR A CE2  7  
ATOM 7304  C CZ   . TYR A 1 26 ? -0.077  -8.950  -2.675  1.00 0.00 ? 26 TYR A CZ   7  
ATOM 7305  O OH   . TYR A 1 26 ? -0.289  -10.235 -2.230  1.00 0.00 ? 26 TYR A OH   7  
ATOM 7306  H H    . TYR A 1 26 ? 1.560   -2.653  -4.553  1.00 0.00 ? 26 TYR A H    7  
ATOM 7307  H HA   . TYR A 1 26 ? 2.718   -5.106  -3.988  1.00 0.00 ? 26 TYR A HA   7  
ATOM 7308  H HB2  . TYR A 1 26 ? 0.461   -4.276  -3.224  1.00 0.00 ? 26 TYR A HB2  7  
ATOM 7309  H HB3  . TYR A 1 26 ? -0.164  -4.719  -4.808  1.00 0.00 ? 26 TYR A HB3  7  
ATOM 7310  H HD1  . TYR A 1 26 ? 0.253   -7.200  -5.531  1.00 0.00 ? 26 TYR A HD1  7  
ATOM 7311  H HD2  . TYR A 1 26 ? 0.401   -5.830  -1.506  1.00 0.00 ? 26 TYR A HD2  7  
ATOM 7312  H HE1  . TYR A 1 26 ? -0.128  -9.498  -4.741  1.00 0.00 ? 26 TYR A HE1  7  
ATOM 7313  H HE2  . TYR A 1 26 ? 0.021   -8.125  -0.705  1.00 0.00 ? 26 TYR A HE2  7  
ATOM 7314  H HH   . TYR A 1 26 ? -0.859  -10.697 -2.849  1.00 0.00 ? 26 TYR A HH   7  
ATOM 7315  N N    . ALA A 1 27 ? 1.401   -4.978  -7.014  1.00 0.00 ? 27 ALA A N    7  
ATOM 7316  C CA   . ALA A 1 27 ? 1.425   -5.602  -8.331  1.00 0.00 ? 27 ALA A CA   7  
ATOM 7317  C C    . ALA A 1 27 ? 2.856   -5.841  -8.800  1.00 0.00 ? 27 ALA A C    7  
ATOM 7318  O O    . ALA A 1 27 ? 3.155   -6.861  -9.420  1.00 0.00 ? 27 ALA A O    7  
ATOM 7319  C CB   . ALA A 1 27 ? 0.675   -4.742  -9.337  1.00 0.00 ? 27 ALA A CB   7  
ATOM 7320  H H    . ALA A 1 27 ? 0.869   -4.167  -6.880  1.00 0.00 ? 27 ALA A H    7  
ATOM 7321  H HA   . ALA A 1 27 ? 0.917   -6.554  -8.259  1.00 0.00 ? 27 ALA A HA   7  
ATOM 7322  H HB1  . ALA A 1 27 ? -0.150  -5.306  -9.748  1.00 0.00 ? 27 ALA A HB1  7  
ATOM 7323  H HB2  . ALA A 1 27 ? 0.297   -3.859  -8.844  1.00 0.00 ? 27 ALA A HB2  7  
ATOM 7324  H HB3  . ALA A 1 27 ? 1.345   -4.452  -10.132 1.00 0.00 ? 27 ALA A HB3  7  
ATOM 7325  N N    . ALA A 1 28 ? 3.738   -4.892  -8.500  1.00 0.00 ? 28 ALA A N    7  
ATOM 7326  C CA   . ALA A 1 28 ? 5.138   -5.000  -8.890  1.00 0.00 ? 28 ALA A CA   7  
ATOM 7327  C C    . ALA A 1 28 ? 5.856   -6.066  -8.069  1.00 0.00 ? 28 ALA A C    7  
ATOM 7328  O O    . ALA A 1 28 ? 6.710   -6.788  -8.582  1.00 0.00 ? 28 ALA A O    7  
ATOM 7329  C CB   . ALA A 1 28 ? 5.834   -3.656  -8.736  1.00 0.00 ? 28 ALA A CB   7  
ATOM 7330  H H    . ALA A 1 28 ? 3.439   -4.102  -8.004  1.00 0.00 ? 28 ALA A H    7  
ATOM 7331  H HA   . ALA A 1 28 ? 5.174   -5.279  -9.933  1.00 0.00 ? 28 ALA A HA   7  
ATOM 7332  H HB1  . ALA A 1 28 ? 5.784   -3.117  -9.671  1.00 0.00 ? 28 ALA A HB1  7  
ATOM 7333  H HB2  . ALA A 1 28 ? 5.344   -3.083  -7.963  1.00 0.00 ? 28 ALA A HB2  7  
ATOM 7334  H HB3  . ALA A 1 28 ? 6.867   -3.814  -8.467  1.00 0.00 ? 28 ALA A HB3  7  
ATOM 7335  N N    . ASN A 1 29 ? 5.504   -6.159  -6.791  1.00 0.00 ? 29 ASN A N    7  
ATOM 7336  C CA   . ASN A 1 29 ? 6.116   -7.136  -5.898  1.00 0.00 ? 29 ASN A CA   7  
ATOM 7337  C C    . ASN A 1 29 ? 5.402   -7.164  -4.550  1.00 0.00 ? 29 ASN A C    7  
ATOM 7338  O O    . ASN A 1 29 ? 5.252   -6.134  -3.893  1.00 0.00 ? 29 ASN A O    7  
ATOM 7339  C CB   . ASN A 1 29 ? 7.598   -6.816  -5.696  1.00 0.00 ? 29 ASN A CB   7  
ATOM 7340  C CG   . ASN A 1 29 ? 7.874   -5.324  -5.709  1.00 0.00 ? 29 ASN A CG   7  
ATOM 7341  O OD1  . ASN A 1 29 ? 8.497   -4.805  -6.635  1.00 0.00 ? 29 ASN A OD1  7  
ATOM 7342  N ND2  . ASN A 1 29 ? 7.410   -4.628  -4.678  1.00 0.00 ? 29 ASN A ND2  7  
ATOM 7343  H H    . ASN A 1 29 ? 4.816   -5.555  -6.439  1.00 0.00 ? 29 ASN A H    7  
ATOM 7344  H HA   . ASN A 1 29 ? 6.027   -8.108  -6.360  1.00 0.00 ? 29 ASN A HA   7  
ATOM 7345  H HB2  . ASN A 1 29 ? 7.920   -7.213  -4.744  1.00 0.00 ? 29 ASN A HB2  7  
ATOM 7346  H HB3  . ASN A 1 29 ? 8.171   -7.276  -6.486  1.00 0.00 ? 29 ASN A HB3  7  
ATOM 7347  H HD21 . ASN A 1 29 ? 6.922   -5.109  -3.976  1.00 0.00 ? 29 ASN A HD21 7  
ATOM 7348  H HD22 . ASN A 1 29 ? 7.573   -3.662  -4.661  1.00 0.00 ? 29 ASN A HD22 7  
ATOM 7349  N N    . LYS A 1 30 ? 4.963   -8.351  -4.143  1.00 0.00 ? 30 LYS A N    7  
ATOM 7350  C CA   . LYS A 1 30 ? 4.267   -8.515  -2.873  1.00 0.00 ? 30 LYS A CA   7  
ATOM 7351  C C    . LYS A 1 30 ? 5.189   -8.197  -1.701  1.00 0.00 ? 30 LYS A C    7  
ATOM 7352  O O    . LYS A 1 30 ? 4.731   -7.832  -0.618  1.00 0.00 ? 30 LYS A O    7  
ATOM 7353  C CB   . LYS A 1 30 ? 3.733   -9.944  -2.742  1.00 0.00 ? 30 LYS A CB   7  
ATOM 7354  C CG   . LYS A 1 30 ? 3.053   -10.457 -4.000  1.00 0.00 ? 30 LYS A CG   7  
ATOM 7355  C CD   . LYS A 1 30 ? 2.290   -11.744 -3.736  1.00 0.00 ? 30 LYS A CD   7  
ATOM 7356  C CE   . LYS A 1 30 ? 2.069   -12.534 -5.017  1.00 0.00 ? 30 LYS A CE   7  
ATOM 7357  N NZ   . LYS A 1 30 ? 1.715   -13.953 -4.739  1.00 0.00 ? 30 LYS A NZ   7  
ATOM 7358  H H    . LYS A 1 30 ? 5.113   -9.136  -4.712  1.00 0.00 ? 30 LYS A H    7  
ATOM 7359  H HA   . LYS A 1 30 ? 3.436   -7.827  -2.859  1.00 0.00 ? 30 LYS A HA   7  
ATOM 7360  H HB2  . LYS A 1 30 ? 4.556   -10.603 -2.508  1.00 0.00 ? 30 LYS A HB2  7  
ATOM 7361  H HB3  . LYS A 1 30 ? 3.017   -9.975  -1.933  1.00 0.00 ? 30 LYS A HB3  7  
ATOM 7362  H HG2  . LYS A 1 30 ? 2.361   -9.708  -4.355  1.00 0.00 ? 30 LYS A HG2  7  
ATOM 7363  H HG3  . LYS A 1 30 ? 3.805   -10.642 -4.754  1.00 0.00 ? 30 LYS A HG3  7  
ATOM 7364  H HD2  . LYS A 1 30 ? 2.855   -12.352 -3.044  1.00 0.00 ? 30 LYS A HD2  7  
ATOM 7365  H HD3  . LYS A 1 30 ? 1.330   -11.501 -3.303  1.00 0.00 ? 30 LYS A HD3  7  
ATOM 7366  H HE2  . LYS A 1 30 ? 1.268   -12.074 -5.574  1.00 0.00 ? 30 LYS A HE2  7  
ATOM 7367  H HE3  . LYS A 1 30 ? 2.977   -12.506 -5.602  1.00 0.00 ? 30 LYS A HE3  7  
ATOM 7368  H HZ1  . LYS A 1 30 ? 2.561   -14.480 -4.440  1.00 0.00 ? 30 LYS A HZ1  7  
ATOM 7369  H HZ2  . LYS A 1 30 ? 1.328   -14.399 -5.595  1.00 0.00 ? 30 LYS A HZ2  7  
ATOM 7370  H HZ3  . LYS A 1 30 ? 1.003   -14.003 -3.983  1.00 0.00 ? 30 LYS A HZ3  7  
ATOM 7371  N N    . PHE A 1 31 ? 6.492   -8.335  -1.925  1.00 0.00 ? 31 PHE A N    7  
ATOM 7372  C CA   . PHE A 1 31 ? 7.479   -8.061  -0.887  1.00 0.00 ? 31 PHE A CA   7  
ATOM 7373  C C    . PHE A 1 31 ? 8.324   -6.843  -1.248  1.00 0.00 ? 31 PHE A C    7  
ATOM 7374  O O    . PHE A 1 31 ? 9.349   -6.962  -1.921  1.00 0.00 ? 31 PHE A O    7  
ATOM 7375  C CB   . PHE A 1 31 ? 8.383   -9.279  -0.679  1.00 0.00 ? 31 PHE A CB   7  
ATOM 7376  C CG   . PHE A 1 31 ? 7.648   -10.494 -0.188  1.00 0.00 ? 31 PHE A CG   7  
ATOM 7377  C CD1  . PHE A 1 31 ? 7.087   -11.389 -1.085  1.00 0.00 ? 31 PHE A CD1  7  
ATOM 7378  C CD2  . PHE A 1 31 ? 7.518   -10.740 1.169   1.00 0.00 ? 31 PHE A CD2  7  
ATOM 7379  C CE1  . PHE A 1 31 ? 6.410   -12.507 -0.636  1.00 0.00 ? 31 PHE A CE1  7  
ATOM 7380  C CE2  . PHE A 1 31 ? 6.842   -11.857 1.623   1.00 0.00 ? 31 PHE A CE2  7  
ATOM 7381  C CZ   . PHE A 1 31 ? 6.288   -12.742 0.719   1.00 0.00 ? 31 PHE A CZ   7  
ATOM 7382  H H    . PHE A 1 31 ? 6.797   -8.629  -2.809  1.00 0.00 ? 31 PHE A H    7  
ATOM 7383  H HA   . PHE A 1 31 ? 6.948   -7.857  0.029   1.00 0.00 ? 31 PHE A HA   7  
ATOM 7384  H HB2  . PHE A 1 31 ? 8.854   -9.533  -1.616  1.00 0.00 ? 31 PHE A HB2  7  
ATOM 7385  H HB3  . PHE A 1 31 ? 9.143   -9.034  0.047   1.00 0.00 ? 31 PHE A HB3  7  
ATOM 7386  H HD1  . PHE A 1 31 ? 7.183   -11.208 -2.145  1.00 0.00 ? 31 PHE A HD1  7  
ATOM 7387  H HD2  . PHE A 1 31 ? 7.951   -10.048 1.877   1.00 0.00 ? 31 PHE A HD2  7  
ATOM 7388  H HE1  . PHE A 1 31 ? 5.978   -13.198 -1.345  1.00 0.00 ? 31 PHE A HE1  7  
ATOM 7389  H HE2  . PHE A 1 31 ? 6.749   -12.037 2.684   1.00 0.00 ? 31 PHE A HE2  7  
ATOM 7390  H HZ   . PHE A 1 31 ? 5.759   -13.615 1.072   1.00 0.00 ? 31 PHE A HZ   7  
ATOM 7391  N N    . ILE A 1 32 ? 7.887   -5.672  -0.797  1.00 0.00 ? 32 ILE A N    7  
ATOM 7392  C CA   . ILE A 1 32 ? 8.602   -4.433  -1.071  1.00 0.00 ? 32 ILE A CA   7  
ATOM 7393  C C    . ILE A 1 32 ? 9.935   -4.392  -0.332  1.00 0.00 ? 32 ILE A C    7  
ATOM 7394  O O    . ILE A 1 32 ? 10.280  -5.319  0.401   1.00 0.00 ? 32 ILE A O    7  
ATOM 7395  C CB   . ILE A 1 32 ? 7.768   -3.201  -0.670  1.00 0.00 ? 32 ILE A CB   7  
ATOM 7396  C CG1  . ILE A 1 32 ? 7.608   -3.140  0.850   1.00 0.00 ? 32 ILE A CG1  7  
ATOM 7397  C CG2  . ILE A 1 32 ? 6.408   -3.238  -1.351  1.00 0.00 ? 32 ILE A CG2  7  
ATOM 7398  C CD1  . ILE A 1 32 ? 6.787   -1.960  1.324   1.00 0.00 ? 32 ILE A CD1  7  
ATOM 7399  H H    . ILE A 1 32 ? 7.064   -5.642  -0.266  1.00 0.00 ? 32 ILE A H    7  
ATOM 7400  H HA   . ILE A 1 32 ? 8.790   -4.385  -2.134  1.00 0.00 ? 32 ILE A HA   7  
ATOM 7401  H HB   . ILE A 1 32 ? 8.289   -2.317  -1.006  1.00 0.00 ? 32 ILE A HB   7  
ATOM 7402  H HG12 . ILE A 1 32 ? 7.121   -4.040  1.191   1.00 0.00 ? 32 ILE A HG12 7  
ATOM 7403  H HG13 . ILE A 1 32 ? 8.585   -3.069  1.305   1.00 0.00 ? 32 ILE A HG13 7  
ATOM 7404  H HG21 . ILE A 1 32 ? 6.370   -4.073  -2.035  1.00 0.00 ? 32 ILE A HG21 7  
ATOM 7405  H HG22 . ILE A 1 32 ? 5.636   -3.349  -0.605  1.00 0.00 ? 32 ILE A HG22 7  
ATOM 7406  H HG23 . ILE A 1 32 ? 6.253   -2.319  -1.896  1.00 0.00 ? 32 ILE A HG23 7  
ATOM 7407  H HD11 . ILE A 1 32 ? 5.824   -1.973  0.837   1.00 0.00 ? 32 ILE A HD11 7  
ATOM 7408  H HD12 . ILE A 1 32 ? 6.652   -2.021  2.393   1.00 0.00 ? 32 ILE A HD12 7  
ATOM 7409  H HD13 . ILE A 1 32 ? 7.302   -1.042  1.078   1.00 0.00 ? 32 ILE A HD13 7  
ATOM 7410  N N    . THR A 1 33 ? 10.682  -3.310  -0.529  1.00 0.00 ? 33 THR A N    7  
ATOM 7411  C CA   . THR A 1 33 ? 11.978  -3.147  0.119   1.00 0.00 ? 33 THR A CA   7  
ATOM 7412  C C    . THR A 1 33 ? 11.970  -1.958  1.072   1.00 0.00 ? 33 THR A C    7  
ATOM 7413  O O    . THR A 1 33 ? 11.133  -1.062  0.958   1.00 0.00 ? 33 THR A O    7  
ATOM 7414  C CB   . THR A 1 33 ? 13.103  -2.955  -0.916  1.00 0.00 ? 33 THR A CB   7  
ATOM 7415  O OG1  . THR A 1 33 ? 14.313  -2.566  -0.257  1.00 0.00 ? 33 THR A OG1  7  
ATOM 7416  C CG2  . THR A 1 33 ? 12.718  -1.902  -1.944  1.00 0.00 ? 33 THR A CG2  7  
ATOM 7417  H H    . THR A 1 33 ? 10.353  -2.605  -1.125  1.00 0.00 ? 33 THR A H    7  
ATOM 7418  H HA   . THR A 1 33 ? 12.184  -4.046  0.681   1.00 0.00 ? 33 THR A HA   7  
ATOM 7419  H HB   . THR A 1 33 ? 13.266  -3.893  -1.427  1.00 0.00 ? 33 THR A HB   7  
ATOM 7420  H HG1  . THR A 1 33 ? 14.968  -3.262  -0.352  1.00 0.00 ? 33 THR A HG1  7  
ATOM 7421  H HG21 . THR A 1 33 ? 12.425  -2.387  -2.864  1.00 0.00 ? 33 THR A HG21 7  
ATOM 7422  H HG22 . THR A 1 33 ? 13.562  -1.255  -2.131  1.00 0.00 ? 33 THR A HG22 7  
ATOM 7423  H HG23 . THR A 1 33 ? 11.892  -1.317  -1.568  1.00 0.00 ? 33 THR A HG23 7  
ATOM 7424  N N    . LYS A 1 34 ? 12.908  -1.954  2.013   1.00 0.00 ? 34 LYS A N    7  
ATOM 7425  C CA   . LYS A 1 34 ? 13.012  -0.873  2.986   1.00 0.00 ? 34 LYS A CA   7  
ATOM 7426  C C    . LYS A 1 34 ? 13.043  0.484   2.291   1.00 0.00 ? 34 LYS A C    7  
ATOM 7427  O O    . LYS A 1 34 ? 12.474  1.458   2.784   1.00 0.00 ? 34 LYS A O    7  
ATOM 7428  C CB   . LYS A 1 34 ? 14.269  -1.048  3.841   1.00 0.00 ? 34 LYS A CB   7  
ATOM 7429  C CG   . LYS A 1 34 ? 14.019  -1.780  5.148   1.00 0.00 ? 34 LYS A CG   7  
ATOM 7430  C CD   . LYS A 1 34 ? 15.318  -2.246  5.784   1.00 0.00 ? 34 LYS A CD   7  
ATOM 7431  C CE   . LYS A 1 34 ? 15.878  -1.203  6.738   1.00 0.00 ? 34 LYS A CE   7  
ATOM 7432  N NZ   . LYS A 1 34 ? 16.976  -1.753  7.580   1.00 0.00 ? 34 LYS A NZ   7  
ATOM 7433  H H    . LYS A 1 34 ? 13.548  -2.696  2.053   1.00 0.00 ? 34 LYS A H    7  
ATOM 7434  H HA   . LYS A 1 34 ? 12.143  -0.917  3.625   1.00 0.00 ? 34 LYS A HA   7  
ATOM 7435  H HB2  . LYS A 1 34 ? 15.001  -1.606  3.275   1.00 0.00 ? 34 LYS A HB2  7  
ATOM 7436  H HB3  . LYS A 1 34 ? 14.673  -0.072  4.071   1.00 0.00 ? 34 LYS A HB3  7  
ATOM 7437  H HG2  . LYS A 1 34 ? 13.515  -1.113  5.833   1.00 0.00 ? 34 LYS A HG2  7  
ATOM 7438  H HG3  . LYS A 1 34 ? 13.394  -2.640  4.955   1.00 0.00 ? 34 LYS A HG3  7  
ATOM 7439  H HD2  . LYS A 1 34 ? 15.133  -3.157  6.334   1.00 0.00 ? 34 LYS A HD2  7  
ATOM 7440  H HD3  . LYS A 1 34 ? 16.042  -2.435  5.005   1.00 0.00 ? 34 LYS A HD3  7  
ATOM 7441  H HE2  . LYS A 1 34 ? 16.259  -0.374  6.161   1.00 0.00 ? 34 LYS A HE2  7  
ATOM 7442  H HE3  . LYS A 1 34 ? 15.081  -0.857  7.381   1.00 0.00 ? 34 LYS A HE3  7  
ATOM 7443  H HZ1  . LYS A 1 34 ? 16.605  -2.037  8.510   1.00 0.00 ? 34 LYS A HZ1  7  
ATOM 7444  H HZ2  . LYS A 1 34 ? 17.714  -1.034  7.719   1.00 0.00 ? 34 LYS A HZ2  7  
ATOM 7445  H HZ3  . LYS A 1 34 ? 17.398  -2.584  7.119   1.00 0.00 ? 34 LYS A HZ3  7  
ATOM 7446  N N    . ASP A 1 35 ? 13.708  0.541   1.142   1.00 0.00 ? 35 ASP A N    7  
ATOM 7447  C CA   . ASP A 1 35 ? 13.810  1.778   0.378   1.00 0.00 ? 35 ASP A CA   7  
ATOM 7448  C C    . ASP A 1 35 ? 12.452  2.181   -0.188  1.00 0.00 ? 35 ASP A C    7  
ATOM 7449  O O    . ASP A 1 35 ? 12.143  3.367   -0.306  1.00 0.00 ? 35 ASP A O    7  
ATOM 7450  C CB   . ASP A 1 35 ? 14.822  1.619   -0.758  1.00 0.00 ? 35 ASP A CB   7  
ATOM 7451  C CG   . ASP A 1 35 ? 16.256  1.710   -0.273  1.00 0.00 ? 35 ASP A CG   7  
ATOM 7452  O OD1  . ASP A 1 35 ? 16.520  1.297   0.875   1.00 0.00 ? 35 ASP A OD1  7  
ATOM 7453  O OD2  . ASP A 1 35 ? 17.112  2.196   -1.041  1.00 0.00 ? 35 ASP A OD2  7  
ATOM 7454  H H    . ASP A 1 35 ? 14.141  -0.270  0.800   1.00 0.00 ? 35 ASP A H    7  
ATOM 7455  H HA   . ASP A 1 35 ? 14.152  2.554   1.046   1.00 0.00 ? 35 ASP A HA   7  
ATOM 7456  H HB2  . ASP A 1 35 ? 14.681  0.655   -1.225  1.00 0.00 ? 35 ASP A HB2  7  
ATOM 7457  H HB3  . ASP A 1 35 ? 14.658  2.397   -1.489  1.00 0.00 ? 35 ASP A HB3  7  
ATOM 7458  N N    . LYS A 1 36 ? 11.643  1.186   -0.537  1.00 0.00 ? 36 LYS A N    7  
ATOM 7459  C CA   . LYS A 1 36 ? 10.317  1.435   -1.090  1.00 0.00 ? 36 LYS A CA   7  
ATOM 7460  C C    . LYS A 1 36 ? 9.359   1.922   -0.008  1.00 0.00 ? 36 LYS A C    7  
ATOM 7461  O O    . LYS A 1 36 ? 8.704   2.952   -0.165  1.00 0.00 ? 36 LYS A O    7  
ATOM 7462  C CB   . LYS A 1 36 ? 9.766   0.163   -1.740  1.00 0.00 ? 36 LYS A CB   7  
ATOM 7463  C CG   . LYS A 1 36 ? 8.307   0.272   -2.147  1.00 0.00 ? 36 LYS A CG   7  
ATOM 7464  C CD   . LYS A 1 36 ? 8.075   1.449   -3.079  1.00 0.00 ? 36 LYS A CD   7  
ATOM 7465  C CE   . LYS A 1 36 ? 8.876   1.309   -4.364  1.00 0.00 ? 36 LYS A CE   7  
ATOM 7466  N NZ   . LYS A 1 36 ? 8.658   2.461   -5.282  1.00 0.00 ? 36 LYS A NZ   7  
ATOM 7467  H H    . LYS A 1 36 ? 11.946  0.261   -0.419  1.00 0.00 ? 36 LYS A H    7  
ATOM 7468  H HA   . LYS A 1 36 ? 10.411  2.202   -1.844  1.00 0.00 ? 36 LYS A HA   7  
ATOM 7469  H HB2  . LYS A 1 36 ? 10.349  -0.058  -2.621  1.00 0.00 ? 36 LYS A HB2  7  
ATOM 7470  H HB3  . LYS A 1 36 ? 9.863   -0.655  -1.040  1.00 0.00 ? 36 LYS A HB3  7  
ATOM 7471  H HG2  . LYS A 1 36 ? 8.015   -0.637  -2.652  1.00 0.00 ? 36 LYS A HG2  7  
ATOM 7472  H HG3  . LYS A 1 36 ? 7.704   0.403   -1.260  1.00 0.00 ? 36 LYS A HG3  7  
ATOM 7473  H HD2  . LYS A 1 36 ? 7.025   1.499   -3.327  1.00 0.00 ? 36 LYS A HD2  7  
ATOM 7474  H HD3  . LYS A 1 36 ? 8.372   2.359   -2.577  1.00 0.00 ? 36 LYS A HD3  7  
ATOM 7475  H HE2  . LYS A 1 36 ? 9.925   1.252   -4.115  1.00 0.00 ? 36 LYS A HE2  7  
ATOM 7476  H HE3  . LYS A 1 36 ? 8.575   0.400   -4.864  1.00 0.00 ? 36 LYS A HE3  7  
ATOM 7477  H HZ1  . LYS A 1 36 ? 8.793   3.357   -4.770  1.00 0.00 ? 36 LYS A HZ1  7  
ATOM 7478  H HZ2  . LYS A 1 36 ? 7.692   2.436   -5.665  1.00 0.00 ? 36 LYS A HZ2  7  
ATOM 7479  H HZ3  . LYS A 1 36 ? 9.333   2.422   -6.072  1.00 0.00 ? 36 LYS A HZ3  7  
ATOM 7480  N N    . ARG A 1 37 ? 9.284   1.176   1.089   1.00 0.00 ? 37 ARG A N    7  
ATOM 7481  C CA   . ARG A 1 37 ? 8.406   1.533   2.197   1.00 0.00 ? 37 ARG A CA   7  
ATOM 7482  C C    . ARG A 1 37 ? 8.641   2.976   2.634   1.00 0.00 ? 37 ARG A C    7  
ATOM 7483  O O    . ARG A 1 37 ? 7.705   3.682   3.009   1.00 0.00 ? 37 ARG A O    7  
ATOM 7484  C CB   . ARG A 1 37 ? 8.631   0.588   3.379   1.00 0.00 ? 37 ARG A CB   7  
ATOM 7485  C CG   . ARG A 1 37 ? 7.343   0.083   4.008   1.00 0.00 ? 37 ARG A CG   7  
ATOM 7486  C CD   . ARG A 1 37 ? 7.596   -1.114  4.912   1.00 0.00 ? 37 ARG A CD   7  
ATOM 7487  N NE   . ARG A 1 37 ? 8.310   -2.182  4.218   1.00 0.00 ? 37 ARG A NE   7  
ATOM 7488  C CZ   . ARG A 1 37 ? 8.786   -3.263  4.825   1.00 0.00 ? 37 ARG A CZ   7  
ATOM 7489  N NH1  . ARG A 1 37 ? 8.625   -3.418  6.132   1.00 0.00 ? 37 ARG A NH1  7  
ATOM 7490  N NH2  . ARG A 1 37 ? 9.425   -4.192  4.125   1.00 0.00 ? 37 ARG A NH2  7  
ATOM 7491  H H    . ARG A 1 37 ? 9.831   0.366   1.155   1.00 0.00 ? 37 ARG A H    7  
ATOM 7492  H HA   . ARG A 1 37 ? 7.386   1.434   1.857   1.00 0.00 ? 37 ARG A HA   7  
ATOM 7493  H HB2  . ARG A 1 37 ? 9.198   -0.266  3.039   1.00 0.00 ? 37 ARG A HB2  7  
ATOM 7494  H HB3  . ARG A 1 37 ? 9.197   1.107   4.137   1.00 0.00 ? 37 ARG A HB3  7  
ATOM 7495  H HG2  . ARG A 1 37 ? 6.904   0.877   4.595   1.00 0.00 ? 37 ARG A HG2  7  
ATOM 7496  H HG3  . ARG A 1 37 ? 6.659   -0.207  3.224   1.00 0.00 ? 37 ARG A HG3  7  
ATOM 7497  H HD2  . ARG A 1 37 ? 8.185   -0.791  5.758   1.00 0.00 ? 37 ARG A HD2  7  
ATOM 7498  H HD3  . ARG A 1 37 ? 6.647   -1.493  5.258   1.00 0.00 ? 37 ARG A HD3  7  
ATOM 7499  H HE   . ARG A 1 37 ? 8.441   -2.088  3.252   1.00 0.00 ? 37 ARG A HE   7  
ATOM 7500  H HH11 . ARG A 1 37 ? 8.143   -2.721  6.662   1.00 0.00 ? 37 ARG A HH11 7  
ATOM 7501  H HH12 . ARG A 1 37 ? 8.983   -4.234  6.587   1.00 0.00 ? 37 ARG A HH12 7  
ATOM 7502  H HH21 . ARG A 1 37 ? 9.549   -4.078  3.140   1.00 0.00 ? 37 ARG A HH21 7  
ATOM 7503  H HH22 . ARG A 1 37 ? 9.783   -5.005  4.583   1.00 0.00 ? 37 ARG A HH22 7  
ATOM 7504  N N    . ARG A 1 38 ? 9.897   3.407   2.584   1.00 0.00 ? 38 ARG A N    7  
ATOM 7505  C CA   . ARG A 1 38 ? 10.256  4.764   2.976   1.00 0.00 ? 38 ARG A CA   7  
ATOM 7506  C C    . ARG A 1 38 ? 9.510   5.790   2.127   1.00 0.00 ? 38 ARG A C    7  
ATOM 7507  O O    . ARG A 1 38 ? 9.027   6.801   2.638   1.00 0.00 ? 38 ARG A O    7  
ATOM 7508  C CB   . ARG A 1 38 ? 11.765  4.975   2.841   1.00 0.00 ? 38 ARG A CB   7  
ATOM 7509  C CG   . ARG A 1 38 ? 12.548  4.586   4.084   1.00 0.00 ? 38 ARG A CG   7  
ATOM 7510  C CD   . ARG A 1 38 ? 14.024  4.394   3.775   1.00 0.00 ? 38 ARG A CD   7  
ATOM 7511  N NE   . ARG A 1 38 ? 14.863  5.350   4.494   1.00 0.00 ? 38 ARG A NE   7  
ATOM 7512  C CZ   . ARG A 1 38 ? 15.046  6.606   4.102   1.00 0.00 ? 38 ARG A CZ   7  
ATOM 7513  N NH1  . ARG A 1 38 ? 14.454  7.055   3.004   1.00 0.00 ? 38 ARG A NH1  7  
ATOM 7514  N NH2  . ARG A 1 38 ? 15.824  7.416   4.810   1.00 0.00 ? 38 ARG A NH2  7  
ATOM 7515  H H    . ARG A 1 38 ? 10.600  2.797   2.276   1.00 0.00 ? 38 ARG A H    7  
ATOM 7516  H HA   . ARG A 1 38 ? 9.974   4.897   4.010   1.00 0.00 ? 38 ARG A HA   7  
ATOM 7517  H HB2  . ARG A 1 38 ? 12.127  4.383   2.014   1.00 0.00 ? 38 ARG A HB2  7  
ATOM 7518  H HB3  . ARG A 1 38 ? 11.953  6.018   2.635   1.00 0.00 ? 38 ARG A HB3  7  
ATOM 7519  H HG2  . ARG A 1 38 ? 12.445  5.367   4.823   1.00 0.00 ? 38 ARG A HG2  7  
ATOM 7520  H HG3  . ARG A 1 38 ? 12.148  3.662   4.475   1.00 0.00 ? 38 ARG A HG3  7  
ATOM 7521  H HD2  . ARG A 1 38 ? 14.311  3.393   4.060   1.00 0.00 ? 38 ARG A HD2  7  
ATOM 7522  H HD3  . ARG A 1 38 ? 14.176  4.523   2.714   1.00 0.00 ? 38 ARG A HD3  7  
ATOM 7523  H HE   . ARG A 1 38 ? 15.310  5.039   5.308   1.00 0.00 ? 38 ARG A HE   7  
ATOM 7524  H HH11 . ARG A 1 38 ? 13.867  6.448   2.470   1.00 0.00 ? 38 ARG A HH11 7  
ATOM 7525  H HH12 . ARG A 1 38 ? 14.593  8.002   2.712   1.00 0.00 ? 38 ARG A HH12 7  
ATOM 7526  H HH21 . ARG A 1 38 ? 16.272  7.081   5.638   1.00 0.00 ? 38 ARG A HH21 7  
ATOM 7527  H HH22 . ARG A 1 38 ? 15.962  8.361   4.514   1.00 0.00 ? 38 ARG A HH22 7  
ATOM 7528  N N    . LYS A 1 39 ? 9.420   5.523   0.829   1.00 0.00 ? 39 LYS A N    7  
ATOM 7529  C CA   . LYS A 1 39 ? 8.733   6.421   -0.092  1.00 0.00 ? 39 LYS A CA   7  
ATOM 7530  C C    . LYS A 1 39 ? 7.221   6.330   0.086   1.00 0.00 ? 39 LYS A C    7  
ATOM 7531  O O    . LYS A 1 39 ? 6.543   7.346   0.244   1.00 0.00 ? 39 LYS A O    7  
ATOM 7532  C CB   . LYS A 1 39 ? 9.109   6.088   -1.537  1.00 0.00 ? 39 LYS A CB   7  
ATOM 7533  C CG   . LYS A 1 39 ? 10.605  6.106   -1.797  1.00 0.00 ? 39 LYS A CG   7  
ATOM 7534  C CD   . LYS A 1 39 ? 11.110  7.516   -2.050  1.00 0.00 ? 39 LYS A CD   7  
ATOM 7535  C CE   . LYS A 1 39 ? 12.596  7.639   -1.749  1.00 0.00 ? 39 LYS A CE   7  
ATOM 7536  N NZ   . LYS A 1 39 ? 13.428  6.946   -2.770  1.00 0.00 ? 39 LYS A NZ   7  
ATOM 7537  H H    . LYS A 1 39 ? 9.826   4.701   0.481   1.00 0.00 ? 39 LYS A H    7  
ATOM 7538  H HA   . LYS A 1 39 ? 9.050   7.429   0.130   1.00 0.00 ? 39 LYS A HA   7  
ATOM 7539  H HB2  . LYS A 1 39 ? 8.735   5.103   -1.776  1.00 0.00 ? 39 LYS A HB2  7  
ATOM 7540  H HB3  . LYS A 1 39 ? 8.642   6.809   -2.193  1.00 0.00 ? 39 LYS A HB3  7  
ATOM 7541  H HG2  . LYS A 1 39 ? 11.116  5.702   -0.935  1.00 0.00 ? 39 LYS A HG2  7  
ATOM 7542  H HG3  . LYS A 1 39 ? 10.818  5.496   -2.663  1.00 0.00 ? 39 LYS A HG3  7  
ATOM 7543  H HD2  . LYS A 1 39 ? 10.943  7.769   -3.087  1.00 0.00 ? 39 LYS A HD2  7  
ATOM 7544  H HD3  . LYS A 1 39 ? 10.565  8.204   -1.419  1.00 0.00 ? 39 LYS A HD3  7  
ATOM 7545  H HE2  . LYS A 1 39 ? 12.861  8.685   -1.730  1.00 0.00 ? 39 LYS A HE2  7  
ATOM 7546  H HE3  . LYS A 1 39 ? 12.790  7.202   -0.780  1.00 0.00 ? 39 LYS A HE3  7  
ATOM 7547  H HZ1  . LYS A 1 39 ? 12.819  6.435   -3.440  1.00 0.00 ? 39 LYS A HZ1  7  
ATOM 7548  H HZ2  . LYS A 1 39 ? 14.065  6.265   -2.310  1.00 0.00 ? 39 LYS A HZ2  7  
ATOM 7549  H HZ3  . LYS A 1 39 ? 14.000  7.638   -3.295  1.00 0.00 ? 39 LYS A HZ3  7  
ATOM 7550  N N    . ILE A 1 40 ? 6.700   5.108   0.061   1.00 0.00 ? 40 ILE A N    7  
ATOM 7551  C CA   . ILE A 1 40 ? 5.268   4.886   0.222   1.00 0.00 ? 40 ILE A CA   7  
ATOM 7552  C C    . ILE A 1 40 ? 4.741   5.579   1.474   1.00 0.00 ? 40 ILE A C    7  
ATOM 7553  O O    . ILE A 1 40 ? 3.601   6.042   1.506   1.00 0.00 ? 40 ILE A O    7  
ATOM 7554  C CB   . ILE A 1 40 ? 4.938   3.384   0.303   1.00 0.00 ? 40 ILE A CB   7  
ATOM 7555  C CG1  . ILE A 1 40 ? 5.420   2.664   -0.958  1.00 0.00 ? 40 ILE A CG1  7  
ATOM 7556  C CG2  . ILE A 1 40 ? 3.442   3.180   0.497   1.00 0.00 ? 40 ILE A CG2  7  
ATOM 7557  C CD1  . ILE A 1 40 ? 5.197   1.168   -0.923  1.00 0.00 ? 40 ILE A CD1  7  
ATOM 7558  H H    . ILE A 1 40 ? 7.292   4.338   -0.068  1.00 0.00 ? 40 ILE A H    7  
ATOM 7559  H HA   . ILE A 1 40 ? 4.768   5.298   -0.643  1.00 0.00 ? 40 ILE A HA   7  
ATOM 7560  H HB   . ILE A 1 40 ? 5.447   2.972   1.161   1.00 0.00 ? 40 ILE A HB   7  
ATOM 7561  H HG12 . ILE A 1 40 ? 4.893   3.057   -1.813  1.00 0.00 ? 40 ILE A HG12 7  
ATOM 7562  H HG13 . ILE A 1 40 ? 6.479   2.840   -1.081  1.00 0.00 ? 40 ILE A HG13 7  
ATOM 7563  H HG21 . ILE A 1 40 ? 2.936   4.130   0.412   1.00 0.00 ? 40 ILE A HG21 7  
ATOM 7564  H HG22 . ILE A 1 40 ? 3.070   2.507   -0.261  1.00 0.00 ? 40 ILE A HG22 7  
ATOM 7565  H HG23 . ILE A 1 40 ? 3.260   2.760   1.474   1.00 0.00 ? 40 ILE A HG23 7  
ATOM 7566  H HD11 . ILE A 1 40 ? 4.149   0.956   -1.075  1.00 0.00 ? 40 ILE A HD11 7  
ATOM 7567  H HD12 . ILE A 1 40 ? 5.777   0.699   -1.703  1.00 0.00 ? 40 ILE A HD12 7  
ATOM 7568  H HD13 . ILE A 1 40 ? 5.507   0.781   0.037   1.00 0.00 ? 40 ILE A HD13 7  
ATOM 7569  N N    . SER A 1 41 ? 5.580   5.649   2.502   1.00 0.00 ? 41 SER A N    7  
ATOM 7570  C CA   . SER A 1 41 ? 5.199   6.284   3.758   1.00 0.00 ? 41 SER A CA   7  
ATOM 7571  C C    . SER A 1 41 ? 4.960   7.778   3.560   1.00 0.00 ? 41 SER A C    7  
ATOM 7572  O O    . SER A 1 41 ? 4.096   8.370   4.207   1.00 0.00 ? 41 SER A O    7  
ATOM 7573  C CB   . SER A 1 41 ? 6.283   6.065   4.815   1.00 0.00 ? 41 SER A CB   7  
ATOM 7574  O OG   . SER A 1 41 ? 6.349   7.159   5.713   1.00 0.00 ? 41 SER A OG   7  
ATOM 7575  H H    . SER A 1 41 ? 6.476   5.261   2.415   1.00 0.00 ? 41 SER A H    7  
ATOM 7576  H HA   . SER A 1 41 ? 4.281   5.826   4.096   1.00 0.00 ? 41 SER A HA   7  
ATOM 7577  H HB2  . SER A 1 41 ? 6.061   5.169   5.374   1.00 0.00 ? 41 SER A HB2  7  
ATOM 7578  H HB3  . SER A 1 41 ? 7.241   5.957   4.327   1.00 0.00 ? 41 SER A HB3  7  
ATOM 7579  H HG   . SER A 1 41 ? 5.719   7.027   6.426   1.00 0.00 ? 41 SER A HG   7  
ATOM 7580  N N    . ALA A 1 42 ? 5.732   8.380   2.662   1.00 0.00 ? 42 ALA A N    7  
ATOM 7581  C CA   . ALA A 1 42 ? 5.604   9.804   2.376   1.00 0.00 ? 42 ALA A CA   7  
ATOM 7582  C C    . ALA A 1 42 ? 4.584   10.053  1.270   1.00 0.00 ? 42 ALA A C    7  
ATOM 7583  O O    . ALA A 1 42 ? 3.979   11.122  1.200   1.00 0.00 ? 42 ALA A O    7  
ATOM 7584  C CB   . ALA A 1 42 ? 6.955   10.389  1.993   1.00 0.00 ? 42 ALA A CB   7  
ATOM 7585  H H    . ALA A 1 42 ? 6.402   7.854   2.178   1.00 0.00 ? 42 ALA A H    7  
ATOM 7586  H HA   . ALA A 1 42 ? 5.269   10.296  3.278   1.00 0.00 ? 42 ALA A HA   7  
ATOM 7587  H HB1  . ALA A 1 42 ? 7.486   10.683  2.887   1.00 0.00 ? 42 ALA A HB1  7  
ATOM 7588  H HB2  . ALA A 1 42 ? 7.530   9.647   1.460   1.00 0.00 ? 42 ALA A HB2  7  
ATOM 7589  H HB3  . ALA A 1 42 ? 6.807   11.252  1.362   1.00 0.00 ? 42 ALA A HB3  7  
ATOM 7590  N N    . ALA A 1 43 ? 4.400   9.059   0.407   1.00 0.00 ? 43 ALA A N    7  
ATOM 7591  C CA   . ALA A 1 43 ? 3.453   9.170   -0.695  1.00 0.00 ? 43 ALA A CA   7  
ATOM 7592  C C    . ALA A 1 43 ? 2.021   8.967   -0.211  1.00 0.00 ? 43 ALA A C    7  
ATOM 7593  O O    . ALA A 1 43 ? 1.077   9.509   -0.786  1.00 0.00 ? 43 ALA A O    7  
ATOM 7594  C CB   . ALA A 1 43 ? 3.791   8.163   -1.785  1.00 0.00 ? 43 ALA A CB   7  
ATOM 7595  H H    . ALA A 1 43 ? 4.912   8.231   0.516   1.00 0.00 ? 43 ALA A H    7  
ATOM 7596  H HA   . ALA A 1 43 ? 3.543   10.161  -1.114  1.00 0.00 ? 43 ALA A HA   7  
ATOM 7597  H HB1  . ALA A 1 43 ? 3.802   8.662   -2.743  1.00 0.00 ? 43 ALA A HB1  7  
ATOM 7598  H HB2  . ALA A 1 43 ? 4.763   7.735   -1.590  1.00 0.00 ? 43 ALA A HB2  7  
ATOM 7599  H HB3  . ALA A 1 43 ? 3.048   7.380   -1.795  1.00 0.00 ? 43 ALA A HB3  7  
ATOM 7600  N N    . THR A 1 44 ? 1.865   8.181   0.850   1.00 0.00 ? 44 THR A N    7  
ATOM 7601  C CA   . THR A 1 44 ? 0.549   7.905   1.410   1.00 0.00 ? 44 THR A CA   7  
ATOM 7602  C C    . THR A 1 44 ? 0.452   8.391   2.852   1.00 0.00 ? 44 THR A C    7  
ATOM 7603  O O    . THR A 1 44 ? -0.499  8.066   3.564   1.00 0.00 ? 44 THR A O    7  
ATOM 7604  C CB   . THR A 1 44 ? 0.223   6.401   1.364   1.00 0.00 ? 44 THR A CB   7  
ATOM 7605  O OG1  . THR A 1 44 ? 1.059   5.690   2.284   1.00 0.00 ? 44 THR A OG1  7  
ATOM 7606  C CG2  . THR A 1 44 ? 0.418   5.847   -0.039  1.00 0.00 ? 44 THR A CG2  7  
ATOM 7607  H H    . THR A 1 44 ? 2.656   7.778   1.265   1.00 0.00 ? 44 THR A H    7  
ATOM 7608  H HA   . THR A 1 44 ? -0.184  8.430   0.814   1.00 0.00 ? 44 THR A HA   7  
ATOM 7609  H HB   . THR A 1 44 ? -0.811  6.263   1.649   1.00 0.00 ? 44 THR A HB   7  
ATOM 7610  H HG1  . THR A 1 44 ? 1.867   5.421   1.839   1.00 0.00 ? 44 THR A HG1  7  
ATOM 7611  H HG21 . THR A 1 44 ? 0.080   4.822   -0.073  1.00 0.00 ? 44 THR A HG21 7  
ATOM 7612  H HG22 . THR A 1 44 ? 1.465   5.890   -0.300  1.00 0.00 ? 44 THR A HG22 7  
ATOM 7613  H HG23 . THR A 1 44 ? -0.152  6.437   -0.741  1.00 0.00 ? 44 THR A HG23 7  
ATOM 7614  N N    . SER A 1 45 ? 1.441   9.171   3.277   1.00 0.00 ? 45 SER A N    7  
ATOM 7615  C CA   . SER A 1 45 ? 1.468   9.699   4.636   1.00 0.00 ? 45 SER A CA   7  
ATOM 7616  C C    . SER A 1 45 ? 1.289   8.579   5.657   1.00 0.00 ? 45 SER A C    7  
ATOM 7617  O O    . SER A 1 45 ? 0.747   8.794   6.742   1.00 0.00 ? 45 SER A O    7  
ATOM 7618  C CB   . SER A 1 45 ? 0.373   10.751  4.819   1.00 0.00 ? 45 SER A CB   7  
ATOM 7619  O OG   . SER A 1 45 ? 0.719   11.675  5.836   1.00 0.00 ? 45 SER A OG   7  
ATOM 7620  H H    . SER A 1 45 ? 2.170   9.394   2.662   1.00 0.00 ? 45 SER A H    7  
ATOM 7621  H HA   . SER A 1 45 ? 2.431   10.162  4.792   1.00 0.00 ? 45 SER A HA   7  
ATOM 7622  H HB2  . SER A 1 45 ? 0.235   11.288  3.893   1.00 0.00 ? 45 SER A HB2  7  
ATOM 7623  H HB3  . SER A 1 45 ? -0.551  10.262  5.092   1.00 0.00 ? 45 SER A HB3  7  
ATOM 7624  H HG   . SER A 1 45 ? 0.121   11.571  6.580   1.00 0.00 ? 45 SER A HG   7  
ATOM 7625  N N    . LEU A 1 46 ? 1.748   7.384   5.302   1.00 0.00 ? 46 LEU A N    7  
ATOM 7626  C CA   . LEU A 1 46 ? 1.640   6.229   6.187   1.00 0.00 ? 46 LEU A CA   7  
ATOM 7627  C C    . LEU A 1 46 ? 2.977   5.929   6.856   1.00 0.00 ? 46 LEU A C    7  
ATOM 7628  O O    . LEU A 1 46 ? 3.972   6.612   6.613   1.00 0.00 ? 46 LEU A O    7  
ATOM 7629  C CB   . LEU A 1 46 ? 1.162   5.005   5.403   1.00 0.00 ? 46 LEU A CB   7  
ATOM 7630  C CG   . LEU A 1 46 ? -0.304  5.017   4.969   1.00 0.00 ? 46 LEU A CG   7  
ATOM 7631  C CD1  . LEU A 1 46 ? -0.561  3.936   3.930   1.00 0.00 ? 46 LEU A CD1  7  
ATOM 7632  C CD2  . LEU A 1 46 ? -1.218  4.832   6.171   1.00 0.00 ? 46 LEU A CD2  7  
ATOM 7633  H H    . LEU A 1 46 ? 2.170   7.275   4.425   1.00 0.00 ? 46 LEU A H    7  
ATOM 7634  H HA   . LEU A 1 46 ? 0.913   6.464   6.950   1.00 0.00 ? 46 LEU A HA   7  
ATOM 7635  H HB2  . LEU A 1 46 ? 1.770   4.924   4.515   1.00 0.00 ? 46 LEU A HB2  7  
ATOM 7636  H HB3  . LEU A 1 46 ? 1.317   4.135   6.025   1.00 0.00 ? 46 LEU A HB3  7  
ATOM 7637  H HG   . LEU A 1 46 ? -0.531  5.973   4.518   1.00 0.00 ? 46 LEU A HG   7  
ATOM 7638  H HD11 . LEU A 1 46 ? -1.150  4.346   3.123   1.00 0.00 ? 46 LEU A HD11 7  
ATOM 7639  H HD12 . LEU A 1 46 ? -1.096  3.118   4.387   1.00 0.00 ? 46 LEU A HD12 7  
ATOM 7640  H HD13 . LEU A 1 46 ? 0.382   3.578   3.543   1.00 0.00 ? 46 LEU A HD13 7  
ATOM 7641  H HD21 . LEU A 1 46 ? -1.426  5.794   6.616   1.00 0.00 ? 46 LEU A HD21 7  
ATOM 7642  H HD22 . LEU A 1 46 ? -0.732  4.197   6.898   1.00 0.00 ? 46 LEU A HD22 7  
ATOM 7643  H HD23 . LEU A 1 46 ? -2.143  4.374   5.853   1.00 0.00 ? 46 LEU A HD23 7  
ATOM 7644  N N    . SER A 1 47 ? 2.994   4.900   7.698   1.00 0.00 ? 47 SER A N    7  
ATOM 7645  C CA   . SER A 1 47 ? 4.208   4.510   8.404   1.00 0.00 ? 47 SER A CA   7  
ATOM 7646  C C    . SER A 1 47 ? 4.765   3.204   7.845   1.00 0.00 ? 47 SER A C    7  
ATOM 7647  O O    . SER A 1 47 ? 4.032   2.401   7.270   1.00 0.00 ? 47 SER A O    7  
ATOM 7648  C CB   . SER A 1 47 ? 3.928   4.359   9.900   1.00 0.00 ? 47 SER A CB   7  
ATOM 7649  O OG   . SER A 1 47 ? 4.248   5.548   10.601  1.00 0.00 ? 47 SER A OG   7  
ATOM 7650  H H    . SER A 1 47 ? 2.168   4.394   7.850   1.00 0.00 ? 47 SER A H    7  
ATOM 7651  H HA   . SER A 1 47 ? 4.941   5.290   8.260   1.00 0.00 ? 47 SER A HA   7  
ATOM 7652  H HB2  . SER A 1 47 ? 2.882   4.140   10.047  1.00 0.00 ? 47 SER A HB2  7  
ATOM 7653  H HB3  . SER A 1 47 ? 4.525   3.550   10.296  1.00 0.00 ? 47 SER A HB3  7  
ATOM 7654  H HG   . SER A 1 47 ? 4.995   5.978   10.179  1.00 0.00 ? 47 SER A HG   7  
ATOM 7655  N N    . GLU A 1 48 ? 6.067   3.001   8.020   1.00 0.00 ? 48 GLU A N    7  
ATOM 7656  C CA   . GLU A 1 48 ? 6.723   1.793   7.532   1.00 0.00 ? 48 GLU A CA   7  
ATOM 7657  C C    . GLU A 1 48 ? 6.003   0.543   8.031   1.00 0.00 ? 48 GLU A C    7  
ATOM 7658  O O    . GLU A 1 48 ? 5.907   -0.457  7.320   1.00 0.00 ? 48 GLU A O    7  
ATOM 7659  C CB   . GLU A 1 48 ? 8.186   1.764   7.979   1.00 0.00 ? 48 GLU A CB   7  
ATOM 7660  C CG   . GLU A 1 48 ? 8.959   3.020   7.613   1.00 0.00 ? 48 GLU A CG   7  
ATOM 7661  C CD   . GLU A 1 48 ? 10.422  2.940   8.002   1.00 0.00 ? 48 GLU A CD   7  
ATOM 7662  O OE1  . GLU A 1 48 ? 10.932  1.810   8.160   1.00 0.00 ? 48 GLU A OE1  7  
ATOM 7663  O OE2  . GLU A 1 48 ? 11.058  4.004   8.149   1.00 0.00 ? 48 GLU A OE2  7  
ATOM 7664  H H    . GLU A 1 48 ? 6.599   3.678   8.486   1.00 0.00 ? 48 GLU A H    7  
ATOM 7665  H HA   . GLU A 1 48 ? 6.686   1.808   6.453   1.00 0.00 ? 48 GLU A HA   7  
ATOM 7666  H HB2  . GLU A 1 48 ? 8.221   1.645   9.052   1.00 0.00 ? 48 GLU A HB2  7  
ATOM 7667  H HB3  . GLU A 1 48 ? 8.675   0.919   7.516   1.00 0.00 ? 48 GLU A HB3  7  
ATOM 7668  H HG2  . GLU A 1 48 ? 8.894   3.169   6.545   1.00 0.00 ? 48 GLU A HG2  7  
ATOM 7669  H HG3  . GLU A 1 48 ? 8.513   3.863   8.120   1.00 0.00 ? 48 GLU A HG3  7  
ATOM 7670  N N    . ARG A 1 49 ? 5.500   0.609   9.259   1.00 0.00 ? 49 ARG A N    7  
ATOM 7671  C CA   . ARG A 1 49 ? 4.790   -0.517  9.855   1.00 0.00 ? 49 ARG A CA   7  
ATOM 7672  C C    . ARG A 1 49 ? 3.393   -0.656  9.259   1.00 0.00 ? 49 ARG A C    7  
ATOM 7673  O O    . ARG A 1 49 ? 2.993   -1.741  8.837   1.00 0.00 ? 49 ARG A O    7  
ATOM 7674  C CB   . ARG A 1 49 ? 4.694   -0.341  11.372  1.00 0.00 ? 49 ARG A CB   7  
ATOM 7675  C CG   . ARG A 1 49 ? 3.942   -1.463  12.069  1.00 0.00 ? 49 ARG A CG   7  
ATOM 7676  C CD   . ARG A 1 49 ? 4.578   -2.816  11.791  1.00 0.00 ? 49 ARG A CD   7  
ATOM 7677  N NE   . ARG A 1 49 ? 3.951   -3.885  12.564  1.00 0.00 ? 49 ARG A NE   7  
ATOM 7678  C CZ   . ARG A 1 49 ? 4.181   -5.176  12.354  1.00 0.00 ? 49 ARG A CZ   7  
ATOM 7679  N NH1  . ARG A 1 49 ? 5.019   -5.557  11.399  1.00 0.00 ? 49 ARG A NH1  7  
ATOM 7680  N NH2  . ARG A 1 49 ? 3.573   -6.090  13.099  1.00 0.00 ? 49 ARG A NH2  7  
ATOM 7681  H H    . ARG A 1 49 ? 5.608   1.434   9.778   1.00 0.00 ? 49 ARG A H    7  
ATOM 7682  H HA   . ARG A 1 49 ? 5.351   -1.414  9.641   1.00 0.00 ? 49 ARG A HA   7  
ATOM 7683  H HB2  . ARG A 1 49 ? 5.692   -0.298  11.782  1.00 0.00 ? 49 ARG A HB2  7  
ATOM 7684  H HB3  . ARG A 1 49 ? 4.186   0.588   11.583  1.00 0.00 ? 49 ARG A HB3  7  
ATOM 7685  H HG2  . ARG A 1 49 ? 3.953   -1.285  13.134  1.00 0.00 ? 49 ARG A HG2  7  
ATOM 7686  H HG3  . ARG A 1 49 ? 2.922   -1.475  11.714  1.00 0.00 ? 49 ARG A HG3  7  
ATOM 7687  H HD2  . ARG A 1 49 ? 4.475   -3.039  10.739  1.00 0.00 ? 49 ARG A HD2  7  
ATOM 7688  H HD3  . ARG A 1 49 ? 5.626   -2.766  12.047  1.00 0.00 ? 49 ARG A HD3  7  
ATOM 7689  H HE   . ARG A 1 49 ? 3.328   -3.626  13.274  1.00 0.00 ? 49 ARG A HE   7  
ATOM 7690  H HH11 . ARG A 1 49 ? 5.480   -4.871  10.837  1.00 0.00 ? 49 ARG A HH11 7  
ATOM 7691  H HH12 . ARG A 1 49 ? 5.191   -6.530  11.244  1.00 0.00 ? 49 ARG A HH12 7  
ATOM 7692  H HH21 . ARG A 1 49 ? 2.940   -5.807  13.820  1.00 0.00 ? 49 ARG A HH21 7  
ATOM 7693  H HH22 . ARG A 1 49 ? 3.746   -7.061  12.940  1.00 0.00 ? 49 ARG A HH22 7  
ATOM 7694  N N    . GLN A 1 50 ? 2.655   0.450   9.228   1.00 0.00 ? 50 GLN A N    7  
ATOM 7695  C CA   . GLN A 1 50 ? 1.302   0.450   8.685   1.00 0.00 ? 50 GLN A CA   7  
ATOM 7696  C C    . GLN A 1 50 ? 1.277   -0.162  7.288   1.00 0.00 ? 50 GLN A C    7  
ATOM 7697  O O    . GLN A 1 50 ? 0.492   -1.070  7.012   1.00 0.00 ? 50 GLN A O    7  
ATOM 7698  C CB   . GLN A 1 50 ? 0.748   1.875   8.640   1.00 0.00 ? 50 GLN A CB   7  
ATOM 7699  C CG   . GLN A 1 50 ? 0.445   2.453   10.013  1.00 0.00 ? 50 GLN A CG   7  
ATOM 7700  C CD   . GLN A 1 50 ? -0.581  3.568   9.964   1.00 0.00 ? 50 GLN A CD   7  
ATOM 7701  O OE1  . GLN A 1 50 ? -0.304  4.700   10.360  1.00 0.00 ? 50 GLN A OE1  7  
ATOM 7702  N NE2  . GLN A 1 50 ? -1.775  3.252   9.476   1.00 0.00 ? 50 GLN A NE2  7  
ATOM 7703  H H    . GLN A 1 50 ? 3.029   1.284   9.580   1.00 0.00 ? 50 GLN A H    7  
ATOM 7704  H HA   . GLN A 1 50 ? 0.683   -0.147  9.337   1.00 0.00 ? 50 GLN A HA   7  
ATOM 7705  H HB2  . GLN A 1 50 ? 1.470   2.514   8.155   1.00 0.00 ? 50 GLN A HB2  7  
ATOM 7706  H HB3  . GLN A 1 50 ? -0.166  1.875   8.064   1.00 0.00 ? 50 GLN A HB3  7  
ATOM 7707  H HG2  . GLN A 1 50 ? 0.066   1.664   10.646  1.00 0.00 ? 50 GLN A HG2  7  
ATOM 7708  H HG3  . GLN A 1 50 ? 1.359   2.843   10.435  1.00 0.00 ? 50 GLN A HG3  7  
ATOM 7709  H HE21 . GLN A 1 50 ? -1.925  2.329   9.180   1.00 0.00 ? 50 GLN A HE21 7  
ATOM 7710  H HE22 . GLN A 1 50 ? -2.458  3.953   9.433   1.00 0.00 ? 50 GLN A HE22 7  
ATOM 7711  N N    . ILE A 1 51 ? 2.138   0.342   6.411   1.00 0.00 ? 51 ILE A N    7  
ATOM 7712  C CA   . ILE A 1 51 ? 2.214   -0.156  5.043   1.00 0.00 ? 51 ILE A CA   7  
ATOM 7713  C C    . ILE A 1 51 ? 2.403   -1.669  5.019   1.00 0.00 ? 51 ILE A C    7  
ATOM 7714  O O    . ILE A 1 51 ? 1.751   -2.375  4.248   1.00 0.00 ? 51 ILE A O    7  
ATOM 7715  C CB   . ILE A 1 51 ? 3.368   0.506   4.266   1.00 0.00 ? 51 ILE A CB   7  
ATOM 7716  C CG1  . ILE A 1 51 ? 3.189   2.025   4.241   1.00 0.00 ? 51 ILE A CG1  7  
ATOM 7717  C CG2  . ILE A 1 51 ? 3.440   -0.048  2.851   1.00 0.00 ? 51 ILE A CG2  7  
ATOM 7718  C CD1  . ILE A 1 51 ? 4.428   2.773   3.801   1.00 0.00 ? 51 ILE A CD1  7  
ATOM 7719  H H    . ILE A 1 51 ? 2.738   1.065   6.691   1.00 0.00 ? 51 ILE A H    7  
ATOM 7720  H HA   . ILE A 1 51 ? 1.286   0.089   4.547   1.00 0.00 ? 51 ILE A HA   7  
ATOM 7721  H HB   . ILE A 1 51 ? 4.293   0.268   4.768   1.00 0.00 ? 51 ILE A HB   7  
ATOM 7722  H HG12 . ILE A 1 51 ? 2.391   2.276   3.560   1.00 0.00 ? 51 ILE A HG12 7  
ATOM 7723  H HG13 . ILE A 1 51 ? 2.930   2.366   5.233   1.00 0.00 ? 51 ILE A HG13 7  
ATOM 7724  H HG21 . ILE A 1 51 ? 4.370   -0.582  2.721   1.00 0.00 ? 51 ILE A HG21 7  
ATOM 7725  H HG22 . ILE A 1 51 ? 2.613   -0.722  2.686   1.00 0.00 ? 51 ILE A HG22 7  
ATOM 7726  H HG23 . ILE A 1 51 ? 3.390   0.765   2.143   1.00 0.00 ? 51 ILE A HG23 7  
ATOM 7727  H HD11 . ILE A 1 51 ? 5.053   2.972   4.659   1.00 0.00 ? 51 ILE A HD11 7  
ATOM 7728  H HD12 . ILE A 1 51 ? 4.975   2.175   3.087   1.00 0.00 ? 51 ILE A HD12 7  
ATOM 7729  H HD13 . ILE A 1 51 ? 4.140   3.707   3.341   1.00 0.00 ? 51 ILE A HD13 7  
ATOM 7730  N N    . THR A 1 52 ? 3.298   -2.163  5.869   1.00 0.00 ? 52 THR A N    7  
ATOM 7731  C CA   . THR A 1 52 ? 3.572   -3.592  5.945   1.00 0.00 ? 52 THR A CA   7  
ATOM 7732  C C    . THR A 1 52 ? 2.313   -4.375  6.303   1.00 0.00 ? 52 THR A C    7  
ATOM 7733  O O    . THR A 1 52 ? 1.995   -5.381  5.668   1.00 0.00 ? 52 THR A O    7  
ATOM 7734  C CB   . THR A 1 52 ? 4.666   -3.899  6.985   1.00 0.00 ? 52 THR A CB   7  
ATOM 7735  O OG1  . THR A 1 52 ? 5.876   -3.215  6.640   1.00 0.00 ? 52 THR A OG1  7  
ATOM 7736  C CG2  . THR A 1 52 ? 4.930   -5.395  7.067   1.00 0.00 ? 52 THR A CG2  7  
ATOM 7737  H H    . THR A 1 52 ? 3.785   -1.549  6.457   1.00 0.00 ? 52 THR A H    7  
ATOM 7738  H HA   . THR A 1 52 ? 3.923   -3.917  4.977   1.00 0.00 ? 52 THR A HA   7  
ATOM 7739  H HB   . THR A 1 52 ? 4.330   -3.554  7.952   1.00 0.00 ? 52 THR A HB   7  
ATOM 7740  H HG1  . THR A 1 52 ? 6.263   -2.831  7.430   1.00 0.00 ? 52 THR A HG1  7  
ATOM 7741  H HG21 . THR A 1 52 ? 4.326   -5.908  6.334   1.00 0.00 ? 52 THR A HG21 7  
ATOM 7742  H HG22 . THR A 1 52 ? 4.677   -5.751  8.055   1.00 0.00 ? 52 THR A HG22 7  
ATOM 7743  H HG23 . THR A 1 52 ? 5.974   -5.587  6.871   1.00 0.00 ? 52 THR A HG23 7  
ATOM 7744  N N    . ILE A 1 53 ? 1.601   -3.907  7.322   1.00 0.00 ? 53 ILE A N    7  
ATOM 7745  C CA   . ILE A 1 53 ? 0.376   -4.563  7.762   1.00 0.00 ? 53 ILE A CA   7  
ATOM 7746  C C    . ILE A 1 53 ? -0.578  -4.787  6.593   1.00 0.00 ? 53 ILE A C    7  
ATOM 7747  O O    . ILE A 1 53 ? -1.110  -5.883  6.415   1.00 0.00 ? 53 ILE A O    7  
ATOM 7748  C CB   . ILE A 1 53 ? -0.345  -3.740  8.847   1.00 0.00 ? 53 ILE A CB   7  
ATOM 7749  C CG1  . ILE A 1 53 ? 0.568   -3.544  10.059  1.00 0.00 ? 53 ILE A CG1  7  
ATOM 7750  C CG2  . ILE A 1 53 ? -1.640  -4.425  9.258   1.00 0.00 ? 53 ILE A CG2  7  
ATOM 7751  C CD1  . ILE A 1 53 ? 0.190   -2.354  10.913  1.00 0.00 ? 53 ILE A CD1  7  
ATOM 7752  H H    . ILE A 1 53 ? 1.906   -3.101  7.789   1.00 0.00 ? 53 ILE A H    7  
ATOM 7753  H HA   . ILE A 1 53 ? 0.644   -5.521  8.184   1.00 0.00 ? 53 ILE A HA   7  
ATOM 7754  H HB   . ILE A 1 53 ? -0.592  -2.776  8.431   1.00 0.00 ? 53 ILE A HB   7  
ATOM 7755  H HG12 . ILE A 1 53 ? 0.526   -4.424  10.680  1.00 0.00 ? 53 ILE A HG12 7  
ATOM 7756  H HG13 . ILE A 1 53 ? 1.583   -3.398  9.716   1.00 0.00 ? 53 ILE A HG13 7  
ATOM 7757  H HG21 . ILE A 1 53 ? -1.862  -4.186  10.287  1.00 0.00 ? 53 ILE A HG21 7  
ATOM 7758  H HG22 . ILE A 1 53 ? -2.445  -4.080  8.627   1.00 0.00 ? 53 ILE A HG22 7  
ATOM 7759  H HG23 . ILE A 1 53 ? -1.531  -5.494  9.152   1.00 0.00 ? 53 ILE A HG23 7  
ATOM 7760  H HD11 . ILE A 1 53 ? 0.966   -1.605  10.852  1.00 0.00 ? 53 ILE A HD11 7  
ATOM 7761  H HD12 . ILE A 1 53 ? -0.741  -1.938  10.560  1.00 0.00 ? 53 ILE A HD12 7  
ATOM 7762  H HD13 . ILE A 1 53 ? 0.077   -2.670  11.940  1.00 0.00 ? 53 ILE A HD13 7  
ATOM 7763  N N    . TRP A 1 54 ? -0.787  -3.744  5.799   1.00 0.00 ? 54 TRP A N    7  
ATOM 7764  C CA   . TRP A 1 54 ? -1.676  -3.828  4.646   1.00 0.00 ? 54 TRP A CA   7  
ATOM 7765  C C    . TRP A 1 54 ? -1.175  -4.865  3.647   1.00 0.00 ? 54 TRP A C    7  
ATOM 7766  O O    . TRP A 1 54 ? -1.942  -5.698  3.164   1.00 0.00 ? 54 TRP A O    7  
ATOM 7767  C CB   . TRP A 1 54 ? -1.793  -2.463  3.966   1.00 0.00 ? 54 TRP A CB   7  
ATOM 7768  C CG   . TRP A 1 54 ? -2.823  -2.428  2.877   1.00 0.00 ? 54 TRP A CG   7  
ATOM 7769  C CD1  . TRP A 1 54 ? -4.136  -2.075  3.003   1.00 0.00 ? 54 TRP A CD1  7  
ATOM 7770  C CD2  . TRP A 1 54 ? -2.624  -2.760  1.499   1.00 0.00 ? 54 TRP A CD2  7  
ATOM 7771  N NE1  . TRP A 1 54 ? -4.766  -2.168  1.785   1.00 0.00 ? 54 TRP A NE1  7  
ATOM 7772  C CE2  . TRP A 1 54 ? -3.860  -2.585  0.846   1.00 0.00 ? 54 TRP A CE2  7  
ATOM 7773  C CE3  . TRP A 1 54 ? -1.522  -3.186  0.752   1.00 0.00 ? 54 TRP A CE3  7  
ATOM 7774  C CZ2  . TRP A 1 54 ? -4.022  -2.823  -0.516  1.00 0.00 ? 54 TRP A CZ2  7  
ATOM 7775  C CZ3  . TRP A 1 54 ? -1.685  -3.423  -0.599  1.00 0.00 ? 54 TRP A CZ3  7  
ATOM 7776  C CH2  . TRP A 1 54 ? -2.927  -3.240  -1.223  1.00 0.00 ? 54 TRP A CH2  7  
ATOM 7777  H H    . TRP A 1 54 ? -0.334  -2.896  5.993   1.00 0.00 ? 54 TRP A H    7  
ATOM 7778  H HA   . TRP A 1 54 ? -2.651  -4.128  5.000   1.00 0.00 ? 54 TRP A HA   7  
ATOM 7779  H HB2  . TRP A 1 54 ? -2.063  -1.722  4.704   1.00 0.00 ? 54 TRP A HB2  7  
ATOM 7780  H HB3  . TRP A 1 54 ? -0.839  -2.202  3.532   1.00 0.00 ? 54 TRP A HB3  7  
ATOM 7781  H HD1  . TRP A 1 54 ? -4.598  -1.771  3.929   1.00 0.00 ? 54 TRP A HD1  7  
ATOM 7782  H HE1  . TRP A 1 54 ? -5.710  -1.966  1.616   1.00 0.00 ? 54 TRP A HE1  7  
ATOM 7783  H HE3  . TRP A 1 54 ? -0.557  -3.333  1.215   1.00 0.00 ? 54 TRP A HE3  7  
ATOM 7784  H HZ2  . TRP A 1 54 ? -4.972  -2.687  -1.011  1.00 0.00 ? 54 TRP A HZ2  7  
ATOM 7785  H HZ3  . TRP A 1 54 ? -0.845  -3.753  -1.192  1.00 0.00 ? 54 TRP A HZ3  7  
ATOM 7786  H HH2  . TRP A 1 54 ? -3.008  -3.437  -2.280  1.00 0.00 ? 54 TRP A HH2  7  
ATOM 7787  N N    . PHE A 1 55 ? 0.118   -4.810  3.341   1.00 0.00 ? 55 PHE A N    7  
ATOM 7788  C CA   . PHE A 1 55 ? 0.721   -5.745  2.399   1.00 0.00 ? 55 PHE A CA   7  
ATOM 7789  C C    . PHE A 1 55 ? 0.573   -7.183  2.889   1.00 0.00 ? 55 PHE A C    7  
ATOM 7790  O O    . PHE A 1 55 ? 0.440   -8.110  2.091   1.00 0.00 ? 55 PHE A O    7  
ATOM 7791  C CB   . PHE A 1 55 ? 2.201   -5.413  2.195   1.00 0.00 ? 55 PHE A CB   7  
ATOM 7792  C CG   . PHE A 1 55 ? 2.460   -4.541  1.000   1.00 0.00 ? 55 PHE A CG   7  
ATOM 7793  C CD1  . PHE A 1 55 ? 2.160   -3.189  1.035   1.00 0.00 ? 55 PHE A CD1  7  
ATOM 7794  C CD2  . PHE A 1 55 ? 3.006   -5.073  -0.157  1.00 0.00 ? 55 PHE A CD2  7  
ATOM 7795  C CE1  . PHE A 1 55 ? 2.397   -2.384  -0.064  1.00 0.00 ? 55 PHE A CE1  7  
ATOM 7796  C CE2  . PHE A 1 55 ? 3.246   -4.273  -1.258  1.00 0.00 ? 55 PHE A CE2  7  
ATOM 7797  C CZ   . PHE A 1 55 ? 2.942   -2.927  -1.211  1.00 0.00 ? 55 PHE A CZ   7  
ATOM 7798  H H    . PHE A 1 55 ? 0.679   -4.123  3.759   1.00 0.00 ? 55 PHE A H    7  
ATOM 7799  H HA   . PHE A 1 55 ? 0.205   -5.644  1.457   1.00 0.00 ? 55 PHE A HA   7  
ATOM 7800  H HB2  . PHE A 1 55 ? 2.570   -4.897  3.069   1.00 0.00 ? 55 PHE A HB2  7  
ATOM 7801  H HB3  . PHE A 1 55 ? 2.753   -6.332  2.064   1.00 0.00 ? 55 PHE A HB3  7  
ATOM 7802  H HD1  . PHE A 1 55 ? 1.735   -2.763  1.932   1.00 0.00 ? 55 PHE A HD1  7  
ATOM 7803  H HD2  . PHE A 1 55 ? 3.244   -6.127  -0.195  1.00 0.00 ? 55 PHE A HD2  7  
ATOM 7804  H HE1  . PHE A 1 55 ? 2.159   -1.332  -0.024  1.00 0.00 ? 55 PHE A HE1  7  
ATOM 7805  H HE2  . PHE A 1 55 ? 3.672   -4.701  -2.154  1.00 0.00 ? 55 PHE A HE2  7  
ATOM 7806  H HZ   . PHE A 1 55 ? 3.128   -2.301  -2.071  1.00 0.00 ? 55 PHE A HZ   7  
ATOM 7807  N N    . GLN A 1 56 ? 0.599   -7.358  4.206   1.00 0.00 ? 56 GLN A N    7  
ATOM 7808  C CA   . GLN A 1 56 ? 0.469   -8.682  4.803   1.00 0.00 ? 56 GLN A CA   7  
ATOM 7809  C C    . GLN A 1 56 ? -0.968  -9.185  4.705   1.00 0.00 ? 56 GLN A C    7  
ATOM 7810  O O    . GLN A 1 56 ? -1.220  -10.275 4.194   1.00 0.00 ? 56 GLN A O    7  
ATOM 7811  C CB   . GLN A 1 56 ? 0.912   -8.650  6.267   1.00 0.00 ? 56 GLN A CB   7  
ATOM 7812  C CG   . GLN A 1 56 ? 2.401   -8.885  6.457   1.00 0.00 ? 56 GLN A CG   7  
ATOM 7813  C CD   . GLN A 1 56 ? 2.728   -10.329 6.783   1.00 0.00 ? 56 GLN A CD   7  
ATOM 7814  O OE1  . GLN A 1 56 ? 1.882   -11.214 6.649   1.00 0.00 ? 56 GLN A OE1  7  
ATOM 7815  N NE2  . GLN A 1 56 ? 3.959   -10.575 7.215   1.00 0.00 ? 56 GLN A NE2  7  
ATOM 7816  H H    . GLN A 1 56 ? 0.707   -6.579  4.790   1.00 0.00 ? 56 GLN A H    7  
ATOM 7817  H HA   . GLN A 1 56 ? 1.111   -9.356  4.257   1.00 0.00 ? 56 GLN A HA   7  
ATOM 7818  H HB2  . GLN A 1 56 ? 0.665   -7.686  6.685   1.00 0.00 ? 56 GLN A HB2  7  
ATOM 7819  H HB3  . GLN A 1 56 ? 0.377   -9.416  6.809   1.00 0.00 ? 56 GLN A HB3  7  
ATOM 7820  H HG2  . GLN A 1 56 ? 2.915   -8.614  5.547   1.00 0.00 ? 56 GLN A HG2  7  
ATOM 7821  H HG3  . GLN A 1 56 ? 2.751   -8.261  7.266   1.00 0.00 ? 56 GLN A HG3  7  
ATOM 7822  H HE21 . GLN A 1 56 ? 4.579   -9.820  7.299   1.00 0.00 ? 56 GLN A HE21 7  
ATOM 7823  H HE22 . GLN A 1 56 ? 4.197   -11.500 7.434   1.00 0.00 ? 56 GLN A HE22 7  
ATOM 7824  N N    . ASN A 1 57 ? -1.905  -8.382  5.198   1.00 0.00 ? 57 ASN A N    7  
ATOM 7825  C CA   . ASN A 1 57 ? -3.317  -8.747  5.167   1.00 0.00 ? 57 ASN A CA   7  
ATOM 7826  C C    . ASN A 1 57 ? -3.766  -9.062  3.743   1.00 0.00 ? 57 ASN A C    7  
ATOM 7827  O O    . ASN A 1 57 ? -4.718  -9.815  3.533   1.00 0.00 ? 57 ASN A O    7  
ATOM 7828  C CB   . ASN A 1 57 ? -4.171  -7.616  5.744   1.00 0.00 ? 57 ASN A CB   7  
ATOM 7829  C CG   . ASN A 1 57 ? -4.419  -7.780  7.231   1.00 0.00 ? 57 ASN A CG   7  
ATOM 7830  O OD1  . ASN A 1 57 ? -5.550  -8.006  7.661   1.00 0.00 ? 57 ASN A OD1  7  
ATOM 7831  N ND2  . ASN A 1 57 ? -3.360  -7.666  8.024   1.00 0.00 ? 57 ASN A ND2  7  
ATOM 7832  H H    . ASN A 1 57 ? -1.642  -7.525  5.593   1.00 0.00 ? 57 ASN A H    7  
ATOM 7833  H HA   . ASN A 1 57 ? -3.445  -9.629  5.776   1.00 0.00 ? 57 ASN A HA   7  
ATOM 7834  H HB2  . ASN A 1 57 ? -3.665  -6.674  5.585   1.00 0.00 ? 57 ASN A HB2  7  
ATOM 7835  H HB3  . ASN A 1 57 ? -5.124  -7.597  5.238   1.00 0.00 ? 57 ASN A HB3  7  
ATOM 7836  H HD21 . ASN A 1 57 ? -2.490  -7.485  7.611   1.00 0.00 ? 57 ASN A HD21 7  
ATOM 7837  H HD22 . ASN A 1 57 ? -3.492  -7.768  8.989   1.00 0.00 ? 57 ASN A HD22 7  
ATOM 7838  N N    . ARG A 1 58 ? -3.074  -8.481  2.768   1.00 0.00 ? 58 ARG A N    7  
ATOM 7839  C CA   . ARG A 1 58 ? -3.402  -8.699  1.364   1.00 0.00 ? 58 ARG A CA   7  
ATOM 7840  C C    . ARG A 1 58 ? -3.038  -10.118 0.935   1.00 0.00 ? 58 ARG A C    7  
ATOM 7841  O O    . ARG A 1 58 ? -3.742  -10.734 0.134   1.00 0.00 ? 58 ARG A O    7  
ATOM 7842  C CB   . ARG A 1 58 ? -2.668  -7.685  0.484   1.00 0.00 ? 58 ARG A CB   7  
ATOM 7843  C CG   . ARG A 1 58 ? -3.598  -6.816  -0.347  1.00 0.00 ? 58 ARG A CG   7  
ATOM 7844  C CD   . ARG A 1 58 ? -4.465  -7.654  -1.273  1.00 0.00 ? 58 ARG A CD   7  
ATOM 7845  N NE   . ARG A 1 58 ? -3.680  -8.300  -2.322  1.00 0.00 ? 58 ARG A NE   7  
ATOM 7846  C CZ   . ARG A 1 58 ? -4.217  -8.875  -3.393  1.00 0.00 ? 58 ARG A CZ   7  
ATOM 7847  N NH1  . ARG A 1 58 ? -5.533  -8.883  -3.555  1.00 0.00 ? 58 ARG A NH1  7  
ATOM 7848  N NH2  . ARG A 1 58 ? -3.437  -9.442  -4.304  1.00 0.00 ? 58 ARG A NH2  7  
ATOM 7849  H H    . ARG A 1 58 ? -2.326  -7.891  2.998   1.00 0.00 ? 58 ARG A H    7  
ATOM 7850  H HA   . ARG A 1 58 ? -4.466  -8.562  1.246   1.00 0.00 ? 58 ARG A HA   7  
ATOM 7851  H HB2  . ARG A 1 58 ? -2.076  -7.040  1.116   1.00 0.00 ? 58 ARG A HB2  7  
ATOM 7852  H HB3  . ARG A 1 58 ? -2.013  -8.218  -0.188  1.00 0.00 ? 58 ARG A HB3  7  
ATOM 7853  H HG2  . ARG A 1 58 ? -4.238  -6.253  0.316   1.00 0.00 ? 58 ARG A HG2  7  
ATOM 7854  H HG3  . ARG A 1 58 ? -3.004  -6.136  -0.940  1.00 0.00 ? 58 ARG A HG3  7  
ATOM 7855  H HD2  . ARG A 1 58 ? -4.962  -8.414  -0.689  1.00 0.00 ? 58 ARG A HD2  7  
ATOM 7856  H HD3  . ARG A 1 58 ? -5.203  -7.013  -1.731  1.00 0.00 ? 58 ARG A HD3  7  
ATOM 7857  H HE   . ARG A 1 58 ? -2.706  -8.305  -2.222  1.00 0.00 ? 58 ARG A HE   7  
ATOM 7858  H HH11 . ARG A 1 58 ? -6.123  -8.455  -2.871  1.00 0.00 ? 58 ARG A HH11 7  
ATOM 7859  H HH12 . ARG A 1 58 ? -5.934  -9.315  -4.363  1.00 0.00 ? 58 ARG A HH12 7  
ATOM 7860  H HH21 . ARG A 1 58 ? -2.444  -9.437  -4.185  1.00 0.00 ? 58 ARG A HH21 7  
ATOM 7861  H HH22 . ARG A 1 58 ? -3.841  -9.874  -5.109  1.00 0.00 ? 58 ARG A HH22 7  
ATOM 7862  N N    . ARG A 1 59 ? -1.936  -10.629 1.473   1.00 0.00 ? 59 ARG A N    7  
ATOM 7863  C CA   . ARG A 1 59 ? -1.479  -11.974 1.145   1.00 0.00 ? 59 ARG A CA   7  
ATOM 7864  C C    . ARG A 1 59 ? -2.171  -13.013 2.022   1.00 0.00 ? 59 ARG A C    7  
ATOM 7865  O O    . ARG A 1 59 ? -2.716  -13.998 1.524   1.00 0.00 ? 59 ARG A O    7  
ATOM 7866  C CB   . ARG A 1 59 ? 0.038   -12.076 1.316   1.00 0.00 ? 59 ARG A CB   7  
ATOM 7867  C CG   . ARG A 1 59 ? 0.823   -11.496 0.151   1.00 0.00 ? 59 ARG A CG   7  
ATOM 7868  C CD   . ARG A 1 59 ? 2.307   -11.402 0.470   1.00 0.00 ? 59 ARG A CD   7  
ATOM 7869  N NE   . ARG A 1 59 ? 3.078   -12.442 -0.205  1.00 0.00 ? 59 ARG A NE   7  
ATOM 7870  C CZ   . ARG A 1 59 ? 3.246   -13.666 0.282   1.00 0.00 ? 59 ARG A CZ   7  
ATOM 7871  N NH1  . ARG A 1 59 ? 2.698   -14.003 1.441   1.00 0.00 ? 59 ARG A NH1  7  
ATOM 7872  N NH2  . ARG A 1 59 ? 3.962   -14.557 -0.392  1.00 0.00 ? 59 ARG A NH2  7  
ATOM 7873  H H    . ARG A 1 59 ? -1.417  -10.089 2.106   1.00 0.00 ? 59 ARG A H    7  
ATOM 7874  H HA   . ARG A 1 59 ? -1.729  -12.167 0.113   1.00 0.00 ? 59 ARG A HA   7  
ATOM 7875  H HB2  . ARG A 1 59 ? 0.324   -11.546 2.213   1.00 0.00 ? 59 ARG A HB2  7  
ATOM 7876  H HB3  . ARG A 1 59 ? 0.307   -13.116 1.421   1.00 0.00 ? 59 ARG A HB3  7  
ATOM 7877  H HG2  . ARG A 1 59 ? 0.691   -12.132 -0.712  1.00 0.00 ? 59 ARG A HG2  7  
ATOM 7878  H HG3  . ARG A 1 59 ? 0.447   -10.507 -0.067  1.00 0.00 ? 59 ARG A HG3  7  
ATOM 7879  H HD2  . ARG A 1 59 ? 2.669   -10.436 0.154   1.00 0.00 ? 59 ARG A HD2  7  
ATOM 7880  H HD3  . ARG A 1 59 ? 2.439   -11.504 1.537   1.00 0.00 ? 59 ARG A HD3  7  
ATOM 7881  H HE   . ARG A 1 59 ? 3.492   -12.215 -1.064  1.00 0.00 ? 59 ARG A HE   7  
ATOM 7882  H HH11 . ARG A 1 59 ? 2.157   -13.334 1.950   1.00 0.00 ? 59 ARG A HH11 7  
ATOM 7883  H HH12 . ARG A 1 59 ? 2.825   -14.926 1.805   1.00 0.00 ? 59 ARG A HH12 7  
ATOM 7884  H HH21 . ARG A 1 59 ? 4.376   -14.307 -1.267  1.00 0.00 ? 59 ARG A HH21 7  
ATOM 7885  H HH22 . ARG A 1 59 ? 4.087   -15.478 -0.025  1.00 0.00 ? 59 ARG A HH22 7  
ATOM 7886  N N    . VAL A 1 60 ? -2.145  -12.787 3.332   1.00 0.00 ? 60 VAL A N    7  
ATOM 7887  C CA   . VAL A 1 60 ? -2.771  -13.702 4.279   1.00 0.00 ? 60 VAL A CA   7  
ATOM 7888  C C    . VAL A 1 60 ? -4.215  -13.995 3.888   1.00 0.00 ? 60 VAL A C    7  
ATOM 7889  O O    . VAL A 1 60 ? -4.736  -15.078 4.157   1.00 0.00 ? 60 VAL A O    7  
ATOM 7890  C CB   . VAL A 1 60 ? -2.742  -13.135 5.710   1.00 0.00 ? 60 VAL A CB   7  
ATOM 7891  C CG1  . VAL A 1 60 ? -3.373  -14.116 6.686   1.00 0.00 ? 60 VAL A CG1  7  
ATOM 7892  C CG2  . VAL A 1 60 ? -1.317  -12.802 6.123   1.00 0.00 ? 60 VAL A CG2  7  
ATOM 7893  H H    . VAL A 1 60 ? -1.696  -11.984 3.669   1.00 0.00 ? 60 VAL A H    7  
ATOM 7894  H HA   . VAL A 1 60 ? -2.211  -14.626 4.269   1.00 0.00 ? 60 VAL A HA   7  
ATOM 7895  H HB   . VAL A 1 60 ? -3.322  -12.223 5.726   1.00 0.00 ? 60 VAL A HB   7  
ATOM 7896  H HG11 . VAL A 1 60 ? -4.358  -13.768 6.961   1.00 0.00 ? 60 VAL A HG11 7  
ATOM 7897  H HG12 . VAL A 1 60 ? -3.450  -15.088 6.221   1.00 0.00 ? 60 VAL A HG12 7  
ATOM 7898  H HG13 . VAL A 1 60 ? -2.758  -14.189 7.571   1.00 0.00 ? 60 VAL A HG13 7  
ATOM 7899  H HG21 . VAL A 1 60 ? -0.626  -13.388 5.535   1.00 0.00 ? 60 VAL A HG21 7  
ATOM 7900  H HG22 . VAL A 1 60 ? -1.129  -11.751 5.956   1.00 0.00 ? 60 VAL A HG22 7  
ATOM 7901  H HG23 . VAL A 1 60 ? -1.182  -13.029 7.170   1.00 0.00 ? 60 VAL A HG23 7  
ATOM 7902  N N    . LYS A 1 61 ? -4.859  -13.022 3.252   1.00 0.00 ? 61 LYS A N    7  
ATOM 7903  C CA   . LYS A 1 61 ? -6.243  -13.174 2.821   1.00 0.00 ? 61 LYS A CA   7  
ATOM 7904  C C    . LYS A 1 61 ? -6.418  -14.440 1.988   1.00 0.00 ? 61 LYS A C    7  
ATOM 7905  O O    . LYS A 1 61 ? -7.473  -15.073 2.020   1.00 0.00 ? 61 LYS A O    7  
ATOM 7906  C CB   . LYS A 1 61 ? -6.684  -11.952 2.011   1.00 0.00 ? 61 LYS A CB   7  
ATOM 7907  C CG   . LYS A 1 61 ? -8.185  -11.882 1.785   1.00 0.00 ? 61 LYS A CG   7  
ATOM 7908  C CD   . LYS A 1 61 ? -8.586  -10.584 1.105   1.00 0.00 ? 61 LYS A CD   7  
ATOM 7909  C CE   . LYS A 1 61 ? -9.940  -10.707 0.424   1.00 0.00 ? 61 LYS A CE   7  
ATOM 7910  N NZ   . LYS A 1 61 ? -10.546 -9.374  0.151   1.00 0.00 ? 61 LYS A NZ   7  
ATOM 7911  H H    . LYS A 1 61 ? -4.390  -12.181 3.066   1.00 0.00 ? 61 LYS A H    7  
ATOM 7912  H HA   . LYS A 1 61 ? -6.859  -13.251 3.705   1.00 0.00 ? 61 LYS A HA   7  
ATOM 7913  H HB2  . LYS A 1 61 ? -6.378  -11.059 2.535   1.00 0.00 ? 61 LYS A HB2  7  
ATOM 7914  H HB3  . LYS A 1 61 ? -6.197  -11.980 1.047   1.00 0.00 ? 61 LYS A HB3  7  
ATOM 7915  H HG2  . LYS A 1 61 ? -8.484  -12.711 1.160   1.00 0.00 ? 61 LYS A HG2  7  
ATOM 7916  H HG3  . LYS A 1 61 ? -8.687  -11.948 2.739   1.00 0.00 ? 61 LYS A HG3  7  
ATOM 7917  H HD2  . LYS A 1 61 ? -8.638  -9.800  1.846   1.00 0.00 ? 61 LYS A HD2  7  
ATOM 7918  H HD3  . LYS A 1 61 ? -7.841  -10.332 0.363   1.00 0.00 ? 61 LYS A HD3  7  
ATOM 7919  H HE2  . LYS A 1 61 ? -9.813  -11.233 -0.510  1.00 0.00 ? 61 LYS A HE2  7  
ATOM 7920  H HE3  . LYS A 1 61 ? -10.601 -11.269 1.067   1.00 0.00 ? 61 LYS A HE3  7  
ATOM 7921  H HZ1  . LYS A 1 61 ? -10.896 -9.335  -0.828  1.00 0.00 ? 61 LYS A HZ1  7  
ATOM 7922  H HZ2  . LYS A 1 61 ? -9.838  -8.625  0.284   1.00 0.00 ? 61 LYS A HZ2  7  
ATOM 7923  H HZ3  . LYS A 1 61 ? -11.342 -9.204  0.799   1.00 0.00 ? 61 LYS A HZ3  7  
ATOM 7924  N N    . GLU A 1 62 ? -5.378  -14.802 1.244   1.00 0.00 ? 62 GLU A N    7  
ATOM 7925  C CA   . GLU A 1 62 ? -5.418  -15.993 0.404   1.00 0.00 ? 62 GLU A CA   7  
ATOM 7926  C C    . GLU A 1 62 ? -4.529  -17.093 0.976   1.00 0.00 ? 62 GLU A C    7  
ATOM 7927  O O    . GLU A 1 62 ? -4.032  -17.950 0.245   1.00 0.00 ? 62 GLU A O    7  
ATOM 7928  C CB   . GLU A 1 62 ? -4.974  -15.654 -1.021  1.00 0.00 ? 62 GLU A CB   7  
ATOM 7929  C CG   . GLU A 1 62 ? -3.715  -14.805 -1.081  1.00 0.00 ? 62 GLU A CG   7  
ATOM 7930  C CD   . GLU A 1 62 ? -3.301  -14.475 -2.502  1.00 0.00 ? 62 GLU A CD   7  
ATOM 7931  O OE1  . GLU A 1 62 ? -4.005  -13.674 -3.153  1.00 0.00 ? 62 GLU A OE1  7  
ATOM 7932  O OE2  . GLU A 1 62 ? -2.275  -15.017 -2.963  1.00 0.00 ? 62 GLU A OE2  7  
ATOM 7933  H H    . GLU A 1 62 ? -4.564  -14.256 1.261   1.00 0.00 ? 62 GLU A H    7  
ATOM 7934  H HA   . GLU A 1 62 ? -6.437  -16.347 0.379   1.00 0.00 ? 62 GLU A HA   7  
ATOM 7935  H HB2  . GLU A 1 62 ? -4.791  -16.573 -1.556  1.00 0.00 ? 62 GLU A HB2  7  
ATOM 7936  H HB3  . GLU A 1 62 ? -5.770  -15.114 -1.513  1.00 0.00 ? 62 GLU A HB3  7  
ATOM 7937  H HG2  . GLU A 1 62 ? -3.893  -13.882 -0.550  1.00 0.00 ? 62 GLU A HG2  7  
ATOM 7938  H HG3  . GLU A 1 62 ? -2.910  -15.345 -0.603  1.00 0.00 ? 62 GLU A HG3  7  
ATOM 7939  N N    . LYS A 1 63 ? -4.333  -17.063 2.290   1.00 0.00 ? 63 LYS A N    7  
ATOM 7940  C CA   . LYS A 1 63 ? -3.506  -18.057 2.964   1.00 0.00 ? 63 LYS A CA   7  
ATOM 7941  C C    . LYS A 1 63 ? -4.299  -18.784 4.044   1.00 0.00 ? 63 LYS A C    7  
ATOM 7942  O O    . LYS A 1 63 ? -4.160  -19.994 4.224   1.00 0.00 ? 63 LYS A O    7  
ATOM 7943  C CB   . LYS A 1 63 ? -2.274  -17.392 3.581   1.00 0.00 ? 63 LYS A CB   7  
ATOM 7944  C CG   . LYS A 1 63 ? -1.342  -16.768 2.557   1.00 0.00 ? 63 LYS A CG   7  
ATOM 7945  C CD   . LYS A 1 63 ? -0.430  -17.807 1.927   1.00 0.00 ? 63 LYS A CD   7  
ATOM 7946  C CE   . LYS A 1 63 ? 0.487   -17.185 0.885   1.00 0.00 ? 63 LYS A CE   7  
ATOM 7947  N NZ   . LYS A 1 63 ? -0.138  -17.171 -0.467  1.00 0.00 ? 63 LYS A NZ   7  
ATOM 7948  H H    . LYS A 1 63 ? -4.757  -16.355 2.821   1.00 0.00 ? 63 LYS A H    7  
ATOM 7949  H HA   . LYS A 1 63 ? -3.184  -18.776 2.225   1.00 0.00 ? 63 LYS A HA   7  
ATOM 7950  H HB2  . LYS A 1 63 ? -2.600  -16.617 4.259   1.00 0.00 ? 63 LYS A HB2  7  
ATOM 7951  H HB3  . LYS A 1 63 ? -1.719  -18.134 4.137   1.00 0.00 ? 63 LYS A HB3  7  
ATOM 7952  H HG2  . LYS A 1 63 ? -1.933  -16.305 1.780   1.00 0.00 ? 63 LYS A HG2  7  
ATOM 7953  H HG3  . LYS A 1 63 ? -0.735  -16.018 3.045   1.00 0.00 ? 63 LYS A HG3  7  
ATOM 7954  H HD2  . LYS A 1 63 ? 0.176   -18.258 2.699   1.00 0.00 ? 63 LYS A HD2  7  
ATOM 7955  H HD3  . LYS A 1 63 ? -1.036  -18.566 1.453   1.00 0.00 ? 63 LYS A HD3  7  
ATOM 7956  H HE2  . LYS A 1 63 ? 0.710   -16.171 1.180   1.00 0.00 ? 63 LYS A HE2  7  
ATOM 7957  H HE3  . LYS A 1 63 ? 1.403   -17.757 0.843   1.00 0.00 ? 63 LYS A HE3  7  
ATOM 7958  H HZ1  . LYS A 1 63 ? 0.453   -17.700 -1.139  1.00 0.00 ? 63 LYS A HZ1  7  
ATOM 7959  H HZ2  . LYS A 1 63 ? -0.235  -16.192 -0.805  1.00 0.00 ? 63 LYS A HZ2  7  
ATOM 7960  H HZ3  . LYS A 1 63 ? -1.080  -17.609 -0.429  1.00 0.00 ? 63 LYS A HZ3  7  
ATOM 7961  N N    . LYS A 1 64 ? -5.134  -18.039 4.761   1.00 0.00 ? 64 LYS A N    7  
ATOM 7962  C CA   . LYS A 1 64 ? -5.953  -18.612 5.823   1.00 0.00 ? 64 LYS A CA   7  
ATOM 7963  C C    . LYS A 1 64 ? -6.869  -19.702 5.275   1.00 0.00 ? 64 LYS A C    7  
ATOM 7964  O O    . LYS A 1 64 ? -7.740  -19.436 4.448   1.00 0.00 ? 64 LYS A O    7  
ATOM 7965  C CB   . LYS A 1 64 ? -6.788  -17.520 6.496   1.00 0.00 ? 64 LYS A CB   7  
ATOM 7966  C CG   . LYS A 1 64 ? -6.003  -16.679 7.488   1.00 0.00 ? 64 LYS A CG   7  
ATOM 7967  C CD   . LYS A 1 64 ? -5.968  -17.325 8.863   1.00 0.00 ? 64 LYS A CD   7  
ATOM 7968  C CE   . LYS A 1 64 ? -5.150  -16.501 9.845   1.00 0.00 ? 64 LYS A CE   7  
ATOM 7969  N NZ   . LYS A 1 64 ? -5.869  -15.266 10.267  1.00 0.00 ? 64 LYS A NZ   7  
ATOM 7970  H H    . LYS A 1 64 ? -5.201  -17.079 4.571   1.00 0.00 ? 64 LYS A H    7  
ATOM 7971  H HA   . LYS A 1 64 ? -5.290  -19.049 6.554   1.00 0.00 ? 64 LYS A HA   7  
ATOM 7972  H HB2  . LYS A 1 64 ? -7.184  -16.866 5.735   1.00 0.00 ? 64 LYS A HB2  7  
ATOM 7973  H HB3  . LYS A 1 64 ? -7.609  -17.986 7.022   1.00 0.00 ? 64 LYS A HB3  7  
ATOM 7974  H HG2  . LYS A 1 64 ? -4.991  -16.567 7.129   1.00 0.00 ? 64 LYS A HG2  7  
ATOM 7975  H HG3  . LYS A 1 64 ? -6.468  -15.707 7.568   1.00 0.00 ? 64 LYS A HG3  7  
ATOM 7976  H HD2  . LYS A 1 64 ? -6.978  -17.411 9.236   1.00 0.00 ? 64 LYS A HD2  7  
ATOM 7977  H HD3  . LYS A 1 64 ? -5.529  -18.309 8.778   1.00 0.00 ? 64 LYS A HD3  7  
ATOM 7978  H HE2  . LYS A 1 64 ? -4.945  -17.103 10.717  1.00 0.00 ? 64 LYS A HE2  7  
ATOM 7979  H HE3  . LYS A 1 64 ? -4.220  -16.222 9.373   1.00 0.00 ? 64 LYS A HE3  7  
ATOM 7980  H HZ1  . LYS A 1 64 ? -5.821  -14.550 9.514   1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 7981  H HZ2  . LYS A 1 64 ? -5.435  -14.877 11.128  1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 7982  H HZ3  . LYS A 1 64 ? -6.867  -15.483 10.462  1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 7983  N N    . SER A 1 65 ? -6.666  -20.929 5.744   1.00 0.00 ? 65 SER A N    7  
ATOM 7984  C CA   . SER A 1 65 ? -7.472  -22.060 5.299   1.00 0.00 ? 65 SER A CA   7  
ATOM 7985  C C    . SER A 1 65 ? -7.444  -22.183 3.779   1.00 0.00 ? 65 SER A C    7  
ATOM 7986  O O    . SER A 1 65 ? -8.449  -22.520 3.154   1.00 0.00 ? 65 SER A O    7  
ATOM 7987  C CB   . SER A 1 65 ? -8.915  -21.907 5.784   1.00 0.00 ? 65 SER A CB   7  
ATOM 7988  O OG   . SER A 1 65 ? -9.590  -23.153 5.778   1.00 0.00 ? 65 SER A OG   7  
ATOM 7989  H H    . SER A 1 65 ? -5.955  -21.078 6.403   1.00 0.00 ? 65 SER A H    7  
ATOM 7990  H HA   . SER A 1 65 ? -7.050  -22.957 5.729   1.00 0.00 ? 65 SER A HA   7  
ATOM 7991  H HB2  . SER A 1 65 ? -8.915  -21.516 6.790   1.00 0.00 ? 65 SER A HB2  7  
ATOM 7992  H HB3  . SER A 1 65 ? -9.440  -21.223 5.132   1.00 0.00 ? 65 SER A HB3  7  
ATOM 7993  H HG   . SER A 1 65 ? -10.432 -23.059 5.326   1.00 0.00 ? 65 SER A HG   7  
ATOM 7994  N N    . GLY A 1 66 ? -6.285  -21.905 3.190   1.00 0.00 ? 66 GLY A N    7  
ATOM 7995  C CA   . GLY A 1 66 ? -6.146  -21.989 1.748   1.00 0.00 ? 66 GLY A CA   7  
ATOM 7996  C C    . GLY A 1 66 ? -6.160  -23.420 1.247   1.00 0.00 ? 66 GLY A C    7  
ATOM 7997  O O    . GLY A 1 66 ? -7.134  -23.883 0.654   1.00 0.00 ? 66 GLY A O    7  
ATOM 7998  H H    . GLY A 1 66 ? -5.517  -21.641 3.739   1.00 0.00 ? 66 GLY A H    7  
ATOM 7999  H HA2  . GLY A 1 66 ? -6.960  -21.450 1.287   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 8000  H HA3  . GLY A 1 66 ? -5.213  -21.528 1.460   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 8001  N N    . PRO A 1 67 ? -5.056  -24.144 1.484   1.00 0.00 ? 67 PRO A N    7  
ATOM 8002  C CA   . PRO A 1 67 ? -4.919  -25.541 1.059   1.00 0.00 ? 67 PRO A CA   7  
ATOM 8003  C C    . PRO A 1 67 ? -5.824  -26.479 1.852   1.00 0.00 ? 67 PRO A C    7  
ATOM 8004  O O    . PRO A 1 67 ? -5.885  -26.408 3.079   1.00 0.00 ? 67 PRO A O    7  
ATOM 8005  C CB   . PRO A 1 67 ? -3.448  -25.854 1.340   1.00 0.00 ? 67 PRO A CB   7  
ATOM 8006  C CG   . PRO A 1 67 ? -3.058  -24.908 2.423   1.00 0.00 ? 67 PRO A CG   7  
ATOM 8007  C CD   . PRO A 1 67 ? -3.857  -23.656 2.185   1.00 0.00 ? 67 PRO A CD   7  
ATOM 8008  H HA   . PRO A 1 67 ? -5.119  -25.656 0.004   1.00 0.00 ? 67 PRO A HA   7  
ATOM 8009  H HB2  . PRO A 1 67 ? -3.350  -26.883 1.659   1.00 0.00 ? 67 PRO A HB2  7  
ATOM 8010  H HB3  . PRO A 1 67 ? -2.865  -25.692 0.446   1.00 0.00 ? 67 PRO A HB3  7  
ATOM 8011  H HG2  . PRO A 1 67 ? -3.301  -25.331 3.385   1.00 0.00 ? 67 PRO A HG2  7  
ATOM 8012  H HG3  . PRO A 1 67 ? -2.001  -24.695 2.361   1.00 0.00 ? 67 PRO A HG3  7  
ATOM 8013  H HD2  . PRO A 1 67 ? -4.121  -23.194 3.125   1.00 0.00 ? 67 PRO A HD2  7  
ATOM 8014  H HD3  . PRO A 1 67 ? -3.302  -22.967 1.566   1.00 0.00 ? 67 PRO A HD3  7  
ATOM 8015  N N    . SER A 1 68 ? -6.525  -27.357 1.142   1.00 0.00 ? 68 SER A N    7  
ATOM 8016  C CA   . SER A 1 68 ? -7.429  -28.307 1.779   1.00 0.00 ? 68 SER A CA   7  
ATOM 8017  C C    . SER A 1 68 ? -6.740  -29.650 1.997   1.00 0.00 ? 68 SER A C    7  
ATOM 8018  O O    . SER A 1 68 ? -6.083  -30.176 1.099   1.00 0.00 ? 68 SER A O    7  
ATOM 8019  C CB   . SER A 1 68 ? -8.685  -28.498 0.927   1.00 0.00 ? 68 SER A CB   7  
ATOM 8020  O OG   . SER A 1 68 ? -9.557  -27.387 1.048   1.00 0.00 ? 68 SER A OG   7  
ATOM 8021  H H    . SER A 1 68 ? -6.434  -27.364 0.166   1.00 0.00 ? 68 SER A H    7  
ATOM 8022  H HA   . SER A 1 68 ? -7.714  -27.901 2.738   1.00 0.00 ? 68 SER A HA   7  
ATOM 8023  H HB2  . SER A 1 68 ? -8.402  -28.606 -0.109  1.00 0.00 ? 68 SER A HB2  7  
ATOM 8024  H HB3  . SER A 1 68 ? -9.206  -29.387 1.252   1.00 0.00 ? 68 SER A HB3  7  
ATOM 8025  H HG   . SER A 1 68 ? -9.894  -27.149 0.181   1.00 0.00 ? 68 SER A HG   7  
ATOM 8026  N N    . SER A 1 69 ? -6.896  -30.200 3.197   1.00 0.00 ? 69 SER A N    7  
ATOM 8027  C CA   . SER A 1 69 ? -6.286  -31.481 3.536   1.00 0.00 ? 69 SER A CA   7  
ATOM 8028  C C    . SER A 1 69 ? -7.327  -32.596 3.534   1.00 0.00 ? 69 SER A C    7  
ATOM 8029  O O    . SER A 1 69 ? -8.506  -32.360 3.791   1.00 0.00 ? 69 SER A O    7  
ATOM 8030  C CB   . SER A 1 69 ? -5.610  -31.400 4.906   1.00 0.00 ? 69 SER A CB   7  
ATOM 8031  O OG   . SER A 1 69 ? -5.087  -32.660 5.292   1.00 0.00 ? 69 SER A OG   7  
ATOM 8032  H H    . SER A 1 69 ? -7.432  -29.732 3.871   1.00 0.00 ? 69 SER A H    7  
ATOM 8033  H HA   . SER A 1 69 ? -5.538  -31.700 2.788   1.00 0.00 ? 69 SER A HA   7  
ATOM 8034  H HB2  . SER A 1 69 ? -4.802  -30.686 4.866   1.00 0.00 ? 69 SER A HB2  7  
ATOM 8035  H HB3  . SER A 1 69 ? -6.334  -31.084 5.643   1.00 0.00 ? 69 SER A HB3  7  
ATOM 8036  H HG   . SER A 1 69 ? -4.148  -32.691 5.095   1.00 0.00 ? 69 SER A HG   7  
ATOM 8037  N N    . GLY A 1 70 ? -6.880  -33.814 3.242   1.00 0.00 ? 70 GLY A N    7  
ATOM 8038  C CA   . GLY A 1 70 ? -7.784  -34.948 3.211   1.00 0.00 ? 70 GLY A CA   7  
ATOM 8039  C C    . GLY A 1 70 ? -7.158  -36.205 3.782   1.00 0.00 ? 70 GLY A C    7  
ATOM 8040  O O    . GLY A 1 70 ? -6.656  -36.201 4.906   1.00 0.00 ? 70 GLY A O    7  
ATOM 8041  H H    . GLY A 1 70 ? -5.928  -33.942 3.045   1.00 0.00 ? 70 GLY A H    7  
ATOM 8042  H HA2  . GLY A 1 70 ? -8.667  -34.706 3.784   1.00 0.00 ? 70 GLY A HA2  7  
ATOM 8043  H HA3  . GLY A 1 70 ? -8.073  -35.136 2.187   1.00 0.00 ? 70 GLY A HA3  7  
ATOM 8044  N N    . GLY A 1 1  ? -20.727 10.182  -11.771 1.00 0.00 ? 1  GLY A N    8  
ATOM 8045  C CA   . GLY A 1 1  ? -19.927 9.393   -10.852 1.00 0.00 ? 1  GLY A CA   8  
ATOM 8046  C C    . GLY A 1 1  ? -19.478 10.190  -9.643  1.00 0.00 ? 1  GLY A C    8  
ATOM 8047  O O    . GLY A 1 1  ? -18.553 10.997  -9.732  1.00 0.00 ? 1  GLY A O    8  
ATOM 8048  H H1   . GLY A 1 1  ? -21.461 10.734  -11.429 1.00 0.00 ? 1  GLY A H1   8  
ATOM 8049  H HA2  . GLY A 1 1  ? -20.511 8.549   -10.517 1.00 0.00 ? 1  GLY A HA2  8  
ATOM 8050  H HA3  . GLY A 1 1  ? -19.054 9.030   -11.374 1.00 0.00 ? 1  GLY A HA3  8  
ATOM 8051  N N    . SER A 1 2  ? -20.137 9.966   -8.511  1.00 0.00 ? 2  SER A N    8  
ATOM 8052  C CA   . SER A 1 2  ? -19.804 10.673  -7.280  1.00 0.00 ? 2  SER A CA   8  
ATOM 8053  C C    . SER A 1 2  ? -20.538 10.066  -6.088  1.00 0.00 ? 2  SER A C    8  
ATOM 8054  O O    . SER A 1 2  ? -21.668 9.594   -6.216  1.00 0.00 ? 2  SER A O    8  
ATOM 8055  C CB   . SER A 1 2  ? -20.156 12.157  -7.408  1.00 0.00 ? 2  SER A CB   8  
ATOM 8056  O OG   . SER A 1 2  ? -21.560 12.350  -7.401  1.00 0.00 ? 2  SER A OG   8  
ATOM 8057  H H    . SER A 1 2  ? -20.865 9.310   -8.504  1.00 0.00 ? 2  SER A H    8  
ATOM 8058  H HA   . SER A 1 2  ? -18.740 10.577  -7.119  1.00 0.00 ? 2  SER A HA   8  
ATOM 8059  H HB2  . SER A 1 2  ? -19.726 12.699  -6.580  1.00 0.00 ? 2  SER A HB2  8  
ATOM 8060  H HB3  . SER A 1 2  ? -19.756 12.540  -8.336  1.00 0.00 ? 2  SER A HB3  8  
ATOM 8061  H HG   . SER A 1 2  ? -21.789 13.004  -6.737  1.00 0.00 ? 2  SER A HG   8  
ATOM 8062  N N    . SER A 1 3  ? -19.887 10.081  -4.930  1.00 0.00 ? 3  SER A N    8  
ATOM 8063  C CA   . SER A 1 3  ? -20.475 9.529   -3.715  1.00 0.00 ? 3  SER A CA   8  
ATOM 8064  C C    . SER A 1 3  ? -19.625 9.870   -2.496  1.00 0.00 ? 3  SER A C    8  
ATOM 8065  O O    . SER A 1 3  ? -18.400 9.953   -2.582  1.00 0.00 ? 3  SER A O    8  
ATOM 8066  C CB   . SER A 1 3  ? -20.623 8.011   -3.839  1.00 0.00 ? 3  SER A CB   8  
ATOM 8067  O OG   . SER A 1 3  ? -20.587 7.390   -2.566  1.00 0.00 ? 3  SER A OG   8  
ATOM 8068  H H    . SER A 1 3  ? -18.989 10.471  -4.892  1.00 0.00 ? 3  SER A H    8  
ATOM 8069  H HA   . SER A 1 3  ? -21.454 9.968   -3.591  1.00 0.00 ? 3  SER A HA   8  
ATOM 8070  H HB2  . SER A 1 3  ? -21.566 7.781   -4.312  1.00 0.00 ? 3  SER A HB2  8  
ATOM 8071  H HB3  . SER A 1 3  ? -19.814 7.622   -4.440  1.00 0.00 ? 3  SER A HB3  8  
ATOM 8072  H HG   . SER A 1 3  ? -19.769 6.896   -2.474  1.00 0.00 ? 3  SER A HG   8  
ATOM 8073  N N    . GLY A 1 4  ? -20.284 10.068  -1.358  1.00 0.00 ? 4  GLY A N    8  
ATOM 8074  C CA   . GLY A 1 4  ? -19.574 10.398  -0.136  1.00 0.00 ? 4  GLY A CA   8  
ATOM 8075  C C    . GLY A 1 4  ? -20.459 10.309  1.091   1.00 0.00 ? 4  GLY A C    8  
ATOM 8076  O O    . GLY A 1 4  ? -20.924 11.326  1.604   1.00 0.00 ? 4  GLY A O    8  
ATOM 8077  H H    . GLY A 1 4  ? -21.261 9.988   -1.348  1.00 0.00 ? 4  GLY A H    8  
ATOM 8078  H HA2  . GLY A 1 4  ? -18.744 9.717   -0.020  1.00 0.00 ? 4  GLY A HA2  8  
ATOM 8079  H HA3  . GLY A 1 4  ? -19.191 11.405  -0.217  1.00 0.00 ? 4  GLY A HA3  8  
ATOM 8080  N N    . SER A 1 5  ? -20.693 9.088   1.562   1.00 0.00 ? 5  SER A N    8  
ATOM 8081  C CA   . SER A 1 5  ? -21.533 8.869   2.734   1.00 0.00 ? 5  SER A CA   8  
ATOM 8082  C C    . SER A 1 5  ? -20.736 8.217   3.860   1.00 0.00 ? 5  SER A C    8  
ATOM 8083  O O    . SER A 1 5  ? -19.733 7.545   3.617   1.00 0.00 ? 5  SER A O    8  
ATOM 8084  C CB   . SER A 1 5  ? -22.734 7.994   2.371   1.00 0.00 ? 5  SER A CB   8  
ATOM 8085  O OG   . SER A 1 5  ? -23.823 8.233   3.246   1.00 0.00 ? 5  SER A OG   8  
ATOM 8086  H H    . SER A 1 5  ? -20.293 8.316   1.109   1.00 0.00 ? 5  SER A H    8  
ATOM 8087  H HA   . SER A 1 5  ? -21.888 9.832   3.072   1.00 0.00 ? 5  SER A HA   8  
ATOM 8088  H HB2  . SER A 1 5  ? -23.045 8.215   1.361   1.00 0.00 ? 5  SER A HB2  8  
ATOM 8089  H HB3  . SER A 1 5  ? -22.452 6.954   2.441   1.00 0.00 ? 5  SER A HB3  8  
ATOM 8090  H HG   . SER A 1 5  ? -24.081 7.411   3.668   1.00 0.00 ? 5  SER A HG   8  
ATOM 8091  N N    . SER A 1 6  ? -21.190 8.419   5.092   1.00 0.00 ? 6  SER A N    8  
ATOM 8092  C CA   . SER A 1 6  ? -20.518 7.855   6.257   1.00 0.00 ? 6  SER A CA   8  
ATOM 8093  C C    . SER A 1 6  ? -21.366 8.033   7.513   1.00 0.00 ? 6  SER A C    8  
ATOM 8094  O O    . SER A 1 6  ? -22.298 8.835   7.537   1.00 0.00 ? 6  SER A O    8  
ATOM 8095  C CB   . SER A 1 6  ? -19.151 8.514   6.453   1.00 0.00 ? 6  SER A CB   8  
ATOM 8096  O OG   . SER A 1 6  ? -18.147 7.832   5.723   1.00 0.00 ? 6  SER A OG   8  
ATOM 8097  H H    . SER A 1 6  ? -21.994 8.964   5.222   1.00 0.00 ? 6  SER A H    8  
ATOM 8098  H HA   . SER A 1 6  ? -20.377 6.799   6.078   1.00 0.00 ? 6  SER A HA   8  
ATOM 8099  H HB2  . SER A 1 6  ? -19.196 9.537   6.112   1.00 0.00 ? 6  SER A HB2  8  
ATOM 8100  H HB3  . SER A 1 6  ? -18.893 8.495   7.502   1.00 0.00 ? 6  SER A HB3  8  
ATOM 8101  H HG   . SER A 1 6  ? -17.850 7.068   6.222   1.00 0.00 ? 6  SER A HG   8  
ATOM 8102  N N    . GLY A 1 7  ? -21.035 7.276   8.555   1.00 0.00 ? 7  GLY A N    8  
ATOM 8103  C CA   . GLY A 1 7  ? -21.775 7.364   9.800   1.00 0.00 ? 7  GLY A CA   8  
ATOM 8104  C C    . GLY A 1 7  ? -20.893 7.154   11.015  1.00 0.00 ? 7  GLY A C    8  
ATOM 8105  O O    . GLY A 1 7  ? -19.674 7.310   10.940  1.00 0.00 ? 7  GLY A O    8  
ATOM 8106  H H    . GLY A 1 7  ? -20.282 6.653   8.477   1.00 0.00 ? 7  GLY A H    8  
ATOM 8107  H HA2  . GLY A 1 7  ? -22.234 8.339   9.865   1.00 0.00 ? 7  GLY A HA2  8  
ATOM 8108  H HA3  . GLY A 1 7  ? -22.550 6.612   9.799   1.00 0.00 ? 7  GLY A HA3  8  
ATOM 8109  N N    . ARG A 1 8  ? -21.509 6.801   12.138  1.00 0.00 ? 8  ARG A N    8  
ATOM 8110  C CA   . ARG A 1 8  ? -20.772 6.573   13.375  1.00 0.00 ? 8  ARG A CA   8  
ATOM 8111  C C    . ARG A 1 8  ? -19.738 5.465   13.195  1.00 0.00 ? 8  ARG A C    8  
ATOM 8112  O O    . ARG A 1 8  ? -18.541 5.681   13.386  1.00 0.00 ? 8  ARG A O    8  
ATOM 8113  C CB   . ARG A 1 8  ? -21.734 6.208   14.507  1.00 0.00 ? 8  ARG A CB   8  
ATOM 8114  C CG   . ARG A 1 8  ? -22.295 7.415   15.242  1.00 0.00 ? 8  ARG A CG   8  
ATOM 8115  C CD   . ARG A 1 8  ? -21.292 7.977   16.237  1.00 0.00 ? 8  ARG A CD   8  
ATOM 8116  N NE   . ARG A 1 8  ? -21.790 9.182   16.894  1.00 0.00 ? 8  ARG A NE   8  
ATOM 8117  C CZ   . ARG A 1 8  ? -21.132 9.821   17.855  1.00 0.00 ? 8  ARG A CZ   8  
ATOM 8118  N NH1  . ARG A 1 8  ? -19.955 9.371   18.269  1.00 0.00 ? 8  ARG A NH1  8  
ATOM 8119  N NH2  . ARG A 1 8  ? -21.651 10.911  18.405  1.00 0.00 ? 8  ARG A NH2  8  
ATOM 8120  H H    . ARG A 1 8  ? -22.483 6.692   12.135  1.00 0.00 ? 8  ARG A H    8  
ATOM 8121  H HA   . ARG A 1 8  ? -20.260 7.489   13.630  1.00 0.00 ? 8  ARG A HA   8  
ATOM 8122  H HB2  . ARG A 1 8  ? -22.561 5.649   14.095  1.00 0.00 ? 8  ARG A HB2  8  
ATOM 8123  H HB3  . ARG A 1 8  ? -21.212 5.590   15.221  1.00 0.00 ? 8  ARG A HB3  8  
ATOM 8124  H HG2  . ARG A 1 8  ? -22.540 8.182   14.522  1.00 0.00 ? 8  ARG A HG2  8  
ATOM 8125  H HG3  . ARG A 1 8  ? -23.188 7.118   15.772  1.00 0.00 ? 8  ARG A HG3  8  
ATOM 8126  H HD2  . ARG A 1 8  ? -21.090 7.227   16.987  1.00 0.00 ? 8  ARG A HD2  8  
ATOM 8127  H HD3  . ARG A 1 8  ? -20.380 8.216   15.711  1.00 0.00 ? 8  ARG A HD3  8  
ATOM 8128  H HE   . ARG A 1 8  ? -22.658 9.532   16.604  1.00 0.00 ? 8  ARG A HE   8  
ATOM 8129  H HH11 . ARG A 1 8  ? -19.561 8.550   17.856  1.00 0.00 ? 8  ARG A HH11 8  
ATOM 8130  H HH12 . ARG A 1 8  ? -19.461 9.854   18.992  1.00 0.00 ? 8  ARG A HH12 8  
ATOM 8131  H HH21 . ARG A 1 8  ? -22.538 11.253  18.096  1.00 0.00 ? 8  ARG A HH21 8  
ATOM 8132  H HH22 . ARG A 1 8  ? -21.155 11.391  19.128  1.00 0.00 ? 8  ARG A HH22 8  
ATOM 8133  N N    . LYS A 1 9  ? -20.208 4.278   12.826  1.00 0.00 ? 9  LYS A N    8  
ATOM 8134  C CA   . LYS A 1 9  ? -19.326 3.136   12.620  1.00 0.00 ? 9  LYS A CA   8  
ATOM 8135  C C    . LYS A 1 9  ? -18.188 3.493   11.669  1.00 0.00 ? 9  LYS A C    8  
ATOM 8136  O O    . LYS A 1 9  ? -18.243 4.505   10.970  1.00 0.00 ? 9  LYS A O    8  
ATOM 8137  C CB   . LYS A 1 9  ? -20.116 1.950   12.063  1.00 0.00 ? 9  LYS A CB   8  
ATOM 8138  C CG   . LYS A 1 9  ? -19.425 0.612   12.261  1.00 0.00 ? 9  LYS A CG   8  
ATOM 8139  C CD   . LYS A 1 9  ? -20.427 -0.501  12.520  1.00 0.00 ? 9  LYS A CD   8  
ATOM 8140  C CE   . LYS A 1 9  ? -19.818 -1.616  13.355  1.00 0.00 ? 9  LYS A CE   8  
ATOM 8141  N NZ   . LYS A 1 9  ? -19.033 -2.569  12.522  1.00 0.00 ? 9  LYS A NZ   8  
ATOM 8142  H H    . LYS A 1 9  ? -21.173 4.168   12.689  1.00 0.00 ? 9  LYS A H    8  
ATOM 8143  H HA   . LYS A 1 9  ? -18.908 2.862   13.576  1.00 0.00 ? 9  LYS A HA   8  
ATOM 8144  H HB2  . LYS A 1 9  ? -21.077 1.911   12.554  1.00 0.00 ? 9  LYS A HB2  8  
ATOM 8145  H HB3  . LYS A 1 9  ? -20.268 2.099   11.004  1.00 0.00 ? 9  LYS A HB3  8  
ATOM 8146  H HG2  . LYS A 1 9  ? -18.859 0.374   11.373  1.00 0.00 ? 9  LYS A HG2  8  
ATOM 8147  H HG3  . LYS A 1 9  ? -18.755 0.685   13.107  1.00 0.00 ? 9  LYS A HG3  8  
ATOM 8148  H HD2  . LYS A 1 9  ? -21.276 -0.094  13.048  1.00 0.00 ? 9  LYS A HD2  8  
ATOM 8149  H HD3  . LYS A 1 9  ? -20.751 -0.909  11.572  1.00 0.00 ? 9  LYS A HD3  8  
ATOM 8150  H HE2  . LYS A 1 9  ? -19.167 -1.179  14.097  1.00 0.00 ? 9  LYS A HE2  8  
ATOM 8151  H HE3  . LYS A 1 9  ? -20.614 -2.154  13.848  1.00 0.00 ? 9  LYS A HE3  8  
ATOM 8152  H HZ1  . LYS A 1 9  ? -19.336 -2.508  11.529  1.00 0.00 ? 9  LYS A HZ1  8  
ATOM 8153  H HZ2  . LYS A 1 9  ? -19.178 -3.542  12.858  1.00 0.00 ? 9  LYS A HZ2  8  
ATOM 8154  H HZ3  . LYS A 1 9  ? -18.019 -2.342  12.578  1.00 0.00 ? 9  LYS A HZ3  8  
ATOM 8155  N N    . LYS A 1 10 ? -17.157 2.655   11.647  1.00 0.00 ? 10 LYS A N    8  
ATOM 8156  C CA   . LYS A 1 10 ? -16.006 2.880   10.781  1.00 0.00 ? 10 LYS A CA   8  
ATOM 8157  C C    . LYS A 1 10 ? -15.933 1.819   9.687   1.00 0.00 ? 10 LYS A C    8  
ATOM 8158  O O    . LYS A 1 10 ? -16.706 0.860   9.686   1.00 0.00 ? 10 LYS A O    8  
ATOM 8159  C CB   . LYS A 1 10 ? -14.714 2.871   11.601  1.00 0.00 ? 10 LYS A CB   8  
ATOM 8160  C CG   . LYS A 1 10 ? -14.408 1.527   12.239  1.00 0.00 ? 10 LYS A CG   8  
ATOM 8161  C CD   . LYS A 1 10 ? -13.013 1.501   12.843  1.00 0.00 ? 10 LYS A CD   8  
ATOM 8162  C CE   . LYS A 1 10 ? -11.953 1.239   11.784  1.00 0.00 ? 10 LYS A CE   8  
ATOM 8163  N NZ   . LYS A 1 10 ? -10.643 1.847   12.150  1.00 0.00 ? 10 LYS A NZ   8  
ATOM 8164  H H    . LYS A 1 10 ? -17.171 1.865   12.228  1.00 0.00 ? 10 LYS A H    8  
ATOM 8165  H HA   . LYS A 1 10 ? -16.122 3.848   10.319  1.00 0.00 ? 10 LYS A HA   8  
ATOM 8166  H HB2  . LYS A 1 10 ? -13.890 3.136   10.955  1.00 0.00 ? 10 LYS A HB2  8  
ATOM 8167  H HB3  . LYS A 1 10 ? -14.796 3.609   12.387  1.00 0.00 ? 10 LYS A HB3  8  
ATOM 8168  H HG2  . LYS A 1 10 ? -15.130 1.336   13.019  1.00 0.00 ? 10 LYS A HG2  8  
ATOM 8169  H HG3  . LYS A 1 10 ? -14.478 0.757   11.485  1.00 0.00 ? 10 LYS A HG3  8  
ATOM 8170  H HD2  . LYS A 1 10 ? -12.814 2.455   13.308  1.00 0.00 ? 10 LYS A HD2  8  
ATOM 8171  H HD3  . LYS A 1 10 ? -12.968 0.719   13.587  1.00 0.00 ? 10 LYS A HD3  8  
ATOM 8172  H HE2  . LYS A 1 10 ? -11.827 0.173   11.675  1.00 0.00 ? 10 LYS A HE2  8  
ATOM 8173  H HE3  . LYS A 1 10 ? -12.287 1.660   10.847  1.00 0.00 ? 10 LYS A HE3  8  
ATOM 8174  H HZ1  . LYS A 1 10 ? -10.550 1.900   13.184  1.00 0.00 ? 10 LYS A HZ1  8  
ATOM 8175  H HZ2  . LYS A 1 10 ? -10.573 2.807   11.757  1.00 0.00 ? 10 LYS A HZ2  8  
ATOM 8176  H HZ3  . LYS A 1 10 ? -9.864  1.272   11.771  1.00 0.00 ? 10 LYS A HZ3  8  
ATOM 8177  N N    . ARG A 1 11 ? -14.999 1.996   8.758   1.00 0.00 ? 11 ARG A N    8  
ATOM 8178  C CA   . ARG A 1 11 ? -14.825 1.054   7.659   1.00 0.00 ? 11 ARG A CA   8  
ATOM 8179  C C    . ARG A 1 11 ? -13.347 0.876   7.324   1.00 0.00 ? 11 ARG A C    8  
ATOM 8180  O O    . ARG A 1 11 ? -12.474 1.332   8.063   1.00 0.00 ? 11 ARG A O    8  
ATOM 8181  C CB   . ARG A 1 11 ? -15.586 1.535   6.422   1.00 0.00 ? 11 ARG A CB   8  
ATOM 8182  C CG   . ARG A 1 11 ? -16.992 2.026   6.724   1.00 0.00 ? 11 ARG A CG   8  
ATOM 8183  C CD   . ARG A 1 11 ? -17.903 1.885   5.515   1.00 0.00 ? 11 ARG A CD   8  
ATOM 8184  N NE   . ARG A 1 11 ? -19.244 2.401   5.777   1.00 0.00 ? 11 ARG A NE   8  
ATOM 8185  C CZ   . ARG A 1 11 ? -20.235 2.355   4.893   1.00 0.00 ? 11 ARG A CZ   8  
ATOM 8186  N NH1  . ARG A 1 11 ? -20.036 1.819   3.697   1.00 0.00 ? 11 ARG A NH1  8  
ATOM 8187  N NH2  . ARG A 1 11 ? -21.427 2.845   5.206   1.00 0.00 ? 11 ARG A NH2  8  
ATOM 8188  H H    . ARG A 1 11 ? -14.413 2.780   8.812   1.00 0.00 ? 11 ARG A H    8  
ATOM 8189  H HA   . ARG A 1 11 ? -15.229 0.102   7.972   1.00 0.00 ? 11 ARG A HA   8  
ATOM 8190  H HB2  . ARG A 1 11 ? -15.035 2.345   5.967   1.00 0.00 ? 11 ARG A HB2  8  
ATOM 8191  H HB3  . ARG A 1 11 ? -15.656 0.719   5.719   1.00 0.00 ? 11 ARG A HB3  8  
ATOM 8192  H HG2  . ARG A 1 11 ? -17.400 1.445   7.538   1.00 0.00 ? 11 ARG A HG2  8  
ATOM 8193  H HG3  . ARG A 1 11 ? -16.946 3.066   7.010   1.00 0.00 ? 11 ARG A HG3  8  
ATOM 8194  H HD2  . ARG A 1 11 ? -17.472 2.433   4.690   1.00 0.00 ? 11 ARG A HD2  8  
ATOM 8195  H HD3  . ARG A 1 11 ? -17.974 0.840   5.255   1.00 0.00 ? 11 ARG A HD3  8  
ATOM 8196  H HE   . ARG A 1 11 ? -19.413 2.801   6.655   1.00 0.00 ? 11 ARG A HE   8  
ATOM 8197  H HH11 . ARG A 1 11 ? -19.139 1.448   3.459   1.00 0.00 ? 11 ARG A HH11 8  
ATOM 8198  H HH12 . ARG A 1 11 ? -20.784 1.785   3.034   1.00 0.00 ? 11 ARG A HH12 8  
ATOM 8199  H HH21 . ARG A 1 11 ? -21.581 3.250   6.107   1.00 0.00 ? 11 ARG A HH21 8  
ATOM 8200  H HH22 . ARG A 1 11 ? -22.172 2.810   4.540   1.00 0.00 ? 11 ARG A HH22 8  
ATOM 8201  N N    . ILE A 1 12 ? -13.076 0.210   6.207   1.00 0.00 ? 12 ILE A N    8  
ATOM 8202  C CA   . ILE A 1 12 ? -11.704 -0.027  5.774   1.00 0.00 ? 12 ILE A CA   8  
ATOM 8203  C C    . ILE A 1 12 ? -10.901 1.269   5.757   1.00 0.00 ? 12 ILE A C    8  
ATOM 8204  O O    . ILE A 1 12 ? -11.360 2.307   5.282   1.00 0.00 ? 12 ILE A O    8  
ATOM 8205  C CB   . ILE A 1 12 ? -11.658 -0.665  4.373   1.00 0.00 ? 12 ILE A CB   8  
ATOM 8206  C CG1  . ILE A 1 12 ? -12.461 -1.967  4.354   1.00 0.00 ? 12 ILE A CG1  8  
ATOM 8207  C CG2  . ILE A 1 12 ? -10.218 -0.918  3.953   1.00 0.00 ? 12 ILE A CG2  8  
ATOM 8208  C CD1  . ILE A 1 12 ? -11.972 -2.993  5.353   1.00 0.00 ? 12 ILE A CD1  8  
ATOM 8209  H H    . ILE A 1 12 ? -13.815 -0.129  5.660   1.00 0.00 ? 12 ILE A H    8  
ATOM 8210  H HA   . ILE A 1 12 ? -11.248 -0.712  6.474   1.00 0.00 ? 12 ILE A HA   8  
ATOM 8211  H HB   . ILE A 1 12 ? -12.095 0.030   3.671   1.00 0.00 ? 12 ILE A HB   8  
ATOM 8212  H HG12 . ILE A 1 12 ? -13.493 -1.750  4.582   1.00 0.00 ? 12 ILE A HG12 8  
ATOM 8213  H HG13 . ILE A 1 12 ? -12.399 -2.406  3.369   1.00 0.00 ? 12 ILE A HG13 8  
ATOM 8214  H HG21 . ILE A 1 12 ? -9.653  -0.001  4.033   1.00 0.00 ? 12 ILE A HG21 8  
ATOM 8215  H HG22 . ILE A 1 12 ? -9.782  -1.666  4.599   1.00 0.00 ? 12 ILE A HG22 8  
ATOM 8216  H HG23 . ILE A 1 12 ? -10.196 -1.267  2.932   1.00 0.00 ? 12 ILE A HG23 8  
ATOM 8217  H HD11 . ILE A 1 12 ? -12.028 -2.581  6.349   1.00 0.00 ? 12 ILE A HD11 8  
ATOM 8218  H HD12 . ILE A 1 12 ? -12.588 -3.877  5.292   1.00 0.00 ? 12 ILE A HD12 8  
ATOM 8219  H HD13 . ILE A 1 12 ? -10.947 -3.253  5.128   1.00 0.00 ? 12 ILE A HD13 8  
ATOM 8220  N N    . PRO A 1 13 ? -9.670  1.209   6.287   1.00 0.00 ? 13 PRO A N    8  
ATOM 8221  C CA   . PRO A 1 13 ? -8.775  2.368   6.343   1.00 0.00 ? 13 PRO A CA   8  
ATOM 8222  C C    . PRO A 1 13 ? -8.075  2.625   5.013   1.00 0.00 ? 13 PRO A C    8  
ATOM 8223  O O    . PRO A 1 13 ? -8.416  2.023   3.995   1.00 0.00 ? 13 PRO A O    8  
ATOM 8224  C CB   . PRO A 1 13 ? -7.756  1.978   7.417   1.00 0.00 ? 13 PRO A CB   8  
ATOM 8225  C CG   . PRO A 1 13 ? -7.745  0.489   7.406   1.00 0.00 ? 13 PRO A CG   8  
ATOM 8226  C CD   . PRO A 1 13 ? -9.057  0.004   6.872   1.00 0.00 ? 13 PRO A CD   8  
ATOM 8227  H HA   . PRO A 1 13 ? -9.300  3.261   6.650   1.00 0.00 ? 13 PRO A HA   8  
ATOM 8228  H HB2  . PRO A 1 13 ? -6.787  2.383   7.161   1.00 0.00 ? 13 PRO A HB2  8  
ATOM 8229  H HB3  . PRO A 1 13 ? -8.072  2.364   8.375   1.00 0.00 ? 13 PRO A HB3  8  
ATOM 8230  H HG2  . PRO A 1 13 ? -6.958  0.132   6.760   1.00 0.00 ? 13 PRO A HG2  8  
ATOM 8231  H HG3  . PRO A 1 13 ? -7.608  0.116   8.410   1.00 0.00 ? 13 PRO A HG3  8  
ATOM 8232  H HD2  . PRO A 1 13 ? -8.867  -0.739  6.113   1.00 0.00 ? 13 PRO A HD2  8  
ATOM 8233  H HD3  . PRO A 1 13 ? -9.681  -0.403  7.654   1.00 0.00 ? 13 PRO A HD3  8  
ATOM 8234  N N    . TYR A 1 14 ? -7.096  3.522   5.029   1.00 0.00 ? 14 TYR A N    8  
ATOM 8235  C CA   . TYR A 1 14 ? -6.349  3.860   3.823   1.00 0.00 ? 14 TYR A CA   8  
ATOM 8236  C C    . TYR A 1 14 ? -7.263  4.490   2.775   1.00 0.00 ? 14 TYR A C    8  
ATOM 8237  O O    . TYR A 1 14 ? -8.076  3.808   2.153   1.00 0.00 ? 14 TYR A O    8  
ATOM 8238  C CB   . TYR A 1 14 ? -5.679  2.612   3.246   1.00 0.00 ? 14 TYR A CB   8  
ATOM 8239  C CG   . TYR A 1 14 ? -4.920  1.803   4.273   1.00 0.00 ? 14 TYR A CG   8  
ATOM 8240  C CD1  . TYR A 1 14 ? -3.780  2.313   4.883   1.00 0.00 ? 14 TYR A CD1  8  
ATOM 8241  C CD2  . TYR A 1 14 ? -5.341  0.530   4.634   1.00 0.00 ? 14 TYR A CD2  8  
ATOM 8242  C CE1  . TYR A 1 14 ? -3.082  1.578   5.821   1.00 0.00 ? 14 TYR A CE1  8  
ATOM 8243  C CE2  . TYR A 1 14 ? -4.650  -0.212  5.573   1.00 0.00 ? 14 TYR A CE2  8  
ATOM 8244  C CZ   . TYR A 1 14 ? -3.522  0.316   6.163   1.00 0.00 ? 14 TYR A CZ   8  
ATOM 8245  O OH   . TYR A 1 14 ? -2.830  -0.420  7.098   1.00 0.00 ? 14 TYR A OH   8  
ATOM 8246  H H    . TYR A 1 14 ? -6.870  3.970   5.871   1.00 0.00 ? 14 TYR A H    8  
ATOM 8247  H HA   . TYR A 1 14 ? -5.586  4.574   4.094   1.00 0.00 ? 14 TYR A HA   8  
ATOM 8248  H HB2  . TYR A 1 14 ? -6.434  1.973   2.814   1.00 0.00 ? 14 TYR A HB2  8  
ATOM 8249  H HB3  . TYR A 1 14 ? -4.982  2.909   2.476   1.00 0.00 ? 14 TYR A HB3  8  
ATOM 8250  H HD1  . TYR A 1 14 ? -3.438  3.302   4.613   1.00 0.00 ? 14 TYR A HD1  8  
ATOM 8251  H HD2  . TYR A 1 14 ? -6.226  0.119   4.169   1.00 0.00 ? 14 TYR A HD2  8  
ATOM 8252  H HE1  . TYR A 1 14 ? -2.198  1.991   6.285   1.00 0.00 ? 14 TYR A HE1  8  
ATOM 8253  H HE2  . TYR A 1 14 ? -4.994  -1.200  5.840   1.00 0.00 ? 14 TYR A HE2  8  
ATOM 8254  H HH   . TYR A 1 14 ? -3.046  -0.104  7.978   1.00 0.00 ? 14 TYR A HH   8  
ATOM 8255  N N    . SER A 1 15 ? -7.121  5.798   2.586   1.00 0.00 ? 15 SER A N    8  
ATOM 8256  C CA   . SER A 1 15 ? -7.934  6.523   1.617   1.00 0.00 ? 15 SER A CA   8  
ATOM 8257  C C    . SER A 1 15 ? -7.650  6.039   0.199   1.00 0.00 ? 15 SER A C    8  
ATOM 8258  O O    . SER A 1 15 ? -6.656  5.356   -0.049  1.00 0.00 ? 15 SER A O    8  
ATOM 8259  C CB   . SER A 1 15 ? -7.667  8.026   1.718   1.00 0.00 ? 15 SER A CB   8  
ATOM 8260  O OG   . SER A 1 15 ? -8.697  8.771   1.092   1.00 0.00 ? 15 SER A OG   8  
ATOM 8261  H H    . SER A 1 15 ? -6.455  6.288   3.113   1.00 0.00 ? 15 SER A H    8  
ATOM 8262  H HA   . SER A 1 15 ? -8.972  6.335   1.848   1.00 0.00 ? 15 SER A HA   8  
ATOM 8263  H HB2  . SER A 1 15 ? -7.614  8.311   2.758   1.00 0.00 ? 15 SER A HB2  8  
ATOM 8264  H HB3  . SER A 1 15 ? -6.728  8.255   1.234   1.00 0.00 ? 15 SER A HB3  8  
ATOM 8265  H HG   . SER A 1 15 ? -8.412  9.681   0.980   1.00 0.00 ? 15 SER A HG   8  
ATOM 8266  N N    . LYS A 1 16 ? -8.530  6.397   -0.730  1.00 0.00 ? 16 LYS A N    8  
ATOM 8267  C CA   . LYS A 1 16 ? -8.376  6.001   -2.125  1.00 0.00 ? 16 LYS A CA   8  
ATOM 8268  C C    . LYS A 1 16 ? -6.987  6.362   -2.642  1.00 0.00 ? 16 LYS A C    8  
ATOM 8269  O O    . LYS A 1 16 ? -6.328  5.553   -3.294  1.00 0.00 ? 16 LYS A O    8  
ATOM 8270  C CB   . LYS A 1 16 ? -9.444  6.675   -2.989  1.00 0.00 ? 16 LYS A CB   8  
ATOM 8271  C CG   . LYS A 1 16 ? -9.506  6.139   -4.408  1.00 0.00 ? 16 LYS A CG   8  
ATOM 8272  C CD   . LYS A 1 16 ? -10.827 6.480   -5.077  1.00 0.00 ? 16 LYS A CD   8  
ATOM 8273  C CE   . LYS A 1 16 ? -10.903 7.955   -5.439  1.00 0.00 ? 16 LYS A CE   8  
ATOM 8274  N NZ   . LYS A 1 16 ? -11.983 8.229   -6.427  1.00 0.00 ? 16 LYS A NZ   8  
ATOM 8275  H H    . LYS A 1 16 ? -9.303  6.942   -0.470  1.00 0.00 ? 16 LYS A H    8  
ATOM 8276  H HA   . LYS A 1 16 ? -8.501  4.931   -2.182  1.00 0.00 ? 16 LYS A HA   8  
ATOM 8277  H HB2  . LYS A 1 16 ? -10.409 6.526   -2.528  1.00 0.00 ? 16 LYS A HB2  8  
ATOM 8278  H HB3  . LYS A 1 16 ? -9.236  7.735   -3.035  1.00 0.00 ? 16 LYS A HB3  8  
ATOM 8279  H HG2  . LYS A 1 16 ? -8.701  6.573   -4.983  1.00 0.00 ? 16 LYS A HG2  8  
ATOM 8280  H HG3  . LYS A 1 16 ? -9.393  5.064   -4.382  1.00 0.00 ? 16 LYS A HG3  8  
ATOM 8281  H HD2  . LYS A 1 16 ? -10.926 5.894   -5.978  1.00 0.00 ? 16 LYS A HD2  8  
ATOM 8282  H HD3  . LYS A 1 16 ? -11.635 6.243   -4.399  1.00 0.00 ? 16 LYS A HD3  8  
ATOM 8283  H HE2  . LYS A 1 16 ? -11.095 8.524   -4.542  1.00 0.00 ? 16 LYS A HE2  8  
ATOM 8284  H HE3  . LYS A 1 16 ? -9.956  8.258   -5.861  1.00 0.00 ? 16 LYS A HE3  8  
ATOM 8285  H HZ1  . LYS A 1 16 ? -11.570 8.500   -7.342  1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 8286  H HZ2  . LYS A 1 16 ? -12.588 9.004   -6.089  1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 8287  H HZ3  . LYS A 1 16 ? -12.568 7.380   -6.561  1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 8288  N N    . GLY A 1 17 ? -6.547  7.581   -2.345  1.00 0.00 ? 17 GLY A N    8  
ATOM 8289  C CA   . GLY A 1 17 ? -5.239  8.026   -2.787  1.00 0.00 ? 17 GLY A CA   8  
ATOM 8290  C C    . GLY A 1 17 ? -4.113  7.219   -2.170  1.00 0.00 ? 17 GLY A C    8  
ATOM 8291  O O    . GLY A 1 17 ? -3.115  6.931   -2.829  1.00 0.00 ? 17 GLY A O    8  
ATOM 8292  H H    . GLY A 1 17 ? -7.117  8.183   -1.822  1.00 0.00 ? 17 GLY A H    8  
ATOM 8293  H HA2  . GLY A 1 17 ? -5.184  7.937   -3.862  1.00 0.00 ? 17 GLY A HA2  8  
ATOM 8294  H HA3  . GLY A 1 17 ? -5.113  9.064   -2.515  1.00 0.00 ? 17 GLY A HA3  8  
ATOM 8295  N N    . GLN A 1 18 ? -4.274  6.856   -0.902  1.00 0.00 ? 18 GLN A N    8  
ATOM 8296  C CA   . GLN A 1 18 ? -3.261  6.080   -0.196  1.00 0.00 ? 18 GLN A CA   8  
ATOM 8297  C C    . GLN A 1 18 ? -3.162  4.669   -0.765  1.00 0.00 ? 18 GLN A C    8  
ATOM 8298  O O    . GLN A 1 18 ? -2.069  4.178   -1.050  1.00 0.00 ? 18 GLN A O    8  
ATOM 8299  C CB   . GLN A 1 18 ? -3.585  6.018   1.298   1.00 0.00 ? 18 GLN A CB   8  
ATOM 8300  C CG   . GLN A 1 18 ? -3.674  7.385   1.958   1.00 0.00 ? 18 GLN A CG   8  
ATOM 8301  C CD   . GLN A 1 18 ? -4.225  7.317   3.369   1.00 0.00 ? 18 GLN A CD   8  
ATOM 8302  O OE1  . GLN A 1 18 ? -5.255  7.918   3.674   1.00 0.00 ? 18 GLN A OE1  8  
ATOM 8303  N NE2  . GLN A 1 18 ? -3.540  6.583   4.238   1.00 0.00 ? 18 GLN A NE2  8  
ATOM 8304  H H    . GLN A 1 18 ? -5.092  7.116   -0.430  1.00 0.00 ? 18 GLN A H    8  
ATOM 8305  H HA   . GLN A 1 18 ? -2.312  6.576   -0.329  1.00 0.00 ? 18 GLN A HA   8  
ATOM 8306  H HB2  . GLN A 1 18 ? -4.532  5.517   1.429   1.00 0.00 ? 18 GLN A HB2  8  
ATOM 8307  H HB3  . GLN A 1 18 ? -2.814  5.451   1.798   1.00 0.00 ? 18 GLN A HB3  8  
ATOM 8308  H HG2  . GLN A 1 18 ? -2.685  7.817   1.995   1.00 0.00 ? 18 GLN A HG2  8  
ATOM 8309  H HG3  . GLN A 1 18 ? -4.319  8.016   1.365   1.00 0.00 ? 18 GLN A HG3  8  
ATOM 8310  H HE21 . GLN A 1 18 ? -2.727  6.134   3.924   1.00 0.00 ? 18 GLN A HE21 8  
ATOM 8311  H HE22 . GLN A 1 18 ? -3.873  6.522   5.156   1.00 0.00 ? 18 GLN A HE22 8  
ATOM 8312  N N    . LEU A 1 19 ? -4.310  4.020   -0.928  1.00 0.00 ? 19 LEU A N    8  
ATOM 8313  C CA   . LEU A 1 19 ? -4.353  2.663   -1.463  1.00 0.00 ? 19 LEU A CA   8  
ATOM 8314  C C    . LEU A 1 19 ? -3.901  2.638   -2.920  1.00 0.00 ? 19 LEU A C    8  
ATOM 8315  O O    . LEU A 1 19 ? -3.422  1.617   -3.414  1.00 0.00 ? 19 LEU A O    8  
ATOM 8316  C CB   . LEU A 1 19 ? -5.767  2.092   -1.346  1.00 0.00 ? 19 LEU A CB   8  
ATOM 8317  C CG   . LEU A 1 19 ? -6.300  1.906   0.075   1.00 0.00 ? 19 LEU A CG   8  
ATOM 8318  C CD1  . LEU A 1 19 ? -7.818  1.810   0.067   1.00 0.00 ? 19 LEU A CD1  8  
ATOM 8319  C CD2  . LEU A 1 19 ? -5.689  0.669   0.716   1.00 0.00 ? 19 LEU A CD2  8  
ATOM 8320  H H    . LEU A 1 19 ? -5.149  4.462   -0.683  1.00 0.00 ? 19 LEU A H    8  
ATOM 8321  H HA   . LEU A 1 19 ? -3.678  2.055   -0.879  1.00 0.00 ? 19 LEU A HA   8  
ATOM 8322  H HB2  . LEU A 1 19 ? -6.437  2.760   -1.866  1.00 0.00 ? 19 LEU A HB2  8  
ATOM 8323  H HB3  . LEU A 1 19 ? -5.774  1.127   -1.833  1.00 0.00 ? 19 LEU A HB3  8  
ATOM 8324  H HG   . LEU A 1 19 ? -6.024  2.765   0.672   1.00 0.00 ? 19 LEU A HG   8  
ATOM 8325  H HD11 . LEU A 1 19 ? -8.234  2.718   -0.344  1.00 0.00 ? 19 LEU A HD11 8  
ATOM 8326  H HD12 . LEU A 1 19 ? -8.175  1.676   1.077   1.00 0.00 ? 19 LEU A HD12 8  
ATOM 8327  H HD13 . LEU A 1 19 ? -8.122  0.968   -0.537  1.00 0.00 ? 19 LEU A HD13 8  
ATOM 8328  H HD21 . LEU A 1 19 ? -6.257  0.402   1.595   1.00 0.00 ? 19 LEU A HD21 8  
ATOM 8329  H HD22 . LEU A 1 19 ? -4.667  0.877   0.997   1.00 0.00 ? 19 LEU A HD22 8  
ATOM 8330  H HD23 . LEU A 1 19 ? -5.711  -0.149  0.011   1.00 0.00 ? 19 LEU A HD23 8  
ATOM 8331  N N    . ARG A 1 20 ? -4.054  3.769   -3.601  1.00 0.00 ? 20 ARG A N    8  
ATOM 8332  C CA   . ARG A 1 20 ? -3.661  3.877   -5.001  1.00 0.00 ? 20 ARG A CA   8  
ATOM 8333  C C    . ARG A 1 20 ? -2.196  3.492   -5.185  1.00 0.00 ? 20 ARG A C    8  
ATOM 8334  O O    . ARG A 1 20 ? -1.847  2.773   -6.121  1.00 0.00 ? 20 ARG A O    8  
ATOM 8335  C CB   . ARG A 1 20 ? -3.892  5.301   -5.509  1.00 0.00 ? 20 ARG A CB   8  
ATOM 8336  C CG   . ARG A 1 20 ? -3.956  5.404   -7.024  1.00 0.00 ? 20 ARG A CG   8  
ATOM 8337  C CD   . ARG A 1 20 ? -5.247  4.812   -7.569  1.00 0.00 ? 20 ARG A CD   8  
ATOM 8338  N NE   . ARG A 1 20 ? -6.352  5.766   -7.515  1.00 0.00 ? 20 ARG A NE   8  
ATOM 8339  C CZ   . ARG A 1 20 ? -7.524  5.566   -8.107  1.00 0.00 ? 20 ARG A CZ   8  
ATOM 8340  N NH1  . ARG A 1 20 ? -7.744  4.453   -8.792  1.00 0.00 ? 20 ARG A NH1  8  
ATOM 8341  N NH2  . ARG A 1 20 ? -8.481  6.481   -8.012  1.00 0.00 ? 20 ARG A NH2  8  
ATOM 8342  H H    . ARG A 1 20 ? -4.442  4.549   -3.152  1.00 0.00 ? 20 ARG A H    8  
ATOM 8343  H HA   . ARG A 1 20 ? -4.275  3.197   -5.571  1.00 0.00 ? 20 ARG A HA   8  
ATOM 8344  H HB2  . ARG A 1 20 ? -4.825  5.668   -5.106  1.00 0.00 ? 20 ARG A HB2  8  
ATOM 8345  H HB3  . ARG A 1 20 ? -3.087  5.930   -5.161  1.00 0.00 ? 20 ARG A HB3  8  
ATOM 8346  H HG2  . ARG A 1 20 ? -3.903  6.445   -7.308  1.00 0.00 ? 20 ARG A HG2  8  
ATOM 8347  H HG3  . ARG A 1 20 ? -3.119  4.870   -7.447  1.00 0.00 ? 20 ARG A HG3  8  
ATOM 8348  H HD2  . ARG A 1 20 ? -5.088  4.518   -8.595  1.00 0.00 ? 20 ARG A HD2  8  
ATOM 8349  H HD3  . ARG A 1 20 ? -5.504  3.944   -6.982  1.00 0.00 ? 20 ARG A HD3  8  
ATOM 8350  H HE   . ARG A 1 20 ? -6.211  6.596   -7.014  1.00 0.00 ? 20 ARG A HE   8  
ATOM 8351  H HH11 . ARG A 1 20 ? -7.025  3.761   -8.864  1.00 0.00 ? 20 ARG A HH11 8  
ATOM 8352  H HH12 . ARG A 1 20 ? -8.628  4.304   -9.236  1.00 0.00 ? 20 ARG A HH12 8  
ATOM 8353  H HH21 . ARG A 1 20 ? -8.319  7.322   -7.496  1.00 0.00 ? 20 ARG A HH21 8  
ATOM 8354  H HH22 . ARG A 1 20 ? -9.363  6.330   -8.458  1.00 0.00 ? 20 ARG A HH22 8  
ATOM 8355  N N    . GLU A 1 21 ? -1.344  3.975   -4.286  1.00 0.00 ? 21 GLU A N    8  
ATOM 8356  C CA   . GLU A 1 21 ? 0.082   3.681   -4.352  1.00 0.00 ? 21 GLU A CA   8  
ATOM 8357  C C    . GLU A 1 21 ? 0.372   2.273   -3.840  1.00 0.00 ? 21 GLU A C    8  
ATOM 8358  O O    . GLU A 1 21 ? 1.207   1.558   -4.397  1.00 0.00 ? 21 GLU A O    8  
ATOM 8359  C CB   . GLU A 1 21 ? 0.874   4.705   -3.535  1.00 0.00 ? 21 GLU A CB   8  
ATOM 8360  C CG   . GLU A 1 21 ? 0.572   6.146   -3.909  1.00 0.00 ? 21 GLU A CG   8  
ATOM 8361  C CD   . GLU A 1 21 ? 0.668   6.394   -5.402  1.00 0.00 ? 21 GLU A CD   8  
ATOM 8362  O OE1  . GLU A 1 21 ? 1.802   6.493   -5.916  1.00 0.00 ? 21 GLU A OE1  8  
ATOM 8363  O OE2  . GLU A 1 21 ? -0.392  6.490   -6.056  1.00 0.00 ? 21 GLU A OE2  8  
ATOM 8364  H H    . GLU A 1 21 ? -1.683  4.542   -3.563  1.00 0.00 ? 21 GLU A H    8  
ATOM 8365  H HA   . GLU A 1 21 ? 0.387   3.746   -5.385  1.00 0.00 ? 21 GLU A HA   8  
ATOM 8366  H HB2  . GLU A 1 21 ? 0.643   4.569   -2.489  1.00 0.00 ? 21 GLU A HB2  8  
ATOM 8367  H HB3  . GLU A 1 21 ? 1.929   4.529   -3.687  1.00 0.00 ? 21 GLU A HB3  8  
ATOM 8368  H HG2  . GLU A 1 21 ? -0.429  6.387   -3.583  1.00 0.00 ? 21 GLU A HG2  8  
ATOM 8369  H HG3  . GLU A 1 21 ? 1.278   6.791   -3.405  1.00 0.00 ? 21 GLU A HG3  8  
ATOM 8370  N N    . LEU A 1 22 ? -0.322  1.881   -2.778  1.00 0.00 ? 22 LEU A N    8  
ATOM 8371  C CA   . LEU A 1 22 ? -0.140  0.559   -2.190  1.00 0.00 ? 22 LEU A CA   8  
ATOM 8372  C C    . LEU A 1 22 ? -0.451  -0.536  -3.206  1.00 0.00 ? 22 LEU A C    8  
ATOM 8373  O O    . LEU A 1 22 ? 0.370   -1.420  -3.449  1.00 0.00 ? 22 LEU A O    8  
ATOM 8374  C CB   . LEU A 1 22 ? -1.036  0.398   -0.960  1.00 0.00 ? 22 LEU A CB   8  
ATOM 8375  C CG   . LEU A 1 22 ? -0.644  1.221   0.268   1.00 0.00 ? 22 LEU A CG   8  
ATOM 8376  C CD1  . LEU A 1 22 ? -1.780  1.245   1.278   1.00 0.00 ? 22 LEU A CD1  8  
ATOM 8377  C CD2  . LEU A 1 22 ? 0.623   0.665   0.900   1.00 0.00 ? 22 LEU A CD2  8  
ATOM 8378  H H    . LEU A 1 22 ? -0.973  2.495   -2.378  1.00 0.00 ? 22 LEU A H    8  
ATOM 8379  H HA   . LEU A 1 22 ? 0.892   0.470   -1.887  1.00 0.00 ? 22 LEU A HA   8  
ATOM 8380  H HB2  . LEU A 1 22 ? -2.038  0.681   -1.242  1.00 0.00 ? 22 LEU A HB2  8  
ATOM 8381  H HB3  . LEU A 1 22 ? -1.024  -0.645  -0.678  1.00 0.00 ? 22 LEU A HB3  8  
ATOM 8382  H HG   . LEU A 1 22 ? -0.447  2.239   -0.037  1.00 0.00 ? 22 LEU A HG   8  
ATOM 8383  H HD11 . LEU A 1 22 ? -1.373  1.302   2.276   1.00 0.00 ? 22 LEU A HD11 8  
ATOM 8384  H HD12 . LEU A 1 22 ? -2.369  0.345   1.180   1.00 0.00 ? 22 LEU A HD12 8  
ATOM 8385  H HD13 . LEU A 1 22 ? -2.406  2.106   1.095   1.00 0.00 ? 22 LEU A HD13 8  
ATOM 8386  H HD21 . LEU A 1 22 ? 0.400   -0.274  1.387   1.00 0.00 ? 22 LEU A HD21 8  
ATOM 8387  H HD22 . LEU A 1 22 ? 1.000   1.367   1.629   1.00 0.00 ? 22 LEU A HD22 8  
ATOM 8388  H HD23 . LEU A 1 22 ? 1.368   0.505   0.135   1.00 0.00 ? 22 LEU A HD23 8  
ATOM 8389  N N    . GLU A 1 23 ? -1.640  -0.469  -3.797  1.00 0.00 ? 23 GLU A N    8  
ATOM 8390  C CA   . GLU A 1 23 ? -2.057  -1.454  -4.787  1.00 0.00 ? 23 GLU A CA   8  
ATOM 8391  C C    . GLU A 1 23 ? -1.031  -1.562  -5.912  1.00 0.00 ? 23 GLU A C    8  
ATOM 8392  O O    . GLU A 1 23 ? -0.767  -2.651  -6.422  1.00 0.00 ? 23 GLU A O    8  
ATOM 8393  C CB   . GLU A 1 23 ? -3.425  -1.083  -5.364  1.00 0.00 ? 23 GLU A CB   8  
ATOM 8394  C CG   . GLU A 1 23 ? -4.548  -1.128  -4.342  1.00 0.00 ? 23 GLU A CG   8  
ATOM 8395  C CD   . GLU A 1 23 ? -5.837  -0.522  -4.864  1.00 0.00 ? 23 GLU A CD   8  
ATOM 8396  O OE1  . GLU A 1 23 ? -5.882  -0.162  -6.059  1.00 0.00 ? 23 GLU A OE1  8  
ATOM 8397  O OE2  . GLU A 1 23 ? -6.800  -0.408  -4.077  1.00 0.00 ? 23 GLU A OE2  8  
ATOM 8398  H H    . GLU A 1 23 ? -2.250  0.261   -3.560  1.00 0.00 ? 23 GLU A H    8  
ATOM 8399  H HA   . GLU A 1 23 ? -2.133  -2.410  -4.292  1.00 0.00 ? 23 GLU A HA   8  
ATOM 8400  H HB2  . GLU A 1 23 ? -3.373  -0.082  -5.767  1.00 0.00 ? 23 GLU A HB2  8  
ATOM 8401  H HB3  . GLU A 1 23 ? -3.664  -1.770  -6.161  1.00 0.00 ? 23 GLU A HB3  8  
ATOM 8402  H HG2  . GLU A 1 23 ? -4.735  -2.158  -4.076  1.00 0.00 ? 23 GLU A HG2  8  
ATOM 8403  H HG3  . GLU A 1 23 ? -4.241  -0.581  -3.463  1.00 0.00 ? 23 GLU A HG3  8  
ATOM 8404  N N    . ARG A 1 24 ? -0.457  -0.426  -6.293  1.00 0.00 ? 24 ARG A N    8  
ATOM 8405  C CA   . ARG A 1 24 ? 0.537   -0.392  -7.358  1.00 0.00 ? 24 ARG A CA   8  
ATOM 8406  C C    . ARG A 1 24 ? 1.818   -1.103  -6.929  1.00 0.00 ? 24 ARG A C    8  
ATOM 8407  O O    . ARG A 1 24 ? 2.251   -2.060  -7.569  1.00 0.00 ? 24 ARG A O    8  
ATOM 8408  C CB   . ARG A 1 24 ? 0.850   1.054   -7.747  1.00 0.00 ? 24 ARG A CB   8  
ATOM 8409  C CG   . ARG A 1 24 ? -0.325  1.783   -8.378  1.00 0.00 ? 24 ARG A CG   8  
ATOM 8410  C CD   . ARG A 1 24 ? -0.174  1.883   -9.888  1.00 0.00 ? 24 ARG A CD   8  
ATOM 8411  N NE   . ARG A 1 24 ? -0.508  0.628   -10.556 1.00 0.00 ? 24 ARG A NE   8  
ATOM 8412  C CZ   . ARG A 1 24 ? -0.308  0.409   -11.851 1.00 0.00 ? 24 ARG A CZ   8  
ATOM 8413  N NH1  . ARG A 1 24 ? 0.222   1.356   -12.613 1.00 0.00 ? 24 ARG A NH1  8  
ATOM 8414  N NH2  . ARG A 1 24 ? -0.638  -0.759  -12.386 1.00 0.00 ? 24 ARG A NH2  8  
ATOM 8415  H H    . ARG A 1 24 ? -0.710  0.410   -5.848  1.00 0.00 ? 24 ARG A H    8  
ATOM 8416  H HA   . ARG A 1 24 ? 0.125   -0.904  -8.214  1.00 0.00 ? 24 ARG A HA   8  
ATOM 8417  H HB2  . ARG A 1 24 ? 1.149   1.597   -6.862  1.00 0.00 ? 24 ARG A HB2  8  
ATOM 8418  H HB3  . ARG A 1 24 ? 1.667   1.055   -8.453  1.00 0.00 ? 24 ARG A HB3  8  
ATOM 8419  H HG2  . ARG A 1 24 ? -1.234  1.244   -8.154  1.00 0.00 ? 24 ARG A HG2  8  
ATOM 8420  H HG3  . ARG A 1 24 ? -0.383  2.778   -7.963  1.00 0.00 ? 24 ARG A HG3  8  
ATOM 8421  H HD2  . ARG A 1 24 ? -0.830  2.659   -10.251 1.00 0.00 ? 24 ARG A HD2  8  
ATOM 8422  H HD3  . ARG A 1 24 ? 0.849   2.141   -10.117 1.00 0.00 ? 24 ARG A HD3  8  
ATOM 8423  H HE   . ARG A 1 24 ? -0.901  -0.085  -10.011 1.00 0.00 ? 24 ARG A HE   8  
ATOM 8424  H HH11 . ARG A 1 24 ? 0.472   2.237   -12.212 1.00 0.00 ? 24 ARG A HH11 8  
ATOM 8425  H HH12 . ARG A 1 24 ? 0.372   1.188   -13.587 1.00 0.00 ? 24 ARG A HH12 8  
ATOM 8426  H HH21 . ARG A 1 24 ? -1.038  -1.475  -11.814 1.00 0.00 ? 24 ARG A HH21 8  
ATOM 8427  H HH22 . ARG A 1 24 ? -0.488  -0.923  -13.360 1.00 0.00 ? 24 ARG A HH22 8  
ATOM 8428  N N    . GLU A 1 25 ? 2.417   -0.626  -5.843  1.00 0.00 ? 25 GLU A N    8  
ATOM 8429  C CA   . GLU A 1 25 ? 3.648   -1.216  -5.330  1.00 0.00 ? 25 GLU A CA   8  
ATOM 8430  C C    . GLU A 1 25 ? 3.460   -2.702  -5.039  1.00 0.00 ? 25 GLU A C    8  
ATOM 8431  O O    . GLU A 1 25 ? 4.364   -3.508  -5.259  1.00 0.00 ? 25 GLU A O    8  
ATOM 8432  C CB   . GLU A 1 25 ? 4.097   -0.490  -4.060  1.00 0.00 ? 25 GLU A CB   8  
ATOM 8433  C CG   . GLU A 1 25 ? 5.015   0.691   -4.327  1.00 0.00 ? 25 GLU A CG   8  
ATOM 8434  C CD   . GLU A 1 25 ? 4.562   1.527   -5.508  1.00 0.00 ? 25 GLU A CD   8  
ATOM 8435  O OE1  . GLU A 1 25 ? 4.806   1.108   -6.659  1.00 0.00 ? 25 GLU A OE1  8  
ATOM 8436  O OE2  . GLU A 1 25 ? 3.964   2.600   -5.282  1.00 0.00 ? 25 GLU A OE2  8  
ATOM 8437  H H    . GLU A 1 25 ? 2.023   0.140   -5.376  1.00 0.00 ? 25 GLU A H    8  
ATOM 8438  H HA   . GLU A 1 25 ? 4.410   -1.103  -6.086  1.00 0.00 ? 25 GLU A HA   8  
ATOM 8439  H HB2  . GLU A 1 25 ? 3.224   -0.130  -3.537  1.00 0.00 ? 25 GLU A HB2  8  
ATOM 8440  H HB3  . GLU A 1 25 ? 4.622   -1.190  -3.426  1.00 0.00 ? 25 GLU A HB3  8  
ATOM 8441  H HG2  . GLU A 1 25 ? 5.037   1.320   -3.449  1.00 0.00 ? 25 GLU A HG2  8  
ATOM 8442  H HG3  . GLU A 1 25 ? 6.010   0.320   -4.527  1.00 0.00 ? 25 GLU A HG3  8  
ATOM 8443  N N    . TYR A 1 26 ? 2.280   -3.057  -4.544  1.00 0.00 ? 26 TYR A N    8  
ATOM 8444  C CA   . TYR A 1 26 ? 1.973   -4.445  -4.220  1.00 0.00 ? 26 TYR A CA   8  
ATOM 8445  C C    . TYR A 1 26 ? 1.843   -5.284  -5.487  1.00 0.00 ? 26 TYR A C    8  
ATOM 8446  O O    . TYR A 1 26 ? 2.400   -6.378  -5.580  1.00 0.00 ? 26 TYR A O    8  
ATOM 8447  C CB   . TYR A 1 26 ? 0.680   -4.527  -3.406  1.00 0.00 ? 26 TYR A CB   8  
ATOM 8448  C CG   . TYR A 1 26 ? 0.199   -5.941  -3.175  1.00 0.00 ? 26 TYR A CG   8  
ATOM 8449  C CD1  . TYR A 1 26 ? 1.020   -6.886  -2.573  1.00 0.00 ? 26 TYR A CD1  8  
ATOM 8450  C CD2  . TYR A 1 26 ? -1.079  -6.332  -3.558  1.00 0.00 ? 26 TYR A CD2  8  
ATOM 8451  C CE1  . TYR A 1 26 ? 0.584   -8.180  -2.361  1.00 0.00 ? 26 TYR A CE1  8  
ATOM 8452  C CE2  . TYR A 1 26 ? -1.523  -7.624  -3.349  1.00 0.00 ? 26 TYR A CE2  8  
ATOM 8453  C CZ   . TYR A 1 26 ? -0.688  -8.544  -2.750  1.00 0.00 ? 26 TYR A CZ   8  
ATOM 8454  O OH   . TYR A 1 26 ? -1.126  -9.831  -2.539  1.00 0.00 ? 26 TYR A OH   8  
ATOM 8455  H H    . TYR A 1 26 ? 1.599   -2.369  -4.390  1.00 0.00 ? 26 TYR A H    8  
ATOM 8456  H HA   . TYR A 1 26 ? 2.786   -4.834  -3.625  1.00 0.00 ? 26 TYR A HA   8  
ATOM 8457  H HB2  . TYR A 1 26 ? 0.840   -4.070  -2.442  1.00 0.00 ? 26 TYR A HB2  8  
ATOM 8458  H HB3  . TYR A 1 26 ? -0.100  -3.992  -3.928  1.00 0.00 ? 26 TYR A HB3  8  
ATOM 8459  H HD1  . TYR A 1 26 ? 2.016   -6.598  -2.269  1.00 0.00 ? 26 TYR A HD1  8  
ATOM 8460  H HD2  . TYR A 1 26 ? -1.731  -5.610  -4.027  1.00 0.00 ? 26 TYR A HD2  8  
ATOM 8461  H HE1  . TYR A 1 26 ? 1.238   -8.900  -1.892  1.00 0.00 ? 26 TYR A HE1  8  
ATOM 8462  H HE2  . TYR A 1 26 ? -2.519  -7.909  -3.653  1.00 0.00 ? 26 TYR A HE2  8  
ATOM 8463  H HH   . TYR A 1 26 ? -0.689  -10.195 -1.765  1.00 0.00 ? 26 TYR A HH   8  
ATOM 8464  N N    . ALA A 1 27 ? 1.106   -4.763  -6.462  1.00 0.00 ? 27 ALA A N    8  
ATOM 8465  C CA   . ALA A 1 27 ? 0.905   -5.461  -7.725  1.00 0.00 ? 27 ALA A CA   8  
ATOM 8466  C C    . ALA A 1 27 ? 2.235   -5.735  -8.419  1.00 0.00 ? 27 ALA A C    8  
ATOM 8467  O O    . ALA A 1 27 ? 2.344   -6.651  -9.233  1.00 0.00 ? 27 ALA A O    8  
ATOM 8468  C CB   . ALA A 1 27 ? -0.011  -4.655  -8.634  1.00 0.00 ? 27 ALA A CB   8  
ATOM 8469  H H    . ALA A 1 27 ? 0.688   -3.887  -6.328  1.00 0.00 ? 27 ALA A H    8  
ATOM 8470  H HA   . ALA A 1 27 ? 0.421   -6.404  -7.512  1.00 0.00 ? 27 ALA A HA   8  
ATOM 8471  H HB1  . ALA A 1 27 ? -1.037  -4.947  -8.461  1.00 0.00 ? 27 ALA A HB1  8  
ATOM 8472  H HB2  . ALA A 1 27 ? 0.105   -3.603  -8.420  1.00 0.00 ? 27 ALA A HB2  8  
ATOM 8473  H HB3  . ALA A 1 27 ? 0.248   -4.844  -9.665  1.00 0.00 ? 27 ALA A HB3  8  
ATOM 8474  N N    . ALA A 1 28 ? 3.243   -4.933  -8.092  1.00 0.00 ? 28 ALA A N    8  
ATOM 8475  C CA   . ALA A 1 28 ? 4.566   -5.090  -8.683  1.00 0.00 ? 28 ALA A CA   8  
ATOM 8476  C C    . ALA A 1 28 ? 5.411   -6.078  -7.884  1.00 0.00 ? 28 ALA A C    8  
ATOM 8477  O O    . ALA A 1 28 ? 6.264   -6.769  -8.439  1.00 0.00 ? 28 ALA A O    8  
ATOM 8478  C CB   . ALA A 1 28 ? 5.268   -3.743  -8.771  1.00 0.00 ? 28 ALA A CB   8  
ATOM 8479  H H    . ALA A 1 28 ? 3.094   -4.221  -7.436  1.00 0.00 ? 28 ALA A H    8  
ATOM 8480  H HA   . ALA A 1 28 ? 4.440   -5.469  -9.687  1.00 0.00 ? 28 ALA A HA   8  
ATOM 8481  H HB1  . ALA A 1 28 ? 4.885   -3.088  -8.001  1.00 0.00 ? 28 ALA A HB1  8  
ATOM 8482  H HB2  . ALA A 1 28 ? 6.330   -3.881  -8.632  1.00 0.00 ? 28 ALA A HB2  8  
ATOM 8483  H HB3  . ALA A 1 28 ? 5.085   -3.305  -9.741  1.00 0.00 ? 28 ALA A HB3  8  
ATOM 8484  N N    . ASN A 1 29 ? 5.167   -6.138  -6.579  1.00 0.00 ? 29 ASN A N    8  
ATOM 8485  C CA   . ASN A 1 29 ? 5.906   -7.040  -5.704  1.00 0.00 ? 29 ASN A CA   8  
ATOM 8486  C C    . ASN A 1 29 ? 5.214   -7.175  -4.352  1.00 0.00 ? 29 ASN A C    8  
ATOM 8487  O O    . ASN A 1 29 ? 4.984   -6.185  -3.657  1.00 0.00 ? 29 ASN A O    8  
ATOM 8488  C CB   . ASN A 1 29 ? 7.338   -6.535  -5.509  1.00 0.00 ? 29 ASN A CB   8  
ATOM 8489  C CG   . ASN A 1 29 ? 7.383   -5.129  -4.944  1.00 0.00 ? 29 ASN A CG   8  
ATOM 8490  O OD1  . ASN A 1 29 ? 7.583   -4.936  -3.744  1.00 0.00 ? 29 ASN A OD1  8  
ATOM 8491  N ND2  . ASN A 1 29 ? 7.196   -4.138  -5.808  1.00 0.00 ? 29 ASN A ND2  8  
ATOM 8492  H H    . ASN A 1 29 ? 4.473   -5.561  -6.195  1.00 0.00 ? 29 ASN A H    8  
ATOM 8493  H HA   . ASN A 1 29 ? 5.937   -8.009  -6.178  1.00 0.00 ? 29 ASN A HA   8  
ATOM 8494  H HB2  . ASN A 1 29 ? 7.855   -7.194  -4.826  1.00 0.00 ? 29 ASN A HB2  8  
ATOM 8495  H HB3  . ASN A 1 29 ? 7.847   -6.538  -6.461  1.00 0.00 ? 29 ASN A HB3  8  
ATOM 8496  H HD21 . ASN A 1 29 ? 7.042   -4.366  -6.748  1.00 0.00 ? 29 ASN A HD21 8  
ATOM 8497  H HD22 . ASN A 1 29 ? 7.221   -3.219  -5.469  1.00 0.00 ? 29 ASN A HD22 8  
ATOM 8498  N N    . LYS A 1 30 ? 4.884   -8.408  -3.983  1.00 0.00 ? 30 LYS A N    8  
ATOM 8499  C CA   . LYS A 1 30 ? 4.219   -8.675  -2.713  1.00 0.00 ? 30 LYS A CA   8  
ATOM 8500  C C    . LYS A 1 30 ? 5.116   -8.297  -1.539  1.00 0.00 ? 30 LYS A C    8  
ATOM 8501  O O    . LYS A 1 30 ? 4.636   -8.037  -0.436  1.00 0.00 ? 30 LYS A O    8  
ATOM 8502  C CB   . LYS A 1 30 ? 3.832   -10.153 -2.617  1.00 0.00 ? 30 LYS A CB   8  
ATOM 8503  C CG   . LYS A 1 30 ? 5.004   -11.101 -2.800  1.00 0.00 ? 30 LYS A CG   8  
ATOM 8504  C CD   . LYS A 1 30 ? 4.547   -12.465 -3.291  1.00 0.00 ? 30 LYS A CD   8  
ATOM 8505  C CE   . LYS A 1 30 ? 4.430   -12.500 -4.807  1.00 0.00 ? 30 LYS A CE   8  
ATOM 8506  N NZ   . LYS A 1 30 ? 3.996   -13.837 -5.299  1.00 0.00 ? 30 LYS A NZ   8  
ATOM 8507  H H    . LYS A 1 30 ? 5.093   -9.158  -4.580  1.00 0.00 ? 30 LYS A H    8  
ATOM 8508  H HA   . LYS A 1 30 ? 3.323   -8.074  -2.674  1.00 0.00 ? 30 LYS A HA   8  
ATOM 8509  H HB2  . LYS A 1 30 ? 3.395   -10.336 -1.646  1.00 0.00 ? 30 LYS A HB2  8  
ATOM 8510  H HB3  . LYS A 1 30 ? 3.098   -10.370 -3.379  1.00 0.00 ? 30 LYS A HB3  8  
ATOM 8511  H HG2  . LYS A 1 30 ? 5.687   -10.681 -3.523  1.00 0.00 ? 30 LYS A HG2  8  
ATOM 8512  H HG3  . LYS A 1 30 ? 5.509   -11.222 -1.852  1.00 0.00 ? 30 LYS A HG3  8  
ATOM 8513  H HD2  . LYS A 1 30 ? 5.264   -13.209 -2.979  1.00 0.00 ? 30 LYS A HD2  8  
ATOM 8514  H HD3  . LYS A 1 30 ? 3.581   -12.688 -2.859  1.00 0.00 ? 30 LYS A HD3  8  
ATOM 8515  H HE2  . LYS A 1 30 ? 3.708   -11.760 -5.117  1.00 0.00 ? 30 LYS A HE2  8  
ATOM 8516  H HE3  . LYS A 1 30 ? 5.393   -12.264 -5.235  1.00 0.00 ? 30 LYS A HE3  8  
ATOM 8517  H HZ1  . LYS A 1 30 ? 2.960   -13.862 -5.397  1.00 0.00 ? 30 LYS A HZ1  8  
ATOM 8518  H HZ2  . LYS A 1 30 ? 4.287   -14.576 -4.629  1.00 0.00 ? 30 LYS A HZ2  8  
ATOM 8519  H HZ3  . LYS A 1 30 ? 4.426   -14.034 -6.225  1.00 0.00 ? 30 LYS A HZ3  8  
ATOM 8520  N N    . PHE A 1 31 ? 6.422   -8.265  -1.784  1.00 0.00 ? 31 PHE A N    8  
ATOM 8521  C CA   . PHE A 1 31 ? 7.387   -7.918  -0.747  1.00 0.00 ? 31 PHE A CA   8  
ATOM 8522  C C    . PHE A 1 31 ? 8.266   -6.753  -1.191  1.00 0.00 ? 31 PHE A C    8  
ATOM 8523  O O    . PHE A 1 31 ? 9.133   -6.908  -2.052  1.00 0.00 ? 31 PHE A O    8  
ATOM 8524  C CB   . PHE A 1 31 ? 8.258   -9.128  -0.405  1.00 0.00 ? 31 PHE A CB   8  
ATOM 8525  C CG   . PHE A 1 31 ? 7.732   -9.940  0.743   1.00 0.00 ? 31 PHE A CG   8  
ATOM 8526  C CD1  . PHE A 1 31 ? 6.440   -10.441 0.721   1.00 0.00 ? 31 PHE A CD1  8  
ATOM 8527  C CD2  . PHE A 1 31 ? 8.529   -10.203 1.846   1.00 0.00 ? 31 PHE A CD2  8  
ATOM 8528  C CE1  . PHE A 1 31 ? 5.953   -11.189 1.776   1.00 0.00 ? 31 PHE A CE1  8  
ATOM 8529  C CE2  . PHE A 1 31 ? 8.047   -10.951 2.904   1.00 0.00 ? 31 PHE A CE2  8  
ATOM 8530  C CZ   . PHE A 1 31 ? 6.757   -11.443 2.869   1.00 0.00 ? 31 PHE A CZ   8  
ATOM 8531  H H    . PHE A 1 31 ? 6.745   -8.482  -2.684  1.00 0.00 ? 31 PHE A H    8  
ATOM 8532  H HA   . PHE A 1 31 ? 6.835   -7.622  0.132   1.00 0.00 ? 31 PHE A HA   8  
ATOM 8533  H HB2  . PHE A 1 31 ? 8.319   -9.774  -1.268  1.00 0.00 ? 31 PHE A HB2  8  
ATOM 8534  H HB3  . PHE A 1 31 ? 9.249   -8.787  -0.146  1.00 0.00 ? 31 PHE A HB3  8  
ATOM 8535  H HD1  . PHE A 1 31 ? 5.809   -10.242 -0.135  1.00 0.00 ? 31 PHE A HD1  8  
ATOM 8536  H HD2  . PHE A 1 31 ? 9.537   -9.818  1.875   1.00 0.00 ? 31 PHE A HD2  8  
ATOM 8537  H HE1  . PHE A 1 31 ? 4.943   -11.572 1.745   1.00 0.00 ? 31 PHE A HE1  8  
ATOM 8538  H HE2  . PHE A 1 31 ? 8.678   -11.148 3.758   1.00 0.00 ? 31 PHE A HE2  8  
ATOM 8539  H HZ   . PHE A 1 31 ? 6.379   -12.028 3.694   1.00 0.00 ? 31 PHE A HZ   8  
ATOM 8540  N N    . ILE A 1 32 ? 8.036   -5.586  -0.598  1.00 0.00 ? 32 ILE A N    8  
ATOM 8541  C CA   . ILE A 1 32 ? 8.808   -4.395  -0.931  1.00 0.00 ? 32 ILE A CA   8  
ATOM 8542  C C    . ILE A 1 32 ? 10.154  -4.394  -0.216  1.00 0.00 ? 32 ILE A C    8  
ATOM 8543  O O    . ILE A 1 32 ? 10.469  -5.313  0.540   1.00 0.00 ? 32 ILE A O    8  
ATOM 8544  C CB   . ILE A 1 32 ? 8.044   -3.109  -0.565  1.00 0.00 ? 32 ILE A CB   8  
ATOM 8545  C CG1  . ILE A 1 32 ? 7.897   -2.992  0.953   1.00 0.00 ? 32 ILE A CG1  8  
ATOM 8546  C CG2  . ILE A 1 32 ? 6.679   -3.094  -1.237  1.00 0.00 ? 32 ILE A CG2  8  
ATOM 8547  C CD1  . ILE A 1 32 ? 7.176   -1.738  1.396   1.00 0.00 ? 32 ILE A CD1  8  
ATOM 8548  H H    . ILE A 1 32 ? 7.332   -5.525  0.080   1.00 0.00 ? 32 ILE A H    8  
ATOM 8549  H HA   . ILE A 1 32 ? 8.978   -4.397  -1.998  1.00 0.00 ? 32 ILE A HA   8  
ATOM 8550  H HB   . ILE A 1 32 ? 8.608   -2.265  -0.932  1.00 0.00 ? 32 ILE A HB   8  
ATOM 8551  H HG12 . ILE A 1 32 ? 7.343   -3.840  1.322   1.00 0.00 ? 32 ILE A HG12 8  
ATOM 8552  H HG13 . ILE A 1 32 ? 8.880   -2.986  1.402   1.00 0.00 ? 32 ILE A HG13 8  
ATOM 8553  H HG21 . ILE A 1 32 ? 6.552   -2.166  -1.775  1.00 0.00 ? 32 ILE A HG21 8  
ATOM 8554  H HG22 . ILE A 1 32 ? 6.609   -3.922  -1.927  1.00 0.00 ? 32 ILE A HG22 8  
ATOM 8555  H HG23 . ILE A 1 32 ? 5.907   -3.184  -0.487  1.00 0.00 ? 32 ILE A HG23 8  
ATOM 8556  H HD11 . ILE A 1 32 ? 7.239   -1.646  2.470   1.00 0.00 ? 32 ILE A HD11 8  
ATOM 8557  H HD12 . ILE A 1 32 ? 7.632   -0.877  0.932   1.00 0.00 ? 32 ILE A HD12 8  
ATOM 8558  H HD13 . ILE A 1 32 ? 6.138   -1.797  1.101   1.00 0.00 ? 32 ILE A HD13 8  
ATOM 8559  N N    . THR A 1 33 ? 10.947  -3.354  -0.459  1.00 0.00 ? 33 THR A N    8  
ATOM 8560  C CA   . THR A 1 33 ? 12.260  -3.233  0.161   1.00 0.00 ? 33 THR A CA   8  
ATOM 8561  C C    . THR A 1 33 ? 12.223  -2.266  1.339   1.00 0.00 ? 33 THR A C    8  
ATOM 8562  O O    . THR A 1 33 ? 11.260  -1.518  1.513   1.00 0.00 ? 33 THR A O    8  
ATOM 8563  C CB   . THR A 1 33 ? 13.317  -2.751  -0.850  1.00 0.00 ? 33 THR A CB   8  
ATOM 8564  O OG1  . THR A 1 33 ? 13.211  -1.335  -1.033  1.00 0.00 ? 33 THR A OG1  8  
ATOM 8565  C CG2  . THR A 1 33 ? 13.145  -3.455  -2.188  1.00 0.00 ? 33 THR A CG2  8  
ATOM 8566  H H    . THR A 1 33 ? 10.640  -2.654  -1.072  1.00 0.00 ? 33 THR A H    8  
ATOM 8567  H HA   . THR A 1 33 ? 12.552  -4.209  0.519   1.00 0.00 ? 33 THR A HA   8  
ATOM 8568  H HB   . THR A 1 33 ? 14.298  -2.984  -0.461  1.00 0.00 ? 33 THR A HB   8  
ATOM 8569  H HG1  . THR A 1 33 ? 14.041  -0.994  -1.376  1.00 0.00 ? 33 THR A HG1  8  
ATOM 8570  H HG21 . THR A 1 33 ? 12.647  -2.794  -2.881  1.00 0.00 ? 33 THR A HG21 8  
ATOM 8571  H HG22 . THR A 1 33 ? 12.553  -4.347  -2.052  1.00 0.00 ? 33 THR A HG22 8  
ATOM 8572  H HG23 . THR A 1 33 ? 14.115  -3.723  -2.581  1.00 0.00 ? 33 THR A HG23 8  
ATOM 8573  N N    . LYS A 1 34 ? 13.278  -2.284  2.147   1.00 0.00 ? 34 LYS A N    8  
ATOM 8574  C CA   . LYS A 1 34 ? 13.369  -1.408  3.308   1.00 0.00 ? 34 LYS A CA   8  
ATOM 8575  C C    . LYS A 1 34 ? 13.308  0.058   2.890   1.00 0.00 ? 34 LYS A C    8  
ATOM 8576  O O    . LYS A 1 34 ? 12.950  0.926   3.686   1.00 0.00 ? 34 LYS A O    8  
ATOM 8577  C CB   . LYS A 1 34 ? 14.665  -1.677  4.076   1.00 0.00 ? 34 LYS A CB   8  
ATOM 8578  C CG   . LYS A 1 34 ? 14.553  -2.810  5.081   1.00 0.00 ? 34 LYS A CG   8  
ATOM 8579  C CD   . LYS A 1 34 ? 14.039  -2.316  6.423   1.00 0.00 ? 34 LYS A CD   8  
ATOM 8580  C CE   . LYS A 1 34 ? 13.953  -3.447  7.437   1.00 0.00 ? 34 LYS A CE   8  
ATOM 8581  N NZ   . LYS A 1 34 ? 15.287  -3.780  8.010   1.00 0.00 ? 34 LYS A NZ   8  
ATOM 8582  H H    . LYS A 1 34 ? 14.015  -2.903  1.956   1.00 0.00 ? 34 LYS A H    8  
ATOM 8583  H HA   . LYS A 1 34 ? 12.528  -1.621  3.952   1.00 0.00 ? 34 LYS A HA   8  
ATOM 8584  H HB2  . LYS A 1 34 ? 15.443  -1.926  3.369   1.00 0.00 ? 34 LYS A HB2  8  
ATOM 8585  H HB3  . LYS A 1 34 ? 14.947  -0.779  4.608   1.00 0.00 ? 34 LYS A HB3  8  
ATOM 8586  H HG2  . LYS A 1 34 ? 13.870  -3.553  4.698   1.00 0.00 ? 34 LYS A HG2  8  
ATOM 8587  H HG3  . LYS A 1 34 ? 15.529  -3.253  5.221   1.00 0.00 ? 34 LYS A HG3  8  
ATOM 8588  H HD2  . LYS A 1 34 ? 14.711  -1.560  6.800   1.00 0.00 ? 34 LYS A HD2  8  
ATOM 8589  H HD3  . LYS A 1 34 ? 13.054  -1.891  6.287   1.00 0.00 ? 34 LYS A HD3  8  
ATOM 8590  H HE2  . LYS A 1 34 ? 13.293  -3.147  8.236   1.00 0.00 ? 34 LYS A HE2  8  
ATOM 8591  H HE3  . LYS A 1 34 ? 13.552  -4.322  6.948   1.00 0.00 ? 34 LYS A HE3  8  
ATOM 8592  H HZ1  . LYS A 1 34 ? 15.785  -4.449  7.389   1.00 0.00 ? 34 LYS A HZ1  8  
ATOM 8593  H HZ2  . LYS A 1 34 ? 15.175  -4.213  8.949   1.00 0.00 ? 34 LYS A HZ2  8  
ATOM 8594  H HZ3  . LYS A 1 34 ? 15.861  -2.918  8.104   1.00 0.00 ? 34 LYS A HZ3  8  
ATOM 8595  N N    . ASP A 1 35 ? 13.658  0.326   1.637   1.00 0.00 ? 35 ASP A N    8  
ATOM 8596  C CA   . ASP A 1 35 ? 13.640  1.686   1.113   1.00 0.00 ? 35 ASP A CA   8  
ATOM 8597  C C    . ASP A 1 35 ? 12.278  2.021   0.514   1.00 0.00 ? 35 ASP A C    8  
ATOM 8598  O O    . ASP A 1 35 ? 11.689  3.057   0.822   1.00 0.00 ? 35 ASP A O    8  
ATOM 8599  C CB   . ASP A 1 35 ? 14.732  1.862   0.056   1.00 0.00 ? 35 ASP A CB   8  
ATOM 8600  C CG   . ASP A 1 35 ? 16.083  2.182   0.667   1.00 0.00 ? 35 ASP A CG   8  
ATOM 8601  O OD1  . ASP A 1 35 ? 16.160  3.135   1.470   1.00 0.00 ? 35 ASP A OD1  8  
ATOM 8602  O OD2  . ASP A 1 35 ? 17.062  1.478   0.342   1.00 0.00 ? 35 ASP A OD2  8  
ATOM 8603  H H    . ASP A 1 35 ? 13.934  -0.409  1.050   1.00 0.00 ? 35 ASP A H    8  
ATOM 8604  H HA   . ASP A 1 35 ? 13.834  2.361   1.933   1.00 0.00 ? 35 ASP A HA   8  
ATOM 8605  H HB2  . ASP A 1 35 ? 14.823  0.949   -0.514  1.00 0.00 ? 35 ASP A HB2  8  
ATOM 8606  H HB3  . ASP A 1 35 ? 14.456  2.670   -0.606  1.00 0.00 ? 35 ASP A HB3  8  
ATOM 8607  N N    . LYS A 1 36 ? 11.781  1.136   -0.344  1.00 0.00 ? 36 LYS A N    8  
ATOM 8608  C CA   . LYS A 1 36 ? 10.487  1.336   -0.986  1.00 0.00 ? 36 LYS A CA   8  
ATOM 8609  C C    . LYS A 1 36 ? 9.403   1.615   0.049   1.00 0.00 ? 36 LYS A C    8  
ATOM 8610  O O    . LYS A 1 36 ? 8.474   2.383   -0.202  1.00 0.00 ? 36 LYS A O    8  
ATOM 8611  C CB   . LYS A 1 36 ? 10.111  0.105   -1.815  1.00 0.00 ? 36 LYS A CB   8  
ATOM 8612  C CG   . LYS A 1 36 ? 8.718   0.179   -2.415  1.00 0.00 ? 36 LYS A CG   8  
ATOM 8613  C CD   . LYS A 1 36 ? 8.543   1.424   -3.268  1.00 0.00 ? 36 LYS A CD   8  
ATOM 8614  C CE   . LYS A 1 36 ? 9.492   1.422   -4.457  1.00 0.00 ? 36 LYS A CE   8  
ATOM 8615  N NZ   . LYS A 1 36 ? 9.164   2.501   -5.430  1.00 0.00 ? 36 LYS A NZ   8  
ATOM 8616  H H    . LYS A 1 36 ? 12.297  0.328   -0.549  1.00 0.00 ? 36 LYS A H    8  
ATOM 8617  H HA   . LYS A 1 36 ? 10.571  2.189   -1.642  1.00 0.00 ? 36 LYS A HA   8  
ATOM 8618  H HB2  . LYS A 1 36 ? 10.822  -0.003  -2.620  1.00 0.00 ? 36 LYS A HB2  8  
ATOM 8619  H HB3  . LYS A 1 36 ? 10.162  -0.769  -1.182  1.00 0.00 ? 36 LYS A HB3  8  
ATOM 8620  H HG2  . LYS A 1 36 ? 8.554   -0.693  -3.031  1.00 0.00 ? 36 LYS A HG2  8  
ATOM 8621  H HG3  . LYS A 1 36 ? 7.991   0.197   -1.615  1.00 0.00 ? 36 LYS A HG3  8  
ATOM 8622  H HD2  . LYS A 1 36 ? 7.527   1.461   -3.633  1.00 0.00 ? 36 LYS A HD2  8  
ATOM 8623  H HD3  . LYS A 1 36 ? 8.742   2.296   -2.662  1.00 0.00 ? 36 LYS A HD3  8  
ATOM 8624  H HE2  . LYS A 1 36 ? 10.499  1.568   -4.098  1.00 0.00 ? 36 LYS A HE2  8  
ATOM 8625  H HE3  . LYS A 1 36 ? 9.422   0.466   -4.955  1.00 0.00 ? 36 LYS A HE3  8  
ATOM 8626  H HZ1  . LYS A 1 36 ? 9.913   2.575   -6.148  1.00 0.00 ? 36 LYS A HZ1  8  
ATOM 8627  H HZ2  . LYS A 1 36 ? 9.081   3.413   -4.938  1.00 0.00 ? 36 LYS A HZ2  8  
ATOM 8628  H HZ3  . LYS A 1 36 ? 8.263   2.292   -5.905  1.00 0.00 ? 36 LYS A HZ3  8  
ATOM 8629  N N    . ARG A 1 37 ? 9.528   0.988   1.215   1.00 0.00 ? 37 ARG A N    8  
ATOM 8630  C CA   . ARG A 1 37 ? 8.558   1.170   2.288   1.00 0.00 ? 37 ARG A CA   8  
ATOM 8631  C C    . ARG A 1 37 ? 8.566   2.612   2.789   1.00 0.00 ? 37 ARG A C    8  
ATOM 8632  O O    . ARG A 1 37 ? 7.512   3.202   3.026   1.00 0.00 ? 37 ARG A O    8  
ATOM 8633  C CB   . ARG A 1 37 ? 8.861   0.216   3.445   1.00 0.00 ? 37 ARG A CB   8  
ATOM 8634  C CG   . ARG A 1 37 ? 7.789   0.205   4.522   1.00 0.00 ? 37 ARG A CG   8  
ATOM 8635  C CD   . ARG A 1 37 ? 7.629   -1.177  5.135   1.00 0.00 ? 37 ARG A CD   8  
ATOM 8636  N NE   . ARG A 1 37 ? 8.566   -1.400  6.234   1.00 0.00 ? 37 ARG A NE   8  
ATOM 8637  C CZ   . ARG A 1 37 ? 8.911   -2.605  6.672   1.00 0.00 ? 37 ARG A CZ   8  
ATOM 8638  N NH1  . ARG A 1 37 ? 8.401   -3.691  6.108   1.00 0.00 ? 37 ARG A NH1  8  
ATOM 8639  N NH2  . ARG A 1 37 ? 9.770   -2.726  7.677   1.00 0.00 ? 37 ARG A NH2  8  
ATOM 8640  H H    . ARG A 1 37 ? 10.290  0.388   1.356   1.00 0.00 ? 37 ARG A H    8  
ATOM 8641  H HA   . ARG A 1 37 ? 7.579   0.944   1.893   1.00 0.00 ? 37 ARG A HA   8  
ATOM 8642  H HB2  . ARG A 1 37 ? 8.958   -0.786  3.054   1.00 0.00 ? 37 ARG A HB2  8  
ATOM 8643  H HB3  . ARG A 1 37 ? 9.795   0.508   3.901   1.00 0.00 ? 37 ARG A HB3  8  
ATOM 8644  H HG2  . ARG A 1 37 ? 8.065   0.902   5.299   1.00 0.00 ? 37 ARG A HG2  8  
ATOM 8645  H HG3  . ARG A 1 37 ? 6.849   0.505   4.083   1.00 0.00 ? 37 ARG A HG3  8  
ATOM 8646  H HD2  . ARG A 1 37 ? 6.621   -1.277  5.509   1.00 0.00 ? 37 ARG A HD2  8  
ATOM 8647  H HD3  . ARG A 1 37 ? 7.804   -1.918  4.370   1.00 0.00 ? 37 ARG A HD3  8  
ATOM 8648  H HE   . ARG A 1 37 ? 8.955   -0.611  6.665   1.00 0.00 ? 37 ARG A HE   8  
ATOM 8649  H HH11 . ARG A 1 37 ? 7.755   -3.603  5.350   1.00 0.00 ? 37 ARG A HH11 8  
ATOM 8650  H HH12 . ARG A 1 37 ? 8.664   -4.597  6.439   1.00 0.00 ? 37 ARG A HH12 8  
ATOM 8651  H HH21 . ARG A 1 37 ? 10.157  -1.910  8.105   1.00 0.00 ? 37 ARG A HH21 8  
ATOM 8652  H HH22 . ARG A 1 37 ? 10.029  -3.633  8.006   1.00 0.00 ? 37 ARG A HH22 8  
ATOM 8653  N N    . ARG A 1 38 ? 9.760   3.172   2.947   1.00 0.00 ? 38 ARG A N    8  
ATOM 8654  C CA   . ARG A 1 38 ? 9.905   4.543   3.421   1.00 0.00 ? 38 ARG A CA   8  
ATOM 8655  C C    . ARG A 1 38 ? 9.285   5.527   2.434   1.00 0.00 ? 38 ARG A C    8  
ATOM 8656  O O    . ARG A 1 38 ? 8.655   6.508   2.830   1.00 0.00 ? 38 ARG A O    8  
ATOM 8657  C CB   . ARG A 1 38 ? 11.382  4.879   3.633   1.00 0.00 ? 38 ARG A CB   8  
ATOM 8658  C CG   . ARG A 1 38 ? 12.059  4.012   4.682   1.00 0.00 ? 38 ARG A CG   8  
ATOM 8659  C CD   . ARG A 1 38 ? 13.574  4.100   4.585   1.00 0.00 ? 38 ARG A CD   8  
ATOM 8660  N NE   . ARG A 1 38 ? 14.096  5.295   5.243   1.00 0.00 ? 38 ARG A NE   8  
ATOM 8661  C CZ   . ARG A 1 38 ? 14.254  5.400   6.557   1.00 0.00 ? 38 ARG A CZ   8  
ATOM 8662  N NH1  . ARG A 1 38 ? 13.933  4.387   7.350   1.00 0.00 ? 38 ARG A NH1  8  
ATOM 8663  N NH2  . ARG A 1 38 ? 14.736  6.520   7.081   1.00 0.00 ? 38 ARG A NH2  8  
ATOM 8664  H H    . ARG A 1 38 ? 10.564  2.650   2.742   1.00 0.00 ? 38 ARG A H    8  
ATOM 8665  H HA   . ARG A 1 38 ? 9.387   4.624   4.365   1.00 0.00 ? 38 ARG A HA   8  
ATOM 8666  H HB2  . ARG A 1 38 ? 11.907  4.749   2.698   1.00 0.00 ? 38 ARG A HB2  8  
ATOM 8667  H HB3  . ARG A 1 38 ? 11.463  5.910   3.943   1.00 0.00 ? 38 ARG A HB3  8  
ATOM 8668  H HG2  . ARG A 1 38 ? 11.753  4.344   5.663   1.00 0.00 ? 38 ARG A HG2  8  
ATOM 8669  H HG3  . ARG A 1 38 ? 11.757  2.985   4.537   1.00 0.00 ? 38 ARG A HG3  8  
ATOM 8670  H HD2  . ARG A 1 38 ? 14.003  3.227   5.053   1.00 0.00 ? 38 ARG A HD2  8  
ATOM 8671  H HD3  . ARG A 1 38 ? 13.853  4.123   3.542   1.00 0.00 ? 38 ARG A HD3  8  
ATOM 8672  H HE   . ARG A 1 38 ? 14.340  6.055   4.675   1.00 0.00 ? 38 ARG A HE   8  
ATOM 8673  H HH11 . ARG A 1 38 ? 13.571  3.542   6.958   1.00 0.00 ? 38 ARG A HH11 8  
ATOM 8674  H HH12 . ARG A 1 38 ? 14.054  4.469   8.340   1.00 0.00 ? 38 ARG A HH12 8  
ATOM 8675  H HH21 . ARG A 1 38 ? 14.979  7.286   6.487   1.00 0.00 ? 38 ARG A HH21 8  
ATOM 8676  H HH22 . ARG A 1 38 ? 14.854  6.599   8.071   1.00 0.00 ? 38 ARG A HH22 8  
ATOM 8677  N N    . LYS A 1 39 ? 9.468   5.259   1.145   1.00 0.00 ? 39 LYS A N    8  
ATOM 8678  C CA   . LYS A 1 39 ? 8.927   6.120   0.100   1.00 0.00 ? 39 LYS A CA   8  
ATOM 8679  C C    . LYS A 1 39 ? 7.403   6.153   0.156   1.00 0.00 ? 39 LYS A C    8  
ATOM 8680  O O    . LYS A 1 39 ? 6.797   7.224   0.181   1.00 0.00 ? 39 LYS A O    8  
ATOM 8681  C CB   . LYS A 1 39 ? 9.387   5.635   -1.277  1.00 0.00 ? 39 LYS A CB   8  
ATOM 8682  C CG   . LYS A 1 39 ? 10.897  5.593   -1.434  1.00 0.00 ? 39 LYS A CG   8  
ATOM 8683  C CD   . LYS A 1 39 ? 11.465  6.971   -1.729  1.00 0.00 ? 39 LYS A CD   8  
ATOM 8684  C CE   . LYS A 1 39 ? 12.986  6.953   -1.758  1.00 0.00 ? 39 LYS A CE   8  
ATOM 8685  N NZ   . LYS A 1 39 ? 13.509  6.125   -2.880  1.00 0.00 ? 39 LYS A NZ   8  
ATOM 8686  H H    . LYS A 1 39 ? 9.980   4.462   0.891   1.00 0.00 ? 39 LYS A H    8  
ATOM 8687  H HA   . LYS A 1 39 ? 9.303   7.118   0.264   1.00 0.00 ? 39 LYS A HA   8  
ATOM 8688  H HB2  . LYS A 1 39 ? 9.001   4.640   -1.442  1.00 0.00 ? 39 LYS A HB2  8  
ATOM 8689  H HB3  . LYS A 1 39 ? 8.986   6.297   -2.031  1.00 0.00 ? 39 LYS A HB3  8  
ATOM 8690  H HG2  . LYS A 1 39 ? 11.335  5.224   -0.519  1.00 0.00 ? 39 LYS A HG2  8  
ATOM 8691  H HG3  . LYS A 1 39 ? 11.147  4.929   -2.249  1.00 0.00 ? 39 LYS A HG3  8  
ATOM 8692  H HD2  . LYS A 1 39 ? 11.102  7.303   -2.691  1.00 0.00 ? 39 LYS A HD2  8  
ATOM 8693  H HD3  . LYS A 1 39 ? 11.137  7.659   -0.962  1.00 0.00 ? 39 LYS A HD3  8  
ATOM 8694  H HE2  . LYS A 1 39 ? 13.343  7.965   -1.872  1.00 0.00 ? 39 LYS A HE2  8  
ATOM 8695  H HE3  . LYS A 1 39 ? 13.346  6.547   -0.824  1.00 0.00 ? 39 LYS A HE3  8  
ATOM 8696  H HZ1  . LYS A 1 39 ? 14.289  5.523   -2.546  1.00 0.00 ? 39 LYS A HZ1  8  
ATOM 8697  H HZ2  . LYS A 1 39 ? 13.863  6.738   -3.642  1.00 0.00 ? 39 LYS A HZ2  8  
ATOM 8698  H HZ3  . LYS A 1 39 ? 12.755  5.519   -3.259  1.00 0.00 ? 39 LYS A HZ3  8  
ATOM 8699  N N    . ILE A 1 40 ? 6.791   4.974   0.178   1.00 0.00 ? 40 ILE A N    8  
ATOM 8700  C CA   . ILE A 1 40 ? 5.339   4.868   0.234   1.00 0.00 ? 40 ILE A CA   8  
ATOM 8701  C C    . ILE A 1 40 ? 4.781   5.608   1.446   1.00 0.00 ? 40 ILE A C    8  
ATOM 8702  O O    . ILE A 1 40 ? 3.706   6.205   1.381   1.00 0.00 ? 40 ILE A O    8  
ATOM 8703  C CB   . ILE A 1 40 ? 4.882   3.399   0.289   1.00 0.00 ? 40 ILE A CB   8  
ATOM 8704  C CG1  . ILE A 1 40 ? 5.403   2.634   -0.930  1.00 0.00 ? 40 ILE A CG1  8  
ATOM 8705  C CG2  . ILE A 1 40 ? 3.365   3.318   0.363   1.00 0.00 ? 40 ILE A CG2  8  
ATOM 8706  C CD1  . ILE A 1 40 ? 5.370   1.132   -0.760  1.00 0.00 ? 40 ILE A CD1  8  
ATOM 8707  H H    . ILE A 1 40 ? 7.329   4.155   0.156   1.00 0.00 ? 40 ILE A H    8  
ATOM 8708  H HA   . ILE A 1 40 ? 4.937   5.316   -0.664  1.00 0.00 ? 40 ILE A HA   8  
ATOM 8709  H HB   . ILE A 1 40 ? 5.287   2.952   1.185   1.00 0.00 ? 40 ILE A HB   8  
ATOM 8710  H HG12 . ILE A 1 40 ? 4.800   2.884   -1.788  1.00 0.00 ? 40 ILE A HG12 8  
ATOM 8711  H HG13 . ILE A 1 40 ? 6.427   2.925   -1.117  1.00 0.00 ? 40 ILE A HG13 8  
ATOM 8712  H HG21 . ILE A 1 40 ? 3.061   2.282   0.402   1.00 0.00 ? 40 ILE A HG21 8  
ATOM 8713  H HG22 . ILE A 1 40 ? 3.021   3.826   1.251   1.00 0.00 ? 40 ILE A HG22 8  
ATOM 8714  H HG23 . ILE A 1 40 ? 2.936   3.786   -0.509  1.00 0.00 ? 40 ILE A HG23 8  
ATOM 8715  H HD11 . ILE A 1 40 ? 4.350   0.783   -0.835  1.00 0.00 ? 40 ILE A HD11 8  
ATOM 8716  H HD12 . ILE A 1 40 ? 5.967   0.668   -1.531  1.00 0.00 ? 40 ILE A HD12 8  
ATOM 8717  H HD13 . ILE A 1 40 ? 5.768   0.870   0.210   1.00 0.00 ? 40 ILE A HD13 8  
ATOM 8718  N N    . SER A 1 41 ? 5.519   5.565   2.550   1.00 0.00 ? 41 SER A N    8  
ATOM 8719  C CA   . SER A 1 41 ? 5.098   6.230   3.778   1.00 0.00 ? 41 SER A CA   8  
ATOM 8720  C C    . SER A 1 41 ? 4.987   7.737   3.569   1.00 0.00 ? 41 SER A C    8  
ATOM 8721  O O    . SER A 1 41 ? 4.233   8.417   4.264   1.00 0.00 ? 41 SER A O    8  
ATOM 8722  C CB   . SER A 1 41 ? 6.083   5.931   4.909   1.00 0.00 ? 41 SER A CB   8  
ATOM 8723  O OG   . SER A 1 41 ? 6.287   7.073   5.723   1.00 0.00 ? 41 SER A OG   8  
ATOM 8724  H H    . SER A 1 41 ? 6.367   5.073   2.539   1.00 0.00 ? 41 SER A H    8  
ATOM 8725  H HA   . SER A 1 41 ? 4.126   5.843   4.047   1.00 0.00 ? 41 SER A HA   8  
ATOM 8726  H HB2  . SER A 1 41 ? 5.694   5.132   5.521   1.00 0.00 ? 41 SER A HB2  8  
ATOM 8727  H HB3  . SER A 1 41 ? 7.032   5.631   4.486   1.00 0.00 ? 41 SER A HB3  8  
ATOM 8728  H HG   . SER A 1 41 ? 6.743   6.815   6.527   1.00 0.00 ? 41 SER A HG   8  
ATOM 8729  N N    . ALA A 1 42 ? 5.745   8.252   2.607   1.00 0.00 ? 42 ALA A N    8  
ATOM 8730  C CA   . ALA A 1 42 ? 5.731   9.678   2.304   1.00 0.00 ? 42 ALA A CA   8  
ATOM 8731  C C    . ALA A 1 42 ? 4.789   9.984   1.145   1.00 0.00 ? 42 ALA A C    8  
ATOM 8732  O O    . ALA A 1 42 ? 4.243   11.083  1.051   1.00 0.00 ? 42 ALA A O    8  
ATOM 8733  C CB   . ALA A 1 42 ? 7.138   10.163  1.986   1.00 0.00 ? 42 ALA A CB   8  
ATOM 8734  H H    . ALA A 1 42 ? 6.326   7.659   2.087   1.00 0.00 ? 42 ALA A H    8  
ATOM 8735  H HA   . ALA A 1 42 ? 5.387   10.202  3.184   1.00 0.00 ? 42 ALA A HA   8  
ATOM 8736  H HB1  . ALA A 1 42 ? 7.082   11.023  1.334   1.00 0.00 ? 42 ALA A HB1  8  
ATOM 8737  H HB2  . ALA A 1 42 ? 7.640   10.437  2.901   1.00 0.00 ? 42 ALA A HB2  8  
ATOM 8738  H HB3  . ALA A 1 42 ? 7.688   9.374   1.495   1.00 0.00 ? 42 ALA A HB3  8  
ATOM 8739  N N    . ALA A 1 43 ? 4.602   9.006   0.265   1.00 0.00 ? 43 ALA A N    8  
ATOM 8740  C CA   . ALA A 1 43 ? 3.725   9.171   -0.887  1.00 0.00 ? 43 ALA A CA   8  
ATOM 8741  C C    . ALA A 1 43 ? 2.259   9.084   -0.477  1.00 0.00 ? 43 ALA A C    8  
ATOM 8742  O O    . ALA A 1 43 ? 1.389   9.689   -1.105  1.00 0.00 ? 43 ALA A O    8  
ATOM 8743  C CB   . ALA A 1 43 ? 4.042   8.127   -1.946  1.00 0.00 ? 43 ALA A CB   8  
ATOM 8744  H H    . ALA A 1 43 ? 5.066   8.152   0.395   1.00 0.00 ? 43 ALA A H    8  
ATOM 8745  H HA   . ALA A 1 43 ? 3.912   10.147  -1.311  1.00 0.00 ? 43 ALA A HA   8  
ATOM 8746  H HB1  . ALA A 1 43 ? 4.966   7.627   -1.693  1.00 0.00 ? 43 ALA A HB1  8  
ATOM 8747  H HB2  . ALA A 1 43 ? 3.241   7.403   -1.989  1.00 0.00 ? 43 ALA A HB2  8  
ATOM 8748  H HB3  . ALA A 1 43 ? 4.145   8.608   -2.907  1.00 0.00 ? 43 ALA A HB3  8  
ATOM 8749  N N    . THR A 1 44 ? 1.989   8.326   0.582   1.00 0.00 ? 44 THR A N    8  
ATOM 8750  C CA   . THR A 1 44 ? 0.628   8.157   1.075   1.00 0.00 ? 44 THR A CA   8  
ATOM 8751  C C    . THR A 1 44 ? 0.504   8.629   2.519   1.00 0.00 ? 44 THR A C    8  
ATOM 8752  O O    . THR A 1 44 ? -0.485  8.341   3.193   1.00 0.00 ? 44 THR A O    8  
ATOM 8753  C CB   . THR A 1 44 ? 0.176   6.688   0.986   1.00 0.00 ? 44 THR A CB   8  
ATOM 8754  O OG1  . THR A 1 44 ? 0.917   5.890   1.916   1.00 0.00 ? 44 THR A OG1  8  
ATOM 8755  C CG2  . THR A 1 44 ? 0.371   6.146   -0.422  1.00 0.00 ? 44 THR A CG2  8  
ATOM 8756  H H    . THR A 1 44 ? 2.725   7.869   1.041   1.00 0.00 ? 44 THR A H    8  
ATOM 8757  H HA   . THR A 1 44 ? -0.027  8.752   0.455   1.00 0.00 ? 44 THR A HA   8  
ATOM 8758  H HB   . THR A 1 44 ? -0.874  6.634   1.234   1.00 0.00 ? 44 THR A HB   8  
ATOM 8759  H HG1  . THR A 1 44 ? 1.791   6.270   2.039   1.00 0.00 ? 44 THR A HG1  8  
ATOM 8760  H HG21 . THR A 1 44 ? -0.303  6.651   -1.099  1.00 0.00 ? 44 THR A HG21 8  
ATOM 8761  H HG22 . THR A 1 44 ? 0.163   5.086   -0.432  1.00 0.00 ? 44 THR A HG22 8  
ATOM 8762  H HG23 . THR A 1 44 ? 1.390   6.317   -0.736  1.00 0.00 ? 44 THR A HG23 8  
ATOM 8763  N N    . SER A 1 45 ? 1.513   9.356   2.989   1.00 0.00 ? 45 SER A N    8  
ATOM 8764  C CA   . SER A 1 45 ? 1.518   9.864   4.355   1.00 0.00 ? 45 SER A CA   8  
ATOM 8765  C C    . SER A 1 45 ? 1.242   8.744   5.353   1.00 0.00 ? 45 SER A C    8  
ATOM 8766  O O    . SER A 1 45 ? 0.588   8.954   6.375   1.00 0.00 ? 45 SER A O    8  
ATOM 8767  C CB   . SER A 1 45 ? 0.473   10.971  4.513   1.00 0.00 ? 45 SER A CB   8  
ATOM 8768  O OG   . SER A 1 45 ? 0.404   11.777  3.349   1.00 0.00 ? 45 SER A OG   8  
ATOM 8769  H H    . SER A 1 45 ? 2.274   9.552   2.402   1.00 0.00 ? 45 SER A H    8  
ATOM 8770  H HA   . SER A 1 45 ? 2.497   10.274  4.553   1.00 0.00 ? 45 SER A HA   8  
ATOM 8771  H HB2  . SER A 1 45 ? -0.495  10.527  4.687   1.00 0.00 ? 45 SER A HB2  8  
ATOM 8772  H HB3  . SER A 1 45 ? 0.739   11.596  5.354   1.00 0.00 ? 45 SER A HB3  8  
ATOM 8773  H HG   . SER A 1 45 ? 1.292   12.018  3.073   1.00 0.00 ? 45 SER A HG   8  
ATOM 8774  N N    . LEU A 1 46 ? 1.747   7.553   5.049   1.00 0.00 ? 46 LEU A N    8  
ATOM 8775  C CA   . LEU A 1 46 ? 1.556   6.397   5.919   1.00 0.00 ? 46 LEU A CA   8  
ATOM 8776  C C    . LEU A 1 46 ? 2.836   6.074   6.683   1.00 0.00 ? 46 LEU A C    8  
ATOM 8777  O O    . LEU A 1 46 ? 3.842   6.771   6.551   1.00 0.00 ? 46 LEU A O    8  
ATOM 8778  C CB   . LEU A 1 46 ? 1.119   5.183   5.098   1.00 0.00 ? 46 LEU A CB   8  
ATOM 8779  C CG   . LEU A 1 46 ? -0.329  5.191   4.606   1.00 0.00 ? 46 LEU A CG   8  
ATOM 8780  C CD1  . LEU A 1 46 ? -0.575  4.033   3.652   1.00 0.00 ? 46 LEU A CD1  8  
ATOM 8781  C CD2  . LEU A 1 46 ? -1.292  5.129   5.783   1.00 0.00 ? 46 LEU A CD2  8  
ATOM 8782  H H    . LEU A 1 46 ? 2.259   7.447   4.221   1.00 0.00 ? 46 LEU A H    8  
ATOM 8783  H HA   . LEU A 1 46 ? 0.779   6.641   6.628   1.00 0.00 ? 46 LEU A HA   8  
ATOM 8784  H HB2  . LEU A 1 46 ? 1.761   5.120   4.233   1.00 0.00 ? 46 LEU A HB2  8  
ATOM 8785  H HB3  . LEU A 1 46 ? 1.257   4.303   5.710   1.00 0.00 ? 46 LEU A HB3  8  
ATOM 8786  H HG   . LEU A 1 46 ? -0.515  6.111   4.069   1.00 0.00 ? 46 LEU A HG   8  
ATOM 8787  H HD11 . LEU A 1 46 ? -1.179  4.371   2.824   1.00 0.00 ? 46 LEU A HD11 8  
ATOM 8788  H HD12 . LEU A 1 46 ? -1.091  3.240   4.174   1.00 0.00 ? 46 LEU A HD12 8  
ATOM 8789  H HD13 . LEU A 1 46 ? 0.370   3.664   3.282   1.00 0.00 ? 46 LEU A HD13 8  
ATOM 8790  H HD21 . LEU A 1 46 ? -0.758  4.814   6.668   1.00 0.00 ? 46 LEU A HD21 8  
ATOM 8791  H HD22 . LEU A 1 46 ? -2.079  4.422   5.567   1.00 0.00 ? 46 LEU A HD22 8  
ATOM 8792  H HD23 . LEU A 1 46 ? -1.720  6.106   5.949   1.00 0.00 ? 46 LEU A HD23 8  
ATOM 8793  N N    . SER A 1 47 ? 2.790   5.012   7.482   1.00 0.00 ? 47 SER A N    8  
ATOM 8794  C CA   . SER A 1 47 ? 3.946   4.598   8.269   1.00 0.00 ? 47 SER A CA   8  
ATOM 8795  C C    . SER A 1 47 ? 4.522   3.288   7.740   1.00 0.00 ? 47 SER A C    8  
ATOM 8796  O O    . SER A 1 47 ? 3.848   2.545   7.026   1.00 0.00 ? 47 SER A O    8  
ATOM 8797  C CB   . SER A 1 47 ? 3.557   4.440   9.740   1.00 0.00 ? 47 SER A CB   8  
ATOM 8798  O OG   . SER A 1 47 ? 4.656   4.719   10.590  1.00 0.00 ? 47 SER A OG   8  
ATOM 8799  H H    . SER A 1 47 ? 1.959   4.497   7.544   1.00 0.00 ? 47 SER A H    8  
ATOM 8800  H HA   . SER A 1 47 ? 4.698   5.368   8.185   1.00 0.00 ? 47 SER A HA   8  
ATOM 8801  H HB2  . SER A 1 47 ? 2.754   5.122   9.973   1.00 0.00 ? 47 SER A HB2  8  
ATOM 8802  H HB3  . SER A 1 47 ? 3.230   3.425   9.916   1.00 0.00 ? 47 SER A HB3  8  
ATOM 8803  H HG   . SER A 1 47 ? 5.264   3.977   10.583  1.00 0.00 ? 47 SER A HG   8  
ATOM 8804  N N    . GLU A 1 48 ? 5.772   3.012   8.095   1.00 0.00 ? 48 GLU A N    8  
ATOM 8805  C CA   . GLU A 1 48 ? 6.439   1.792   7.656   1.00 0.00 ? 48 GLU A CA   8  
ATOM 8806  C C    . GLU A 1 48 ? 5.670   0.556   8.113   1.00 0.00 ? 48 GLU A C    8  
ATOM 8807  O O    . GLU A 1 48 ? 5.659   -0.469  7.431   1.00 0.00 ? 48 GLU A O    8  
ATOM 8808  C CB   . GLU A 1 48 ? 7.870   1.744   8.196   1.00 0.00 ? 48 GLU A CB   8  
ATOM 8809  C CG   . GLU A 1 48 ? 8.650   3.028   7.971   1.00 0.00 ? 48 GLU A CG   8  
ATOM 8810  C CD   . GLU A 1 48 ? 10.110  2.900   8.357   1.00 0.00 ? 48 GLU A CD   8  
ATOM 8811  O OE1  . GLU A 1 48 ? 10.871  2.265   7.596   1.00 0.00 ? 48 GLU A OE1  8  
ATOM 8812  O OE2  . GLU A 1 48 ? 10.493  3.434   9.419   1.00 0.00 ? 48 GLU A OE2  8  
ATOM 8813  H H    . GLU A 1 48 ? 6.258   3.643   8.666   1.00 0.00 ? 48 GLU A H    8  
ATOM 8814  H HA   . GLU A 1 48 ? 6.472   1.802   6.577   1.00 0.00 ? 48 GLU A HA   8  
ATOM 8815  H HB2  . GLU A 1 48 ? 7.835   1.549   9.258   1.00 0.00 ? 48 GLU A HB2  8  
ATOM 8816  H HB3  . GLU A 1 48 ? 8.398   0.937   7.709   1.00 0.00 ? 48 GLU A HB3  8  
ATOM 8817  H HG2  . GLU A 1 48 ? 8.591   3.291   6.925   1.00 0.00 ? 48 GLU A HG2  8  
ATOM 8818  H HG3  . GLU A 1 48 ? 8.203   3.814   8.563   1.00 0.00 ? 48 GLU A HG3  8  
ATOM 8819  N N    . ARG A 1 49 ? 5.027   0.661   9.271   1.00 0.00 ? 49 ARG A N    8  
ATOM 8820  C CA   . ARG A 1 49 ? 4.257   -0.448  9.821   1.00 0.00 ? 49 ARG A CA   8  
ATOM 8821  C C    . ARG A 1 49 ? 2.932   -0.609  9.081   1.00 0.00 ? 49 ARG A C    8  
ATOM 8822  O O    . ARG A 1 49 ? 2.595   -1.700  8.623   1.00 0.00 ? 49 ARG A O    8  
ATOM 8823  C CB   . ARG A 1 49 ? 3.996   -0.226  11.312  1.00 0.00 ? 49 ARG A CB   8  
ATOM 8824  C CG   . ARG A 1 49 ? 3.456   -1.455  12.025  1.00 0.00 ? 49 ARG A CG   8  
ATOM 8825  C CD   . ARG A 1 49 ? 4.549   -2.484  12.268  1.00 0.00 ? 49 ARG A CD   8  
ATOM 8826  N NE   . ARG A 1 49 ? 5.530   -2.020  13.246  1.00 0.00 ? 49 ARG A NE   8  
ATOM 8827  C CZ   . ARG A 1 49 ? 6.529   -2.770  13.698  1.00 0.00 ? 49 ARG A CZ   8  
ATOM 8828  N NH1  . ARG A 1 49 ? 6.678   -4.013  13.263  1.00 0.00 ? 49 ARG A NH1  8  
ATOM 8829  N NH2  . ARG A 1 49 ? 7.381   -2.276  14.587  1.00 0.00 ? 49 ARG A NH2  8  
ATOM 8830  H H    . ARG A 1 49 ? 5.073   1.504   9.769   1.00 0.00 ? 49 ARG A H    8  
ATOM 8831  H HA   . ARG A 1 49 ? 4.837   -1.350  9.696   1.00 0.00 ? 49 ARG A HA   8  
ATOM 8832  H HB2  . ARG A 1 49 ? 4.922   0.061   11.789  1.00 0.00 ? 49 ARG A HB2  8  
ATOM 8833  H HB3  . ARG A 1 49 ? 3.280   0.573   11.425  1.00 0.00 ? 49 ARG A HB3  8  
ATOM 8834  H HG2  . ARG A 1 49 ? 3.042   -1.155  12.976  1.00 0.00 ? 49 ARG A HG2  8  
ATOM 8835  H HG3  . ARG A 1 49 ? 2.683   -1.901  11.418  1.00 0.00 ? 49 ARG A HG3  8  
ATOM 8836  H HD2  . ARG A 1 49 ? 4.095   -3.393  12.633  1.00 0.00 ? 49 ARG A HD2  8  
ATOM 8837  H HD3  . ARG A 1 49 ? 5.052   -2.683  11.334  1.00 0.00 ? 49 ARG A HD3  8  
ATOM 8838  H HE   . ARG A 1 49 ? 5.438   -1.104  13.581  1.00 0.00 ? 49 ARG A HE   8  
ATOM 8839  H HH11 . ARG A 1 49 ? 6.038   -4.387  12.592  1.00 0.00 ? 49 ARG A HH11 8  
ATOM 8840  H HH12 . ARG A 1 49 ? 7.432   -4.575  13.604  1.00 0.00 ? 49 ARG A HH12 8  
ATOM 8841  H HH21 . ARG A 1 49 ? 7.272   -1.339  14.917  1.00 0.00 ? 49 ARG A HH21 8  
ATOM 8842  H HH22 . ARG A 1 49 ? 8.132   -2.841  14.927  1.00 0.00 ? 49 ARG A HH22 8  
ATOM 8843  N N    . GLN A 1 50 ? 2.185   0.486   8.970   1.00 0.00 ? 50 GLN A N    8  
ATOM 8844  C CA   . GLN A 1 50 ? 0.897   0.465   8.287   1.00 0.00 ? 50 GLN A CA   8  
ATOM 8845  C C    . GLN A 1 50 ? 1.026   -0.157  6.900   1.00 0.00 ? 50 GLN A C    8  
ATOM 8846  O O    . GLN A 1 50 ? 0.287   -1.077  6.551   1.00 0.00 ? 50 GLN A O    8  
ATOM 8847  C CB   . GLN A 1 50 ? 0.334   1.882   8.173   1.00 0.00 ? 50 GLN A CB   8  
ATOM 8848  C CG   . GLN A 1 50 ? -0.173  2.443   9.492   1.00 0.00 ? 50 GLN A CG   8  
ATOM 8849  C CD   . GLN A 1 50 ? -1.359  3.371   9.314   1.00 0.00 ? 50 GLN A CD   8  
ATOM 8850  O OE1  . GLN A 1 50 ? -1.231  4.590   9.430   1.00 0.00 ? 50 GLN A OE1  8  
ATOM 8851  N NE2  . GLN A 1 50 ? -2.523  2.797   9.031   1.00 0.00 ? 50 GLN A NE2  8  
ATOM 8852  H H    . GLN A 1 50 ? 2.508   1.326   9.356   1.00 0.00 ? 50 GLN A H    8  
ATOM 8853  H HA   . GLN A 1 50 ? 0.220   -0.136  8.875   1.00 0.00 ? 50 GLN A HA   8  
ATOM 8854  H HB2  . GLN A 1 50 ? 1.109   2.536   7.803   1.00 0.00 ? 50 GLN A HB2  8  
ATOM 8855  H HB3  . GLN A 1 50 ? -0.487  1.875   7.471   1.00 0.00 ? 50 GLN A HB3  8  
ATOM 8856  H HG2  . GLN A 1 50 ? -0.471  1.622   10.127  1.00 0.00 ? 50 GLN A HG2  8  
ATOM 8857  H HG3  . GLN A 1 50 ? 0.627   2.992   9.966   1.00 0.00 ? 50 GLN A HG3  8  
ATOM 8858  H HE21 . GLN A 1 50 ? -2.550  1.820   8.955   1.00 0.00 ? 50 GLN A HE21 8  
ATOM 8859  H HE22 . GLN A 1 50 ? -3.306  3.373   8.912   1.00 0.00 ? 50 GLN A HE22 8  
ATOM 8860  N N    . ILE A 1 51 ? 1.969   0.353   6.115   1.00 0.00 ? 51 ILE A N    8  
ATOM 8861  C CA   . ILE A 1 51 ? 2.195   -0.153  4.766   1.00 0.00 ? 51 ILE A CA   8  
ATOM 8862  C C    . ILE A 1 51 ? 2.454   -1.656  4.779   1.00 0.00 ? 51 ILE A C    8  
ATOM 8863  O O    . ILE A 1 51 ? 2.017   -2.381  3.885   1.00 0.00 ? 51 ILE A O    8  
ATOM 8864  C CB   . ILE A 1 51 ? 3.384   0.555   4.091   1.00 0.00 ? 51 ILE A CB   8  
ATOM 8865  C CG1  . ILE A 1 51 ? 3.128   2.062   4.009   1.00 0.00 ? 51 ILE A CG1  8  
ATOM 8866  C CG2  . ILE A 1 51 ? 3.626   -0.023  2.705   1.00 0.00 ? 51 ILE A CG2  8  
ATOM 8867  C CD1  . ILE A 1 51 ? 4.371   2.870   3.710   1.00 0.00 ? 51 ILE A CD1  8  
ATOM 8868  H H    . ILE A 1 51 ? 2.527   1.085   6.450   1.00 0.00 ? 51 ILE A H    8  
ATOM 8869  H HA   . ILE A 1 51 ? 1.306   0.043   4.184   1.00 0.00 ? 51 ILE A HA   8  
ATOM 8870  H HB   . ILE A 1 51 ? 4.266   0.379   4.687   1.00 0.00 ? 51 ILE A HB   8  
ATOM 8871  H HG12 . ILE A 1 51 ? 2.410   2.257   3.228   1.00 0.00 ? 51 ILE A HG12 8  
ATOM 8872  H HG13 . ILE A 1 51 ? 2.728   2.403   4.953   1.00 0.00 ? 51 ILE A HG13 8  
ATOM 8873  H HG21 . ILE A 1 51 ? 3.643   0.777   1.979   1.00 0.00 ? 51 ILE A HG21 8  
ATOM 8874  H HG22 . ILE A 1 51 ? 4.575   -0.539  2.691   1.00 0.00 ? 51 ILE A HG22 8  
ATOM 8875  H HG23 . ILE A 1 51 ? 2.836   -0.715  2.459   1.00 0.00 ? 51 ILE A HG23 8  
ATOM 8876  H HD11 . ILE A 1 51 ? 5.188   2.203   3.478   1.00 0.00 ? 51 ILE A HD11 8  
ATOM 8877  H HD12 . ILE A 1 51 ? 4.185   3.520   2.868   1.00 0.00 ? 51 ILE A HD12 8  
ATOM 8878  H HD13 . ILE A 1 51 ? 4.629   3.466   4.574   1.00 0.00 ? 51 ILE A HD13 8  
ATOM 8879  N N    . THR A 1 52 ? 3.168   -2.119  5.801   1.00 0.00 ? 52 THR A N    8  
ATOM 8880  C CA   . THR A 1 52 ? 3.485   -3.536  5.932   1.00 0.00 ? 52 THR A CA   8  
ATOM 8881  C C    . THR A 1 52 ? 2.242   -4.348  6.275   1.00 0.00 ? 52 THR A C    8  
ATOM 8882  O O    . THR A 1 52 ? 1.976   -5.382  5.661   1.00 0.00 ? 52 THR A O    8  
ATOM 8883  C CB   . THR A 1 52 ? 4.555   -3.774  7.014   1.00 0.00 ? 52 THR A CB   8  
ATOM 8884  O OG1  . THR A 1 52 ? 5.742   -3.037  6.700   1.00 0.00 ? 52 THR A OG1  8  
ATOM 8885  C CG2  . THR A 1 52 ? 4.888   -5.254  7.130   1.00 0.00 ? 52 THR A CG2  8  
ATOM 8886  H H    . THR A 1 52 ? 3.489   -1.492  6.482   1.00 0.00 ? 52 THR A H    8  
ATOM 8887  H HA   . THR A 1 52 ? 3.878   -3.878  4.985   1.00 0.00 ? 52 THR A HA   8  
ATOM 8888  H HB   . THR A 1 52 ? 4.168   -3.432  7.963   1.00 0.00 ? 52 THR A HB   8  
ATOM 8889  H HG1  . THR A 1 52 ? 6.253   -2.896  7.501   1.00 0.00 ? 52 THR A HG1  8  
ATOM 8890  H HG21 . THR A 1 52 ? 4.532   -5.773  6.251   1.00 0.00 ? 52 THR A HG21 8  
ATOM 8891  H HG22 . THR A 1 52 ? 4.409   -5.663  8.007   1.00 0.00 ? 52 THR A HG22 8  
ATOM 8892  H HG23 . THR A 1 52 ? 5.957   -5.377  7.212   1.00 0.00 ? 52 THR A HG23 8  
ATOM 8893  N N    . ILE A 1 53 ? 1.484   -3.875  7.258   1.00 0.00 ? 53 ILE A N    8  
ATOM 8894  C CA   . ILE A 1 53 ? 0.268   -4.557  7.681   1.00 0.00 ? 53 ILE A CA   8  
ATOM 8895  C C    . ILE A 1 53 ? -0.641  -4.849  6.491   1.00 0.00 ? 53 ILE A C    8  
ATOM 8896  O O    . ILE A 1 53 ? -1.188  -5.946  6.370   1.00 0.00 ? 53 ILE A O    8  
ATOM 8897  C CB   . ILE A 1 53 ? -0.513  -3.726  8.717   1.00 0.00 ? 53 ILE A CB   8  
ATOM 8898  C CG1  . ILE A 1 53 ? 0.352   -3.467  9.952   1.00 0.00 ? 53 ILE A CG1  8  
ATOM 8899  C CG2  . ILE A 1 53 ? -1.801  -4.438  9.105   1.00 0.00 ? 53 ILE A CG2  8  
ATOM 8900  C CD1  . ILE A 1 53 ? -0.043  -2.222  10.715  1.00 0.00 ? 53 ILE A CD1  8  
ATOM 8901  H H    . ILE A 1 53 ? 1.749   -3.046  7.709   1.00 0.00 ? 53 ILE A H    8  
ATOM 8902  H HA   . ILE A 1 53 ? 0.553   -5.492  8.141   1.00 0.00 ? 53 ILE A HA   8  
ATOM 8903  H HB   . ILE A 1 53 ? -0.774  -2.782  8.264   1.00 0.00 ? 53 ILE A HB   8  
ATOM 8904  H HG12 . ILE A 1 53 ? 0.270   -4.307  10.623  1.00 0.00 ? 53 ILE A HG12 8  
ATOM 8905  H HG13 . ILE A 1 53 ? 1.382   -3.357  9.644   1.00 0.00 ? 53 ILE A HG13 8  
ATOM 8906  H HG21 . ILE A 1 53 ? -2.477  -4.442  8.263   1.00 0.00 ? 53 ILE A HG21 8  
ATOM 8907  H HG22 . ILE A 1 53 ? -1.577  -5.455  9.391   1.00 0.00 ? 53 ILE A HG22 8  
ATOM 8908  H HG23 . ILE A 1 53 ? -2.261  -3.923  9.934   1.00 0.00 ? 53 ILE A HG23 8  
ATOM 8909  H HD11 . ILE A 1 53 ? 0.712   -1.462  10.579  1.00 0.00 ? 53 ILE A HD11 8  
ATOM 8910  H HD12 . ILE A 1 53 ? -0.991  -1.860  10.349  1.00 0.00 ? 53 ILE A HD12 8  
ATOM 8911  H HD13 . ILE A 1 53 ? -0.129  -2.457  11.767  1.00 0.00 ? 53 ILE A HD13 8  
ATOM 8912  N N    . TRP A 1 54 ? -0.795  -3.863  5.616   1.00 0.00 ? 54 TRP A N    8  
ATOM 8913  C CA   . TRP A 1 54 ? -1.635  -4.015  4.434   1.00 0.00 ? 54 TRP A CA   8  
ATOM 8914  C C    . TRP A 1 54 ? -1.041  -5.038  3.471   1.00 0.00 ? 54 TRP A C    8  
ATOM 8915  O O    . TRP A 1 54 ? -1.734  -5.944  3.008   1.00 0.00 ? 54 TRP A O    8  
ATOM 8916  C CB   . TRP A 1 54 ? -1.805  -2.669  3.727   1.00 0.00 ? 54 TRP A CB   8  
ATOM 8917  C CG   . TRP A 1 54 ? -2.860  -2.687  2.662   1.00 0.00 ? 54 TRP A CG   8  
ATOM 8918  C CD1  . TRP A 1 54 ? -4.197  -2.466  2.830   1.00 0.00 ? 54 TRP A CD1  8  
ATOM 8919  C CD2  . TRP A 1 54 ? -2.666  -2.940  1.267   1.00 0.00 ? 54 TRP A CD2  8  
ATOM 8920  N NE1  . TRP A 1 54 ? -4.846  -2.567  1.623   1.00 0.00 ? 54 TRP A NE1  8  
ATOM 8921  C CE2  . TRP A 1 54 ? -3.928  -2.856  0.648   1.00 0.00 ? 54 TRP A CE2  8  
ATOM 8922  C CE3  . TRP A 1 54 ? -1.548  -3.227  0.479   1.00 0.00 ? 54 TRP A CE3  8  
ATOM 8923  C CZ2  . TRP A 1 54 ? -4.101  -3.050  -0.720  1.00 0.00 ? 54 TRP A CZ2  8  
ATOM 8924  C CZ3  . TRP A 1 54 ? -1.721  -3.420  -0.878  1.00 0.00 ? 54 TRP A CZ3  8  
ATOM 8925  C CH2  . TRP A 1 54 ? -2.990  -3.331  -1.467  1.00 0.00 ? 54 TRP A CH2  8  
ATOM 8926  H H    . TRP A 1 54 ? -0.332  -3.012  5.767   1.00 0.00 ? 54 TRP A H    8  
ATOM 8927  H HA   . TRP A 1 54 ? -2.604  -4.365  4.760   1.00 0.00 ? 54 TRP A HA   8  
ATOM 8928  H HB2  . TRP A 1 54 ? -2.078  -1.919  4.454   1.00 0.00 ? 54 TRP A HB2  8  
ATOM 8929  H HB3  . TRP A 1 54 ? -0.868  -2.394  3.264   1.00 0.00 ? 54 TRP A HB3  8  
ATOM 8930  H HD1  . TRP A 1 54 ? -4.663  -2.247  3.779   1.00 0.00 ? 54 TRP A HD1  8  
ATOM 8931  H HE1  . TRP A 1 54 ? -5.809  -2.449  1.483   1.00 0.00 ? 54 TRP A HE1  8  
ATOM 8932  H HE3  . TRP A 1 54 ? -0.562  -3.301  0.914   1.00 0.00 ? 54 TRP A HE3  8  
ATOM 8933  H HZ2  . TRP A 1 54 ? -5.072  -2.984  -1.188  1.00 0.00 ? 54 TRP A HZ2  8  
ATOM 8934  H HZ3  . TRP A 1 54 ? -0.869  -3.644  -1.503  1.00 0.00 ? 54 TRP A HZ3  8  
ATOM 8935  H HH2  . TRP A 1 54 ? -3.078  -3.489  -2.530  1.00 0.00 ? 54 TRP A HH2  8  
ATOM 8936  N N    . PHE A 1 55 ? 0.245   -4.886  3.173   1.00 0.00 ? 55 PHE A N    8  
ATOM 8937  C CA   . PHE A 1 55 ? 0.932   -5.797  2.265   1.00 0.00 ? 55 PHE A CA   8  
ATOM 8938  C C    . PHE A 1 55 ? 0.864   -7.232  2.779   1.00 0.00 ? 55 PHE A C    8  
ATOM 8939  O O    . PHE A 1 55 ? 0.790   -8.179  1.997   1.00 0.00 ? 55 PHE A O    8  
ATOM 8940  C CB   . PHE A 1 55 ? 2.392   -5.374  2.092   1.00 0.00 ? 55 PHE A CB   8  
ATOM 8941  C CG   . PHE A 1 55 ? 2.621   -4.483  0.904   1.00 0.00 ? 55 PHE A CG   8  
ATOM 8942  C CD1  . PHE A 1 55 ? 2.081   -3.208  0.863   1.00 0.00 ? 55 PHE A CD1  8  
ATOM 8943  C CD2  . PHE A 1 55 ? 3.376   -4.922  -0.172  1.00 0.00 ? 55 PHE A CD2  8  
ATOM 8944  C CE1  . PHE A 1 55 ? 2.290   -2.386  -0.228  1.00 0.00 ? 55 PHE A CE1  8  
ATOM 8945  C CE2  . PHE A 1 55 ? 3.589   -4.104  -1.265  1.00 0.00 ? 55 PHE A CE2  8  
ATOM 8946  C CZ   . PHE A 1 55 ? 3.044   -2.835  -1.294  1.00 0.00 ? 55 PHE A CZ   8  
ATOM 8947  H H    . PHE A 1 55 ? 0.744   -4.144  3.574   1.00 0.00 ? 55 PHE A H    8  
ATOM 8948  H HA   . PHE A 1 55 ? 0.435   -5.746  1.308   1.00 0.00 ? 55 PHE A HA   8  
ATOM 8949  H HB2  . PHE A 1 55 ? 2.711   -4.838  2.973   1.00 0.00 ? 55 PHE A HB2  8  
ATOM 8950  H HB3  . PHE A 1 55 ? 3.002   -6.255  1.970   1.00 0.00 ? 55 PHE A HB3  8  
ATOM 8951  H HD1  . PHE A 1 55 ? 1.490   -2.855  1.697   1.00 0.00 ? 55 PHE A HD1  8  
ATOM 8952  H HD2  . PHE A 1 55 ? 3.801   -5.914  -0.152  1.00 0.00 ? 55 PHE A HD2  8  
ATOM 8953  H HE1  . PHE A 1 55 ? 1.863   -1.394  -0.247  1.00 0.00 ? 55 PHE A HE1  8  
ATOM 8954  H HE2  . PHE A 1 55 ? 4.179   -4.458  -2.098  1.00 0.00 ? 55 PHE A HE2  8  
ATOM 8955  H HZ   . PHE A 1 55 ? 3.210   -2.194  -2.147  1.00 0.00 ? 55 PHE A HZ   8  
ATOM 8956  N N    . GLN A 1 56 ? 0.890   -7.383  4.099   1.00 0.00 ? 56 GLN A N    8  
ATOM 8957  C CA   . GLN A 1 56 ? 0.833   -8.702  4.718   1.00 0.00 ? 56 GLN A CA   8  
ATOM 8958  C C    . GLN A 1 56 ? -0.595  -9.237  4.729   1.00 0.00 ? 56 GLN A C    8  
ATOM 8959  O O    . GLN A 1 56 ? -0.847  -10.370 4.322   1.00 0.00 ? 56 GLN A O    8  
ATOM 8960  C CB   . GLN A 1 56 ? 1.379   -8.643  6.146   1.00 0.00 ? 56 GLN A CB   8  
ATOM 8961  C CG   . GLN A 1 56 ? 2.891   -8.775  6.225   1.00 0.00 ? 56 GLN A CG   8  
ATOM 8962  C CD   . GLN A 1 56 ? 3.371   -10.180 5.917   1.00 0.00 ? 56 GLN A CD   8  
ATOM 8963  O OE1  . GLN A 1 56 ? 2.569   -11.097 5.736   1.00 0.00 ? 56 GLN A OE1  8  
ATOM 8964  N NE2  . GLN A 1 56 ? 4.686   -10.356 5.855   1.00 0.00 ? 56 GLN A NE2  8  
ATOM 8965  H H    . GLN A 1 56 ? 0.949   -6.589  4.670   1.00 0.00 ? 56 GLN A H    8  
ATOM 8966  H HA   . GLN A 1 56 ? 1.449   -9.369  4.134   1.00 0.00 ? 56 GLN A HA   8  
ATOM 8967  H HB2  . GLN A 1 56 ? 1.098   -7.699  6.587   1.00 0.00 ? 56 GLN A HB2  8  
ATOM 8968  H HB3  . GLN A 1 56 ? 0.939   -9.445  6.720   1.00 0.00 ? 56 GLN A HB3  8  
ATOM 8969  H HG2  . GLN A 1 56 ? 3.337   -8.096  5.514   1.00 0.00 ? 56 GLN A HG2  8  
ATOM 8970  H HG3  . GLN A 1 56 ? 3.211   -8.512  7.222   1.00 0.00 ? 56 GLN A HG3  8  
ATOM 8971  H HE21 . GLN A 1 56 ? 5.264   -9.580  6.011   1.00 0.00 ? 56 GLN A HE21 8  
ATOM 8972  H HE22 . GLN A 1 56 ? 5.024   -11.254 5.658   1.00 0.00 ? 56 GLN A HE22 8  
ATOM 8973  N N    . ASN A 1 57 ? -1.527  -8.413  5.198   1.00 0.00 ? 57 ASN A N    8  
ATOM 8974  C CA   . ASN A 1 57 ? -2.930  -8.804  5.263   1.00 0.00 ? 57 ASN A CA   8  
ATOM 8975  C C    . ASN A 1 57 ? -3.451  -9.193  3.882   1.00 0.00 ? 57 ASN A C    8  
ATOM 8976  O O    . ASN A 1 57 ? -4.415  -9.949  3.761   1.00 0.00 ? 57 ASN A O    8  
ATOM 8977  C CB   . ASN A 1 57 ? -3.773  -7.663  5.836   1.00 0.00 ? 57 ASN A CB   8  
ATOM 8978  C CG   . ASN A 1 57 ? -3.901  -7.741  7.345   1.00 0.00 ? 57 ASN A CG   8  
ATOM 8979  O OD1  . ASN A 1 57 ? -5.006  -7.821  7.882   1.00 0.00 ? 57 ASN A OD1  8  
ATOM 8980  N ND2  . ASN A 1 57 ? -2.768  -7.718  8.037   1.00 0.00 ? 57 ASN A ND2  8  
ATOM 8981  H H    . ASN A 1 57 ? -1.264  -7.522  5.509   1.00 0.00 ? 57 ASN A H    8  
ATOM 8982  H HA   . ASN A 1 57 ? -3.006  -9.660  5.917   1.00 0.00 ? 57 ASN A HA   8  
ATOM 8983  H HB2  . ASN A 1 57 ? -3.312  -6.720  5.582   1.00 0.00 ? 57 ASN A HB2  8  
ATOM 8984  H HB3  . ASN A 1 57 ? -4.763  -7.703  5.406   1.00 0.00 ? 57 ASN A HB3  8  
ATOM 8985  H HD21 . ASN A 1 57 ? -1.924  -7.652  7.542   1.00 0.00 ? 57 ASN A HD21 8  
ATOM 8986  H HD22 . ASN A 1 57 ? -2.822  -7.767  9.014   1.00 0.00 ? 57 ASN A HD22 8  
ATOM 8987  N N    . ARG A 1 58 ? -2.807  -8.669  2.844   1.00 0.00 ? 58 ARG A N    8  
ATOM 8988  C CA   . ARG A 1 58 ? -3.205  -8.960  1.472   1.00 0.00 ? 58 ARG A CA   8  
ATOM 8989  C C    . ARG A 1 58 ? -2.750  -10.356 1.058   1.00 0.00 ? 58 ARG A C    8  
ATOM 8990  O O    . ARG A 1 58 ? -3.533  -11.143 0.526   1.00 0.00 ? 58 ARG A O    8  
ATOM 8991  C CB   . ARG A 1 58 ? -2.622  -7.917  0.517   1.00 0.00 ? 58 ARG A CB   8  
ATOM 8992  C CG   . ARG A 1 58 ? -3.676  -7.105  -0.216  1.00 0.00 ? 58 ARG A CG   8  
ATOM 8993  C CD   . ARG A 1 58 ? -4.656  -8.002  -0.955  1.00 0.00 ? 58 ARG A CD   8  
ATOM 8994  N NE   . ARG A 1 58 ? -3.975  -9.045  -1.717  1.00 0.00 ? 58 ARG A NE   8  
ATOM 8995  C CZ   . ARG A 1 58 ? -4.606  -10.051 -2.312  1.00 0.00 ? 58 ARG A CZ   8  
ATOM 8996  N NH1  . ARG A 1 58 ? -5.926  -10.149 -2.235  1.00 0.00 ? 58 ARG A NH1  8  
ATOM 8997  N NH2  . ARG A 1 58 ? -3.917  -10.962 -2.988  1.00 0.00 ? 58 ARG A NH2  8  
ATOM 8998  H H    . ARG A 1 58 ? -2.046  -8.072  3.005   1.00 0.00 ? 58 ARG A H    8  
ATOM 8999  H HA   . ARG A 1 58 ? -4.283  -8.917  1.423   1.00 0.00 ? 58 ARG A HA   8  
ATOM 9000  H HB2  . ARG A 1 58 ? -2.002  -7.236  1.082   1.00 0.00 ? 58 ARG A HB2  8  
ATOM 9001  H HB3  . ARG A 1 58 ? -2.012  -8.421  -0.217  1.00 0.00 ? 58 ARG A HB3  8  
ATOM 9002  H HG2  . ARG A 1 58 ? -4.222  -6.509  0.502   1.00 0.00 ? 58 ARG A HG2  8  
ATOM 9003  H HG3  . ARG A 1 58 ? -3.187  -6.456  -0.927  1.00 0.00 ? 58 ARG A HG3  8  
ATOM 9004  H HD2  . ARG A 1 58 ? -5.313  -8.466  -0.235  1.00 0.00 ? 58 ARG A HD2  8  
ATOM 9005  H HD3  . ARG A 1 58 ? -5.237  -7.395  -1.633  1.00 0.00 ? 58 ARG A HD3  8  
ATOM 9006  H HE   . ARG A 1 58 ? -3.000  -8.992  -1.787  1.00 0.00 ? 58 ARG A HE   8  
ATOM 9007  H HH11 . ARG A 1 58 ? -6.448  -9.463  -1.728  1.00 0.00 ? 58 ARG A HH11 8  
ATOM 9008  H HH12 . ARG A 1 58 ? -6.399  -10.906 -2.685  1.00 0.00 ? 58 ARG A HH12 8  
ATOM 9009  H HH21 . ARG A 1 58 ? -2.922  -10.891 -3.049  1.00 0.00 ? 58 ARG A HH21 8  
ATOM 9010  H HH22 . ARG A 1 58 ? -4.393  -11.718 -3.435  1.00 0.00 ? 58 ARG A HH22 8  
ATOM 9011  N N    . ARG A 1 59 ? -1.479  -10.656 1.306   1.00 0.00 ? 59 ARG A N    8  
ATOM 9012  C CA   . ARG A 1 59 ? -0.919  -11.956 0.958   1.00 0.00 ? 59 ARG A CA   8  
ATOM 9013  C C    . ARG A 1 59 ? -1.517  -13.057 1.829   1.00 0.00 ? 59 ARG A C    8  
ATOM 9014  O O    . ARG A 1 59 ? -1.910  -14.112 1.331   1.00 0.00 ? 59 ARG A O    8  
ATOM 9015  C CB   . ARG A 1 59 ? 0.603   -11.938 1.114   1.00 0.00 ? 59 ARG A CB   8  
ATOM 9016  C CG   . ARG A 1 59 ? 1.351   -11.910 -0.209  1.00 0.00 ? 59 ARG A CG   8  
ATOM 9017  C CD   . ARG A 1 59 ? 2.670   -12.661 -0.119  1.00 0.00 ? 59 ARG A CD   8  
ATOM 9018  N NE   . ARG A 1 59 ? 2.628   -13.930 -0.840  1.00 0.00 ? 59 ARG A NE   8  
ATOM 9019  C CZ   . ARG A 1 59 ? 3.698   -14.685 -1.063  1.00 0.00 ? 59 ARG A CZ   8  
ATOM 9020  N NH1  . ARG A 1 59 ? 4.888   -14.299 -0.624  1.00 0.00 ? 59 ARG A NH1  8  
ATOM 9021  N NH2  . ARG A 1 59 ? 3.579   -15.827 -1.727  1.00 0.00 ? 59 ARG A NH2  8  
ATOM 9022  H H    . ARG A 1 59 ? -0.904  -9.987  1.733   1.00 0.00 ? 59 ARG A H    8  
ATOM 9023  H HA   . ARG A 1 59 ? -1.163  -12.157 -0.074  1.00 0.00 ? 59 ARG A HA   8  
ATOM 9024  H HB2  . ARG A 1 59 ? 0.885   -11.062 1.680   1.00 0.00 ? 59 ARG A HB2  8  
ATOM 9025  H HB3  . ARG A 1 59 ? 0.908   -12.820 1.656   1.00 0.00 ? 59 ARG A HB3  8  
ATOM 9026  H HG2  . ARG A 1 59 ? 0.738   -12.373 -0.968  1.00 0.00 ? 59 ARG A HG2  8  
ATOM 9027  H HG3  . ARG A 1 59 ? 1.548   -10.883 -0.479  1.00 0.00 ? 59 ARG A HG3  8  
ATOM 9028  H HD2  . ARG A 1 59 ? 3.450   -12.044 -0.541  1.00 0.00 ? 59 ARG A HD2  8  
ATOM 9029  H HD3  . ARG A 1 59 ? 2.889   -12.854 0.921   1.00 0.00 ? 59 ARG A HD3  8  
ATOM 9030  H HE   . ARG A 1 59 ? 1.758   -14.234 -1.173  1.00 0.00 ? 59 ARG A HE   8  
ATOM 9031  H HH11 . ARG A 1 59 ? 4.981   -13.439 -0.123  1.00 0.00 ? 59 ARG A HH11 8  
ATOM 9032  H HH12 . ARG A 1 59 ? 5.693   -14.870 -0.792  1.00 0.00 ? 59 ARG A HH12 8  
ATOM 9033  H HH21 . ARG A 1 59 ? 2.684   -16.121 -2.059  1.00 0.00 ? 59 ARG A HH21 8  
ATOM 9034  H HH22 . ARG A 1 59 ? 4.385   -16.394 -1.894  1.00 0.00 ? 59 ARG A HH22 8  
ATOM 9035  N N    . VAL A 1 60 ? -1.582  -12.804 3.132   1.00 0.00 ? 60 VAL A N    8  
ATOM 9036  C CA   . VAL A 1 60 ? -2.132  -13.772 4.073   1.00 0.00 ? 60 VAL A CA   8  
ATOM 9037  C C    . VAL A 1 60 ? -3.569  -14.132 3.713   1.00 0.00 ? 60 VAL A C    8  
ATOM 9038  O O    . VAL A 1 60 ? -4.072  -15.187 4.099   1.00 0.00 ? 60 VAL A O    8  
ATOM 9039  C CB   . VAL A 1 60 ? -2.095  -13.237 5.516   1.00 0.00 ? 60 VAL A CB   8  
ATOM 9040  C CG1  . VAL A 1 60 ? -2.613  -14.286 6.489   1.00 0.00 ? 60 VAL A CG1  8  
ATOM 9041  C CG2  . VAL A 1 60 ? -0.684  -12.805 5.887   1.00 0.00 ? 60 VAL A CG2  8  
ATOM 9042  H H    . VAL A 1 60 ? -1.252  -11.945 3.469   1.00 0.00 ? 60 VAL A H    8  
ATOM 9043  H HA   . VAL A 1 60 ? -1.525  -14.665 4.026   1.00 0.00 ? 60 VAL A HA   8  
ATOM 9044  H HB   . VAL A 1 60 ? -2.740  -12.373 5.575   1.00 0.00 ? 60 VAL A HB   8  
ATOM 9045  H HG11 . VAL A 1 60 ? -2.061  -15.205 6.354   1.00 0.00 ? 60 VAL A HG11 8  
ATOM 9046  H HG12 . VAL A 1 60 ? -2.485  -13.932 7.501   1.00 0.00 ? 60 VAL A HG12 8  
ATOM 9047  H HG13 . VAL A 1 60 ? -3.661  -14.465 6.299   1.00 0.00 ? 60 VAL A HG13 8  
ATOM 9048  H HG21 . VAL A 1 60 ? -0.336  -13.395 6.722   1.00 0.00 ? 60 VAL A HG21 8  
ATOM 9049  H HG22 . VAL A 1 60 ? -0.027  -12.955 5.042   1.00 0.00 ? 60 VAL A HG22 8  
ATOM 9050  H HG23 . VAL A 1 60 ? -0.687  -11.760 6.160   1.00 0.00 ? 60 VAL A HG23 8  
ATOM 9051  N N    . LYS A 1 61 ? -4.226  -13.248 2.970   1.00 0.00 ? 61 LYS A N    8  
ATOM 9052  C CA   . LYS A 1 61 ? -5.606  -13.472 2.555   1.00 0.00 ? 61 LYS A CA   8  
ATOM 9053  C C    . LYS A 1 61 ? -5.676  -14.497 1.428   1.00 0.00 ? 61 LYS A C    8  
ATOM 9054  O O    . LYS A 1 61 ? -6.653  -15.235 1.309   1.00 0.00 ? 61 LYS A O    8  
ATOM 9055  C CB   . LYS A 1 61 ? -6.244  -12.156 2.102   1.00 0.00 ? 61 LYS A CB   8  
ATOM 9056  C CG   . LYS A 1 61 ? -7.252  -11.597 3.090   1.00 0.00 ? 61 LYS A CG   8  
ATOM 9057  C CD   . LYS A 1 61 ? -7.686  -10.191 2.709   1.00 0.00 ? 61 LYS A CD   8  
ATOM 9058  C CE   . LYS A 1 61 ? -8.173  -9.410  3.920   1.00 0.00 ? 61 LYS A CE   8  
ATOM 9059  N NZ   . LYS A 1 61 ? -9.513  -9.872  4.376   1.00 0.00 ? 61 LYS A NZ   8  
ATOM 9060  H H    . LYS A 1 61 ? -3.771  -12.425 2.693   1.00 0.00 ? 61 LYS A H    8  
ATOM 9061  H HA   . LYS A 1 61 ? -6.151  -13.851 3.406   1.00 0.00 ? 61 LYS A HA   8  
ATOM 9062  H HB2  . LYS A 1 61 ? -5.464  -11.422 1.961   1.00 0.00 ? 61 LYS A HB2  8  
ATOM 9063  H HB3  . LYS A 1 61 ? -6.747  -12.320 1.160   1.00 0.00 ? 61 LYS A HB3  8  
ATOM 9064  H HG2  . LYS A 1 61 ? -8.121  -12.238 3.106   1.00 0.00 ? 61 LYS A HG2  8  
ATOM 9065  H HG3  . LYS A 1 61 ? -6.803  -11.571 4.073   1.00 0.00 ? 61 LYS A HG3  8  
ATOM 9066  H HD2  . LYS A 1 61 ? -6.847  -9.671  2.272   1.00 0.00 ? 61 LYS A HD2  8  
ATOM 9067  H HD3  . LYS A 1 61 ? -8.488  -10.255 1.986   1.00 0.00 ? 61 LYS A HD3  8  
ATOM 9068  H HE2  . LYS A 1 61 ? -7.464  -9.540  4.724   1.00 0.00 ? 61 LYS A HE2  8  
ATOM 9069  H HE3  . LYS A 1 61 ? -8.231  -8.364  3.657   1.00 0.00 ? 61 LYS A HE3  8  
ATOM 9070  H HZ1  . LYS A 1 61 ? -9.508  -10.021 5.405   1.00 0.00 ? 61 LYS A HZ1  8  
ATOM 9071  H HZ2  . LYS A 1 61 ? -9.761  -10.767 3.909   1.00 0.00 ? 61 LYS A HZ2  8  
ATOM 9072  H HZ3  . LYS A 1 61 ? -10.235 -9.160  4.142   1.00 0.00 ? 61 LYS A HZ3  8  
ATOM 9073  N N    . GLU A 1 62 ? -4.633  -14.538 0.605   1.00 0.00 ? 62 GLU A N    8  
ATOM 9074  C CA   . GLU A 1 62 ? -4.577  -15.474 -0.511  1.00 0.00 ? 62 GLU A CA   8  
ATOM 9075  C C    . GLU A 1 62 ? -3.761  -16.711 -0.144  1.00 0.00 ? 62 GLU A C    8  
ATOM 9076  O O    . GLU A 1 62 ? -3.241  -17.407 -1.016  1.00 0.00 ? 62 GLU A O    8  
ATOM 9077  C CB   . GLU A 1 62 ? -3.973  -14.798 -1.743  1.00 0.00 ? 62 GLU A CB   8  
ATOM 9078  C CG   . GLU A 1 62 ? -2.602  -14.193 -1.495  1.00 0.00 ? 62 GLU A CG   8  
ATOM 9079  C CD   . GLU A 1 62 ? -1.810  -13.998 -2.773  1.00 0.00 ? 62 GLU A CD   8  
ATOM 9080  O OE1  . GLU A 1 62 ? -2.029  -12.977 -3.458  1.00 0.00 ? 62 GLU A OE1  8  
ATOM 9081  O OE2  . GLU A 1 62 ? -0.970  -14.867 -3.088  1.00 0.00 ? 62 GLU A OE2  8  
ATOM 9082  H H    . GLU A 1 62 ? -3.884  -13.924 0.752   1.00 0.00 ? 62 GLU A H    8  
ATOM 9083  H HA   . GLU A 1 62 ? -5.588  -15.779 -0.738  1.00 0.00 ? 62 GLU A HA   8  
ATOM 9084  H HB2  . GLU A 1 62 ? -3.884  -15.530 -2.533  1.00 0.00 ? 62 GLU A HB2  8  
ATOM 9085  H HB3  . GLU A 1 62 ? -4.637  -14.011 -2.068  1.00 0.00 ? 62 GLU A HB3  8  
ATOM 9086  H HG2  . GLU A 1 62 ? -2.727  -13.233 -1.017  1.00 0.00 ? 62 GLU A HG2  8  
ATOM 9087  H HG3  . GLU A 1 62 ? -2.046  -14.849 -0.841  1.00 0.00 ? 62 GLU A HG3  8  
ATOM 9088  N N    . LYS A 1 63 ? -3.653  -16.977 1.153   1.00 0.00 ? 63 LYS A N    8  
ATOM 9089  C CA   . LYS A 1 63 ? -2.902  -18.129 1.638   1.00 0.00 ? 63 LYS A CA   8  
ATOM 9090  C C    . LYS A 1 63 ? -3.832  -19.302 1.930   1.00 0.00 ? 63 LYS A C    8  
ATOM 9091  O O    . LYS A 1 63 ? -3.455  -20.463 1.768   1.00 0.00 ? 63 LYS A O    8  
ATOM 9092  C CB   . LYS A 1 63 ? -2.119  -17.759 2.899   1.00 0.00 ? 63 LYS A CB   8  
ATOM 9093  C CG   . LYS A 1 63 ? -0.724  -17.227 2.616   1.00 0.00 ? 63 LYS A CG   8  
ATOM 9094  C CD   . LYS A 1 63 ? 0.238   -18.349 2.263   1.00 0.00 ? 63 LYS A CD   8  
ATOM 9095  C CE   . LYS A 1 63 ? 0.909   -18.918 3.504   1.00 0.00 ? 63 LYS A CE   8  
ATOM 9096  N NZ   . LYS A 1 63 ? 2.014   -19.855 3.157   1.00 0.00 ? 63 LYS A NZ   8  
ATOM 9097  H H    . LYS A 1 63 ? -4.091  -16.385 1.801   1.00 0.00 ? 63 LYS A H    8  
ATOM 9098  H HA   . LYS A 1 63 ? -2.207  -18.421 0.865   1.00 0.00 ? 63 LYS A HA   8  
ATOM 9099  H HB2  . LYS A 1 63 ? -2.667  -17.001 3.439   1.00 0.00 ? 63 LYS A HB2  8  
ATOM 9100  H HB3  . LYS A 1 63 ? -2.027  -18.637 3.522   1.00 0.00 ? 63 LYS A HB3  8  
ATOM 9101  H HG2  . LYS A 1 63 ? -0.774  -16.536 1.787   1.00 0.00 ? 63 LYS A HG2  8  
ATOM 9102  H HG3  . LYS A 1 63 ? -0.359  -16.714 3.494   1.00 0.00 ? 63 LYS A HG3  8  
ATOM 9103  H HD2  . LYS A 1 63 ? -0.308  -19.139 1.769   1.00 0.00 ? 63 LYS A HD2  8  
ATOM 9104  H HD3  . LYS A 1 63 ? 0.998   -17.964 1.598   1.00 0.00 ? 63 LYS A HD3  8  
ATOM 9105  H HE2  . LYS A 1 63 ? 1.310   -18.103 4.087   1.00 0.00 ? 63 LYS A HE2  8  
ATOM 9106  H HE3  . LYS A 1 63 ? 0.170   -19.447 4.087   1.00 0.00 ? 63 LYS A HE3  8  
ATOM 9107  H HZ1  . LYS A 1 63 ? 2.608   -20.030 3.993   1.00 0.00 ? 63 LYS A HZ1  8  
ATOM 9108  H HZ2  . LYS A 1 63 ? 2.605   -19.448 2.405   1.00 0.00 ? 63 LYS A HZ2  8  
ATOM 9109  H HZ3  . LYS A 1 63 ? 1.624   -20.760 2.826   1.00 0.00 ? 63 LYS A HZ3  8  
ATOM 9110  N N    . LYS A 1 64 ? -5.051  -18.992 2.360   1.00 0.00 ? 64 LYS A N    8  
ATOM 9111  C CA   . LYS A 1 64 ? -6.037  -20.019 2.673   1.00 0.00 ? 64 LYS A CA   8  
ATOM 9112  C C    . LYS A 1 64 ? -6.844  -20.393 1.434   1.00 0.00 ? 64 LYS A C    8  
ATOM 9113  O O    . LYS A 1 64 ? -7.766  -19.677 1.043   1.00 0.00 ? 64 LYS A O    8  
ATOM 9114  C CB   . LYS A 1 64 ? -6.976  -19.534 3.779   1.00 0.00 ? 64 LYS A CB   8  
ATOM 9115  C CG   . LYS A 1 64 ? -6.423  -19.737 5.179   1.00 0.00 ? 64 LYS A CG   8  
ATOM 9116  C CD   . LYS A 1 64 ? -5.489  -18.607 5.579   1.00 0.00 ? 64 LYS A CD   8  
ATOM 9117  C CE   . LYS A 1 64 ? -6.258  -17.336 5.902   1.00 0.00 ? 64 LYS A CE   8  
ATOM 9118  N NZ   . LYS A 1 64 ? -7.133  -17.505 7.096   1.00 0.00 ? 64 LYS A NZ   8  
ATOM 9119  H H    . LYS A 1 64 ? -5.293  -18.048 2.470   1.00 0.00 ? 64 LYS A H    8  
ATOM 9120  H HA   . LYS A 1 64 ? -5.507  -20.893 3.020   1.00 0.00 ? 64 LYS A HA   8  
ATOM 9121  H HB2  . LYS A 1 64 ? -7.165  -18.480 3.638   1.00 0.00 ? 64 LYS A HB2  8  
ATOM 9122  H HB3  . LYS A 1 64 ? -7.910  -20.071 3.703   1.00 0.00 ? 64 LYS A HB3  8  
ATOM 9123  H HG2  . LYS A 1 64 ? -7.244  -19.775 5.879   1.00 0.00 ? 64 LYS A HG2  8  
ATOM 9124  H HG3  . LYS A 1 64 ? -5.878  -20.670 5.209   1.00 0.00 ? 64 LYS A HG3  8  
ATOM 9125  H HD2  . LYS A 1 64 ? -4.928  -18.906 6.452   1.00 0.00 ? 64 LYS A HD2  8  
ATOM 9126  H HD3  . LYS A 1 64 ? -4.809  -18.408 4.763   1.00 0.00 ? 64 LYS A HD3  8  
ATOM 9127  H HE2  . LYS A 1 64 ? -5.553  -16.542 6.093   1.00 0.00 ? 64 LYS A HE2  8  
ATOM 9128  H HE3  . LYS A 1 64 ? -6.871  -17.075 5.052   1.00 0.00 ? 64 LYS A HE3  8  
ATOM 9129  H HZ1  . LYS A 1 64 ? -7.460  -16.577 7.433   1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 9130  H HZ2  . LYS A 1 64 ? -6.606  -17.973 7.861   1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 9131  H HZ3  . LYS A 1 64 ? -7.960  -18.086 6.853   1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 9132  N N    . SER A 1 65 ? -6.493  -21.519 0.822   1.00 0.00 ? 65 SER A N    8  
ATOM 9133  C CA   . SER A 1 65 ? -7.184  -21.987 -0.374  1.00 0.00 ? 65 SER A CA   8  
ATOM 9134  C C    . SER A 1 65 ? -8.545  -22.578 -0.019  1.00 0.00 ? 65 SER A C    8  
ATOM 9135  O O    . SER A 1 65 ? -8.868  -22.760 1.153   1.00 0.00 ? 65 SER A O    8  
ATOM 9136  C CB   . SER A 1 65 ? -6.336  -23.032 -1.103  1.00 0.00 ? 65 SER A CB   8  
ATOM 9137  O OG   . SER A 1 65 ? -5.451  -22.418 -2.024  1.00 0.00 ? 65 SER A OG   8  
ATOM 9138  H H    . SER A 1 65 ? -5.749  -22.047 1.182   1.00 0.00 ? 65 SER A H    8  
ATOM 9139  H HA   . SER A 1 65 ? -7.331  -21.138 -1.025  1.00 0.00 ? 65 SER A HA   8  
ATOM 9140  H HB2  . SER A 1 65 ? -5.757  -23.588 -0.382  1.00 0.00 ? 65 SER A HB2  8  
ATOM 9141  H HB3  . SER A 1 65 ? -6.986  -23.707 -1.641  1.00 0.00 ? 65 SER A HB3  8  
ATOM 9142  H HG   . SER A 1 65 ? -4.939  -21.742 -1.574  1.00 0.00 ? 65 SER A HG   8  
ATOM 9143  N N    . GLY A 1 66 ? -9.339  -22.874 -1.044  1.00 0.00 ? 66 GLY A N    8  
ATOM 9144  C CA   . GLY A 1 66 ? -10.657 -23.441 -0.820  1.00 0.00 ? 66 GLY A CA   8  
ATOM 9145  C C    . GLY A 1 66 ? -11.430 -23.637 -2.110  1.00 0.00 ? 66 GLY A C    8  
ATOM 9146  O O    . GLY A 1 66 ? -11.584 -24.754 -2.603  1.00 0.00 ? 66 GLY A O    8  
ATOM 9147  H H    . GLY A 1 66 ? -9.028  -22.707 -1.958  1.00 0.00 ? 66 GLY A H    8  
ATOM 9148  H HA2  . GLY A 1 66 ? -10.547 -24.397 -0.330  1.00 0.00 ? 66 GLY A HA2  8  
ATOM 9149  H HA3  . GLY A 1 66 ? -11.216 -22.779 -0.176  1.00 0.00 ? 66 GLY A HA3  8  
ATOM 9150  N N    . PRO A 1 67 ? -11.934 -22.530 -2.675  1.00 0.00 ? 67 PRO A N    8  
ATOM 9151  C CA   . PRO A 1 67 ? -12.705 -22.559 -3.922  1.00 0.00 ? 67 PRO A CA   8  
ATOM 9152  C C    . PRO A 1 67 ? -11.840 -22.901 -5.130  1.00 0.00 ? 67 PRO A C    8  
ATOM 9153  O O    . PRO A 1 67 ? -10.737 -22.377 -5.285  1.00 0.00 ? 67 PRO A O    8  
ATOM 9154  C CB   . PRO A 1 67 ? -13.245 -21.131 -4.038  1.00 0.00 ? 67 PRO A CB   8  
ATOM 9155  C CG   . PRO A 1 67 ? -12.280 -20.297 -3.268  1.00 0.00 ? 67 PRO A CG   8  
ATOM 9156  C CD   . PRO A 1 67 ? -11.789 -21.165 -2.142  1.00 0.00 ? 67 PRO A CD   8  
ATOM 9157  H HA   . PRO A 1 67 ? -13.529 -23.254 -3.862  1.00 0.00 ? 67 PRO A HA   8  
ATOM 9158  H HB2  . PRO A 1 67 ? -13.278 -20.840 -5.079  1.00 0.00 ? 67 PRO A HB2  8  
ATOM 9159  H HB3  . PRO A 1 67 ? -14.236 -21.082 -3.613  1.00 0.00 ? 67 PRO A HB3  8  
ATOM 9160  H HG2  . PRO A 1 67 ? -11.457 -20.006 -3.904  1.00 0.00 ? 67 PRO A HG2  8  
ATOM 9161  H HG3  . PRO A 1 67 ? -12.781 -19.424 -2.877  1.00 0.00 ? 67 PRO A HG3  8  
ATOM 9162  H HD2  . PRO A 1 67 ? -10.756 -20.945 -1.920  1.00 0.00 ? 67 PRO A HD2  8  
ATOM 9163  H HD3  . PRO A 1 67 ? -12.404 -21.027 -1.265  1.00 0.00 ? 67 PRO A HD3  8  
ATOM 9164  N N    . SER A 1 68 ? -12.348 -23.784 -5.985  1.00 0.00 ? 68 SER A N    8  
ATOM 9165  C CA   . SER A 1 68 ? -11.621 -24.198 -7.179  1.00 0.00 ? 68 SER A CA   8  
ATOM 9166  C C    . SER A 1 68 ? -12.360 -23.770 -8.442  1.00 0.00 ? 68 SER A C    8  
ATOM 9167  O O    . SER A 1 68 ? -11.760 -23.239 -9.376  1.00 0.00 ? 68 SER A O    8  
ATOM 9168  C CB   . SER A 1 68 ? -11.422 -25.715 -7.179  1.00 0.00 ? 68 SER A CB   8  
ATOM 9169  O OG   . SER A 1 68 ? -10.357 -26.090 -8.035  1.00 0.00 ? 68 SER A OG   8  
ATOM 9170  H H    . SER A 1 68 ? -13.233 -24.166 -5.807  1.00 0.00 ? 68 SER A H    8  
ATOM 9171  H HA   . SER A 1 68 ? -10.654 -23.717 -7.161  1.00 0.00 ? 68 SER A HA   8  
ATOM 9172  H HB2  . SER A 1 68 ? -11.197 -26.047 -6.177  1.00 0.00 ? 68 SER A HB2  8  
ATOM 9173  H HB3  . SER A 1 68 ? -12.329 -26.194 -7.522  1.00 0.00 ? 68 SER A HB3  8  
ATOM 9174  H HG   . SER A 1 68 ? -10.253 -27.044 -8.018  1.00 0.00 ? 68 SER A HG   8  
ATOM 9175  N N    . SER A 1 69 ? -13.668 -24.006 -8.463  1.00 0.00 ? 69 SER A N    8  
ATOM 9176  C CA   . SER A 1 69 ? -14.491 -23.649 -9.613  1.00 0.00 ? 69 SER A CA   8  
ATOM 9177  C C    . SER A 1 69 ? -15.708 -22.837 -9.179  1.00 0.00 ? 69 SER A C    8  
ATOM 9178  O O    . SER A 1 69 ? -15.977 -21.765 -9.719  1.00 0.00 ? 69 SER A O    8  
ATOM 9179  C CB   . SER A 1 69 ? -14.943 -24.909 -10.354 1.00 0.00 ? 69 SER A CB   8  
ATOM 9180  O OG   . SER A 1 69 ? -13.834 -25.613 -10.886 1.00 0.00 ? 69 SER A OG   8  
ATOM 9181  H H    . SER A 1 69 ? -14.089 -24.433 -7.688  1.00 0.00 ? 69 SER A H    8  
ATOM 9182  H HA   . SER A 1 69 ? -13.889 -23.047 -10.277 1.00 0.00 ? 69 SER A HA   8  
ATOM 9183  H HB2  . SER A 1 69 ? -15.471 -25.556 -9.671  1.00 0.00 ? 69 SER A HB2  8  
ATOM 9184  H HB3  . SER A 1 69 ? -15.600 -24.630 -11.166 1.00 0.00 ? 69 SER A HB3  8  
ATOM 9185  H HG   . SER A 1 69 ? -13.394 -25.069 -11.543 1.00 0.00 ? 69 SER A HG   8  
ATOM 9186  N N    . GLY A 1 70 ? -16.440 -23.357 -8.199  1.00 0.00 ? 70 GLY A N    8  
ATOM 9187  C CA   . GLY A 1 70 ? -17.619 -22.668 -7.708  1.00 0.00 ? 70 GLY A CA   8  
ATOM 9188  C C    . GLY A 1 70 ? -18.659 -23.622 -7.154  1.00 0.00 ? 70 GLY A C    8  
ATOM 9189  O O    . GLY A 1 70 ? -18.646 -23.944 -5.966  1.00 0.00 ? 70 GLY A O    8  
ATOM 9190  H H    . GLY A 1 70 ? -16.177 -24.216 -7.805  1.00 0.00 ? 70 GLY A H    8  
ATOM 9191  H HA2  . GLY A 1 70 ? -17.324 -21.982 -6.929  1.00 0.00 ? 70 GLY A HA2  8  
ATOM 9192  H HA3  . GLY A 1 70 ? -18.058 -22.108 -8.520  1.00 0.00 ? 70 GLY A HA3  8  
ATOM 9193  N N    . GLY A 1 1  ? -30.170 13.165  -5.376  1.00 0.00 ? 1  GLY A N    9  
ATOM 9194  C CA   . GLY A 1 1  ? -29.894 13.676  -4.046  1.00 0.00 ? 1  GLY A CA   9  
ATOM 9195  C C    . GLY A 1 1  ? -29.283 12.628  -3.138  1.00 0.00 ? 1  GLY A C    9  
ATOM 9196  O O    . GLY A 1 1  ? -29.935 12.140  -2.214  1.00 0.00 ? 1  GLY A O    9  
ATOM 9197  H H1   . GLY A 1 1  ? -30.681 13.708  -6.012  1.00 0.00 ? 1  GLY A H1   9  
ATOM 9198  H HA2  . GLY A 1 1  ? -29.212 14.509  -4.127  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 9199  H HA3  . GLY A 1 1  ? -30.819 14.021  -3.607  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 9200  N N    . SER A 1 2  ? -28.027 12.279  -3.400  1.00 0.00 ? 2  SER A N    9  
ATOM 9201  C CA   . SER A 1 2  ? -27.330 11.277  -2.602  1.00 0.00 ? 2  SER A CA   9  
ATOM 9202  C C    . SER A 1 2  ? -27.083 11.786  -1.185  1.00 0.00 ? 2  SER A C    9  
ATOM 9203  O O    . SER A 1 2  ? -26.325 12.734  -0.977  1.00 0.00 ? 2  SER A O    9  
ATOM 9204  C CB   . SER A 1 2  ? -26.000 10.905  -3.261  1.00 0.00 ? 2  SER A CB   9  
ATOM 9205  O OG   . SER A 1 2  ? -25.436 9.754   -2.658  1.00 0.00 ? 2  SER A OG   9  
ATOM 9206  H H    . SER A 1 2  ? -27.560 12.703  -4.150  1.00 0.00 ? 2  SER A H    9  
ATOM 9207  H HA   . SER A 1 2  ? -27.955 10.398  -2.553  1.00 0.00 ? 2  SER A HA   9  
ATOM 9208  H HB2  . SER A 1 2  ? -26.164 10.704  -4.309  1.00 0.00 ? 2  SER A HB2  9  
ATOM 9209  H HB3  . SER A 1 2  ? -25.307 11.728  -3.156  1.00 0.00 ? 2  SER A HB3  9  
ATOM 9210  H HG   . SER A 1 2  ? -25.687 8.974   -3.159  1.00 0.00 ? 2  SER A HG   9  
ATOM 9211  N N    . SER A 1 3  ? -27.730 11.150  -0.214  1.00 0.00 ? 3  SER A N    9  
ATOM 9212  C CA   . SER A 1 3  ? -27.585 11.540  1.184   1.00 0.00 ? 3  SER A CA   9  
ATOM 9213  C C    . SER A 1 3  ? -27.921 10.376  2.110   1.00 0.00 ? 3  SER A C    9  
ATOM 9214  O O    . SER A 1 3  ? -29.027 9.839   2.076   1.00 0.00 ? 3  SER A O    9  
ATOM 9215  C CB   . SER A 1 3  ? -28.489 12.734  1.499   1.00 0.00 ? 3  SER A CB   9  
ATOM 9216  O OG   . SER A 1 3  ? -28.169 13.846  0.681   1.00 0.00 ? 3  SER A OG   9  
ATOM 9217  H H    . SER A 1 3  ? -28.321 10.402  -0.443  1.00 0.00 ? 3  SER A H    9  
ATOM 9218  H HA   . SER A 1 3  ? -26.557 11.827  1.343   1.00 0.00 ? 3  SER A HA   9  
ATOM 9219  H HB2  . SER A 1 3  ? -29.518 12.459  1.324   1.00 0.00 ? 3  SER A HB2  9  
ATOM 9220  H HB3  . SER A 1 3  ? -28.362 13.015  2.534   1.00 0.00 ? 3  SER A HB3  9  
ATOM 9221  H HG   . SER A 1 3  ? -28.328 14.658  1.167   1.00 0.00 ? 3  SER A HG   9  
ATOM 9222  N N    . GLY A 1 4  ? -26.955 9.990   2.940   1.00 0.00 ? 4  GLY A N    9  
ATOM 9223  C CA   . GLY A 1 4  ? -27.166 8.892   3.864   1.00 0.00 ? 4  GLY A CA   9  
ATOM 9224  C C    . GLY A 1 4  ? -25.988 8.682   4.794   1.00 0.00 ? 4  GLY A C    9  
ATOM 9225  O O    . GLY A 1 4  ? -24.838 8.886   4.405   1.00 0.00 ? 4  GLY A O    9  
ATOM 9226  H H    . GLY A 1 4  ? -26.093 10.456  2.923   1.00 0.00 ? 4  GLY A H    9  
ATOM 9227  H HA2  . GLY A 1 4  ? -28.046 9.097   4.456   1.00 0.00 ? 4  GLY A HA2  9  
ATOM 9228  H HA3  . GLY A 1 4  ? -27.329 7.986   3.298   1.00 0.00 ? 4  GLY A HA3  9  
ATOM 9229  N N    . SER A 1 5  ? -26.273 8.276   6.027   1.00 0.00 ? 5  SER A N    9  
ATOM 9230  C CA   . SER A 1 5  ? -25.228 8.044   7.017   1.00 0.00 ? 5  SER A CA   9  
ATOM 9231  C C    . SER A 1 5  ? -25.220 6.586   7.467   1.00 0.00 ? 5  SER A C    9  
ATOM 9232  O O    . SER A 1 5  ? -26.261 5.929   7.500   1.00 0.00 ? 5  SER A O    9  
ATOM 9233  C CB   . SER A 1 5  ? -25.427 8.962   8.225   1.00 0.00 ? 5  SER A CB   9  
ATOM 9234  O OG   . SER A 1 5  ? -26.462 8.481   9.065   1.00 0.00 ? 5  SER A OG   9  
ATOM 9235  H H    . SER A 1 5  ? -27.210 8.131   6.277   1.00 0.00 ? 5  SER A H    9  
ATOM 9236  H HA   . SER A 1 5  ? -24.278 8.271   6.556   1.00 0.00 ? 5  SER A HA   9  
ATOM 9237  H HB2  . SER A 1 5  ? -24.511 9.008   8.793   1.00 0.00 ? 5  SER A HB2  9  
ATOM 9238  H HB3  . SER A 1 5  ? -25.689 9.952   7.881   1.00 0.00 ? 5  SER A HB3  9  
ATOM 9239  H HG   . SER A 1 5  ? -27.302 8.537   8.603   1.00 0.00 ? 5  SER A HG   9  
ATOM 9240  N N    . SER A 1 6  ? -24.038 6.086   7.814   1.00 0.00 ? 6  SER A N    9  
ATOM 9241  C CA   . SER A 1 6  ? -23.893 4.706   8.259   1.00 0.00 ? 6  SER A CA   9  
ATOM 9242  C C    . SER A 1 6  ? -22.961 4.619   9.464   1.00 0.00 ? 6  SER A C    9  
ATOM 9243  O O    . SER A 1 6  ? -22.106 5.480   9.665   1.00 0.00 ? 6  SER A O    9  
ATOM 9244  C CB   . SER A 1 6  ? -23.357 3.834   7.121   1.00 0.00 ? 6  SER A CB   9  
ATOM 9245  O OG   . SER A 1 6  ? -22.521 4.583   6.256   1.00 0.00 ? 6  SER A OG   9  
ATOM 9246  H H    . SER A 1 6  ? -23.245 6.660   7.766   1.00 0.00 ? 6  SER A H    9  
ATOM 9247  H HA   . SER A 1 6  ? -24.869 4.346   8.548   1.00 0.00 ? 6  SER A HA   9  
ATOM 9248  H HB2  . SER A 1 6  ? -22.786 3.017   7.535   1.00 0.00 ? 6  SER A HB2  9  
ATOM 9249  H HB3  . SER A 1 6  ? -24.187 3.442   6.551   1.00 0.00 ? 6  SER A HB3  9  
ATOM 9250  H HG   . SER A 1 6  ? -22.407 4.108   5.430   1.00 0.00 ? 6  SER A HG   9  
ATOM 9251  N N    . GLY A 1 7  ? -23.133 3.570   10.263  1.00 0.00 ? 7  GLY A N    9  
ATOM 9252  C CA   . GLY A 1 7  ? -22.301 3.388   11.438  1.00 0.00 ? 7  GLY A CA   9  
ATOM 9253  C C    . GLY A 1 7  ? -20.845 3.157   11.088  1.00 0.00 ? 7  GLY A C    9  
ATOM 9254  O O    . GLY A 1 7  ? -20.386 3.557   10.017  1.00 0.00 ? 7  GLY A O    9  
ATOM 9255  H H    . GLY A 1 7  ? -23.831 2.914   10.053  1.00 0.00 ? 7  GLY A H    9  
ATOM 9256  H HA2  . GLY A 1 7  ? -22.376 4.269   12.058  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 9257  H HA3  . GLY A 1 7  ? -22.665 2.537   11.994  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 9258  N N    . ARG A 1 8  ? -20.115 2.513   11.992  1.00 0.00 ? 8  ARG A N    9  
ATOM 9259  C CA   . ARG A 1 8  ? -18.701 2.232   11.774  1.00 0.00 ? 8  ARG A CA   9  
ATOM 9260  C C    . ARG A 1 8  ? -18.451 0.729   11.691  1.00 0.00 ? 8  ARG A C    9  
ATOM 9261  O O    . ARG A 1 8  ? -18.062 0.098   12.673  1.00 0.00 ? 8  ARG A O    9  
ATOM 9262  C CB   . ARG A 1 8  ? -17.859 2.838   12.899  1.00 0.00 ? 8  ARG A CB   9  
ATOM 9263  C CG   . ARG A 1 8  ? -17.511 4.301   12.678  1.00 0.00 ? 8  ARG A CG   9  
ATOM 9264  C CD   . ARG A 1 8  ? -16.178 4.659   13.318  1.00 0.00 ? 8  ARG A CD   9  
ATOM 9265  N NE   . ARG A 1 8  ? -15.826 6.060   13.102  1.00 0.00 ? 8  ARG A NE   9  
ATOM 9266  C CZ   . ARG A 1 8  ? -14.606 6.549   13.294  1.00 0.00 ? 8  ARG A CZ   9  
ATOM 9267  N NH1  . ARG A 1 8  ? -13.627 5.755   13.703  1.00 0.00 ? 8  ARG A NH1  9  
ATOM 9268  N NH2  . ARG A 1 8  ? -14.364 7.835   13.077  1.00 0.00 ? 8  ARG A NH2  9  
ATOM 9269  H H    . ARG A 1 8  ? -20.537 2.220   12.827  1.00 0.00 ? 8  ARG A H    9  
ATOM 9270  H HA   . ARG A 1 8  ? -18.413 2.685   10.837  1.00 0.00 ? 8  ARG A HA   9  
ATOM 9271  H HB2  . ARG A 1 8  ? -18.407 2.757   13.826  1.00 0.00 ? 8  ARG A HB2  9  
ATOM 9272  H HB3  . ARG A 1 8  ? -16.939 2.280   12.984  1.00 0.00 ? 8  ARG A HB3  9  
ATOM 9273  H HG2  . ARG A 1 8  ? -17.450 4.491   11.616  1.00 0.00 ? 8  ARG A HG2  9  
ATOM 9274  H HG3  . ARG A 1 8  ? -18.285 4.915   13.112  1.00 0.00 ? 8  ARG A HG3  9  
ATOM 9275  H HD2  . ARG A 1 8  ? -16.243 4.473   14.379  1.00 0.00 ? 8  ARG A HD2  9  
ATOM 9276  H HD3  . ARG A 1 8  ? -15.409 4.034   12.889  1.00 0.00 ? 8  ARG A HD3  9  
ATOM 9277  H HE   . ARG A 1 8  ? -16.535 6.665   12.800  1.00 0.00 ? 8  ARG A HE   9  
ATOM 9278  H HH11 . ARG A 1 8  ? -13.806 4.785   13.867  1.00 0.00 ? 8  ARG A HH11 9  
ATOM 9279  H HH12 . ARG A 1 8  ? -12.709 6.125   13.845  1.00 0.00 ? 8  ARG A HH12 9  
ATOM 9280  H HH21 . ARG A 1 8  ? -15.100 8.437   12.768  1.00 0.00 ? 8  ARG A HH21 9  
ATOM 9281  H HH22 . ARG A 1 8  ? -13.446 8.202   13.221  1.00 0.00 ? 8  ARG A HH22 9  
ATOM 9282  N N    . LYS A 1 9  ? -18.679 0.161   10.511  1.00 0.00 ? 9  LYS A N    9  
ATOM 9283  C CA   . LYS A 1 9  ? -18.479 -1.267  10.298  1.00 0.00 ? 9  LYS A CA   9  
ATOM 9284  C C    . LYS A 1 9  ? -17.032 -1.563  9.915   1.00 0.00 ? 9  LYS A C    9  
ATOM 9285  O O    . LYS A 1 9  ? -16.357 -0.731  9.309   1.00 0.00 ? 9  LYS A O    9  
ATOM 9286  C CB   . LYS A 1 9  ? -19.421 -1.777  9.205   1.00 0.00 ? 9  LYS A CB   9  
ATOM 9287  C CG   . LYS A 1 9  ? -19.633 -3.281  9.238   1.00 0.00 ? 9  LYS A CG   9  
ATOM 9288  C CD   . LYS A 1 9  ? -20.516 -3.694  10.404  1.00 0.00 ? 9  LYS A CD   9  
ATOM 9289  C CE   . LYS A 1 9  ? -20.366 -5.174  10.720  1.00 0.00 ? 9  LYS A CE   9  
ATOM 9290  N NZ   . LYS A 1 9  ? -21.328 -5.618  11.766  1.00 0.00 ? 9  LYS A NZ   9  
ATOM 9291  H H    . LYS A 1 9  ? -18.988 0.717   9.765   1.00 0.00 ? 9  LYS A H    9  
ATOM 9292  H HA   . LYS A 1 9  ? -18.705 -1.776  11.223  1.00 0.00 ? 9  LYS A HA   9  
ATOM 9293  H HB2  . LYS A 1 9  ? -20.381 -1.296  9.320   1.00 0.00 ? 9  LYS A HB2  9  
ATOM 9294  H HB3  . LYS A 1 9  ? -19.010 -1.514  8.241   1.00 0.00 ? 9  LYS A HB3  9  
ATOM 9295  H HG2  . LYS A 1 9  ? -20.105 -3.589  8.317   1.00 0.00 ? 9  LYS A HG2  9  
ATOM 9296  H HG3  . LYS A 1 9  ? -18.674 -3.769  9.335   1.00 0.00 ? 9  LYS A HG3  9  
ATOM 9297  H HD2  . LYS A 1 9  ? -20.237 -3.121  11.276  1.00 0.00 ? 9  LYS A HD2  9  
ATOM 9298  H HD3  . LYS A 1 9  ? -21.547 -3.491  10.153  1.00 0.00 ? 9  LYS A HD3  9  
ATOM 9299  H HE2  . LYS A 1 9  ? -20.540 -5.741  9.819   1.00 0.00 ? 9  LYS A HE2  9  
ATOM 9300  H HE3  . LYS A 1 9  ? -19.360 -5.354  11.069  1.00 0.00 ? 9  LYS A HE3  9  
ATOM 9301  H HZ1  . LYS A 1 9  ? -21.084 -6.575  12.093  1.00 0.00 ? 9  LYS A HZ1  9  
ATOM 9302  H HZ2  . LYS A 1 9  ? -22.294 -5.631  11.381  1.00 0.00 ? 9  LYS A HZ2  9  
ATOM 9303  H HZ3  . LYS A 1 9  ? -21.299 -4.969  12.578  1.00 0.00 ? 9  LYS A HZ3  9  
ATOM 9304  N N    . LYS A 1 10 ? -16.562 -2.753  10.272  1.00 0.00 ? 10 LYS A N    9  
ATOM 9305  C CA   . LYS A 1 10 ? -15.196 -3.160  9.964   1.00 0.00 ? 10 LYS A CA   9  
ATOM 9306  C C    . LYS A 1 10 ? -14.904 -3.005  8.475   1.00 0.00 ? 10 LYS A C    9  
ATOM 9307  O O    . LYS A 1 10 ? -15.346 -3.814  7.659   1.00 0.00 ? 10 LYS A O    9  
ATOM 9308  C CB   . LYS A 1 10 ? -14.967 -4.612  10.391  1.00 0.00 ? 10 LYS A CB   9  
ATOM 9309  C CG   . LYS A 1 10 ? -15.149 -4.845  11.881  1.00 0.00 ? 10 LYS A CG   9  
ATOM 9310  C CD   . LYS A 1 10 ? -14.962 -6.308  12.243  1.00 0.00 ? 10 LYS A CD   9  
ATOM 9311  C CE   . LYS A 1 10 ? -16.277 -7.070  12.185  1.00 0.00 ? 10 LYS A CE   9  
ATOM 9312  N NZ   . LYS A 1 10 ? -16.310 -8.196  13.159  1.00 0.00 ? 10 LYS A NZ   9  
ATOM 9313  H H    . LYS A 1 10 ? -17.149 -3.374  10.754  1.00 0.00 ? 10 LYS A H    9  
ATOM 9314  H HA   . LYS A 1 10 ? -14.526 -2.521  10.519  1.00 0.00 ? 10 LYS A HA   9  
ATOM 9315  H HB2  . LYS A 1 10 ? -15.664 -5.245  9.861   1.00 0.00 ? 10 LYS A HB2  9  
ATOM 9316  H HB3  . LYS A 1 10 ? -13.959 -4.898  10.124  1.00 0.00 ? 10 LYS A HB3  9  
ATOM 9317  H HG2  . LYS A 1 10 ? -14.422 -4.256  12.419  1.00 0.00 ? 10 LYS A HG2  9  
ATOM 9318  H HG3  . LYS A 1 10 ? -16.146 -4.537  12.164  1.00 0.00 ? 10 LYS A HG3  9  
ATOM 9319  H HD2  . LYS A 1 10 ? -14.268 -6.757  11.548  1.00 0.00 ? 10 LYS A HD2  9  
ATOM 9320  H HD3  . LYS A 1 10 ? -14.563 -6.373  13.246  1.00 0.00 ? 10 LYS A HD3  9  
ATOM 9321  H HE2  . LYS A 1 10 ? -17.083 -6.388  12.409  1.00 0.00 ? 10 LYS A HE2  9  
ATOM 9322  H HE3  . LYS A 1 10 ? -16.406 -7.463  11.187  1.00 0.00 ? 10 LYS A HE3  9  
ATOM 9323  H HZ1  . LYS A 1 10 ? -15.764 -9.001  12.792  1.00 0.00 ? 10 LYS A HZ1  9  
ATOM 9324  H HZ2  . LYS A 1 10 ? -17.291 -8.501  13.318  1.00 0.00 ? 10 LYS A HZ2  9  
ATOM 9325  H HZ3  . LYS A 1 10 ? -15.900 -7.896  14.066  1.00 0.00 ? 10 LYS A HZ3  9  
ATOM 9326  N N    . ARG A 1 11 ? -14.158 -1.961  8.129   1.00 0.00 ? 11 ARG A N    9  
ATOM 9327  C CA   . ARG A 1 11 ? -13.807 -1.700  6.739   1.00 0.00 ? 11 ARG A CA   9  
ATOM 9328  C C    . ARG A 1 11 ? -12.308 -1.458  6.592   1.00 0.00 ? 11 ARG A C    9  
ATOM 9329  O O    . ARG A 1 11 ? -11.587 -1.348  7.584   1.00 0.00 ? 11 ARG A O    9  
ATOM 9330  C CB   . ARG A 1 11 ? -14.583 -0.491  6.213   1.00 0.00 ? 11 ARG A CB   9  
ATOM 9331  C CG   . ARG A 1 11 ? -14.896 -0.567  4.727   1.00 0.00 ? 11 ARG A CG   9  
ATOM 9332  C CD   . ARG A 1 11 ? -16.194 0.150   4.394   1.00 0.00 ? 11 ARG A CD   9  
ATOM 9333  N NE   . ARG A 1 11 ? -17.337 -0.434  5.091   1.00 0.00 ? 11 ARG A NE   9  
ATOM 9334  C CZ   . ARG A 1 11 ? -17.852 -1.621  4.792   1.00 0.00 ? 11 ARG A CZ   9  
ATOM 9335  N NH1  . ARG A 1 11 ? -17.330 -2.346  3.813   1.00 0.00 ? 11 ARG A NH1  9  
ATOM 9336  N NH2  . ARG A 1 11 ? -18.893 -2.085  5.472   1.00 0.00 ? 11 ARG A NH2  9  
ATOM 9337  H H    . ARG A 1 11 ? -13.835 -1.351  8.826   1.00 0.00 ? 11 ARG A H    9  
ATOM 9338  H HA   . ARG A 1 11 ? -14.078 -2.570  6.159   1.00 0.00 ? 11 ARG A HA   9  
ATOM 9339  H HB2  . ARG A 1 11 ? -15.517 -0.415  6.751   1.00 0.00 ? 11 ARG A HB2  9  
ATOM 9340  H HB3  . ARG A 1 11 ? -14.001 0.400   6.391   1.00 0.00 ? 11 ARG A HB3  9  
ATOM 9341  H HG2  . ARG A 1 11 ? -14.090 -0.105  4.175   1.00 0.00 ? 11 ARG A HG2  9  
ATOM 9342  H HG3  . ARG A 1 11 ? -14.983 -1.604  4.440   1.00 0.00 ? 11 ARG A HG3  9  
ATOM 9343  H HD2  . ARG A 1 11 ? -16.102 1.187   4.681   1.00 0.00 ? 11 ARG A HD2  9  
ATOM 9344  H HD3  . ARG A 1 11 ? -16.363 0.085   3.329   1.00 0.00 ? 11 ARG A HD3  9  
ATOM 9345  H HE   . ARG A 1 11 ? -17.739 0.085   5.818   1.00 0.00 ? 11 ARG A HE   9  
ATOM 9346  H HH11 . ARG A 1 11 ? -16.545 -2.000  3.299   1.00 0.00 ? 11 ARG A HH11 9  
ATOM 9347  H HH12 . ARG A 1 11 ? -17.719 -3.241  3.590   1.00 0.00 ? 11 ARG A HH12 9  
ATOM 9348  H HH21 . ARG A 1 11 ? -19.289 -1.541  6.211   1.00 0.00 ? 11 ARG A HH21 9  
ATOM 9349  H HH22 . ARG A 1 11 ? -19.280 -2.978  5.246   1.00 0.00 ? 11 ARG A HH22 9  
ATOM 9350  N N    . ILE A 1 12 ? -11.845 -1.378  5.349   1.00 0.00 ? 12 ILE A N    9  
ATOM 9351  C CA   . ILE A 1 12 ? -10.432 -1.149  5.073   1.00 0.00 ? 12 ILE A CA   9  
ATOM 9352  C C    . ILE A 1 12 ? -10.094 0.337   5.134   1.00 0.00 ? 12 ILE A C    9  
ATOM 9353  O O    . ILE A 1 12 ? -10.811 1.184   4.602   1.00 0.00 ? 12 ILE A O    9  
ATOM 9354  C CB   . ILE A 1 12 ? -10.032 -1.699  3.691   1.00 0.00 ? 12 ILE A CB   9  
ATOM 9355  C CG1  . ILE A 1 12 ? -10.362 -3.190  3.596   1.00 0.00 ? 12 ILE A CG1  9  
ATOM 9356  C CG2  . ILE A 1 12 ? -8.551  -1.461  3.436   1.00 0.00 ? 12 ILE A CG2  9  
ATOM 9357  C CD1  . ILE A 1 12 ? -9.666  -4.031  4.642   1.00 0.00 ? 12 ILE A CD1  9  
ATOM 9358  H H    . ILE A 1 12 ? -12.469 -1.474  4.600   1.00 0.00 ? 12 ILE A H    9  
ATOM 9359  H HA   . ILE A 1 12 ? -9.858  -1.670  5.826   1.00 0.00 ? 12 ILE A HA   9  
ATOM 9360  H HB   . ILE A 1 12 ? -10.593 -1.164  2.940   1.00 0.00 ? 12 ILE A HB   9  
ATOM 9361  H HG12 . ILE A 1 12 ? -11.426 -3.325  3.717   1.00 0.00 ? 12 ILE A HG12 9  
ATOM 9362  H HG13 . ILE A 1 12 ? -10.065 -3.555  2.623   1.00 0.00 ? 12 ILE A HG13 9  
ATOM 9363  H HG21 . ILE A 1 12 ? -8.308  -1.761  2.427   1.00 0.00 ? 12 ILE A HG21 9  
ATOM 9364  H HG22 . ILE A 1 12 ? -8.328  -0.413  3.562   1.00 0.00 ? 12 ILE A HG22 9  
ATOM 9365  H HG23 . ILE A 1 12 ? -7.967  -2.041  4.134   1.00 0.00 ? 12 ILE A HG23 9  
ATOM 9366  H HD11 . ILE A 1 12 ? -8.964  -3.419  5.188   1.00 0.00 ? 12 ILE A HD11 9  
ATOM 9367  H HD12 . ILE A 1 12 ? -10.397 -4.437  5.324   1.00 0.00 ? 12 ILE A HD12 9  
ATOM 9368  H HD13 . ILE A 1 12 ? -9.136  -4.840  4.159   1.00 0.00 ? 12 ILE A HD13 9  
ATOM 9369  N N    . PRO A 1 13 ? -8.975  0.662   5.798   1.00 0.00 ? 13 PRO A N    9  
ATOM 9370  C CA   . PRO A 1 13 ? -8.514  2.046   5.943   1.00 0.00 ? 13 PRO A CA   9  
ATOM 9371  C C    . PRO A 1 13 ? -7.791  2.549   4.698   1.00 0.00 ? 13 PRO A C    9  
ATOM 9372  O O    . PRO A 1 13 ? -7.790  1.889   3.659   1.00 0.00 ? 13 PRO A O    9  
ATOM 9373  C CB   . PRO A 1 13 ? -7.550  1.976   7.129   1.00 0.00 ? 13 PRO A CB   9  
ATOM 9374  C CG   . PRO A 1 13 ? -7.033  0.579   7.117   1.00 0.00 ? 13 PRO A CG   9  
ATOM 9375  C CD   . PRO A 1 13 ? -8.072  -0.297  6.457   1.00 0.00 ? 13 PRO A CD   9  
ATOM 9376  H HA   . PRO A 1 13 ? -9.330  2.713   6.178   1.00 0.00 ? 13 PRO A HA   9  
ATOM 9377  H HB2  . PRO A 1 13 ? -6.753  2.694   6.992   1.00 0.00 ? 13 PRO A HB2  9  
ATOM 9378  H HB3  . PRO A 1 13 ? -8.082  2.192   8.043   1.00 0.00 ? 13 PRO A HB3  9  
ATOM 9379  H HG2  . PRO A 1 13 ? -6.132  0.526   6.526   1.00 0.00 ? 13 PRO A HG2  9  
ATOM 9380  H HG3  . PRO A 1 13 ? -6.841  0.250   8.127   1.00 0.00 ? 13 PRO A HG3  9  
ATOM 9381  H HD2  . PRO A 1 13 ? -7.569  -0.916  5.730   1.00 0.00 ? 13 PRO A HD2  9  
ATOM 9382  H HD3  . PRO A 1 13 ? -8.611  -0.907  7.167   1.00 0.00 ? 13 PRO A HD3  9  
ATOM 9383  N N    . TYR A 1 14 ? -7.177  3.722   4.810   1.00 0.00 ? 14 TYR A N    9  
ATOM 9384  C CA   . TYR A 1 14 ? -6.452  4.315   3.692   1.00 0.00 ? 14 TYR A CA   9  
ATOM 9385  C C    . TYR A 1 14 ? -7.402  4.668   2.552   1.00 0.00 ? 14 TYR A C    9  
ATOM 9386  O O    . TYR A 1 14 ? -7.999  3.788   1.931   1.00 0.00 ? 14 TYR A O    9  
ATOM 9387  C CB   . TYR A 1 14 ? -5.372  3.355   3.191   1.00 0.00 ? 14 TYR A CB   9  
ATOM 9388  C CG   . TYR A 1 14 ? -4.651  2.622   4.300   1.00 0.00 ? 14 TYR A CG   9  
ATOM 9389  C CD1  . TYR A 1 14 ? -4.127  3.310   5.388   1.00 0.00 ? 14 TYR A CD1  9  
ATOM 9390  C CD2  . TYR A 1 14 ? -4.494  1.242   4.261   1.00 0.00 ? 14 TYR A CD2  9  
ATOM 9391  C CE1  . TYR A 1 14 ? -3.467  2.644   6.403   1.00 0.00 ? 14 TYR A CE1  9  
ATOM 9392  C CE2  . TYR A 1 14 ? -3.837  0.568   5.272   1.00 0.00 ? 14 TYR A CE2  9  
ATOM 9393  C CZ   . TYR A 1 14 ? -3.325  1.274   6.341   1.00 0.00 ? 14 TYR A CZ   9  
ATOM 9394  O OH   . TYR A 1 14 ? -2.670  0.607   7.351   1.00 0.00 ? 14 TYR A OH   9  
ATOM 9395  H H    . TYR A 1 14 ? -7.213  4.201   5.664   1.00 0.00 ? 14 TYR A H    9  
ATOM 9396  H HA   . TYR A 1 14 ? -5.980  5.220   4.046   1.00 0.00 ? 14 TYR A HA   9  
ATOM 9397  H HB2  . TYR A 1 14 ? -5.825  2.617   2.548   1.00 0.00 ? 14 TYR A HB2  9  
ATOM 9398  H HB3  . TYR A 1 14 ? -4.637  3.912   2.629   1.00 0.00 ? 14 TYR A HB3  9  
ATOM 9399  H HD1  . TYR A 1 14 ? -4.241  4.383   5.434   1.00 0.00 ? 14 TYR A HD1  9  
ATOM 9400  H HD2  . TYR A 1 14 ? -4.897  0.692   3.422   1.00 0.00 ? 14 TYR A HD2  9  
ATOM 9401  H HE1  . TYR A 1 14 ? -3.067  3.197   7.241   1.00 0.00 ? 14 TYR A HE1  9  
ATOM 9402  H HE2  . TYR A 1 14 ? -3.725  -0.505  5.224   1.00 0.00 ? 14 TYR A HE2  9  
ATOM 9403  H HH   . TYR A 1 14 ? -3.074  -0.254  7.480   1.00 0.00 ? 14 TYR A HH   9  
ATOM 9404  N N    . SER A 1 15 ? -7.538  5.963   2.283   1.00 0.00 ? 15 SER A N    9  
ATOM 9405  C CA   . SER A 1 15 ? -8.418  6.434   1.220   1.00 0.00 ? 15 SER A CA   9  
ATOM 9406  C C    . SER A 1 15 ? -7.971  5.893   -0.135  1.00 0.00 ? 15 SER A C    9  
ATOM 9407  O O    . SER A 1 15 ? -6.879  5.341   -0.267  1.00 0.00 ? 15 SER A O    9  
ATOM 9408  C CB   . SER A 1 15 ? -8.440  7.964   1.189   1.00 0.00 ? 15 SER A CB   9  
ATOM 9409  O OG   . SER A 1 15 ? -9.657  8.445   0.647   1.00 0.00 ? 15 SER A OG   9  
ATOM 9410  H H    . SER A 1 15 ? -7.036  6.616   2.814   1.00 0.00 ? 15 SER A H    9  
ATOM 9411  H HA   . SER A 1 15 ? -9.413  6.073   1.429   1.00 0.00 ? 15 SER A HA   9  
ATOM 9412  H HB2  . SER A 1 15 ? -8.332  8.343   2.194   1.00 0.00 ? 15 SER A HB2  9  
ATOM 9413  H HB3  . SER A 1 15 ? -7.622  8.321   0.580   1.00 0.00 ? 15 SER A HB3  9  
ATOM 9414  H HG   . SER A 1 15 ? -9.552  9.364   0.389   1.00 0.00 ? 15 SER A HG   9  
ATOM 9415  N N    . LYS A 1 16 ? -8.825  6.056   -1.140  1.00 0.00 ? 16 LYS A N    9  
ATOM 9416  C CA   . LYS A 1 16 ? -8.521  5.587   -2.486  1.00 0.00 ? 16 LYS A CA   9  
ATOM 9417  C C    . LYS A 1 16 ? -7.156  6.091   -2.943  1.00 0.00 ? 16 LYS A C    9  
ATOM 9418  O O    . LYS A 1 16 ? -6.463  5.426   -3.712  1.00 0.00 ? 16 LYS A O    9  
ATOM 9419  C CB   . LYS A 1 16 ? -9.602  6.049   -3.466  1.00 0.00 ? 16 LYS A CB   9  
ATOM 9420  C CG   . LYS A 1 16 ? -10.872 5.219   -3.406  1.00 0.00 ? 16 LYS A CG   9  
ATOM 9421  C CD   . LYS A 1 16 ? -10.695 3.878   -4.098  1.00 0.00 ? 16 LYS A CD   9  
ATOM 9422  C CE   . LYS A 1 16 ? -11.746 2.875   -3.648  1.00 0.00 ? 16 LYS A CE   9  
ATOM 9423  N NZ   . LYS A 1 16 ? -11.861 1.729   -4.592  1.00 0.00 ? 16 LYS A NZ   9  
ATOM 9424  H H    . LYS A 1 16 ? -9.681  6.505   -0.972  1.00 0.00 ? 16 LYS A H    9  
ATOM 9425  H HA   . LYS A 1 16 ? -8.504  4.508   -2.465  1.00 0.00 ? 16 LYS A HA   9  
ATOM 9426  H HB2  . LYS A 1 16 ? -9.856  7.075   -3.245  1.00 0.00 ? 16 LYS A HB2  9  
ATOM 9427  H HB3  . LYS A 1 16 ? -9.207  5.993   -4.471  1.00 0.00 ? 16 LYS A HB3  9  
ATOM 9428  H HG2  . LYS A 1 16 ? -11.130 5.046   -2.372  1.00 0.00 ? 16 LYS A HG2  9  
ATOM 9429  H HG3  . LYS A 1 16 ? -11.670 5.762   -3.892  1.00 0.00 ? 16 LYS A HG3  9  
ATOM 9430  H HD2  . LYS A 1 16 ? -10.783 4.019   -5.166  1.00 0.00 ? 16 LYS A HD2  9  
ATOM 9431  H HD3  . LYS A 1 16 ? -9.715  3.488   -3.864  1.00 0.00 ? 16 LYS A HD3  9  
ATOM 9432  H HE2  . LYS A 1 16 ? -11.473 2.501   -2.673  1.00 0.00 ? 16 LYS A HE2  9  
ATOM 9433  H HE3  . LYS A 1 16 ? -12.701 3.377   -3.586  1.00 0.00 ? 16 LYS A HE3  9  
ATOM 9434  H HZ1  . LYS A 1 16 ? -11.464 0.870   -4.161  1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 9435  H HZ2  . LYS A 1 16 ? -11.341 1.936   -5.469  1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 9436  H HZ3  . LYS A 1 16 ? -12.860 1.558   -4.827  1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 9437  N N    . GLY A 1 17 ? -6.775  7.272   -2.464  1.00 0.00 ? 17 GLY A N    9  
ATOM 9438  C CA   . GLY A 1 17 ? -5.494  7.844   -2.833  1.00 0.00 ? 17 GLY A CA   9  
ATOM 9439  C C    . GLY A 1 17 ? -4.331  7.155   -2.148  1.00 0.00 ? 17 GLY A C    9  
ATOM 9440  O O    . GLY A 1 17 ? -3.255  7.017   -2.727  1.00 0.00 ? 17 GLY A O    9  
ATOM 9441  H H    . GLY A 1 17 ? -7.369  7.758   -1.854  1.00 0.00 ? 17 GLY A H    9  
ATOM 9442  H HA2  . GLY A 1 17 ? -5.369  7.760   -3.902  1.00 0.00 ? 17 GLY A HA2  9  
ATOM 9443  H HA3  . GLY A 1 17 ? -5.488  8.890   -2.562  1.00 0.00 ? 17 GLY A HA3  9  
ATOM 9444  N N    . GLN A 1 18 ? -4.548  6.723   -0.909  1.00 0.00 ? 18 GLN A N    9  
ATOM 9445  C CA   . GLN A 1 18 ? -3.508  6.046   -0.144  1.00 0.00 ? 18 GLN A CA   9  
ATOM 9446  C C    . GLN A 1 18 ? -3.389  4.584   -0.560  1.00 0.00 ? 18 GLN A C    9  
ATOM 9447  O O    . GLN A 1 18 ? -2.306  4.000   -0.511  1.00 0.00 ? 18 GLN A O    9  
ATOM 9448  C CB   . GLN A 1 18 ? -3.805  6.140   1.354   1.00 0.00 ? 18 GLN A CB   9  
ATOM 9449  C CG   . GLN A 1 18 ? -3.609  7.534   1.927   1.00 0.00 ? 18 GLN A CG   9  
ATOM 9450  C CD   . GLN A 1 18 ? -3.858  7.591   3.422   1.00 0.00 ? 18 GLN A CD   9  
ATOM 9451  O OE1  . GLN A 1 18 ? -4.999  7.499   3.876   1.00 0.00 ? 18 GLN A OE1  9  
ATOM 9452  N NE2  . GLN A 1 18 ? -2.789  7.742   4.195   1.00 0.00 ? 18 GLN A NE2  9  
ATOM 9453  H H    . GLN A 1 18 ? -5.428  6.863   -0.502  1.00 0.00 ? 18 GLN A H    9  
ATOM 9454  H HA   . GLN A 1 18 ? -2.571  6.543   -0.347  1.00 0.00 ? 18 GLN A HA   9  
ATOM 9455  H HB2  . GLN A 1 18 ? -4.830  5.845   1.525   1.00 0.00 ? 18 GLN A HB2  9  
ATOM 9456  H HB3  . GLN A 1 18 ? -3.151  5.462   1.882   1.00 0.00 ? 18 GLN A HB3  9  
ATOM 9457  H HG2  . GLN A 1 18 ? -2.594  7.848   1.736   1.00 0.00 ? 18 GLN A HG2  9  
ATOM 9458  H HG3  . GLN A 1 18 ? -4.293  8.211   1.437   1.00 0.00 ? 18 GLN A HG3  9  
ATOM 9459  H HE21 . GLN A 1 18 ? -1.912  7.810   3.763   1.00 0.00 ? 18 GLN A HE21 9  
ATOM 9460  H HE22 . GLN A 1 18 ? -2.922  7.783   5.164   1.00 0.00 ? 18 GLN A HE22 9  
ATOM 9461  N N    . LEU A 1 19 ? -4.509  3.998   -0.970  1.00 0.00 ? 19 LEU A N    9  
ATOM 9462  C CA   . LEU A 1 19 ? -4.531  2.603   -1.395  1.00 0.00 ? 19 LEU A CA   9  
ATOM 9463  C C    . LEU A 1 19 ? -3.975  2.455   -2.808  1.00 0.00 ? 19 LEU A C    9  
ATOM 9464  O O    . LEU A 1 19 ? -3.600  1.360   -3.227  1.00 0.00 ? 19 LEU A O    9  
ATOM 9465  C CB   . LEU A 1 19 ? -5.958  2.054   -1.337  1.00 0.00 ? 19 LEU A CB   9  
ATOM 9466  C CG   . LEU A 1 19 ? -6.550  1.873   0.061   1.00 0.00 ? 19 LEU A CG   9  
ATOM 9467  C CD1  . LEU A 1 19 ? -8.051  1.644   -0.021  1.00 0.00 ? 19 LEU A CD1  9  
ATOM 9468  C CD2  . LEU A 1 19 ? -5.871  0.719   0.783   1.00 0.00 ? 19 LEU A CD2  9  
ATOM 9469  H H    . LEU A 1 19 ? -5.341  4.515   -0.987  1.00 0.00 ? 19 LEU A H    9  
ATOM 9470  H HA   . LEU A 1 19 ? -3.909  2.040   -0.716  1.00 0.00 ? 19 LEU A HA   9  
ATOM 9471  H HB2  . LEU A 1 19 ? -6.596  2.733   -1.881  1.00 0.00 ? 19 LEU A HB2  9  
ATOM 9472  H HB3  . LEU A 1 19 ? -5.960  1.090   -1.826  1.00 0.00 ? 19 LEU A HB3  9  
ATOM 9473  H HG   . LEU A 1 19 ? -6.382  2.774   0.636   1.00 0.00 ? 19 LEU A HG   9  
ATOM 9474  H HD11 . LEU A 1 19 ? -8.243  0.645   -0.383  1.00 0.00 ? 19 LEU A HD11 9  
ATOM 9475  H HD12 . LEU A 1 19 ? -8.489  2.362   -0.698  1.00 0.00 ? 19 LEU A HD12 9  
ATOM 9476  H HD13 . LEU A 1 19 ? -8.488  1.762   0.960   1.00 0.00 ? 19 LEU A HD13 9  
ATOM 9477  H HD21 . LEU A 1 19 ? -4.807  0.898   0.827   1.00 0.00 ? 19 LEU A HD21 9  
ATOM 9478  H HD22 . LEU A 1 19 ? -6.060  -0.201  0.249   1.00 0.00 ? 19 LEU A HD22 9  
ATOM 9479  H HD23 . LEU A 1 19 ? -6.264  0.640   1.786   1.00 0.00 ? 19 LEU A HD23 9  
ATOM 9480  N N    . ARG A 1 20 ? -3.922  3.566   -3.536  1.00 0.00 ? 20 ARG A N    9  
ATOM 9481  C CA   . ARG A 1 20 ? -3.410  3.560   -4.902  1.00 0.00 ? 20 ARG A CA   9  
ATOM 9482  C C    . ARG A 1 20 ? -1.945  3.136   -4.931  1.00 0.00 ? 20 ARG A C    9  
ATOM 9483  O O    . ARG A 1 20 ? -1.534  2.348   -5.782  1.00 0.00 ? 20 ARG A O    9  
ATOM 9484  C CB   . ARG A 1 20 ? -3.564  4.945   -5.532  1.00 0.00 ? 20 ARG A CB   9  
ATOM 9485  C CG   . ARG A 1 20 ? -3.708  4.913   -7.045  1.00 0.00 ? 20 ARG A CG   9  
ATOM 9486  C CD   . ARG A 1 20 ? -4.083  6.279   -7.598  1.00 0.00 ? 20 ARG A CD   9  
ATOM 9487  N NE   . ARG A 1 20 ? -4.061  6.303   -9.058  1.00 0.00 ? 20 ARG A NE   9  
ATOM 9488  C CZ   . ARG A 1 20 ? -5.051  5.842   -9.816  1.00 0.00 ? 20 ARG A CZ   9  
ATOM 9489  N NH1  . ARG A 1 20 ? -6.135  5.325   -9.253  1.00 0.00 ? 20 ARG A NH1  9  
ATOM 9490  N NH2  . ARG A 1 20 ? -4.958  5.899   -11.138 1.00 0.00 ? 20 ARG A NH2  9  
ATOM 9491  H H    . ARG A 1 20 ? -4.235  4.409   -3.147  1.00 0.00 ? 20 ARG A H    9  
ATOM 9492  H HA   . ARG A 1 20 ? -3.990  2.849   -5.470  1.00 0.00 ? 20 ARG A HA   9  
ATOM 9493  H HB2  . ARG A 1 20 ? -4.442  5.420   -5.120  1.00 0.00 ? 20 ARG A HB2  9  
ATOM 9494  H HB3  . ARG A 1 20 ? -2.696  5.537   -5.287  1.00 0.00 ? 20 ARG A HB3  9  
ATOM 9495  H HG2  . ARG A 1 20 ? -2.768  4.606   -7.480  1.00 0.00 ? 20 ARG A HG2  9  
ATOM 9496  H HG3  . ARG A 1 20 ? -4.478  4.203   -7.309  1.00 0.00 ? 20 ARG A HG3  9  
ATOM 9497  H HD2  . ARG A 1 20 ? -5.076  6.530   -7.259  1.00 0.00 ? 20 ARG A HD2  9  
ATOM 9498  H HD3  . ARG A 1 20 ? -3.380  7.009   -7.225  1.00 0.00 ? 20 ARG A HD3  9  
ATOM 9499  H HE   . ARG A 1 20 ? -3.270  6.680   -9.495  1.00 0.00 ? 20 ARG A HE   9  
ATOM 9500  H HH11 . ARG A 1 20 ? -6.208  5.282   -8.257  1.00 0.00 ? 20 ARG A HH11 9  
ATOM 9501  H HH12 . ARG A 1 20 ? -6.879  4.980   -9.826  1.00 0.00 ? 20 ARG A HH12 9  
ATOM 9502  H HH21 . ARG A 1 20 ? -4.142  6.288   -11.565 1.00 0.00 ? 20 ARG A HH21 9  
ATOM 9503  H HH22 . ARG A 1 20 ? -5.703  5.552   -11.707 1.00 0.00 ? 20 ARG A HH22 9  
ATOM 9504  N N    . GLU A 1 21 ? -1.162  3.665   -3.996  1.00 0.00 ? 21 GLU A N    9  
ATOM 9505  C CA   . GLU A 1 21 ? 0.258   3.342   -3.916  1.00 0.00 ? 21 GLU A CA   9  
ATOM 9506  C C    . GLU A 1 21 ? 0.471   1.984   -3.254  1.00 0.00 ? 21 GLU A C    9  
ATOM 9507  O O    . GLU A 1 21 ? 1.406   1.256   -3.590  1.00 0.00 ? 21 GLU A O    9  
ATOM 9508  C CB   . GLU A 1 21 ? 1.007   4.425   -3.138  1.00 0.00 ? 21 GLU A CB   9  
ATOM 9509  C CG   . GLU A 1 21 ? 0.681   5.838   -3.592  1.00 0.00 ? 21 GLU A CG   9  
ATOM 9510  C CD   . GLU A 1 21 ? -0.460  6.455   -2.806  1.00 0.00 ? 21 GLU A CD   9  
ATOM 9511  O OE1  . GLU A 1 21 ? -1.120  5.719   -2.043  1.00 0.00 ? 21 GLU A OE1  9  
ATOM 9512  O OE2  . GLU A 1 21 ? -0.693  7.672   -2.955  1.00 0.00 ? 21 GLU A OE2  9  
ATOM 9513  H H    . GLU A 1 21 ? -1.548  4.287   -3.345  1.00 0.00 ? 21 GLU A H    9  
ATOM 9514  H HA   . GLU A 1 21 ? 0.646   3.303   -4.923  1.00 0.00 ? 21 GLU A HA   9  
ATOM 9515  H HB2  . GLU A 1 21 ? 0.756   4.338   -2.091  1.00 0.00 ? 21 GLU A HB2  9  
ATOM 9516  H HB3  . GLU A 1 21 ? 2.069   4.268   -3.257  1.00 0.00 ? 21 GLU A HB3  9  
ATOM 9517  H HG2  . GLU A 1 21 ? 1.558   6.455   -3.467  1.00 0.00 ? 21 GLU A HG2  9  
ATOM 9518  H HG3  . GLU A 1 21 ? 0.407   5.812   -4.637  1.00 0.00 ? 21 GLU A HG3  9  
ATOM 9519  N N    . LEU A 1 22 ? -0.402  1.650   -2.310  1.00 0.00 ? 22 LEU A N    9  
ATOM 9520  C CA   . LEU A 1 22 ? -0.311  0.380   -1.598  1.00 0.00 ? 22 LEU A CA   9  
ATOM 9521  C C    . LEU A 1 22 ? -0.641  -0.787  -2.523  1.00 0.00 ? 22 LEU A C    9  
ATOM 9522  O O    . LEU A 1 22 ? -0.082  -1.875  -2.388  1.00 0.00 ? 22 LEU A O    9  
ATOM 9523  C CB   . LEU A 1 22 ? -1.258  0.377   -0.397  1.00 0.00 ? 22 LEU A CB   9  
ATOM 9524  C CG   . LEU A 1 22 ? -0.881  1.306   0.757   1.00 0.00 ? 22 LEU A CG   9  
ATOM 9525  C CD1  . LEU A 1 22 ? -2.059  1.491   1.701   1.00 0.00 ? 22 LEU A CD1  9  
ATOM 9526  C CD2  . LEU A 1 22 ? 0.325   0.762   1.508   1.00 0.00 ? 22 LEU A CD2  9  
ATOM 9527  H H    . LEU A 1 22 ? -1.126  2.271   -2.086  1.00 0.00 ? 22 LEU A H    9  
ATOM 9528  H HA   . LEU A 1 22 ? 0.704   0.269   -1.247  1.00 0.00 ? 22 LEU A HA   9  
ATOM 9529  H HB2  . LEU A 1 22 ? -2.237  0.665   -0.747  1.00 0.00 ? 22 LEU A HB2  9  
ATOM 9530  H HB3  . LEU A 1 22 ? -1.298  -0.632  -0.011  1.00 0.00 ? 22 LEU A HB3  9  
ATOM 9531  H HG   . LEU A 1 22 ? -0.618  2.276   0.359   1.00 0.00 ? 22 LEU A HG   9  
ATOM 9532  H HD11 . LEU A 1 22 ? -2.444  0.524   1.990   1.00 0.00 ? 22 LEU A HD11 9  
ATOM 9533  H HD12 . LEU A 1 22 ? -2.835  2.052   1.202   1.00 0.00 ? 22 LEU A HD12 9  
ATOM 9534  H HD13 . LEU A 1 22 ? -1.736  2.028   2.580   1.00 0.00 ? 22 LEU A HD13 9  
ATOM 9535  H HD21 . LEU A 1 22 ? 0.616   -0.187  1.081   1.00 0.00 ? 22 LEU A HD21 9  
ATOM 9536  H HD22 . LEU A 1 22 ? 0.070   0.625   2.549   1.00 0.00 ? 22 LEU A HD22 9  
ATOM 9537  H HD23 . LEU A 1 22 ? 1.145   1.460   1.427   1.00 0.00 ? 22 LEU A HD23 9  
ATOM 9538  N N    . GLU A 1 23 ? -1.551  -0.552  -3.464  1.00 0.00 ? 23 GLU A N    9  
ATOM 9539  C CA   . GLU A 1 23 ? -1.953  -1.584  -4.412  1.00 0.00 ? 23 GLU A CA   9  
ATOM 9540  C C    . GLU A 1 23 ? -0.973  -1.663  -5.579  1.00 0.00 ? 23 GLU A C    9  
ATOM 9541  O O    . GLU A 1 23 ? -0.607  -2.750  -6.024  1.00 0.00 ? 23 GLU A O    9  
ATOM 9542  C CB   . GLU A 1 23 ? -3.364  -1.307  -4.934  1.00 0.00 ? 23 GLU A CB   9  
ATOM 9543  C CG   . GLU A 1 23 ? -4.460  -1.652  -3.939  1.00 0.00 ? 23 GLU A CG   9  
ATOM 9544  C CD   . GLU A 1 23 ? -4.962  -3.074  -4.095  1.00 0.00 ? 23 GLU A CD   9  
ATOM 9545  O OE1  . GLU A 1 23 ? -4.312  -3.856  -4.820  1.00 0.00 ? 23 GLU A OE1  9  
ATOM 9546  O OE2  . GLU A 1 23 ? -6.004  -3.405  -3.492  1.00 0.00 ? 23 GLU A OE2  9  
ATOM 9547  H H    . GLU A 1 23 ? -1.961  0.336   -3.521  1.00 0.00 ? 23 GLU A H    9  
ATOM 9548  H HA   . GLU A 1 23 ? -1.951  -2.531  -3.892  1.00 0.00 ? 23 GLU A HA   9  
ATOM 9549  H HB2  . GLU A 1 23 ? -3.445  -0.258  -5.178  1.00 0.00 ? 23 GLU A HB2  9  
ATOM 9550  H HB3  . GLU A 1 23 ? -3.524  -1.888  -5.829  1.00 0.00 ? 23 GLU A HB3  9  
ATOM 9551  H HG2  . GLU A 1 23 ? -4.072  -1.531  -2.939  1.00 0.00 ? 23 GLU A HG2  9  
ATOM 9552  H HG3  . GLU A 1 23 ? -5.288  -0.975  -4.086  1.00 0.00 ? 23 GLU A HG3  9  
ATOM 9553  N N    . ARG A 1 24 ? -0.554  -0.501  -6.071  1.00 0.00 ? 24 ARG A N    9  
ATOM 9554  C CA   . ARG A 1 24 ? 0.381   -0.437  -7.187  1.00 0.00 ? 24 ARG A CA   9  
ATOM 9555  C C    . ARG A 1 24 ? 1.703   -1.111  -6.829  1.00 0.00 ? 24 ARG A C    9  
ATOM 9556  O O    . ARG A 1 24 ? 2.174   -1.994  -7.545  1.00 0.00 ? 24 ARG A O    9  
ATOM 9557  C CB   . ARG A 1 24 ? 0.631   1.018   -7.588  1.00 0.00 ? 24 ARG A CB   9  
ATOM 9558  C CG   . ARG A 1 24 ? -0.362  1.547   -8.610  1.00 0.00 ? 24 ARG A CG   9  
ATOM 9559  C CD   . ARG A 1 24 ? 0.214   2.715   -9.394  1.00 0.00 ? 24 ARG A CD   9  
ATOM 9560  N NE   . ARG A 1 24 ? -0.423  2.866   -10.700 1.00 0.00 ? 24 ARG A NE   9  
ATOM 9561  C CZ   . ARG A 1 24 ? -0.096  2.142   -11.765 1.00 0.00 ? 24 ARG A CZ   9  
ATOM 9562  N NH1  . ARG A 1 24 ? 0.855   1.223   -11.680 1.00 0.00 ? 24 ARG A NH1  9  
ATOM 9563  N NH2  . ARG A 1 24 ? -0.722  2.338   -12.919 1.00 0.00 ? 24 ARG A NH2  9  
ATOM 9564  H H    . ARG A 1 24 ? -0.882  0.333   -5.674  1.00 0.00 ? 24 ARG A H    9  
ATOM 9565  H HA   . ARG A 1 24 ? -0.061  -0.960  -8.021  1.00 0.00 ? 24 ARG A HA   9  
ATOM 9566  H HB2  . ARG A 1 24 ? 0.571   1.638   -6.706  1.00 0.00 ? 24 ARG A HB2  9  
ATOM 9567  H HB3  . ARG A 1 24 ? 1.623   1.098   -8.008  1.00 0.00 ? 24 ARG A HB3  9  
ATOM 9568  H HG2  . ARG A 1 24 ? -0.612  0.754   -9.299  1.00 0.00 ? 24 ARG A HG2  9  
ATOM 9569  H HG3  . ARG A 1 24 ? -1.253  1.874   -8.096  1.00 0.00 ? 24 ARG A HG3  9  
ATOM 9570  H HD2  . ARG A 1 24 ? 0.067   3.621   -8.826  1.00 0.00 ? 24 ARG A HD2  9  
ATOM 9571  H HD3  . ARG A 1 24 ? 1.272   2.548   -9.537  1.00 0.00 ? 24 ARG A HD3  9  
ATOM 9572  H HE   . ARG A 1 24 ? -1.128  3.540   -10.785 1.00 0.00 ? 24 ARG A HE   9  
ATOM 9573  H HH11 . ARG A 1 24 ? 1.328   1.073   -10.811 1.00 0.00 ? 24 ARG A HH11 9  
ATOM 9574  H HH12 . ARG A 1 24 ? 1.099   0.679   -12.483 1.00 0.00 ? 24 ARG A HH12 9  
ATOM 9575  H HH21 . ARG A 1 24 ? -1.440  3.030   -12.987 1.00 0.00 ? 24 ARG A HH21 9  
ATOM 9576  H HH22 . ARG A 1 24 ? -0.475  1.793   -13.720 1.00 0.00 ? 24 ARG A HH22 9  
ATOM 9577  N N    . GLU A 1 25 ? 2.295   -0.687  -5.717  1.00 0.00 ? 25 GLU A N    9  
ATOM 9578  C CA   . GLU A 1 25 ? 3.562   -1.249  -5.265  1.00 0.00 ? 25 GLU A CA   9  
ATOM 9579  C C    . GLU A 1 25 ? 3.433   -2.748  -5.010  1.00 0.00 ? 25 GLU A C    9  
ATOM 9580  O O    . GLU A 1 25 ? 4.361   -3.515  -5.269  1.00 0.00 ? 25 GLU A O    9  
ATOM 9581  C CB   . GLU A 1 25 ? 4.034   -0.543  -3.992  1.00 0.00 ? 25 GLU A CB   9  
ATOM 9582  C CG   . GLU A 1 25 ? 4.849   0.711   -4.258  1.00 0.00 ? 25 GLU A CG   9  
ATOM 9583  C CD   . GLU A 1 25 ? 4.263   1.564   -5.366  1.00 0.00 ? 25 GLU A CD   9  
ATOM 9584  O OE1  . GLU A 1 25 ? 3.391   2.407   -5.069  1.00 0.00 ? 25 GLU A OE1  9  
ATOM 9585  O OE2  . GLU A 1 25 ? 4.677   1.389   -6.532  1.00 0.00 ? 25 GLU A OE2  9  
ATOM 9586  H H    . GLU A 1 25 ? 1.870   0.020   -5.188  1.00 0.00 ? 25 GLU A H    9  
ATOM 9587  H HA   . GLU A 1 25 ? 4.292   -1.091  -6.045  1.00 0.00 ? 25 GLU A HA   9  
ATOM 9588  H HB2  . GLU A 1 25 ? 3.170   -0.269  -3.406  1.00 0.00 ? 25 GLU A HB2  9  
ATOM 9589  H HB3  . GLU A 1 25 ? 4.643   -1.228  -3.420  1.00 0.00 ? 25 GLU A HB3  9  
ATOM 9590  H HG2  . GLU A 1 25 ? 4.887   1.300   -3.354  1.00 0.00 ? 25 GLU A HG2  9  
ATOM 9591  H HG3  . GLU A 1 25 ? 5.851   0.421   -4.539  1.00 0.00 ? 25 GLU A HG3  9  
ATOM 9592  N N    . TYR A 1 26 ? 2.277   -3.158  -4.501  1.00 0.00 ? 26 TYR A N    9  
ATOM 9593  C CA   . TYR A 1 26 ? 2.026   -4.564  -4.208  1.00 0.00 ? 26 TYR A CA   9  
ATOM 9594  C C    . TYR A 1 26 ? 1.946   -5.382  -5.493  1.00 0.00 ? 26 TYR A C    9  
ATOM 9595  O O    . TYR A 1 26 ? 2.575   -6.433  -5.613  1.00 0.00 ? 26 TYR A O    9  
ATOM 9596  C CB   . TYR A 1 26 ? 0.729   -4.717  -3.411  1.00 0.00 ? 26 TYR A CB   9  
ATOM 9597  C CG   . TYR A 1 26 ? 0.288   -6.153  -3.242  1.00 0.00 ? 26 TYR A CG   9  
ATOM 9598  C CD1  . TYR A 1 26 ? 0.927   -6.995  -2.340  1.00 0.00 ? 26 TYR A CD1  9  
ATOM 9599  C CD2  . TYR A 1 26 ? -0.768  -6.668  -3.983  1.00 0.00 ? 26 TYR A CD2  9  
ATOM 9600  C CE1  . TYR A 1 26 ? 0.528   -8.308  -2.183  1.00 0.00 ? 26 TYR A CE1  9  
ATOM 9601  C CE2  . TYR A 1 26 ? -1.175  -7.979  -3.832  1.00 0.00 ? 26 TYR A CE2  9  
ATOM 9602  C CZ   . TYR A 1 26 ? -0.524  -8.796  -2.931  1.00 0.00 ? 26 TYR A CZ   9  
ATOM 9603  O OH   . TYR A 1 26 ? -0.925  -10.103 -2.776  1.00 0.00 ? 26 TYR A OH   9  
ATOM 9604  H H    . TYR A 1 26 ? 1.575   -2.499  -4.316  1.00 0.00 ? 26 TYR A H    9  
ATOM 9605  H HA   . TYR A 1 26 ? 2.849   -4.930  -3.612  1.00 0.00 ? 26 TYR A HA   9  
ATOM 9606  H HB2  . TYR A 1 26 ? 0.867   -4.295  -2.427  1.00 0.00 ? 26 TYR A HB2  9  
ATOM 9607  H HB3  . TYR A 1 26 ? -0.062  -4.184  -3.918  1.00 0.00 ? 26 TYR A HB3  9  
ATOM 9608  H HD1  . TYR A 1 26 ? 1.750   -6.610  -1.755  1.00 0.00 ? 26 TYR A HD1  9  
ATOM 9609  H HD2  . TYR A 1 26 ? -1.276  -6.026  -4.688  1.00 0.00 ? 26 TYR A HD2  9  
ATOM 9610  H HE1  . TYR A 1 26 ? 1.038   -8.948  -1.477  1.00 0.00 ? 26 TYR A HE1  9  
ATOM 9611  H HE2  . TYR A 1 26 ? -1.998  -8.361  -4.417  1.00 0.00 ? 26 TYR A HE2  9  
ATOM 9612  H HH   . TYR A 1 26 ? -1.498  -10.350 -3.506  1.00 0.00 ? 26 TYR A HH   9  
ATOM 9613  N N    . ALA A 1 27 ? 1.166   -4.892  -6.451  1.00 0.00 ? 27 ALA A N    9  
ATOM 9614  C CA   . ALA A 1 27 ? 1.005   -5.575  -7.729  1.00 0.00 ? 27 ALA A CA   9  
ATOM 9615  C C    . ALA A 1 27 ? 2.355   -5.831  -8.389  1.00 0.00 ? 27 ALA A C    9  
ATOM 9616  O O    . ALA A 1 27 ? 2.505   -6.765  -9.177  1.00 0.00 ? 27 ALA A O    9  
ATOM 9617  C CB   . ALA A 1 27 ? 0.110   -4.762  -8.652  1.00 0.00 ? 27 ALA A CB   9  
ATOM 9618  H H    . ALA A 1 27 ? 0.690   -4.050  -6.296  1.00 0.00 ? 27 ALA A H    9  
ATOM 9619  H HA   . ALA A 1 27 ? 0.522   -6.523  -7.541  1.00 0.00 ? 27 ALA A HA   9  
ATOM 9620  H HB1  . ALA A 1 27 ? -0.089  -3.800  -8.204  1.00 0.00 ? 27 ALA A HB1  9  
ATOM 9621  H HB2  . ALA A 1 27 ? 0.605   -4.622  -9.602  1.00 0.00 ? 27 ALA A HB2  9  
ATOM 9622  H HB3  . ALA A 1 27 ? -0.821  -5.288  -8.805  1.00 0.00 ? 27 ALA A HB3  9  
ATOM 9623  N N    . ALA A 1 28 ? 3.336   -4.996  -8.063  1.00 0.00 ? 28 ALA A N    9  
ATOM 9624  C CA   . ALA A 1 28 ? 4.675   -5.133  -8.623  1.00 0.00 ? 28 ALA A CA   9  
ATOM 9625  C C    . ALA A 1 28 ? 5.515   -6.109  -7.806  1.00 0.00 ? 28 ALA A C    9  
ATOM 9626  O O    . ALA A 1 28 ? 6.456   -6.712  -8.319  1.00 0.00 ? 28 ALA A O    9  
ATOM 9627  C CB   . ALA A 1 28 ? 5.359   -3.776  -8.694  1.00 0.00 ? 28 ALA A CB   9  
ATOM 9628  H H    . ALA A 1 28 ? 3.156   -4.271  -7.429  1.00 0.00 ? 28 ALA A H    9  
ATOM 9629  H HA   . ALA A 1 28 ? 4.578   -5.513  -9.630  1.00 0.00 ? 28 ALA A HA   9  
ATOM 9630  H HB1  . ALA A 1 28 ? 5.112   -3.298  -9.631  1.00 0.00 ? 28 ALA A HB1  9  
ATOM 9631  H HB2  . ALA A 1 28 ? 5.021   -3.159  -7.875  1.00 0.00 ? 28 ALA A HB2  9  
ATOM 9632  H HB3  . ALA A 1 28 ? 6.429   -3.909  -8.629  1.00 0.00 ? 28 ALA A HB3  9  
ATOM 9633  N N    . ASN A 1 29 ? 5.168   -6.258  -6.532  1.00 0.00 ? 29 ASN A N    9  
ATOM 9634  C CA   . ASN A 1 29 ? 5.891   -7.160  -5.643  1.00 0.00 ? 29 ASN A CA   9  
ATOM 9635  C C    . ASN A 1 29 ? 5.091   -7.430  -4.372  1.00 0.00 ? 29 ASN A C    9  
ATOM 9636  O O    . ASN A 1 29 ? 4.505   -6.517  -3.789  1.00 0.00 ? 29 ASN A O    9  
ATOM 9637  C CB   . ASN A 1 29 ? 7.256   -6.570  -5.284  1.00 0.00 ? 29 ASN A CB   9  
ATOM 9638  C CG   . ASN A 1 29 ? 7.157   -5.136  -4.801  1.00 0.00 ? 29 ASN A CG   9  
ATOM 9639  O OD1  . ASN A 1 29 ? 7.174   -4.872  -3.598  1.00 0.00 ? 29 ASN A OD1  9  
ATOM 9640  N ND2  . ASN A 1 29 ? 7.052   -4.202  -5.738  1.00 0.00 ? 29 ASN A ND2  9  
ATOM 9641  H H    . ASN A 1 29 ? 4.407   -5.750  -6.180  1.00 0.00 ? 29 ASN A H    9  
ATOM 9642  H HA   . ASN A 1 29 ? 6.038   -8.093  -6.166  1.00 0.00 ? 29 ASN A HA   9  
ATOM 9643  H HB2  . ASN A 1 29 ? 7.703   -7.164  -4.500  1.00 0.00 ? 29 ASN A HB2  9  
ATOM 9644  H HB3  . ASN A 1 29 ? 7.893   -6.594  -6.156  1.00 0.00 ? 29 ASN A HB3  9  
ATOM 9645  H HD21 . ASN A 1 29 ? 7.044   -4.486  -6.677  1.00 0.00 ? 29 ASN A HD21 9  
ATOM 9646  H HD22 . ASN A 1 29 ? 6.987   -3.266  -5.454  1.00 0.00 ? 29 ASN A HD22 9  
ATOM 9647  N N    . LYS A 1 30 ? 5.072   -8.688  -3.947  1.00 0.00 ? 30 LYS A N    9  
ATOM 9648  C CA   . LYS A 1 30 ? 4.346   -9.080  -2.745  1.00 0.00 ? 30 LYS A CA   9  
ATOM 9649  C C    . LYS A 1 30 ? 4.998   -8.488  -1.499  1.00 0.00 ? 30 LYS A C    9  
ATOM 9650  O O    . LYS A 1 30 ? 4.336   -8.265  -0.486  1.00 0.00 ? 30 LYS A O    9  
ATOM 9651  C CB   . LYS A 1 30 ? 4.292   -10.605 -2.630  1.00 0.00 ? 30 LYS A CB   9  
ATOM 9652  C CG   . LYS A 1 30 ? 3.844   -11.295 -3.907  1.00 0.00 ? 30 LYS A CG   9  
ATOM 9653  C CD   . LYS A 1 30 ? 2.399   -10.964 -4.242  1.00 0.00 ? 30 LYS A CD   9  
ATOM 9654  C CE   . LYS A 1 30 ? 2.109   -11.169 -5.721  1.00 0.00 ? 30 LYS A CE   9  
ATOM 9655  N NZ   . LYS A 1 30 ? 1.014   -10.281 -6.200  1.00 0.00 ? 30 LYS A NZ   9  
ATOM 9656  H H    . LYS A 1 30 ? 5.559   -9.371  -4.455  1.00 0.00 ? 30 LYS A H    9  
ATOM 9657  H HA   . LYS A 1 30 ? 3.340   -8.697  -2.825  1.00 0.00 ? 30 LYS A HA   9  
ATOM 9658  H HB2  . LYS A 1 30 ? 5.275   -10.970 -2.374  1.00 0.00 ? 30 LYS A HB2  9  
ATOM 9659  H HB3  . LYS A 1 30 ? 3.602   -10.870 -1.841  1.00 0.00 ? 30 LYS A HB3  9  
ATOM 9660  H HG2  . LYS A 1 30 ? 4.474   -10.970 -4.721  1.00 0.00 ? 30 LYS A HG2  9  
ATOM 9661  H HG3  . LYS A 1 30 ? 3.939   -12.364 -3.780  1.00 0.00 ? 30 LYS A HG3  9  
ATOM 9662  H HD2  . LYS A 1 30 ? 1.749   -11.607 -3.667  1.00 0.00 ? 30 LYS A HD2  9  
ATOM 9663  H HD3  . LYS A 1 30 ? 2.206   -9.932  -3.986  1.00 0.00 ? 30 LYS A HD3  9  
ATOM 9664  H HE2  . LYS A 1 30 ? 3.005   -10.956 -6.283  1.00 0.00 ? 30 LYS A HE2  9  
ATOM 9665  H HE3  . LYS A 1 30 ? 1.821   -12.198 -5.879  1.00 0.00 ? 30 LYS A HE3  9  
ATOM 9666  H HZ1  . LYS A 1 30 ? 0.105   -10.585 -5.796  1.00 0.00 ? 30 LYS A HZ1  9  
ATOM 9667  H HZ2  . LYS A 1 30 ? 0.949   -10.321 -7.237  1.00 0.00 ? 30 LYS A HZ2  9  
ATOM 9668  H HZ3  . LYS A 1 30 ? 1.198   -9.299  -5.912  1.00 0.00 ? 30 LYS A HZ3  9  
ATOM 9669  N N    . PHE A 1 31 ? 6.301   -8.236  -1.582  1.00 0.00 ? 31 PHE A N    9  
ATOM 9670  C CA   . PHE A 1 31 ? 7.043   -7.671  -0.461  1.00 0.00 ? 31 PHE A CA   9  
ATOM 9671  C C    . PHE A 1 31 ? 8.008   -6.589  -0.938  1.00 0.00 ? 31 PHE A C    9  
ATOM 9672  O O    . PHE A 1 31 ? 8.980   -6.875  -1.637  1.00 0.00 ? 31 PHE A O    9  
ATOM 9673  C CB   . PHE A 1 31 ? 7.813   -8.769  0.275   1.00 0.00 ? 31 PHE A CB   9  
ATOM 9674  C CG   . PHE A 1 31 ? 6.932   -9.856  0.820   1.00 0.00 ? 31 PHE A CG   9  
ATOM 9675  C CD1  . PHE A 1 31 ? 6.563   -10.930 0.026   1.00 0.00 ? 31 PHE A CD1  9  
ATOM 9676  C CD2  . PHE A 1 31 ? 6.474   -9.805  2.127   1.00 0.00 ? 31 PHE A CD2  9  
ATOM 9677  C CE1  . PHE A 1 31 ? 5.752   -11.932 0.526   1.00 0.00 ? 31 PHE A CE1  9  
ATOM 9678  C CE2  . PHE A 1 31 ? 5.663   -10.804 2.632   1.00 0.00 ? 31 PHE A CE2  9  
ATOM 9679  C CZ   . PHE A 1 31 ? 5.302   -11.869 1.830   1.00 0.00 ? 31 PHE A CZ   9  
ATOM 9680  H H    . PHE A 1 31 ? 6.774   -8.436  -2.417  1.00 0.00 ? 31 PHE A H    9  
ATOM 9681  H HA   . PHE A 1 31 ? 6.330   -7.227  0.217   1.00 0.00 ? 31 PHE A HA   9  
ATOM 9682  H HB2  . PHE A 1 31 ? 8.517   -9.223  -0.407  1.00 0.00 ? 31 PHE A HB2  9  
ATOM 9683  H HB3  . PHE A 1 31 ? 8.350   -8.330  1.101   1.00 0.00 ? 31 PHE A HB3  9  
ATOM 9684  H HD1  . PHE A 1 31 ? 6.914   -10.982 -0.994  1.00 0.00 ? 31 PHE A HD1  9  
ATOM 9685  H HD2  . PHE A 1 31 ? 6.756   -8.972  2.755   1.00 0.00 ? 31 PHE A HD2  9  
ATOM 9686  H HE1  . PHE A 1 31 ? 5.471   -12.764 -0.103  1.00 0.00 ? 31 PHE A HE1  9  
ATOM 9687  H HE2  . PHE A 1 31 ? 5.313   -10.752 3.652   1.00 0.00 ? 31 PHE A HE2  9  
ATOM 9688  H HZ   . PHE A 1 31 ? 4.668   -12.650 2.222   1.00 0.00 ? 31 PHE A HZ   9  
ATOM 9689  N N    . ILE A 1 32 ? 7.730   -5.347  -0.556  1.00 0.00 ? 32 ILE A N    9  
ATOM 9690  C CA   . ILE A 1 32 ? 8.574   -4.223  -0.944  1.00 0.00 ? 32 ILE A CA   9  
ATOM 9691  C C    . ILE A 1 32 ? 9.928   -4.285  -0.245  1.00 0.00 ? 32 ILE A C    9  
ATOM 9692  O O    . ILE A 1 32 ? 10.217  -5.229  0.490   1.00 0.00 ? 32 ILE A O    9  
ATOM 9693  C CB   . ILE A 1 32 ? 7.901   -2.876  -0.618  1.00 0.00 ? 32 ILE A CB   9  
ATOM 9694  C CG1  . ILE A 1 32 ? 7.715   -2.727  0.893   1.00 0.00 ? 32 ILE A CG1  9  
ATOM 9695  C CG2  . ILE A 1 32 ? 6.564   -2.764  -1.335  1.00 0.00 ? 32 ILE A CG2  9  
ATOM 9696  C CD1  . ILE A 1 32 ? 7.132   -1.393  1.302   1.00 0.00 ? 32 ILE A CD1  9  
ATOM 9697  H H    . ILE A 1 32 ? 6.941   -5.183  0.000   1.00 0.00 ? 32 ILE A H    9  
ATOM 9698  H HA   . ILE A 1 32 ? 8.729   -4.276  -2.012  1.00 0.00 ? 32 ILE A HA   9  
ATOM 9699  H HB   . ILE A 1 32 ? 8.542   -2.084  -0.975  1.00 0.00 ? 32 ILE A HB   9  
ATOM 9700  H HG12 . ILE A 1 32 ? 7.052   -3.501  1.246   1.00 0.00 ? 32 ILE A HG12 9  
ATOM 9701  H HG13 . ILE A 1 32 ? 8.675   -2.833  1.379   1.00 0.00 ? 32 ILE A HG13 9  
ATOM 9702  H HG21 . ILE A 1 32 ? 5.793   -2.517  -0.622  1.00 0.00 ? 32 ILE A HG21 9  
ATOM 9703  H HG22 . ILE A 1 32 ? 6.622   -1.989  -2.085  1.00 0.00 ? 32 ILE A HG22 9  
ATOM 9704  H HG23 . ILE A 1 32 ? 6.329   -3.706  -1.808  1.00 0.00 ? 32 ILE A HG23 9  
ATOM 9705  H HD11 . ILE A 1 32 ? 7.656   -0.599  0.790   1.00 0.00 ? 32 ILE A HD11 9  
ATOM 9706  H HD12 . ILE A 1 32 ? 6.085   -1.362  1.040   1.00 0.00 ? 32 ILE A HD12 9  
ATOM 9707  H HD13 . ILE A 1 32 ? 7.239   -1.264  2.369   1.00 0.00 ? 32 ILE A HD13 9  
ATOM 9708  N N    . THR A 1 33 ? 10.755  -3.271  -0.479  1.00 0.00 ? 33 THR A N    9  
ATOM 9709  C CA   . THR A 1 33 ? 12.079  -3.209  0.127   1.00 0.00 ? 33 THR A CA   9  
ATOM 9710  C C    . THR A 1 33 ? 12.094  -2.255  1.317   1.00 0.00 ? 33 THR A C    9  
ATOM 9711  O O    . THR A 1 33 ? 11.163  -1.474  1.512   1.00 0.00 ? 33 THR A O    9  
ATOM 9712  C CB   . THR A 1 33 ? 13.143  -2.758  -0.891  1.00 0.00 ? 33 THR A CB   9  
ATOM 9713  O OG1  . THR A 1 33 ? 13.079  -1.339  -1.072  1.00 0.00 ? 33 THR A OG1  9  
ATOM 9714  C CG2  . THR A 1 33 ? 12.941  -3.455  -2.228  1.00 0.00 ? 33 THR A CG2  9  
ATOM 9715  H H    . THR A 1 33 ? 10.467  -2.548  -1.075  1.00 0.00 ? 33 THR A H    9  
ATOM 9716  H HA   . THR A 1 33 ? 12.335  -4.201  0.470   1.00 0.00 ? 33 THR A HA   9  
ATOM 9717  H HB   . THR A 1 33 ? 14.119  -3.021  -0.509  1.00 0.00 ? 33 THR A HB   9  
ATOM 9718  H HG1  . THR A 1 33 ? 13.728  -1.070  -1.727  1.00 0.00 ? 33 THR A HG1  9  
ATOM 9719  H HG21 . THR A 1 33 ? 13.894  -3.799  -2.603  1.00 0.00 ? 33 THR A HG21 9  
ATOM 9720  H HG22 . THR A 1 33 ? 12.506  -2.762  -2.933  1.00 0.00 ? 33 THR A HG22 9  
ATOM 9721  H HG23 . THR A 1 33 ? 12.280  -4.298  -2.098  1.00 0.00 ? 33 THR A HG23 9  
ATOM 9722  N N    . LYS A 1 34 ? 13.158  -2.323  2.110   1.00 0.00 ? 34 LYS A N    9  
ATOM 9723  C CA   . LYS A 1 34 ? 13.297  -1.464  3.280   1.00 0.00 ? 34 LYS A CA   9  
ATOM 9724  C C    . LYS A 1 34 ? 13.337  0.006   2.874   1.00 0.00 ? 34 LYS A C    9  
ATOM 9725  O O    . LYS A 1 34 ? 13.024  0.889   3.673   1.00 0.00 ? 34 LYS A O    9  
ATOM 9726  C CB   . LYS A 1 34 ? 14.566  -1.825  4.055   1.00 0.00 ? 34 LYS A CB   9  
ATOM 9727  C CG   . LYS A 1 34 ? 14.674  -1.131  5.402   1.00 0.00 ? 34 LYS A CG   9  
ATOM 9728  C CD   . LYS A 1 34 ? 13.774  -1.782  6.439   1.00 0.00 ? 34 LYS A CD   9  
ATOM 9729  C CE   . LYS A 1 34 ? 14.486  -2.914  7.163   1.00 0.00 ? 34 LYS A CE   9  
ATOM 9730  N NZ   . LYS A 1 34 ? 14.295  -4.221  6.474   1.00 0.00 ? 34 LYS A NZ   9  
ATOM 9731  H H    . LYS A 1 34 ? 13.868  -2.967  1.902   1.00 0.00 ? 34 LYS A H    9  
ATOM 9732  H HA   . LYS A 1 34 ? 12.439  -1.627  3.914   1.00 0.00 ? 34 LYS A HA   9  
ATOM 9733  H HB2  . LYS A 1 34 ? 14.580  -2.892  4.221   1.00 0.00 ? 34 LYS A HB2  9  
ATOM 9734  H HB3  . LYS A 1 34 ? 15.426  -1.550  3.462   1.00 0.00 ? 34 LYS A HB3  9  
ATOM 9735  H HG2  . LYS A 1 34 ? 15.697  -1.186  5.744   1.00 0.00 ? 34 LYS A HG2  9  
ATOM 9736  H HG3  . LYS A 1 34 ? 14.385  -0.096  5.287   1.00 0.00 ? 34 LYS A HG3  9  
ATOM 9737  H HD2  . LYS A 1 34 ? 13.476  -1.038  7.163   1.00 0.00 ? 34 LYS A HD2  9  
ATOM 9738  H HD3  . LYS A 1 34 ? 12.898  -2.177  5.945   1.00 0.00 ? 34 LYS A HD3  9  
ATOM 9739  H HE2  . LYS A 1 34 ? 15.541  -2.690  7.205   1.00 0.00 ? 34 LYS A HE2  9  
ATOM 9740  H HE3  . LYS A 1 34 ? 14.094  -2.985  8.166   1.00 0.00 ? 34 LYS A HE3  9  
ATOM 9741  H HZ1  . LYS A 1 34 ? 13.931  -4.928  7.144   1.00 0.00 ? 34 LYS A HZ1  9  
ATOM 9742  H HZ2  . LYS A 1 34 ? 15.201  -4.558  6.090   1.00 0.00 ? 34 LYS A HZ2  9  
ATOM 9743  H HZ3  . LYS A 1 34 ? 13.616  -4.117  5.693   1.00 0.00 ? 34 LYS A HZ3  9  
ATOM 9744  N N    . ASP A 1 35 ? 13.724  0.261   1.629   1.00 0.00 ? 35 ASP A N    9  
ATOM 9745  C CA   . ASP A 1 35 ? 13.802  1.624   1.117   1.00 0.00 ? 35 ASP A CA   9  
ATOM 9746  C C    . ASP A 1 35 ? 12.476  2.047   0.492   1.00 0.00 ? 35 ASP A C    9  
ATOM 9747  O O    . ASP A 1 35 ? 11.964  3.131   0.771   1.00 0.00 ? 35 ASP A O    9  
ATOM 9748  C CB   . ASP A 1 35 ? 14.926  1.740   0.086   1.00 0.00 ? 35 ASP A CB   9  
ATOM 9749  C CG   . ASP A 1 35 ? 15.372  3.173   -0.125  1.00 0.00 ? 35 ASP A CG   9  
ATOM 9750  O OD1  . ASP A 1 35 ? 14.499  4.044   -0.322  1.00 0.00 ? 35 ASP A OD1  9  
ATOM 9751  O OD2  . ASP A 1 35 ? 16.595  3.424   -0.093  1.00 0.00 ? 35 ASP A OD2  9  
ATOM 9752  H H    . ASP A 1 35 ? 13.961  -0.486  1.040   1.00 0.00 ? 35 ASP A H    9  
ATOM 9753  H HA   . ASP A 1 35 ? 14.019  2.278   1.947   1.00 0.00 ? 35 ASP A HA   9  
ATOM 9754  H HB2  . ASP A 1 35 ? 15.776  1.164   0.422   1.00 0.00 ? 35 ASP A HB2  9  
ATOM 9755  H HB3  . ASP A 1 35 ? 14.581  1.346   -0.859  1.00 0.00 ? 35 ASP A HB3  9  
ATOM 9756  N N    . LYS A 1 36 ? 11.925  1.184   -0.355  1.00 0.00 ? 36 LYS A N    9  
ATOM 9757  C CA   . LYS A 1 36 ? 10.659  1.467   -1.020  1.00 0.00 ? 36 LYS A CA   9  
ATOM 9758  C C    . LYS A 1 36 ? 9.571   1.793   -0.002  1.00 0.00 ? 36 LYS A C    9  
ATOM 9759  O O    . LYS A 1 36 ? 8.699   2.624   -0.257  1.00 0.00 ? 36 LYS A O    9  
ATOM 9760  C CB   . LYS A 1 36 ? 10.231  0.273   -1.876  1.00 0.00 ? 36 LYS A CB   9  
ATOM 9761  C CG   . LYS A 1 36 ? 8.833   0.409   -2.454  1.00 0.00 ? 36 LYS A CG   9  
ATOM 9762  C CD   . LYS A 1 36 ? 8.702   1.659   -3.308  1.00 0.00 ? 36 LYS A CD   9  
ATOM 9763  C CE   . LYS A 1 36 ? 9.583   1.584   -4.545  1.00 0.00 ? 36 LYS A CE   9  
ATOM 9764  N NZ   . LYS A 1 36 ? 9.060   2.433   -5.651  1.00 0.00 ? 36 LYS A NZ   9  
ATOM 9765  H H    . LYS A 1 36 ? 12.382  0.336   -0.537  1.00 0.00 ? 36 LYS A H    9  
ATOM 9766  H HA   . LYS A 1 36 ? 10.804  2.324   -1.661  1.00 0.00 ? 36 LYS A HA   9  
ATOM 9767  H HB2  . LYS A 1 36 ? 10.927  0.163   -2.694  1.00 0.00 ? 36 LYS A HB2  9  
ATOM 9768  H HB3  . LYS A 1 36 ? 10.260  -0.620  -1.267  1.00 0.00 ? 36 LYS A HB3  9  
ATOM 9769  H HG2  . LYS A 1 36 ? 8.620   -0.455  -3.066  1.00 0.00 ? 36 LYS A HG2  9  
ATOM 9770  H HG3  . LYS A 1 36 ? 8.121   0.462   -1.642  1.00 0.00 ? 36 LYS A HG3  9  
ATOM 9771  H HD2  . LYS A 1 36 ? 7.673   1.767   -3.618  1.00 0.00 ? 36 LYS A HD2  9  
ATOM 9772  H HD3  . LYS A 1 36 ? 8.994   2.518   -2.720  1.00 0.00 ? 36 LYS A HD3  9  
ATOM 9773  H HE2  . LYS A 1 36 ? 10.576  1.918   -4.285  1.00 0.00 ? 36 LYS A HE2  9  
ATOM 9774  H HE3  . LYS A 1 36 ? 9.625   0.558   -4.879  1.00 0.00 ? 36 LYS A HE3  9  
ATOM 9775  H HZ1  . LYS A 1 36 ? 9.839   2.954   -6.100  1.00 0.00 ? 36 LYS A HZ1  9  
ATOM 9776  H HZ2  . LYS A 1 36 ? 8.369   3.116   -5.281  1.00 0.00 ? 36 LYS A HZ2  9  
ATOM 9777  H HZ3  . LYS A 1 36 ? 8.595   1.840   -6.368  1.00 0.00 ? 36 LYS A HZ3  9  
ATOM 9778  N N    . ARG A 1 37 ? 9.629   1.135   1.151   1.00 0.00 ? 37 ARG A N    9  
ATOM 9779  C CA   . ARG A 1 37 ? 8.649   1.355   2.207   1.00 0.00 ? 37 ARG A CA   9  
ATOM 9780  C C    . ARG A 1 37 ? 8.656   2.812   2.660   1.00 0.00 ? 37 ARG A C    9  
ATOM 9781  O O    . ARG A 1 37 ? 7.603   3.435   2.798   1.00 0.00 ? 37 ARG A O    9  
ATOM 9782  C CB   . ARG A 1 37 ? 8.935   0.438   3.397   1.00 0.00 ? 37 ARG A CB   9  
ATOM 9783  C CG   . ARG A 1 37 ? 7.878   0.507   4.487   1.00 0.00 ? 37 ARG A CG   9  
ATOM 9784  C CD   . ARG A 1 37 ? 7.739   -0.822  5.214   1.00 0.00 ? 37 ARG A CD   9  
ATOM 9785  N NE   . ARG A 1 37 ? 8.733   -0.972  6.273   1.00 0.00 ? 37 ARG A NE   9  
ATOM 9786  C CZ   . ARG A 1 37 ? 9.092   -2.145  6.783   1.00 0.00 ? 37 ARG A CZ   9  
ATOM 9787  N NH1  . ARG A 1 37 ? 8.540   -3.264  6.333   1.00 0.00 ? 37 ARG A NH1  9  
ATOM 9788  N NH2  . ARG A 1 37 ? 10.004  -2.201  7.745   1.00 0.00 ? 37 ARG A NH2  9  
ATOM 9789  H H    . ARG A 1 37 ? 10.348  0.484   1.295   1.00 0.00 ? 37 ARG A H    9  
ATOM 9790  H HA   . ARG A 1 37 ? 7.673   1.119   1.809   1.00 0.00 ? 37 ARG A HA   9  
ATOM 9791  H HB2  . ARG A 1 37 ? 8.992   -0.582  3.046   1.00 0.00 ? 37 ARG A HB2  9  
ATOM 9792  H HB3  . ARG A 1 37 ? 9.885   0.715   3.829   1.00 0.00 ? 37 ARG A HB3  9  
ATOM 9793  H HG2  . ARG A 1 37 ? 8.159   1.267   5.201   1.00 0.00 ? 37 ARG A HG2  9  
ATOM 9794  H HG3  . ARG A 1 37 ? 6.929   0.764   4.040   1.00 0.00 ? 37 ARG A HG3  9  
ATOM 9795  H HD2  . ARG A 1 37 ? 6.753   -0.878  5.649   1.00 0.00 ? 37 ARG A HD2  9  
ATOM 9796  H HD3  . ARG A 1 37 ? 7.863   -1.622  4.500   1.00 0.00 ? 37 ARG A HD3  9  
ATOM 9797  H HE   . ARG A 1 37 ? 9.154   -0.159  6.620   1.00 0.00 ? 37 ARG A HE   9  
ATOM 9798  H HH11 . ARG A 1 37 ? 7.853   -3.225  5.607   1.00 0.00 ? 37 ARG A HH11 9  
ATOM 9799  H HH12 . ARG A 1 37 ? 8.812   -4.146  6.718   1.00 0.00 ? 37 ARG A HH12 9  
ATOM 9800  H HH21 . ARG A 1 37 ? 10.422  -1.360  8.087   1.00 0.00 ? 37 ARG A HH21 9  
ATOM 9801  H HH22 . ARG A 1 37 ? 10.273  -3.084  8.128   1.00 0.00 ? 37 ARG A HH22 9  
ATOM 9802  N N    . ARG A 1 38 ? 9.850   3.349   2.890   1.00 0.00 ? 38 ARG A N    9  
ATOM 9803  C CA   . ARG A 1 38 ? 9.994   4.732   3.329   1.00 0.00 ? 38 ARG A CA   9  
ATOM 9804  C C    . ARG A 1 38 ? 9.332   5.688   2.341   1.00 0.00 ? 38 ARG A C    9  
ATOM 9805  O O    . ARG A 1 38 ? 8.667   6.645   2.737   1.00 0.00 ? 38 ARG A O    9  
ATOM 9806  C CB   . ARG A 1 38 ? 11.474  5.088   3.486   1.00 0.00 ? 38 ARG A CB   9  
ATOM 9807  C CG   . ARG A 1 38 ? 12.181  4.288   4.569   1.00 0.00 ? 38 ARG A CG   9  
ATOM 9808  C CD   . ARG A 1 38 ? 13.692  4.366   4.421   1.00 0.00 ? 38 ARG A CD   9  
ATOM 9809  N NE   . ARG A 1 38 ? 14.177  5.743   4.472   1.00 0.00 ? 38 ARG A NE   9  
ATOM 9810  C CZ   . ARG A 1 38 ? 14.306  6.435   5.599   1.00 0.00 ? 38 ARG A CZ   9  
ATOM 9811  N NH1  . ARG A 1 38 ? 13.990  5.882   6.761   1.00 0.00 ? 38 ARG A NH1  9  
ATOM 9812  N NH2  . ARG A 1 38 ? 14.754  7.684   5.564   1.00 0.00 ? 38 ARG A NH2  9  
ATOM 9813  H H    . ARG A 1 38 ? 10.653  2.802   2.762   1.00 0.00 ? 38 ARG A H    9  
ATOM 9814  H HA   . ARG A 1 38 ? 9.506   4.828   4.287   1.00 0.00 ? 38 ARG A HA   9  
ATOM 9815  H HB2  . ARG A 1 38 ? 11.977  4.905   2.548   1.00 0.00 ? 38 ARG A HB2  9  
ATOM 9816  H HB3  . ARG A 1 38 ? 11.555  6.136   3.732   1.00 0.00 ? 38 ARG A HB3  9  
ATOM 9817  H HG2  . ARG A 1 38 ? 11.903  4.684   5.535   1.00 0.00 ? 38 ARG A HG2  9  
ATOM 9818  H HG3  . ARG A 1 38 ? 11.873  3.256   4.499   1.00 0.00 ? 38 ARG A HG3  9  
ATOM 9819  H HD2  . ARG A 1 38 ? 14.148  3.805   5.223   1.00 0.00 ? 38 ARG A HD2  9  
ATOM 9820  H HD3  . ARG A 1 38 ? 13.970  3.931   3.473   1.00 0.00 ? 38 ARG A HD3  9  
ATOM 9821  H HE   . ARG A 1 38 ? 14.417  6.172   3.625   1.00 0.00 ? 38 ARG A HE   9  
ATOM 9822  H HH11 . ARG A 1 38 ? 13.653  4.941   6.791   1.00 0.00 ? 38 ARG A HH11 9  
ATOM 9823  H HH12 . ARG A 1 38 ? 14.089  6.404   7.608   1.00 0.00 ? 38 ARG A HH12 9  
ATOM 9824  H HH21 . ARG A 1 38 ? 14.994  8.104   4.690   1.00 0.00 ? 38 ARG A HH21 9  
ATOM 9825  H HH22 . ARG A 1 38 ? 14.851  8.204   6.412   1.00 0.00 ? 38 ARG A HH22 9  
ATOM 9826  N N    . LYS A 1 39 ? 9.519   5.422   1.053   1.00 0.00 ? 39 LYS A N    9  
ATOM 9827  C CA   . LYS A 1 39 ? 8.940   6.257   0.007   1.00 0.00 ? 39 LYS A CA   9  
ATOM 9828  C C    . LYS A 1 39 ? 7.417   6.255   0.090   1.00 0.00 ? 39 LYS A C    9  
ATOM 9829  O O    . LYS A 1 39 ? 6.788   7.312   0.146   1.00 0.00 ? 39 LYS A O    9  
ATOM 9830  C CB   . LYS A 1 39 ? 9.387   5.766   -1.372  1.00 0.00 ? 39 LYS A CB   9  
ATOM 9831  C CG   . LYS A 1 39 ? 10.895  5.742   -1.550  1.00 0.00 ? 39 LYS A CG   9  
ATOM 9832  C CD   . LYS A 1 39 ? 11.435  7.114   -1.914  1.00 0.00 ? 39 LYS A CD   9  
ATOM 9833  C CE   . LYS A 1 39 ? 12.934  7.207   -1.668  1.00 0.00 ? 39 LYS A CE   9  
ATOM 9834  N NZ   . LYS A 1 39 ? 13.718  6.673   -2.816  1.00 0.00 ? 39 LYS A NZ   9  
ATOM 9835  H H    . LYS A 1 39 ? 10.059  4.643   0.799   1.00 0.00 ? 39 LYS A H    9  
ATOM 9836  H HA   . LYS A 1 39 ? 9.295   7.265   0.153   1.00 0.00 ? 39 LYS A HA   9  
ATOM 9837  H HB2  . LYS A 1 39 ? 9.011   4.764   -1.523  1.00 0.00 ? 39 LYS A HB2  9  
ATOM 9838  H HB3  . LYS A 1 39 ? 8.967   6.416   -2.126  1.00 0.00 ? 39 LYS A HB3  9  
ATOM 9839  H HG2  . LYS A 1 39 ? 11.352  5.420   -0.626  1.00 0.00 ? 39 LYS A HG2  9  
ATOM 9840  H HG3  . LYS A 1 39 ? 11.144  5.046   -2.338  1.00 0.00 ? 39 LYS A HG3  9  
ATOM 9841  H HD2  . LYS A 1 39 ? 11.242  7.303   -2.959  1.00 0.00 ? 39 LYS A HD2  9  
ATOM 9842  H HD3  . LYS A 1 39 ? 10.934  7.860   -1.313  1.00 0.00 ? 39 LYS A HD3  9  
ATOM 9843  H HE2  . LYS A 1 39 ? 13.197  8.242   -1.514  1.00 0.00 ? 39 LYS A HE2  9  
ATOM 9844  H HE3  . LYS A 1 39 ? 13.175  6.638   -0.782  1.00 0.00 ? 39 LYS A HE3  9  
ATOM 9845  H HZ1  . LYS A 1 39 ? 14.105  5.737   -2.579  1.00 0.00 ? 39 LYS A HZ1  9  
ATOM 9846  H HZ2  . LYS A 1 39 ? 14.505  7.314   -3.040  1.00 0.00 ? 39 LYS A HZ2  9  
ATOM 9847  H HZ3  . LYS A 1 39 ? 13.109  6.582   -3.654  1.00 0.00 ? 39 LYS A HZ3  9  
ATOM 9848  N N    . ILE A 1 40 ? 6.831   5.063   0.098   1.00 0.00 ? 40 ILE A N    9  
ATOM 9849  C CA   . ILE A 1 40 ? 5.382   4.925   0.177   1.00 0.00 ? 40 ILE A CA   9  
ATOM 9850  C C    . ILE A 1 40 ? 4.824   5.667   1.387   1.00 0.00 ? 40 ILE A C    9  
ATOM 9851  O O    . ILE A 1 40 ? 3.728   6.225   1.335   1.00 0.00 ? 40 ILE A O    9  
ATOM 9852  C CB   . ILE A 1 40 ? 4.960   3.446   0.257   1.00 0.00 ? 40 ILE A CB   9  
ATOM 9853  C CG1  . ILE A 1 40 ? 5.498   2.674   -0.949  1.00 0.00 ? 40 ILE A CG1  9  
ATOM 9854  C CG2  . ILE A 1 40 ? 3.445   3.330   0.335   1.00 0.00 ? 40 ILE A CG2  9  
ATOM 9855  C CD1  . ILE A 1 40 ? 5.384   1.172   -0.805  1.00 0.00 ? 40 ILE A CD1  9  
ATOM 9856  H H    . ILE A 1 40 ? 7.386   4.257   0.051   1.00 0.00 ? 40 ILE A H    9  
ATOM 9857  H HA   . ILE A 1 40 ? 4.957   5.351   -0.720  1.00 0.00 ? 40 ILE A HA   9  
ATOM 9858  H HB   . ILE A 1 40 ? 5.376   3.025   1.160   1.00 0.00 ? 40 ILE A HB   9  
ATOM 9859  H HG12 . ILE A 1 40 ? 4.947   2.964   -1.830  1.00 0.00 ? 40 ILE A HG12 9  
ATOM 9860  H HG13 . ILE A 1 40 ? 6.542   2.917   -1.086  1.00 0.00 ? 40 ILE A HG13 9  
ATOM 9861  H HG21 . ILE A 1 40 ? 3.004   3.807   -0.528  1.00 0.00 ? 40 ILE A HG21 9  
ATOM 9862  H HG22 . ILE A 1 40 ? 3.165   2.288   0.352   1.00 0.00 ? 40 ILE A HG22 9  
ATOM 9863  H HG23 . ILE A 1 40 ? 3.093   3.813   1.233   1.00 0.00 ? 40 ILE A HG23 9  
ATOM 9864  H HD11 . ILE A 1 40 ? 5.758   0.873   0.163   1.00 0.00 ? 40 ILE A HD11 9  
ATOM 9865  H HD12 . ILE A 1 40 ? 4.350   0.878   -0.899  1.00 0.00 ? 40 ILE A HD12 9  
ATOM 9866  H HD13 . ILE A 1 40 ? 5.967   0.691   -1.578  1.00 0.00 ? 40 ILE A HD13 9  
ATOM 9867  N N    . SER A 1 41 ? 5.587   5.670   2.476   1.00 0.00 ? 41 SER A N    9  
ATOM 9868  C CA   . SER A 1 41 ? 5.168   6.343   3.700   1.00 0.00 ? 41 SER A CA   9  
ATOM 9869  C C    . SER A 1 41 ? 5.036   7.846   3.477   1.00 0.00 ? 41 SER A C    9  
ATOM 9870  O O    . SER A 1 41 ? 4.291   8.526   4.181   1.00 0.00 ? 41 SER A O    9  
ATOM 9871  C CB   . SER A 1 41 ? 6.169   6.069   4.825   1.00 0.00 ? 41 SER A CB   9  
ATOM 9872  O OG   . SER A 1 41 ? 6.251   7.170   5.713   1.00 0.00 ? 41 SER A OG   9  
ATOM 9873  H H    . SER A 1 41 ? 6.451   5.208   2.455   1.00 0.00 ? 41 SER A H    9  
ATOM 9874  H HA   . SER A 1 41 ? 4.205   5.946   3.983   1.00 0.00 ? 41 SER A HA   9  
ATOM 9875  H HB2  . SER A 1 41 ? 5.855   5.197   5.378   1.00 0.00 ? 41 SER A HB2  9  
ATOM 9876  H HB3  . SER A 1 41 ? 7.146   5.892   4.398   1.00 0.00 ? 41 SER A HB3  9  
ATOM 9877  H HG   . SER A 1 41 ? 5.581   7.082   6.395   1.00 0.00 ? 41 SER A HG   9  
ATOM 9878  N N    . ALA A 1 42 ? 5.765   8.358   2.491   1.00 0.00 ? 42 ALA A N    9  
ATOM 9879  C CA   . ALA A 1 42 ? 5.729   9.780   2.172   1.00 0.00 ? 42 ALA A CA   9  
ATOM 9880  C C    . ALA A 1 42 ? 4.651   10.082  1.136   1.00 0.00 ? 42 ALA A C    9  
ATOM 9881  O O    . ALA A 1 42 ? 3.896   11.044  1.275   1.00 0.00 ? 42 ALA A O    9  
ATOM 9882  C CB   . ALA A 1 42 ? 7.089   10.244  1.673   1.00 0.00 ? 42 ALA A CB   9  
ATOM 9883  H H    . ALA A 1 42 ? 6.340   7.764   1.964   1.00 0.00 ? 42 ALA A H    9  
ATOM 9884  H HA   . ALA A 1 42 ? 5.503   10.320  3.080   1.00 0.00 ? 42 ALA A HA   9  
ATOM 9885  H HB1  . ALA A 1 42 ? 6.955   10.917  0.838   1.00 0.00 ? 42 ALA A HB1  9  
ATOM 9886  H HB2  . ALA A 1 42 ? 7.609   10.756  2.469   1.00 0.00 ? 42 ALA A HB2  9  
ATOM 9887  H HB3  . ALA A 1 42 ? 7.667   9.388   1.356   1.00 0.00 ? 42 ALA A HB3  9  
ATOM 9888  N N    . ALA A 1 43 ? 4.587   9.256   0.097   1.00 0.00 ? 43 ALA A N    9  
ATOM 9889  C CA   . ALA A 1 43 ? 3.601   9.435   -0.962  1.00 0.00 ? 43 ALA A CA   9  
ATOM 9890  C C    . ALA A 1 43 ? 2.186   9.219   -0.436  1.00 0.00 ? 43 ALA A C    9  
ATOM 9891  O O    . ALA A 1 43 ? 1.223   9.774   -0.968  1.00 0.00 ? 43 ALA A O    9  
ATOM 9892  C CB   . ALA A 1 43 ? 3.888   8.486   -2.116  1.00 0.00 ? 43 ALA A CB   9  
ATOM 9893  H H    . ALA A 1 43 ? 5.216   8.507   0.042   1.00 0.00 ? 43 ALA A H    9  
ATOM 9894  H HA   . ALA A 1 43 ? 3.687   10.447  -1.330  1.00 0.00 ? 43 ALA A HA   9  
ATOM 9895  H HB1  . ALA A 1 43 ? 3.017   7.874   -2.302  1.00 0.00 ? 43 ALA A HB1  9  
ATOM 9896  H HB2  . ALA A 1 43 ? 4.123   9.058   -3.001  1.00 0.00 ? 43 ALA A HB2  9  
ATOM 9897  H HB3  . ALA A 1 43 ? 4.725   7.854   -1.862  1.00 0.00 ? 43 ALA A HB3  9  
ATOM 9898  N N    . THR A 1 44 ? 2.065   8.409   0.611   1.00 0.00 ? 44 THR A N    9  
ATOM 9899  C CA   . THR A 1 44 ? 0.768   8.119   1.207   1.00 0.00 ? 44 THR A CA   9  
ATOM 9900  C C    . THR A 1 44 ? 0.638   8.763   2.583   1.00 0.00 ? 44 THR A C    9  
ATOM 9901  O O    . THR A 1 44 ? -0.446  8.791   3.166   1.00 0.00 ? 44 THR A O    9  
ATOM 9902  C CB   . THR A 1 44 ? 0.537   6.601   1.340   1.00 0.00 ? 44 THR A CB   9  
ATOM 9903  O OG1  . THR A 1 44 ? 1.333   6.076   2.408   1.00 0.00 ? 44 THR A OG1  9  
ATOM 9904  C CG2  . THR A 1 44 ? 0.885   5.886   0.043   1.00 0.00 ? 44 THR A CG2  9  
ATOM 9905  H H    . THR A 1 44 ? 2.870   7.997   0.990   1.00 0.00 ? 44 THR A H    9  
ATOM 9906  H HA   . THR A 1 44 ? 0.004   8.522   0.558   1.00 0.00 ? 44 THR A HA   9  
ATOM 9907  H HB   . THR A 1 44 ? -0.507  6.429   1.560   1.00 0.00 ? 44 THR A HB   9  
ATOM 9908  H HG1  . THR A 1 44 ? 2.192   6.506   2.409   1.00 0.00 ? 44 THR A HG1  9  
ATOM 9909  H HG21 . THR A 1 44 ? 0.957   6.607   -0.758  1.00 0.00 ? 44 THR A HG21 9  
ATOM 9910  H HG22 . THR A 1 44 ? 0.114   5.166   -0.188  1.00 0.00 ? 44 THR A HG22 9  
ATOM 9911  H HG23 . THR A 1 44 ? 1.831   5.378   0.155   1.00 0.00 ? 44 THR A HG23 9  
ATOM 9912  N N    . SER A 1 45 ? 1.749   9.280   3.096   1.00 0.00 ? 45 SER A N    9  
ATOM 9913  C CA   . SER A 1 45 ? 1.760   9.922   4.405   1.00 0.00 ? 45 SER A CA   9  
ATOM 9914  C C    . SER A 1 45 ? 1.412   8.922   5.503   1.00 0.00 ? 45 SER A C    9  
ATOM 9915  O O    . SER A 1 45 ? 0.834   9.284   6.529   1.00 0.00 ? 45 SER A O    9  
ATOM 9916  C CB   . SER A 1 45 ? 0.773   11.090  4.432   1.00 0.00 ? 45 SER A CB   9  
ATOM 9917  O OG   . SER A 1 45 ? 0.870   11.867  3.251   1.00 0.00 ? 45 SER A OG   9  
ATOM 9918  H H    . SER A 1 45 ? 2.583   9.227   2.583   1.00 0.00 ? 45 SER A H    9  
ATOM 9919  H HA   . SER A 1 45 ? 2.756   10.299  4.581   1.00 0.00 ? 45 SER A HA   9  
ATOM 9920  H HB2  . SER A 1 45 ? -0.233  10.707  4.514   1.00 0.00 ? 45 SER A HB2  9  
ATOM 9921  H HB3  . SER A 1 45 ? 0.988   11.721  5.283   1.00 0.00 ? 45 SER A HB3  9  
ATOM 9922  H HG   . SER A 1 45 ? 0.012   12.247  3.046   1.00 0.00 ? 45 SER A HG   9  
ATOM 9923  N N    . LEU A 1 46 ? 1.767   7.661   5.281   1.00 0.00 ? 46 LEU A N    9  
ATOM 9924  C CA   . LEU A 1 46 ? 1.492   6.606   6.251   1.00 0.00 ? 46 LEU A CA   9  
ATOM 9925  C C    . LEU A 1 46 ? 2.765   6.197   6.984   1.00 0.00 ? 46 LEU A C    9  
ATOM 9926  O O    . LEU A 1 46 ? 3.830   6.776   6.771   1.00 0.00 ? 46 LEU A O    9  
ATOM 9927  C CB   . LEU A 1 46 ? 0.879   5.391   5.552   1.00 0.00 ? 46 LEU A CB   9  
ATOM 9928  C CG   . LEU A 1 46 ? -0.539  5.573   5.010   1.00 0.00 ? 46 LEU A CG   9  
ATOM 9929  C CD1  . LEU A 1 46 ? -0.776  4.661   3.817   1.00 0.00 ? 46 LEU A CD1  9  
ATOM 9930  C CD2  . LEU A 1 46 ? -1.565  5.305   6.101   1.00 0.00 ? 46 LEU A CD2  9  
ATOM 9931  H H    . LEU A 1 46 ? 2.224   7.433   4.445   1.00 0.00 ? 46 LEU A H    9  
ATOM 9932  H HA   . LEU A 1 46 ? 0.785   6.993   6.969   1.00 0.00 ? 46 LEU A HA   9  
ATOM 9933  H HB2  . LEU A 1 46 ? 1.519   5.129   4.723   1.00 0.00 ? 46 LEU A HB2  9  
ATOM 9934  H HB3  . LEU A 1 46 ? 0.861   4.577   6.263   1.00 0.00 ? 46 LEU A HB3  9  
ATOM 9935  H HG   . LEU A 1 46 ? -0.662  6.595   4.678   1.00 0.00 ? 46 LEU A HG   9  
ATOM 9936  H HD11 . LEU A 1 46 ? 0.163   4.234   3.498   1.00 0.00 ? 46 LEU A HD11 9  
ATOM 9937  H HD12 . LEU A 1 46 ? -1.205  5.231   3.007   1.00 0.00 ? 46 LEU A HD12 9  
ATOM 9938  H HD13 . LEU A 1 46 ? -1.455  3.869   4.099   1.00 0.00 ? 46 LEU A HD13 9  
ATOM 9939  H HD21 . LEU A 1 46 ? -1.415  5.999   6.915   1.00 0.00 ? 46 LEU A HD21 9  
ATOM 9940  H HD22 . LEU A 1 46 ? -1.449  4.294   6.464   1.00 0.00 ? 46 LEU A HD22 9  
ATOM 9941  H HD23 . LEU A 1 46 ? -2.559  5.432   5.699   1.00 0.00 ? 46 LEU A HD23 9  
ATOM 9942  N N    . SER A 1 47 ? 2.647   5.194   7.848   1.00 0.00 ? 47 SER A N    9  
ATOM 9943  C CA   . SER A 1 47 ? 3.788   4.707   8.615   1.00 0.00 ? 47 SER A CA   9  
ATOM 9944  C C    . SER A 1 47 ? 4.350   3.428   8.001   1.00 0.00 ? 47 SER A C    9  
ATOM 9945  O O    . SER A 1 47 ? 3.638   2.690   7.322   1.00 0.00 ? 47 SER A O    9  
ATOM 9946  C CB   . SER A 1 47 ? 3.382   4.454   10.068  1.00 0.00 ? 47 SER A CB   9  
ATOM 9947  O OG   . SER A 1 47 ? 3.594   5.606   10.866  1.00 0.00 ? 47 SER A OG   9  
ATOM 9948  H H    . SER A 1 47 ? 1.771   4.773   7.975   1.00 0.00 ? 47 SER A H    9  
ATOM 9949  H HA   . SER A 1 47 ? 4.553   5.470   8.592   1.00 0.00 ? 47 SER A HA   9  
ATOM 9950  H HB2  . SER A 1 47 ? 2.336   4.192   10.107  1.00 0.00 ? 47 SER A HB2  9  
ATOM 9951  H HB3  . SER A 1 47 ? 3.972   3.641   10.467  1.00 0.00 ? 47 SER A HB3  9  
ATOM 9952  H HG   . SER A 1 47 ? 3.610   5.356   11.792  1.00 0.00 ? 47 SER A HG   9  
ATOM 9953  N N    . GLU A 1 48 ? 5.632   3.175   8.247   1.00 0.00 ? 48 GLU A N    9  
ATOM 9954  C CA   . GLU A 1 48 ? 6.289   1.986   7.718   1.00 0.00 ? 48 GLU A CA   9  
ATOM 9955  C C    . GLU A 1 48 ? 5.494   0.728   8.056   1.00 0.00 ? 48 GLU A C    9  
ATOM 9956  O O    . GLU A 1 48 ? 5.231   -0.105  7.188   1.00 0.00 ? 48 GLU A O    9  
ATOM 9957  C CB   . GLU A 1 48 ? 7.709   1.870   8.276   1.00 0.00 ? 48 GLU A CB   9  
ATOM 9958  C CG   . GLU A 1 48 ? 8.586   3.071   7.964   1.00 0.00 ? 48 GLU A CG   9  
ATOM 9959  C CD   . GLU A 1 48 ? 10.039  2.846   8.335   1.00 0.00 ? 48 GLU A CD   9  
ATOM 9960  O OE1  . GLU A 1 48 ? 10.314  2.604   9.529   1.00 0.00 ? 48 GLU A OE1  9  
ATOM 9961  O OE2  . GLU A 1 48 ? 10.899  2.911   7.433   1.00 0.00 ? 48 GLU A OE2  9  
ATOM 9962  H H    . GLU A 1 48 ? 6.147   3.802   8.796   1.00 0.00 ? 48 GLU A H    9  
ATOM 9963  H HA   . GLU A 1 48 ? 6.342   2.086   6.644   1.00 0.00 ? 48 GLU A HA   9  
ATOM 9964  H HB2  . GLU A 1 48 ? 7.653   1.760   9.349   1.00 0.00 ? 48 GLU A HB2  9  
ATOM 9965  H HB3  . GLU A 1 48 ? 8.177   0.992   7.857   1.00 0.00 ? 48 GLU A HB3  9  
ATOM 9966  H HG2  . GLU A 1 48 ? 8.529   3.277   6.905   1.00 0.00 ? 48 GLU A HG2  9  
ATOM 9967  H HG3  . GLU A 1 48 ? 8.217   3.924   8.515   1.00 0.00 ? 48 GLU A HG3  9  
ATOM 9968  N N    . ARG A 1 49 ? 5.115   0.598   9.323   1.00 0.00 ? 49 ARG A N    9  
ATOM 9969  C CA   . ARG A 1 49 ? 4.351   -0.558  9.777   1.00 0.00 ? 49 ARG A CA   9  
ATOM 9970  C C    . ARG A 1 49 ? 3.002   -0.631  9.068   1.00 0.00 ? 49 ARG A C    9  
ATOM 9971  O O    . ARG A 1 49 ? 2.607   -1.687  8.574   1.00 0.00 ? 49 ARG A O    9  
ATOM 9972  C CB   . ARG A 1 49 ? 4.141   -0.495  11.291  1.00 0.00 ? 49 ARG A CB   9  
ATOM 9973  C CG   . ARG A 1 49 ? 3.420   -1.707  11.857  1.00 0.00 ? 49 ARG A CG   9  
ATOM 9974  C CD   . ARG A 1 49 ? 4.239   -2.976  11.681  1.00 0.00 ? 49 ARG A CD   9  
ATOM 9975  N NE   . ARG A 1 49 ? 3.811   -4.035  12.590  1.00 0.00 ? 49 ARG A NE   9  
ATOM 9976  C CZ   . ARG A 1 49 ? 4.411   -5.217  12.677  1.00 0.00 ? 49 ARG A CZ   9  
ATOM 9977  N NH1  . ARG A 1 49 ? 5.460   -5.488  11.913  1.00 0.00 ? 49 ARG A NH1  9  
ATOM 9978  N NH2  . ARG A 1 49 ? 3.963   -6.129  13.529  1.00 0.00 ? 49 ARG A NH2  9  
ATOM 9979  H H    . ARG A 1 49 ? 5.354   1.296   9.968   1.00 0.00 ? 49 ARG A H    9  
ATOM 9980  H HA   . ARG A 1 49 ? 4.919   -1.445  9.538   1.00 0.00 ? 49 ARG A HA   9  
ATOM 9981  H HB2  . ARG A 1 49 ? 5.104   -0.419  11.773  1.00 0.00 ? 49 ARG A HB2  9  
ATOM 9982  H HB3  . ARG A 1 49 ? 3.560   0.385   11.525  1.00 0.00 ? 49 ARG A HB3  9  
ATOM 9983  H HG2  . ARG A 1 49 ? 3.243   -1.550  12.910  1.00 0.00 ? 49 ARG A HG2  9  
ATOM 9984  H HG3  . ARG A 1 49 ? 2.476   -1.824  11.344  1.00 0.00 ? 49 ARG A HG3  9  
ATOM 9985  H HD2  . ARG A 1 49 ? 4.129   -3.321  10.664  1.00 0.00 ? 49 ARG A HD2  9  
ATOM 9986  H HD3  . ARG A 1 49 ? 5.277   -2.747  11.872  1.00 0.00 ? 49 ARG A HD3  9  
ATOM 9987  H HE   . ARG A 1 49 ? 3.038   -3.855  13.164  1.00 0.00 ? 49 ARG A HE   9  
ATOM 9988  H HH11 . ARG A 1 49 ? 5.801   -4.802  11.270  1.00 0.00 ? 49 ARG A HH11 9  
ATOM 9989  H HH12 . ARG A 1 49 ? 5.911   -6.379  11.981  1.00 0.00 ? 49 ARG A HH12 9  
ATOM 9990  H HH21 . ARG A 1 49 ? 3.172   -5.928  14.107  1.00 0.00 ? 49 ARG A HH21 9  
ATOM 9991  H HH22 . ARG A 1 49 ? 4.415   -7.018  13.593  1.00 0.00 ? 49 ARG A HH22 9  
ATOM 9992  N N    . GLN A 1 50 ? 2.301   0.497   9.023   1.00 0.00 ? 50 GLN A N    9  
ATOM 9993  C CA   . GLN A 1 50 ? 0.996   0.560   8.376   1.00 0.00 ? 50 GLN A CA   9  
ATOM 9994  C C    . GLN A 1 50 ? 1.064   0.001   6.958   1.00 0.00 ? 50 GLN A C    9  
ATOM 9995  O O    . GLN A 1 50 ? 0.250   -0.838  6.572   1.00 0.00 ? 50 GLN A O    9  
ATOM 9996  C CB   . GLN A 1 50 ? 0.488   2.002   8.344   1.00 0.00 ? 50 GLN A CB   9  
ATOM 9997  C CG   . GLN A 1 50 ? -0.040  2.491   9.683   1.00 0.00 ? 50 GLN A CG   9  
ATOM 9998  C CD   . GLN A 1 50 ? -1.155  3.508   9.535   1.00 0.00 ? 50 GLN A CD   9  
ATOM 9999  O OE1  . GLN A 1 50 ? -2.333  3.153   9.494   1.00 0.00 ? 50 GLN A OE1  9  
ATOM 10000 N NE2  . GLN A 1 50 ? -0.788  4.781   9.454   1.00 0.00 ? 50 GLN A NE2  9  
ATOM 10001 H H    . GLN A 1 50 ? 2.670   1.306   9.435   1.00 0.00 ? 50 GLN A H    9  
ATOM 10002 H HA   . GLN A 1 50 ? 0.310   -0.041  8.953   1.00 0.00 ? 50 GLN A HA   9  
ATOM 10003 H HB2  . GLN A 1 50 ? 1.297   2.650   8.042   1.00 0.00 ? 50 GLN A HB2  9  
ATOM 10004 H HB3  . GLN A 1 50 ? -0.310  2.074   7.619   1.00 0.00 ? 50 GLN A HB3  9  
ATOM 10005 H HG2  . GLN A 1 50 ? -0.418  1.644   10.237  1.00 0.00 ? 50 GLN A HG2  9  
ATOM 10006 H HG3  . GLN A 1 50 ? 0.772   2.945   10.231  1.00 0.00 ? 50 GLN A HG3  9  
ATOM 10007 H HE21 . GLN A 1 50 ? 0.170   4.990   9.493   1.00 0.00 ? 50 GLN A HE21 9  
ATOM 10008 H HE22 . GLN A 1 50 ? -1.487  5.459   9.357   1.00 0.00 ? 50 GLN A HE22 9  
ATOM 10009 N N    . ILE A 1 51 ? 2.039   0.471   6.188   1.00 0.00 ? 51 ILE A N    9  
ATOM 10010 C CA   . ILE A 1 51 ? 2.213   0.018   4.814   1.00 0.00 ? 51 ILE A CA   9  
ATOM 10011 C C    . ILE A 1 51 ? 2.532   -1.473  4.763   1.00 0.00 ? 51 ILE A C    9  
ATOM 10012 O O    . ILE A 1 51 ? 2.161   -2.167  3.816   1.00 0.00 ? 51 ILE A O    9  
ATOM 10013 C CB   . ILE A 1 51 ? 3.335   0.796   4.102   1.00 0.00 ? 51 ILE A CB   9  
ATOM 10014 C CG1  . ILE A 1 51 ? 3.026   2.294   4.102   1.00 0.00 ? 51 ILE A CG1  9  
ATOM 10015 C CG2  . ILE A 1 51 ? 3.513   0.286   2.680   1.00 0.00 ? 51 ILE A CG2  9  
ATOM 10016 C CD1  . ILE A 1 51 ? 4.222   3.159   3.771   1.00 0.00 ? 51 ILE A CD1  9  
ATOM 10017 H H    . ILE A 1 51 ? 2.657   1.139   6.553   1.00 0.00 ? 51 ILE A H    9  
ATOM 10018 H HA   . ILE A 1 51 ? 1.288   0.195   4.285   1.00 0.00 ? 51 ILE A HA   9  
ATOM 10019 H HB   . ILE A 1 51 ? 4.257   0.626   4.638   1.00 0.00 ? 51 ILE A HB   9  
ATOM 10020 H HG12 . ILE A 1 51 ? 2.259   2.497   3.371   1.00 0.00 ? 51 ILE A HG12 9  
ATOM 10021 H HG13 . ILE A 1 51 ? 2.669   2.581   5.080   1.00 0.00 ? 51 ILE A HG13 9  
ATOM 10022 H HG21 . ILE A 1 51 ? 3.528   1.123   1.997   1.00 0.00 ? 51 ILE A HG21 9  
ATOM 10023 H HG22 . ILE A 1 51 ? 4.445   -0.254  2.605   1.00 0.00 ? 51 ILE A HG22 9  
ATOM 10024 H HG23 . ILE A 1 51 ? 2.695   -0.371  2.427   1.00 0.00 ? 51 ILE A HG23 9  
ATOM 10025 H HD11 . ILE A 1 51 ? 4.874   2.627   3.093   1.00 0.00 ? 51 ILE A HD11 9  
ATOM 10026 H HD12 . ILE A 1 51 ? 3.889   4.075   3.308   1.00 0.00 ? 51 ILE A HD12 9  
ATOM 10027 H HD13 . ILE A 1 51 ? 4.761   3.390   4.679   1.00 0.00 ? 51 ILE A HD13 9  
ATOM 10028 N N    . THR A 1 52 ? 3.222   -1.960  5.790   1.00 0.00 ? 52 THR A N    9  
ATOM 10029 C CA   . THR A 1 52 ? 3.591   -3.368  5.864   1.00 0.00 ? 52 THR A CA   9  
ATOM 10030 C C    . THR A 1 52 ? 2.375   -4.240  6.153   1.00 0.00 ? 52 THR A C    9  
ATOM 10031 O O    . THR A 1 52 ? 2.130   -5.229  5.461   1.00 0.00 ? 52 THR A O    9  
ATOM 10032 C CB   . THR A 1 52 ? 4.656   -3.614  6.949   1.00 0.00 ? 52 THR A CB   9  
ATOM 10033 O OG1  . THR A 1 52 ? 5.782   -2.756  6.734   1.00 0.00 ? 52 THR A OG1  9  
ATOM 10034 C CG2  . THR A 1 52 ? 5.109   -5.066  6.944   1.00 0.00 ? 52 THR A CG2  9  
ATOM 10035 H H    . THR A 1 52 ? 3.490   -1.356  6.514   1.00 0.00 ? 52 THR A H    9  
ATOM 10036 H HA   . THR A 1 52 ? 4.008   -3.654  4.909   1.00 0.00 ? 52 THR A HA   9  
ATOM 10037 H HB   . THR A 1 52 ? 4.222   -3.391  7.914   1.00 0.00 ? 52 THR A HB   9  
ATOM 10038 H HG1  . THR A 1 52 ? 5.979   -2.716  5.795   1.00 0.00 ? 52 THR A HG1  9  
ATOM 10039 H HG21 . THR A 1 52 ? 6.181   -5.108  6.821   1.00 0.00 ? 52 THR A HG21 9  
ATOM 10040 H HG22 . THR A 1 52 ? 4.632   -5.588  6.128   1.00 0.00 ? 52 THR A HG22 9  
ATOM 10041 H HG23 . THR A 1 52 ? 4.835   -5.531  7.879   1.00 0.00 ? 52 THR A HG23 9  
ATOM 10042 N N    . ILE A 1 53 ? 1.617   -3.869  7.179   1.00 0.00 ? 53 ILE A N    9  
ATOM 10043 C CA   . ILE A 1 53 ? 0.425   -4.617  7.559   1.00 0.00 ? 53 ILE A CA   9  
ATOM 10044 C C    . ILE A 1 53 ? -0.490  -4.838  6.359   1.00 0.00 ? 53 ILE A C    9  
ATOM 10045 O O    . ILE A 1 53 ? -1.004  -5.938  6.152   1.00 0.00 ? 53 ILE A O    9  
ATOM 10046 C CB   . ILE A 1 53 ? -0.364  -3.895  8.666   1.00 0.00 ? 53 ILE A CB   9  
ATOM 10047 C CG1  . ILE A 1 53 ? 0.515   -3.698  9.903   1.00 0.00 ? 53 ILE A CG1  9  
ATOM 10048 C CG2  . ILE A 1 53 ? -1.618  -4.680  9.021   1.00 0.00 ? 53 ILE A CG2  9  
ATOM 10049 C CD1  . ILE A 1 53 ? 0.020   -2.607  10.828  1.00 0.00 ? 53 ILE A CD1  9  
ATOM 10050 H H    . ILE A 1 53 ? 1.865   -3.072  7.693   1.00 0.00 ? 53 ILE A H    9  
ATOM 10051 H HA   . ILE A 1 53 ? 0.742   -5.578  7.938   1.00 0.00 ? 53 ILE A HA   9  
ATOM 10052 H HB   . ILE A 1 53 ? -0.667  -2.930  8.291   1.00 0.00 ? 53 ILE A HB   9  
ATOM 10053 H HG12 . ILE A 1 53 ? 0.547   -4.618  10.465  1.00 0.00 ? 53 ILE A HG12 9  
ATOM 10054 H HG13 . ILE A 1 53 ? 1.515   -3.438  9.587   1.00 0.00 ? 53 ILE A HG13 9  
ATOM 10055 H HG21 . ILE A 1 53 ? -1.511  -5.701  8.685   1.00 0.00 ? 53 ILE A HG21 9  
ATOM 10056 H HG22 . ILE A 1 53 ? -1.760  -4.667  10.091  1.00 0.00 ? 53 ILE A HG22 9  
ATOM 10057 H HG23 . ILE A 1 53 ? -2.473  -4.231  8.538   1.00 0.00 ? 53 ILE A HG23 9  
ATOM 10058 H HD11 . ILE A 1 53 ? -1.048  -2.496  10.716  1.00 0.00 ? 53 ILE A HD11 9  
ATOM 10059 H HD12 . ILE A 1 53 ? 0.252   -2.868  11.849  1.00 0.00 ? 53 ILE A HD12 9  
ATOM 10060 H HD13 . ILE A 1 53 ? 0.506   -1.675  10.576  1.00 0.00 ? 53 ILE A HD13 9  
ATOM 10061 N N    . TRP A 1 54 ? -0.688  -3.787  5.572   1.00 0.00 ? 54 TRP A N    9  
ATOM 10062 C CA   . TRP A 1 54 ? -1.540  -3.867  4.391   1.00 0.00 ? 54 TRP A CA   9  
ATOM 10063 C C    . TRP A 1 54 ? -1.052  -4.955  3.440   1.00 0.00 ? 54 TRP A C    9  
ATOM 10064 O O    . TRP A 1 54 ? -1.818  -5.831  3.038   1.00 0.00 ? 54 TRP A O    9  
ATOM 10065 C CB   . TRP A 1 54 ? -1.574  -2.519  3.669   1.00 0.00 ? 54 TRP A CB   9  
ATOM 10066 C CG   . TRP A 1 54 ? -2.614  -2.448  2.592   1.00 0.00 ? 54 TRP A CG   9  
ATOM 10067 C CD1  . TRP A 1 54 ? -3.882  -1.956  2.707   1.00 0.00 ? 54 TRP A CD1  9  
ATOM 10068 C CD2  . TRP A 1 54 ? -2.473  -2.886  1.236   1.00 0.00 ? 54 TRP A CD2  9  
ATOM 10069 N NE1  . TRP A 1 54 ? -4.539  -2.061  1.505   1.00 0.00 ? 54 TRP A NE1  9  
ATOM 10070 C CE2  . TRP A 1 54 ? -3.696  -2.628  0.586   1.00 0.00 ? 54 TRP A CE2  9  
ATOM 10071 C CE3  . TRP A 1 54 ? -1.433  -3.469  0.507   1.00 0.00 ? 54 TRP A CE3  9  
ATOM 10072 C CZ2  . TRP A 1 54 ? -3.904  -2.934  -0.756  1.00 0.00 ? 54 TRP A CZ2  9  
ATOM 10073 C CZ3  . TRP A 1 54 ? -1.642  -3.773  -0.825  1.00 0.00 ? 54 TRP A CZ3  9  
ATOM 10074 C CH2  . TRP A 1 54 ? -2.869  -3.505  -1.446  1.00 0.00 ? 54 TRP A CH2  9  
ATOM 10075 H H    . TRP A 1 54 ? -0.250  -2.937  5.789   1.00 0.00 ? 54 TRP A H    9  
ATOM 10076 H HA   . TRP A 1 54 ? -2.538  -4.115  4.720   1.00 0.00 ? 54 TRP A HA   9  
ATOM 10077 H HB2  . TRP A 1 54 ? -1.784  -1.739  4.386   1.00 0.00 ? 54 TRP A HB2  9  
ATOM 10078 H HB3  . TRP A 1 54 ? -0.610  -2.337  3.216   1.00 0.00 ? 54 TRP A HB3  9  
ATOM 10079 H HD1  . TRP A 1 54 ? -4.295  -1.549  3.617   1.00 0.00 ? 54 TRP A HD1  9  
ATOM 10080 H HE1  . TRP A 1 54 ? -5.461  -1.776  1.333   1.00 0.00 ? 54 TRP A HE1  9  
ATOM 10081 H HE3  . TRP A 1 54 ? -0.480  -3.683  0.967   1.00 0.00 ? 54 TRP A HE3  9  
ATOM 10082 H HZ2  . TRP A 1 54 ? -4.844  -2.733  -1.249  1.00 0.00 ? 54 TRP A HZ2  9  
ATOM 10083 H HZ3  . TRP A 1 54 ? -0.849  -4.224  -1.404  1.00 0.00 ? 54 TRP A HZ3  9  
ATOM 10084 H HH2  . TRP A 1 54 ? -2.987  -3.759  -2.488  1.00 0.00 ? 54 TRP A HH2  9  
ATOM 10085 N N    . PHE A 1 55 ? 0.227   -4.893  3.084   1.00 0.00 ? 55 PHE A N    9  
ATOM 10086 C CA   . PHE A 1 55 ? 0.817   -5.873  2.179   1.00 0.00 ? 55 PHE A CA   9  
ATOM 10087 C C    . PHE A 1 55 ? 0.612   -7.290  2.704   1.00 0.00 ? 55 PHE A C    9  
ATOM 10088 O O    . PHE A 1 55 ? 0.449   -8.232  1.929   1.00 0.00 ? 55 PHE A O    9  
ATOM 10089 C CB   . PHE A 1 55 ? 2.310   -5.595  1.995   1.00 0.00 ? 55 PHE A CB   9  
ATOM 10090 C CG   . PHE A 1 55 ? 2.609   -4.643  0.872   1.00 0.00 ? 55 PHE A CG   9  
ATOM 10091 C CD1  . PHE A 1 55 ? 2.104   -3.353  0.886   1.00 0.00 ? 55 PHE A CD1  9  
ATOM 10092 C CD2  . PHE A 1 55 ? 3.396   -5.039  -0.197  1.00 0.00 ? 55 PHE A CD2  9  
ATOM 10093 C CE1  . PHE A 1 55 ? 2.377   -2.477  -0.147  1.00 0.00 ? 55 PHE A CE1  9  
ATOM 10094 C CE2  . PHE A 1 55 ? 3.674   -4.166  -1.233  1.00 0.00 ? 55 PHE A CE2  9  
ATOM 10095 C CZ   . PHE A 1 55 ? 3.164   -2.883  -1.207  1.00 0.00 ? 55 PHE A CZ   9  
ATOM 10096 H H    . PHE A 1 55 ? 0.787   -4.170  3.438   1.00 0.00 ? 55 PHE A H    9  
ATOM 10097 H HA   . PHE A 1 55 ? 0.322   -5.781  1.224   1.00 0.00 ? 55 PHE A HA   9  
ATOM 10098 H HB2  . PHE A 1 55 ? 2.704   -5.167  2.905   1.00 0.00 ? 55 PHE A HB2  9  
ATOM 10099 H HB3  . PHE A 1 55 ? 2.819   -6.524  1.789   1.00 0.00 ? 55 PHE A HB3  9  
ATOM 10100 H HD1  . PHE A 1 55 ? 1.489   -3.034  1.715   1.00 0.00 ? 55 PHE A HD1  9  
ATOM 10101 H HD2  . PHE A 1 55 ? 3.796   -6.043  -0.218  1.00 0.00 ? 55 PHE A HD2  9  
ATOM 10102 H HE1  . PHE A 1 55 ? 1.977   -1.474  -0.124  1.00 0.00 ? 55 PHE A HE1  9  
ATOM 10103 H HE2  . PHE A 1 55 ? 4.289   -4.487  -2.060  1.00 0.00 ? 55 PHE A HE2  9  
ATOM 10104 H HZ   . PHE A 1 55 ? 3.378   -2.200  -2.015  1.00 0.00 ? 55 PHE A HZ   9  
ATOM 10105 N N    . GLN A 1 56 ? 0.623   -7.433  4.026   1.00 0.00 ? 56 GLN A N    9  
ATOM 10106 C CA   . GLN A 1 56 ? 0.441   -8.735  4.655   1.00 0.00 ? 56 GLN A CA   9  
ATOM 10107 C C    . GLN A 1 56 ? -0.996  -9.220  4.495   1.00 0.00 ? 56 GLN A C    9  
ATOM 10108 O O    . GLN A 1 56 ? -1.238  -10.322 4.003   1.00 0.00 ? 56 GLN A O    9  
ATOM 10109 C CB   . GLN A 1 56 ? 0.805   -8.664  6.139   1.00 0.00 ? 56 GLN A CB   9  
ATOM 10110 C CG   . GLN A 1 56 ? 2.299   -8.551  6.394   1.00 0.00 ? 56 GLN A CG   9  
ATOM 10111 C CD   . GLN A 1 56 ? 2.617   -7.835  7.691   1.00 0.00 ? 56 GLN A CD   9  
ATOM 10112 O OE1  . GLN A 1 56 ? 2.782   -6.614  7.716   1.00 0.00 ? 56 GLN A OE1  9  
ATOM 10113 N NE2  . GLN A 1 56 ? 2.706   -8.591  8.779   1.00 0.00 ? 56 GLN A NE2  9  
ATOM 10114 H H    . GLN A 1 56 ? 0.758   -6.644  4.590   1.00 0.00 ? 56 GLN A H    9  
ATOM 10115 H HA   . GLN A 1 56 ? 1.100   -9.435  4.165   1.00 0.00 ? 56 GLN A HA   9  
ATOM 10116 H HB2  . GLN A 1 56 ? 0.321   -7.803  6.575   1.00 0.00 ? 56 GLN A HB2  9  
ATOM 10117 H HB3  . GLN A 1 56 ? 0.445   -9.557  6.629   1.00 0.00 ? 56 GLN A HB3  9  
ATOM 10118 H HG2  . GLN A 1 56 ? 2.721   -9.544  6.436   1.00 0.00 ? 56 GLN A HG2  9  
ATOM 10119 H HG3  . GLN A 1 56 ? 2.750   -8.005  5.578   1.00 0.00 ? 56 GLN A HG3  9  
ATOM 10120 H HE21 . GLN A 1 56 ? 2.564   -9.557  8.683   1.00 0.00 ? 56 GLN A HE21 9  
ATOM 10121 H HE22 . GLN A 1 56 ? 2.911   -8.155  9.631   1.00 0.00 ? 56 GLN A HE22 9  
ATOM 10122 N N    . ASN A 1 57 ? -1.946  -8.391  4.914   1.00 0.00 ? 57 ASN A N    9  
ATOM 10123 C CA   . ASN A 1 57 ? -3.360  -8.736  4.817   1.00 0.00 ? 57 ASN A CA   9  
ATOM 10124 C C    . ASN A 1 57 ? -3.717  -9.176  3.401   1.00 0.00 ? 57 ASN A C    9  
ATOM 10125 O O    . ASN A 1 57 ? -4.619  -9.990  3.202   1.00 0.00 ? 57 ASN A O    9  
ATOM 10126 C CB   . ASN A 1 57 ? -4.226  -7.543  5.227   1.00 0.00 ? 57 ASN A CB   9  
ATOM 10127 C CG   . ASN A 1 57 ? -4.535  -7.535  6.712   1.00 0.00 ? 57 ASN A CG   9  
ATOM 10128 O OD1  . ASN A 1 57 ? -5.692  -7.639  7.117   1.00 0.00 ? 57 ASN A OD1  9  
ATOM 10129 N ND2  . ASN A 1 57 ? -3.497  -7.410  7.530   1.00 0.00 ? 57 ASN A ND2  9  
ATOM 10130 H H    . ASN A 1 57 ? -1.691  -7.526  5.297   1.00 0.00 ? 57 ASN A H    9  
ATOM 10131 H HA   . ASN A 1 57 ? -3.548  -9.555  5.495   1.00 0.00 ? 57 ASN A HA   9  
ATOM 10132 H HB2  . ASN A 1 57 ? -3.707  -6.628  4.982   1.00 0.00 ? 57 ASN A HB2  9  
ATOM 10133 H HB3  . ASN A 1 57 ? -5.159  -7.580  4.684   1.00 0.00 ? 57 ASN A HB3  9  
ATOM 10134 H HD21 . ASN A 1 57 ? -2.603  -7.332  7.136   1.00 0.00 ? 57 ASN A HD21 9  
ATOM 10135 H HD22 . ASN A 1 57 ? -3.667  -7.403  8.495   1.00 0.00 ? 57 ASN A HD22 9  
ATOM 10136 N N    . ARG A 1 58 ? -3.003  -8.633  2.421   1.00 0.00 ? 58 ARG A N    9  
ATOM 10137 C CA   . ARG A 1 58 ? -3.245  -8.969  1.023   1.00 0.00 ? 58 ARG A CA   9  
ATOM 10138 C C    . ARG A 1 58 ? -2.744  -10.375 0.707   1.00 0.00 ? 58 ARG A C    9  
ATOM 10139 O O    . ARG A 1 58 ? -3.502  -11.225 0.239   1.00 0.00 ? 58 ARG A O    9  
ATOM 10140 C CB   . ARG A 1 58 ? -2.559  -7.954  0.106   1.00 0.00 ? 58 ARG A CB   9  
ATOM 10141 C CG   . ARG A 1 58 ? -3.287  -7.732  -1.209  1.00 0.00 ? 58 ARG A CG   9  
ATOM 10142 C CD   . ARG A 1 58 ? -4.667  -7.131  -0.987  1.00 0.00 ? 58 ARG A CD   9  
ATOM 10143 N NE   . ARG A 1 58 ? -5.228  -6.581  -2.218  1.00 0.00 ? 58 ARG A NE   9  
ATOM 10144 C CZ   . ARG A 1 58 ? -5.765  -7.327  -3.178  1.00 0.00 ? 58 ARG A CZ   9  
ATOM 10145 N NH1  . ARG A 1 58 ? -5.812  -8.645  -3.050  1.00 0.00 ? 58 ARG A NH1  9  
ATOM 10146 N NH2  . ARG A 1 58 ? -6.256  -6.753  -4.269  1.00 0.00 ? 58 ARG A NH2  9  
ATOM 10147 H H    . ARG A 1 58 ? -2.297  -7.990  2.642   1.00 0.00 ? 58 ARG A H    9  
ATOM 10148 H HA   . ARG A 1 58 ? -4.310  -8.933  0.852   1.00 0.00 ? 58 ARG A HA   9  
ATOM 10149 H HB2  . ARG A 1 58 ? -2.495  -7.007  0.621   1.00 0.00 ? 58 ARG A HB2  9  
ATOM 10150 H HB3  . ARG A 1 58 ? -1.561  -8.303  -0.114  1.00 0.00 ? 58 ARG A HB3  9  
ATOM 10151 H HG2  . ARG A 1 58 ? -2.707  -7.057  -1.822  1.00 0.00 ? 58 ARG A HG2  9  
ATOM 10152 H HG3  . ARG A 1 58 ? -3.394  -8.680  -1.715  1.00 0.00 ? 58 ARG A HG3  9  
ATOM 10153 H HD2  . ARG A 1 58 ? -5.325  -7.902  -0.615  1.00 0.00 ? 58 ARG A HD2  9  
ATOM 10154 H HD3  . ARG A 1 58 ? -4.587  -6.342  -0.255  1.00 0.00 ? 58 ARG A HD3  9  
ATOM 10155 H HE   . ARG A 1 58 ? -5.204  -5.609  -2.334  1.00 0.00 ? 58 ARG A HE   9  
ATOM 10156 H HH11 . ARG A 1 58 ? -5.444  -9.080  -2.228  1.00 0.00 ? 58 ARG A HH11 9  
ATOM 10157 H HH12 . ARG A 1 58 ? -6.217  -9.204  -3.774  1.00 0.00 ? 58 ARG A HH12 9  
ATOM 10158 H HH21 . ARG A 1 58 ? -6.222  -5.759  -4.369  1.00 0.00 ? 58 ARG A HH21 9  
ATOM 10159 H HH22 . ARG A 1 58 ? -6.659  -7.315  -4.991  1.00 0.00 ? 58 ARG A HH22 9  
ATOM 10160 N N    . ARG A 1 59 ? -1.462  -10.613 0.966   1.00 0.00 ? 59 ARG A N    9  
ATOM 10161 C CA   . ARG A 1 59 ? -0.859  -11.916 0.708   1.00 0.00 ? 59 ARG A CA   9  
ATOM 10162 C C    . ARG A 1 59 ? -1.516  -12.997 1.561   1.00 0.00 ? 59 ARG A C    9  
ATOM 10163 O O    . ARG A 1 59 ? -1.524  -14.172 1.194   1.00 0.00 ? 59 ARG A O    9  
ATOM 10164 C CB   . ARG A 1 59 ? 0.644   -11.871 0.990   1.00 0.00 ? 59 ARG A CB   9  
ATOM 10165 C CG   . ARG A 1 59 ? 1.490   -11.637 -0.250  1.00 0.00 ? 59 ARG A CG   9  
ATOM 10166 C CD   . ARG A 1 59 ? 1.966   -12.949 -0.855  1.00 0.00 ? 59 ARG A CD   9  
ATOM 10167 N NE   . ARG A 1 59 ? 2.905   -13.646 0.019   1.00 0.00 ? 59 ARG A NE   9  
ATOM 10168 C CZ   . ARG A 1 59 ? 3.555   -14.750 -0.332  1.00 0.00 ? 59 ARG A CZ   9  
ATOM 10169 N NH1  . ARG A 1 59 ? 3.369   -15.279 -1.533  1.00 0.00 ? 59 ARG A NH1  9  
ATOM 10170 N NH2  . ARG A 1 59 ? 4.395   -15.326 0.519   1.00 0.00 ? 59 ARG A NH2  9  
ATOM 10171 H H    . ARG A 1 59 ? -0.908  -9.896  1.339   1.00 0.00 ? 59 ARG A H    9  
ATOM 10172 H HA   . ARG A 1 59 ? -1.014  -12.152 -0.334  1.00 0.00 ? 59 ARG A HA   9  
ATOM 10173 H HB2  . ARG A 1 59 ? 0.843   -11.073 1.691   1.00 0.00 ? 59 ARG A HB2  9  
ATOM 10174 H HB3  . ARG A 1 59 ? 0.942   -12.809 1.432   1.00 0.00 ? 59 ARG A HB3  9  
ATOM 10175 H HG2  . ARG A 1 59 ? 0.898   -11.109 -0.984  1.00 0.00 ? 59 ARG A HG2  9  
ATOM 10176 H HG3  . ARG A 1 59 ? 2.349   -11.042 0.019   1.00 0.00 ? 59 ARG A HG3  9  
ATOM 10177 H HD2  . ARG A 1 59 ? 1.109   -13.583 -1.025  1.00 0.00 ? 59 ARG A HD2  9  
ATOM 10178 H HD3  . ARG A 1 59 ? 2.451   -12.740 -1.797  1.00 0.00 ? 59 ARG A HD3  9  
ATOM 10179 H HE   . ARG A 1 59 ? 3.058   -13.271 0.911   1.00 0.00 ? 59 ARG A HE   9  
ATOM 10180 H HH11 . ARG A 1 59 ? 2.738   -14.846 -2.177  1.00 0.00 ? 59 ARG A HH11 9  
ATOM 10181 H HH12 . ARG A 1 59 ? 3.861   -16.110 -1.796  1.00 0.00 ? 59 ARG A HH12 9  
ATOM 10182 H HH21 . ARG A 1 59 ? 4.538   -14.929 1.425   1.00 0.00 ? 59 ARG A HH21 9  
ATOM 10183 H HH22 . ARG A 1 59 ? 4.883   -16.156 0.254   1.00 0.00 ? 59 ARG A HH22 9  
ATOM 10184 N N    . VAL A 1 60 ? -2.065  -12.592 2.702   1.00 0.00 ? 60 VAL A N    9  
ATOM 10185 C CA   . VAL A 1 60 ? -2.725  -13.525 3.607   1.00 0.00 ? 60 VAL A CA   9  
ATOM 10186 C C    . VAL A 1 60 ? -4.169  -13.773 3.185   1.00 0.00 ? 60 VAL A C    9  
ATOM 10187 O O    . VAL A 1 60 ? -4.764  -14.792 3.535   1.00 0.00 ? 60 VAL A O    9  
ATOM 10188 C CB   . VAL A 1 60 ? -2.706  -13.008 5.058   1.00 0.00 ? 60 VAL A CB   9  
ATOM 10189 C CG1  . VAL A 1 60 ? -3.433  -13.976 5.979   1.00 0.00 ? 60 VAL A CG1  9  
ATOM 10190 C CG2  . VAL A 1 60 ? -1.276  -12.786 5.526   1.00 0.00 ? 60 VAL A CG2  9  
ATOM 10191 H H    . VAL A 1 60 ? -2.026  -11.642 2.940   1.00 0.00 ? 60 VAL A H    9  
ATOM 10192 H HA   . VAL A 1 60 ? -2.185  -14.461 3.573   1.00 0.00 ? 60 VAL A HA   9  
ATOM 10193 H HB   . VAL A 1 60 ? -3.224  -12.061 5.087   1.00 0.00 ? 60 VAL A HB   9  
ATOM 10194 H HG11 . VAL A 1 60 ? -3.003  -13.923 6.968   1.00 0.00 ? 60 VAL A HG11 9  
ATOM 10195 H HG12 . VAL A 1 60 ? -4.479  -13.713 6.025   1.00 0.00 ? 60 VAL A HG12 9  
ATOM 10196 H HG13 . VAL A 1 60 ? -3.331  -14.982 5.597   1.00 0.00 ? 60 VAL A HG13 9  
ATOM 10197 H HG21 . VAL A 1 60 ? -0.594  -13.031 4.725   1.00 0.00 ? 60 VAL A HG21 9  
ATOM 10198 H HG22 . VAL A 1 60 ? -1.145  -11.751 5.805   1.00 0.00 ? 60 VAL A HG22 9  
ATOM 10199 H HG23 . VAL A 1 60 ? -1.073  -13.417 6.378   1.00 0.00 ? 60 VAL A HG23 9  
ATOM 10200 N N    . LYS A 1 61 ? -4.728  -12.833 2.431   1.00 0.00 ? 61 LYS A N    9  
ATOM 10201 C CA   . LYS A 1 61 ? -6.102  -12.947 1.958   1.00 0.00 ? 61 LYS A CA   9  
ATOM 10202 C C    . LYS A 1 61 ? -6.184  -13.858 0.737   1.00 0.00 ? 61 LYS A C    9  
ATOM 10203 O O    . LYS A 1 61 ? -7.200  -14.512 0.507   1.00 0.00 ? 61 LYS A O    9  
ATOM 10204 C CB   . LYS A 1 61 ? -6.663  -11.565 1.615   1.00 0.00 ? 61 LYS A CB   9  
ATOM 10205 C CG   . LYS A 1 61 ? -7.572  -10.994 2.689   1.00 0.00 ? 61 LYS A CG   9  
ATOM 10206 C CD   . LYS A 1 61 ? -7.926  -9.543  2.407   1.00 0.00 ? 61 LYS A CD   9  
ATOM 10207 C CE   . LYS A 1 61 ? -8.579  -8.884  3.612   1.00 0.00 ? 61 LYS A CE   9  
ATOM 10208 N NZ   . LYS A 1 61 ? -8.465  -7.400  3.562   1.00 0.00 ? 61 LYS A NZ   9  
ATOM 10209 H H    . LYS A 1 61 ? -4.202  -12.042 2.185   1.00 0.00 ? 61 LYS A H    9  
ATOM 10210 H HA   . LYS A 1 61 ? -6.692  -13.378 2.754   1.00 0.00 ? 61 LYS A HA   9  
ATOM 10211 H HB2  . LYS A 1 61 ? -5.839  -10.882 1.470   1.00 0.00 ? 61 LYS A HB2  9  
ATOM 10212 H HB3  . LYS A 1 61 ? -7.226  -11.637 0.696   1.00 0.00 ? 61 LYS A HB3  9  
ATOM 10213 H HG2  . LYS A 1 61 ? -8.482  -11.575 2.724   1.00 0.00 ? 61 LYS A HG2  9  
ATOM 10214 H HG3  . LYS A 1 61 ? -7.069  -11.053 3.644   1.00 0.00 ? 61 LYS A HG3  9  
ATOM 10215 H HD2  . LYS A 1 61 ? -7.024  -9.003  2.161   1.00 0.00 ? 61 LYS A HD2  9  
ATOM 10216 H HD3  . LYS A 1 61 ? -8.610  -9.505  1.571   1.00 0.00 ? 61 LYS A HD3  9  
ATOM 10217 H HE2  . LYS A 1 61 ? -9.623  -9.156  3.633   1.00 0.00 ? 61 LYS A HE2  9  
ATOM 10218 H HE3  . LYS A 1 61 ? -8.096  -9.244  4.509   1.00 0.00 ? 61 LYS A HE3  9  
ATOM 10219 H HZ1  . LYS A 1 61 ? -9.377  -6.981  3.290   1.00 0.00 ? 61 LYS A HZ1  9  
ATOM 10220 H HZ2  . LYS A 1 61 ? -7.746  -7.120  2.865   1.00 0.00 ? 61 LYS A HZ2  9  
ATOM 10221 H HZ3  . LYS A 1 61 ? -8.190  -7.031  4.495   1.00 0.00 ? 61 LYS A HZ3  9  
ATOM 10222 N N    . GLU A 1 62 ? -5.106  -13.895 -0.040  1.00 0.00 ? 62 GLU A N    9  
ATOM 10223 C CA   . GLU A 1 62 ? -5.057  -14.727 -1.237  1.00 0.00 ? 62 GLU A CA   9  
ATOM 10224 C C    . GLU A 1 62 ? -4.843  -16.193 -0.873  1.00 0.00 ? 62 GLU A C    9  
ATOM 10225 O O    . GLU A 1 62 ? -5.229  -17.093 -1.619  1.00 0.00 ? 62 GLU A O    9  
ATOM 10226 C CB   . GLU A 1 62 ? -3.940  -14.253 -2.169  1.00 0.00 ? 62 GLU A CB   9  
ATOM 10227 C CG   . GLU A 1 62 ? -2.560  -14.294 -1.534  1.00 0.00 ? 62 GLU A CG   9  
ATOM 10228 C CD   . GLU A 1 62 ? -1.447  -14.102 -2.545  1.00 0.00 ? 62 GLU A CD   9  
ATOM 10229 O OE1  . GLU A 1 62 ? -1.489  -13.100 -3.290  1.00 0.00 ? 62 GLU A OE1  9  
ATOM 10230 O OE2  . GLU A 1 62 ? -0.534  -14.953 -2.593  1.00 0.00 ? 62 GLU A OE2  9  
ATOM 10231 H H    . GLU A 1 62 ? -4.327  -13.351 0.196   1.00 0.00 ? 62 GLU A H    9  
ATOM 10232 H HA   . GLU A 1 62 ? -6.004  -14.630 -1.747  1.00 0.00 ? 62 GLU A HA   9  
ATOM 10233 H HB2  . GLU A 1 62 ? -3.929  -14.882 -3.047  1.00 0.00 ? 62 GLU A HB2  9  
ATOM 10234 H HB3  . GLU A 1 62 ? -4.145  -13.236 -2.468  1.00 0.00 ? 62 GLU A HB3  9  
ATOM 10235 H HG2  . GLU A 1 62 ? -2.494  -13.510 -0.795  1.00 0.00 ? 62 GLU A HG2  9  
ATOM 10236 H HG3  . GLU A 1 62 ? -2.428  -15.252 -1.053  1.00 0.00 ? 62 GLU A HG3  9  
ATOM 10237 N N    . LYS A 1 63 ? -4.225  -16.426 0.280   1.00 0.00 ? 63 LYS A N    9  
ATOM 10238 C CA   . LYS A 1 63 ? -3.959  -17.782 0.747   1.00 0.00 ? 63 LYS A CA   9  
ATOM 10239 C C    . LYS A 1 63 ? -5.033  -18.240 1.729   1.00 0.00 ? 63 LYS A C    9  
ATOM 10240 O O    . LYS A 1 63 ? -5.340  -19.428 1.819   1.00 0.00 ? 63 LYS A O    9  
ATOM 10241 C CB   . LYS A 1 63 ? -2.582  -17.854 1.410   1.00 0.00 ? 63 LYS A CB   9  
ATOM 10242 C CG   . LYS A 1 63 ? -2.437  -16.936 2.611   1.00 0.00 ? 63 LYS A CG   9  
ATOM 10243 C CD   . LYS A 1 63 ? -2.577  -17.699 3.917   1.00 0.00 ? 63 LYS A CD   9  
ATOM 10244 C CE   . LYS A 1 63 ? -1.250  -18.297 4.359   1.00 0.00 ? 63 LYS A CE   9  
ATOM 10245 N NZ   . LYS A 1 63 ? -1.441  -19.484 5.238   1.00 0.00 ? 63 LYS A NZ   9  
ATOM 10246 H H    . LYS A 1 63 ? -3.942  -15.666 0.832   1.00 0.00 ? 63 LYS A H    9  
ATOM 10247 H HA   . LYS A 1 63 ? -3.971  -18.436 -0.112  1.00 0.00 ? 63 LYS A HA   9  
ATOM 10248 H HB2  . LYS A 1 63 ? -2.405  -18.868 1.735   1.00 0.00 ? 63 LYS A HB2  9  
ATOM 10249 H HB3  . LYS A 1 63 ? -1.831  -17.582 0.682   1.00 0.00 ? 63 LYS A HB3  9  
ATOM 10250 H HG2  . LYS A 1 63 ? -1.462  -16.471 2.581   1.00 0.00 ? 63 LYS A HG2  9  
ATOM 10251 H HG3  . LYS A 1 63 ? -3.203  -16.174 2.565   1.00 0.00 ? 63 LYS A HG3  9  
ATOM 10252 H HD2  . LYS A 1 63 ? -2.927  -17.024 4.683   1.00 0.00 ? 63 LYS A HD2  9  
ATOM 10253 H HD3  . LYS A 1 63 ? -3.294  -18.497 3.782   1.00 0.00 ? 63 LYS A HD3  9  
ATOM 10254 H HE2  . LYS A 1 63 ? -0.695  -18.595 3.483   1.00 0.00 ? 63 LYS A HE2  9  
ATOM 10255 H HE3  . LYS A 1 63 ? -0.694  -17.545 4.899   1.00 0.00 ? 63 LYS A HE3  9  
ATOM 10256 H HZ1  . LYS A 1 63 ? -1.034  -19.301 6.177   1.00 0.00 ? 63 LYS A HZ1  9  
ATOM 10257 H HZ2  . LYS A 1 63 ? -0.971  -20.314 4.824   1.00 0.00 ? 63 LYS A HZ2  9  
ATOM 10258 H HZ3  . LYS A 1 63 ? -2.455  -19.690 5.345   1.00 0.00 ? 63 LYS A HZ3  9  
ATOM 10259 N N    . LYS A 1 64 ? -5.602  -17.289 2.462   1.00 0.00 ? 64 LYS A N    9  
ATOM 10260 C CA   . LYS A 1 64 ? -6.644  -17.593 3.436   1.00 0.00 ? 64 LYS A CA   9  
ATOM 10261 C C    . LYS A 1 64 ? -8.016  -17.181 2.912   1.00 0.00 ? 64 LYS A C    9  
ATOM 10262 O O    . LYS A 1 64 ? -8.251  -16.009 2.616   1.00 0.00 ? 64 LYS A O    9  
ATOM 10263 C CB   . LYS A 1 64 ? -6.357  -16.882 4.760   1.00 0.00 ? 64 LYS A CB   9  
ATOM 10264 C CG   . LYS A 1 64 ? -7.042  -17.522 5.955   1.00 0.00 ? 64 LYS A CG   9  
ATOM 10265 C CD   . LYS A 1 64 ? -6.410  -17.077 7.263   1.00 0.00 ? 64 LYS A CD   9  
ATOM 10266 C CE   . LYS A 1 64 ? -7.230  -17.532 8.461   1.00 0.00 ? 64 LYS A CE   9  
ATOM 10267 N NZ   . LYS A 1 64 ? -6.873  -18.914 8.885   1.00 0.00 ? 64 LYS A NZ   9  
ATOM 10268 H H    . LYS A 1 64 ? -5.315  -16.359 2.345   1.00 0.00 ? 64 LYS A H    9  
ATOM 10269 H HA   . LYS A 1 64 ? -6.641  -18.660 3.602   1.00 0.00 ? 64 LYS A HA   9  
ATOM 10270 H HB2  . LYS A 1 64 ? -5.291  -16.890 4.935   1.00 0.00 ? 64 LYS A HB2  9  
ATOM 10271 H HB3  . LYS A 1 64 ? -6.693  -15.858 4.684   1.00 0.00 ? 64 LYS A HB3  9  
ATOM 10272 H HG2  . LYS A 1 64 ? -8.083  -17.237 5.956   1.00 0.00 ? 64 LYS A HG2  9  
ATOM 10273 H HG3  . LYS A 1 64 ? -6.960  -18.596 5.873   1.00 0.00 ? 64 LYS A HG3  9  
ATOM 10274 H HD2  . LYS A 1 64 ? -5.419  -17.502 7.338   1.00 0.00 ? 64 LYS A HD2  9  
ATOM 10275 H HD3  . LYS A 1 64 ? -6.342  -15.999 7.273   1.00 0.00 ? 64 LYS A HD3  9  
ATOM 10276 H HE2  . LYS A 1 64 ? -7.049  -16.855 9.282   1.00 0.00 ? 64 LYS A HE2  9  
ATOM 10277 H HE3  . LYS A 1 64 ? -8.276  -17.505 8.195   1.00 0.00 ? 64 LYS A HE3  9  
ATOM 10278 H HZ1  . LYS A 1 64 ? -6.385  -19.410 8.112   1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 10279 H HZ2  . LYS A 1 64 ? -7.732  -19.445 9.134   1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 10280 H HZ3  . LYS A 1 64 ? -6.245  -18.884 9.713   1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 10281 N N    . SER A 1 65 ? -8.918  -18.150 2.801   1.00 0.00 ? 65 SER A N    9  
ATOM 10282 C CA   . SER A 1 65 ? -10.266 -17.888 2.310   1.00 0.00 ? 65 SER A CA   9  
ATOM 10283 C C    . SER A 1 65 ? -10.940 -16.795 3.134   1.00 0.00 ? 65 SER A C    9  
ATOM 10284 O O    . SER A 1 65 ? -10.698 -16.667 4.334   1.00 0.00 ? 65 SER A O    9  
ATOM 10285 C CB   . SER A 1 65 ? -11.105 -19.166 2.354   1.00 0.00 ? 65 SER A CB   9  
ATOM 10286 O OG   . SER A 1 65 ? -10.462 -20.222 1.661   1.00 0.00 ? 65 SER A OG   9  
ATOM 10287 H H    . SER A 1 65 ? -8.670  -19.065 3.053   1.00 0.00 ? 65 SER A H    9  
ATOM 10288 H HA   . SER A 1 65 ? -10.187 -17.554 1.287   1.00 0.00 ? 65 SER A HA   9  
ATOM 10289 H HB2  . SER A 1 65 ? -11.252 -19.463 3.381   1.00 0.00 ? 65 SER A HB2  9  
ATOM 10290 H HB3  . SER A 1 65 ? -12.064 -18.980 1.891   1.00 0.00 ? 65 SER A HB3  9  
ATOM 10291 H HG   . SER A 1 65 ? -11.120 -20.761 1.216   1.00 0.00 ? 65 SER A HG   9  
ATOM 10292 N N    . GLY A 1 66 ? -11.790 -16.009 2.480   1.00 0.00 ? 66 GLY A N    9  
ATOM 10293 C CA   . GLY A 1 66 ? -12.487 -14.937 3.167   1.00 0.00 ? 66 GLY A CA   9  
ATOM 10294 C C    . GLY A 1 66 ? -13.267 -14.050 2.216   1.00 0.00 ? 66 GLY A C    9  
ATOM 10295 O O    . GLY A 1 66 ? -14.493 -14.126 2.128   1.00 0.00 ? 66 GLY A O    9  
ATOM 10296 H H    . GLY A 1 66 ? -11.944 -16.157 1.524   1.00 0.00 ? 66 GLY A H    9  
ATOM 10297 H HA2  . GLY A 1 66 ? -13.170 -15.367 3.884   1.00 0.00 ? 66 GLY A HA2  9  
ATOM 10298 H HA3  . GLY A 1 66 ? -11.763 -14.331 3.692   1.00 0.00 ? 66 GLY A HA3  9  
ATOM 10299 N N    . PRO A 1 67 ? -12.550 -13.185 1.484   1.00 0.00 ? 67 PRO A N    9  
ATOM 10300 C CA   . PRO A 1 67 ? -13.163 -12.263 0.523   1.00 0.00 ? 67 PRO A CA   9  
ATOM 10301 C C    . PRO A 1 67 ? -13.720 -12.985 -0.699  1.00 0.00 ? 67 PRO A C    9  
ATOM 10302 O O    . PRO A 1 67 ? -13.380 -14.139 -0.958  1.00 0.00 ? 67 PRO A O    9  
ATOM 10303 C CB   . PRO A 1 67 ? -12.003 -11.348 0.121   1.00 0.00 ? 67 PRO A CB   9  
ATOM 10304 C CG   . PRO A 1 67 ? -10.779 -12.163 0.356   1.00 0.00 ? 67 PRO A CG   9  
ATOM 10305 C CD   . PRO A 1 67 ? -11.086 -13.040 1.538   1.00 0.00 ? 67 PRO A CD   9  
ATOM 10306 H HA   . PRO A 1 67 ? -13.945 -11.675 0.981   1.00 0.00 ? 67 PRO A HA   9  
ATOM 10307 H HB2  . PRO A 1 67 ? -12.103 -11.074 -0.920  1.00 0.00 ? 67 PRO A HB2  9  
ATOM 10308 H HB3  . PRO A 1 67 ? -12.011 -10.460 0.735   1.00 0.00 ? 67 PRO A HB3  9  
ATOM 10309 H HG2  . PRO A 1 67 ? -10.566 -12.766 -0.513  1.00 0.00 ? 67 PRO A HG2  9  
ATOM 10310 H HG3  . PRO A 1 67 ? -9.944  -11.514 0.578   1.00 0.00 ? 67 PRO A HG3  9  
ATOM 10311 H HD2  . PRO A 1 67 ? -10.599 -13.998 1.433   1.00 0.00 ? 67 PRO A HD2  9  
ATOM 10312 H HD3  . PRO A 1 67 ? -10.780 -12.558 2.455   1.00 0.00 ? 67 PRO A HD3  9  
ATOM 10313 N N    . SER A 1 68 ? -14.578 -12.298 -1.446  1.00 0.00 ? 68 SER A N    9  
ATOM 10314 C CA   . SER A 1 68 ? -15.185 -12.876 -2.639  1.00 0.00 ? 68 SER A CA   9  
ATOM 10315 C C    . SER A 1 68 ? -15.521 -11.791 -3.658  1.00 0.00 ? 68 SER A C    9  
ATOM 10316 O O    . SER A 1 68 ? -15.810 -10.651 -3.294  1.00 0.00 ? 68 SER A O    9  
ATOM 10317 C CB   . SER A 1 68 ? -16.451 -13.652 -2.269  1.00 0.00 ? 68 SER A CB   9  
ATOM 10318 O OG   . SER A 1 68 ? -17.125 -13.040 -1.183  1.00 0.00 ? 68 SER A OG   9  
ATOM 10319 H H    . SER A 1 68 ? -14.810 -11.382 -1.187  1.00 0.00 ? 68 SER A H    9  
ATOM 10320 H HA   . SER A 1 68 ? -14.471 -13.557 -3.078  1.00 0.00 ? 68 SER A HA   9  
ATOM 10321 H HB2  . SER A 1 68 ? -17.115 -13.680 -3.119  1.00 0.00 ? 68 SER A HB2  9  
ATOM 10322 H HB3  . SER A 1 68 ? -16.182 -14.660 -1.988  1.00 0.00 ? 68 SER A HB3  9  
ATOM 10323 H HG   . SER A 1 68 ? -16.508 -12.898 -0.461  1.00 0.00 ? 68 SER A HG   9  
ATOM 10324 N N    . SER A 1 69 ? -15.480 -12.154 -4.936  1.00 0.00 ? 69 SER A N    9  
ATOM 10325 C CA   . SER A 1 69 ? -15.775 -11.212 -6.009  1.00 0.00 ? 69 SER A CA   9  
ATOM 10326 C C    . SER A 1 69 ? -17.159 -10.597 -5.825  1.00 0.00 ? 69 SER A C    9  
ATOM 10327 O O    . SER A 1 69 ? -17.330 -9.383  -5.929  1.00 0.00 ? 69 SER A O    9  
ATOM 10328 C CB   . SER A 1 69 ? -15.691 -11.910 -7.367  1.00 0.00 ? 69 SER A CB   9  
ATOM 10329 O OG   . SER A 1 69 ? -16.640 -12.959 -7.461  1.00 0.00 ? 69 SER A OG   9  
ATOM 10330 H H    . SER A 1 69 ? -15.242 -13.078 -5.162  1.00 0.00 ? 69 SER A H    9  
ATOM 10331 H HA   . SER A 1 69 ? -15.037 -10.425 -5.971  1.00 0.00 ? 69 SER A HA   9  
ATOM 10332 H HB2  . SER A 1 69 ? -15.886 -11.194 -8.150  1.00 0.00 ? 69 SER A HB2  9  
ATOM 10333 H HB3  . SER A 1 69 ? -14.701 -12.324 -7.495  1.00 0.00 ? 69 SER A HB3  9  
ATOM 10334 H HG   . SER A 1 69 ? -16.669 -13.285 -8.364  1.00 0.00 ? 69 SER A HG   9  
ATOM 10335 N N    . GLY A 1 70 ? -18.146 -11.445 -5.551  1.00 0.00 ? 70 GLY A N    9  
ATOM 10336 C CA   . GLY A 1 70 ? -19.502 -10.968 -5.357  1.00 0.00 ? 70 GLY A CA   9  
ATOM 10337 C C    . GLY A 1 70 ? -20.252 -10.804 -6.665  1.00 0.00 ? 70 GLY A C    9  
ATOM 10338 O O    . GLY A 1 70 ? -20.482 -9.684  -7.120  1.00 0.00 ? 70 GLY A O    9  
ATOM 10339 H H    . GLY A 1 70 ? -17.951 -12.403 -5.480  1.00 0.00 ? 70 GLY A H    9  
ATOM 10340 H HA2  . GLY A 1 70 ? -20.035 -11.671 -4.735  1.00 0.00 ? 70 GLY A HA2  9  
ATOM 10341 H HA3  . GLY A 1 70 ? -19.467 -10.012 -4.854  1.00 0.00 ? 70 GLY A HA3  9  
ATOM 10342 N N    . GLY A 1 1  ? 3.460   12.319  7.010   1.00 0.00 ? 1  GLY A N    10 
ATOM 10343 C CA   . GLY A 1 1  ? 4.547   11.991  7.914   1.00 0.00 ? 1  GLY A CA   10 
ATOM 10344 C C    . GLY A 1 1  ? 4.336   10.665  8.617   1.00 0.00 ? 1  GLY A C    10 
ATOM 10345 O O    . GLY A 1 1  ? 5.012   9.681   8.317   1.00 0.00 ? 1  GLY A O    10 
ATOM 10346 H H1   . GLY A 1 1  ? 3.040   13.203  7.052   1.00 0.00 ? 1  GLY A H1   10 
ATOM 10347 H HA2  . GLY A 1 1  ? 5.468   11.947  7.352   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 10348 H HA3  . GLY A 1 1  ? 4.629   12.770  8.658   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 10349 N N    . SER A 1 2  ? 3.397   10.638  9.558   1.00 0.00 ? 2  SER A N    10 
ATOM 10350 C CA   . SER A 1 2  ? 3.103   9.424   10.310  1.00 0.00 ? 2  SER A CA   10 
ATOM 10351 C C    . SER A 1 2  ? 1.883   9.621   11.204  1.00 0.00 ? 2  SER A C    10 
ATOM 10352 O O    . SER A 1 2  ? 1.602   10.732  11.654  1.00 0.00 ? 2  SER A O    10 
ATOM 10353 C CB   . SER A 1 2  ? 4.311   9.019   11.158  1.00 0.00 ? 2  SER A CB   10 
ATOM 10354 O OG   . SER A 1 2  ? 5.175   8.157   10.436  1.00 0.00 ? 2  SER A OG   10 
ATOM 10355 H H    . SER A 1 2  ? 2.892   11.455  9.752   1.00 0.00 ? 2  SER A H    10 
ATOM 10356 H HA   . SER A 1 2  ? 2.892   8.637   9.601   1.00 0.00 ? 2  SER A HA   10 
ATOM 10357 H HB2  . SER A 1 2  ? 4.860   9.903   11.443  1.00 0.00 ? 2  SER A HB2  10 
ATOM 10358 H HB3  . SER A 1 2  ? 3.968   8.506   12.045  1.00 0.00 ? 2  SER A HB3  10 
ATOM 10359 H HG   . SER A 1 2  ? 5.733   7.676   11.051  1.00 0.00 ? 2  SER A HG   10 
ATOM 10360 N N    . SER A 1 3  ? 1.161   8.534   11.457  1.00 0.00 ? 3  SER A N    10 
ATOM 10361 C CA   . SER A 1 3  ? -0.032  8.586   12.294  1.00 0.00 ? 3  SER A CA   10 
ATOM 10362 C C    . SER A 1 3  ? 0.037   7.542   13.405  1.00 0.00 ? 3  SER A C    10 
ATOM 10363 O O    . SER A 1 3  ? 0.063   6.341   13.141  1.00 0.00 ? 3  SER A O    10 
ATOM 10364 C CB   . SER A 1 3  ? -1.286  8.364   11.447  1.00 0.00 ? 3  SER A CB   10 
ATOM 10365 O OG   . SER A 1 3  ? -1.191  9.045   10.208  1.00 0.00 ? 3  SER A OG   10 
ATOM 10366 H H    . SER A 1 3  ? 1.436   7.677   11.070  1.00 0.00 ? 3  SER A H    10 
ATOM 10367 H HA   . SER A 1 3  ? -0.080  9.568   12.742  1.00 0.00 ? 3  SER A HA   10 
ATOM 10368 H HB2  . SER A 1 3  ? -1.405  7.308   11.255  1.00 0.00 ? 3  SER A HB2  10 
ATOM 10369 H HB3  . SER A 1 3  ? -2.149  8.733   11.982  1.00 0.00 ? 3  SER A HB3  10 
ATOM 10370 H HG   . SER A 1 3  ? -1.410  9.971   10.333  1.00 0.00 ? 3  SER A HG   10 
ATOM 10371 N N    . GLY A 1 4  ? 0.067   8.011   14.649  1.00 0.00 ? 4  GLY A N    10 
ATOM 10372 C CA   . GLY A 1 4  ? 0.133   7.106   15.781  1.00 0.00 ? 4  GLY A CA   10 
ATOM 10373 C C    . GLY A 1 4  ? -0.969  6.065   15.756  1.00 0.00 ? 4  GLY A C    10 
ATOM 10374 O O    . GLY A 1 4  ? -1.910  6.166   14.970  1.00 0.00 ? 4  GLY A O    10 
ATOM 10375 H H    . GLY A 1 4  ? 0.044   8.979   14.799  1.00 0.00 ? 4  GLY A H    10 
ATOM 10376 H HA2  . GLY A 1 4  ? 1.089   6.603   15.771  1.00 0.00 ? 4  GLY A HA2  10 
ATOM 10377 H HA3  . GLY A 1 4  ? 0.049   7.680   16.692  1.00 0.00 ? 4  GLY A HA3  10 
ATOM 10378 N N    . SER A 1 5  ? -0.851  5.060   16.619  1.00 0.00 ? 5  SER A N    10 
ATOM 10379 C CA   . SER A 1 5  ? -1.842  3.993   16.689  1.00 0.00 ? 5  SER A CA   10 
ATOM 10380 C C    . SER A 1 5  ? -3.244  4.565   16.876  1.00 0.00 ? 5  SER A C    10 
ATOM 10381 O O    . SER A 1 5  ? -3.413  5.663   17.407  1.00 0.00 ? 5  SER A O    10 
ATOM 10382 C CB   . SER A 1 5  ? -1.512  3.036   17.836  1.00 0.00 ? 5  SER A CB   10 
ATOM 10383 O OG   . SER A 1 5  ? -0.829  3.708   18.880  1.00 0.00 ? 5  SER A OG   10 
ATOM 10384 H H    . SER A 1 5  ? -0.077  5.035   17.220  1.00 0.00 ? 5  SER A H    10 
ATOM 10385 H HA   . SER A 1 5  ? -1.810  3.449   15.757  1.00 0.00 ? 5  SER A HA   10 
ATOM 10386 H HB2  . SER A 1 5  ? -2.427  2.621   18.230  1.00 0.00 ? 5  SER A HB2  10 
ATOM 10387 H HB3  . SER A 1 5  ? -0.885  2.238   17.466  1.00 0.00 ? 5  SER A HB3  10 
ATOM 10388 H HG   . SER A 1 5  ? 0.064   3.363   18.952  1.00 0.00 ? 5  SER A HG   10 
ATOM 10389 N N    . SER A 1 6  ? -4.248  3.813   16.436  1.00 0.00 ? 6  SER A N    10 
ATOM 10390 C CA   . SER A 1 6  ? -5.635  4.246   16.551  1.00 0.00 ? 6  SER A CA   10 
ATOM 10391 C C    . SER A 1 6  ? -6.590  3.088   16.275  1.00 0.00 ? 6  SER A C    10 
ATOM 10392 O O    . SER A 1 6  ? -6.257  2.155   15.546  1.00 0.00 ? 6  SER A O    10 
ATOM 10393 C CB   . SER A 1 6  ? -5.915  5.395   15.581  1.00 0.00 ? 6  SER A CB   10 
ATOM 10394 O OG   . SER A 1 6  ? -7.068  6.122   15.970  1.00 0.00 ? 6  SER A OG   10 
ATOM 10395 H H    . SER A 1 6  ? -4.049  2.947   16.021  1.00 0.00 ? 6  SER A H    10 
ATOM 10396 H HA   . SER A 1 6  ? -5.792  4.593   17.561  1.00 0.00 ? 6  SER A HA   10 
ATOM 10397 H HB2  . SER A 1 6  ? -5.070  6.066   15.567  1.00 0.00 ? 6  SER A HB2  10 
ATOM 10398 H HB3  . SER A 1 6  ? -6.074  4.995   14.590  1.00 0.00 ? 6  SER A HB3  10 
ATOM 10399 H HG   . SER A 1 6  ? -7.851  5.588   15.814  1.00 0.00 ? 6  SER A HG   10 
ATOM 10400 N N    . GLY A 1 7  ? -7.780  3.157   16.864  1.00 0.00 ? 7  GLY A N    10 
ATOM 10401 C CA   . GLY A 1 7  ? -8.766  2.110   16.670  1.00 0.00 ? 7  GLY A CA   10 
ATOM 10402 C C    . GLY A 1 7  ? -9.418  2.174   15.304  1.00 0.00 ? 7  GLY A C    10 
ATOM 10403 O O    . GLY A 1 7  ? -8.864  2.753   14.370  1.00 0.00 ? 7  GLY A O    10 
ATOM 10404 H H    . GLY A 1 7  ? -7.990  3.926   17.435  1.00 0.00 ? 7  GLY A H    10 
ATOM 10405 H HA2  . GLY A 1 7  ? -8.283  1.151   16.783  1.00 0.00 ? 7  GLY A HA2  10 
ATOM 10406 H HA3  . GLY A 1 7  ? -9.531  2.207   17.426  1.00 0.00 ? 7  GLY A HA3  10 
ATOM 10407 N N    . ARG A 1 8  ? -10.599 1.574   15.185  1.00 0.00 ? 8  ARG A N    10 
ATOM 10408 C CA   . ARG A 1 8  ? -11.326 1.563   13.921  1.00 0.00 ? 8  ARG A CA   10 
ATOM 10409 C C    . ARG A 1 8  ? -12.828 1.441   14.160  1.00 0.00 ? 8  ARG A C    10 
ATOM 10410 O O    . ARG A 1 8  ? -13.318 0.393   14.581  1.00 0.00 ? 8  ARG A O    10 
ATOM 10411 C CB   . ARG A 1 8  ? -10.843 0.409   13.041  1.00 0.00 ? 8  ARG A CB   10 
ATOM 10412 C CG   . ARG A 1 8  ? -10.717 -0.912  13.784  1.00 0.00 ? 8  ARG A CG   10 
ATOM 10413 C CD   . ARG A 1 8  ? -10.214 -2.018  12.870  1.00 0.00 ? 8  ARG A CD   10 
ATOM 10414 N NE   . ARG A 1 8  ? -8.755  -2.086  12.844  1.00 0.00 ? 8  ARG A NE   10 
ATOM 10415 C CZ   . ARG A 1 8  ? -8.020  -2.490  13.875  1.00 0.00 ? 8  ARG A CZ   10 
ATOM 10416 N NH1  . ARG A 1 8  ? -8.604  -2.860  15.006  1.00 0.00 ? 8  ARG A NH1  10 
ATOM 10417 N NH2  . ARG A 1 8  ? -6.697  -2.525  13.774  1.00 0.00 ? 8  ARG A NH2  10 
ATOM 10418 H H    . ARG A 1 8  ? -10.990 1.129   15.965  1.00 0.00 ? 8  ARG A H    10 
ATOM 10419 H HA   . ARG A 1 8  ? -11.128 2.496   13.416  1.00 0.00 ? 8  ARG A HA   10 
ATOM 10420 H HB2  . ARG A 1 8  ? -11.543 0.274   12.229  1.00 0.00 ? 8  ARG A HB2  10 
ATOM 10421 H HB3  . ARG A 1 8  ? -9.876  0.662   12.634  1.00 0.00 ? 8  ARG A HB3  10 
ATOM 10422 H HG2  . ARG A 1 8  ? -10.020 -0.790  14.600  1.00 0.00 ? 8  ARG A HG2  10 
ATOM 10423 H HG3  . ARG A 1 8  ? -11.685 -1.189  14.172  1.00 0.00 ? 8  ARG A HG3  10 
ATOM 10424 H HD2  . ARG A 1 8  ? -10.602 -2.962  13.222  1.00 0.00 ? 8  ARG A HD2  10 
ATOM 10425 H HD3  . ARG A 1 8  ? -10.574 -1.832  11.869  1.00 0.00 ? 8  ARG A HD3  10 
ATOM 10426 H HE   . ARG A 1 8  ? -8.302  -1.817  12.018  1.00 0.00 ? 8  ARG A HE   10 
ATOM 10427 H HH11 . ARG A 1 8  ? -9.601  -2.836  15.084  1.00 0.00 ? 8  ARG A HH11 10 
ATOM 10428 H HH12 . ARG A 1 8  ? -8.049  -3.165  15.779  1.00 0.00 ? 8  ARG A HH12 10 
ATOM 10429 H HH21 . ARG A 1 8  ? -6.253  -2.247  12.923  1.00 0.00 ? 8  ARG A HH21 10 
ATOM 10430 H HH22 . ARG A 1 8  ? -6.145  -2.828  14.550  1.00 0.00 ? 8  ARG A HH22 10 
ATOM 10431 N N    . LYS A 1 9  ? -13.554 2.520   13.888  1.00 0.00 ? 9  LYS A N    10 
ATOM 10432 C CA   . LYS A 1 9  ? -15.001 2.536   14.072  1.00 0.00 ? 9  LYS A CA   10 
ATOM 10433 C C    . LYS A 1 9  ? -15.717 2.708   12.736  1.00 0.00 ? 9  LYS A C    10 
ATOM 10434 O O    . LYS A 1 9  ? -16.883 2.340   12.594  1.00 0.00 ? 9  LYS A O    10 
ATOM 10435 C CB   . LYS A 1 9  ? -15.402 3.663   15.026  1.00 0.00 ? 9  LYS A CB   10 
ATOM 10436 C CG   . LYS A 1 9  ? -15.053 5.049   14.512  1.00 0.00 ? 9  LYS A CG   10 
ATOM 10437 C CD   . LYS A 1 9  ? -15.437 6.128   15.511  1.00 0.00 ? 9  LYS A CD   10 
ATOM 10438 C CE   . LYS A 1 9  ? -14.844 7.476   15.131  1.00 0.00 ? 9  LYS A CE   10 
ATOM 10439 N NZ   . LYS A 1 9  ? -15.169 7.849   13.727  1.00 0.00 ? 9  LYS A NZ   10 
ATOM 10440 H H    . LYS A 1 9  ? -13.106 3.327   13.555  1.00 0.00 ? 9  LYS A H    10 
ATOM 10441 H HA   . LYS A 1 9  ? -15.291 1.590   14.504  1.00 0.00 ? 9  LYS A HA   10 
ATOM 10442 H HB2  . LYS A 1 9  ? -16.469 3.619   15.187  1.00 0.00 ? 9  LYS A HB2  10 
ATOM 10443 H HB3  . LYS A 1 9  ? -14.898 3.515   15.971  1.00 0.00 ? 9  LYS A HB3  10 
ATOM 10444 H HG2  . LYS A 1 9  ? -13.989 5.100   14.334  1.00 0.00 ? 9  LYS A HG2  10 
ATOM 10445 H HG3  . LYS A 1 9  ? -15.583 5.223   13.586  1.00 0.00 ? 9  LYS A HG3  10 
ATOM 10446 H HD2  . LYS A 1 9  ? -16.513 6.215   15.538  1.00 0.00 ? 9  LYS A HD2  10 
ATOM 10447 H HD3  . LYS A 1 9  ? -15.072 5.846   16.489  1.00 0.00 ? 9  LYS A HD3  10 
ATOM 10448 H HE2  . LYS A 1 9  ? -15.240 8.229   15.795  1.00 0.00 ? 9  LYS A HE2  10 
ATOM 10449 H HE3  . LYS A 1 9  ? -13.771 7.426   15.243  1.00 0.00 ? 9  LYS A HE3  10 
ATOM 10450 H HZ1  . LYS A 1 9  ? -14.359 7.644   13.106  1.00 0.00 ? 9  LYS A HZ1  10 
ATOM 10451 H HZ2  . LYS A 1 9  ? -15.388 8.863   13.668  1.00 0.00 ? 9  LYS A HZ2  10 
ATOM 10452 H HZ3  . LYS A 1 9  ? -15.992 7.307   13.394  1.00 0.00 ? 9  LYS A HZ3  10 
ATOM 10453 N N    . LYS A 1 10 ? -15.012 3.267   11.759  1.00 0.00 ? 10 LYS A N    10 
ATOM 10454 C CA   . LYS A 1 10 ? -15.578 3.485   10.434  1.00 0.00 ? 10 LYS A CA   10 
ATOM 10455 C C    . LYS A 1 10 ? -15.214 2.342   9.492   1.00 0.00 ? 10 LYS A C    10 
ATOM 10456 O O    . LYS A 1 10 ? -14.556 1.382   9.892   1.00 0.00 ? 10 LYS A O    10 
ATOM 10457 C CB   . LYS A 1 10 ? -15.083 4.813   9.857   1.00 0.00 ? 10 LYS A CB   10 
ATOM 10458 C CG   . LYS A 1 10 ? -15.784 6.028   10.438  1.00 0.00 ? 10 LYS A CG   10 
ATOM 10459 C CD   . LYS A 1 10 ? -17.173 6.206   9.849   1.00 0.00 ? 10 LYS A CD   10 
ATOM 10460 C CE   . LYS A 1 10 ? -17.119 6.870   8.482   1.00 0.00 ? 10 LYS A CE   10 
ATOM 10461 N NZ   . LYS A 1 10 ? -17.033 5.869   7.382   1.00 0.00 ? 10 LYS A NZ   10 
ATOM 10462 H H    . LYS A 1 10 ? -14.086 3.540   11.934  1.00 0.00 ? 10 LYS A H    10 
ATOM 10463 H HA   . LYS A 1 10 ? -16.652 3.525   10.534  1.00 0.00 ? 10 LYS A HA   10 
ATOM 10464 H HB2  . LYS A 1 10 ? -14.025 4.905   10.054  1.00 0.00 ? 10 LYS A HB2  10 
ATOM 10465 H HB3  . LYS A 1 10 ? -15.242 4.809   8.788   1.00 0.00 ? 10 LYS A HB3  10 
ATOM 10466 H HG2  . LYS A 1 10 ? -15.871 5.905   11.508  1.00 0.00 ? 10 LYS A HG2  10 
ATOM 10467 H HG3  . LYS A 1 10 ? -15.196 6.910   10.222  1.00 0.00 ? 10 LYS A HG3  10 
ATOM 10468 H HD2  . LYS A 1 10 ? -17.638 5.236   9.748   1.00 0.00 ? 10 LYS A HD2  10 
ATOM 10469 H HD3  . LYS A 1 10 ? -17.762 6.821   10.516  1.00 0.00 ? 10 LYS A HD3  10 
ATOM 10470 H HE2  . LYS A 1 10 ? -18.010 7.463   8.349   1.00 0.00 ? 10 LYS A HE2  10 
ATOM 10471 H HE3  . LYS A 1 10 ? -16.250 7.511   8.443   1.00 0.00 ? 10 LYS A HE3  10 
ATOM 10472 H HZ1  . LYS A 1 10 ? -16.055 5.803   7.036   1.00 0.00 ? 10 LYS A HZ1  10 
ATOM 10473 H HZ2  . LYS A 1 10 ? -17.649 6.152   6.594   1.00 0.00 ? 10 LYS A HZ2  10 
ATOM 10474 H HZ3  . LYS A 1 10 ? -17.333 4.935   7.725   1.00 0.00 ? 10 LYS A HZ3  10 
ATOM 10475 N N    . ARG A 1 11 ? -15.645 2.453   8.240   1.00 0.00 ? 11 ARG A N    10 
ATOM 10476 C CA   . ARG A 1 11 ? -15.364 1.429   7.241   1.00 0.00 ? 11 ARG A CA   10 
ATOM 10477 C C    . ARG A 1 11 ? -13.862 1.291   7.012   1.00 0.00 ? 11 ARG A C    10 
ATOM 10478 O O    . ARG A 1 11 ? -13.057 1.851   7.756   1.00 0.00 ? 11 ARG A O    10 
ATOM 10479 C CB   . ARG A 1 11 ? -16.063 1.765   5.923   1.00 0.00 ? 11 ARG A CB   10 
ATOM 10480 C CG   . ARG A 1 11 ? -17.516 2.181   6.093   1.00 0.00 ? 11 ARG A CG   10 
ATOM 10481 C CD   . ARG A 1 11 ? -18.312 1.955   4.817   1.00 0.00 ? 11 ARG A CD   10 
ATOM 10482 N NE   . ARG A 1 11 ? -18.086 3.012   3.835   1.00 0.00 ? 11 ARG A NE   10 
ATOM 10483 C CZ   . ARG A 1 11 ? -18.607 3.003   2.613   1.00 0.00 ? 11 ARG A CZ   10 
ATOM 10484 N NH1  . ARG A 1 11 ? -19.380 1.998   2.225   1.00 0.00 ? 11 ARG A NH1  10 
ATOM 10485 N NH2  . ARG A 1 11 ? -18.355 4.002   1.777   1.00 0.00 ? 11 ARG A NH2  10 
ATOM 10486 H H    . ARG A 1 11 ? -16.166 3.242   7.981   1.00 0.00 ? 11 ARG A H    10 
ATOM 10487 H HA   . ARG A 1 11 ? -15.748 0.490   7.612   1.00 0.00 ? 11 ARG A HA   10 
ATOM 10488 H HB2  . ARG A 1 11 ? -15.533 2.576   5.445   1.00 0.00 ? 11 ARG A HB2  10 
ATOM 10489 H HB3  . ARG A 1 11 ? -16.033 0.898   5.281   1.00 0.00 ? 11 ARG A HB3  10 
ATOM 10490 H HG2  . ARG A 1 11 ? -17.957 1.599   6.888   1.00 0.00 ? 11 ARG A HG2  10 
ATOM 10491 H HG3  . ARG A 1 11 ? -17.552 3.230   6.349   1.00 0.00 ? 11 ARG A HG3  10 
ATOM 10492 H HD2  . ARG A 1 11 ? -18.018 1.009   4.388   1.00 0.00 ? 11 ARG A HD2  10 
ATOM 10493 H HD3  . ARG A 1 11 ? -19.363 1.925   5.066   1.00 0.00 ? 11 ARG A HD3  10 
ATOM 10494 H HE   . ARG A 1 11 ? -17.518 3.764   4.101   1.00 0.00 ? 11 ARG A HE   10 
ATOM 10495 H HH11 . ARG A 1 11 ? -19.572 1.245   2.854   1.00 0.00 ? 11 ARG A HH11 10 
ATOM 10496 H HH12 . ARG A 1 11 ? -19.771 1.995   1.305   1.00 0.00 ? 11 ARG A HH12 10 
ATOM 10497 H HH21 . ARG A 1 11 ? -17.773 4.761   2.066   1.00 0.00 ? 11 ARG A HH21 10 
ATOM 10498 H HH22 . ARG A 1 11 ? -18.747 3.994   0.857   1.00 0.00 ? 11 ARG A HH22 10 
ATOM 10499 N N    . ILE A 1 12 ? -13.493 0.541   5.979   1.00 0.00 ? 12 ILE A N    10 
ATOM 10500 C CA   . ILE A 1 12 ? -12.088 0.331   5.651   1.00 0.00 ? 12 ILE A CA   10 
ATOM 10501 C C    . ILE A 1 12 ? -11.341 1.657   5.555   1.00 0.00 ? 12 ILE A C    10 
ATOM 10502 O O    . ILE A 1 12 ? -11.815 2.622   4.954   1.00 0.00 ? 12 ILE A O    10 
ATOM 10503 C CB   . ILE A 1 12 ? -11.928 -0.434  4.324   1.00 0.00 ? 12 ILE A CB   10 
ATOM 10504 C CG1  . ILE A 1 12 ? -12.672 -1.770  4.387   1.00 0.00 ? 12 ILE A CG1  10 
ATOM 10505 C CG2  . ILE A 1 12 ? -10.455 -0.656  4.016   1.00 0.00 ? 12 ILE A CG2  10 
ATOM 10506 C CD1  . ILE A 1 12 ? -12.174 -2.688  5.481   1.00 0.00 ? 12 ILE A CD1  10 
ATOM 10507 H H    . ILE A 1 12 ? -14.181 0.121   5.423   1.00 0.00 ? 12 ILE A H    10 
ATOM 10508 H HA   . ILE A 1 12 ? -11.648 -0.262  6.441   1.00 0.00 ? 12 ILE A HA   10 
ATOM 10509 H HB   . ILE A 1 12 ? -12.349 0.168   3.534   1.00 0.00 ? 12 ILE A HB   10 
ATOM 10510 H HG12 . ILE A 1 12 ? -13.719 -1.583  4.562   1.00 0.00 ? 12 ILE A HG12 10 
ATOM 10511 H HG13 . ILE A 1 12 ? -12.555 -2.283  3.443   1.00 0.00 ? 12 ILE A HG13 10 
ATOM 10512 H HG21 . ILE A 1 12 ? -10.027 -1.315  4.757   1.00 0.00 ? 12 ILE A HG21 10 
ATOM 10513 H HG22 . ILE A 1 12 ? -10.355 -1.104  3.038   1.00 0.00 ? 12 ILE A HG22 10 
ATOM 10514 H HG23 . ILE A 1 12 ? -9.936  0.290   4.033   1.00 0.00 ? 12 ILE A HG23 10 
ATOM 10515 H HD11 . ILE A 1 12 ? -12.727 -3.615  5.452   1.00 0.00 ? 12 ILE A HD11 10 
ATOM 10516 H HD12 . ILE A 1 12 ? -11.124 -2.889  5.333   1.00 0.00 ? 12 ILE A HD12 10 
ATOM 10517 H HD13 . ILE A 1 12 ? -12.318 -2.214  6.442   1.00 0.00 ? 12 ILE A HD13 10 
ATOM 10518 N N    . PRO A 1 13 ? -10.145 1.707   6.158   1.00 0.00 ? 13 PRO A N    10 
ATOM 10519 C CA   . PRO A 1 13 ? -9.305  2.909   6.152   1.00 0.00 ? 13 PRO A CA   10 
ATOM 10520 C C    . PRO A 1 13 ? -8.541  3.076   4.843   1.00 0.00 ? 13 PRO A C    10 
ATOM 10521 O O    . PRO A 1 13 ? -8.794  2.365   3.870   1.00 0.00 ? 13 PRO A O    10 
ATOM 10522 C CB   . PRO A 1 13 ? -8.334  2.669   7.311   1.00 0.00 ? 13 PRO A CB   10 
ATOM 10523 C CG   . PRO A 1 13 ? -8.257  1.187   7.440   1.00 0.00 ? 13 PRO A CG   10 
ATOM 10524 C CD   . PRO A 1 13 ? -9.518  0.595   6.892   1.00 0.00 ? 13 PRO A CD   10 
ATOM 10525 H HA   . PRO A 1 13 ? -9.885  3.799   6.345   1.00 0.00 ? 13 PRO A HA   10 
ATOM 10526 H HB2  . PRO A 1 13 ? -7.371  3.096   7.071   1.00 0.00 ? 13 PRO A HB2  10 
ATOM 10527 H HB3  . PRO A 1 13 ? -8.722  3.124   8.210   1.00 0.00 ? 13 PRO A HB3  10 
ATOM 10528 H HG2  . PRO A 1 13 ? -7.424  0.811   6.865   1.00 0.00 ? 13 PRO A HG2  10 
ATOM 10529 H HG3  . PRO A 1 13 ? -8.151  0.914   8.480   1.00 0.00 ? 13 PRO A HG3  10 
ATOM 10530 H HD2  . PRO A 1 13 ? -9.254  -0.210  6.222   1.00 0.00 ? 13 PRO A HD2  10 
ATOM 10531 H HD3  . PRO A 1 13 ? -10.169 0.236   7.676   1.00 0.00 ? 13 PRO A HD3  10 
ATOM 10532 N N    . TYR A 1 14 ? -7.605  4.018   4.826   1.00 0.00 ? 14 TYR A N    10 
ATOM 10533 C CA   . TYR A 1 14 ? -6.806  4.279   3.635   1.00 0.00 ? 14 TYR A CA   10 
ATOM 10534 C C    . TYR A 1 14 ? -7.681  4.779   2.490   1.00 0.00 ? 14 TYR A C    10 
ATOM 10535 O O    . TYR A 1 14 ? -8.483  4.029   1.933   1.00 0.00 ? 14 TYR A O    10 
ATOM 10536 C CB   . TYR A 1 14 ? -6.061  3.014   3.207   1.00 0.00 ? 14 TYR A CB   10 
ATOM 10537 C CG   . TYR A 1 14 ? -5.315  2.340   4.336   1.00 0.00 ? 14 TYR A CG   10 
ATOM 10538 C CD1  . TYR A 1 14 ? -4.213  2.946   4.927   1.00 0.00 ? 14 TYR A CD1  10 
ATOM 10539 C CD2  . TYR A 1 14 ? -5.712  1.096   4.813   1.00 0.00 ? 14 TYR A CD2  10 
ATOM 10540 C CE1  . TYR A 1 14 ? -3.528  2.333   5.958   1.00 0.00 ? 14 TYR A CE1  10 
ATOM 10541 C CE2  . TYR A 1 14 ? -5.034  0.477   5.845   1.00 0.00 ? 14 TYR A CE2  10 
ATOM 10542 C CZ   . TYR A 1 14 ? -3.942  1.099   6.414   1.00 0.00 ? 14 TYR A CZ   10 
ATOM 10543 O OH   . TYR A 1 14 ? -3.263  0.486   7.442   1.00 0.00 ? 14 TYR A OH   10 
ATOM 10544 H H    . TYR A 1 14 ? -7.449  4.552   5.632   1.00 0.00 ? 14 TYR A H    10 
ATOM 10545 H HA   . TYR A 1 14 ? -6.083  5.044   3.881   1.00 0.00 ? 14 TYR A HA   10 
ATOM 10546 H HB2  . TYR A 1 14 ? -6.770  2.304   2.809   1.00 0.00 ? 14 TYR A HB2  10 
ATOM 10547 H HB3  . TYR A 1 14 ? -5.344  3.268   2.440   1.00 0.00 ? 14 TYR A HB3  10 
ATOM 10548 H HD1  . TYR A 1 14 ? -3.891  3.913   4.568   1.00 0.00 ? 14 TYR A HD1  10 
ATOM 10549 H HD2  . TYR A 1 14 ? -6.568  0.612   4.366   1.00 0.00 ? 14 TYR A HD2  10 
ATOM 10550 H HE1  . TYR A 1 14 ? -2.673  2.820   6.404   1.00 0.00 ? 14 TYR A HE1  10 
ATOM 10551 H HE2  . TYR A 1 14 ? -5.358  -0.490  6.202   1.00 0.00 ? 14 TYR A HE2  10 
ATOM 10552 H HH   . TYR A 1 14 ? -3.862  -0.091  7.921   1.00 0.00 ? 14 TYR A HH   10 
ATOM 10553 N N    . SER A 1 15 ? -7.520  6.052   2.143   1.00 0.00 ? 15 SER A N    10 
ATOM 10554 C CA   . SER A 1 15 ? -8.296  6.655   1.066   1.00 0.00 ? 15 SER A CA   10 
ATOM 10555 C C    . SER A 1 15 ? -7.829  6.144   -0.293  1.00 0.00 ? 15 SER A C    10 
ATOM 10556 O O    . SER A 1 15 ? -6.781  5.507   -0.404  1.00 0.00 ? 15 SER A O    10 
ATOM 10557 C CB   . SER A 1 15 ? -8.181  8.180   1.117   1.00 0.00 ? 15 SER A CB   10 
ATOM 10558 O OG   . SER A 1 15 ? -8.966  8.716   2.168   1.00 0.00 ? 15 SER A OG   10 
ATOM 10559 H H    . SER A 1 15 ? -6.864  6.600   2.624   1.00 0.00 ? 15 SER A H    10 
ATOM 10560 H HA   . SER A 1 15 ? -9.330  6.376   1.207   1.00 0.00 ? 15 SER A HA   10 
ATOM 10561 H HB2  . SER A 1 15 ? -7.149  8.455   1.278   1.00 0.00 ? 15 SER A HB2  10 
ATOM 10562 H HB3  . SER A 1 15 ? -8.522  8.596   0.180   1.00 0.00 ? 15 SER A HB3  10 
ATOM 10563 H HG   . SER A 1 15 ? -9.872  8.822   1.869   1.00 0.00 ? 15 SER A HG   10 
ATOM 10564 N N    . LYS A 1 16 ? -8.615  6.427   -1.327  1.00 0.00 ? 16 LYS A N    10 
ATOM 10565 C CA   . LYS A 1 16 ? -8.284  5.998   -2.680  1.00 0.00 ? 16 LYS A CA   10 
ATOM 10566 C C    . LYS A 1 16 ? -6.893  6.481   -3.079  1.00 0.00 ? 16 LYS A C    10 
ATOM 10567 O O    . LYS A 1 16 ? -6.195  5.824   -3.850  1.00 0.00 ? 16 LYS A O    10 
ATOM 10568 C CB   . LYS A 1 16 ? -9.323  6.525   -3.673  1.00 0.00 ? 16 LYS A CB   10 
ATOM 10569 C CG   . LYS A 1 16 ? -10.727 6.007   -3.416  1.00 0.00 ? 16 LYS A CG   10 
ATOM 10570 C CD   . LYS A 1 16 ? -11.754 6.732   -4.270  1.00 0.00 ? 16 LYS A CD   10 
ATOM 10571 C CE   . LYS A 1 16 ? -11.915 8.181   -3.839  1.00 0.00 ? 16 LYS A CE   10 
ATOM 10572 N NZ   . LYS A 1 16 ? -13.242 8.732   -4.229  1.00 0.00 ? 16 LYS A NZ   10 
ATOM 10573 H H    . LYS A 1 16 ? -9.438  6.938   -1.175  1.00 0.00 ? 16 LYS A H    10 
ATOM 10574 H HA   . LYS A 1 16 ? -8.296  4.919   -2.699  1.00 0.00 ? 16 LYS A HA   10 
ATOM 10575 H HB2  . LYS A 1 16 ? -9.343  7.603   -3.616  1.00 0.00 ? 16 LYS A HB2  10 
ATOM 10576 H HB3  . LYS A 1 16 ? -9.030  6.231   -4.671  1.00 0.00 ? 16 LYS A HB3  10 
ATOM 10577 H HG2  . LYS A 1 16 ? -10.761 4.953   -3.649  1.00 0.00 ? 16 LYS A HG2  10 
ATOM 10578 H HG3  . LYS A 1 16 ? -10.970 6.155   -2.374  1.00 0.00 ? 16 LYS A HG3  10 
ATOM 10579 H HD2  . LYS A 1 16 ? -11.433 6.709   -5.301  1.00 0.00 ? 16 LYS A HD2  10 
ATOM 10580 H HD3  . LYS A 1 16 ? -12.706 6.229   -4.177  1.00 0.00 ? 16 LYS A HD3  10 
ATOM 10581 H HE2  . LYS A 1 16 ? -11.813 8.237   -2.766  1.00 0.00 ? 16 LYS A HE2  10 
ATOM 10582 H HE3  . LYS A 1 16 ? -11.139 8.770   -4.305  1.00 0.00 ? 16 LYS A HE3  10 
ATOM 10583 H HZ1  . LYS A 1 16 ? -13.845 7.974   -4.609  1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 10584 H HZ2  . LYS A 1 16 ? -13.125 9.465   -4.957  1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 10585 H HZ3  . LYS A 1 16 ? -13.712 9.152   -3.402  1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 10586 N N    . GLY A 1 17 ? -6.496  7.633   -2.548  1.00 0.00 ? 17 GLY A N    10 
ATOM 10587 C CA   . GLY A 1 17 ? -5.190  8.183   -2.859  1.00 0.00 ? 17 GLY A CA   10 
ATOM 10588 C C    . GLY A 1 17 ? -4.066  7.426   -2.182  1.00 0.00 ? 17 GLY A C    10 
ATOM 10589 O O    . GLY A 1 17 ? -2.961  7.334   -2.717  1.00 0.00 ? 17 GLY A O    10 
ATOM 10590 H H    . GLY A 1 17 ? -7.096  8.114   -1.939  1.00 0.00 ? 17 GLY A H    10 
ATOM 10591 H HA2  . GLY A 1 17 ? -5.042  8.147   -3.928  1.00 0.00 ? 17 GLY A HA2  10 
ATOM 10592 H HA3  . GLY A 1 17 ? -5.160  9.214   -2.536  1.00 0.00 ? 17 GLY A HA3  10 
ATOM 10593 N N    . GLN A 1 18 ? -4.346  6.883   -1.002  1.00 0.00 ? 18 GLN A N    10 
ATOM 10594 C CA   . GLN A 1 18 ? -3.348  6.131   -0.250  1.00 0.00 ? 18 GLN A CA   10 
ATOM 10595 C C    . GLN A 1 18 ? -3.251  4.697   -0.758  1.00 0.00 ? 18 GLN A C    10 
ATOM 10596 O O    . GLN A 1 18 ? -2.155  4.164   -0.940  1.00 0.00 ? 18 GLN A O    10 
ATOM 10597 C CB   . GLN A 1 18 ? -3.692  6.135   1.240   1.00 0.00 ? 18 GLN A CB   10 
ATOM 10598 C CG   . GLN A 1 18 ? -3.731  7.527   1.852   1.00 0.00 ? 18 GLN A CG   10 
ATOM 10599 C CD   . GLN A 1 18 ? -4.261  7.525   3.272   1.00 0.00 ? 18 GLN A CD   10 
ATOM 10600 O OE1  . GLN A 1 18 ? -5.436  7.244   3.509   1.00 0.00 ? 18 GLN A OE1  10 
ATOM 10601 N NE2  . GLN A 1 18 ? -3.394  7.839   4.228   1.00 0.00 ? 18 GLN A NE2  10 
ATOM 10602 H H    . GLN A 1 18 ? -5.245  6.990   -0.628  1.00 0.00 ? 18 GLN A H    10 
ATOM 10603 H HA   . GLN A 1 18 ? -2.394  6.615   -0.391  1.00 0.00 ? 18 GLN A HA   10 
ATOM 10604 H HB2  . GLN A 1 18 ? -4.661  5.678   1.375   1.00 0.00 ? 18 GLN A HB2  10 
ATOM 10605 H HB3  . GLN A 1 18 ? -2.952  5.554   1.770   1.00 0.00 ? 18 GLN A HB3  10 
ATOM 10606 H HG2  . GLN A 1 18 ? -2.730  7.931   1.858   1.00 0.00 ? 18 GLN A HG2  10 
ATOM 10607 H HG3  . GLN A 1 18 ? -4.368  8.154   1.246   1.00 0.00 ? 18 GLN A HG3  10 
ATOM 10608 H HE21 . GLN A 1 18 ? -2.474  8.052   3.966   1.00 0.00 ? 18 GLN A HE21 10 
ATOM 10609 H HE22 . GLN A 1 18 ? -3.709  7.846   5.155   1.00 0.00 ? 18 GLN A HE22 10 
ATOM 10610 N N    . LEU A 1 19 ? -4.403  4.075   -0.984  1.00 0.00 ? 19 LEU A N    10 
ATOM 10611 C CA   . LEU A 1 19 ? -4.448  2.700   -1.471  1.00 0.00 ? 19 LEU A CA   10 
ATOM 10612 C C    . LEU A 1 19 ? -3.946  2.615   -2.909  1.00 0.00 ? 19 LEU A C    10 
ATOM 10613 O O    . LEU A 1 19 ? -3.493  1.562   -3.357  1.00 0.00 ? 19 LEU A O    10 
ATOM 10614 C CB   . LEU A 1 19 ? -5.873  2.154   -1.383  1.00 0.00 ? 19 LEU A CB   10 
ATOM 10615 C CG   . LEU A 1 19 ? -6.484  2.095   0.018   1.00 0.00 ? 19 LEU A CG   10 
ATOM 10616 C CD1  . LEU A 1 19 ? -7.999  1.988   -0.064  1.00 0.00 ? 19 LEU A CD1  10 
ATOM 10617 C CD2  . LEU A 1 19 ? -5.907  0.925   0.802   1.00 0.00 ? 19 LEU A CD2  10 
ATOM 10618 H H    . LEU A 1 19 ? -5.243  4.550   -0.821  1.00 0.00 ? 19 LEU A H    10 
ATOM 10619 H HA   . LEU A 1 19 ? -3.803  2.105   -0.842  1.00 0.00 ? 19 LEU A HA   10 
ATOM 10620 H HB2  . LEU A 1 19 ? -6.506  2.780   -1.993  1.00 0.00 ? 19 LEU A HB2  10 
ATOM 10621 H HB3  . LEU A 1 19 ? -5.868  1.150   -1.785  1.00 0.00 ? 19 LEU A HB3  10 
ATOM 10622 H HG   . LEU A 1 19 ? -6.242  3.006   0.548   1.00 0.00 ? 19 LEU A HG   10 
ATOM 10623 H HD11 . LEU A 1 19 ? -8.398  2.881   -0.521  1.00 0.00 ? 19 LEU A HD11 10 
ATOM 10624 H HD12 . LEU A 1 19 ? -8.407  1.879   0.930   1.00 0.00 ? 19 LEU A HD12 10 
ATOM 10625 H HD13 . LEU A 1 19 ? -8.268  1.128   -0.659  1.00 0.00 ? 19 LEU A HD13 10 
ATOM 10626 H HD21 . LEU A 1 19 ? -5.843  0.059   0.161   1.00 0.00 ? 19 LEU A HD21 10 
ATOM 10627 H HD22 . LEU A 1 19 ? -6.550  0.704   1.643   1.00 0.00 ? 19 LEU A HD22 10 
ATOM 10628 H HD23 . LEU A 1 19 ? -4.922  1.183   1.160   1.00 0.00 ? 19 LEU A HD23 10 
ATOM 10629 N N    . ARG A 1 20 ? -4.029  3.731   -3.626  1.00 0.00 ? 20 ARG A N    10 
ATOM 10630 C CA   . ARG A 1 20 ? -3.583  3.783   -5.013  1.00 0.00 ? 20 ARG A CA   10 
ATOM 10631 C C    . ARG A 1 20 ? -2.110  3.400   -5.125  1.00 0.00 ? 20 ARG A C    10 
ATOM 10632 O O    . ARG A 1 20 ? -1.706  2.720   -6.067  1.00 0.00 ? 20 ARG A O    10 
ATOM 10633 C CB   . ARG A 1 20 ? -3.803  5.183   -5.590  1.00 0.00 ? 20 ARG A CB   10 
ATOM 10634 C CG   . ARG A 1 20 ? -3.178  5.381   -6.961  1.00 0.00 ? 20 ARG A CG   10 
ATOM 10635 C CD   . ARG A 1 20 ? -3.357  6.809   -7.453  1.00 0.00 ? 20 ARG A CD   10 
ATOM 10636 N NE   . ARG A 1 20 ? -4.527  6.948   -8.315  1.00 0.00 ? 20 ARG A NE   10 
ATOM 10637 C CZ   . ARG A 1 20 ? -4.554  6.562   -9.586  1.00 0.00 ? 20 ARG A CZ   10 
ATOM 10638 N NH1  . ARG A 1 20 ? -3.481  6.015   -10.139 1.00 0.00 ? 20 ARG A NH1  10 
ATOM 10639 N NH2  . ARG A 1 20 ? -5.657  6.722   -10.306 1.00 0.00 ? 20 ARG A NH2  10 
ATOM 10640 H H    . ARG A 1 20 ? -4.401  4.539   -3.213  1.00 0.00 ? 20 ARG A H    10 
ATOM 10641 H HA   . ARG A 1 20 ? -4.171  3.074   -5.577  1.00 0.00 ? 20 ARG A HA   10 
ATOM 10642 H HB2  . ARG A 1 20 ? -4.865  5.362   -5.674  1.00 0.00 ? 20 ARG A HB2  10 
ATOM 10643 H HB3  . ARG A 1 20 ? -3.375  5.908   -4.915  1.00 0.00 ? 20 ARG A HB3  10 
ATOM 10644 H HG2  . ARG A 1 20 ? -2.122  5.163   -6.900  1.00 0.00 ? 20 ARG A HG2  10 
ATOM 10645 H HG3  . ARG A 1 20 ? -3.647  4.707   -7.661  1.00 0.00 ? 20 ARG A HG3  10 
ATOM 10646 H HD2  . ARG A 1 20 ? -3.472  7.459   -6.598  1.00 0.00 ? 20 ARG A HD2  10 
ATOM 10647 H HD3  . ARG A 1 20 ? -2.476  7.097   -8.008  1.00 0.00 ? 20 ARG A HD3  10 
ATOM 10648 H HE   . ARG A 1 20 ? -5.332  7.350   -7.927  1.00 0.00 ? 20 ARG A HE   10 
ATOM 10649 H HH11 . ARG A 1 20 ? -2.648  5.892   -9.598  1.00 0.00 ? 20 ARG A HH11 10 
ATOM 10650 H HH12 . ARG A 1 20 ? -3.504  5.723   -11.096 1.00 0.00 ? 20 ARG A HH12 10 
ATOM 10651 H HH21 . ARG A 1 20 ? -6.469  7.133   -9.892  1.00 0.00 ? 20 ARG A HH21 10 
ATOM 10652 H HH22 . ARG A 1 20 ? -5.677  6.431   -11.262 1.00 0.00 ? 20 ARG A HH22 10 
ATOM 10653 N N    . GLU A 1 21 ? -1.314  3.844   -4.158  1.00 0.00 ? 21 GLU A N    10 
ATOM 10654 C CA   . GLU A 1 21 ? 0.114   3.548   -4.149  1.00 0.00 ? 21 GLU A CA   10 
ATOM 10655 C C    . GLU A 1 21 ? 0.380   2.164   -3.565  1.00 0.00 ? 21 GLU A C    10 
ATOM 10656 O O    . GLU A 1 21 ? 1.266   1.443   -4.026  1.00 0.00 ? 21 GLU A O    10 
ATOM 10657 C CB   . GLU A 1 21 ? 0.872   4.607   -3.345  1.00 0.00 ? 21 GLU A CB   10 
ATOM 10658 C CG   . GLU A 1 21 ? 0.699   6.018   -3.883  1.00 0.00 ? 21 GLU A CG   10 
ATOM 10659 C CD   . GLU A 1 21 ? 0.991   6.116   -5.368  1.00 0.00 ? 21 GLU A CD   10 
ATOM 10660 O OE1  . GLU A 1 21 ? 2.011   5.547   -5.810  1.00 0.00 ? 21 GLU A OE1  10 
ATOM 10661 O OE2  . GLU A 1 21 ? 0.201   6.762   -6.087  1.00 0.00 ? 21 GLU A OE2  10 
ATOM 10662 H H    . GLU A 1 21 ? -1.695  4.382   -3.433  1.00 0.00 ? 21 GLU A H    10 
ATOM 10663 H HA   . GLU A 1 21 ? 0.463   3.568   -5.171  1.00 0.00 ? 21 GLU A HA   10 
ATOM 10664 H HB2  . GLU A 1 21 ? 0.520   4.587   -2.324  1.00 0.00 ? 21 GLU A HB2  10 
ATOM 10665 H HB3  . GLU A 1 21 ? 1.924   4.366   -3.358  1.00 0.00 ? 21 GLU A HB3  10 
ATOM 10666 H HG2  . GLU A 1 21 ? -0.318  6.334   -3.710  1.00 0.00 ? 21 GLU A HG2  10 
ATOM 10667 H HG3  . GLU A 1 21 ? 1.374   6.676   -3.354  1.00 0.00 ? 21 GLU A HG3  10 
ATOM 10668 N N    . LEU A 1 22 ? -0.392  1.799   -2.548  1.00 0.00 ? 22 LEU A N    10 
ATOM 10669 C CA   . LEU A 1 22 ? -0.241  0.502   -1.899  1.00 0.00 ? 22 LEU A CA   10 
ATOM 10670 C C    . LEU A 1 22 ? -0.551  -0.632  -2.871  1.00 0.00 ? 22 LEU A C    10 
ATOM 10671 O O    . LEU A 1 22 ? 0.235   -1.567  -3.019  1.00 0.00 ? 22 LEU A O    10 
ATOM 10672 C CB   . LEU A 1 22 ? -1.160  0.409   -0.679  1.00 0.00 ? 22 LEU A CB   10 
ATOM 10673 C CG   . LEU A 1 22 ? -0.789  1.296   0.510   1.00 0.00 ? 22 LEU A CG   10 
ATOM 10674 C CD1  . LEU A 1 22 ? -1.918  1.325   1.527   1.00 0.00 ? 22 LEU A CD1  10 
ATOM 10675 C CD2  . LEU A 1 22 ? 0.501   0.811   1.155   1.00 0.00 ? 22 LEU A CD2  10 
ATOM 10676 H H    . LEU A 1 22 ? -1.081  2.417   -2.225  1.00 0.00 ? 22 LEU A H    10 
ATOM 10677 H HA   . LEU A 1 22 ? 0.785   0.411   -1.574  1.00 0.00 ? 22 LEU A HA   10 
ATOM 10678 H HB2  . LEU A 1 22 ? -2.156  0.679   -0.995  1.00 0.00 ? 22 LEU A HB2  10 
ATOM 10679 H HB3  . LEU A 1 22 ? -1.157  -0.618  -0.341  1.00 0.00 ? 22 LEU A HB3  10 
ATOM 10680 H HG   . LEU A 1 22 ? -0.629  2.307   0.160   1.00 0.00 ? 22 LEU A HG   10 
ATOM 10681 H HD11 . LEU A 1 22 ? -2.625  0.540   1.303   1.00 0.00 ? 22 LEU A HD11 10 
ATOM 10682 H HD12 . LEU A 1 22 ? -2.417  2.282   1.485   1.00 0.00 ? 22 LEU A HD12 10 
ATOM 10683 H HD13 . LEU A 1 22 ? -1.514  1.174   2.518   1.00 0.00 ? 22 LEU A HD13 10 
ATOM 10684 H HD21 . LEU A 1 22 ? 0.857   1.555   1.852   1.00 0.00 ? 22 LEU A HD21 10 
ATOM 10685 H HD22 . LEU A 1 22 ? 1.247   0.648   0.390   1.00 0.00 ? 22 LEU A HD22 10 
ATOM 10686 H HD23 . LEU A 1 22 ? 0.315   -0.114  1.680   1.00 0.00 ? 22 LEU A HD23 10 
ATOM 10687 N N    . GLU A 1 23 ? -1.701  -0.541  -3.531  1.00 0.00 ? 23 GLU A N    10 
ATOM 10688 C CA   . GLU A 1 23 ? -2.114  -1.560  -4.490  1.00 0.00 ? 23 GLU A CA   10 
ATOM 10689 C C    . GLU A 1 23 ? -1.145  -1.621  -5.668  1.00 0.00 ? 23 GLU A C    10 
ATOM 10690 O O    . GLU A 1 23 ? -0.838  -2.700  -6.176  1.00 0.00 ? 23 GLU A O    10 
ATOM 10691 C CB   . GLU A 1 23 ? -3.530  -1.274  -4.994  1.00 0.00 ? 23 GLU A CB   10 
ATOM 10692 C CG   . GLU A 1 23 ? -4.592  -1.369  -3.912  1.00 0.00 ? 23 GLU A CG   10 
ATOM 10693 C CD   . GLU A 1 23 ? -5.958  -0.921  -4.394  1.00 0.00 ? 23 GLU A CD   10 
ATOM 10694 O OE1  . GLU A 1 23 ? -6.035  -0.321  -5.486  1.00 0.00 ? 23 GLU A OE1  10 
ATOM 10695 O OE2  . GLU A 1 23 ? -6.950  -1.172  -3.678  1.00 0.00 ? 23 GLU A OE2  10 
ATOM 10696 H H    . GLU A 1 23 ? -2.286  0.228   -3.370  1.00 0.00 ? 23 GLU A H    10 
ATOM 10697 H HA   . GLU A 1 23 ? -2.107  -2.513  -3.984  1.00 0.00 ? 23 GLU A HA   10 
ATOM 10698 H HB2  . GLU A 1 23 ? -3.557  -0.277  -5.410  1.00 0.00 ? 23 GLU A HB2  10 
ATOM 10699 H HB3  . GLU A 1 23 ? -3.772  -1.984  -5.770  1.00 0.00 ? 23 GLU A HB3  10 
ATOM 10700 H HG2  . GLU A 1 23 ? -4.662  -2.395  -3.583  1.00 0.00 ? 23 GLU A HG2  10 
ATOM 10701 H HG3  . GLU A 1 23 ? -4.297  -0.746  -3.080  1.00 0.00 ? 23 GLU A HG3  10 
ATOM 10702 N N    . ARG A 1 24 ? -0.669  -0.457  -6.097  1.00 0.00 ? 24 ARG A N    10 
ATOM 10703 C CA   . ARG A 1 24 ? 0.262   -0.378  -7.216  1.00 0.00 ? 24 ARG A CA   10 
ATOM 10704 C C    . ARG A 1 24 ? 1.546   -1.144  -6.910  1.00 0.00 ? 24 ARG A C    10 
ATOM 10705 O O    . ARG A 1 24 ? 1.898   -2.089  -7.615  1.00 0.00 ? 24 ARG A O    10 
ATOM 10706 C CB   . ARG A 1 24 ? 0.590   1.082   -7.531  1.00 0.00 ? 24 ARG A CB   10 
ATOM 10707 C CG   . ARG A 1 24 ? 1.734   1.250   -8.518  1.00 0.00 ? 24 ARG A CG   10 
ATOM 10708 C CD   . ARG A 1 24 ? 1.453   2.366   -9.512  1.00 0.00 ? 24 ARG A CD   10 
ATOM 10709 N NE   . ARG A 1 24 ? 2.435   2.397   -10.592 1.00 0.00 ? 24 ARG A NE   10 
ATOM 10710 C CZ   . ARG A 1 24 ? 2.415   1.566   -11.628 1.00 0.00 ? 24 ARG A CZ   10 
ATOM 10711 N NH1  . ARG A 1 24 ? 1.467   0.644   -11.724 1.00 0.00 ? 24 ARG A NH1  10 
ATOM 10712 N NH2  . ARG A 1 24 ? 3.344   1.657   -12.572 1.00 0.00 ? 24 ARG A NH2  10 
ATOM 10713 H H    . ARG A 1 24 ? -0.952  0.369   -5.651  1.00 0.00 ? 24 ARG A H    10 
ATOM 10714 H HA   . ARG A 1 24 ? -0.214  -0.825  -8.076  1.00 0.00 ? 24 ARG A HA   10 
ATOM 10715 H HB2  . ARG A 1 24 ? -0.287  1.555   -7.948  1.00 0.00 ? 24 ARG A HB2  10 
ATOM 10716 H HB3  . ARG A 1 24 ? 0.859   1.585   -6.614  1.00 0.00 ? 24 ARG A HB3  10 
ATOM 10717 H HG2  . ARG A 1 24 ? 2.636   1.487   -7.973  1.00 0.00 ? 24 ARG A HG2  10 
ATOM 10718 H HG3  . ARG A 1 24 ? 1.870   0.325   -9.058  1.00 0.00 ? 24 ARG A HG3  10 
ATOM 10719 H HD2  . ARG A 1 24 ? 0.471   2.215   -9.935  1.00 0.00 ? 24 ARG A HD2  10 
ATOM 10720 H HD3  . ARG A 1 24 ? 1.477   3.310   -8.989  1.00 0.00 ? 24 ARG A HD3  10 
ATOM 10721 H HE   . ARG A 1 24 ? 3.144   3.071   -10.542 1.00 0.00 ? 24 ARG A HE   10 
ATOM 10722 H HH11 . ARG A 1 24 ? 0.766   0.574   -11.015 1.00 0.00 ? 24 ARG A HH11 10 
ATOM 10723 H HH12 . ARG A 1 24 ? 1.453   0.020   -12.506 1.00 0.00 ? 24 ARG A HH12 10 
ATOM 10724 H HH21 . ARG A 1 24 ? 4.060   2.351   -12.503 1.00 0.00 ? 24 ARG A HH21 10 
ATOM 10725 H HH22 . ARG A 1 24 ? 3.328   1.031   -13.351 1.00 0.00 ? 24 ARG A HH22 10 
ATOM 10726 N N    . GLU A 1 25 ? 2.239   -0.730  -5.854  1.00 0.00 ? 25 GLU A N    10 
ATOM 10727 C CA   . GLU A 1 25 ? 3.484   -1.377  -5.457  1.00 0.00 ? 25 GLU A CA   10 
ATOM 10728 C C    . GLU A 1 25 ? 3.289   -2.882  -5.300  1.00 0.00 ? 25 GLU A C    10 
ATOM 10729 O O    . GLU A 1 25 ? 4.160   -3.673  -5.662  1.00 0.00 ? 25 GLU A O    10 
ATOM 10730 C CB   . GLU A 1 25 ? 3.999   -0.779  -4.146  1.00 0.00 ? 25 GLU A CB   10 
ATOM 10731 C CG   . GLU A 1 25 ? 5.006   0.342   -4.342  1.00 0.00 ? 25 GLU A CG   10 
ATOM 10732 C CD   . GLU A 1 25 ? 4.609   1.294   -5.454  1.00 0.00 ? 25 GLU A CD   10 
ATOM 10733 O OE1  . GLU A 1 25 ? 4.936   1.008   -6.625  1.00 0.00 ? 25 GLU A OE1  10 
ATOM 10734 O OE2  . GLU A 1 25 ? 3.972   2.324   -5.153  1.00 0.00 ? 25 GLU A OE2  10 
ATOM 10735 H H    . GLU A 1 25 ? 1.906   0.029   -5.331  1.00 0.00 ? 25 GLU A H    10 
ATOM 10736 H HA   . GLU A 1 25 ? 4.212   -1.200  -6.233  1.00 0.00 ? 25 GLU A HA   10 
ATOM 10737 H HB2  . GLU A 1 25 ? 3.161   -0.390  -3.588  1.00 0.00 ? 25 GLU A HB2  10 
ATOM 10738 H HB3  . GLU A 1 25 ? 4.471   -1.561  -3.569  1.00 0.00 ? 25 GLU A HB3  10 
ATOM 10739 H HG2  . GLU A 1 25 ? 5.086   0.902   -3.422  1.00 0.00 ? 25 GLU A HG2  10 
ATOM 10740 H HG3  . GLU A 1 25 ? 5.965   -0.091  -4.584  1.00 0.00 ? 25 GLU A HG3  10 
ATOM 10741 N N    . TYR A 1 26 ? 2.140   -3.270  -4.758  1.00 0.00 ? 26 TYR A N    10 
ATOM 10742 C CA   . TYR A 1 26 ? 1.830   -4.680  -4.550  1.00 0.00 ? 26 TYR A CA   10 
ATOM 10743 C C    . TYR A 1 26 ? 1.908   -5.454  -5.863  1.00 0.00 ? 26 TYR A C    10 
ATOM 10744 O O    . TYR A 1 26 ? 2.511   -6.524  -5.931  1.00 0.00 ? 26 TYR A O    10 
ATOM 10745 C CB   . TYR A 1 26 ? 0.438   -4.833  -3.937  1.00 0.00 ? 26 TYR A CB   10 
ATOM 10746 C CG   . TYR A 1 26 ? 0.053   -6.269  -3.659  1.00 0.00 ? 26 TYR A CG   10 
ATOM 10747 C CD1  . TYR A 1 26 ? 0.749   -7.028  -2.727  1.00 0.00 ? 26 TYR A CD1  10 
ATOM 10748 C CD2  . TYR A 1 26 ? -1.008  -6.866  -4.329  1.00 0.00 ? 26 TYR A CD2  10 
ATOM 10749 C CE1  . TYR A 1 26 ? 0.401   -8.340  -2.471  1.00 0.00 ? 26 TYR A CE1  10 
ATOM 10750 C CE2  . TYR A 1 26 ? -1.364  -8.177  -4.079  1.00 0.00 ? 26 TYR A CE2  10 
ATOM 10751 C CZ   . TYR A 1 26 ? -0.656  -8.910  -3.149  1.00 0.00 ? 26 TYR A CZ   10 
ATOM 10752 O OH   . TYR A 1 26 ? -1.007  -10.216 -2.896  1.00 0.00 ? 26 TYR A OH   10 
ATOM 10753 H H    . TYR A 1 26 ? 1.484   -2.593  -4.490  1.00 0.00 ? 26 TYR A H    10 
ATOM 10754 H HA   . TYR A 1 26 ? 2.561   -5.082  -3.865  1.00 0.00 ? 26 TYR A HA   10 
ATOM 10755 H HB2  . TYR A 1 26 ? 0.402   -4.294  -3.002  1.00 0.00 ? 26 TYR A HB2  10 
ATOM 10756 H HB3  . TYR A 1 26 ? -0.294  -4.418  -4.614  1.00 0.00 ? 26 TYR A HB3  10 
ATOM 10757 H HD1  . TYR A 1 26 ? 1.576   -6.578  -2.197  1.00 0.00 ? 26 TYR A HD1  10 
ATOM 10758 H HD2  . TYR A 1 26 ? -1.561  -6.289  -5.057  1.00 0.00 ? 26 TYR A HD2  10 
ATOM 10759 H HE1  . TYR A 1 26 ? 0.954   -8.914  -1.742  1.00 0.00 ? 26 TYR A HE1  10 
ATOM 10760 H HE2  . TYR A 1 26 ? -2.192  -8.624  -4.610  1.00 0.00 ? 26 TYR A HE2  10 
ATOM 10761 H HH   . TYR A 1 26 ? -1.507  -10.260 -2.077  1.00 0.00 ? 26 TYR A HH   10 
ATOM 10762 N N    . ALA A 1 27 ? 1.292   -4.903  -6.904  1.00 0.00 ? 27 ALA A N    10 
ATOM 10763 C CA   . ALA A 1 27 ? 1.293   -5.539  -8.216  1.00 0.00 ? 27 ALA A CA   10 
ATOM 10764 C C    . ALA A 1 27 ? 2.711   -5.677  -8.758  1.00 0.00 ? 27 ALA A C    10 
ATOM 10765 O O    . ALA A 1 27 ? 2.997   -6.569  -9.556  1.00 0.00 ? 27 ALA A O    10 
ATOM 10766 C CB   . ALA A 1 27 ? 0.429   -4.747  -9.186  1.00 0.00 ? 27 ALA A CB   10 
ATOM 10767 H H    . ALA A 1 27 ? 0.828   -4.048  -6.788  1.00 0.00 ? 27 ALA A H    10 
ATOM 10768 H HA   . ALA A 1 27 ? 0.861   -6.524  -8.109  1.00 0.00 ? 27 ALA A HA   10 
ATOM 10769 H HB1  . ALA A 1 27 ? 0.411   -3.709  -8.887  1.00 0.00 ? 27 ALA A HB1  10 
ATOM 10770 H HB2  . ALA A 1 27 ? 0.840   -4.828  -10.182 1.00 0.00 ? 27 ALA A HB2  10 
ATOM 10771 H HB3  . ALA A 1 27 ? -0.576  -5.142  -9.178  1.00 0.00 ? 27 ALA A HB3  10 
ATOM 10772 N N    . ALA A 1 28 ? 3.596   -4.787  -8.321  1.00 0.00 ? 28 ALA A N    10 
ATOM 10773 C CA   . ALA A 1 28 ? 4.985   -4.811  -8.762  1.00 0.00 ? 28 ALA A CA   10 
ATOM 10774 C C    . ALA A 1 28 ? 5.813   -5.773  -7.916  1.00 0.00 ? 28 ALA A C    10 
ATOM 10775 O O    . ALA A 1 28 ? 6.791   -6.349  -8.392  1.00 0.00 ? 28 ALA A O    10 
ATOM 10776 C CB   . ALA A 1 28 ? 5.580   -3.412  -8.708  1.00 0.00 ? 28 ALA A CB   10 
ATOM 10777 H H    . ALA A 1 28 ? 3.308   -4.100  -7.685  1.00 0.00 ? 28 ALA A H    10 
ATOM 10778 H HA   . ALA A 1 28 ? 5.004   -5.144  -9.790  1.00 0.00 ? 28 ALA A HA   10 
ATOM 10779 H HB1  . ALA A 1 28 ? 5.440   -2.925  -9.662  1.00 0.00 ? 28 ALA A HB1  10 
ATOM 10780 H HB2  . ALA A 1 28 ? 5.087   -2.841  -7.936  1.00 0.00 ? 28 ALA A HB2  10 
ATOM 10781 H HB3  . ALA A 1 28 ? 6.636   -3.478  -8.489  1.00 0.00 ? 28 ALA A HB3  10 
ATOM 10782 N N    . ASN A 1 29 ? 5.416   -5.942  -6.659  1.00 0.00 ? 29 ASN A N    10 
ATOM 10783 C CA   . ASN A 1 29 ? 6.122   -6.833  -5.747  1.00 0.00 ? 29 ASN A CA   10 
ATOM 10784 C C    . ASN A 1 29 ? 5.332   -7.030  -4.457  1.00 0.00 ? 29 ASN A C    10 
ATOM 10785 O O    . ASN A 1 29 ? 5.188   -6.105  -3.657  1.00 0.00 ? 29 ASN A O    10 
ATOM 10786 C CB   . ASN A 1 29 ? 7.511   -6.275  -5.428  1.00 0.00 ? 29 ASN A CB   10 
ATOM 10787 C CG   . ASN A 1 29 ? 7.453   -4.862  -4.881  1.00 0.00 ? 29 ASN A CG   10 
ATOM 10788 O OD1  . ASN A 1 29 ? 7.570   -4.646  -3.674  1.00 0.00 ? 29 ASN A OD1  10 
ATOM 10789 N ND2  . ASN A 1 29 ? 7.272   -3.891  -5.768  1.00 0.00 ? 29 ASN A ND2  10 
ATOM 10790 H H    . ASN A 1 29 ? 4.628   -5.455  -6.337  1.00 0.00 ? 29 ASN A H    10 
ATOM 10791 H HA   . ASN A 1 29 ? 6.233   -7.789  -6.237  1.00 0.00 ? 29 ASN A HA   10 
ATOM 10792 H HB2  . ASN A 1 29 ? 7.986   -6.906  -4.692  1.00 0.00 ? 29 ASN A HB2  10 
ATOM 10793 H HB3  . ASN A 1 29 ? 8.106   -6.269  -6.329  1.00 0.00 ? 29 ASN A HB3  10 
ATOM 10794 H HD21 . ASN A 1 29 ? 7.187   -4.136  -6.713  1.00 0.00 ? 29 ASN A HD21 10 
ATOM 10795 H HD22 . ASN A 1 29 ? 7.232   -2.967  -5.442  1.00 0.00 ? 29 ASN A HD22 10 
ATOM 10796 N N    . LYS A 1 30 ? 4.822   -8.241  -4.260  1.00 0.00 ? 30 LYS A N    10 
ATOM 10797 C CA   . LYS A 1 30 ? 4.048   -8.561  -3.067  1.00 0.00 ? 30 LYS A CA   10 
ATOM 10798 C C    . LYS A 1 30 ? 4.811   -8.175  -1.804  1.00 0.00 ? 30 LYS A C    10 
ATOM 10799 O O    . LYS A 1 30 ? 4.212   -7.796  -0.797  1.00 0.00 ? 30 LYS A O    10 
ATOM 10800 C CB   . LYS A 1 30 ? 3.713   -10.054 -3.037  1.00 0.00 ? 30 LYS A CB   10 
ATOM 10801 C CG   . LYS A 1 30 ? 4.932   -10.953 -3.149  1.00 0.00 ? 30 LYS A CG   10 
ATOM 10802 C CD   . LYS A 1 30 ? 4.548   -12.364 -3.564  1.00 0.00 ? 30 LYS A CD   10 
ATOM 10803 C CE   . LYS A 1 30 ? 4.498   -12.505 -5.078  1.00 0.00 ? 30 LYS A CE   10 
ATOM 10804 N NZ   . LYS A 1 30 ? 4.154   -13.893 -5.494  1.00 0.00 ? 30 LYS A NZ   10 
ATOM 10805 H H    . LYS A 1 30 ? 4.971   -8.937  -4.934  1.00 0.00 ? 30 LYS A H    10 
ATOM 10806 H HA   . LYS A 1 30 ? 3.130   -7.995  -3.106  1.00 0.00 ? 30 LYS A HA   10 
ATOM 10807 H HB2  . LYS A 1 30 ? 3.209   -10.279 -2.108  1.00 0.00 ? 30 LYS A HB2  10 
ATOM 10808 H HB3  . LYS A 1 30 ? 3.049   -10.278 -3.860  1.00 0.00 ? 30 LYS A HB3  10 
ATOM 10809 H HG2  . LYS A 1 30 ? 5.604   -10.543 -3.887  1.00 0.00 ? 30 LYS A HG2  10 
ATOM 10810 H HG3  . LYS A 1 30 ? 5.428   -10.993 -2.189  1.00 0.00 ? 30 LYS A HG3  10 
ATOM 10811 H HD2  . LYS A 1 30 ? 5.278   -13.056 -3.173  1.00 0.00 ? 30 LYS A HD2  10 
ATOM 10812 H HD3  . LYS A 1 30 ? 3.574   -12.597 -3.157  1.00 0.00 ? 30 LYS A HD3  10 
ATOM 10813 H HE2  . LYS A 1 30 ? 3.752   -11.827 -5.465  1.00 0.00 ? 30 LYS A HE2  10 
ATOM 10814 H HE3  . LYS A 1 30 ? 5.465   -12.246 -5.482  1.00 0.00 ? 30 LYS A HE3  10 
ATOM 10815 H HZ1  . LYS A 1 30 ? 4.034   -13.936 -6.526  1.00 0.00 ? 30 LYS A HZ1  10 
ATOM 10816 H HZ2  . LYS A 1 30 ? 3.268   -14.193 -5.040  1.00 0.00 ? 30 LYS A HZ2  10 
ATOM 10817 H HZ3  . LYS A 1 30 ? 4.912   -14.548 -5.216  1.00 0.00 ? 30 LYS A HZ3  10 
ATOM 10818 N N    . PHE A 1 31 ? 6.135   -8.272  -1.864  1.00 0.00 ? 31 PHE A N    10 
ATOM 10819 C CA   . PHE A 1 31 ? 6.979   -7.933  -0.725  1.00 0.00 ? 31 PHE A CA   10 
ATOM 10820 C C    . PHE A 1 31 ? 7.957   -6.818  -1.086  1.00 0.00 ? 31 PHE A C    10 
ATOM 10821 O O    . PHE A 1 31 ? 8.867   -7.013  -1.892  1.00 0.00 ? 31 PHE A O    10 
ATOM 10822 C CB   . PHE A 1 31 ? 7.749   -9.166  -0.248  1.00 0.00 ? 31 PHE A CB   10 
ATOM 10823 C CG   . PHE A 1 31 ? 7.019   -9.961  0.797   1.00 0.00 ? 31 PHE A CG   10 
ATOM 10824 C CD1  . PHE A 1 31 ? 5.726   -10.404 0.571   1.00 0.00 ? 31 PHE A CD1  10 
ATOM 10825 C CD2  . PHE A 1 31 ? 7.625   -10.264 2.005   1.00 0.00 ? 31 PHE A CD2  10 
ATOM 10826 C CE1  . PHE A 1 31 ? 5.051   -11.135 1.531   1.00 0.00 ? 31 PHE A CE1  10 
ATOM 10827 C CE2  . PHE A 1 31 ? 6.956   -10.995 2.969   1.00 0.00 ? 31 PHE A CE2  10 
ATOM 10828 C CZ   . PHE A 1 31 ? 5.668   -11.432 2.731   1.00 0.00 ? 31 PHE A CZ   10 
ATOM 10829 H H    . PHE A 1 31 ? 6.554   -8.581  -2.695  1.00 0.00 ? 31 PHE A H    10 
ATOM 10830 H HA   . PHE A 1 31 ? 6.338   -7.589  0.071   1.00 0.00 ? 31 PHE A HA   10 
ATOM 10831 H HB2  . PHE A 1 31 ? 7.931   -9.816  -1.090  1.00 0.00 ? 31 PHE A HB2  10 
ATOM 10832 H HB3  . PHE A 1 31 ? 8.693   -8.852  0.171   1.00 0.00 ? 31 PHE A HB3  10 
ATOM 10833 H HD1  . PHE A 1 31 ? 5.242   -10.174 -0.367  1.00 0.00 ? 31 PHE A HD1  10 
ATOM 10834 H HD2  . PHE A 1 31 ? 8.634   -9.923  2.192   1.00 0.00 ? 31 PHE A HD2  10 
ATOM 10835 H HE1  . PHE A 1 31 ? 4.044   -11.475 1.343   1.00 0.00 ? 31 PHE A HE1  10 
ATOM 10836 H HE2  . PHE A 1 31 ? 7.442   -11.225 3.906   1.00 0.00 ? 31 PHE A HE2  10 
ATOM 10837 H HZ   . PHE A 1 31 ? 5.143   -12.002 3.483   1.00 0.00 ? 31 PHE A HZ   10 
ATOM 10838 N N    . ILE A 1 32 ? 7.761   -5.650  -0.484  1.00 0.00 ? 32 ILE A N    10 
ATOM 10839 C CA   . ILE A 1 32 ? 8.624   -4.504  -0.741  1.00 0.00 ? 32 ILE A CA   10 
ATOM 10840 C C    . ILE A 1 32 ? 9.909   -4.590  0.076   1.00 0.00 ? 32 ILE A C    10 
ATOM 10841 O O    . ILE A 1 32 ? 10.107  -5.530  0.846   1.00 0.00 ? 32 ILE A O    10 
ATOM 10842 C CB   . ILE A 1 32 ? 7.911   -3.178  -0.418  1.00 0.00 ? 32 ILE A CB   10 
ATOM 10843 C CG1  . ILE A 1 32 ? 7.650   -3.067  1.086   1.00 0.00 ? 32 ILE A CG1  10 
ATOM 10844 C CG2  . ILE A 1 32 ? 6.608   -3.073  -1.196  1.00 0.00 ? 32 ILE A CG2  10 
ATOM 10845 C CD1  . ILE A 1 32 ? 6.966   -1.779  1.487   1.00 0.00 ? 32 ILE A CD1  10 
ATOM 10846 H H    . ILE A 1 32 ? 7.018   -5.556  0.149   1.00 0.00 ? 32 ILE A H    10 
ATOM 10847 H HA   . ILE A 1 32 ? 8.878   -4.507  -1.791  1.00 0.00 ? 32 ILE A HA   10 
ATOM 10848 H HB   . ILE A 1 32 ? 8.552   -2.366  -0.725  1.00 0.00 ? 32 ILE A HB   10 
ATOM 10849 H HG12 . ILE A 1 32 ? 7.021   -3.886  1.397   1.00 0.00 ? 32 ILE A HG12 10 
ATOM 10850 H HG13 . ILE A 1 32 ? 8.592   -3.121  1.612   1.00 0.00 ? 32 ILE A HG13 10 
ATOM 10851 H HG21 . ILE A 1 32 ? 5.786   -2.953  -0.507  1.00 0.00 ? 32 ILE A HG21 10 
ATOM 10852 H HG22 . ILE A 1 32 ? 6.651   -2.220  -1.856  1.00 0.00 ? 32 ILE A HG22 10 
ATOM 10853 H HG23 . ILE A 1 32 ? 6.463   -3.972  -1.777  1.00 0.00 ? 32 ILE A HG23 10 
ATOM 10854 H HD11 . ILE A 1 32 ? 5.947   -1.785  1.129   1.00 0.00 ? 32 ILE A HD11 10 
ATOM 10855 H HD12 . ILE A 1 32 ? 6.970   -1.688  2.563   1.00 0.00 ? 32 ILE A HD12 10 
ATOM 10856 H HD13 . ILE A 1 32 ? 7.494   -0.941  1.054   1.00 0.00 ? 32 ILE A HD13 10 
ATOM 10857 N N    . THR A 1 33 ? 10.780  -3.600  -0.094  1.00 0.00 ? 33 THR A N    10 
ATOM 10858 C CA   . THR A 1 33 ? 12.045  -3.562  0.627   1.00 0.00 ? 33 THR A CA   10 
ATOM 10859 C C    . THR A 1 33 ? 12.008  -2.531  1.749   1.00 0.00 ? 33 THR A C    10 
ATOM 10860 O O    . THR A 1 33 ? 11.010  -1.835  1.934   1.00 0.00 ? 33 THR A O    10 
ATOM 10861 C CB   . THR A 1 33 ? 13.220  -3.237  -0.315  1.00 0.00 ? 33 THR A CB   10 
ATOM 10862 O OG1  . THR A 1 33 ? 13.301  -1.823  -0.527  1.00 0.00 ? 33 THR A OG1  10 
ATOM 10863 C CG2  . THR A 1 33 ? 13.055  -3.947  -1.650  1.00 0.00 ? 33 THR A CG2  10 
ATOM 10864 H H    . THR A 1 33 ? 10.565  -2.878  -0.722  1.00 0.00 ? 33 THR A H    10 
ATOM 10865 H HA   . THR A 1 33 ? 12.215  -4.540  1.055   1.00 0.00 ? 33 THR A HA   10 
ATOM 10866 H HB   . THR A 1 33 ? 14.136  -3.577  0.146   1.00 0.00 ? 33 THR A HB   10 
ATOM 10867 H HG1  . THR A 1 33 ? 13.876  -1.644  -1.275  1.00 0.00 ? 33 THR A HG1  10 
ATOM 10868 H HG21 . THR A 1 33 ? 12.389  -4.789  -1.531  1.00 0.00 ? 33 THR A HG21 10 
ATOM 10869 H HG22 . THR A 1 33 ? 14.018  -4.295  -1.994  1.00 0.00 ? 33 THR A HG22 10 
ATOM 10870 H HG23 . THR A 1 33 ? 12.641  -3.261  -2.373  1.00 0.00 ? 33 THR A HG23 10 
ATOM 10871 N N    . LYS A 1 34 ? 13.103  -2.436  2.496   1.00 0.00 ? 34 LYS A N    10 
ATOM 10872 C CA   . LYS A 1 34 ? 13.197  -1.488  3.600   1.00 0.00 ? 34 LYS A CA   10 
ATOM 10873 C C    . LYS A 1 34 ? 13.197  -0.052  3.085   1.00 0.00 ? 34 LYS A C    10 
ATOM 10874 O O    . LYS A 1 34 ? 12.837  0.876   3.809   1.00 0.00 ? 34 LYS A O    10 
ATOM 10875 C CB   . LYS A 1 34 ? 14.466  -1.748  4.416   1.00 0.00 ? 34 LYS A CB   10 
ATOM 10876 C CG   . LYS A 1 34 ? 14.253  -2.690  5.588   1.00 0.00 ? 34 LYS A CG   10 
ATOM 10877 C CD   . LYS A 1 34 ? 15.293  -2.473  6.674   1.00 0.00 ? 34 LYS A CD   10 
ATOM 10878 C CE   . LYS A 1 34 ? 16.530  -3.325  6.439   1.00 0.00 ? 34 LYS A CE   10 
ATOM 10879 N NZ   . LYS A 1 34 ? 17.496  -2.660  5.521   1.00 0.00 ? 34 LYS A NZ   10 
ATOM 10880 H H    . LYS A 1 34 ? 13.867  -3.019  2.300   1.00 0.00 ? 34 LYS A H    10 
ATOM 10881 H HA   . LYS A 1 34 ? 12.336  -1.631  4.234   1.00 0.00 ? 34 LYS A HA   10 
ATOM 10882 H HB2  . LYS A 1 34 ? 15.215  -2.177  3.767   1.00 0.00 ? 34 LYS A HB2  10 
ATOM 10883 H HB3  . LYS A 1 34 ? 14.831  -0.807  4.800   1.00 0.00 ? 34 LYS A HB3  10 
ATOM 10884 H HG2  . LYS A 1 34 ? 13.272  -2.517  6.004   1.00 0.00 ? 34 LYS A HG2  10 
ATOM 10885 H HG3  . LYS A 1 34 ? 14.321  -3.710  5.235   1.00 0.00 ? 34 LYS A HG3  10 
ATOM 10886 H HD2  . LYS A 1 34 ? 15.582  -1.433  6.681   1.00 0.00 ? 34 LYS A HD2  10 
ATOM 10887 H HD3  . LYS A 1 34 ? 14.862  -2.735  7.630   1.00 0.00 ? 34 LYS A HD3  10 
ATOM 10888 H HE2  . LYS A 1 34 ? 17.013  -3.504  7.388   1.00 0.00 ? 34 LYS A HE2  10 
ATOM 10889 H HE3  . LYS A 1 34 ? 16.226  -4.267  6.007   1.00 0.00 ? 34 LYS A HE3  10 
ATOM 10890 H HZ1  . LYS A 1 34 ? 17.367  -1.628  5.554   1.00 0.00 ? 34 LYS A HZ1  10 
ATOM 10891 H HZ2  . LYS A 1 34 ? 17.344  -2.986  4.546   1.00 0.00 ? 34 LYS A HZ2  10 
ATOM 10892 H HZ3  . LYS A 1 34 ? 18.471  -2.886  5.803   1.00 0.00 ? 34 LYS A HZ3  10 
ATOM 10893 N N    . ASP A 1 35 ? 13.599  0.122   1.831   1.00 0.00 ? 35 ASP A N    10 
ATOM 10894 C CA   . ASP A 1 35 ? 13.642  1.445   1.219   1.00 0.00 ? 35 ASP A CA   10 
ATOM 10895 C C    . ASP A 1 35 ? 12.297  1.798   0.594   1.00 0.00 ? 35 ASP A C    10 
ATOM 10896 O O    . ASP A 1 35 ? 11.746  2.871   0.843   1.00 0.00 ? 35 ASP A O    10 
ATOM 10897 C CB   . ASP A 1 35 ? 14.743  1.504   0.158   1.00 0.00 ? 35 ASP A CB   10 
ATOM 10898 C CG   . ASP A 1 35 ? 16.083  1.913   0.736   1.00 0.00 ? 35 ASP A CG   10 
ATOM 10899 O OD1  . ASP A 1 35 ? 16.297  3.127   0.937   1.00 0.00 ? 35 ASP A OD1  10 
ATOM 10900 O OD2  . ASP A 1 35 ? 16.918  1.020   0.989   1.00 0.00 ? 35 ASP A OD2  10 
ATOM 10901 H H    . ASP A 1 35 ? 13.873  -0.658  1.304   1.00 0.00 ? 35 ASP A H    10 
ATOM 10902 H HA   . ASP A 1 35 ? 13.864  2.162   1.994   1.00 0.00 ? 35 ASP A HA   10 
ATOM 10903 H HB2  . ASP A 1 35 ? 14.850  0.528   -0.294  1.00 0.00 ? 35 ASP A HB2  10 
ATOM 10904 H HB3  . ASP A 1 35 ? 14.464  2.220   -0.601  1.00 0.00 ? 35 ASP A HB3  10 
ATOM 10905 N N    . LYS A 1 36 ? 11.772  0.890   -0.221  1.00 0.00 ? 36 LYS A N    10 
ATOM 10906 C CA   . LYS A 1 36 ? 10.490  1.104   -0.883  1.00 0.00 ? 36 LYS A CA   10 
ATOM 10907 C C    . LYS A 1 36 ? 9.409   1.466   0.130   1.00 0.00 ? 36 LYS A C    10 
ATOM 10908 O O    . LYS A 1 36 ? 8.534   2.287   -0.148  1.00 0.00 ? 36 LYS A O    10 
ATOM 10909 C CB   . LYS A 1 36 ? 10.078  -0.149  -1.660  1.00 0.00 ? 36 LYS A CB   10 
ATOM 10910 C CG   . LYS A 1 36 ? 8.676   -0.072  -2.239  1.00 0.00 ? 36 LYS A CG   10 
ATOM 10911 C CD   . LYS A 1 36 ? 8.512   1.139   -3.143  1.00 0.00 ? 36 LYS A CD   10 
ATOM 10912 C CE   . LYS A 1 36 ? 9.449   1.073   -4.339  1.00 0.00 ? 36 LYS A CE   10 
ATOM 10913 N NZ   . LYS A 1 36 ? 9.132   2.118   -5.351  1.00 0.00 ? 36 LYS A NZ   10 
ATOM 10914 H H    . LYS A 1 36 ? 12.258  0.053   -0.381  1.00 0.00 ? 36 LYS A H    10 
ATOM 10915 H HA   . LYS A 1 36 ? 10.607  1.924   -1.575  1.00 0.00 ? 36 LYS A HA   10 
ATOM 10916 H HB2  . LYS A 1 36 ? 10.773  -0.298  -2.473  1.00 0.00 ? 36 LYS A HB2  10 
ATOM 10917 H HB3  . LYS A 1 36 ? 10.125  -1.000  -0.997  1.00 0.00 ? 36 LYS A HB3  10 
ATOM 10918 H HG2  . LYS A 1 36 ? 8.484   -0.965  -2.814  1.00 0.00 ? 36 LYS A HG2  10 
ATOM 10919 H HG3  . LYS A 1 36 ? 7.965   -0.003  -1.428  1.00 0.00 ? 36 LYS A HG3  10 
ATOM 10920 H HD2  . LYS A 1 36 ? 7.494   1.176   -3.500  1.00 0.00 ? 36 LYS A HD2  10 
ATOM 10921 H HD3  . LYS A 1 36 ? 8.729   2.033   -2.575  1.00 0.00 ? 36 LYS A HD3  10 
ATOM 10922 H HE2  . LYS A 1 36 ? 10.462  1.214   -3.994  1.00 0.00 ? 36 LYS A HE2  10 
ATOM 10923 H HE3  . LYS A 1 36 ? 9.358   0.100   -4.798  1.00 0.00 ? 36 LYS A HE3  10 
ATOM 10924 H HZ1  . LYS A 1 36 ? 8.890   3.012   -4.877  1.00 0.00 ? 36 LYS A HZ1  10 
ATOM 10925 H HZ2  . LYS A 1 36 ? 8.324   1.819   -5.933  1.00 0.00 ? 36 LYS A HZ2  10 
ATOM 10926 H HZ3  . LYS A 1 36 ? 9.952   2.277   -5.970  1.00 0.00 ? 36 LYS A HZ3  10 
ATOM 10927 N N    . ARG A 1 37 ? 9.475   0.849   1.305   1.00 0.00 ? 37 ARG A N    10 
ATOM 10928 C CA   . ARG A 1 37 ? 8.501   1.106   2.359   1.00 0.00 ? 37 ARG A CA   10 
ATOM 10929 C C    . ARG A 1 37 ? 8.559   2.563   2.808   1.00 0.00 ? 37 ARG A C    10 
ATOM 10930 O O    . ARG A 1 37 ? 7.535   3.163   3.138   1.00 0.00 ? 37 ARG A O    10 
ATOM 10931 C CB   . ARG A 1 37 ? 8.752   0.183   3.552   1.00 0.00 ? 37 ARG A CB   10 
ATOM 10932 C CG   . ARG A 1 37 ? 7.792   0.406   4.709   1.00 0.00 ? 37 ARG A CG   10 
ATOM 10933 C CD   . ARG A 1 37 ? 7.392   -0.907  5.363   1.00 0.00 ? 37 ARG A CD   10 
ATOM 10934 N NE   . ARG A 1 37 ? 7.950   -1.042  6.706   1.00 0.00 ? 37 ARG A NE   10 
ATOM 10935 C CZ   . ARG A 1 37 ? 9.189   -1.453  6.949   1.00 0.00 ? 37 ARG A CZ   10 
ATOM 10936 N NH1  . ARG A 1 37 ? 9.996   -1.767  5.945   1.00 0.00 ? 37 ARG A NH1  10 
ATOM 10937 N NH2  . ARG A 1 37 ? 9.624   -1.550  8.199   1.00 0.00 ? 37 ARG A NH2  10 
ATOM 10938 H H    . ARG A 1 37 ? 10.195  0.204   1.467   1.00 0.00 ? 37 ARG A H    10 
ATOM 10939 H HA   . ARG A 1 37 ? 7.518   0.904   1.959   1.00 0.00 ? 37 ARG A HA   10 
ATOM 10940 H HB2  . ARG A 1 37 ? 8.655   -0.842  3.226   1.00 0.00 ? 37 ARG A HB2  10 
ATOM 10941 H HB3  . ARG A 1 37 ? 9.758   0.344   3.911   1.00 0.00 ? 37 ARG A HB3  10 
ATOM 10942 H HG2  . ARG A 1 37 ? 8.272   1.032   5.447   1.00 0.00 ? 37 ARG A HG2  10 
ATOM 10943 H HG3  . ARG A 1 37 ? 6.906   0.899   4.338   1.00 0.00 ? 37 ARG A HG3  10 
ATOM 10944 H HD2  . ARG A 1 37 ? 6.315   -0.949  5.425   1.00 0.00 ? 37 ARG A HD2  10 
ATOM 10945 H HD3  . ARG A 1 37 ? 7.749   -1.721  4.751   1.00 0.00 ? 37 ARG A HD3  10 
ATOM 10946 H HE   . ARG A 1 37 ? 7.371   -0.814  7.462   1.00 0.00 ? 37 ARG A HE   10 
ATOM 10947 H HH11 . ARG A 1 37 ? 9.671   -1.694  5.002   1.00 0.00 ? 37 ARG A HH11 10 
ATOM 10948 H HH12 . ARG A 1 37 ? 10.929  -2.076  6.130   1.00 0.00 ? 37 ARG A HH12 10 
ATOM 10949 H HH21 . ARG A 1 37 ? 9.019   -1.313  8.958   1.00 0.00 ? 37 ARG A HH21 10 
ATOM 10950 H HH22 . ARG A 1 37 ? 10.557  -1.859  8.380   1.00 0.00 ? 37 ARG A HH22 10 
ATOM 10951 N N    . ARG A 1 38 ? 9.763   3.126   2.820   1.00 0.00 ? 38 ARG A N    10 
ATOM 10952 C CA   . ARG A 1 38 ? 9.955   4.511   3.231   1.00 0.00 ? 38 ARG A CA   10 
ATOM 10953 C C    . ARG A 1 38 ? 9.335   5.470   2.218   1.00 0.00 ? 38 ARG A C    10 
ATOM 10954 O O    . ARG A 1 38 ? 8.754   6.490   2.587   1.00 0.00 ? 38 ARG A O    10 
ATOM 10955 C CB   . ARG A 1 38 ? 11.445  4.816   3.392   1.00 0.00 ? 38 ARG A CB   10 
ATOM 10956 C CG   . ARG A 1 38 ? 12.096  4.078   4.550   1.00 0.00 ? 38 ARG A CG   10 
ATOM 10957 C CD   . ARG A 1 38 ? 13.612  4.200   4.507   1.00 0.00 ? 38 ARG A CD   10 
ATOM 10958 N NE   . ARG A 1 38 ? 14.211  4.043   5.830   1.00 0.00 ? 38 ARG A NE   10 
ATOM 10959 C CZ   . ARG A 1 38 ? 14.262  5.016   6.733   1.00 0.00 ? 38 ARG A CZ   10 
ATOM 10960 N NH1  . ARG A 1 38 ? 13.751  6.208   6.458   1.00 0.00 ? 38 ARG A NH1  10 
ATOM 10961 N NH2  . ARG A 1 38 ? 14.824  4.797   7.915   1.00 0.00 ? 38 ARG A NH2  10 
ATOM 10962 H H    . ARG A 1 38 ? 10.541  2.596   2.547   1.00 0.00 ? 38 ARG A H    10 
ATOM 10963 H HA   . ARG A 1 38 ? 9.464   4.646   4.183   1.00 0.00 ? 38 ARG A HA   10 
ATOM 10964 H HB2  . ARG A 1 38 ? 11.958  4.538   2.483   1.00 0.00 ? 38 ARG A HB2  10 
ATOM 10965 H HB3  . ARG A 1 38 ? 11.568  5.876   3.555   1.00 0.00 ? 38 ARG A HB3  10 
ATOM 10966 H HG2  . ARG A 1 38 ? 11.739  4.497   5.479   1.00 0.00 ? 38 ARG A HG2  10 
ATOM 10967 H HG3  . ARG A 1 38 ? 11.826  3.034   4.496   1.00 0.00 ? 38 ARG A HG3  10 
ATOM 10968 H HD2  . ARG A 1 38 ? 14.003  3.435   3.853   1.00 0.00 ? 38 ARG A HD2  10 
ATOM 10969 H HD3  . ARG A 1 38 ? 13.870  5.173   4.117   1.00 0.00 ? 38 ARG A HD3  10 
ATOM 10970 H HE   . ARG A 1 38 ? 14.594  3.170   6.054   1.00 0.00 ? 38 ARG A HE   10 
ATOM 10971 H HH11 . ARG A 1 38 ? 13.326  6.376   5.568   1.00 0.00 ? 38 ARG A HH11 10 
ATOM 10972 H HH12 . ARG A 1 38 ? 13.790  6.939   7.140   1.00 0.00 ? 38 ARG A HH12 10 
ATOM 10973 H HH21 . ARG A 1 38 ? 15.210  3.899   8.126   1.00 0.00 ? 38 ARG A HH21 10 
ATOM 10974 H HH22 . ARG A 1 38 ? 14.862  5.529   8.594   1.00 0.00 ? 38 ARG A HH22 10 
ATOM 10975 N N    . LYS A 1 39 ? 9.464   5.134   0.939   1.00 0.00 ? 39 LYS A N    10 
ATOM 10976 C CA   . LYS A 1 39 ? 8.917   5.963   -0.129  1.00 0.00 ? 39 LYS A CA   10 
ATOM 10977 C C    . LYS A 1 39 ? 7.395   6.026   -0.043  1.00 0.00 ? 39 LYS A C    10 
ATOM 10978 O O    . LYS A 1 39 ? 6.808   7.109   -0.054  1.00 0.00 ? 39 LYS A O    10 
ATOM 10979 C CB   . LYS A 1 39 ? 9.339   5.416   -1.494  1.00 0.00 ? 39 LYS A CB   10 
ATOM 10980 C CG   . LYS A 1 39 ? 10.845  5.354   -1.685  1.00 0.00 ? 39 LYS A CG   10 
ATOM 10981 C CD   . LYS A 1 39 ? 11.410  6.700   -2.103  1.00 0.00 ? 39 LYS A CD   10 
ATOM 10982 C CE   . LYS A 1 39 ? 11.273  6.922   -3.602  1.00 0.00 ? 39 LYS A CE   10 
ATOM 10983 N NZ   . LYS A 1 39 ? 12.189  7.990   -4.091  1.00 0.00 ? 39 LYS A NZ   10 
ATOM 10984 H H    . LYS A 1 39 ? 9.938   4.308   0.707   1.00 0.00 ? 39 LYS A H    10 
ATOM 10985 H HA   . LYS A 1 39 ? 9.313   6.960   -0.011  1.00 0.00 ? 39 LYS A HA   10 
ATOM 10986 H HB2  . LYS A 1 39 ? 8.940   4.419   -1.608  1.00 0.00 ? 39 LYS A HB2  10 
ATOM 10987 H HB3  . LYS A 1 39 ? 8.926   6.050   -2.266  1.00 0.00 ? 39 LYS A HB3  10 
ATOM 10988 H HG2  . LYS A 1 39 ? 11.304  5.055   -0.755  1.00 0.00 ? 39 LYS A HG2  10 
ATOM 10989 H HG3  . LYS A 1 39 ? 11.071  4.625   -2.451  1.00 0.00 ? 39 LYS A HG3  10 
ATOM 10990 H HD2  . LYS A 1 39 ? 10.876  7.482   -1.585  1.00 0.00 ? 39 LYS A HD2  10 
ATOM 10991 H HD3  . LYS A 1 39 ? 12.457  6.740   -1.836  1.00 0.00 ? 39 LYS A HD3  10 
ATOM 10992 H HE2  . LYS A 1 39 ? 11.505  5.999   -4.111  1.00 0.00 ? 39 LYS A HE2  10 
ATOM 10993 H HE3  . LYS A 1 39 ? 10.254  7.206   -3.818  1.00 0.00 ? 39 LYS A HE3  10 
ATOM 10994 H HZ1  . LYS A 1 39 ? 11.784  8.449   -4.932  1.00 0.00 ? 39 LYS A HZ1  10 
ATOM 10995 H HZ2  . LYS A 1 39 ? 13.111  7.581   -4.343  1.00 0.00 ? 39 LYS A HZ2  10 
ATOM 10996 H HZ3  . LYS A 1 39 ? 12.329  8.707   -3.351  1.00 0.00 ? 39 LYS A HZ3  10 
ATOM 10997 N N    . ILE A 1 40 ? 6.763   4.861   0.043   1.00 0.00 ? 40 ILE A N    10 
ATOM 10998 C CA   . ILE A 1 40 ? 5.310   4.785   0.134   1.00 0.00 ? 40 ILE A CA   10 
ATOM 10999 C C    . ILE A 1 40 ? 4.791   5.585   1.323   1.00 0.00 ? 40 ILE A C    10 
ATOM 11000 O O    . ILE A 1 40 ? 3.719   6.187   1.259   1.00 0.00 ? 40 ILE A O    10 
ATOM 11001 C CB   . ILE A 1 40 ? 4.829   3.327   0.260   1.00 0.00 ? 40 ILE A CB   10 
ATOM 11002 C CG1  . ILE A 1 40 ? 5.344   2.493   -0.915  1.00 0.00 ? 40 ILE A CG1  10 
ATOM 11003 C CG2  . ILE A 1 40 ? 3.311   3.275   0.330   1.00 0.00 ? 40 ILE A CG2  10 
ATOM 11004 C CD1  . ILE A 1 40 ? 5.169   1.003   -0.721  1.00 0.00 ? 40 ILE A CD1  10 
ATOM 11005 H H    . ILE A 1 40 ? 7.286   4.032   0.047   1.00 0.00 ? 40 ILE A H    10 
ATOM 11006 H HA   . ILE A 1 40 ? 4.898   5.201   -0.774  1.00 0.00 ? 40 ILE A HA   10 
ATOM 11007 H HB   . ILE A 1 40 ? 5.222   2.921   1.180   1.00 0.00 ? 40 ILE A HB   10 
ATOM 11008 H HG12 . ILE A 1 40 ? 4.811   2.776   -1.809  1.00 0.00 ? 40 ILE A HG12 10 
ATOM 11009 H HG13 . ILE A 1 40 ? 6.397   2.690   -1.052  1.00 0.00 ? 40 ILE A HG13 10 
ATOM 11010 H HG21 . ILE A 1 40 ? 2.971   2.293   0.035   1.00 0.00 ? 40 ILE A HG21 10 
ATOM 11011 H HG22 . ILE A 1 40 ? 2.990   3.477   1.340   1.00 0.00 ? 40 ILE A HG22 10 
ATOM 11012 H HG23 . ILE A 1 40 ? 2.894   4.015   -0.337  1.00 0.00 ? 40 ILE A HG23 10 
ATOM 11013 H HD11 . ILE A 1 40 ? 4.338   0.657   -1.318  1.00 0.00 ? 40 ILE A HD11 10 
ATOM 11014 H HD12 . ILE A 1 40 ? 6.070   0.492   -1.026  1.00 0.00 ? 40 ILE A HD12 10 
ATOM 11015 H HD13 . ILE A 1 40 ? 4.973   0.797   0.321   1.00 0.00 ? 40 ILE A HD13 10 
ATOM 11016 N N    . SER A 1 41 ? 5.559   5.588   2.408   1.00 0.00 ? 41 SER A N    10 
ATOM 11017 C CA   . SER A 1 41 ? 5.176   6.312   3.614   1.00 0.00 ? 41 SER A CA   10 
ATOM 11018 C C    . SER A 1 41 ? 5.230   7.819   3.382   1.00 0.00 ? 41 SER A C    10 
ATOM 11019 O O    . SER A 1 41 ? 4.550   8.588   4.062   1.00 0.00 ? 41 SER A O    10 
ATOM 11020 C CB   . SER A 1 41 ? 6.093   5.930   4.777   1.00 0.00 ? 41 SER A CB   10 
ATOM 11021 O OG   . SER A 1 41 ? 6.242   7.009   5.684   1.00 0.00 ? 41 SER A OG   10 
ATOM 11022 H H    . SER A 1 41 ? 6.402   5.088   2.398   1.00 0.00 ? 41 SER A H    10 
ATOM 11023 H HA   . SER A 1 41 ? 4.162   6.034   3.860   1.00 0.00 ? 41 SER A HA   10 
ATOM 11024 H HB2  . SER A 1 41 ? 5.670   5.089   5.304   1.00 0.00 ? 41 SER A HB2  10 
ATOM 11025 H HB3  . SER A 1 41 ? 7.066   5.662   4.392   1.00 0.00 ? 41 SER A HB3  10 
ATOM 11026 H HG   . SER A 1 41 ? 5.525   6.993   6.322   1.00 0.00 ? 41 SER A HG   10 
ATOM 11027 N N    . ALA A 1 42 ? 6.044   8.234   2.418   1.00 0.00 ? 42 ALA A N    10 
ATOM 11028 C CA   . ALA A 1 42 ? 6.187   9.649   2.094   1.00 0.00 ? 42 ALA A CA   10 
ATOM 11029 C C    . ALA A 1 42 ? 5.057   10.121  1.186   1.00 0.00 ? 42 ALA A C    10 
ATOM 11030 O O    . ALA A 1 42 ? 4.600   11.259  1.288   1.00 0.00 ? 42 ALA A O    10 
ATOM 11031 C CB   . ALA A 1 42 ? 7.536   9.907   1.439   1.00 0.00 ? 42 ALA A CB   10 
ATOM 11032 H H    . ALA A 1 42 ? 6.561   7.574   1.911   1.00 0.00 ? 42 ALA A H    10 
ATOM 11033 H HA   . ALA A 1 42 ? 6.150   10.208  3.018   1.00 0.00 ? 42 ALA A HA   10 
ATOM 11034 H HB1  . ALA A 1 42 ? 7.415   10.623  0.640   1.00 0.00 ? 42 ALA A HB1  10 
ATOM 11035 H HB2  . ALA A 1 42 ? 8.224   10.298  2.174   1.00 0.00 ? 42 ALA A HB2  10 
ATOM 11036 H HB3  . ALA A 1 42 ? 7.924   8.982   1.039   1.00 0.00 ? 42 ALA A HB3  10 
ATOM 11037 N N    . ALA A 1 43 ? 4.610   9.239   0.298   1.00 0.00 ? 43 ALA A N    10 
ATOM 11038 C CA   . ALA A 1 43 ? 3.532   9.565   -0.627  1.00 0.00 ? 43 ALA A CA   10 
ATOM 11039 C C    . ALA A 1 43 ? 2.172   9.448   0.051   1.00 0.00 ? 43 ALA A C    10 
ATOM 11040 O O    . ALA A 1 43 ? 1.430   10.426  0.153   1.00 0.00 ? 43 ALA A O    10 
ATOM 11041 C CB   . ALA A 1 43 ? 3.594   8.662   -1.850  1.00 0.00 ? 43 ALA A CB   10 
ATOM 11042 H H    . ALA A 1 43 ? 5.014   8.347   0.265   1.00 0.00 ? 43 ALA A H    10 
ATOM 11043 H HA   . ALA A 1 43 ? 3.672   10.585  -0.956  1.00 0.00 ? 43 ALA A HA   10 
ATOM 11044 H HB1  . ALA A 1 43 ? 3.757   9.263   -2.733  1.00 0.00 ? 43 ALA A HB1  10 
ATOM 11045 H HB2  . ALA A 1 43 ? 4.406   7.959   -1.737  1.00 0.00 ? 43 ALA A HB2  10 
ATOM 11046 H HB3  . ALA A 1 43 ? 2.663   8.124   -1.947  1.00 0.00 ? 43 ALA A HB3  10 
ATOM 11047 N N    . THR A 1 44 ? 1.848   8.244   0.515   1.00 0.00 ? 44 THR A N    10 
ATOM 11048 C CA   . THR A 1 44 ? 0.576   7.999   1.182   1.00 0.00 ? 44 THR A CA   10 
ATOM 11049 C C    . THR A 1 44 ? 0.547   8.642   2.563   1.00 0.00 ? 44 THR A C    10 
ATOM 11050 O O    . THR A 1 44 ? -0.503  8.717   3.202   1.00 0.00 ? 44 THR A O    10 
ATOM 11051 C CB   . THR A 1 44 ? 0.299   6.490   1.325   1.00 0.00 ? 44 THR A CB   10 
ATOM 11052 O OG1  . THR A 1 44 ? 1.210   5.912   2.266   1.00 0.00 ? 44 THR A OG1  10 
ATOM 11053 C CG2  . THR A 1 44 ? 0.433   5.786   -0.017  1.00 0.00 ? 44 THR A CG2  10 
ATOM 11054 H H    . THR A 1 44 ? 2.482   7.505   0.403   1.00 0.00 ? 44 THR A H    10 
ATOM 11055 H HA   . THR A 1 44 ? -0.207  8.432   0.577   1.00 0.00 ? 44 THR A HA   10 
ATOM 11056 H HB   . THR A 1 44 ? -0.711  6.358   1.685   1.00 0.00 ? 44 THR A HB   10 
ATOM 11057 H HG1  . THR A 1 44 ? 1.340   4.984   2.057   1.00 0.00 ? 44 THR A HG1  10 
ATOM 11058 H HG21 . THR A 1 44 ? 1.395   6.015   -0.450  1.00 0.00 ? 44 THR A HG21 10 
ATOM 11059 H HG22 . THR A 1 44 ? -0.350  6.123   -0.680  1.00 0.00 ? 44 THR A HG22 10 
ATOM 11060 H HG23 . THR A 1 44 ? 0.349   4.719   0.127   1.00 0.00 ? 44 THR A HG23 10 
ATOM 11061 N N    . SER A 1 45 ? 1.705   9.107   3.020   1.00 0.00 ? 45 SER A N    10 
ATOM 11062 C CA   . SER A 1 45 ? 1.813   9.742   4.328   1.00 0.00 ? 45 SER A CA   10 
ATOM 11063 C C    . SER A 1 45 ? 1.474   8.755   5.440   1.00 0.00 ? 45 SER A C    10 
ATOM 11064 O O    . SER A 1 45 ? 1.004   9.144   6.511   1.00 0.00 ? 45 SER A O    10 
ATOM 11065 C CB   . SER A 1 45 ? 0.884   10.955  4.407   1.00 0.00 ? 45 SER A CB   10 
ATOM 11066 O OG   . SER A 1 45 ? 0.885   11.679  3.188   1.00 0.00 ? 45 SER A OG   10 
ATOM 11067 H H    . SER A 1 45 ? 2.508   9.018   2.464   1.00 0.00 ? 45 SER A H    10 
ATOM 11068 H HA   . SER A 1 45 ? 2.833   10.072  4.454   1.00 0.00 ? 45 SER A HA   10 
ATOM 11069 H HB2  . SER A 1 45 ? -0.122  10.623  4.613   1.00 0.00 ? 45 SER A HB2  10 
ATOM 11070 H HB3  . SER A 1 45 ? 1.217   11.609  5.200   1.00 0.00 ? 45 SER A HB3  10 
ATOM 11071 H HG   . SER A 1 45 ? 0.032   12.102  3.066   1.00 0.00 ? 45 SER A HG   10 
ATOM 11072 N N    . LEU A 1 46 ? 1.715   7.475   5.180   1.00 0.00 ? 46 LEU A N    10 
ATOM 11073 C CA   . LEU A 1 46 ? 1.436   6.429   6.159   1.00 0.00 ? 46 LEU A CA   10 
ATOM 11074 C C    . LEU A 1 46 ? 2.708   6.014   6.890   1.00 0.00 ? 46 LEU A C    10 
ATOM 11075 O O    . LEU A 1 46 ? 3.807   6.445   6.539   1.00 0.00 ? 46 LEU A O    10 
ATOM 11076 C CB   . LEU A 1 46 ? 0.810   5.214   5.472   1.00 0.00 ? 46 LEU A CB   10 
ATOM 11077 C CG   . LEU A 1 46 ? -0.604  5.408   4.923   1.00 0.00 ? 46 LEU A CG   10 
ATOM 11078 C CD1  . LEU A 1 46 ? -0.868  4.446   3.776   1.00 0.00 ? 46 LEU A CD1  10 
ATOM 11079 C CD2  . LEU A 1 46 ? -1.635  5.220   6.027   1.00 0.00 ? 46 LEU A CD2  10 
ATOM 11080 H H    . LEU A 1 46 ? 2.089   7.225   4.310   1.00 0.00 ? 46 LEU A H    10 
ATOM 11081 H HA   . LEU A 1 46 ? 0.735   6.827   6.878   1.00 0.00 ? 46 LEU A HA   10 
ATOM 11082 H HB2  . LEU A 1 46 ? 1.448   4.935   4.648   1.00 0.00 ? 46 LEU A HB2  10 
ATOM 11083 H HB3  . LEU A 1 46 ? 0.779   4.408   6.191   1.00 0.00 ? 46 LEU A HB3  10 
ATOM 11084 H HG   . LEU A 1 46 ? -0.701  6.415   4.542   1.00 0.00 ? 46 LEU A HG   10 
ATOM 11085 H HD11 . LEU A 1 46 ? 0.072   4.099   3.373   1.00 0.00 ? 46 LEU A HD11 10 
ATOM 11086 H HD12 . LEU A 1 46 ? -1.426  4.952   3.002   1.00 0.00 ? 46 LEU A HD12 10 
ATOM 11087 H HD13 . LEU A 1 46 ? -1.439  3.603   4.137   1.00 0.00 ? 46 LEU A HD13 10 
ATOM 11088 H HD21 . LEU A 1 46 ? -1.662  6.104   6.647   1.00 0.00 ? 46 LEU A HD21 10 
ATOM 11089 H HD22 . LEU A 1 46 ? -1.365  4.366   6.630   1.00 0.00 ? 46 LEU A HD22 10 
ATOM 11090 H HD23 . LEU A 1 46 ? -2.608  5.058   5.587   1.00 0.00 ? 46 LEU A HD23 10 
ATOM 11091 N N    . SER A 1 47 ? 2.553   5.174   7.908   1.00 0.00 ? 47 SER A N    10 
ATOM 11092 C CA   . SER A 1 47 ? 3.689   4.701   8.690   1.00 0.00 ? 47 SER A CA   10 
ATOM 11093 C C    . SER A 1 47 ? 4.254   3.412   8.103   1.00 0.00 ? 47 SER A C    10 
ATOM 11094 O O    . SER A 1 47 ? 3.528   2.621   7.503   1.00 0.00 ? 47 SER A O    10 
ATOM 11095 C CB   . SER A 1 47 ? 3.274   4.474   10.145  1.00 0.00 ? 47 SER A CB   10 
ATOM 11096 O OG   . SER A 1 47 ? 4.345   4.752   11.030  1.00 0.00 ? 47 SER A OG   10 
ATOM 11097 H H    . SER A 1 47 ? 1.651   4.866   8.140   1.00 0.00 ? 47 SER A H    10 
ATOM 11098 H HA   . SER A 1 47 ? 4.453   5.463   8.658   1.00 0.00 ? 47 SER A HA   10 
ATOM 11099 H HB2  . SER A 1 47 ? 2.446   5.122   10.386  1.00 0.00 ? 47 SER A HB2  10 
ATOM 11100 H HB3  . SER A 1 47 ? 2.975   3.444   10.274  1.00 0.00 ? 47 SER A HB3  10 
ATOM 11101 H HG   . SER A 1 47 ? 4.061   5.393   11.686  1.00 0.00 ? 47 SER A HG   10 
ATOM 11102 N N    . GLU A 1 48 ? 5.556   3.209   8.281   1.00 0.00 ? 48 GLU A N    10 
ATOM 11103 C CA   . GLU A 1 48 ? 6.220   2.016   7.768   1.00 0.00 ? 48 GLU A CA   10 
ATOM 11104 C C    . GLU A 1 48 ? 5.488   0.753   8.212   1.00 0.00 ? 48 GLU A C    10 
ATOM 11105 O O    . GLU A 1 48 ? 5.439   -0.238  7.483   1.00 0.00 ? 48 GLU A O    10 
ATOM 11106 C CB   . GLU A 1 48 ? 7.673   1.970   8.243   1.00 0.00 ? 48 GLU A CB   10 
ATOM 11107 C CG   . GLU A 1 48 ? 8.434   3.262   8.000   1.00 0.00 ? 48 GLU A CG   10 
ATOM 11108 C CD   . GLU A 1 48 ? 9.915   3.133   8.302   1.00 0.00 ? 48 GLU A CD   10 
ATOM 11109 O OE1  . GLU A 1 48 ? 10.664  2.682   7.410   1.00 0.00 ? 48 GLU A OE1  10 
ATOM 11110 O OE2  . GLU A 1 48 ? 10.324  3.482   9.428   1.00 0.00 ? 48 GLU A OE2  10 
ATOM 11111 H H    . GLU A 1 48 ? 6.082   3.877   8.768   1.00 0.00 ? 48 GLU A H    10 
ATOM 11112 H HA   . GLU A 1 48 ? 6.204   2.066   6.690   1.00 0.00 ? 48 GLU A HA   10 
ATOM 11113 H HB2  . GLU A 1 48 ? 7.687   1.762   9.303   1.00 0.00 ? 48 GLU A HB2  10 
ATOM 11114 H HB3  . GLU A 1 48 ? 8.184   1.173   7.723   1.00 0.00 ? 48 GLU A HB3  10 
ATOM 11115 H HG2  . GLU A 1 48 ? 8.317   3.545   6.964   1.00 0.00 ? 48 GLU A HG2  10 
ATOM 11116 H HG3  . GLU A 1 48 ? 8.019   4.034   8.631   1.00 0.00 ? 48 GLU A HG3  10 
ATOM 11117 N N    . ARG A 1 49 ? 4.920   0.796   9.414   1.00 0.00 ? 49 ARG A N    10 
ATOM 11118 C CA   . ARG A 1 49 ? 4.193   -0.345  9.956   1.00 0.00 ? 49 ARG A CA   10 
ATOM 11119 C C    . ARG A 1 49 ? 2.842   -0.508  9.264   1.00 0.00 ? 49 ARG A C    10 
ATOM 11120 O O    . ARG A 1 49 ? 2.454   -1.615  8.894   1.00 0.00 ? 49 ARG A O    10 
ATOM 11121 C CB   . ARG A 1 49 ? 3.988   -0.176  11.463  1.00 0.00 ? 49 ARG A CB   10 
ATOM 11122 C CG   . ARG A 1 49 ? 3.693   -1.480  12.187  1.00 0.00 ? 49 ARG A CG   10 
ATOM 11123 C CD   . ARG A 1 49 ? 4.935   -2.351  12.294  1.00 0.00 ? 49 ARG A CD   10 
ATOM 11124 N NE   . ARG A 1 49 ? 5.853   -1.871  13.324  1.00 0.00 ? 49 ARG A NE   10 
ATOM 11125 C CZ   . ARG A 1 49 ? 7.052   -2.399  13.543  1.00 0.00 ? 49 ARG A CZ   10 
ATOM 11126 N NH1  . ARG A 1 49 ? 7.477   -3.417  12.808  1.00 0.00 ? 49 ARG A NH1  10 
ATOM 11127 N NH2  . ARG A 1 49 ? 7.830   -1.907  14.499  1.00 0.00 ? 49 ARG A NH2  10 
ATOM 11128 H H    . ARG A 1 49 ? 4.994   1.614   9.948   1.00 0.00 ? 49 ARG A H    10 
ATOM 11129 H HA   . ARG A 1 49 ? 4.784   -1.231  9.779   1.00 0.00 ? 49 ARG A HA   10 
ATOM 11130 H HB2  . ARG A 1 49 ? 4.883   0.253   11.890  1.00 0.00 ? 49 ARG A HB2  10 
ATOM 11131 H HB3  . ARG A 1 49 ? 3.161   0.497   11.629  1.00 0.00 ? 49 ARG A HB3  10 
ATOM 11132 H HG2  . ARG A 1 49 ? 3.338   -1.256  13.182  1.00 0.00 ? 49 ARG A HG2  10 
ATOM 11133 H HG3  . ARG A 1 49 ? 2.932   -2.019  11.643  1.00 0.00 ? 49 ARG A HG3  10 
ATOM 11134 H HD2  . ARG A 1 49 ? 4.632   -3.359  12.537  1.00 0.00 ? 49 ARG A HD2  10 
ATOM 11135 H HD3  . ARG A 1 49 ? 5.444   -2.348  11.342  1.00 0.00 ? 49 ARG A HD3  10 
ATOM 11136 H HE   . ARG A 1 49 ? 5.559   -1.120  13.879  1.00 0.00 ? 49 ARG A HE   10 
ATOM 11137 H HH11 . ARG A 1 49 ? 6.893   -3.789  12.086  1.00 0.00 ? 49 ARG A HH11 10 
ATOM 11138 H HH12 . ARG A 1 49 ? 8.381   -3.811  12.974  1.00 0.00 ? 49 ARG A HH12 10 
ATOM 11139 H HH21 . ARG A 1 49 ? 7.514   -1.139  15.055  1.00 0.00 ? 49 ARG A HH21 10 
ATOM 11140 H HH22 . ARG A 1 49 ? 8.732   -2.304  14.663  1.00 0.00 ? 49 ARG A HH22 10 
ATOM 11141 N N    . GLN A 1 50 ? 2.133   0.603   9.093   1.00 0.00 ? 50 GLN A N    10 
ATOM 11142 C CA   . GLN A 1 50 ? 0.826   0.582   8.447   1.00 0.00 ? 50 GLN A CA   10 
ATOM 11143 C C    . GLN A 1 50 ? 0.920   -0.018  7.048   1.00 0.00 ? 50 GLN A C    10 
ATOM 11144 O O    . GLN A 1 50 ? 0.113   -0.869  6.672   1.00 0.00 ? 50 GLN A O    10 
ATOM 11145 C CB   . GLN A 1 50 ? 0.250   1.997   8.369   1.00 0.00 ? 50 GLN A CB   10 
ATOM 11146 C CG   . GLN A 1 50 ? -0.204  2.544   9.713   1.00 0.00 ? 50 GLN A CG   10 
ATOM 11147 C CD   . GLN A 1 50 ? -1.347  3.532   9.586   1.00 0.00 ? 50 GLN A CD   10 
ATOM 11148 O OE1  . GLN A 1 50 ? -1.170  4.733   9.788   1.00 0.00 ? 50 GLN A OE1  10 
ATOM 11149 N NE2  . GLN A 1 50 ? -2.529  3.029   9.249   1.00 0.00 ? 50 GLN A NE2  10 
ATOM 11150 H H    . GLN A 1 50 ? 2.496   1.456   9.410   1.00 0.00 ? 50 GLN A H    10 
ATOM 11151 H HA   . GLN A 1 50 ? 0.170   -0.031  9.045   1.00 0.00 ? 50 GLN A HA   10 
ATOM 11152 H HB2  . GLN A 1 50 ? 1.004   2.659   7.971   1.00 0.00 ? 50 GLN A HB2  10 
ATOM 11153 H HB3  . GLN A 1 50 ? -0.600  1.991   7.703   1.00 0.00 ? 50 GLN A HB3  10 
ATOM 11154 H HG2  . GLN A 1 50 ? -0.528  1.720   10.332  1.00 0.00 ? 50 GLN A HG2  10 
ATOM 11155 H HG3  . GLN A 1 50 ? 0.631   3.040   10.186  1.00 0.00 ? 50 GLN A HG3  10 
ATOM 11156 H HE21 . GLN A 1 50 ? -2.596  2.062   9.104   1.00 0.00 ? 50 GLN A HE21 10 
ATOM 11157 H HE22 . GLN A 1 50 ? -3.285  3.645   9.160   1.00 0.00 ? 50 GLN A HE22 10 
ATOM 11158 N N    . ILE A 1 51 ? 1.910   0.429   6.283   1.00 0.00 ? 51 ILE A N    10 
ATOM 11159 C CA   . ILE A 1 51 ? 2.109   -0.065  4.926   1.00 0.00 ? 51 ILE A CA   10 
ATOM 11160 C C    . ILE A 1 51 ? 2.412   -1.560  4.925   1.00 0.00 ? 51 ILE A C    10 
ATOM 11161 O O    . ILE A 1 51 ? 1.927   -2.303  4.071   1.00 0.00 ? 51 ILE A O    10 
ATOM 11162 C CB   . ILE A 1 51 ? 3.255   0.680   4.218   1.00 0.00 ? 51 ILE A CB   10 
ATOM 11163 C CG1  . ILE A 1 51 ? 2.951   2.178   4.146   1.00 0.00 ? 51 ILE A CG1  10 
ATOM 11164 C CG2  . ILE A 1 51 ? 3.476   0.112   2.824   1.00 0.00 ? 51 ILE A CG2  10 
ATOM 11165 C CD1  . ILE A 1 51 ? 4.139   3.017   3.729   1.00 0.00 ? 51 ILE A CD1  10 
ATOM 11166 H H    . ILE A 1 51 ? 2.521   1.107   6.639   1.00 0.00 ? 51 ILE A H    10 
ATOM 11167 H HA   . ILE A 1 51 ? 1.197   0.107   4.372   1.00 0.00 ? 51 ILE A HA   10 
ATOM 11168 H HB   . ILE A 1 51 ? 4.159   0.530   4.788   1.00 0.00 ? 51 ILE A HB   10 
ATOM 11169 H HG12 . ILE A 1 51 ? 2.161   2.345   3.431   1.00 0.00 ? 51 ILE A HG12 10 
ATOM 11170 H HG13 . ILE A 1 51 ? 2.628   2.519   5.119   1.00 0.00 ? 51 ILE A HG13 10 
ATOM 11171 H HG21 . ILE A 1 51 ? 3.490   0.917   2.105   1.00 0.00 ? 51 ILE A HG21 10 
ATOM 11172 H HG22 . ILE A 1 51 ? 4.419   -0.413  2.795   1.00 0.00 ? 51 ILE A HG22 10 
ATOM 11173 H HG23 . ILE A 1 51 ? 2.675   -0.572  2.583   1.00 0.00 ? 51 ILE A HG23 10 
ATOM 11174 H HD11 . ILE A 1 51 ? 3.793   3.899   3.212   1.00 0.00 ? 51 ILE A HD11 10 
ATOM 11175 H HD12 . ILE A 1 51 ? 4.700   3.308   4.605   1.00 0.00 ? 51 ILE A HD12 10 
ATOM 11176 H HD13 . ILE A 1 51 ? 4.773   2.440   3.071   1.00 0.00 ? 51 ILE A HD13 10 
ATOM 11177 N N    . THR A 1 52 ? 3.218   -1.996  5.888   1.00 0.00 ? 52 THR A N    10 
ATOM 11178 C CA   . THR A 1 52 ? 3.586   -3.402  6.000   1.00 0.00 ? 52 THR A CA   10 
ATOM 11179 C C    . THR A 1 52 ? 2.367   -4.267  6.298   1.00 0.00 ? 52 THR A C    10 
ATOM 11180 O O    . THR A 1 52 ? 2.097   -5.239  5.592   1.00 0.00 ? 52 THR A O    10 
ATOM 11181 C CB   . THR A 1 52 ? 4.639   -3.621  7.102   1.00 0.00 ? 52 THR A CB   10 
ATOM 11182 O OG1  . THR A 1 52 ? 5.824   -2.875  6.803   1.00 0.00 ? 52 THR A OG1  10 
ATOM 11183 C CG2  . THR A 1 52 ? 4.983   -5.097  7.235   1.00 0.00 ? 52 THR A CG2  10 
ATOM 11184 H H    . THR A 1 52 ? 3.573   -1.355  6.539   1.00 0.00 ? 52 THR A H    10 
ATOM 11185 H HA   . THR A 1 52 ? 4.012   -3.710  5.056   1.00 0.00 ? 52 THR A HA   10 
ATOM 11186 H HB   . THR A 1 52 ? 4.232   -3.275  8.041   1.00 0.00 ? 52 THR A HB   10 
ATOM 11187 H HG1  . THR A 1 52 ? 6.236   -2.588  7.621   1.00 0.00 ? 52 THR A HG1  10 
ATOM 11188 H HG21 . THR A 1 52 ? 5.859   -5.208  7.858   1.00 0.00 ? 52 THR A HG21 10 
ATOM 11189 H HG22 . THR A 1 52 ? 5.182   -5.510  6.257   1.00 0.00 ? 52 THR A HG22 10 
ATOM 11190 H HG23 . THR A 1 52 ? 4.153   -5.621  7.685   1.00 0.00 ? 52 THR A HG23 10 
ATOM 11191 N N    . ILE A 1 53 ? 1.634   -3.907  7.346   1.00 0.00 ? 53 ILE A N    10 
ATOM 11192 C CA   . ILE A 1 53 ? 0.442   -4.651  7.735   1.00 0.00 ? 53 ILE A CA   10 
ATOM 11193 C C    . ILE A 1 53 ? -0.504  -4.831  6.553   1.00 0.00 ? 53 ILE A C    10 
ATOM 11194 O O    . ILE A 1 53 ? -0.930  -5.946  6.250   1.00 0.00 ? 53 ILE A O    10 
ATOM 11195 C CB   . ILE A 1 53 ? -0.312  -3.947  8.879   1.00 0.00 ? 53 ILE A CB   10 
ATOM 11196 C CG1  . ILE A 1 53 ? 0.597   -3.795  10.100  1.00 0.00 ? 53 ILE A CG1  10 
ATOM 11197 C CG2  . ILE A 1 53 ? -1.569  -4.723  9.241   1.00 0.00 ? 53 ILE A CG2  10 
ATOM 11198 C CD1  . ILE A 1 53 ? 0.162   -2.696  11.044  1.00 0.00 ? 53 ILE A CD1  10 
ATOM 11199 H H    . ILE A 1 53 ? 1.900   -3.123  7.869   1.00 0.00 ? 53 ILE A H    10 
ATOM 11200 H HA   . ILE A 1 53 ? 0.756   -5.625  8.083   1.00 0.00 ? 53 ILE A HA   10 
ATOM 11201 H HB   . ILE A 1 53 ? -0.609  -2.968  8.536   1.00 0.00 ? 53 ILE A HB   10 
ATOM 11202 H HG12 . ILE A 1 53 ? 0.606   -4.721  10.653  1.00 0.00 ? 53 ILE A HG12 10 
ATOM 11203 H HG13 . ILE A 1 53 ? 1.600   -3.570  9.767   1.00 0.00 ? 53 ILE A HG13 10 
ATOM 11204 H HG21 . ILE A 1 53 ? -2.285  -4.645  8.436   1.00 0.00 ? 53 ILE A HG21 10 
ATOM 11205 H HG22 . ILE A 1 53 ? -1.318  -5.762  9.398   1.00 0.00 ? 53 ILE A HG22 10 
ATOM 11206 H HG23 . ILE A 1 53 ? -1.997  -4.316  10.144  1.00 0.00 ? 53 ILE A HG23 10 
ATOM 11207 H HD11 . ILE A 1 53 ? 0.799   -2.697  11.917  1.00 0.00 ? 53 ILE A HD11 10 
ATOM 11208 H HD12 . ILE A 1 53 ? 0.235   -1.742  10.545  1.00 0.00 ? 53 ILE A HD12 10 
ATOM 11209 H HD13 . ILE A 1 53 ? -0.862  -2.866  11.347  1.00 0.00 ? 53 ILE A HD13 10 
ATOM 11210 N N    . TRP A 1 54 ? -0.828  -3.728  5.888   1.00 0.00 ? 54 TRP A N    10 
ATOM 11211 C CA   . TRP A 1 54 ? -1.723  -3.765  4.737   1.00 0.00 ? 54 TRP A CA   10 
ATOM 11212 C C    . TRP A 1 54 ? -1.214  -4.741  3.682   1.00 0.00 ? 54 TRP A C    10 
ATOM 11213 O O    . TRP A 1 54 ? -1.996  -5.449  3.049   1.00 0.00 ? 54 TRP A O    10 
ATOM 11214 C CB   . TRP A 1 54 ? -1.865  -2.367  4.131   1.00 0.00 ? 54 TRP A CB   10 
ATOM 11215 C CG   . TRP A 1 54 ? -2.910  -2.288  3.060   1.00 0.00 ? 54 TRP A CG   10 
ATOM 11216 C CD1  . TRP A 1 54 ? -4.179  -1.798  3.188   1.00 0.00 ? 54 TRP A CD1  10 
ATOM 11217 C CD2  . TRP A 1 54 ? -2.777  -2.713  1.699   1.00 0.00 ? 54 TRP A CD2  10 
ATOM 11218 N NE1  . TRP A 1 54 ? -4.842  -1.893  1.988   1.00 0.00 ? 54 TRP A NE1  10 
ATOM 11219 C CE2  . TRP A 1 54 ? -4.004  -2.450  1.059   1.00 0.00 ? 54 TRP A CE2  10 
ATOM 11220 C CE3  . TRP A 1 54 ? -1.741  -3.289  0.959   1.00 0.00 ? 54 TRP A CE3  10 
ATOM 11221 C CZ2  . TRP A 1 54 ? -4.220  -2.744  -0.285  1.00 0.00 ? 54 TRP A CZ2  10 
ATOM 11222 C CZ3  . TRP A 1 54 ? -1.957  -3.580  -0.374  1.00 0.00 ? 54 TRP A CZ3  10 
ATOM 11223 C CH2  . TRP A 1 54 ? -3.188  -3.308  -0.985  1.00 0.00 ? 54 TRP A CH2  10 
ATOM 11224 H H    . TRP A 1 54 ? -0.457  -2.868  6.178   1.00 0.00 ? 54 TRP A H    10 
ATOM 11225 H HA   . TRP A 1 54 ? -2.691  -4.098  5.082   1.00 0.00 ? 54 TRP A HA   10 
ATOM 11226 H HB2  . TRP A 1 54 ? -2.132  -1.669  4.910   1.00 0.00 ? 54 TRP A HB2  10 
ATOM 11227 H HB3  . TRP A 1 54 ? -0.920  -2.074  3.698   1.00 0.00 ? 54 TRP A HB3  10 
ATOM 11228 H HD1  . TRP A 1 54 ? -4.587  -1.399  4.104   1.00 0.00 ? 54 TRP A HD1  10 
ATOM 11229 H HE1  . TRP A 1 54 ? -5.765  -1.606  1.825   1.00 0.00 ? 54 TRP A HE1  10 
ATOM 11230 H HE3  . TRP A 1 54 ? -0.785  -3.506  1.412   1.00 0.00 ? 54 TRP A HE3  10 
ATOM 11231 H HZ2  . TRP A 1 54 ? -5.163  -2.540  -0.770  1.00 0.00 ? 54 TRP A HZ2  10 
ATOM 11232 H HZ3  . TRP A 1 54 ? -1.168  -4.026  -0.962  1.00 0.00 ? 54 TRP A HZ3  10 
ATOM 11233 H HH2  . TRP A 1 54 ? -3.313  -3.552  -2.029  1.00 0.00 ? 54 TRP A HH2  10 
ATOM 11234 N N    . PHE A 1 55 ? 0.102   -4.773  3.499   1.00 0.00 ? 55 PHE A N    10 
ATOM 11235 C CA   . PHE A 1 55 ? 0.715   -5.663  2.520   1.00 0.00 ? 55 PHE A CA   10 
ATOM 11236 C C    . PHE A 1 55 ? 0.658   -7.113  2.991   1.00 0.00 ? 55 PHE A C    10 
ATOM 11237 O O    . PHE A 1 55 ? 0.703   -8.041  2.184   1.00 0.00 ? 55 PHE A O    10 
ATOM 11238 C CB   . PHE A 1 55 ? 2.168   -5.254  2.267   1.00 0.00 ? 55 PHE A CB   10 
ATOM 11239 C CG   . PHE A 1 55 ? 2.339   -4.354  1.076   1.00 0.00 ? 55 PHE A CG   10 
ATOM 11240 C CD1  . PHE A 1 55 ? 1.756   -3.097  1.052   1.00 0.00 ? 55 PHE A CD1  10 
ATOM 11241 C CD2  . PHE A 1 55 ? 3.082   -4.765  -0.019  1.00 0.00 ? 55 PHE A CD2  10 
ATOM 11242 C CE1  . PHE A 1 55 ? 1.911   -2.268  -0.043  1.00 0.00 ? 55 PHE A CE1  10 
ATOM 11243 C CE2  . PHE A 1 55 ? 3.241   -3.940  -1.116  1.00 0.00 ? 55 PHE A CE2  10 
ATOM 11244 C CZ   . PHE A 1 55 ? 2.655   -2.689  -1.128  1.00 0.00 ? 55 PHE A CZ   10 
ATOM 11245 H H    . PHE A 1 55 ? 0.674   -4.184  4.034   1.00 0.00 ? 55 PHE A H    10 
ATOM 11246 H HA   . PHE A 1 55 ? 0.160   -5.574  1.599   1.00 0.00 ? 55 PHE A HA   10 
ATOM 11247 H HB2  . PHE A 1 55 ? 2.543   -4.730  3.133   1.00 0.00 ? 55 PHE A HB2  10 
ATOM 11248 H HB3  . PHE A 1 55 ? 2.760   -6.141  2.102   1.00 0.00 ? 55 PHE A HB3  10 
ATOM 11249 H HD1  . PHE A 1 55 ? 1.175   -2.765  1.899   1.00 0.00 ? 55 PHE A HD1  10 
ATOM 11250 H HD2  . PHE A 1 55 ? 3.541   -5.744  -0.010  1.00 0.00 ? 55 PHE A HD2  10 
ATOM 11251 H HE1  . PHE A 1 55 ? 1.453   -1.290  -0.050  1.00 0.00 ? 55 PHE A HE1  10 
ATOM 11252 H HE2  . PHE A 1 55 ? 3.823   -4.273  -1.963  1.00 0.00 ? 55 PHE A HE2  10 
ATOM 11253 H HZ   . PHE A 1 55 ? 2.777   -2.043  -1.984  1.00 0.00 ? 55 PHE A HZ   10 
ATOM 11254 N N    . GLN A 1 56 ? 0.560   -7.299  4.304   1.00 0.00 ? 56 GLN A N    10 
ATOM 11255 C CA   . GLN A 1 56 ? 0.499   -8.635  4.883   1.00 0.00 ? 56 GLN A CA   10 
ATOM 11256 C C    . GLN A 1 56 ? -0.902  -9.223  4.747   1.00 0.00 ? 56 GLN A C    10 
ATOM 11257 O O    . GLN A 1 56 ? -1.065  -10.381 4.363   1.00 0.00 ? 56 GLN A O    10 
ATOM 11258 C CB   . GLN A 1 56 ? 0.907   -8.595  6.356   1.00 0.00 ? 56 GLN A CB   10 
ATOM 11259 C CG   . GLN A 1 56 ? 2.411   -8.655  6.573   1.00 0.00 ? 56 GLN A CG   10 
ATOM 11260 C CD   . GLN A 1 56 ? 2.797   -9.541  7.741   1.00 0.00 ? 56 GLN A CD   10 
ATOM 11261 O OE1  . GLN A 1 56 ? 3.417   -10.589 7.561   1.00 0.00 ? 56 GLN A OE1  10 
ATOM 11262 N NE2  . GLN A 1 56 ? 2.432   -9.123  8.947   1.00 0.00 ? 56 GLN A NE2  10 
ATOM 11263 H H    . GLN A 1 56 ? 0.529   -6.519  4.896   1.00 0.00 ? 56 GLN A H    10 
ATOM 11264 H HA   . GLN A 1 56 ? 1.193   -9.262  4.344   1.00 0.00 ? 56 GLN A HA   10 
ATOM 11265 H HB2  . GLN A 1 56 ? 0.538   -7.680  6.795   1.00 0.00 ? 56 GLN A HB2  10 
ATOM 11266 H HB3  . GLN A 1 56 ? 0.458   -9.435  6.865   1.00 0.00 ? 56 GLN A HB3  10 
ATOM 11267 H HG2  . GLN A 1 56 ? 2.875   -9.042  5.679   1.00 0.00 ? 56 GLN A HG2  10 
ATOM 11268 H HG3  . GLN A 1 56 ? 2.774   -7.655  6.762   1.00 0.00 ? 56 GLN A HG3  10 
ATOM 11269 H HE21 . GLN A 1 56 ? 1.939   -8.278  9.015   1.00 0.00 ? 56 GLN A HE21 10 
ATOM 11270 H HE22 . GLN A 1 56 ? 2.668   -9.676  9.720   1.00 0.00 ? 56 GLN A HE22 10 
ATOM 11271 N N    . ASN A 1 57 ? -1.910  -8.418  5.066   1.00 0.00 ? 57 ASN A N    10 
ATOM 11272 C CA   . ASN A 1 57 ? -3.297  -8.859  4.980   1.00 0.00 ? 57 ASN A CA   10 
ATOM 11273 C C    . ASN A 1 57 ? -3.644  -9.291  3.559   1.00 0.00 ? 57 ASN A C    10 
ATOM 11274 O O    . ASN A 1 57 ? -4.592  -10.047 3.342   1.00 0.00 ? 57 ASN A O    10 
ATOM 11275 C CB   . ASN A 1 57 ? -4.239  -7.740  5.429   1.00 0.00 ? 57 ASN A CB   10 
ATOM 11276 C CG   . ASN A 1 57 ? -4.734  -7.936  6.849   1.00 0.00 ? 57 ASN A CG   10 
ATOM 11277 O OD1  . ASN A 1 57 ? -5.769  -8.562  7.077   1.00 0.00 ? 57 ASN A OD1  10 
ATOM 11278 N ND2  . ASN A 1 57 ? -3.994  -7.399  7.813   1.00 0.00 ? 57 ASN A ND2  10 
ATOM 11279 H H    . ASN A 1 57 ? -1.717  -7.505  5.366   1.00 0.00 ? 57 ASN A H    10 
ATOM 11280 H HA   . ASN A 1 57 ? -3.417  -9.705  5.640   1.00 0.00 ? 57 ASN A HA   10 
ATOM 11281 H HB2  . ASN A 1 57 ? -3.716  -6.796  5.378   1.00 0.00 ? 57 ASN A HB2  10 
ATOM 11282 H HB3  . ASN A 1 57 ? -5.094  -7.711  4.770   1.00 0.00 ? 57 ASN A HB3  10 
ATOM 11283 H HD21 . ASN A 1 57 ? -3.181  -6.914  7.557   1.00 0.00 ? 57 ASN A HD21 10 
ATOM 11284 H HD22 . ASN A 1 57 ? -4.290  -7.511  8.740   1.00 0.00 ? 57 ASN A HD22 10 
ATOM 11285 N N    . ARG A 1 58 ? -2.869  -8.807  2.593   1.00 0.00 ? 58 ARG A N    10 
ATOM 11286 C CA   . ARG A 1 58 ? -3.094  -9.142  1.193   1.00 0.00 ? 58 ARG A CA   10 
ATOM 11287 C C    . ARG A 1 58 ? -2.586  -10.547 0.881   1.00 0.00 ? 58 ARG A C    10 
ATOM 11288 O O    . ARG A 1 58 ? -3.313  -11.373 0.329   1.00 0.00 ? 58 ARG A O    10 
ATOM 11289 C CB   . ARG A 1 58 ? -2.402  -8.124  0.285   1.00 0.00 ? 58 ARG A CB   10 
ATOM 11290 C CG   . ARG A 1 58 ? -3.223  -7.738  -0.934  1.00 0.00 ? 58 ARG A CG   10 
ATOM 11291 C CD   . ARG A 1 58 ? -4.515  -7.042  -0.538  1.00 0.00 ? 58 ARG A CD   10 
ATOM 11292 N NE   . ARG A 1 58 ? -5.042  -6.209  -1.615  1.00 0.00 ? 58 ARG A NE   10 
ATOM 11293 C CZ   . ARG A 1 58 ? -6.308  -5.815  -1.688  1.00 0.00 ? 58 ARG A CZ   10 
ATOM 11294 N NH1  . ARG A 1 58 ? -7.173  -6.176  -0.750  1.00 0.00 ? 58 ARG A NH1  10 
ATOM 11295 N NH2  . ARG A 1 58 ? -6.712  -5.057  -2.700  1.00 0.00 ? 58 ARG A NH2  10 
ATOM 11296 H H    . ARG A 1 58 ? -2.129  -8.210  2.829   1.00 0.00 ? 58 ARG A H    10 
ATOM 11297 H HA   . ARG A 1 58 ? -4.158  -9.109  1.010   1.00 0.00 ? 58 ARG A HA   10 
ATOM 11298 H HB2  . ARG A 1 58 ? -2.201  -7.229  0.855   1.00 0.00 ? 58 ARG A HB2  10 
ATOM 11299 H HB3  . ARG A 1 58 ? -1.466  -8.542  -0.056  1.00 0.00 ? 58 ARG A HB3  10 
ATOM 11300 H HG2  . ARG A 1 58 ? -2.641  -7.068  -1.551  1.00 0.00 ? 58 ARG A HG2  10 
ATOM 11301 H HG3  . ARG A 1 58 ? -3.461  -8.630  -1.494  1.00 0.00 ? 58 ARG A HG3  10 
ATOM 11302 H HD2  . ARG A 1 58 ? -5.249  -7.793  -0.285  1.00 0.00 ? 58 ARG A HD2  10 
ATOM 11303 H HD3  . ARG A 1 58 ? -4.324  -6.421  0.325   1.00 0.00 ? 58 ARG A HD3  10 
ATOM 11304 H HE   . ARG A 1 58 ? -4.420  -5.930  -2.319  1.00 0.00 ? 58 ARG A HE   10 
ATOM 11305 H HH11 . ARG A 1 58 ? -6.872  -6.746  0.014   1.00 0.00 ? 58 ARG A HH11 10 
ATOM 11306 H HH12 . ARG A 1 58 ? -8.126  -5.877  -0.807  1.00 0.00 ? 58 ARG A HH12 10 
ATOM 11307 H HH21 . ARG A 1 58 ? -6.062  -4.783  -3.408  1.00 0.00 ? 58 ARG A HH21 10 
ATOM 11308 H HH22 . ARG A 1 58 ? -7.665  -4.761  -2.754  1.00 0.00 ? 58 ARG A HH22 10 
ATOM 11309 N N    . ARG A 1 59 ? -1.333  -10.809 1.238   1.00 0.00 ? 59 ARG A N    10 
ATOM 11310 C CA   . ARG A 1 59 ? -0.726  -12.113 0.995   1.00 0.00 ? 59 ARG A CA   10 
ATOM 11311 C C    . ARG A 1 59 ? -1.332  -13.173 1.910   1.00 0.00 ? 59 ARG A C    10 
ATOM 11312 O O    . ARG A 1 59 ? -1.544  -14.315 1.500   1.00 0.00 ? 59 ARG A O    10 
ATOM 11313 C CB   . ARG A 1 59 ? 0.787   -12.043 1.209   1.00 0.00 ? 59 ARG A CB   10 
ATOM 11314 C CG   . ARG A 1 59 ? 1.564   -11.688 -0.048  1.00 0.00 ? 59 ARG A CG   10 
ATOM 11315 C CD   . ARG A 1 59 ? 2.166   -12.924 -0.698  1.00 0.00 ? 59 ARG A CD   10 
ATOM 11316 N NE   . ARG A 1 59 ? 1.391   -13.367 -1.854  1.00 0.00 ? 59 ARG A NE   10 
ATOM 11317 C CZ   . ARG A 1 59 ? 1.753   -14.377 -2.638  1.00 0.00 ? 59 ARG A CZ   10 
ATOM 11318 N NH1  . ARG A 1 59 ? 2.870   -15.045 -2.390  1.00 0.00 ? 59 ARG A NH1  10 
ATOM 11319 N NH2  . ARG A 1 59 ? 0.994   -14.720 -3.671  1.00 0.00 ? 59 ARG A NH2  10 
ATOM 11320 H H    . ARG A 1 59 ? -0.803  -10.110 1.674   1.00 0.00 ? 59 ARG A H    10 
ATOM 11321 H HA   . ARG A 1 59 ? -0.924  -12.385 -0.031  1.00 0.00 ? 59 ARG A HA   10 
ATOM 11322 H HB2  . ARG A 1 59 ? 0.999   -11.295 1.959   1.00 0.00 ? 59 ARG A HB2  10 
ATOM 11323 H HB3  . ARG A 1 59 ? 1.133   -13.003 1.561   1.00 0.00 ? 59 ARG A HB3  10 
ATOM 11324 H HG2  . ARG A 1 59 ? 0.896   -11.215 -0.752  1.00 0.00 ? 59 ARG A HG2  10 
ATOM 11325 H HG3  . ARG A 1 59 ? 2.359   -11.005 0.212   1.00 0.00 ? 59 ARG A HG3  10 
ATOM 11326 H HD2  . ARG A 1 59 ? 3.171   -12.693 -1.018  1.00 0.00 ? 59 ARG A HD2  10 
ATOM 11327 H HD3  . ARG A 1 59 ? 2.194   -13.720 0.031   1.00 0.00 ? 59 ARG A HD3  10 
ATOM 11328 H HE   . ARG A 1 59 ? 0.562   -12.887 -2.056  1.00 0.00 ? 59 ARG A HE   10 
ATOM 11329 H HH11 . ARG A 1 59 ? 3.443   -14.789 -1.612  1.00 0.00 ? 59 ARG A HH11 10 
ATOM 11330 H HH12 . ARG A 1 59 ? 3.140   -15.806 -2.981  1.00 0.00 ? 59 ARG A HH12 10 
ATOM 11331 H HH21 . ARG A 1 59 ? 0.151   -14.219 -3.861  1.00 0.00 ? 59 ARG A HH21 10 
ATOM 11332 H HH22 . ARG A 1 59 ? 1.267   -15.480 -4.260  1.00 0.00 ? 59 ARG A HH22 10 
ATOM 11333 N N    . VAL A 1 60 ? -1.608  -12.788 3.152   1.00 0.00 ? 60 VAL A N    10 
ATOM 11334 C CA   . VAL A 1 60 ? -2.189  -13.705 4.125   1.00 0.00 ? 60 VAL A CA   10 
ATOM 11335 C C    . VAL A 1 60 ? -3.625  -14.061 3.756   1.00 0.00 ? 60 VAL A C    10 
ATOM 11336 O O    . VAL A 1 60 ? -4.149  -15.092 4.176   1.00 0.00 ? 60 VAL A O    10 
ATOM 11337 C CB   . VAL A 1 60 ? -2.170  -13.105 5.543   1.00 0.00 ? 60 VAL A CB   10 
ATOM 11338 C CG1  . VAL A 1 60 ? -2.818  -14.057 6.536   1.00 0.00 ? 60 VAL A CG1  10 
ATOM 11339 C CG2  . VAL A 1 60 ? -0.745  -12.774 5.962   1.00 0.00 ? 60 VAL A CG2  10 
ATOM 11340 H H    . VAL A 1 60 ? -1.417  -11.865 3.420   1.00 0.00 ? 60 VAL A H    10 
ATOM 11341 H HA   . VAL A 1 60 ? -1.595  -14.607 4.131   1.00 0.00 ? 60 VAL A HA   10 
ATOM 11342 H HB   . VAL A 1 60 ? -2.741  -12.188 5.532   1.00 0.00 ? 60 VAL A HB   10 
ATOM 11343 H HG11 . VAL A 1 60 ? -2.552  -15.074 6.286   1.00 0.00 ? 60 VAL A HG11 10 
ATOM 11344 H HG12 . VAL A 1 60 ? -2.473  -13.828 7.533   1.00 0.00 ? 60 VAL A HG12 10 
ATOM 11345 H HG13 . VAL A 1 60 ? -3.892  -13.946 6.492   1.00 0.00 ? 60 VAL A HG13 10 
ATOM 11346 H HG21 . VAL A 1 60 ? -0.674  -11.723 6.199   1.00 0.00 ? 60 VAL A HG21 10 
ATOM 11347 H HG22 . VAL A 1 60 ? -0.480  -13.358 6.832   1.00 0.00 ? 60 VAL A HG22 10 
ATOM 11348 H HG23 . VAL A 1 60 ? -0.068  -13.008 5.153   1.00 0.00 ? 60 VAL A HG23 10 
ATOM 11349 N N    . LYS A 1 61 ? -4.257  -13.200 2.965   1.00 0.00 ? 61 LYS A N    10 
ATOM 11350 C CA   . LYS A 1 61 ? -5.633  -13.422 2.536   1.00 0.00 ? 61 LYS A CA   10 
ATOM 11351 C C    . LYS A 1 61 ? -5.734  -14.663 1.655   1.00 0.00 ? 61 LYS A C    10 
ATOM 11352 O O    . LYS A 1 61 ? -6.477  -15.594 1.963   1.00 0.00 ? 61 LYS A O    10 
ATOM 11353 C CB   . LYS A 1 61 ? -6.156  -12.201 1.777   1.00 0.00 ? 61 LYS A CB   10 
ATOM 11354 C CG   . LYS A 1 61 ? -7.504  -12.427 1.115   1.00 0.00 ? 61 LYS A CG   10 
ATOM 11355 C CD   . LYS A 1 61 ? -7.985  -11.182 0.389   1.00 0.00 ? 61 LYS A CD   10 
ATOM 11356 C CE   . LYS A 1 61 ? -9.485  -11.226 0.141   1.00 0.00 ? 61 LYS A CE   10 
ATOM 11357 N NZ   . LYS A 1 61 ? -10.090 -9.865  0.161   1.00 0.00 ? 61 LYS A NZ   10 
ATOM 11358 H H    . LYS A 1 61 ? -3.786  -12.394 2.663   1.00 0.00 ? 61 LYS A H    10 
ATOM 11359 H HA   . LYS A 1 61 ? -6.236  -13.572 3.419   1.00 0.00 ? 61 LYS A HA   10 
ATOM 11360 H HB2  . LYS A 1 61 ? -6.251  -11.376 2.468   1.00 0.00 ? 61 LYS A HB2  10 
ATOM 11361 H HB3  . LYS A 1 61 ? -5.442  -11.936 1.010   1.00 0.00 ? 61 LYS A HB3  10 
ATOM 11362 H HG2  . LYS A 1 61 ? -7.414  -13.234 0.403   1.00 0.00 ? 61 LYS A HG2  10 
ATOM 11363 H HG3  . LYS A 1 61 ? -8.227  -12.693 1.873   1.00 0.00 ? 61 LYS A HG3  10 
ATOM 11364 H HD2  . LYS A 1 61 ? -7.756  -10.314 0.989   1.00 0.00 ? 61 LYS A HD2  10 
ATOM 11365 H HD3  . LYS A 1 61 ? -7.474  -11.110 -0.561  1.00 0.00 ? 61 LYS A HD3  10 
ATOM 11366 H HE2  . LYS A 1 61 ? -9.665  -11.676 -0.823  1.00 0.00 ? 61 LYS A HE2  10 
ATOM 11367 H HE3  . LYS A 1 61 ? -9.946  -11.827 0.911   1.00 0.00 ? 61 LYS A HE3  10 
ATOM 11368 H HZ1  . LYS A 1 61 ? -9.699  -9.312  0.951   1.00 0.00 ? 61 LYS A HZ1  10 
ATOM 11369 H HZ2  . LYS A 1 61 ? -11.121 -9.934  0.278   1.00 0.00 ? 61 LYS A HZ2  10 
ATOM 11370 H HZ3  . LYS A 1 61 ? -9.885  -9.370  -0.730  1.00 0.00 ? 61 LYS A HZ3  10 
ATOM 11371 N N    . GLU A 1 62 ? -4.981  -14.669 0.560   1.00 0.00 ? 62 GLU A N    10 
ATOM 11372 C CA   . GLU A 1 62 ? -4.986  -15.797 -0.364  1.00 0.00 ? 62 GLU A CA   10 
ATOM 11373 C C    . GLU A 1 62 ? -4.612  -17.090 0.353   1.00 0.00 ? 62 GLU A C    10 
ATOM 11374 O O    . GLU A 1 62 ? -5.005  -18.181 -0.061  1.00 0.00 ? 62 GLU A O    10 
ATOM 11375 C CB   . GLU A 1 62 ? -4.017  -15.542 -1.520  1.00 0.00 ? 62 GLU A CB   10 
ATOM 11376 C CG   . GLU A 1 62 ? -2.605  -15.209 -1.068  1.00 0.00 ? 62 GLU A CG   10 
ATOM 11377 C CD   . GLU A 1 62 ? -1.552  -15.668 -2.057  1.00 0.00 ? 62 GLU A CD   10 
ATOM 11378 O OE1  . GLU A 1 62 ? -1.850  -15.702 -3.269  1.00 0.00 ? 62 GLU A OE1  10 
ATOM 11379 O OE2  . GLU A 1 62 ? -0.428  -15.992 -1.619  1.00 0.00 ? 62 GLU A OE2  10 
ATOM 11380 H H    . GLU A 1 62 ? -4.409  -13.896 0.368   1.00 0.00 ? 62 GLU A H    10 
ATOM 11381 H HA   . GLU A 1 62 ? -5.986  -15.896 -0.761  1.00 0.00 ? 62 GLU A HA   10 
ATOM 11382 H HB2  . GLU A 1 62 ? -3.975  -16.426 -2.141  1.00 0.00 ? 62 GLU A HB2  10 
ATOM 11383 H HB3  . GLU A 1 62 ? -4.387  -14.717 -2.110  1.00 0.00 ? 62 GLU A HB3  10 
ATOM 11384 H HG2  . GLU A 1 62 ? -2.522  -14.139 -0.949  1.00 0.00 ? 62 GLU A HG2  10 
ATOM 11385 H HG3  . GLU A 1 62 ? -2.421  -15.691 -0.119  1.00 0.00 ? 62 GLU A HG3  10 
ATOM 11386 N N    . LYS A 1 63 ? -3.847  -16.961 1.432   1.00 0.00 ? 63 LYS A N    10 
ATOM 11387 C CA   . LYS A 1 63 ? -3.418  -18.117 2.210   1.00 0.00 ? 63 LYS A CA   10 
ATOM 11388 C C    . LYS A 1 63 ? -4.038  -18.096 3.604   1.00 0.00 ? 63 LYS A C    10 
ATOM 11389 O O    . LYS A 1 63 ? -3.429  -18.551 4.572   1.00 0.00 ? 63 LYS A O    10 
ATOM 11390 C CB   . LYS A 1 63 ? -1.892  -18.147 2.319   1.00 0.00 ? 63 LYS A CB   10 
ATOM 11391 C CG   . LYS A 1 63 ? -1.326  -17.071 3.229   1.00 0.00 ? 63 LYS A CG   10 
ATOM 11392 C CD   . LYS A 1 63 ? -0.562  -17.673 4.397   1.00 0.00 ? 63 LYS A CD   10 
ATOM 11393 C CE   . LYS A 1 63 ? -0.797  -16.890 5.680   1.00 0.00 ? 63 LYS A CE   10 
ATOM 11394 N NZ   . LYS A 1 63 ? 0.214   -17.219 6.723   1.00 0.00 ? 63 LYS A NZ   10 
ATOM 11395 H H    . LYS A 1 63 ? -3.565  -16.064 1.713   1.00 0.00 ? 63 LYS A H    10 
ATOM 11396 H HA   . LYS A 1 63 ? -3.751  -19.005 1.695   1.00 0.00 ? 63 LYS A HA   10 
ATOM 11397 H HB2  . LYS A 1 63 ? -1.589  -19.110 2.703   1.00 0.00 ? 63 LYS A HB2  10 
ATOM 11398 H HB3  . LYS A 1 63 ? -1.470  -18.013 1.333   1.00 0.00 ? 63 LYS A HB3  10 
ATOM 11399 H HG2  . LYS A 1 63 ? -0.656  -16.445 2.659   1.00 0.00 ? 63 LYS A HG2  10 
ATOM 11400 H HG3  . LYS A 1 63 ? -2.141  -16.473 3.614   1.00 0.00 ? 63 LYS A HG3  10 
ATOM 11401 H HD2  . LYS A 1 63 ? -0.891  -18.691 4.544   1.00 0.00 ? 63 LYS A HD2  10 
ATOM 11402 H HD3  . LYS A 1 63 ? 0.494   -17.664 4.167   1.00 0.00 ? 63 LYS A HD3  10 
ATOM 11403 H HE2  . LYS A 1 63 ? -0.741  -15.835 5.457   1.00 0.00 ? 63 LYS A HE2  10 
ATOM 11404 H HE3  . LYS A 1 63 ? -1.781  -17.128 6.056   1.00 0.00 ? 63 LYS A HE3  10 
ATOM 11405 H HZ1  . LYS A 1 63 ? 0.332   -16.415 7.372   1.00 0.00 ? 63 LYS A HZ1  10 
ATOM 11406 H HZ2  . LYS A 1 63 ? 1.130   -17.429 6.279   1.00 0.00 ? 63 LYS A HZ2  10 
ATOM 11407 H HZ3  . LYS A 1 63 ? -0.093  -18.050 7.268   1.00 0.00 ? 63 LYS A HZ3  10 
ATOM 11408 N N    . LYS A 1 64 ? -5.252  -17.565 3.698   1.00 0.00 ? 64 LYS A N    10 
ATOM 11409 C CA   . LYS A 1 64 ? -5.956  -17.487 4.973   1.00 0.00 ? 64 LYS A CA   10 
ATOM 11410 C C    . LYS A 1 64 ? -6.817  -18.726 5.196   1.00 0.00 ? 64 LYS A C    10 
ATOM 11411 O O    . LYS A 1 64 ? -7.254  -19.370 4.243   1.00 0.00 ? 64 LYS A O    10 
ATOM 11412 C CB   . LYS A 1 64 ? -6.830  -16.231 5.020   1.00 0.00 ? 64 LYS A CB   10 
ATOM 11413 C CG   . LYS A 1 64 ? -6.934  -15.615 6.404   1.00 0.00 ? 64 LYS A CG   10 
ATOM 11414 C CD   . LYS A 1 64 ? -7.104  -14.106 6.331   1.00 0.00 ? 64 LYS A CD   10 
ATOM 11415 C CE   . LYS A 1 64 ? -7.612  -13.539 7.648   1.00 0.00 ? 64 LYS A CE   10 
ATOM 11416 N NZ   . LYS A 1 64 ? -7.681  -12.051 7.620   1.00 0.00 ? 64 LYS A NZ   10 
ATOM 11417 H H    . LYS A 1 64 ? -5.687  -17.219 2.890   1.00 0.00 ? 64 LYS A H    10 
ATOM 11418 H HA   . LYS A 1 64 ? -5.217  -17.430 5.757   1.00 0.00 ? 64 LYS A HA   10 
ATOM 11419 H HB2  . LYS A 1 64 ? -6.414  -15.493 4.350   1.00 0.00 ? 64 LYS A HB2  10 
ATOM 11420 H HB3  . LYS A 1 64 ? -7.825  -16.487 4.687   1.00 0.00 ? 64 LYS A HB3  10 
ATOM 11421 H HG2  . LYS A 1 64 ? -7.787  -16.038 6.913   1.00 0.00 ? 64 LYS A HG2  10 
ATOM 11422 H HG3  . LYS A 1 64 ? -6.034  -15.840 6.957   1.00 0.00 ? 64 LYS A HG3  10 
ATOM 11423 H HD2  . LYS A 1 64 ? -6.150  -13.656 6.102   1.00 0.00 ? 64 LYS A HD2  10 
ATOM 11424 H HD3  . LYS A 1 64 ? -7.813  -13.870 5.550   1.00 0.00 ? 64 LYS A HD3  10 
ATOM 11425 H HE2  . LYS A 1 64 ? -8.598  -13.932 7.838   1.00 0.00 ? 64 LYS A HE2  10 
ATOM 11426 H HE3  . LYS A 1 64 ? -6.943  -13.845 8.438   1.00 0.00 ? 64 LYS A HE3  10 
ATOM 11427 H HZ1  . LYS A 1 64 ? -7.194  -11.687 6.776   1.00 0.00 ? 64 LYS A HZ1  10 
ATOM 11428 H HZ2  . LYS A 1 64 ? -7.223  -11.657 8.467   1.00 0.00 ? 64 LYS A HZ2  10 
ATOM 11429 H HZ3  . LYS A 1 64 ? -8.672  -11.739 7.598   1.00 0.00 ? 64 LYS A HZ3  10 
ATOM 11430 N N    . SER A 1 65 ? -7.057  -19.054 6.462   1.00 0.00 ? 65 SER A N    10 
ATOM 11431 C CA   . SER A 1 65 ? -7.863  -20.218 6.810   1.00 0.00 ? 65 SER A CA   10 
ATOM 11432 C C    . SER A 1 65 ? -8.971  -19.838 7.788   1.00 0.00 ? 65 SER A C    10 
ATOM 11433 O O    . SER A 1 65 ? -8.762  -19.809 9.000   1.00 0.00 ? 65 SER A O    10 
ATOM 11434 C CB   . SER A 1 65 ? -6.983  -21.312 7.419   1.00 0.00 ? 65 SER A CB   10 
ATOM 11435 O OG   . SER A 1 65 ? -5.992  -21.738 6.500   1.00 0.00 ? 65 SER A OG   10 
ATOM 11436 H H    . SER A 1 65 ? -6.680  -18.502 7.178   1.00 0.00 ? 65 SER A H    10 
ATOM 11437 H HA   . SER A 1 65 ? -8.313  -20.593 5.903   1.00 0.00 ? 65 SER A HA   10 
ATOM 11438 H HB2  . SER A 1 65 ? -6.496  -20.928 8.302   1.00 0.00 ? 65 SER A HB2  10 
ATOM 11439 H HB3  . SER A 1 65 ? -7.599  -22.159 7.685   1.00 0.00 ? 65 SER A HB3  10 
ATOM 11440 H HG   . SER A 1 65 ? -6.414  -22.063 5.701   1.00 0.00 ? 65 SER A HG   10 
ATOM 11441 N N    . GLY A 1 66 ? -10.152 -19.549 7.251   1.00 0.00 ? 66 GLY A N    10 
ATOM 11442 C CA   . GLY A 1 66 ? -11.277 -19.174 8.089   1.00 0.00 ? 66 GLY A CA   10 
ATOM 11443 C C    . GLY A 1 66 ? -12.597 -19.692 7.553   1.00 0.00 ? 66 GLY A C    10 
ATOM 11444 O O    . GLY A 1 66 ? -12.640 -20.541 6.663   1.00 0.00 ? 66 GLY A O    10 
ATOM 11445 H H    . GLY A 1 66 ? -10.261 -19.589 6.278   1.00 0.00 ? 66 GLY A H    10 
ATOM 11446 H HA2  . GLY A 1 66 ? -11.121 -19.573 9.080   1.00 0.00 ? 66 GLY A HA2  10 
ATOM 11447 H HA3  . GLY A 1 66 ? -11.323 -18.097 8.148   1.00 0.00 ? 66 GLY A HA3  10 
ATOM 11448 N N    . PRO A 1 67 ? -13.706 -19.175 8.102   1.00 0.00 ? 67 PRO A N    10 
ATOM 11449 C CA   . PRO A 1 67 ? -15.054 -19.577 7.690   1.00 0.00 ? 67 PRO A CA   10 
ATOM 11450 C C    . PRO A 1 67 ? -15.402 -19.087 6.289   1.00 0.00 ? 67 PRO A C    10 
ATOM 11451 O O    . PRO A 1 67 ? -14.836 -18.106 5.805   1.00 0.00 ? 67 PRO A O    10 
ATOM 11452 C CB   . PRO A 1 67 ? -15.957 -18.907 8.730   1.00 0.00 ? 67 PRO A CB   10 
ATOM 11453 C CG   . PRO A 1 67 ? -15.173 -17.738 9.216   1.00 0.00 ? 67 PRO A CG   10 
ATOM 11454 C CD   . PRO A 1 67 ? -13.730 -18.158 9.167   1.00 0.00 ? 67 PRO A CD   10 
ATOM 11455 H HA   . PRO A 1 67 ? -15.181 -20.648 7.737   1.00 0.00 ? 67 PRO A HA   10 
ATOM 11456 H HB2  . PRO A 1 67 ? -16.881 -18.597 8.262   1.00 0.00 ? 67 PRO A HB2  10 
ATOM 11457 H HB3  . PRO A 1 67 ? -16.167 -19.602 9.529   1.00 0.00 ? 67 PRO A HB3  10 
ATOM 11458 H HG2  . PRO A 1 67 ? -15.338 -16.890 8.569   1.00 0.00 ? 67 PRO A HG2  10 
ATOM 11459 H HG3  . PRO A 1 67 ? -15.459 -17.500 10.230  1.00 0.00 ? 67 PRO A HG3  10 
ATOM 11460 H HD2  . PRO A 1 67 ? -13.100 -17.319 8.913   1.00 0.00 ? 67 PRO A HD2  10 
ATOM 11461 H HD3  . PRO A 1 67 ? -13.429 -18.585 10.113  1.00 0.00 ? 67 PRO A HD3  10 
ATOM 11462 N N    . SER A 1 68 ? -16.336 -19.776 5.641   1.00 0.00 ? 68 SER A N    10 
ATOM 11463 C CA   . SER A 1 68 ? -16.757 -19.412 4.293   1.00 0.00 ? 68 SER A CA   10 
ATOM 11464 C C    . SER A 1 68 ? -17.260 -17.972 4.250   1.00 0.00 ? 68 SER A C    10 
ATOM 11465 O O    . SER A 1 68 ? -17.986 -17.530 5.140   1.00 0.00 ? 68 SER A O    10 
ATOM 11466 C CB   . SER A 1 68 ? -17.853 -20.362 3.804   1.00 0.00 ? 68 SER A CB   10 
ATOM 11467 O OG   . SER A 1 68 ? -17.923 -20.375 2.389   1.00 0.00 ? 68 SER A OG   10 
ATOM 11468 H H    . SER A 1 68 ? -16.750 -20.548 6.079   1.00 0.00 ? 68 SER A H    10 
ATOM 11469 H HA   . SER A 1 68 ? -15.899 -19.501 3.642   1.00 0.00 ? 68 SER A HA   10 
ATOM 11470 H HB2  . SER A 1 68 ? -17.640 -21.361 4.151   1.00 0.00 ? 68 SER A HB2  10 
ATOM 11471 H HB3  . SER A 1 68 ? -18.806 -20.039 4.197   1.00 0.00 ? 68 SER A HB3  10 
ATOM 11472 H HG   . SER A 1 68 ? -18.151 -21.257 2.087   1.00 0.00 ? 68 SER A HG   10 
ATOM 11473 N N    . SER A 1 69 ? -16.868 -17.246 3.208   1.00 0.00 ? 69 SER A N    10 
ATOM 11474 C CA   . SER A 1 69 ? -17.275 -15.855 3.050   1.00 0.00 ? 69 SER A CA   10 
ATOM 11475 C C    . SER A 1 69 ? -18.132 -15.678 1.800   1.00 0.00 ? 69 SER A C    10 
ATOM 11476 O O    . SER A 1 69 ? -19.110 -14.932 1.805   1.00 0.00 ? 69 SER A O    10 
ATOM 11477 C CB   . SER A 1 69 ? -16.045 -14.947 2.971   1.00 0.00 ? 69 SER A CB   10 
ATOM 11478 O OG   . SER A 1 69 ? -16.410 -13.583 3.087   1.00 0.00 ? 69 SER A OG   10 
ATOM 11479 H H    . SER A 1 69 ? -16.289 -17.655 2.531   1.00 0.00 ? 69 SER A H    10 
ATOM 11480 H HA   . SER A 1 69 ? -17.859 -15.580 3.915   1.00 0.00 ? 69 SER A HA   10 
ATOM 11481 H HB2  . SER A 1 69 ? -15.366 -15.195 3.772   1.00 0.00 ? 69 SER A HB2  10 
ATOM 11482 H HB3  . SER A 1 69 ? -15.552 -15.097 2.021   1.00 0.00 ? 69 SER A HB3  10 
ATOM 11483 H HG   . SER A 1 69 ? -15.624 -13.035 3.026   1.00 0.00 ? 69 SER A HG   10 
ATOM 11484 N N    . GLY A 1 70 ? -17.757 -16.372 0.730   1.00 0.00 ? 70 GLY A N    10 
ATOM 11485 C CA   . GLY A 1 70 ? -18.501 -16.279 -0.513  1.00 0.00 ? 70 GLY A CA   10 
ATOM 11486 C C    . GLY A 1 70 ? -17.641 -16.567 -1.727  1.00 0.00 ? 70 GLY A C    10 
ATOM 11487 O O    . GLY A 1 70 ? -17.858 -16.001 -2.798  1.00 0.00 ? 70 GLY A O    10 
ATOM 11488 H H    . GLY A 1 70 ? -16.969 -16.952 0.784   1.00 0.00 ? 70 GLY A H    10 
ATOM 11489 H HA2  . GLY A 1 70 ? -19.316 -16.987 -0.486  1.00 0.00 ? 70 GLY A HA2  10 
ATOM 11490 H HA3  . GLY A 1 70 ? -18.907 -15.282 -0.602  1.00 0.00 ? 70 GLY A HA3  10 
ATOM 11491 N N    . GLY A 1 1  ? -22.136 7.844   -1.668  1.00 0.00 ? 1  GLY A N    11 
ATOM 11492 C CA   . GLY A 1 1  ? -21.445 8.132   -0.425  1.00 0.00 ? 1  GLY A CA   11 
ATOM 11493 C C    . GLY A 1 1  ? -19.972 7.781   -0.485  1.00 0.00 ? 1  GLY A C    11 
ATOM 11494 O O    . GLY A 1 1  ? -19.557 6.729   0.003   1.00 0.00 ? 1  GLY A O    11 
ATOM 11495 H H1   . GLY A 1 1  ? -21.632 7.507   -2.439  1.00 0.00 ? 1  GLY A H1   11 
ATOM 11496 H HA2  . GLY A 1 1  ? -21.546 9.184   -0.205  1.00 0.00 ? 1  GLY A HA2  11 
ATOM 11497 H HA3  . GLY A 1 1  ? -21.907 7.563   0.370   1.00 0.00 ? 1  GLY A HA3  11 
ATOM 11498 N N    . SER A 1 2  ? -19.179 8.663   -1.085  1.00 0.00 ? 2  SER A N    11 
ATOM 11499 C CA   . SER A 1 2  ? -17.744 8.438   -1.212  1.00 0.00 ? 2  SER A CA   11 
ATOM 11500 C C    . SER A 1 2  ? -17.034 8.700   0.112   1.00 0.00 ? 2  SER A C    11 
ATOM 11501 O O    . SER A 1 2  ? -16.559 9.806   0.367   1.00 0.00 ? 2  SER A O    11 
ATOM 11502 C CB   . SER A 1 2  ? -17.160 9.338   -2.303  1.00 0.00 ? 2  SER A CB   11 
ATOM 11503 O OG   . SER A 1 2  ? -17.581 8.919   -3.590  1.00 0.00 ? 2  SER A OG   11 
ATOM 11504 H H    . SER A 1 2  ? -19.570 9.483   -1.454  1.00 0.00 ? 2  SER A H    11 
ATOM 11505 H HA   . SER A 1 2  ? -17.593 7.406   -1.491  1.00 0.00 ? 2  SER A HA   11 
ATOM 11506 H HB2  . SER A 1 2  ? -17.490 10.354  -2.143  1.00 0.00 ? 2  SER A HB2  11 
ATOM 11507 H HB3  . SER A 1 2  ? -16.082 9.299   -2.259  1.00 0.00 ? 2  SER A HB3  11 
ATOM 11508 H HG   . SER A 1 2  ? -16.817 8.835   -4.165  1.00 0.00 ? 2  SER A HG   11 
ATOM 11509 N N    . SER A 1 3  ? -16.966 7.672   0.953   1.00 0.00 ? 3  SER A N    11 
ATOM 11510 C CA   . SER A 1 3  ? -16.318 7.790   2.254   1.00 0.00 ? 3  SER A CA   11 
ATOM 11511 C C    . SER A 1 3  ? -17.045 8.802   3.133   1.00 0.00 ? 3  SER A C    11 
ATOM 11512 O O    . SER A 1 3  ? -16.447 9.421   4.012   1.00 0.00 ? 3  SER A O    11 
ATOM 11513 C CB   . SER A 1 3  ? -14.855 8.205   2.082   1.00 0.00 ? 3  SER A CB   11 
ATOM 11514 O OG   . SER A 1 3  ? -14.313 7.680   0.883   1.00 0.00 ? 3  SER A OG   11 
ATOM 11515 H H    . SER A 1 3  ? -17.363 6.815   0.692   1.00 0.00 ? 3  SER A H    11 
ATOM 11516 H HA   . SER A 1 3  ? -16.355 6.823   2.732   1.00 0.00 ? 3  SER A HA   11 
ATOM 11517 H HB2  . SER A 1 3  ? -14.790 9.282   2.052   1.00 0.00 ? 3  SER A HB2  11 
ATOM 11518 H HB3  . SER A 1 3  ? -14.278 7.833   2.917   1.00 0.00 ? 3  SER A HB3  11 
ATOM 11519 H HG   . SER A 1 3  ? -13.515 8.162   0.654   1.00 0.00 ? 3  SER A HG   11 
ATOM 11520 N N    . GLY A 1 4  ? -18.343 8.964   2.890   1.00 0.00 ? 4  GLY A N    11 
ATOM 11521 C CA   . GLY A 1 4  ? -19.132 9.901   3.667   1.00 0.00 ? 4  GLY A CA   11 
ATOM 11522 C C    . GLY A 1 4  ? -20.450 9.309   4.125   1.00 0.00 ? 4  GLY A C    11 
ATOM 11523 O O    . GLY A 1 4  ? -21.295 8.950   3.306   1.00 0.00 ? 4  GLY A O    11 
ATOM 11524 H H    . GLY A 1 4  ? -18.767 8.443   2.176   1.00 0.00 ? 4  GLY A H    11 
ATOM 11525 H HA2  . GLY A 1 4  ? -18.563 10.202  4.534   1.00 0.00 ? 4  GLY A HA2  11 
ATOM 11526 H HA3  . GLY A 1 4  ? -19.334 10.773  3.062   1.00 0.00 ? 4  GLY A HA3  11 
ATOM 11527 N N    . SER A 1 5  ? -20.625 9.205   5.439   1.00 0.00 ? 5  SER A N    11 
ATOM 11528 C CA   . SER A 1 5  ? -21.847 8.646   6.005   1.00 0.00 ? 5  SER A CA   11 
ATOM 11529 C C    . SER A 1 5  ? -22.015 9.070   7.461   1.00 0.00 ? 5  SER A C    11 
ATOM 11530 O O    . SER A 1 5  ? -21.049 9.448   8.124   1.00 0.00 ? 5  SER A O    11 
ATOM 11531 C CB   . SER A 1 5  ? -21.830 7.120   5.905   1.00 0.00 ? 5  SER A CB   11 
ATOM 11532 O OG   . SER A 1 5  ? -22.576 6.531   6.957   1.00 0.00 ? 5  SER A OG   11 
ATOM 11533 H H    . SER A 1 5  ? -19.914 9.508   6.041   1.00 0.00 ? 5  SER A H    11 
ATOM 11534 H HA   . SER A 1 5  ? -22.681 9.026   5.434   1.00 0.00 ? 5  SER A HA   11 
ATOM 11535 H HB2  . SER A 1 5  ? -22.260 6.818   4.963   1.00 0.00 ? 5  SER A HB2  11 
ATOM 11536 H HB3  . SER A 1 5  ? -20.809 6.770   5.964   1.00 0.00 ? 5  SER A HB3  11 
ATOM 11537 H HG   . SER A 1 5  ? -22.061 6.554   7.767   1.00 0.00 ? 5  SER A HG   11 
ATOM 11538 N N    . SER A 1 6  ? -23.249 9.005   7.952   1.00 0.00 ? 6  SER A N    11 
ATOM 11539 C CA   . SER A 1 6  ? -23.545 9.386   9.328   1.00 0.00 ? 6  SER A CA   11 
ATOM 11540 C C    . SER A 1 6  ? -24.369 8.307   10.024  1.00 0.00 ? 6  SER A C    11 
ATOM 11541 O O    . SER A 1 6  ? -25.349 7.807   9.474   1.00 0.00 ? 6  SER A O    11 
ATOM 11542 C CB   . SER A 1 6  ? -24.296 10.718  9.360   1.00 0.00 ? 6  SER A CB   11 
ATOM 11543 O OG   . SER A 1 6  ? -25.306 10.758  8.367   1.00 0.00 ? 6  SER A OG   11 
ATOM 11544 H H    . SER A 1 6  ? -23.977 8.696   7.373   1.00 0.00 ? 6  SER A H    11 
ATOM 11545 H HA   . SER A 1 6  ? -22.607 9.499   9.850   1.00 0.00 ? 6  SER A HA   11 
ATOM 11546 H HB2  . SER A 1 6  ? -24.756 10.846  10.328  1.00 0.00 ? 6  SER A HB2  11 
ATOM 11547 H HB3  . SER A 1 6  ? -23.600 11.525  9.182   1.00 0.00 ? 6  SER A HB3  11 
ATOM 11548 H HG   . SER A 1 6  ? -25.126 11.477  7.756   1.00 0.00 ? 6  SER A HG   11 
ATOM 11549 N N    . GLY A 1 7  ? -23.963 7.953   11.240  1.00 0.00 ? 7  GLY A N    11 
ATOM 11550 C CA   . GLY A 1 7  ? -24.674 6.936   11.993  1.00 0.00 ? 7  GLY A CA   11 
ATOM 11551 C C    . GLY A 1 7  ? -24.071 5.557   11.815  1.00 0.00 ? 7  GLY A C    11 
ATOM 11552 O O    . GLY A 1 7  ? -23.978 4.785   12.770  1.00 0.00 ? 7  GLY A O    11 
ATOM 11553 H H    . GLY A 1 7  ? -23.174 8.386   11.629  1.00 0.00 ? 7  GLY A H    11 
ATOM 11554 H HA2  . GLY A 1 7  ? -24.649 7.197   13.040  1.00 0.00 ? 7  GLY A HA2  11 
ATOM 11555 H HA3  . GLY A 1 7  ? -25.702 6.912   11.662  1.00 0.00 ? 7  GLY A HA3  11 
ATOM 11556 N N    . ARG A 1 8  ? -23.662 5.244   10.590  1.00 0.00 ? 8  ARG A N    11 
ATOM 11557 C CA   . ARG A 1 8  ? -23.068 3.947   10.290  1.00 0.00 ? 8  ARG A CA   11 
ATOM 11558 C C    . ARG A 1 8  ? -21.812 3.718   11.126  1.00 0.00 ? 8  ARG A C    11 
ATOM 11559 O O    . ARG A 1 8  ? -21.470 4.528   11.988  1.00 0.00 ? 8  ARG A O    11 
ATOM 11560 C CB   . ARG A 1 8  ? -22.727 3.850   8.802   1.00 0.00 ? 8  ARG A CB   11 
ATOM 11561 C CG   . ARG A 1 8  ? -23.945 3.904   7.894   1.00 0.00 ? 8  ARG A CG   11 
ATOM 11562 C CD   . ARG A 1 8  ? -23.722 3.111   6.616   1.00 0.00 ? 8  ARG A CD   11 
ATOM 11563 N NE   . ARG A 1 8  ? -22.515 3.536   5.912   1.00 0.00 ? 8  ARG A NE   11 
ATOM 11564 C CZ   . ARG A 1 8  ? -22.199 3.133   4.686   1.00 0.00 ? 8  ARG A CZ   11 
ATOM 11565 N NH1  . ARG A 1 8  ? -22.997 2.301   4.032   1.00 0.00 ? 8  ARG A NH1  11 
ATOM 11566 N NH2  . ARG A 1 8  ? -21.083 3.564   4.112   1.00 0.00 ? 8  ARG A NH2  11 
ATOM 11567 H H    . ARG A 1 8  ? -23.762 5.902   9.870   1.00 0.00 ? 8  ARG A H    11 
ATOM 11568 H HA   . ARG A 1 8  ? -23.793 3.186   10.536  1.00 0.00 ? 8  ARG A HA   11 
ATOM 11569 H HB2  . ARG A 1 8  ? -22.074 4.668   8.540   1.00 0.00 ? 8  ARG A HB2  11 
ATOM 11570 H HB3  . ARG A 1 8  ? -22.213 2.917   8.623   1.00 0.00 ? 8  ARG A HB3  11 
ATOM 11571 H HG2  . ARG A 1 8  ? -24.793 3.488   8.419   1.00 0.00 ? 8  ARG A HG2  11 
ATOM 11572 H HG3  . ARG A 1 8  ? -24.147 4.933   7.639   1.00 0.00 ? 8  ARG A HG3  11 
ATOM 11573 H HD2  . ARG A 1 8  ? -23.632 2.065   6.867   1.00 0.00 ? 8  ARG A HD2  11 
ATOM 11574 H HD3  . ARG A 1 8  ? -24.574 3.253   5.967   1.00 0.00 ? 8  ARG A HD3  11 
ATOM 11575 H HE   . ARG A 1 8  ? -21.911 4.151   6.377   1.00 0.00 ? 8  ARG A HE   11 
ATOM 11576 H HH11 . ARG A 1 8  ? -23.839 1.976   4.461   1.00 0.00 ? 8  ARG A HH11 11 
ATOM 11577 H HH12 . ARG A 1 8  ? -22.757 2.001   3.108   1.00 0.00 ? 8  ARG A HH12 11 
ATOM 11578 H HH21 . ARG A 1 8  ? -20.479 4.192   4.603   1.00 0.00 ? 8  ARG A HH21 11 
ATOM 11579 H HH22 . ARG A 1 8  ? -20.845 3.260   3.190   1.00 0.00 ? 8  ARG A HH22 11 
ATOM 11580 N N    . LYS A 1 9  ? -21.128 2.609   10.866  1.00 0.00 ? 9  LYS A N    11 
ATOM 11581 C CA   . LYS A 1 9  ? -19.910 2.272   11.593  1.00 0.00 ? 9  LYS A CA   11 
ATOM 11582 C C    . LYS A 1 9  ? -18.679 2.473   10.714  1.00 0.00 ? 9  LYS A C    11 
ATOM 11583 O O    . LYS A 1 9  ? -18.790 2.625   9.497   1.00 0.00 ? 9  LYS A O    11 
ATOM 11584 C CB   . LYS A 1 9  ? -19.968 0.824   12.084  1.00 0.00 ? 9  LYS A CB   11 
ATOM 11585 C CG   . LYS A 1 9  ? -20.412 -0.163  11.018  1.00 0.00 ? 9  LYS A CG   11 
ATOM 11586 C CD   . LYS A 1 9  ? -21.915 -0.382  11.052  1.00 0.00 ? 9  LYS A CD   11 
ATOM 11587 C CE   . LYS A 1 9  ? -22.274 -1.831  10.758  1.00 0.00 ? 9  LYS A CE   11 
ATOM 11588 N NZ   . LYS A 1 9  ? -22.062 -2.174  9.324   1.00 0.00 ? 9  LYS A NZ   11 
ATOM 11589 H H    . LYS A 1 9  ? -21.451 2.002   10.167  1.00 0.00 ? 9  LYS A H    11 
ATOM 11590 H HA   . LYS A 1 9  ? -19.840 2.930   12.446  1.00 0.00 ? 9  LYS A HA   11 
ATOM 11591 H HB2  . LYS A 1 9  ? -18.987 0.533   12.428  1.00 0.00 ? 9  LYS A HB2  11 
ATOM 11592 H HB3  . LYS A 1 9  ? -20.662 0.764   12.910  1.00 0.00 ? 9  LYS A HB3  11 
ATOM 11593 H HG2  . LYS A 1 9  ? -20.137 0.222   10.047  1.00 0.00 ? 9  LYS A HG2  11 
ATOM 11594 H HG3  . LYS A 1 9  ? -19.916 -1.108  11.186  1.00 0.00 ? 9  LYS A HG3  11 
ATOM 11595 H HD2  . LYS A 1 9  ? -22.286 -0.123  12.032  1.00 0.00 ? 9  LYS A HD2  11 
ATOM 11596 H HD3  . LYS A 1 9  ? -22.380 0.253   10.310  1.00 0.00 ? 9  LYS A HD3  11 
ATOM 11597 H HE2  . LYS A 1 9  ? -21.657 -2.472  11.368  1.00 0.00 ? 9  LYS A HE2  11 
ATOM 11598 H HE3  . LYS A 1 9  ? -23.313 -1.988  11.007  1.00 0.00 ? 9  LYS A HE3  11 
ATOM 11599 H HZ1  . LYS A 1 9  ? -21.649 -3.126  9.243   1.00 0.00 ? 9  LYS A HZ1  11 
ATOM 11600 H HZ2  . LYS A 1 9  ? -21.415 -1.489  8.884   1.00 0.00 ? 9  LYS A HZ2  11 
ATOM 11601 H HZ3  . LYS A 1 9  ? -22.968 -2.156  8.815   1.00 0.00 ? 9  LYS A HZ3  11 
ATOM 11602 N N    . LYS A 1 10 ? -17.506 2.470   11.337  1.00 0.00 ? 10 LYS A N    11 
ATOM 11603 C CA   . LYS A 1 10 ? -16.253 2.649   10.613  1.00 0.00 ? 10 LYS A CA   11 
ATOM 11604 C C    . LYS A 1 10 ? -16.010 1.489   9.653   1.00 0.00 ? 10 LYS A C    11 
ATOM 11605 O O    . LYS A 1 10 ? -16.426 0.359   9.911   1.00 0.00 ? 10 LYS A O    11 
ATOM 11606 C CB   . LYS A 1 10 ? -15.085 2.766   11.594  1.00 0.00 ? 10 LYS A CB   11 
ATOM 11607 C CG   . LYS A 1 10 ? -13.740 2.964   10.917  1.00 0.00 ? 10 LYS A CG   11 
ATOM 11608 C CD   . LYS A 1 10 ? -13.702 4.255   10.117  1.00 0.00 ? 10 LYS A CD   11 
ATOM 11609 C CE   . LYS A 1 10 ? -12.433 4.359   9.285   1.00 0.00 ? 10 LYS A CE   11 
ATOM 11610 N NZ   . LYS A 1 10 ? -11.239 4.645   10.128  1.00 0.00 ? 10 LYS A NZ   11 
ATOM 11611 H H    . LYS A 1 10 ? -17.482 2.343   12.310  1.00 0.00 ? 10 LYS A H    11 
ATOM 11612 H HA   . LYS A 1 10 ? -16.327 3.562   10.043  1.00 0.00 ? 10 LYS A HA   11 
ATOM 11613 H HB2  . LYS A 1 10 ? -15.263 3.607   12.248  1.00 0.00 ? 10 LYS A HB2  11 
ATOM 11614 H HB3  . LYS A 1 10 ? -15.037 1.864   12.187  1.00 0.00 ? 10 LYS A HB3  11 
ATOM 11615 H HG2  . LYS A 1 10 ? -12.968 2.998   11.672  1.00 0.00 ? 10 LYS A HG2  11 
ATOM 11616 H HG3  . LYS A 1 10 ? -13.557 2.133   10.250  1.00 0.00 ? 10 LYS A HG3  11 
ATOM 11617 H HD2  . LYS A 1 10 ? -14.556 4.285   9.456   1.00 0.00 ? 10 LYS A HD2  11 
ATOM 11618 H HD3  . LYS A 1 10 ? -13.745 5.093   10.800  1.00 0.00 ? 10 LYS A HD3  11 
ATOM 11619 H HE2  . LYS A 1 10 ? -12.282 3.426   8.766   1.00 0.00 ? 10 LYS A HE2  11 
ATOM 11620 H HE3  . LYS A 1 10 ? -12.555 5.156   8.566   1.00 0.00 ? 10 LYS A HE3  11 
ATOM 11621 H HZ1  . LYS A 1 10 ? -10.632 3.803   10.184  1.00 0.00 ? 10 LYS A HZ1  11 
ATOM 11622 H HZ2  . LYS A 1 10 ? -11.535 4.909   11.089  1.00 0.00 ? 10 LYS A HZ2  11 
ATOM 11623 H HZ3  . LYS A 1 10 ? -10.692 5.428   9.718   1.00 0.00 ? 10 LYS A HZ3  11 
ATOM 11624 N N    . ARG A 1 11 ? -15.333 1.775   8.546   1.00 0.00 ? 11 ARG A N    11 
ATOM 11625 C CA   . ARG A 1 11 ? -15.034 0.755   7.548   1.00 0.00 ? 11 ARG A CA   11 
ATOM 11626 C C    . ARG A 1 11 ? -13.535 0.688   7.271   1.00 0.00 ? 11 ARG A C    11 
ATOM 11627 O O    . ARG A 1 11 ? -12.734 1.295   7.983   1.00 0.00 ? 11 ARG A O    11 
ATOM 11628 C CB   . ARG A 1 11 ? -15.791 1.044   6.250   1.00 0.00 ? 11 ARG A CB   11 
ATOM 11629 C CG   . ARG A 1 11 ? -17.257 1.384   6.463   1.00 0.00 ? 11 ARG A CG   11 
ATOM 11630 C CD   . ARG A 1 11 ? -18.105 0.958   5.275   1.00 0.00 ? 11 ARG A CD   11 
ATOM 11631 N NE   . ARG A 1 11 ? -17.668 1.592   4.034   1.00 0.00 ? 11 ARG A NE   11 
ATOM 11632 C CZ   . ARG A 1 11 ? -18.202 1.329   2.847   1.00 0.00 ? 11 ARG A CZ   11 
ATOM 11633 N NH1  . ARG A 1 11 ? -19.189 0.450   2.740   1.00 0.00 ? 11 ARG A NH1  11 
ATOM 11634 N NH2  . ARG A 1 11 ? -17.750 1.947   1.763   1.00 0.00 ? 11 ARG A NH2  11 
ATOM 11635 H H    . ARG A 1 11 ? -15.027 2.694   8.396   1.00 0.00 ? 11 ARG A H    11 
ATOM 11636 H HA   . ARG A 1 11 ? -15.358 -0.198  7.939   1.00 0.00 ? 11 ARG A HA   11 
ATOM 11637 H HB2  . ARG A 1 11 ? -15.320 1.877   5.750   1.00 0.00 ? 11 ARG A HB2  11 
ATOM 11638 H HB3  . ARG A 1 11 ? -15.734 0.174   5.613   1.00 0.00 ? 11 ARG A HB3  11 
ATOM 11639 H HG2  . ARG A 1 11 ? -17.611 0.873   7.346   1.00 0.00 ? 11 ARG A HG2  11 
ATOM 11640 H HG3  . ARG A 1 11 ? -17.353 2.451   6.599   1.00 0.00 ? 11 ARG A HG3  11 
ATOM 11641 H HD2  . ARG A 1 11 ? -18.034 -0.114  5.165   1.00 0.00 ? 11 ARG A HD2  11 
ATOM 11642 H HD3  . ARG A 1 11 ? -19.132 1.232   5.466   1.00 0.00 ? 11 ARG A HD3  11 
ATOM 11643 H HE   . ARG A 1 11 ? -16.940 2.245   4.090   1.00 0.00 ? 11 ARG A HE   11 
ATOM 11644 H HH11 . ARG A 1 11 ? -19.533 -0.016  3.555   1.00 0.00 ? 11 ARG A HH11 11 
ATOM 11645 H HH12 . ARG A 1 11 ? -19.591 0.255   1.844   1.00 0.00 ? 11 ARG A HH12 11 
ATOM 11646 H HH21 . ARG A 1 11 ? -17.006 2.610   1.840   1.00 0.00 ? 11 ARG A HH21 11 
ATOM 11647 H HH22 . ARG A 1 11 ? -18.153 1.749   0.870   1.00 0.00 ? 11 ARG A HH22 11 
ATOM 11648 N N    . ILE A 1 12 ? -13.163 -0.054  6.233   1.00 0.00 ? 12 ILE A N    11 
ATOM 11649 C CA   . ILE A 1 12 ? -11.760 -0.199  5.862   1.00 0.00 ? 12 ILE A CA   11 
ATOM 11650 C C    . ILE A 1 12 ? -11.083 1.160   5.732   1.00 0.00 ? 12 ILE A C    11 
ATOM 11651 O O    . ILE A 1 12 ? -11.620 2.096   5.138   1.00 0.00 ? 12 ILE A O    11 
ATOM 11652 C CB   . ILE A 1 12 ? -11.605 -0.967  4.536   1.00 0.00 ? 12 ILE A CB   11 
ATOM 11653 C CG1  . ILE A 1 12 ? -12.283 -2.336  4.632   1.00 0.00 ? 12 ILE A CG1  11 
ATOM 11654 C CG2  . ILE A 1 12 ? -10.134 -1.122  4.183   1.00 0.00 ? 12 ILE A CG2  11 
ATOM 11655 C CD1  . ILE A 1 12 ? -11.730 -3.208  5.737   1.00 0.00 ? 12 ILE A CD1  11 
ATOM 11656 H H    . ILE A 1 12 ? -13.847 -0.513  5.704   1.00 0.00 ? 12 ILE A H    11 
ATOM 11657 H HA   . ILE A 1 12 ? -11.267 -0.762  6.641   1.00 0.00 ? 12 ILE A HA   11 
ATOM 11658 H HB   . ILE A 1 12 ? -12.080 -0.392  3.756   1.00 0.00 ? 12 ILE A HB   11 
ATOM 11659 H HG12 . ILE A 1 12 ? -13.337 -2.197  4.816   1.00 0.00 ? 12 ILE A HG12 11 
ATOM 11660 H HG13 . ILE A 1 12 ? -12.152 -2.860  3.696   1.00 0.00 ? 12 ILE A HG13 11 
ATOM 11661 H HG21 . ILE A 1 12 ? -9.652  -1.750  4.918   1.00 0.00 ? 12 ILE A HG21 11 
ATOM 11662 H HG22 . ILE A 1 12 ? -10.044 -1.577  3.208   1.00 0.00 ? 12 ILE A HG22 11 
ATOM 11663 H HG23 . ILE A 1 12 ? -9.661  -0.152  4.173   1.00 0.00 ? 12 ILE A HG23 11 
ATOM 11664 H HD11 . ILE A 1 12 ? -11.860 -2.712  6.687   1.00 0.00 ? 12 ILE A HD11 11 
ATOM 11665 H HD12 . ILE A 1 12 ? -12.253 -4.152  5.747   1.00 0.00 ? 12 ILE A HD12 11 
ATOM 11666 H HD13 . ILE A 1 12 ? -10.677 -3.382  5.564   1.00 0.00 ? 12 ILE A HD13 11 
ATOM 11667 N N    . PRO A 1 13 ? -9.872  1.275   6.297   1.00 0.00 ? 13 PRO A N    11 
ATOM 11668 C CA   . PRO A 1 13 ? -9.092  2.515   6.255   1.00 0.00 ? 13 PRO A CA   11 
ATOM 11669 C C    . PRO A 1 13 ? -8.373  2.704   4.924   1.00 0.00 ? 13 PRO A C    11 
ATOM 11670 O O    . PRO A 1 13 ? -8.616  1.968   3.966   1.00 0.00 ? 13 PRO A O    11 
ATOM 11671 C CB   . PRO A 1 13 ? -8.080  2.337   7.389   1.00 0.00 ? 13 PRO A CB   11 
ATOM 11672 C CG   . PRO A 1 13 ? -7.925  0.862   7.530   1.00 0.00 ? 13 PRO A CG   11 
ATOM 11673 C CD   . PRO A 1 13 ? -9.170  0.201   7.020   1.00 0.00 ? 13 PRO A CD   11 
ATOM 11674 H HA   . PRO A 1 13 ? -9.710  3.379   6.454   1.00 0.00 ? 13 PRO A HA   11 
ATOM 11675 H HB2  . PRO A 1 13 ? -7.146  2.809   7.119   1.00 0.00 ? 13 PRO A HB2  11 
ATOM 11676 H HB3  . PRO A 1 13 ? -8.466  2.781   8.294   1.00 0.00 ? 13 PRO A HB3  11 
ATOM 11677 H HG2  . PRO A 1 13 ? -7.090  0.522   6.936   1.00 0.00 ? 13 PRO A HG2  11 
ATOM 11678 H HG3  . PRO A 1 13 ? -7.777  0.606   8.569   1.00 0.00 ? 13 PRO A HG3  11 
ATOM 11679 H HD2  . PRO A 1 13 ? -8.883  -0.594  6.347   1.00 0.00 ? 13 PRO A HD2  11 
ATOM 11680 H HD3  . PRO A 1 13 ? -9.780  -0.184  7.824   1.00 0.00 ? 13 PRO A HD3  11 
ATOM 11681 N N    . TYR A 1 14 ? -7.487  3.692   4.870   1.00 0.00 ? 14 TYR A N    11 
ATOM 11682 C CA   . TYR A 1 14 ? -6.734  3.977   3.655   1.00 0.00 ? 14 TYR A CA   11 
ATOM 11683 C C    . TYR A 1 14 ? -7.663  4.422   2.529   1.00 0.00 ? 14 TYR A C    11 
ATOM 11684 O O    . TYR A 1 14 ? -8.435  3.625   1.996   1.00 0.00 ? 14 TYR A O    11 
ATOM 11685 C CB   . TYR A 1 14 ? -5.940  2.744   3.219   1.00 0.00 ? 14 TYR A CB   11 
ATOM 11686 C CG   . TYR A 1 14 ? -5.164  2.096   4.343   1.00 0.00 ? 14 TYR A CG   11 
ATOM 11687 C CD1  . TYR A 1 14 ? -4.117  2.764   4.966   1.00 0.00 ? 14 TYR A CD1  11 
ATOM 11688 C CD2  . TYR A 1 14 ? -5.476  0.815   4.781   1.00 0.00 ? 14 TYR A CD2  11 
ATOM 11689 C CE1  . TYR A 1 14 ? -3.405  2.176   5.993   1.00 0.00 ? 14 TYR A CE1  11 
ATOM 11690 C CE2  . TYR A 1 14 ? -4.770  0.219   5.808   1.00 0.00 ? 14 TYR A CE2  11 
ATOM 11691 C CZ   . TYR A 1 14 ? -3.735  0.903   6.411   1.00 0.00 ? 14 TYR A CZ   11 
ATOM 11692 O OH   . TYR A 1 14 ? -3.028  0.313   7.433   1.00 0.00 ? 14 TYR A OH   11 
ATOM 11693 H H    . TYR A 1 14 ? -7.337  4.243   5.666   1.00 0.00 ? 14 TYR A H    11 
ATOM 11694 H HA   . TYR A 1 14 ? -6.043  4.779   3.873   1.00 0.00 ? 14 TYR A HA   11 
ATOM 11695 H HB2  . TYR A 1 14 ? -6.622  2.009   2.821   1.00 0.00 ? 14 TYR A HB2  11 
ATOM 11696 H HB3  . TYR A 1 14 ? -5.237  3.030   2.451   1.00 0.00 ? 14 TYR A HB3  11 
ATOM 11697 H HD1  . TYR A 1 14 ? -3.861  3.761   4.637   1.00 0.00 ? 14 TYR A HD1  11 
ATOM 11698 H HD2  . TYR A 1 14 ? -6.287  0.282   4.307   1.00 0.00 ? 14 TYR A HD2  11 
ATOM 11699 H HE1  . TYR A 1 14 ? -2.594  2.711   6.466   1.00 0.00 ? 14 TYR A HE1  11 
ATOM 11700 H HE2  . TYR A 1 14 ? -5.028  -0.777  6.135   1.00 0.00 ? 14 TYR A HE2  11 
ATOM 11701 H HH   . TYR A 1 14 ? -3.502  -0.462  7.744   1.00 0.00 ? 14 TYR A HH   11 
ATOM 11702 N N    . SER A 1 15 ? -7.582  5.700   2.173   1.00 0.00 ? 15 SER A N    11 
ATOM 11703 C CA   . SER A 1 15 ? -8.417  6.252   1.113   1.00 0.00 ? 15 SER A CA   11 
ATOM 11704 C C    . SER A 1 15 ? -7.999  5.706   -0.248  1.00 0.00 ? 15 SER A C    11 
ATOM 11705 O O    . SER A 1 15 ? -6.941  5.093   -0.387  1.00 0.00 ? 15 SER A O    11 
ATOM 11706 C CB   . SER A 1 15 ? -8.330  7.780   1.111   1.00 0.00 ? 15 SER A CB   11 
ATOM 11707 O OG   . SER A 1 15 ? -9.258  8.345   2.022   1.00 0.00 ? 15 SER A OG   11 
ATOM 11708 H H    . SER A 1 15 ? -6.946  6.285   2.636   1.00 0.00 ? 15 SER A H    11 
ATOM 11709 H HA   . SER A 1 15 ? -9.438  5.959   1.309   1.00 0.00 ? 15 SER A HA   11 
ATOM 11710 H HB2  . SER A 1 15 ? -7.334  8.082   1.397   1.00 0.00 ? 15 SER A HB2  11 
ATOM 11711 H HB3  . SER A 1 15 ? -8.547  8.148   0.119   1.00 0.00 ? 15 SER A HB3  11 
ATOM 11712 H HG   . SER A 1 15 ? -10.151 8.177   1.714   1.00 0.00 ? 15 SER A HG   11 
ATOM 11713 N N    . LYS A 1 16 ? -8.839  5.933   -1.253  1.00 0.00 ? 16 LYS A N    11 
ATOM 11714 C CA   . LYS A 1 16 ? -8.559  5.465   -2.605  1.00 0.00 ? 16 LYS A CA   11 
ATOM 11715 C C    . LYS A 1 16 ? -7.223  6.008   -3.103  1.00 0.00 ? 16 LYS A C    11 
ATOM 11716 O O    . LYS A 1 16 ? -6.598  5.427   -3.989  1.00 0.00 ? 16 LYS A O    11 
ATOM 11717 C CB   . LYS A 1 16 ? -9.680  5.891   -3.556  1.00 0.00 ? 16 LYS A CB   11 
ATOM 11718 C CG   . LYS A 1 16 ? -10.984 5.145   -3.332  1.00 0.00 ? 16 LYS A CG   11 
ATOM 11719 C CD   . LYS A 1 16 ? -12.185 5.989   -3.725  1.00 0.00 ? 16 LYS A CD   11 
ATOM 11720 C CE   . LYS A 1 16 ? -13.493 5.281   -3.407  1.00 0.00 ? 16 LYS A CE   11 
ATOM 11721 N NZ   . LYS A 1 16 ? -14.669 6.171   -3.608  1.00 0.00 ? 16 LYS A NZ   11 
ATOM 11722 H H    . LYS A 1 16 ? -9.668  6.428   -1.080  1.00 0.00 ? 16 LYS A H    11 
ATOM 11723 H HA   . LYS A 1 16 ? -8.510  4.387   -2.580  1.00 0.00 ? 16 LYS A HA   11 
ATOM 11724 H HB2  . LYS A 1 16 ? -9.867  6.947   -3.424  1.00 0.00 ? 16 LYS A HB2  11 
ATOM 11725 H HB3  . LYS A 1 16 ? -9.360  5.715   -4.573  1.00 0.00 ? 16 LYS A HB3  11 
ATOM 11726 H HG2  . LYS A 1 16 ? -10.980 4.244   -3.928  1.00 0.00 ? 16 LYS A HG2  11 
ATOM 11727 H HG3  . LYS A 1 16 ? -11.065 4.885   -2.286  1.00 0.00 ? 16 LYS A HG3  11 
ATOM 11728 H HD2  . LYS A 1 16 ? -12.152 6.921   -3.181  1.00 0.00 ? 16 LYS A HD2  11 
ATOM 11729 H HD3  . LYS A 1 16 ? -12.142 6.188   -4.787  1.00 0.00 ? 16 LYS A HD3  11 
ATOM 11730 H HE2  . LYS A 1 16 ? -13.588 4.421   -4.053  1.00 0.00 ? 16 LYS A HE2  11 
ATOM 11731 H HE3  . LYS A 1 16 ? -13.469 4.956   -2.377  1.00 0.00 ? 16 LYS A HE3  11 
ATOM 11732 H HZ1  . LYS A 1 16 ? -15.529 5.602   -3.744  1.00 0.00 ? 16 LYS A HZ1  11 
ATOM 11733 H HZ2  . LYS A 1 16 ? -14.526 6.767   -4.448  1.00 0.00 ? 16 LYS A HZ2  11 
ATOM 11734 H HZ3  . LYS A 1 16 ? -14.799 6.784   -2.779  1.00 0.00 ? 16 LYS A HZ3  11 
ATOM 11735 N N    . GLY A 1 17 ? -6.791  7.124   -2.525  1.00 0.00 ? 17 GLY A N    11 
ATOM 11736 C CA   . GLY A 1 17 ? -5.531  7.725   -2.922  1.00 0.00 ? 17 GLY A CA   11 
ATOM 11737 C C    . GLY A 1 17 ? -4.339  7.065   -2.257  1.00 0.00 ? 17 GLY A C    11 
ATOM 11738 O O    . GLY A 1 17 ? -3.286  6.907   -2.873  1.00 0.00 ? 17 GLY A O    11 
ATOM 11739 H H    . GLY A 1 17 ? -7.332  7.544   -1.823  1.00 0.00 ? 17 GLY A H    11 
ATOM 11740 H HA2  . GLY A 1 17 ? -5.425  7.639   -3.993  1.00 0.00 ? 17 GLY A HA2  11 
ATOM 11741 H HA3  . GLY A 1 17 ? -5.544  8.771   -2.654  1.00 0.00 ? 17 GLY A HA3  11 
ATOM 11742 N N    . GLN A 1 18 ? -4.505  6.681   -0.995  1.00 0.00 ? 18 GLN A N    11 
ATOM 11743 C CA   . GLN A 1 18 ? -3.432  6.037   -0.246  1.00 0.00 ? 18 GLN A CA   11 
ATOM 11744 C C    . GLN A 1 18 ? -3.268  4.582   -0.672  1.00 0.00 ? 18 GLN A C    11 
ATOM 11745 O O    . GLN A 1 18 ? -2.155  4.056   -0.704  1.00 0.00 ? 18 GLN A O    11 
ATOM 11746 C CB   . GLN A 1 18 ? -3.714  6.113   1.256   1.00 0.00 ? 18 GLN A CB   11 
ATOM 11747 C CG   . GLN A 1 18 ? -3.658  7.525   1.815   1.00 0.00 ? 18 GLN A CG   11 
ATOM 11748 C CD   . GLN A 1 18 ? -4.148  7.605   3.248   1.00 0.00 ? 18 GLN A CD   11 
ATOM 11749 O OE1  . GLN A 1 18 ? -5.310  7.317   3.536   1.00 0.00 ? 18 GLN A OE1  11 
ATOM 11750 N NE2  . GLN A 1 18 ? -3.262  7.996   4.156   1.00 0.00 ? 18 GLN A NE2  11 
ATOM 11751 H H    . GLN A 1 18 ? -5.368  6.835   -0.558  1.00 0.00 ? 18 GLN A H    11 
ATOM 11752 H HA   . GLN A 1 18 ? -2.516  6.567   -0.458  1.00 0.00 ? 18 GLN A HA   11 
ATOM 11753 H HB2  . GLN A 1 18 ? -4.699  5.712   1.445   1.00 0.00 ? 18 GLN A HB2  11 
ATOM 11754 H HB3  . GLN A 1 18 ? -2.983  5.513   1.778   1.00 0.00 ? 18 GLN A HB3  11 
ATOM 11755 H HG2  . GLN A 1 18 ? -2.636  7.872   1.781   1.00 0.00 ? 18 GLN A HG2  11 
ATOM 11756 H HG3  . GLN A 1 18 ? -4.275  8.165   1.203   1.00 0.00 ? 18 GLN A HG3  11 
ATOM 11757 H HE21 . GLN A 1 18 ? -2.354  8.210   3.853   1.00 0.00 ? 18 GLN A HE21 11 
ATOM 11758 H HE22 . GLN A 1 18 ? -3.551  8.058   5.089   1.00 0.00 ? 18 GLN A HE22 11 
ATOM 11759 N N    . LEU A 1 19 ? -4.382  3.937   -0.998  1.00 0.00 ? 19 LEU A N    11 
ATOM 11760 C CA   . LEU A 1 19 ? -4.362  2.542   -1.423  1.00 0.00 ? 19 LEU A CA   11 
ATOM 11761 C C    . LEU A 1 19 ? -3.816  2.412   -2.841  1.00 0.00 ? 19 LEU A C    11 
ATOM 11762 O O    . LEU A 1 19 ? -3.424  1.326   -3.268  1.00 0.00 ? 19 LEU A O    11 
ATOM 11763 C CB   . LEU A 1 19 ? -5.769  1.945   -1.350  1.00 0.00 ? 19 LEU A CB   11 
ATOM 11764 C CG   . LEU A 1 19 ? -6.374  1.822   0.049   1.00 0.00 ? 19 LEU A CG   11 
ATOM 11765 C CD1  . LEU A 1 19 ? -7.881  1.636   -0.035  1.00 0.00 ? 19 LEU A CD1  11 
ATOM 11766 C CD2  . LEU A 1 19 ? -5.734  0.667   0.806   1.00 0.00 ? 19 LEU A CD2  11 
ATOM 11767 H H    . LEU A 1 19 ? -5.240  4.409   -0.953  1.00 0.00 ? 19 LEU A H    11 
ATOM 11768 H HA   . LEU A 1 19 ? -3.715  2.000   -0.749  1.00 0.00 ? 19 LEU A HA   11 
ATOM 11769 H HB2  . LEU A 1 19 ? -6.424  2.570   -1.938  1.00 0.00 ? 19 LEU A HB2  11 
ATOM 11770 H HB3  . LEU A 1 19 ? -5.731  0.956   -1.784  1.00 0.00 ? 19 LEU A HB3  11 
ATOM 11771 H HG   . LEU A 1 19 ? -6.180  2.732   0.600   1.00 0.00 ? 19 LEU A HG   11 
ATOM 11772 H HD11 . LEU A 1 19 ? -8.292  1.573   0.961   1.00 0.00 ? 19 LEU A HD11 11 
ATOM 11773 H HD12 . LEU A 1 19 ? -8.102  0.727   -0.575  1.00 0.00 ? 19 LEU A HD12 11 
ATOM 11774 H HD13 . LEU A 1 19 ? -8.318  2.477   -0.553  1.00 0.00 ? 19 LEU A HD13 11 
ATOM 11775 H HD21 . LEU A 1 19 ? -6.344  0.416   1.661   1.00 0.00 ? 19 LEU A HD21 11 
ATOM 11776 H HD22 . LEU A 1 19 ? -4.749  0.958   1.141   1.00 0.00 ? 19 LEU A HD22 11 
ATOM 11777 H HD23 . LEU A 1 19 ? -5.656  -0.191  0.155   1.00 0.00 ? 19 LEU A HD23 11 
ATOM 11778 N N    . ARG A 1 20 ? -3.791  3.526   -3.565  1.00 0.00 ? 20 ARG A N    11 
ATOM 11779 C CA   . ARG A 1 20 ? -3.291  3.537   -4.934  1.00 0.00 ? 20 ARG A CA   11 
ATOM 11780 C C    . ARG A 1 20 ? -1.809  3.178   -4.975  1.00 0.00 ? 20 ARG A C    11 
ATOM 11781 O O    . ARG A 1 20 ? -1.354  2.479   -5.880  1.00 0.00 ? 20 ARG A O    11 
ATOM 11782 C CB   . ARG A 1 20 ? -3.512  4.911   -5.569  1.00 0.00 ? 20 ARG A CB   11 
ATOM 11783 C CG   . ARG A 1 20 ? -4.844  5.042   -6.290  1.00 0.00 ? 20 ARG A CG   11 
ATOM 11784 C CD   . ARG A 1 20 ? -4.714  4.702   -7.766  1.00 0.00 ? 20 ARG A CD   11 
ATOM 11785 N NE   . ARG A 1 20 ? -4.493  5.891   -8.585  1.00 0.00 ? 20 ARG A NE   11 
ATOM 11786 C CZ   . ARG A 1 20 ? -4.312  5.855   -9.900  1.00 0.00 ? 20 ARG A CZ   11 
ATOM 11787 N NH1  . ARG A 1 20 ? -4.326  4.695   -10.543 1.00 0.00 ? 20 ARG A NH1  11 
ATOM 11788 N NH2  . ARG A 1 20 ? -4.117  6.980   -10.575 1.00 0.00 ? 20 ARG A NH2  11 
ATOM 11789 H H    . ARG A 1 20 ? -4.117  4.361   -3.168  1.00 0.00 ? 20 ARG A H    11 
ATOM 11790 H HA   . ARG A 1 20 ? -3.844  2.798   -5.495  1.00 0.00 ? 20 ARG A HA   11 
ATOM 11791 H HB2  . ARG A 1 20 ? -3.471  5.663   -4.795  1.00 0.00 ? 20 ARG A HB2  11 
ATOM 11792 H HB3  . ARG A 1 20 ? -2.722  5.095   -6.282  1.00 0.00 ? 20 ARG A HB3  11 
ATOM 11793 H HG2  . ARG A 1 20 ? -5.555  4.366   -5.838  1.00 0.00 ? 20 ARG A HG2  11 
ATOM 11794 H HG3  . ARG A 1 20 ? -5.197  6.057   -6.193  1.00 0.00 ? 20 ARG A HG3  11 
ATOM 11795 H HD2  . ARG A 1 20 ? -3.880  4.028   -7.895  1.00 0.00 ? 20 ARG A HD2  11 
ATOM 11796 H HD3  . ARG A 1 20 ? -5.622  4.216   -8.091  1.00 0.00 ? 20 ARG A HD3  11 
ATOM 11797 H HE   . ARG A 1 20 ? -4.479  6.758   -8.130  1.00 0.00 ? 20 ARG A HE   11 
ATOM 11798 H HH11 . ARG A 1 20 ? -4.474  3.846   -10.037 1.00 0.00 ? 20 ARG A HH11 11 
ATOM 11799 H HH12 . ARG A 1 20 ? -4.191  4.671   -11.534 1.00 0.00 ? 20 ARG A HH12 11 
ATOM 11800 H HH21 . ARG A 1 20 ? -4.106  7.856   -10.094 1.00 0.00 ? 20 ARG A HH21 11 
ATOM 11801 H HH22 . ARG A 1 20 ? -3.981  6.952   -11.565 1.00 0.00 ? 20 ARG A HH22 11 
ATOM 11802 N N    . GLU A 1 21 ? -1.060  3.663   -3.988  1.00 0.00 ? 21 GLU A N    11 
ATOM 11803 C CA   . GLU A 1 21 ? 0.371   3.394   -3.913  1.00 0.00 ? 21 GLU A CA   11 
ATOM 11804 C C    . GLU A 1 21 ? 0.635   2.014   -3.316  1.00 0.00 ? 21 GLU A C    11 
ATOM 11805 O O    . GLU A 1 21 ? 1.580   1.327   -3.706  1.00 0.00 ? 21 GLU A O    11 
ATOM 11806 C CB   . GLU A 1 21 ? 1.070   4.466   -3.075  1.00 0.00 ? 21 GLU A CB   11 
ATOM 11807 C CG   . GLU A 1 21 ? 0.832   5.881   -3.575  1.00 0.00 ? 21 GLU A CG   11 
ATOM 11808 C CD   . GLU A 1 21 ? -0.228  6.612   -2.775  1.00 0.00 ? 21 GLU A CD   11 
ATOM 11809 O OE1  . GLU A 1 21 ? -1.020  5.939   -2.084  1.00 0.00 ? 21 GLU A OE1  11 
ATOM 11810 O OE2  . GLU A 1 21 ? -0.265  7.859   -2.840  1.00 0.00 ? 21 GLU A OE2  11 
ATOM 11811 H H    . GLU A 1 21 ? -1.481  4.214   -3.295  1.00 0.00 ? 21 GLU A H    11 
ATOM 11812 H HA   . GLU A 1 21 ? 0.766   3.420   -4.917  1.00 0.00 ? 21 GLU A HA   11 
ATOM 11813 H HB2  . GLU A 1 21 ? 0.713   4.401   -2.058  1.00 0.00 ? 21 GLU A HB2  11 
ATOM 11814 H HB3  . GLU A 1 21 ? 2.133   4.277   -3.086  1.00 0.00 ? 21 GLU A HB3  11 
ATOM 11815 H HG2  . GLU A 1 21 ? 1.757   6.434   -3.507  1.00 0.00 ? 21 GLU A HG2  11 
ATOM 11816 H HG3  . GLU A 1 21 ? 0.517   5.836   -4.607  1.00 0.00 ? 21 GLU A HG3  11 
ATOM 11817 N N    . LEU A 1 22 ? -0.206  1.615   -2.369  1.00 0.00 ? 22 LEU A N    11 
ATOM 11818 C CA   . LEU A 1 22 ? -0.065  0.318   -1.717  1.00 0.00 ? 22 LEU A CA   11 
ATOM 11819 C C    . LEU A 1 22 ? -0.409  -0.815  -2.678  1.00 0.00 ? 22 LEU A C    11 
ATOM 11820 O O    . LEU A 1 22 ? 0.301   -1.817  -2.751  1.00 0.00 ? 22 LEU A O    11 
ATOM 11821 C CB   . LEU A 1 22 ? -0.965  0.245   -0.482  1.00 0.00 ? 22 LEU A CB   11 
ATOM 11822 C CG   . LEU A 1 22 ? -0.737  1.322   0.579   1.00 0.00 ? 22 LEU A CG   11 
ATOM 11823 C CD1  . LEU A 1 22 ? -1.947  1.436   1.493   1.00 0.00 ? 22 LEU A CD1  11 
ATOM 11824 C CD2  . LEU A 1 22 ? 0.516   1.017   1.388   1.00 0.00 ? 22 LEU A CD2  11 
ATOM 11825 H H    . LEU A 1 22 ? -0.940  2.206   -2.100  1.00 0.00 ? 22 LEU A H    11 
ATOM 11826 H HA   . LEU A 1 22 ? 0.965   0.213   -1.409  1.00 0.00 ? 22 LEU A HA   11 
ATOM 11827 H HB2  . LEU A 1 22 ? -1.989  0.320   -0.814  1.00 0.00 ? 22 LEU A HB2  11 
ATOM 11828 H HB3  . LEU A 1 22 ? -0.809  -0.718  -0.017  1.00 0.00 ? 22 LEU A HB3  11 
ATOM 11829 H HG   . LEU A 1 22 ? -0.597  2.276   0.091   1.00 0.00 ? 22 LEU A HG   11 
ATOM 11830 H HD11 . LEU A 1 22 ? -2.519  0.521   1.449   1.00 0.00 ? 22 LEU A HD11 11 
ATOM 11831 H HD12 . LEU A 1 22 ? -2.565  2.262   1.170   1.00 0.00 ? 22 LEU A HD12 11 
ATOM 11832 H HD13 . LEU A 1 22 ? -1.618  1.608   2.507   1.00 0.00 ? 22 LEU A HD13 11 
ATOM 11833 H HD21 . LEU A 1 22 ? 0.887   1.928   1.833   1.00 0.00 ? 22 LEU A HD21 11 
ATOM 11834 H HD22 . LEU A 1 22 ? 1.272   0.602   0.737   1.00 0.00 ? 22 LEU A HD22 11 
ATOM 11835 H HD23 . LEU A 1 22 ? 0.279   0.306   2.165   1.00 0.00 ? 22 LEU A HD23 11 
ATOM 11836 N N    . GLU A 1 23 ? -1.502  -0.647  -3.416  1.00 0.00 ? 23 GLU A N    11 
ATOM 11837 C CA   . GLU A 1 23 ? -1.938  -1.655  -4.375  1.00 0.00 ? 23 GLU A CA   11 
ATOM 11838 C C    . GLU A 1 23 ? -0.980  -1.731  -5.560  1.00 0.00 ? 23 GLU A C    11 
ATOM 11839 O O    . GLU A 1 23 ? -0.635  -2.818  -6.024  1.00 0.00 ? 23 GLU A O    11 
ATOM 11840 C CB   . GLU A 1 23 ? -3.353  -1.344  -4.868  1.00 0.00 ? 23 GLU A CB   11 
ATOM 11841 C CG   . GLU A 1 23 ? -4.406  -1.402  -3.774  1.00 0.00 ? 23 GLU A CG   11 
ATOM 11842 C CD   . GLU A 1 23 ? -5.728  -0.798  -4.205  1.00 0.00 ? 23 GLU A CD   11 
ATOM 11843 O OE1  . GLU A 1 23 ? -5.728  0.025   -5.144  1.00 0.00 ? 23 GLU A OE1  11 
ATOM 11844 O OE2  . GLU A 1 23 ? -6.764  -1.150  -3.602  1.00 0.00 ? 23 GLU A OE2  11 
ATOM 11845 H H    . GLU A 1 23 ? -2.027  0.174   -3.313  1.00 0.00 ? 23 GLU A H    11 
ATOM 11846 H HA   . GLU A 1 23 ? -1.945  -2.610  -3.871  1.00 0.00 ? 23 GLU A HA   11 
ATOM 11847 H HB2  . GLU A 1 23 ? -3.362  -0.352  -5.296  1.00 0.00 ? 23 GLU A HB2  11 
ATOM 11848 H HB3  . GLU A 1 23 ? -3.619  -2.058  -5.633  1.00 0.00 ? 23 GLU A HB3  11 
ATOM 11849 H HG2  . GLU A 1 23 ? -4.570  -2.434  -3.504  1.00 0.00 ? 23 GLU A HG2  11 
ATOM 11850 H HG3  . GLU A 1 23 ? -4.042  -0.