data_2CZY
# 
_entry.id   2CZY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CZY         
RCSB  RCSB024815   
WWPDB D_1000024815 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CZY 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nomura, M.'     1 
'Uda-Tochio, H.' 2 
'Murai, K.'      3 
'Mori, N.'       4 
'Nishimura, Y.'  5 
# 
_citation.id                        primary 
_citation.title                     
'The Neural Repressor NRSF/REST Binds the PAH1 Domain of the Sin3 Corepressor by Using its Distinct Short Hydrophobic Helix' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            354 
_citation.page_first                903 
_citation.page_last                 915 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16288918 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.10.008 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nomura, M.'     1 
primary 'Uda-Tochio, H.' 2 
primary 'Murai, K.'      3 
primary 'Mori, N.'       4 
primary 'Nishimura, Y.'  5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Paired amphipathic helix protein Sin3b' 8813.080 1 ? ? 'PAH1 domain (residues 31-107)'            ? 
2 polymer syn 'transcription factor REST (version 3)'  1540.822 1 ? ? 'Sin3 interaction domain (residues 43-57)' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Sin3B, Transcriptional corepressor Sin3b, Histone deacetylase complex subunit Sin3b' 
2 NRSF/REST                                                                             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPK 
PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPK A ? 
2 'polypeptide(L)' no no APQLIMLANVALTGE                                                               APQLIMLANVALTGE B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  VAL n 
1 3  HIS n 
1 4  VAL n 
1 5  GLU n 
1 6  ASP n 
1 7  ALA n 
1 8  LEU n 
1 9  THR n 
1 10 TYR n 
1 11 LEU n 
1 12 ASP n 
1 13 GLN n 
1 14 VAL n 
1 15 LYS n 
1 16 ILE n 
1 17 ARG n 
1 18 PHE n 
1 19 GLY n 
1 20 SER n 
1 21 ASP n 
1 22 PRO n 
1 23 ALA n 
1 24 THR n 
1 25 TYR n 
1 26 ASN n 
1 27 GLY n 
1 28 PHE n 
1 29 LEU n 
1 30 GLU n 
1 31 ILE n 
1 32 MET n 
1 33 LYS n 
1 34 GLU n 
1 35 PHE n 
1 36 LYS n 
1 37 SER n 
1 38 GLN n 
1 39 SER n 
1 40 ILE n 
1 41 ASP n 
1 42 THR n 
1 43 PRO n 
1 44 GLY n 
1 45 VAL n 
1 46 ILE n 
1 47 ARG n 
1 48 ARG n 
1 49 VAL n 
1 50 SER n 
1 51 GLN n 
1 52 LEU n 
1 53 PHE n 
1 54 HIS n 
1 55 GLU n 
1 56 HIS n 
1 57 PRO n 
1 58 ASP n 
1 59 LEU n 
1 60 ILE n 
1 61 VAL n 
1 62 GLY n 
1 63 PHE n 
1 64 ASN n 
1 65 ALA n 
1 66 PHE n 
1 67 LEU n 
1 68 PRO n 
1 69 LEU n 
1 70 GLY n 
1 71 TYR n 
1 72 ARG n 
1 73 ILE n 
1 74 ASP n 
1 75 ILE n 
1 76 PRO n 
1 77 LYS n 
2 1  ALA n 
2 2  PRO n 
2 3  GLN n 
2 4  LEU n 
2 5  ILE n 
2 6  MET n 
2 7  LEU n 
2 8  ALA n 
2 9  ASN n 
2 10 VAL n 
2 11 ALA n 
2 12 LEU n 
2 13 THR n 
2 14 GLY n 
2 15 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 Sin3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SIN3B_MOUSE  Q62141 1 PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPK 31 ? 
2 UNP Q13127_HUMAN Q13127 2 APQLIMLANVALTGE                                                               43 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CZY A 1 ? 77 ? Q62141 31 ? 107 ? 31 107 
2 2 2CZY B 1 ? 15 ? Q13127 43 ? 57  ? 43 57  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY           1 
2 1 2D_X-filtered_NOESY              1 
3 1 HNHA                             1 
4 1 3D_13C-separated_NOESY           2 
5 1 2D_X-filtered_NOESY              2 
6 1 3D_13C-filtered_13C-edited_NOESY 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '20mM potassium phosphate' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.5-0.8mM PAH1 U-15N,13C; 0.5-0.8mM SID; 20mM potassium phosphate buffer' '95% H2O/5% D2O' 
2 '0.5-0.8mM PAH1 U-15N,13C; 0.5-0.8mM SID; 20mM potassium phosphate buffer' '100% D2O'       
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2CZY 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2CZY 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2CZY 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement      CNS     1.1   Brunger  1 
processing      NMRPipe 2004  Delaglio 2 
'data analysis' NMRView 5.0.4 Johnson  3 
# 
_exptl.entry_id          2CZY 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CZY 
_struct.title                     'Solution structure of the NRSF/REST-mSin3B PAH1 complex' 
_struct.pdbx_descriptor           'Paired amphipathic helix protein Sin3b, transcription factor REST (version 3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CZY 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            'NRSF, Sin3, PAH1, transcriptional repressor, GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 4  ? ARG A 17 ? VAL A 34 ARG A 47 1 ? 14 
HELX_P HELX_P2 2 PRO A 22 ? LYS A 36 ? PRO A 52 LYS A 66 1 ? 15 
HELX_P HELX_P3 3 THR A 42 ? LEU A 52 ? THR A 72 LEU A 82 1 ? 11 
HELX_P HELX_P4 4 PRO A 57 ? ASN A 64 ? PRO A 87 ASN A 94 1 ? 8  
HELX_P HELX_P5 5 PRO B 2  ? LEU B 12 ? PRO B 44 LEU B 54 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2CZY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CZY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PRO A 1 1  ? 2.744   13.454  -7.692  1.00 0.00 ? 31  PRO A N    1  
ATOM 2     C CA   . PRO A 1 1  ? 2.623   14.104  -6.359  1.00 0.00 ? 31  PRO A CA   1  
ATOM 3     C C    . PRO A 1 1  ? 1.888   13.213  -5.358  1.00 0.00 ? 31  PRO A C    1  
ATOM 4     O O    . PRO A 1 1  ? 0.657   13.170  -5.339  1.00 0.00 ? 31  PRO A O    1  
ATOM 5     C CB   . PRO A 1 1  ? 1.874   15.419  -6.555  1.00 0.00 ? 31  PRO A CB   1  
ATOM 6     C CG   . PRO A 1 1  ? 1.451   15.395  -7.986  1.00 0.00 ? 31  PRO A CG   1  
ATOM 7     C CD   . PRO A 1 1  ? 2.412   14.476  -8.699  1.00 0.00 ? 31  PRO A CD   1  
ATOM 8     H H2   . PRO A 1 1  ? 2.124   12.632  -7.602  1.00 0.00 ? 31  PRO A H2   1  
ATOM 9     H H3   . PRO A 1 1  ? 3.712   13.059  -7.644  1.00 0.00 ? 31  PRO A H3   1  
ATOM 10    H HA   . PRO A 1 1  ? 3.615   14.311  -5.985  1.00 0.00 ? 31  PRO A HA   1  
ATOM 11    H HB2  . PRO A 1 1  ? 1.024   15.458  -5.888  1.00 0.00 ? 31  PRO A HB2  1  
ATOM 12    H HB3  . PRO A 1 1  ? 2.535   16.249  -6.354  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 13    H HG2  . PRO A 1 1  ? 0.443   15.014  -8.062  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 14    H HG3  . PRO A 1 1  ? 1.508   16.391  -8.400  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 15    H HD2  . PRO A 1 1  ? 1.934   14.026  -9.558  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 16    H HD3  . PRO A 1 1  ? 3.296   15.017  -9.000  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 17    N N    . VAL A 1 2  ? 2.650   12.507  -4.530  1.00 0.00 ? 32  VAL A N    1  
ATOM 18    C CA   . VAL A 1 2  ? 2.082   11.623  -3.531  1.00 0.00 ? 32  VAL A CA   1  
ATOM 19    C C    . VAL A 1 2  ? 1.346   12.409  -2.451  1.00 0.00 ? 32  VAL A C    1  
ATOM 20    O O    . VAL A 1 2  ? 1.903   12.701  -1.393  1.00 0.00 ? 32  VAL A O    1  
ATOM 21    C CB   . VAL A 1 2  ? 3.177   10.768  -2.874  1.00 0.00 ? 32  VAL A CB   1  
ATOM 22    C CG1  . VAL A 1 2  ? 3.586   9.623   -3.788  1.00 0.00 ? 32  VAL A CG1  1  
ATOM 23    C CG2  . VAL A 1 2  ? 4.381   11.621  -2.501  1.00 0.00 ? 32  VAL A CG2  1  
ATOM 24    H H    . VAL A 1 2  ? 3.622   12.581  -4.590  1.00 0.00 ? 32  VAL A H    1  
ATOM 25    H HA   . VAL A 1 2  ? 1.384   10.962  -4.024  1.00 0.00 ? 32  VAL A HA   1  
ATOM 26    H HB   . VAL A 1 2  ? 2.773   10.350  -1.975  1.00 0.00 ? 32  VAL A HB   1  
ATOM 27    H HG11 . VAL A 1 2  ? 3.759   8.736   -3.197  1.00 0.00 ? 32  VAL A HG11 1  
ATOM 28    H HG12 . VAL A 1 2  ? 4.491   9.889   -4.313  1.00 0.00 ? 32  VAL A HG12 1  
ATOM 29    H HG13 . VAL A 1 2  ? 2.799   9.434   -4.502  1.00 0.00 ? 32  VAL A HG13 1  
ATOM 30    H HG21 . VAL A 1 2  ? 5.103   11.594  -3.302  1.00 0.00 ? 32  VAL A HG21 1  
ATOM 31    H HG22 . VAL A 1 2  ? 4.828   11.236  -1.597  1.00 0.00 ? 32  VAL A HG22 1  
ATOM 32    H HG23 . VAL A 1 2  ? 4.063   12.641  -2.337  1.00 0.00 ? 32  VAL A HG23 1  
ATOM 33    N N    . HIS A 1 3  ? 0.091   12.750  -2.726  1.00 0.00 ? 33  HIS A N    1  
ATOM 34    C CA   . HIS A 1 3  ? -0.721  13.502  -1.777  1.00 0.00 ? 33  HIS A CA   1  
ATOM 35    C C    . HIS A 1 3  ? -2.026  12.770  -1.480  1.00 0.00 ? 33  HIS A C    1  
ATOM 36    O O    . HIS A 1 3  ? -2.252  11.663  -1.968  1.00 0.00 ? 33  HIS A O    1  
ATOM 37    C CB   . HIS A 1 3  ? -1.019  14.900  -2.325  1.00 0.00 ? 33  HIS A CB   1  
ATOM 38    C CG   . HIS A 1 3  ? 0.155   15.827  -2.268  1.00 0.00 ? 33  HIS A CG   1  
ATOM 39    N ND1  . HIS A 1 3  ? 1.194   15.784  -3.174  1.00 0.00 ? 33  HIS A ND1  1  
ATOM 40    C CD2  . HIS A 1 3  ? 0.452   16.830  -1.406  1.00 0.00 ? 33  HIS A CD2  1  
ATOM 41    C CE1  . HIS A 1 3  ? 2.080   16.716  -2.870  1.00 0.00 ? 33  HIS A CE1  1  
ATOM 42    N NE2  . HIS A 1 3  ? 1.652   17.364  -1.803  1.00 0.00 ? 33  HIS A NE2  1  
ATOM 43    H H    . HIS A 1 3  ? -0.297  12.489  -3.586  1.00 0.00 ? 33  HIS A H    1  
ATOM 44    H HA   . HIS A 1 3  ? -0.159  13.597  -0.861  1.00 0.00 ? 33  HIS A HA   1  
ATOM 45    H HB2  . HIS A 1 3  ? -1.325  14.816  -3.358  1.00 0.00 ? 33  HIS A HB2  1  
ATOM 46    H HB3  . HIS A 1 3  ? -1.821  15.341  -1.752  1.00 0.00 ? 33  HIS A HB3  1  
ATOM 47    H HD1  . HIS A 1 3  ? 1.272   15.160  -3.925  1.00 0.00 ? 33  HIS A HD1  1  
ATOM 48    H HD2  . HIS A 1 3  ? -0.145  17.148  -0.564  1.00 0.00 ? 33  HIS A HD2  1  
ATOM 49    H HE1  . HIS A 1 3  ? 2.997   16.914  -3.406  1.00 0.00 ? 33  HIS A HE1  1  
ATOM 50    H HE2  . HIS A 1 3  ? 2.075   18.161  -1.420  1.00 0.00 ? 33  HIS A HE2  1  
ATOM 51    N N    . VAL A 1 4  ? -2.883  13.395  -0.676  1.00 0.00 ? 34  VAL A N    1  
ATOM 52    C CA   . VAL A 1 4  ? -4.166  12.802  -0.316  1.00 0.00 ? 34  VAL A CA   1  
ATOM 53    C C    . VAL A 1 4  ? -4.947  12.378  -1.556  1.00 0.00 ? 34  VAL A C    1  
ATOM 54    O O    . VAL A 1 4  ? -5.739  11.437  -1.511  1.00 0.00 ? 34  VAL A O    1  
ATOM 55    C CB   . VAL A 1 4  ? -5.024  13.780  0.509   1.00 0.00 ? 34  VAL A CB   1  
ATOM 56    C CG1  . VAL A 1 4  ? -6.279  13.090  1.023   1.00 0.00 ? 34  VAL A CG1  1  
ATOM 57    C CG2  . VAL A 1 4  ? -4.216  14.363  1.662   1.00 0.00 ? 34  VAL A CG2  1  
ATOM 58    H H    . VAL A 1 4  ? -2.646  14.277  -0.319  1.00 0.00 ? 34  VAL A H    1  
ATOM 59    H HA   . VAL A 1 4  ? -3.970  11.929  0.290   1.00 0.00 ? 34  VAL A HA   1  
ATOM 60    H HB   . VAL A 1 4  ? -5.327  14.592  -0.135  1.00 0.00 ? 34  VAL A HB   1  
ATOM 61    H HG11 . VAL A 1 4  ? -7.097  13.278  0.343   1.00 0.00 ? 34  VAL A HG11 1  
ATOM 62    H HG12 . VAL A 1 4  ? -6.528  13.475  2.000   1.00 0.00 ? 34  VAL A HG12 1  
ATOM 63    H HG13 . VAL A 1 4  ? -6.103  12.027  1.090   1.00 0.00 ? 34  VAL A HG13 1  
ATOM 64    H HG21 . VAL A 1 4  ? -4.266  15.441  1.627   1.00 0.00 ? 34  VAL A HG21 1  
ATOM 65    H HG22 . VAL A 1 4  ? -3.186  14.048  1.577   1.00 0.00 ? 34  VAL A HG22 1  
ATOM 66    H HG23 . VAL A 1 4  ? -4.621  14.014  2.600   1.00 0.00 ? 34  VAL A HG23 1  
ATOM 67    N N    . GLU A 1 5  ? -4.714  13.077  -2.663  1.00 0.00 ? 35  GLU A N    1  
ATOM 68    C CA   . GLU A 1 5  ? -5.394  12.773  -3.916  1.00 0.00 ? 35  GLU A CA   1  
ATOM 69    C C    . GLU A 1 5  ? -4.849  11.485  -4.529  1.00 0.00 ? 35  GLU A C    1  
ATOM 70    O O    . GLU A 1 5  ? -5.608  10.659  -5.036  1.00 0.00 ? 35  GLU A O    1  
ATOM 71    C CB   . GLU A 1 5  ? -5.235  13.932  -4.902  1.00 0.00 ? 35  GLU A CB   1  
ATOM 72    C CG   . GLU A 1 5  ? -6.554  14.454  -5.447  1.00 0.00 ? 35  GLU A CG   1  
ATOM 73    C CD   . GLU A 1 5  ? -7.335  13.393  -6.198  1.00 0.00 ? 35  GLU A CD   1  
ATOM 74    O OE1  . GLU A 1 5  ? -6.986  13.111  -7.364  1.00 0.00 ? 35  GLU A OE1  1  
ATOM 75    O OE2  . GLU A 1 5  ? -8.295  12.842  -5.619  1.00 0.00 ? 35  GLU A OE2  1  
ATOM 76    H H    . GLU A 1 5  ? -4.070  13.815  -2.636  1.00 0.00 ? 35  GLU A H    1  
ATOM 77    H HA   . GLU A 1 5  ? -6.443  12.638  -3.700  1.00 0.00 ? 35  GLU A HA   1  
ATOM 78    H HB2  . GLU A 1 5  ? -4.730  14.747  -4.404  1.00 0.00 ? 35  GLU A HB2  1  
ATOM 79    H HB3  . GLU A 1 5  ? -4.630  13.603  -5.735  1.00 0.00 ? 35  GLU A HB3  1  
ATOM 80    H HG2  . GLU A 1 5  ? -7.156  14.806  -4.623  1.00 0.00 ? 35  GLU A HG2  1  
ATOM 81    H HG3  . GLU A 1 5  ? -6.352  15.275  -6.120  1.00 0.00 ? 35  GLU A HG3  1  
ATOM 82    N N    . ASP A 1 6  ? -3.531  11.322  -4.475  1.00 0.00 ? 36  ASP A N    1  
ATOM 83    C CA   . ASP A 1 6  ? -2.885  10.135  -5.024  1.00 0.00 ? 36  ASP A CA   1  
ATOM 84    C C    . ASP A 1 6  ? -3.248  8.896   -4.212  1.00 0.00 ? 36  ASP A C    1  
ATOM 85    O O    . ASP A 1 6  ? -3.452  7.816   -4.767  1.00 0.00 ? 36  ASP A O    1  
ATOM 86    C CB   . ASP A 1 6  ? -1.367  10.318  -5.047  1.00 0.00 ? 36  ASP A CB   1  
ATOM 87    C CG   . ASP A 1 6  ? -0.733  9.736   -6.297  1.00 0.00 ? 36  ASP A CG   1  
ATOM 88    O OD1  . ASP A 1 6  ? -0.477  8.515   -6.317  1.00 0.00 ? 36  ASP A OD1  1  
ATOM 89    O OD2  . ASP A 1 6  ? -0.494  10.503  -7.252  1.00 0.00 ? 36  ASP A OD2  1  
ATOM 90    H H    . ASP A 1 6  ? -2.980  12.016  -4.057  1.00 0.00 ? 36  ASP A H    1  
ATOM 91    H HA   . ASP A 1 6  ? -3.239  10.004  -6.036  1.00 0.00 ? 36  ASP A HA   1  
ATOM 92    H HB2  . ASP A 1 6  ? -1.137  11.373  -5.009  1.00 0.00 ? 36  ASP A HB2  1  
ATOM 93    H HB3  . ASP A 1 6  ? -0.937  9.828   -4.186  1.00 0.00 ? 36  ASP A HB3  1  
ATOM 94    N N    . ALA A 1 7  ? -3.330  9.060   -2.896  1.00 0.00 ? 37  ALA A N    1  
ATOM 95    C CA   . ALA A 1 7  ? -3.671  7.954   -2.010  1.00 0.00 ? 37  ALA A CA   1  
ATOM 96    C C    . ALA A 1 7  ? -5.148  7.596   -2.132  1.00 0.00 ? 37  ALA A C    1  
ATOM 97    O O    . ALA A 1 7  ? -5.526  6.429   -2.021  1.00 0.00 ? 37  ALA A O    1  
ATOM 98    C CB   . ALA A 1 7  ? -3.328  8.306   -0.570  1.00 0.00 ? 37  ALA A CB   1  
ATOM 99    H H    . ALA A 1 7  ? -3.158  9.946   -2.513  1.00 0.00 ? 37  ALA A H    1  
ATOM 100   H HA   . ALA A 1 7  ? -3.078  7.099   -2.299  1.00 0.00 ? 37  ALA A HA   1  
ATOM 101   H HB1  . ALA A 1 7  ? -2.260  8.233   -0.427  1.00 0.00 ? 37  ALA A HB1  1  
ATOM 102   H HB2  . ALA A 1 7  ? -3.829  7.619   0.096   1.00 0.00 ? 37  ALA A HB2  1  
ATOM 103   H HB3  . ALA A 1 7  ? -3.652  9.313   -0.359  1.00 0.00 ? 37  ALA A HB3  1  
ATOM 104   N N    . LEU A 1 8  ? -5.979  8.607   -2.363  1.00 0.00 ? 38  LEU A N    1  
ATOM 105   C CA   . LEU A 1 8  ? -7.415  8.401   -2.501  1.00 0.00 ? 38  LEU A CA   1  
ATOM 106   C C    . LEU A 1 8  ? -7.727  7.532   -3.715  1.00 0.00 ? 38  LEU A C    1  
ATOM 107   O O    . LEU A 1 8  ? -8.417  6.519   -3.605  1.00 0.00 ? 38  LEU A O    1  
ATOM 108   C CB   . LEU A 1 8  ? -8.134  9.748   -2.621  1.00 0.00 ? 38  LEU A CB   1  
ATOM 109   C CG   . LEU A 1 8  ? -8.728  10.283  -1.317  1.00 0.00 ? 38  LEU A CG   1  
ATOM 110   C CD1  . LEU A 1 8  ? -8.859  11.797  -1.372  1.00 0.00 ? 38  LEU A CD1  1  
ATOM 111   C CD2  . LEU A 1 8  ? -10.079 9.639   -1.045  1.00 0.00 ? 38  LEU A CD2  1  
ATOM 112   H H    . LEU A 1 8  ? -5.617  9.514   -2.441  1.00 0.00 ? 38  LEU A H    1  
ATOM 113   H HA   . LEU A 1 8  ? -7.763  7.897   -1.613  1.00 0.00 ? 38  LEU A HA   1  
ATOM 114   H HB2  . LEU A 1 8  ? -7.430  10.475  -2.997  1.00 0.00 ? 38  LEU A HB2  1  
ATOM 115   H HB3  . LEU A 1 8  ? -8.935  9.643   -3.339  1.00 0.00 ? 38  LEU A HB3  1  
ATOM 116   H HG   . LEU A 1 8  ? -8.068  10.034  -0.499  1.00 0.00 ? 38  LEU A HG   1  
ATOM 117   H HD11 . LEU A 1 8  ? -8.131  12.196  -2.063  1.00 0.00 ? 38  LEU A HD11 1  
ATOM 118   H HD12 . LEU A 1 8  ? -8.684  12.208  -0.389  1.00 0.00 ? 38  LEU A HD12 1  
ATOM 119   H HD13 . LEU A 1 8  ? -9.852  12.062  -1.702  1.00 0.00 ? 38  LEU A HD13 1  
ATOM 120   H HD21 . LEU A 1 8  ? -10.136 8.692   -1.560  1.00 0.00 ? 38  LEU A HD21 1  
ATOM 121   H HD22 . LEU A 1 8  ? -10.866 10.289  -1.400  1.00 0.00 ? 38  LEU A HD22 1  
ATOM 122   H HD23 . LEU A 1 8  ? -10.196 9.481   0.016   1.00 0.00 ? 38  LEU A HD23 1  
ATOM 123   N N    . THR A 1 9  ? -7.214  7.935   -4.874  1.00 0.00 ? 39  THR A N    1  
ATOM 124   C CA   . THR A 1 9  ? -7.440  7.191   -6.108  1.00 0.00 ? 39  THR A CA   1  
ATOM 125   C C    . THR A 1 9  ? -6.912  5.766   -5.989  1.00 0.00 ? 39  THR A C    1  
ATOM 126   O O    . THR A 1 9  ? -7.556  4.815   -6.431  1.00 0.00 ? 39  THR A O    1  
ATOM 127   C CB   . THR A 1 9  ? -6.770  7.902   -7.290  1.00 0.00 ? 39  THR A CB   1  
ATOM 128   O OG1  . THR A 1 9  ? -7.321  7.458   -8.517  1.00 0.00 ? 39  THR A OG1  1  
ATOM 129   C CG2  . THR A 1 9  ? -5.270  7.689   -7.358  1.00 0.00 ? 39  THR A CG2  1  
ATOM 130   H H    . THR A 1 9  ? -6.672  8.752   -4.899  1.00 0.00 ? 39  THR A H    1  
ATOM 131   H HA   . THR A 1 9  ? -8.505  7.154   -6.281  1.00 0.00 ? 39  THR A HA   1  
ATOM 132   H HB   . THR A 1 9  ? -6.948  8.965   -7.204  1.00 0.00 ? 39  THR A HB   1  
ATOM 133   H HG1  . THR A 1 9  ? -7.410  8.204   -9.116  1.00 0.00 ? 39  THR A HG1  1  
ATOM 134   H HG21 . THR A 1 9  ? -4.802  8.148   -6.500  1.00 0.00 ? 39  THR A HG21 1  
ATOM 135   H HG22 . THR A 1 9  ? -4.883  8.136   -8.260  1.00 0.00 ? 39  THR A HG22 1  
ATOM 136   H HG23 . THR A 1 9  ? -5.055  6.627   -7.361  1.00 0.00 ? 39  THR A HG23 1  
ATOM 137   N N    . TYR A 1 10 ? -5.731  5.629   -5.395  1.00 0.00 ? 40  TYR A N    1  
ATOM 138   C CA   . TYR A 1 10 ? -5.108  4.322   -5.225  1.00 0.00 ? 40  TYR A CA   1  
ATOM 139   C C    . TYR A 1 10 ? -6.066  3.343   -4.552  1.00 0.00 ? 40  TYR A C    1  
ATOM 140   O O    . TYR A 1 10 ? -6.222  2.207   -4.997  1.00 0.00 ? 40  TYR A O    1  
ATOM 141   C CB   . TYR A 1 10 ? -3.826  4.446   -4.400  1.00 0.00 ? 40  TYR A CB   1  
ATOM 142   C CG   . TYR A 1 10 ? -2.949  3.215   -4.452  1.00 0.00 ? 40  TYR A CG   1  
ATOM 143   C CD1  . TYR A 1 10 ? -2.222  2.905   -5.596  1.00 0.00 ? 40  TYR A CD1  1  
ATOM 144   C CD2  . TYR A 1 10 ? -2.848  2.362   -3.360  1.00 0.00 ? 40  TYR A CD2  1  
ATOM 145   C CE1  . TYR A 1 10 ? -1.421  1.781   -5.649  1.00 0.00 ? 40  TYR A CE1  1  
ATOM 146   C CE2  . TYR A 1 10 ? -2.047  1.236   -3.405  1.00 0.00 ? 40  TYR A CE2  1  
ATOM 147   C CZ   . TYR A 1 10 ? -1.336  0.950   -4.551  1.00 0.00 ? 40  TYR A CZ   1  
ATOM 148   O OH   . TYR A 1 10 ? -0.539  -0.170  -4.600  1.00 0.00 ? 40  TYR A OH   1  
ATOM 149   H H    . TYR A 1 10 ? -5.264  6.427   -5.069  1.00 0.00 ? 40  TYR A H    1  
ATOM 150   H HA   . TYR A 1 10 ? -4.858  3.950   -6.206  1.00 0.00 ? 40  TYR A HA   1  
ATOM 151   H HB2  . TYR A 1 10 ? -3.248  5.280   -4.768  1.00 0.00 ? 40  TYR A HB2  1  
ATOM 152   H HB3  . TYR A 1 10 ? -4.087  4.624   -3.366  1.00 0.00 ? 40  TYR A HB3  1  
ATOM 153   H HD1  . TYR A 1 10 ? -2.290  3.558   -6.454  1.00 0.00 ? 40  TYR A HD1  1  
ATOM 154   H HD2  . TYR A 1 10 ? -3.407  2.588   -2.464  1.00 0.00 ? 40  TYR A HD2  1  
ATOM 155   H HE1  . TYR A 1 10 ? -0.863  1.557   -6.547  1.00 0.00 ? 40  TYR A HE1  1  
ATOM 156   H HE2  . TYR A 1 10 ? -1.982  0.585   -2.545  1.00 0.00 ? 40  TYR A HE2  1  
ATOM 157   H HH   . TYR A 1 10 ? 0.262   0.027   -5.092  1.00 0.00 ? 40  TYR A HH   1  
ATOM 158   N N    . LEU A 1 11 ? -6.704  3.795   -3.477  1.00 0.00 ? 41  LEU A N    1  
ATOM 159   C CA   . LEU A 1 11 ? -7.647  2.960   -2.742  1.00 0.00 ? 41  LEU A CA   1  
ATOM 160   C C    . LEU A 1 11 ? -8.845  2.595   -3.614  1.00 0.00 ? 41  LEU A C    1  
ATOM 161   O O    . LEU A 1 11 ? -9.292  1.449   -3.621  1.00 0.00 ? 41  LEU A O    1  
ATOM 162   C CB   . LEU A 1 11 ? -8.123  3.683   -1.481  1.00 0.00 ? 41  LEU A CB   1  
ATOM 163   C CG   . LEU A 1 11 ? -7.175  3.589   -0.284  1.00 0.00 ? 41  LEU A CG   1  
ATOM 164   C CD1  . LEU A 1 11 ? -7.581  4.577   0.797   1.00 0.00 ? 41  LEU A CD1  1  
ATOM 165   C CD2  . LEU A 1 11 ? -7.153  2.171   0.266   1.00 0.00 ? 41  LEU A CD2  1  
ATOM 166   H H    . LEU A 1 11 ? -6.538  4.711   -3.171  1.00 0.00 ? 41  LEU A H    1  
ATOM 167   H HA   . LEU A 1 11 ? -7.136  2.054   -2.456  1.00 0.00 ? 41  LEU A HA   1  
ATOM 168   H HB2  . LEU A 1 11 ? -8.265  4.727   -1.721  1.00 0.00 ? 41  LEU A HB2  1  
ATOM 169   H HB3  . LEU A 1 11 ? -9.076  3.266   -1.189  1.00 0.00 ? 41  LEU A HB3  1  
ATOM 170   H HG   . LEU A 1 11 ? -6.175  3.839   -0.606  1.00 0.00 ? 41  LEU A HG   1  
ATOM 171   H HD11 . LEU A 1 11 ? -7.352  5.581   0.473   1.00 0.00 ? 41  LEU A HD11 1  
ATOM 172   H HD12 . LEU A 1 11 ? -7.039  4.360   1.706   1.00 0.00 ? 41  LEU A HD12 1  
ATOM 173   H HD13 . LEU A 1 11 ? -8.642  4.492   0.983   1.00 0.00 ? 41  LEU A HD13 1  
ATOM 174   H HD21 . LEU A 1 11 ? -7.019  1.472   -0.546  1.00 0.00 ? 41  LEU A HD21 1  
ATOM 175   H HD22 . LEU A 1 11 ? -8.088  1.965   0.766   1.00 0.00 ? 41  LEU A HD22 1  
ATOM 176   H HD23 . LEU A 1 11 ? -6.339  2.069   0.967   1.00 0.00 ? 41  LEU A HD23 1  
ATOM 177   N N    . ASP A 1 12 ? -9.358  3.577   -4.347  1.00 0.00 ? 42  ASP A N    1  
ATOM 178   C CA   . ASP A 1 12 ? -10.504 3.359   -5.223  1.00 0.00 ? 42  ASP A CA   1  
ATOM 179   C C    . ASP A 1 12 ? -10.139 2.433   -6.377  1.00 0.00 ? 42  ASP A C    1  
ATOM 180   O O    . ASP A 1 12 ? -10.983 1.701   -6.894  1.00 0.00 ? 42  ASP A O    1  
ATOM 181   C CB   . ASP A 1 12 ? -11.023 4.693   -5.762  1.00 0.00 ? 42  ASP A CB   1  
ATOM 182   C CG   . ASP A 1 12 ? -12.365 5.075   -5.168  1.00 0.00 ? 42  ASP A CG   1  
ATOM 183   O OD1  . ASP A 1 12 ? -12.528 4.941   -3.937  1.00 0.00 ? 42  ASP A OD1  1  
ATOM 184   O OD2  . ASP A 1 12 ? -13.253 5.505   -5.934  1.00 0.00 ? 42  ASP A OD2  1  
ATOM 185   H H    . ASP A 1 12 ? -8.957  4.470   -4.299  1.00 0.00 ? 42  ASP A H    1  
ATOM 186   H HA   . ASP A 1 12 ? -11.277 2.891   -4.640  1.00 0.00 ? 42  ASP A HA   1  
ATOM 187   H HB2  . ASP A 1 12 ? -10.313 5.471   -5.525  1.00 0.00 ? 42  ASP A HB2  1  
ATOM 188   H HB3  . ASP A 1 12 ? -11.131 4.626   -6.836  1.00 0.00 ? 42  ASP A HB3  1  
ATOM 189   N N    . GLN A 1 13 ? -8.874  2.470   -6.772  1.00 0.00 ? 43  GLN A N    1  
ATOM 190   C CA   . GLN A 1 13 ? -8.388  1.634   -7.864  1.00 0.00 ? 43  GLN A CA   1  
ATOM 191   C C    . GLN A 1 13 ? -8.192  0.197   -7.399  1.00 0.00 ? 43  GLN A C    1  
ATOM 192   O O    . GLN A 1 13 ? -8.358  -0.747  -8.171  1.00 0.00 ? 43  GLN A O    1  
ATOM 193   C CB   . GLN A 1 13 ? -7.076  2.191   -8.419  1.00 0.00 ? 43  GLN A CB   1  
ATOM 194   C CG   . GLN A 1 13 ? -6.979  2.119   -9.935  1.00 0.00 ? 43  GLN A CG   1  
ATOM 195   C CD   . GLN A 1 13 ? -7.152  3.473   -10.595 1.00 0.00 ? 43  GLN A CD   1  
ATOM 196   O OE1  . GLN A 1 13 ? -6.686  4.490   -10.084 1.00 0.00 ? 43  GLN A OE1  1  
ATOM 197   N NE2  . GLN A 1 13 ? -7.826  3.491   -11.740 1.00 0.00 ? 43  GLN A NE2  1  
ATOM 198   H H    . GLN A 1 13 ? -8.252  3.073   -6.316  1.00 0.00 ? 43  GLN A H    1  
ATOM 199   H HA   . GLN A 1 13 ? -9.132  1.646   -8.641  1.00 0.00 ? 43  GLN A HA   1  
ATOM 200   H HB2  . GLN A 1 13 ? -6.984  3.225   -8.123  1.00 0.00 ? 43  GLN A HB2  1  
ATOM 201   H HB3  . GLN A 1 13 ? -6.254  1.630   -8.000  1.00 0.00 ? 43  GLN A HB3  1  
ATOM 202   H HG2  . GLN A 1 13 ? -6.009  1.727   -10.202 1.00 0.00 ? 43  GLN A HG2  1  
ATOM 203   H HG3  . GLN A 1 13 ? -7.748  1.455   -10.301 1.00 0.00 ? 43  GLN A HG3  1  
ATOM 204   H HE21 . GLN A 1 13 ? -8.169  2.641   -12.089 1.00 0.00 ? 43  GLN A HE21 1  
ATOM 205   H HE22 . GLN A 1 13 ? -7.952  4.353   -12.189 1.00 0.00 ? 43  GLN A HE22 1  
ATOM 206   N N    . VAL A 1 14 ? -7.845  0.044   -6.131  1.00 0.00 ? 44  VAL A N    1  
ATOM 207   C CA   . VAL A 1 14 ? -7.628  -1.274  -5.547  1.00 0.00 ? 44  VAL A CA   1  
ATOM 208   C C    . VAL A 1 14 ? -8.955  -1.941  -5.195  1.00 0.00 ? 44  VAL A C    1  
ATOM 209   O O    . VAL A 1 14 ? -9.043  -3.167  -5.125  1.00 0.00 ? 44  VAL A O    1  
ATOM 210   C CB   . VAL A 1 14 ? -6.754  -1.190  -4.282  1.00 0.00 ? 44  VAL A CB   1  
ATOM 211   C CG1  . VAL A 1 14 ? -6.416  -2.582  -3.769  1.00 0.00 ? 44  VAL A CG1  1  
ATOM 212   C CG2  . VAL A 1 14 ? -5.487  -0.393  -4.558  1.00 0.00 ? 44  VAL A CG2  1  
ATOM 213   H H    . VAL A 1 14 ? -7.736  0.840   -5.572  1.00 0.00 ? 44  VAL A H    1  
ATOM 214   H HA   . VAL A 1 14 ? -7.113  -1.882  -6.277  1.00 0.00 ? 44  VAL A HA   1  
ATOM 215   H HB   . VAL A 1 14 ? -7.316  -0.676  -3.514  1.00 0.00 ? 44  VAL A HB   1  
ATOM 216   H HG11 . VAL A 1 14 ? -6.076  -3.195  -4.590  1.00 0.00 ? 44  VAL A HG11 1  
ATOM 217   H HG12 . VAL A 1 14 ? -7.295  -3.026  -3.327  1.00 0.00 ? 44  VAL A HG12 1  
ATOM 218   H HG13 . VAL A 1 14 ? -5.635  -2.512  -3.025  1.00 0.00 ? 44  VAL A HG13 1  
ATOM 219   H HG21 . VAL A 1 14 ? -5.338  0.331   -3.770  1.00 0.00 ? 44  VAL A HG21 1  
ATOM 220   H HG22 . VAL A 1 14 ? -5.583  0.120   -5.504  1.00 0.00 ? 44  VAL A HG22 1  
ATOM 221   H HG23 . VAL A 1 14 ? -4.642  -1.062  -4.596  1.00 0.00 ? 44  VAL A HG23 1  
ATOM 222   N N    . LYS A 1 15 ? -9.982  -1.127  -4.973  1.00 0.00 ? 45  LYS A N    1  
ATOM 223   C CA   . LYS A 1 15 ? -11.303 -1.640  -4.628  1.00 0.00 ? 45  LYS A CA   1  
ATOM 224   C C    . LYS A 1 15 ? -12.024 -2.164  -5.866  1.00 0.00 ? 45  LYS A C    1  
ATOM 225   O O    . LYS A 1 15 ? -12.634 -3.233  -5.836  1.00 0.00 ? 45  LYS A O    1  
ATOM 226   C CB   . LYS A 1 15 ? -12.138 -0.545  -3.959  1.00 0.00 ? 45  LYS A CB   1  
ATOM 227   C CG   . LYS A 1 15 ? -12.899 -1.023  -2.734  1.00 0.00 ? 45  LYS A CG   1  
ATOM 228   C CD   . LYS A 1 15 ? -13.352 0.143   -1.870  1.00 0.00 ? 45  LYS A CD   1  
ATOM 229   C CE   . LYS A 1 15 ? -14.455 -0.272  -0.908  1.00 0.00 ? 45  LYS A CE   1  
ATOM 230   N NZ   . LYS A 1 15 ? -15.781 -0.348  -1.581  1.00 0.00 ? 45  LYS A NZ   1  
ATOM 231   H H    . LYS A 1 15 ? -9.851  -0.160  -5.042  1.00 0.00 ? 45  LYS A H    1  
ATOM 232   H HA   . LYS A 1 15 ? -11.171 -2.455  -3.931  1.00 0.00 ? 45  LYS A HA   1  
ATOM 233   H HB2  . LYS A 1 15 ? -11.481 0.258   -3.658  1.00 0.00 ? 45  LYS A HB2  1  
ATOM 234   H HB3  . LYS A 1 15 ? -12.852 -0.165  -4.675  1.00 0.00 ? 45  LYS A HB3  1  
ATOM 235   H HG2  . LYS A 1 15 ? -13.768 -1.579  -3.056  1.00 0.00 ? 45  LYS A HG2  1  
ATOM 236   H HG3  . LYS A 1 15 ? -12.255 -1.664  -2.149  1.00 0.00 ? 45  LYS A HG3  1  
ATOM 237   H HD2  . LYS A 1 15 ? -12.510 0.506   -1.301  1.00 0.00 ? 45  LYS A HD2  1  
ATOM 238   H HD3  . LYS A 1 15 ? -13.724 0.930   -2.510  1.00 0.00 ? 45  LYS A HD3  1  
ATOM 239   H HE2  . LYS A 1 15 ? -14.212 -1.241  -0.499  1.00 0.00 ? 45  LYS A HE2  1  
ATOM 240   H HE3  . LYS A 1 15 ? -14.507 0.453   -0.109  1.00 0.00 ? 45  LYS A HE3  1  
ATOM 241   H HZ1  . LYS A 1 15 ? -15.884 -1.264  -2.063  1.00 0.00 ? 45  LYS A HZ1  1  
ATOM 242   H HZ2  . LYS A 1 15 ? -15.869 0.414   -2.284  1.00 0.00 ? 45  LYS A HZ2  1  
ATOM 243   H HZ3  . LYS A 1 15 ? -16.543 -0.249  -0.881  1.00 0.00 ? 45  LYS A HZ3  1  
ATOM 244   N N    . ILE A 1 16 ? -11.955 -1.402  -6.953  1.00 0.00 ? 46  ILE A N    1  
ATOM 245   C CA   . ILE A 1 16 ? -12.604 -1.787  -8.198  1.00 0.00 ? 46  ILE A CA   1  
ATOM 246   C C    . ILE A 1 16 ? -11.925 -3.002  -8.826  1.00 0.00 ? 46  ILE A C    1  
ATOM 247   O O    . ILE A 1 16 ? -12.585 -3.982  -9.172  1.00 0.00 ? 46  ILE A O    1  
ATOM 248   C CB   . ILE A 1 16 ? -12.603 -0.629  -9.217  1.00 0.00 ? 46  ILE A CB   1  
ATOM 249   C CG1  . ILE A 1 16 ? -13.158 0.646   -8.577  1.00 0.00 ? 46  ILE A CG1  1  
ATOM 250   C CG2  . ILE A 1 16 ? -13.415 -1.001  -10.450 1.00 0.00 ? 46  ILE A CG2  1  
ATOM 251   C CD1  . ILE A 1 16 ? -12.666 1.916   -9.235  1.00 0.00 ? 46  ILE A CD1  1  
ATOM 252   H H    . ILE A 1 16 ? -11.458 -0.559  -6.914  1.00 0.00 ? 46  ILE A H    1  
ATOM 253   H HA   . ILE A 1 16 ? -13.628 -2.036  -7.973  1.00 0.00 ? 46  ILE A HA   1  
ATOM 254   H HB   . ILE A 1 16 ? -11.584 -0.452  -9.528  1.00 0.00 ? 46  ILE A HB   1  
ATOM 255   H HG12 . ILE A 1 16 ? -14.235 0.635   -8.643  1.00 0.00 ? 46  ILE A HG12 1  
ATOM 256   H HG13 . ILE A 1 16 ? -12.865 0.676   -7.537  1.00 0.00 ? 46  ILE A HG13 1  
ATOM 257   H HG21 . ILE A 1 16 ? -13.058 -0.439  -11.300 1.00 0.00 ? 46  ILE A HG21 1  
ATOM 258   H HG22 . ILE A 1 16 ? -14.456 -0.771  -10.278 1.00 0.00 ? 46  ILE A HG22 1  
ATOM 259   H HG23 . ILE A 1 16 ? -13.308 -2.057  -10.646 1.00 0.00 ? 46  ILE A HG23 1  
ATOM 260   H HD11 . ILE A 1 16 ? -13.246 2.107   -10.127 1.00 0.00 ? 46  ILE A HD11 1  
ATOM 261   H HD12 . ILE A 1 16 ? -11.626 1.806   -9.501  1.00 0.00 ? 46  ILE A HD12 1  
ATOM 262   H HD13 . ILE A 1 16 ? -12.777 2.743   -8.551  1.00 0.00 ? 46  ILE A HD13 1  
ATOM 263   N N    . ARG A 1 17 ? -10.606 -2.930  -8.972  1.00 0.00 ? 47  ARG A N    1  
ATOM 264   C CA   . ARG A 1 17 ? -9.841  -4.024  -9.563  1.00 0.00 ? 47  ARG A CA   1  
ATOM 265   C C    . ARG A 1 17 ? -10.052 -5.324  -8.790  1.00 0.00 ? 47  ARG A C    1  
ATOM 266   O O    . ARG A 1 17 ? -9.972  -6.413  -9.357  1.00 0.00 ? 47  ARG A O    1  
ATOM 267   C CB   . ARG A 1 17 ? -8.352  -3.673  -9.601  1.00 0.00 ? 47  ARG A CB   1  
ATOM 268   C CG   . ARG A 1 17 ? -7.844  -3.333  -10.995 1.00 0.00 ? 47  ARG A CG   1  
ATOM 269   C CD   . ARG A 1 17 ? -7.505  -1.856  -11.124 1.00 0.00 ? 47  ARG A CD   1  
ATOM 270   N NE   . ARG A 1 17 ? -8.026  -1.281  -12.363 1.00 0.00 ? 47  ARG A NE   1  
ATOM 271   C CZ   . ARG A 1 17 ? -9.291  -0.904  -12.531 1.00 0.00 ? 47  ARG A CZ   1  
ATOM 272   N NH1  . ARG A 1 17 ? -10.169 -1.044  -11.547 1.00 0.00 ? 47  ARG A NH1  1  
ATOM 273   N NH2  . ARG A 1 17 ? -9.679  -0.387  -13.689 1.00 0.00 ? 47  ARG A NH2  1  
ATOM 274   H H    . ARG A 1 17 ? -10.135 -2.121  -8.680  1.00 0.00 ? 47  ARG A H    1  
ATOM 275   H HA   . ARG A 1 17 ? -10.194 -4.163  -10.574 1.00 0.00 ? 47  ARG A HA   1  
ATOM 276   H HB2  . ARG A 1 17 ? -8.178  -2.822  -8.960  1.00 0.00 ? 47  ARG A HB2  1  
ATOM 277   H HB3  . ARG A 1 17 ? -7.783  -4.513  -9.230  1.00 0.00 ? 47  ARG A HB3  1  
ATOM 278   H HG2  . ARG A 1 17 ? -6.957  -3.914  -11.195 1.00 0.00 ? 47  ARG A HG2  1  
ATOM 279   H HG3  . ARG A 1 17 ? -8.610  -3.582  -11.715 1.00 0.00 ? 47  ARG A HG3  1  
ATOM 280   H HD2  . ARG A 1 17 ? -7.932  -1.326  -10.287 1.00 0.00 ? 47  ARG A HD2  1  
ATOM 281   H HD3  . ARG A 1 17 ? -6.431  -1.744  -11.109 1.00 0.00 ? 47  ARG A HD3  1  
ATOM 282   H HE   . ARG A 1 17 ? -7.398  -1.169  -13.108 1.00 0.00 ? 47  ARG A HE   1  
ATOM 283   H HH11 . ARG A 1 17 ? -9.883  -1.433  -10.671 1.00 0.00 ? 47  ARG A HH11 1  
ATOM 284   H HH12 . ARG A 1 17 ? -11.118 -0.759  -11.679 1.00 0.00 ? 47  ARG A HH12 1  
ATOM 285   H HH21 . ARG A 1 17 ? -9.022  -0.281  -14.435 1.00 0.00 ? 47  ARG A HH21 1  
ATOM 286   H HH22 . ARG A 1 17 ? -10.630 -0.104  -13.816 1.00 0.00 ? 47  ARG A HH22 1  
ATOM 287   N N    . PHE A 1 18 ? -10.322 -5.203  -7.494  1.00 0.00 ? 48  PHE A N    1  
ATOM 288   C CA   . PHE A 1 18 ? -10.544 -6.371  -6.648  1.00 0.00 ? 48  PHE A CA   1  
ATOM 289   C C    . PHE A 1 18 ? -11.972 -6.390  -6.112  1.00 0.00 ? 48  PHE A C    1  
ATOM 290   O O    . PHE A 1 18 ? -12.208 -6.745  -4.957  1.00 0.00 ? 48  PHE A O    1  
ATOM 291   C CB   . PHE A 1 18 ? -9.548  -6.385  -5.486  1.00 0.00 ? 48  PHE A CB   1  
ATOM 292   C CG   . PHE A 1 18 ? -8.247  -7.055  -5.819  1.00 0.00 ? 48  PHE A CG   1  
ATOM 293   C CD1  . PHE A 1 18 ? -8.218  -8.383  -6.213  1.00 0.00 ? 48  PHE A CD1  1  
ATOM 294   C CD2  . PHE A 1 18 ? -7.052  -6.358  -5.736  1.00 0.00 ? 48  PHE A CD2  1  
ATOM 295   C CE1  . PHE A 1 18 ? -7.021  -9.004  -6.519  1.00 0.00 ? 48  PHE A CE1  1  
ATOM 296   C CE2  . PHE A 1 18 ? -5.852  -6.973  -6.041  1.00 0.00 ? 48  PHE A CE2  1  
ATOM 297   C CZ   . PHE A 1 18 ? -5.837  -8.298  -6.432  1.00 0.00 ? 48  PHE A CZ   1  
ATOM 298   H H    . PHE A 1 18 ? -10.375 -4.309  -7.097  1.00 0.00 ? 48  PHE A H    1  
ATOM 299   H HA   . PHE A 1 18 ? -10.390 -7.252  -7.253  1.00 0.00 ? 48  PHE A HA   1  
ATOM 300   H HB2  . PHE A 1 18 ? -9.333  -5.368  -5.195  1.00 0.00 ? 48  PHE A HB2  1  
ATOM 301   H HB3  . PHE A 1 18 ? -9.989  -6.907  -4.650  1.00 0.00 ? 48  PHE A HB3  1  
ATOM 302   H HD1  . PHE A 1 18 ? -9.143  -8.936  -6.280  1.00 0.00 ? 48  PHE A HD1  1  
ATOM 303   H HD2  . PHE A 1 18 ? -7.063  -5.322  -5.430  1.00 0.00 ? 48  PHE A HD2  1  
ATOM 304   H HE1  . PHE A 1 18 ? -7.012  -10.040 -6.824  1.00 0.00 ? 48  PHE A HE1  1  
ATOM 305   H HE2  . PHE A 1 18 ? -4.928  -6.419  -5.972  1.00 0.00 ? 48  PHE A HE2  1  
ATOM 306   H HZ   . PHE A 1 18 ? -4.901  -8.780  -6.671  1.00 0.00 ? 48  PHE A HZ   1  
ATOM 307   N N    . GLY A 1 19 ? -12.919 -6.004  -6.960  1.00 0.00 ? 49  GLY A N    1  
ATOM 308   C CA   . GLY A 1 19 ? -14.312 -5.984  -6.556  1.00 0.00 ? 49  GLY A CA   1  
ATOM 309   C C    . GLY A 1 19 ? -14.839 -7.364  -6.212  1.00 0.00 ? 49  GLY A C    1  
ATOM 310   O O    . GLY A 1 19 ? -15.757 -7.501  -5.404  1.00 0.00 ? 49  GLY A O    1  
ATOM 311   H H    . GLY A 1 19 ? -12.669 -5.732  -7.867  1.00 0.00 ? 49  GLY A H    1  
ATOM 312   H HA2  . GLY A 1 19 ? -14.416 -5.346  -5.691  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 313   H HA3  . GLY A 1 19 ? -14.903 -5.576  -7.363  1.00 0.00 ? 49  GLY A HA3  1  
ATOM 314   N N    . SER A 1 20 ? -14.258 -8.388  -6.828  1.00 0.00 ? 50  SER A N    1  
ATOM 315   C CA   . SER A 1 20 ? -14.675 -9.764  -6.582  1.00 0.00 ? 50  SER A CA   1  
ATOM 316   C C    . SER A 1 20 ? -13.771 -10.447 -5.558  1.00 0.00 ? 50  SER A C    1  
ATOM 317   O O    . SER A 1 20 ? -13.895 -11.648 -5.315  1.00 0.00 ? 50  SER A O    1  
ATOM 318   C CB   . SER A 1 20 ? -14.671 -10.559 -7.890  1.00 0.00 ? 50  SER A CB   1  
ATOM 319   O OG   . SER A 1 20 ? -13.532 -10.247 -8.673  1.00 0.00 ? 50  SER A OG   1  
ATOM 320   H H    . SER A 1 20 ? -13.531 -8.215  -7.462  1.00 0.00 ? 50  SER A H    1  
ATOM 321   H HA   . SER A 1 20 ? -15.683 -9.739  -6.193  1.00 0.00 ? 50  SER A HA   1  
ATOM 322   H HB2  . SER A 1 20 ? -14.661 -11.615 -7.667  1.00 0.00 ? 50  SER A HB2  1  
ATOM 323   H HB3  . SER A 1 20 ? -15.559 -10.320 -8.457  1.00 0.00 ? 50  SER A HB3  1  
ATOM 324   H HG   . SER A 1 20 ? -13.179 -11.052 -9.060  1.00 0.00 ? 50  SER A HG   1  
ATOM 325   N N    . ASP A 1 21 ? -12.864 -9.682  -4.956  1.00 0.00 ? 51  ASP A N    1  
ATOM 326   C CA   . ASP A 1 21 ? -11.951 -10.219 -3.962  1.00 0.00 ? 51  ASP A CA   1  
ATOM 327   C C    . ASP A 1 21 ? -11.758 -9.234  -2.810  1.00 0.00 ? 51  ASP A C    1  
ATOM 328   O O    . ASP A 1 21 ? -10.825 -8.431  -2.820  1.00 0.00 ? 51  ASP A O    1  
ATOM 329   C CB   . ASP A 1 21 ? -10.602 -10.555 -4.602  1.00 0.00 ? 51  ASP A CB   1  
ATOM 330   C CG   . ASP A 1 21 ? -10.353 -12.049 -4.675  1.00 0.00 ? 51  ASP A CG   1  
ATOM 331   O OD1  . ASP A 1 21 ? -9.912  -12.626 -3.660  1.00 0.00 ? 51  ASP A OD1  1  
ATOM 332   O OD2  . ASP A 1 21 ? -10.601 -12.640 -5.747  1.00 0.00 ? 51  ASP A OD2  1  
ATOM 333   H H    . ASP A 1 21 ? -12.810 -8.737  -5.181  1.00 0.00 ? 51  ASP A H    1  
ATOM 334   H HA   . ASP A 1 21 ? -12.391 -11.120 -3.576  1.00 0.00 ? 51  ASP A HA   1  
ATOM 335   H HB2  . ASP A 1 21 ? -10.578 -10.157 -5.606  1.00 0.00 ? 51  ASP A HB2  1  
ATOM 336   H HB3  . ASP A 1 21 ? -9.810  -10.104 -4.022  1.00 0.00 ? 51  ASP A HB3  1  
ATOM 337   N N    . PRO A 1 22 ? -12.641 -9.285  -1.798  1.00 0.00 ? 52  PRO A N    1  
ATOM 338   C CA   . PRO A 1 22 ? -12.563 -8.394  -0.636  1.00 0.00 ? 52  PRO A CA   1  
ATOM 339   C C    . PRO A 1 22 ? -11.371 -8.709  0.262   1.00 0.00 ? 52  PRO A C    1  
ATOM 340   O O    . PRO A 1 22 ? -10.881 -7.844  0.987   1.00 0.00 ? 52  PRO A O    1  
ATOM 341   C CB   . PRO A 1 22 ? -13.875 -8.658  0.105   1.00 0.00 ? 52  PRO A CB   1  
ATOM 342   C CG   . PRO A 1 22 ? -14.262 -10.041 -0.292  1.00 0.00 ? 52  PRO A CG   1  
ATOM 343   C CD   . PRO A 1 22 ? -13.784 -10.213 -1.707  1.00 0.00 ? 52  PRO A CD   1  
ATOM 344   H HA   . PRO A 1 22 ? -12.520 -7.357  -0.936  1.00 0.00 ? 52  PRO A HA   1  
ATOM 345   H HB2  . PRO A 1 22 ? -13.711 -8.584  1.171   1.00 0.00 ? 52  PRO A HB2  1  
ATOM 346   H HB3  . PRO A 1 22 ? -14.619 -7.938  -0.202  1.00 0.00 ? 52  PRO A HB3  1  
ATOM 347   H HG2  . PRO A 1 22 ? -13.780 -10.757 0.357   1.00 0.00 ? 52  PRO A HG2  1  
ATOM 348   H HG3  . PRO A 1 22 ? -15.335 -10.151 -0.242  1.00 0.00 ? 52  PRO A HG3  1  
ATOM 349   H HD2  . PRO A 1 22 ? -13.468 -11.233 -1.877  1.00 0.00 ? 52  PRO A HD2  1  
ATOM 350   H HD3  . PRO A 1 22 ? -14.561 -9.936  -2.404  1.00 0.00 ? 52  PRO A HD3  1  
ATOM 351   N N    . ALA A 1 23 ? -10.910 -9.955  0.210   1.00 0.00 ? 53  ALA A N    1  
ATOM 352   C CA   . ALA A 1 23 ? -9.776  -10.385 1.020   1.00 0.00 ? 53  ALA A CA   1  
ATOM 353   C C    . ALA A 1 23 ? -8.541  -9.537  0.734   1.00 0.00 ? 53  ALA A C    1  
ATOM 354   O O    . ALA A 1 23 ? -7.837  -9.118  1.653   1.00 0.00 ? 53  ALA A O    1  
ATOM 355   C CB   . ALA A 1 23 ? -9.478  -11.856 0.770   1.00 0.00 ? 53  ALA A CB   1  
ATOM 356   H H    . ALA A 1 23 ? -11.343 -10.602 -0.385  1.00 0.00 ? 53  ALA A H    1  
ATOM 357   H HA   . ALA A 1 23 ? -10.046 -10.269 2.060   1.00 0.00 ? 53  ALA A HA   1  
ATOM 358   H HB1  . ALA A 1 23 ? -10.355 -12.337 0.365   1.00 0.00 ? 53  ALA A HB1  1  
ATOM 359   H HB2  . ALA A 1 23 ? -9.203  -12.330 1.701   1.00 0.00 ? 53  ALA A HB2  1  
ATOM 360   H HB3  . ALA A 1 23 ? -8.662  -11.944 0.067   1.00 0.00 ? 53  ALA A HB3  1  
ATOM 361   N N    . THR A 1 24 ? -8.284  -9.289  -0.545  1.00 0.00 ? 54  THR A N    1  
ATOM 362   C CA   . THR A 1 24 ? -7.133  -8.491  -0.954  1.00 0.00 ? 54  THR A CA   1  
ATOM 363   C C    . THR A 1 24 ? -7.220  -7.078  -0.386  1.00 0.00 ? 54  THR A C    1  
ATOM 364   O O    . THR A 1 24 ? -6.237  -6.544  0.130   1.00 0.00 ? 54  THR A O    1  
ATOM 365   C CB   . THR A 1 24 ? -7.041  -8.437  -2.480  1.00 0.00 ? 54  THR A CB   1  
ATOM 366   O OG1  . THR A 1 24 ? -7.141  -9.736  -3.035  1.00 0.00 ? 54  THR A OG1  1  
ATOM 367   C CG2  . THR A 1 24 ? -5.752  -7.821  -2.980  1.00 0.00 ? 54  THR A CG2  1  
ATOM 368   H H    . THR A 1 24 ? -8.882  -9.650  -1.232  1.00 0.00 ? 54  THR A H    1  
ATOM 369   H HA   . THR A 1 24 ? -6.245  -8.968  -0.566  1.00 0.00 ? 54  THR A HA   1  
ATOM 370   H HB   . THR A 1 24 ? -7.860  -7.842  -2.859  1.00 0.00 ? 54  THR A HB   1  
ATOM 371   H HG1  . THR A 1 24 ? -7.872  -9.763  -3.656  1.00 0.00 ? 54  THR A HG1  1  
ATOM 372   H HG21 . THR A 1 24 ? -4.975  -7.961  -2.244  1.00 0.00 ? 54  THR A HG21 1  
ATOM 373   H HG22 . THR A 1 24 ? -5.900  -6.765  -3.151  1.00 0.00 ? 54  THR A HG22 1  
ATOM 374   H HG23 . THR A 1 24 ? -5.461  -8.297  -3.905  1.00 0.00 ? 54  THR A HG23 1  
ATOM 375   N N    . TYR A 1 25 ? -8.401  -6.478  -0.483  1.00 0.00 ? 55  TYR A N    1  
ATOM 376   C CA   . TYR A 1 25 ? -8.617  -5.127  0.021   1.00 0.00 ? 55  TYR A CA   1  
ATOM 377   C C    . TYR A 1 25 ? -8.363  -5.059  1.523   1.00 0.00 ? 55  TYR A C    1  
ATOM 378   O O    . TYR A 1 25 ? -7.616  -4.204  1.999   1.00 0.00 ? 55  TYR A O    1  
ATOM 379   C CB   . TYR A 1 25 ? -10.044 -4.667  -0.288  1.00 0.00 ? 55  TYR A CB   1  
ATOM 380   C CG   . TYR A 1 25 ? -10.236 -3.171  -0.185  1.00 0.00 ? 55  TYR A CG   1  
ATOM 381   C CD1  . TYR A 1 25 ? -9.808  -2.324  -1.200  1.00 0.00 ? 55  TYR A CD1  1  
ATOM 382   C CD2  . TYR A 1 25 ? -10.848 -2.605  0.926   1.00 0.00 ? 55  TYR A CD2  1  
ATOM 383   C CE1  . TYR A 1 25 ? -9.984  -0.957  -1.111  1.00 0.00 ? 55  TYR A CE1  1  
ATOM 384   C CE2  . TYR A 1 25 ? -11.028 -1.238  1.023   1.00 0.00 ? 55  TYR A CE2  1  
ATOM 385   C CZ   . TYR A 1 25 ? -10.594 -0.418  0.002   1.00 0.00 ? 55  TYR A CZ   1  
ATOM 386   O OH   . TYR A 1 25 ? -10.772 0.943   0.095   1.00 0.00 ? 55  TYR A OH   1  
ATOM 387   H H    . TYR A 1 25 ? -9.146  -6.955  -0.904  1.00 0.00 ? 55  TYR A H    1  
ATOM 388   H HA   . TYR A 1 25 ? -7.921  -4.471  -0.480  1.00 0.00 ? 55  TYR A HA   1  
ATOM 389   H HB2  . TYR A 1 25 ? -10.300 -4.966  -1.293  1.00 0.00 ? 55  TYR A HB2  1  
ATOM 390   H HB3  . TYR A 1 25 ? -10.723 -5.138  0.406   1.00 0.00 ? 55  TYR A HB3  1  
ATOM 391   H HD1  . TYR A 1 25 ? -9.330  -2.749  -2.071  1.00 0.00 ? 55  TYR A HD1  1  
ATOM 392   H HD2  . TYR A 1 25 ? -11.187 -3.248  1.724   1.00 0.00 ? 55  TYR A HD2  1  
ATOM 393   H HE1  . TYR A 1 25 ? -9.643  -0.315  -1.911  1.00 0.00 ? 55  TYR A HE1  1  
ATOM 394   H HE2  . TYR A 1 25 ? -11.506 -0.817  1.894   1.00 0.00 ? 55  TYR A HE2  1  
ATOM 395   H HH   . TYR A 1 25 ? -9.989  1.391   -0.236  1.00 0.00 ? 55  TYR A HH   1  
ATOM 396   N N    . ASN A 1 26 ? -8.987  -5.969  2.266   1.00 0.00 ? 56  ASN A N    1  
ATOM 397   C CA   . ASN A 1 26 ? -8.829  -6.013  3.714   1.00 0.00 ? 56  ASN A CA   1  
ATOM 398   C C    . ASN A 1 26 ? -7.364  -6.211  4.095   1.00 0.00 ? 56  ASN A C    1  
ATOM 399   O O    . ASN A 1 26 ? -6.913  -5.735  5.136   1.00 0.00 ? 56  ASN A O    1  
ATOM 400   C CB   . ASN A 1 26 ? -9.681  -7.139  4.307   1.00 0.00 ? 56  ASN A CB   1  
ATOM 401   C CG   . ASN A 1 26 ? -10.551 -6.662  5.454   1.00 0.00 ? 56  ASN A CG   1  
ATOM 402   O OD1  . ASN A 1 26 ? -10.243 -6.899  6.622   1.00 0.00 ? 56  ASN A OD1  1  
ATOM 403   N ND2  . ASN A 1 26 ? -11.646 -5.987  5.124   1.00 0.00 ? 56  ASN A ND2  1  
ATOM 404   H H    . ASN A 1 26 ? -9.569  -6.625  1.828   1.00 0.00 ? 56  ASN A H    1  
ATOM 405   H HA   . ASN A 1 26 ? -9.167  -5.070  4.114   1.00 0.00 ? 56  ASN A HA   1  
ATOM 406   H HB2  . ASN A 1 26 ? -10.323 -7.539  3.537   1.00 0.00 ? 56  ASN A HB2  1  
ATOM 407   H HB3  . ASN A 1 26 ? -9.032  -7.921  4.672   1.00 0.00 ? 56  ASN A HB3  1  
ATOM 408   H HD21 . ASN A 1 26 ? -11.829 -5.836  4.173   1.00 0.00 ? 56  ASN A HD21 1  
ATOM 409   H HD22 . ASN A 1 26 ? -12.227 -5.667  5.845   1.00 0.00 ? 56  ASN A HD22 1  
ATOM 410   N N    . GLY A 1 27 ? -6.627  -6.916  3.242   1.00 0.00 ? 57  GLY A N    1  
ATOM 411   C CA   . GLY A 1 27 ? -5.223  -7.163  3.505   1.00 0.00 ? 57  GLY A CA   1  
ATOM 412   C C    . GLY A 1 27 ? -4.388  -5.899  3.430   1.00 0.00 ? 57  GLY A C    1  
ATOM 413   O O    . GLY A 1 27 ? -3.526  -5.667  4.277   1.00 0.00 ? 57  GLY A O    1  
ATOM 414   H H    . GLY A 1 27 ? -7.041  -7.269  2.427   1.00 0.00 ? 57  GLY A H    1  
ATOM 415   H HA2  . GLY A 1 27 ? -5.121  -7.591  4.491   1.00 0.00 ? 57  GLY A HA2  1  
ATOM 416   H HA3  . GLY A 1 27 ? -4.850  -7.869  2.777   1.00 0.00 ? 57  GLY A HA3  1  
ATOM 417   N N    . PHE A 1 28 ? -4.646  -5.080  2.416   1.00 0.00 ? 58  PHE A N    1  
ATOM 418   C CA   . PHE A 1 28 ? -3.914  -3.833  2.234   1.00 0.00 ? 58  PHE A CA   1  
ATOM 419   C C    . PHE A 1 28 ? -4.113  -2.905  3.428   1.00 0.00 ? 58  PHE A C    1  
ATOM 420   O O    . PHE A 1 28 ? -3.161  -2.303  3.925   1.00 0.00 ? 58  PHE A O    1  
ATOM 421   C CB   . PHE A 1 28 ? -4.363  -3.133  0.949   1.00 0.00 ? 58  PHE A CB   1  
ATOM 422   C CG   . PHE A 1 28 ? -3.525  -1.937  0.594   1.00 0.00 ? 58  PHE A CG   1  
ATOM 423   C CD1  . PHE A 1 28 ? -2.145  -2.041  0.519   1.00 0.00 ? 58  PHE A CD1  1  
ATOM 424   C CD2  . PHE A 1 28 ? -4.118  -0.712  0.336   1.00 0.00 ? 58  PHE A CD2  1  
ATOM 425   C CE1  . PHE A 1 28 ? -1.371  -0.943  0.193   1.00 0.00 ? 58  PHE A CE1  1  
ATOM 426   C CE2  . PHE A 1 28 ? -3.349  0.389   0.009   1.00 0.00 ? 58  PHE A CE2  1  
ATOM 427   C CZ   . PHE A 1 28 ? -1.974  0.274   -0.063  1.00 0.00 ? 58  PHE A CZ   1  
ATOM 428   H H    . PHE A 1 28 ? -5.348  -5.322  1.774   1.00 0.00 ? 58  PHE A H    1  
ATOM 429   H HA   . PHE A 1 28 ? -2.865  -4.075  2.152   1.00 0.00 ? 58  PHE A HA   1  
ATOM 430   H HB2  . PHE A 1 28 ? -4.309  -3.833  0.129   1.00 0.00 ? 58  PHE A HB2  1  
ATOM 431   H HB3  . PHE A 1 28 ? -5.385  -2.801  1.067   1.00 0.00 ? 58  PHE A HB3  1  
ATOM 432   H HD1  . PHE A 1 28 ? -1.673  -2.992  0.717   1.00 0.00 ? 58  PHE A HD1  1  
ATOM 433   H HD2  . PHE A 1 28 ? -5.192  -0.621  0.391   1.00 0.00 ? 58  PHE A HD2  1  
ATOM 434   H HE1  . PHE A 1 28 ? -0.297  -1.036  0.137   1.00 0.00 ? 58  PHE A HE1  1  
ATOM 435   H HE2  . PHE A 1 28 ? -3.822  1.339   -0.190  1.00 0.00 ? 58  PHE A HE2  1  
ATOM 436   H HZ   . PHE A 1 28 ? -1.371  1.133   -0.318  1.00 0.00 ? 58  PHE A HZ   1  
ATOM 437   N N    . LEU A 1 29 ? -5.357  -2.794  3.885   1.00 0.00 ? 59  LEU A N    1  
ATOM 438   C CA   . LEU A 1 29 ? -5.679  -1.940  5.022   1.00 0.00 ? 59  LEU A CA   1  
ATOM 439   C C    . LEU A 1 29 ? -4.964  -2.417  6.280   1.00 0.00 ? 59  LEU A C    1  
ATOM 440   O O    . LEU A 1 29 ? -4.521  -1.611  7.099   1.00 0.00 ? 59  LEU A O    1  
ATOM 441   C CB   . LEU A 1 29 ? -7.191  -1.917  5.258   1.00 0.00 ? 59  LEU A CB   1  
ATOM 442   C CG   . LEU A 1 29 ? -8.014  -1.312  4.120   1.00 0.00 ? 59  LEU A CG   1  
ATOM 443   C CD1  . LEU A 1 29 ? -9.369  -1.997  4.019   1.00 0.00 ? 59  LEU A CD1  1  
ATOM 444   C CD2  . LEU A 1 29 ? -8.187  0.186   4.323   1.00 0.00 ? 59  LEU A CD2  1  
ATOM 445   H H    . LEU A 1 29 ? -6.074  -3.299  3.447   1.00 0.00 ? 59  LEU A H    1  
ATOM 446   H HA   . LEU A 1 29 ? -5.345  -0.939  4.789   1.00 0.00 ? 59  LEU A HA   1  
ATOM 447   H HB2  . LEU A 1 29 ? -7.524  -2.931  5.418   1.00 0.00 ? 59  LEU A HB2  1  
ATOM 448   H HB3  . LEU A 1 29 ? -7.385  -1.346  6.154   1.00 0.00 ? 59  LEU A HB3  1  
ATOM 449   H HG   . LEU A 1 29 ? -7.493  -1.466  3.186   1.00 0.00 ? 59  LEU A HG   1  
ATOM 450   H HD11 . LEU A 1 29 ? -10.056 -1.357  3.486   1.00 0.00 ? 59  LEU A HD11 1  
ATOM 451   H HD12 . LEU A 1 29 ? -9.750  -2.190  5.010   1.00 0.00 ? 59  LEU A HD12 1  
ATOM 452   H HD13 . LEU A 1 29 ? -9.260  -2.931  3.487   1.00 0.00 ? 59  LEU A HD13 1  
ATOM 453   H HD21 . LEU A 1 29 ? -9.150  0.492   3.944   1.00 0.00 ? 59  LEU A HD21 1  
ATOM 454   H HD22 . LEU A 1 29 ? -7.407  0.713   3.794   1.00 0.00 ? 59  LEU A HD22 1  
ATOM 455   H HD23 . LEU A 1 29 ? -8.125  0.415   5.377   1.00 0.00 ? 59  LEU A HD23 1  
ATOM 456   N N    . GLU A 1 30 ? -4.852  -3.733  6.429   1.00 0.00 ? 60  GLU A N    1  
ATOM 457   C CA   . GLU A 1 30 ? -4.189  -4.318  7.588   1.00 0.00 ? 60  GLU A CA   1  
ATOM 458   C C    . GLU A 1 30 ? -2.732  -3.876  7.661   1.00 0.00 ? 60  GLU A C    1  
ATOM 459   O O    . GLU A 1 30 ? -2.238  -3.509  8.728   1.00 0.00 ? 60  GLU A O    1  
ATOM 460   C CB   . GLU A 1 30 ? -4.268  -5.846  7.531   1.00 0.00 ? 60  GLU A CB   1  
ATOM 461   C CG   . GLU A 1 30 ? -4.344  -6.502  8.899   1.00 0.00 ? 60  GLU A CG   1  
ATOM 462   C CD   . GLU A 1 30 ? -4.175  -8.008  8.832   1.00 0.00 ? 60  GLU A CD   1  
ATOM 463   O OE1  . GLU A 1 30 ? -5.041  -8.676  8.229   1.00 0.00 ? 60  GLU A OE1  1  
ATOM 464   O OE2  . GLU A 1 30 ? -3.177  -8.519  9.383   1.00 0.00 ? 60  GLU A OE2  1  
ATOM 465   H H    . GLU A 1 30 ? -5.224  -4.325  5.742   1.00 0.00 ? 60  GLU A H    1  
ATOM 466   H HA   . GLU A 1 30 ? -4.704  -3.974  8.473   1.00 0.00 ? 60  GLU A HA   1  
ATOM 467   H HB2  . GLU A 1 30 ? -5.147  -6.128  6.970   1.00 0.00 ? 60  GLU A HB2  1  
ATOM 468   H HB3  . GLU A 1 30 ? -3.392  -6.220  7.022   1.00 0.00 ? 60  GLU A HB3  1  
ATOM 469   H HG2  . GLU A 1 30 ? -3.562  -6.096  9.523   1.00 0.00 ? 60  GLU A HG2  1  
ATOM 470   H HG3  . GLU A 1 30 ? -5.305  -6.281  9.337   1.00 0.00 ? 60  GLU A HG3  1  
ATOM 471   N N    . ILE A 1 31 ? -2.051  -3.910  6.521   1.00 0.00 ? 61  ILE A N    1  
ATOM 472   C CA   . ILE A 1 31 ? -0.649  -3.512  6.456   1.00 0.00 ? 61  ILE A CA   1  
ATOM 473   C C    . ILE A 1 31 ? -0.470  -2.066  6.906   1.00 0.00 ? 61  ILE A C    1  
ATOM 474   O O    . ILE A 1 31 ? 0.338   -1.775  7.787   1.00 0.00 ? 61  ILE A O    1  
ATOM 475   C CB   . ILE A 1 31 ? -0.086  -3.670  5.030   1.00 0.00 ? 61  ILE A CB   1  
ATOM 476   C CG1  . ILE A 1 31 ? -0.361  -5.079  4.500   1.00 0.00 ? 61  ILE A CG1  1  
ATOM 477   C CG2  . ILE A 1 31 ? 1.406   -3.375  5.012   1.00 0.00 ? 61  ILE A CG2  1  
ATOM 478   C CD1  . ILE A 1 31 ? -0.784  -5.107  3.047   1.00 0.00 ? 61  ILE A CD1  1  
ATOM 479   H H    . ILE A 1 31 ? -2.501  -4.211  5.705   1.00 0.00 ? 61  ILE A H    1  
ATOM 480   H HA   . ILE A 1 31 ? -0.088  -4.156  7.117   1.00 0.00 ? 61  ILE A HA   1  
ATOM 481   H HB   . ILE A 1 31 ? -0.577  -2.951  4.390   1.00 0.00 ? 61  ILE A HB   1  
ATOM 482   H HG12 . ILE A 1 31 ? 0.535   -5.674  4.595   1.00 0.00 ? 61  ILE A HG12 1  
ATOM 483   H HG13 . ILE A 1 31 ? -1.150  -5.529  5.084   1.00 0.00 ? 61  ILE A HG13 1  
ATOM 484   H HG21 . ILE A 1 31 ? 1.562   -2.306  5.019   1.00 0.00 ? 61  ILE A HG21 1  
ATOM 485   H HG22 . ILE A 1 31 ? 1.846   -3.796  4.119   1.00 0.00 ? 61  ILE A HG22 1  
ATOM 486   H HG23 . ILE A 1 31 ? 1.871   -3.813  5.883   1.00 0.00 ? 61  ILE A HG23 1  
ATOM 487   H HD11 . ILE A 1 31 ? -0.028  -5.611  2.462   1.00 0.00 ? 61  ILE A HD11 1  
ATOM 488   H HD12 . ILE A 1 31 ? -0.902  -4.096  2.687   1.00 0.00 ? 61  ILE A HD12 1  
ATOM 489   H HD13 . ILE A 1 31 ? -1.722  -5.635  2.955   1.00 0.00 ? 61  ILE A HD13 1  
ATOM 490   N N    . MET A 1 32 ? -1.230  -1.162  6.295   1.00 0.00 ? 62  MET A N    1  
ATOM 491   C CA   . MET A 1 32 ? -1.154  0.254   6.634   1.00 0.00 ? 62  MET A CA   1  
ATOM 492   C C    . MET A 1 32 ? -1.588  0.492   8.077   1.00 0.00 ? 62  MET A C    1  
ATOM 493   O O    . MET A 1 32 ? -0.889  1.154   8.845   1.00 0.00 ? 62  MET A O    1  
ATOM 494   C CB   . MET A 1 32 ? -2.026  1.077   5.681   1.00 0.00 ? 62  MET A CB   1  
ATOM 495   C CG   . MET A 1 32 ? -1.237  1.773   4.584   1.00 0.00 ? 62  MET A CG   1  
ATOM 496   S SD   . MET A 1 32 ? -1.378  0.941   2.991   1.00 0.00 ? 62  MET A SD   1  
ATOM 497   C CE   . MET A 1 32 ? -0.273  -0.447  3.234   1.00 0.00 ? 62  MET A CE   1  
ATOM 498   H H    . MET A 1 32 ? -1.856  -1.454  5.601   1.00 0.00 ? 62  MET A H    1  
ATOM 499   H HA   . MET A 1 32 ? -0.126  0.566   6.524   1.00 0.00 ? 62  MET A HA   1  
ATOM 500   H HB2  . MET A 1 32 ? -2.748  0.420   5.217   1.00 0.00 ? 62  MET A HB2  1  
ATOM 501   H HB3  . MET A 1 32 ? -2.551  1.829   6.251   1.00 0.00 ? 62  MET A HB3  1  
ATOM 502   H HG2  . MET A 1 32 ? -1.605  2.783   4.481   1.00 0.00 ? 62  MET A HG2  1  
ATOM 503   H HG3  . MET A 1 32 ? -0.196  1.798   4.870   1.00 0.00 ? 62  MET A HG3  1  
ATOM 504   H HE1  . MET A 1 32 ? 0.682   -0.230  2.778   1.00 0.00 ? 62  MET A HE1  1  
ATOM 505   H HE2  . MET A 1 32 ? -0.697  -1.329  2.777   1.00 0.00 ? 62  MET A HE2  1  
ATOM 506   H HE3  . MET A 1 32 ? -0.138  -0.619  4.291   1.00 0.00 ? 62  MET A HE3  1  
ATOM 507   N N    . LYS A 1 33 ? -2.745  -0.051  8.439   1.00 0.00 ? 63  LYS A N    1  
ATOM 508   C CA   . LYS A 1 33 ? -3.272  0.102   9.791   1.00 0.00 ? 63  LYS A CA   1  
ATOM 509   C C    . LYS A 1 33 ? -2.301  -0.465  10.821  1.00 0.00 ? 63  LYS A C    1  
ATOM 510   O O    . LYS A 1 33 ? -2.109  0.112   11.892  1.00 0.00 ? 63  LYS A O    1  
ATOM 511   C CB   . LYS A 1 33 ? -4.628  -0.594  9.915   1.00 0.00 ? 63  LYS A CB   1  
ATOM 512   C CG   . LYS A 1 33 ? -5.420  -0.167  11.141  1.00 0.00 ? 63  LYS A CG   1  
ATOM 513   C CD   . LYS A 1 33 ? -6.330  -1.281  11.632  1.00 0.00 ? 63  LYS A CD   1  
ATOM 514   C CE   . LYS A 1 33 ? -7.406  -0.750  12.564  1.00 0.00 ? 63  LYS A CE   1  
ATOM 515   N NZ   . LYS A 1 33 ? -6.843  -0.319  13.875  1.00 0.00 ? 63  LYS A NZ   1  
ATOM 516   H H    . LYS A 1 33 ? -3.258  -0.568  7.782   1.00 0.00 ? 63  LYS A H    1  
ATOM 517   H HA   . LYS A 1 33 ? -3.401  1.157   9.978   1.00 0.00 ? 63  LYS A HA   1  
ATOM 518   H HB2  . LYS A 1 33 ? -5.217  -0.371  9.038   1.00 0.00 ? 63  LYS A HB2  1  
ATOM 519   H HB3  . LYS A 1 33 ? -4.470  -1.661  9.969   1.00 0.00 ? 63  LYS A HB3  1  
ATOM 520   H HG2  . LYS A 1 33 ? -4.730  0.094   11.929  1.00 0.00 ? 63  LYS A HG2  1  
ATOM 521   H HG3  . LYS A 1 33 ? -6.022  0.692   10.887  1.00 0.00 ? 63  LYS A HG3  1  
ATOM 522   H HD2  . LYS A 1 33 ? -6.804  -1.748  10.782  1.00 0.00 ? 63  LYS A HD2  1  
ATOM 523   H HD3  . LYS A 1 33 ? -5.736  -2.011  12.162  1.00 0.00 ? 63  LYS A HD3  1  
ATOM 524   H HE2  . LYS A 1 33 ? -7.885  0.096   12.095  1.00 0.00 ? 63  LYS A HE2  1  
ATOM 525   H HE3  . LYS A 1 33 ? -8.136  -1.528  12.733  1.00 0.00 ? 63  LYS A HE3  1  
ATOM 526   H HZ1  . LYS A 1 33 ? -7.606  -0.214  14.575  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM 527   H HZ2  . LYS A 1 33 ? -6.353  0.592   13.772  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM 528   H HZ3  . LYS A 1 33 ? -6.165  -1.027  14.222  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM 529   N N    . GLU A 1 34 ? -1.689  -1.598  10.490  1.00 0.00 ? 64  GLU A N    1  
ATOM 530   C CA   . GLU A 1 34 ? -0.736  -2.242  11.387  1.00 0.00 ? 64  GLU A CA   1  
ATOM 531   C C    . GLU A 1 34 ? 0.511   -1.382  11.565  1.00 0.00 ? 64  GLU A C    1  
ATOM 532   O O    . GLU A 1 34 ? 1.142   -1.399  12.622  1.00 0.00 ? 64  GLU A O    1  
ATOM 533   C CB   . GLU A 1 34 ? -0.349  -3.620  10.847  1.00 0.00 ? 64  GLU A CB   1  
ATOM 534   C CG   . GLU A 1 34 ? -1.403  -4.688  11.089  1.00 0.00 ? 64  GLU A CG   1  
ATOM 535   C CD   . GLU A 1 34 ? -1.045  -5.612  12.235  1.00 0.00 ? 64  GLU A CD   1  
ATOM 536   O OE1  . GLU A 1 34 ? 0.161   -5.866  12.438  1.00 0.00 ? 64  GLU A OE1  1  
ATOM 537   O OE2  . GLU A 1 34 ? -1.970  -6.084  12.929  1.00 0.00 ? 64  GLU A OE2  1  
ATOM 538   H H    . GLU A 1 34 ? -1.882  -2.010  9.623   1.00 0.00 ? 64  GLU A H    1  
ATOM 539   H HA   . GLU A 1 34 ? -1.215  -2.364  12.347  1.00 0.00 ? 64  GLU A HA   1  
ATOM 540   H HB2  . GLU A 1 34 ? -0.182  -3.543  9.782   1.00 0.00 ? 64  GLU A HB2  1  
ATOM 541   H HB3  . GLU A 1 34 ? 0.568   -3.935  11.323  1.00 0.00 ? 64  GLU A HB3  1  
ATOM 542   H HG2  . GLU A 1 34 ? -2.341  -4.203  11.318  1.00 0.00 ? 64  GLU A HG2  1  
ATOM 543   H HG3  . GLU A 1 34 ? -1.513  -5.277  10.191  1.00 0.00 ? 64  GLU A HG3  1  
ATOM 544   N N    . PHE A 1 35 ? 0.860   -0.632  10.525  1.00 0.00 ? 65  PHE A N    1  
ATOM 545   C CA   . PHE A 1 35 ? 2.032   0.235   10.567  1.00 0.00 ? 65  PHE A CA   1  
ATOM 546   C C    . PHE A 1 35 ? 1.803   1.414   11.507  1.00 0.00 ? 65  PHE A C    1  
ATOM 547   O O    . PHE A 1 35 ? 2.699   1.809   12.252  1.00 0.00 ? 65  PHE A O    1  
ATOM 548   C CB   . PHE A 1 35 ? 2.365   0.744   9.163   1.00 0.00 ? 65  PHE A CB   1  
ATOM 549   C CG   . PHE A 1 35 ? 3.728   1.365   9.057   1.00 0.00 ? 65  PHE A CG   1  
ATOM 550   C CD1  . PHE A 1 35 ? 4.864   0.571   9.004   1.00 0.00 ? 65  PHE A CD1  1  
ATOM 551   C CD2  . PHE A 1 35 ? 3.876   2.741   9.011   1.00 0.00 ? 65  PHE A CD2  1  
ATOM 552   C CE1  . PHE A 1 35 ? 6.120   1.140   8.906   1.00 0.00 ? 65  PHE A CE1  1  
ATOM 553   C CE2  . PHE A 1 35 ? 5.129   3.316   8.914   1.00 0.00 ? 65  PHE A CE2  1  
ATOM 554   C CZ   . PHE A 1 35 ? 6.252   2.514   8.861   1.00 0.00 ? 65  PHE A CZ   1  
ATOM 555   H H    . PHE A 1 35 ? 0.316   -0.662  9.710   1.00 0.00 ? 65  PHE A H    1  
ATOM 556   H HA   . PHE A 1 35 ? 2.862   -0.348  10.935  1.00 0.00 ? 65  PHE A HA   1  
ATOM 557   H HB2  . PHE A 1 35 ? 2.322   -0.081  8.469   1.00 0.00 ? 65  PHE A HB2  1  
ATOM 558   H HB3  . PHE A 1 35 ? 1.637   1.488   8.876   1.00 0.00 ? 65  PHE A HB3  1  
ATOM 559   H HD1  . PHE A 1 35 ? 4.761   -0.503  9.039   1.00 0.00 ? 65  PHE A HD1  1  
ATOM 560   H HD2  . PHE A 1 35 ? 2.998   3.370   9.053   1.00 0.00 ? 65  PHE A HD2  1  
ATOM 561   H HE1  . PHE A 1 35 ? 6.996   0.510   8.866   1.00 0.00 ? 65  PHE A HE1  1  
ATOM 562   H HE2  . PHE A 1 35 ? 5.229   4.391   8.878   1.00 0.00 ? 65  PHE A HE2  1  
ATOM 563   H HZ   . PHE A 1 35 ? 7.232   2.961   8.784   1.00 0.00 ? 65  PHE A HZ   1  
ATOM 564   N N    . LYS A 1 36 ? 0.597   1.971   11.468  1.00 0.00 ? 66  LYS A N    1  
ATOM 565   C CA   . LYS A 1 36 ? 0.251   3.105   12.318  1.00 0.00 ? 66  LYS A CA   1  
ATOM 566   C C    . LYS A 1 36 ? 0.405   2.744   13.792  1.00 0.00 ? 66  LYS A C    1  
ATOM 567   O O    . LYS A 1 36 ? 0.790   3.581   14.609  1.00 0.00 ? 66  LYS A O    1  
ATOM 568   C CB   . LYS A 1 36 ? -1.183  3.560   12.039  1.00 0.00 ? 66  LYS A CB   1  
ATOM 569   C CG   . LYS A 1 36 ? -1.289  4.576   10.912  1.00 0.00 ? 66  LYS A CG   1  
ATOM 570   C CD   . LYS A 1 36 ? -2.720  5.056   10.731  1.00 0.00 ? 66  LYS A CD   1  
ATOM 571   C CE   . LYS A 1 36 ? -2.994  6.313   11.540  1.00 0.00 ? 66  LYS A CE   1  
ATOM 572   N NZ   . LYS A 1 36 ? -2.870  7.545   10.714  1.00 0.00 ? 66  LYS A NZ   1  
ATOM 573   H H    . LYS A 1 36 ? -0.076  1.611   10.854  1.00 0.00 ? 66  LYS A H    1  
ATOM 574   H HA   . LYS A 1 36 ? 0.928   3.912   12.085  1.00 0.00 ? 66  LYS A HA   1  
ATOM 575   H HB2  . LYS A 1 36 ? -1.776  2.698   11.774  1.00 0.00 ? 66  LYS A HB2  1  
ATOM 576   H HB3  . LYS A 1 36 ? -1.589  4.004   12.935  1.00 0.00 ? 66  LYS A HB3  1  
ATOM 577   H HG2  . LYS A 1 36 ? -0.662  5.423   11.145  1.00 0.00 ? 66  LYS A HG2  1  
ATOM 578   H HG3  . LYS A 1 36 ? -0.953  4.116   9.994   1.00 0.00 ? 66  LYS A HG3  1  
ATOM 579   H HD2  . LYS A 1 36 ? -2.888  5.269   9.686   1.00 0.00 ? 66  LYS A HD2  1  
ATOM 580   H HD3  . LYS A 1 36 ? -3.395  4.277   11.054  1.00 0.00 ? 66  LYS A HD3  1  
ATOM 581   H HE2  . LYS A 1 36 ? -3.995  6.257   11.940  1.00 0.00 ? 66  LYS A HE2  1  
ATOM 582   H HE3  . LYS A 1 36 ? -2.284  6.362   12.354  1.00 0.00 ? 66  LYS A HE3  1  
ATOM 583   H HZ1  . LYS A 1 36 ? -2.538  8.338   11.301  1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 584   H HZ2  . LYS A 1 36 ? -3.793  7.795   10.304  1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 585   H HZ3  . LYS A 1 36 ? -2.190  7.392   9.942   1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 586   N N    . SER A 1 37 ? 0.104   1.493   14.123  1.00 0.00 ? 67  SER A N    1  
ATOM 587   C CA   . SER A 1 37 ? 0.211   1.018   15.497  1.00 0.00 ? 67  SER A CA   1  
ATOM 588   C C    . SER A 1 37 ? 1.661   1.040   15.980  1.00 0.00 ? 67  SER A C    1  
ATOM 589   O O    . SER A 1 37 ? 1.924   0.961   17.180  1.00 0.00 ? 67  SER A O    1  
ATOM 590   C CB   . SER A 1 37 ? -0.353  -0.400  15.613  1.00 0.00 ? 67  SER A CB   1  
ATOM 591   O OG   . SER A 1 37 ? -1.748  -0.417  15.362  1.00 0.00 ? 67  SER A OG   1  
ATOM 592   H H    . SER A 1 37 ? -0.195  0.873   13.427  1.00 0.00 ? 67  SER A H    1  
ATOM 593   H HA   . SER A 1 37 ? -0.372  1.677   16.119  1.00 0.00 ? 67  SER A HA   1  
ATOM 594   H HB2  . SER A 1 37 ? 0.137   -1.040  14.894  1.00 0.00 ? 67  SER A HB2  1  
ATOM 595   H HB3  . SER A 1 37 ? -0.174  -0.776  16.609  1.00 0.00 ? 67  SER A HB3  1  
ATOM 596   H HG   . SER A 1 37 ? -2.189  -0.928  16.044  1.00 0.00 ? 67  SER A HG   1  
ATOM 597   N N    . GLN A 1 38 ? 2.598   1.147   15.040  1.00 0.00 ? 68  GLN A N    1  
ATOM 598   C CA   . GLN A 1 38 ? 4.020   1.179   15.373  1.00 0.00 ? 68  GLN A CA   1  
ATOM 599   C C    . GLN A 1 38 ? 4.499   -0.193  15.839  1.00 0.00 ? 68  GLN A C    1  
ATOM 600   O O    . GLN A 1 38 ? 5.297   -0.300  16.771  1.00 0.00 ? 68  GLN A O    1  
ATOM 601   C CB   . GLN A 1 38 ? 4.297   2.229   16.454  1.00 0.00 ? 68  GLN A CB   1  
ATOM 602   C CG   . GLN A 1 38 ? 5.434   3.174   16.105  1.00 0.00 ? 68  GLN A CG   1  
ATOM 603   C CD   . GLN A 1 38 ? 5.239   4.561   16.688  1.00 0.00 ? 68  GLN A CD   1  
ATOM 604   O OE1  . GLN A 1 38 ? 5.192   5.552   15.961  1.00 0.00 ? 68  GLN A OE1  1  
ATOM 605   N NE2  . GLN A 1 38 ? 5.126   4.636   18.010  1.00 0.00 ? 68  GLN A NE2  1  
ATOM 606   H H    . GLN A 1 38 ? 2.330   1.205   14.100  1.00 0.00 ? 68  GLN A H    1  
ATOM 607   H HA   . GLN A 1 38 ? 4.562   1.447   14.478  1.00 0.00 ? 68  GLN A HA   1  
ATOM 608   H HB2  . GLN A 1 38 ? 3.403   2.816   16.604  1.00 0.00 ? 68  GLN A HB2  1  
ATOM 609   H HB3  . GLN A 1 38 ? 4.545   1.726   17.377  1.00 0.00 ? 68  GLN A HB3  1  
ATOM 610   H HG2  . GLN A 1 38 ? 6.356   2.766   16.490  1.00 0.00 ? 68  GLN A HG2  1  
ATOM 611   H HG3  . GLN A 1 38 ? 5.500   3.258   15.030  1.00 0.00 ? 68  GLN A HG3  1  
ATOM 612   H HE21 . GLN A 1 38 ? 5.174   3.804   18.526  1.00 0.00 ? 68  GLN A HE21 1  
ATOM 613   H HE22 . GLN A 1 38 ? 4.999   5.519   18.413  1.00 0.00 ? 68  GLN A HE22 1  
ATOM 614   N N    . SER A 1 39 ? 4.006   -1.239  15.184  1.00 0.00 ? 69  SER A N    1  
ATOM 615   C CA   . SER A 1 39 ? 4.383   -2.605  15.530  1.00 0.00 ? 69  SER A CA   1  
ATOM 616   C C    . SER A 1 39 ? 5.116   -3.275  14.372  1.00 0.00 ? 69  SER A C    1  
ATOM 617   O O    . SER A 1 39 ? 6.202   -3.828  14.549  1.00 0.00 ? 69  SER A O    1  
ATOM 618   C CB   . SER A 1 39 ? 3.142   -3.419  15.902  1.00 0.00 ? 69  SER A CB   1  
ATOM 619   O OG   . SER A 1 39 ? 3.437   -4.362  16.918  1.00 0.00 ? 69  SER A OG   1  
ATOM 620   H H    . SER A 1 39 ? 3.374   -1.089  14.450  1.00 0.00 ? 69  SER A H    1  
ATOM 621   H HA   . SER A 1 39 ? 5.043   -2.562  16.382  1.00 0.00 ? 69  SER A HA   1  
ATOM 622   H HB2  . SER A 1 39 ? 2.372   -2.754  16.259  1.00 0.00 ? 69  SER A HB2  1  
ATOM 623   H HB3  . SER A 1 39 ? 2.787   -3.948  15.030  1.00 0.00 ? 69  SER A HB3  1  
ATOM 624   H HG   . SER A 1 39 ? 2.928   -5.162  16.771  1.00 0.00 ? 69  SER A HG   1  
ATOM 625   N N    . ILE A 1 40 ? 4.516   -3.221  13.188  1.00 0.00 ? 70  ILE A N    1  
ATOM 626   C CA   . ILE A 1 40 ? 5.113   -3.823  12.001  1.00 0.00 ? 70  ILE A CA   1  
ATOM 627   C C    . ILE A 1 40 ? 6.197   -2.922  11.416  1.00 0.00 ? 70  ILE A C    1  
ATOM 628   O O    . ILE A 1 40 ? 5.986   -1.725  11.221  1.00 0.00 ? 70  ILE A O    1  
ATOM 629   C CB   . ILE A 1 40 ? 4.050   -4.108  10.921  1.00 0.00 ? 70  ILE A CB   1  
ATOM 630   C CG1  . ILE A 1 40 ? 4.678   -4.844  9.735   1.00 0.00 ? 70  ILE A CG1  1  
ATOM 631   C CG2  . ILE A 1 40 ? 3.394   -2.815  10.461  1.00 0.00 ? 70  ILE A CG2  1  
ATOM 632   C CD1  . ILE A 1 40 ? 3.697   -5.705  8.970   1.00 0.00 ? 70  ILE A CD1  1  
ATOM 633   H H    . ILE A 1 40 ? 3.652   -2.767  13.110  1.00 0.00 ? 70  ILE A H    1  
ATOM 634   H HA   . ILE A 1 40 ? 5.559   -4.762  12.294  1.00 0.00 ? 70  ILE A HA   1  
ATOM 635   H HB   . ILE A 1 40 ? 3.286   -4.733  11.357  1.00 0.00 ? 70  ILE A HB   1  
ATOM 636   H HG12 . ILE A 1 40 ? 5.089   -4.120  9.047   1.00 0.00 ? 70  ILE A HG12 1  
ATOM 637   H HG13 . ILE A 1 40 ? 5.472   -5.483  10.095  1.00 0.00 ? 70  ILE A HG13 1  
ATOM 638   H HG21 . ILE A 1 40 ? 2.938   -2.321  11.307  1.00 0.00 ? 70  ILE A HG21 1  
ATOM 639   H HG22 . ILE A 1 40 ? 2.636   -3.037  9.723   1.00 0.00 ? 70  ILE A HG22 1  
ATOM 640   H HG23 . ILE A 1 40 ? 4.140   -2.166  10.025  1.00 0.00 ? 70  ILE A HG23 1  
ATOM 641   H HD11 . ILE A 1 40 ? 2.813   -5.129  8.744   1.00 0.00 ? 70  ILE A HD11 1  
ATOM 642   H HD12 . ILE A 1 40 ? 3.425   -6.561  9.570   1.00 0.00 ? 70  ILE A HD12 1  
ATOM 643   H HD13 . ILE A 1 40 ? 4.153   -6.041  8.050   1.00 0.00 ? 70  ILE A HD13 1  
ATOM 644   N N    . ASP A 1 41 ? 7.357   -3.507  11.139  1.00 0.00 ? 71  ASP A N    1  
ATOM 645   C CA   . ASP A 1 41 ? 8.476   -2.758  10.577  1.00 0.00 ? 71  ASP A CA   1  
ATOM 646   C C    . ASP A 1 41 ? 8.220   -2.418  9.111   1.00 0.00 ? 71  ASP A C    1  
ATOM 647   O O    . ASP A 1 41 ? 7.245   -2.878  8.519   1.00 0.00 ? 71  ASP A O    1  
ATOM 648   C CB   . ASP A 1 41 ? 9.772   -3.560  10.715  1.00 0.00 ? 71  ASP A CB   1  
ATOM 649   C CG   . ASP A 1 41 ? 10.884  -2.756  11.357  1.00 0.00 ? 71  ASP A CG   1  
ATOM 650   O OD1  . ASP A 1 41 ? 10.576  -1.864  12.176  1.00 0.00 ? 71  ASP A OD1  1  
ATOM 651   O OD2  . ASP A 1 41 ? 12.064  -3.017  11.042  1.00 0.00 ? 71  ASP A OD2  1  
ATOM 652   H H    . ASP A 1 41 ? 7.466   -4.464  11.317  1.00 0.00 ? 71  ASP A H    1  
ATOM 653   H HA   . ASP A 1 41 ? 8.572   -1.839  11.136  1.00 0.00 ? 71  ASP A HA   1  
ATOM 654   H HB2  . ASP A 1 41 ? 9.585   -4.432  11.326  1.00 0.00 ? 71  ASP A HB2  1  
ATOM 655   H HB3  . ASP A 1 41 ? 10.100  -3.877  9.736   1.00 0.00 ? 71  ASP A HB3  1  
ATOM 656   N N    . THR A 1 42 ? 9.103   -1.608  8.533   1.00 0.00 ? 72  THR A N    1  
ATOM 657   C CA   . THR A 1 42 ? 8.969   -1.205  7.136   1.00 0.00 ? 72  THR A CA   1  
ATOM 658   C C    . THR A 1 42 ? 8.996   -2.423  6.213   1.00 0.00 ? 72  THR A C    1  
ATOM 659   O O    . THR A 1 42 ? 8.050   -2.662  5.463   1.00 0.00 ? 72  THR A O    1  
ATOM 660   C CB   . THR A 1 42 ? 10.083  -0.227  6.750   1.00 0.00 ? 72  THR A CB   1  
ATOM 661   O OG1  . THR A 1 42 ? 10.980  -0.032  7.829   1.00 0.00 ? 72  THR A OG1  1  
ATOM 662   C CG2  . THR A 1 42 ? 9.566   1.133   6.335   1.00 0.00 ? 72  THR A CG2  1  
ATOM 663   H H    . THR A 1 42 ? 9.860   -1.272  9.057   1.00 0.00 ? 72  THR A H    1  
ATOM 664   H HA   . THR A 1 42 ? 8.016   -0.710  7.027   1.00 0.00 ? 72  THR A HA   1  
ATOM 665   H HB   . THR A 1 42 ? 10.639  -0.637  5.919   1.00 0.00 ? 72  THR A HB   1  
ATOM 666   H HG1  . THR A 1 42 ? 11.684  0.562   7.558   1.00 0.00 ? 72  THR A HG1  1  
ATOM 667   H HG21 . THR A 1 42 ? 9.732   1.274   5.277   1.00 0.00 ? 72  THR A HG21 1  
ATOM 668   H HG22 . THR A 1 42 ? 10.088  1.902   6.886   1.00 0.00 ? 72  THR A HG22 1  
ATOM 669   H HG23 . THR A 1 42 ? 8.508   1.195   6.544   1.00 0.00 ? 72  THR A HG23 1  
ATOM 670   N N    . PRO A 1 43 ? 10.083  -3.216  6.258   1.00 0.00 ? 73  PRO A N    1  
ATOM 671   C CA   . PRO A 1 43 ? 10.222  -4.413  5.423   1.00 0.00 ? 73  PRO A CA   1  
ATOM 672   C C    . PRO A 1 43 ? 8.954   -5.260  5.404   1.00 0.00 ? 73  PRO A C    1  
ATOM 673   O O    . PRO A 1 43 ? 8.649   -5.918  4.409   1.00 0.00 ? 73  PRO A O    1  
ATOM 674   C CB   . PRO A 1 43 ? 11.363  -5.173  6.096   1.00 0.00 ? 73  PRO A CB   1  
ATOM 675   C CG   . PRO A 1 43 ? 12.203  -4.113  6.721   1.00 0.00 ? 73  PRO A CG   1  
ATOM 676   C CD   . PRO A 1 43 ? 11.260  -3.009  7.126   1.00 0.00 ? 73  PRO A CD   1  
ATOM 677   H HA   . PRO A 1 43 ? 10.501  -4.160  4.411   1.00 0.00 ? 73  PRO A HA   1  
ATOM 678   H HB2  . PRO A 1 43 ? 10.961  -5.850  6.837   1.00 0.00 ? 73  PRO A HB2  1  
ATOM 679   H HB3  . PRO A 1 43 ? 11.917  -5.729  5.354   1.00 0.00 ? 73  PRO A HB3  1  
ATOM 680   H HG2  . PRO A 1 43 ? 12.707  -4.511  7.589   1.00 0.00 ? 73  PRO A HG2  1  
ATOM 681   H HG3  . PRO A 1 43 ? 12.923  -3.747  6.005   1.00 0.00 ? 73  PRO A HG3  1  
ATOM 682   H HD2  . PRO A 1 43 ? 10.992  -3.106  8.167   1.00 0.00 ? 73  PRO A HD2  1  
ATOM 683   H HD3  . PRO A 1 43 ? 11.711  -2.047  6.941   1.00 0.00 ? 73  PRO A HD3  1  
ATOM 684   N N    . GLY A 1 44 ? 8.217   -5.237  6.510   1.00 0.00 ? 74  GLY A N    1  
ATOM 685   C CA   . GLY A 1 44 ? 6.989   -6.004  6.599   1.00 0.00 ? 74  GLY A CA   1  
ATOM 686   C C    . GLY A 1 44 ? 5.879   -5.421  5.747   1.00 0.00 ? 74  GLY A C    1  
ATOM 687   O O    . GLY A 1 44 ? 5.040   -6.153  5.222   1.00 0.00 ? 74  GLY A O    1  
ATOM 688   H H    . GLY A 1 44 ? 8.508   -4.692  7.271   1.00 0.00 ? 74  GLY A H    1  
ATOM 689   H HA2  . GLY A 1 44 ? 7.185   -7.015  6.273   1.00 0.00 ? 74  GLY A HA2  1  
ATOM 690   H HA3  . GLY A 1 44 ? 6.664   -6.026  7.629   1.00 0.00 ? 74  GLY A HA3  1  
ATOM 691   N N    . VAL A 1 45 ? 5.876   -4.099  5.609   1.00 0.00 ? 75  VAL A N    1  
ATOM 692   C CA   . VAL A 1 45 ? 4.862   -3.417  4.813   1.00 0.00 ? 75  VAL A CA   1  
ATOM 693   C C    . VAL A 1 45 ? 5.066   -3.679  3.326   1.00 0.00 ? 75  VAL A C    1  
ATOM 694   O O    . VAL A 1 45 ? 4.126   -4.028  2.611   1.00 0.00 ? 75  VAL A O    1  
ATOM 695   C CB   . VAL A 1 45 ? 4.881   -1.895  5.062   1.00 0.00 ? 75  VAL A CB   1  
ATOM 696   C CG1  . VAL A 1 45 ? 3.727   -1.216  4.338   1.00 0.00 ? 75  VAL A CG1  1  
ATOM 697   C CG2  . VAL A 1 45 ? 4.836   -1.597  6.553   1.00 0.00 ? 75  VAL A CG2  1  
ATOM 698   H H    . VAL A 1 45 ? 6.572   -3.570  6.050   1.00 0.00 ? 75  VAL A H    1  
ATOM 699   H HA   . VAL A 1 45 ? 3.894   -3.797  5.108   1.00 0.00 ? 75  VAL A HA   1  
ATOM 700   H HB   . VAL A 1 45 ? 5.806   -1.499  4.666   1.00 0.00 ? 75  VAL A HB   1  
ATOM 701   H HG11 . VAL A 1 45 ? 4.093   -0.349  3.811   1.00 0.00 ? 75  VAL A HG11 1  
ATOM 702   H HG12 . VAL A 1 45 ? 2.980   -0.912  5.057   1.00 0.00 ? 75  VAL A HG12 1  
ATOM 703   H HG13 . VAL A 1 45 ? 3.287   -1.907  3.634   1.00 0.00 ? 75  VAL A HG13 1  
ATOM 704   H HG21 . VAL A 1 45 ? 5.285   -0.633  6.741   1.00 0.00 ? 75  VAL A HG21 1  
ATOM 705   H HG22 . VAL A 1 45 ? 5.381   -2.358  7.090   1.00 0.00 ? 75  VAL A HG22 1  
ATOM 706   H HG23 . VAL A 1 45 ? 3.809   -1.586  6.887   1.00 0.00 ? 75  VAL A HG23 1  
ATOM 707   N N    . ILE A 1 46 ? 6.301   -3.509  2.866   1.00 0.00 ? 76  ILE A N    1  
ATOM 708   C CA   . ILE A 1 46 ? 6.632   -3.727  1.464   1.00 0.00 ? 76  ILE A CA   1  
ATOM 709   C C    . ILE A 1 46 ? 6.515   -5.201  1.092   1.00 0.00 ? 76  ILE A C    1  
ATOM 710   O O    . ILE A 1 46 ? 6.172   -5.541  -0.040  1.00 0.00 ? 76  ILE A O    1  
ATOM 711   C CB   . ILE A 1 46 ? 8.058   -3.240  1.142   1.00 0.00 ? 76  ILE A CB   1  
ATOM 712   C CG1  . ILE A 1 46 ? 8.266   -1.818  1.668   1.00 0.00 ? 76  ILE A CG1  1  
ATOM 713   C CG2  . ILE A 1 46 ? 8.315   -3.302  -0.356  1.00 0.00 ? 76  ILE A CG2  1  
ATOM 714   C CD1  . ILE A 1 46 ? 9.085   -1.758  2.939   1.00 0.00 ? 76  ILE A CD1  1  
ATOM 715   H H    . ILE A 1 46 ? 7.008   -3.229  3.486   1.00 0.00 ? 76  ILE A H    1  
ATOM 716   H HA   . ILE A 1 46 ? 5.937   -3.158  0.864   1.00 0.00 ? 76  ILE A HA   1  
ATOM 717   H HB   . ILE A 1 46 ? 8.758   -3.902  1.630   1.00 0.00 ? 76  ILE A HB   1  
ATOM 718   H HG12 . ILE A 1 46 ? 8.777   -1.233  0.918   1.00 0.00 ? 76  ILE A HG12 1  
ATOM 719   H HG13 . ILE A 1 46 ? 7.304   -1.371  1.871   1.00 0.00 ? 76  ILE A HG13 1  
ATOM 720   H HG21 . ILE A 1 46 ? 8.743   -4.261  -0.608  1.00 0.00 ? 76  ILE A HG21 1  
ATOM 721   H HG22 . ILE A 1 46 ? 9.001   -2.517  -0.636  1.00 0.00 ? 76  ILE A HG22 1  
ATOM 722   H HG23 . ILE A 1 46 ? 7.383   -3.173  -0.887  1.00 0.00 ? 76  ILE A HG23 1  
ATOM 723   H HD11 . ILE A 1 46 ? 10.113  -1.537  2.695   1.00 0.00 ? 76  ILE A HD11 1  
ATOM 724   H HD12 . ILE A 1 46 ? 9.031   -2.709  3.447   1.00 0.00 ? 76  ILE A HD12 1  
ATOM 725   H HD13 . ILE A 1 46 ? 8.694   -0.983  3.583   1.00 0.00 ? 76  ILE A HD13 1  
ATOM 726   N N    . ARG A 1 47 ? 6.803   -6.073  2.053   1.00 0.00 ? 77  ARG A N    1  
ATOM 727   C CA   . ARG A 1 47 ? 6.731   -7.512  1.826   1.00 0.00 ? 77  ARG A CA   1  
ATOM 728   C C    . ARG A 1 47 ? 5.301   -7.945  1.519   1.00 0.00 ? 77  ARG A C    1  
ATOM 729   O O    . ARG A 1 47 ? 5.044   -8.613  0.517   1.00 0.00 ? 77  ARG A O    1  
ATOM 730   C CB   . ARG A 1 47 ? 7.256   -8.269  3.047   1.00 0.00 ? 77  ARG A CB   1  
ATOM 731   C CG   . ARG A 1 47 ? 8.764   -8.450  3.048   1.00 0.00 ? 77  ARG A CG   1  
ATOM 732   C CD   . ARG A 1 47 ? 9.253   -9.064  4.350   1.00 0.00 ? 77  ARG A CD   1  
ATOM 733   N NE   . ARG A 1 47 ? 9.529   -10.491 4.213   1.00 0.00 ? 77  ARG A NE   1  
ATOM 734   C CZ   . ARG A 1 47 ? 9.621   -11.331 5.241   1.00 0.00 ? 77  ARG A CZ   1  
ATOM 735   N NH1  . ARG A 1 47 ? 9.458   -10.891 6.483   1.00 0.00 ? 77  ARG A NH1  1  
ATOM 736   N NH2  . ARG A 1 47 ? 9.876   -12.615 5.028   1.00 0.00 ? 77  ARG A NH2  1  
ATOM 737   H H    . ARG A 1 47 ? 7.071   -5.742  2.935   1.00 0.00 ? 77  ARG A H    1  
ATOM 738   H HA   . ARG A 1 47 ? 7.354   -7.744  0.975   1.00 0.00 ? 77  ARG A HA   1  
ATOM 739   H HB2  . ARG A 1 47 ? 6.979   -7.727  3.939   1.00 0.00 ? 77  ARG A HB2  1  
ATOM 740   H HB3  . ARG A 1 47 ? 6.797   -9.247  3.073   1.00 0.00 ? 77  ARG A HB3  1  
ATOM 741   H HG2  . ARG A 1 47 ? 9.040   -9.099  2.231   1.00 0.00 ? 77  ARG A HG2  1  
ATOM 742   H HG3  . ARG A 1 47 ? 9.233   -7.485  2.917   1.00 0.00 ? 77  ARG A HG3  1  
ATOM 743   H HD2  . ARG A 1 47 ? 10.157  -8.559  4.655   1.00 0.00 ? 77  ARG A HD2  1  
ATOM 744   H HD3  . ARG A 1 47 ? 8.493   -8.925  5.106   1.00 0.00 ? 77  ARG A HD3  1  
ATOM 745   H HE   . ARG A 1 47 ? 9.654   -10.842 3.307   1.00 0.00 ? 77  ARG A HE   1  
ATOM 746   H HH11 . ARG A 1 47 ? 9.266   -9.924  6.651   1.00 0.00 ? 77  ARG A HH11 1  
ATOM 747   H HH12 . ARG A 1 47 ? 9.529   -11.527 7.251   1.00 0.00 ? 77  ARG A HH12 1  
ATOM 748   H HH21 . ARG A 1 47 ? 9.999   -12.951 4.094   1.00 0.00 ? 77  ARG A HH21 1  
ATOM 749   H HH22 . ARG A 1 47 ? 9.945   -13.246 5.800   1.00 0.00 ? 77  ARG A HH22 1  
ATOM 750   N N    . ARG A 1 48 ? 4.371   -7.561  2.389   1.00 0.00 ? 78  ARG A N    1  
ATOM 751   C CA   . ARG A 1 48 ? 2.966   -7.911  2.210   1.00 0.00 ? 78  ARG A CA   1  
ATOM 752   C C    . ARG A 1 48 ? 2.446   -7.414  0.865   1.00 0.00 ? 78  ARG A C    1  
ATOM 753   O O    . ARG A 1 48 ? 1.807   -8.159  0.123   1.00 0.00 ? 78  ARG A O    1  
ATOM 754   C CB   . ARG A 1 48 ? 2.122   -7.326  3.344   1.00 0.00 ? 78  ARG A CB   1  
ATOM 755   C CG   . ARG A 1 48 ? 0.972   -8.222  3.771   1.00 0.00 ? 78  ARG A CG   1  
ATOM 756   C CD   . ARG A 1 48 ? 1.462   -9.398  4.601   1.00 0.00 ? 78  ARG A CD   1  
ATOM 757   N NE   . ARG A 1 48 ? 0.440   -9.876  5.529   1.00 0.00 ? 78  ARG A NE   1  
ATOM 758   C CZ   . ARG A 1 48 ? -0.667  -10.512 5.151   1.00 0.00 ? 78  ARG A CZ   1  
ATOM 759   N NH1  . ARG A 1 48 ? -0.900  -10.745 3.866   1.00 0.00 ? 78  ARG A NH1  1  
ATOM 760   N NH2  . ARG A 1 48 ? -1.543  -10.914 6.061   1.00 0.00 ? 78  ARG A NH2  1  
ATOM 761   H H    . ARG A 1 48 ? 4.636   -7.030  3.169   1.00 0.00 ? 78  ARG A H    1  
ATOM 762   H HA   . ARG A 1 48 ? 2.888   -8.987  2.236   1.00 0.00 ? 78  ARG A HA   1  
ATOM 763   H HB2  . ARG A 1 48 ? 2.758   -7.159  4.201   1.00 0.00 ? 78  ARG A HB2  1  
ATOM 764   H HB3  . ARG A 1 48 ? 1.714   -6.379  3.022   1.00 0.00 ? 78  ARG A HB3  1  
ATOM 765   H HG2  . ARG A 1 48 ? 0.275   -7.644  4.359   1.00 0.00 ? 78  ARG A HG2  1  
ATOM 766   H HG3  . ARG A 1 48 ? 0.475   -8.598  2.887   1.00 0.00 ? 78  ARG A HG3  1  
ATOM 767   H HD2  . ARG A 1 48 ? 1.734   -10.204 3.935   1.00 0.00 ? 78  ARG A HD2  1  
ATOM 768   H HD3  . ARG A 1 48 ? 2.329   -9.088  5.164   1.00 0.00 ? 78  ARG A HD3  1  
ATOM 769   H HE   . ARG A 1 48 ? 0.587   -9.715  6.484   1.00 0.00 ? 78  ARG A HE   1  
ATOM 770   H HH11 . ARG A 1 48 ? -0.244  -10.443 3.174   1.00 0.00 ? 78  ARG A HH11 1  
ATOM 771   H HH12 . ARG A 1 48 ? -1.733  -11.223 3.588   1.00 0.00 ? 78  ARG A HH12 1  
ATOM 772   H HH21 . ARG A 1 48 ? -1.372  -10.741 7.030   1.00 0.00 ? 78  ARG A HH21 1  
ATOM 773   H HH22 . ARG A 1 48 ? -2.375  -11.391 5.778   1.00 0.00 ? 78  ARG A HH22 1  
ATOM 774   N N    . VAL A 1 49 ? 2.725   -6.152  0.556   1.00 0.00 ? 79  VAL A N    1  
ATOM 775   C CA   . VAL A 1 49 ? 2.287   -5.560  -0.701  1.00 0.00 ? 79  VAL A CA   1  
ATOM 776   C C    . VAL A 1 49 ? 2.894   -6.295  -1.891  1.00 0.00 ? 79  VAL A C    1  
ATOM 777   O O    . VAL A 1 49 ? 2.217   -6.552  -2.887  1.00 0.00 ? 79  VAL A O    1  
ATOM 778   C CB   . VAL A 1 49 ? 2.665   -4.068  -0.783  1.00 0.00 ? 79  VAL A CB   1  
ATOM 779   C CG1  . VAL A 1 49 ? 2.116   -3.443  -2.057  1.00 0.00 ? 79  VAL A CG1  1  
ATOM 780   C CG2  . VAL A 1 49 ? 2.163   -3.321  0.444   1.00 0.00 ? 79  VAL A CG2  1  
ATOM 781   H H    . VAL A 1 49 ? 3.241   -5.607  1.188   1.00 0.00 ? 79  VAL A H    1  
ATOM 782   H HA   . VAL A 1 49 ? 1.211   -5.641  -0.751  1.00 0.00 ? 79  VAL A HA   1  
ATOM 783   H HB   . VAL A 1 49 ? 3.742   -3.992  -0.808  1.00 0.00 ? 79  VAL A HB   1  
ATOM 784   H HG11 . VAL A 1 49 ? 1.245   -3.992  -2.381  1.00 0.00 ? 79  VAL A HG11 1  
ATOM 785   H HG12 . VAL A 1 49 ? 2.871   -3.475  -2.828  1.00 0.00 ? 79  VAL A HG12 1  
ATOM 786   H HG13 . VAL A 1 49 ? 1.842   -2.415  -1.864  1.00 0.00 ? 79  VAL A HG13 1  
ATOM 787   H HG21 . VAL A 1 49 ? 2.920   -2.627  0.778   1.00 0.00 ? 79  VAL A HG21 1  
ATOM 788   H HG22 . VAL A 1 49 ? 1.949   -4.027  1.233   1.00 0.00 ? 79  VAL A HG22 1  
ATOM 789   H HG23 . VAL A 1 49 ? 1.264   -2.779  0.192   1.00 0.00 ? 79  VAL A HG23 1  
ATOM 790   N N    . SER A 1 50 ? 4.175   -6.632  -1.781  1.00 0.00 ? 80  SER A N    1  
ATOM 791   C CA   . SER A 1 50 ? 4.874   -7.339  -2.847  1.00 0.00 ? 80  SER A CA   1  
ATOM 792   C C    . SER A 1 50 ? 4.255   -8.710  -3.097  1.00 0.00 ? 80  SER A C    1  
ATOM 793   O O    . SER A 1 50 ? 4.366   -9.263  -4.191  1.00 0.00 ? 80  SER A O    1  
ATOM 794   C CB   . SER A 1 50 ? 6.356   -7.491  -2.501  1.00 0.00 ? 80  SER A CB   1  
ATOM 795   O OG   . SER A 1 50 ? 7.107   -6.392  -2.984  1.00 0.00 ? 80  SER A OG   1  
ATOM 796   H H    . SER A 1 50 ? 4.661   -6.400  -0.963  1.00 0.00 ? 80  SER A H    1  
ATOM 797   H HA   . SER A 1 50 ? 4.782   -6.752  -3.745  1.00 0.00 ? 80  SER A HA   1  
ATOM 798   H HB2  . SER A 1 50 ? 6.469   -7.545  -1.428  1.00 0.00 ? 80  SER A HB2  1  
ATOM 799   H HB3  . SER A 1 50 ? 6.737   -8.397  -2.949  1.00 0.00 ? 80  SER A HB3  1  
ATOM 800   H HG   . SER A 1 50 ? 7.352   -5.824  -2.250  1.00 0.00 ? 80  SER A HG   1  
ATOM 801   N N    . GLN A 1 51 ? 3.602   -9.251  -2.076  1.00 0.00 ? 81  GLN A N    1  
ATOM 802   C CA   . GLN A 1 51 ? 2.963   -10.558 -2.181  1.00 0.00 ? 81  GLN A CA   1  
ATOM 803   C C    . GLN A 1 51 ? 1.479   -10.411 -2.503  1.00 0.00 ? 81  GLN A C    1  
ATOM 804   O O    . GLN A 1 51 ? 0.907   -11.221 -3.233  1.00 0.00 ? 81  GLN A O    1  
ATOM 805   C CB   . GLN A 1 51 ? 3.139   -11.343 -0.880  1.00 0.00 ? 81  GLN A CB   1  
ATOM 806   C CG   . GLN A 1 51 ? 2.629   -12.772 -0.959  1.00 0.00 ? 81  GLN A CG   1  
ATOM 807   C CD   . GLN A 1 51 ? 3.436   -13.726 -0.100  1.00 0.00 ? 81  GLN A CD   1  
ATOM 808   O OE1  . GLN A 1 51 ? 4.021   -13.331 0.908   1.00 0.00 ? 81  GLN A OE1  1  
ATOM 809   N NE2  . GLN A 1 51 ? 3.471   -14.993 -0.497  1.00 0.00 ? 81  GLN A NE2  1  
ATOM 810   H H    . GLN A 1 51 ? 3.549   -8.760  -1.231  1.00 0.00 ? 81  GLN A H    1  
ATOM 811   H HA   . GLN A 1 51 ? 3.441   -11.097 -2.985  1.00 0.00 ? 81  GLN A HA   1  
ATOM 812   H HB2  . GLN A 1 51 ? 4.190   -11.371 -0.631  1.00 0.00 ? 81  GLN A HB2  1  
ATOM 813   H HB3  . GLN A 1 51 ? 2.605   -10.835 -0.091  1.00 0.00 ? 81  GLN A HB3  1  
ATOM 814   H HG2  . GLN A 1 51 ? 1.602   -12.793 -0.624  1.00 0.00 ? 81  GLN A HG2  1  
ATOM 815   H HG3  . GLN A 1 51 ? 2.679   -13.104 -1.985  1.00 0.00 ? 81  GLN A HG3  1  
ATOM 816   H HE21 . GLN A 1 51 ? 2.982   -15.238 -1.310  1.00 0.00 ? 81  GLN A HE21 1  
ATOM 817   H HE22 . GLN A 1 51 ? 3.986   -15.632 0.039   1.00 0.00 ? 81  GLN A HE22 1  
ATOM 818   N N    . LEU A 1 52 ? 0.861   -9.371  -1.952  1.00 0.00 ? 82  LEU A N    1  
ATOM 819   C CA   . LEU A 1 52 ? -0.556  -9.114  -2.177  1.00 0.00 ? 82  LEU A CA   1  
ATOM 820   C C    . LEU A 1 52 ? -0.832  -8.838  -3.652  1.00 0.00 ? 82  LEU A C    1  
ATOM 821   O O    . LEU A 1 52 ? -1.793  -9.352  -4.222  1.00 0.00 ? 82  LEU A O    1  
ATOM 822   C CB   . LEU A 1 52 ? -1.020  -7.930  -1.328  1.00 0.00 ? 82  LEU A CB   1  
ATOM 823   C CG   . LEU A 1 52 ? -2.502  -7.945  -0.947  1.00 0.00 ? 82  LEU A CG   1  
ATOM 824   C CD1  . LEU A 1 52 ? -2.706  -8.679  0.370   1.00 0.00 ? 82  LEU A CD1  1  
ATOM 825   C CD2  . LEU A 1 52 ? -3.044  -6.527  -0.860  1.00 0.00 ? 82  LEU A CD2  1  
ATOM 826   H H    . LEU A 1 52 ? 1.370   -8.762  -1.379  1.00 0.00 ? 82  LEU A H    1  
ATOM 827   H HA   . LEU A 1 52 ? -1.103  -9.995  -1.880  1.00 0.00 ? 82  LEU A HA   1  
ATOM 828   H HB2  . LEU A 1 52 ? -0.437  -7.914  -0.420  1.00 0.00 ? 82  LEU A HB2  1  
ATOM 829   H HB3  . LEU A 1 52 ? -0.824  -7.021  -1.878  1.00 0.00 ? 82  LEU A HB3  1  
ATOM 830   H HG   . LEU A 1 52 ? -3.058  -8.470  -1.710  1.00 0.00 ? 82  LEU A HG   1  
ATOM 831   H HD11 . LEU A 1 52 ? -3.755  -8.903  0.499   1.00 0.00 ? 82  LEU A HD11 1  
ATOM 832   H HD12 . LEU A 1 52 ? -2.370  -8.054  1.185   1.00 0.00 ? 82  LEU A HD12 1  
ATOM 833   H HD13 . LEU A 1 52 ? -2.139  -9.597  0.362   1.00 0.00 ? 82  LEU A HD13 1  
ATOM 834   H HD21 . LEU A 1 52 ? -2.478  -5.883  -1.516  1.00 0.00 ? 82  LEU A HD21 1  
ATOM 835   H HD22 . LEU A 1 52 ? -2.958  -6.171  0.156   1.00 0.00 ? 82  LEU A HD22 1  
ATOM 836   H HD23 . LEU A 1 52 ? -4.083  -6.519  -1.156  1.00 0.00 ? 82  LEU A HD23 1  
ATOM 837   N N    . PHE A 1 53 ? 0.019   -8.019  -4.263  1.00 0.00 ? 83  PHE A N    1  
ATOM 838   C CA   . PHE A 1 53 ? -0.132  -7.672  -5.671  1.00 0.00 ? 83  PHE A CA   1  
ATOM 839   C C    . PHE A 1 53 ? 0.929   -8.367  -6.520  1.00 0.00 ? 83  PHE A C    1  
ATOM 840   O O    . PHE A 1 53 ? 1.625   -7.727  -7.310  1.00 0.00 ? 83  PHE A O    1  
ATOM 841   C CB   . PHE A 1 53 ? -0.042  -6.156  -5.856  1.00 0.00 ? 83  PHE A CB   1  
ATOM 842   C CG   . PHE A 1 53 ? -0.995  -5.387  -4.986  1.00 0.00 ? 83  PHE A CG   1  
ATOM 843   C CD1  . PHE A 1 53 ? -2.328  -5.755  -4.903  1.00 0.00 ? 83  PHE A CD1  1  
ATOM 844   C CD2  . PHE A 1 53 ? -0.559  -4.297  -4.251  1.00 0.00 ? 83  PHE A CD2  1  
ATOM 845   C CE1  . PHE A 1 53 ? -3.208  -5.050  -4.104  1.00 0.00 ? 83  PHE A CE1  1  
ATOM 846   C CE2  . PHE A 1 53 ? -1.434  -3.588  -3.451  1.00 0.00 ? 83  PHE A CE2  1  
ATOM 847   C CZ   . PHE A 1 53 ? -2.761  -3.965  -3.377  1.00 0.00 ? 83  PHE A CZ   1  
ATOM 848   H H    . PHE A 1 53 ? 0.765   -7.640  -3.755  1.00 0.00 ? 83  PHE A H    1  
ATOM 849   H HA   . PHE A 1 53 ? -1.107  -8.007  -5.992  1.00 0.00 ? 83  PHE A HA   1  
ATOM 850   H HB2  . PHE A 1 53 ? 0.960   -5.831  -5.617  1.00 0.00 ? 83  PHE A HB2  1  
ATOM 851   H HB3  . PHE A 1 53 ? -0.258  -5.912  -6.886  1.00 0.00 ? 83  PHE A HB3  1  
ATOM 852   H HD1  . PHE A 1 53 ? -2.680  -6.604  -5.471  1.00 0.00 ? 83  PHE A HD1  1  
ATOM 853   H HD2  . PHE A 1 53 ? 0.478   -4.001  -4.308  1.00 0.00 ? 83  PHE A HD2  1  
ATOM 854   H HE1  . PHE A 1 53 ? -4.245  -5.347  -4.049  1.00 0.00 ? 83  PHE A HE1  1  
ATOM 855   H HE2  . PHE A 1 53 ? -1.081  -2.739  -2.883  1.00 0.00 ? 83  PHE A HE2  1  
ATOM 856   H HZ   . PHE A 1 53 ? -3.447  -3.413  -2.752  1.00 0.00 ? 83  PHE A HZ   1  
ATOM 857   N N    . HIS A 1 54 ? 1.050   -9.679  -6.349  1.00 0.00 ? 84  HIS A N    1  
ATOM 858   C CA   . HIS A 1 54 ? 2.027   -10.461 -7.095  1.00 0.00 ? 84  HIS A CA   1  
ATOM 859   C C    . HIS A 1 54 ? 1.683   -10.493 -8.582  1.00 0.00 ? 84  HIS A C    1  
ATOM 860   O O    . HIS A 1 54 ? 2.570   -10.579 -9.432  1.00 0.00 ? 84  HIS A O    1  
ATOM 861   C CB   . HIS A 1 54 ? 2.096   -11.887 -6.545  1.00 0.00 ? 84  HIS A CB   1  
ATOM 862   C CG   . HIS A 1 54 ? 0.771   -12.582 -6.511  1.00 0.00 ? 84  HIS A CG   1  
ATOM 863   N ND1  . HIS A 1 54 ? 0.040   -12.753 -5.353  1.00 0.00 ? 84  HIS A ND1  1  
ATOM 864   C CD2  . HIS A 1 54 ? 0.042   -13.151 -7.501  1.00 0.00 ? 84  HIS A CD2  1  
ATOM 865   C CE1  . HIS A 1 54 ? -1.079  -13.398 -5.633  1.00 0.00 ? 84  HIS A CE1  1  
ATOM 866   N NE2  . HIS A 1 54 ? -1.102  -13.650 -6.928  1.00 0.00 ? 84  HIS A NE2  1  
ATOM 867   H H    . HIS A 1 54 ? 0.470   -10.131 -5.704  1.00 0.00 ? 84  HIS A H    1  
ATOM 868   H HA   . HIS A 1 54 ? 2.989   -9.990  -6.971  1.00 0.00 ? 84  HIS A HA   1  
ATOM 869   H HB2  . HIS A 1 54 ? 2.761   -12.472 -7.164  1.00 0.00 ? 84  HIS A HB2  1  
ATOM 870   H HB3  . HIS A 1 54 ? 2.483   -11.857 -5.537  1.00 0.00 ? 84  HIS A HB3  1  
ATOM 871   H HD1  . HIS A 1 54 ? 0.303   -12.448 -4.460  1.00 0.00 ? 84  HIS A HD1  1  
ATOM 872   H HD2  . HIS A 1 54 ? 0.311   -13.203 -8.546  1.00 0.00 ? 84  HIS A HD2  1  
ATOM 873   H HE1  . HIS A 1 54 ? -1.845  -13.671 -4.922  1.00 0.00 ? 84  HIS A HE1  1  
ATOM 874   H HE2  . HIS A 1 54 ? -1.854  -14.051 -7.413  1.00 0.00 ? 84  HIS A HE2  1  
ATOM 875   N N    . GLU A 1 55 ? 0.392   -10.428 -8.889  1.00 0.00 ? 85  GLU A N    1  
ATOM 876   C CA   . GLU A 1 55 ? -0.065  -10.452 -10.275 1.00 0.00 ? 85  GLU A CA   1  
ATOM 877   C C    . GLU A 1 55 ? -0.626  -9.094  -10.692 1.00 0.00 ? 85  GLU A C    1  
ATOM 878   O O    . GLU A 1 55 ? -1.471  -9.010  -11.583 1.00 0.00 ? 85  GLU A O    1  
ATOM 879   C CB   . GLU A 1 55 ? -1.130  -11.534 -10.461 1.00 0.00 ? 85  GLU A CB   1  
ATOM 880   C CG   . GLU A 1 55 ? -1.003  -12.293 -11.772 1.00 0.00 ? 85  GLU A CG   1  
ATOM 881   C CD   . GLU A 1 55 ? -2.299  -12.965 -12.185 1.00 0.00 ? 85  GLU A CD   1  
ATOM 882   O OE1  . GLU A 1 55 ? -3.375  -12.382 -11.937 1.00 0.00 ? 85  GLU A OE1  1  
ATOM 883   O OE2  . GLU A 1 55 ? -2.237  -14.074 -12.758 1.00 0.00 ? 85  GLU A OE2  1  
ATOM 884   H H    . GLU A 1 55 ? -0.269  -10.362 -8.169  1.00 0.00 ? 85  GLU A H    1  
ATOM 885   H HA   . GLU A 1 55 ? 0.784   -10.684 -10.900 1.00 0.00 ? 85  GLU A HA   1  
ATOM 886   H HB2  . GLU A 1 55 ? -1.052  -12.243 -9.651  1.00 0.00 ? 85  GLU A HB2  1  
ATOM 887   H HB3  . GLU A 1 55 ? -2.106  -11.073 -10.431 1.00 0.00 ? 85  GLU A HB3  1  
ATOM 888   H HG2  . GLU A 1 55 ? -0.712  -11.602 -12.548 1.00 0.00 ? 85  GLU A HG2  1  
ATOM 889   H HG3  . GLU A 1 55 ? -0.241  -13.051 -11.662 1.00 0.00 ? 85  GLU A HG3  1  
ATOM 890   N N    . HIS A 1 56 ? -0.150  -8.035  -10.044 1.00 0.00 ? 86  HIS A N    1  
ATOM 891   C CA   . HIS A 1 56 ? -0.606  -6.684  -10.352 1.00 0.00 ? 86  HIS A CA   1  
ATOM 892   C C    . HIS A 1 56 ? 0.557   -5.695  -10.323 1.00 0.00 ? 86  HIS A C    1  
ATOM 893   O O    . HIS A 1 56 ? 0.919   -5.184  -9.265  1.00 0.00 ? 86  HIS A O    1  
ATOM 894   C CB   . HIS A 1 56 ? -1.683  -6.250  -9.358  1.00 0.00 ? 86  HIS A CB   1  
ATOM 895   C CG   . HIS A 1 56 ? -3.040  -6.798  -9.669  1.00 0.00 ? 86  HIS A CG   1  
ATOM 896   N ND1  . HIS A 1 56 ? -3.558  -6.848  -10.946 1.00 0.00 ? 86  HIS A ND1  1  
ATOM 897   C CD2  . HIS A 1 56 ? -3.990  -7.327  -8.860  1.00 0.00 ? 86  HIS A CD2  1  
ATOM 898   C CE1  . HIS A 1 56 ? -4.766  -7.381  -10.911 1.00 0.00 ? 86  HIS A CE1  1  
ATOM 899   N NE2  . HIS A 1 56 ? -5.052  -7.680  -9.656  1.00 0.00 ? 86  HIS A NE2  1  
ATOM 900   H H    . HIS A 1 56 ? 0.523   -8.164  -9.344  1.00 0.00 ? 86  HIS A H    1  
ATOM 901   H HA   . HIS A 1 56 ? -1.031  -6.696  -11.345 1.00 0.00 ? 86  HIS A HA   1  
ATOM 902   H HB2  . HIS A 1 56 ? -1.408  -6.587  -8.370  1.00 0.00 ? 86  HIS A HB2  1  
ATOM 903   H HB3  . HIS A 1 56 ? -1.751  -5.172  -9.360  1.00 0.00 ? 86  HIS A HB3  1  
ATOM 904   H HD1  . HIS A 1 56 ? -3.106  -6.537  -11.759 1.00 0.00 ? 86  HIS A HD1  1  
ATOM 905   H HD2  . HIS A 1 56 ? -3.924  -7.446  -7.789  1.00 0.00 ? 86  HIS A HD2  1  
ATOM 906   H HE1  . HIS A 1 56 ? -5.410  -7.544  -11.762 1.00 0.00 ? 86  HIS A HE1  1  
ATOM 907   H HE2  . HIS A 1 56 ? -5.918  -8.008  -9.338  1.00 0.00 ? 86  HIS A HE2  1  
ATOM 908   N N    . PRO A 1 57 ? 1.162   -5.409  -11.491 1.00 0.00 ? 87  PRO A N    1  
ATOM 909   C CA   . PRO A 1 57 ? 2.289   -4.475  -11.585 1.00 0.00 ? 87  PRO A CA   1  
ATOM 910   C C    . PRO A 1 57 ? 1.878   -3.038  -11.284 1.00 0.00 ? 87  PRO A C    1  
ATOM 911   O O    . PRO A 1 57 ? 2.520   -2.352  -10.489 1.00 0.00 ? 87  PRO A O    1  
ATOM 912   C CB   . PRO A 1 57 ? 2.746   -4.605  -13.040 1.00 0.00 ? 87  PRO A CB   1  
ATOM 913   C CG   . PRO A 1 57 ? 1.550   -5.103  -13.775 1.00 0.00 ? 87  PRO A CG   1  
ATOM 914   C CD   . PRO A 1 57 ? 0.799   -5.972  -12.805 1.00 0.00 ? 87  PRO A CD   1  
ATOM 915   H HA   . PRO A 1 57 ? 3.095   -4.762  -10.925 1.00 0.00 ? 87  PRO A HA   1  
ATOM 916   H HB2  . PRO A 1 57 ? 3.063   -3.641  -13.408 1.00 0.00 ? 87  PRO A HB2  1  
ATOM 917   H HB3  . PRO A 1 57 ? 3.566   -5.307  -13.101 1.00 0.00 ? 87  PRO A HB3  1  
ATOM 918   H HG2  . PRO A 1 57 ? 0.937   -4.271  -14.086 1.00 0.00 ? 87  PRO A HG2  1  
ATOM 919   H HG3  . PRO A 1 57 ? 1.860   -5.682  -14.632 1.00 0.00 ? 87  PRO A HG3  1  
ATOM 920   H HD2  . PRO A 1 57 ? -0.264  -5.896  -12.976 1.00 0.00 ? 87  PRO A HD2  1  
ATOM 921   H HD3  . PRO A 1 57 ? 1.124   -6.999  -12.887 1.00 0.00 ? 87  PRO A HD3  1  
ATOM 922   N N    . ASP A 1 58 ? 0.801   -2.588  -11.920 1.00 0.00 ? 88  ASP A N    1  
ATOM 923   C CA   . ASP A 1 58 ? 0.301   -1.230  -11.723 1.00 0.00 ? 88  ASP A CA   1  
ATOM 924   C C    . ASP A 1 58 ? 0.036   -0.942  -10.245 1.00 0.00 ? 88  ASP A C    1  
ATOM 925   O O    . ASP A 1 58 ? -0.015  0.215   -9.830  1.00 0.00 ? 88  ASP A O    1  
ATOM 926   C CB   . ASP A 1 58 ? -0.980  -1.017  -12.531 1.00 0.00 ? 88  ASP A CB   1  
ATOM 927   C CG   . ASP A 1 58 ? -1.358  0.448   -12.637 1.00 0.00 ? 88  ASP A CG   1  
ATOM 928   O OD1  . ASP A 1 58 ? -2.009  0.962   -11.704 1.00 0.00 ? 88  ASP A OD1  1  
ATOM 929   O OD2  . ASP A 1 58 ? -1.002  1.080   -13.654 1.00 0.00 ? 88  ASP A OD2  1  
ATOM 930   H H    . ASP A 1 58 ? 0.331   -3.184  -12.541 1.00 0.00 ? 88  ASP A H    1  
ATOM 931   H HA   . ASP A 1 58 ? 1.057   -0.547  -12.078 1.00 0.00 ? 88  ASP A HA   1  
ATOM 932   H HB2  . ASP A 1 58 ? -0.838  -1.405  -13.528 1.00 0.00 ? 88  ASP A HB2  1  
ATOM 933   H HB3  . ASP A 1 58 ? -1.792  -1.546  -12.053 1.00 0.00 ? 88  ASP A HB3  1  
ATOM 934   N N    . LEU A 1 59 ? -0.126  -1.999  -9.455  1.00 0.00 ? 89  LEU A N    1  
ATOM 935   C CA   . LEU A 1 59 ? -0.380  -1.852  -8.028  1.00 0.00 ? 89  LEU A CA   1  
ATOM 936   C C    . LEU A 1 59 ? 0.930   -1.718  -7.267  1.00 0.00 ? 89  LEU A C    1  
ATOM 937   O O    . LEU A 1 59 ? 1.153   -0.737  -6.559  1.00 0.00 ? 89  LEU A O    1  
ATOM 938   C CB   . LEU A 1 59 ? -1.175  -3.049  -7.501  1.00 0.00 ? 89  LEU A CB   1  
ATOM 939   C CG   . LEU A 1 59 ? -2.696  -2.898  -7.580  1.00 0.00 ? 89  LEU A CG   1  
ATOM 940   C CD1  . LEU A 1 59 ? -3.362  -4.262  -7.683  1.00 0.00 ? 89  LEU A CD1  1  
ATOM 941   C CD2  . LEU A 1 59 ? -3.217  -2.137  -6.371  1.00 0.00 ? 89  LEU A CD2  1  
ATOM 942   H H    . LEU A 1 59 ? -0.068  -2.897  -9.836  1.00 0.00 ? 89  LEU A H    1  
ATOM 943   H HA   . LEU A 1 59 ? -0.960  -0.952  -7.885  1.00 0.00 ? 89  LEU A HA   1  
ATOM 944   H HB2  . LEU A 1 59 ? -0.890  -3.922  -8.070  1.00 0.00 ? 89  LEU A HB2  1  
ATOM 945   H HB3  . LEU A 1 59 ? -0.905  -3.208  -6.469  1.00 0.00 ? 89  LEU A HB3  1  
ATOM 946   H HG   . LEU A 1 59 ? -2.949  -2.335  -8.466  1.00 0.00 ? 89  LEU A HG   1  
ATOM 947   H HD11 . LEU A 1 59 ? -4.280  -4.258  -7.113  1.00 0.00 ? 89  LEU A HD11 1  
ATOM 948   H HD12 . LEU A 1 59 ? -2.698  -5.018  -7.292  1.00 0.00 ? 89  LEU A HD12 1  
ATOM 949   H HD13 . LEU A 1 59 ? -3.582  -4.477  -8.718  1.00 0.00 ? 89  LEU A HD13 1  
ATOM 950   H HD21 . LEU A 1 59 ? -2.876  -1.113  -6.416  1.00 0.00 ? 89  LEU A HD21 1  
ATOM 951   H HD22 . LEU A 1 59 ? -2.849  -2.600  -5.467  1.00 0.00 ? 89  LEU A HD22 1  
ATOM 952   H HD23 . LEU A 1 59 ? -4.297  -2.157  -6.371  1.00 0.00 ? 89  LEU A HD23 1  
ATOM 953   N N    . ILE A 1 60 ? 1.804   -2.706  -7.431  1.00 0.00 ? 90  ILE A N    1  
ATOM 954   C CA   . ILE A 1 60 ? 3.100   -2.689  -6.771  1.00 0.00 ? 90  ILE A CA   1  
ATOM 955   C C    . ILE A 1 60 ? 3.907   -1.475  -7.221  1.00 0.00 ? 90  ILE A C    1  
ATOM 956   O O    . ILE A 1 60 ? 4.733   -0.952  -6.472  1.00 0.00 ? 90  ILE A O    1  
ATOM 957   C CB   . ILE A 1 60 ? 3.902   -3.974  -7.063  1.00 0.00 ? 90  ILE A CB   1  
ATOM 958   C CG1  . ILE A 1 60 ? 5.219   -3.970  -6.283  1.00 0.00 ? 90  ILE A CG1  1  
ATOM 959   C CG2  . ILE A 1 60 ? 4.163   -4.111  -8.556  1.00 0.00 ? 90  ILE A CG2  1  
ATOM 960   C CD1  . ILE A 1 60 ? 5.852   -5.339  -6.163  1.00 0.00 ? 90  ILE A CD1  1  
ATOM 961   H H    . ILE A 1 60 ? 1.574   -3.457  -8.017  1.00 0.00 ? 90  ILE A H    1  
ATOM 962   H HA   . ILE A 1 60 ? 2.933   -2.624  -5.706  1.00 0.00 ? 90  ILE A HA   1  
ATOM 963   H HB   . ILE A 1 60 ? 3.309   -4.819  -6.749  1.00 0.00 ? 90  ILE A HB   1  
ATOM 964   H HG12 . ILE A 1 60 ? 5.924   -3.322  -6.781  1.00 0.00 ? 90  ILE A HG12 1  
ATOM 965   H HG13 . ILE A 1 60 ? 5.037   -3.599  -5.286  1.00 0.00 ? 90  ILE A HG13 1  
ATOM 966   H HG21 . ILE A 1 60 ? 4.551   -5.097  -8.765  1.00 0.00 ? 90  ILE A HG21 1  
ATOM 967   H HG22 . ILE A 1 60 ? 4.883   -3.368  -8.866  1.00 0.00 ? 90  ILE A HG22 1  
ATOM 968   H HG23 . ILE A 1 60 ? 3.240   -3.965  -9.099  1.00 0.00 ? 90  ILE A HG23 1  
ATOM 969   H HD11 . ILE A 1 60 ? 5.133   -6.095  -6.441  1.00 0.00 ? 90  ILE A HD11 1  
ATOM 970   H HD12 . ILE A 1 60 ? 6.170   -5.502  -5.143  1.00 0.00 ? 90  ILE A HD12 1  
ATOM 971   H HD13 . ILE A 1 60 ? 6.708   -5.399  -6.819  1.00 0.00 ? 90  ILE A HD13 1  
ATOM 972   N N    . VAL A 1 61 ? 3.652   -1.026  -8.448  1.00 0.00 ? 91  VAL A N    1  
ATOM 973   C CA   . VAL A 1 61 ? 4.349   0.133   -8.992  1.00 0.00 ? 91  VAL A CA   1  
ATOM 974   C C    . VAL A 1 61 ? 3.802   1.420   -8.384  1.00 0.00 ? 91  VAL A C    1  
ATOM 975   O O    . VAL A 1 61 ? 4.562   2.281   -7.936  1.00 0.00 ? 91  VAL A O    1  
ATOM 976   C CB   . VAL A 1 61 ? 4.227   0.199   -10.529 1.00 0.00 ? 91  VAL A CB   1  
ATOM 977   C CG1  . VAL A 1 61 ? 4.919   1.440   -11.078 1.00 0.00 ? 91  VAL A CG1  1  
ATOM 978   C CG2  . VAL A 1 61 ? 4.798   -1.061  -11.162 1.00 0.00 ? 91  VAL A CG2  1  
ATOM 979   H H    . VAL A 1 61 ? 2.973   -1.481  -8.995  1.00 0.00 ? 91  VAL A H    1  
ATOM 980   H HA   . VAL A 1 61 ? 5.395   0.042   -8.737  1.00 0.00 ? 91  VAL A HA   1  
ATOM 981   H HB   . VAL A 1 61 ? 3.178   0.258   -10.783 1.00 0.00 ? 91  VAL A HB   1  
ATOM 982   H HG11 . VAL A 1 61 ? 5.343   2.006   -10.262 1.00 0.00 ? 91  VAL A HG11 1  
ATOM 983   H HG12 . VAL A 1 61 ? 4.200   2.051   -11.603 1.00 0.00 ? 91  VAL A HG12 1  
ATOM 984   H HG13 . VAL A 1 61 ? 5.705   1.145   -11.757 1.00 0.00 ? 91  VAL A HG13 1  
ATOM 985   H HG21 . VAL A 1 61 ? 5.825   -0.884  -11.451 1.00 0.00 ? 91  VAL A HG21 1  
ATOM 986   H HG22 . VAL A 1 61 ? 4.219   -1.321  -12.035 1.00 0.00 ? 91  VAL A HG22 1  
ATOM 987   H HG23 . VAL A 1 61 ? 4.761   -1.872  -10.449 1.00 0.00 ? 91  VAL A HG23 1  
ATOM 988   N N    . GLY A 1 62 ? 2.478   1.543   -8.362  1.00 0.00 ? 92  GLY A N    1  
ATOM 989   C CA   . GLY A 1 62 ? 1.854   2.725   -7.797  1.00 0.00 ? 92  GLY A CA   1  
ATOM 990   C C    . GLY A 1 62 ? 2.307   2.986   -6.374  1.00 0.00 ? 92  GLY A C    1  
ATOM 991   O O    . GLY A 1 62 ? 2.527   4.132   -5.985  1.00 0.00 ? 92  GLY A O    1  
ATOM 992   H H    . GLY A 1 62 ? 1.921   0.823   -8.727  1.00 0.00 ? 92  GLY A H    1  
ATOM 993   H HA2  . GLY A 1 62 ? 2.105   3.579   -8.408  1.00 0.00 ? 92  GLY A HA2  1  
ATOM 994   H HA3  . GLY A 1 62 ? 0.782   2.592   -7.803  1.00 0.00 ? 92  GLY A HA3  1  
ATOM 995   N N    . PHE A 1 63 ? 2.451   1.916   -5.598  1.00 0.00 ? 93  PHE A N    1  
ATOM 996   C CA   . PHE A 1 63 ? 2.885   2.029   -4.214  1.00 0.00 ? 93  PHE A CA   1  
ATOM 997   C C    . PHE A 1 63 ? 4.376   2.326   -4.138  1.00 0.00 ? 93  PHE A C    1  
ATOM 998   O O    . PHE A 1 63 ? 4.841   3.017   -3.231  1.00 0.00 ? 93  PHE A O    1  
ATOM 999   C CB   . PHE A 1 63 ? 2.568   0.742   -3.449  1.00 0.00 ? 93  PHE A CB   1  
ATOM 1000  C CG   . PHE A 1 63 ? 2.773   0.858   -1.965  1.00 0.00 ? 93  PHE A CG   1  
ATOM 1001  C CD1  . PHE A 1 63 ? 1.809   1.450   -1.165  1.00 0.00 ? 93  PHE A CD1  1  
ATOM 1002  C CD2  . PHE A 1 63 ? 3.928   0.376   -1.373  1.00 0.00 ? 93  PHE A CD2  1  
ATOM 1003  C CE1  . PHE A 1 63 ? 1.996   1.558   0.200   1.00 0.00 ? 93  PHE A CE1  1  
ATOM 1004  C CE2  . PHE A 1 63 ? 4.119   0.481   -0.008  1.00 0.00 ? 93  PHE A CE2  1  
ATOM 1005  C CZ   . PHE A 1 63 ? 3.152   1.074   0.780   1.00 0.00 ? 93  PHE A CZ   1  
ATOM 1006  H H    . PHE A 1 63 ? 2.263   1.030   -5.966  1.00 0.00 ? 93  PHE A H    1  
ATOM 1007  H HA   . PHE A 1 63 ? 2.348   2.843   -3.770  1.00 0.00 ? 93  PHE A HA   1  
ATOM 1008  H HB2  . PHE A 1 63 ? 1.536   0.475   -3.621  1.00 0.00 ? 93  PHE A HB2  1  
ATOM 1009  H HB3  . PHE A 1 63 ? 3.205   -0.051  -3.812  1.00 0.00 ? 93  PHE A HB3  1  
ATOM 1010  H HD1  . PHE A 1 63 ? 0.905   1.830   -1.617  1.00 0.00 ? 93  PHE A HD1  1  
ATOM 1011  H HD2  . PHE A 1 63 ? 4.686   -0.087  -1.988  1.00 0.00 ? 93  PHE A HD2  1  
ATOM 1012  H HE1  . PHE A 1 63 ? 1.236   2.022   0.815   1.00 0.00 ? 93  PHE A HE1  1  
ATOM 1013  H HE2  . PHE A 1 63 ? 5.025   0.101   0.442   1.00 0.00 ? 93  PHE A HE2  1  
ATOM 1014  H HZ   . PHE A 1 63 ? 3.299   1.157   1.846   1.00 0.00 ? 93  PHE A HZ   1  
ATOM 1015  N N    . ASN A 1 64 ? 5.118   1.799   -5.101  1.00 0.00 ? 94  ASN A N    1  
ATOM 1016  C CA   . ASN A 1 64 ? 6.562   2.005   -5.159  1.00 0.00 ? 94  ASN A CA   1  
ATOM 1017  C C    . ASN A 1 64 ? 6.891   3.486   -5.310  1.00 0.00 ? 94  ASN A C    1  
ATOM 1018  O O    . ASN A 1 64 ? 7.936   3.951   -4.854  1.00 0.00 ? 94  ASN A O    1  
ATOM 1019  C CB   . ASN A 1 64 ? 7.164   1.215   -6.321  1.00 0.00 ? 94  ASN A CB   1  
ATOM 1020  C CG   . ASN A 1 64 ? 8.535   0.655   -5.992  1.00 0.00 ? 94  ASN A CG   1  
ATOM 1021  O OD1  . ASN A 1 64 ? 8.788   -0.537  -6.165  1.00 0.00 ? 94  ASN A OD1  1  
ATOM 1022  N ND2  . ASN A 1 64 ? 9.427   1.515   -5.517  1.00 0.00 ? 94  ASN A ND2  1  
ATOM 1023  H H    . ASN A 1 64 ? 4.683   1.262   -5.793  1.00 0.00 ? 94  ASN A H    1  
ATOM 1024  H HA   . ASN A 1 64 ? 6.985   1.647   -4.232  1.00 0.00 ? 94  ASN A HA   1  
ATOM 1025  H HB2  . ASN A 1 64 ? 6.511   0.392   -6.567  1.00 0.00 ? 94  ASN A HB2  1  
ATOM 1026  H HB3  . ASN A 1 64 ? 7.257   1.864   -7.180  1.00 0.00 ? 94  ASN A HB3  1  
ATOM 1027  H HD21 . ASN A 1 64 ? 9.157   2.451   -5.406  1.00 0.00 ? 94  ASN A HD21 1  
ATOM 1028  H HD22 . ASN A 1 64 ? 10.322  1.180   -5.296  1.00 0.00 ? 94  ASN A HD22 1  
ATOM 1029  N N    . ALA A 1 65 ? 5.993   4.222   -5.958  1.00 0.00 ? 95  ALA A N    1  
ATOM 1030  C CA   . ALA A 1 65 ? 6.184   5.651   -6.175  1.00 0.00 ? 95  ALA A CA   1  
ATOM 1031  C C    . ALA A 1 65 ? 6.084   6.442   -4.869  1.00 0.00 ? 95  ALA A C    1  
ATOM 1032  O O    . ALA A 1 65 ? 6.376   7.638   -4.839  1.00 0.00 ? 95  ALA A O    1  
ATOM 1033  C CB   . ALA A 1 65 ? 5.168   6.169   -7.182  1.00 0.00 ? 95  ALA A CB   1  
ATOM 1034  H H    . ALA A 1 65 ? 5.182   3.794   -6.300  1.00 0.00 ? 95  ALA A H    1  
ATOM 1035  H HA   . ALA A 1 65 ? 7.168   5.791   -6.592  1.00 0.00 ? 95  ALA A HA   1  
ATOM 1036  H HB1  . ALA A 1 65 ? 5.338   5.696   -8.138  1.00 0.00 ? 95  ALA A HB1  1  
ATOM 1037  H HB2  . ALA A 1 65 ? 5.275   7.238   -7.285  1.00 0.00 ? 95  ALA A HB2  1  
ATOM 1038  H HB3  . ALA A 1 65 ? 4.170   5.938   -6.839  1.00 0.00 ? 95  ALA A HB3  1  
ATOM 1039  N N    . PHE A 1 66 ? 5.669   5.777   -3.794  1.00 0.00 ? 96  PHE A N    1  
ATOM 1040  C CA   . PHE A 1 66 ? 5.533   6.433   -2.498  1.00 0.00 ? 96  PHE A CA   1  
ATOM 1041  C C    . PHE A 1 66 ? 6.736   6.139   -1.607  1.00 0.00 ? 96  PHE A C    1  
ATOM 1042  O O    . PHE A 1 66 ? 7.209   7.012   -0.878  1.00 0.00 ? 96  PHE A O    1  
ATOM 1043  C CB   . PHE A 1 66 ? 4.249   5.975   -1.803  1.00 0.00 ? 96  PHE A CB   1  
ATOM 1044  C CG   . PHE A 1 66 ? 2.996   6.403   -2.513  1.00 0.00 ? 96  PHE A CG   1  
ATOM 1045  C CD1  . PHE A 1 66 ? 2.713   5.936   -3.786  1.00 0.00 ? 96  PHE A CD1  1  
ATOM 1046  C CD2  . PHE A 1 66 ? 2.103   7.271   -1.907  1.00 0.00 ? 96  PHE A CD2  1  
ATOM 1047  C CE1  . PHE A 1 66 ? 1.561   6.327   -4.442  1.00 0.00 ? 96  PHE A CE1  1  
ATOM 1048  C CE2  . PHE A 1 66 ? 0.949   7.665   -2.557  1.00 0.00 ? 96  PHE A CE2  1  
ATOM 1049  C CZ   . PHE A 1 66 ? 0.677   7.193   -3.825  1.00 0.00 ? 96  PHE A CZ   1  
ATOM 1050  H H    . PHE A 1 66 ? 5.445   4.827   -3.872  1.00 0.00 ? 96  PHE A H    1  
ATOM 1051  H HA   . PHE A 1 66 ? 5.480   7.497   -2.670  1.00 0.00 ? 96  PHE A HA   1  
ATOM 1052  H HB2  . PHE A 1 66 ? 4.246   4.897   -1.743  1.00 0.00 ? 96  PHE A HB2  1  
ATOM 1053  H HB3  . PHE A 1 66 ? 4.223   6.386   -0.804  1.00 0.00 ? 96  PHE A HB3  1  
ATOM 1054  H HD1  . PHE A 1 66 ? 3.402   5.259   -4.268  1.00 0.00 ? 96  PHE A HD1  1  
ATOM 1055  H HD2  . PHE A 1 66 ? 2.315   7.641   -0.914  1.00 0.00 ? 96  PHE A HD2  1  
ATOM 1056  H HE1  . PHE A 1 66 ? 1.350   5.956   -5.434  1.00 0.00 ? 96  PHE A HE1  1  
ATOM 1057  H HE2  . PHE A 1 66 ? 0.260   8.342   -2.073  1.00 0.00 ? 96  PHE A HE2  1  
ATOM 1058  H HZ   . PHE A 1 66 ? -0.224  7.499   -4.335  1.00 0.00 ? 96  PHE A HZ   1  
ATOM 1059  N N    . LEU A 1 67 ? 7.228   4.905   -1.668  1.00 0.00 ? 97  LEU A N    1  
ATOM 1060  C CA   . LEU A 1 67 ? 8.375   4.501   -0.864  1.00 0.00 ? 97  LEU A CA   1  
ATOM 1061  C C    . LEU A 1 67 ? 9.656   5.167   -1.368  1.00 0.00 ? 97  LEU A C    1  
ATOM 1062  O O    . LEU A 1 67 ? 9.882   5.256   -2.575  1.00 0.00 ? 97  LEU A O    1  
ATOM 1063  C CB   . LEU A 1 67 ? 8.533   2.979   -0.892  1.00 0.00 ? 97  LEU A CB   1  
ATOM 1064  C CG   . LEU A 1 67 ? 7.303   2.193   -0.436  1.00 0.00 ? 97  LEU A CG   1  
ATOM 1065  C CD1  . LEU A 1 67 ? 7.594   0.700   -0.440  1.00 0.00 ? 97  LEU A CD1  1  
ATOM 1066  C CD2  . LEU A 1 67 ? 6.862   2.648   0.946   1.00 0.00 ? 97  LEU A CD2  1  
ATOM 1067  H H    . LEU A 1 67 ? 6.809   4.253   -2.267  1.00 0.00 ? 97  LEU A H    1  
ATOM 1068  H HA   . LEU A 1 67 ? 8.193   4.816   0.151   1.00 0.00 ? 97  LEU A HA   1  
ATOM 1069  H HB2  . LEU A 1 67 ? 8.771   2.682   -1.903  1.00 0.00 ? 97  LEU A HB2  1  
ATOM 1070  H HB3  . LEU A 1 67 ? 9.360   2.712   -0.251  1.00 0.00 ? 97  LEU A HB3  1  
ATOM 1071  H HG   . LEU A 1 67 ? 6.492   2.376   -1.125  1.00 0.00 ? 97  LEU A HG   1  
ATOM 1072  H HD11 . LEU A 1 67 ? 7.017   0.219   0.337   1.00 0.00 ? 97  LEU A HD11 1  
ATOM 1073  H HD12 . LEU A 1 67 ? 8.647   0.537   -0.259  1.00 0.00 ? 97  LEU A HD12 1  
ATOM 1074  H HD13 . LEU A 1 67 ? 7.324   0.282   -1.398  1.00 0.00 ? 97  LEU A HD13 1  
ATOM 1075  H HD21 . LEU A 1 67 ? 5.928   2.169   1.203   1.00 0.00 ? 97  LEU A HD21 1  
ATOM 1076  H HD22 . LEU A 1 67 ? 6.729   3.720   0.946   1.00 0.00 ? 97  LEU A HD22 1  
ATOM 1077  H HD23 . LEU A 1 67 ? 7.616   2.380   1.672   1.00 0.00 ? 97  LEU A HD23 1  
ATOM 1078  N N    . PRO A 1 68 ? 10.514  5.644   -0.448  1.00 0.00 ? 98  PRO A N    1  
ATOM 1079  C CA   . PRO A 1 68 ? 11.772  6.302   -0.810  1.00 0.00 ? 98  PRO A CA   1  
ATOM 1080  C C    . PRO A 1 68 ? 12.837  5.310   -1.260  1.00 0.00 ? 98  PRO A C    1  
ATOM 1081  O O    . PRO A 1 68 ? 12.619  4.098   -1.240  1.00 0.00 ? 98  PRO A O    1  
ATOM 1082  C CB   . PRO A 1 68 ? 12.193  6.986   0.490   1.00 0.00 ? 98  PRO A CB   1  
ATOM 1083  C CG   . PRO A 1 68 ? 11.615  6.133   1.565   1.00 0.00 ? 98  PRO A CG   1  
ATOM 1084  C CD   . PRO A 1 68 ? 10.325  5.582   1.016   1.00 0.00 ? 98  PRO A CD   1  
ATOM 1085  H HA   . PRO A 1 68 ? 11.624  7.045   -1.581  1.00 0.00 ? 98  PRO A HA   1  
ATOM 1086  H HB2  . PRO A 1 68 ? 13.271  7.021   0.548   1.00 0.00 ? 98  PRO A HB2  1  
ATOM 1087  H HB3  . PRO A 1 68 ? 11.791  7.988   0.522   1.00 0.00 ? 98  PRO A HB3  1  
ATOM 1088  H HG2  . PRO A 1 68 ? 12.295  5.329   1.801   1.00 0.00 ? 98  PRO A HG2  1  
ATOM 1089  H HG3  . PRO A 1 68 ? 11.421  6.731   2.443   1.00 0.00 ? 98  PRO A HG3  1  
ATOM 1090  H HD2  . PRO A 1 68 ? 10.182  4.563   1.342   1.00 0.00 ? 98  PRO A HD2  1  
ATOM 1091  H HD3  . PRO A 1 68 ? 9.492   6.197   1.323   1.00 0.00 ? 98  PRO A HD3  1  
ATOM 1092  N N    . LEU A 1 69 ? 13.991  5.830   -1.665  1.00 0.00 ? 99  LEU A N    1  
ATOM 1093  C CA   . LEU A 1 69 ? 15.092  4.990   -2.119  1.00 0.00 ? 99  LEU A CA   1  
ATOM 1094  C C    . LEU A 1 69 ? 15.543  4.039   -1.015  1.00 0.00 ? 99  LEU A C    1  
ATOM 1095  O O    . LEU A 1 69 ? 16.024  2.939   -1.288  1.00 0.00 ? 99  LEU A O    1  
ATOM 1096  C CB   . LEU A 1 69 ? 16.268  5.856   -2.572  1.00 0.00 ? 99  LEU A CB   1  
ATOM 1097  C CG   . LEU A 1 69 ? 17.162  5.225   -3.641  1.00 0.00 ? 99  LEU A CG   1  
ATOM 1098  C CD1  . LEU A 1 69 ? 16.704  5.637   -5.031  1.00 0.00 ? 99  LEU A CD1  1  
ATOM 1099  C CD2  . LEU A 1 69 ? 18.616  5.616   -3.420  1.00 0.00 ? 99  LEU A CD2  1  
ATOM 1100  H H    . LEU A 1 69 ? 14.104  6.805   -1.657  1.00 0.00 ? 99  LEU A H    1  
ATOM 1101  H HA   . LEU A 1 69 ? 14.741  4.408   -2.958  1.00 0.00 ? 99  LEU A HA   1  
ATOM 1102  H HB2  . LEU A 1 69 ? 15.876  6.784   -2.962  1.00 0.00 ? 99  LEU A HB2  1  
ATOM 1103  H HB3  . LEU A 1 69 ? 16.878  6.078   -1.710  1.00 0.00 ? 99  LEU A HB3  1  
ATOM 1104  H HG   . LEU A 1 69 ? 17.089  4.149   -3.572  1.00 0.00 ? 99  LEU A HG   1  
ATOM 1105  H HD11 . LEU A 1 69 ? 16.724  6.714   -5.113  1.00 0.00 ? 99  LEU A HD11 1  
ATOM 1106  H HD12 . LEU A 1 69 ? 15.698  5.283   -5.198  1.00 0.00 ? 99  LEU A HD12 1  
ATOM 1107  H HD13 . LEU A 1 69 ? 17.364  5.207   -5.770  1.00 0.00 ? 99  LEU A HD13 1  
ATOM 1108  H HD21 . LEU A 1 69 ? 19.100  4.869   -2.807  1.00 0.00 ? 99  LEU A HD21 1  
ATOM 1109  H HD22 . LEU A 1 69 ? 18.660  6.573   -2.922  1.00 0.00 ? 99  LEU A HD22 1  
ATOM 1110  H HD23 . LEU A 1 69 ? 19.120  5.682   -4.373  1.00 0.00 ? 99  LEU A HD23 1  
ATOM 1111  N N    . GLY A 1 70 ? 15.386  4.470   0.233   1.00 0.00 ? 100 GLY A N    1  
ATOM 1112  C CA   . GLY A 1 70 ? 15.783  3.644   1.359   1.00 0.00 ? 100 GLY A CA   1  
ATOM 1113  C C    . GLY A 1 70 ? 15.081  2.301   1.372   1.00 0.00 ? 100 GLY A C    1  
ATOM 1114  O O    . GLY A 1 70 ? 15.723  1.257   1.255   1.00 0.00 ? 100 GLY A O    1  
ATOM 1115  H H    . GLY A 1 70 ? 14.998  5.356   0.390   1.00 0.00 ? 100 GLY A H    1  
ATOM 1116  H HA2  . GLY A 1 70 ? 16.849  3.480   1.312   1.00 0.00 ? 100 GLY A HA2  1  
ATOM 1117  H HA3  . GLY A 1 70 ? 15.551  4.168   2.274   1.00 0.00 ? 100 GLY A HA3  1  
ATOM 1118  N N    . TYR A 1 71 ? 13.760  2.326   1.516   1.00 0.00 ? 101 TYR A N    1  
ATOM 1119  C CA   . TYR A 1 71 ? 12.970  1.100   1.546   1.00 0.00 ? 101 TYR A CA   1  
ATOM 1120  C C    . TYR A 1 71 ? 12.236  0.894   0.226   1.00 0.00 ? 101 TYR A C    1  
ATOM 1121  O O    . TYR A 1 71 ? 11.093  1.324   0.067   1.00 0.00 ? 101 TYR A O    1  
ATOM 1122  C CB   . TYR A 1 71 ? 11.968  1.141   2.700   1.00 0.00 ? 101 TYR A CB   1  
ATOM 1123  C CG   . TYR A 1 71 ? 12.601  1.432   4.043   1.00 0.00 ? 101 TYR A CG   1  
ATOM 1124  C CD1  . TYR A 1 71 ? 13.453  0.512   4.643   1.00 0.00 ? 101 TYR A CD1  1  
ATOM 1125  C CD2  . TYR A 1 71 ? 12.344  2.623   4.710   1.00 0.00 ? 101 TYR A CD2  1  
ATOM 1126  C CE1  . TYR A 1 71 ? 14.032  0.773   5.871   1.00 0.00 ? 101 TYR A CE1  1  
ATOM 1127  C CE2  . TYR A 1 71 ? 12.921  2.891   5.938   1.00 0.00 ? 101 TYR A CE2  1  
ATOM 1128  C CZ   . TYR A 1 71 ? 13.763  1.964   6.513   1.00 0.00 ? 101 TYR A CZ   1  
ATOM 1129  O OH   . TYR A 1 71 ? 14.338  2.227   7.735   1.00 0.00 ? 101 TYR A OH   1  
ATOM 1130  H H    . TYR A 1 71 ? 13.305  3.190   1.605   1.00 0.00 ? 101 TYR A H    1  
ATOM 1131  H HA   . TYR A 1 71 ? 13.648  0.274   1.699   1.00 0.00 ? 101 TYR A HA   1  
ATOM 1132  H HB2  . TYR A 1 71 ? 11.237  1.913   2.506   1.00 0.00 ? 101 TYR A HB2  1  
ATOM 1133  H HB3  . TYR A 1 71 ? 11.467  0.187   2.767   1.00 0.00 ? 101 TYR A HB3  1  
ATOM 1134  H HD1  . TYR A 1 71 ? 13.662  -0.418  4.138   1.00 0.00 ? 101 TYR A HD1  1  
ATOM 1135  H HD2  . TYR A 1 71 ? 11.684  3.346   4.257   1.00 0.00 ? 101 TYR A HD2  1  
ATOM 1136  H HE1  . TYR A 1 71 ? 14.692  0.047   6.321   1.00 0.00 ? 101 TYR A HE1  1  
ATOM 1137  H HE2  . TYR A 1 71 ? 12.710  3.824   6.441   1.00 0.00 ? 101 TYR A HE2  1  
ATOM 1138  H HH   . TYR A 1 71 ? 15.286  2.333   7.627   1.00 0.00 ? 101 TYR A HH   1  
ATOM 1139  N N    . ARG A 1 72 ? 12.898  0.235   -0.719  1.00 0.00 ? 102 ARG A N    1  
ATOM 1140  C CA   . ARG A 1 72 ? 12.307  -0.030  -2.025  1.00 0.00 ? 102 ARG A CA   1  
ATOM 1141  C C    . ARG A 1 72 ? 11.503  -1.325  -2.006  1.00 0.00 ? 102 ARG A C    1  
ATOM 1142  O O    . ARG A 1 72 ? 11.435  -2.010  -0.986  1.00 0.00 ? 102 ARG A O    1  
ATOM 1143  C CB   . ARG A 1 72 ? 13.397  -0.106  -3.096  1.00 0.00 ? 102 ARG A CB   1  
ATOM 1144  C CG   . ARG A 1 72 ? 13.662  1.220   -3.790  1.00 0.00 ? 102 ARG A CG   1  
ATOM 1145  C CD   . ARG A 1 72 ? 15.071  1.280   -4.357  1.00 0.00 ? 102 ARG A CD   1  
ATOM 1146  N NE   . ARG A 1 72 ? 15.247  2.408   -5.268  1.00 0.00 ? 102 ARG A NE   1  
ATOM 1147  C CZ   . ARG A 1 72 ? 14.801  2.424   -6.522  1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1148  N NH1  . ARG A 1 72 ? 14.152  1.377   -7.016  1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1149  N NH2  . ARG A 1 72 ? 15.003  3.491   -7.284  1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1150  H H    . ARG A 1 72 ? 13.806  -0.083  -0.532  1.00 0.00 ? 102 ARG A H    1  
ATOM 1151  H HA   . ARG A 1 72 ? 11.642  0.789   -2.259  1.00 0.00 ? 102 ARG A HA   1  
ATOM 1152  H HB2  . ARG A 1 72 ? 14.316  -0.436  -2.633  1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1153  H HB3  . ARG A 1 72 ? 13.102  -0.827  -3.844  1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1154  H HG2  . ARG A 1 72 ? 12.956  1.341   -4.596  1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1155  H HG3  . ARG A 1 72 ? 13.537  2.021   -3.075  1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1156  H HD2  . ARG A 1 72 ? 15.771  1.378   -3.540  1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1157  H HD3  . ARG A 1 72 ? 15.270  0.363   -4.891  1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1158  H HE   . ARG A 1 72 ? 15.723  3.195   -4.929  1.00 0.00 ? 102 ARG A HE   1  
ATOM 1159  H HH11 . ARG A 1 72 ? 13.996  0.570   -6.447  1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1160  H HH12 . ARG A 1 72 ? 13.819  1.395   -7.959  1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1161  H HH21 . ARG A 1 72 ? 15.491  4.283   -6.917  1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1162  H HH22 . ARG A 1 72 ? 14.668  3.502   -8.227  1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1163  N N    . ILE A 1 73 ? 10.895  -1.656  -3.141  1.00 0.00 ? 103 ILE A N    1  
ATOM 1164  C CA   . ILE A 1 73 ? 10.096  -2.869  -3.255  1.00 0.00 ? 103 ILE A CA   1  
ATOM 1165  C C    . ILE A 1 73 ? 10.792  -3.906  -4.130  1.00 0.00 ? 103 ILE A C    1  
ATOM 1166  O O    . ILE A 1 73 ? 11.395  -3.569  -5.148  1.00 0.00 ? 103 ILE A O    1  
ATOM 1167  C CB   . ILE A 1 73 ? 8.702   -2.575  -3.841  1.00 0.00 ? 103 ILE A CB   1  
ATOM 1168  C CG1  . ILE A 1 73 ? 8.081   -1.355  -3.157  1.00 0.00 ? 103 ILE A CG1  1  
ATOM 1169  C CG2  . ILE A 1 73 ? 7.798   -3.789  -3.695  1.00 0.00 ? 103 ILE A CG2  1  
ATOM 1170  C CD1  . ILE A 1 73 ? 6.713   -0.992  -3.695  1.00 0.00 ? 103 ILE A CD1  1  
ATOM 1171  H H    . ILE A 1 73 ? 10.986  -1.068  -3.921  1.00 0.00 ? 103 ILE A H    1  
ATOM 1172  H HA   . ILE A 1 73 ? 9.967   -3.278  -2.263  1.00 0.00 ? 103 ILE A HA   1  
ATOM 1173  H HB   . ILE A 1 73 ? 8.817   -2.368  -4.895  1.00 0.00 ? 103 ILE A HB   1  
ATOM 1174  H HG12 . ILE A 1 73 ? 7.979   -1.554  -2.102  1.00 0.00 ? 103 ILE A HG12 1  
ATOM 1175  H HG13 . ILE A 1 73 ? 8.730   -0.502  -3.298  1.00 0.00 ? 103 ILE A HG13 1  
ATOM 1176  H HG21 . ILE A 1 73 ? 7.185   -3.678  -2.812  1.00 0.00 ? 103 ILE A HG21 1  
ATOM 1177  H HG22 . ILE A 1 73 ? 8.403   -4.679  -3.602  1.00 0.00 ? 103 ILE A HG22 1  
ATOM 1178  H HG23 . ILE A 1 73 ? 7.164   -3.874  -4.565  1.00 0.00 ? 103 ILE A HG23 1  
ATOM 1179  H HD11 . ILE A 1 73 ? 6.405   -0.043  -3.282  1.00 0.00 ? 103 ILE A HD11 1  
ATOM 1180  H HD12 . ILE A 1 73 ? 6.002   -1.755  -3.413  1.00 0.00 ? 103 ILE A HD12 1  
ATOM 1181  H HD13 . ILE A 1 73 ? 6.756   -0.921  -4.771  1.00 0.00 ? 103 ILE A HD13 1  
ATOM 1182  N N    . ASP A 1 74 ? 10.703  -5.169  -3.726  1.00 0.00 ? 104 ASP A N    1  
ATOM 1183  C CA   . ASP A 1 74 ? 11.323  -6.256  -4.474  1.00 0.00 ? 104 ASP A CA   1  
ATOM 1184  C C    . ASP A 1 74 ? 10.265  -7.135  -5.134  1.00 0.00 ? 104 ASP A C    1  
ATOM 1185  O O    . ASP A 1 74 ? 9.129   -7.211  -4.666  1.00 0.00 ? 104 ASP A O    1  
ATOM 1186  C CB   . ASP A 1 74 ? 12.203  -7.102  -3.553  1.00 0.00 ? 104 ASP A CB   1  
ATOM 1187  C CG   . ASP A 1 74 ? 13.533  -6.438  -3.252  1.00 0.00 ? 104 ASP A CG   1  
ATOM 1188  O OD1  . ASP A 1 74 ? 13.526  -5.269  -2.811  1.00 0.00 ? 104 ASP A OD1  1  
ATOM 1189  O OD2  . ASP A 1 74 ? 14.580  -7.086  -3.459  1.00 0.00 ? 104 ASP A OD2  1  
ATOM 1190  H H    . ASP A 1 74 ? 10.208  -5.375  -2.906  1.00 0.00 ? 104 ASP A H    1  
ATOM 1191  H HA   . ASP A 1 74 ? 11.941  -5.819  -5.246  1.00 0.00 ? 104 ASP A HA   1  
ATOM 1192  H HB2  . ASP A 1 74 ? 11.685  -7.265  -2.620  1.00 0.00 ? 104 ASP A HB2  1  
ATOM 1193  H HB3  . ASP A 1 74 ? 12.395  -8.055  -4.023  1.00 0.00 ? 104 ASP A HB3  1  
ATOM 1194  N N    . ILE A 1 75 ? 10.645  -7.799  -6.221  1.00 0.00 ? 105 ILE A N    1  
ATOM 1195  C CA   . ILE A 1 75 ? 9.728   -8.672  -6.943  1.00 0.00 ? 105 ILE A CA   1  
ATOM 1196  C C    . ILE A 1 75 ? 10.254  -10.106 -6.990  1.00 0.00 ? 105 ILE A C    1  
ATOM 1197  O O    . ILE A 1 75 ? 10.801  -10.542 -8.003  1.00 0.00 ? 105 ILE A O    1  
ATOM 1198  C CB   . ILE A 1 75 ? 9.495   -8.175  -8.381  1.00 0.00 ? 105 ILE A CB   1  
ATOM 1199  C CG1  . ILE A 1 75 ? 10.830  -7.868  -9.062  1.00 0.00 ? 105 ILE A CG1  1  
ATOM 1200  C CG2  . ILE A 1 75 ? 8.601   -6.945  -8.379  1.00 0.00 ? 105 ILE A CG2  1  
ATOM 1201  C CD1  . ILE A 1 75 ? 10.860  -8.236  -10.530 1.00 0.00 ? 105 ILE A CD1  1  
ATOM 1202  H H    . ILE A 1 75 ? 11.565  -7.698  -6.544  1.00 0.00 ? 105 ILE A H    1  
ATOM 1203  H HA   . ILE A 1 75 ? 8.781   -8.664  -6.422  1.00 0.00 ? 105 ILE A HA   1  
ATOM 1204  H HB   . ILE A 1 75 ? 8.990   -8.955  -8.931  1.00 0.00 ? 105 ILE A HB   1  
ATOM 1205  H HG12 . ILE A 1 75 ? 11.033  -6.810  -8.982  1.00 0.00 ? 105 ILE A HG12 1  
ATOM 1206  H HG13 . ILE A 1 75 ? 11.615  -8.420  -8.565  1.00 0.00 ? 105 ILE A HG13 1  
ATOM 1207  H HG21 . ILE A 1 75 ? 8.811   -6.349  -7.503  1.00 0.00 ? 105 ILE A HG21 1  
ATOM 1208  H HG22 . ILE A 1 75 ? 7.565   -7.252  -8.365  1.00 0.00 ? 105 ILE A HG22 1  
ATOM 1209  H HG23 . ILE A 1 75 ? 8.790   -6.360  -9.267  1.00 0.00 ? 105 ILE A HG23 1  
ATOM 1210  H HD11 . ILE A 1 75 ? 11.213  -7.393  -11.105 1.00 0.00 ? 105 ILE A HD11 1  
ATOM 1211  H HD12 . ILE A 1 75 ? 9.864   -8.501  -10.854 1.00 0.00 ? 105 ILE A HD12 1  
ATOM 1212  H HD13 . ILE A 1 75 ? 11.523  -9.075  -10.677 1.00 0.00 ? 105 ILE A HD13 1  
ATOM 1213  N N    . PRO A 1 76 ? 10.096  -10.859 -5.888  1.00 0.00 ? 106 PRO A N    1  
ATOM 1214  C CA   . PRO A 1 76 ? 10.558  -12.250 -5.809  1.00 0.00 ? 106 PRO A CA   1  
ATOM 1215  C C    . PRO A 1 76 ? 9.994   -13.110 -6.933  1.00 0.00 ? 106 PRO A C    1  
ATOM 1216  O O    . PRO A 1 76 ? 8.785   -13.328 -7.016  1.00 0.00 ? 106 PRO A O    1  
ATOM 1217  C CB   . PRO A 1 76 ? 10.028  -12.729 -4.454  1.00 0.00 ? 106 PRO A CB   1  
ATOM 1218  C CG   . PRO A 1 76 ? 9.846   -11.486 -3.654  1.00 0.00 ? 106 PRO A CG   1  
ATOM 1219  C CD   . PRO A 1 76 ? 9.457   -10.417 -4.635  1.00 0.00 ? 106 PRO A CD   1  
ATOM 1220  H HA   . PRO A 1 76 ? 11.636  -12.309 -5.818  1.00 0.00 ? 106 PRO A HA   1  
ATOM 1221  H HB2  . PRO A 1 76 ? 9.092   -13.250 -4.596  1.00 0.00 ? 106 PRO A HB2  1  
ATOM 1222  H HB3  . PRO A 1 76 ? 10.748  -13.390 -3.996  1.00 0.00 ? 106 PRO A HB3  1  
ATOM 1223  H HG2  . PRO A 1 76 ? 9.061   -11.630 -2.925  1.00 0.00 ? 106 PRO A HG2  1  
ATOM 1224  H HG3  . PRO A 1 76 ? 10.771  -11.226 -3.164  1.00 0.00 ? 106 PRO A HG3  1  
ATOM 1225  H HD2  . PRO A 1 76 ? 8.382   -10.376 -4.743  1.00 0.00 ? 106 PRO A HD2  1  
ATOM 1226  H HD3  . PRO A 1 76 ? 9.843   -9.458  -4.323  1.00 0.00 ? 106 PRO A HD3  1  
ATOM 1227  N N    . LYS A 1 77 ? 10.878  -13.597 -7.798  1.00 0.00 ? 107 LYS A N    1  
ATOM 1228  C CA   . LYS A 1 77 ? 10.468  -14.435 -8.920  1.00 0.00 ? 107 LYS A CA   1  
ATOM 1229  C C    . LYS A 1 77 ? 9.784   -15.706 -8.427  1.00 0.00 ? 107 LYS A C    1  
ATOM 1230  O O    . LYS A 1 77 ? 10.502  -16.667 -8.082  1.00 0.00 ? 107 LYS A O    1  
ATOM 1231  C CB   . LYS A 1 77 ? 11.677  -14.795 -9.784  1.00 0.00 ? 107 LYS A CB   1  
ATOM 1232  C CG   . LYS A 1 77 ? 11.305  -15.383 -11.135 1.00 0.00 ? 107 LYS A CG   1  
ATOM 1233  C CD   . LYS A 1 77 ? 12.230  -14.885 -12.235 1.00 0.00 ? 107 LYS A CD   1  
ATOM 1234  C CE   . LYS A 1 77 ? 11.761  -13.553 -12.801 1.00 0.00 ? 107 LYS A CE   1  
ATOM 1235  N NZ   . LYS A 1 77 ? 11.679  -13.580 -14.289 1.00 0.00 ? 107 LYS A NZ   1  
ATOM 1236  O OXT  . LYS A 1 77 ? 8.536   -15.729 -8.389  1.00 0.00 ? 107 LYS A OXT  1  
ATOM 1237  H H    . LYS A 1 77 ? 11.827  -13.389 -7.681  1.00 0.00 ? 107 LYS A H    1  
ATOM 1238  H HA   . LYS A 1 77 ? 9.766   -13.870 -9.515  1.00 0.00 ? 107 LYS A HA   1  
ATOM 1239  H HB2  . LYS A 1 77 ? 12.264  -13.903 -9.951  1.00 0.00 ? 107 LYS A HB2  1  
ATOM 1240  H HB3  . LYS A 1 77 ? 12.280  -15.517 -9.255  1.00 0.00 ? 107 LYS A HB3  1  
ATOM 1241  H HG2  . LYS A 1 77 ? 11.374  -16.458 -11.080 1.00 0.00 ? 107 LYS A HG2  1  
ATOM 1242  H HG3  . LYS A 1 77 ? 10.290  -15.097 -11.373 1.00 0.00 ? 107 LYS A HG3  1  
ATOM 1243  H HD2  . LYS A 1 77 ? 13.222  -14.761 -11.829 1.00 0.00 ? 107 LYS A HD2  1  
ATOM 1244  H HD3  . LYS A 1 77 ? 12.252  -15.616 -13.030 1.00 0.00 ? 107 LYS A HD3  1  
ATOM 1245  H HE2  . LYS A 1 77 ? 10.783  -13.329 -12.401 1.00 0.00 ? 107 LYS A HE2  1  
ATOM 1246  H HE3  . LYS A 1 77 ? 12.457  -12.784 -12.502 1.00 0.00 ? 107 LYS A HE3  1  
ATOM 1247  H HZ1  . LYS A 1 77 ? 11.146  -14.417 -14.602 1.00 0.00 ? 107 LYS A HZ1  1  
ATOM 1248  H HZ2  . LYS A 1 77 ? 12.635  -13.617 -14.698 1.00 0.00 ? 107 LYS A HZ2  1  
ATOM 1249  H HZ3  . LYS A 1 77 ? 11.198  -12.726 -14.636 1.00 0.00 ? 107 LYS A HZ3  1  
ATOM 1250  N N    . ALA B 2 1  ? 8.798   7.192   7.549   1.00 0.00 ? 43  ALA B N    1  
ATOM 1251  C CA   . ALA B 2 1  ? 8.026   7.175   6.279   1.00 0.00 ? 43  ALA B CA   1  
ATOM 1252  C C    . ALA B 2 1  ? 6.719   7.952   6.423   1.00 0.00 ? 43  ALA B C    1  
ATOM 1253  O O    . ALA B 2 1  ? 5.697   7.392   6.820   1.00 0.00 ? 43  ALA B O    1  
ATOM 1254  C CB   . ALA B 2 1  ? 7.743   5.743   5.853   1.00 0.00 ? 43  ALA B CB   1  
ATOM 1255  H H1   . ALA B 2 1  ? 8.427   6.433   8.155   1.00 0.00 ? 43  ALA B H1   1  
ATOM 1256  H H2   . ALA B 2 1  ? 8.664   8.125   7.989   1.00 0.00 ? 43  ALA B H2   1  
ATOM 1257  H H3   . ALA B 2 1  ? 9.798   7.027   7.315   1.00 0.00 ? 43  ALA B H3   1  
ATOM 1258  H HA   . ALA B 2 1  ? 8.626   7.641   5.511   1.00 0.00 ? 43  ALA B HA   1  
ATOM 1259  H HB1  . ALA B 2 1  ? 8.671   5.189   5.814   1.00 0.00 ? 43  ALA B HB1  1  
ATOM 1260  H HB2  . ALA B 2 1  ? 7.282   5.742   4.877   1.00 0.00 ? 43  ALA B HB2  1  
ATOM 1261  H HB3  . ALA B 2 1  ? 7.078   5.279   6.567   1.00 0.00 ? 43  ALA B HB3  1  
ATOM 1262  N N    . PRO B 2 2  ? 6.732   9.258   6.102   1.00 0.00 ? 44  PRO B N    1  
ATOM 1263  C CA   . PRO B 2 2  ? 5.539   10.106  6.200   1.00 0.00 ? 44  PRO B CA   1  
ATOM 1264  C C    . PRO B 2 2  ? 4.459   9.709   5.198   1.00 0.00 ? 44  PRO B C    1  
ATOM 1265  O O    . PRO B 2 2  ? 3.277   9.996   5.398   1.00 0.00 ? 44  PRO B O    1  
ATOM 1266  C CB   . PRO B 2 2  ? 6.067   11.510  5.889   1.00 0.00 ? 44  PRO B CB   1  
ATOM 1267  C CG   . PRO B 2 2  ? 7.309   11.285  5.098   1.00 0.00 ? 44  PRO B CG   1  
ATOM 1268  C CD   . PRO B 2 2  ? 7.906   10.009  5.620   1.00 0.00 ? 44  PRO B CD   1  
ATOM 1269  H HA   . PRO B 2 2  ? 5.124   10.089  7.197   1.00 0.00 ? 44  PRO B HA   1  
ATOM 1270  H HB2  . PRO B 2 2  ? 5.330   12.057  5.321   1.00 0.00 ? 44  PRO B HB2  1  
ATOM 1271  H HB3  . PRO B 2 2  ? 6.276   12.030  6.812   1.00 0.00 ? 44  PRO B HB3  1  
ATOM 1272  H HG2  . PRO B 2 2  ? 7.065   11.184  4.051   1.00 0.00 ? 44  PRO B HG2  1  
ATOM 1273  H HG3  . PRO B 2 2  ? 7.993   12.107  5.248   1.00 0.00 ? 44  PRO B HG3  1  
ATOM 1274  H HD2  . PRO B 2 2  ? 8.408   9.475   4.826   1.00 0.00 ? 44  PRO B HD2  1  
ATOM 1275  H HD3  . PRO B 2 2  ? 8.591   10.214  6.430   1.00 0.00 ? 44  PRO B HD3  1  
ATOM 1276  N N    . GLN B 2 3  ? 4.868   9.043   4.122   1.00 0.00 ? 45  GLN B N    1  
ATOM 1277  C CA   . GLN B 2 3  ? 3.930   8.604   3.097   1.00 0.00 ? 45  GLN B CA   1  
ATOM 1278  C C    . GLN B 2 3  ? 3.165   7.374   3.564   1.00 0.00 ? 45  GLN B C    1  
ATOM 1279  O O    . GLN B 2 3  ? 2.047   7.115   3.116   1.00 0.00 ? 45  GLN B O    1  
ATOM 1280  C CB   . GLN B 2 3  ? 4.669   8.299   1.792   1.00 0.00 ? 45  GLN B CB   1  
ATOM 1281  C CG   . GLN B 2 3  ? 5.699   9.350   1.412   1.00 0.00 ? 45  GLN B CG   1  
ATOM 1282  C CD   . GLN B 2 3  ? 5.073   10.700  1.115   1.00 0.00 ? 45  GLN B CD   1  
ATOM 1283  O OE1  . GLN B 2 3  ? 3.909   10.941  1.434   1.00 0.00 ? 45  GLN B OE1  1  
ATOM 1284  N NE2  . GLN B 2 3  ? 5.845   11.587  0.499   1.00 0.00 ? 45  GLN B NE2  1  
ATOM 1285  H H    . GLN B 2 3  ? 5.819   8.836   4.018   1.00 0.00 ? 45  GLN B H    1  
ATOM 1286  H HA   . GLN B 2 3  ? 3.229   9.404   2.928   1.00 0.00 ? 45  GLN B HA   1  
ATOM 1287  H HB2  . GLN B 2 3  ? 5.175   7.350   1.891   1.00 0.00 ? 45  GLN B HB2  1  
ATOM 1288  H HB3  . GLN B 2 3  ? 3.946   8.228   0.991   1.00 0.00 ? 45  GLN B HB3  1  
ATOM 1289  H HG2  . GLN B 2 3  ? 6.393   9.467   2.230   1.00 0.00 ? 45  GLN B HG2  1  
ATOM 1290  H HG3  . GLN B 2 3  ? 6.230   9.015   0.534   1.00 0.00 ? 45  GLN B HG3  1  
ATOM 1291  H HE21 . GLN B 2 3  ? 6.763   11.325  0.274   1.00 0.00 ? 45  GLN B HE21 1  
ATOM 1292  H HE22 . GLN B 2 3  ? 5.467   12.468  0.294   1.00 0.00 ? 45  GLN B HE22 1  
ATOM 1293  N N    . LEU B 2 4  ? 3.773   6.623   4.472   1.00 0.00 ? 46  LEU B N    1  
ATOM 1294  C CA   . LEU B 2 4  ? 3.149   5.425   5.010   1.00 0.00 ? 46  LEU B CA   1  
ATOM 1295  C C    . LEU B 2 4  ? 2.094   5.798   6.043   1.00 0.00 ? 46  LEU B C    1  
ATOM 1296  O O    . LEU B 2 4  ? 1.068   5.130   6.171   1.00 0.00 ? 46  LEU B O    1  
ATOM 1297  C CB   . LEU B 2 4  ? 4.203   4.507   5.635   1.00 0.00 ? 46  LEU B CB   1  
ATOM 1298  C CG   . LEU B 2 4  ? 4.450   3.199   4.881   1.00 0.00 ? 46  LEU B CG   1  
ATOM 1299  C CD1  . LEU B 2 4  ? 5.564   2.404   5.544   1.00 0.00 ? 46  LEU B CD1  1  
ATOM 1300  C CD2  . LEU B 2 4  ? 3.173   2.375   4.811   1.00 0.00 ? 46  LEU B CD2  1  
ATOM 1301  H H    . LEU B 2 4  ? 4.659   6.887   4.792   1.00 0.00 ? 46  LEU B H    1  
ATOM 1302  H HA   . LEU B 2 4  ? 2.670   4.910   4.192   1.00 0.00 ? 46  LEU B HA   1  
ATOM 1303  H HB2  . LEU B 2 4  ? 5.136   5.050   5.688   1.00 0.00 ? 46  LEU B HB2  1  
ATOM 1304  H HB3  . LEU B 2 4  ? 3.891   4.262   6.639   1.00 0.00 ? 46  LEU B HB3  1  
ATOM 1305  H HG   . LEU B 2 4  ? 4.758   3.426   3.871   1.00 0.00 ? 46  LEU B HG   1  
ATOM 1306  H HD11 . LEU B 2 4  ? 5.698   1.467   5.024   1.00 0.00 ? 46  LEU B HD11 1  
ATOM 1307  H HD12 . LEU B 2 4  ? 5.303   2.209   6.574   1.00 0.00 ? 46  LEU B HD12 1  
ATOM 1308  H HD13 . LEU B 2 4  ? 6.483   2.971   5.506   1.00 0.00 ? 46  LEU B HD13 1  
ATOM 1309  H HD21 . LEU B 2 4  ? 3.193   1.754   3.928   1.00 0.00 ? 46  LEU B HD21 1  
ATOM 1310  H HD22 . LEU B 2 4  ? 2.320   3.036   4.766   1.00 0.00 ? 46  LEU B HD22 1  
ATOM 1311  H HD23 . LEU B 2 4  ? 3.099   1.751   5.689   1.00 0.00 ? 46  LEU B HD23 1  
ATOM 1312  N N    . ILE B 2 5  ? 2.352   6.879   6.772   1.00 0.00 ? 47  ILE B N    1  
ATOM 1313  C CA   . ILE B 2 5  ? 1.424   7.354   7.788   1.00 0.00 ? 47  ILE B CA   1  
ATOM 1314  C C    . ILE B 2 5  ? 0.204   7.996   7.140   1.00 0.00 ? 47  ILE B C    1  
ATOM 1315  O O    . ILE B 2 5  ? -0.916  7.864   7.634   1.00 0.00 ? 47  ILE B O    1  
ATOM 1316  C CB   . ILE B 2 5  ? 2.090   8.376   8.728   1.00 0.00 ? 47  ILE B CB   1  
ATOM 1317  C CG1  . ILE B 2 5  ? 3.429   7.839   9.238   1.00 0.00 ? 47  ILE B CG1  1  
ATOM 1318  C CG2  . ILE B 2 5  ? 1.168   8.707   9.891   1.00 0.00 ? 47  ILE B CG2  1  
ATOM 1319  C CD1  . ILE B 2 5  ? 3.312   6.518   9.966   1.00 0.00 ? 47  ILE B CD1  1  
ATOM 1320  H H    . ILE B 2 5  ? 3.184   7.373   6.616   1.00 0.00 ? 47  ILE B H    1  
ATOM 1321  H HA   . ILE B 2 5  ? 1.105   6.505   8.375   1.00 0.00 ? 47  ILE B HA   1  
ATOM 1322  H HB   . ILE B 2 5  ? 2.265   9.284   8.170   1.00 0.00 ? 47  ILE B HB   1  
ATOM 1323  H HG12 . ILE B 2 5  ? 4.095   7.697   8.399   1.00 0.00 ? 47  ILE B HG12 1  
ATOM 1324  H HG13 . ILE B 2 5  ? 3.861   8.557   9.918   1.00 0.00 ? 47  ILE B HG13 1  
ATOM 1325  H HG21 . ILE B 2 5  ? 1.254   9.757   10.133  1.00 0.00 ? 47  ILE B HG21 1  
ATOM 1326  H HG22 . ILE B 2 5  ? 1.446   8.116   10.751  1.00 0.00 ? 47  ILE B HG22 1  
ATOM 1327  H HG23 . ILE B 2 5  ? 0.148   8.483   9.617   1.00 0.00 ? 47  ILE B HG23 1  
ATOM 1328  H HD11 . ILE B 2 5  ? 2.694   5.843   9.391   1.00 0.00 ? 47  ILE B HD11 1  
ATOM 1329  H HD12 . ILE B 2 5  ? 2.862   6.680   10.934  1.00 0.00 ? 47  ILE B HD12 1  
ATOM 1330  H HD13 . ILE B 2 5  ? 4.294   6.089   10.093  1.00 0.00 ? 47  ILE B HD13 1  
ATOM 1331  N N    . MET B 2 6  ? 0.430   8.687   6.027   1.00 0.00 ? 48  MET B N    1  
ATOM 1332  C CA   . MET B 2 6  ? -0.653  9.347   5.308   1.00 0.00 ? 48  MET B CA   1  
ATOM 1333  C C    . MET B 2 6  ? -1.501  8.327   4.556   1.00 0.00 ? 48  MET B C    1  
ATOM 1334  O O    . MET B 2 6  ? -2.700  8.524   4.358   1.00 0.00 ? 48  MET B O    1  
ATOM 1335  C CB   . MET B 2 6  ? -0.093  10.396  4.340   1.00 0.00 ? 48  MET B CB   1  
ATOM 1336  C CG   . MET B 2 6  ? 0.474   9.814   3.054   1.00 0.00 ? 48  MET B CG   1  
ATOM 1337  S SD   . MET B 2 6  ? 1.027   11.087  1.902   1.00 0.00 ? 48  MET B SD   1  
ATOM 1338  C CE   . MET B 2 6  ? 0.921   10.203  0.347   1.00 0.00 ? 48  MET B CE   1  
ATOM 1339  H H    . MET B 2 6  ? 1.345   8.754   5.681   1.00 0.00 ? 48  MET B H    1  
ATOM 1340  H HA   . MET B 2 6  ? -1.275  9.837   6.035   1.00 0.00 ? 48  MET B HA   1  
ATOM 1341  H HB2  . MET B 2 6  ? -0.882  11.085  4.080   1.00 0.00 ? 48  MET B HB2  1  
ATOM 1342  H HB3  . MET B 2 6  ? 0.697   10.940  4.838   1.00 0.00 ? 48  MET B HB3  1  
ATOM 1343  H HG2  . MET B 2 6  ? 1.313   9.183   3.299   1.00 0.00 ? 48  MET B HG2  1  
ATOM 1344  H HG3  . MET B 2 6  ? -0.293  9.223   2.575   1.00 0.00 ? 48  MET B HG3  1  
ATOM 1345  H HE1  . MET B 2 6  ? 1.905   10.135  -0.096  1.00 0.00 ? 48  MET B HE1  1  
ATOM 1346  H HE2  . MET B 2 6  ? 0.261   10.733  -0.324  1.00 0.00 ? 48  MET B HE2  1  
ATOM 1347  H HE3  . MET B 2 6  ? 0.535   9.210   0.522   1.00 0.00 ? 48  MET B HE3  1  
ATOM 1348  N N    . LEU B 2 7  ? -0.867  7.237   4.146   1.00 0.00 ? 49  LEU B N    1  
ATOM 1349  C CA   . LEU B 2 7  ? -1.559  6.179   3.421   1.00 0.00 ? 49  LEU B CA   1  
ATOM 1350  C C    . LEU B 2 7  ? -2.565  5.475   4.326   1.00 0.00 ? 49  LEU B C    1  
ATOM 1351  O O    . LEU B 2 7  ? -3.722  5.279   3.951   1.00 0.00 ? 49  LEU B O    1  
ATOM 1352  C CB   . LEU B 2 7  ? -0.552  5.165   2.873   1.00 0.00 ? 49  LEU B CB   1  
ATOM 1353  C CG   . LEU B 2 7  ? 0.020   5.500   1.495   1.00 0.00 ? 49  LEU B CG   1  
ATOM 1354  C CD1  . LEU B 2 7  ? 1.442   4.976   1.366   1.00 0.00 ? 49  LEU B CD1  1  
ATOM 1355  C CD2  . LEU B 2 7  ? -0.864  4.926   0.399   1.00 0.00 ? 49  LEU B CD2  1  
ATOM 1356  H H    . LEU B 2 7  ? 0.088   7.140   4.341   1.00 0.00 ? 49  LEU B H    1  
ATOM 1357  H HA   . LEU B 2 7  ? -2.087  6.632   2.596   1.00 0.00 ? 49  LEU B HA   1  
ATOM 1358  H HB2  . LEU B 2 7  ? 0.268   5.088   3.573   1.00 0.00 ? 49  LEU B HB2  1  
ATOM 1359  H HB3  . LEU B 2 7  ? -1.040  4.203   2.811   1.00 0.00 ? 49  LEU B HB3  1  
ATOM 1360  H HG   . LEU B 2 7  ? 0.049   6.574   1.377   1.00 0.00 ? 49  LEU B HG   1  
ATOM 1361  H HD11 . LEU B 2 7  ? 2.031   5.671   0.786   1.00 0.00 ? 49  LEU B HD11 1  
ATOM 1362  H HD12 . LEU B 2 7  ? 1.429   4.016   0.871   1.00 0.00 ? 49  LEU B HD12 1  
ATOM 1363  H HD13 . LEU B 2 7  ? 1.877   4.868   2.348   1.00 0.00 ? 49  LEU B HD13 1  
ATOM 1364  H HD21 . LEU B 2 7  ? -1.729  5.558   0.266   1.00 0.00 ? 49  LEU B HD21 1  
ATOM 1365  H HD22 . LEU B 2 7  ? -1.183  3.933   0.678   1.00 0.00 ? 49  LEU B HD22 1  
ATOM 1366  H HD23 . LEU B 2 7  ? -0.307  4.879   -0.525  1.00 0.00 ? 49  LEU B HD23 1  
ATOM 1367  N N    . ALA B 2 8  ? -2.117  5.101   5.519   1.00 0.00 ? 50  ALA B N    1  
ATOM 1368  C CA   . ALA B 2 8  ? -2.974  4.422   6.479   1.00 0.00 ? 50  ALA B CA   1  
ATOM 1369  C C    . ALA B 2 8  ? -4.075  5.349   6.982   1.00 0.00 ? 50  ALA B C    1  
ATOM 1370  O O    . ALA B 2 8  ? -5.186  4.906   7.275   1.00 0.00 ? 50  ALA B O    1  
ATOM 1371  C CB   . ALA B 2 8  ? -2.150  3.897   7.645   1.00 0.00 ? 50  ALA B CB   1  
ATOM 1372  H H    . ALA B 2 8  ? -1.186  5.286   5.759   1.00 0.00 ? 50  ALA B H    1  
ATOM 1373  H HA   . ALA B 2 8  ? -3.427  3.579   5.981   1.00 0.00 ? 50  ALA B HA   1  
ATOM 1374  H HB1  . ALA B 2 8  ? -1.422  3.187   7.280   1.00 0.00 ? 50  ALA B HB1  1  
ATOM 1375  H HB2  . ALA B 2 8  ? -2.801  3.412   8.357   1.00 0.00 ? 50  ALA B HB2  1  
ATOM 1376  H HB3  . ALA B 2 8  ? -1.640  4.720   8.124   1.00 0.00 ? 50  ALA B HB3  1  
ATOM 1377  N N    . ASN B 2 9  ? -3.761  6.637   7.080   1.00 0.00 ? 51  ASN B N    1  
ATOM 1378  C CA   . ASN B 2 9  ? -4.727  7.624   7.547   1.00 0.00 ? 51  ASN B CA   1  
ATOM 1379  C C    . ASN B 2 9  ? -5.896  7.736   6.576   1.00 0.00 ? 51  ASN B C    1  
ATOM 1380  O O    . ASN B 2 9  ? -7.056  7.744   6.985   1.00 0.00 ? 51  ASN B O    1  
ATOM 1381  C CB   . ASN B 2 9  ? -4.055  8.988   7.716   1.00 0.00 ? 51  ASN B CB   1  
ATOM 1382  C CG   . ASN B 2 9  ? -4.865  9.927   8.588   1.00 0.00 ? 51  ASN B CG   1  
ATOM 1383  O OD1  . ASN B 2 9  ? -5.955  10.357  8.213   1.00 0.00 ? 51  ASN B OD1  1  
ATOM 1384  N ND2  . ASN B 2 9  ? -4.332  10.251  9.761   1.00 0.00 ? 51  ASN B ND2  1  
ATOM 1385  H H    . ASN B 2 9  ? -2.859  6.930   6.830   1.00 0.00 ? 51  ASN B H    1  
ATOM 1386  H HA   . ASN B 2 9  ? -5.100  7.295   8.505   1.00 0.00 ? 51  ASN B HA   1  
ATOM 1387  H HB2  . ASN B 2 9  ? -3.085  8.851   8.171   1.00 0.00 ? 51  ASN B HB2  1  
ATOM 1388  H HB3  . ASN B 2 9  ? -3.931  9.444   6.744   1.00 0.00 ? 51  ASN B HB3  1  
ATOM 1389  H HD21 . ASN B 2 9  ? -3.460  9.871   9.994   1.00 0.00 ? 51  ASN B HD21 1  
ATOM 1390  H HD22 . ASN B 2 9  ? -4.834  10.857  10.346  1.00 0.00 ? 51  ASN B HD22 1  
ATOM 1391  N N    . VAL B 2 10 ? -5.582  7.817   5.288   1.00 0.00 ? 52  VAL B N    1  
ATOM 1392  C CA   . VAL B 2 10 ? -6.607  7.924   4.258   1.00 0.00 ? 52  VAL B CA   1  
ATOM 1393  C C    . VAL B 2 10 ? -7.414  6.634   4.161   1.00 0.00 ? 52  VAL B C    1  
ATOM 1394  O O    . VAL B 2 10 ? -8.590  6.652   3.796   1.00 0.00 ? 52  VAL B O    1  
ATOM 1395  C CB   . VAL B 2 10 ? -5.991  8.241   2.881   1.00 0.00 ? 52  VAL B CB   1  
ATOM 1396  C CG1  . VAL B 2 10 ? -7.080  8.508   1.854   1.00 0.00 ? 52  VAL B CG1  1  
ATOM 1397  C CG2  . VAL B 2 10 ? -5.040  9.425   2.979   1.00 0.00 ? 52  VAL B CG2  1  
ATOM 1398  H H    . VAL B 2 10 ? -4.638  7.804   5.024   1.00 0.00 ? 52  VAL B H    1  
ATOM 1399  H HA   . VAL B 2 10 ? -7.270  8.733   4.530   1.00 0.00 ? 52  VAL B HA   1  
ATOM 1400  H HB   . VAL B 2 10 ? -5.426  7.379   2.557   1.00 0.00 ? 52  VAL B HB   1  
ATOM 1401  H HG11 . VAL B 2 10 ? -7.190  9.574   1.716   1.00 0.00 ? 52  VAL B HG11 1  
ATOM 1402  H HG12 . VAL B 2 10 ? -8.015  8.093   2.203   1.00 0.00 ? 52  VAL B HG12 1  
ATOM 1403  H HG13 . VAL B 2 10 ? -6.811  8.048   0.915   1.00 0.00 ? 52  VAL B HG13 1  
ATOM 1404  H HG21 . VAL B 2 10 ? -4.756  9.576   4.010   1.00 0.00 ? 52  VAL B HG21 1  
ATOM 1405  H HG22 . VAL B 2 10 ? -5.530  10.311  2.607   1.00 0.00 ? 52  VAL B HG22 1  
ATOM 1406  H HG23 . VAL B 2 10 ? -4.157  9.226   2.390   1.00 0.00 ? 52  VAL B HG23 1  
ATOM 1407  N N    . ALA B 2 11 ? -6.778  5.516   4.499   1.00 0.00 ? 53  ALA B N    1  
ATOM 1408  C CA   . ALA B 2 11 ? -7.438  4.224   4.458   1.00 0.00 ? 53  ALA B CA   1  
ATOM 1409  C C    . ALA B 2 11 ? -8.325  4.045   5.680   1.00 0.00 ? 53  ALA B C    1  
ATOM 1410  O O    . ALA B 2 11 ? -9.399  3.447   5.602   1.00 0.00 ? 53  ALA B O    1  
ATOM 1411  C CB   . ALA B 2 11 ? -6.409  3.106   4.377   1.00 0.00 ? 53  ALA B CB   1  
ATOM 1412  H H    . ALA B 2 11 ? -5.849  5.563   4.789   1.00 0.00 ? 53  ALA B H    1  
ATOM 1413  H HA   . ALA B 2 11 ? -8.046  4.191   3.570   1.00 0.00 ? 53  ALA B HA   1  
ATOM 1414  H HB1  . ALA B 2 11 ? -6.243  2.844   3.343   1.00 0.00 ? 53  ALA B HB1  1  
ATOM 1415  H HB2  . ALA B 2 11 ? -6.773  2.242   4.914   1.00 0.00 ? 53  ALA B HB2  1  
ATOM 1416  H HB3  . ALA B 2 11 ? -5.481  3.438   4.817   1.00 0.00 ? 53  ALA B HB3  1  
ATOM 1417  N N    . LEU B 2 12 ? -7.868  4.576   6.809   1.00 0.00 ? 54  LEU B N    1  
ATOM 1418  C CA   . LEU B 2 12 ? -8.614  4.487   8.050   1.00 0.00 ? 54  LEU B CA   1  
ATOM 1419  C C    . LEU B 2 12 ? -9.613  5.636   8.169   1.00 0.00 ? 54  LEU B C    1  
ATOM 1420  O O    . LEU B 2 12 ? -10.569 5.562   8.942   1.00 0.00 ? 54  LEU B O    1  
ATOM 1421  C CB   . LEU B 2 12 ? -7.658  4.493   9.247   1.00 0.00 ? 54  LEU B CB   1  
ATOM 1422  C CG   . LEU B 2 12 ? -7.425  3.125   9.894   1.00 0.00 ? 54  LEU B CG   1  
ATOM 1423  C CD1  . LEU B 2 12 ? -6.929  2.125   8.860   1.00 0.00 ? 54  LEU B CD1  1  
ATOM 1424  C CD2  . LEU B 2 12 ? -6.434  3.243   11.042  1.00 0.00 ? 54  LEU B CD2  1  
ATOM 1425  H H    . LEU B 2 12 ? -7.010  5.041   6.804   1.00 0.00 ? 54  LEU B H    1  
ATOM 1426  H HA   . LEU B 2 12 ? -9.149  3.559   8.033   1.00 0.00 ? 54  LEU B HA   1  
ATOM 1427  H HB2  . LEU B 2 12 ? -6.705  4.880   8.919   1.00 0.00 ? 54  LEU B HB2  1  
ATOM 1428  H HB3  . LEU B 2 12 ? -8.057  5.157   9.999   1.00 0.00 ? 54  LEU B HB3  1  
ATOM 1429  H HG   . LEU B 2 12 ? -8.359  2.758   10.292  1.00 0.00 ? 54  LEU B HG   1  
ATOM 1430  H HD11 . LEU B 2 12 ? -5.871  2.269   8.699   1.00 0.00 ? 54  LEU B HD11 1  
ATOM 1431  H HD12 . LEU B 2 12 ? -7.459  2.275   7.932   1.00 0.00 ? 54  LEU B HD12 1  
ATOM 1432  H HD13 . LEU B 2 12 ? -7.106  1.121   9.218   1.00 0.00 ? 54  LEU B HD13 1  
ATOM 1433  H HD21 . LEU B 2 12 ? -6.671  2.508   11.798  1.00 0.00 ? 54  LEU B HD21 1  
ATOM 1434  H HD22 . LEU B 2 12 ? -6.496  4.232   11.471  1.00 0.00 ? 54  LEU B HD22 1  
ATOM 1435  H HD23 . LEU B 2 12 ? -5.433  3.072   10.674  1.00 0.00 ? 54  LEU B HD23 1  
ATOM 1436  N N    . THR B 2 13 ? -9.385  6.697   7.399   1.00 0.00 ? 55  THR B N    1  
ATOM 1437  C CA   . THR B 2 13 ? -10.263 7.858   7.417   1.00 0.00 ? 55  THR B CA   1  
ATOM 1438  C C    . THR B 2 13 ? -9.921  8.814   6.277   1.00 0.00 ? 55  THR B C    1  
ATOM 1439  O O    . THR B 2 13 ? -9.265  9.836   6.486   1.00 0.00 ? 55  THR B O    1  
ATOM 1440  C CB   . THR B 2 13 ? -10.159 8.585   8.760   1.00 0.00 ? 55  THR B CB   1  
ATOM 1441  O OG1  . THR B 2 13 ? -9.012  8.160   9.475   1.00 0.00 ? 55  THR B OG1  1  
ATOM 1442  C CG2  . THR B 2 13 ? -11.363 8.367   9.652   1.00 0.00 ? 55  THR B CG2  1  
ATOM 1443  H H    . THR B 2 13 ? -8.610  6.697   6.805   1.00 0.00 ? 55  THR B H    1  
ATOM 1444  H HA   . THR B 2 13 ? -11.273 7.509   7.284   1.00 0.00 ? 55  THR B HA   1  
ATOM 1445  H HB   . THR B 2 13 ? -10.071 9.647   8.579   1.00 0.00 ? 55  THR B HB   1  
ATOM 1446  H HG1  . THR B 2 13 ? -8.438  8.913   9.636   1.00 0.00 ? 55  THR B HG1  1  
ATOM 1447  H HG21 . THR B 2 13 ? -12.031 7.657   9.189   1.00 0.00 ? 55  THR B HG21 1  
ATOM 1448  H HG22 . THR B 2 13 ? -11.879 9.305   9.796   1.00 0.00 ? 55  THR B HG22 1  
ATOM 1449  H HG23 . THR B 2 13 ? -11.037 7.985   10.609  1.00 0.00 ? 55  THR B HG23 1  
ATOM 1450  N N    . GLY B 2 14 ? -10.369 8.476   5.073   1.00 0.00 ? 56  GLY B N    1  
ATOM 1451  C CA   . GLY B 2 14 ? -10.101 9.313   3.918   1.00 0.00 ? 56  GLY B CA   1  
ATOM 1452  C C    . GLY B 2 14 ? -11.352 9.986   3.387   1.00 0.00 ? 56  GLY B C    1  
ATOM 1453  O O    . GLY B 2 14 ? -11.642 9.918   2.194   1.00 0.00 ? 56  GLY B O    1  
ATOM 1454  H H    . GLY B 2 14 ? -10.887 7.650   4.967   1.00 0.00 ? 56  GLY B H    1  
ATOM 1455  H HA2  . GLY B 2 14 ? -9.388  10.075  4.197   1.00 0.00 ? 56  GLY B HA2  1  
ATOM 1456  H HA3  . GLY B 2 14 ? -9.674  8.703   3.137   1.00 0.00 ? 56  GLY B HA3  1  
ATOM 1457  N N    . GLU B 2 15 ? -12.095 10.635  4.277   1.00 0.00 ? 57  GLU B N    1  
ATOM 1458  C CA   . GLU B 2 15 ? -13.322 11.323  3.892   1.00 0.00 ? 57  GLU B CA   1  
ATOM 1459  C C    . GLU B 2 15 ? -13.936 12.050  5.084   1.00 0.00 ? 57  GLU B C    1  
ATOM 1460  O O    . GLU B 2 15 ? -14.015 11.441  6.171   1.00 0.00 ? 57  GLU B O    1  
ATOM 1461  C CB   . GLU B 2 15 ? -14.329 10.327  3.315   1.00 0.00 ? 57  GLU B CB   1  
ATOM 1462  C CG   . GLU B 2 15 ? -14.533 9.096   4.182   1.00 0.00 ? 57  GLU B CG   1  
ATOM 1463  C CD   . GLU B 2 15 ? -15.738 9.218   5.095   1.00 0.00 ? 57  GLU B CD   1  
ATOM 1464  O OE1  . GLU B 2 15 ? -16.788 9.706   4.628   1.00 0.00 ? 57  GLU B OE1  1  
ATOM 1465  O OE2  . GLU B 2 15 ? -15.629 8.826   6.275   1.00 0.00 ? 57  GLU B OE2  1  
ATOM 1466  O OXT  . GLU B 2 15 ? -14.331 13.224  4.919   1.00 0.00 ? 57  GLU B OXT  1  
ATOM 1467  H H    . GLU B 2 15 ? -11.812 10.654  5.215   1.00 0.00 ? 57  GLU B H    1  
ATOM 1468  H HA   . GLU B 2 15 ? -13.071 12.048  3.133   1.00 0.00 ? 57  GLU B HA   1  
ATOM 1469  H HB2  . GLU B 2 15 ? -15.283 10.822  3.200   1.00 0.00 ? 57  GLU B HB2  1  
ATOM 1470  H HB3  . GLU B 2 15 ? -13.983 10.003  2.344   1.00 0.00 ? 57  GLU B HB3  1  
ATOM 1471  H HG2  . GLU B 2 15 ? -14.672 8.238   3.541   1.00 0.00 ? 57  GLU B HG2  1  
ATOM 1472  H HG3  . GLU B 2 15 ? -13.652 8.949   4.790   1.00 0.00 ? 57  GLU B HG3  1  
ATOM 1473  N N    . PRO A 1 1  ? 2.323   17.143  -4.477  1.00 0.00 ? 31  PRO A N    2  
ATOM 1474  C CA   . PRO A 1 1  ? 3.031   16.004  -3.833  1.00 0.00 ? 31  PRO A CA   2  
ATOM 1475  C C    . PRO A 1 1  ? 2.114   14.795  -3.656  1.00 0.00 ? 31  PRO A C    2  
ATOM 1476  O O    . PRO A 1 1  ? 0.924   14.856  -3.965  1.00 0.00 ? 31  PRO A O    2  
ATOM 1477  C CB   . PRO A 1 1  ? 3.541   16.487  -2.478  1.00 0.00 ? 31  PRO A CB   2  
ATOM 1478  C CG   . PRO A 1 1  ? 3.226   17.946  -2.461  1.00 0.00 ? 31  PRO A CG   2  
ATOM 1479  C CD   . PRO A 1 1  ? 2.084   18.146  -3.428  1.00 0.00 ? 31  PRO A CD   2  
ATOM 1480  H H2   . PRO A 1 1  ? 1.508   16.683  -4.916  1.00 0.00 ? 31  PRO A H2   2  
ATOM 1481  H H3   . PRO A 1 1  ? 2.964   17.360  -5.276  1.00 0.00 ? 31  PRO A H3   2  
ATOM 1482  H HA   . PRO A 1 1  ? 3.871   15.725  -4.450  1.00 0.00 ? 31  PRO A HA   2  
ATOM 1483  H HB2  . PRO A 1 1  ? 3.028   15.961  -1.686  1.00 0.00 ? 31  PRO A HB2  2  
ATOM 1484  H HB3  . PRO A 1 1  ? 4.604   16.313  -2.406  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 1485  H HG2  . PRO A 1 1  ? 2.930   18.245  -1.467  1.00 0.00 ? 31  PRO A HG2  2  
ATOM 1486  H HG3  . PRO A 1 1  ? 4.089   18.511  -2.781  1.00 0.00 ? 31  PRO A HG3  2  
ATOM 1487  H HD2  . PRO A 1 1  ? 1.139   17.967  -2.936  1.00 0.00 ? 31  PRO A HD2  2  
ATOM 1488  H HD3  . PRO A 1 1  ? 2.111   19.144  -3.841  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 1489  N N    . VAL A 1 2  ? 2.677   13.700  -3.156  1.00 0.00 ? 32  VAL A N    2  
ATOM 1490  C CA   . VAL A 1 2  ? 1.911   12.479  -2.938  1.00 0.00 ? 32  VAL A CA   2  
ATOM 1491  C C    . VAL A 1 2  ? 1.142   12.545  -1.622  1.00 0.00 ? 32  VAL A C    2  
ATOM 1492  O O    . VAL A 1 2  ? 1.553   11.959  -0.620  1.00 0.00 ? 32  VAL A O    2  
ATOM 1493  C CB   . VAL A 1 2  ? 2.822   11.236  -2.928  1.00 0.00 ? 32  VAL A CB   2  
ATOM 1494  C CG1  . VAL A 1 2  ? 1.990   9.965   -2.867  1.00 0.00 ? 32  VAL A CG1  2  
ATOM 1495  C CG2  . VAL A 1 2  ? 3.731   11.228  -4.149  1.00 0.00 ? 32  VAL A CG2  2  
ATOM 1496  H H    . VAL A 1 2  ? 3.631   13.714  -2.929  1.00 0.00 ? 32  VAL A H    2  
ATOM 1497  H HA   . VAL A 1 2  ? 1.207   12.378  -3.751  1.00 0.00 ? 32  VAL A HA   2  
ATOM 1498  H HB   . VAL A 1 2  ? 3.442   11.276  -2.045  1.00 0.00 ? 32  VAL A HB   2  
ATOM 1499  H HG11 . VAL A 1 2  ? 1.558   9.864   -1.882  1.00 0.00 ? 32  VAL A HG11 2  
ATOM 1500  H HG12 . VAL A 1 2  ? 2.621   9.112   -3.073  1.00 0.00 ? 32  VAL A HG12 2  
ATOM 1501  H HG13 . VAL A 1 2  ? 1.201   10.015  -3.603  1.00 0.00 ? 32  VAL A HG13 2  
ATOM 1502  H HG21 . VAL A 1 2  ? 3.768   12.219  -4.578  1.00 0.00 ? 32  VAL A HG21 2  
ATOM 1503  H HG22 . VAL A 1 2  ? 3.346   10.534  -4.880  1.00 0.00 ? 32  VAL A HG22 2  
ATOM 1504  H HG23 . VAL A 1 2  ? 4.725   10.926  -3.855  1.00 0.00 ? 32  VAL A HG23 2  
ATOM 1505  N N    . HIS A 1 3  ? 0.024   13.263  -1.634  1.00 0.00 ? 33  HIS A N    2  
ATOM 1506  C CA   . HIS A 1 3  ? -0.805  13.408  -0.443  1.00 0.00 ? 33  HIS A CA   2  
ATOM 1507  C C    . HIS A 1 3  ? -2.082  12.579  -0.564  1.00 0.00 ? 33  HIS A C    2  
ATOM 1508  O O    . HIS A 1 3  ? -2.161  11.662  -1.382  1.00 0.00 ? 33  HIS A O    2  
ATOM 1509  C CB   . HIS A 1 3  ? -1.150  14.882  -0.218  1.00 0.00 ? 33  HIS A CB   2  
ATOM 1510  C CG   . HIS A 1 3  ? -1.111  15.293  1.221   1.00 0.00 ? 33  HIS A CG   2  
ATOM 1511  N ND1  . HIS A 1 3  ? -1.474  16.551  1.656   1.00 0.00 ? 33  HIS A ND1  2  
ATOM 1512  C CD2  . HIS A 1 3  ? -0.750  14.604  2.330   1.00 0.00 ? 33  HIS A CD2  2  
ATOM 1513  C CE1  . HIS A 1 3  ? -1.337  16.618  2.968   1.00 0.00 ? 33  HIS A CE1  2  
ATOM 1514  N NE2  . HIS A 1 3  ? -0.900  15.450  3.401   1.00 0.00 ? 33  HIS A NE2  2  
ATOM 1515  H H    . HIS A 1 3  ? -0.250  13.707  -2.463  1.00 0.00 ? 33  HIS A H    2  
ATOM 1516  H HA   . HIS A 1 3  ? -0.236  13.048  0.402   1.00 0.00 ? 33  HIS A HA   2  
ATOM 1517  H HB2  . HIS A 1 3  ? -0.445  15.497  -0.757  1.00 0.00 ? 33  HIS A HB2  2  
ATOM 1518  H HB3  . HIS A 1 3  ? -2.146  15.073  -0.593  1.00 0.00 ? 33  HIS A HB3  2  
ATOM 1519  H HD1  . HIS A 1 3  ? -1.785  17.285  1.086   1.00 0.00 ? 33  HIS A HD1  2  
ATOM 1520  H HD2  . HIS A 1 3  ? -0.408  13.579  2.365   1.00 0.00 ? 33  HIS A HD2  2  
ATOM 1521  H HE1  . HIS A 1 3  ? -1.548  17.481  3.582   1.00 0.00 ? 33  HIS A HE1  2  
ATOM 1522  H HE2  . HIS A 1 3  ? -0.797  15.199  4.343   1.00 0.00 ? 33  HIS A HE2  2  
ATOM 1523  N N    . VAL A 1 4  ? -3.081  12.905  0.254   1.00 0.00 ? 34  VAL A N    2  
ATOM 1524  C CA   . VAL A 1 4  ? -4.354  12.190  0.239   1.00 0.00 ? 34  VAL A CA   2  
ATOM 1525  C C    . VAL A 1 4  ? -4.882  12.019  -1.184  1.00 0.00 ? 34  VAL A C    2  
ATOM 1526  O O    . VAL A 1 4  ? -5.598  11.062  -1.479  1.00 0.00 ? 34  VAL A O    2  
ATOM 1527  C CB   . VAL A 1 4  ? -5.417  12.920  1.082   1.00 0.00 ? 34  VAL A CB   2  
ATOM 1528  C CG1  . VAL A 1 4  ? -6.673  12.073  1.216   1.00 0.00 ? 34  VAL A CG1  2  
ATOM 1529  C CG2  . VAL A 1 4  ? -4.858  13.278  2.452   1.00 0.00 ? 34  VAL A CG2  2  
ATOM 1530  H H    . VAL A 1 4  ? -2.958  13.644  0.885   1.00 0.00 ? 34  VAL A H    2  
ATOM 1531  H HA   . VAL A 1 4  ? -4.192  11.213  0.671   1.00 0.00 ? 34  VAL A HA   2  
ATOM 1532  H HB   . VAL A 1 4  ? -5.681  13.837  0.575   1.00 0.00 ? 34  VAL A HB   2  
ATOM 1533  H HG11 . VAL A 1 4  ? -6.718  11.648  2.208   1.00 0.00 ? 34  VAL A HG11 2  
ATOM 1534  H HG12 . VAL A 1 4  ? -6.652  11.278  0.484   1.00 0.00 ? 34  VAL A HG12 2  
ATOM 1535  H HG13 . VAL A 1 4  ? -7.543  12.691  1.050   1.00 0.00 ? 34  VAL A HG13 2  
ATOM 1536  H HG21 . VAL A 1 4  ? -4.471  14.286  2.431   1.00 0.00 ? 34  VAL A HG21 2  
ATOM 1537  H HG22 . VAL A 1 4  ? -4.063  12.592  2.706   1.00 0.00 ? 34  VAL A HG22 2  
ATOM 1538  H HG23 . VAL A 1 4  ? -5.643  13.209  3.190   1.00 0.00 ? 34  VAL A HG23 2  
ATOM 1539  N N    . GLU A 1 5  ? -4.525  12.951  -2.061  1.00 0.00 ? 35  GLU A N    2  
ATOM 1540  C CA   . GLU A 1 5  ? -4.964  12.901  -3.451  1.00 0.00 ? 35  GLU A CA   2  
ATOM 1541  C C    . GLU A 1 5  ? -4.498  11.611  -4.123  1.00 0.00 ? 35  GLU A C    2  
ATOM 1542  O O    . GLU A 1 5  ? -5.297  10.884  -4.713  1.00 0.00 ? 35  GLU A O    2  
ATOM 1543  C CB   . GLU A 1 5  ? -4.432  14.113  -4.220  1.00 0.00 ? 35  GLU A CB   2  
ATOM 1544  C CG   . GLU A 1 5  ? -5.449  15.232  -4.368  1.00 0.00 ? 35  GLU A CG   2  
ATOM 1545  C CD   . GLU A 1 5  ? -5.055  16.241  -5.429  1.00 0.00 ? 35  GLU A CD   2  
ATOM 1546  O OE1  . GLU A 1 5  ? -4.602  15.816  -6.513  1.00 0.00 ? 35  GLU A OE1  2  
ATOM 1547  O OE2  . GLU A 1 5  ? -5.199  17.456  -5.176  1.00 0.00 ? 35  GLU A OE2  2  
ATOM 1548  H H    . GLU A 1 5  ? -3.953  13.691  -1.767  1.00 0.00 ? 35  GLU A H    2  
ATOM 1549  H HA   . GLU A 1 5  ? -6.043  12.926  -3.459  1.00 0.00 ? 35  GLU A HA   2  
ATOM 1550  H HB2  . GLU A 1 5  ? -3.571  14.505  -3.699  1.00 0.00 ? 35  GLU A HB2  2  
ATOM 1551  H HB3  . GLU A 1 5  ? -4.131  13.796  -5.208  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 1552  H HG2  . GLU A 1 5  ? -6.402  14.803  -4.639  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 1553  H HG3  . GLU A 1 5  ? -5.542  15.745  -3.422  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 1554  N N    . ASP A 1 6  ? -3.201  11.336  -4.028  1.00 0.00 ? 36  ASP A N    2  
ATOM 1555  C CA   . ASP A 1 6  ? -2.629  10.135  -4.627  1.00 0.00 ? 36  ASP A CA   2  
ATOM 1556  C C    . ASP A 1 6  ? -3.053  8.887   -3.858  1.00 0.00 ? 36  ASP A C    2  
ATOM 1557  O O    . ASP A 1 6  ? -3.181  7.806   -4.432  1.00 0.00 ? 36  ASP A O    2  
ATOM 1558  C CB   . ASP A 1 6  ? -1.102  10.237  -4.662  1.00 0.00 ? 36  ASP A CB   2  
ATOM 1559  C CG   . ASP A 1 6  ? -0.542  10.066  -6.061  1.00 0.00 ? 36  ASP A CG   2  
ATOM 1560  O OD1  . ASP A 1 6  ? -0.595  11.037  -6.844  1.00 0.00 ? 36  ASP A OD1  2  
ATOM 1561  O OD2  . ASP A 1 6  ? -0.051  8.961   -6.372  1.00 0.00 ? 36  ASP A OD2  2  
ATOM 1562  H H    . ASP A 1 6  ? -2.615  11.955  -3.545  1.00 0.00 ? 36  ASP A H    2  
ATOM 1563  H HA   . ASP A 1 6  ? -2.998  10.062  -5.639  1.00 0.00 ? 36  ASP A HA   2  
ATOM 1564  H HB2  . ASP A 1 6  ? -0.803  11.207  -4.292  1.00 0.00 ? 36  ASP A HB2  2  
ATOM 1565  H HB3  . ASP A 1 6  ? -0.679  9.470   -4.028  1.00 0.00 ? 36  ASP A HB3  2  
ATOM 1566  N N    . ALA A 1 7  ? -3.269  9.044   -2.556  1.00 0.00 ? 37  ALA A N    2  
ATOM 1567  C CA   . ALA A 1 7  ? -3.679  7.929   -1.710  1.00 0.00 ? 37  ALA A CA   2  
ATOM 1568  C C    . ALA A 1 7  ? -5.141  7.567   -1.948  1.00 0.00 ? 37  ALA A C    2  
ATOM 1569  O O    . ALA A 1 7  ? -5.505  6.392   -1.963  1.00 0.00 ? 37  ALA A O    2  
ATOM 1570  C CB   . ALA A 1 7  ? -3.448  8.268   -0.245  1.00 0.00 ? 37  ALA A CB   2  
ATOM 1571  H H    . ALA A 1 7  ? -3.150  9.930   -2.155  1.00 0.00 ? 37  ALA A H    2  
ATOM 1572  H HA   . ALA A 1 7  ? -3.062  7.078   -1.959  1.00 0.00 ? 37  ALA A HA   2  
ATOM 1573  H HB1  . ALA A 1 7  ? -4.202  7.784   0.359   1.00 0.00 ? 37  ALA A HB1  2  
ATOM 1574  H HB2  . ALA A 1 7  ? -3.510  9.338   -0.109  1.00 0.00 ? 37  ALA A HB2  2  
ATOM 1575  H HB3  . ALA A 1 7  ? -2.470  7.923   0.055   1.00 0.00 ? 37  ALA A HB3  2  
ATOM 1576  N N    . LEU A 1 8  ? -5.975  8.586   -2.131  1.00 0.00 ? 38  LEU A N    2  
ATOM 1577  C CA   . LEU A 1 8  ? -7.398  8.376   -2.367  1.00 0.00 ? 38  LEU A CA   2  
ATOM 1578  C C    . LEU A 1 8  ? -7.630  7.616   -3.670  1.00 0.00 ? 38  LEU A C    2  
ATOM 1579  O O    . LEU A 1 8  ? -8.346  6.615   -3.696  1.00 0.00 ? 38  LEU A O    2  
ATOM 1580  C CB   . LEU A 1 8  ? -8.132  9.718   -2.406  1.00 0.00 ? 38  LEU A CB   2  
ATOM 1581  C CG   . LEU A 1 8  ? -8.752  10.155  -1.077  1.00 0.00 ? 38  LEU A CG   2  
ATOM 1582  C CD1  . LEU A 1 8  ? -8.984  11.658  -1.065  1.00 0.00 ? 38  LEU A CD1  2  
ATOM 1583  C CD2  . LEU A 1 8  ? -10.056 9.412   -0.829  1.00 0.00 ? 38  LEU A CD2  2  
ATOM 1584  H H    . LEU A 1 8  ? -5.625  9.500   -2.107  1.00 0.00 ? 38  LEU A H    2  
ATOM 1585  H HA   . LEU A 1 8  ? -7.784  7.789   -1.548  1.00 0.00 ? 38  LEU A HA   2  
ATOM 1586  H HB2  . LEU A 1 8  ? -7.432  10.479  -2.720  1.00 0.00 ? 38  LEU A HB2  2  
ATOM 1587  H HB3  . LEU A 1 8  ? -8.921  9.654   -3.140  1.00 0.00 ? 38  LEU A HB3  2  
ATOM 1588  H HG   . LEU A 1 8  ? -8.071  9.916   -0.274  1.00 0.00 ? 38  LEU A HG   2  
ATOM 1589  H HD11 . LEU A 1 8  ? -9.877  11.890  -1.627  1.00 0.00 ? 38  LEU A HD11 2  
ATOM 1590  H HD12 . LEU A 1 8  ? -8.137  12.157  -1.514  1.00 0.00 ? 38  LEU A HD12 2  
ATOM 1591  H HD13 . LEU A 1 8  ? -9.101  11.996  -0.046  1.00 0.00 ? 38  LEU A HD13 2  
ATOM 1592  H HD21 . LEU A 1 8  ? -10.056 8.488   -1.388  1.00 0.00 ? 38  LEU A HD21 2  
ATOM 1593  H HD22 . LEU A 1 8  ? -10.887 10.025  -1.146  1.00 0.00 ? 38  LEU A HD22 2  
ATOM 1594  H HD23 . LEU A 1 8  ? -10.151 9.194   0.225   1.00 0.00 ? 38  LEU A HD23 2  
ATOM 1595  N N    . THR A 1 9  ? -7.022  8.099   -4.749  1.00 0.00 ? 39  THR A N    2  
ATOM 1596  C CA   . THR A 1 9  ? -7.165  7.464   -6.054  1.00 0.00 ? 39  THR A CA   2  
ATOM 1597  C C    . THR A 1 9  ? -6.672  6.021   -6.015  1.00 0.00 ? 39  THR A C    2  
ATOM 1598  O O    . THR A 1 9  ? -7.317  5.118   -6.548  1.00 0.00 ? 39  THR A O    2  
ATOM 1599  C CB   . THR A 1 9  ? -6.396  8.253   -7.119  1.00 0.00 ? 39  THR A CB   2  
ATOM 1600  O OG1  . THR A 1 9  ? -6.875  7.941   -8.415  1.00 0.00 ? 39  THR A OG1  2  
ATOM 1601  C CG2  . THR A 1 9  ? -4.902  7.993   -7.108  1.00 0.00 ? 39  THR A CG2  2  
ATOM 1602  H H    . THR A 1 9  ? -6.465  8.901   -4.666  1.00 0.00 ? 39  THR A H    2  
ATOM 1603  H HA   . THR A 1 9  ? -8.215  7.465   -6.307  1.00 0.00 ? 39  THR A HA   2  
ATOM 1604  H HB   . THR A 1 9  ? -6.548  9.309   -6.948  1.00 0.00 ? 39  THR A HB   2  
ATOM 1605  H HG1  . THR A 1 9  ? -6.756  7.004   -8.583  1.00 0.00 ? 39  THR A HG1  2  
ATOM 1606  H HG21 . THR A 1 9  ? -4.718  6.935   -7.238  1.00 0.00 ? 39  THR A HG21 2  
ATOM 1607  H HG22 . THR A 1 9  ? -4.487  8.317   -6.165  1.00 0.00 ? 39  THR A HG22 2  
ATOM 1608  H HG23 . THR A 1 9  ? -4.435  8.541   -7.914  1.00 0.00 ? 39  THR A HG23 2  
ATOM 1609  N N    . TYR A 1 10 ? -5.517  5.816   -5.389  1.00 0.00 ? 40  TYR A N    2  
ATOM 1610  C CA   . TYR A 1 10 ? -4.928  4.488   -5.289  1.00 0.00 ? 40  TYR A CA   2  
ATOM 1611  C C    . TYR A 1 10 ? -5.912  3.496   -4.676  1.00 0.00 ? 40  TYR A C    2  
ATOM 1612  O O    . TYR A 1 10 ? -6.031  2.360   -5.135  1.00 0.00 ? 40  TYR A O    2  
ATOM 1613  C CB   . TYR A 1 10 ? -3.648  4.535   -4.453  1.00 0.00 ? 40  TYR A CB   2  
ATOM 1614  C CG   . TYR A 1 10 ? -2.857  3.245   -4.482  1.00 0.00 ? 40  TYR A CG   2  
ATOM 1615  C CD1  . TYR A 1 10 ? -2.180  2.850   -5.629  1.00 0.00 ? 40  TYR A CD1  2  
ATOM 1616  C CD2  . TYR A 1 10 ? -2.787  2.424   -3.363  1.00 0.00 ? 40  TYR A CD2  2  
ATOM 1617  C CE1  . TYR A 1 10 ? -1.456  1.673   -5.661  1.00 0.00 ? 40  TYR A CE1  2  
ATOM 1618  C CE2  . TYR A 1 10 ? -2.065  1.246   -3.387  1.00 0.00 ? 40  TYR A CE2  2  
ATOM 1619  C CZ   . TYR A 1 10 ? -1.402  0.875   -4.538  1.00 0.00 ? 40  TYR A CZ   2  
ATOM 1620  O OH   . TYR A 1 10 ? -0.682  -0.297  -4.565  1.00 0.00 ? 40  TYR A OH   2  
ATOM 1621  H H    . TYR A 1 10 ? -5.047  6.579   -4.991  1.00 0.00 ? 40  TYR A H    2  
ATOM 1622  H HA   . TYR A 1 10 ? -4.681  4.165   -6.289  1.00 0.00 ? 40  TYR A HA   2  
ATOM 1623  H HB2  . TYR A 1 10 ? -3.011  5.322   -4.826  1.00 0.00 ? 40  TYR A HB2  2  
ATOM 1624  H HB3  . TYR A 1 10 ? -3.905  4.744   -3.425  1.00 0.00 ? 40  TYR A HB3  2  
ATOM 1625  H HD1  . TYR A 1 10 ? -2.224  3.477   -6.508  1.00 0.00 ? 40  TYR A HD1  2  
ATOM 1626  H HD2  . TYR A 1 10 ? -3.309  2.716   -2.464  1.00 0.00 ? 40  TYR A HD2  2  
ATOM 1627  H HE1  . TYR A 1 10 ? -0.937  1.383   -6.562  1.00 0.00 ? 40  TYR A HE1  2  
ATOM 1628  H HE2  . TYR A 1 10 ? -2.022  0.620   -2.507  1.00 0.00 ? 40  TYR A HE2  2  
ATOM 1629  H HH   . TYR A 1 10 ? -0.261  -0.434  -3.713  1.00 0.00 ? 40  TYR A HH   2  
ATOM 1630  N N    . LEU A 1 11 ? -6.614  3.933   -3.637  1.00 0.00 ? 41  LEU A N    2  
ATOM 1631  C CA   . LEU A 1 11 ? -7.587  3.084   -2.960  1.00 0.00 ? 41  LEU A CA   2  
ATOM 1632  C C    . LEU A 1 11 ? -8.828  2.878   -3.823  1.00 0.00 ? 41  LEU A C    2  
ATOM 1633  O O    . LEU A 1 11 ? -9.486  1.840   -3.743  1.00 0.00 ? 41  LEU A O    2  
ATOM 1634  C CB   . LEU A 1 11 ? -7.983  3.700   -1.616  1.00 0.00 ? 41  LEU A CB   2  
ATOM 1635  C CG   . LEU A 1 11 ? -6.891  3.676   -0.547  1.00 0.00 ? 41  LEU A CG   2  
ATOM 1636  C CD1  . LEU A 1 11 ? -7.192  4.690   0.546   1.00 0.00 ? 41  LEU A CD1  2  
ATOM 1637  C CD2  . LEU A 1 11 ? -6.753  2.280   0.041   1.00 0.00 ? 41  LEU A CD2  2  
ATOM 1638  H H    . LEU A 1 11 ? -6.474  4.849   -3.317  1.00 0.00 ? 41  LEU A H    2  
ATOM 1639  H HA   . LEU A 1 11 ? -7.123  2.125   -2.782  1.00 0.00 ? 41  LEU A HA   2  
ATOM 1640  H HB2  . LEU A 1 11 ? -8.271  4.727   -1.787  1.00 0.00 ? 41  LEU A HB2  2  
ATOM 1641  H HB3  . LEU A 1 11 ? -8.839  3.163   -1.236  1.00 0.00 ? 41  LEU A HB3  2  
ATOM 1642  H HG   . LEU A 1 11 ? -5.947  3.944   -0.999  1.00 0.00 ? 41  LEU A HG   2  
ATOM 1643  H HD11 . LEU A 1 11 ? -7.820  5.473   0.148   1.00 0.00 ? 41  LEU A HD11 2  
ATOM 1644  H HD12 . LEU A 1 11 ? -6.268  5.117   0.906   1.00 0.00 ? 41  LEU A HD12 2  
ATOM 1645  H HD13 . LEU A 1 11 ? -7.703  4.199   1.362   1.00 0.00 ? 41  LEU A HD13 2  
ATOM 1646  H HD21 . LEU A 1 11 ? -7.098  1.551   -0.678  1.00 0.00 ? 41  LEU A HD21 2  
ATOM 1647  H HD22 . LEU A 1 11 ? -7.347  2.207   0.940   1.00 0.00 ? 41  LEU A HD22 2  
ATOM 1648  H HD23 . LEU A 1 11 ? -5.717  2.089   0.278   1.00 0.00 ? 41  LEU A HD23 2  
ATOM 1649  N N    . ASP A 1 12 ? -9.144  3.872   -4.645  1.00 0.00 ? 42  ASP A N    2  
ATOM 1650  C CA   . ASP A 1 12 ? -10.309 3.798   -5.519  1.00 0.00 ? 42  ASP A CA   2  
ATOM 1651  C C    . ASP A 1 12 ? -10.093 2.785   -6.636  1.00 0.00 ? 42  ASP A C    2  
ATOM 1652  O O    . ASP A 1 12 ? -11.035 2.144   -7.101  1.00 0.00 ? 42  ASP A O    2  
ATOM 1653  C CB   . ASP A 1 12 ? -10.616 5.174   -6.114  1.00 0.00 ? 42  ASP A CB   2  
ATOM 1654  C CG   . ASP A 1 12 ? -11.960 5.213   -6.817  1.00 0.00 ? 42  ASP A CG   2  
ATOM 1655  O OD1  . ASP A 1 12 ? -12.984 4.948   -6.154  1.00 0.00 ? 42  ASP A OD1  2  
ATOM 1656  O OD2  . ASP A 1 12 ? -11.987 5.510   -8.030  1.00 0.00 ? 42  ASP A OD2  2  
ATOM 1657  H H    . ASP A 1 12 ? -8.583  4.676   -4.663  1.00 0.00 ? 42  ASP A H    2  
ATOM 1658  H HA   . ASP A 1 12 ? -11.145 3.479   -4.924  1.00 0.00 ? 42  ASP A HA   2  
ATOM 1659  H HB2  . ASP A 1 12 ? -10.624 5.908   -5.323  1.00 0.00 ? 42  ASP A HB2  2  
ATOM 1660  H HB3  . ASP A 1 12 ? -9.849  5.429   -6.830  1.00 0.00 ? 42  ASP A HB3  2  
ATOM 1661  N N    . GLN A 1 13 ? -8.846  2.646   -7.059  1.00 0.00 ? 43  GLN A N    2  
ATOM 1662  C CA   . GLN A 1 13 ? -8.499  1.710   -8.122  1.00 0.00 ? 43  GLN A CA   2  
ATOM 1663  C C    . GLN A 1 13 ? -8.346  0.297   -7.577  1.00 0.00 ? 43  GLN A C    2  
ATOM 1664  O O    . GLN A 1 13 ? -8.620  -0.682  -8.270  1.00 0.00 ? 43  GLN A O    2  
ATOM 1665  C CB   . GLN A 1 13 ? -7.209  2.147   -8.819  1.00 0.00 ? 43  GLN A CB   2  
ATOM 1666  C CG   . GLN A 1 13 ? -6.041  2.353   -7.868  1.00 0.00 ? 43  GLN A CG   2  
ATOM 1667  C CD   . GLN A 1 13 ? -4.721  2.522   -8.593  1.00 0.00 ? 43  GLN A CD   2  
ATOM 1668  O OE1  . GLN A 1 13 ? -4.366  3.624   -9.013  1.00 0.00 ? 43  GLN A OE1  2  
ATOM 1669  N NE2  . GLN A 1 13 ? -3.985  1.427   -8.746  1.00 0.00 ? 43  GLN A NE2  2  
ATOM 1670  H H    . GLN A 1 13 ? -8.143  3.185   -6.644  1.00 0.00 ? 43  GLN A H    2  
ATOM 1671  H HA   . GLN A 1 13 ? -9.302  1.716   -8.837  1.00 0.00 ? 43  GLN A HA   2  
ATOM 1672  H HB2  . GLN A 1 13 ? -6.929  1.393   -9.540  1.00 0.00 ? 43  GLN A HB2  2  
ATOM 1673  H HB3  . GLN A 1 13 ? -7.391  3.077   -9.338  1.00 0.00 ? 43  GLN A HB3  2  
ATOM 1674  H HG2  . GLN A 1 13 ? -6.226  3.238   -7.278  1.00 0.00 ? 43  GLN A HG2  2  
ATOM 1675  H HG3  . GLN A 1 13 ? -5.971  1.495   -7.216  1.00 0.00 ? 43  GLN A HG3  2  
ATOM 1676  H HE21 . GLN A 1 13 ? -4.330  0.583   -8.387  1.00 0.00 ? 43  GLN A HE21 2  
ATOM 1677  H HE22 . GLN A 1 13 ? -3.126  1.508   -9.210  1.00 0.00 ? 43  GLN A HE22 2  
ATOM 1678  N N    . VAL A 1 14 ? -7.913  0.201   -6.328  1.00 0.00 ? 44  VAL A N    2  
ATOM 1679  C CA   . VAL A 1 14 ? -7.727  -1.090  -5.678  1.00 0.00 ? 44  VAL A CA   2  
ATOM 1680  C C    . VAL A 1 14 ? -9.065  -1.683  -5.242  1.00 0.00 ? 44  VAL A C    2  
ATOM 1681  O O    . VAL A 1 14 ? -9.189  -2.895  -5.065  1.00 0.00 ? 44  VAL A O    2  
ATOM 1682  C CB   . VAL A 1 14 ? -6.801  -0.976  -4.450  1.00 0.00 ? 44  VAL A CB   2  
ATOM 1683  C CG1  . VAL A 1 14 ? -6.531  -2.348  -3.850  1.00 0.00 ? 44  VAL A CG1  2  
ATOM 1684  C CG2  . VAL A 1 14 ? -5.496  -0.289  -4.826  1.00 0.00 ? 44  VAL A CG2  2  
ATOM 1685  H H    . VAL A 1 14 ? -7.719  1.021   -5.831  1.00 0.00 ? 44  VAL A H    2  
ATOM 1686  H HA   . VAL A 1 14 ? -7.265  -1.758  -6.391  1.00 0.00 ? 44  VAL A HA   2  
ATOM 1687  H HB   . VAL A 1 14 ? -7.298  -0.373  -3.704  1.00 0.00 ? 44  VAL A HB   2  
ATOM 1688  H HG11 . VAL A 1 14 ? -6.639  -3.103  -4.614  1.00 0.00 ? 44  VAL A HG11 2  
ATOM 1689  H HG12 . VAL A 1 14 ? -7.237  -2.538  -3.054  1.00 0.00 ? 44  VAL A HG12 2  
ATOM 1690  H HG13 . VAL A 1 14 ? -5.526  -2.377  -3.454  1.00 0.00 ? 44  VAL A HG13 2  
ATOM 1691  H HG21 . VAL A 1 14 ? -5.609  0.200   -5.782  1.00 0.00 ? 44  VAL A HG21 2  
ATOM 1692  H HG22 . VAL A 1 14 ? -4.706  -1.023  -4.888  1.00 0.00 ? 44  VAL A HG22 2  
ATOM 1693  H HG23 . VAL A 1 14 ? -5.247  0.446   -4.075  1.00 0.00 ? 44  VAL A HG23 2  
ATOM 1694  N N    . LYS A 1 15 ? -10.064 -0.822  -5.069  1.00 0.00 ? 45  LYS A N    2  
ATOM 1695  C CA   . LYS A 1 15 ? -11.390 -1.264  -4.654  1.00 0.00 ? 45  LYS A CA   2  
ATOM 1696  C C    . LYS A 1 15 ? -12.220 -1.705  -5.856  1.00 0.00 ? 45  LYS A C    2  
ATOM 1697  O O    . LYS A 1 15 ? -12.847 -2.764  -5.834  1.00 0.00 ? 45  LYS A O    2  
ATOM 1698  C CB   . LYS A 1 15 ? -12.111 -0.143  -3.900  1.00 0.00 ? 45  LYS A CB   2  
ATOM 1699  C CG   . LYS A 1 15 ? -12.231 -0.394  -2.406  1.00 0.00 ? 45  LYS A CG   2  
ATOM 1700  C CD   . LYS A 1 15 ? -13.123 -1.590  -2.110  1.00 0.00 ? 45  LYS A CD   2  
ATOM 1701  C CE   . LYS A 1 15 ? -14.213 -1.241  -1.108  1.00 0.00 ? 45  LYS A CE   2  
ATOM 1702  N NZ   . LYS A 1 15 ? -15.504 -0.923  -1.779  1.00 0.00 ? 45  LYS A NZ   2  
ATOM 1703  H H    . LYS A 1 15 ? -9.906  0.133   -5.224  1.00 0.00 ? 45  LYS A H    2  
ATOM 1704  H HA   . LYS A 1 15 ? -11.264 -2.107  -3.991  1.00 0.00 ? 45  LYS A HA   2  
ATOM 1705  H HB2  . LYS A 1 15 ? -11.568 0.779   -4.045  1.00 0.00 ? 45  LYS A HB2  2  
ATOM 1706  H HB3  . LYS A 1 15 ? -13.106 -0.031  -4.306  1.00 0.00 ? 45  LYS A HB3  2  
ATOM 1707  H HG2  . LYS A 1 15 ? -11.247 -0.584  -2.003  1.00 0.00 ? 45  LYS A HG2  2  
ATOM 1708  H HG3  . LYS A 1 15 ? -12.651 0.484   -1.936  1.00 0.00 ? 45  LYS A HG3  2  
ATOM 1709  H HD2  . LYS A 1 15 ? -13.586 -1.919  -3.028  1.00 0.00 ? 45  LYS A HD2  2  
ATOM 1710  H HD3  . LYS A 1 15 ? -12.517 -2.387  -1.705  1.00 0.00 ? 45  LYS A HD3  2  
ATOM 1711  H HE2  . LYS A 1 15 ? -14.359 -2.082  -0.447  1.00 0.00 ? 45  LYS A HE2  2  
ATOM 1712  H HE3  . LYS A 1 15 ? -13.894 -0.384  -0.533  1.00 0.00 ? 45  LYS A HE3  2  
ATOM 1713  H HZ1  . LYS A 1 15 ? -15.604 0.107   -1.890  1.00 0.00 ? 45  LYS A HZ1  2  
ATOM 1714  H HZ2  . LYS A 1 15 ? -16.299 -1.279  -1.211  1.00 0.00 ? 45  LYS A HZ2  2  
ATOM 1715  H HZ3  . LYS A 1 15 ? -15.537 -1.367  -2.718  1.00 0.00 ? 45  LYS A HZ3  2  
ATOM 1716  N N    . ILE A 1 16 ? -12.221 -0.886  -6.904  1.00 0.00 ? 46  ILE A N    2  
ATOM 1717  C CA   . ILE A 1 16 ? -12.977 -1.196  -8.112  1.00 0.00 ? 46  ILE A CA   2  
ATOM 1718  C C    . ILE A 1 16 ? -12.463 -2.471  -8.774  1.00 0.00 ? 46  ILE A C    2  
ATOM 1719  O O    . ILE A 1 16 ? -13.231 -3.395  -9.041  1.00 0.00 ? 46  ILE A O    2  
ATOM 1720  C CB   . ILE A 1 16 ? -12.914 -0.038  -9.129  1.00 0.00 ? 46  ILE A CB   2  
ATOM 1721  C CG1  . ILE A 1 16 ? -13.374 1.268   -8.478  1.00 0.00 ? 46  ILE A CG1  2  
ATOM 1722  C CG2  . ILE A 1 16 ? -13.768 -0.353  -10.350 1.00 0.00 ? 46  ILE A CG2  2  
ATOM 1723  C CD1  . ILE A 1 16 ? -12.819 2.505   -9.148  1.00 0.00 ? 46  ILE A CD1  2  
ATOM 1724  H H    . ILE A 1 16 ? -11.703 -0.055  -6.864  1.00 0.00 ? 46  ILE A H    2  
ATOM 1725  H HA   . ILE A 1 16 ? -14.009 -1.341  -7.829  1.00 0.00 ? 46  ILE A HA   2  
ATOM 1726  H HB   . ILE A 1 16 ? -11.891 0.071   -9.455  1.00 0.00 ? 46  ILE A HB   2  
ATOM 1727  H HG12 . ILE A 1 16 ? -14.452 1.324   -8.521  1.00 0.00 ? 46  ILE A HG12 2  
ATOM 1728  H HG13 . ILE A 1 16 ? -13.059 1.278   -7.445  1.00 0.00 ? 46  ILE A HG13 2  
ATOM 1729  H HG21 . ILE A 1 16 ? -14.586 -0.996  -10.061 1.00 0.00 ? 46  ILE A HG21 2  
ATOM 1730  H HG22 . ILE A 1 16 ? -13.164 -0.851  -11.093 1.00 0.00 ? 46  ILE A HG22 2  
ATOM 1731  H HG23 . ILE A 1 16 ? -14.160 0.565   -10.761 1.00 0.00 ? 46  ILE A HG23 2  
ATOM 1732  H HD11 . ILE A 1 16 ? -13.066 3.376   -8.559  1.00 0.00 ? 46  ILE A HD11 2  
ATOM 1733  H HD12 . ILE A 1 16 ? -13.248 2.604   -10.134 1.00 0.00 ? 46  ILE A HD12 2  
ATOM 1734  H HD13 . ILE A 1 16 ? -11.745 2.419   -9.230  1.00 0.00 ? 46  ILE A HD13 2  
ATOM 1735  N N    . ARG A 1 17 ? -11.160 -2.516  -9.038  1.00 0.00 ? 47  ARG A N    2  
ATOM 1736  C CA   . ARG A 1 17 ? -10.550 -3.680  -9.671  1.00 0.00 ? 47  ARG A CA   2  
ATOM 1737  C C    . ARG A 1 17 ? -10.764 -4.935  -8.829  1.00 0.00 ? 47  ARG A C    2  
ATOM 1738  O O    . ARG A 1 17 ? -10.837 -6.044  -9.358  1.00 0.00 ? 47  ARG A O    2  
ATOM 1739  C CB   . ARG A 1 17 ? -9.054  -3.445  -9.890  1.00 0.00 ? 47  ARG A CB   2  
ATOM 1740  C CG   . ARG A 1 17 ? -8.711  -2.982  -11.297 1.00 0.00 ? 47  ARG A CG   2  
ATOM 1741  C CD   . ARG A 1 17 ? -8.896  -1.481  -11.452 1.00 0.00 ? 47  ARG A CD   2  
ATOM 1742  N NE   . ARG A 1 17 ? -10.169 -1.149  -12.086 1.00 0.00 ? 47  ARG A NE   2  
ATOM 1743  C CZ   . ARG A 1 17 ? -10.702 0.071   -12.083 1.00 0.00 ? 47  ARG A CZ   2  
ATOM 1744  N NH1  . ARG A 1 17 ? -10.076 1.075   -11.482 1.00 0.00 ? 47  ARG A NH1  2  
ATOM 1745  N NH2  . ARG A 1 17 ? -11.864 0.287   -12.684 1.00 0.00 ? 47  ARG A NH2  2  
ATOM 1746  H H    . ARG A 1 17 ? -10.597 -1.748  -8.803  1.00 0.00 ? 47  ARG A H    2  
ATOM 1747  H HA   . ARG A 1 17 ? -11.026 -3.821  -10.630 1.00 0.00 ? 47  ARG A HA   2  
ATOM 1748  H HB2  . ARG A 1 17 ? -8.714  -2.693  -9.194  1.00 0.00 ? 47  ARG A HB2  2  
ATOM 1749  H HB3  . ARG A 1 17 ? -8.523  -4.366  -9.698  1.00 0.00 ? 47  ARG A HB3  2  
ATOM 1750  H HG2  . ARG A 1 17 ? -7.681  -3.231  -11.506 1.00 0.00 ? 47  ARG A HG2  2  
ATOM 1751  H HG3  . ARG A 1 17 ? -9.356  -3.490  -11.999 1.00 0.00 ? 47  ARG A HG3  2  
ATOM 1752  H HD2  . ARG A 1 17 ? -8.862  -1.025  -10.474 1.00 0.00 ? 47  ARG A HD2  2  
ATOM 1753  H HD3  . ARG A 1 17 ? -8.090  -1.093  -12.057 1.00 0.00 ? 47  ARG A HD3  2  
ATOM 1754  H HE   . ARG A 1 17 ? -10.652 -1.872  -12.537 1.00 0.00 ? 47  ARG A HE   2  
ATOM 1755  H HH11 . ARG A 1 17 ? -9.200  0.919   -11.028 1.00 0.00 ? 47  ARG A HH11 2  
ATOM 1756  H HH12 . ARG A 1 17 ? -10.482 1.989   -11.484 1.00 0.00 ? 47  ARG A HH12 2  
ATOM 1757  H HH21 . ARG A 1 17 ? -12.340 -0.466  -13.139 1.00 0.00 ? 47  ARG A HH21 2  
ATOM 1758  H HH22 . ARG A 1 17 ? -12.265 1.203   -12.682 1.00 0.00 ? 47  ARG A HH22 2  
ATOM 1759  N N    . PHE A 1 18 ? -10.863 -4.753  -7.516  1.00 0.00 ? 48  PHE A N    2  
ATOM 1760  C CA   . PHE A 1 18 ? -11.068 -5.872  -6.603  1.00 0.00 ? 48  PHE A CA   2  
ATOM 1761  C C    . PHE A 1 18 ? -12.387 -5.726  -5.850  1.00 0.00 ? 48  PHE A C    2  
ATOM 1762  O O    . PHE A 1 18 ? -12.467 -6.014  -4.656  1.00 0.00 ? 48  PHE A O    2  
ATOM 1763  C CB   . PHE A 1 18 ? -9.907  -5.968  -5.610  1.00 0.00 ? 48  PHE A CB   2  
ATOM 1764  C CG   . PHE A 1 18 ? -8.578  -6.234  -6.260  1.00 0.00 ? 48  PHE A CG   2  
ATOM 1765  C CD1  . PHE A 1 18 ? -8.469  -7.144  -7.300  1.00 0.00 ? 48  PHE A CD1  2  
ATOM 1766  C CD2  . PHE A 1 18 ? -7.438  -5.575  -5.830  1.00 0.00 ? 48  PHE A CD2  2  
ATOM 1767  C CE1  . PHE A 1 18 ? -7.248  -7.391  -7.899  1.00 0.00 ? 48  PHE A CE1  2  
ATOM 1768  C CE2  . PHE A 1 18 ? -6.214  -5.818  -6.425  1.00 0.00 ? 48  PHE A CE2  2  
ATOM 1769  C CZ   . PHE A 1 18 ? -6.119  -6.727  -7.460  1.00 0.00 ? 48  PHE A CZ   2  
ATOM 1770  H H    . PHE A 1 18 ? -10.797 -3.845  -7.152  1.00 0.00 ? 48  PHE A H    2  
ATOM 1771  H HA   . PHE A 1 18 ? -11.102 -6.777  -7.191  1.00 0.00 ? 48  PHE A HA   2  
ATOM 1772  H HB2  . PHE A 1 18 ? -9.829  -5.038  -5.067  1.00 0.00 ? 48  PHE A HB2  2  
ATOM 1773  H HB3  . PHE A 1 18 ? -10.104 -6.770  -4.914  1.00 0.00 ? 48  PHE A HB3  2  
ATOM 1774  H HD1  . PHE A 1 18 ? -9.352  -7.663  -7.644  1.00 0.00 ? 48  PHE A HD1  2  
ATOM 1775  H HD2  . PHE A 1 18 ? -7.510  -4.864  -5.020  1.00 0.00 ? 48  PHE A HD2  2  
ATOM 1776  H HE1  . PHE A 1 18 ? -7.177  -8.103  -8.708  1.00 0.00 ? 48  PHE A HE1  2  
ATOM 1777  H HE2  . PHE A 1 18 ? -5.333  -5.298  -6.080  1.00 0.00 ? 48  PHE A HE2  2  
ATOM 1778  H HZ   . PHE A 1 18 ? -5.164  -6.918  -7.927  1.00 0.00 ? 48  PHE A HZ   2  
ATOM 1779  N N    . GLY A 1 19 ? -13.419 -5.278  -6.557  1.00 0.00 ? 49  GLY A N    2  
ATOM 1780  C CA   . GLY A 1 19 ? -14.720 -5.103  -5.940  1.00 0.00 ? 49  GLY A CA   2  
ATOM 1781  C C    . GLY A 1 19 ? -15.263 -6.391  -5.354  1.00 0.00 ? 49  GLY A C    2  
ATOM 1782  O O    . GLY A 1 19 ? -16.035 -6.369  -4.395  1.00 0.00 ? 49  GLY A O    2  
ATOM 1783  H H    . GLY A 1 19 ? -13.295 -5.065  -7.506  1.00 0.00 ? 49  GLY A H    2  
ATOM 1784  H HA2  . GLY A 1 19 ? -14.637 -4.369  -5.152  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 1785  H HA3  . GLY A 1 19 ? -15.413 -4.739  -6.685  1.00 0.00 ? 49  GLY A HA3  2  
ATOM 1786  N N    . SER A 1 20 ? -14.860 -7.518  -5.932  1.00 0.00 ? 50  SER A N    2  
ATOM 1787  C CA   . SER A 1 20 ? -15.310 -8.823  -5.462  1.00 0.00 ? 50  SER A CA   2  
ATOM 1788  C C    . SER A 1 20 ? -14.144 -9.633  -4.903  1.00 0.00 ? 50  SER A C    2  
ATOM 1789  O O    . SER A 1 20 ? -14.067 -10.846 -5.098  1.00 0.00 ? 50  SER A O    2  
ATOM 1790  C CB   . SER A 1 20 ? -15.982 -9.594  -6.600  1.00 0.00 ? 50  SER A CB   2  
ATOM 1791  O OG   . SER A 1 20 ? -16.698 -10.713 -6.106  1.00 0.00 ? 50  SER A OG   2  
ATOM 1792  H H    . SER A 1 20 ? -14.244 -7.471  -6.693  1.00 0.00 ? 50  SER A H    2  
ATOM 1793  H HA   . SER A 1 20 ? -16.030 -8.662  -4.674  1.00 0.00 ? 50  SER A HA   2  
ATOM 1794  H HB2  . SER A 1 20 ? -16.672 -8.942  -7.116  1.00 0.00 ? 50  SER A HB2  2  
ATOM 1795  H HB3  . SER A 1 20 ? -15.229 -9.940  -7.292  1.00 0.00 ? 50  SER A HB3  2  
ATOM 1796  H HG   . SER A 1 20 ? -17.064 -11.209 -6.842  1.00 0.00 ? 50  SER A HG   2  
ATOM 1797  N N    . ASP A 1 21 ? -13.239 -8.953  -4.206  1.00 0.00 ? 51  ASP A N    2  
ATOM 1798  C CA   . ASP A 1 21 ? -12.082 -9.604  -3.618  1.00 0.00 ? 51  ASP A CA   2  
ATOM 1799  C C    . ASP A 1 21 ? -11.785 -9.041  -2.230  1.00 0.00 ? 51  ASP A C    2  
ATOM 1800  O O    . ASP A 1 21 ? -10.999 -8.105  -2.086  1.00 0.00 ? 51  ASP A O    2  
ATOM 1801  C CB   . ASP A 1 21 ? -10.860 -9.442  -4.524  1.00 0.00 ? 51  ASP A CB   2  
ATOM 1802  C CG   . ASP A 1 21 ? -10.018 -10.701 -4.590  1.00 0.00 ? 51  ASP A CG   2  
ATOM 1803  O OD1  . ASP A 1 21 ? -9.617  -11.205 -3.520  1.00 0.00 ? 51  ASP A OD1  2  
ATOM 1804  O OD2  . ASP A 1 21 ? -9.761  -11.185 -5.713  1.00 0.00 ? 51  ASP A OD2  2  
ATOM 1805  H H    . ASP A 1 21 ? -13.355 -7.995  -4.082  1.00 0.00 ? 51  ASP A H    2  
ATOM 1806  H HA   . ASP A 1 21 ? -12.314 -10.648 -3.525  1.00 0.00 ? 51  ASP A HA   2  
ATOM 1807  H HB2  . ASP A 1 21 ? -11.190 -9.199  -5.523  1.00 0.00 ? 51  ASP A HB2  2  
ATOM 1808  H HB3  . ASP A 1 21 ? -10.244 -8.638  -4.147  1.00 0.00 ? 51  ASP A HB3  2  
ATOM 1809  N N    . PRO A 1 22 ? -12.413 -9.608  -1.185  1.00 0.00 ? 52  PRO A N    2  
ATOM 1810  C CA   . PRO A 1 22 ? -12.212 -9.157  0.196   1.00 0.00 ? 52  PRO A CA   2  
ATOM 1811  C C    . PRO A 1 22 ? -10.818 -9.492  0.718   1.00 0.00 ? 52  PRO A C    2  
ATOM 1812  O O    . PRO A 1 22 ? -10.275 -8.784  1.566   1.00 0.00 ? 52  PRO A O    2  
ATOM 1813  C CB   . PRO A 1 22 ? -13.276 -9.926  0.982   1.00 0.00 ? 52  PRO A CB   2  
ATOM 1814  C CG   . PRO A 1 22 ? -13.540 -11.145 0.168   1.00 0.00 ? 52  PRO A CG   2  
ATOM 1815  C CD   . PRO A 1 22 ? -13.366 -10.730 -1.267  1.00 0.00 ? 52  PRO A CD   2  
ATOM 1816  H HA   . PRO A 1 22 ? -12.385 -8.095  0.294   1.00 0.00 ? 52  PRO A HA   2  
ATOM 1817  H HB2  . PRO A 1 22 ? -12.893 -10.178 1.960   1.00 0.00 ? 52  PRO A HB2  2  
ATOM 1818  H HB3  . PRO A 1 22 ? -14.164 -9.319  1.081   1.00 0.00 ? 52  PRO A HB3  2  
ATOM 1819  H HG2  . PRO A 1 22 ? -12.831 -11.918 0.424   1.00 0.00 ? 52  PRO A HG2  2  
ATOM 1820  H HG3  . PRO A 1 22 ? -14.550 -11.489 0.339   1.00 0.00 ? 52  PRO A HG3  2  
ATOM 1821  H HD2  . PRO A 1 22 ? -12.955 -11.543 -1.847  1.00 0.00 ? 52  PRO A HD2  2  
ATOM 1822  H HD3  . PRO A 1 22 ? -14.308 -10.406 -1.683  1.00 0.00 ? 52  PRO A HD3  2  
ATOM 1823  N N    . ALA A 1 23 ? -10.245 -10.576 0.205   1.00 0.00 ? 53  ALA A N    2  
ATOM 1824  C CA   . ALA A 1 23 ? -8.914  -11.005 0.619   1.00 0.00 ? 53  ALA A CA   2  
ATOM 1825  C C    . ALA A 1 23 ? -7.876  -9.925  0.333   1.00 0.00 ? 53  ALA A C    2  
ATOM 1826  O O    . ALA A 1 23 ? -7.085  -9.564  1.204   1.00 0.00 ? 53  ALA A O    2  
ATOM 1827  C CB   . ALA A 1 23 ? -8.537  -12.301 -0.082  1.00 0.00 ? 53  ALA A CB   2  
ATOM 1828  H H    . ALA A 1 23 ? -10.728 -11.100 -0.468  1.00 0.00 ? 53  ALA A H    2  
ATOM 1829  H HA   . ALA A 1 23 ? -8.941  -11.192 1.683   1.00 0.00 ? 53  ALA A HA   2  
ATOM 1830  H HB1  . ALA A 1 23 ? -9.397  -12.954 -0.118  1.00 0.00 ? 53  ALA A HB1  2  
ATOM 1831  H HB2  . ALA A 1 23 ? -7.740  -12.786 0.463   1.00 0.00 ? 53  ALA A HB2  2  
ATOM 1832  H HB3  . ALA A 1 23 ? -8.207  -12.085 -1.087  1.00 0.00 ? 53  ALA A HB3  2  
ATOM 1833  N N    . THR A 1 24 ? -7.885  -9.415  -0.894  1.00 0.00 ? 54  THR A N    2  
ATOM 1834  C CA   . THR A 1 24 ? -6.944  -8.376  -1.296  1.00 0.00 ? 54  THR A CA   2  
ATOM 1835  C C    . THR A 1 24 ? -7.181  -7.091  -0.509  1.00 0.00 ? 54  THR A C    2  
ATOM 1836  O O    . THR A 1 24 ? -6.258  -6.538  0.088   1.00 0.00 ? 54  THR A O    2  
ATOM 1837  C CB   . THR A 1 24 ? -7.068  -8.099  -2.796  1.00 0.00 ? 54  THR A CB   2  
ATOM 1838  O OG1  . THR A 1 24 ? -7.335  -9.296  -3.505  1.00 0.00 ? 54  THR A OG1  2  
ATOM 1839  C CG2  . THR A 1 24 ? -5.826  -7.477  -3.395  1.00 0.00 ? 54  THR A CG2  2  
ATOM 1840  H H    . THR A 1 24 ? -8.540  -9.744  -1.544  1.00 0.00 ? 54  THR A H    2  
ATOM 1841  H HA   . THR A 1 24 ? -5.946  -8.733  -1.087  1.00 0.00 ? 54  THR A HA   2  
ATOM 1842  H HB   . THR A 1 24 ? -7.891  -7.417  -2.958  1.00 0.00 ? 54  THR A HB   2  
ATOM 1843  H HG1  . THR A 1 24 ? -7.403  -9.103  -4.444  1.00 0.00 ? 54  THR A HG1  2  
ATOM 1844  H HG21 . THR A 1 24 ? -5.315  -8.209  -4.004  1.00 0.00 ? 54  THR A HG21 2  
ATOM 1845  H HG22 . THR A 1 24 ? -5.170  -7.148  -2.603  1.00 0.00 ? 54  THR A HG22 2  
ATOM 1846  H HG23 . THR A 1 24 ? -6.105  -6.632  -4.006  1.00 0.00 ? 54  THR A HG23 2  
ATOM 1847  N N    . TYR A 1 25 ? -8.425  -6.623  -0.512  1.00 0.00 ? 55  TYR A N    2  
ATOM 1848  C CA   . TYR A 1 25 ? -8.784  -5.403  0.202   1.00 0.00 ? 55  TYR A CA   2  
ATOM 1849  C C    . TYR A 1 25 ? -8.489  -5.537  1.693   1.00 0.00 ? 55  TYR A C    2  
ATOM 1850  O O    . TYR A 1 25 ? -7.865  -4.663  2.294   1.00 0.00 ? 55  TYR A O    2  
ATOM 1851  C CB   . TYR A 1 25 ? -10.264 -5.079  -0.010  1.00 0.00 ? 55  TYR A CB   2  
ATOM 1852  C CG   . TYR A 1 25 ? -10.623 -3.645  0.308   1.00 0.00 ? 55  TYR A CG   2  
ATOM 1853  C CD1  . TYR A 1 25 ? -9.840  -2.594  -0.154  1.00 0.00 ? 55  TYR A CD1  2  
ATOM 1854  C CD2  . TYR A 1 25 ? -11.744 -3.342  1.071   1.00 0.00 ? 55  TYR A CD2  2  
ATOM 1855  C CE1  . TYR A 1 25 ? -10.165 -1.282  0.134   1.00 0.00 ? 55  TYR A CE1  2  
ATOM 1856  C CE2  . TYR A 1 25 ? -12.075 -2.033  1.363   1.00 0.00 ? 55  TYR A CE2  2  
ATOM 1857  C CZ   . TYR A 1 25 ? -11.283 -1.007  0.893   1.00 0.00 ? 55  TYR A CZ   2  
ATOM 1858  O OH   . TYR A 1 25 ? -11.609 0.298   1.183   1.00 0.00 ? 55  TYR A OH   2  
ATOM 1859  H H    . TYR A 1 25 ? -9.118  -7.108  -1.006  1.00 0.00 ? 55  TYR A H    2  
ATOM 1860  H HA   . TYR A 1 25 ? -8.188  -4.597  -0.199  1.00 0.00 ? 55  TYR A HA   2  
ATOM 1861  H HB2  . TYR A 1 25 ? -10.521 -5.264  -1.042  1.00 0.00 ? 55  TYR A HB2  2  
ATOM 1862  H HB3  . TYR A 1 25 ? -10.859 -5.720  0.624   1.00 0.00 ? 55  TYR A HB3  2  
ATOM 1863  H HD1  . TYR A 1 25 ? -8.966  -2.813  -0.749  1.00 0.00 ? 55  TYR A HD1  2  
ATOM 1864  H HD2  . TYR A 1 25 ? -12.362 -4.148  1.438   1.00 0.00 ? 55  TYR A HD2  2  
ATOM 1865  H HE1  . TYR A 1 25 ? -9.544  -0.479  -0.234  1.00 0.00 ? 55  TYR A HE1  2  
ATOM 1866  H HE2  . TYR A 1 25 ? -12.951 -1.818  1.958   1.00 0.00 ? 55  TYR A HE2  2  
ATOM 1867  H HH   . TYR A 1 25 ? -11.506 0.836   0.394   1.00 0.00 ? 55  TYR A HH   2  
ATOM 1868  N N    . ASN A 1 26 ? -8.942  -6.638  2.284   1.00 0.00 ? 56  ASN A N    2  
ATOM 1869  C CA   . ASN A 1 26 ? -8.726  -6.887  3.705   1.00 0.00 ? 56  ASN A CA   2  
ATOM 1870  C C    . ASN A 1 26 ? -7.236  -6.947  4.025   1.00 0.00 ? 56  ASN A C    2  
ATOM 1871  O O    . ASN A 1 26 ? -6.812  -6.594  5.126   1.00 0.00 ? 56  ASN A O    2  
ATOM 1872  C CB   . ASN A 1 26 ? -9.403  -8.192  4.125   1.00 0.00 ? 56  ASN A CB   2  
ATOM 1873  C CG   . ASN A 1 26 ? -9.422  -8.375  5.630   1.00 0.00 ? 56  ASN A CG   2  
ATOM 1874  O OD1  . ASN A 1 26 ? -10.100 -7.641  6.348   1.00 0.00 ? 56  ASN A OD1  2  
ATOM 1875  N ND2  . ASN A 1 26 ? -8.673  -9.359  6.116   1.00 0.00 ? 56  ASN A ND2  2  
ATOM 1876  H H    . ASN A 1 26 ? -9.433  -7.299  1.753   1.00 0.00 ? 56  ASN A H    2  
ATOM 1877  H HA   . ASN A 1 26 ? -9.167  -6.069  4.255   1.00 0.00 ? 56  ASN A HA   2  
ATOM 1878  H HB2  . ASN A 1 26 ? -10.422 -8.193  3.769   1.00 0.00 ? 56  ASN A HB2  2  
ATOM 1879  H HB3  . ASN A 1 26 ? -8.871  -9.024  3.686   1.00 0.00 ? 56  ASN A HB3  2  
ATOM 1880  H HD21 . ASN A 1 26 ? -8.158  -9.904  5.485   1.00 0.00 ? 56  ASN A HD21 2  
ATOM 1881  H HD22 . ASN A 1 26 ? -8.667  -9.500  7.086   1.00 0.00 ? 56  ASN A HD22 2  
ATOM 1882  N N    . GLY A 1 27 ? -6.445  -7.397  3.056   1.00 0.00 ? 57  GLY A N    2  
ATOM 1883  C CA   . GLY A 1 27 ? -5.011  -7.496  3.255   1.00 0.00 ? 57  GLY A CA   2  
ATOM 1884  C C    . GLY A 1 27 ? -4.339  -6.138  3.323   1.00 0.00 ? 57  GLY A C    2  
ATOM 1885  O O    . GLY A 1 27 ? -3.673  -5.818  4.307   1.00 0.00 ? 57  GLY A O    2  
ATOM 1886  H H    . GLY A 1 27 ? -6.838  -7.664  2.199   1.00 0.00 ? 57  GLY A H    2  
ATOM 1887  H HA2  . GLY A 1 27 ? -4.822  -8.026  4.176   1.00 0.00 ? 57  GLY A HA2  2  
ATOM 1888  H HA3  . GLY A 1 27 ? -4.583  -8.055  2.436   1.00 0.00 ? 57  GLY A HA3  2  
ATOM 1889  N N    . PHE A 1 28 ? -4.514  -5.339  2.275   1.00 0.00 ? 58  PHE A N    2  
ATOM 1890  C CA   . PHE A 1 28 ? -3.918  -4.009  2.219   1.00 0.00 ? 58  PHE A CA   2  
ATOM 1891  C C    . PHE A 1 28 ? -4.356  -3.163  3.411   1.00 0.00 ? 58  PHE A C    2  
ATOM 1892  O O    . PHE A 1 28 ? -3.554  -2.435  3.996   1.00 0.00 ? 58  PHE A O    2  
ATOM 1893  C CB   . PHE A 1 28 ? -4.304  -3.309  0.915   1.00 0.00 ? 58  PHE A CB   2  
ATOM 1894  C CG   . PHE A 1 28 ? -3.387  -2.178  0.547   1.00 0.00 ? 58  PHE A CG   2  
ATOM 1895  C CD1  . PHE A 1 28 ? -2.020  -2.381  0.447   1.00 0.00 ? 58  PHE A CD1  2  
ATOM 1896  C CD2  . PHE A 1 28 ? -3.893  -0.911  0.300   1.00 0.00 ? 58  PHE A CD2  2  
ATOM 1897  C CE1  . PHE A 1 28 ? -1.174  -1.342  0.109   1.00 0.00 ? 58  PHE A CE1  2  
ATOM 1898  C CE2  . PHE A 1 28 ? -3.052  0.132   -0.038  1.00 0.00 ? 58  PHE A CE2  2  
ATOM 1899  C CZ   . PHE A 1 28 ? -1.691  -0.084  -0.134  1.00 0.00 ? 58  PHE A CZ   2  
ATOM 1900  H H    . PHE A 1 28 ? -5.056  -5.652  1.521   1.00 0.00 ? 58  PHE A H    2  
ATOM 1901  H HA   . PHE A 1 28 ? -2.846  -4.124  2.250   1.00 0.00 ? 58  PHE A HA   2  
ATOM 1902  H HB2  . PHE A 1 28 ? -4.284  -4.028  0.109   1.00 0.00 ? 58  PHE A HB2  2  
ATOM 1903  H HB3  . PHE A 1 28 ? -5.304  -2.911  1.010   1.00 0.00 ? 58  PHE A HB3  2  
ATOM 1904  H HD1  . PHE A 1 28 ? -1.615  -3.364  0.637   1.00 0.00 ? 58  PHE A HD1  2  
ATOM 1905  H HD2  . PHE A 1 28 ? -4.957  -0.742  0.375   1.00 0.00 ? 58  PHE A HD2  2  
ATOM 1906  H HE1  . PHE A 1 28 ? -0.111  -1.513  0.035   1.00 0.00 ? 58  PHE A HE1  2  
ATOM 1907  H HE2  . PHE A 1 28 ? -3.458  1.114   -0.229  1.00 0.00 ? 58  PHE A HE2  2  
ATOM 1908  H HZ   . PHE A 1 28 ? -1.032  0.730   -0.399  1.00 0.00 ? 58  PHE A HZ   2  
ATOM 1909  N N    . LEU A 1 29 ? -5.633  -3.263  3.765   1.00 0.00 ? 59  LEU A N    2  
ATOM 1910  C CA   . LEU A 1 29 ? -6.176  -2.507  4.887   1.00 0.00 ? 59  LEU A CA   2  
ATOM 1911  C C    . LEU A 1 29 ? -5.457  -2.865  6.183   1.00 0.00 ? 59  LEU A C    2  
ATOM 1912  O O    . LEU A 1 29 ? -5.080  -1.986  6.959   1.00 0.00 ? 59  LEU A O    2  
ATOM 1913  C CB   . LEU A 1 29 ? -7.677  -2.773  5.030   1.00 0.00 ? 59  LEU A CB   2  
ATOM 1914  C CG   . LEU A 1 29 ? -8.584  -1.749  4.344   1.00 0.00 ? 59  LEU A CG   2  
ATOM 1915  C CD1  . LEU A 1 29 ? -9.819  -2.428  3.773   1.00 0.00 ? 59  LEU A CD1  2  
ATOM 1916  C CD2  . LEU A 1 29 ? -8.979  -0.653  5.321   1.00 0.00 ? 59  LEU A CD2  2  
ATOM 1917  H H    . LEU A 1 29 ? -6.224  -3.860  3.259   1.00 0.00 ? 59  LEU A H    2  
ATOM 1918  H HA   . LEU A 1 29 ? -6.024  -1.457  4.683   1.00 0.00 ? 59  LEU A HA   2  
ATOM 1919  H HB2  . LEU A 1 29 ? -7.888  -3.748  4.614   1.00 0.00 ? 59  LEU A HB2  2  
ATOM 1920  H HB3  . LEU A 1 29 ? -7.921  -2.789  6.081   1.00 0.00 ? 59  LEU A HB3  2  
ATOM 1921  H HG   . LEU A 1 29 ? -8.046  -1.292  3.526   1.00 0.00 ? 59  LEU A HG   2  
ATOM 1922  H HD11 . LEU A 1 29 ? -9.647  -2.676  2.736   1.00 0.00 ? 59  LEU A HD11 2  
ATOM 1923  H HD12 . LEU A 1 29 ? -10.664 -1.759  3.847   1.00 0.00 ? 59  LEU A HD12 2  
ATOM 1924  H HD13 . LEU A 1 29 ? -10.025 -3.330  4.329   1.00 0.00 ? 59  LEU A HD13 2  
ATOM 1925  H HD21 . LEU A 1 29 ? -9.685  0.014   4.848   1.00 0.00 ? 59  LEU A HD21 2  
ATOM 1926  H HD22 . LEU A 1 29 ? -8.100  -0.097  5.614   1.00 0.00 ? 59  LEU A HD22 2  
ATOM 1927  H HD23 . LEU A 1 29 ? -9.433  -1.096  6.196   1.00 0.00 ? 59  LEU A HD23 2  
ATOM 1928  N N    . GLU A 1 30 ? -5.269  -4.161  6.411   1.00 0.00 ? 60  GLU A N    2  
ATOM 1929  C CA   . GLU A 1 30 ? -4.595  -4.637  7.614   1.00 0.00 ? 60  GLU A CA   2  
ATOM 1930  C C    . GLU A 1 30 ? -3.191  -4.049  7.723   1.00 0.00 ? 60  GLU A C    2  
ATOM 1931  O O    . GLU A 1 30 ? -2.774  -3.606  8.793   1.00 0.00 ? 60  GLU A O    2  
ATOM 1932  C CB   . GLU A 1 30 ? -4.522  -6.166  7.611   1.00 0.00 ? 60  GLU A CB   2  
ATOM 1933  C CG   . GLU A 1 30 ? -4.845  -6.793  8.957   1.00 0.00 ? 60  GLU A CG   2  
ATOM 1934  C CD   . GLU A 1 30 ? -6.223  -7.424  8.992   1.00 0.00 ? 60  GLU A CD   2  
ATOM 1935  O OE1  . GLU A 1 30 ? -7.215  -6.677  9.131   1.00 0.00 ? 60  GLU A OE1  2  
ATOM 1936  O OE2  . GLU A 1 30 ? -6.311  -8.664  8.880   1.00 0.00 ? 60  GLU A OE2  2  
ATOM 1937  H H    . GLU A 1 30 ? -5.592  -4.813  5.755   1.00 0.00 ? 60  GLU A H    2  
ATOM 1938  H HA   . GLU A 1 30 ? -5.173  -4.316  8.467   1.00 0.00 ? 60  GLU A HA   2  
ATOM 1939  H HB2  . GLU A 1 30 ? -5.224  -6.546  6.883   1.00 0.00 ? 60  GLU A HB2  2  
ATOM 1940  H HB3  . GLU A 1 30 ? -3.525  -6.468  7.327   1.00 0.00 ? 60  GLU A HB3  2  
ATOM 1941  H HG2  . GLU A 1 30 ? -4.112  -7.556  9.169   1.00 0.00 ? 60  GLU A HG2  2  
ATOM 1942  H HG3  . GLU A 1 30 ? -4.796  -6.027  9.717   1.00 0.00 ? 60  GLU A HG3  2  
ATOM 1943  N N    . ILE A 1 31 ? -2.467  -4.047  6.608   1.00 0.00 ? 61  ILE A N    2  
ATOM 1944  C CA   . ILE A 1 31 ? -1.111  -3.513  6.579   1.00 0.00 ? 61  ILE A CA   2  
ATOM 1945  C C    . ILE A 1 31 ? -1.104  -2.021  6.895   1.00 0.00 ? 61  ILE A C    2  
ATOM 1946  O O    . ILE A 1 31 ? -0.146  -1.502  7.468   1.00 0.00 ? 61  ILE A O    2  
ATOM 1947  C CB   . ILE A 1 31 ? -0.446  -3.741  5.207   1.00 0.00 ? 61  ILE A CB   2  
ATOM 1948  C CG1  . ILE A 1 31 ? -0.546  -5.213  4.803   1.00 0.00 ? 61  ILE A CG1  2  
ATOM 1949  C CG2  . ILE A 1 31 ? 1.009   -3.295  5.240   1.00 0.00 ? 61  ILE A CG2  2  
ATOM 1950  C CD1  . ILE A 1 31 ? -0.748  -5.420  3.317   1.00 0.00 ? 61  ILE A CD1  2  
ATOM 1951  H H    . ILE A 1 31 ? -2.855  -4.414  5.786   1.00 0.00 ? 61  ILE A H    2  
ATOM 1952  H HA   . ILE A 1 31 ? -0.532  -4.033  7.328   1.00 0.00 ? 61  ILE A HA   2  
ATOM 1953  H HB   . ILE A 1 31 ? -0.964  -3.138  4.476   1.00 0.00 ? 61  ILE A HB   2  
ATOM 1954  H HG12 . ILE A 1 31 ? 0.363   -5.720  5.087   1.00 0.00 ? 61  ILE A HG12 2  
ATOM 1955  H HG13 . ILE A 1 31 ? -1.381  -5.666  5.318   1.00 0.00 ? 61  ILE A HG13 2  
ATOM 1956  H HG21 . ILE A 1 31 ? 1.079   -2.331  5.722   1.00 0.00 ? 61  ILE A HG21 2  
ATOM 1957  H HG22 . ILE A 1 31 ? 1.387   -3.221  4.231   1.00 0.00 ? 61  ILE A HG22 2  
ATOM 1958  H HG23 . ILE A 1 31 ? 1.594   -4.016  5.792   1.00 0.00 ? 61  ILE A HG23 2  
ATOM 1959  H HD11 . ILE A 1 31 ? -0.183  -6.282  2.994   1.00 0.00 ? 61  ILE A HD11 2  
ATOM 1960  H HD12 . ILE A 1 31 ? -0.408  -4.546  2.783   1.00 0.00 ? 61  ILE A HD12 2  
ATOM 1961  H HD13 . ILE A 1 31 ? -1.796  -5.581  3.115   1.00 0.00 ? 61  ILE A HD13 2  
ATOM 1962  N N    . MET A 1 32 ? -2.179  -1.336  6.517   1.00 0.00 ? 62  MET A N    2  
ATOM 1963  C CA   . MET A 1 32 ? -2.297  0.097   6.760   1.00 0.00 ? 62  MET A CA   2  
ATOM 1964  C C    . MET A 1 32 ? -2.594  0.378   8.230   1.00 0.00 ? 62  MET A C    2  
ATOM 1965  O O    . MET A 1 32 ? -1.962  1.235   8.848   1.00 0.00 ? 62  MET A O    2  
ATOM 1966  C CB   . MET A 1 32 ? -3.396  0.695   5.878   1.00 0.00 ? 62  MET A CB   2  
ATOM 1967  C CG   . MET A 1 32 ? -2.867  1.380   4.629   1.00 0.00 ? 62  MET A CG   2  
ATOM 1968  S SD   . MET A 1 32 ? -2.572  0.225   3.275   1.00 0.00 ? 62  MET A SD   2  
ATOM 1969  C CE   . MET A 1 32 ? -0.849  -0.181  3.547   1.00 0.00 ? 62  MET A CE   2  
ATOM 1970  H H    . MET A 1 32 ? -2.910  -1.806  6.063   1.00 0.00 ? 62  MET A H    2  
ATOM 1971  H HA   . MET A 1 32 ? -1.353  0.554   6.503   1.00 0.00 ? 62  MET A HA   2  
ATOM 1972  H HB2  . MET A 1 32 ? -4.066  -0.094  5.574   1.00 0.00 ? 62  MET A HB2  2  
ATOM 1973  H HB3  . MET A 1 32 ? -3.949  1.423   6.454   1.00 0.00 ? 62  MET A HB3  2  
ATOM 1974  H HG2  . MET A 1 32 ? -3.589  2.115   4.304   1.00 0.00 ? 62  MET A HG2  2  
ATOM 1975  H HG3  . MET A 1 32 ? -1.938  1.874   4.871   1.00 0.00 ? 62  MET A HG3  2  
ATOM 1976  H HE1  . MET A 1 32 ? -0.303  0.716   3.797   1.00 0.00 ? 62  MET A HE1  2  
ATOM 1977  H HE2  . MET A 1 32 ? -0.436  -0.616  2.649   1.00 0.00 ? 62  MET A HE2  2  
ATOM 1978  H HE3  . MET A 1 32 ? -0.770  -0.889  4.359   1.00 0.00 ? 62  MET A HE3  2  
ATOM 1979  N N    . LYS A 1 33 ? -3.560  -0.349  8.784   1.00 0.00 ? 63  LYS A N    2  
ATOM 1980  C CA   . LYS A 1 33 ? -3.938  -0.174  10.182  1.00 0.00 ? 63  LYS A CA   2  
ATOM 1981  C C    . LYS A 1 33 ? -2.807  -0.610  11.108  1.00 0.00 ? 63  LYS A C    2  
ATOM 1982  O O    . LYS A 1 33 ? -2.524  0.046   12.110  1.00 0.00 ? 63  LYS A O    2  
ATOM 1983  C CB   . LYS A 1 33 ? -5.208  -0.970  10.502  1.00 0.00 ? 63  LYS A CB   2  
ATOM 1984  C CG   . LYS A 1 33 ? -6.227  -0.986  9.373   1.00 0.00 ? 63  LYS A CG   2  
ATOM 1985  C CD   . LYS A 1 33 ? -7.635  -0.729  9.885   1.00 0.00 ? 63  LYS A CD   2  
ATOM 1986  C CE   . LYS A 1 33 ? -8.682  -1.096  8.845   1.00 0.00 ? 63  LYS A CE   2  
ATOM 1987  N NZ   . LYS A 1 33 ? -9.288  -2.430  9.113   1.00 0.00 ? 63  LYS A NZ   2  
ATOM 1988  H H    . LYS A 1 33 ? -4.027  -1.017  8.241   1.00 0.00 ? 63  LYS A H    2  
ATOM 1989  H HA   . LYS A 1 33 ? -4.133  0.876   10.343  1.00 0.00 ? 63  LYS A HA   2  
ATOM 1990  H HB2  . LYS A 1 33 ? -4.932  -1.991  10.722  1.00 0.00 ? 63  LYS A HB2  2  
ATOM 1991  H HB3  . LYS A 1 33 ? -5.677  -0.538  11.375  1.00 0.00 ? 63  LYS A HB3  2  
ATOM 1992  H HG2  . LYS A 1 33 ? -5.969  -0.219  8.658   1.00 0.00 ? 63  LYS A HG2  2  
ATOM 1993  H HG3  . LYS A 1 33 ? -6.199  -1.953  8.891   1.00 0.00 ? 63  LYS A HG3  2  
ATOM 1994  H HD2  . LYS A 1 33 ? -7.799  -1.324  10.771  1.00 0.00 ? 63  LYS A HD2  2  
ATOM 1995  H HD3  . LYS A 1 33 ? -7.734  0.318   10.129  1.00 0.00 ? 63  LYS A HD3  2  
ATOM 1996  H HE2  . LYS A 1 33 ? -9.461  -0.348  8.858   1.00 0.00 ? 63  LYS A HE2  2  
ATOM 1997  H HE3  . LYS A 1 33 ? -8.214  -1.111  7.872   1.00 0.00 ? 63  LYS A HE3  2  
ATOM 1998  H HZ1  . LYS A 1 33 ? -8.815  -3.159  8.541   1.00 0.00 ? 63  LYS A HZ1  2  
ATOM 1999  H HZ2  . LYS A 1 33 ? -10.300 -2.417  8.873   1.00 0.00 ? 63  LYS A HZ2  2  
ATOM 2000  H HZ3  . LYS A 1 33 ? -9.185  -2.674  10.118  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM 2001  N N    . GLU A 1 34 ? -2.165  -1.722  10.765  1.00 0.00 ? 64  GLU A N    2  
ATOM 2002  C CA   . GLU A 1 34 ? -1.064  -2.247  11.564  1.00 0.00 ? 64  GLU A CA   2  
ATOM 2003  C C    . GLU A 1 34 ? 0.096   -1.258  11.608  1.00 0.00 ? 64  GLU A C    2  
ATOM 2004  O O    . GLU A 1 34 ? 0.708   -1.051  12.656  1.00 0.00 ? 64  GLU A O    2  
ATOM 2005  C CB   . GLU A 1 34 ? -0.588  -3.585  10.997  1.00 0.00 ? 64  GLU A CB   2  
ATOM 2006  C CG   . GLU A 1 34 ? -0.003  -4.517  12.047  1.00 0.00 ? 64  GLU A CG   2  
ATOM 2007  C CD   . GLU A 1 34 ? -0.920  -5.680  12.370  1.00 0.00 ? 64  GLU A CD   2  
ATOM 2008  O OE1  . GLU A 1 34 ? -1.147  -6.524  11.476  1.00 0.00 ? 64  GLU A OE1  2  
ATOM 2009  O OE2  . GLU A 1 34 ? -1.412  -5.748  13.516  1.00 0.00 ? 64  GLU A OE2  2  
ATOM 2010  H H    . GLU A 1 34 ? -2.438  -2.201  9.954   1.00 0.00 ? 64  GLU A H    2  
ATOM 2011  H HA   . GLU A 1 34 ? -1.429  -2.401  12.569  1.00 0.00 ? 64  GLU A HA   2  
ATOM 2012  H HB2  . GLU A 1 34 ? -1.424  -4.083  10.529  1.00 0.00 ? 64  GLU A HB2  2  
ATOM 2013  H HB3  . GLU A 1 34 ? 0.171   -3.397  10.252  1.00 0.00 ? 64  GLU A HB3  2  
ATOM 2014  H HG2  . GLU A 1 34 ? 0.934   -4.909  11.680  1.00 0.00 ? 64  GLU A HG2  2  
ATOM 2015  H HG3  . GLU A 1 34 ? 0.173   -3.954  12.952  1.00 0.00 ? 64  GLU A HG3  2  
ATOM 2016  N N    . PHE A 1 35 ? 0.393   -0.650  10.464  1.00 0.00 ? 65  PHE A N    2  
ATOM 2017  C CA   . PHE A 1 35 ? 1.480   0.317   10.372  1.00 0.00 ? 65  PHE A CA   2  
ATOM 2018  C C    . PHE A 1 35 ? 1.248   1.488   11.321  1.00 0.00 ? 65  PHE A C    2  
ATOM 2019  O O    . PHE A 1 35 ? 2.144   1.883   12.067  1.00 0.00 ? 65  PHE A O    2  
ATOM 2020  C CB   . PHE A 1 35 ? 1.619   0.828   8.937   1.00 0.00 ? 65  PHE A CB   2  
ATOM 2021  C CG   . PHE A 1 35 ? 2.927   1.515   8.669   1.00 0.00 ? 65  PHE A CG   2  
ATOM 2022  C CD1  . PHE A 1 35 ? 4.112   0.796   8.658   1.00 0.00 ? 65  PHE A CD1  2  
ATOM 2023  C CD2  . PHE A 1 35 ? 2.973   2.878   8.429   1.00 0.00 ? 65  PHE A CD2  2  
ATOM 2024  C CE1  . PHE A 1 35 ? 5.318   1.425   8.412   1.00 0.00 ? 65  PHE A CE1  2  
ATOM 2025  C CE2  . PHE A 1 35 ? 4.175   3.513   8.182   1.00 0.00 ? 65  PHE A CE2  2  
ATOM 2026  C CZ   . PHE A 1 35 ? 5.349   2.785   8.174   1.00 0.00 ? 65  PHE A CZ   2  
ATOM 2027  H H    . PHE A 1 35 ? -0.132  -0.857  9.662   1.00 0.00 ? 65  PHE A H    2  
ATOM 2028  H HA   . PHE A 1 35 ? 2.394   -0.184  10.656  1.00 0.00 ? 65  PHE A HA   2  
ATOM 2029  H HB2  . PHE A 1 35 ? 1.535   -0.006  8.256   1.00 0.00 ? 65  PHE A HB2  2  
ATOM 2030  H HB3  . PHE A 1 35 ? 0.825   1.532   8.735   1.00 0.00 ? 65  PHE A HB3  2  
ATOM 2031  H HD1  . PHE A 1 35 ? 4.089   -0.268  8.843   1.00 0.00 ? 65  PHE A HD1  2  
ATOM 2032  H HD2  . PHE A 1 35 ? 2.055   3.448   8.435   1.00 0.00 ? 65  PHE A HD2  2  
ATOM 2033  H HE1  . PHE A 1 35 ? 6.235   0.854   8.407   1.00 0.00 ? 65  PHE A HE1  2  
ATOM 2034  H HE2  . PHE A 1 35 ? 4.197   4.576   7.996   1.00 0.00 ? 65  PHE A HE2  2  
ATOM 2035  H HZ   . PHE A 1 35 ? 6.291   3.279   7.982   1.00 0.00 ? 65  PHE A HZ   2  
ATOM 2036  N N    . LYS A 1 36 ? 0.039   2.039   11.289  1.00 0.00 ? 66  LYS A N    2  
ATOM 2037  C CA   . LYS A 1 36 ? -0.311  3.164   12.149  1.00 0.00 ? 66  LYS A CA   2  
ATOM 2038  C C    . LYS A 1 36 ? -0.152  2.792   13.619  1.00 0.00 ? 66  LYS A C    2  
ATOM 2039  O O    . LYS A 1 36 ? 0.262   3.614   14.437  1.00 0.00 ? 66  LYS A O    2  
ATOM 2040  C CB   . LYS A 1 36 ? -1.747  3.615   11.876  1.00 0.00 ? 66  LYS A CB   2  
ATOM 2041  C CG   . LYS A 1 36 ? -2.026  5.049   12.296  1.00 0.00 ? 66  LYS A CG   2  
ATOM 2042  C CD   . LYS A 1 36 ? -2.990  5.734   11.340  1.00 0.00 ? 66  LYS A CD   2  
ATOM 2043  C CE   . LYS A 1 36 ? -2.264  6.685   10.403  1.00 0.00 ? 66  LYS A CE   2  
ATOM 2044  N NZ   . LYS A 1 36 ? -1.182  5.999   9.643   1.00 0.00 ? 66  LYS A NZ   2  
ATOM 2045  H H    . LYS A 1 36 ? -0.635  1.680   10.675  1.00 0.00 ? 66  LYS A H    2  
ATOM 2046  H HA   . LYS A 1 36 ? 0.362   3.977   11.921  1.00 0.00 ? 66  LYS A HA   2  
ATOM 2047  H HB2  . LYS A 1 36 ? -1.945  3.528   10.818  1.00 0.00 ? 66  LYS A HB2  2  
ATOM 2048  H HB3  . LYS A 1 36 ? -2.424  2.967   12.414  1.00 0.00 ? 66  LYS A HB3  2  
ATOM 2049  H HG2  . LYS A 1 36 ? -2.458  5.046   13.286  1.00 0.00 ? 66  LYS A HG2  2  
ATOM 2050  H HG3  . LYS A 1 36 ? -1.095  5.597   12.310  1.00 0.00 ? 66  LYS A HG3  2  
ATOM 2051  H HD2  . LYS A 1 36 ? -3.495  4.982   10.753  1.00 0.00 ? 66  LYS A HD2  2  
ATOM 2052  H HD3  . LYS A 1 36 ? -3.715  6.292   11.915  1.00 0.00 ? 66  LYS A HD3  2  
ATOM 2053  H HE2  . LYS A 1 36 ? -2.977  7.095   9.703   1.00 0.00 ? 66  LYS A HE2  2  
ATOM 2054  H HE3  . LYS A 1 36 ? -1.831  7.485   10.986  1.00 0.00 ? 66  LYS A HE3  2  
ATOM 2055  H HZ1  . LYS A 1 36 ? -1.111  6.396   8.684   1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 2056  H HZ2  . LYS A 1 36 ? -1.385  4.982   9.572   1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 2057  H HZ3  . LYS A 1 36 ? -0.270  6.126   10.126  1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 2058  N N    . SER A 1 37 ? -0.482  1.547   13.947  1.00 0.00 ? 67  SER A N    2  
ATOM 2059  C CA   . SER A 1 37 ? -0.374  1.063   15.318  1.00 0.00 ? 67  SER A CA   2  
ATOM 2060  C C    . SER A 1 37 ? 1.079   1.065   15.790  1.00 0.00 ? 67  SER A C    2  
ATOM 2061  O O    . SER A 1 37 ? 1.351   0.987   16.988  1.00 0.00 ? 67  SER A O    2  
ATOM 2062  C CB   . SER A 1 37 ? -0.956  -0.348  15.429  1.00 0.00 ? 67  SER A CB   2  
ATOM 2063  O OG   . SER A 1 37 ? -1.653  -0.518  16.650  1.00 0.00 ? 67  SER A OG   2  
ATOM 2064  H H    . SER A 1 37 ? -0.805  0.939   13.251  1.00 0.00 ? 67  SER A H    2  
ATOM 2065  H HA   . SER A 1 37 ? -0.944  1.727   15.948  1.00 0.00 ? 67  SER A HA   2  
ATOM 2066  H HB2  . SER A 1 37 ? -1.641  -0.518  14.611  1.00 0.00 ? 67  SER A HB2  2  
ATOM 2067  H HB3  . SER A 1 37 ? -0.154  -1.070  15.382  1.00 0.00 ? 67  SER A HB3  2  
ATOM 2068  H HG   . SER A 1 37 ? -2.595  -0.583  16.475  1.00 0.00 ? 67  SER A HG   2  
ATOM 2069  N N    . GLN A 1 38 ? 2.010   1.153   14.842  1.00 0.00 ? 68  GLN A N    2  
ATOM 2070  C CA   . GLN A 1 38 ? 3.435   1.163   15.161  1.00 0.00 ? 68  GLN A CA   2  
ATOM 2071  C C    . GLN A 1 38 ? 3.895   -0.210  15.639  1.00 0.00 ? 68  GLN A C    2  
ATOM 2072  O O    . GLN A 1 38 ? 4.687   -0.321  16.575  1.00 0.00 ? 68  GLN A O    2  
ATOM 2073  C CB   . GLN A 1 38 ? 3.740   2.219   16.228  1.00 0.00 ? 68  GLN A CB   2  
ATOM 2074  C CG   . GLN A 1 38 ? 5.061   2.938   16.011  1.00 0.00 ? 68  GLN A CG   2  
ATOM 2075  C CD   . GLN A 1 38 ? 5.773   3.256   17.312  1.00 0.00 ? 68  GLN A CD   2  
ATOM 2076  O OE1  . GLN A 1 38 ? 5.987   4.420   17.647  1.00 0.00 ? 68  GLN A OE1  2  
ATOM 2077  N NE2  . GLN A 1 38 ? 6.144   2.217   18.052  1.00 0.00 ? 68  GLN A NE2  2  
ATOM 2078  H H    . GLN A 1 38 ? 1.734   1.210   13.905  1.00 0.00 ? 68  GLN A H    2  
ATOM 2079  H HA   . GLN A 1 38 ? 3.971   1.414   14.258  1.00 0.00 ? 68  GLN A HA   2  
ATOM 2080  H HB2  . GLN A 1 38 ? 2.949   2.955   16.227  1.00 0.00 ? 68  GLN A HB2  2  
ATOM 2081  H HB3  . GLN A 1 38 ? 3.770   1.738   17.195  1.00 0.00 ? 68  GLN A HB3  2  
ATOM 2082  H HG2  . GLN A 1 38 ? 5.704   2.311   15.412  1.00 0.00 ? 68  GLN A HG2  2  
ATOM 2083  H HG3  . GLN A 1 38 ? 4.871   3.863   15.487  1.00 0.00 ? 68  GLN A HG3  2  
ATOM 2084  H HE21 . GLN A 1 38 ? 5.941   1.317   17.722  1.00 0.00 ? 68  GLN A HE21 2  
ATOM 2085  H HE22 . GLN A 1 38 ? 6.606   2.394   18.898  1.00 0.00 ? 68  GLN A HE22 2  
ATOM 2086  N N    . SER A 1 39 ? 3.394   -1.254  14.987  1.00 0.00 ? 69  SER A N    2  
ATOM 2087  C CA   . SER A 1 39 ? 3.754   -2.623  15.341  1.00 0.00 ? 69  SER A CA   2  
ATOM 2088  C C    . SER A 1 39 ? 4.581   -3.269  14.235  1.00 0.00 ? 69  SER A C    2  
ATOM 2089  O O    . SER A 1 39 ? 5.519   -4.019  14.505  1.00 0.00 ? 69  SER A O    2  
ATOM 2090  C CB   . SER A 1 39 ? 2.495   -3.451  15.604  1.00 0.00 ? 69  SER A CB   2  
ATOM 2091  O OG   . SER A 1 39 ? 1.907   -3.885  14.390  1.00 0.00 ? 69  SER A OG   2  
ATOM 2092  H H    . SER A 1 39 ? 2.769   -1.101  14.248  1.00 0.00 ? 69  SER A H    2  
ATOM 2093  H HA   . SER A 1 39 ? 4.346   -2.587  16.243  1.00 0.00 ? 69  SER A HA   2  
ATOM 2094  H HB2  . SER A 1 39 ? 2.754   -4.318  16.193  1.00 0.00 ? 69  SER A HB2  2  
ATOM 2095  H HB3  . SER A 1 39 ? 1.777   -2.851  16.143  1.00 0.00 ? 69  SER A HB3  2  
ATOM 2096  H HG   . SER A 1 39 ? 1.226   -4.535  14.578  1.00 0.00 ? 69  SER A HG   2  
ATOM 2097  N N    . ILE A 1 40 ? 4.226   -2.973  12.989  1.00 0.00 ? 70  ILE A N    2  
ATOM 2098  C CA   . ILE A 1 40 ? 4.935   -3.524  11.840  1.00 0.00 ? 70  ILE A CA   2  
ATOM 2099  C C    . ILE A 1 40 ? 5.949   -2.524  11.292  1.00 0.00 ? 70  ILE A C    2  
ATOM 2100  O O    . ILE A 1 40 ? 5.639   -1.347  11.110  1.00 0.00 ? 70  ILE A O    2  
ATOM 2101  C CB   . ILE A 1 40 ? 3.957   -3.924  10.717  1.00 0.00 ? 70  ILE A CB   2  
ATOM 2102  C CG1  . ILE A 1 40 ? 4.710   -4.593  9.565   1.00 0.00 ? 70  ILE A CG1  2  
ATOM 2103  C CG2  . ILE A 1 40 ? 3.189   -2.707  10.220  1.00 0.00 ? 70  ILE A CG2  2  
ATOM 2104  C CD1  . ILE A 1 40 ? 3.888   -5.625  8.824   1.00 0.00 ? 70  ILE A CD1  2  
ATOM 2105  H H    . ILE A 1 40 ? 3.469   -2.369  12.838  1.00 0.00 ? 70  ILE A H    2  
ATOM 2106  H HA   . ILE A 1 40 ? 5.458   -4.411  12.166  1.00 0.00 ? 70  ILE A HA   2  
ATOM 2107  H HB   . ILE A 1 40 ? 3.244   -4.624  11.125  1.00 0.00 ? 70  ILE A HB   2  
ATOM 2108  H HG12 . ILE A 1 40 ? 5.011   -3.839  8.854   1.00 0.00 ? 70  ILE A HG12 2  
ATOM 2109  H HG13 . ILE A 1 40 ? 5.588   -5.085  9.955   1.00 0.00 ? 70  ILE A HG13 2  
ATOM 2110  H HG21 . ILE A 1 40 ? 2.615   -2.287  11.032  1.00 0.00 ? 70  ILE A HG21 2  
ATOM 2111  H HG22 . ILE A 1 40 ? 2.523   -3.003  9.423   1.00 0.00 ? 70  ILE A HG22 2  
ATOM 2112  H HG23 . ILE A 1 40 ? 3.885   -1.968  9.852   1.00 0.00 ? 70  ILE A HG23 2  
ATOM 2113  H HD11 . ILE A 1 40 ? 4.067   -5.535  7.763   1.00 0.00 ? 70  ILE A HD11 2  
ATOM 2114  H HD12 . ILE A 1 40 ? 2.839   -5.463  9.027   1.00 0.00 ? 70  ILE A HD12 2  
ATOM 2115  H HD13 . ILE A 1 40 ? 4.170   -6.614  9.154   1.00 0.00 ? 70  ILE A HD13 2  
ATOM 2116  N N    . ASP A 1 41 ? 7.162   -3.001  11.034  1.00 0.00 ? 71  ASP A N    2  
ATOM 2117  C CA   . ASP A 1 41 ? 8.222   -2.149  10.508  1.00 0.00 ? 71  ASP A CA   2  
ATOM 2118  C C    . ASP A 1 41 ? 8.009   -1.866  9.024   1.00 0.00 ? 71  ASP A C    2  
ATOM 2119  O O    . ASP A 1 41 ? 7.052   -2.350  8.421   1.00 0.00 ? 71  ASP A O    2  
ATOM 2120  C CB   . ASP A 1 41 ? 9.587   -2.806  10.722  1.00 0.00 ? 71  ASP A CB   2  
ATOM 2121  C CG   . ASP A 1 41 ? 9.805   -3.229  12.162  1.00 0.00 ? 71  ASP A CG   2  
ATOM 2122  O OD1  . ASP A 1 41 ? 10.049  -2.346  13.010  1.00 0.00 ? 71  ASP A OD1  2  
ATOM 2123  O OD2  . ASP A 1 41 ? 9.731   -4.445  12.440  1.00 0.00 ? 71  ASP A OD2  2  
ATOM 2124  H H    . ASP A 1 41 ? 7.349   -3.949  11.201  1.00 0.00 ? 71  ASP A H    2  
ATOM 2125  H HA   . ASP A 1 41 ? 8.194   -1.214  11.048  1.00 0.00 ? 71  ASP A HA   2  
ATOM 2126  H HB2  . ASP A 1 41 ? 9.661   -3.681  10.094  1.00 0.00 ? 71  ASP A HB2  2  
ATOM 2127  H HB3  . ASP A 1 41 ? 10.363  -2.105  10.451  1.00 0.00 ? 71  ASP A HB3  2  
ATOM 2128  N N    . THR A 1 42 ? 8.908   -1.079  8.443   1.00 0.00 ? 72  THR A N    2  
ATOM 2129  C CA   . THR A 1 42 ? 8.820   -0.730  7.029   1.00 0.00 ? 72  THR A CA   2  
ATOM 2130  C C    . THR A 1 42 ? 8.995   -1.968  6.150   1.00 0.00 ? 72  THR A C    2  
ATOM 2131  O O    . THR A 1 42 ? 8.164   -2.247  5.286   1.00 0.00 ? 72  THR A O    2  
ATOM 2132  C CB   . THR A 1 42 ? 9.875   0.322   6.670   1.00 0.00 ? 72  THR A CB   2  
ATOM 2133  O OG1  . THR A 1 42 ? 10.591  0.731   7.822   1.00 0.00 ? 72  THR A OG1  2  
ATOM 2134  C CG2  . THR A 1 42 ? 9.288   1.562   6.032   1.00 0.00 ? 72  THR A CG2  2  
ATOM 2135  H H    . THR A 1 42 ? 9.649   -0.723  8.977   1.00 0.00 ? 72  THR A H    2  
ATOM 2136  H HA   . THR A 1 42 ? 7.839   -0.316  6.852   1.00 0.00 ? 72  THR A HA   2  
ATOM 2137  H HB   . THR A 1 42 ? 10.577  -0.109  5.971   1.00 0.00 ? 72  THR A HB   2  
ATOM 2138  H HG1  . THR A 1 42 ? 9.996   1.180   8.427   1.00 0.00 ? 72  THR A HG1  2  
ATOM 2139  H HG21 . THR A 1 42 ? 8.210   1.524   6.095   1.00 0.00 ? 72  THR A HG21 2  
ATOM 2140  H HG22 . THR A 1 42 ? 9.585   1.608   4.995   1.00 0.00 ? 72  THR A HG22 2  
ATOM 2141  H HG23 . THR A 1 42 ? 9.649   2.439   6.549   1.00 0.00 ? 72  THR A HG23 2  
ATOM 2142  N N    . PRO A 1 43 ? 10.083  -2.730  6.361   1.00 0.00 ? 73  PRO A N    2  
ATOM 2143  C CA   . PRO A 1 43 ? 10.362  -3.942  5.584   1.00 0.00 ? 73  PRO A CA   2  
ATOM 2144  C C    . PRO A 1 43 ? 9.149   -4.862  5.487   1.00 0.00 ? 73  PRO A C    2  
ATOM 2145  O O    . PRO A 1 43 ? 8.893   -5.460  4.443   1.00 0.00 ? 73  PRO A O    2  
ATOM 2146  C CB   . PRO A 1 43 ? 11.484  -4.615  6.374   1.00 0.00 ? 73  PRO A CB   2  
ATOM 2147  C CG   . PRO A 1 43 ? 12.184  -3.495  7.061   1.00 0.00 ? 73  PRO A CG   2  
ATOM 2148  C CD   . PRO A 1 43 ? 11.127  -2.471  7.373   1.00 0.00 ? 73  PRO A CD   2  
ATOM 2149  H HA   . PRO A 1 43 ? 10.711  -3.703  4.590   1.00 0.00 ? 73  PRO A HA   2  
ATOM 2150  H HB2  . PRO A 1 43 ? 11.060  -5.313  7.083   1.00 0.00 ? 73  PRO A HB2  2  
ATOM 2151  H HB3  . PRO A 1 43 ? 12.143  -5.137  5.697   1.00 0.00 ? 73  PRO A HB3  2  
ATOM 2152  H HG2  . PRO A 1 43 ? 12.641  -3.852  7.972   1.00 0.00 ? 73  PRO A HG2  2  
ATOM 2153  H HG3  . PRO A 1 43 ? 12.932  -3.073  6.406   1.00 0.00 ? 73  PRO A HG3  2  
ATOM 2154  H HD2  . PRO A 1 43 ? 10.741  -2.619  8.371   1.00 0.00 ? 73  PRO A HD2  2  
ATOM 2155  H HD3  . PRO A 1 43 ? 11.525  -1.473  7.267   1.00 0.00 ? 73  PRO A HD3  2  
ATOM 2156  N N    . GLY A 1 44 ? 8.405   -4.969  6.583   1.00 0.00 ? 74  GLY A N    2  
ATOM 2157  C CA   . GLY A 1 44 ? 7.227   -5.816  6.600   1.00 0.00 ? 74  GLY A CA   2  
ATOM 2158  C C    . GLY A 1 44 ? 6.130   -5.298  5.692   1.00 0.00 ? 74  GLY A C    2  
ATOM 2159  O O    . GLY A 1 44 ? 5.334   -6.074  5.163   1.00 0.00 ? 74  GLY A O    2  
ATOM 2160  H H    . GLY A 1 44 ? 8.657   -4.468  7.387   1.00 0.00 ? 74  GLY A H    2  
ATOM 2161  H HA2  . GLY A 1 44 ? 7.507   -6.809  6.279   1.00 0.00 ? 74  GLY A HA2  2  
ATOM 2162  H HA3  . GLY A 1 44 ? 6.849   -5.869  7.610   1.00 0.00 ? 74  GLY A HA3  2  
ATOM 2163  N N    . VAL A 1 45 ? 6.088   -3.982  5.512   1.00 0.00 ? 75  VAL A N    2  
ATOM 2164  C CA   . VAL A 1 45 ? 5.081   -3.358  4.663   1.00 0.00 ? 75  VAL A CA   2  
ATOM 2165  C C    . VAL A 1 45 ? 5.382   -3.599  3.187   1.00 0.00 ? 75  VAL A C    2  
ATOM 2166  O O    . VAL A 1 45 ? 4.502   -3.989  2.420   1.00 0.00 ? 75  VAL A O    2  
ATOM 2167  C CB   . VAL A 1 45 ? 4.993   -1.840  4.915   1.00 0.00 ? 75  VAL A CB   2  
ATOM 2168  C CG1  . VAL A 1 45 ? 3.836   -1.234  4.137   1.00 0.00 ? 75  VAL A CG1  2  
ATOM 2169  C CG2  . VAL A 1 45 ? 4.854   -1.552  6.403   1.00 0.00 ? 75  VAL A CG2  2  
ATOM 2170  H H    . VAL A 1 45 ? 6.750   -3.417  5.962   1.00 0.00 ? 75  VAL A H    2  
ATOM 2171  H HA   . VAL A 1 45 ? 4.123   -3.798  4.901   1.00 0.00 ? 75  VAL A HA   2  
ATOM 2172  H HB   . VAL A 1 45 ? 5.909   -1.385  4.567   1.00 0.00 ? 75  VAL A HB   2  
ATOM 2173  H HG11 . VAL A 1 45 ? 2.994   -1.911  4.157   1.00 0.00 ? 75  VAL A HG11 2  
ATOM 2174  H HG12 . VAL A 1 45 ? 4.138   -1.065  3.114   1.00 0.00 ? 75  VAL A HG12 2  
ATOM 2175  H HG13 . VAL A 1 45 ? 3.552   -0.294  4.588   1.00 0.00 ? 75  VAL A HG13 2  
ATOM 2176  H HG21 . VAL A 1 45 ? 5.477   -0.709  6.666   1.00 0.00 ? 75  VAL A HG21 2  
ATOM 2177  H HG22 . VAL A 1 45 ? 5.164   -2.418  6.969   1.00 0.00 ? 75  VAL A HG22 2  
ATOM 2178  H HG23 . VAL A 1 45 ? 3.824   -1.323  6.631   1.00 0.00 ? 75  VAL A HG23 2  
ATOM 2179  N N    . ILE A 1 46 ? 6.631   -3.365  2.797   1.00 0.00 ? 76  ILE A N    2  
ATOM 2180  C CA   . ILE A 1 46 ? 7.047   -3.558  1.414   1.00 0.00 ? 76  ILE A CA   2  
ATOM 2181  C C    . ILE A 1 46 ? 6.834   -5.003  0.975   1.00 0.00 ? 76  ILE A C    2  
ATOM 2182  O O    . ILE A 1 46 ? 6.460   -5.267  -0.168  1.00 0.00 ? 76  ILE A O    2  
ATOM 2183  C CB   . ILE A 1 46 ? 8.529   -3.183  1.214   1.00 0.00 ? 76  ILE A CB   2  
ATOM 2184  C CG1  . ILE A 1 46 ? 8.803   -1.781  1.763   1.00 0.00 ? 76  ILE A CG1  2  
ATOM 2185  C CG2  . ILE A 1 46 ? 8.904   -3.261  -0.259  1.00 0.00 ? 76  ILE A CG2  2  
ATOM 2186  C CD1  . ILE A 1 46 ? 10.119  -1.669  2.503   1.00 0.00 ? 76  ILE A CD1  2  
ATOM 2187  H H    . ILE A 1 46 ? 7.288   -3.057  3.456   1.00 0.00 ? 76  ILE A H    2  
ATOM 2188  H HA   . ILE A 1 46 ? 6.446   -2.911  0.791   1.00 0.00 ? 76  ILE A HA   2  
ATOM 2189  H HB   . ILE A 1 46 ? 9.134   -3.897  1.752   1.00 0.00 ? 76  ILE A HB   2  
ATOM 2190  H HG12 . ILE A 1 46 ? 8.823   -1.078  0.945   1.00 0.00 ? 76  ILE A HG12 2  
ATOM 2191  H HG13 . ILE A 1 46 ? 8.013   -1.508  2.447   1.00 0.00 ? 76  ILE A HG13 2  
ATOM 2192  H HG21 . ILE A 1 46 ? 8.080   -2.904  -0.859  1.00 0.00 ? 76  ILE A HG21 2  
ATOM 2193  H HG22 . ILE A 1 46 ? 9.122   -4.286  -0.521  1.00 0.00 ? 76  ILE A HG22 2  
ATOM 2194  H HG23 . ILE A 1 46 ? 9.775   -2.649  -0.442  1.00 0.00 ? 76  ILE A HG23 2  
ATOM 2195  H HD11 . ILE A 1 46 ? 10.631  -0.771  2.191   1.00 0.00 ? 76  ILE A HD11 2  
ATOM 2196  H HD12 . ILE A 1 46 ? 10.732  -2.529  2.280   1.00 0.00 ? 76  ILE A HD12 2  
ATOM 2197  H HD13 . ILE A 1 46 ? 9.932   -1.625  3.566   1.00 0.00 ? 76  ILE A HD13 2  
ATOM 2198  N N    . ARG A 1 47 ? 7.073   -5.935  1.892   1.00 0.00 ? 77  ARG A N    2  
ATOM 2199  C CA   . ARG A 1 47 ? 6.905   -7.354  1.600   1.00 0.00 ? 77  ARG A CA   2  
ATOM 2200  C C    . ARG A 1 47 ? 5.427   -7.726  1.551   1.00 0.00 ? 77  ARG A C    2  
ATOM 2201  O O    . ARG A 1 47 ? 4.996   -8.489  0.686   1.00 0.00 ? 77  ARG A O    2  
ATOM 2202  C CB   . ARG A 1 47 ? 7.623   -8.201  2.654   1.00 0.00 ? 77  ARG A CB   2  
ATOM 2203  C CG   . ARG A 1 47 ? 8.398   -9.370  2.069   1.00 0.00 ? 77  ARG A CG   2  
ATOM 2204  C CD   . ARG A 1 47 ? 9.636   -9.688  2.892   1.00 0.00 ? 77  ARG A CD   2  
ATOM 2205  N NE   . ARG A 1 47 ? 10.818  -9.874  2.053   1.00 0.00 ? 77  ARG A NE   2  
ATOM 2206  C CZ   . ARG A 1 47 ? 12.067  -9.812  2.508   1.00 0.00 ? 77  ARG A CZ   2  
ATOM 2207  N NH1  . ARG A 1 47 ? 12.303  -9.570  3.791   1.00 0.00 ? 77  ARG A NH1  2  
ATOM 2208  N NH2  . ARG A 1 47 ? 13.085  -9.993  1.677   1.00 0.00 ? 77  ARG A NH2  2  
ATOM 2209  H H    . ARG A 1 47 ? 7.368   -5.663  2.786   1.00 0.00 ? 77  ARG A H    2  
ATOM 2210  H HA   . ARG A 1 47 ? 7.346   -7.548  0.634   1.00 0.00 ? 77  ARG A HA   2  
ATOM 2211  H HB2  . ARG A 1 47 ? 8.316   -7.572  3.193   1.00 0.00 ? 77  ARG A HB2  2  
ATOM 2212  H HB3  . ARG A 1 47 ? 6.892   -8.591  3.346   1.00 0.00 ? 77  ARG A HB3  2  
ATOM 2213  H HG2  . ARG A 1 47 ? 7.758   -10.240 2.050   1.00 0.00 ? 77  ARG A HG2  2  
ATOM 2214  H HG3  . ARG A 1 47 ? 8.700   -9.122  1.062   1.00 0.00 ? 77  ARG A HG3  2  
ATOM 2215  H HD2  . ARG A 1 47 ? 9.818   -8.873  3.576   1.00 0.00 ? 77  ARG A HD2  2  
ATOM 2216  H HD3  . ARG A 1 47 ? 9.458   -10.594 3.452   1.00 0.00 ? 77  ARG A HD3  2  
ATOM 2217  H HE   . ARG A 1 47 ? 10.673  -10.054 1.101   1.00 0.00 ? 77  ARG A HE   2  
ATOM 2218  H HH11 . ARG A 1 47 ? 11.540  -9.433  4.424   1.00 0.00 ? 77  ARG A HH11 2  
ATOM 2219  H HH12 . ARG A 1 47 ? 13.244  -9.525  4.127   1.00 0.00 ? 77  ARG A HH12 2  
ATOM 2220  H HH21 . ARG A 1 47 ? 12.913  -10.176 0.709   1.00 0.00 ? 77  ARG A HH21 2  
ATOM 2221  H HH22 . ARG A 1 47 ? 14.023  -9.946  2.018   1.00 0.00 ? 77  ARG A HH22 2  
ATOM 2222  N N    . ARG A 1 48 ? 4.653   -7.180  2.484   1.00 0.00 ? 78  ARG A N    2  
ATOM 2223  C CA   . ARG A 1 48 ? 3.222   -7.452  2.548   1.00 0.00 ? 78  ARG A CA   2  
ATOM 2224  C C    . ARG A 1 48 ? 2.534   -7.048  1.247   1.00 0.00 ? 78  ARG A C    2  
ATOM 2225  O O    . ARG A 1 48 ? 1.769   -7.821  0.671   1.00 0.00 ? 78  ARG A O    2  
ATOM 2226  C CB   . ARG A 1 48 ? 2.594   -6.709  3.730   1.00 0.00 ? 78  ARG A CB   2  
ATOM 2227  C CG   . ARG A 1 48 ? 2.118   -7.630  4.842   1.00 0.00 ? 78  ARG A CG   2  
ATOM 2228  C CD   . ARG A 1 48 ? 3.240   -8.523  5.345   1.00 0.00 ? 78  ARG A CD   2  
ATOM 2229  N NE   . ARG A 1 48 ? 3.213   -8.670  6.798   1.00 0.00 ? 78  ARG A NE   2  
ATOM 2230  C CZ   . ARG A 1 48 ? 2.329   -9.420  7.451   1.00 0.00 ? 78  ARG A CZ   2  
ATOM 2231  N NH1  . ARG A 1 48 ? 1.400   -10.094 6.786   1.00 0.00 ? 78  ARG A NH1  2  
ATOM 2232  N NH2  . ARG A 1 48 ? 2.375   -9.498  8.774   1.00 0.00 ? 78  ARG A NH2  2  
ATOM 2233  H H    . ARG A 1 48 ? 5.055   -6.579  3.146   1.00 0.00 ? 78  ARG A H    2  
ATOM 2234  H HA   . ARG A 1 48 ? 3.094   -8.514  2.693   1.00 0.00 ? 78  ARG A HA   2  
ATOM 2235  H HB2  . ARG A 1 48 ? 3.325   -6.030  4.142   1.00 0.00 ? 78  ARG A HB2  2  
ATOM 2236  H HB3  . ARG A 1 48 ? 1.747   -6.140  3.376   1.00 0.00 ? 78  ARG A HB3  2  
ATOM 2237  H HG2  . ARG A 1 48 ? 1.754   -7.029  5.662   1.00 0.00 ? 78  ARG A HG2  2  
ATOM 2238  H HG3  . ARG A 1 48 ? 1.318   -8.250  4.465   1.00 0.00 ? 78  ARG A HG3  2  
ATOM 2239  H HD2  . ARG A 1 48 ? 3.137   -9.498  4.893   1.00 0.00 ? 78  ARG A HD2  2  
ATOM 2240  H HD3  . ARG A 1 48 ? 4.186   -8.090  5.054   1.00 0.00 ? 78  ARG A HD3  2  
ATOM 2241  H HE   . ARG A 1 48 ? 3.889   -8.183  7.315   1.00 0.00 ? 78  ARG A HE   2  
ATOM 2242  H HH11 . ARG A 1 48 ? 1.360   -10.040 5.788   1.00 0.00 ? 78  ARG A HH11 2  
ATOM 2243  H HH12 . ARG A 1 48 ? 0.739   -10.657 7.282   1.00 0.00 ? 78  ARG A HH12 2  
ATOM 2244  H HH21 . ARG A 1 48 ? 3.074   -8.993  9.281   1.00 0.00 ? 78  ARG A HH21 2  
ATOM 2245  H HH22 . ARG A 1 48 ? 1.711   -10.062 9.265   1.00 0.00 ? 78  ARG A HH22 2  
ATOM 2246  N N    . VAL A 1 49 ? 2.814   -5.832  0.788   1.00 0.00 ? 79  VAL A N    2  
ATOM 2247  C CA   . VAL A 1 49 ? 2.224   -5.327  -0.445  1.00 0.00 ? 79  VAL A CA   2  
ATOM 2248  C C    . VAL A 1 49 ? 2.713   -6.123  -1.651  1.00 0.00 ? 79  VAL A C    2  
ATOM 2249  O O    . VAL A 1 49 ? 1.948   -6.407  -2.572  1.00 0.00 ? 79  VAL A O    2  
ATOM 2250  C CB   . VAL A 1 49 ? 2.550   -3.835  -0.657  1.00 0.00 ? 79  VAL A CB   2  
ATOM 2251  C CG1  . VAL A 1 49 ? 1.877   -3.311  -1.916  1.00 0.00 ? 79  VAL A CG1  2  
ATOM 2252  C CG2  . VAL A 1 49 ? 2.130   -3.019  0.557   1.00 0.00 ? 79  VAL A CG2  2  
ATOM 2253  H H    . VAL A 1 49 ? 3.433   -5.262  1.290   1.00 0.00 ? 79  VAL A H    2  
ATOM 2254  H HA   . VAL A 1 49 ? 1.151   -5.432  -0.369  1.00 0.00 ? 79  VAL A HA   2  
ATOM 2255  H HB   . VAL A 1 49 ? 3.619   -3.735  -0.779  1.00 0.00 ? 79  VAL A HB   2  
ATOM 2256  H HG11 . VAL A 1 49 ? 1.022   -3.928  -2.150  1.00 0.00 ? 79  VAL A HG11 2  
ATOM 2257  H HG12 . VAL A 1 49 ? 2.577   -3.340  -2.738  1.00 0.00 ? 79  VAL A HG12 2  
ATOM 2258  H HG13 . VAL A 1 49 ? 1.553   -2.293  -1.756  1.00 0.00 ? 79  VAL A HG13 2  
ATOM 2259  H HG21 . VAL A 1 49 ? 1.053   -3.020  0.636   1.00 0.00 ? 79  VAL A HG21 2  
ATOM 2260  H HG22 . VAL A 1 49 ? 2.483   -2.004  0.448   1.00 0.00 ? 79  VAL A HG22 2  
ATOM 2261  H HG23 . VAL A 1 49 ? 2.557   -3.455  1.448   1.00 0.00 ? 79  VAL A HG23 2  
ATOM 2262  N N    . SER A 1 50 ? 3.994   -6.482  -1.639  1.00 0.00 ? 80  SER A N    2  
ATOM 2263  C CA   . SER A 1 50 ? 4.583   -7.245  -2.733  1.00 0.00 ? 80  SER A CA   2  
ATOM 2264  C C    . SER A 1 50 ? 3.903   -8.602  -2.881  1.00 0.00 ? 80  SER A C    2  
ATOM 2265  O O    . SER A 1 50 ? 3.890   -9.188  -3.964  1.00 0.00 ? 80  SER A O    2  
ATOM 2266  C CB   . SER A 1 50 ? 6.084   -7.432  -2.505  1.00 0.00 ? 80  SER A CB   2  
ATOM 2267  O OG   . SER A 1 50 ? 6.341   -8.549  -1.670  1.00 0.00 ? 80  SER A OG   2  
ATOM 2268  H H    . SER A 1 50 ? 4.555   -6.227  -0.878  1.00 0.00 ? 80  SER A H    2  
ATOM 2269  H HA   . SER A 1 50 ? 4.433   -6.686  -3.640  1.00 0.00 ? 80  SER A HA   2  
ATOM 2270  H HB2  . SER A 1 50 ? 6.573   -7.591  -3.455  1.00 0.00 ? 80  SER A HB2  2  
ATOM 2271  H HB3  . SER A 1 50 ? 6.488   -6.547  -2.036  1.00 0.00 ? 80  SER A HB3  2  
ATOM 2272  H HG   . SER A 1 50 ? 6.144   -8.319  -0.759  1.00 0.00 ? 80  SER A HG   2  
ATOM 2273  N N    . GLN A 1 51 ? 3.338   -9.094  -1.786  1.00 0.00 ? 81  GLN A N    2  
ATOM 2274  C CA   . GLN A 1 51 ? 2.652   -10.381 -1.790  1.00 0.00 ? 81  GLN A CA   2  
ATOM 2275  C C    . GLN A 1 51 ? 1.213   -10.226 -2.273  1.00 0.00 ? 81  GLN A C    2  
ATOM 2276  O O    . GLN A 1 51 ? 0.734   -11.011 -3.090  1.00 0.00 ? 81  GLN A O    2  
ATOM 2277  C CB   . GLN A 1 51 ? 2.674   -10.998 -0.389  1.00 0.00 ? 81  GLN A CB   2  
ATOM 2278  C CG   . GLN A 1 51 ? 3.631   -12.172 -0.257  1.00 0.00 ? 81  GLN A CG   2  
ATOM 2279  C CD   . GLN A 1 51 ? 3.011   -13.350 0.469   1.00 0.00 ? 81  GLN A CD   2  
ATOM 2280  O OE1  . GLN A 1 51 ? 3.360   -13.644 1.612   1.00 0.00 ? 81  GLN A OE1  2  
ATOM 2281  N NE2  . GLN A 1 51 ? 2.086   -14.034 -0.195  1.00 0.00 ? 81  GLN A NE2  2  
ATOM 2282  H H    . GLN A 1 51 ? 3.381   -8.577  -0.956  1.00 0.00 ? 81  GLN A H    2  
ATOM 2283  H HA   . GLN A 1 51 ? 3.179   -11.034 -2.469  1.00 0.00 ? 81  GLN A HA   2  
ATOM 2284  H HB2  . GLN A 1 51 ? 2.969   -10.239 0.321   1.00 0.00 ? 81  GLN A HB2  2  
ATOM 2285  H HB3  . GLN A 1 51 ? 1.680   -11.341 -0.142  1.00 0.00 ? 81  GLN A HB3  2  
ATOM 2286  H HG2  . GLN A 1 51 ? 3.926   -12.492 -1.245  1.00 0.00 ? 81  GLN A HG2  2  
ATOM 2287  H HG3  . GLN A 1 51 ? 4.503   -11.848 0.292   1.00 0.00 ? 81  GLN A HG3  2  
ATOM 2288  H HE21 . GLN A 1 51 ? 1.858   -13.743 -1.103  1.00 0.00 ? 81  GLN A HE21 2  
ATOM 2289  H HE22 . GLN A 1 51 ? 1.668   -14.801 0.250   1.00 0.00 ? 81  GLN A HE22 2  
ATOM 2290  N N    . LEU A 1 52 ? 0.531   -9.206  -1.762  1.00 0.00 ? 82  LEU A N    2  
ATOM 2291  C CA   . LEU A 1 52 ? -0.852  -8.944  -2.142  1.00 0.00 ? 82  LEU A CA   2  
ATOM 2292  C C    . LEU A 1 52 ? -0.960  -8.671  -3.638  1.00 0.00 ? 82  LEU A C    2  
ATOM 2293  O O    . LEU A 1 52 ? -1.910  -9.103  -4.292  1.00 0.00 ? 82  LEU A O    2  
ATOM 2294  C CB   . LEU A 1 52 ? -1.401  -7.753  -1.353  1.00 0.00 ? 82  LEU A CB   2  
ATOM 2295  C CG   . LEU A 1 52 ? -2.926  -7.649  -1.314  1.00 0.00 ? 82  LEU A CG   2  
ATOM 2296  C CD1  . LEU A 1 52 ? -3.510  -8.709  -0.394  1.00 0.00 ? 82  LEU A CD1  2  
ATOM 2297  C CD2  . LEU A 1 52 ? -3.352  -6.258  -0.867  1.00 0.00 ? 82  LEU A CD2  2  
ATOM 2298  H H    . LEU A 1 52 ? 0.969   -8.614  -1.116  1.00 0.00 ? 82  LEU A H    2  
ATOM 2299  H HA   . LEU A 1 52 ? -1.434  -9.822  -1.904  1.00 0.00 ? 82  LEU A HA   2  
ATOM 2300  H HB2  . LEU A 1 52 ? -1.040  -7.825  -0.337  1.00 0.00 ? 82  LEU A HB2  2  
ATOM 2301  H HB3  . LEU A 1 52 ? -1.012  -6.847  -1.792  1.00 0.00 ? 82  LEU A HB3  2  
ATOM 2302  H HG   . LEU A 1 52 ? -3.317  -7.817  -2.307  1.00 0.00 ? 82  LEU A HG   2  
ATOM 2303  H HD11 . LEU A 1 52 ? -4.388  -8.316  0.098   1.00 0.00 ? 82  LEU A HD11 2  
ATOM 2304  H HD12 . LEU A 1 52 ? -2.776  -8.986  0.348   1.00 0.00 ? 82  LEU A HD12 2  
ATOM 2305  H HD13 . LEU A 1 52 ? -3.782  -9.579  -0.973  1.00 0.00 ? 82  LEU A HD13 2  
ATOM 2306  H HD21 . LEU A 1 52 ? -2.767  -5.517  -1.392  1.00 0.00 ? 82  LEU A HD21 2  
ATOM 2307  H HD22 . LEU A 1 52 ? -3.192  -6.157  0.196   1.00 0.00 ? 82  LEU A HD22 2  
ATOM 2308  H HD23 . LEU A 1 52 ? -4.399  -6.114  -1.089  1.00 0.00 ? 82  LEU A HD23 2  
ATOM 2309  N N    . PHE A 1 53 ? 0.021   -7.953  -4.173  1.00 0.00 ? 83  PHE A N    2  
ATOM 2310  C CA   . PHE A 1 53 ? 0.044   -7.620  -5.592  1.00 0.00 ? 83  PHE A CA   2  
ATOM 2311  C C    . PHE A 1 53 ? 1.102   -8.444  -6.322  1.00 0.00 ? 83  PHE A C    2  
ATOM 2312  O O    . PHE A 1 53 ? 2.047   -7.898  -6.893  1.00 0.00 ? 83  PHE A O    2  
ATOM 2313  C CB   . PHE A 1 53 ? 0.316   -6.125  -5.778  1.00 0.00 ? 83  PHE A CB   2  
ATOM 2314  C CG   . PHE A 1 53 ? -0.557  -5.241  -4.931  1.00 0.00 ? 83  PHE A CG   2  
ATOM 2315  C CD1  . PHE A 1 53 ? -1.877  -5.582  -4.675  1.00 0.00 ? 83  PHE A CD1  2  
ATOM 2316  C CD2  . PHE A 1 53 ? -0.058  -4.066  -4.392  1.00 0.00 ? 83  PHE A CD2  2  
ATOM 2317  C CE1  . PHE A 1 53 ? -2.680  -4.768  -3.899  1.00 0.00 ? 83  PHE A CE1  2  
ATOM 2318  C CE2  . PHE A 1 53 ? -0.857  -3.248  -3.615  1.00 0.00 ? 83  PHE A CE2  2  
ATOM 2319  C CZ   . PHE A 1 53 ? -2.170  -3.600  -3.368  1.00 0.00 ? 83  PHE A CZ   2  
ATOM 2320  H H    . PHE A 1 53 ? 0.751   -7.639  -3.598  1.00 0.00 ? 83  PHE A H    2  
ATOM 2321  H HA   . PHE A 1 53 ? -0.927  -7.856  -6.004  1.00 0.00 ? 83  PHE A HA   2  
ATOM 2322  H HB2  . PHE A 1 53 ? 1.344   -5.920  -5.520  1.00 0.00 ? 83  PHE A HB2  2  
ATOM 2323  H HB3  . PHE A 1 53 ? 0.153   -5.863  -6.813  1.00 0.00 ? 83  PHE A HB3  2  
ATOM 2324  H HD1  . PHE A 1 53 ? -2.278  -6.495  -5.089  1.00 0.00 ? 83  PHE A HD1  2  
ATOM 2325  H HD2  . PHE A 1 53 ? 0.968   -3.789  -4.585  1.00 0.00 ? 83  PHE A HD2  2  
ATOM 2326  H HE1  . PHE A 1 53 ? -3.706  -5.046  -3.707  1.00 0.00 ? 83  PHE A HE1  2  
ATOM 2327  H HE2  . PHE A 1 53 ? -0.455  -2.336  -3.201  1.00 0.00 ? 83  PHE A HE2  2  
ATOM 2328  H HZ   . PHE A 1 53 ? -2.797  -2.963  -2.762  1.00 0.00 ? 83  PHE A HZ   2  
ATOM 2329  N N    . HIS A 1 54 ? 0.939   -9.762  -6.290  1.00 0.00 ? 84  HIS A N    2  
ATOM 2330  C CA   . HIS A 1 54 ? 1.878   -10.669 -6.937  1.00 0.00 ? 84  HIS A CA   2  
ATOM 2331  C C    . HIS A 1 54 ? 1.847   -10.512 -8.456  1.00 0.00 ? 84  HIS A C    2  
ATOM 2332  O O    . HIS A 1 54 ? 2.867   -10.220 -9.079  1.00 0.00 ? 84  HIS A O    2  
ATOM 2333  C CB   . HIS A 1 54 ? 1.563   -12.117 -6.556  1.00 0.00 ? 84  HIS A CB   2  
ATOM 2334  C CG   . HIS A 1 54 ? 2.780   -12.934 -6.251  1.00 0.00 ? 84  HIS A CG   2  
ATOM 2335  N ND1  . HIS A 1 54 ? 2.751   -14.056 -5.449  1.00 0.00 ? 84  HIS A ND1  2  
ATOM 2336  C CD2  . HIS A 1 54 ? 4.067   -12.789 -6.645  1.00 0.00 ? 84  HIS A CD2  2  
ATOM 2337  C CE1  . HIS A 1 54 ? 3.968   -14.563 -5.362  1.00 0.00 ? 84  HIS A CE1  2  
ATOM 2338  N NE2  . HIS A 1 54 ? 4.784   -13.814 -6.079  1.00 0.00 ? 84  HIS A NE2  2  
ATOM 2339  H H    . HIS A 1 54 ? 0.170   -10.136 -5.813  1.00 0.00 ? 84  HIS A H    2  
ATOM 2340  H HA   . HIS A 1 54 ? 2.867   -10.423 -6.584  1.00 0.00 ? 84  HIS A HA   2  
ATOM 2341  H HB2  . HIS A 1 54 ? 0.933   -12.121 -5.680  1.00 0.00 ? 84  HIS A HB2  2  
ATOM 2342  H HB3  . HIS A 1 54 ? 1.039   -12.591 -7.373  1.00 0.00 ? 84  HIS A HB3  2  
ATOM 2343  H HD1  . HIS A 1 54 ? 1.957   -14.424 -5.008  1.00 0.00 ? 84  HIS A HD1  2  
ATOM 2344  H HD2  . HIS A 1 54 ? 4.458   -12.010 -7.286  1.00 0.00 ? 84  HIS A HD2  2  
ATOM 2345  H HE1  . HIS A 1 54 ? 4.247   -15.443 -4.800  1.00 0.00 ? 84  HIS A HE1  2  
ATOM 2346  H HE2  . HIS A 1 54 ? 5.758   -13.915 -6.114  1.00 0.00 ? 84  HIS A HE2  2  
ATOM 2347  N N    . GLU A 1 55 ? 0.674   -10.717 -9.046  1.00 0.00 ? 85  GLU A N    2  
ATOM 2348  C CA   . GLU A 1 55 ? 0.519   -10.607 -10.494 1.00 0.00 ? 85  GLU A CA   2  
ATOM 2349  C C    . GLU A 1 55 ? -0.085  -9.262  -10.887 1.00 0.00 ? 85  GLU A C    2  
ATOM 2350  O O    . GLU A 1 55 ? -0.754  -9.150  -11.914 1.00 0.00 ? 85  GLU A O    2  
ATOM 2351  C CB   . GLU A 1 55 ? -0.360  -11.744 -11.019 1.00 0.00 ? 85  GLU A CB   2  
ATOM 2352  C CG   . GLU A 1 55 ? 0.394   -13.048 -11.228 1.00 0.00 ? 85  GLU A CG   2  
ATOM 2353  C CD   . GLU A 1 55 ? -0.304  -14.235 -10.591 1.00 0.00 ? 85  GLU A CD   2  
ATOM 2354  O OE1  . GLU A 1 55 ? -0.600  -14.169 -9.380  1.00 0.00 ? 85  GLU A OE1  2  
ATOM 2355  O OE2  . GLU A 1 55 ? -0.555  -15.229 -11.305 1.00 0.00 ? 85  GLU A OE2  2  
ATOM 2356  H H    . GLU A 1 55 ? -0.104  -10.954 -8.498  1.00 0.00 ? 85  GLU A H    2  
ATOM 2357  H HA   . GLU A 1 55 ? 1.499   -10.691 -10.937 1.00 0.00 ? 85  GLU A HA   2  
ATOM 2358  H HB2  . GLU A 1 55 ? -1.158  -11.923 -10.313 1.00 0.00 ? 85  GLU A HB2  2  
ATOM 2359  H HB3  . GLU A 1 55 ? -0.788  -11.446 -11.964 1.00 0.00 ? 85  GLU A HB3  2  
ATOM 2360  H HG2  . GLU A 1 55 ? 0.484   -13.231 -12.288 1.00 0.00 ? 85  GLU A HG2  2  
ATOM 2361  H HG3  . GLU A 1 55 ? 1.379   -12.953 -10.795 1.00 0.00 ? 85  GLU A HG3  2  
ATOM 2362  N N    . HIS A 1 56 ? 0.158   -8.243  -10.070 1.00 0.00 ? 86  HIS A N    2  
ATOM 2363  C CA   . HIS A 1 56 ? -0.361  -6.907  -10.341 1.00 0.00 ? 86  HIS A CA   2  
ATOM 2364  C C    . HIS A 1 56 ? 0.770   -5.879  -10.359 1.00 0.00 ? 86  HIS A C    2  
ATOM 2365  O O    . HIS A 1 56 ? 1.114   -5.308  -9.324  1.00 0.00 ? 86  HIS A O    2  
ATOM 2366  C CB   . HIS A 1 56 ? -1.406  -6.514  -9.292  1.00 0.00 ? 86  HIS A CB   2  
ATOM 2367  C CG   . HIS A 1 56 ? -2.312  -7.637  -8.889  1.00 0.00 ? 86  HIS A CG   2  
ATOM 2368  N ND1  . HIS A 1 56 ? -2.856  -7.749  -7.627  1.00 0.00 ? 86  HIS A ND1  2  
ATOM 2369  C CD2  . HIS A 1 56 ? -2.769  -8.703  -9.589  1.00 0.00 ? 86  HIS A CD2  2  
ATOM 2370  C CE1  . HIS A 1 56 ? -3.607  -8.834  -7.568  1.00 0.00 ? 86  HIS A CE1  2  
ATOM 2371  N NE2  . HIS A 1 56 ? -3.571  -9.430  -8.745  1.00 0.00 ? 86  HIS A NE2  2  
ATOM 2372  H H    . HIS A 1 56 ? 0.701   -8.392  -9.267  1.00 0.00 ? 86  HIS A H    2  
ATOM 2373  H HA   . HIS A 1 56 ? -0.831  -6.925  -11.313 1.00 0.00 ? 86  HIS A HA   2  
ATOM 2374  H HB2  . HIS A 1 56 ? -0.900  -6.163  -8.406  1.00 0.00 ? 86  HIS A HB2  2  
ATOM 2375  H HB3  . HIS A 1 56 ? -2.019  -5.717  -9.688  1.00 0.00 ? 86  HIS A HB3  2  
ATOM 2376  H HD1  . HIS A 1 56 ? -2.713  -7.125  -6.886  1.00 0.00 ? 86  HIS A HD1  2  
ATOM 2377  H HD2  . HIS A 1 56 ? -2.544  -8.936  -10.619 1.00 0.00 ? 86  HIS A HD2  2  
ATOM 2378  H HE1  . HIS A 1 56 ? -4.157  -9.175  -6.704  1.00 0.00 ? 86  HIS A HE1  2  
ATOM 2379  H HE2  . HIS A 1 56 ? -4.122  -10.197 -9.006  1.00 0.00 ? 86  HIS A HE2  2  
ATOM 2380  N N    . PRO A 1 57 ? 1.367   -5.632  -11.539 1.00 0.00 ? 87  PRO A N    2  
ATOM 2381  C CA   . PRO A 1 57 ? 2.466   -4.670  -11.681 1.00 0.00 ? 87  PRO A CA   2  
ATOM 2382  C C    . PRO A 1 57 ? 2.028   -3.238  -11.387 1.00 0.00 ? 87  PRO A C    2  
ATOM 2383  O O    . PRO A 1 57 ? 2.647   -2.543  -10.583 1.00 0.00 ? 87  PRO A O    2  
ATOM 2384  C CB   . PRO A 1 57 ? 2.886   -4.810  -13.148 1.00 0.00 ? 87  PRO A CB   2  
ATOM 2385  C CG   . PRO A 1 57 ? 1.700   -5.392  -13.836 1.00 0.00 ? 87  PRO A CG   2  
ATOM 2386  C CD   . PRO A 1 57 ? 1.023   -6.270  -12.822 1.00 0.00 ? 87  PRO A CD   2  
ATOM 2387  H HA   . PRO A 1 57 ? 3.298   -4.926  -11.041 1.00 0.00 ? 87  PRO A HA   2  
ATOM 2388  H HB2  . PRO A 1 57 ? 3.137   -3.838  -13.547 1.00 0.00 ? 87  PRO A HB2  2  
ATOM 2389  H HB3  . PRO A 1 57 ? 3.742   -5.465  -13.218 1.00 0.00 ? 87  PRO A HB3  2  
ATOM 2390  H HG2  . PRO A 1 57 ? 1.035   -4.603  -14.152 1.00 0.00 ? 87  PRO A HG2  2  
ATOM 2391  H HG3  . PRO A 1 57 ? 2.019   -5.978  -14.685 1.00 0.00 ? 87  PRO A HG3  2  
ATOM 2392  H HD2  . PRO A 1 57 ? -0.046  -6.271  -12.979 1.00 0.00 ? 87  PRO A HD2  2  
ATOM 2393  H HD3  . PRO A 1 57 ? 1.415   -7.275  -12.870 1.00 0.00 ? 87  PRO A HD3  2  
ATOM 2394  N N    . ASP A 1 58 ? 0.956   -2.804  -12.043 1.00 0.00 ? 88  ASP A N    2  
ATOM 2395  C CA   . ASP A 1 58 ? 0.435   -1.453  -11.852 1.00 0.00 ? 88  ASP A CA   2  
ATOM 2396  C C    . ASP A 1 58 ? 0.127   -1.177  -10.381 1.00 0.00 ? 88  ASP A C    2  
ATOM 2397  O O    . ASP A 1 58 ? 0.045   -0.022  -9.962  1.00 0.00 ? 88  ASP A O    2  
ATOM 2398  C CB   . ASP A 1 58 ? -0.825  -1.248  -12.694 1.00 0.00 ? 88  ASP A CB   2  
ATOM 2399  C CG   . ASP A 1 58 ? -1.041  0.205   -13.070 1.00 0.00 ? 88  ASP A CG   2  
ATOM 2400  O OD1  . ASP A 1 58 ? -0.064  0.981   -13.021 1.00 0.00 ? 88  ASP A OD1  2  
ATOM 2401  O OD2  . ASP A 1 58 ? -2.186  0.566   -13.411 1.00 0.00 ? 88  ASP A OD2  2  
ATOM 2402  H H    . ASP A 1 58 ? 0.504   -3.405  -12.671 1.00 0.00 ? 88  ASP A H    2  
ATOM 2403  H HA   . ASP A 1 58 ? 1.192   -0.758  -12.184 1.00 0.00 ? 88  ASP A HA   2  
ATOM 2404  H HB2  . ASP A 1 58 ? -0.742  -1.827  -13.602 1.00 0.00 ? 88  ASP A HB2  2  
ATOM 2405  H HB3  . ASP A 1 58 ? -1.684  -1.588  -12.133 1.00 0.00 ? 88  ASP A HB3  2  
ATOM 2406  N N    . LEU A 1 59 ? -0.039  -2.240  -9.600  1.00 0.00 ? 89  LEU A N    2  
ATOM 2407  C CA   . LEU A 1 59 ? -0.333  -2.106  -8.180  1.00 0.00 ? 89  LEU A CA   2  
ATOM 2408  C C    . LEU A 1 59 ? 0.958   -1.986  -7.384  1.00 0.00 ? 89  LEU A C    2  
ATOM 2409  O O    . LEU A 1 59 ? 1.166   -1.011  -6.662  1.00 0.00 ? 89  LEU A O    2  
ATOM 2410  C CB   . LEU A 1 59 ? -1.146  -3.304  -7.688  1.00 0.00 ? 89  LEU A CB   2  
ATOM 2411  C CG   . LEU A 1 59 ? -2.662  -3.157  -7.826  1.00 0.00 ? 89  LEU A CG   2  
ATOM 2412  C CD1  . LEU A 1 59 ? -3.368  -4.411  -7.334  1.00 0.00 ? 89  LEU A CD1  2  
ATOM 2413  C CD2  . LEU A 1 59 ? -3.150  -1.935  -7.062  1.00 0.00 ? 89  LEU A CD2  2  
ATOM 2414  H H    . LEU A 1 59 ? 0.045   -3.135  -9.986  1.00 0.00 ? 89  LEU A H    2  
ATOM 2415  H HA   . LEU A 1 59 ? -0.912  -1.205  -8.044  1.00 0.00 ? 89  LEU A HA   2  
ATOM 2416  H HB2  . LEU A 1 59 ? -0.837  -4.176  -8.246  1.00 0.00 ? 89  LEU A HB2  2  
ATOM 2417  H HB3  . LEU A 1 59 ? -0.916  -3.465  -6.645  1.00 0.00 ? 89  LEU A HB3  2  
ATOM 2418  H HG   . LEU A 1 59 ? -2.910  -3.022  -8.869  1.00 0.00 ? 89  LEU A HG   2  
ATOM 2419  H HD11 . LEU A 1 59 ? -4.363  -4.452  -7.752  1.00 0.00 ? 89  LEU A HD11 2  
ATOM 2420  H HD12 . LEU A 1 59 ? -3.430  -4.390  -6.256  1.00 0.00 ? 89  LEU A HD12 2  
ATOM 2421  H HD13 . LEU A 1 59 ? -2.811  -5.282  -7.645  1.00 0.00 ? 89  LEU A HD13 2  
ATOM 2422  H HD21 . LEU A 1 59 ? -4.171  -2.091  -6.747  1.00 0.00 ? 89  LEU A HD21 2  
ATOM 2423  H HD22 . LEU A 1 59 ? -3.099  -1.066  -7.702  1.00 0.00 ? 89  LEU A HD22 2  
ATOM 2424  H HD23 . LEU A 1 59 ? -2.525  -1.779  -6.195  1.00 0.00 ? 89  LEU A HD23 2  
ATOM 2425  N N    . ILE A 1 60 ? 1.831   -2.977  -7.534  1.00 0.00 ? 90  ILE A N    2  
ATOM 2426  C CA   . ILE A 1 60 ? 3.110   -2.970  -6.842  1.00 0.00 ? 90  ILE A CA   2  
ATOM 2427  C C    . ILE A 1 60 ? 3.916   -1.740  -7.241  1.00 0.00 ? 90  ILE A C    2  
ATOM 2428  O O    . ILE A 1 60 ? 4.677   -1.192  -6.441  1.00 0.00 ? 90  ILE A O    2  
ATOM 2429  C CB   . ILE A 1 60 ? 3.927   -4.242  -7.151  1.00 0.00 ? 90  ILE A CB   2  
ATOM 2430  C CG1  . ILE A 1 60 ? 5.232   -4.247  -6.352  1.00 0.00 ? 90  ILE A CG1  2  
ATOM 2431  C CG2  . ILE A 1 60 ? 4.211   -4.343  -8.642  1.00 0.00 ? 90  ILE A CG2  2  
ATOM 2432  C CD1  . ILE A 1 60 ? 6.020   -5.531  -6.492  1.00 0.00 ? 90  ILE A CD1  2  
ATOM 2433  H H    . ILE A 1 60 ? 1.613   -3.721  -8.133  1.00 0.00 ? 90  ILE A H    2  
ATOM 2434  H HA   . ILE A 1 60 ? 2.917   -2.936  -5.779  1.00 0.00 ? 90  ILE A HA   2  
ATOM 2435  H HB   . ILE A 1 60 ? 3.336   -5.099  -6.865  1.00 0.00 ? 90  ILE A HB   2  
ATOM 2436  H HG12 . ILE A 1 60 ? 5.858   -3.436  -6.692  1.00 0.00 ? 90  ILE A HG12 2  
ATOM 2437  H HG13 . ILE A 1 60 ? 5.006   -4.107  -5.305  1.00 0.00 ? 90  ILE A HG13 2  
ATOM 2438  H HG21 . ILE A 1 60 ? 4.592   -5.327  -8.871  1.00 0.00 ? 90  ILE A HG21 2  
ATOM 2439  H HG22 . ILE A 1 60 ? 4.943   -3.600  -8.921  1.00 0.00 ? 90  ILE A HG22 2  
ATOM 2440  H HG23 . ILE A 1 60 ? 3.298   -4.173  -9.195  1.00 0.00 ? 90  ILE A HG23 2  
ATOM 2441  H HD11 . ILE A 1 60 ? 5.369   -6.316  -6.848  1.00 0.00 ? 90  ILE A HD11 2  
ATOM 2442  H HD12 . ILE A 1 60 ? 6.427   -5.809  -5.531  1.00 0.00 ? 90  ILE A HD12 2  
ATOM 2443  H HD13 . ILE A 1 60 ? 6.825   -5.384  -7.196  1.00 0.00 ? 90  ILE A HD13 2  
ATOM 2444  N N    . VAL A 1 61 ? 3.728   -1.301  -8.483  1.00 0.00 ? 91  VAL A N    2  
ATOM 2445  C CA   . VAL A 1 61 ? 4.426   -0.125  -8.985  1.00 0.00 ? 91  VAL A CA   2  
ATOM 2446  C C    . VAL A 1 61 ? 3.812   1.143   -8.404  1.00 0.00 ? 91  VAL A C    2  
ATOM 2447  O O    . VAL A 1 61 ? 4.523   2.044   -7.958  1.00 0.00 ? 91  VAL A O    2  
ATOM 2448  C CB   . VAL A 1 61 ? 4.388   -0.055  -10.525 1.00 0.00 ? 91  VAL A CB   2  
ATOM 2449  C CG1  . VAL A 1 61 ? 5.110   1.187   -11.028 1.00 0.00 ? 91  VAL A CG1  2  
ATOM 2450  C CG2  . VAL A 1 61 ? 4.997   -1.311  -11.131 1.00 0.00 ? 91  VAL A CG2  2  
ATOM 2451  H H    . VAL A 1 61 ? 3.096   -1.773  -9.070  1.00 0.00 ? 91  VAL A H    2  
ATOM 2452  H HA   . VAL A 1 61 ? 5.458   -0.190  -8.671  1.00 0.00 ? 91  VAL A HA   2  
ATOM 2453  H HB   . VAL A 1 61 ? 3.356   0.005   -10.837 1.00 0.00 ? 91  VAL A HB   2  
ATOM 2454  H HG11 . VAL A 1 61 ? 6.156   1.126   -10.766 1.00 0.00 ? 91  VAL A HG11 2  
ATOM 2455  H HG12 . VAL A 1 61 ? 4.675   2.065   -10.573 1.00 0.00 ? 91  VAL A HG12 2  
ATOM 2456  H HG13 . VAL A 1 61 ? 5.011   1.252   -12.101 1.00 0.00 ? 91  VAL A HG13 2  
ATOM 2457  H HG21 . VAL A 1 61 ? 4.515   -1.525  -12.074 1.00 0.00 ? 91  VAL A HG21 2  
ATOM 2458  H HG22 . VAL A 1 61 ? 4.853   -2.142  -10.456 1.00 0.00 ? 91  VAL A HG22 2  
ATOM 2459  H HG23 . VAL A 1 61 ? 6.053   -1.157  -11.293 1.00 0.00 ? 91  VAL A HG23 2  
ATOM 2460  N N    . GLY A 1 62 ? 2.483   1.200   -8.403  1.00 0.00 ? 92  GLY A N    2  
ATOM 2461  C CA   . GLY A 1 62 ? 1.795   2.356   -7.864  1.00 0.00 ? 92  GLY A CA   2  
ATOM 2462  C C    . GLY A 1 62 ? 2.152   2.605   -6.412  1.00 0.00 ? 92  GLY A C    2  
ATOM 2463  O O    . GLY A 1 62 ? 2.200   3.750   -5.965  1.00 0.00 ? 92  GLY A O    2  
ATOM 2464  H H    . GLY A 1 62 ? 1.967   0.449   -8.765  1.00 0.00 ? 92  GLY A H    2  
ATOM 2465  H HA2  . GLY A 1 62 ? 2.061   3.226   -8.445  1.00 0.00 ? 92  GLY A HA2  2  
ATOM 2466  H HA3  . GLY A 1 62 ? 0.729   2.196   -7.939  1.00 0.00 ? 92  GLY A HA3  2  
ATOM 2467  N N    . PHE A 1 63 ? 2.409   1.527   -5.677  1.00 0.00 ? 93  PHE A N    2  
ATOM 2468  C CA   . PHE A 1 63 ? 2.770   1.629   -4.271  1.00 0.00 ? 93  PHE A CA   2  
ATOM 2469  C C    . PHE A 1 63 ? 4.190   2.150   -4.117  1.00 0.00 ? 93  PHE A C    2  
ATOM 2470  O O    . PHE A 1 63 ? 4.469   2.995   -3.266  1.00 0.00 ? 93  PHE A O    2  
ATOM 2471  C CB   . PHE A 1 63 ? 2.633   0.270   -3.583  1.00 0.00 ? 93  PHE A CB   2  
ATOM 2472  C CG   . PHE A 1 63 ? 2.678   0.348   -2.083  1.00 0.00 ? 93  PHE A CG   2  
ATOM 2473  C CD1  . PHE A 1 63 ? 1.557   0.728   -1.362  1.00 0.00 ? 93  PHE A CD1  2  
ATOM 2474  C CD2  . PHE A 1 63 ? 3.841   0.043   -1.395  1.00 0.00 ? 93  PHE A CD2  2  
ATOM 2475  C CE1  . PHE A 1 63 ? 1.595   0.801   0.017   1.00 0.00 ? 93  PHE A CE1  2  
ATOM 2476  C CE2  . PHE A 1 63 ? 3.886   0.114   -0.016  1.00 0.00 ? 93  PHE A CE2  2  
ATOM 2477  C CZ   . PHE A 1 63 ? 2.762   0.494   0.691   1.00 0.00 ? 93  PHE A CZ   2  
ATOM 2478  H H    . PHE A 1 63 ? 2.357   0.643   -6.090  1.00 0.00 ? 93  PHE A H    2  
ATOM 2479  H HA   . PHE A 1 63 ? 2.097   2.324   -3.813  1.00 0.00 ? 93  PHE A HA   2  
ATOM 2480  H HB2  . PHE A 1 63 ? 1.690   -0.174  -3.863  1.00 0.00 ? 93  PHE A HB2  2  
ATOM 2481  H HB3  . PHE A 1 63 ? 3.438   -0.373  -3.907  1.00 0.00 ? 93  PHE A HB3  2  
ATOM 2482  H HD1  . PHE A 1 63 ? 0.645   0.968   -1.888  1.00 0.00 ? 93  PHE A HD1  2  
ATOM 2483  H HD2  . PHE A 1 63 ? 4.721   -0.254  -1.947  1.00 0.00 ? 93  PHE A HD2  2  
ATOM 2484  H HE1  . PHE A 1 63 ? 0.715   1.098   0.568   1.00 0.00 ? 93  PHE A HE1  2  
ATOM 2485  H HE2  . PHE A 1 63 ? 4.799   -0.127  0.509   1.00 0.00 ? 93  PHE A HE2  2  
ATOM 2486  H HZ   . PHE A 1 63 ? 2.794   0.550   1.769   1.00 0.00 ? 93  PHE A HZ   2  
ATOM 2487  N N    . ASN A 1 64 ? 5.078   1.641   -4.953  1.00 0.00 ? 94  ASN A N    2  
ATOM 2488  C CA   . ASN A 1 64 ? 6.478   2.049   -4.929  1.00 0.00 ? 94  ASN A CA   2  
ATOM 2489  C C    . ASN A 1 64 ? 6.613   3.539   -5.231  1.00 0.00 ? 94  ASN A C    2  
ATOM 2490  O O    . ASN A 1 64 ? 7.590   4.177   -4.836  1.00 0.00 ? 94  ASN A O    2  
ATOM 2491  C CB   . ASN A 1 64 ? 7.287   1.236   -5.940  1.00 0.00 ? 94  ASN A CB   2  
ATOM 2492  C CG   . ASN A 1 64 ? 8.782   1.403   -5.752  1.00 0.00 ? 94  ASN A CG   2  
ATOM 2493  O OD1  . ASN A 1 64 ? 9.459   0.510   -5.242  1.00 0.00 ? 94  ASN A OD1  2  
ATOM 2494  N ND2  . ASN A 1 64 ? 9.306   2.551   -6.165  1.00 0.00 ? 94  ASN A ND2  2  
ATOM 2495  H H    . ASN A 1 64 ? 4.782   0.975   -5.607  1.00 0.00 ? 94  ASN A H    2  
ATOM 2496  H HA   . ASN A 1 64 ? 6.861   1.859   -3.938  1.00 0.00 ? 94  ASN A HA   2  
ATOM 2497  H HB2  . ASN A 1 64 ? 7.044   0.190   -5.829  1.00 0.00 ? 94  ASN A HB2  2  
ATOM 2498  H HB3  . ASN A 1 64 ? 7.030   1.557   -6.939  1.00 0.00 ? 94  ASN A HB3  2  
ATOM 2499  H HD21 . ASN A 1 64 ? 8.706   3.217   -6.562  1.00 0.00 ? 94  ASN A HD21 2  
ATOM 2500  H HD22 . ASN A 1 64 ? 10.270  2.686   -6.055  1.00 0.00 ? 94  ASN A HD22 2  
ATOM 2501  N N    . ALA A 1 65 ? 5.627   4.088   -5.936  1.00 0.00 ? 95  ALA A N    2  
ATOM 2502  C CA   . ALA A 1 65 ? 5.633   5.501   -6.294  1.00 0.00 ? 95  ALA A CA   2  
ATOM 2503  C C    . ALA A 1 65 ? 5.466   6.399   -5.067  1.00 0.00 ? 95  ALA A C    2  
ATOM 2504  O O    . ALA A 1 65 ? 5.627   7.616   -5.157  1.00 0.00 ? 95  ALA A O    2  
ATOM 2505  C CB   . ALA A 1 65 ? 4.538   5.788   -7.309  1.00 0.00 ? 95  ALA A CB   2  
ATOM 2506  H H    . ALA A 1 65 ? 4.877   3.529   -6.224  1.00 0.00 ? 95  ALA A H    2  
ATOM 2507  H HA   . ALA A 1 65 ? 6.582   5.718   -6.758  1.00 0.00 ? 95  ALA A HA   2  
ATOM 2508  H HB1  . ALA A 1 65 ? 3.589   5.446   -6.923  1.00 0.00 ? 95  ALA A HB1  2  
ATOM 2509  H HB2  . ALA A 1 65 ? 4.758   5.272   -8.232  1.00 0.00 ? 95  ALA A HB2  2  
ATOM 2510  H HB3  . ALA A 1 65 ? 4.488   6.851   -7.494  1.00 0.00 ? 95  ALA A HB3  2  
ATOM 2511  N N    . PHE A 1 66 ? 5.140   5.799   -3.924  1.00 0.00 ? 96  PHE A N    2  
ATOM 2512  C CA   . PHE A 1 66 ? 4.954   6.559   -2.692  1.00 0.00 ? 96  PHE A CA   2  
ATOM 2513  C C    . PHE A 1 66 ? 6.196   6.482   -1.812  1.00 0.00 ? 96  PHE A C    2  
ATOM 2514  O O    . PHE A 1 66 ? 6.502   7.415   -1.069  1.00 0.00 ? 96  PHE A O    2  
ATOM 2515  C CB   . PHE A 1 66 ? 3.740   6.035   -1.922  1.00 0.00 ? 96  PHE A CB   2  
ATOM 2516  C CG   . PHE A 1 66 ? 2.433   6.271   -2.624  1.00 0.00 ? 96  PHE A CG   2  
ATOM 2517  C CD1  . PHE A 1 66 ? 2.156   5.644   -3.827  1.00 0.00 ? 96  PHE A CD1  2  
ATOM 2518  C CD2  . PHE A 1 66 ? 1.483   7.121   -2.081  1.00 0.00 ? 96  PHE A CD2  2  
ATOM 2519  C CE1  . PHE A 1 66 ? 0.955   5.858   -4.476  1.00 0.00 ? 96  PHE A CE1  2  
ATOM 2520  C CE2  . PHE A 1 66 ? 0.280   7.340   -2.725  1.00 0.00 ? 96  PHE A CE2  2  
ATOM 2521  C CZ   . PHE A 1 66 ? 0.016   6.708   -3.925  1.00 0.00 ? 96  PHE A CZ   2  
ATOM 2522  H H    . PHE A 1 66 ? 5.020   4.828   -3.906  1.00 0.00 ? 96  PHE A H    2  
ATOM 2523  H HA   . PHE A 1 66 ? 4.780   7.590   -2.961  1.00 0.00 ? 96  PHE A HA   2  
ATOM 2524  H HB2  . PHE A 1 66 ? 3.849   4.971   -1.775  1.00 0.00 ? 96  PHE A HB2  2  
ATOM 2525  H HB3  . PHE A 1 66 ? 3.695   6.523   -0.960  1.00 0.00 ? 96  PHE A HB3  2  
ATOM 2526  H HD1  . PHE A 1 66 ? 2.890   4.979   -4.259  1.00 0.00 ? 96  PHE A HD1  2  
ATOM 2527  H HD2  . PHE A 1 66 ? 1.690   7.616   -1.144  1.00 0.00 ? 96  PHE A HD2  2  
ATOM 2528  H HE1  . PHE A 1 66 ? 0.751   5.363   -5.414  1.00 0.00 ? 96  PHE A HE1  2  
ATOM 2529  H HE2  . PHE A 1 66 ? -0.452  8.004   -2.291  1.00 0.00 ? 96  PHE A HE2  2  
ATOM 2530  H HZ   . PHE A 1 66 ? -0.923  6.877   -4.430  1.00 0.00 ? 96  PHE A HZ   2  
ATOM 2531  N N    . LEU A 1 67 ? 6.911   5.365   -1.900  1.00 0.00 ? 97  LEU A N    2  
ATOM 2532  C CA   . LEU A 1 67 ? 8.121   5.169   -1.112  1.00 0.00 ? 97  LEU A CA   2  
ATOM 2533  C C    . LEU A 1 67 ? 9.321   5.831   -1.786  1.00 0.00 ? 97  LEU A C    2  
ATOM 2534  O O    . LEU A 1 67 ? 9.403   5.882   -3.013  1.00 0.00 ? 97  LEU A O    2  
ATOM 2535  C CB   . LEU A 1 67 ? 8.391   3.676   -0.915  1.00 0.00 ? 97  LEU A CB   2  
ATOM 2536  C CG   . LEU A 1 67 ? 7.202   2.867   -0.395  1.00 0.00 ? 97  LEU A CG   2  
ATOM 2537  C CD1  . LEU A 1 67 ? 7.217   1.462   -0.976  1.00 0.00 ? 97  LEU A CD1  2  
ATOM 2538  C CD2  . LEU A 1 67 ? 7.216   2.818   1.125   1.00 0.00 ? 97  LEU A CD2  2  
ATOM 2539  H H    . LEU A 1 67 ? 6.618   4.657   -2.511  1.00 0.00 ? 97  LEU A H    2  
ATOM 2540  H HA   . LEU A 1 67 ? 7.966   5.628   -0.147  1.00 0.00 ? 97  LEU A HA   2  
ATOM 2541  H HB2  . LEU A 1 67 ? 8.697   3.260   -1.864  1.00 0.00 ? 97  LEU A HB2  2  
ATOM 2542  H HB3  . LEU A 1 67 ? 9.205   3.568   -0.214  1.00 0.00 ? 97  LEU A HB3  2  
ATOM 2543  H HG   . LEU A 1 67 ? 6.285   3.346   -0.707  1.00 0.00 ? 97  LEU A HG   2  
ATOM 2544  H HD11 . LEU A 1 67 ? 7.813   0.818   -0.345  1.00 0.00 ? 97  LEU A HD11 2  
ATOM 2545  H HD12 . LEU A 1 67 ? 7.643   1.487   -1.968  1.00 0.00 ? 97  LEU A HD12 2  
ATOM 2546  H HD13 . LEU A 1 67 ? 6.208   1.081   -1.026  1.00 0.00 ? 97  LEU A HD13 2  
ATOM 2547  H HD21 . LEU A 1 67 ? 8.168   2.439   1.465   1.00 0.00 ? 97  LEU A HD21 2  
ATOM 2548  H HD22 . LEU A 1 67 ? 6.426   2.169   1.472   1.00 0.00 ? 97  LEU A HD22 2  
ATOM 2549  H HD23 . LEU A 1 67 ? 7.064   3.813   1.519   1.00 0.00 ? 97  LEU A HD23 2  
ATOM 2550  N N    . PRO A 1 68 ? 10.272  6.350   -0.989  1.00 0.00 ? 98  PRO A N    2  
ATOM 2551  C CA   . PRO A 1 68 ? 11.470  7.009   -1.518  1.00 0.00 ? 98  PRO A CA   2  
ATOM 2552  C C    . PRO A 1 68 ? 12.411  6.030   -2.212  1.00 0.00 ? 98  PRO A C    2  
ATOM 2553  O O    . PRO A 1 68 ? 12.220  4.816   -2.144  1.00 0.00 ? 98  PRO A O    2  
ATOM 2554  C CB   . PRO A 1 68 ? 12.135  7.599   -0.272  1.00 0.00 ? 98  PRO A CB   2  
ATOM 2555  C CG   . PRO A 1 68 ? 11.652  6.752   0.853   1.00 0.00 ? 98  PRO A CG   2  
ATOM 2556  C CD   . PRO A 1 68 ? 10.255  6.333   0.486   1.00 0.00 ? 98  PRO A CD   2  
ATOM 2557  H HA   . PRO A 1 68 ? 11.213  7.804   -2.203  1.00 0.00 ? 98  PRO A HA   2  
ATOM 2558  H HB2  . PRO A 1 68 ? 13.209  7.546   -0.375  1.00 0.00 ? 98  PRO A HB2  2  
ATOM 2559  H HB3  . PRO A 1 68 ? 11.829  8.627   -0.150  1.00 0.00 ? 98  PRO A HB3  2  
ATOM 2560  H HG2  . PRO A 1 68 ? 12.288  5.885   0.959   1.00 0.00 ? 98  PRO A HG2  2  
ATOM 2561  H HG3  . PRO A 1 68 ? 11.642  7.326   1.768   1.00 0.00 ? 98  PRO A HG3  2  
ATOM 2562  H HD2  . PRO A 1 68 ? 10.048  5.341   0.858   1.00 0.00 ? 98  PRO A HD2  2  
ATOM 2563  H HD3  . PRO A 1 68 ? 9.536   7.040   0.870   1.00 0.00 ? 98  PRO A HD3  2  
ATOM 2564  N N    . LEU A 1 69 ? 13.428  6.566   -2.879  1.00 0.00 ? 99  LEU A N    2  
ATOM 2565  C CA   . LEU A 1 69 ? 14.400  5.740   -3.586  1.00 0.00 ? 99  LEU A CA   2  
ATOM 2566  C C    . LEU A 1 69 ? 15.095  4.775   -2.630  1.00 0.00 ? 99  LEU A C    2  
ATOM 2567  O O    . LEU A 1 69 ? 15.537  3.699   -3.033  1.00 0.00 ? 99  LEU A O    2  
ATOM 2568  C CB   . LEU A 1 69 ? 15.437  6.622   -4.283  1.00 0.00 ? 99  LEU A CB   2  
ATOM 2569  C CG   . LEU A 1 69 ? 16.045  6.025   -5.554  1.00 0.00 ? 99  LEU A CG   2  
ATOM 2570  C CD1  . LEU A 1 69 ? 15.209  6.396   -6.769  1.00 0.00 ? 99  LEU A CD1  2  
ATOM 2571  C CD2  . LEU A 1 69 ? 17.481  6.495   -5.728  1.00 0.00 ? 99  LEU A CD2  2  
ATOM 2572  H H    . LEU A 1 69 ? 13.527  7.541   -2.897  1.00 0.00 ? 99  LEU A H    2  
ATOM 2573  H HA   . LEU A 1 69 ? 13.868  5.168   -4.331  1.00 0.00 ? 99  LEU A HA   2  
ATOM 2574  H HB2  . LEU A 1 69 ? 14.967  7.560   -4.540  1.00 0.00 ? 99  LEU A HB2  2  
ATOM 2575  H HB3  . LEU A 1 69 ? 16.238  6.818   -3.587  1.00 0.00 ? 99  LEU A HB3  2  
ATOM 2576  H HG   . LEU A 1 69 ? 16.051  4.948   -5.470  1.00 0.00 ? 99  LEU A HG   2  
ATOM 2577  H HD11 . LEU A 1 69 ? 14.941  7.441   -6.717  1.00 0.00 ? 99  LEU A HD11 2  
ATOM 2578  H HD12 . LEU A 1 69 ? 14.312  5.795   -6.786  1.00 0.00 ? 99  LEU A HD12 2  
ATOM 2579  H HD13 . LEU A 1 69 ? 15.780  6.215   -7.668  1.00 0.00 ? 99  LEU A HD13 2  
ATOM 2580  H HD21 . LEU A 1 69 ? 17.486  7.513   -6.087  1.00 0.00 ? 99  LEU A HD21 2  
ATOM 2581  H HD22 . LEU A 1 69 ? 17.983  5.859   -6.442  1.00 0.00 ? 99  LEU A HD22 2  
ATOM 2582  H HD23 . LEU A 1 69 ? 17.994  6.445   -4.779  1.00 0.00 ? 99  LEU A HD23 2  
ATOM 2583  N N    . GLY A 1 70 ? 15.190  5.167   -1.363  1.00 0.00 ? 100 GLY A N    2  
ATOM 2584  C CA   . GLY A 1 70 ? 15.834  4.324   -0.372  1.00 0.00 ? 100 GLY A CA   2  
ATOM 2585  C C    . GLY A 1 70 ? 15.198  2.951   -0.274  1.00 0.00 ? 100 GLY A C    2  
ATOM 2586  O O    . GLY A 1 70 ? 15.895  1.938   -0.238  1.00 0.00 ? 100 GLY A O    2  
ATOM 2587  H H    . GLY A 1 70 ? 14.821  6.035   -1.099  1.00 0.00 ? 100 GLY A H    2  
ATOM 2588  H HA2  . GLY A 1 70 ? 16.874  4.208   -0.635  1.00 0.00 ? 100 GLY A HA2  2  
ATOM 2589  H HA3  . GLY A 1 70 ? 15.769  4.808   0.592   1.00 0.00 ? 100 GLY A HA3  2  
ATOM 2590  N N    . TYR A 1 71 ? 13.870  2.917   -0.230  1.00 0.00 ? 101 TYR A N    2  
ATOM 2591  C CA   . TYR A 1 71 ? 13.140  1.658   -0.135  1.00 0.00 ? 101 TYR A CA   2  
ATOM 2592  C C    . TYR A 1 71 ? 12.440  1.334   -1.451  1.00 0.00 ? 101 TYR A C    2  
ATOM 2593  O O    . TYR A 1 71 ? 11.687  2.150   -1.983  1.00 0.00 ? 101 TYR A O    2  
ATOM 2594  C CB   . TYR A 1 71 ? 12.114  1.724   0.998   1.00 0.00 ? 101 TYR A CB   2  
ATOM 2595  C CG   . TYR A 1 71 ? 12.694  1.409   2.359   1.00 0.00 ? 101 TYR A CG   2  
ATOM 2596  C CD1  . TYR A 1 71 ? 13.532  0.316   2.543   1.00 0.00 ? 101 TYR A CD1  2  
ATOM 2597  C CD2  . TYR A 1 71 ? 12.404  2.206   3.460   1.00 0.00 ? 101 TYR A CD2  2  
ATOM 2598  C CE1  . TYR A 1 71 ? 14.064  0.026   3.785   1.00 0.00 ? 101 TYR A CE1  2  
ATOM 2599  C CE2  . TYR A 1 71 ? 12.932  1.922   4.705   1.00 0.00 ? 101 TYR A CE2  2  
ATOM 2600  C CZ   . TYR A 1 71 ? 13.761  0.831   4.862   1.00 0.00 ? 101 TYR A CZ   2  
ATOM 2601  O OH   . TYR A 1 71 ? 14.288  0.545   6.100   1.00 0.00 ? 101 TYR A OH   2  
ATOM 2602  H H    . TYR A 1 71 ? 13.369  3.759   -0.262  1.00 0.00 ? 101 TYR A H    2  
ATOM 2603  H HA   . TYR A 1 71 ? 13.853  0.877   0.081   1.00 0.00 ? 101 TYR A HA   2  
ATOM 2604  H HB2  . TYR A 1 71 ? 11.696  2.718   1.038   1.00 0.00 ? 101 TYR A HB2  2  
ATOM 2605  H HB3  . TYR A 1 71 ? 11.325  1.013   0.801   1.00 0.00 ? 101 TYR A HB3  2  
ATOM 2606  H HD1  . TYR A 1 71 ? 13.768  -0.313  1.697   1.00 0.00 ? 101 TYR A HD1  2  
ATOM 2607  H HD2  . TYR A 1 71 ? 11.755  3.059   3.333   1.00 0.00 ? 101 TYR A HD2  2  
ATOM 2608  H HE1  . TYR A 1 71 ? 14.713  -0.829  3.907   1.00 0.00 ? 101 TYR A HE1  2  
ATOM 2609  H HE2  . TYR A 1 71 ? 12.695  2.553   5.548   1.00 0.00 ? 101 TYR A HE2  2  
ATOM 2610  H HH   . TYR A 1 71 ? 15.214  0.308   6.007   1.00 0.00 ? 101 TYR A HH   2  
ATOM 2611  N N    . ARG A 1 72 ? 12.696  0.139   -1.973  1.00 0.00 ? 102 ARG A N    2  
ATOM 2612  C CA   . ARG A 1 72 ? 12.091  -0.293  -3.228  1.00 0.00 ? 102 ARG A CA   2  
ATOM 2613  C C    . ARG A 1 72 ? 11.407  -1.647  -3.066  1.00 0.00 ? 102 ARG A C    2  
ATOM 2614  O O    . ARG A 1 72 ? 11.952  -2.559  -2.443  1.00 0.00 ? 102 ARG A O    2  
ATOM 2615  C CB   . ARG A 1 72 ? 13.151  -0.372  -4.328  1.00 0.00 ? 102 ARG A CB   2  
ATOM 2616  C CG   . ARG A 1 72 ? 14.064  0.844   -4.379  1.00 0.00 ? 102 ARG A CG   2  
ATOM 2617  C CD   . ARG A 1 72 ? 14.192  1.390   -5.793  1.00 0.00 ? 102 ARG A CD   2  
ATOM 2618  N NE   . ARG A 1 72 ? 15.554  1.823   -6.092  1.00 0.00 ? 102 ARG A NE   2  
ATOM 2619  C CZ   . ARG A 1 72 ? 15.869  2.644   -7.091  1.00 0.00 ? 102 ARG A CZ   2  
ATOM 2620  N NH1  . ARG A 1 72 ? 14.923  3.123   -7.889  1.00 0.00 ? 102 ARG A NH1  2  
ATOM 2621  N NH2  . ARG A 1 72 ? 17.134  2.987   -7.293  1.00 0.00 ? 102 ARG A NH2  2  
ATOM 2622  H H    . ARG A 1 72 ? 13.306  -0.468  -1.503  1.00 0.00 ? 102 ARG A H    2  
ATOM 2623  H HA   . ARG A 1 72 ? 11.349  0.440   -3.507  1.00 0.00 ? 102 ARG A HA   2  
ATOM 2624  H HB2  . ARG A 1 72 ? 13.762  -1.247  -4.161  1.00 0.00 ? 102 ARG A HB2  2  
ATOM 2625  H HB3  . ARG A 1 72 ? 12.656  -0.466  -5.283  1.00 0.00 ? 102 ARG A HB3  2  
ATOM 2626  H HG2  . ARG A 1 72 ? 13.657  1.615   -3.743  1.00 0.00 ? 102 ARG A HG2  2  
ATOM 2627  H HG3  . ARG A 1 72 ? 15.044  0.561   -4.022  1.00 0.00 ? 102 ARG A HG3  2  
ATOM 2628  H HD2  . ARG A 1 72 ? 13.909  0.616   -6.491  1.00 0.00 ? 102 ARG A HD2  2  
ATOM 2629  H HD3  . ARG A 1 72 ? 13.524  2.232   -5.901  1.00 0.00 ? 102 ARG A HD3  2  
ATOM 2630  H HE   . ARG A 1 72 ? 16.273  1.484   -5.518  1.00 0.00 ? 102 ARG A HE   2  
ATOM 2631  H HH11 . ARG A 1 72 ? 13.967  2.869   -7.742  1.00 0.00 ? 102 ARG A HH11 2  
ATOM 2632  H HH12 . ARG A 1 72 ? 15.166  3.740   -8.638  1.00 0.00 ? 102 ARG A HH12 2  
ATOM 2633  H HH21 . ARG A 1 72 ? 17.851  2.629   -6.695  1.00 0.00 ? 102 ARG A HH21 2  
ATOM 2634  H HH22 . ARG A 1 72 ? 17.371  3.604   -8.044  1.00 0.00 ? 102 ARG A HH22 2  
ATOM 2635  N N    . ILE A 1 73 ? 10.210  -1.770  -3.630  1.00 0.00 ? 103 ILE A N    2  
ATOM 2636  C CA   . ILE A 1 73 ? 9.450   -3.012  -3.548  1.00 0.00 ? 103 ILE A CA   2  
ATOM 2637  C C    . ILE A 1 73 ? 9.762   -3.926  -4.729  1.00 0.00 ? 103 ILE A C    2  
ATOM 2638  O O    . ILE A 1 73 ? 9.532   -3.566  -5.884  1.00 0.00 ? 103 ILE A O    2  
ATOM 2639  C CB   . ILE A 1 73 ? 7.932   -2.740  -3.501  1.00 0.00 ? 103 ILE A CB   2  
ATOM 2640  C CG1  . ILE A 1 73 ? 7.166   -4.038  -3.242  1.00 0.00 ? 103 ILE A CG1  2  
ATOM 2641  C CG2  . ILE A 1 73 ? 7.461   -2.091  -4.796  1.00 0.00 ? 103 ILE A CG2  2  
ATOM 2642  C CD1  . ILE A 1 73 ? 5.701   -3.822  -2.929  1.00 0.00 ? 103 ILE A CD1  2  
ATOM 2643  H H    . ILE A 1 73 ? 9.829   -1.007  -4.112  1.00 0.00 ? 103 ILE A H    2  
ATOM 2644  H HA   . ILE A 1 73 ? 9.732   -3.514  -2.634  1.00 0.00 ? 103 ILE A HA   2  
ATOM 2645  H HB   . ILE A 1 73 ? 7.739   -2.050  -2.694  1.00 0.00 ? 103 ILE A HB   2  
ATOM 2646  H HG12 . ILE A 1 73 ? 7.228   -4.666  -4.117  1.00 0.00 ? 103 ILE A HG12 2  
ATOM 2647  H HG13 . ILE A 1 73 ? 7.614   -4.551  -2.403  1.00 0.00 ? 103 ILE A HG13 2  
ATOM 2648  H HG21 . ILE A 1 73 ? 7.435   -2.832  -5.581  1.00 0.00 ? 103 ILE A HG21 2  
ATOM 2649  H HG22 . ILE A 1 73 ? 8.142   -1.299  -5.071  1.00 0.00 ? 103 ILE A HG22 2  
ATOM 2650  H HG23 . ILE A 1 73 ? 6.472   -1.682  -4.654  1.00 0.00 ? 103 ILE A HG23 2  
ATOM 2651  H HD11 . ILE A 1 73 ? 5.592   -3.549  -1.890  1.00 0.00 ? 103 ILE A HD11 2  
ATOM 2652  H HD12 . ILE A 1 73 ? 5.154   -4.733  -3.121  1.00 0.00 ? 103 ILE A HD12 2  
ATOM 2653  H HD13 . ILE A 1 73 ? 5.313   -3.030  -3.552  1.00 0.00 ? 103 ILE A HD13 2  
ATOM 2654  N N    . ASP A 1 74 ? 10.290  -5.110  -4.432  1.00 0.00 ? 104 ASP A N    2  
ATOM 2655  C CA   . ASP A 1 74 ? 10.635  -6.074  -5.470  1.00 0.00 ? 104 ASP A CA   2  
ATOM 2656  C C    . ASP A 1 74 ? 9.615   -7.208  -5.525  1.00 0.00 ? 104 ASP A C    2  
ATOM 2657  O O    . ASP A 1 74 ? 8.681   -7.255  -4.724  1.00 0.00 ? 104 ASP A O    2  
ATOM 2658  C CB   . ASP A 1 74 ? 12.037  -6.639  -5.224  1.00 0.00 ? 104 ASP A CB   2  
ATOM 2659  C CG   . ASP A 1 74 ? 13.041  -6.161  -6.254  1.00 0.00 ? 104 ASP A CG   2  
ATOM 2660  O OD1  . ASP A 1 74 ? 13.042  -4.952  -6.566  1.00 0.00 ? 104 ASP A OD1  2  
ATOM 2661  O OD2  . ASP A 1 74 ? 13.827  -6.997  -6.749  1.00 0.00 ? 104 ASP A OD2  2  
ATOM 2662  H H    . ASP A 1 74 ? 10.452  -5.339  -3.493  1.00 0.00 ? 104 ASP A H    2  
ATOM 2663  H HA   . ASP A 1 74 ? 10.628  -5.556  -6.417  1.00 0.00 ? 104 ASP A HA   2  
ATOM 2664  H HB2  . ASP A 1 74 ? 12.376  -6.328  -4.247  1.00 0.00 ? 104 ASP A HB2  2  
ATOM 2665  H HB3  . ASP A 1 74 ? 11.997  -7.718  -5.260  1.00 0.00 ? 104 ASP A HB3  2  
ATOM 2666  N N    . ILE A 1 75 ? 9.802   -8.118  -6.475  1.00 0.00 ? 105 ILE A N    2  
ATOM 2667  C CA   . ILE A 1 75 ? 8.899   -9.252  -6.636  1.00 0.00 ? 105 ILE A CA   2  
ATOM 2668  C C    . ILE A 1 75 ? 9.672   -10.570 -6.665  1.00 0.00 ? 105 ILE A C    2  
ATOM 2669  O O    . ILE A 1 75 ? 10.159  -10.988 -7.715  1.00 0.00 ? 105 ILE A O    2  
ATOM 2670  C CB   . ILE A 1 75 ? 8.069   -9.133  -7.931  1.00 0.00 ? 105 ILE A CB   2  
ATOM 2671  C CG1  . ILE A 1 75 ? 7.547   -7.703  -8.104  1.00 0.00 ? 105 ILE A CG1  2  
ATOM 2672  C CG2  . ILE A 1 75 ? 6.917   -10.126 -7.914  1.00 0.00 ? 105 ILE A CG2  2  
ATOM 2673  C CD1  . ILE A 1 75 ? 8.145   -6.983  -9.293  1.00 0.00 ? 105 ILE A CD1  2  
ATOM 2674  H H    . ILE A 1 75 ? 10.565  -8.025  -7.083  1.00 0.00 ? 105 ILE A H    2  
ATOM 2675  H HA   . ILE A 1 75 ? 8.219   -9.260  -5.797  1.00 0.00 ? 105 ILE A HA   2  
ATOM 2676  H HB   . ILE A 1 75 ? 8.709   -9.378  -8.765  1.00 0.00 ? 105 ILE A HB   2  
ATOM 2677  H HG12 . ILE A 1 75 ? 6.476   -7.730  -8.238  1.00 0.00 ? 105 ILE A HG12 2  
ATOM 2678  H HG13 . ILE A 1 75 ? 7.780   -7.131  -7.217  1.00 0.00 ? 105 ILE A HG13 2  
ATOM 2679  H HG21 . ILE A 1 75 ? 6.777   -10.532 -8.905  1.00 0.00 ? 105 ILE A HG21 2  
ATOM 2680  H HG22 . ILE A 1 75 ? 6.014   -9.625  -7.598  1.00 0.00 ? 105 ILE A HG22 2  
ATOM 2681  H HG23 . ILE A 1 75 ? 7.143   -10.928 -7.226  1.00 0.00 ? 105 ILE A HG23 2  
ATOM 2682  H HD11 . ILE A 1 75 ? 8.864   -7.626  -9.779  1.00 0.00 ? 105 ILE A HD11 2  
ATOM 2683  H HD12 . ILE A 1 75 ? 8.637   -6.082  -8.958  1.00 0.00 ? 105 ILE A HD12 2  
ATOM 2684  H HD13 . ILE A 1 75 ? 7.361   -6.727  -9.990  1.00 0.00 ? 105 ILE A HD13 2  
ATOM 2685  N N    . PRO A 1 76 ? 9.796   -11.245 -5.508  1.00 0.00 ? 106 PRO A N    2  
ATOM 2686  C CA   . PRO A 1 76 ? 10.516  -12.519 -5.413  1.00 0.00 ? 106 PRO A CA   2  
ATOM 2687  C C    . PRO A 1 76 ? 9.794   -13.648 -6.141  1.00 0.00 ? 106 PRO A C    2  
ATOM 2688  O O    . PRO A 1 76 ? 8.613   -13.532 -6.471  1.00 0.00 ? 106 PRO A O    2  
ATOM 2689  C CB   . PRO A 1 76 ? 10.560  -12.796 -3.908  1.00 0.00 ? 106 PRO A CB   2  
ATOM 2690  C CG   . PRO A 1 76 ? 9.400   -12.049 -3.350  1.00 0.00 ? 106 PRO A CG   2  
ATOM 2691  C CD   . PRO A 1 76 ? 9.248   -10.822 -4.205  1.00 0.00 ? 106 PRO A CD   2  
ATOM 2692  H HA   . PRO A 1 76 ? 11.522  -12.433 -5.796  1.00 0.00 ? 106 PRO A HA   2  
ATOM 2693  H HB2  . PRO A 1 76 ? 10.470  -13.858 -3.732  1.00 0.00 ? 106 PRO A HB2  2  
ATOM 2694  H HB3  . PRO A 1 76 ? 11.493  -12.436 -3.501  1.00 0.00 ? 106 PRO A HB3  2  
ATOM 2695  H HG2  . PRO A 1 76 ? 8.509   -12.658 -3.406  1.00 0.00 ? 106 PRO A HG2  2  
ATOM 2696  H HG3  . PRO A 1 76 ? 9.600   -11.769 -2.326  1.00 0.00 ? 106 PRO A HG3  2  
ATOM 2697  H HD2  . PRO A 1 76 ? 8.206   -10.551 -4.294  1.00 0.00 ? 106 PRO A HD2  2  
ATOM 2698  H HD3  . PRO A 1 76 ? 9.819   -10.002 -3.795  1.00 0.00 ? 106 PRO A HD3  2  
ATOM 2699  N N    . LYS A 1 77 ? 10.511  -14.740 -6.388  1.00 0.00 ? 107 LYS A N    2  
ATOM 2700  C CA   . LYS A 1 77 ? 9.939   -15.890 -7.077  1.00 0.00 ? 107 LYS A CA   2  
ATOM 2701  C C    . LYS A 1 77 ? 10.944  -17.036 -7.150  1.00 0.00 ? 107 LYS A C    2  
ATOM 2702  O O    . LYS A 1 77 ? 12.089  -16.848 -6.688  1.00 0.00 ? 107 LYS A O    2  
ATOM 2703  C CB   . LYS A 1 77 ? 9.493   -15.498 -8.486  1.00 0.00 ? 107 LYS A CB   2  
ATOM 2704  C CG   . LYS A 1 77 ? 10.632  -15.027 -9.376  1.00 0.00 ? 107 LYS A CG   2  
ATOM 2705  C CD   . LYS A 1 77 ? 10.493  -15.561 -10.793 1.00 0.00 ? 107 LYS A CD   2  
ATOM 2706  C CE   . LYS A 1 77 ? 11.479  -16.687 -11.065 1.00 0.00 ? 107 LYS A CE   2  
ATOM 2707  N NZ   . LYS A 1 77 ? 11.623  -16.960 -12.522 1.00 0.00 ? 107 LYS A NZ   2  
ATOM 2708  O OXT  . LYS A 1 77 ? 10.576  -18.112 -7.667  1.00 0.00 ? 107 LYS A OXT  2  
ATOM 2709  H H    . LYS A 1 77 ? 11.446  -14.772 -6.100  1.00 0.00 ? 107 LYS A H    2  
ATOM 2710  H HA   . LYS A 1 77 ? 9.078   -16.218 -6.514  1.00 0.00 ? 107 LYS A HA   2  
ATOM 2711  H HB2  . LYS A 1 77 ? 9.027   -16.353 -8.955  1.00 0.00 ? 107 LYS A HB2  2  
ATOM 2712  H HB3  . LYS A 1 77 ? 8.769   -14.700 -8.413  1.00 0.00 ? 107 LYS A HB3  2  
ATOM 2713  H HG2  . LYS A 1 77 ? 10.629  -13.948 -9.407  1.00 0.00 ? 107 LYS A HG2  2  
ATOM 2714  H HG3  . LYS A 1 77 ? 11.567  -15.374 -8.959  1.00 0.00 ? 107 LYS A HG3  2  
ATOM 2715  H HD2  . LYS A 1 77 ? 9.490   -15.935 -10.931 1.00 0.00 ? 107 LYS A HD2  2  
ATOM 2716  H HD3  . LYS A 1 77 ? 10.678  -14.757 -11.490 1.00 0.00 ? 107 LYS A HD3  2  
ATOM 2717  H HE2  . LYS A 1 77 ? 12.442  -16.409 -10.664 1.00 0.00 ? 107 LYS A HE2  2  
ATOM 2718  H HE3  . LYS A 1 77 ? 11.129  -17.582 -10.572 1.00 0.00 ? 107 LYS A HE3  2  
ATOM 2719  H HZ1  . LYS A 1 77 ? 10.685  -17.042 -12.964 1.00 0.00 ? 107 LYS A HZ1  2  
ATOM 2720  H HZ2  . LYS A 1 77 ? 12.143  -17.849 -12.669 1.00 0.00 ? 107 LYS A HZ2  2  
ATOM 2721  H HZ3  . LYS A 1 77 ? 12.144  -16.187 -12.981 1.00 0.00 ? 107 LYS A HZ3  2  
ATOM 2722  N N    . ALA B 2 1  ? 8.512   6.326   6.570   1.00 0.00 ? 43  ALA B N    2  
ATOM 2723  C CA   . ALA B 2 1  ? 8.237   7.269   5.456   1.00 0.00 ? 43  ALA B CA   2  
ATOM 2724  C C    . ALA B 2 1  ? 7.011   8.129   5.756   1.00 0.00 ? 43  ALA B C    2  
ATOM 2725  O O    . ALA B 2 1  ? 6.073   7.677   6.413   1.00 0.00 ? 43  ALA B O    2  
ATOM 2726  C CB   . ALA B 2 1  ? 8.039   6.504   4.155   1.00 0.00 ? 43  ALA B CB   2  
ATOM 2727  H H1   . ALA B 2 1  ? 7.881   5.508   6.457   1.00 0.00 ? 43  ALA B H1   2  
ATOM 2728  H H2   . ALA B 2 1  ? 8.323   6.827   7.463   1.00 0.00 ? 43  ALA B H2   2  
ATOM 2729  H H3   . ALA B 2 1  ? 9.510   6.040   6.504   1.00 0.00 ? 43  ALA B H3   2  
ATOM 2730  H HA   . ALA B 2 1  ? 9.095   7.914   5.338   1.00 0.00 ? 43  ALA B HA   2  
ATOM 2731  H HB1  . ALA B 2 1  ? 7.559   5.560   4.363   1.00 0.00 ? 43  ALA B HB1  2  
ATOM 2732  H HB2  . ALA B 2 1  ? 8.999   6.326   3.693   1.00 0.00 ? 43  ALA B HB2  2  
ATOM 2733  H HB3  . ALA B 2 1  ? 7.420   7.084   3.487   1.00 0.00 ? 43  ALA B HB3  2  
ATOM 2734  N N    . PRO B 2 2  ? 7.002   9.385   5.278   1.00 0.00 ? 44  PRO B N    2  
ATOM 2735  C CA   . PRO B 2 2  ? 5.884   10.306  5.500   1.00 0.00 ? 44  PRO B CA   2  
ATOM 2736  C C    . PRO B 2 2  ? 4.657   9.940   4.671   1.00 0.00 ? 44  PRO B C    2  
ATOM 2737  O O    . PRO B 2 2  ? 3.522   10.167  5.090   1.00 0.00 ? 44  PRO B O    2  
ATOM 2738  C CB   . PRO B 2 2  ? 6.446   11.656  5.056   1.00 0.00 ? 44  PRO B CB   2  
ATOM 2739  C CG   . PRO B 2 2  ? 7.485   11.316  4.045   1.00 0.00 ? 44  PRO B CG   2  
ATOM 2740  C CD   . PRO B 2 2  ? 8.081   10.006  4.484   1.00 0.00 ? 44  PRO B CD   2  
ATOM 2741  H HA   . PRO B 2 2  ? 5.611   10.352  6.544   1.00 0.00 ? 44  PRO B HA   2  
ATOM 2742  H HB2  . PRO B 2 2  ? 5.656   12.255  4.627   1.00 0.00 ? 44  PRO B HB2  2  
ATOM 2743  H HB3  . PRO B 2 2  ? 6.875   12.169  5.904   1.00 0.00 ? 44  PRO B HB3  2  
ATOM 2744  H HG2  . PRO B 2 2  ? 7.030   11.213  3.071   1.00 0.00 ? 44  PRO B HG2  2  
ATOM 2745  H HG3  . PRO B 2 2  ? 8.244   12.084  4.025   1.00 0.00 ? 44  PRO B HG3  2  
ATOM 2746  H HD2  . PRO B 2 2  ? 8.326   9.397   3.626   1.00 0.00 ? 44  PRO B HD2  2  
ATOM 2747  H HD3  . PRO B 2 2  ? 8.957   10.175  5.091   1.00 0.00 ? 44  PRO B HD3  2  
ATOM 2748  N N    . GLN B 2 3  ? 4.893   9.367   3.495   1.00 0.00 ? 45  GLN B N    2  
ATOM 2749  C CA   . GLN B 2 3  ? 3.807   8.967   2.611   1.00 0.00 ? 45  GLN B CA   2  
ATOM 2750  C C    . GLN B 2 3  ? 3.166   7.670   3.092   1.00 0.00 ? 45  GLN B C    2  
ATOM 2751  O O    . GLN B 2 3  ? 2.029   7.359   2.737   1.00 0.00 ? 45  GLN B O    2  
ATOM 2752  C CB   . GLN B 2 3  ? 4.319   8.799   1.179   1.00 0.00 ? 45  GLN B CB   2  
ATOM 2753  C CG   . GLN B 2 3  ? 4.195   10.060  0.338   1.00 0.00 ? 45  GLN B CG   2  
ATOM 2754  C CD   . GLN B 2 3  ? 5.541   10.630  -0.063  1.00 0.00 ? 45  GLN B CD   2  
ATOM 2755  O OE1  . GLN B 2 3  ? 6.270   11.175  0.766   1.00 0.00 ? 45  GLN B OE1  2  
ATOM 2756  N NE2  . GLN B 2 3  ? 5.878   10.508  -1.342  1.00 0.00 ? 45  GLN B NE2  2  
ATOM 2757  H H    . GLN B 2 3  ? 5.818   9.206   3.218   1.00 0.00 ? 45  GLN B H    2  
ATOM 2758  H HA   . GLN B 2 3  ? 3.063   9.748   2.629   1.00 0.00 ? 45  GLN B HA   2  
ATOM 2759  H HB2  . GLN B 2 3  ? 5.360   8.515   1.213   1.00 0.00 ? 45  GLN B HB2  2  
ATOM 2760  H HB3  . GLN B 2 3  ? 3.755   8.014   0.697   1.00 0.00 ? 45  GLN B HB3  2  
ATOM 2761  H HG2  . GLN B 2 3  ? 3.639   9.827   -0.558  1.00 0.00 ? 45  GLN B HG2  2  
ATOM 2762  H HG3  . GLN B 2 3  ? 3.660   10.806  0.908   1.00 0.00 ? 45  GLN B HG3  2  
ATOM 2763  H HE21 . GLN B 2 3  ? 5.248   10.063  -1.946  1.00 0.00 ? 45  GLN B HE21 2  
ATOM 2764  H HE22 . GLN B 2 3  ? 6.744   10.867  -1.629  1.00 0.00 ? 45  GLN B HE22 2  
ATOM 2765  N N    . LEU B 2 4  ? 3.898   6.919   3.906   1.00 0.00 ? 46  LEU B N    2  
ATOM 2766  C CA   . LEU B 2 4  ? 3.392   5.663   4.437   1.00 0.00 ? 46  LEU B CA   2  
ATOM 2767  C C    . LEU B 2 4  ? 2.416   5.925   5.577   1.00 0.00 ? 46  LEU B C    2  
ATOM 2768  O O    . LEU B 2 4  ? 1.384   5.264   5.690   1.00 0.00 ? 46  LEU B O    2  
ATOM 2769  C CB   . LEU B 2 4  ? 4.546   4.781   4.920   1.00 0.00 ? 46  LEU B CB   2  
ATOM 2770  C CG   . LEU B 2 4  ? 5.020   3.729   3.915   1.00 0.00 ? 46  LEU B CG   2  
ATOM 2771  C CD1  . LEU B 2 4  ? 6.264   3.022   4.430   1.00 0.00 ? 46  LEU B CD1  2  
ATOM 2772  C CD2  . LEU B 2 4  ? 3.911   2.726   3.633   1.00 0.00 ? 46  LEU B CD2  2  
ATOM 2773  H H    . LEU B 2 4  ? 4.795   7.219   4.157   1.00 0.00 ? 46  LEU B H    2  
ATOM 2774  H HA   . LEU B 2 4  ? 2.869   5.157   3.641   1.00 0.00 ? 46  LEU B HA   2  
ATOM 2775  H HB2  . LEU B 2 4  ? 5.383   5.420   5.163   1.00 0.00 ? 46  LEU B HB2  2  
ATOM 2776  H HB3  . LEU B 2 4  ? 4.232   4.271   5.818   1.00 0.00 ? 46  LEU B HB3  2  
ATOM 2777  H HG   . LEU B 2 4  ? 5.275   4.217   2.986   1.00 0.00 ? 46  LEU B HG   2  
ATOM 2778  H HD11 . LEU B 2 4  ? 6.249   1.990   4.112   1.00 0.00 ? 46  LEU B HD11 2  
ATOM 2779  H HD12 . LEU B 2 4  ? 6.282   3.065   5.509   1.00 0.00 ? 46  LEU B HD12 2  
ATOM 2780  H HD13 . LEU B 2 4  ? 7.144   3.507   4.035   1.00 0.00 ? 46  LEU B HD13 2  
ATOM 2781  H HD21 . LEU B 2 4  ? 3.294   2.614   4.512   1.00 0.00 ? 46  LEU B HD21 2  
ATOM 2782  H HD22 . LEU B 2 4  ? 4.347   1.771   3.376   1.00 0.00 ? 46  LEU B HD22 2  
ATOM 2783  H HD23 . LEU B 2 4  ? 3.307   3.079   2.811   1.00 0.00 ? 46  LEU B HD23 2  
ATOM 2784  N N    . ILE B 2 5  ? 2.745   6.905   6.413   1.00 0.00 ? 47  ILE B N    2  
ATOM 2785  C CA   . ILE B 2 5  ? 1.892   7.266   7.536   1.00 0.00 ? 47  ILE B CA   2  
ATOM 2786  C C    . ILE B 2 5  ? 0.619   7.940   7.040   1.00 0.00 ? 47  ILE B C    2  
ATOM 2787  O O    . ILE B 2 5  ? -0.469  7.706   7.569   1.00 0.00 ? 47  ILE B O    2  
ATOM 2788  C CB   . ILE B 2 5  ? 2.615   8.211   8.516   1.00 0.00 ? 47  ILE B CB   2  
ATOM 2789  C CG1  . ILE B 2 5  ? 3.973   7.628   8.914   1.00 0.00 ? 47  ILE B CG1  2  
ATOM 2790  C CG2  . ILE B 2 5  ? 1.756   8.458   9.747   1.00 0.00 ? 47  ILE B CG2  2  
ATOM 2791  C CD1  . ILE B 2 5  ? 3.871   6.349   9.717   1.00 0.00 ? 47  ILE B CD1  2  
ATOM 2792  H H    . ILE B 2 5  ? 3.577   7.402   6.265   1.00 0.00 ? 47  ILE B H    2  
ATOM 2793  H HA   . ILE B 2 5  ? 1.629   6.360   8.063   1.00 0.00 ? 47  ILE B HA   2  
ATOM 2794  H HB   . ILE B 2 5  ? 2.769   9.157   8.020   1.00 0.00 ? 47  ILE B HB   2  
ATOM 2795  H HG12 . ILE B 2 5  ? 4.541   7.413   8.022   1.00 0.00 ? 47  ILE B HG12 2  
ATOM 2796  H HG13 . ILE B 2 5  ? 4.507   8.353   9.510   1.00 0.00 ? 47  ILE B HG13 2  
ATOM 2797  H HG21 . ILE B 2 5  ? 1.801   7.596   10.397  1.00 0.00 ? 47  ILE B HG21 2  
ATOM 2798  H HG22 . ILE B 2 5  ? 0.733   8.627   9.444   1.00 0.00 ? 47  ILE B HG22 2  
ATOM 2799  H HG23 . ILE B 2 5  ? 2.124   9.326   10.274  1.00 0.00 ? 47  ILE B HG23 2  
ATOM 2800  H HD11 . ILE B 2 5  ? 4.740   5.736   9.530   1.00 0.00 ? 47  ILE B HD11 2  
ATOM 2801  H HD12 . ILE B 2 5  ? 2.981   5.811   9.425   1.00 0.00 ? 47  ILE B HD12 2  
ATOM 2802  H HD13 . ILE B 2 5  ? 3.818   6.588   10.769  1.00 0.00 ? 47  ILE B HD13 2  
ATOM 2803  N N    . MET B 2 6  ? 0.762   8.775   6.014   1.00 0.00 ? 48  MET B N    2  
ATOM 2804  C CA   . MET B 2 6  ? -0.377  9.479   5.440   1.00 0.00 ? 48  MET B CA   2  
ATOM 2805  C C    . MET B 2 6  ? -1.253  8.526   4.635   1.00 0.00 ? 48  MET B C    2  
ATOM 2806  O O    . MET B 2 6  ? -2.455  8.746   4.487   1.00 0.00 ? 48  MET B O    2  
ATOM 2807  C CB   . MET B 2 6  ? 0.101   10.642  4.561   1.00 0.00 ? 48  MET B CB   2  
ATOM 2808  C CG   . MET B 2 6  ? 0.598   10.216  3.188   1.00 0.00 ? 48  MET B CG   2  
ATOM 2809  S SD   . MET B 2 6  ? -0.673  10.355  1.916   1.00 0.00 ? 48  MET B SD   2  
ATOM 2810  C CE   . MET B 2 6  ? 0.075   9.419   0.586   1.00 0.00 ? 48  MET B CE   2  
ATOM 2811  H H    . MET B 2 6  ? 1.655   8.916   5.633   1.00 0.00 ? 48  MET B H    2  
ATOM 2812  H HA   . MET B 2 6  ? -0.960  9.873   6.255   1.00 0.00 ? 48  MET B HA   2  
ATOM 2813  H HB2  . MET B 2 6  ? -0.717  11.333  4.424   1.00 0.00 ? 48  MET B HB2  2  
ATOM 2814  H HB3  . MET B 2 6  ? 0.908   11.151  5.068   1.00 0.00 ? 48  MET B HB3  2  
ATOM 2815  H HG2  . MET B 2 6  ? 1.432   10.844  2.912   1.00 0.00 ? 48  MET B HG2  2  
ATOM 2816  H HG3  . MET B 2 6  ? 0.924   9.189   3.241   1.00 0.00 ? 48  MET B HG3  2  
ATOM 2817  H HE1  . MET B 2 6  ? 1.046   9.062   0.898   1.00 0.00 ? 48  MET B HE1  2  
ATOM 2818  H HE2  . MET B 2 6  ? 0.187   10.053  -0.282  1.00 0.00 ? 48  MET B HE2  2  
ATOM 2819  H HE3  . MET B 2 6  ? -0.555  8.578   0.338   1.00 0.00 ? 48  MET B HE3  2  
ATOM 2820  N N    . LEU B 2 7  ? -0.643  7.465   4.122   1.00 0.00 ? 49  LEU B N    2  
ATOM 2821  C CA   . LEU B 2 7  ? -1.368  6.474   3.337   1.00 0.00 ? 49  LEU B CA   2  
ATOM 2822  C C    . LEU B 2 7  ? -2.341  5.702   4.221   1.00 0.00 ? 49  LEU B C    2  
ATOM 2823  O O    . LEU B 2 7  ? -3.522  5.571   3.897   1.00 0.00 ? 49  LEU B O    2  
ATOM 2824  C CB   . LEU B 2 7  ? -0.390  5.507   2.666   1.00 0.00 ? 49  LEU B CB   2  
ATOM 2825  C CG   . LEU B 2 7  ? 0.106   5.943   1.287   1.00 0.00 ? 49  LEU B CG   2  
ATOM 2826  C CD1  . LEU B 2 7  ? 1.376   5.194   0.915   1.00 0.00 ? 49  LEU B CD1  2  
ATOM 2827  C CD2  . LEU B 2 7  ? -0.974  5.718   0.238   1.00 0.00 ? 49  LEU B CD2  2  
ATOM 2828  H H    . LEU B 2 7  ? 0.316   7.344   4.279   1.00 0.00 ? 49  LEU B H    2  
ATOM 2829  H HA   . LEU B 2 7  ? -1.926  6.996   2.575   1.00 0.00 ? 49  LEU B HA   2  
ATOM 2830  H HB2  . LEU B 2 7  ? 0.467   5.388   3.314   1.00 0.00 ? 49  LEU B HB2  2  
ATOM 2831  H HB3  . LEU B 2 7  ? -0.877  4.549   2.563   1.00 0.00 ? 49  LEU B HB3  2  
ATOM 2832  H HG   . LEU B 2 7  ? 0.336   6.998   1.310   1.00 0.00 ? 49  LEU B HG   2  
ATOM 2833  H HD11 . LEU B 2 7  ? 1.175   4.133   0.889   1.00 0.00 ? 49  LEU B HD11 2  
ATOM 2834  H HD12 . LEU B 2 7  ? 2.142   5.397   1.650   1.00 0.00 ? 49  LEU B HD12 2  
ATOM 2835  H HD13 . LEU B 2 7  ? 1.715   5.520   -0.057  1.00 0.00 ? 49  LEU B HD13 2  
ATOM 2836  H HD21 . LEU B 2 7  ? -0.804  4.773   -0.257  1.00 0.00 ? 49  LEU B HD21 2  
ATOM 2837  H HD22 . LEU B 2 7  ? -0.942  6.516   -0.488  1.00 0.00 ? 49  LEU B HD22 2  
ATOM 2838  H HD23 . LEU B 2 7  ? -1.942  5.705   0.716   1.00 0.00 ? 49  LEU B HD23 2  
ATOM 2839  N N    . ALA B 2 8  ? -1.838  5.199   5.343   1.00 0.00 ? 50  ALA B N    2  
ATOM 2840  C CA   . ALA B 2 8  ? -2.660  4.446   6.279   1.00 0.00 ? 50  ALA B CA   2  
ATOM 2841  C C    . ALA B 2 8  ? -3.752  5.327   6.875   1.00 0.00 ? 50  ALA B C    2  
ATOM 2842  O O    . ALA B 2 8  ? -4.867  4.869   7.123   1.00 0.00 ? 50  ALA B O    2  
ATOM 2843  C CB   . ALA B 2 8  ? -1.797  3.852   7.381   1.00 0.00 ? 50  ALA B CB   2  
ATOM 2844  H H    . ALA B 2 8  ? -0.891  5.340   5.548   1.00 0.00 ? 50  ALA B H    2  
ATOM 2845  H HA   . ALA B 2 8  ? -3.121  3.634   5.737   1.00 0.00 ? 50  ALA B HA   2  
ATOM 2846  H HB1  . ALA B 2 8  ? -1.015  4.550   7.641   1.00 0.00 ? 50  ALA B HB1  2  
ATOM 2847  H HB2  . ALA B 2 8  ? -1.356  2.929   7.035   1.00 0.00 ? 50  ALA B HB2  2  
ATOM 2848  H HB3  . ALA B 2 8  ? -2.408  3.656   8.250   1.00 0.00 ? 50  ALA B HB3  2  
ATOM 2849  N N    . ASN B 2 9  ? -3.424  6.596   7.099   1.00 0.00 ? 51  ASN B N    2  
ATOM 2850  C CA   . ASN B 2 9  ? -4.380  7.541   7.664   1.00 0.00 ? 51  ASN B CA   2  
ATOM 2851  C C    . ASN B 2 9  ? -5.566  7.735   6.726   1.00 0.00 ? 51  ASN B C    2  
ATOM 2852  O O    . ASN B 2 9  ? -6.710  7.836   7.169   1.00 0.00 ? 51  ASN B O    2  
ATOM 2853  C CB   . ASN B 2 9  ? -3.703  8.886   7.935   1.00 0.00 ? 51  ASN B CB   2  
ATOM 2854  C CG   . ASN B 2 9  ? -4.512  9.761   8.872   1.00 0.00 ? 51  ASN B CG   2  
ATOM 2855  O OD1  . ASN B 2 9  ? -4.823  10.909  8.554   1.00 0.00 ? 51  ASN B OD1  2  
ATOM 2856  N ND2  . ASN B 2 9  ? -4.857  9.221   10.035  1.00 0.00 ? 51  ASN B ND2  2  
ATOM 2857  H H    . ASN B 2 9  ? -2.519  6.905   6.879   1.00 0.00 ? 51  ASN B H    2  
ATOM 2858  H HA   . ASN B 2 9  ? -4.738  7.133   8.597   1.00 0.00 ? 51  ASN B HA   2  
ATOM 2859  H HB2  . ASN B 2 9  ? -2.735  8.711   8.381   1.00 0.00 ? 51  ASN B HB2  2  
ATOM 2860  H HB3  . ASN B 2 9  ? -3.574  9.412   7.001   1.00 0.00 ? 51  ASN B HB3  2  
ATOM 2861  H HD21 . ASN B 2 9  ? -4.573  8.302   10.221  1.00 0.00 ? 51  ASN B HD21 2  
ATOM 2862  H HD22 . ASN B 2 9  ? -5.380  9.765   10.661  1.00 0.00 ? 51  ASN B HD22 2  
ATOM 2863  N N    . VAL B 2 10 ? -5.286  7.783   5.428   1.00 0.00 ? 52  VAL B N    2  
ATOM 2864  C CA   . VAL B 2 10 ? -6.330  7.961   4.427   1.00 0.00 ? 52  VAL B CA   2  
ATOM 2865  C C    . VAL B 2 10 ? -7.189  6.708   4.310   1.00 0.00 ? 52  VAL B C    2  
ATOM 2866  O O    . VAL B 2 10 ? -8.379  6.784   4.002   1.00 0.00 ? 52  VAL B O    2  
ATOM 2867  C CB   . VAL B 2 10 ? -5.734  8.297   3.046   1.00 0.00 ? 52  VAL B CB   2  
ATOM 2868  C CG1  . VAL B 2 10 ? -6.836  8.616   2.047   1.00 0.00 ? 52  VAL B CG1  2  
ATOM 2869  C CG2  . VAL B 2 10 ? -4.751  9.454   3.156   1.00 0.00 ? 52  VAL B CG2  2  
ATOM 2870  H H    . VAL B 2 10 ? -4.354  7.694   5.137   1.00 0.00 ? 52  VAL B H    2  
ATOM 2871  H HA   . VAL B 2 10 ? -6.954  8.786   4.739   1.00 0.00 ? 52  VAL B HA   2  
ATOM 2872  H HB   . VAL B 2 10 ? -5.197  7.430   2.689   1.00 0.00 ? 52  VAL B HB   2  
ATOM 2873  H HG11 . VAL B 2 10 ? -6.905  9.686   1.916   1.00 0.00 ? 52  VAL B HG11 2  
ATOM 2874  H HG12 . VAL B 2 10 ? -7.778  8.238   2.417   1.00 0.00 ? 52  VAL B HG12 2  
ATOM 2875  H HG13 . VAL B 2 10 ? -6.609  8.151   1.100   1.00 0.00 ? 52  VAL B HG13 2  
ATOM 2876  H HG21 . VAL B 2 10 ? -5.200  10.348  2.750   1.00 0.00 ? 52  VAL B HG21 2  
ATOM 2877  H HG22 . VAL B 2 10 ? -3.854  9.218   2.602   1.00 0.00 ? 52  VAL B HG22 2  
ATOM 2878  H HG23 . VAL B 2 10 ? -4.500  9.617   4.194   1.00 0.00 ? 52  VAL B HG23 2  
ATOM 2879  N N    . ALA B 2 11 ? -6.582  5.554   4.566   1.00 0.00 ? 53  ALA B N    2  
ATOM 2880  C CA   . ALA B 2 11 ? -7.290  4.289   4.498   1.00 0.00 ? 53  ALA B CA   2  
ATOM 2881  C C    . ALA B 2 11 ? -8.121  4.078   5.754   1.00 0.00 ? 53  ALA B C    2  
ATOM 2882  O O    . ALA B 2 11 ? -9.217  3.519   5.704   1.00 0.00 ? 53  ALA B O    2  
ATOM 2883  C CB   . ALA B 2 11 ? -6.309  3.141   4.309   1.00 0.00 ? 53  ALA B CB   2  
ATOM 2884  H H    . ALA B 2 11 ? -5.639  5.554   4.813   1.00 0.00 ? 53  ALA B H    2  
ATOM 2885  H HA   . ALA B 2 11 ? -7.943  4.321   3.642   1.00 0.00 ? 53  ALA B HA   2  
ATOM 2886  H HB1  . ALA B 2 11 ? -5.409  3.340   4.872   1.00 0.00 ? 53  ALA B HB1  2  
ATOM 2887  H HB2  . ALA B 2 11 ? -6.064  3.046   3.261   1.00 0.00 ? 53  ALA B HB2  2  
ATOM 2888  H HB3  . ALA B 2 11 ? -6.758  2.223   4.658   1.00 0.00 ? 53  ALA B HB3  2  
ATOM 2889  N N    . LEU B 2 12 ? -7.590  4.537   6.882   1.00 0.00 ? 54  LEU B N    2  
ATOM 2890  C CA   . LEU B 2 12 ? -8.275  4.410   8.155   1.00 0.00 ? 54  LEU B CA   2  
ATOM 2891  C C    . LEU B 2 12 ? -9.215  5.589   8.393   1.00 0.00 ? 54  LEU B C    2  
ATOM 2892  O O    . LEU B 2 12 ? -10.136 5.507   9.206   1.00 0.00 ? 54  LEU B O    2  
ATOM 2893  C CB   . LEU B 2 12 ? -7.263  4.306   9.298   1.00 0.00 ? 54  LEU B CB   2  
ATOM 2894  C CG   . LEU B 2 12 ? -6.770  2.891   9.601   1.00 0.00 ? 54  LEU B CG   2  
ATOM 2895  C CD1  . LEU B 2 12 ? -6.222  2.235   8.342   1.00 0.00 ? 54  LEU B CD1  2  
ATOM 2896  C CD2  . LEU B 2 12 ? -5.712  2.920   10.694  1.00 0.00 ? 54  LEU B CD2  2  
ATOM 2897  H H    . LEU B 2 12 ? -6.718  4.973   6.857   1.00 0.00 ? 54  LEU B H    2  
ATOM 2898  H HA   . LEU B 2 12 ? -8.852  3.507   8.116   1.00 0.00 ? 54  LEU B HA   2  
ATOM 2899  H HB2  . LEU B 2 12 ? -6.408  4.918   9.050   1.00 0.00 ? 54  LEU B HB2  2  
ATOM 2900  H HB3  . LEU B 2 12 ? -7.720  4.702   10.192  1.00 0.00 ? 54  LEU B HB3  2  
ATOM 2901  H HG   . LEU B 2 12 ? -7.600  2.295   9.953   1.00 0.00 ? 54  LEU B HG   2  
ATOM 2902  H HD11 . LEU B 2 12 ? -6.966  1.569   7.930   1.00 0.00 ? 54  LEU B HD11 2  
ATOM 2903  H HD12 . LEU B 2 12 ? -5.332  1.673   8.585   1.00 0.00 ? 54  LEU B HD12 2  
ATOM 2904  H HD13 . LEU B 2 12 ? -5.980  2.996   7.615   1.00 0.00 ? 54  LEU B HD13 2  
ATOM 2905  H HD21 . LEU B 2 12 ? -4.754  3.166   10.261  1.00 0.00 ? 54  LEU B HD21 2  
ATOM 2906  H HD22 . LEU B 2 12 ? -5.655  1.950   11.166  1.00 0.00 ? 54  LEU B HD22 2  
ATOM 2907  H HD23 . LEU B 2 12 ? -5.976  3.664   11.431  1.00 0.00 ? 54  LEU B HD23 2  
ATOM 2908  N N    . THR B 2 13 ? -8.975  6.686   7.680   1.00 0.00 ? 55  THR B N    2  
ATOM 2909  C CA   . THR B 2 13 ? -9.798  7.881   7.812   1.00 0.00 ? 55  THR B CA   2  
ATOM 2910  C C    . THR B 2 13 ? -9.433  8.911   6.747   1.00 0.00 ? 55  THR B C    2  
ATOM 2911  O O    . THR B 2 13 ? -8.521  9.716   6.934   1.00 0.00 ? 55  THR B O    2  
ATOM 2912  C CB   . THR B 2 13 ? -9.635  8.490   9.208   1.00 0.00 ? 55  THR B CB   2  
ATOM 2913  O OG1  . THR B 2 13 ? -8.675  7.773   9.964   1.00 0.00 ? 55  THR B OG1  2  
ATOM 2914  C CG2  . THR B 2 13 ? -10.922 8.511   10.004  1.00 0.00 ? 55  THR B CG2  2  
ATOM 2915  H H    . THR B 2 13 ? -8.228  6.691   7.049   1.00 0.00 ? 55  THR B H    2  
ATOM 2916  H HA   . THR B 2 13 ? -10.827 7.589   7.674   1.00 0.00 ? 55  THR B HA   2  
ATOM 2917  H HB   . THR B 2 13 ? -9.293  9.511   9.108   1.00 0.00 ? 55  THR B HB   2  
ATOM 2918  H HG1  . THR B 2 13 ? -7.808  7.885   9.569   1.00 0.00 ? 55  THR B HG1  2  
ATOM 2919  H HG21 . THR B 2 13 ? -11.028 7.581   10.542  1.00 0.00 ? 55  THR B HG21 2  
ATOM 2920  H HG22 . THR B 2 13 ? -11.759 8.636   9.333   1.00 0.00 ? 55  THR B HG22 2  
ATOM 2921  H HG23 . THR B 2 13 ? -10.898 9.332   10.706  1.00 0.00 ? 55  THR B HG23 2  
ATOM 2922  N N    . GLY B 2 14 ? -10.152 8.879   5.629   1.00 0.00 ? 56  GLY B N    2  
ATOM 2923  C CA   . GLY B 2 14 ? -9.889  9.814   4.551   1.00 0.00 ? 56  GLY B CA   2  
ATOM 2924  C C    . GLY B 2 14 ? -10.799 11.026  4.598   1.00 0.00 ? 56  GLY B C    2  
ATOM 2925  O O    . GLY B 2 14 ? -11.131 11.601  3.562   1.00 0.00 ? 56  GLY B O    2  
ATOM 2926  H H    . GLY B 2 14 ? -10.866 8.215   5.536   1.00 0.00 ? 56  GLY B H    2  
ATOM 2927  H HA2  . GLY B 2 14 ? -8.863  10.145  4.619   1.00 0.00 ? 56  GLY B HA2  2  
ATOM 2928  H HA3  . GLY B 2 14 ? -10.031 9.307   3.608   1.00 0.00 ? 56  GLY B HA3  2  
ATOM 2929  N N    . GLU B 2 15 ? -11.203 11.414  5.804   1.00 0.00 ? 57  GLU B N    2  
ATOM 2930  C CA   . GLU B 2 15 ? -12.080 12.565  5.983   1.00 0.00 ? 57  GLU B CA   2  
ATOM 2931  C C    . GLU B 2 15 ? -13.392 12.373  5.230   1.00 0.00 ? 57  GLU B C    2  
ATOM 2932  O O    . GLU B 2 15 ? -13.704 11.218  4.870   1.00 0.00 ? 57  GLU B O    2  
ATOM 2933  C CB   . GLU B 2 15 ? -11.385 13.841  5.503   1.00 0.00 ? 57  GLU B CB   2  
ATOM 2934  C CG   . GLU B 2 15 ? -10.051 14.100  6.183   1.00 0.00 ? 57  GLU B CG   2  
ATOM 2935  C CD   . GLU B 2 15 ? -10.141 15.166  7.257   1.00 0.00 ? 57  GLU B CD   2  
ATOM 2936  O OE1  . GLU B 2 15 ? -10.110 16.365  6.907   1.00 0.00 ? 57  GLU B OE1  2  
ATOM 2937  O OE2  . GLU B 2 15 ? -10.242 14.803  8.448   1.00 0.00 ? 57  GLU B OE2  2  
ATOM 2938  O OXT  . GLU B 2 15 ? -14.098 13.379  5.007   1.00 0.00 ? 57  GLU B OXT  2  
ATOM 2939  H H    . GLU B 2 15 ? -10.903 10.914  6.592   1.00 0.00 ? 57  GLU B H    2  
ATOM 2940  H HA   . GLU B 2 15 ? -12.293 12.658  7.037   1.00 0.00 ? 57  GLU B HA   2  
ATOM 2941  H HB2  . GLU B 2 15 ? -11.214 13.766  4.439   1.00 0.00 ? 57  GLU B HB2  2  
ATOM 2942  H HB3  . GLU B 2 15 ? -12.032 14.684  5.696   1.00 0.00 ? 57  GLU B HB3  2  
ATOM 2943  H HG2  . GLU B 2 15 ? -9.709  13.182  6.638   1.00 0.00 ? 57  GLU B HG2  2  
ATOM 2944  H HG3  . GLU B 2 15 ? -9.337  14.419  5.438   1.00 0.00 ? 57  GLU B HG3  2  
ATOM 2945  N N    . PRO A 1 1  ? 2.673   14.920  -7.175  1.00 0.00 ? 31  PRO A N    3  
ATOM 2946  C CA   . PRO A 1 1  ? 3.310   14.305  -5.980  1.00 0.00 ? 31  PRO A CA   3  
ATOM 2947  C C    . PRO A 1 1  ? 2.338   13.405  -5.218  1.00 0.00 ? 31  PRO A C    3  
ATOM 2948  O O    . PRO A 1 1  ? 1.129   13.636  -5.221  1.00 0.00 ? 31  PRO A O    3  
ATOM 2949  C CB   . PRO A 1 1  ? 3.801   15.439  -5.084  1.00 0.00 ? 31  PRO A CB   3  
ATOM 2950  C CG   . PRO A 1 1  ? 3.267   16.674  -5.728  1.00 0.00 ? 31  PRO A CG   3  
ATOM 2951  C CD   . PRO A 1 1  ? 3.062   16.340  -7.184  1.00 0.00 ? 31  PRO A CD   3  
ATOM 2952  H H2   . PRO A 1 1  ? 1.674   14.685  -7.046  1.00 0.00 ? 31  PRO A H2   3  
ATOM 2953  H H3   . PRO A 1 1  ? 2.997   14.281  -7.936  1.00 0.00 ? 31  PRO A H3   3  
ATOM 2954  H HA   . PRO A 1 1  ? 4.155   13.718  -6.303  1.00 0.00 ? 31  PRO A HA   3  
ATOM 2955  H HB2  . PRO A 1 1  ? 3.410   15.310  -4.084  1.00 0.00 ? 31  PRO A HB2  3  
ATOM 2956  H HB3  . PRO A 1 1  ? 4.880   15.442  -5.058  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 2957  H HG2  . PRO A 1 1  ? 2.327   16.948  -5.271  1.00 0.00 ? 31  PRO A HG2  3  
ATOM 2958  H HG3  . PRO A 1 1  ? 3.982   17.478  -5.625  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 2959  H HD2  . PRO A 1 1  ? 2.274   16.950  -7.603  1.00 0.00 ? 31  PRO A HD2  3  
ATOM 2960  H HD3  . PRO A 1 1  ? 3.981   16.479  -7.736  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 2961  N N    . VAL A 1 2  ? 2.876   12.379  -4.567  1.00 0.00 ? 32  VAL A N    3  
ATOM 2962  C CA   . VAL A 1 2  ? 2.069   11.447  -3.805  1.00 0.00 ? 32  VAL A CA   3  
ATOM 2963  C C    . VAL A 1 2  ? 1.367   12.144  -2.644  1.00 0.00 ? 32  VAL A C    3  
ATOM 2964  O O    . VAL A 1 2  ? 1.847   12.120  -1.511  1.00 0.00 ? 32  VAL A O    3  
ATOM 2965  C CB   . VAL A 1 2  ? 2.936   10.303  -3.258  1.00 0.00 ? 32  VAL A CB   3  
ATOM 2966  C CG1  . VAL A 1 2  ? 3.266   9.306   -4.359  1.00 0.00 ? 32  VAL A CG1  3  
ATOM 2967  C CG2  . VAL A 1 2  ? 4.207   10.844  -2.617  1.00 0.00 ? 32  VAL A CG2  3  
ATOM 2968  H H    . VAL A 1 2  ? 3.842   12.242  -4.598  1.00 0.00 ? 32  VAL A H    3  
ATOM 2969  H HA   . VAL A 1 2  ? 1.326   11.026  -4.466  1.00 0.00 ? 32  VAL A HA   3  
ATOM 2970  H HB   . VAL A 1 2  ? 2.373   9.793   -2.503  1.00 0.00 ? 32  VAL A HB   3  
ATOM 2971  H HG11 . VAL A 1 2  ? 4.279   8.955   -4.235  1.00 0.00 ? 32  VAL A HG11 3  
ATOM 2972  H HG12 . VAL A 1 2  ? 3.168   9.788   -5.321  1.00 0.00 ? 32  VAL A HG12 3  
ATOM 2973  H HG13 . VAL A 1 2  ? 2.586   8.469   -4.304  1.00 0.00 ? 32  VAL A HG13 3  
ATOM 2974  H HG21 . VAL A 1 2  ? 5.029   10.746  -3.310  1.00 0.00 ? 32  VAL A HG21 3  
ATOM 2975  H HG22 . VAL A 1 2  ? 4.424   10.285  -1.719  1.00 0.00 ? 32  VAL A HG22 3  
ATOM 2976  H HG23 . VAL A 1 2  ? 4.067   11.886  -2.369  1.00 0.00 ? 32  VAL A HG23 3  
ATOM 2977  N N    . HIS A 1 3  ? 0.231   12.766  -2.936  1.00 0.00 ? 33  HIS A N    3  
ATOM 2978  C CA   . HIS A 1 3  ? -0.538  13.472  -1.918  1.00 0.00 ? 33  HIS A CA   3  
ATOM 2979  C C    . HIS A 1 3  ? -1.810  12.706  -1.567  1.00 0.00 ? 33  HIS A C    3  
ATOM 2980  O O    . HIS A 1 3  ? -2.028  11.593  -2.045  1.00 0.00 ? 33  HIS A O    3  
ATOM 2981  C CB   . HIS A 1 3  ? -0.892  14.879  -2.402  1.00 0.00 ? 33  HIS A CB   3  
ATOM 2982  C CG   . HIS A 1 3  ? 0.056   15.934  -1.921  1.00 0.00 ? 33  HIS A CG   3  
ATOM 2983  N ND1  . HIS A 1 3  ? 0.037   17.232  -2.385  1.00 0.00 ? 33  HIS A ND1  3  
ATOM 2984  C CD2  . HIS A 1 3  ? 1.056   15.878  -1.009  1.00 0.00 ? 33  HIS A CD2  3  
ATOM 2985  C CE1  . HIS A 1 3  ? 0.984   17.928  -1.781  1.00 0.00 ? 33  HIS A CE1  3  
ATOM 2986  N NE2  . HIS A 1 3  ? 1.616   17.130  -0.941  1.00 0.00 ? 33  HIS A NE2  3  
ATOM 2987  H H    . HIS A 1 3  ? -0.101  12.750  -3.859  1.00 0.00 ? 33  HIS A H    3  
ATOM 2988  H HA   . HIS A 1 3  ? 0.075   13.548  -1.034  1.00 0.00 ? 33  HIS A HA   3  
ATOM 2989  H HB2  . HIS A 1 3  ? -0.883  14.894  -3.482  1.00 0.00 ? 33  HIS A HB2  3  
ATOM 2990  H HB3  . HIS A 1 3  ? -1.882  15.137  -2.052  1.00 0.00 ? 33  HIS A HB3  3  
ATOM 2991  H HD1  . HIS A 1 3  ? -0.579  17.591  -3.058  1.00 0.00 ? 33  HIS A HD1  3  
ATOM 2992  H HD2  . HIS A 1 3  ? 1.357   15.009  -0.440  1.00 0.00 ? 33  HIS A HD2  3  
ATOM 2993  H HE1  . HIS A 1 3  ? 1.202   18.973  -1.946  1.00 0.00 ? 33  HIS A HE1  3  
ATOM 2994  H HE2  . HIS A 1 3  ? 2.416   17.368  -0.429  1.00 0.00 ? 33  HIS A HE2  3  
ATOM 2995  N N    . VAL A 1 4  ? -2.647  13.312  -0.729  1.00 0.00 ? 34  VAL A N    3  
ATOM 2996  C CA   . VAL A 1 4  ? -3.900  12.689  -0.314  1.00 0.00 ? 34  VAL A CA   3  
ATOM 2997  C C    . VAL A 1 4  ? -4.738  12.282  -1.520  1.00 0.00 ? 34  VAL A C    3  
ATOM 2998  O O    . VAL A 1 4  ? -5.451  11.279  -1.483  1.00 0.00 ? 34  VAL A O    3  
ATOM 2999  C CB   . VAL A 1 4  ? -4.728  13.633  0.578   1.00 0.00 ? 34  VAL A CB   3  
ATOM 3000  C CG1  . VAL A 1 4  ? -5.925  12.901  1.164   1.00 0.00 ? 34  VAL A CG1  3  
ATOM 3001  C CG2  . VAL A 1 4  ? -3.861  14.222  1.680   1.00 0.00 ? 34  VAL A CG2  3  
ATOM 3002  H H    . VAL A 1 4  ? -2.418  14.199  -0.383  1.00 0.00 ? 34  VAL A H    3  
ATOM 3003  H HA   . VAL A 1 4  ? -3.658  11.805  0.260   1.00 0.00 ? 34  VAL A HA   3  
ATOM 3004  H HB   . VAL A 1 4  ? -5.095  14.443  -0.035  1.00 0.00 ? 34  VAL A HB   3  
ATOM 3005  H HG11 . VAL A 1 4  ? -6.124  13.274  2.158   1.00 0.00 ? 34  VAL A HG11 3  
ATOM 3006  H HG12 . VAL A 1 4  ? -5.712  11.843  1.212   1.00 0.00 ? 34  VAL A HG12 3  
ATOM 3007  H HG13 . VAL A 1 4  ? -6.790  13.066  0.538   1.00 0.00 ? 34  VAL A HG13 3  
ATOM 3008  H HG21 . VAL A 1 4  ? -3.228  14.994  1.268   1.00 0.00 ? 34  VAL A HG21 3  
ATOM 3009  H HG22 . VAL A 1 4  ? -3.248  13.444  2.111   1.00 0.00 ? 34  VAL A HG22 3  
ATOM 3010  H HG23 . VAL A 1 4  ? -4.493  14.647  2.446   1.00 0.00 ? 34  VAL A HG23 3  
ATOM 3011  N N    . GLU A 1 5  ? -4.647  13.065  -2.590  1.00 0.00 ? 35  GLU A N    3  
ATOM 3012  C CA   . GLU A 1 5  ? -5.395  12.785  -3.809  1.00 0.00 ? 35  GLU A CA   3  
ATOM 3013  C C    . GLU A 1 5  ? -4.886  11.510  -4.475  1.00 0.00 ? 35  GLU A C    3  
ATOM 3014  O O    . GLU A 1 5  ? -5.671  10.674  -4.922  1.00 0.00 ? 35  GLU A O    3  
ATOM 3015  C CB   . GLU A 1 5  ? -5.289  13.961  -4.781  1.00 0.00 ? 35  GLU A CB   3  
ATOM 3016  C CG   . GLU A 1 5  ? -6.447  14.047  -5.761  1.00 0.00 ? 35  GLU A CG   3  
ATOM 3017  C CD   . GLU A 1 5  ? -7.646  14.774  -5.186  1.00 0.00 ? 35  GLU A CD   3  
ATOM 3018  O OE1  . GLU A 1 5  ? -7.443  15.756  -4.440  1.00 0.00 ? 35  GLU A OE1  3  
ATOM 3019  O OE2  . GLU A 1 5  ? -8.788  14.362  -5.479  1.00 0.00 ? 35  GLU A OE2  3  
ATOM 3020  H H    . GLU A 1 5  ? -4.060  13.849  -2.559  1.00 0.00 ? 35  GLU A H    3  
ATOM 3021  H HA   . GLU A 1 5  ? -6.431  12.645  -3.537  1.00 0.00 ? 35  GLU A HA   3  
ATOM 3022  H HB2  . GLU A 1 5  ? -5.256  14.879  -4.215  1.00 0.00 ? 35  GLU A HB2  3  
ATOM 3023  H HB3  . GLU A 1 5  ? -4.374  13.864  -5.346  1.00 0.00 ? 35  GLU A HB3  3  
ATOM 3024  H HG2  . GLU A 1 5  ? -6.116  14.574  -6.644  1.00 0.00 ? 35  GLU A HG2  3  
ATOM 3025  H HG3  . GLU A 1 5  ? -6.748  13.045  -6.033  1.00 0.00 ? 35  GLU A HG3  3  
ATOM 3026  N N    . ASP A 1 6  ? -3.565  11.369  -4.536  1.00 0.00 ? 36  ASP A N    3  
ATOM 3027  C CA   . ASP A 1 6  ? -2.950  10.195  -5.145  1.00 0.00 ? 36  ASP A CA   3  
ATOM 3028  C C    . ASP A 1 6  ? -3.255  8.941   -4.332  1.00 0.00 ? 36  ASP A C    3  
ATOM 3029  O O    . ASP A 1 6  ? -3.503  7.872   -4.890  1.00 0.00 ? 36  ASP A O    3  
ATOM 3030  C CB   . ASP A 1 6  ? -1.437  10.388  -5.260  1.00 0.00 ? 36  ASP A CB   3  
ATOM 3031  C CG   . ASP A 1 6  ? -1.031  10.998  -6.587  1.00 0.00 ? 36  ASP A CG   3  
ATOM 3032  O OD1  . ASP A 1 6  ? -1.723  10.741  -7.595  1.00 0.00 ? 36  ASP A OD1  3  
ATOM 3033  O OD2  . ASP A 1 6  ? -0.022  11.733  -6.618  1.00 0.00 ? 36  ASP A OD2  3  
ATOM 3034  H H    . ASP A 1 6  ? -2.991  12.069  -4.160  1.00 0.00 ? 36  ASP A H    3  
ATOM 3035  H HA   . ASP A 1 6  ? -3.367  10.078  -6.135  1.00 0.00 ? 36  ASP A HA   3  
ATOM 3036  H HB2  . ASP A 1 6  ? -1.102  11.040  -4.467  1.00 0.00 ? 36  ASP A HB2  3  
ATOM 3037  H HB3  . ASP A 1 6  ? -0.951  9.429   -5.161  1.00 0.00 ? 36  ASP A HB3  3  
ATOM 3038  N N    . ALA A 1 7  ? -3.238  9.080   -3.011  1.00 0.00 ? 37  ALA A N    3  
ATOM 3039  C CA   . ALA A 1 7  ? -3.516  7.958   -2.123  1.00 0.00 ? 37  ALA A CA   3  
ATOM 3040  C C    . ALA A 1 7  ? -4.994  7.584   -2.163  1.00 0.00 ? 37  ALA A C    3  
ATOM 3041  O O    . ALA A 1 7  ? -5.352  6.413   -2.031  1.00 0.00 ? 37  ALA A O    3  
ATOM 3042  C CB   . ALA A 1 7  ? -3.092  8.294   -0.701  1.00 0.00 ? 37  ALA A CB   3  
ATOM 3043  H H    . ALA A 1 7  ? -3.036  9.959   -2.625  1.00 0.00 ? 37  ALA A H    3  
ATOM 3044  H HA   . ALA A 1 7  ? -2.931  7.114   -2.459  1.00 0.00 ? 37  ALA A HA   3  
ATOM 3045  H HB1  . ALA A 1 7  ? -3.397  9.303   -0.463  1.00 0.00 ? 37  ALA A HB1  3  
ATOM 3046  H HB2  . ALA A 1 7  ? -2.018  8.215   -0.618  1.00 0.00 ? 37  ALA A HB2  3  
ATOM 3047  H HB3  . ALA A 1 7  ? -3.558  7.605   -0.014  1.00 0.00 ? 37  ALA A HB3  3  
ATOM 3048  N N    . LEU A 1 8  ? -5.848  8.586   -2.344  1.00 0.00 ? 38  LEU A N    3  
ATOM 3049  C CA   . LEU A 1 8  ? -7.286  8.364   -2.402  1.00 0.00 ? 38  LEU A CA   3  
ATOM 3050  C C    . LEU A 1 8  ? -7.660  7.508   -3.608  1.00 0.00 ? 38  LEU A C    3  
ATOM 3051  O O    . LEU A 1 8  ? -8.320  6.478   -3.469  1.00 0.00 ? 38  LEU A O    3  
ATOM 3052  C CB   . LEU A 1 8  ? -8.028  9.704   -2.458  1.00 0.00 ? 38  LEU A CB   3  
ATOM 3053  C CG   . LEU A 1 8  ? -8.991  9.959   -1.296  1.00 0.00 ? 38  LEU A CG   3  
ATOM 3054  C CD1  . LEU A 1 8  ? -9.320  11.439  -1.192  1.00 0.00 ? 38  LEU A CD1  3  
ATOM 3055  C CD2  . LEU A 1 8  ? -10.260 9.138   -1.467  1.00 0.00 ? 38  LEU A CD2  3  
ATOM 3056  H H    . LEU A 1 8  ? -5.501  9.497   -2.441  1.00 0.00 ? 38  LEU A H    3  
ATOM 3057  H HA   . LEU A 1 8  ? -7.574  7.842   -1.502  1.00 0.00 ? 38  LEU A HA   3  
ATOM 3058  H HB2  . LEU A 1 8  ? -7.295  10.497  -2.470  1.00 0.00 ? 38  LEU A HB2  3  
ATOM 3059  H HB3  . LEU A 1 8  ? -8.593  9.743   -3.377  1.00 0.00 ? 38  LEU A HB3  3  
ATOM 3060  H HG   . LEU A 1 8  ? -8.517  9.657   -0.373  1.00 0.00 ? 38  LEU A HG   3  
ATOM 3061  H HD11 . LEU A 1 8  ? -9.994  11.601  -0.364  1.00 0.00 ? 38  LEU A HD11 3  
ATOM 3062  H HD12 . LEU A 1 8  ? -9.791  11.768  -2.107  1.00 0.00 ? 38  LEU A HD12 3  
ATOM 3063  H HD13 . LEU A 1 8  ? -8.412  12.000  -1.033  1.00 0.00 ? 38  LEU A HD13 3  
ATOM 3064  H HD21 . LEU A 1 8  ? -10.788 9.091   -0.526  1.00 0.00 ? 38  LEU A HD21 3  
ATOM 3065  H HD22 . LEU A 1 8  ? -10.002 8.139   -1.785  1.00 0.00 ? 38  LEU A HD22 3  
ATOM 3066  H HD23 . LEU A 1 8  ? -10.891 9.602   -2.211  1.00 0.00 ? 38  LEU A HD23 3  
ATOM 3067  N N    . THR A 1 9  ? -7.237  7.942   -4.791  1.00 0.00 ? 39  THR A N    3  
ATOM 3068  C CA   . THR A 1 9  ? -7.530  7.214   -6.021  1.00 0.00 ? 39  THR A CA   3  
ATOM 3069  C C    . THR A 1 9  ? -6.994  5.787   -5.951  1.00 0.00 ? 39  THR A C    3  
ATOM 3070  O O    . THR A 1 9  ? -7.664  4.840   -6.363  1.00 0.00 ? 39  THR A O    3  
ATOM 3071  C CB   . THR A 1 9  ? -6.931  7.941   -7.230  1.00 0.00 ? 39  THR A CB   3  
ATOM 3072  O OG1  . THR A 1 9  ? -7.557  7.516   -8.427  1.00 0.00 ? 39  THR A OG1  3  
ATOM 3073  C CG2  . THR A 1 9  ? -5.439  7.727   -7.393  1.00 0.00 ? 39  THR A CG2  3  
ATOM 3074  H H    . THR A 1 9  ? -6.716  8.770   -4.839  1.00 0.00 ? 39  THR A H    3  
ATOM 3075  H HA   . THR A 1 9  ? -8.603  7.175   -6.132  1.00 0.00 ? 39  THR A HA   3  
ATOM 3076  H HB   . THR A 1 9  ? -7.102  9.002   -7.117  1.00 0.00 ? 39  THR A HB   3  
ATOM 3077  H HG1  . THR A 1 9  ? -7.625  6.559   -8.432  1.00 0.00 ? 39  THR A HG1  3  
ATOM 3078  H HG21 . THR A 1 9  ? -5.225  6.667   -7.420  1.00 0.00 ? 39  THR A HG21 3  
ATOM 3079  H HG22 . THR A 1 9  ? -4.918  8.177   -6.561  1.00 0.00 ? 39  THR A HG22 3  
ATOM 3080  H HG23 . THR A 1 9  ? -5.108  8.184   -8.314  1.00 0.00 ? 39  THR A HG23 3  
ATOM 3081  N N    . TYR A 1 10 ? -5.779  5.644   -5.431  1.00 0.00 ? 40  TYR A N    3  
ATOM 3082  C CA   . TYR A 1 10 ? -5.148  4.335   -5.313  1.00 0.00 ? 40  TYR A CA   3  
ATOM 3083  C C    . TYR A 1 10 ? -6.064  3.349   -4.594  1.00 0.00 ? 40  TYR A C    3  
ATOM 3084  O O    . TYR A 1 10 ? -6.283  2.233   -5.064  1.00 0.00 ? 40  TYR A O    3  
ATOM 3085  C CB   . TYR A 1 10 ? -3.818  4.447   -4.567  1.00 0.00 ? 40  TYR A CB   3  
ATOM 3086  C CG   . TYR A 1 10 ? -2.995  3.179   -4.603  1.00 0.00 ? 40  TYR A CG   3  
ATOM 3087  C CD1  . TYR A 1 10 ? -2.336  2.789   -5.763  1.00 0.00 ? 40  TYR A CD1  3  
ATOM 3088  C CD2  . TYR A 1 10 ? -2.877  2.371   -3.479  1.00 0.00 ? 40  TYR A CD2  3  
ATOM 3089  C CE1  . TYR A 1 10 ? -1.583  1.631   -5.801  1.00 0.00 ? 40  TYR A CE1  3  
ATOM 3090  C CE2  . TYR A 1 10 ? -2.126  1.210   -3.509  1.00 0.00 ? 40  TYR A CE2  3  
ATOM 3091  C CZ   . TYR A 1 10 ? -1.482  0.845   -4.672  1.00 0.00 ? 40  TYR A CZ   3  
ATOM 3092  O OH   . TYR A 1 10 ? -0.734  -0.309  -4.706  1.00 0.00 ? 40  TYR A OH   3  
ATOM 3093  H H    . TYR A 1 10 ? -5.292  6.438   -5.124  1.00 0.00 ? 40  TYR A H    3  
ATOM 3094  H HA   . TYR A 1 10 ? -4.961  3.974   -6.313  1.00 0.00 ? 40  TYR A HA   3  
ATOM 3095  H HB2  . TYR A 1 10 ? -3.229  5.237   -5.011  1.00 0.00 ? 40  TYR A HB2  3  
ATOM 3096  H HB3  . TYR A 1 10 ? -4.012  4.689   -3.532  1.00 0.00 ? 40  TYR A HB3  3  
ATOM 3097  H HD1  . TYR A 1 10 ? -2.416  3.407   -6.645  1.00 0.00 ? 40  TYR A HD1  3  
ATOM 3098  H HD2  . TYR A 1 10 ? -3.384  2.659   -2.570  1.00 0.00 ? 40  TYR A HD2  3  
ATOM 3099  H HE1  . TYR A 1 10 ? -1.078  1.346   -6.712  1.00 0.00 ? 40  TYR A HE1  3  
ATOM 3100  H HE2  . TYR A 1 10 ? -2.047  0.595   -2.625  1.00 0.00 ? 40  TYR A HE2  3  
ATOM 3101  H HH   . TYR A 1 10 ? 0.039   -0.175  -5.261  1.00 0.00 ? 40  TYR A HH   3  
ATOM 3102  N N    . LEU A 1 11 ? -6.599  3.772   -3.453  1.00 0.00 ? 41  LEU A N    3  
ATOM 3103  C CA   . LEU A 1 11 ? -7.493  2.929   -2.669  1.00 0.00 ? 41  LEU A CA   3  
ATOM 3104  C C    . LEU A 1 11 ? -8.750  2.587   -3.463  1.00 0.00 ? 41  LEU A C    3  
ATOM 3105  O O    . LEU A 1 11 ? -9.261  1.470   -3.382  1.00 0.00 ? 41  LEU A O    3  
ATOM 3106  C CB   . LEU A 1 11 ? -7.875  3.628   -1.363  1.00 0.00 ? 41  LEU A CB   3  
ATOM 3107  C CG   . LEU A 1 11 ? -6.851  3.496   -0.235  1.00 0.00 ? 41  LEU A CG   3  
ATOM 3108  C CD1  . LEU A 1 11 ? -7.243  4.370   0.947   1.00 0.00 ? 41  LEU A CD1  3  
ATOM 3109  C CD2  . LEU A 1 11 ? -6.717  2.044   0.196   1.00 0.00 ? 41  LEU A CD2  3  
ATOM 3110  H H    . LEU A 1 11 ? -6.387  4.674   -3.131  1.00 0.00 ? 41  LEU A H    3  
ATOM 3111  H HA   . LEU A 1 11 ? -6.968  2.014   -2.437  1.00 0.00 ? 41  LEU A HA   3  
ATOM 3112  H HB2  . LEU A 1 11 ? -8.018  4.679   -1.571  1.00 0.00 ? 41  LEU A HB2  3  
ATOM 3113  H HB3  . LEU A 1 11 ? -8.811  3.215   -1.018  1.00 0.00 ? 41  LEU A HB3  3  
ATOM 3114  H HG   . LEU A 1 11 ? -5.887  3.831   -0.592  1.00 0.00 ? 41  LEU A HG   3  
ATOM 3115  H HD11 . LEU A 1 11 ? -6.413  4.438   1.635   1.00 0.00 ? 41  LEU A HD11 3  
ATOM 3116  H HD12 . LEU A 1 11 ? -8.093  3.935   1.449   1.00 0.00 ? 41  LEU A HD12 3  
ATOM 3117  H HD13 . LEU A 1 11 ? -7.500  5.358   0.594   1.00 0.00 ? 41  LEU A HD13 3  
ATOM 3118  H HD21 . LEU A 1 11 ? -6.468  2.001   1.245   1.00 0.00 ? 41  LEU A HD21 3  
ATOM 3119  H HD22 . LEU A 1 11 ? -5.936  1.568   -0.380  1.00 0.00 ? 41  LEU A HD22 3  
ATOM 3120  H HD23 . LEU A 1 11 ? -7.652  1.530   0.026   1.00 0.00 ? 41  LEU A HD23 3  
ATOM 3121  N N    . ASP A 1 12 ? -9.243  3.554   -4.230  1.00 0.00 ? 42  ASP A N    3  
ATOM 3122  C CA   . ASP A 1 12 ? -10.439 3.352   -5.039  1.00 0.00 ? 42  ASP A CA   3  
ATOM 3123  C C    . ASP A 1 12 ? -10.149 2.440   -6.223  1.00 0.00 ? 42  ASP A C    3  
ATOM 3124  O O    . ASP A 1 12 ? -11.024 1.710   -6.690  1.00 0.00 ? 42  ASP A O    3  
ATOM 3125  C CB   . ASP A 1 12 ? -10.982 4.695   -5.532  1.00 0.00 ? 42  ASP A CB   3  
ATOM 3126  C CG   . ASP A 1 12 ? -12.453 4.628   -5.890  1.00 0.00 ? 42  ASP A CG   3  
ATOM 3127  O OD1  . ASP A 1 12 ? -13.195 3.883   -5.214  1.00 0.00 ? 42  ASP A OD1  3  
ATOM 3128  O OD2  . ASP A 1 12 ? -12.865 5.319   -6.845  1.00 0.00 ? 42  ASP A OD2  3  
ATOM 3129  H H    . ASP A 1 12 ? -8.790  4.423   -4.253  1.00 0.00 ? 42  ASP A H    3  
ATOM 3130  H HA   . ASP A 1 12 ? -11.179 2.882   -4.416  1.00 0.00 ? 42  ASP A HA   3  
ATOM 3131  H HB2  . ASP A 1 12 ? -10.852 5.436   -4.758  1.00 0.00 ? 42  ASP A HB2  3  
ATOM 3132  H HB3  . ASP A 1 12 ? -10.429 4.998   -6.411  1.00 0.00 ? 42  ASP A HB3  3  
ATOM 3133  N N    . GLN A 1 13 ? -8.913  2.484   -6.698  1.00 0.00 ? 43  GLN A N    3  
ATOM 3134  C CA   . GLN A 1 13 ? -8.497  1.660   -7.826  1.00 0.00 ? 43  GLN A CA   3  
ATOM 3135  C C    . GLN A 1 13 ? -8.270  0.219   -7.387  1.00 0.00 ? 43  GLN A C    3  
ATOM 3136  O O    . GLN A 1 13 ? -8.457  -0.718  -8.163  1.00 0.00 ? 43  GLN A O    3  
ATOM 3137  C CB   . GLN A 1 13 ? -7.223  2.226   -8.459  1.00 0.00 ? 43  GLN A CB   3  
ATOM 3138  C CG   . GLN A 1 13 ? -7.273  2.283   -9.977  1.00 0.00 ? 43  GLN A CG   3  
ATOM 3139  C CD   . GLN A 1 13 ? -5.908  2.515   -10.596 1.00 0.00 ? 43  GLN A CD   3  
ATOM 3140  O OE1  . GLN A 1 13 ? -5.152  1.573   -10.831 1.00 0.00 ? 43  GLN A OE1  3  
ATOM 3141  N NE2  . GLN A 1 13 ? -5.586  3.776   -10.863 1.00 0.00 ? 43  GLN A NE2  3  
ATOM 3142  H H    . GLN A 1 13 ? -8.265  3.084   -6.277  1.00 0.00 ? 43  GLN A H    3  
ATOM 3143  H HA   . GLN A 1 13 ? -9.289  1.677   -8.554  1.00 0.00 ? 43  GLN A HA   3  
ATOM 3144  H HB2  . GLN A 1 13 ? -7.065  3.227   -8.087  1.00 0.00 ? 43  GLN A HB2  3  
ATOM 3145  H HB3  . GLN A 1 13 ? -6.386  1.609   -8.170  1.00 0.00 ? 43  GLN A HB3  3  
ATOM 3146  H HG2  . GLN A 1 13 ? -7.664  1.347   -10.348 1.00 0.00 ? 43  GLN A HG2  3  
ATOM 3147  H HG3  . GLN A 1 13 ? -7.928  3.090   -10.273 1.00 0.00 ? 43  GLN A HG3  3  
ATOM 3148  H HE21 . GLN A 1 13 ? -6.237  4.475   -10.648 1.00 0.00 ? 43  GLN A HE21 3  
ATOM 3149  H HE22 . GLN A 1 13 ? -4.710  3.955   -11.263 1.00 0.00 ? 43  GLN A HE22 3  
ATOM 3150  N N    . VAL A 1 14 ? -7.870  0.055   -6.135  1.00 0.00 ? 44  VAL A N    3  
ATOM 3151  C CA   . VAL A 1 14 ? -7.618  -1.267  -5.576  1.00 0.00 ? 44  VAL A CA   3  
ATOM 3152  C C    . VAL A 1 14 ? -8.926  -1.955  -5.202  1.00 0.00 ? 44  VAL A C    3  
ATOM 3153  O O    . VAL A 1 14 ? -9.031  -3.180  -5.251  1.00 0.00 ? 44  VAL A O    3  
ATOM 3154  C CB   . VAL A 1 14 ? -6.715  -1.188  -4.330  1.00 0.00 ? 44  VAL A CB   3  
ATOM 3155  C CG1  . VAL A 1 14 ? -6.328  -2.581  -3.858  1.00 0.00 ? 44  VAL A CG1  3  
ATOM 3156  C CG2  . VAL A 1 14 ? -5.476  -0.351  -4.619  1.00 0.00 ? 44  VAL A CG2  3  
ATOM 3157  H H    . VAL A 1 14 ? -7.744  0.845   -5.570  1.00 0.00 ? 44  VAL A H    3  
ATOM 3158  H HA   . VAL A 1 14 ? -7.112  -1.856  -6.326  1.00 0.00 ? 44  VAL A HA   3  
ATOM 3159  H HB   . VAL A 1 14 ? -7.270  -0.706  -3.538  1.00 0.00 ? 44  VAL A HB   3  
ATOM 3160  H HG11 . VAL A 1 14 ? -5.868  -3.122  -4.672  1.00 0.00 ? 44  VAL A HG11 3  
ATOM 3161  H HG12 . VAL A 1 14 ? -7.211  -3.108  -3.530  1.00 0.00 ? 44  VAL A HG12 3  
ATOM 3162  H HG13 . VAL A 1 14 ? -5.630  -2.502  -3.038  1.00 0.00 ? 44  VAL A HG13 3  
ATOM 3163  H HG21 . VAL A 1 14 ? -5.597  0.159   -5.563  1.00 0.00 ? 44  VAL A HG21 3  
ATOM 3164  H HG22 . VAL A 1 14 ? -4.609  -0.993  -4.666  1.00 0.00 ? 44  VAL A HG22 3  
ATOM 3165  H HG23 . VAL A 1 14 ? -5.341  0.378   -3.832  1.00 0.00 ? 44  VAL A HG23 3  
ATOM 3166  N N    . LYS A 1 15 ? -9.922  -1.157  -4.831  1.00 0.00 ? 45  LYS A N    3  
ATOM 3167  C CA   . LYS A 1 15 ? -11.226 -1.686  -4.451  1.00 0.00 ? 45  LYS A CA   3  
ATOM 3168  C C    . LYS A 1 15 ? -11.972 -2.210  -5.674  1.00 0.00 ? 45  LYS A C    3  
ATOM 3169  O O    . LYS A 1 15 ? -12.507 -3.318  -5.660  1.00 0.00 ? 45  LYS A O    3  
ATOM 3170  C CB   . LYS A 1 15 ? -12.057 -0.606  -3.757  1.00 0.00 ? 45  LYS A CB   3  
ATOM 3171  C CG   . LYS A 1 15 ? -13.393 -1.108  -3.234  1.00 0.00 ? 45  LYS A CG   3  
ATOM 3172  C CD   . LYS A 1 15 ? -13.328 -1.421  -1.747  1.00 0.00 ? 45  LYS A CD   3  
ATOM 3173  C CE   . LYS A 1 15 ? -13.889 -0.281  -0.913  1.00 0.00 ? 45  LYS A CE   3  
ATOM 3174  N NZ   . LYS A 1 15 ? -15.365 -0.157  -1.064  1.00 0.00 ? 45  LYS A NZ   3  
ATOM 3175  H H    . LYS A 1 15 ? -9.777  -0.187  -4.814  1.00 0.00 ? 45  LYS A H    3  
ATOM 3176  H HA   . LYS A 1 15 ? -11.066 -2.503  -3.764  1.00 0.00 ? 45  LYS A HA   3  
ATOM 3177  H HB2  . LYS A 1 15 ? -11.492 -0.214  -2.923  1.00 0.00 ? 45  LYS A HB2  3  
ATOM 3178  H HB3  . LYS A 1 15 ? -12.247 0.193   -4.459  1.00 0.00 ? 45  LYS A HB3  3  
ATOM 3179  H HG2  . LYS A 1 15 ? -14.141 -0.347  -3.398  1.00 0.00 ? 45  LYS A HG2  3  
ATOM 3180  H HG3  . LYS A 1 15 ? -13.664 -2.005  -3.771  1.00 0.00 ? 45  LYS A HG3  3  
ATOM 3181  H HD2  . LYS A 1 15 ? -13.903 -2.314  -1.552  1.00 0.00 ? 45  LYS A HD2  3  
ATOM 3182  H HD3  . LYS A 1 15 ? -12.296 -1.586  -1.469  1.00 0.00 ? 45  LYS A HD3  3  
ATOM 3183  H HE2  . LYS A 1 15 ? -13.658 -0.465  0.125   1.00 0.00 ? 45  LYS A HE2  3  
ATOM 3184  H HE3  . LYS A 1 15 ? -13.423 0.641   -1.227  1.00 0.00 ? 45  LYS A HE3  3  
ATOM 3185  H HZ1  . LYS A 1 15 ? -15.837 -0.989  -0.658  1.00 0.00 ? 45  LYS A HZ1  3  
ATOM 3186  H HZ2  . LYS A 1 15 ? -15.616 -0.086  -2.071  1.00 0.00 ? 45  LYS A HZ2  3  
ATOM 3187  H HZ3  . LYS A 1 15 ? -15.704 0.694   -0.574  1.00 0.00 ? 45  LYS A HZ3  3  
ATOM 3188  N N    . ILE A 1 16 ? -11.999 -1.406  -6.734  1.00 0.00 ? 46  ILE A N    3  
ATOM 3189  C CA   . ILE A 1 16 ? -12.676 -1.792  -7.965  1.00 0.00 ? 46  ILE A CA   3  
ATOM 3190  C C    . ILE A 1 16 ? -12.022 -3.025  -8.582  1.00 0.00 ? 46  ILE A C    3  
ATOM 3191  O O    . ILE A 1 16 ? -12.703 -3.980  -8.955  1.00 0.00 ? 46  ILE A O    3  
ATOM 3192  C CB   . ILE A 1 16 ? -12.671 -0.645  -8.995  1.00 0.00 ? 46  ILE A CB   3  
ATOM 3193  C CG1  . ILE A 1 16 ? -13.258 0.627   -8.380  1.00 0.00 ? 46  ILE A CG1  3  
ATOM 3194  C CG2  . ILE A 1 16 ? -13.450 -1.043  -10.241 1.00 0.00 ? 46  ILE A CG2  3  
ATOM 3195  C CD1  . ILE A 1 16 ? -12.869 1.889   -9.116  1.00 0.00 ? 46  ILE A CD1  3  
ATOM 3196  H H    . ILE A 1 16 ? -11.552 -0.537  -6.686  1.00 0.00 ? 46  ILE A H    3  
ATOM 3197  H HA   . ILE A 1 16 ? -13.701 -2.025  -7.722  1.00 0.00 ? 46  ILE A HA   3  
ATOM 3198  H HB   . ILE A 1 16 ? -11.648 -0.456  -9.286  1.00 0.00 ? 46  ILE A HB   3  
ATOM 3199  H HG12 . ILE A 1 16 ? -14.335 0.557   -8.388  1.00 0.00 ? 46  ILE A HG12 3  
ATOM 3200  H HG13 . ILE A 1 16 ? -12.915 0.716   -7.359  1.00 0.00 ? 46  ILE A HG13 3  
ATOM 3201  H HG21 . ILE A 1 16 ? -14.479 -1.240  -9.975  1.00 0.00 ? 46  ILE A HG21 3  
ATOM 3202  H HG22 . ILE A 1 16 ? -13.013 -1.931  -10.672 1.00 0.00 ? 46  ILE A HG22 3  
ATOM 3203  H HG23 . ILE A 1 16 ? -13.413 -0.238  -10.961 1.00 0.00 ? 46  ILE A HG23 3  
ATOM 3204  H HD11 . ILE A 1 16 ? -13.161 1.807   -10.153 1.00 0.00 ? 46  ILE A HD11 3  
ATOM 3205  H HD12 . ILE A 1 16 ? -11.800 2.028   -9.053  1.00 0.00 ? 46  ILE A HD12 3  
ATOM 3206  H HD13 . ILE A 1 16 ? -13.368 2.736   -8.667  1.00 0.00 ? 46  ILE A HD13 3  
ATOM 3207  N N    . ARG A 1 17 ? -10.697 -2.997  -8.685  1.00 0.00 ? 47  ARG A N    3  
ATOM 3208  C CA   . ARG A 1 17 ? -9.952  -4.114  -9.255  1.00 0.00 ? 47  ARG A CA   3  
ATOM 3209  C C    . ARG A 1 17 ? -10.176 -5.385  -8.441  1.00 0.00 ? 47  ARG A C    3  
ATOM 3210  O O    . ARG A 1 17 ? -10.142 -6.492  -8.979  1.00 0.00 ? 47  ARG A O    3  
ATOM 3211  C CB   . ARG A 1 17 ? -8.458  -3.782  -9.310  1.00 0.00 ? 47  ARG A CB   3  
ATOM 3212  C CG   . ARG A 1 17 ? -7.931  -3.585  -10.722 1.00 0.00 ? 47  ARG A CG   3  
ATOM 3213  C CD   . ARG A 1 17 ? -7.839  -4.906  -11.472 1.00 0.00 ? 47  ARG A CD   3  
ATOM 3214  N NE   . ARG A 1 17 ? -8.904  -5.047  -12.463 1.00 0.00 ? 47  ARG A NE   3  
ATOM 3215  C CZ   . ARG A 1 17 ? -8.887  -4.463  -13.658 1.00 0.00 ? 47  ARG A CZ   3  
ATOM 3216  N NH1  . ARG A 1 17 ? -7.863  -3.698  -14.017 1.00 0.00 ? 47  ARG A NH1  3  
ATOM 3217  N NH2  . ARG A 1 17 ? -9.896  -4.644  -14.498 1.00 0.00 ? 47  ARG A NH2  3  
ATOM 3218  H H    . ARG A 1 17 ? -10.209 -2.208  -8.369  1.00 0.00 ? 47  ARG A H    3  
ATOM 3219  H HA   . ARG A 1 17 ? -10.314 -4.274  -10.259 1.00 0.00 ? 47  ARG A HA   3  
ATOM 3220  H HB2  . ARG A 1 17 ? -8.283  -2.871  -8.755  1.00 0.00 ? 47  ARG A HB2  3  
ATOM 3221  H HB3  . ARG A 1 17 ? -7.903  -4.586  -8.850  1.00 0.00 ? 47  ARG A HB3  3  
ATOM 3222  H HG2  . ARG A 1 17 ? -8.598  -2.926  -11.257 1.00 0.00 ? 47  ARG A HG2  3  
ATOM 3223  H HG3  . ARG A 1 17 ? -6.948  -3.142  -10.670 1.00 0.00 ? 47  ARG A HG3  3  
ATOM 3224  H HD2  . ARG A 1 17 ? -6.885  -4.953  -11.976 1.00 0.00 ? 47  ARG A HD2  3  
ATOM 3225  H HD3  . ARG A 1 17 ? -7.911  -5.715  -10.762 1.00 0.00 ? 47  ARG A HD3  3  
ATOM 3226  H HE   . ARG A 1 17 ? -9.672  -5.607  -12.224 1.00 0.00 ? 47  ARG A HE   3  
ATOM 3227  H HH11 . ARG A 1 17 ? -7.098  -3.557  -13.388 1.00 0.00 ? 47  ARG A HH11 3  
ATOM 3228  H HH12 . ARG A 1 17 ? -7.857  -3.262  -14.916 1.00 0.00 ? 47  ARG A HH12 3  
ATOM 3229  H HH21 . ARG A 1 17 ? -10.670 -5.220  -14.234 1.00 0.00 ? 47  ARG A HH21 3  
ATOM 3230  H HH22 . ARG A 1 17 ? -9.884  -4.205  -15.397 1.00 0.00 ? 47  ARG A HH22 3  
ATOM 3231  N N    . PHE A 1 18 ? -10.406 -5.216  -7.143  1.00 0.00 ? 48  PHE A N    3  
ATOM 3232  C CA   . PHE A 1 18 ? -10.637 -6.349  -6.253  1.00 0.00 ? 48  PHE A CA   3  
ATOM 3233  C C    . PHE A 1 18 ? -11.993 -6.229  -5.562  1.00 0.00 ? 48  PHE A C    3  
ATOM 3234  O O    . PHE A 1 18 ? -12.118 -6.497  -4.367  1.00 0.00 ? 48  PHE A O    3  
ATOM 3235  C CB   . PHE A 1 18 ? -9.523  -6.436  -5.208  1.00 0.00 ? 48  PHE A CB   3  
ATOM 3236  C CG   . PHE A 1 18 ? -8.184  -6.797  -5.785  1.00 0.00 ? 48  PHE A CG   3  
ATOM 3237  C CD1  . PHE A 1 18 ? -7.959  -8.058  -6.311  1.00 0.00 ? 48  PHE A CD1  3  
ATOM 3238  C CD2  . PHE A 1 18 ? -7.151  -5.874  -5.799  1.00 0.00 ? 48  PHE A CD2  3  
ATOM 3239  C CE1  . PHE A 1 18 ? -6.728  -8.393  -6.843  1.00 0.00 ? 48  PHE A CE1  3  
ATOM 3240  C CE2  . PHE A 1 18 ? -5.917  -6.203  -6.329  1.00 0.00 ? 48  PHE A CE2  3  
ATOM 3241  C CZ   . PHE A 1 18 ? -5.706  -7.464  -6.851  1.00 0.00 ? 48  PHE A CZ   3  
ATOM 3242  H H    . PHE A 1 18 ? -10.421 -4.309  -6.774  1.00 0.00 ? 48  PHE A H    3  
ATOM 3243  H HA   . PHE A 1 18 ? -10.629 -7.248  -6.850  1.00 0.00 ? 48  PHE A HA   3  
ATOM 3244  H HB2  . PHE A 1 18 ? -9.426  -5.480  -4.715  1.00 0.00 ? 48  PHE A HB2  3  
ATOM 3245  H HB3  . PHE A 1 18 ? -9.784  -7.187  -4.476  1.00 0.00 ? 48  PHE A HB3  3  
ATOM 3246  H HD1  . PHE A 1 18 ? -8.758  -8.785  -6.305  1.00 0.00 ? 48  PHE A HD1  3  
ATOM 3247  H HD2  . PHE A 1 18 ? -7.315  -4.888  -5.391  1.00 0.00 ? 48  PHE A HD2  3  
ATOM 3248  H HE1  . PHE A 1 18 ? -6.566  -9.380  -7.251  1.00 0.00 ? 48  PHE A HE1  3  
ATOM 3249  H HE2  . PHE A 1 18 ? -5.120  -5.475  -6.335  1.00 0.00 ? 48  PHE A HE2  3  
ATOM 3250  H HZ   . PHE A 1 18 ? -4.743  -7.724  -7.266  1.00 0.00 ? 48  PHE A HZ   3  
ATOM 3251  N N    . GLY A 1 19 ? -13.004 -5.825  -6.325  1.00 0.00 ? 49  GLY A N    3  
ATOM 3252  C CA   . GLY A 1 19 ? -14.338 -5.674  -5.771  1.00 0.00 ? 49  GLY A CA   3  
ATOM 3253  C C    . GLY A 1 19 ? -14.857 -6.956  -5.147  1.00 0.00 ? 49  GLY A C    3  
ATOM 3254  O O    . GLY A 1 19 ? -15.406 -6.940  -4.046  1.00 0.00 ? 49  GLY A O    3  
ATOM 3255  H H    . GLY A 1 19 ? -12.844 -5.625  -7.271  1.00 0.00 ? 49  GLY A H    3  
ATOM 3256  H HA2  . GLY A 1 19 ? -14.317 -4.903  -5.015  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 3257  H HA3  . GLY A 1 19 ? -15.011 -5.373  -6.559  1.00 0.00 ? 49  GLY A HA3  3  
ATOM 3258  N N    . SER A 1 20 ? -14.684 -8.069  -5.853  1.00 0.00 ? 50  SER A N    3  
ATOM 3259  C CA   . SER A 1 20 ? -15.139 -9.363  -5.362  1.00 0.00 ? 50  SER A CA   3  
ATOM 3260  C C    . SER A 1 20 ? -13.992 -10.139 -4.722  1.00 0.00 ? 50  SER A C    3  
ATOM 3261  O O    . SER A 1 20 ? -13.993 -11.369 -4.708  1.00 0.00 ? 50  SER A O    3  
ATOM 3262  C CB   . SER A 1 20 ? -15.748 -10.180 -6.503  1.00 0.00 ? 50  SER A CB   3  
ATOM 3263  O OG   . SER A 1 20 ? -14.738 -10.782 -7.294  1.00 0.00 ? 50  SER A OG   3  
ATOM 3264  H H    . SER A 1 20 ? -14.238 -8.018  -6.725  1.00 0.00 ? 50  SER A H    3  
ATOM 3265  H HA   . SER A 1 20 ? -15.898 -9.185  -4.615  1.00 0.00 ? 50  SER A HA   3  
ATOM 3266  H HB2  . SER A 1 20 ? -16.377 -10.955 -6.093  1.00 0.00 ? 50  SER A HB2  3  
ATOM 3267  H HB3  . SER A 1 20 ? -16.341 -9.530  -7.131  1.00 0.00 ? 50  SER A HB3  3  
ATOM 3268  H HG   . SER A 1 20 ? -14.112 -10.114 -7.580  1.00 0.00 ? 50  SER A HG   3  
ATOM 3269  N N    . ASP A 1 21 ? -13.015 -9.411  -4.188  1.00 0.00 ? 51  ASP A N    3  
ATOM 3270  C CA   . ASP A 1 21 ? -11.868 -10.027 -3.545  1.00 0.00 ? 51  ASP A CA   3  
ATOM 3271  C C    . ASP A 1 21 ? -11.468 -9.257  -2.288  1.00 0.00 ? 51  ASP A C    3  
ATOM 3272  O O    . ASP A 1 21 ? -10.391 -8.663  -2.228  1.00 0.00 ? 51  ASP A O    3  
ATOM 3273  C CB   . ASP A 1 21 ? -10.689 -10.101 -4.517  1.00 0.00 ? 51  ASP A CB   3  
ATOM 3274  C CG   . ASP A 1 21 ? -9.610  -11.057 -4.046  1.00 0.00 ? 51  ASP A CG   3  
ATOM 3275  O OD1  . ASP A 1 21 ? -8.830  -10.676 -3.149  1.00 0.00 ? 51  ASP A OD1  3  
ATOM 3276  O OD2  . ASP A 1 21 ? -9.547  -12.188 -4.574  1.00 0.00 ? 51  ASP A OD2  3  
ATOM 3277  H H    . ASP A 1 21 ? -13.070 -8.440  -4.225  1.00 0.00 ? 51  ASP A H    3  
ATOM 3278  H HA   . ASP A 1 21 ? -12.154 -11.022 -3.265  1.00 0.00 ? 51  ASP A HA   3  
ATOM 3279  H HB2  . ASP A 1 21 ? -11.044 -10.437 -5.480  1.00 0.00 ? 51  ASP A HB2  3  
ATOM 3280  H HB3  . ASP A 1 21 ? -10.253 -9.118  -4.622  1.00 0.00 ? 51  ASP A HB3  3  
ATOM 3281  N N    . PRO A 1 22 ? -12.337 -9.255  -1.263  1.00 0.00 ? 52  PRO A N    3  
ATOM 3282  C CA   . PRO A 1 22 ? -12.071 -8.552  -0.002  1.00 0.00 ? 52  PRO A CA   3  
ATOM 3283  C C    . PRO A 1 22 ? -10.729 -8.941  0.611   1.00 0.00 ? 52  PRO A C    3  
ATOM 3284  O O    . PRO A 1 22 ? -10.154 -8.188  1.396   1.00 0.00 ? 52  PRO A O    3  
ATOM 3285  C CB   . PRO A 1 22 ? -13.221 -8.997  0.905   1.00 0.00 ? 52  PRO A CB   3  
ATOM 3286  C CG   . PRO A 1 22 ? -14.318 -9.377  -0.029  1.00 0.00 ? 52  PRO A CG   3  
ATOM 3287  C CD   . PRO A 1 22 ? -13.645 -9.937  -1.250  1.00 0.00 ? 52  PRO A CD   3  
ATOM 3288  H HA   . PRO A 1 22 ? -12.107 -7.481  -0.133  1.00 0.00 ? 52  PRO A HA   3  
ATOM 3289  H HB2  . PRO A 1 22 ? -12.905 -9.837  1.507   1.00 0.00 ? 52  PRO A HB2  3  
ATOM 3290  H HB3  . PRO A 1 22 ? -13.515 -8.180  1.547   1.00 0.00 ? 52  PRO A HB3  3  
ATOM 3291  H HG2  . PRO A 1 22 ? -14.948 -10.125 0.429   1.00 0.00 ? 52  PRO A HG2  3  
ATOM 3292  H HG3  . PRO A 1 22 ? -14.898 -8.503  -0.288  1.00 0.00 ? 52  PRO A HG3  3  
ATOM 3293  H HD2  . PRO A 1 22 ? -13.522 -11.006 -1.157  1.00 0.00 ? 52  PRO A HD2  3  
ATOM 3294  H HD3  . PRO A 1 22 ? -14.213 -9.696  -2.137  1.00 0.00 ? 52  PRO A HD3  3  
ATOM 3295  N N    . ALA A 1 23 ? -10.234 -10.122 0.250   1.00 0.00 ? 53  ALA A N    3  
ATOM 3296  C CA   . ALA A 1 23 ? -8.960  -10.610 0.767   1.00 0.00 ? 53  ALA A CA   3  
ATOM 3297  C C    . ALA A 1 23 ? -7.840  -9.603  0.521   1.00 0.00 ? 53  ALA A C    3  
ATOM 3298  O O    . ALA A 1 23 ? -6.976  -9.400  1.374   1.00 0.00 ? 53  ALA A O    3  
ATOM 3299  C CB   . ALA A 1 23 ? -8.613  -11.950 0.136   1.00 0.00 ? 53  ALA A CB   3  
ATOM 3300  H H    . ALA A 1 23 ? -10.738 -10.680 -0.379  1.00 0.00 ? 53  ALA A H    3  
ATOM 3301  H HA   . ALA A 1 23 ? -9.068  -10.759 1.832   1.00 0.00 ? 53  ALA A HA   3  
ATOM 3302  H HB1  . ALA A 1 23 ? -9.064  -12.015 -0.843  1.00 0.00 ? 53  ALA A HB1  3  
ATOM 3303  H HB2  . ALA A 1 23 ? -8.989  -12.749 0.760   1.00 0.00 ? 53  ALA A HB2  3  
ATOM 3304  H HB3  . ALA A 1 23 ? -7.541  -12.038 0.045   1.00 0.00 ? 53  ALA A HB3  3  
ATOM 3305  N N    . THR A 1 24 ? -7.861  -8.977  -0.651  1.00 0.00 ? 54  THR A N    3  
ATOM 3306  C CA   . THR A 1 24 ? -6.847  -7.991  -1.008  1.00 0.00 ? 54  THR A CA   3  
ATOM 3307  C C    . THR A 1 24 ? -7.106  -6.662  -0.305  1.00 0.00 ? 54  THR A C    3  
ATOM 3308  O O    . THR A 1 24 ? -6.192  -6.057  0.257   1.00 0.00 ? 54  THR A O    3  
ATOM 3309  C CB   . THR A 1 24 ? -6.821  -7.781  -2.523  1.00 0.00 ? 54  THR A CB   3  
ATOM 3310  O OG1  . THR A 1 24 ? -6.974  -9.016  -3.202  1.00 0.00 ? 54  THR A OG1  3  
ATOM 3311  C CG2  . THR A 1 24 ? -5.541  -7.141  -3.017  1.00 0.00 ? 54  THR A CG2  3  
ATOM 3312  H H    . THR A 1 24 ? -8.575  -9.181  -1.290  1.00 0.00 ? 54  THR A H    3  
ATOM 3313  H HA   . THR A 1 24 ? -5.888  -8.371  -0.690  1.00 0.00 ? 54  THR A HA   3  
ATOM 3314  H HB   . THR A 1 24 ? -7.642  -7.137  -2.801  1.00 0.00 ? 54  THR A HB   3  
ATOM 3315  H HG1  . THR A 1 24 ? -6.953  -8.864  -4.150  1.00 0.00 ? 54  THR A HG1  3  
ATOM 3316  H HG21 . THR A 1 24 ? -5.048  -6.642  -2.197  1.00 0.00 ? 54  THR A HG21 3  
ATOM 3317  H HG22 . THR A 1 24 ? -5.774  -6.422  -3.789  1.00 0.00 ? 54  THR A HG22 3  
ATOM 3318  H HG23 . THR A 1 24 ? -4.890  -7.903  -3.420  1.00 0.00 ? 54  THR A HG23 3  
ATOM 3319  N N    . TYR A 1 25 ? -8.357  -6.214  -0.341  1.00 0.00 ? 55  TYR A N    3  
ATOM 3320  C CA   . TYR A 1 25 ? -8.735  -4.955  0.294   1.00 0.00 ? 55  TYR A CA   3  
ATOM 3321  C C    . TYR A 1 25 ? -8.501  -5.013  1.800   1.00 0.00 ? 55  TYR A C    3  
ATOM 3322  O O    . TYR A 1 25 ? -7.851  -4.137  2.370   1.00 0.00 ? 55  TYR A O    3  
ATOM 3323  C CB   . TYR A 1 25 ? -10.204 -4.638  0.007   1.00 0.00 ? 55  TYR A CB   3  
ATOM 3324  C CG   . TYR A 1 25 ? -10.600 -3.221  0.363   1.00 0.00 ? 55  TYR A CG   3  
ATOM 3325  C CD1  . TYR A 1 25 ? -10.010 -2.136  -0.273  1.00 0.00 ? 55  TYR A CD1  3  
ATOM 3326  C CD2  . TYR A 1 25 ? -11.562 -2.971  1.332   1.00 0.00 ? 55  TYR A CD2  3  
ATOM 3327  C CE1  . TYR A 1 25 ? -10.368 -0.841  0.050   1.00 0.00 ? 55  TYR A CE1  3  
ATOM 3328  C CE2  . TYR A 1 25 ? -11.926 -1.678  1.660   1.00 0.00 ? 55  TYR A CE2  3  
ATOM 3329  C CZ   . TYR A 1 25 ? -11.326 -0.617  1.016   1.00 0.00 ? 55  TYR A CZ   3  
ATOM 3330  O OH   . TYR A 1 25 ? -11.685 0.672   1.339   1.00 0.00 ? 55  TYR A OH   3  
ATOM 3331  H H    . TYR A 1 25 ? -9.041  -6.740  -0.804  1.00 0.00 ? 55  TYR A H    3  
ATOM 3332  H HA   . TYR A 1 25 ? -8.120  -4.175  -0.125  1.00 0.00 ? 55  TYR A HA   3  
ATOM 3333  H HB2  . TYR A 1 25 ? -10.397 -4.780  -1.046  1.00 0.00 ? 55  TYR A HB2  3  
ATOM 3334  H HB3  . TYR A 1 25 ? -10.829 -5.311  0.576   1.00 0.00 ? 55  TYR A HB3  3  
ATOM 3335  H HD1  . TYR A 1 25 ? -9.260  -2.314  -1.029  1.00 0.00 ? 55  TYR A HD1  3  
ATOM 3336  H HD2  . TYR A 1 25 ? -12.030 -3.805  1.835   1.00 0.00 ? 55  TYR A HD2  3  
ATOM 3337  H HE1  . TYR A 1 25 ? -9.898  -0.009  -0.454  1.00 0.00 ? 55  TYR A HE1  3  
ATOM 3338  H HE2  . TYR A 1 25 ? -12.676 -1.504  2.417   1.00 0.00 ? 55  TYR A HE2  3  
ATOM 3339  H HH   . TYR A 1 25 ? -12.632 0.713   1.484   1.00 0.00 ? 55  TYR A HH   3  
ATOM 3340  N N    . ASN A 1 26 ? -9.036  -6.049  2.438   1.00 0.00 ? 56  ASN A N    3  
ATOM 3341  C CA   . ASN A 1 26 ? -8.885  -6.221  3.879   1.00 0.00 ? 56  ASN A CA   3  
ATOM 3342  C C    . ASN A 1 26 ? -7.413  -6.317  4.266   1.00 0.00 ? 56  ASN A C    3  
ATOM 3343  O O    . ASN A 1 26 ? -6.979  -5.714  5.248   1.00 0.00 ? 56  ASN A O    3  
ATOM 3344  C CB   . ASN A 1 26 ? -9.630  -7.472  4.344   1.00 0.00 ? 56  ASN A CB   3  
ATOM 3345  C CG   . ASN A 1 26 ? -11.083 -7.193  4.673   1.00 0.00 ? 56  ASN A CG   3  
ATOM 3346  O OD1  . ASN A 1 26 ? -11.853 -6.764  3.814   1.00 0.00 ? 56  ASN A OD1  3  
ATOM 3347  N ND2  . ASN A 1 26 ? -11.466 -7.437  5.921   1.00 0.00 ? 56  ASN A ND2  3  
ATOM 3348  H H    . ASN A 1 26 ? -9.544  -6.714  1.928   1.00 0.00 ? 56  ASN A H    3  
ATOM 3349  H HA   . ASN A 1 26 ? -9.317  -5.356  4.361   1.00 0.00 ? 56  ASN A HA   3  
ATOM 3350  H HB2  . ASN A 1 26 ? -9.593  -8.218  3.564   1.00 0.00 ? 56  ASN A HB2  3  
ATOM 3351  H HB3  . ASN A 1 26 ? -9.147  -7.861  5.230   1.00 0.00 ? 56  ASN A HB3  3  
ATOM 3352  H HD21 . ASN A 1 26 ? -10.797 -7.778  6.551   1.00 0.00 ? 56  ASN A HD21 3  
ATOM 3353  H HD22 . ASN A 1 26 ? -12.400 -7.265  6.160   1.00 0.00 ? 56  ASN A HD22 3  
ATOM 3354  N N    . GLY A 1 27 ? -6.649  -7.077  3.489   1.00 0.00 ? 57  GLY A N    3  
ATOM 3355  C CA   . GLY A 1 27 ? -5.234  -7.237  3.769   1.00 0.00 ? 57  GLY A CA   3  
ATOM 3356  C C    . GLY A 1 27 ? -4.480  -5.923  3.711   1.00 0.00 ? 57  GLY A C    3  
ATOM 3357  O O    . GLY A 1 27 ? -3.711  -5.602  4.618   1.00 0.00 ? 57  GLY A O    3  
ATOM 3358  H H    . GLY A 1 27 ? -7.050  -7.534  2.720   1.00 0.00 ? 57  GLY A H    3  
ATOM 3359  H HA2  . GLY A 1 27 ? -5.119  -7.663  4.755   1.00 0.00 ? 57  GLY A HA2  3  
ATOM 3360  H HA3  . GLY A 1 27 ? -4.810  -7.916  3.044   1.00 0.00 ? 57  GLY A HA3  3  
ATOM 3361  N N    . PHE A 1 28 ? -4.699  -5.164  2.643   1.00 0.00 ? 58  PHE A N    3  
ATOM 3362  C CA   . PHE A 1 28 ? -4.034  -3.877  2.470   1.00 0.00 ? 58  PHE A CA   3  
ATOM 3363  C C    . PHE A 1 28 ? -4.367  -2.932  3.621   1.00 0.00 ? 58  PHE A C    3  
ATOM 3364  O O    . PHE A 1 28 ? -3.554  -2.088  3.999   1.00 0.00 ? 58  PHE A O    3  
ATOM 3365  C CB   . PHE A 1 28 ? -4.443  -3.243  1.140   1.00 0.00 ? 58  PHE A CB   3  
ATOM 3366  C CG   . PHE A 1 28 ? -3.587  -2.074  0.744   1.00 0.00 ? 58  PHE A CG   3  
ATOM 3367  C CD1  . PHE A 1 28 ? -2.204  -2.176  0.752   1.00 0.00 ? 58  PHE A CD1  3  
ATOM 3368  C CD2  . PHE A 1 28 ? -4.164  -0.873  0.365   1.00 0.00 ? 58  PHE A CD2  3  
ATOM 3369  C CE1  . PHE A 1 28 ? -1.414  -1.102  0.390   1.00 0.00 ? 58  PHE A CE1  3  
ATOM 3370  C CE2  . PHE A 1 28 ? -3.379  0.206   0.001   1.00 0.00 ? 58  PHE A CE2  3  
ATOM 3371  C CZ   . PHE A 1 28 ? -2.002  0.090   0.013   1.00 0.00 ? 58  PHE A CZ   3  
ATOM 3372  H H    . PHE A 1 28 ? -5.324  -5.475  1.955   1.00 0.00 ? 58  PHE A H    3  
ATOM 3373  H HA   . PHE A 1 28 ? -2.969  -4.053  2.462   1.00 0.00 ? 58  PHE A HA   3  
ATOM 3374  H HB2  . PHE A 1 28 ? -4.372  -3.985  0.358   1.00 0.00 ? 58  PHE A HB2  3  
ATOM 3375  H HB3  . PHE A 1 28 ? -5.465  -2.899  1.212   1.00 0.00 ? 58  PHE A HB3  3  
ATOM 3376  H HD1  . PHE A 1 28 ? -1.745  -3.107  1.047   1.00 0.00 ? 58  PHE A HD1  3  
ATOM 3377  H HD2  . PHE A 1 28 ? -5.240  -0.781  0.355   1.00 0.00 ? 58  PHE A HD2  3  
ATOM 3378  H HE1  . PHE A 1 28 ? -0.338  -1.195  0.401   1.00 0.00 ? 58  PHE A HE1  3  
ATOM 3379  H HE2  . PHE A 1 28 ? -3.841  1.136   -0.293  1.00 0.00 ? 58  PHE A HE2  3  
ATOM 3380  H HZ   . PHE A 1 28 ? -1.387  0.930   -0.271  1.00 0.00 ? 58  PHE A HZ   3  
ATOM 3381  N N    . LEU A 1 29 ? -5.569  -3.079  4.171   1.00 0.00 ? 59  LEU A N    3  
ATOM 3382  C CA   . LEU A 1 29 ? -6.010  -2.239  5.279   1.00 0.00 ? 59  LEU A CA   3  
ATOM 3383  C C    . LEU A 1 29 ? -5.247  -2.574  6.555   1.00 0.00 ? 59  LEU A C    3  
ATOM 3384  O O    . LEU A 1 29 ? -4.771  -1.683  7.258   1.00 0.00 ? 59  LEU A O    3  
ATOM 3385  C CB   . LEU A 1 29 ? -7.513  -2.413  5.509   1.00 0.00 ? 59  LEU A CB   3  
ATOM 3386  C CG   . LEU A 1 29 ? -8.407  -1.514  4.653   1.00 0.00 ? 59  LEU A CG   3  
ATOM 3387  C CD1  . LEU A 1 29 ? -9.847  -2.002  4.693   1.00 0.00 ? 59  LEU A CD1  3  
ATOM 3388  C CD2  . LEU A 1 29 ? -8.318  -0.071  5.125   1.00 0.00 ? 59  LEU A CD2  3  
ATOM 3389  H H    . LEU A 1 29 ? -6.172  -3.770  3.825   1.00 0.00 ? 59  LEU A H    3  
ATOM 3390  H HA   . LEU A 1 29 ? -5.812  -1.211  5.014   1.00 0.00 ? 59  LEU A HA   3  
ATOM 3391  H HB2  . LEU A 1 29 ? -7.770  -3.442  5.304   1.00 0.00 ? 59  LEU A HB2  3  
ATOM 3392  H HB3  . LEU A 1 29 ? -7.722  -2.206  6.548   1.00 0.00 ? 59  LEU A HB3  3  
ATOM 3393  H HG   . LEU A 1 29 ? -8.070  -1.554  3.628   1.00 0.00 ? 59  LEU A HG   3  
ATOM 3394  H HD11 . LEU A 1 29 ? -10.390 -1.591  3.855   1.00 0.00 ? 59  LEU A HD11 3  
ATOM 3395  H HD12 . LEU A 1 29 ? -10.311 -1.682  5.615   1.00 0.00 ? 59  LEU A HD12 3  
ATOM 3396  H HD13 . LEU A 1 29 ? -9.863  -3.081  4.638   1.00 0.00 ? 59  LEU A HD13 3  
ATOM 3397  H HD21 . LEU A 1 29 ? -8.145  -0.051  6.191   1.00 0.00 ? 59  LEU A HD21 3  
ATOM 3398  H HD22 . LEU A 1 29 ? -9.243  0.438   4.901   1.00 0.00 ? 59  LEU A HD22 3  
ATOM 3399  H HD23 . LEU A 1 29 ? -7.503  0.424   4.618   1.00 0.00 ? 59  LEU A HD23 3  
ATOM 3400  N N    . GLU A 1 30 ? -5.135  -3.865  6.850   1.00 0.00 ? 60  GLU A N    3  
ATOM 3401  C CA   . GLU A 1 30 ? -4.430  -4.319  8.044   1.00 0.00 ? 60  GLU A CA   3  
ATOM 3402  C C    . GLU A 1 30 ? -2.971  -3.876  8.017   1.00 0.00 ? 60  GLU A C    3  
ATOM 3403  O O    . GLU A 1 30 ? -2.406  -3.506  9.046   1.00 0.00 ? 60  GLU A O    3  
ATOM 3404  C CB   . GLU A 1 30 ? -4.510  -5.842  8.160   1.00 0.00 ? 60  GLU A CB   3  
ATOM 3405  C CG   . GLU A 1 30 ? -3.980  -6.380  9.480   1.00 0.00 ? 60  GLU A CG   3  
ATOM 3406  C CD   . GLU A 1 30 ? -5.005  -7.214  10.224  1.00 0.00 ? 60  GLU A CD   3  
ATOM 3407  O OE1  . GLU A 1 30 ? -5.973  -6.630  10.755  1.00 0.00 ? 60  GLU A OE1  3  
ATOM 3408  O OE2  . GLU A 1 30 ? -4.839  -8.451  10.276  1.00 0.00 ? 60  GLU A OE2  3  
ATOM 3409  H H    . GLU A 1 30 ? -5.537  -4.529  6.251   1.00 0.00 ? 60  GLU A H    3  
ATOM 3410  H HA   . GLU A 1 30 ? -4.913  -3.876  8.901   1.00 0.00 ? 60  GLU A HA   3  
ATOM 3411  H HB2  . GLU A 1 30 ? -5.541  -6.145  8.059   1.00 0.00 ? 60  GLU A HB2  3  
ATOM 3412  H HB3  . GLU A 1 30 ? -3.935  -6.283  7.359   1.00 0.00 ? 60  GLU A HB3  3  
ATOM 3413  H HG2  . GLU A 1 30 ? -3.115  -6.995  9.281   1.00 0.00 ? 60  GLU A HG2  3  
ATOM 3414  H HG3  . GLU A 1 30 ? -3.693  -5.546  10.103  1.00 0.00 ? 60  GLU A HG3  3  
ATOM 3415  N N    . ILE A 1 31 ? -2.366  -3.916  6.834   1.00 0.00 ? 61  ILE A N    3  
ATOM 3416  C CA   . ILE A 1 31 ? -0.972  -3.520  6.674   1.00 0.00 ? 61  ILE A CA   3  
ATOM 3417  C C    . ILE A 1 31 ? -0.788  -2.031  6.957   1.00 0.00 ? 61  ILE A C    3  
ATOM 3418  O O    . ILE A 1 31 ? 0.073   -1.642  7.745   1.00 0.00 ? 61  ILE A O    3  
ATOM 3419  C CB   . ILE A 1 31 ? -0.460  -3.830  5.252   1.00 0.00 ? 61  ILE A CB   3  
ATOM 3420  C CG1  . ILE A 1 31 ? -0.722  -5.296  4.902   1.00 0.00 ? 61  ILE A CG1  3  
ATOM 3421  C CG2  . ILE A 1 31 ? 1.024   -3.511  5.138   1.00 0.00 ? 61  ILE A CG2  3  
ATOM 3422  C CD1  . ILE A 1 31 ? -0.914  -5.539  3.422   1.00 0.00 ? 61  ILE A CD1  3  
ATOM 3423  H H    . ILE A 1 31 ? -2.870  -4.221  6.050   1.00 0.00 ? 61  ILE A H    3  
ATOM 3424  H HA   . ILE A 1 31 ? -0.382  -4.086  7.378   1.00 0.00 ? 61  ILE A HA   3  
ATOM 3425  H HB   . ILE A 1 31 ? -0.993  -3.200  4.556   1.00 0.00 ? 61  ILE A HB   3  
ATOM 3426  H HG12 . ILE A 1 31 ? 0.117   -5.892  5.229   1.00 0.00 ? 61  ILE A HG12 3  
ATOM 3427  H HG13 . ILE A 1 31 ? -1.613  -5.628  5.413   1.00 0.00 ? 61  ILE A HG13 3  
ATOM 3428  H HG21 . ILE A 1 31 ? 1.481   -3.569  6.115   1.00 0.00 ? 61  ILE A HG21 3  
ATOM 3429  H HG22 . ILE A 1 31 ? 1.149   -2.514  4.742   1.00 0.00 ? 61  ILE A HG22 3  
ATOM 3430  H HG23 . ILE A 1 31 ? 1.495   -4.223  4.476   1.00 0.00 ? 61  ILE A HG23 3  
ATOM 3431  H HD11 . ILE A 1 31 ? -1.969  -5.609  3.202   1.00 0.00 ? 61  ILE A HD11 3  
ATOM 3432  H HD12 . ILE A 1 31 ? -0.427  -6.461  3.142   1.00 0.00 ? 61  ILE A HD12 3  
ATOM 3433  H HD13 . ILE A 1 31 ? -0.484  -4.721  2.863   1.00 0.00 ? 61  ILE A HD13 3  
ATOM 3434  N N    . MET A 1 32 ? -1.603  -1.205  6.310   1.00 0.00 ? 62  MET A N    3  
ATOM 3435  C CA   . MET A 1 32 ? -1.529  0.240   6.494   1.00 0.00 ? 62  MET A CA   3  
ATOM 3436  C C    . MET A 1 32 ? -1.948  0.630   7.908   1.00 0.00 ? 62  MET A C    3  
ATOM 3437  O O    . MET A 1 32 ? -1.332  1.494   8.533   1.00 0.00 ? 62  MET A O    3  
ATOM 3438  C CB   . MET A 1 32 ? -2.416  0.952   5.471   1.00 0.00 ? 62  MET A CB   3  
ATOM 3439  C CG   . MET A 1 32 ? -2.160  0.518   4.037   1.00 0.00 ? 62  MET A CG   3  
ATOM 3440  S SD   . MET A 1 32 ? -0.804  1.425   3.269   1.00 0.00 ? 62  MET A SD   3  
ATOM 3441  C CE   . MET A 1 32 ? 0.476   0.173   3.252   1.00 0.00 ? 62  MET A CE   3  
ATOM 3442  H H    . MET A 1 32 ? -2.269  -1.575  5.695   1.00 0.00 ? 62  MET A H    3  
ATOM 3443  H HA   . MET A 1 32 ? -0.504  0.540   6.339   1.00 0.00 ? 62  MET A HA   3  
ATOM 3444  H HB2  . MET A 1 32 ? -3.450  0.750   5.707   1.00 0.00 ? 62  MET A HB2  3  
ATOM 3445  H HB3  . MET A 1 32 ? -2.241  2.016   5.540   1.00 0.00 ? 62  MET A HB3  3  
ATOM 3446  H HG2  . MET A 1 32 ? -1.920  -0.534  4.031   1.00 0.00 ? 62  MET A HG2  3  
ATOM 3447  H HG3  . MET A 1 32 ? -3.058  0.684   3.460   1.00 0.00 ? 62  MET A HG3  3  
ATOM 3448  H HE1  . MET A 1 32 ? 0.527   -0.302  4.220   1.00 0.00 ? 62  MET A HE1  3  
ATOM 3449  H HE2  . MET A 1 32 ? 1.426   0.632   3.025   1.00 0.00 ? 62  MET A HE2  3  
ATOM 3450  H HE3  . MET A 1 32 ? 0.245   -0.568  2.500   1.00 0.00 ? 62  MET A HE3  3  
ATOM 3451  N N    . LYS A 1 33 ? -2.998  -0.013  8.407   1.00 0.00 ? 63  LYS A N    3  
ATOM 3452  C CA   . LYS A 1 33 ? -3.501  0.266   9.747   1.00 0.00 ? 63  LYS A CA   3  
ATOM 3453  C C    . LYS A 1 33 ? -2.511  -0.205  10.808  1.00 0.00 ? 63  LYS A C    3  
ATOM 3454  O O    . LYS A 1 33 ? -2.414  0.383   11.885  1.00 0.00 ? 63  LYS A O    3  
ATOM 3455  C CB   . LYS A 1 33 ? -4.855  -0.413  9.957   1.00 0.00 ? 63  LYS A CB   3  
ATOM 3456  C CG   . LYS A 1 33 ? -5.456  -0.163  11.331  1.00 0.00 ? 63  LYS A CG   3  
ATOM 3457  C CD   . LYS A 1 33 ? -6.863  -0.732  11.438  1.00 0.00 ? 63  LYS A CD   3  
ATOM 3458  C CE   . LYS A 1 33 ? -7.910  0.371   11.495  1.00 0.00 ? 63  LYS A CE   3  
ATOM 3459  N NZ   . LYS A 1 33 ? -8.495  0.513   12.857  1.00 0.00 ? 63  LYS A NZ   3  
ATOM 3460  H H    . LYS A 1 33 ? -3.447  -0.691  7.860   1.00 0.00 ? 63  LYS A H    3  
ATOM 3461  H HA   . LYS A 1 33 ? -3.626  1.335   9.838   1.00 0.00 ? 63  LYS A HA   3  
ATOM 3462  H HB2  . LYS A 1 33 ? -5.547  -0.048  9.213   1.00 0.00 ? 63  LYS A HB2  3  
ATOM 3463  H HB3  . LYS A 1 33 ? -4.734  -1.479  9.830   1.00 0.00 ? 63  LYS A HB3  3  
ATOM 3464  H HG2  . LYS A 1 33 ? -4.832  -0.633  12.077  1.00 0.00 ? 63  LYS A HG2  3  
ATOM 3465  H HG3  . LYS A 1 33 ? -5.492  0.902   11.508  1.00 0.00 ? 63  LYS A HG3  3  
ATOM 3466  H HD2  . LYS A 1 33 ? -7.057  -1.353  10.577  1.00 0.00 ? 63  LYS A HD2  3  
ATOM 3467  H HD3  . LYS A 1 33 ? -6.932  -1.327  12.337  1.00 0.00 ? 63  LYS A HD3  3  
ATOM 3468  H HE2  . LYS A 1 33 ? -7.447  1.305   11.212  1.00 0.00 ? 63  LYS A HE2  3  
ATOM 3469  H HE3  . LYS A 1 33 ? -8.699  0.135   10.796  1.00 0.00 ? 63  LYS A HE3  3  
ATOM 3470  H HZ1  . LYS A 1 33 ? -8.690  -0.425  13.261  1.00 0.00 ? 63  LYS A HZ1  3  
ATOM 3471  H HZ2  . LYS A 1 33 ? -9.383  1.051   12.809  1.00 0.00 ? 63  LYS A HZ2  3  
ATOM 3472  H HZ3  . LYS A 1 33 ? -7.831  1.015   13.480  1.00 0.00 ? 63  LYS A HZ3  3  
ATOM 3473  N N    . GLU A 1 34 ? -1.781  -1.270  10.498  1.00 0.00 ? 64  GLU A N    3  
ATOM 3474  C CA   . GLU A 1 34 ? -0.799  -1.821  11.426  1.00 0.00 ? 64  GLU A CA   3  
ATOM 3475  C C    . GLU A 1 34 ? 0.448   -0.946  11.483  1.00 0.00 ? 64  GLU A C    3  
ATOM 3476  O O    . GLU A 1 34 ? 1.074   -0.810  12.535  1.00 0.00 ? 64  GLU A O    3  
ATOM 3477  C CB   . GLU A 1 34 ? -0.420  -3.244  11.014  1.00 0.00 ? 64  GLU A CB   3  
ATOM 3478  C CG   . GLU A 1 34 ? -1.412  -4.298  11.480  1.00 0.00 ? 64  GLU A CG   3  
ATOM 3479  C CD   . GLU A 1 34 ? -1.260  -4.631  12.951  1.00 0.00 ? 64  GLU A CD   3  
ATOM 3480  O OE1  . GLU A 1 34 ? -1.828  -3.898  13.788  1.00 0.00 ? 64  GLU A OE1  3  
ATOM 3481  O OE2  . GLU A 1 34 ? -0.571  -5.624  13.266  1.00 0.00 ? 64  GLU A OE2  3  
ATOM 3482  H H    . GLU A 1 34 ? -1.904  -1.697  9.623   1.00 0.00 ? 64  GLU A H    3  
ATOM 3483  H HA   . GLU A 1 34 ? -1.251  -1.848  12.406  1.00 0.00 ? 64  GLU A HA   3  
ATOM 3484  H HB2  . GLU A 1 34 ? -0.358  -3.290  9.936   1.00 0.00 ? 64  GLU A HB2  3  
ATOM 3485  H HB3  . GLU A 1 34 ? 0.548   -3.481  11.431  1.00 0.00 ? 64  GLU A HB3  3  
ATOM 3486  H HG2  . GLU A 1 34 ? -2.413  -3.930  11.312  1.00 0.00 ? 64  GLU A HG2  3  
ATOM 3487  H HG3  . GLU A 1 34 ? -1.258  -5.197  10.904  1.00 0.00 ? 64  GLU A HG3  3  
ATOM 3488  N N    . PHE A 1 35 ? 0.807   -0.357  10.347  1.00 0.00 ? 65  PHE A N    3  
ATOM 3489  C CA   . PHE A 1 35 ? 1.982   0.504   10.271  1.00 0.00 ? 65  PHE A CA   3  
ATOM 3490  C C    . PHE A 1 35 ? 1.804   1.750   11.133  1.00 0.00 ? 65  PHE A C    3  
ATOM 3491  O O    . PHE A 1 35 ? 2.615   2.025   12.017  1.00 0.00 ? 65  PHE A O    3  
ATOM 3492  C CB   . PHE A 1 35 ? 2.255   0.907   8.821   1.00 0.00 ? 65  PHE A CB   3  
ATOM 3493  C CG   . PHE A 1 35 ? 3.652   1.410   8.592   1.00 0.00 ? 65  PHE A CG   3  
ATOM 3494  C CD1  . PHE A 1 35 ? 4.693   0.524   8.365   1.00 0.00 ? 65  PHE A CD1  3  
ATOM 3495  C CD2  . PHE A 1 35 ? 3.924   2.768   8.606   1.00 0.00 ? 65  PHE A CD2  3  
ATOM 3496  C CE1  . PHE A 1 35 ? 5.979   0.983   8.155   1.00 0.00 ? 65  PHE A CE1  3  
ATOM 3497  C CE2  . PHE A 1 35 ? 5.209   3.233   8.396   1.00 0.00 ? 65  PHE A CE2  3  
ATOM 3498  C CZ   . PHE A 1 35 ? 6.237   2.340   8.171   1.00 0.00 ? 65  PHE A CZ   3  
ATOM 3499  H H    . PHE A 1 35 ? 0.269   -0.503  9.541   1.00 0.00 ? 65  PHE A H    3  
ATOM 3500  H HA   . PHE A 1 35 ? 2.827   -0.057  10.643  1.00 0.00 ? 65  PHE A HA   3  
ATOM 3501  H HB2  . PHE A 1 35 ? 2.101   0.051   8.182   1.00 0.00 ? 65  PHE A HB2  3  
ATOM 3502  H HB3  . PHE A 1 35 ? 1.567   1.691   8.537   1.00 0.00 ? 65  PHE A HB3  3  
ATOM 3503  H HD1  . PHE A 1 35 ? 4.492   -0.538  8.352   1.00 0.00 ? 65  PHE A HD1  3  
ATOM 3504  H HD2  . PHE A 1 35 ? 3.120   3.468   8.782   1.00 0.00 ? 65  PHE A HD2  3  
ATOM 3505  H HE1  . PHE A 1 35 ? 6.781   0.282   7.978   1.00 0.00 ? 65  PHE A HE1  3  
ATOM 3506  H HE2  . PHE A 1 35 ? 5.407   4.295   8.409   1.00 0.00 ? 65  PHE A HE2  3  
ATOM 3507  H HZ   . PHE A 1 35 ? 7.241   2.701   8.007   1.00 0.00 ? 65  PHE A HZ   3  
ATOM 3508  N N    . LYS A 1 36 ? 0.738   2.501   10.871  1.00 0.00 ? 66  LYS A N    3  
ATOM 3509  C CA   . LYS A 1 36 ? 0.457   3.716   11.625  1.00 0.00 ? 66  LYS A CA   3  
ATOM 3510  C C    . LYS A 1 36 ? 0.327   3.414   13.115  1.00 0.00 ? 66  LYS A C    3  
ATOM 3511  O O    . LYS A 1 36 ? 0.745   4.207   13.959  1.00 0.00 ? 66  LYS A O    3  
ATOM 3512  C CB   . LYS A 1 36 ? -0.823  4.380   11.114  1.00 0.00 ? 66  LYS A CB   3  
ATOM 3513  C CG   . LYS A 1 36 ? -2.006  3.427   11.011  1.00 0.00 ? 66  LYS A CG   3  
ATOM 3514  C CD   . LYS A 1 36 ? -3.155  3.856   11.913  1.00 0.00 ? 66  LYS A CD   3  
ATOM 3515  C CE   . LYS A 1 36 ? -3.554  2.749   12.877  1.00 0.00 ? 66  LYS A CE   3  
ATOM 3516  N NZ   . LYS A 1 36 ? -4.551  3.216   13.879  1.00 0.00 ? 66  LYS A NZ   3  
ATOM 3517  H H    . LYS A 1 36 ? 0.127   2.229   10.154  1.00 0.00 ? 66  LYS A H    3  
ATOM 3518  H HA   . LYS A 1 36 ? 1.285   4.394   11.481  1.00 0.00 ? 66  LYS A HA   3  
ATOM 3519  H HB2  . LYS A 1 36 ? -1.090  5.183   11.784  1.00 0.00 ? 66  LYS A HB2  3  
ATOM 3520  H HB3  . LYS A 1 36 ? -0.633  4.791   10.133  1.00 0.00 ? 66  LYS A HB3  3  
ATOM 3521  H HG2  . LYS A 1 36 ? -2.353  3.412   9.989   1.00 0.00 ? 66  LYS A HG2  3  
ATOM 3522  H HG3  . LYS A 1 36 ? -1.683  2.438   11.298  1.00 0.00 ? 66  LYS A HG3  3  
ATOM 3523  H HD2  . LYS A 1 36 ? -2.853  4.722   12.483  1.00 0.00 ? 66  LYS A HD2  3  
ATOM 3524  H HD3  . LYS A 1 36 ? -4.007  4.108   11.298  1.00 0.00 ? 66  LYS A HD3  3  
ATOM 3525  H HE2  . LYS A 1 36 ? -3.980  1.934   12.312  1.00 0.00 ? 66  LYS A HE2  3  
ATOM 3526  H HE3  . LYS A 1 36 ? -2.669  2.405   13.394  1.00 0.00 ? 66  LYS A HE3  3  
ATOM 3527  H HZ1  . LYS A 1 36 ? -5.085  4.026   13.502  1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 3528  H HZ2  . LYS A 1 36 ? -4.069  3.508   14.753  1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 3529  H HZ3  . LYS A 1 36 ? -5.218  2.451   14.104  1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 3530  N N    . SER A 1 37 ? -0.251  2.259   13.428  1.00 0.00 ? 67  SER A N    3  
ATOM 3531  C CA   . SER A 1 37 ? -0.433  1.846   14.814  1.00 0.00 ? 67  SER A CA   3  
ATOM 3532  C C    . SER A 1 37 ? 0.908   1.559   15.486  1.00 0.00 ? 67  SER A C    3  
ATOM 3533  O O    . SER A 1 37 ? 0.982   1.424   16.708  1.00 0.00 ? 67  SER A O    3  
ATOM 3534  C CB   . SER A 1 37 ? -1.328  0.607   14.884  1.00 0.00 ? 67  SER A CB   3  
ATOM 3535  O OG   . SER A 1 37 ? -2.021  0.548   16.119  1.00 0.00 ? 67  SER A OG   3  
ATOM 3536  H H    . SER A 1 37 ? -0.560  1.670   12.712  1.00 0.00 ? 67  SER A H    3  
ATOM 3537  H HA   . SER A 1 37 ? -0.917  2.656   15.336  1.00 0.00 ? 67  SER A HA   3  
ATOM 3538  H HB2  . SER A 1 37 ? -2.049  0.640   14.082  1.00 0.00 ? 67  SER A HB2  3  
ATOM 3539  H HB3  . SER A 1 37 ? -0.718  -0.279  14.784  1.00 0.00 ? 67  SER A HB3  3  
ATOM 3540  H HG   . SER A 1 37 ? -2.386  1.412   16.323  1.00 0.00 ? 67  SER A HG   3  
ATOM 3541  N N    . GLN A 1 38 ? 1.969   1.461   14.683  1.00 0.00 ? 68  GLN A N    3  
ATOM 3542  C CA   . GLN A 1 38 ? 3.306   1.188   15.204  1.00 0.00 ? 68  GLN A CA   3  
ATOM 3543  C C    . GLN A 1 38 ? 3.439   -0.276  15.612  1.00 0.00 ? 68  GLN A C    3  
ATOM 3544  O O    . GLN A 1 38 ? 3.967   -0.591  16.679  1.00 0.00 ? 68  GLN A O    3  
ATOM 3545  C CB   . GLN A 1 38 ? 3.618   2.097   16.397  1.00 0.00 ? 68  GLN A CB   3  
ATOM 3546  C CG   . GLN A 1 38 ? 5.088   2.465   16.515  1.00 0.00 ? 68  GLN A CG   3  
ATOM 3547  C CD   . GLN A 1 38 ? 5.299   3.820   17.161  1.00 0.00 ? 68  GLN A CD   3  
ATOM 3548  O OE1  . GLN A 1 38 ? 4.442   4.700   17.075  1.00 0.00 ? 68  GLN A OE1  3  
ATOM 3549  N NE2  . GLN A 1 38 ? 6.443   3.994   17.811  1.00 0.00 ? 68  GLN A NE2  3  
ATOM 3550  H H    . GLN A 1 38 ? 1.851   1.576   13.719  1.00 0.00 ? 68  GLN A H    3  
ATOM 3551  H HA   . GLN A 1 38 ? 4.014   1.392   14.414  1.00 0.00 ? 68  GLN A HA   3  
ATOM 3552  H HB2  . GLN A 1 38 ? 3.048   3.008   16.299  1.00 0.00 ? 68  GLN A HB2  3  
ATOM 3553  H HB3  . GLN A 1 38 ? 3.321   1.593   17.306  1.00 0.00 ? 68  GLN A HB3  3  
ATOM 3554  H HG2  . GLN A 1 38 ? 5.587   1.716   17.114  1.00 0.00 ? 68  GLN A HG2  3  
ATOM 3555  H HG3  . GLN A 1 38 ? 5.522   2.481   15.526  1.00 0.00 ? 68  GLN A HG3  3  
ATOM 3556  H HE21 . GLN A 1 38 ? 7.079   3.248   17.837  1.00 0.00 ? 68  GLN A HE21 3  
ATOM 3557  H HE22 . GLN A 1 38 ? 6.606   4.861   18.238  1.00 0.00 ? 68  GLN A HE22 3  
ATOM 3558  N N    . SER A 1 39 ? 2.956   -1.169  14.752  1.00 0.00 ? 69  SER A N    3  
ATOM 3559  C CA   . SER A 1 39 ? 3.020   -2.602  15.019  1.00 0.00 ? 69  SER A CA   3  
ATOM 3560  C C    . SER A 1 39 ? 3.931   -3.301  14.015  1.00 0.00 ? 69  SER A C    3  
ATOM 3561  O O    . SER A 1 39 ? 4.931   -3.913  14.390  1.00 0.00 ? 69  SER A O    3  
ATOM 3562  C CB   . SER A 1 39 ? 1.619   -3.214  14.967  1.00 0.00 ? 69  SER A CB   3  
ATOM 3563  O OG   . SER A 1 39 ? 1.019   -3.224  16.251  1.00 0.00 ? 69  SER A OG   3  
ATOM 3564  H H    . SER A 1 39 ? 2.547   -0.856  13.918  1.00 0.00 ? 69  SER A H    3  
ATOM 3565  H HA   . SER A 1 39 ? 3.426   -2.737  16.010  1.00 0.00 ? 69  SER A HA   3  
ATOM 3566  H HB2  . SER A 1 39 ? 0.999   -2.635  14.300  1.00 0.00 ? 69  SER A HB2  3  
ATOM 3567  H HB3  . SER A 1 39 ? 1.686   -4.229  14.606  1.00 0.00 ? 69  SER A HB3  3  
ATOM 3568  H HG   . SER A 1 39 ? 0.942   -2.324  16.576  1.00 0.00 ? 69  SER A HG   3  
ATOM 3569  N N    . ILE A 1 40 ? 3.577   -3.207  12.736  1.00 0.00 ? 70  ILE A N    3  
ATOM 3570  C CA   . ILE A 1 40 ? 4.361   -3.831  11.678  1.00 0.00 ? 70  ILE A CA   3  
ATOM 3571  C C    . ILE A 1 40 ? 5.557   -2.964  11.298  1.00 0.00 ? 70  ILE A C    3  
ATOM 3572  O O    . ILE A 1 40 ? 5.507   -1.738  11.405  1.00 0.00 ? 70  ILE A O    3  
ATOM 3573  C CB   . ILE A 1 40 ? 3.504   -4.095  10.423  1.00 0.00 ? 70  ILE A CB   3  
ATOM 3574  C CG1  . ILE A 1 40 ? 4.318   -4.846  9.367   1.00 0.00 ? 70  ILE A CG1  3  
ATOM 3575  C CG2  . ILE A 1 40 ? 2.971   -2.787  9.857   1.00 0.00 ? 70  ILE A CG2  3  
ATOM 3576  C CD1  . ILE A 1 40 ? 3.481   -5.749  8.488   1.00 0.00 ? 70  ILE A CD1  3  
ATOM 3577  H H    . ILE A 1 40 ? 2.768   -2.706  12.500  1.00 0.00 ? 70  ILE A H    3  
ATOM 3578  H HA   . ILE A 1 40 ? 4.722   -4.781  12.048  1.00 0.00 ? 70  ILE A HA   3  
ATOM 3579  H HB   . ILE A 1 40 ? 2.660   -4.701  10.714  1.00 0.00 ? 70  ILE A HB   3  
ATOM 3580  H HG12 . ILE A 1 40 ? 4.815   -4.131  8.729   1.00 0.00 ? 70  ILE A HG12 3  
ATOM 3581  H HG13 . ILE A 1 40 ? 5.060   -5.457  9.861   1.00 0.00 ? 70  ILE A HG13 3  
ATOM 3582  H HG21 . ILE A 1 40 ? 3.798   -2.137  9.612   1.00 0.00 ? 70  ILE A HG21 3  
ATOM 3583  H HG22 . ILE A 1 40 ? 2.341   -2.306  10.592  1.00 0.00 ? 70  ILE A HG22 3  
ATOM 3584  H HG23 . ILE A 1 40 ? 2.394   -2.988  8.967   1.00 0.00 ? 70  ILE A HG23 3  
ATOM 3585  H HD11 . ILE A 1 40 ? 4.046   -6.634  8.240   1.00 0.00 ? 70  ILE A HD11 3  
ATOM 3586  H HD12 . ILE A 1 40 ? 3.217   -5.225  7.582   1.00 0.00 ? 70  ILE A HD12 3  
ATOM 3587  H HD13 . ILE A 1 40 ? 2.582   -6.032  9.016   1.00 0.00 ? 70  ILE A HD13 3  
ATOM 3588  N N    . ASP A 1 41 ? 6.633   -3.607  10.855  1.00 0.00 ? 71  ASP A N    3  
ATOM 3589  C CA   . ASP A 1 41 ? 7.841   -2.895  10.460  1.00 0.00 ? 71  ASP A CA   3  
ATOM 3590  C C    . ASP A 1 41 ? 7.781   -2.498  8.987   1.00 0.00 ? 71  ASP A C    3  
ATOM 3591  O O    . ASP A 1 41 ? 6.767   -2.704  8.321   1.00 0.00 ? 71  ASP A O    3  
ATOM 3592  C CB   . ASP A 1 41 ? 9.076   -3.761  10.717  1.00 0.00 ? 71  ASP A CB   3  
ATOM 3593  C CG   . ASP A 1 41 ? 10.266  -2.947  11.187  1.00 0.00 ? 71  ASP A CG   3  
ATOM 3594  O OD1  . ASP A 1 41 ? 10.426  -1.802  10.713  1.00 0.00 ? 71  ASP A OD1  3  
ATOM 3595  O OD2  . ASP A 1 41 ? 11.038  -3.454  12.028  1.00 0.00 ? 71  ASP A OD2  3  
ATOM 3596  H H    . ASP A 1 41 ? 6.612   -4.586  10.794  1.00 0.00 ? 71  ASP A H    3  
ATOM 3597  H HA   . ASP A 1 41 ? 7.909   -1.999  11.059  1.00 0.00 ? 71  ASP A HA   3  
ATOM 3598  H HB2  . ASP A 1 41 ? 8.842   -4.493  11.477  1.00 0.00 ? 71  ASP A HB2  3  
ATOM 3599  H HB3  . ASP A 1 41 ? 9.348   -4.270  9.804   1.00 0.00 ? 71  ASP A HB3  3  
ATOM 3600  N N    . THR A 1 42 ? 8.872   -1.926  8.487   1.00 0.00 ? 72  THR A N    3  
ATOM 3601  C CA   . THR A 1 42 ? 8.939   -1.500  7.093   1.00 0.00 ? 72  THR A CA   3  
ATOM 3602  C C    . THR A 1 42 ? 9.055   -2.703  6.160   1.00 0.00 ? 72  THR A C    3  
ATOM 3603  O O    . THR A 1 42 ? 8.253   -2.864  5.240   1.00 0.00 ? 72  THR A O    3  
ATOM 3604  C CB   . THR A 1 42 ? 10.125  -0.553  6.881   1.00 0.00 ? 72  THR A CB   3  
ATOM 3605  O OG1  . THR A 1 42 ? 10.906  -0.448  8.058   1.00 0.00 ? 72  THR A OG1  3  
ATOM 3606  C CG2  . THR A 1 42 ? 9.706   0.847   6.482   1.00 0.00 ? 72  THR A CG2  3  
ATOM 3607  H H    . THR A 1 42 ? 9.649   -1.788  9.068   1.00 0.00 ? 72  THR A H    3  
ATOM 3608  H HA   . THR A 1 42 ? 8.025   -0.972  6.866   1.00 0.00 ? 72  THR A HA   3  
ATOM 3609  H HB   . THR A 1 42 ? 10.752  -0.946  6.093   1.00 0.00 ? 72  THR A HB   3  
ATOM 3610  H HG1  . THR A 1 42 ? 10.410  0.025   8.731   1.00 0.00 ? 72  THR A HG1  3  
ATOM 3611  H HG21 . THR A 1 42 ? 9.942   1.534   7.281   1.00 0.00 ? 72  THR A HG21 3  
ATOM 3612  H HG22 . THR A 1 42 ? 8.644   0.865   6.294   1.00 0.00 ? 72  THR A HG22 3  
ATOM 3613  H HG23 . THR A 1 42 ? 10.235  1.140   5.587   1.00 0.00 ? 72  THR A HG23 3  
ATOM 3614  N N    . PRO A 1 43 ? 10.058  -3.571  6.386   1.00 0.00 ? 73  PRO A N    3  
ATOM 3615  C CA   . PRO A 1 43 ? 10.272  -4.763  5.560   1.00 0.00 ? 73  PRO A CA   3  
ATOM 3616  C C    . PRO A 1 43 ? 8.988   -5.560  5.345   1.00 0.00 ? 73  PRO A C    3  
ATOM 3617  O O    . PRO A 1 43 ? 8.800   -6.180  4.299   1.00 0.00 ? 73  PRO A O    3  
ATOM 3618  C CB   . PRO A 1 43 ? 11.276  -5.579  6.375   1.00 0.00 ? 73  PRO A CB   3  
ATOM 3619  C CG   . PRO A 1 43 ? 12.034  -4.566  7.160   1.00 0.00 ? 73  PRO A CG   3  
ATOM 3620  C CD   . PRO A 1 43 ? 11.061  -3.458  7.464   1.00 0.00 ? 73  PRO A CD   3  
ATOM 3621  H HA   . PRO A 1 43 ? 10.702  -4.510  4.603   1.00 0.00 ? 73  PRO A HA   3  
ATOM 3622  H HB2  . PRO A 1 43 ? 10.747  -6.265  7.021   1.00 0.00 ? 73  PRO A HB2  3  
ATOM 3623  H HB3  . PRO A 1 43 ? 11.925  -6.127  5.709   1.00 0.00 ? 73  PRO A HB3  3  
ATOM 3624  H HG2  . PRO A 1 43 ? 12.397  -5.008  8.076   1.00 0.00 ? 73  PRO A HG2  3  
ATOM 3625  H HG3  . PRO A 1 43 ? 12.859  -4.189  6.573   1.00 0.00 ? 73  PRO A HG3  3  
ATOM 3626  H HD2  . PRO A 1 43 ? 10.607  -3.611  8.430   1.00 0.00 ? 73  PRO A HD2  3  
ATOM 3627  H HD3  . PRO A 1 43 ? 11.558  -2.500  7.427   1.00 0.00 ? 73  PRO A HD3  3  
ATOM 3628  N N    . GLY A 1 44 ? 8.109   -5.535  6.340   1.00 0.00 ? 74  GLY A N    3  
ATOM 3629  C CA   . GLY A 1 44 ? 6.854   -6.255  6.238   1.00 0.00 ? 74  GLY A CA   3  
ATOM 3630  C C    . GLY A 1 44 ? 5.889   -5.604  5.266   1.00 0.00 ? 74  GLY A C    3  
ATOM 3631  O O    . GLY A 1 44 ? 5.177   -6.290  4.534   1.00 0.00 ? 74  GLY A O    3  
ATOM 3632  H H    . GLY A 1 44 ? 8.312   -5.021  7.149   1.00 0.00 ? 74  GLY A H    3  
ATOM 3633  H HA2  . GLY A 1 44 ? 7.057   -7.263  5.907   1.00 0.00 ? 74  GLY A HA2  3  
ATOM 3634  H HA3  . GLY A 1 44 ? 6.393   -6.295  7.214   1.00 0.00 ? 74  GLY A HA3  3  
ATOM 3635  N N    . VAL A 1 45 ? 5.867   -4.276  5.262   1.00 0.00 ? 75  VAL A N    3  
ATOM 3636  C CA   . VAL A 1 45 ? 4.983   -3.530  4.373   1.00 0.00 ? 75  VAL A CA   3  
ATOM 3637  C C    . VAL A 1 45 ? 5.367   -3.744  2.913   1.00 0.00 ? 75  VAL A C    3  
ATOM 3638  O O    . VAL A 1 45 ? 4.509   -3.763  2.031   1.00 0.00 ? 75  VAL A O    3  
ATOM 3639  C CB   . VAL A 1 45 ? 5.016   -2.020  4.683   1.00 0.00 ? 75  VAL A CB   3  
ATOM 3640  C CG1  . VAL A 1 45 ? 3.973   -1.280  3.858   1.00 0.00 ? 75  VAL A CG1  3  
ATOM 3641  C CG2  . VAL A 1 45 ? 4.804   -1.774  6.170   1.00 0.00 ? 75  VAL A CG2  3  
ATOM 3642  H H    . VAL A 1 45 ? 6.458   -3.785  5.869   1.00 0.00 ? 75  VAL A H    3  
ATOM 3643  H HA   . VAL A 1 45 ? 3.976   -3.887  4.527   1.00 0.00 ? 75  VAL A HA   3  
ATOM 3644  H HB   . VAL A 1 45 ? 5.990   -1.640  4.414   1.00 0.00 ? 75  VAL A HB   3  
ATOM 3645  H HG11 . VAL A 1 45 ? 3.129   -1.030  4.484   1.00 0.00 ? 75  VAL A HG11 3  
ATOM 3646  H HG12 . VAL A 1 45 ? 3.644   -1.910  3.044   1.00 0.00 ? 75  VAL A HG12 3  
ATOM 3647  H HG13 . VAL A 1 45 ? 4.406   -0.375  3.459   1.00 0.00 ? 75  VAL A HG13 3  
ATOM 3648  H HG21 . VAL A 1 45 ? 4.965   -2.692  6.715   1.00 0.00 ? 75  VAL A HG21 3  
ATOM 3649  H HG22 . VAL A 1 45 ? 3.795   -1.428  6.337   1.00 0.00 ? 75  VAL A HG22 3  
ATOM 3650  H HG23 . VAL A 1 45 ? 5.502   -1.024  6.514   1.00 0.00 ? 75  VAL A HG23 3  
ATOM 3651  N N    . ILE A 1 46 ? 6.662   -3.906  2.666   1.00 0.00 ? 76  ILE A N    3  
ATOM 3652  C CA   . ILE A 1 46 ? 7.162   -4.119  1.313   1.00 0.00 ? 76  ILE A CA   3  
ATOM 3653  C C    . ILE A 1 46 ? 6.874   -5.539  0.838   1.00 0.00 ? 76  ILE A C    3  
ATOM 3654  O O    . ILE A 1 46 ? 6.602   -5.767  -0.341  1.00 0.00 ? 76  ILE A O    3  
ATOM 3655  C CB   . ILE A 1 46 ? 8.679   -3.860  1.228   1.00 0.00 ? 76  ILE A CB   3  
ATOM 3656  C CG1  . ILE A 1 46 ? 9.023   -2.506  1.852   1.00 0.00 ? 76  ILE A CG1  3  
ATOM 3657  C CG2  . ILE A 1 46 ? 9.147   -3.916  -0.220  1.00 0.00 ? 76  ILE A CG2  3  
ATOM 3658  C CD1  . ILE A 1 46 ? 10.476  -2.378  2.256   1.00 0.00 ? 76  ILE A CD1  3  
ATOM 3659  H H    . ILE A 1 46 ? 7.298   -3.881  3.411   1.00 0.00 ? 76  ILE A H    3  
ATOM 3660  H HA   . ILE A 1 46 ? 6.661   -3.421  0.658   1.00 0.00 ? 76  ILE A HA   3  
ATOM 3661  H HB   . ILE A 1 46 ? 9.186   -4.639  1.774   1.00 0.00 ? 76  ILE A HB   3  
ATOM 3662  H HG12 . ILE A 1 46 ? 8.808   -1.723  1.140   1.00 0.00 ? 76  ILE A HG12 3  
ATOM 3663  H HG13 . ILE A 1 46 ? 8.418   -2.360  2.735   1.00 0.00 ? 76  ILE A HG13 3  
ATOM 3664  H HG21 . ILE A 1 46 ? 9.539   -4.898  -0.432  1.00 0.00 ? 76  ILE A HG21 3  
ATOM 3665  H HG22 . ILE A 1 46 ? 9.918   -3.177  -0.378  1.00 0.00 ? 76  ILE A HG22 3  
ATOM 3666  H HG23 . ILE A 1 46 ? 8.313   -3.712  -0.876  1.00 0.00 ? 76  ILE A HG23 3  
ATOM 3667  H HD11 . ILE A 1 46 ? 10.803  -3.298  2.717   1.00 0.00 ? 76  ILE A HD11 3  
ATOM 3668  H HD12 . ILE A 1 46 ? 10.584  -1.565  2.958   1.00 0.00 ? 76  ILE A HD12 3  
ATOM 3669  H HD13 . ILE A 1 46 ? 11.076  -2.181  1.380   1.00 0.00 ? 76  ILE A HD13 3  
ATOM 3670  N N    . ARG A 1 47 ? 6.935   -6.492  1.762   1.00 0.00 ? 77  ARG A N    3  
ATOM 3671  C CA   . ARG A 1 47 ? 6.682   -7.890  1.437   1.00 0.00 ? 77  ARG A CA   3  
ATOM 3672  C C    . ARG A 1 47 ? 5.189   -8.145  1.251   1.00 0.00 ? 77  ARG A C    3  
ATOM 3673  O O    . ARG A 1 47 ? 4.780   -8.849  0.328   1.00 0.00 ? 77  ARG A O    3  
ATOM 3674  C CB   . ARG A 1 47 ? 7.233   -8.800  2.536   1.00 0.00 ? 77  ARG A CB   3  
ATOM 3675  C CG   . ARG A 1 47 ? 8.752   -8.868  2.564   1.00 0.00 ? 77  ARG A CG   3  
ATOM 3676  C CD   . ARG A 1 47 ? 9.291   -9.792  1.483   1.00 0.00 ? 77  ARG A CD   3  
ATOM 3677  N NE   . ARG A 1 47 ? 10.058  -9.065  0.474   1.00 0.00 ? 77  ARG A NE   3  
ATOM 3678  C CZ   . ARG A 1 47 ? 10.350  -9.554  -0.729  1.00 0.00 ? 77  ARG A CZ   3  
ATOM 3679  N NH1  . ARG A 1 47 ? 9.943   -10.768 -1.076  1.00 0.00 ? 77  ARG A NH1  3  
ATOM 3680  N NH2  . ARG A 1 47 ? 11.051  -8.826  -1.587  1.00 0.00 ? 77  ARG A NH2  3  
ATOM 3681  H H    . ARG A 1 47 ? 7.158   -6.248  2.685   1.00 0.00 ? 77  ARG A H    3  
ATOM 3682  H HA   . ARG A 1 47 ? 7.191   -8.112  0.510   1.00 0.00 ? 77  ARG A HA   3  
ATOM 3683  H HB2  . ARG A 1 47 ? 6.892   -8.436  3.493   1.00 0.00 ? 77  ARG A HB2  3  
ATOM 3684  H HB3  . ARG A 1 47 ? 6.852   -9.799  2.384   1.00 0.00 ? 77  ARG A HB3  3  
ATOM 3685  H HG2  . ARG A 1 47 ? 9.150   -7.876  2.407   1.00 0.00 ? 77  ARG A HG2  3  
ATOM 3686  H HG3  . ARG A 1 47 ? 9.067   -9.235  3.530   1.00 0.00 ? 77  ARG A HG3  3  
ATOM 3687  H HD2  . ARG A 1 47 ? 9.932   -10.529 1.945   1.00 0.00 ? 77  ARG A HD2  3  
ATOM 3688  H HD3  . ARG A 1 47 ? 8.461   -10.289 1.003   1.00 0.00 ? 77  ARG A HD3  3  
ATOM 3689  H HE   . ARG A 1 47 ? 10.371  -8.165  0.705   1.00 0.00 ? 77  ARG A HE   3  
ATOM 3690  H HH11 . ARG A 1 47 ? 9.413   -11.322 -0.434  1.00 0.00 ? 77  ARG A HH11 3  
ATOM 3691  H HH12 . ARG A 1 47 ? 10.167  -11.129 -1.981  1.00 0.00 ? 77  ARG A HH12 3  
ATOM 3692  H HH21 . ARG A 1 47 ? 11.361  -7.910  -1.331  1.00 0.00 ? 77  ARG A HH21 3  
ATOM 3693  H HH22 . ARG A 1 47 ? 11.272  -9.194  -2.491  1.00 0.00 ? 77  ARG A HH22 3  
ATOM 3694  N N    . ARG A 1 48 ? 4.382   -7.570  2.136   1.00 0.00 ? 78  ARG A N    3  
ATOM 3695  C CA   . ARG A 1 48 ? 2.935   -7.738  2.070   1.00 0.00 ? 78  ARG A CA   3  
ATOM 3696  C C    . ARG A 1 48 ? 2.378   -7.166  0.769   1.00 0.00 ? 78  ARG A C    3  
ATOM 3697  O O    . ARG A 1 48 ? 1.725   -7.870  -0.001  1.00 0.00 ? 78  ARG A O    3  
ATOM 3698  C CB   . ARG A 1 48 ? 2.267   -7.062  3.270   1.00 0.00 ? 78  ARG A CB   3  
ATOM 3699  C CG   . ARG A 1 48 ? 1.552   -8.037  4.194   1.00 0.00 ? 78  ARG A CG   3  
ATOM 3700  C CD   . ARG A 1 48 ? 2.318   -8.249  5.491   1.00 0.00 ? 78  ARG A CD   3  
ATOM 3701  N NE   . ARG A 1 48 ? 1.451   -8.145  6.663   1.00 0.00 ? 78  ARG A NE   3  
ATOM 3702  C CZ   . ARG A 1 48 ? 1.764   -8.625  7.864   1.00 0.00 ? 78  ARG A CZ   3  
ATOM 3703  N NH1  . ARG A 1 48 ? 2.923   -9.243  8.057   1.00 0.00 ? 78  ARG A NH1  3  
ATOM 3704  N NH2  . ARG A 1 48 ? 0.918   -8.487  8.875   1.00 0.00 ? 78  ARG A NH2  3  
ATOM 3705  H H    . ARG A 1 48 ? 4.767   -7.022  2.850   1.00 0.00 ? 78  ARG A H    3  
ATOM 3706  H HA   . ARG A 1 48 ? 2.723   -8.796  2.101   1.00 0.00 ? 78  ARG A HA   3  
ATOM 3707  H HB2  . ARG A 1 48 ? 3.023   -6.545  3.843   1.00 0.00 ? 78  ARG A HB2  3  
ATOM 3708  H HB3  . ARG A 1 48 ? 1.545   -6.344  2.912   1.00 0.00 ? 78  ARG A HB3  3  
ATOM 3709  H HG2  . ARG A 1 48 ? 0.573   -7.646  4.426   1.00 0.00 ? 78  ARG A HG2  3  
ATOM 3710  H HG3  . ARG A 1 48 ? 1.450   -8.987  3.688   1.00 0.00 ? 78  ARG A HG3  3  
ATOM 3711  H HD2  . ARG A 1 48 ? 2.764   -9.233  5.474   1.00 0.00 ? 78  ARG A HD2  3  
ATOM 3712  H HD3  . ARG A 1 48 ? 3.096   -7.503  5.563   1.00 0.00 ? 78  ARG A HD3  3  
ATOM 3713  H HE   . ARG A 1 48 ? 0.588   -7.693  6.548   1.00 0.00 ? 78  ARG A HE   3  
ATOM 3714  H HH11 . ARG A 1 48 ? 3.566   -9.351  7.299   1.00 0.00 ? 78  ARG A HH11 3  
ATOM 3715  H HH12 . ARG A 1 48 ? 3.154   -9.602  8.961   1.00 0.00 ? 78  ARG A HH12 3  
ATOM 3716  H HH21 . ARG A 1 48 ? 0.044   -8.021  8.734   1.00 0.00 ? 78  ARG A HH21 3  
ATOM 3717  H HH22 . ARG A 1 48 ? 1.153   -8.848  9.777   1.00 0.00 ? 78  ARG A HH22 3  
ATOM 3718  N N    . VAL A 1 49 ? 2.640   -5.884  0.530   1.00 0.00 ? 79  VAL A N    3  
ATOM 3719  C CA   . VAL A 1 49 ? 2.165   -5.220  -0.679  1.00 0.00 ? 79  VAL A CA   3  
ATOM 3720  C C    . VAL A 1 49 ? 2.679   -5.926  -1.931  1.00 0.00 ? 79  VAL A C    3  
ATOM 3721  O O    . VAL A 1 49 ? 1.915   -6.206  -2.855  1.00 0.00 ? 79  VAL A O    3  
ATOM 3722  C CB   . VAL A 1 49 ? 2.599   -3.741  -0.716  1.00 0.00 ? 79  VAL A CB   3  
ATOM 3723  C CG1  . VAL A 1 49 ? 2.030   -3.044  -1.943  1.00 0.00 ? 79  VAL A CG1  3  
ATOM 3724  C CG2  . VAL A 1 49 ? 2.171   -3.027  0.557   1.00 0.00 ? 79  VAL A CG2  3  
ATOM 3725  H H    . VAL A 1 49 ? 3.166   -5.374  1.181   1.00 0.00 ? 79  VAL A H    3  
ATOM 3726  H HA   . VAL A 1 49 ? 1.085   -5.257  -0.676  1.00 0.00 ? 79  VAL A HA   3  
ATOM 3727  H HB   . VAL A 1 49 ? 3.677   -3.706  -0.778  1.00 0.00 ? 79  VAL A HB   3  
ATOM 3728  H HG11 . VAL A 1 49 ? 1.152   -3.573  -2.283  1.00 0.00 ? 79  VAL A HG11 3  
ATOM 3729  H HG12 . VAL A 1 49 ? 2.771   -3.034  -2.728  1.00 0.00 ? 79  VAL A HG12 3  
ATOM 3730  H HG13 . VAL A 1 49 ? 1.762   -2.029  -1.688  1.00 0.00 ? 79  VAL A HG13 3  
ATOM 3731  H HG21 . VAL A 1 49 ? 1.955   -3.756  1.325   1.00 0.00 ? 79  VAL A HG21 3  
ATOM 3732  H HG22 . VAL A 1 49 ? 1.287   -2.439  0.360   1.00 0.00 ? 79  VAL A HG22 3  
ATOM 3733  H HG23 . VAL A 1 49 ? 2.967   -2.379  0.892   1.00 0.00 ? 79  VAL A HG23 3  
ATOM 3734  N N    . SER A 1 50 ? 3.977   -6.209  -1.954  1.00 0.00 ? 80  SER A N    3  
ATOM 3735  C CA   . SER A 1 50 ? 4.591   -6.883  -3.093  1.00 0.00 ? 80  SER A CA   3  
ATOM 3736  C C    . SER A 1 50 ? 3.971   -8.258  -3.316  1.00 0.00 ? 80  SER A C    3  
ATOM 3737  O O    . SER A 1 50 ? 4.025   -8.803  -4.418  1.00 0.00 ? 80  SER A O    3  
ATOM 3738  C CB   . SER A 1 50 ? 6.100   -7.017  -2.882  1.00 0.00 ? 80  SER A CB   3  
ATOM 3739  O OG   . SER A 1 50 ? 6.393   -7.999  -1.904  1.00 0.00 ? 80  SER A OG   3  
ATOM 3740  H H    . SER A 1 50 ? 4.535   -5.961  -1.188  1.00 0.00 ? 80  SER A H    3  
ATOM 3741  H HA   . SER A 1 50 ? 4.411   -6.278  -3.967  1.00 0.00 ? 80  SER A HA   3  
ATOM 3742  H HB2  . SER A 1 50 ? 6.567   -7.303  -3.813  1.00 0.00 ? 80  SER A HB2  3  
ATOM 3743  H HB3  . SER A 1 50 ? 6.502   -6.069  -2.555  1.00 0.00 ? 80  SER A HB3  3  
ATOM 3744  H HG   . SER A 1 50 ? 5.797   -7.897  -1.158  1.00 0.00 ? 80  SER A HG   3  
ATOM 3745  N N    . GLN A 1 51 ? 3.381   -8.813  -2.264  1.00 0.00 ? 81  GLN A N    3  
ATOM 3746  C CA   . GLN A 1 51 ? 2.749   -10.125 -2.344  1.00 0.00 ? 81  GLN A CA   3  
ATOM 3747  C C    . GLN A 1 51 ? 1.274   -9.993  -2.707  1.00 0.00 ? 81  GLN A C    3  
ATOM 3748  O O    . GLN A 1 51 ? 0.756   -10.748 -3.530  1.00 0.00 ? 81  GLN A O    3  
ATOM 3749  C CB   . GLN A 1 51 ? 2.895   -10.867 -1.015  1.00 0.00 ? 81  GLN A CB   3  
ATOM 3750  C CG   . GLN A 1 51 ? 2.362   -12.290 -1.051  1.00 0.00 ? 81  GLN A CG   3  
ATOM 3751  C CD   . GLN A 1 51 ? 3.440   -13.307 -1.373  1.00 0.00 ? 81  GLN A CD   3  
ATOM 3752  O OE1  . GLN A 1 51 ? 4.482   -13.352 -0.721  1.00 0.00 ? 81  GLN A OE1  3  
ATOM 3753  N NE2  . GLN A 1 51 ? 3.192   -14.132 -2.385  1.00 0.00 ? 81  GLN A NE2  3  
ATOM 3754  H H    . GLN A 1 51 ? 3.370   -8.328  -1.414  1.00 0.00 ? 81  GLN A H    3  
ATOM 3755  H HA   . GLN A 1 51 ? 3.249   -10.687 -3.118  1.00 0.00 ? 81  GLN A HA   3  
ATOM 3756  H HB2  . GLN A 1 51 ? 3.941   -10.904 -0.749  1.00 0.00 ? 81  GLN A HB2  3  
ATOM 3757  H HB3  . GLN A 1 51 ? 2.357   -10.324 -0.251  1.00 0.00 ? 81  GLN A HB3  3  
ATOM 3758  H HG2  . GLN A 1 51 ? 1.941   -12.529 -0.086  1.00 0.00 ? 81  GLN A HG2  3  
ATOM 3759  H HG3  . GLN A 1 51 ? 1.591   -12.353 -1.805  1.00 0.00 ? 81  GLN A HG3  3  
ATOM 3760  H HE21 . GLN A 1 51 ? 2.340   -14.038 -2.860  1.00 0.00 ? 81  GLN A HE21 3  
ATOM 3761  H HE22 . GLN A 1 51 ? 3.872   -14.799 -2.614  1.00 0.00 ? 81  GLN A HE22 3  
ATOM 3762  N N    . LEU A 1 52 ? 0.602   -9.026  -2.089  1.00 0.00 ? 82  LEU A N    3  
ATOM 3763  C CA   . LEU A 1 52 ? -0.813  -8.793  -2.349  1.00 0.00 ? 82  LEU A CA   3  
ATOM 3764  C C    . LEU A 1 52 ? -1.047  -8.450  -3.817  1.00 0.00 ? 82  LEU A C    3  
ATOM 3765  O O    . LEU A 1 52 ? -2.100  -8.757  -4.377  1.00 0.00 ? 82  LEU A O    3  
ATOM 3766  C CB   . LEU A 1 52 ? -1.337  -7.663  -1.458  1.00 0.00 ? 82  LEU A CB   3  
ATOM 3767  C CG   . LEU A 1 52 ? -2.693  -7.931  -0.801  1.00 0.00 ? 82  LEU A CG   3  
ATOM 3768  C CD1  . LEU A 1 52 ? -2.570  -9.024  0.249   1.00 0.00 ? 82  LEU A CD1  3  
ATOM 3769  C CD2  . LEU A 1 52 ? -3.245  -6.655  -0.184  1.00 0.00 ? 82  LEU A CD2  3  
ATOM 3770  H H    . LEU A 1 52 ? 1.070   -8.456  -1.445  1.00 0.00 ? 82  LEU A H    3  
ATOM 3771  H HA   . LEU A 1 52 ? -1.348  -9.702  -2.114  1.00 0.00 ? 82  LEU A HA   3  
ATOM 3772  H HB2  . LEU A 1 52 ? -0.611  -7.485  -0.677  1.00 0.00 ? 82  LEU A HB2  3  
ATOM 3773  H HB3  . LEU A 1 52 ? -1.423  -6.769  -2.057  1.00 0.00 ? 82  LEU A HB3  3  
ATOM 3774  H HG   . LEU A 1 52 ? -3.389  -8.269  -1.555  1.00 0.00 ? 82  LEU A HG   3  
ATOM 3775  H HD11 . LEU A 1 52 ? -1.860  -9.766  -0.084  1.00 0.00 ? 82  LEU A HD11 3  
ATOM 3776  H HD12 . LEU A 1 52 ? -3.533  -9.489  0.398   1.00 0.00 ? 82  LEU A HD12 3  
ATOM 3777  H HD13 . LEU A 1 52 ? -2.231  -8.593  1.179   1.00 0.00 ? 82  LEU A HD13 3  
ATOM 3778  H HD21 . LEU A 1 52 ? -4.115  -6.891  0.412   1.00 0.00 ? 82  LEU A HD21 3  
ATOM 3779  H HD22 . LEU A 1 52 ? -3.523  -5.967  -0.967  1.00 0.00 ? 82  LEU A HD22 3  
ATOM 3780  H HD23 . LEU A 1 52 ? -2.491  -6.202  0.444   1.00 0.00 ? 82  LEU A HD23 3  
ATOM 3781  N N    . PHE A 1 53 ? -0.057  -7.813  -4.434  1.00 0.00 ? 83  PHE A N    3  
ATOM 3782  C CA   . PHE A 1 53 ? -0.152  -7.427  -5.838  1.00 0.00 ? 83  PHE A CA   3  
ATOM 3783  C C    . PHE A 1 53 ? 0.795   -8.262  -6.695  1.00 0.00 ? 83  PHE A C    3  
ATOM 3784  O O    . PHE A 1 53 ? 1.521   -7.731  -7.535  1.00 0.00 ? 83  PHE A O    3  
ATOM 3785  C CB   . PHE A 1 53 ? 0.166   -5.940  -6.000  1.00 0.00 ? 83  PHE A CB   3  
ATOM 3786  C CG   . PHE A 1 53 ? -0.680  -5.046  -5.137  1.00 0.00 ? 83  PHE A CG   3  
ATOM 3787  C CD1  . PHE A 1 53 ? -2.042  -5.268  -5.012  1.00 0.00 ? 83  PHE A CD1  3  
ATOM 3788  C CD2  . PHE A 1 53 ? -0.113  -3.983  -4.452  1.00 0.00 ? 83  PHE A CD2  3  
ATOM 3789  C CE1  . PHE A 1 53 ? -2.822  -4.448  -4.218  1.00 0.00 ? 83  PHE A CE1  3  
ATOM 3790  C CE2  . PHE A 1 53 ? -0.887  -3.160  -3.658  1.00 0.00 ? 83  PHE A CE2  3  
ATOM 3791  C CZ   . PHE A 1 53 ? -2.244  -3.392  -3.541  1.00 0.00 ? 83  PHE A CZ   3  
ATOM 3792  H H    . PHE A 1 53 ? 0.756   -7.596  -3.934  1.00 0.00 ? 83  PHE A H    3  
ATOM 3793  H HA   . PHE A 1 53 ? -1.166  -7.607  -6.163  1.00 0.00 ? 83  PHE A HA   3  
ATOM 3794  H HB2  . PHE A 1 53 ? 1.200   -5.769  -5.740  1.00 0.00 ? 83  PHE A HB2  3  
ATOM 3795  H HB3  . PHE A 1 53 ? 0.009   -5.655  -7.030  1.00 0.00 ? 83  PHE A HB3  3  
ATOM 3796  H HD1  . PHE A 1 53 ? -2.495  -6.095  -5.539  1.00 0.00 ? 83  PHE A HD1  3  
ATOM 3797  H HD2  . PHE A 1 53 ? 0.949   -3.800  -4.543  1.00 0.00 ? 83  PHE A HD2  3  
ATOM 3798  H HE1  . PHE A 1 53 ? -3.882  -4.632  -4.129  1.00 0.00 ? 83  PHE A HE1  3  
ATOM 3799  H HE2  . PHE A 1 53 ? -0.433  -2.334  -3.130  1.00 0.00 ? 83  PHE A HE2  3  
ATOM 3800  H HZ   . PHE A 1 53 ? -2.851  -2.749  -2.921  1.00 0.00 ? 83  PHE A HZ   3  
ATOM 3801  N N    . HIS A 1 54 ? 0.783   -9.573  -6.473  1.00 0.00 ? 84  HIS A N    3  
ATOM 3802  C CA   . HIS A 1 54 ? 1.642   -10.484 -7.221  1.00 0.00 ? 84  HIS A CA   3  
ATOM 3803  C C    . HIS A 1 54 ? 1.288   -10.477 -8.706  1.00 0.00 ? 84  HIS A C    3  
ATOM 3804  O O    . HIS A 1 54 ? 2.162   -10.615 -9.561  1.00 0.00 ? 84  HIS A O    3  
ATOM 3805  C CB   . HIS A 1 54 ? 1.521   -11.903 -6.663  1.00 0.00 ? 84  HIS A CB   3  
ATOM 3806  C CG   . HIS A 1 54 ? 2.796   -12.684 -6.735  1.00 0.00 ? 84  HIS A CG   3  
ATOM 3807  N ND1  . HIS A 1 54 ? 3.491   -13.092 -5.617  1.00 0.00 ? 84  HIS A ND1  3  
ATOM 3808  C CD2  . HIS A 1 54 ? 3.502   -13.132 -7.800  1.00 0.00 ? 84  HIS A CD2  3  
ATOM 3809  C CE1  . HIS A 1 54 ? 4.570   -13.757 -5.990  1.00 0.00 ? 84  HIS A CE1  3  
ATOM 3810  N NE2  . HIS A 1 54 ? 4.599   -13.796 -7.310  1.00 0.00 ? 84  HIS A NE2  3  
ATOM 3811  H H    . HIS A 1 54 ? 0.184   -9.936  -5.789  1.00 0.00 ? 84  HIS A H    3  
ATOM 3812  H HA   . HIS A 1 54 ? 2.660   -10.147 -7.104  1.00 0.00 ? 84  HIS A HA   3  
ATOM 3813  H HB2  . HIS A 1 54 ? 1.221   -11.851 -5.628  1.00 0.00 ? 84  HIS A HB2  3  
ATOM 3814  H HB3  . HIS A 1 54 ? 0.769   -12.439 -7.224  1.00 0.00 ? 84  HIS A HB3  3  
ATOM 3815  H HD1  . HIS A 1 54 ? 3.233   -12.920 -4.687  1.00 0.00 ? 84  HIS A HD1  3  
ATOM 3816  H HD2  . HIS A 1 54 ? 3.249   -12.994 -8.842  1.00 0.00 ? 84  HIS A HD2  3  
ATOM 3817  H HE1  . HIS A 1 54 ? 5.304   -14.195 -5.330  1.00 0.00 ? 84  HIS A HE1  3  
ATOM 3818  H HE2  . HIS A 1 54 ? 5.337   -14.151 -7.848  1.00 0.00 ? 84  HIS A HE2  3  
ATOM 3819  N N    . GLU A 1 55 ? 0.003   -10.318 -9.003  1.00 0.00 ? 85  GLU A N    3  
ATOM 3820  C CA   . GLU A 1 55 ? -0.463  -10.297 -10.387 1.00 0.00 ? 85  GLU A CA   3  
ATOM 3821  C C    . GLU A 1 55 ? -0.877  -8.890  -10.806 1.00 0.00 ? 85  GLU A C    3  
ATOM 3822  O O    . GLU A 1 55 ? -1.707  -8.718  -11.699 1.00 0.00 ? 85  GLU A O    3  
ATOM 3823  C CB   . GLU A 1 55 ? -1.640  -11.260 -10.563 1.00 0.00 ? 85  GLU A CB   3  
ATOM 3824  C CG   . GLU A 1 55 ? -1.231  -12.723 -10.580 1.00 0.00 ? 85  GLU A CG   3  
ATOM 3825  C CD   . GLU A 1 55 ? -0.821  -13.231 -9.211  1.00 0.00 ? 85  GLU A CD   3  
ATOM 3826  O OE1  . GLU A 1 55 ? -1.333  -12.698 -8.203  1.00 0.00 ? 85  GLU A OE1  3  
ATOM 3827  O OE2  . GLU A 1 55 ? 0.010   -14.160 -9.146  1.00 0.00 ? 85  GLU A OE2  3  
ATOM 3828  H H    . GLU A 1 55 ? -0.648  -10.214 -8.278  1.00 0.00 ? 85  GLU A H    3  
ATOM 3829  H HA   . GLU A 1 55 ? 0.352   -10.622 -11.015 1.00 0.00 ? 85  GLU A HA   3  
ATOM 3830  H HB2  . GLU A 1 55 ? -2.335  -11.112 -9.750  1.00 0.00 ? 85  GLU A HB2  3  
ATOM 3831  H HB3  . GLU A 1 55 ? -2.136  -11.036 -11.495 1.00 0.00 ? 85  GLU A HB3  3  
ATOM 3832  H HG2  . GLU A 1 55 ? -2.065  -13.313 -10.931 1.00 0.00 ? 85  GLU A HG2  3  
ATOM 3833  H HG3  . GLU A 1 55 ? -0.397  -12.843 -11.256 1.00 0.00 ? 85  GLU A HG3  3  
ATOM 3834  N N    . HIS A 1 56 ? -0.295  -7.886  -10.159 1.00 0.00 ? 86  HIS A N    3  
ATOM 3835  C CA   . HIS A 1 56 ? -0.607  -6.495  -10.469 1.00 0.00 ? 86  HIS A CA   3  
ATOM 3836  C C    . HIS A 1 56 ? 0.655   -5.634  -10.438 1.00 0.00 ? 86  HIS A C    3  
ATOM 3837  O O    . HIS A 1 56 ? 1.061   -5.153  -9.381  1.00 0.00 ? 86  HIS A O    3  
ATOM 3838  C CB   . HIS A 1 56 ? -1.635  -5.949  -9.477  1.00 0.00 ? 86  HIS A CB   3  
ATOM 3839  C CG   . HIS A 1 56 ? -2.976  -6.604  -9.584  1.00 0.00 ? 86  HIS A CG   3  
ATOM 3840  N ND1  . HIS A 1 56 ? -4.114  -5.929  -9.975  1.00 0.00 ? 86  HIS A ND1  3  
ATOM 3841  C CD2  . HIS A 1 56 ? -3.360  -7.882  -9.352  1.00 0.00 ? 86  HIS A CD2  3  
ATOM 3842  C CE1  . HIS A 1 56 ? -5.139  -6.764  -9.977  1.00 0.00 ? 86  HIS A CE1  3  
ATOM 3843  N NE2  . HIS A 1 56 ? -4.708  -7.954  -9.603  1.00 0.00 ? 86  HIS A NE2  3  
ATOM 3844  H H    . HIS A 1 56 ? 0.360   -8.084  -9.457  1.00 0.00 ? 86  HIS A H    3  
ATOM 3845  H HA   . HIS A 1 56 ? -1.027  -6.464  -11.462 1.00 0.00 ? 86  HIS A HA   3  
ATOM 3846  H HB2  . HIS A 1 56 ? -1.271  -6.102  -8.472  1.00 0.00 ? 86  HIS A HB2  3  
ATOM 3847  H HB3  . HIS A 1 56 ? -1.765  -4.891  -9.650  1.00 0.00 ? 86  HIS A HB3  3  
ATOM 3848  H HD1  . HIS A 1 56 ? -4.163  -4.981  -10.215 1.00 0.00 ? 86  HIS A HD1  3  
ATOM 3849  H HD2  . HIS A 1 56 ? -2.723  -8.693  -9.028  1.00 0.00 ? 86  HIS A HD2  3  
ATOM 3850  H HE1  . HIS A 1 56 ? -6.156  -6.514  -10.239 1.00 0.00 ? 86  HIS A HE1  3  
ATOM 3851  H HE2  . HIS A 1 56 ? -5.278  -8.732  -9.430  1.00 0.00 ? 86  HIS A HE2  3  
ATOM 3852  N N    . PRO A 1 57 ? 1.296   -5.428  -11.604 1.00 0.00 ? 87  PRO A N    3  
ATOM 3853  C CA   . PRO A 1 57 ? 2.517   -4.621  -11.698 1.00 0.00 ? 87  PRO A CA   3  
ATOM 3854  C C    . PRO A 1 57 ? 2.257   -3.142  -11.433 1.00 0.00 ? 87  PRO A C    3  
ATOM 3855  O O    . PRO A 1 57 ? 2.999   -2.493  -10.696 1.00 0.00 ? 87  PRO A O    3  
ATOM 3856  C CB   . PRO A 1 57 ? 2.977   -4.832  -13.144 1.00 0.00 ? 87  PRO A CB   3  
ATOM 3857  C CG   . PRO A 1 57 ? 1.739   -5.198  -13.886 1.00 0.00 ? 87  PRO A CG   3  
ATOM 3858  C CD   . PRO A 1 57 ? 0.886   -5.965  -12.915 1.00 0.00 ? 87  PRO A CD   3  
ATOM 3859  H HA   . PRO A 1 57 ? 3.280   -4.977  -11.020 1.00 0.00 ? 87  PRO A HA   3  
ATOM 3860  H HB2  . PRO A 1 57 ? 3.411   -3.919  -13.523 1.00 0.00 ? 87  PRO A HB2  3  
ATOM 3861  H HB3  . PRO A 1 57 ? 3.707   -5.626  -13.179 1.00 0.00 ? 87  PRO A HB3  3  
ATOM 3862  H HG2  . PRO A 1 57 ? 1.227   -4.304  -14.210 1.00 0.00 ? 87  PRO A HG2  3  
ATOM 3863  H HG3  . PRO A 1 57 ? 1.988   -5.817  -14.734 1.00 0.00 ? 87  PRO A HG3  3  
ATOM 3864  H HD2  . PRO A 1 57 ? -0.162  -5.772  -13.100 1.00 0.00 ? 87  PRO A HD2  3  
ATOM 3865  H HD3  . PRO A 1 57 ? 1.094   -7.022  -12.981 1.00 0.00 ? 87  PRO A HD3  3  
ATOM 3866  N N    . ASP A 1 58 ? 1.194   -2.615  -12.034 1.00 0.00 ? 88  ASP A N    3  
ATOM 3867  C CA   . ASP A 1 58 ? 0.834   -1.210  -11.863 1.00 0.00 ? 88  ASP A CA   3  
ATOM 3868  C C    . ASP A 1 58 ? 0.458   -0.904  -10.412 1.00 0.00 ? 88  ASP A C    3  
ATOM 3869  O O    . ASP A 1 58 ? 0.378   0.260   -10.018 1.00 0.00 ? 88  ASP A O    3  
ATOM 3870  C CB   . ASP A 1 58 ? -0.329  -0.846  -12.788 1.00 0.00 ? 88  ASP A CB   3  
ATOM 3871  C CG   . ASP A 1 58 ? -1.548  -1.717  -12.555 1.00 0.00 ? 88  ASP A CG   3  
ATOM 3872  O OD1  . ASP A 1 58 ? -1.647  -2.322  -11.467 1.00 0.00 ? 88  ASP A OD1  3  
ATOM 3873  O OD2  . ASP A 1 58 ? -2.405  -1.792  -13.460 1.00 0.00 ? 88  ASP A OD2  3  
ATOM 3874  H H    . ASP A 1 58 ? 0.639   -3.184  -12.608 1.00 0.00 ? 88  ASP A H    3  
ATOM 3875  H HA   . ASP A 1 58 ? 1.693   -0.614  -12.131 1.00 0.00 ? 88  ASP A HA   3  
ATOM 3876  H HB2  . ASP A 1 58 ? -0.607  0.183   -12.618 1.00 0.00 ? 88  ASP A HB2  3  
ATOM 3877  H HB3  . ASP A 1 58 ? -0.015  -0.965  -13.814 1.00 0.00 ? 88  ASP A HB3  3  
ATOM 3878  N N    . LEU A 1 59 ? 0.236   -1.950  -9.621  1.00 0.00 ? 89  LEU A N    3  
ATOM 3879  C CA   . LEU A 1 59 ? -0.123  -1.782  -8.219  1.00 0.00 ? 89  LEU A CA   3  
ATOM 3880  C C    . LEU A 1 59 ? 1.131   -1.664  -7.367  1.00 0.00 ? 89  LEU A C    3  
ATOM 3881  O O    . LEU A 1 59 ? 1.306   -0.695  -6.630  1.00 0.00 ? 89  LEU A O    3  
ATOM 3882  C CB   . LEU A 1 59 ? -0.975  -2.960  -7.740  1.00 0.00 ? 89  LEU A CB   3  
ATOM 3883  C CG   . LEU A 1 59 ? -2.479  -2.803  -7.966  1.00 0.00 ? 89  LEU A CG   3  
ATOM 3884  C CD1  . LEU A 1 59 ? -3.224  -4.036  -7.481  1.00 0.00 ? 89  LEU A CD1  3  
ATOM 3885  C CD2  . LEU A 1 59 ? -2.995  -1.555  -7.265  1.00 0.00 ? 89  LEU A CD2  3  
ATOM 3886  H H    . LEU A 1 59 ? 0.322   -2.852  -9.984  1.00 0.00 ? 89  LEU A H    3  
ATOM 3887  H HA   . LEU A 1 59 ? -0.695  -0.872  -8.127  1.00 0.00 ? 89  LEU A HA   3  
ATOM 3888  H HB2  . LEU A 1 59 ? -0.643  -3.850  -8.257  1.00 0.00 ? 89  LEU A HB2  3  
ATOM 3889  H HB3  . LEU A 1 59 ? -0.804  -3.094  -6.683  1.00 0.00 ? 89  LEU A HB3  3  
ATOM 3890  H HG   . LEU A 1 59 ? -2.668  -2.696  -9.024  1.00 0.00 ? 89  LEU A HG   3  
ATOM 3891  H HD11 . LEU A 1 59 ? -4.020  -4.272  -8.171  1.00 0.00 ? 89  LEU A HD11 3  
ATOM 3892  H HD12 . LEU A 1 59 ? -3.642  -3.843  -6.504  1.00 0.00 ? 89  LEU A HD12 3  
ATOM 3893  H HD13 . LEU A 1 59 ? -2.541  -4.870  -7.420  1.00 0.00 ? 89  LEU A HD13 3  
ATOM 3894  H HD21 . LEU A 1 59 ? -2.479  -1.432  -6.324  1.00 0.00 ? 89  LEU A HD21 3  
ATOM 3895  H HD22 . LEU A 1 59 ? -4.055  -1.656  -7.084  1.00 0.00 ? 89  LEU A HD22 3  
ATOM 3896  H HD23 . LEU A 1 59 ? -2.816  -0.692  -7.889  1.00 0.00 ? 89  LEU A HD23 3  
ATOM 3897  N N    . ILE A 1 60 ? 2.013   -2.649  -7.489  1.00 0.00 ? 90  ILE A N    3  
ATOM 3898  C CA   . ILE A 1 60 ? 3.264   -2.645  -6.745  1.00 0.00 ? 90  ILE A CA   3  
ATOM 3899  C C    . ILE A 1 60 ? 4.078   -1.404  -7.093  1.00 0.00 ? 90  ILE A C    3  
ATOM 3900  O O    . ILE A 1 60 ? 4.840   -0.893  -6.272  1.00 0.00 ? 90  ILE A O    3  
ATOM 3901  C CB   . ILE A 1 60 ? 4.101   -3.907  -7.039  1.00 0.00 ? 90  ILE A CB   3  
ATOM 3902  C CG1  . ILE A 1 60 ? 5.370   -3.918  -6.184  1.00 0.00 ? 90  ILE A CG1  3  
ATOM 3903  C CG2  . ILE A 1 60 ? 4.451   -3.981  -8.518  1.00 0.00 ? 90  ILE A CG2  3  
ATOM 3904  C CD1  . ILE A 1 60 ? 6.060   -5.265  -6.145  1.00 0.00 ? 90  ILE A CD1  3  
ATOM 3905  H H    . ILE A 1 60 ? 1.825   -3.389  -8.104  1.00 0.00 ? 90  ILE A H    3  
ATOM 3906  H HA   . ILE A 1 60 ? 3.027   -2.628  -5.690  1.00 0.00 ? 90  ILE A HA   3  
ATOM 3907  H HB   . ILE A 1 60 ? 3.503   -4.771  -6.794  1.00 0.00 ? 90  ILE A HB   3  
ATOM 3908  H HG12 . ILE A 1 60 ? 6.071   -3.199  -6.581  1.00 0.00 ? 90  ILE A HG12 3  
ATOM 3909  H HG13 . ILE A 1 60 ? 5.116   -3.645  -5.171  1.00 0.00 ? 90  ILE A HG13 3  
ATOM 3910  H HG21 . ILE A 1 60 ? 3.543   -4.037  -9.101  1.00 0.00 ? 90  ILE A HG21 3  
ATOM 3911  H HG22 . ILE A 1 60 ? 5.050   -4.860  -8.703  1.00 0.00 ? 90  ILE A HG22 3  
ATOM 3912  H HG23 . ILE A 1 60 ? 5.007   -3.100  -8.802  1.00 0.00 ? 90  ILE A HG23 3  
ATOM 3913  H HD11 . ILE A 1 60 ? 5.336   -6.046  -6.327  1.00 0.00 ? 90  ILE A HD11 3  
ATOM 3914  H HD12 . ILE A 1 60 ? 6.510   -5.410  -5.175  1.00 0.00 ? 90  ILE A HD12 3  
ATOM 3915  H HD13 . ILE A 1 60 ? 6.826   -5.300  -6.906  1.00 0.00 ? 90  ILE A HD13 3  
ATOM 3916  N N    . VAL A 1 61 ? 3.896   -0.914  -8.318  1.00 0.00 ? 91  VAL A N    3  
ATOM 3917  C CA   . VAL A 1 61 ? 4.602   0.276   -8.774  1.00 0.00 ? 91  VAL A CA   3  
ATOM 3918  C C    . VAL A 1 61 ? 3.990   1.528   -8.157  1.00 0.00 ? 91  VAL A C    3  
ATOM 3919  O O    . VAL A 1 61 ? 4.696   2.367   -7.596  1.00 0.00 ? 91  VAL A O    3  
ATOM 3920  C CB   . VAL A 1 61 ? 4.575   0.398   -10.311 1.00 0.00 ? 91  VAL A CB   3  
ATOM 3921  C CG1  . VAL A 1 61 ? 5.338   1.634   -10.767 1.00 0.00 ? 91  VAL A CG1  3  
ATOM 3922  C CG2  . VAL A 1 61 ? 5.149   -0.855  -10.955 1.00 0.00 ? 91  VAL A CG2  3  
ATOM 3923  H H    . VAL A 1 61 ? 3.263   -1.360  -8.926  1.00 0.00 ? 91  VAL A H    3  
ATOM 3924  H HA   . VAL A 1 61 ? 5.632   0.196   -8.456  1.00 0.00 ? 91  VAL A HA   3  
ATOM 3925  H HB   . VAL A 1 61 ? 3.547   0.500   -10.627 1.00 0.00 ? 91  VAL A HB   3  
ATOM 3926  H HG11 . VAL A 1 61 ? 4.890   2.514   -10.332 1.00 0.00 ? 91  VAL A HG11 3  
ATOM 3927  H HG12 . VAL A 1 61 ? 5.297   1.704   -11.845 1.00 0.00 ? 91  VAL A HG12 3  
ATOM 3928  H HG13 . VAL A 1 61 ? 6.368   1.560   -10.450 1.00 0.00 ? 91  VAL A HG13 3  
ATOM 3929  H HG21 . VAL A 1 61 ? 4.587   -1.090  -11.847 1.00 0.00 ? 91  VAL A HG21 3  
ATOM 3930  H HG22 . VAL A 1 61 ? 5.085   -1.679  -10.260 1.00 0.00 ? 91  VAL A HG22 3  
ATOM 3931  H HG23 . VAL A 1 61 ? 6.183   -0.684  -11.216 1.00 0.00 ? 91  VAL A HG23 3  
ATOM 3932  N N    . GLY A 1 62 ? 2.668   1.642   -8.255  1.00 0.00 ? 92  GLY A N    3  
ATOM 3933  C CA   . GLY A 1 62 ? 1.982   2.789   -7.692  1.00 0.00 ? 92  GLY A CA   3  
ATOM 3934  C C    . GLY A 1 62 ? 2.242   2.935   -6.207  1.00 0.00 ? 92  GLY A C    3  
ATOM 3935  O O    . GLY A 1 62 ? 2.397   4.046   -5.702  1.00 0.00 ? 92  GLY A O    3  
ATOM 3936  H H    . GLY A 1 62 ? 2.156   0.939   -8.707  1.00 0.00 ? 92  GLY A H    3  
ATOM 3937  H HA2  . GLY A 1 62 ? 2.321   3.682   -8.197  1.00 0.00 ? 92  GLY A HA2  3  
ATOM 3938  H HA3  . GLY A 1 62 ? 0.921   2.677   -7.854  1.00 0.00 ? 92  GLY A HA3  3  
ATOM 3939  N N    . PHE A 1 63 ? 2.295   1.806   -5.507  1.00 0.00 ? 93  PHE A N    3  
ATOM 3940  C CA   . PHE A 1 63 ? 2.543   1.807   -4.073  1.00 0.00 ? 93  PHE A CA   3  
ATOM 3941  C C    . PHE A 1 63 ? 3.989   2.182   -3.780  1.00 0.00 ? 93  PHE A C    3  
ATOM 3942  O O    . PHE A 1 63 ? 4.284   2.836   -2.779  1.00 0.00 ? 93  PHE A O    3  
ATOM 3943  C CB   . PHE A 1 63 ? 2.224   0.435   -3.473  1.00 0.00 ? 93  PHE A CB   3  
ATOM 3944  C CG   . PHE A 1 63 ? 2.433   0.365   -1.987  1.00 0.00 ? 93  PHE A CG   3  
ATOM 3945  C CD1  . PHE A 1 63 ? 1.464   0.836   -1.116  1.00 0.00 ? 93  PHE A CD1  3  
ATOM 3946  C CD2  . PHE A 1 63 ? 3.596   -0.171  -1.462  1.00 0.00 ? 93  PHE A CD2  3  
ATOM 3947  C CE1  . PHE A 1 63 ? 1.652   0.773   0.251   1.00 0.00 ? 93  PHE A CE1  3  
ATOM 3948  C CE2  . PHE A 1 63 ? 3.792   -0.237  -0.096  1.00 0.00 ? 93  PHE A CE2  3  
ATOM 3949  C CZ   . PHE A 1 63 ? 2.818   0.236   0.763   1.00 0.00 ? 93  PHE A CZ   3  
ATOM 3950  H H    . PHE A 1 63 ? 2.168   0.952   -5.966  1.00 0.00 ? 93  PHE A H    3  
ATOM 3951  H HA   . PHE A 1 63 ? 1.900   2.542   -3.631  1.00 0.00 ? 93  PHE A HA   3  
ATOM 3952  H HB2  . PHE A 1 63 ? 1.191   0.194   -3.675  1.00 0.00 ? 93  PHE A HB2  3  
ATOM 3953  H HB3  . PHE A 1 63 ? 2.859   -0.308  -3.934  1.00 0.00 ? 93  PHE A HB3  3  
ATOM 3954  H HD1  . PHE A 1 63 ? 0.551   1.256   -1.514  1.00 0.00 ? 93  PHE A HD1  3  
ATOM 3955  H HD2  . PHE A 1 63 ? 4.359   -0.541  -2.132  1.00 0.00 ? 93  PHE A HD2  3  
ATOM 3956  H HE1  . PHE A 1 63 ? 0.889   1.144   0.921   1.00 0.00 ? 93  PHE A HE1  3  
ATOM 3957  H HE2  . PHE A 1 63 ? 4.703   -0.657  0.301   1.00 0.00 ? 93  PHE A HE2  3  
ATOM 3958  H HZ   . PHE A 1 63 ? 2.967   0.186   1.831   1.00 0.00 ? 93  PHE A HZ   3  
ATOM 3959  N N    . ASN A 1 64 ? 4.881   1.765   -4.666  1.00 0.00 ? 94  ASN A N    3  
ATOM 3960  C CA   . ASN A 1 64 ? 6.302   2.057   -4.518  1.00 0.00 ? 94  ASN A CA   3  
ATOM 3961  C C    . ASN A 1 64 ? 6.544   3.562   -4.538  1.00 0.00 ? 94  ASN A C    3  
ATOM 3962  O O    . ASN A 1 64 ? 7.445   4.067   -3.867  1.00 0.00 ? 94  ASN A O    3  
ATOM 3963  C CB   . ASN A 1 64 ? 7.102   1.383   -5.635  1.00 0.00 ? 94  ASN A CB   3  
ATOM 3964  C CG   . ASN A 1 64 ? 8.593   1.624   -5.505  1.00 0.00 ? 94  ASN A CG   3  
ATOM 3965  O OD1  . ASN A 1 64 ? 9.080   2.728   -5.748  1.00 0.00 ? 94  ASN A OD1  3  
ATOM 3966  N ND2  . ASN A 1 64 ? 9.329   0.587   -5.122  1.00 0.00 ? 94  ASN A ND2  3  
ATOM 3967  H H    . ASN A 1 64 ? 4.574   1.253   -5.441  1.00 0.00 ? 94  ASN A H    3  
ATOM 3968  H HA   . ASN A 1 64 ? 6.625   1.664   -3.565  1.00 0.00 ? 94  ASN A HA   3  
ATOM 3969  H HB2  . ASN A 1 64 ? 6.924   0.318   -5.603  1.00 0.00 ? 94  ASN A HB2  3  
ATOM 3970  H HB3  . ASN A 1 64 ? 6.774   1.770   -6.588  1.00 0.00 ? 94  ASN A HB3  3  
ATOM 3971  H HD21 . ASN A 1 64 ? 8.874   -0.263  -4.946  1.00 0.00 ? 94  ASN A HD21 3  
ATOM 3972  H HD22 . ASN A 1 64 ? 10.297  0.715   -5.030  1.00 0.00 ? 94  ASN A HD22 3  
ATOM 3973  N N    . ALA A 1 65 ? 5.731   4.274   -5.313  1.00 0.00 ? 95  ALA A N    3  
ATOM 3974  C CA   . ALA A 1 65 ? 5.852   5.722   -5.424  1.00 0.00 ? 95  ALA A CA   3  
ATOM 3975  C C    . ALA A 1 65 ? 5.625   6.406   -4.077  1.00 0.00 ? 95  ALA A C    3  
ATOM 3976  O O    . ALA A 1 65 ? 6.000   7.564   -3.892  1.00 0.00 ? 95  ALA A O    3  
ATOM 3977  C CB   . ALA A 1 65 ? 4.868   6.252   -6.457  1.00 0.00 ? 95  ALA A CB   3  
ATOM 3978  H H    . ALA A 1 65 ? 5.034   3.812   -5.823  1.00 0.00 ? 95  ALA A H    3  
ATOM 3979  H HA   . ALA A 1 65 ? 6.850   5.946   -5.767  1.00 0.00 ? 95  ALA A HA   3  
ATOM 3980  H HB1  . ALA A 1 65 ? 4.711   5.505   -7.221  1.00 0.00 ? 95  ALA A HB1  3  
ATOM 3981  H HB2  . ALA A 1 65 ? 5.269   7.149   -6.908  1.00 0.00 ? 95  ALA A HB2  3  
ATOM 3982  H HB3  . ALA A 1 65 ? 3.929   6.480   -5.977  1.00 0.00 ? 95  ALA A HB3  3  
ATOM 3983  N N    . PHE A 1 66 ? 5.012   5.687   -3.141  1.00 0.00 ? 96  PHE A N    3  
ATOM 3984  C CA   . PHE A 1 66 ? 4.741   6.234   -1.816  1.00 0.00 ? 96  PHE A CA   3  
ATOM 3985  C C    . PHE A 1 66 ? 5.779   5.755   -0.806  1.00 0.00 ? 96  PHE A C    3  
ATOM 3986  O O    . PHE A 1 66 ? 5.485   5.618   0.382   1.00 0.00 ? 96  PHE A O    3  
ATOM 3987  C CB   . PHE A 1 66 ? 3.340   5.831   -1.350  1.00 0.00 ? 96  PHE A CB   3  
ATOM 3988  C CG   . PHE A 1 66 ? 2.248   6.263   -2.287  1.00 0.00 ? 96  PHE A CG   3  
ATOM 3989  C CD1  . PHE A 1 66 ? 1.884   5.467   -3.361  1.00 0.00 ? 96  PHE A CD1  3  
ATOM 3990  C CD2  . PHE A 1 66 ? 1.585   7.464   -2.091  1.00 0.00 ? 96  PHE A CD2  3  
ATOM 3991  C CE1  . PHE A 1 66 ? 0.878   5.861   -4.223  1.00 0.00 ? 96  PHE A CE1  3  
ATOM 3992  C CE2  . PHE A 1 66 ? 0.579   7.863   -2.950  1.00 0.00 ? 96  PHE A CE2  3  
ATOM 3993  C CZ   . PHE A 1 66 ? 0.225   7.061   -4.017  1.00 0.00 ? 96  PHE A CZ   3  
ATOM 3994  H H    . PHE A 1 66 ? 4.735   4.770   -3.344  1.00 0.00 ? 96  PHE A H    3  
ATOM 3995  H HA   . PHE A 1 66 ? 4.793   7.310   -1.884  1.00 0.00 ? 96  PHE A HA   3  
ATOM 3996  H HB2  . PHE A 1 66 ? 3.294   4.757   -1.261  1.00 0.00 ? 96  PHE A HB2  3  
ATOM 3997  H HB3  . PHE A 1 66 ? 3.148   6.277   -0.386  1.00 0.00 ? 96  PHE A HB3  3  
ATOM 3998  H HD1  . PHE A 1 66 ? 2.393   4.529   -3.521  1.00 0.00 ? 96  PHE A HD1  3  
ATOM 3999  H HD2  . PHE A 1 66 ? 1.861   8.092   -1.257  1.00 0.00 ? 96  PHE A HD2  3  
ATOM 4000  H HE1  . PHE A 1 66 ? 0.604   5.232   -5.057  1.00 0.00 ? 96  PHE A HE1  3  
ATOM 4001  H HE2  . PHE A 1 66 ? 0.070   8.802   -2.788  1.00 0.00 ? 96  PHE A HE2  3  
ATOM 4002  H HZ   . PHE A 1 66 ? -0.561  7.370   -4.690  1.00 0.00 ? 96  PHE A HZ   3  
ATOM 4003  N N    . LEU A 1 67 ? 6.992   5.503   -1.285  1.00 0.00 ? 97  LEU A N    3  
ATOM 4004  C CA   . LEU A 1 67 ? 8.072   5.042   -0.422  1.00 0.00 ? 97  LEU A CA   3  
ATOM 4005  C C    . LEU A 1 67 ? 9.364   5.806   -0.710  1.00 0.00 ? 97  LEU A C    3  
ATOM 4006  O O    . LEU A 1 67 ? 9.650   6.143   -1.858  1.00 0.00 ? 97  LEU A O    3  
ATOM 4007  C CB   . LEU A 1 67 ? 8.299   3.540   -0.614  1.00 0.00 ? 97  LEU A CB   3  
ATOM 4008  C CG   . LEU A 1 67 ? 7.359   2.636   0.186   1.00 0.00 ? 97  LEU A CG   3  
ATOM 4009  C CD1  . LEU A 1 67 ? 6.720   1.590   -0.716  1.00 0.00 ? 97  LEU A CD1  3  
ATOM 4010  C CD2  . LEU A 1 67 ? 8.105   1.967   1.332   1.00 0.00 ? 97  LEU A CD2  3  
ATOM 4011  H H    . LEU A 1 67 ? 7.166   5.633   -2.241  1.00 0.00 ? 97  LEU A H    3  
ATOM 4012  H HA   . LEU A 1 67 ? 7.779   5.224   0.601   1.00 0.00 ? 97  LEU A HA   3  
ATOM 4013  H HB2  . LEU A 1 67 ? 8.182   3.313   -1.664  1.00 0.00 ? 97  LEU A HB2  3  
ATOM 4014  H HB3  . LEU A 1 67 ? 9.315   3.312   -0.326  1.00 0.00 ? 97  LEU A HB3  3  
ATOM 4015  H HG   . LEU A 1 67 ? 6.566   3.237   0.610   1.00 0.00 ? 97  LEU A HG   3  
ATOM 4016  H HD11 . LEU A 1 67 ? 6.378   2.062   -1.626  1.00 0.00 ? 97  LEU A HD11 3  
ATOM 4017  H HD12 . LEU A 1 67 ? 5.882   1.138   -0.207  1.00 0.00 ? 97  LEU A HD12 3  
ATOM 4018  H HD13 . LEU A 1 67 ? 7.449   0.830   -0.958  1.00 0.00 ? 97  LEU A HD13 3  
ATOM 4019  H HD21 . LEU A 1 67 ? 8.625   1.096   0.962   1.00 0.00 ? 97  LEU A HD21 3  
ATOM 4020  H HD22 . LEU A 1 67 ? 7.402   1.669   2.095   1.00 0.00 ? 97  LEU A HD22 3  
ATOM 4021  H HD23 . LEU A 1 67 ? 8.818   2.661   1.750   1.00 0.00 ? 97  LEU A HD23 3  
ATOM 4022  N N    . PRO A 1 68 ? 10.163  6.089   0.334   1.00 0.00 ? 98  PRO A N    3  
ATOM 4023  C CA   . PRO A 1 68 ? 11.426  6.817   0.184   1.00 0.00 ? 98  PRO A CA   3  
ATOM 4024  C C    . PRO A 1 68 ? 12.507  5.970   -0.481  1.00 0.00 ? 98  PRO A C    3  
ATOM 4025  O O    . PRO A 1 68 ? 12.300  4.791   -0.764  1.00 0.00 ? 98  PRO A O    3  
ATOM 4026  C CB   . PRO A 1 68 ? 11.818  7.148   1.624   1.00 0.00 ? 98  PRO A CB   3  
ATOM 4027  C CG   . PRO A 1 68 ? 11.181  6.079   2.442   1.00 0.00 ? 98  PRO A CG   3  
ATOM 4028  C CD   . PRO A 1 68 ? 9.899   5.725   1.739   1.00 0.00 ? 98  PRO A CD   3  
ATOM 4029  H HA   . PRO A 1 68 ? 11.292  7.731   -0.376  1.00 0.00 ? 98  PRO A HA   3  
ATOM 4030  H HB2  . PRO A 1 68 ? 12.893  7.134   1.720   1.00 0.00 ? 98  PRO A HB2  3  
ATOM 4031  H HB3  . PRO A 1 68 ? 11.439  8.125   1.888   1.00 0.00 ? 98  PRO A HB3  3  
ATOM 4032  H HG2  . PRO A 1 68 ? 11.833  5.219   2.493   1.00 0.00 ? 98  PRO A HG2  3  
ATOM 4033  H HG3  . PRO A 1 68 ? 10.974  6.452   3.434   1.00 0.00 ? 98  PRO A HG3  3  
ATOM 4034  H HD2  . PRO A 1 68 ? 9.699   4.668   1.832   1.00 0.00 ? 98  PRO A HD2  3  
ATOM 4035  H HD3  . PRO A 1 68 ? 9.078   6.301   2.139   1.00 0.00 ? 98  PRO A HD3  3  
ATOM 4036  N N    . LEU A 1 69 ? 13.661  6.582   -0.728  1.00 0.00 ? 99  LEU A N    3  
ATOM 4037  C CA   . LEU A 1 69 ? 14.776  5.886   -1.360  1.00 0.00 ? 99  LEU A CA   3  
ATOM 4038  C C    . LEU A 1 69 ? 15.426  4.896   -0.396  1.00 0.00 ? 99  LEU A C    3  
ATOM 4039  O O    . LEU A 1 69 ? 16.131  3.978   -0.817  1.00 0.00 ? 99  LEU A O    3  
ATOM 4040  C CB   . LEU A 1 69 ? 15.815  6.895   -1.856  1.00 0.00 ? 99  LEU A CB   3  
ATOM 4041  C CG   . LEU A 1 69 ? 16.220  6.737   -3.324  1.00 0.00 ? 99  LEU A CG   3  
ATOM 4042  C CD1  . LEU A 1 69 ? 16.167  8.077   -4.042  1.00 0.00 ? 99  LEU A CD1  3  
ATOM 4043  C CD2  . LEU A 1 69 ? 17.609  6.127   -3.434  1.00 0.00 ? 99  LEU A CD2  3  
ATOM 4044  H H    . LEU A 1 69 ? 13.765  7.525   -0.480  1.00 0.00 ? 99  LEU A H    3  
ATOM 4045  H HA   . LEU A 1 69 ? 14.387  5.341   -2.207  1.00 0.00 ? 99  LEU A HA   3  
ATOM 4046  H HB2  . LEU A 1 69 ? 15.414  7.889   -1.717  1.00 0.00 ? 99  LEU A HB2  3  
ATOM 4047  H HB3  . LEU A 1 69 ? 16.703  6.797   -1.249  1.00 0.00 ? 99  LEU A HB3  3  
ATOM 4048  H HG   . LEU A 1 69 ? 15.523  6.071   -3.813  1.00 0.00 ? 99  LEU A HG   3  
ATOM 4049  H HD11 . LEU A 1 69 ? 15.471  8.729   -3.536  1.00 0.00 ? 99  LEU A HD11 3  
ATOM 4050  H HD12 . LEU A 1 69 ? 15.843  7.927   -5.062  1.00 0.00 ? 99  LEU A HD12 3  
ATOM 4051  H HD13 . LEU A 1 69 ? 17.150  8.527   -4.039  1.00 0.00 ? 99  LEU A HD13 3  
ATOM 4052  H HD21 . LEU A 1 69 ? 17.643  5.459   -4.282  1.00 0.00 ? 99  LEU A HD21 3  
ATOM 4053  H HD22 . LEU A 1 69 ? 17.832  5.575   -2.531  1.00 0.00 ? 99  LEU A HD22 3  
ATOM 4054  H HD23 . LEU A 1 69 ? 18.339  6.912   -3.565  1.00 0.00 ? 99  LEU A HD23 3  
ATOM 4055  N N    . GLY A 1 70 ? 15.188  5.086   0.901   1.00 0.00 ? 100 GLY A N    3  
ATOM 4056  C CA   . GLY A 1 70 ? 15.760  4.202   1.899   1.00 0.00 ? 100 GLY A CA   3  
ATOM 4057  C C    . GLY A 1 70 ? 15.449  2.741   1.638   1.00 0.00 ? 100 GLY A C    3  
ATOM 4058  O O    . GLY A 1 70 ? 16.257  1.864   1.939   1.00 0.00 ? 100 GLY A O    3  
ATOM 4059  H H    . GLY A 1 70 ? 14.621  5.834   1.181   1.00 0.00 ? 100 GLY A H    3  
ATOM 4060  H HA2  . GLY A 1 70 ? 16.833  4.333   1.907   1.00 0.00 ? 100 GLY A HA2  3  
ATOM 4061  H HA3  . GLY A 1 70 ? 15.370  4.474   2.869   1.00 0.00 ? 100 GLY A HA3  3  
ATOM 4062  N N    . TYR A 1 71 ? 14.273  2.478   1.076   1.00 0.00 ? 101 TYR A N    3  
ATOM 4063  C CA   . TYR A 1 71 ? 13.858  1.112   0.776   1.00 0.00 ? 101 TYR A CA   3  
ATOM 4064  C C    . TYR A 1 71 ? 13.396  0.987   -0.671  1.00 0.00 ? 101 TYR A C    3  
ATOM 4065  O O    . TYR A 1 71 ? 12.811  1.915   -1.229  1.00 0.00 ? 101 TYR A O    3  
ATOM 4066  C CB   . TYR A 1 71 ? 12.737  0.677   1.722   1.00 0.00 ? 101 TYR A CB   3  
ATOM 4067  C CG   . TYR A 1 71 ? 13.187  0.496   3.153   1.00 0.00 ? 101 TYR A CG   3  
ATOM 4068  C CD1  . TYR A 1 71 ? 13.250  1.577   4.023   1.00 0.00 ? 101 TYR A CD1  3  
ATOM 4069  C CD2  . TYR A 1 71 ? 13.546  -0.757  3.636   1.00 0.00 ? 101 TYR A CD2  3  
ATOM 4070  C CE1  . TYR A 1 71 ? 13.661  1.416   5.333   1.00 0.00 ? 101 TYR A CE1  3  
ATOM 4071  C CE2  . TYR A 1 71 ? 13.957  -0.926  4.944   1.00 0.00 ? 101 TYR A CE2  3  
ATOM 4072  C CZ   . TYR A 1 71 ? 14.013  0.162   5.789   1.00 0.00 ? 101 TYR A CZ   3  
ATOM 4073  O OH   . TYR A 1 71 ? 14.422  -0.002  7.092   1.00 0.00 ? 101 TYR A OH   3  
ATOM 4074  H H    . TYR A 1 71 ? 13.670  3.220   0.859   1.00 0.00 ? 101 TYR A H    3  
ATOM 4075  H HA   . TYR A 1 71 ? 14.712  0.467   0.926   1.00 0.00 ? 101 TYR A HA   3  
ATOM 4076  H HB2  . TYR A 1 71 ? 11.957  1.425   1.711   1.00 0.00 ? 101 TYR A HB2  3  
ATOM 4077  H HB3  . TYR A 1 71 ? 12.331  -0.263  1.378   1.00 0.00 ? 101 TYR A HB3  3  
ATOM 4078  H HD1  . TYR A 1 71 ? 12.974  2.557   3.664   1.00 0.00 ? 101 TYR A HD1  3  
ATOM 4079  H HD2  . TYR A 1 71 ? 13.502  -1.607  2.971   1.00 0.00 ? 101 TYR A HD2  3  
ATOM 4080  H HE1  . TYR A 1 71 ? 13.704  2.268   5.995   1.00 0.00 ? 101 TYR A HE1  3  
ATOM 4081  H HE2  . TYR A 1 71 ? 14.233  -1.908  5.300   1.00 0.00 ? 101 TYR A HE2  3  
ATOM 4082  H HH   . TYR A 1 71 ? 14.985  0.733   7.347   1.00 0.00 ? 101 TYR A HH   3  
ATOM 4083  N N    . ARG A 1 72 ? 13.663  -0.167  -1.274  1.00 0.00 ? 102 ARG A N    3  
ATOM 4084  C CA   . ARG A 1 72 ? 13.274  -0.417  -2.658  1.00 0.00 ? 102 ARG A CA   3  
ATOM 4085  C C    . ARG A 1 72 ? 12.553  -1.755  -2.786  1.00 0.00 ? 102 ARG A C    3  
ATOM 4086  O O    . ARG A 1 72 ? 12.965  -2.753  -2.196  1.00 0.00 ? 102 ARG A O    3  
ATOM 4087  C CB   . ARG A 1 72 ? 14.505  -0.398  -3.567  1.00 0.00 ? 102 ARG A CB   3  
ATOM 4088  C CG   . ARG A 1 72 ? 14.730  0.938   -4.259  1.00 0.00 ? 102 ARG A CG   3  
ATOM 4089  C CD   . ARG A 1 72 ? 15.934  1.669   -3.687  1.00 0.00 ? 102 ARG A CD   3  
ATOM 4090  N NE   . ARG A 1 72 ? 17.132  0.834   -3.687  1.00 0.00 ? 102 ARG A NE   3  
ATOM 4091  C CZ   . ARG A 1 72 ? 17.841  0.554   -4.778  1.00 0.00 ? 102 ARG A CZ   3  
ATOM 4092  N NH1  . ARG A 1 72 ? 17.477  1.041   -5.958  1.00 0.00 ? 102 ARG A NH1  3  
ATOM 4093  N NH2  . ARG A 1 72 ? 18.919  -0.215  -4.689  1.00 0.00 ? 102 ARG A NH2  3  
ATOM 4094  H H    . ARG A 1 72 ? 14.132  -0.869  -0.776  1.00 0.00 ? 102 ARG A H    3  
ATOM 4095  H HA   . ARG A 1 72 ? 12.602  0.372   -2.960  1.00 0.00 ? 102 ARG A HA   3  
ATOM 4096  H HB2  . ARG A 1 72 ? 15.379  -0.625  -2.975  1.00 0.00 ? 102 ARG A HB2  3  
ATOM 4097  H HB3  . ARG A 1 72 ? 14.390  -1.156  -4.327  1.00 0.00 ? 102 ARG A HB3  3  
ATOM 4098  H HG2  . ARG A 1 72 ? 14.894  0.764   -5.311  1.00 0.00 ? 102 ARG A HG2  3  
ATOM 4099  H HG3  . ARG A 1 72 ? 13.851  1.552   -4.127  1.00 0.00 ? 102 ARG A HG3  3  
ATOM 4100  H HD2  . ARG A 1 72 ? 16.121  2.550   -4.284  1.00 0.00 ? 102 ARG A HD2  3  
ATOM 4101  H HD3  . ARG A 1 72 ? 15.711  1.964   -2.672  1.00 0.00 ? 102 ARG A HD3  3  
ATOM 4102  H HE   . ARG A 1 72 ? 17.424  0.462   -2.828  1.00 0.00 ? 102 ARG A HE   3  
ATOM 4103  H HH11 . ARG A 1 72 ? 16.666  1.622   -6.032  1.00 0.00 ? 102 ARG A HH11 3  
ATOM 4104  H HH12 . ARG A 1 72 ? 18.014  0.827   -6.774  1.00 0.00 ? 102 ARG A HH12 3  
ATOM 4105  H HH21 . ARG A 1 72 ? 19.197  -0.583  -3.803  1.00 0.00 ? 102 ARG A HH21 3  
ATOM 4106  H HH22 . ARG A 1 72 ? 19.451  -0.425  -5.509  1.00 0.00 ? 102 ARG A HH22 3  
ATOM 4107  N N    . ILE A 1 73 ? 11.472  -1.767  -3.560  1.00 0.00 ? 103 ILE A N    3  
ATOM 4108  C CA   . ILE A 1 73 ? 10.693  -2.983  -3.764  1.00 0.00 ? 103 ILE A CA   3  
ATOM 4109  C C    . ILE A 1 73 ? 11.188  -3.754  -4.982  1.00 0.00 ? 103 ILE A C    3  
ATOM 4110  O O    . ILE A 1 73 ? 11.697  -3.166  -5.937  1.00 0.00 ? 103 ILE A O    3  
ATOM 4111  C CB   . ILE A 1 73 ? 9.195   -2.670  -3.944  1.00 0.00 ? 103 ILE A CB   3  
ATOM 4112  C CG1  . ILE A 1 73 ? 8.727   -1.668  -2.886  1.00 0.00 ? 103 ILE A CG1  3  
ATOM 4113  C CG2  . ILE A 1 73 ? 8.374   -3.949  -3.870  1.00 0.00 ? 103 ILE A CG2  3  
ATOM 4114  C CD1  . ILE A 1 73 ? 7.267   -1.292  -3.014  1.00 0.00 ? 103 ILE A CD1  3  
ATOM 4115  H H    . ILE A 1 73 ? 11.192  -0.940  -4.003  1.00 0.00 ? 103 ILE A H    3  
ATOM 4116  H HA   . ILE A 1 73 ? 10.807  -3.604  -2.887  1.00 0.00 ? 103 ILE A HA   3  
ATOM 4117  H HB   . ILE A 1 73 ? 9.056   -2.240  -4.925  1.00 0.00 ? 103 ILE A HB   3  
ATOM 4118  H HG12 . ILE A 1 73 ? 8.874   -2.095  -1.905  1.00 0.00 ? 103 ILE A HG12 3  
ATOM 4119  H HG13 . ILE A 1 73 ? 9.312   -0.764  -2.973  1.00 0.00 ? 103 ILE A HG13 3  
ATOM 4120  H HG21 . ILE A 1 73 ? 8.624   -4.587  -4.704  1.00 0.00 ? 103 ILE A HG21 3  
ATOM 4121  H HG22 . ILE A 1 73 ? 7.323   -3.705  -3.907  1.00 0.00 ? 103 ILE A HG22 3  
ATOM 4122  H HG23 . ILE A 1 73 ? 8.592   -4.463  -2.945  1.00 0.00 ? 103 ILE A HG23 3  
ATOM 4123  H HD11 . ILE A 1 73 ? 6.744   -2.060  -3.568  1.00 0.00 ? 103 ILE A HD11 3  
ATOM 4124  H HD12 . ILE A 1 73 ? 7.181   -0.351  -3.536  1.00 0.00 ? 103 ILE A HD12 3  
ATOM 4125  H HD13 . ILE A 1 73 ? 6.832   -1.199  -2.029  1.00 0.00 ? 103 ILE A HD13 3  
ATOM 4126  N N    . ASP A 1 74 ? 11.035  -5.074  -4.943  1.00 0.00 ? 104 ASP A N    3  
ATOM 4127  C CA   . ASP A 1 74 ? 11.466  -5.926  -6.045  1.00 0.00 ? 104 ASP A CA   3  
ATOM 4128  C C    . ASP A 1 74 ? 10.267  -6.569  -6.735  1.00 0.00 ? 104 ASP A C    3  
ATOM 4129  O O    . ASP A 1 74 ? 9.197   -6.707  -6.142  1.00 0.00 ? 104 ASP A O    3  
ATOM 4130  C CB   . ASP A 1 74 ? 12.418  -7.010  -5.537  1.00 0.00 ? 104 ASP A CB   3  
ATOM 4131  C CG   . ASP A 1 74 ? 13.838  -6.503  -5.375  1.00 0.00 ? 104 ASP A CG   3  
ATOM 4132  O OD1  . ASP A 1 74 ? 14.047  -5.573  -4.568  1.00 0.00 ? 104 ASP A OD1  3  
ATOM 4133  O OD2  . ASP A 1 74 ? 14.739  -7.036  -6.055  1.00 0.00 ? 104 ASP A OD2  3  
ATOM 4134  H H    . ASP A 1 74 ? 10.622  -5.484  -4.155  1.00 0.00 ? 104 ASP A H    3  
ATOM 4135  H HA   . ASP A 1 74 ? 11.988  -5.308  -6.760  1.00 0.00 ? 104 ASP A HA   3  
ATOM 4136  H HB2  . ASP A 1 74 ? 12.072  -7.365  -4.578  1.00 0.00 ? 104 ASP A HB2  3  
ATOM 4137  H HB3  . ASP A 1 74 ? 12.426  -7.832  -6.239  1.00 0.00 ? 104 ASP A HB3  3  
ATOM 4138  N N    . ILE A 1 75 ? 10.453  -6.961  -7.991  1.00 0.00 ? 105 ILE A N    3  
ATOM 4139  C CA   . ILE A 1 75 ? 9.387   -7.589  -8.762  1.00 0.00 ? 105 ILE A CA   3  
ATOM 4140  C C    . ILE A 1 75 ? 9.834   -8.935  -9.327  1.00 0.00 ? 105 ILE A C    3  
ATOM 4141  O O    . ILE A 1 75 ? 10.183  -9.039  -10.503 1.00 0.00 ? 105 ILE A O    3  
ATOM 4142  C CB   . ILE A 1 75 ? 8.923   -6.686  -9.920  1.00 0.00 ? 105 ILE A CB   3  
ATOM 4143  C CG1  . ILE A 1 75 ? 8.657   -5.267  -9.416  1.00 0.00 ? 105 ILE A CG1  3  
ATOM 4144  C CG2  . ILE A 1 75 ? 7.679   -7.264  -10.578 1.00 0.00 ? 105 ILE A CG2  3  
ATOM 4145  C CD1  . ILE A 1 75 ? 9.868   -4.362  -9.489  1.00 0.00 ? 105 ILE A CD1  3  
ATOM 4146  H H    . ILE A 1 75 ? 11.329  -6.825  -8.410  1.00 0.00 ? 105 ILE A H    3  
ATOM 4147  H HA   . ILE A 1 75 ? 8.547   -7.750  -8.100  1.00 0.00 ? 105 ILE A HA   3  
ATOM 4148  H HB   . ILE A 1 75 ? 9.710   -6.656  -10.660 1.00 0.00 ? 105 ILE A HB   3  
ATOM 4149  H HG12 . ILE A 1 75 ? 7.874   -4.821  -10.010 1.00 0.00 ? 105 ILE A HG12 3  
ATOM 4150  H HG13 . ILE A 1 75 ? 8.338   -5.313  -8.384  1.00 0.00 ? 105 ILE A HG13 3  
ATOM 4151  H HG21 . ILE A 1 75 ? 7.154   -7.887  -9.869  1.00 0.00 ? 105 ILE A HG21 3  
ATOM 4152  H HG22 . ILE A 1 75 ? 7.965   -7.856  -11.434 1.00 0.00 ? 105 ILE A HG22 3  
ATOM 4153  H HG23 . ILE A 1 75 ? 7.034   -6.458  -10.897 1.00 0.00 ? 105 ILE A HG23 3  
ATOM 4154  H HD11 . ILE A 1 75 ? 9.606   -3.452  -10.007 1.00 0.00 ? 105 ILE A HD11 3  
ATOM 4155  H HD12 . ILE A 1 75 ? 10.661  -4.864  -10.022 1.00 0.00 ? 105 ILE A HD12 3  
ATOM 4156  H HD13 . ILE A 1 75 ? 10.200  -4.124  -8.489  1.00 0.00 ? 105 ILE A HD13 3  
ATOM 4157  N N    . PRO A 1 76 ? 9.830   -9.989  -8.493  1.00 0.00 ? 106 PRO A N    3  
ATOM 4158  C CA   . PRO A 1 76 ? 10.237  -11.333 -8.916  1.00 0.00 ? 106 PRO A CA   3  
ATOM 4159  C C    . PRO A 1 76 ? 9.471   -11.808 -10.147 1.00 0.00 ? 106 PRO A C    3  
ATOM 4160  O O    . PRO A 1 76 ? 8.259   -11.627 -10.244 1.00 0.00 ? 106 PRO A O    3  
ATOM 4161  C CB   . PRO A 1 76 ? 9.899   -12.209 -7.706  1.00 0.00 ? 106 PRO A CB   3  
ATOM 4162  C CG   . PRO A 1 76 ? 9.909   -11.276 -6.546  1.00 0.00 ? 106 PRO A CG   3  
ATOM 4163  C CD   . PRO A 1 76 ? 9.428   -9.953  -7.074  1.00 0.00 ? 106 PRO A CD   3  
ATOM 4164  H HA   . PRO A 1 76 ? 11.298  -11.381 -9.114  1.00 0.00 ? 106 PRO A HA   3  
ATOM 4165  H HB2  . PRO A 1 76 ? 8.925   -12.657 -7.844  1.00 0.00 ? 106 PRO A HB2  3  
ATOM 4166  H HB3  . PRO A 1 76 ? 10.646  -12.981 -7.598  1.00 0.00 ? 106 PRO A HB3  3  
ATOM 4167  H HG2  . PRO A 1 76 ? 9.242   -11.638 -5.777  1.00 0.00 ? 106 PRO A HG2  3  
ATOM 4168  H HG3  . PRO A 1 76 ? 10.913  -11.181 -6.159  1.00 0.00 ? 106 PRO A HG3  3  
ATOM 4169  H HD2  . PRO A 1 76 ? 8.355   -9.876  -6.979  1.00 0.00 ? 106 PRO A HD2  3  
ATOM 4170  H HD3  . PRO A 1 76 ? 9.915   -9.140  -6.557  1.00 0.00 ? 106 PRO A HD3  3  
ATOM 4171  N N    . LYS A 1 77 ? 10.189  -12.417 -11.085 1.00 0.00 ? 107 LYS A N    3  
ATOM 4172  C CA   . LYS A 1 77 ? 9.578   -12.918 -12.310 1.00 0.00 ? 107 LYS A CA   3  
ATOM 4173  C C    . LYS A 1 77 ? 8.518   -13.970 -11.997 1.00 0.00 ? 107 LYS A C    3  
ATOM 4174  O O    . LYS A 1 77 ? 8.889   -15.152 -11.837 1.00 0.00 ? 107 LYS A O    3  
ATOM 4175  C CB   . LYS A 1 77 ? 10.647  -13.505 -13.236 1.00 0.00 ? 107 LYS A CB   3  
ATOM 4176  C CG   . LYS A 1 77 ? 10.750  -12.789 -14.574 1.00 0.00 ? 107 LYS A CG   3  
ATOM 4177  C CD   . LYS A 1 77 ? 10.656  -13.763 -15.739 1.00 0.00 ? 107 LYS A CD   3  
ATOM 4178  C CE   . LYS A 1 77 ? 9.849   -13.180 -16.888 1.00 0.00 ? 107 LYS A CE   3  
ATOM 4179  N NZ   . LYS A 1 77 ? 9.369   -14.236 -17.823 1.00 0.00 ? 107 LYS A NZ   3  
ATOM 4180  O OXT  . LYS A 1 77 ? 7.327   -13.604 -11.914 1.00 0.00 ? 107 LYS A OXT  3  
ATOM 4181  H H    . LYS A 1 77 ? 11.154  -12.531 -10.951 1.00 0.00 ? 107 LYS A H    3  
ATOM 4182  H HA   . LYS A 1 77 ? 9.103   -12.085 -12.807 1.00 0.00 ? 107 LYS A HA   3  
ATOM 4183  H HB2  . LYS A 1 77 ? 11.606  -13.442 -12.744 1.00 0.00 ? 107 LYS A HB2  3  
ATOM 4184  H HB3  . LYS A 1 77 ? 10.416  -14.543 -13.423 1.00 0.00 ? 107 LYS A HB3  3  
ATOM 4185  H HG2  . LYS A 1 77 ? 9.946   -12.074 -14.652 1.00 0.00 ? 107 LYS A HG2  3  
ATOM 4186  H HG3  . LYS A 1 77 ? 11.699  -12.276 -14.623 1.00 0.00 ? 107 LYS A HG3  3  
ATOM 4187  H HD2  . LYS A 1 77 ? 11.652  -13.987 -16.090 1.00 0.00 ? 107 LYS A HD2  3  
ATOM 4188  H HD3  . LYS A 1 77 ? 10.178  -14.671 -15.399 1.00 0.00 ? 107 LYS A HD3  3  
ATOM 4189  H HE2  . LYS A 1 77 ? 8.995   -12.657 -16.483 1.00 0.00 ? 107 LYS A HE2  3  
ATOM 4190  H HE3  . LYS A 1 77 ? 10.471  -12.485 -17.432 1.00 0.00 ? 107 LYS A HE3  3  
ATOM 4191  H HZ1  . LYS A 1 77 ? 8.414   -14.005 -18.163 1.00 0.00 ? 107 LYS A HZ1  3  
ATOM 4192  H HZ2  . LYS A 1 77 ? 9.341   -15.155 -17.339 1.00 0.00 ? 107 LYS A HZ2  3  
ATOM 4193  H HZ3  . LYS A 1 77 ? 10.009  -14.306 -18.640 1.00 0.00 ? 107 LYS A HZ3  3  
ATOM 4194  N N    . ALA B 2 1  ? 9.102   7.128   7.375   1.00 0.00 ? 43  ALA B N    3  
ATOM 4195  C CA   . ALA B 2 1  ? 8.186   7.018   6.209   1.00 0.00 ? 43  ALA B CA   3  
ATOM 4196  C C    . ALA B 2 1  ? 6.873   7.750   6.472   1.00 0.00 ? 43  ALA B C    3  
ATOM 4197  O O    . ALA B 2 1  ? 5.908   7.156   6.952   1.00 0.00 ? 43  ALA B O    3  
ATOM 4198  C CB   . ALA B 2 1  ? 7.920   5.555   5.886   1.00 0.00 ? 43  ALA B CB   3  
ATOM 4199  H H1   . ALA B 2 1  ? 10.073  6.992   7.030   1.00 0.00 ? 43  ALA B H1   3  
ATOM 4200  H H2   . ALA B 2 1  ? 8.837   6.388   8.056   1.00 0.00 ? 43  ALA B H2   3  
ATOM 4201  H H3   . ALA B 2 1  ? 8.981   8.076   7.784   1.00 0.00 ? 43  ALA B H3   3  
ATOM 4202  H HA   . ALA B 2 1  ? 8.670   7.467   5.353   1.00 0.00 ? 43  ALA B HA   3  
ATOM 4203  H HB1  . ALA B 2 1  ? 7.309   5.488   4.997   1.00 0.00 ? 43  ALA B HB1  3  
ATOM 4204  H HB2  . ALA B 2 1  ? 7.403   5.092   6.713   1.00 0.00 ? 43  ALA B HB2  3  
ATOM 4205  H HB3  . ALA B 2 1  ? 8.857   5.048   5.717   1.00 0.00 ? 43  ALA B HB3  3  
ATOM 4206  N N    . PRO B 2 2  ? 6.819   9.056   6.157   1.00 0.00 ? 44  PRO B N    3  
ATOM 4207  C CA   . PRO B 2 2  ? 5.616   9.868   6.360   1.00 0.00 ? 44  PRO B CA   3  
ATOM 4208  C C    . PRO B 2 2  ? 4.524   9.552   5.342   1.00 0.00 ? 44  PRO B C    3  
ATOM 4209  O O    . PRO B 2 2  ? 3.352   9.866   5.557   1.00 0.00 ? 44  PRO B O    3  
ATOM 4210  C CB   . PRO B 2 2  ? 6.123   11.297  6.176   1.00 0.00 ? 44  PRO B CB   3  
ATOM 4211  C CG   . PRO B 2 2  ? 7.286   11.166  5.256   1.00 0.00 ? 44  PRO B CG   3  
ATOM 4212  C CD   . PRO B 2 2  ? 7.926   9.842   5.578   1.00 0.00 ? 44  PRO B CD   3  
ATOM 4213  H HA   . PRO B 2 2  ? 5.221   9.748   7.359   1.00 0.00 ? 44  PRO B HA   3  
ATOM 4214  H HB2  . PRO B 2 2  ? 5.342   11.906  5.744   1.00 0.00 ? 44  PRO B HB2  3  
ATOM 4215  H HB3  . PRO B 2 2  ? 6.420   11.704  7.131   1.00 0.00 ? 44  PRO B HB3  3  
ATOM 4216  H HG2  . PRO B 2 2  ? 6.947   11.179  4.231   1.00 0.00 ? 44  PRO B HG2  3  
ATOM 4217  H HG3  . PRO B 2 2  ? 7.985   11.971  5.430   1.00 0.00 ? 44  PRO B HG3  3  
ATOM 4218  H HD2  . PRO B 2 2  ? 8.299   9.375   4.679   1.00 0.00 ? 44  PRO B HD2  3  
ATOM 4219  H HD3  . PRO B 2 2  ? 8.721   9.972   6.296   1.00 0.00 ? 44  PRO B HD3  3  
ATOM 4220  N N    . GLN B 2 3  ? 4.914   8.928   4.234   1.00 0.00 ? 45  GLN B N    3  
ATOM 4221  C CA   . GLN B 2 3  ? 3.965   8.568   3.188   1.00 0.00 ? 45  GLN B CA   3  
ATOM 4222  C C    . GLN B 2 3  ? 3.172   7.331   3.584   1.00 0.00 ? 45  GLN B C    3  
ATOM 4223  O O    . GLN B 2 3  ? 2.050   7.122   3.122   1.00 0.00 ? 45  GLN B O    3  
ATOM 4224  C CB   . GLN B 2 3  ? 4.697   8.325   1.866   1.00 0.00 ? 45  GLN B CB   3  
ATOM 4225  C CG   . GLN B 2 3  ? 4.734   9.543   0.958   1.00 0.00 ? 45  GLN B CG   3  
ATOM 4226  C CD   . GLN B 2 3  ? 5.938   10.427  1.215   1.00 0.00 ? 45  GLN B CD   3  
ATOM 4227  O OE1  . GLN B 2 3  ? 5.982   11.165  2.200   1.00 0.00 ? 45  GLN B OE1  3  
ATOM 4228  N NE2  . GLN B 2 3  ? 6.924   10.359  0.328   1.00 0.00 ? 45  GLN B NE2  3  
ATOM 4229  H H    . GLN B 2 3  ? 5.857   8.698   4.120   1.00 0.00 ? 45  GLN B H    3  
ATOM 4230  H HA   . GLN B 2 3  ? 3.282   9.392   3.066   1.00 0.00 ? 45  GLN B HA   3  
ATOM 4231  H HB2  . GLN B 2 3  ? 5.714   8.032   2.080   1.00 0.00 ? 45  GLN B HB2  3  
ATOM 4232  H HB3  . GLN B 2 3  ? 4.204   7.523   1.336   1.00 0.00 ? 45  GLN B HB3  3  
ATOM 4233  H HG2  . GLN B 2 3  ? 4.765   9.210   -0.069  1.00 0.00 ? 45  GLN B HG2  3  
ATOM 4234  H HG3  . GLN B 2 3  ? 3.838   10.124  1.119   1.00 0.00 ? 45  GLN B HG3  3  
ATOM 4235  H HE21 . GLN B 2 3  ? 6.820   9.749   -0.433  1.00 0.00 ? 45  GLN B HE21 3  
ATOM 4236  H HE22 . GLN B 2 3  ? 7.715   10.920  0.470   1.00 0.00 ? 45  GLN B HE22 3  
ATOM 4237  N N    . LEU B 2 4  ? 3.762   6.515   4.447   1.00 0.00 ? 46  LEU B N    3  
ATOM 4238  C CA   . LEU B 2 4  ? 3.108   5.302   4.913   1.00 0.00 ? 46  LEU B CA   3  
ATOM 4239  C C    . LEU B 2 4  ? 2.051   5.637   5.956   1.00 0.00 ? 46  LEU B C    3  
ATOM 4240  O O    . LEU B 2 4  ? 1.007   4.989   6.030   1.00 0.00 ? 46  LEU B O    3  
ATOM 4241  C CB   . LEU B 2 4  ? 4.137   4.329   5.495   1.00 0.00 ? 46  LEU B CB   3  
ATOM 4242  C CG   . LEU B 2 4  ? 4.582   3.216   4.545   1.00 0.00 ? 46  LEU B CG   3  
ATOM 4243  C CD1  . LEU B 2 4  ? 5.589   2.303   5.227   1.00 0.00 ? 46  LEU B CD1  3  
ATOM 4244  C CD2  . LEU B 2 4  ? 3.380   2.419   4.058   1.00 0.00 ? 46  LEU B CD2  3  
ATOM 4245  H H    . LEU B 2 4  ? 4.654   6.739   4.783   1.00 0.00 ? 46  LEU B H    3  
ATOM 4246  H HA   . LEU B 2 4  ? 2.627   4.843   4.064   1.00 0.00 ? 46  LEU B HA   3  
ATOM 4247  H HB2  . LEU B 2 4  ? 5.009   4.894   5.789   1.00 0.00 ? 46  LEU B HB2  3  
ATOM 4248  H HB3  . LEU B 2 4  ? 3.712   3.870   6.375   1.00 0.00 ? 46  LEU B HB3  3  
ATOM 4249  H HG   . LEU B 2 4  ? 5.063   3.657   3.684   1.00 0.00 ? 46  LEU B HG   3  
ATOM 4250  H HD11 . LEU B 2 4  ? 6.329   2.901   5.738   1.00 0.00 ? 46  LEU B HD11 3  
ATOM 4251  H HD12 . LEU B 2 4  ? 6.074   1.685   4.487   1.00 0.00 ? 46  LEU B HD12 3  
ATOM 4252  H HD13 . LEU B 2 4  ? 5.078   1.675   5.942   1.00 0.00 ? 46  LEU B HD13 3  
ATOM 4253  H HD21 . LEU B 2 4  ? 2.549   2.572   4.731   1.00 0.00 ? 46  LEU B HD21 3  
ATOM 4254  H HD22 . LEU B 2 4  ? 3.630   1.370   4.027   1.00 0.00 ? 46  LEU B HD22 3  
ATOM 4255  H HD23 . LEU B 2 4  ? 3.106   2.752   3.067   1.00 0.00 ? 46  LEU B HD23 3  
ATOM 4256  N N    . ILE B 2 5  ? 2.323   6.666   6.751   1.00 0.00 ? 47  ILE B N    3  
ATOM 4257  C CA   . ILE B 2 5  ? 1.392   7.101   7.780   1.00 0.00 ? 47  ILE B CA   3  
ATOM 4258  C C    . ILE B 2 5  ? 0.189   7.791   7.151   1.00 0.00 ? 47  ILE B C    3  
ATOM 4259  O O    . ILE B 2 5  ? -0.950  7.598   7.581   1.00 0.00 ? 47  ILE B O    3  
ATOM 4260  C CB   . ILE B 2 5  ? 2.061   8.063   8.781   1.00 0.00 ? 47  ILE B CB   3  
ATOM 4261  C CG1  . ILE B 2 5  ? 3.368   7.464   9.302   1.00 0.00 ? 47  ILE B CG1  3  
ATOM 4262  C CG2  . ILE B 2 5  ? 1.117   8.370   9.934   1.00 0.00 ? 47  ILE B CG2  3  
ATOM 4263  C CD1  . ILE B 2 5  ? 4.285   8.481   9.946   1.00 0.00 ? 47  ILE B CD1  3  
ATOM 4264  H H    . ILE B 2 5  ? 3.168   7.149   6.636   1.00 0.00 ? 47  ILE B H    3  
ATOM 4265  H HA   . ILE B 2 5  ? 1.054   6.226   8.319   1.00 0.00 ? 47  ILE B HA   3  
ATOM 4266  H HB   . ILE B 2 5  ? 2.276   8.987   8.268   1.00 0.00 ? 47  ILE B HB   3  
ATOM 4267  H HG12 . ILE B 2 5  ? 3.143   6.709   10.040  1.00 0.00 ? 47  ILE B HG12 3  
ATOM 4268  H HG13 . ILE B 2 5  ? 3.902   7.009   8.480   1.00 0.00 ? 47  ILE B HG13 3  
ATOM 4269  H HG21 . ILE B 2 5  ? 0.099   8.190   9.623   1.00 0.00 ? 47  ILE B HG21 3  
ATOM 4270  H HG22 . ILE B 2 5  ? 1.228   9.405   10.224  1.00 0.00 ? 47  ILE B HG22 3  
ATOM 4271  H HG23 . ILE B 2 5  ? 1.355   7.734   10.773  1.00 0.00 ? 47  ILE B HG23 3  
ATOM 4272  H HD11 . ILE B 2 5  ? 5.297   8.102   9.951   1.00 0.00 ? 47  ILE B HD11 3  
ATOM 4273  H HD12 . ILE B 2 5  ? 3.963   8.665   10.960  1.00 0.00 ? 47  ILE B HD12 3  
ATOM 4274  H HD13 . ILE B 2 5  ? 4.249   9.404   9.385   1.00 0.00 ? 47  ILE B HD13 3  
ATOM 4275  N N    . MET B 2 6  ? 0.449   8.593   6.121   1.00 0.00 ? 48  MET B N    3  
ATOM 4276  C CA   . MET B 2 6  ? -0.613  9.306   5.425   1.00 0.00 ? 48  MET B CA   3  
ATOM 4277  C C    . MET B 2 6  ? -1.470  8.338   4.618   1.00 0.00 ? 48  MET B C    3  
ATOM 4278  O O    . MET B 2 6  ? -2.665  8.564   4.420   1.00 0.00 ? 48  MET B O    3  
ATOM 4279  C CB   . MET B 2 6  ? -0.025  10.393  4.515   1.00 0.00 ? 48  MET B CB   3  
ATOM 4280  C CG   . MET B 2 6  ? 0.512   9.871   3.191   1.00 0.00 ? 48  MET B CG   3  
ATOM 4281  S SD   . MET B 2 6  ? -0.597  10.207  1.809   1.00 0.00 ? 48  MET B SD   3  
ATOM 4282  C CE   . MET B 2 6  ? 0.578   10.634  0.526   1.00 0.00 ? 48  MET B CE   3  
ATOM 4283  H H    . MET B 2 6  ? 1.376   8.702   5.821   1.00 0.00 ? 48  MET B H    3  
ATOM 4284  H HA   . MET B 2 6  ? -1.234  9.772   6.170   1.00 0.00 ? 48  MET B HA   3  
ATOM 4285  H HB2  . MET B 2 6  ? -0.793  11.122  4.305   1.00 0.00 ? 48  MET B HB2  3  
ATOM 4286  H HB3  . MET B 2 6  ? 0.784   10.881  5.038   1.00 0.00 ? 48  MET B HB3  3  
ATOM 4287  H HG2  . MET B 2 6  ? 1.463   10.341  2.992   1.00 0.00 ? 48  MET B HG2  3  
ATOM 4288  H HG3  . MET B 2 6  ? 0.651   8.803   3.270   1.00 0.00 ? 48  MET B HG3  3  
ATOM 4289  H HE1  . MET B 2 6  ? 1.476   10.047  0.652   1.00 0.00 ? 48  MET B HE1  3  
ATOM 4290  H HE2  . MET B 2 6  ? 0.822   11.684  0.596   1.00 0.00 ? 48  MET B HE2  3  
ATOM 4291  H HE3  . MET B 2 6  ? 0.146   10.428  -0.442  1.00 0.00 ? 48  MET B HE3  3  
ATOM 4292  N N    . LEU B 2 7  ? -0.852  7.256   4.163   1.00 0.00 ? 49  LEU B N    3  
ATOM 4293  C CA   . LEU B 2 7  ? -1.555  6.246   3.384   1.00 0.00 ? 49  LEU B CA   3  
ATOM 4294  C C    . LEU B 2 7  ? -2.597  5.540   4.245   1.00 0.00 ? 49  LEU B C    3  
ATOM 4295  O O    . LEU B 2 7  ? -3.761  5.423   3.861   1.00 0.00 ? 49  LEU B O    3  
ATOM 4296  C CB   . LEU B 2 7  ? -0.565  5.227   2.816   1.00 0.00 ? 49  LEU B CB   3  
ATOM 4297  C CG   . LEU B 2 7  ? -0.036  5.548   1.416   1.00 0.00 ? 49  LEU B CG   3  
ATOM 4298  C CD1  . LEU B 2 7  ? 1.332   4.917   1.207   1.00 0.00 ? 49  LEU B CD1  3  
ATOM 4299  C CD2  . LEU B 2 7  ? -1.015  5.069   0.355   1.00 0.00 ? 49  LEU B CD2  3  
ATOM 4300  H H    . LEU B 2 7  ? 0.100   7.133   4.361   1.00 0.00 ? 49  LEU B H    3  
ATOM 4301  H HA   . LEU B 2 7  ? -2.056  6.745   2.567   1.00 0.00 ? 49  LEU B HA   3  
ATOM 4302  H HB2  . LEU B 2 7  ? 0.277   5.160   3.490   1.00 0.00 ? 49  LEU B HB2  3  
ATOM 4303  H HB3  . LEU B 2 7  ? -1.052  4.263   2.780   1.00 0.00 ? 49  LEU B HB3  3  
ATOM 4304  H HG   . LEU B 2 7  ? 0.070   6.618   1.316   1.00 0.00 ? 49  LEU B HG   3  
ATOM 4305  H HD11 . LEU B 2 7  ? 1.436   4.059   1.852   1.00 0.00 ? 49  LEU B HD11 3  
ATOM 4306  H HD12 . LEU B 2 7  ? 2.101   5.639   1.440   1.00 0.00 ? 49  LEU B HD12 3  
ATOM 4307  H HD13 . LEU B 2 7  ? 1.431   4.607   0.176   1.00 0.00 ? 49  LEU B HD13 3  
ATOM 4308  H HD21 . LEU B 2 7  ? -0.555  5.145   -0.619  1.00 0.00 ? 49  LEU B HD21 3  
ATOM 4309  H HD22 . LEU B 2 7  ? -1.904  5.680   0.383   1.00 0.00 ? 49  LEU B HD22 3  
ATOM 4310  H HD23 . LEU B 2 7  ? -1.281  4.040   0.548   1.00 0.00 ? 49  LEU B HD23 3  
ATOM 4311  N N    . ALA B 2 8  ? -2.170  5.078   5.415   1.00 0.00 ? 50  ALA B N    3  
ATOM 4312  C CA   . ALA B 2 8  ? -3.063  4.390   6.336   1.00 0.00 ? 50  ALA B CA   3  
ATOM 4313  C C    . ALA B 2 8  ? -4.190  5.313   6.787   1.00 0.00 ? 50  ALA B C    3  
ATOM 4314  O O    . ALA B 2 8  ? -5.315  4.869   7.018   1.00 0.00 ? 50  ALA B O    3  
ATOM 4315  C CB   . ALA B 2 8  ? -2.288  3.872   7.537   1.00 0.00 ? 50  ALA B CB   3  
ATOM 4316  H H    . ALA B 2 8  ? -1.232  5.207   5.667   1.00 0.00 ? 50  ALA B H    3  
ATOM 4317  H HA   . ALA B 2 8  ? -3.489  3.544   5.817   1.00 0.00 ? 50  ALA B HA   3  
ATOM 4318  H HB1  . ALA B 2 8  ? -2.031  4.698   8.184   1.00 0.00 ? 50  ALA B HB1  3  
ATOM 4319  H HB2  . ALA B 2 8  ? -1.386  3.384   7.200   1.00 0.00 ? 50  ALA B HB2  3  
ATOM 4320  H HB3  . ALA B 2 8  ? -2.898  3.166   8.082   1.00 0.00 ? 50  ALA B HB3  3  
ATOM 4321  N N    . ASN B 2 9  ? -3.881  6.600   6.905   1.00 0.00 ? 51  ASN B N    3  
ATOM 4322  C CA   . ASN B 2 9  ? -4.870  7.586   7.324   1.00 0.00 ? 51  ASN B CA   3  
ATOM 4323  C C    . ASN B 2 9  ? -6.022  7.647   6.329   1.00 0.00 ? 51  ASN B C    3  
ATOM 4324  O O    . ASN B 2 9  ? -7.190  7.678   6.715   1.00 0.00 ? 51  ASN B O    3  
ATOM 4325  C CB   . ASN B 2 9  ? -4.222  8.965   7.460   1.00 0.00 ? 51  ASN B CB   3  
ATOM 4326  C CG   . ASN B 2 9  ? -3.441  9.113   8.751   1.00 0.00 ? 51  ASN B CG   3  
ATOM 4327  O OD1  . ASN B 2 9  ? -2.990  8.127   9.334   1.00 0.00 ? 51  ASN B OD1  3  
ATOM 4328  N ND2  . ASN B 2 9  ? -3.277  10.350  9.205   1.00 0.00 ? 51  ASN B ND2  3  
ATOM 4329  H H    . ASN B 2 9  ? -2.968  6.894   6.703   1.00 0.00 ? 51  ASN B H    3  
ATOM 4330  H HA   . ASN B 2 9  ? -5.256  7.282   8.286   1.00 0.00 ? 51  ASN B HA   3  
ATOM 4331  H HB2  . ASN B 2 9  ? -3.546  9.121   6.632   1.00 0.00 ? 51  ASN B HB2  3  
ATOM 4332  H HB3  . ASN B 2 9  ? -4.993  9.722   7.437   1.00 0.00 ? 51  ASN B HB3  3  
ATOM 4333  H HD21 . ASN B 2 9  ? -3.665  11.087  8.689   1.00 0.00 ? 51  ASN B HD21 3  
ATOM 4334  H HD22 . ASN B 2 9  ? -2.777  10.475  10.038  1.00 0.00 ? 51  ASN B HD22 3  
ATOM 4335  N N    . VAL B 2 10 ? -5.683  7.658   5.043   1.00 0.00 ? 52  VAL B N    3  
ATOM 4336  C CA   . VAL B 2 10 ? -6.687  7.709   3.990   1.00 0.00 ? 52  VAL B CA   3  
ATOM 4337  C C    . VAL B 2 10 ? -7.493  6.414   3.943   1.00 0.00 ? 52  VAL B C    3  
ATOM 4338  O O    . VAL B 2 10 ? -8.664  6.414   3.564   1.00 0.00 ? 52  VAL B O    3  
ATOM 4339  C CB   . VAL B 2 10 ? -6.044  7.953   2.611   1.00 0.00 ? 52  VAL B CB   3  
ATOM 4340  C CG1  . VAL B 2 10 ? -7.112  8.126   1.541   1.00 0.00 ? 52  VAL B CG1  3  
ATOM 4341  C CG2  . VAL B 2 10 ? -5.124  9.164   2.658   1.00 0.00 ? 52  VAL B CG2  3  
ATOM 4342  H H    . VAL B 2 10 ? -4.735  7.627   4.799   1.00 0.00 ? 52  VAL B H    3  
ATOM 4343  H HA   . VAL B 2 10 ? -7.356  8.530   4.204   1.00 0.00 ? 52  VAL B HA   3  
ATOM 4344  H HB   . VAL B 2 10 ? -5.449  7.088   2.357   1.00 0.00 ? 52  VAL B HB   3  
ATOM 4345  H HG11 . VAL B 2 10 ? -7.661  7.202   1.428   1.00 0.00 ? 52  VAL B HG11 3  
ATOM 4346  H HG12 . VAL B 2 10 ? -6.643  8.384   0.603   1.00 0.00 ? 52  VAL B HG12 3  
ATOM 4347  H HG13 . VAL B 2 10 ? -7.790  8.913   1.835   1.00 0.00 ? 52  VAL B HG13 3  
ATOM 4348  H HG21 . VAL B 2 10 ? -4.098  8.835   2.727   1.00 0.00 ? 52  VAL B HG21 3  
ATOM 4349  H HG22 . VAL B 2 10 ? -5.367  9.767   3.521   1.00 0.00 ? 52  VAL B HG22 3  
ATOM 4350  H HG23 . VAL B 2 10 ? -5.253  9.751   1.760   1.00 0.00 ? 52  VAL B HG23 3  
ATOM 4351  N N    . ALA B 2 11 ? -6.860  5.314   4.338   1.00 0.00 ? 53  ALA B N    3  
ATOM 4352  C CA   . ALA B 2 11 ? -7.518  4.021   4.349   1.00 0.00 ? 53  ALA B CA   3  
ATOM 4353  C C    . ALA B 2 11 ? -8.434  3.908   5.558   1.00 0.00 ? 53  ALA B C    3  
ATOM 4354  O O    . ALA B 2 11 ? -9.504  3.303   5.490   1.00 0.00 ? 53  ALA B O    3  
ATOM 4355  C CB   . ALA B 2 11 ? -6.489  2.900   4.352   1.00 0.00 ? 53  ALA B CB   3  
ATOM 4356  H H    . ALA B 2 11 ? -5.933  5.375   4.634   1.00 0.00 ? 53  ALA B H    3  
ATOM 4357  H HA   . ALA B 2 11 ? -8.105  3.941   3.451   1.00 0.00 ? 53  ALA B HA   3  
ATOM 4358  H HB1  . ALA B 2 11 ? -5.550  3.273   3.970   1.00 0.00 ? 53  ALA B HB1  3  
ATOM 4359  H HB2  . ALA B 2 11 ? -6.836  2.091   3.727   1.00 0.00 ? 53  ALA B HB2  3  
ATOM 4360  H HB3  . ALA B 2 11 ? -6.350  2.541   5.361   1.00 0.00 ? 53  ALA B HB3  3  
ATOM 4361  N N    . LEU B 2 12 ? -8.004  4.506   6.663   1.00 0.00 ? 54  LEU B N    3  
ATOM 4362  C CA   . LEU B 2 12 ? -8.778  4.488   7.891   1.00 0.00 ? 54  LEU B CA   3  
ATOM 4363  C C    . LEU B 2 12 ? -9.819  5.604   7.894   1.00 0.00 ? 54  LEU B C    3  
ATOM 4364  O O    . LEU B 2 12 ? -10.808 5.543   8.625   1.00 0.00 ? 54  LEU B O    3  
ATOM 4365  C CB   . LEU B 2 12 ? -7.856  4.623   9.105   1.00 0.00 ? 54  LEU B CB   3  
ATOM 4366  C CG   . LEU B 2 12 ? -7.379  3.301   9.707   1.00 0.00 ? 54  LEU B CG   3  
ATOM 4367  C CD1  . LEU B 2 12 ? -6.717  2.439   8.643   1.00 0.00 ? 54  LEU B CD1  3  
ATOM 4368  C CD2  . LEU B 2 12 ? -6.421  3.559   10.861  1.00 0.00 ? 54  LEU B CD2  3  
ATOM 4369  H H    . LEU B 2 12 ? -7.149  4.973   6.652   1.00 0.00 ? 54  LEU B H    3  
ATOM 4370  H HA   . LEU B 2 12 ? -9.281  3.542   7.936   1.00 0.00 ? 54  LEU B HA   3  
ATOM 4371  H HB2  . LEU B 2 12 ? -6.989  5.196   8.810   1.00 0.00 ? 54  LEU B HB2  3  
ATOM 4372  H HB3  . LEU B 2 12 ? -8.384  5.172   9.871   1.00 0.00 ? 54  LEU B HB3  3  
ATOM 4373  H HG   . LEU B 2 12 ? -8.231  2.760   10.093  1.00 0.00 ? 54  LEU B HG   3  
ATOM 4374  H HD11 . LEU B 2 12 ? -7.432  1.725   8.262   1.00 0.00 ? 54  LEU B HD11 3  
ATOM 4375  H HD12 . LEU B 2 12 ? -5.878  1.912   9.076   1.00 0.00 ? 54  LEU B HD12 3  
ATOM 4376  H HD13 . LEU B 2 12 ? -6.369  3.066   7.836   1.00 0.00 ? 54  LEU B HD13 3  
ATOM 4377  H HD21 . LEU B 2 12 ? -5.665  2.787   10.881  1.00 0.00 ? 54  LEU B HD21 3  
ATOM 4378  H HD22 . LEU B 2 12 ? -6.969  3.550   11.792  1.00 0.00 ? 54  LEU B HD22 3  
ATOM 4379  H HD23 . LEU B 2 12 ? -5.949  4.522   10.729  1.00 0.00 ? 54  LEU B HD23 3  
ATOM 4380  N N    . THR B 2 13 ? -9.589  6.623   7.071   1.00 0.00 ? 55  THR B N    3  
ATOM 4381  C CA   . THR B 2 13 ? -10.502 7.754   6.974   1.00 0.00 ? 55  THR B CA   3  
ATOM 4382  C C    . THR B 2 13 ? -10.107 8.672   5.821   1.00 0.00 ? 55  THR B C    3  
ATOM 4383  O O    . THR B 2 13 ? -9.280  9.570   5.983   1.00 0.00 ? 55  THR B O    3  
ATOM 4384  C CB   . THR B 2 13 ? -10.520 8.540   8.288   1.00 0.00 ? 55  THR B CB   3  
ATOM 4385  O OG1  . THR B 2 13 ? -9.492  8.096   9.156   1.00 0.00 ? 55  THR B OG1  3  
ATOM 4386  C CG2  . THR B 2 13 ? -11.831 8.427   9.035   1.00 0.00 ? 55  THR B CG2  3  
ATOM 4387  H H    . THR B 2 13 ? -8.785  6.613   6.514   1.00 0.00 ? 55  THR B H    3  
ATOM 4388  H HA   . THR B 2 13 ? -11.488 7.365   6.785   1.00 0.00 ? 55  THR B HA   3  
ATOM 4389  H HB   . THR B 2 13 ? -10.353 9.586   8.074   1.00 0.00 ? 55  THR B HB   3  
ATOM 4390  H HG1  . THR B 2 13 ? -8.641  8.196   8.722   1.00 0.00 ? 55  THR B HG1  3  
ATOM 4391  H HG21 . THR B 2 13 ? -12.342 9.377   9.014   1.00 0.00 ? 55  THR B HG21 3  
ATOM 4392  H HG22 . THR B 2 13 ? -11.639 8.144   10.060  1.00 0.00 ? 55  THR B HG22 3  
ATOM 4393  H HG23 . THR B 2 13 ? -12.449 7.675   8.566   1.00 0.00 ? 55  THR B HG23 3  
ATOM 4394  N N    . GLY B 2 14 ? -10.703 8.441   4.656   1.00 0.00 ? 56  GLY B N    3  
ATOM 4395  C CA   . GLY B 2 14 ? -10.400 9.254   3.493   1.00 0.00 ? 56  GLY B CA   3  
ATOM 4396  C C    . GLY B 2 14 ? -11.281 10.485  3.399   1.00 0.00 ? 56  GLY B C    3  
ATOM 4397  O O    . GLY B 2 14 ? -11.900 10.736  2.365   1.00 0.00 ? 56  GLY B O    3  
ATOM 4398  H H    . GLY B 2 14 ? -11.355 7.712   4.586   1.00 0.00 ? 56  GLY B H    3  
ATOM 4399  H HA2  . GLY B 2 14 ? -9.368  9.567   3.545   1.00 0.00 ? 56  GLY B HA2  3  
ATOM 4400  H HA3  . GLY B 2 14 ? -10.540 8.657   2.604   1.00 0.00 ? 56  GLY B HA3  3  
ATOM 4401  N N    . GLU B 2 15 ? -11.336 11.253  4.481   1.00 0.00 ? 57  GLU B N    3  
ATOM 4402  C CA   . GLU B 2 15 ? -12.146 12.465  4.518   1.00 0.00 ? 57  GLU B CA   3  
ATOM 4403  C C    . GLU B 2 15 ? -11.689 13.459  3.455   1.00 0.00 ? 57  GLU B C    3  
ATOM 4404  O O    . GLU B 2 15 ? -12.554 14.162  2.892   1.00 0.00 ? 57  GLU B O    3  
ATOM 4405  C CB   . GLU B 2 15 ? -12.073 13.111  5.902   1.00 0.00 ? 57  GLU B CB   3  
ATOM 4406  C CG   . GLU B 2 15 ? -12.922 12.407  6.949   1.00 0.00 ? 57  GLU B CG   3  
ATOM 4407  C CD   . GLU B 2 15 ? -12.449 12.680  8.362   1.00 0.00 ? 57  GLU B CD   3  
ATOM 4408  O OE1  . GLU B 2 15 ? -12.435 13.862  8.766   1.00 0.00 ? 57  GLU B OE1  3  
ATOM 4409  O OE2  . GLU B 2 15 ? -12.092 11.713  9.066   1.00 0.00 ? 57  GLU B OE2  3  
ATOM 4410  O OXT  . GLU B 2 15 ? -10.469 13.526  3.196   1.00 0.00 ? 57  GLU B OXT  3  
ATOM 4411  H H    . GLU B 2 15 ? -10.820 11.000  5.275   1.00 0.00 ? 57  GLU B H    3  
ATOM 4412  H HA   . GLU B 2 15 ? -13.170 12.186  4.315   1.00 0.00 ? 57  GLU B HA   3  
ATOM 4413  H HB2  . GLU B 2 15 ? -11.046 13.102  6.237   1.00 0.00 ? 57  GLU B HB2  3  
ATOM 4414  H HB3  . GLU B 2 15 ? -12.409 14.135  5.828   1.00 0.00 ? 57  GLU B HB3  3  
ATOM 4415  H HG2  . GLU B 2 15 ? -13.941 12.748  6.854   1.00 0.00 ? 57  GLU B HG2  3  
ATOM 4416  H HG3  . GLU B 2 15 ? -12.880 11.343  6.770   1.00 0.00 ? 57  GLU B HG3  3  
ATOM 4417  N N    . PRO A 1 1  ? 2.401   13.734  -8.001  1.00 0.00 ? 31  PRO A N    4  
ATOM 4418  C CA   . PRO A 1 1  ? 2.267   14.226  -6.602  1.00 0.00 ? 31  PRO A CA   4  
ATOM 4419  C C    . PRO A 1 1  ? 1.582   13.196  -5.705  1.00 0.00 ? 31  PRO A C    4  
ATOM 4420  O O    . PRO A 1 1  ? 0.355   13.126  -5.649  1.00 0.00 ? 31  PRO A O    4  
ATOM 4421  C CB   . PRO A 1 1  ? 1.455   15.517  -6.646  1.00 0.00 ? 31  PRO A CB   4  
ATOM 4422  C CG   . PRO A 1 1  ? 1.284   15.799  -8.101  1.00 0.00 ? 31  PRO A CG   4  
ATOM 4423  C CD   . PRO A 1 1  ? 1.419   14.474  -8.810  1.00 0.00 ? 31  PRO A CD   4  
ATOM 4424  H H2   . PRO A 1 1  ? 2.284   12.713  -7.894  1.00 0.00 ? 31  PRO A H2   4  
ATOM 4425  H H3   . PRO A 1 1  ? 3.426   13.865  -8.169  1.00 0.00 ? 31  PRO A H3   4  
ATOM 4426  H HA   . PRO A 1 1  ? 3.252   14.437  -6.213  1.00 0.00 ? 31  PRO A HA   4  
ATOM 4427  H HB2  . PRO A 1 1  ? 0.502   15.366  -6.156  1.00 0.00 ? 31  PRO A HB2  4  
ATOM 4428  H HB3  . PRO A 1 1  ? 2.000   16.308  -6.152  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 4429  H HG2  . PRO A 1 1  ? 0.306   16.221  -8.280  1.00 0.00 ? 31  PRO A HG2  4  
ATOM 4430  H HG3  . PRO A 1 1  ? 2.053   16.481  -8.433  1.00 0.00 ? 31  PRO A HG3  4  
ATOM 4431  H HD2  . PRO A 1 1  ? 0.471   13.958  -8.827  1.00 0.00 ? 31  PRO A HD2  4  
ATOM 4432  H HD3  . PRO A 1 1  ? 1.787   14.620  -9.816  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 4433  N N    . VAL A 1 2  ? 2.385   12.399  -5.007  1.00 0.00 ? 32  VAL A N    4  
ATOM 4434  C CA   . VAL A 1 2  ? 1.866   11.379  -4.117  1.00 0.00 ? 32  VAL A CA   4  
ATOM 4435  C C    . VAL A 1 2  ? 1.352   11.990  -2.818  1.00 0.00 ? 32  VAL A C    4  
ATOM 4436  O O    . VAL A 1 2  ? 2.086   12.089  -1.835  1.00 0.00 ? 32  VAL A O    4  
ATOM 4437  C CB   . VAL A 1 2  ? 2.946   10.334  -3.785  1.00 0.00 ? 32  VAL A CB   4  
ATOM 4438  C CG1  . VAL A 1 2  ? 3.086   9.328   -4.917  1.00 0.00 ? 32  VAL A CG1  4  
ATOM 4439  C CG2  . VAL A 1 2  ? 4.279   11.004  -3.487  1.00 0.00 ? 32  VAL A CG2  4  
ATOM 4440  H H    . VAL A 1 2  ? 3.352   12.498  -5.092  1.00 0.00 ? 32  VAL A H    4  
ATOM 4441  H HA   . VAL A 1 2  ? 1.050   10.878  -4.618  1.00 0.00 ? 32  VAL A HA   4  
ATOM 4442  H HB   . VAL A 1 2  ? 2.634   9.807   -2.906  1.00 0.00 ? 32  VAL A HB   4  
ATOM 4443  H HG11 . VAL A 1 2  ? 3.871   9.647   -5.587  1.00 0.00 ? 32  VAL A HG11 4  
ATOM 4444  H HG12 . VAL A 1 2  ? 2.155   9.264   -5.460  1.00 0.00 ? 32  VAL A HG12 4  
ATOM 4445  H HG13 . VAL A 1 2  ? 3.332   8.359   -4.509  1.00 0.00 ? 32  VAL A HG13 4  
ATOM 4446  H HG21 . VAL A 1 2  ? 4.889   10.341  -2.892  1.00 0.00 ? 32  VAL A HG21 4  
ATOM 4447  H HG22 . VAL A 1 2  ? 4.107   11.921  -2.943  1.00 0.00 ? 32  VAL A HG22 4  
ATOM 4448  H HG23 . VAL A 1 2  ? 4.787   11.225  -4.415  1.00 0.00 ? 32  VAL A HG23 4  
ATOM 4449  N N    . HIS A 1 3  ? 0.087   12.399  -2.819  1.00 0.00 ? 33  HIS A N    4  
ATOM 4450  C CA   . HIS A 1 3  ? -0.522  13.000  -1.639  1.00 0.00 ? 33  HIS A CA   4  
ATOM 4451  C C    . HIS A 1 3  ? -1.913  12.419  -1.392  1.00 0.00 ? 33  HIS A C    4  
ATOM 4452  O O    . HIS A 1 3  ? -2.269  11.382  -1.951  1.00 0.00 ? 33  HIS A O    4  
ATOM 4453  C CB   . HIS A 1 3  ? -0.596  14.522  -1.797  1.00 0.00 ? 33  HIS A CB   4  
ATOM 4454  C CG   . HIS A 1 3  ? -1.462  14.971  -2.933  1.00 0.00 ? 33  HIS A CG   4  
ATOM 4455  N ND1  . HIS A 1 3  ? -1.220  14.626  -4.245  1.00 0.00 ? 33  HIS A ND1  4  
ATOM 4456  C CD2  . HIS A 1 3  ? -2.569  15.751  -2.949  1.00 0.00 ? 33  HIS A CD2  4  
ATOM 4457  C CE1  . HIS A 1 3  ? -2.139  15.175  -5.020  1.00 0.00 ? 33  HIS A CE1  4  
ATOM 4458  N NE2  . HIS A 1 3  ? -2.969  15.862  -4.258  1.00 0.00 ? 33  HIS A NE2  4  
ATOM 4459  H H    . HIS A 1 3  ? -0.448  12.294  -3.632  1.00 0.00 ? 33  HIS A H    4  
ATOM 4460  H HA   . HIS A 1 3  ? 0.105   12.767  -0.791  1.00 0.00 ? 33  HIS A HA   4  
ATOM 4461  H HB2  . HIS A 1 3  ? -0.988  14.954  -0.890  1.00 0.00 ? 33  HIS A HB2  4  
ATOM 4462  H HB3  . HIS A 1 3  ? 0.400   14.904  -1.968  1.00 0.00 ? 33  HIS A HB3  4  
ATOM 4463  H HD1  . HIS A 1 3  ? -0.484  14.063  -4.563  1.00 0.00 ? 33  HIS A HD1  4  
ATOM 4464  H HD2  . HIS A 1 3  ? -3.047  16.202  -2.091  1.00 0.00 ? 33  HIS A HD2  4  
ATOM 4465  H HE1  . HIS A 1 3  ? -2.201  15.077  -6.093  1.00 0.00 ? 33  HIS A HE1  4  
ATOM 4466  H HE2  . HIS A 1 3  ? -3.677  16.455  -4.586  1.00 0.00 ? 33  HIS A HE2  4  
ATOM 4467  N N    . VAL A 1 4  ? -2.695  13.090  -0.546  1.00 0.00 ? 34  VAL A N    4  
ATOM 4468  C CA   . VAL A 1 4  ? -4.045  12.638  -0.217  1.00 0.00 ? 34  VAL A CA   4  
ATOM 4469  C C    . VAL A 1 4  ? -4.816  12.204  -1.462  1.00 0.00 ? 34  VAL A C    4  
ATOM 4470  O O    . VAL A 1 4  ? -5.367  11.105  -1.511  1.00 0.00 ? 34  VAL A O    4  
ATOM 4471  C CB   . VAL A 1 4  ? -4.844  13.740  0.505   1.00 0.00 ? 34  VAL A CB   4  
ATOM 4472  C CG1  . VAL A 1 4  ? -6.175  13.198  1.004   1.00 0.00 ? 34  VAL A CG1  4  
ATOM 4473  C CG2  . VAL A 1 4  ? -4.033  14.324  1.653   1.00 0.00 ? 34  VAL A CG2  4  
ATOM 4474  H H    . VAL A 1 4  ? -2.352  13.906  -0.128  1.00 0.00 ? 34  VAL A H    4  
ATOM 4475  H HA   . VAL A 1 4  ? -3.959  11.794  0.450   1.00 0.00 ? 34  VAL A HA   4  
ATOM 4476  H HB   . VAL A 1 4  ? -5.047  14.532  -0.202  1.00 0.00 ? 34  VAL A HB   4  
ATOM 4477  H HG11 . VAL A 1 4  ? -6.943  13.399  0.272   1.00 0.00 ? 34  VAL A HG11 4  
ATOM 4478  H HG12 . VAL A 1 4  ? -6.433  13.679  1.937   1.00 0.00 ? 34  VAL A HG12 4  
ATOM 4479  H HG13 . VAL A 1 4  ? -6.094  12.132  1.158   1.00 0.00 ? 34  VAL A HG13 4  
ATOM 4480  H HG21 . VAL A 1 4  ? -3.511  15.205  1.313   1.00 0.00 ? 34  VAL A HG21 4  
ATOM 4481  H HG22 . VAL A 1 4  ? -3.319  13.591  1.998   1.00 0.00 ? 34  VAL A HG22 4  
ATOM 4482  H HG23 . VAL A 1 4  ? -4.697  14.588  2.464   1.00 0.00 ? 34  VAL A HG23 4  
ATOM 4483  N N    . GLU A 1 5  ? -4.851  13.075  -2.466  1.00 0.00 ? 35  GLU A N    4  
ATOM 4484  C CA   . GLU A 1 5  ? -5.557  12.778  -3.708  1.00 0.00 ? 35  GLU A CA   4  
ATOM 4485  C C    . GLU A 1 5  ? -5.013  11.509  -4.357  1.00 0.00 ? 35  GLU A C    4  
ATOM 4486  O O    . GLU A 1 5  ? -5.774  10.620  -4.738  1.00 0.00 ? 35  GLU A O    4  
ATOM 4487  C CB   . GLU A 1 5  ? -5.438  13.953  -4.680  1.00 0.00 ? 35  GLU A CB   4  
ATOM 4488  C CG   . GLU A 1 5  ? -6.039  15.245  -4.150  1.00 0.00 ? 35  GLU A CG   4  
ATOM 4489  C CD   . GLU A 1 5  ? -6.572  16.137  -5.254  1.00 0.00 ? 35  GLU A CD   4  
ATOM 4490  O OE1  . GLU A 1 5  ? -5.866  16.309  -6.270  1.00 0.00 ? 35  GLU A OE1  4  
ATOM 4491  O OE2  . GLU A 1 5  ? -7.694  16.664  -5.102  1.00 0.00 ? 35  GLU A OE2  4  
ATOM 4492  H H    . GLU A 1 5  ? -4.394  13.936  -2.369  1.00 0.00 ? 35  GLU A H    4  
ATOM 4493  H HA   . GLU A 1 5  ? -6.598  12.627  -3.469  1.00 0.00 ? 35  GLU A HA   4  
ATOM 4494  H HB2  . GLU A 1 5  ? -4.394  14.128  -4.890  1.00 0.00 ? 35  GLU A HB2  4  
ATOM 4495  H HB3  . GLU A 1 5  ? -5.943  13.698  -5.599  1.00 0.00 ? 35  GLU A HB3  4  
ATOM 4496  H HG2  . GLU A 1 5  ? -6.852  15.001  -3.482  1.00 0.00 ? 35  GLU A HG2  4  
ATOM 4497  H HG3  . GLU A 1 5  ? -5.278  15.784  -3.605  1.00 0.00 ? 35  GLU A HG3  4  
ATOM 4498  N N    . ASP A 1 6  ? -3.692  11.432  -4.481  1.00 0.00 ? 36  ASP A N    4  
ATOM 4499  C CA   . ASP A 1 6  ? -3.047  10.271  -5.085  1.00 0.00 ? 36  ASP A CA   4  
ATOM 4500  C C    . ASP A 1 6  ? -3.392  8.997   -4.319  1.00 0.00 ? 36  ASP A C    4  
ATOM 4501  O O    . ASP A 1 6  ? -3.565  7.931   -4.912  1.00 0.00 ? 36  ASP A O    4  
ATOM 4502  C CB   . ASP A 1 6  ? -1.530  10.464  -5.121  1.00 0.00 ? 36  ASP A CB   4  
ATOM 4503  C CG   . ASP A 1 6  ? -0.878  9.712   -6.264  1.00 0.00 ? 36  ASP A CG   4  
ATOM 4504  O OD1  . ASP A 1 6  ? -1.317  8.579   -6.556  1.00 0.00 ? 36  ASP A OD1  4  
ATOM 4505  O OD2  . ASP A 1 6  ? 0.071   10.254  -6.867  1.00 0.00 ? 36  ASP A OD2  4  
ATOM 4506  H H    . ASP A 1 6  ? -3.137  12.172  -4.158  1.00 0.00 ? 36  ASP A H    4  
ATOM 4507  H HA   . ASP A 1 6  ? -3.413  10.178  -6.096  1.00 0.00 ? 36  ASP A HA   4  
ATOM 4508  H HB2  . ASP A 1 6  ? -1.310  11.515  -5.235  1.00 0.00 ? 36  ASP A HB2  4  
ATOM 4509  H HB3  . ASP A 1 6  ? -1.106  10.111  -4.193  1.00 0.00 ? 36  ASP A HB3  4  
ATOM 4510  N N    . ALA A 1 7  ? -3.494  9.114   -3.000  1.00 0.00 ? 37  ALA A N    4  
ATOM 4511  C CA   . ALA A 1 7  ? -3.822  7.972   -2.155  1.00 0.00 ? 37  ALA A CA   4  
ATOM 4512  C C    . ALA A 1 7  ? -5.290  7.588   -2.305  1.00 0.00 ? 37  ALA A C    4  
ATOM 4513  O O    . ALA A 1 7  ? -5.651  6.418   -2.186  1.00 0.00 ? 37  ALA A O    4  
ATOM 4514  C CB   . ALA A 1 7  ? -3.500  8.281   -0.702  1.00 0.00 ? 37  ALA A CB   4  
ATOM 4515  H H    . ALA A 1 7  ? -3.347  9.990   -2.584  1.00 0.00 ? 37  ALA A H    4  
ATOM 4516  H HA   . ALA A 1 7  ? -3.207  7.140   -2.468  1.00 0.00 ? 37  ALA A HA   4  
ATOM 4517  H HB1  . ALA A 1 7  ? -3.672  7.401   -0.099  1.00 0.00 ? 37  ALA A HB1  4  
ATOM 4518  H HB2  . ALA A 1 7  ? -4.134  9.084   -0.354  1.00 0.00 ? 37  ALA A HB2  4  
ATOM 4519  H HB3  . ALA A 1 7  ? -2.465  8.578   -0.617  1.00 0.00 ? 37  ALA A HB3  4  
ATOM 4520  N N    . LEU A 1 8  ? -6.131  8.583   -2.568  1.00 0.00 ? 38  LEU A N    4  
ATOM 4521  C CA   . LEU A 1 8  ? -7.560  8.353   -2.735  1.00 0.00 ? 38  LEU A CA   4  
ATOM 4522  C C    . LEU A 1 8  ? -7.837  7.524   -3.985  1.00 0.00 ? 38  LEU A C    4  
ATOM 4523  O O    . LEU A 1 8  ? -8.520  6.501   -3.925  1.00 0.00 ? 38  LEU A O    4  
ATOM 4524  C CB   . LEU A 1 8  ? -8.306  9.687   -2.816  1.00 0.00 ? 38  LEU A CB   4  
ATOM 4525  C CG   . LEU A 1 8  ? -8.847  10.208  -1.485  1.00 0.00 ? 38  LEU A CG   4  
ATOM 4526  C CD1  . LEU A 1 8  ? -9.441  11.597  -1.657  1.00 0.00 ? 38  LEU A CD1  4  
ATOM 4527  C CD2  . LEU A 1 8  ? -9.883  9.249   -0.919  1.00 0.00 ? 38  LEU A CD2  4  
ATOM 4528  H H    . LEU A 1 8  ? -5.783  9.494   -2.651  1.00 0.00 ? 38  LEU A H    4  
ATOM 4529  H HA   . LEU A 1 8  ? -7.908  7.809   -1.872  1.00 0.00 ? 38  LEU A HA   4  
ATOM 4530  H HB2  . LEU A 1 8  ? -7.633  10.427  -3.224  1.00 0.00 ? 38  LEU A HB2  4  
ATOM 4531  H HB3  . LEU A 1 8  ? -9.138  9.570   -3.495  1.00 0.00 ? 38  LEU A HB3  4  
ATOM 4532  H HG   . LEU A 1 8  ? -8.034  10.279  -0.776  1.00 0.00 ? 38  LEU A HG   4  
ATOM 4533  H HD11 . LEU A 1 8  ? -10.284 11.713  -0.991  1.00 0.00 ? 38  LEU A HD11 4  
ATOM 4534  H HD12 . LEU A 1 8  ? -9.770  11.724  -2.678  1.00 0.00 ? 38  LEU A HD12 4  
ATOM 4535  H HD13 . LEU A 1 8  ? -8.693  12.341  -1.424  1.00 0.00 ? 38  LEU A HD13 4  
ATOM 4536  H HD21 . LEU A 1 8  ? -10.343 8.699   -1.726  1.00 0.00 ? 38  LEU A HD21 4  
ATOM 4537  H HD22 . LEU A 1 8  ? -10.639 9.807   -0.388  1.00 0.00 ? 38  LEU A HD22 4  
ATOM 4538  H HD23 . LEU A 1 8  ? -9.403  8.559   -0.241  1.00 0.00 ? 38  LEU A HD23 4  
ATOM 4539  N N    . THR A 1 9  ? -7.304  7.971   -5.118  1.00 0.00 ? 39  THR A N    4  
ATOM 4540  C CA   . THR A 1 9  ? -7.497  7.269   -6.382  1.00 0.00 ? 39  THR A CA   4  
ATOM 4541  C C    . THR A 1 9  ? -6.957  5.845   -6.303  1.00 0.00 ? 39  THR A C    4  
ATOM 4542  O O    . THR A 1 9  ? -7.595  4.901   -6.769  1.00 0.00 ? 39  THR A O    4  
ATOM 4543  C CB   . THR A 1 9  ? -6.813  8.028   -7.525  1.00 0.00 ? 39  THR A CB   4  
ATOM 4544  O OG1  . THR A 1 9  ? -7.346  7.633   -8.776  1.00 0.00 ? 39  THR A OG1  4  
ATOM 4545  C CG2  . THR A 1 9  ? -5.311  7.820   -7.581  1.00 0.00 ? 39  THR A CG2  4  
ATOM 4546  H H    . THR A 1 9  ? -6.769  8.792   -5.104  1.00 0.00 ? 39  THR A H    4  
ATOM 4547  H HA   . THR A 1 9  ? -8.558  7.226   -6.576  1.00 0.00 ? 39  THR A HA   4  
ATOM 4548  H HB   . THR A 1 9  ? -6.995  9.086   -7.398  1.00 0.00 ? 39  THR A HB   4  
ATOM 4549  H HG1  . THR A 1 9  ? -7.565  8.413   -9.291  1.00 0.00 ? 39  THR A HG1  4  
ATOM 4550  H HG21 . THR A 1 9  ? -4.911  8.319   -8.452  1.00 0.00 ? 39  THR A HG21 4  
ATOM 4551  H HG22 . THR A 1 9  ? -5.094  6.762   -7.642  1.00 0.00 ? 39  THR A HG22 4  
ATOM 4552  H HG23 . THR A 1 9  ? -4.858  8.229   -6.692  1.00 0.00 ? 39  THR A HG23 4  
ATOM 4553  N N    . TYR A 1 10 ? -5.773  5.701   -5.714  1.00 0.00 ? 40  TYR A N    4  
ATOM 4554  C CA   . TYR A 1 10 ? -5.141  4.394   -5.581  1.00 0.00 ? 40  TYR A CA   4  
ATOM 4555  C C    . TYR A 1 10 ? -6.087  3.390   -4.929  1.00 0.00 ? 40  TYR A C    4  
ATOM 4556  O O    . TYR A 1 10 ? -6.319  2.305   -5.460  1.00 0.00 ? 40  TYR A O    4  
ATOM 4557  C CB   . TYR A 1 10 ? -3.854  4.505   -4.761  1.00 0.00 ? 40  TYR A CB   4  
ATOM 4558  C CG   . TYR A 1 10 ? -3.038  3.231   -4.739  1.00 0.00 ? 40  TYR A CG   4  
ATOM 4559  C CD1  . TYR A 1 10 ? -2.520  2.697   -5.913  1.00 0.00 ? 40  TYR A CD1  4  
ATOM 4560  C CD2  . TYR A 1 10 ? -2.787  2.564   -3.547  1.00 0.00 ? 40  TYR A CD2  4  
ATOM 4561  C CE1  . TYR A 1 10 ? -1.774  1.534   -5.898  1.00 0.00 ? 40  TYR A CE1  4  
ATOM 4562  C CE2  . TYR A 1 10 ? -2.041  1.400   -3.524  1.00 0.00 ? 40  TYR A CE2  4  
ATOM 4563  C CZ   . TYR A 1 10 ? -1.538  0.889   -4.703  1.00 0.00 ? 40  TYR A CZ   4  
ATOM 4564  O OH   . TYR A 1 10 ? -0.795  -0.270  -4.684  1.00 0.00 ? 40  TYR A OH   4  
ATOM 4565  H H    . TYR A 1 10 ? -5.311  6.493   -5.368  1.00 0.00 ? 40  TYR A H    4  
ATOM 4566  H HA   . TYR A 1 10 ? -4.894  4.049   -6.575  1.00 0.00 ? 40  TYR A HA   4  
ATOM 4567  H HB2  . TYR A 1 10 ? -3.237  5.287   -5.176  1.00 0.00 ? 40  TYR A HB2  4  
ATOM 4568  H HB3  . TYR A 1 10 ? -4.107  4.756   -3.741  1.00 0.00 ? 40  TYR A HB3  4  
ATOM 4569  H HD1  . TYR A 1 10 ? -2.707  3.204   -6.847  1.00 0.00 ? 40  TYR A HD1  4  
ATOM 4570  H HD2  . TYR A 1 10 ? -3.184  2.965   -2.627  1.00 0.00 ? 40  TYR A HD2  4  
ATOM 4571  H HE1  . TYR A 1 10 ? -1.380  1.134   -6.821  1.00 0.00 ? 40  TYR A HE1  4  
ATOM 4572  H HE2  . TYR A 1 10 ? -1.857  0.895   -2.587  1.00 0.00 ? 40  TYR A HE2  4  
ATOM 4573  H HH   . TYR A 1 10 ? -0.092  -0.210  -5.335  1.00 0.00 ? 40  TYR A HH   4  
ATOM 4574  N N    . LEU A 1 11 ? -6.630  3.763   -3.774  1.00 0.00 ? 41  LEU A N    4  
ATOM 4575  C CA   . LEU A 1 11 ? -7.549  2.896   -3.047  1.00 0.00 ? 41  LEU A CA   4  
ATOM 4576  C C    . LEU A 1 11 ? -8.809  2.630   -3.866  1.00 0.00 ? 41  LEU A C    4  
ATOM 4577  O O    . LEU A 1 11 ? -9.353  1.526   -3.844  1.00 0.00 ? 41  LEU A O    4  
ATOM 4578  C CB   . LEU A 1 11 ? -7.925  3.527   -1.706  1.00 0.00 ? 41  LEU A CB   4  
ATOM 4579  C CG   . LEU A 1 11 ? -6.861  3.405   -0.613  1.00 0.00 ? 41  LEU A CG   4  
ATOM 4580  C CD1  . LEU A 1 11 ? -6.949  4.577   0.351   1.00 0.00 ? 41  LEU A CD1  4  
ATOM 4581  C CD2  . LEU A 1 11 ? -7.015  2.087   0.132   1.00 0.00 ? 41  LEU A CD2  4  
ATOM 4582  H H    . LEU A 1 11 ? -6.405  4.641   -3.402  1.00 0.00 ? 41  LEU A H    4  
ATOM 4583  H HA   . LEU A 1 11 ? -7.048  1.957   -2.866  1.00 0.00 ? 41  LEU A HA   4  
ATOM 4584  H HB2  . LEU A 1 11 ? -8.124  4.577   -1.868  1.00 0.00 ? 41  LEU A HB2  4  
ATOM 4585  H HB3  . LEU A 1 11 ? -8.829  3.057   -1.350  1.00 0.00 ? 41  LEU A HB3  4  
ATOM 4586  H HG   . LEU A 1 11 ? -5.881  3.419   -1.069  1.00 0.00 ? 41  LEU A HG   4  
ATOM 4587  H HD11 . LEU A 1 11 ? -5.955  4.856   0.669   1.00 0.00 ? 41  LEU A HD11 4  
ATOM 4588  H HD12 . LEU A 1 11 ? -7.536  4.292   1.212   1.00 0.00 ? 41  LEU A HD12 4  
ATOM 4589  H HD13 . LEU A 1 11 ? -7.417  5.415   -0.143  1.00 0.00 ? 41  LEU A HD13 4  
ATOM 4590  H HD21 . LEU A 1 11 ? -6.803  1.267   -0.538  1.00 0.00 ? 41  LEU A HD21 4  
ATOM 4591  H HD22 . LEU A 1 11 ? -8.026  1.998   0.501   1.00 0.00 ? 41  LEU A HD22 4  
ATOM 4592  H HD23 . LEU A 1 11 ? -6.324  2.060   0.963   1.00 0.00 ? 41  LEU A HD23 4  
ATOM 4593  N N    . ASP A 1 12 ? -9.268  3.647   -4.588  1.00 0.00 ? 42  ASP A N    4  
ATOM 4594  C CA   . ASP A 1 12 ? -10.463 3.519   -5.412  1.00 0.00 ? 42  ASP A CA   4  
ATOM 4595  C C    . ASP A 1 12 ? -10.231 2.543   -6.558  1.00 0.00 ? 42  ASP A C    4  
ATOM 4596  O O    . ASP A 1 12 ? -11.146 1.841   -6.988  1.00 0.00 ? 42  ASP A O    4  
ATOM 4597  C CB   . ASP A 1 12 ? -10.882 4.884   -5.963  1.00 0.00 ? 42  ASP A CB   4  
ATOM 4598  C CG   . ASP A 1 12 ? -12.374 4.973   -6.212  1.00 0.00 ? 42  ASP A CG   4  
ATOM 4599  O OD1  . ASP A 1 12 ? -13.150 4.550   -5.329  1.00 0.00 ? 42  ASP A OD1  4  
ATOM 4600  O OD2  . ASP A 1 12 ? -12.768 5.467   -7.289  1.00 0.00 ? 42  ASP A OD2  4  
ATOM 4601  H H    . ASP A 1 12 ? -8.792  4.504   -4.565  1.00 0.00 ? 42  ASP A H    4  
ATOM 4602  H HA   . ASP A 1 12 ? -11.251 3.135   -4.789  1.00 0.00 ? 42  ASP A HA   4  
ATOM 4603  H HB2  . ASP A 1 12 ? -10.607 5.650   -5.252  1.00 0.00 ? 42  ASP A HB2  4  
ATOM 4604  H HB3  . ASP A 1 12 ? -10.367 5.062   -6.895  1.00 0.00 ? 42  ASP A HB3  4  
ATOM 4605  N N    . GLN A 1 13 ? -9.000  2.506   -7.042  1.00 0.00 ? 43  GLN A N    4  
ATOM 4606  C CA   . GLN A 1 13 ? -8.635  1.616   -8.139  1.00 0.00 ? 43  GLN A CA   4  
ATOM 4607  C C    . GLN A 1 13 ? -8.383  0.205   -7.628  1.00 0.00 ? 43  GLN A C    4  
ATOM 4608  O O    . GLN A 1 13 ? -8.624  -0.777  -8.330  1.00 0.00 ? 43  GLN A O    4  
ATOM 4609  C CB   . GLN A 1 13 ? -7.395  2.143   -8.862  1.00 0.00 ? 43  GLN A CB   4  
ATOM 4610  C CG   . GLN A 1 13 ? -7.615  3.477   -9.555  1.00 0.00 ? 43  GLN A CG   4  
ATOM 4611  C CD   . GLN A 1 13 ? -6.338  4.282   -9.690  1.00 0.00 ? 43  GLN A CD   4  
ATOM 4612  O OE1  . GLN A 1 13 ? -5.353  4.027   -8.996  1.00 0.00 ? 43  GLN A OE1  4  
ATOM 4613  N NE2  . GLN A 1 13 ? -6.347  5.262   -10.585 1.00 0.00 ? 43  GLN A NE2  4  
ATOM 4614  H H    . GLN A 1 13 ? -8.320  3.089   -6.651  1.00 0.00 ? 43  GLN A H    4  
ATOM 4615  H HA   . GLN A 1 13 ? -9.460  1.590   -8.828  1.00 0.00 ? 43  GLN A HA   4  
ATOM 4616  H HB2  . GLN A 1 13 ? -6.597  2.262   -8.143  1.00 0.00 ? 43  GLN A HB2  4  
ATOM 4617  H HB3  . GLN A 1 13 ? -7.092  1.421   -9.606  1.00 0.00 ? 43  GLN A HB3  4  
ATOM 4618  H HG2  . GLN A 1 13 ? -8.013  3.294   -10.542 1.00 0.00 ? 43  GLN A HG2  4  
ATOM 4619  H HG3  . GLN A 1 13 ? -8.327  4.053   -8.982  1.00 0.00 ? 43  GLN A HG3  4  
ATOM 4620  H HE21 . GLN A 1 13 ? -7.167  5.409   -11.103 1.00 0.00 ? 43  GLN A HE21 4  
ATOM 4621  H HE22 . GLN A 1 13 ? -5.534  5.798   -10.693 1.00 0.00 ? 43  GLN A HE22 4  
ATOM 4622  N N    . VAL A 1 14 ? -7.898  0.116   -6.398  1.00 0.00 ? 44  VAL A N    4  
ATOM 4623  C CA   . VAL A 1 14 ? -7.612  -1.171  -5.776  1.00 0.00 ? 44  VAL A CA   4  
ATOM 4624  C C    . VAL A 1 14 ? -8.888  -1.829  -5.263  1.00 0.00 ? 44  VAL A C    4  
ATOM 4625  O O    . VAL A 1 14 ? -8.953  -3.050  -5.119  1.00 0.00 ? 44  VAL A O    4  
ATOM 4626  C CB   . VAL A 1 14 ? -6.616  -1.021  -4.609  1.00 0.00 ? 44  VAL A CB   4  
ATOM 4627  C CG1  . VAL A 1 14 ? -6.217  -2.384  -4.067  1.00 0.00 ? 44  VAL A CG1  4  
ATOM 4628  C CG2  . VAL A 1 14 ? -5.390  -0.235  -5.050  1.00 0.00 ? 44  VAL A CG2  4  
ATOM 4629  H H    . VAL A 1 14 ? -7.734  0.937   -5.895  1.00 0.00 ? 44  VAL A H    4  
ATOM 4630  H HA   . VAL A 1 14 ? -7.164  -1.810  -6.524  1.00 0.00 ? 44  VAL A HA   4  
ATOM 4631  H HB   . VAL A 1 14 ? -7.103  -0.472  -3.817  1.00 0.00 ? 44  VAL A HB   4  
ATOM 4632  H HG11 . VAL A 1 14 ? -7.094  -2.900  -3.706  1.00 0.00 ? 44  VAL A HG11 4  
ATOM 4633  H HG12 . VAL A 1 14 ? -5.515  -2.257  -3.256  1.00 0.00 ? 44  VAL A HG12 4  
ATOM 4634  H HG13 . VAL A 1 14 ? -5.756  -2.965  -4.853  1.00 0.00 ? 44  VAL A HG13 4  
ATOM 4635  H HG21 . VAL A 1 14 ? -5.593  0.253   -5.993  1.00 0.00 ? 44  VAL A HG21 4  
ATOM 4636  H HG22 . VAL A 1 14 ? -4.553  -0.907  -5.166  1.00 0.00 ? 44  VAL A HG22 4  
ATOM 4637  H HG23 . VAL A 1 14 ? -5.153  0.510   -4.304  1.00 0.00 ? 44  VAL A HG23 4  
ATOM 4638  N N    . LYS A 1 15 ? -9.902  -1.014  -4.987  1.00 0.00 ? 45  LYS A N    4  
ATOM 4639  C CA   . LYS A 1 15 ? -11.176 -1.519  -4.488  1.00 0.00 ? 45  LYS A CA   4  
ATOM 4640  C C    . LYS A 1 15 ? -12.042 -2.036  -5.634  1.00 0.00 ? 45  LYS A C    4  
ATOM 4641  O O    . LYS A 1 15 ? -12.614 -3.122  -5.552  1.00 0.00 ? 45  LYS A O    4  
ATOM 4642  C CB   . LYS A 1 15 ? -11.919 -0.422  -3.724  1.00 0.00 ? 45  LYS A CB   4  
ATOM 4643  C CG   . LYS A 1 15 ? -13.263 -0.867  -3.169  1.00 0.00 ? 45  LYS A CG   4  
ATOM 4644  C CD   . LYS A 1 15 ? -13.103 -1.619  -1.858  1.00 0.00 ? 45  LYS A CD   4  
ATOM 4645  C CE   . LYS A 1 15 ? -14.433 -2.169  -1.367  1.00 0.00 ? 45  LYS A CE   4  
ATOM 4646  N NZ   . LYS A 1 15 ? -14.284 -3.516  -0.752  1.00 0.00 ? 45  LYS A NZ   4  
ATOM 4647  H H    . LYS A 1 15 ? -9.792  -0.050  -5.120  1.00 0.00 ? 45  LYS A H    4  
ATOM 4648  H HA   . LYS A 1 15 ? -10.967 -2.337  -3.815  1.00 0.00 ? 45  LYS A HA   4  
ATOM 4649  H HB2  . LYS A 1 15 ? -11.304 -0.094  -2.899  1.00 0.00 ? 45  LYS A HB2  4  
ATOM 4650  H HB3  . LYS A 1 15 ? -12.087 0.413   -4.389  1.00 0.00 ? 45  LYS A HB3  4  
ATOM 4651  H HG2  . LYS A 1 15 ? -13.877 0.005   -3.000  1.00 0.00 ? 45  LYS A HG2  4  
ATOM 4652  H HG3  . LYS A 1 15 ? -13.742 -1.513  -3.889  1.00 0.00 ? 45  LYS A HG3  4  
ATOM 4653  H HD2  . LYS A 1 15 ? -12.418 -2.440  -2.006  1.00 0.00 ? 45  LYS A HD2  4  
ATOM 4654  H HD3  . LYS A 1 15 ? -12.705 -0.945  -1.114  1.00 0.00 ? 45  LYS A HD3  4  
ATOM 4655  H HE2  . LYS A 1 15 ? -14.839 -1.490  -0.631  1.00 0.00 ? 45  LYS A HE2  4  
ATOM 4656  H HE3  . LYS A 1 15 ? -15.111 -2.237  -2.204  1.00 0.00 ? 45  LYS A HE3  4  
ATOM 4657  H HZ1  . LYS A 1 15 ? -14.214 -3.431  0.283   1.00 0.00 ? 45  LYS A HZ1  4  
ATOM 4658  H HZ2  . LYS A 1 15 ? -13.425 -3.980  -1.110  1.00 0.00 ? 45  LYS A HZ2  4  
ATOM 4659  H HZ3  . LYS A 1 15 ? -15.106 -4.108  -0.985  1.00 0.00 ? 45  LYS A HZ3  4  
ATOM 4660  N N    . ILE A 1 16 ? -12.137 -1.247  -6.700  1.00 0.00 ? 46  ILE A N    4  
ATOM 4661  C CA   . ILE A 1 16 ? -12.937 -1.624  -7.858  1.00 0.00 ? 46  ILE A CA   4  
ATOM 4662  C C    . ILE A 1 16 ? -12.364 -2.860  -8.547  1.00 0.00 ? 46  ILE A C    4  
ATOM 4663  O O    . ILE A 1 16 ? -13.095 -3.801  -8.859  1.00 0.00 ? 46  ILE A O    4  
ATOM 4664  C CB   . ILE A 1 16 ? -13.025 -0.472  -8.881  1.00 0.00 ? 46  ILE A CB   4  
ATOM 4665  C CG1  . ILE A 1 16 ? -13.516 0.807   -8.200  1.00 0.00 ? 46  ILE A CG1  4  
ATOM 4666  C CG2  . ILE A 1 16 ? -13.947 -0.850  -10.031 1.00 0.00 ? 46  ILE A CG2  4  
ATOM 4667  C CD1  . ILE A 1 16 ? -13.085 2.073   -8.910  1.00 0.00 ? 46  ILE A CD1  4  
ATOM 4668  H H    . ILE A 1 16 ? -11.660 -0.391  -6.707  1.00 0.00 ? 46  ILE A H    4  
ATOM 4669  H HA   . ILE A 1 16 ? -13.934 -1.846  -7.513  1.00 0.00 ? 46  ILE A HA   4  
ATOM 4670  H HB   . ILE A 1 16 ? -12.039 -0.301  -9.284  1.00 0.00 ? 46  ILE A HB   4  
ATOM 4671  H HG12 . ILE A 1 16 ? -14.595 0.798   -8.167  1.00 0.00 ? 46  ILE A HG12 4  
ATOM 4672  H HG13 . ILE A 1 16 ? -13.130 0.842   -7.193  1.00 0.00 ? 46  ILE A HG13 4  
ATOM 4673  H HG21 . ILE A 1 16 ? -13.366 -1.285  -10.831 1.00 0.00 ? 46  ILE A HG21 4  
ATOM 4674  H HG22 . ILE A 1 16 ? -14.453 0.033   -10.393 1.00 0.00 ? 46  ILE A HG22 4  
ATOM 4675  H HG23 . ILE A 1 16 ? -14.678 -1.567  -9.687  1.00 0.00 ? 46  ILE A HG23 4  
ATOM 4676  H HD11 . ILE A 1 16 ? -13.355 2.930   -8.312  1.00 0.00 ? 46  ILE A HD11 4  
ATOM 4677  H HD12 . ILE A 1 16 ? -13.578 2.134   -9.869  1.00 0.00 ? 46  ILE A HD12 4  
ATOM 4678  H HD13 . ILE A 1 16 ? -12.015 2.057   -9.055  1.00 0.00 ? 46  ILE A HD13 4  
ATOM 4679  N N    . ARG A 1 17 ? -11.057 -2.851  -8.785  1.00 0.00 ? 47  ARG A N    4  
ATOM 4680  C CA   . ARG A 1 17 ? -10.392 -3.972  -9.440  1.00 0.00 ? 47  ARG A CA   4  
ATOM 4681  C C    . ARG A 1 17 ? -10.522 -5.248  -8.613  1.00 0.00 ? 47  ARG A C    4  
ATOM 4682  O O    . ARG A 1 17 ? -10.536 -6.353  -9.158  1.00 0.00 ? 47  ARG A O    4  
ATOM 4683  C CB   . ARG A 1 17 ? -8.915  -3.650  -9.677  1.00 0.00 ? 47  ARG A CB   4  
ATOM 4684  C CG   . ARG A 1 17 ? -8.398  -4.120  -11.027 1.00 0.00 ? 47  ARG A CG   4  
ATOM 4685  C CD   . ARG A 1 17 ? -9.234  -3.566  -12.170 1.00 0.00 ? 47  ARG A CD   4  
ATOM 4686  N NE   . ARG A 1 17 ? -8.408  -3.121  -13.289 1.00 0.00 ? 47  ARG A NE   4  
ATOM 4687  C CZ   . ARG A 1 17 ? -7.776  -1.950  -13.327 1.00 0.00 ? 47  ARG A CZ   4  
ATOM 4688  N NH1  . ARG A 1 17 ? -7.870  -1.105  -12.308 1.00 0.00 ? 47  ARG A NH1  4  
ATOM 4689  N NH2  . ARG A 1 17 ? -7.048  -1.624  -14.386 1.00 0.00 ? 47  ARG A NH2  4  
ATOM 4690  H H    . ARG A 1 17 ? -10.526 -2.071  -8.516  1.00 0.00 ? 47  ARG A H    4  
ATOM 4691  H HA   . ARG A 1 17 ? -10.874 -4.128  -10.394 1.00 0.00 ? 47  ARG A HA   4  
ATOM 4692  H HB2  . ARG A 1 17 ? -8.779  -2.581  -9.617  1.00 0.00 ? 47  ARG A HB2  4  
ATOM 4693  H HB3  . ARG A 1 17 ? -8.327  -4.124  -8.905  1.00 0.00 ? 47  ARG A HB3  4  
ATOM 4694  H HG2  . ARG A 1 17 ? -7.378  -3.785  -11.147 1.00 0.00 ? 47  ARG A HG2  4  
ATOM 4695  H HG3  . ARG A 1 17 ? -8.431  -5.199  -11.059 1.00 0.00 ? 47  ARG A HG3  4  
ATOM 4696  H HD2  . ARG A 1 17 ? -9.905  -4.338  -12.515 1.00 0.00 ? 47  ARG A HD2  4  
ATOM 4697  H HD3  . ARG A 1 17 ? -9.810  -2.727  -11.805 1.00 0.00 ? 47  ARG A HD3  4  
ATOM 4698  H HE   . ARG A 1 17 ? -8.319  -3.727  -14.055 1.00 0.00 ? 47  ARG A HE   4  
ATOM 4699  H HH11 . ARG A 1 17 ? -8.416  -1.345  -11.505 1.00 0.00 ? 47  ARG A HH11 4  
ATOM 4700  H HH12 . ARG A 1 17 ? -7.393  -0.227  -12.342 1.00 0.00 ? 47  ARG A HH12 4  
ATOM 4701  H HH21 . ARG A 1 17 ? -6.973  -2.258  -15.155 1.00 0.00 ? 47  ARG A HH21 4  
ATOM 4702  H HH22 . ARG A 1 17 ? -6.574  -0.744  -14.415 1.00 0.00 ? 47  ARG A HH22 4  
ATOM 4703  N N    . PHE A 1 18 ? -10.617 -5.092  -7.297  1.00 0.00 ? 48  PHE A N    4  
ATOM 4704  C CA   . PHE A 1 18 ? -10.746 -6.234  -6.399  1.00 0.00 ? 48  PHE A CA   4  
ATOM 4705  C C    . PHE A 1 18 ? -12.086 -6.206  -5.672  1.00 0.00 ? 48  PHE A C    4  
ATOM 4706  O O    . PHE A 1 18 ? -12.169 -6.527  -4.487  1.00 0.00 ? 48  PHE A O    4  
ATOM 4707  C CB   . PHE A 1 18 ? -9.601  -6.245  -5.384  1.00 0.00 ? 48  PHE A CB   4  
ATOM 4708  C CG   . PHE A 1 18 ? -8.334  -6.855  -5.913  1.00 0.00 ? 48  PHE A CG   4  
ATOM 4709  C CD1  . PHE A 1 18 ? -8.289  -8.195  -6.262  1.00 0.00 ? 48  PHE A CD1  4  
ATOM 4710  C CD2  . PHE A 1 18 ? -7.189  -6.089  -6.062  1.00 0.00 ? 48  PHE A CD2  4  
ATOM 4711  C CE1  . PHE A 1 18 ? -7.125  -8.761  -6.748  1.00 0.00 ? 48  PHE A CE1  4  
ATOM 4712  C CE2  . PHE A 1 18 ? -6.023  -6.648  -6.548  1.00 0.00 ? 48  PHE A CE2  4  
ATOM 4713  C CZ   . PHE A 1 18 ? -5.990  -7.986  -6.891  1.00 0.00 ? 48  PHE A CZ   4  
ATOM 4714  H H    . PHE A 1 18 ? -10.600 -4.188  -6.920  1.00 0.00 ? 48  PHE A H    4  
ATOM 4715  H HA   . PHE A 1 18 ? -10.694 -7.132  -6.997  1.00 0.00 ? 48  PHE A HA   4  
ATOM 4716  H HB2  . PHE A 1 18 ? -9.382  -5.231  -5.089  1.00 0.00 ? 48  PHE A HB2  4  
ATOM 4717  H HB3  . PHE A 1 18 ? -9.905  -6.810  -4.515  1.00 0.00 ? 48  PHE A HB3  4  
ATOM 4718  H HD1  . PHE A 1 18 ? -9.174  -8.802  -6.150  1.00 0.00 ? 48  PHE A HD1  4  
ATOM 4719  H HD2  . PHE A 1 18 ? -7.214  -5.043  -5.793  1.00 0.00 ? 48  PHE A HD2  4  
ATOM 4720  H HE1  . PHE A 1 18 ? -7.103  -9.806  -7.015  1.00 0.00 ? 48  PHE A HE1  4  
ATOM 4721  H HE2  . PHE A 1 18 ? -5.138  -6.040  -6.660  1.00 0.00 ? 48  PHE A HE2  4  
ATOM 4722  H HZ   . PHE A 1 18 ? -5.080  -8.425  -7.271  1.00 0.00 ? 48  PHE A HZ   4  
ATOM 4723  N N    . GLY A 1 19 ? -13.133 -5.819  -6.393  1.00 0.00 ? 49  GLY A N    4  
ATOM 4724  C CA   . GLY A 1 19 ? -14.457 -5.755  -5.804  1.00 0.00 ? 49  GLY A CA   4  
ATOM 4725  C C    . GLY A 1 19 ? -14.971 -7.116  -5.378  1.00 0.00 ? 49  GLY A C    4  
ATOM 4726  O O    . GLY A 1 19 ? -15.761 -7.224  -4.441  1.00 0.00 ? 49  GLY A O    4  
ATOM 4727  H H    . GLY A 1 19 ? -13.004 -5.575  -7.333  1.00 0.00 ? 49  GLY A H    4  
ATOM 4728  H HA2  . GLY A 1 19 ? -14.423 -5.109  -4.939  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 4729  H HA3  . GLY A 1 19 ? -15.141 -5.335  -6.527  1.00 0.00 ? 49  GLY A HA3  4  
ATOM 4730  N N    . SER A 1 20 ? -14.520 -8.160  -6.067  1.00 0.00 ? 50  SER A N    4  
ATOM 4731  C CA   . SER A 1 20 ? -14.940 -9.522  -5.754  1.00 0.00 ? 50  SER A CA   4  
ATOM 4732  C C    . SER A 1 20 ? -13.868 -10.259 -4.955  1.00 0.00 ? 50  SER A C    4  
ATOM 4733  O O    . SER A 1 20 ? -13.877 -11.489 -4.879  1.00 0.00 ? 50  SER A O    4  
ATOM 4734  C CB   . SER A 1 20 ? -15.249 -10.289 -7.040  1.00 0.00 ? 50  SER A CB   4  
ATOM 4735  O OG   . SER A 1 20 ? -16.093 -9.535  -7.895  1.00 0.00 ? 50  SER A OG   4  
ATOM 4736  H H    . SER A 1 20 ? -13.890 -8.012  -6.804  1.00 0.00 ? 50  SER A H    4  
ATOM 4737  H HA   . SER A 1 20 ? -15.838 -9.461  -5.158  1.00 0.00 ? 50  SER A HA   4  
ATOM 4738  H HB2  . SER A 1 20 ? -14.327 -10.501 -7.562  1.00 0.00 ? 50  SER A HB2  4  
ATOM 4739  H HB3  . SER A 1 20 ? -15.744 -11.218 -6.794  1.00 0.00 ? 50  SER A HB3  4  
ATOM 4740  H HG   . SER A 1 20 ? -16.983 -9.521  -7.535  1.00 0.00 ? 50  SER A HG   4  
ATOM 4741  N N    . ASP A 1 21 ? -12.948 -9.506  -4.360  1.00 0.00 ? 51  ASP A N    4  
ATOM 4742  C CA   . ASP A 1 21 ? -11.879 -10.091 -3.569  1.00 0.00 ? 51  ASP A CA   4  
ATOM 4743  C C    . ASP A 1 21 ? -11.606 -9.258  -2.318  1.00 0.00 ? 51  ASP A C    4  
ATOM 4744  O O    . ASP A 1 21 ? -10.744 -8.380  -2.323  1.00 0.00 ? 51  ASP A O    4  
ATOM 4745  C CB   . ASP A 1 21 ? -10.604 -10.218 -4.408  1.00 0.00 ? 51  ASP A CB   4  
ATOM 4746  C CG   . ASP A 1 21 ? -10.252 -11.661 -4.709  1.00 0.00 ? 51  ASP A CG   4  
ATOM 4747  O OD1  . ASP A 1 21 ? -10.876 -12.248 -5.618  1.00 0.00 ? 51  ASP A OD1  4  
ATOM 4748  O OD2  . ASP A 1 21 ? -9.352  -12.206 -4.036  1.00 0.00 ? 51  ASP A OD2  4  
ATOM 4749  H H    . ASP A 1 21 ? -12.990 -8.539  -4.450  1.00 0.00 ? 51  ASP A H    4  
ATOM 4750  H HA   . ASP A 1 21 ? -12.201 -11.070 -3.270  1.00 0.00 ? 51  ASP A HA   4  
ATOM 4751  H HB2  . ASP A 1 21 ? -10.746 -9.699  -5.344  1.00 0.00 ? 51  ASP A HB2  4  
ATOM 4752  H HB3  . ASP A 1 21 ? -9.780  -9.768  -3.874  1.00 0.00 ? 51  ASP A HB3  4  
ATOM 4753  N N    . PRO A 1 22 ? -12.341 -9.526  -1.224  1.00 0.00 ? 52  PRO A N    4  
ATOM 4754  C CA   . PRO A 1 22 ? -12.172 -8.796  0.037   1.00 0.00 ? 52  PRO A CA   4  
ATOM 4755  C C    . PRO A 1 22 ? -10.839 -9.104  0.711   1.00 0.00 ? 52  PRO A C    4  
ATOM 4756  O O    . PRO A 1 22 ? -10.311 -8.289  1.466   1.00 0.00 ? 52  PRO A O    4  
ATOM 4757  C CB   . PRO A 1 22 ? -13.335 -9.296  0.898   1.00 0.00 ? 52  PRO A CB   4  
ATOM 4758  C CG   . PRO A 1 22 ? -13.668 -10.638 0.345   1.00 0.00 ? 52  PRO A CG   4  
ATOM 4759  C CD   . PRO A 1 22 ? -13.390 -10.557 -1.130  1.00 0.00 ? 52  PRO A CD   4  
ATOM 4760  H HA   . PRO A 1 22 ? -12.262 -7.729  -0.109  1.00 0.00 ? 52  PRO A HA   4  
ATOM 4761  H HB2  . PRO A 1 22 ? -13.022 -9.359  1.929   1.00 0.00 ? 52  PRO A HB2  4  
ATOM 4762  H HB3  . PRO A 1 22 ? -14.170 -8.616  0.809   1.00 0.00 ? 52  PRO A HB3  4  
ATOM 4763  H HG2  . PRO A 1 22 ? -13.042 -11.389 0.803   1.00 0.00 ? 52  PRO A HG2  4  
ATOM 4764  H HG3  . PRO A 1 22 ? -14.711 -10.860 0.518   1.00 0.00 ? 52  PRO A HG3  4  
ATOM 4765  H HD2  . PRO A 1 22 ? -13.031 -11.507 -1.500  1.00 0.00 ? 52  PRO A HD2  4  
ATOM 4766  H HD3  . PRO A 1 22 ? -14.278 -10.254 -1.666  1.00 0.00 ? 52  PRO A HD3  4  
ATOM 4767  N N    . ALA A 1 23 ? -10.301 -10.288 0.432   1.00 0.00 ? 53  ALA A N    4  
ATOM 4768  C CA   . ALA A 1 23 ? -9.030  -10.705 1.012   1.00 0.00 ? 53  ALA A CA   4  
ATOM 4769  C C    . ALA A 1 23 ? -7.914  -9.730  0.648   1.00 0.00 ? 53  ALA A C    4  
ATOM 4770  O O    . ALA A 1 23 ? -7.042  -9.436  1.466   1.00 0.00 ? 53  ALA A O    4  
ATOM 4771  C CB   . ALA A 1 23 ? -8.676  -12.111 0.552   1.00 0.00 ? 53  ALA A CB   4  
ATOM 4772  H H    . ALA A 1 23 ? -10.770 -10.896 -0.176  1.00 0.00 ? 53  ALA A H    4  
ATOM 4773  H HA   . ALA A 1 23 ? -9.142  -10.721 2.087   1.00 0.00 ? 53  ALA A HA   4  
ATOM 4774  H HB1  . ALA A 1 23 ? -7.602  -12.225 0.538   1.00 0.00 ? 53  ALA A HB1  4  
ATOM 4775  H HB2  . ALA A 1 23 ? -9.068  -12.274 -0.441  1.00 0.00 ? 53  ALA A HB2  4  
ATOM 4776  H HB3  . ALA A 1 23 ? -9.106  -12.831 1.231   1.00 0.00 ? 53  ALA A HB3  4  
ATOM 4777  N N    . THR A 1 24 ? -7.948  -9.233  -0.583  1.00 0.00 ? 54  THR A N    4  
ATOM 4778  C CA   . THR A 1 24 ? -6.940  -8.291  -1.055  1.00 0.00 ? 54  THR A CA   4  
ATOM 4779  C C    . THR A 1 24 ? -7.183  -6.899  -0.482  1.00 0.00 ? 54  THR A C    4  
ATOM 4780  O O    . THR A 1 24 ? -6.242  -6.181  -0.146  1.00 0.00 ? 54  THR A O    4  
ATOM 4781  C CB   . THR A 1 24 ? -6.941  -8.233  -2.583  1.00 0.00 ? 54  THR A CB   4  
ATOM 4782  O OG1  . THR A 1 24 ? -6.846  -9.535  -3.134  1.00 0.00 ? 54  THR A OG1  4  
ATOM 4783  C CG2  . THR A 1 24 ? -5.805  -7.410  -3.152  1.00 0.00 ? 54  THR A CG2  4  
ATOM 4784  H H    . THR A 1 24 ? -8.668  -9.505  -1.189  1.00 0.00 ? 54  THR A H    4  
ATOM 4785  H HA   . THR A 1 24 ? -5.976  -8.641  -0.718  1.00 0.00 ? 54  THR A HA   4  
ATOM 4786  H HB   . THR A 1 24 ? -7.869  -7.791  -2.916  1.00 0.00 ? 54  THR A HB   4  
ATOM 4787  H HG1  . THR A 1 24 ? -5.982  -9.905  -2.934  1.00 0.00 ? 54  THR A HG1  4  
ATOM 4788  H HG21 . THR A 1 24 ? -5.636  -7.693  -4.180  1.00 0.00 ? 54  THR A HG21 4  
ATOM 4789  H HG22 . THR A 1 24 ? -4.909  -7.590  -2.578  1.00 0.00 ? 54  THR A HG22 4  
ATOM 4790  H HG23 . THR A 1 24 ? -6.062  -6.363  -3.103  1.00 0.00 ? 54  THR A HG23 4  
ATOM 4791  N N    . TYR A 1 25 ? -8.453  -6.523  -0.374  1.00 0.00 ? 55  TYR A N    4  
ATOM 4792  C CA   . TYR A 1 25 ? -8.820  -5.216  0.158   1.00 0.00 ? 55  TYR A CA   4  
ATOM 4793  C C    . TYR A 1 25 ? -8.577  -5.153  1.663   1.00 0.00 ? 55  TYR A C    4  
ATOM 4794  O O    . TYR A 1 25 ? -7.902  -4.249  2.155   1.00 0.00 ? 55  TYR A O    4  
ATOM 4795  C CB   . TYR A 1 25 ? -10.288 -4.911  -0.145  1.00 0.00 ? 55  TYR A CB   4  
ATOM 4796  C CG   . TYR A 1 25 ? -10.721 -3.528  0.288   1.00 0.00 ? 55  TYR A CG   4  
ATOM 4797  C CD1  . TYR A 1 25 ? -10.042 -2.398  -0.151  1.00 0.00 ? 55  TYR A CD1  4  
ATOM 4798  C CD2  . TYR A 1 25 ? -11.808 -3.353  1.135   1.00 0.00 ? 55  TYR A CD2  4  
ATOM 4799  C CE1  . TYR A 1 25 ? -10.433 -1.133  0.243   1.00 0.00 ? 55  TYR A CE1  4  
ATOM 4800  C CE2  . TYR A 1 25 ? -12.206 -2.091  1.532   1.00 0.00 ? 55  TYR A CE2  4  
ATOM 4801  C CZ   . TYR A 1 25 ? -11.516 -0.985  1.084   1.00 0.00 ? 55  TYR A CZ   4  
ATOM 4802  O OH   . TYR A 1 25 ? -11.910 0.274   1.478   1.00 0.00 ? 55  TYR A OH   4  
ATOM 4803  H H    . TYR A 1 25 ? -9.160  -7.139  -0.658  1.00 0.00 ? 55  TYR A H    4  
ATOM 4804  H HA   . TYR A 1 25 ? -8.201  -4.475  -0.325  1.00 0.00 ? 55  TYR A HA   4  
ATOM 4805  H HB2  . TYR A 1 25 ? -10.453 -4.991  -1.209  1.00 0.00 ? 55  TYR A HB2  4  
ATOM 4806  H HB3  . TYR A 1 25 ? -10.911 -5.630  0.367   1.00 0.00 ? 55  TYR A HB3  4  
ATOM 4807  H HD1  . TYR A 1 25 ? -9.195  -2.518  -0.809  1.00 0.00 ? 55  TYR A HD1  4  
ATOM 4808  H HD2  . TYR A 1 25 ? -12.346 -4.221  1.485   1.00 0.00 ? 55  TYR A HD2  4  
ATOM 4809  H HE1  . TYR A 1 25 ? -9.894  -0.267  -0.109  1.00 0.00 ? 55  TYR A HE1  4  
ATOM 4810  H HE2  . TYR A 1 25 ? -13.054 -1.975  2.191   1.00 0.00 ? 55  TYR A HE2  4  
ATOM 4811  H HH   . TYR A 1 25 ? -11.163 0.736   1.867   1.00 0.00 ? 55  TYR A HH   4  
ATOM 4812  N N    . ASN A 1 26 ? -9.130  -6.120  2.387   1.00 0.00 ? 56  ASN A N    4  
ATOM 4813  C CA   . ASN A 1 26 ? -8.974  -6.175  3.837   1.00 0.00 ? 56  ASN A CA   4  
ATOM 4814  C C    . ASN A 1 26 ? -7.502  -6.287  4.221   1.00 0.00 ? 56  ASN A C    4  
ATOM 4815  O O    . ASN A 1 26 ? -7.062  -5.700  5.209   1.00 0.00 ? 56  ASN A O    4  
ATOM 4816  C CB   . ASN A 1 26 ? -9.755  -7.358  4.410   1.00 0.00 ? 56  ASN A CB   4  
ATOM 4817  C CG   . ASN A 1 26 ? -10.001 -7.222  5.899   1.00 0.00 ? 56  ASN A CG   4  
ATOM 4818  O OD1  . ASN A 1 26 ? -10.880 -6.475  6.330   1.00 0.00 ? 56  ASN A OD1  4  
ATOM 4819  N ND2  . ASN A 1 26 ? -9.222  -7.945  6.697   1.00 0.00 ? 56  ASN A ND2  4  
ATOM 4820  H H    . ASN A 1 26 ? -9.657  -6.812  1.938   1.00 0.00 ? 56  ASN A H    4  
ATOM 4821  H HA   . ASN A 1 26 ? -9.372  -5.260  4.248   1.00 0.00 ? 56  ASN A HA   4  
ATOM 4822  H HB2  . ASN A 1 26 ? -10.710 -7.428  3.912   1.00 0.00 ? 56  ASN A HB2  4  
ATOM 4823  H HB3  . ASN A 1 26 ? -9.197  -8.267  4.237   1.00 0.00 ? 56  ASN A HB3  4  
ATOM 4824  H HD21 . ASN A 1 26 ? -8.543  -8.518  6.285   1.00 0.00 ? 56  ASN A HD21 4  
ATOM 4825  H HD22 . ASN A 1 26 ? -9.360  -7.876  7.665   1.00 0.00 ? 56  ASN A HD22 4  
ATOM 4826  N N    . GLY A 1 27 ? -6.746  -7.045  3.433   1.00 0.00 ? 57  GLY A N    4  
ATOM 4827  C CA   . GLY A 1 27 ? -5.332  -7.220  3.709   1.00 0.00 ? 57  GLY A CA   4  
ATOM 4828  C C    . GLY A 1 27 ? -4.548  -5.932  3.557   1.00 0.00 ? 57  GLY A C    4  
ATOM 4829  O O    . GLY A 1 27 ? -3.682  -5.623  4.376   1.00 0.00 ? 57  GLY A O    4  
ATOM 4830  H H    . GLY A 1 27 ? -7.151  -7.489  2.659   1.00 0.00 ? 57  GLY A H    4  
ATOM 4831  H HA2  . GLY A 1 27 ? -5.215  -7.582  4.720   1.00 0.00 ? 57  GLY A HA2  4  
ATOM 4832  H HA3  . GLY A 1 27 ? -4.931  -7.954  3.026   1.00 0.00 ? 57  GLY A HA3  4  
ATOM 4833  N N    . PHE A 1 28 ? -4.852  -5.178  2.506   1.00 0.00 ? 58  PHE A N    4  
ATOM 4834  C CA   . PHE A 1 28 ? -4.170  -3.914  2.247   1.00 0.00 ? 58  PHE A CA   4  
ATOM 4835  C C    . PHE A 1 28 ? -4.350  -2.950  3.415   1.00 0.00 ? 58  PHE A C    4  
ATOM 4836  O O    . PHE A 1 28 ? -3.377  -2.422  3.954   1.00 0.00 ? 58  PHE A O    4  
ATOM 4837  C CB   . PHE A 1 28 ? -4.698  -3.279  0.961   1.00 0.00 ? 58  PHE A CB   4  
ATOM 4838  C CG   . PHE A 1 28 ? -3.952  -2.039  0.555   1.00 0.00 ? 58  PHE A CG   4  
ATOM 4839  C CD1  . PHE A 1 28 ? -2.573  -2.055  0.428   1.00 0.00 ? 58  PHE A CD1  4  
ATOM 4840  C CD2  . PHE A 1 28 ? -4.632  -0.859  0.301   1.00 0.00 ? 58  PHE A CD2  4  
ATOM 4841  C CE1  . PHE A 1 28 ? -1.885  -0.915  0.054   1.00 0.00 ? 58  PHE A CE1  4  
ATOM 4842  C CE2  . PHE A 1 28 ? -3.950  0.283   -0.072  1.00 0.00 ? 58  PHE A CE2  4  
ATOM 4843  C CZ   . PHE A 1 28 ? -2.575  0.255   -0.196  1.00 0.00 ? 58  PHE A CZ   4  
ATOM 4844  H H    . PHE A 1 28 ? -5.551  -5.476  1.888   1.00 0.00 ? 58  PHE A H    4  
ATOM 4845  H HA   . PHE A 1 28 ? -3.117  -4.125  2.128   1.00 0.00 ? 58  PHE A HA   4  
ATOM 4846  H HB2  . PHE A 1 28 ? -4.617  -3.993  0.155   1.00 0.00 ? 58  PHE A HB2  4  
ATOM 4847  H HB3  . PHE A 1 28 ? -5.736  -3.014  1.098   1.00 0.00 ? 58  PHE A HB3  4  
ATOM 4848  H HD1  . PHE A 1 28 ? -2.034  -2.970  0.622   1.00 0.00 ? 58  PHE A HD1  4  
ATOM 4849  H HD2  . PHE A 1 28 ? -5.708  -0.836  0.397   1.00 0.00 ? 58  PHE A HD2  4  
ATOM 4850  H HE1  . PHE A 1 28 ? -0.810  -0.941  -0.041  1.00 0.00 ? 58  PHE A HE1  4  
ATOM 4851  H HE2  . PHE A 1 28 ? -4.492  1.197   -0.267  1.00 0.00 ? 58  PHE A HE2  4  
ATOM 4852  H HZ   . PHE A 1 28 ? -2.039  1.146   -0.487  1.00 0.00 ? 58  PHE A HZ   4  
ATOM 4853  N N    . LEU A 1 29 ? -5.601  -2.725  3.802   1.00 0.00 ? 59  LEU A N    4  
ATOM 4854  C CA   . LEU A 1 29 ? -5.910  -1.825  4.906   1.00 0.00 ? 59  LEU A CA   4  
ATOM 4855  C C    . LEU A 1 29 ? -5.251  -2.302  6.197   1.00 0.00 ? 59  LEU A C    4  
ATOM 4856  O O    . LEU A 1 29 ? -4.818  -1.494  7.019   1.00 0.00 ? 59  LEU A O    4  
ATOM 4857  C CB   . LEU A 1 29 ? -7.424  -1.723  5.101   1.00 0.00 ? 59  LEU A CB   4  
ATOM 4858  C CG   . LEU A 1 29 ? -8.219  -1.392  3.836   1.00 0.00 ? 59  LEU A CG   4  
ATOM 4859  C CD1  . LEU A 1 29 ? -9.560  -2.110  3.843   1.00 0.00 ? 59  LEU A CD1  4  
ATOM 4860  C CD2  . LEU A 1 29 ? -8.417  0.112   3.710   1.00 0.00 ? 59  LEU A CD2  4  
ATOM 4861  H H    . LEU A 1 29 ? -6.334  -3.175  3.333   1.00 0.00 ? 59  LEU A H    4  
ATOM 4862  H HA   . LEU A 1 29 ? -5.522  -0.849  4.657   1.00 0.00 ? 59  LEU A HA   4  
ATOM 4863  H HB2  . LEU A 1 29 ? -7.780  -2.666  5.489   1.00 0.00 ? 59  LEU A HB2  4  
ATOM 4864  H HB3  . LEU A 1 29 ? -7.621  -0.954  5.833   1.00 0.00 ? 59  LEU A HB3  4  
ATOM 4865  H HG   . LEU A 1 29 ? -7.664  -1.730  2.972   1.00 0.00 ? 59  LEU A HG   4  
ATOM 4866  H HD11 . LEU A 1 29 ? -9.397  -3.177  3.876   1.00 0.00 ? 59  LEU A HD11 4  
ATOM 4867  H HD12 . LEU A 1 29 ? -10.108 -1.856  2.949   1.00 0.00 ? 59  LEU A HD12 4  
ATOM 4868  H HD13 . LEU A 1 29 ? -10.126 -1.806  4.712   1.00 0.00 ? 59  LEU A HD13 4  
ATOM 4869  H HD21 . LEU A 1 29 ? -8.781  0.346   2.721   1.00 0.00 ? 59  LEU A HD21 4  
ATOM 4870  H HD22 . LEU A 1 29 ? -7.476  0.613   3.876   1.00 0.00 ? 59  LEU A HD22 4  
ATOM 4871  H HD23 . LEU A 1 29 ? -9.136  0.442   4.446   1.00 0.00 ? 59  LEU A HD23 4  
ATOM 4872  N N    . GLU A 1 30 ? -5.178  -3.617  6.365   1.00 0.00 ? 60  GLU A N    4  
ATOM 4873  C CA   . GLU A 1 30 ? -4.572  -4.204  7.554   1.00 0.00 ? 60  GLU A CA   4  
ATOM 4874  C C    . GLU A 1 30 ? -3.103  -3.808  7.669   1.00 0.00 ? 60  GLU A C    4  
ATOM 4875  O O    . GLU A 1 30 ? -2.608  -3.529  8.760   1.00 0.00 ? 60  GLU A O    4  
ATOM 4876  C CB   . GLU A 1 30 ? -4.703  -5.729  7.519   1.00 0.00 ? 60  GLU A CB   4  
ATOM 4877  C CG   . GLU A 1 30 ? -5.183  -6.329  8.830   1.00 0.00 ? 60  GLU A CG   4  
ATOM 4878  C CD   . GLU A 1 30 ? -6.643  -6.736  8.784   1.00 0.00 ? 60  GLU A CD   4  
ATOM 4879  O OE1  . GLU A 1 30 ? -7.389  -6.181  7.950   1.00 0.00 ? 60  GLU A OE1  4  
ATOM 4880  O OE2  . GLU A 1 30 ? -7.040  -7.612  9.582   1.00 0.00 ? 60  GLU A OE2  4  
ATOM 4881  H H    . GLU A 1 30 ? -5.542  -4.209  5.673   1.00 0.00 ? 60  GLU A H    4  
ATOM 4882  H HA   . GLU A 1 30 ? -5.101  -3.827  8.416   1.00 0.00 ? 60  GLU A HA   4  
ATOM 4883  H HB2  . GLU A 1 30 ? -5.405  -6.000  6.745   1.00 0.00 ? 60  GLU A HB2  4  
ATOM 4884  H HB3  . GLU A 1 30 ? -3.739  -6.157  7.283   1.00 0.00 ? 60  GLU A HB3  4  
ATOM 4885  H HG2  . GLU A 1 30 ? -4.588  -7.203  9.050   1.00 0.00 ? 60  GLU A HG2  4  
ATOM 4886  H HG3  . GLU A 1 30 ? -5.053  -5.598  9.614   1.00 0.00 ? 60  GLU A HG3  4  
ATOM 4887  N N    . ILE A 1 31 ? -2.411  -3.788  6.533   1.00 0.00 ? 61  ILE A N    4  
ATOM 4888  C CA   . ILE A 1 31 ? -0.998  -3.428  6.507   1.00 0.00 ? 61  ILE A CA   4  
ATOM 4889  C C    . ILE A 1 31 ? -0.796  -1.977  6.932   1.00 0.00 ? 61  ILE A C    4  
ATOM 4890  O O    . ILE A 1 31 ? -0.026  -1.690  7.849   1.00 0.00 ? 61  ILE A O    4  
ATOM 4891  C CB   . ILE A 1 31 ? -0.391  -3.630  5.105   1.00 0.00 ? 61  ILE A CB   4  
ATOM 4892  C CG1  . ILE A 1 31 ? -0.712  -5.032  4.581   1.00 0.00 ? 61  ILE A CG1  4  
ATOM 4893  C CG2  . ILE A 1 31 ? 1.115   -3.407  5.139   1.00 0.00 ? 61  ILE A CG2  4  
ATOM 4894  C CD1  . ILE A 1 31 ? -1.032  -5.067  3.103   1.00 0.00 ? 61  ILE A CD1  4  
ATOM 4895  H H    . ILE A 1 31 ? -2.861  -4.021  5.695   1.00 0.00 ? 61  ILE A H    4  
ATOM 4896  H HA   . ILE A 1 31 ? -0.477  -4.071  7.200   1.00 0.00 ? 61  ILE A HA   4  
ATOM 4897  H HB   . ILE A 1 31 ? -0.823  -2.899  4.440   1.00 0.00 ? 61  ILE A HB   4  
ATOM 4898  H HG12 . ILE A 1 31 ? 0.138   -5.676  4.749   1.00 0.00 ? 61  ILE A HG12 4  
ATOM 4899  H HG13 . ILE A 1 31 ? -1.565  -5.423  5.116   1.00 0.00 ? 61  ILE A HG13 4  
ATOM 4900  H HG21 . ILE A 1 31 ? 1.360   -2.728  5.941   1.00 0.00 ? 61  ILE A HG21 4  
ATOM 4901  H HG22 . ILE A 1 31 ? 1.436   -2.985  4.198   1.00 0.00 ? 61  ILE A HG22 4  
ATOM 4902  H HG23 . ILE A 1 31 ? 1.615   -4.351  5.299   1.00 0.00 ? 61  ILE A HG23 4  
ATOM 4903  H HD11 . ILE A 1 31 ? -1.949  -5.615  2.946   1.00 0.00 ? 61  ILE A HD11 4  
ATOM 4904  H HD12 . ILE A 1 31 ? -0.227  -5.551  2.572   1.00 0.00 ? 61  ILE A HD12 4  
ATOM 4905  H HD13 . ILE A 1 31 ? -1.150  -4.057  2.737   1.00 0.00 ? 61  ILE A HD13 4  
ATOM 4906  N N    . MET A 1 32 ? -1.493  -1.066  6.261   1.00 0.00 ? 62  MET A N    4  
ATOM 4907  C CA   . MET A 1 32 ? -1.389  0.355   6.570   1.00 0.00 ? 62  MET A CA   4  
ATOM 4908  C C    . MET A 1 32 ? -1.852  0.637   7.997   1.00 0.00 ? 62  MET A C    4  
ATOM 4909  O O    . MET A 1 32 ? -1.251  1.442   8.708   1.00 0.00 ? 62  MET A O    4  
ATOM 4910  C CB   . MET A 1 32 ? -2.218  1.177   5.582   1.00 0.00 ? 62  MET A CB   4  
ATOM 4911  C CG   . MET A 1 32 ? -1.932  0.847   4.126   1.00 0.00 ? 62  MET A CG   4  
ATOM 4912  S SD   . MET A 1 32 ? -0.189  1.021   3.704   1.00 0.00 ? 62  MET A SD   4  
ATOM 4913  C CE   . MET A 1 32 ? 0.239   -0.675  3.316   1.00 0.00 ? 62  MET A CE   4  
ATOM 4914  H H    . MET A 1 32 ? -2.091  -1.356  5.541   1.00 0.00 ? 62  MET A H    4  
ATOM 4915  H HA   . MET A 1 32 ? -0.351  0.640   6.480   1.00 0.00 ? 62  MET A HA   4  
ATOM 4916  H HB2  . MET A 1 32 ? -3.266  0.996   5.770   1.00 0.00 ? 62  MET A HB2  4  
ATOM 4917  H HB3  . MET A 1 32 ? -2.010  2.225   5.738   1.00 0.00 ? 62  MET A HB3  4  
ATOM 4918  H HG2  . MET A 1 32 ? -2.233  -0.173  3.936   1.00 0.00 ? 62  MET A HG2  4  
ATOM 4919  H HG3  . MET A 1 32 ? -2.509  1.512   3.500   1.00 0.00 ? 62  MET A HG3  4  
ATOM 4920  H HE1  . MET A 1 32 ? 0.902   -1.061  4.075   1.00 0.00 ? 62  MET A HE1  4  
ATOM 4921  H HE2  . MET A 1 32 ? 0.730   -0.712  2.355   1.00 0.00 ? 62  MET A HE2  4  
ATOM 4922  H HE3  . MET A 1 32 ? -0.660  -1.273  3.284   1.00 0.00 ? 62  MET A HE3  4  
ATOM 4923  N N    . LYS A 1 33 ? -2.924  -0.033  8.407   1.00 0.00 ? 63  LYS A N    4  
ATOM 4924  C CA   . LYS A 1 33 ? -3.469  0.144   9.748   1.00 0.00 ? 63  LYS A CA   4  
ATOM 4925  C C    . LYS A 1 33 ? -2.513  -0.409  10.801  1.00 0.00 ? 63  LYS A C    4  
ATOM 4926  O O    . LYS A 1 33 ? -2.455  0.092   11.924  1.00 0.00 ? 63  LYS A O    4  
ATOM 4927  C CB   . LYS A 1 33 ? -4.828  -0.547  9.864   1.00 0.00 ? 63  LYS A CB   4  
ATOM 4928  C CG   . LYS A 1 33 ? -5.596  -0.170  11.121  1.00 0.00 ? 63  LYS A CG   4  
ATOM 4929  C CD   . LYS A 1 33 ? -6.859  -1.005  11.276  1.00 0.00 ? 63  LYS A CD   4  
ATOM 4930  C CE   . LYS A 1 33 ? -8.046  -0.150  11.689  1.00 0.00 ? 63  LYS A CE   4  
ATOM 4931  N NZ   . LYS A 1 33 ? -9.080  -0.946  12.406  1.00 0.00 ? 63  LYS A NZ   4  
ATOM 4932  H H    . LYS A 1 33 ? -3.359  -0.661  7.794   1.00 0.00 ? 63  LYS A H    4  
ATOM 4933  H HA   . LYS A 1 33 ? -3.597  1.202   9.916   1.00 0.00 ? 63  LYS A HA   4  
ATOM 4934  H HB2  . LYS A 1 33 ? -5.429  -0.278  9.008   1.00 0.00 ? 63  LYS A HB2  4  
ATOM 4935  H HB3  . LYS A 1 33 ? -4.678  -1.616  9.867   1.00 0.00 ? 63  LYS A HB3  4  
ATOM 4936  H HG2  . LYS A 1 33 ? -4.963  -0.333  11.981  1.00 0.00 ? 63  LYS A HG2  4  
ATOM 4937  H HG3  . LYS A 1 33 ? -5.869  0.873   11.066  1.00 0.00 ? 63  LYS A HG3  4  
ATOM 4938  H HD2  . LYS A 1 33 ? -7.082  -1.482  10.334  1.00 0.00 ? 63  LYS A HD2  4  
ATOM 4939  H HD3  . LYS A 1 33 ? -6.689  -1.759  12.031  1.00 0.00 ? 63  LYS A HD3  4  
ATOM 4940  H HE2  . LYS A 1 33 ? -7.696  0.638   12.338  1.00 0.00 ? 63  LYS A HE2  4  
ATOM 4941  H HE3  . LYS A 1 33 ? -8.486  0.282   10.802  1.00 0.00 ? 63  LYS A HE3  4  
ATOM 4942  H HZ1  . LYS A 1 33 ? -8.645  -1.474  13.190  1.00 0.00 ? 63  LYS A HZ1  4  
ATOM 4943  H HZ2  . LYS A 1 33 ? -9.528  -1.620  11.754  1.00 0.00 ? 63  LYS A HZ2  4  
ATOM 4944  H HZ3  . LYS A 1 33 ? -9.811  -0.316  12.791  1.00 0.00 ? 63  LYS A HZ3  4  
ATOM 4945  N N    . GLU A 1 34 ? -1.768  -1.445  10.431  1.00 0.00 ? 64  GLU A N    4  
ATOM 4946  C CA   . GLU A 1 34 ? -0.816  -2.066  11.345  1.00 0.00 ? 64  GLU A CA   4  
ATOM 4947  C C    . GLU A 1 34 ? 0.437   -1.208  11.493  1.00 0.00 ? 64  GLU A C    4  
ATOM 4948  O O    . GLU A 1 34 ? 1.006   -1.106  12.580  1.00 0.00 ? 64  GLU A O    4  
ATOM 4949  C CB   . GLU A 1 34 ? -0.437  -3.463  10.848  1.00 0.00 ? 64  GLU A CB   4  
ATOM 4950  C CG   . GLU A 1 34 ? 0.279   -4.306  11.891  1.00 0.00 ? 64  GLU A CG   4  
ATOM 4951  C CD   . GLU A 1 34 ? 0.009   -5.790  11.725  1.00 0.00 ? 64  GLU A CD   4  
ATOM 4952  O OE1  . GLU A 1 34 ? 0.107   -6.287  10.583  1.00 0.00 ? 64  GLU A OE1  4  
ATOM 4953  O OE2  . GLU A 1 34 ? -0.300  -6.453  12.737  1.00 0.00 ? 64  GLU A OE2  4  
ATOM 4954  H H    . GLU A 1 34 ? -1.860  -1.801  9.523   1.00 0.00 ? 64  GLU A H    4  
ATOM 4955  H HA   . GLU A 1 34 ? -1.293  -2.155  12.310  1.00 0.00 ? 64  GLU A HA   4  
ATOM 4956  H HB2  . GLU A 1 34 ? -1.335  -3.982  10.550  1.00 0.00 ? 64  GLU A HB2  4  
ATOM 4957  H HB3  . GLU A 1 34 ? 0.212   -3.363  9.990   1.00 0.00 ? 64  GLU A HB3  4  
ATOM 4958  H HG2  . GLU A 1 34 ? 1.342   -4.138  11.803  1.00 0.00 ? 64  GLU A HG2  4  
ATOM 4959  H HG3  . GLU A 1 34 ? -0.054  -4.002  12.872  1.00 0.00 ? 64  GLU A HG3  4  
ATOM 4960  N N    . PHE A 1 35 ? 0.862   -0.595  10.393  1.00 0.00 ? 65  PHE A N    4  
ATOM 4961  C CA   . PHE A 1 35 ? 2.049   0.253   10.403  1.00 0.00 ? 65  PHE A CA   4  
ATOM 4962  C C    . PHE A 1 35 ? 1.809   1.516   11.224  1.00 0.00 ? 65  PHE A C    4  
ATOM 4963  O O    . PHE A 1 35 ? 2.695   1.978   11.943  1.00 0.00 ? 65  PHE A O    4  
ATOM 4964  C CB   . PHE A 1 35 ? 2.447   0.627   8.975   1.00 0.00 ? 65  PHE A CB   4  
ATOM 4965  C CG   . PHE A 1 35 ? 3.796   1.281   8.881   1.00 0.00 ? 65  PHE A CG   4  
ATOM 4966  C CD1  . PHE A 1 35 ? 4.945   0.516   8.766   1.00 0.00 ? 65  PHE A CD1  4  
ATOM 4967  C CD2  . PHE A 1 35 ? 3.916   2.662   8.908   1.00 0.00 ? 65  PHE A CD2  4  
ATOM 4968  C CE1  . PHE A 1 35 ? 6.188   1.114   8.680   1.00 0.00 ? 65  PHE A CE1  4  
ATOM 4969  C CE2  . PHE A 1 35 ? 5.155   3.266   8.823   1.00 0.00 ? 65  PHE A CE2  4  
ATOM 4970  C CZ   . PHE A 1 35 ? 6.293   2.491   8.708   1.00 0.00 ? 65  PHE A CZ   4  
ATOM 4971  H H    . PHE A 1 35 ? 0.367   -0.716  9.557   1.00 0.00 ? 65  PHE A H    4  
ATOM 4972  H HA   . PHE A 1 35 ? 2.852   -0.308  10.856  1.00 0.00 ? 65  PHE A HA   4  
ATOM 4973  H HB2  . PHE A 1 35 ? 2.468   -0.266  8.369   1.00 0.00 ? 65  PHE A HB2  4  
ATOM 4974  H HB3  . PHE A 1 35 ? 1.715   1.312   8.572   1.00 0.00 ? 65  PHE A HB3  4  
ATOM 4975  H HD1  . PHE A 1 35 ? 4.864   -0.560  8.743   1.00 0.00 ? 65  PHE A HD1  4  
ATOM 4976  H HD2  . PHE A 1 35 ? 3.026   3.269   8.999   1.00 0.00 ? 65  PHE A HD2  4  
ATOM 4977  H HE1  . PHE A 1 35 ? 7.077   0.507   8.590   1.00 0.00 ? 65  PHE A HE1  4  
ATOM 4978  H HE2  . PHE A 1 35 ? 5.234   4.343   8.844   1.00 0.00 ? 65  PHE A HE2  4  
ATOM 4979  H HZ   . PHE A 1 35 ? 7.263   2.962   8.640   1.00 0.00 ? 65  PHE A HZ   4  
ATOM 4980  N N    . LYS A 1 36 ? 0.606   2.072   11.112  1.00 0.00 ? 66  LYS A N    4  
ATOM 4981  C CA   . LYS A 1 36 ? 0.252   3.282   11.847  1.00 0.00 ? 66  LYS A CA   4  
ATOM 4982  C C    . LYS A 1 36 ? 0.413   3.070   13.348  1.00 0.00 ? 66  LYS A C    4  
ATOM 4983  O O    . LYS A 1 36 ? 0.748   3.999   14.084  1.00 0.00 ? 66  LYS A O    4  
ATOM 4984  C CB   . LYS A 1 36 ? -1.185  3.696   11.527  1.00 0.00 ? 66  LYS A CB   4  
ATOM 4985  C CG   . LYS A 1 36 ? -1.573  5.044   12.115  1.00 0.00 ? 66  LYS A CG   4  
ATOM 4986  C CD   . LYS A 1 36 ? -3.076  5.149   12.320  1.00 0.00 ? 66  LYS A CD   4  
ATOM 4987  C CE   . LYS A 1 36 ? -3.484  6.557   12.723  1.00 0.00 ? 66  LYS A CE   4  
ATOM 4988  N NZ   . LYS A 1 36 ? -2.739  7.032   13.921  1.00 0.00 ? 66  LYS A NZ   4  
ATOM 4989  H H    . LYS A 1 36 ? -0.059  1.657   10.524  1.00 0.00 ? 66  LYS A H    4  
ATOM 4990  H HA   . LYS A 1 36 ? 0.923   4.066   11.533  1.00 0.00 ? 66  LYS A HA   4  
ATOM 4991  H HB2  . LYS A 1 36 ? -1.303  3.748   10.455  1.00 0.00 ? 66  LYS A HB2  4  
ATOM 4992  H HB3  . LYS A 1 36 ? -1.859  2.950   11.920  1.00 0.00 ? 66  LYS A HB3  4  
ATOM 4993  H HG2  . LYS A 1 36 ? -1.081  5.167   13.067  1.00 0.00 ? 66  LYS A HG2  4  
ATOM 4994  H HG3  . LYS A 1 36 ? -1.255  5.824   11.439  1.00 0.00 ? 66  LYS A HG3  4  
ATOM 4995  H HD2  . LYS A 1 36 ? -3.575  4.891   11.398  1.00 0.00 ? 66  LYS A HD2  4  
ATOM 4996  H HD3  . LYS A 1 36 ? -3.372  4.461   13.098  1.00 0.00 ? 66  LYS A HD3  4  
ATOM 4997  H HE2  . LYS A 1 36 ? -3.285  7.226   11.898  1.00 0.00 ? 66  LYS A HE2  4  
ATOM 4998  H HE3  . LYS A 1 36 ? -4.542  6.562   12.941  1.00 0.00 ? 66  LYS A HE3  4  
ATOM 4999  H HZ1  . LYS A 1 36 ? -2.358  6.222   14.449  1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 5000  H HZ2  . LYS A 1 36 ? -3.372  7.572   14.545  1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 5001  H HZ3  . LYS A 1 36 ? -1.951  7.645   13.633  1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 5002  N N    . SER A 1 37 ? 0.176   1.841   13.794  1.00 0.00 ? 67  SER A N    4  
ATOM 5003  C CA   . SER A 1 37 ? 0.298   1.503   15.206  1.00 0.00 ? 67  SER A CA   4  
ATOM 5004  C C    . SER A 1 37 ? 1.756   1.561   15.663  1.00 0.00 ? 67  SER A C    4  
ATOM 5005  O O    . SER A 1 37 ? 2.039   1.523   16.860  1.00 0.00 ? 67  SER A O    4  
ATOM 5006  C CB   . SER A 1 37 ? -0.274  0.109   15.469  1.00 0.00 ? 67  SER A CB   4  
ATOM 5007  O OG   . SER A 1 37 ? -0.614  -0.054  16.835  1.00 0.00 ? 67  SER A OG   4  
ATOM 5008  H H    . SER A 1 37 ? -0.085  1.144   13.160  1.00 0.00 ? 67  SER A H    4  
ATOM 5009  H HA   . SER A 1 37 ? -0.272  2.226   15.767  1.00 0.00 ? 67  SER A HA   4  
ATOM 5010  H HB2  . SER A 1 37 ? -1.162  -0.032  14.871  1.00 0.00 ? 67  SER A HB2  4  
ATOM 5011  H HB3  . SER A 1 37 ? 0.461   -0.636  15.201  1.00 0.00 ? 67  SER A HB3  4  
ATOM 5012  H HG   . SER A 1 37 ? 0.088   0.301   17.384  1.00 0.00 ? 67  SER A HG   4  
ATOM 5013  N N    . GLN A 1 38 ? 2.677   1.651   14.704  1.00 0.00 ? 68  GLN A N    4  
ATOM 5014  C CA   . GLN A 1 38 ? 4.101   1.711   15.010  1.00 0.00 ? 68  GLN A CA   4  
ATOM 5015  C C    . GLN A 1 38 ? 4.576   0.405   15.641  1.00 0.00 ? 68  GLN A C    4  
ATOM 5016  O O    . GLN A 1 38 ? 5.387   0.407   16.568  1.00 0.00 ? 68  GLN A O    4  
ATOM 5017  C CB   . GLN A 1 38 ? 4.399   2.889   15.943  1.00 0.00 ? 68  GLN A CB   4  
ATOM 5018  C CG   . GLN A 1 38 ? 4.893   4.129   15.216  1.00 0.00 ? 68  GLN A CG   4  
ATOM 5019  C CD   . GLN A 1 38 ? 4.562   5.410   15.958  1.00 0.00 ? 68  GLN A CD   4  
ATOM 5020  O OE1  . GLN A 1 38 ? 3.754   6.216   15.498  1.00 0.00 ? 68  GLN A OE1  4  
ATOM 5021  N NE2  . GLN A 1 38 ? 5.189   5.603   17.112  1.00 0.00 ? 68  GLN A NE2  4  
ATOM 5022  H H    . GLN A 1 38 ? 2.392   1.674   13.767  1.00 0.00 ? 68  GLN A H    4  
ATOM 5023  H HA   . GLN A 1 38 ? 4.631   1.859   14.081  1.00 0.00 ? 68  GLN A HA   4  
ATOM 5024  H HB2  . GLN A 1 38 ? 3.497   3.148   16.478  1.00 0.00 ? 68  GLN A HB2  4  
ATOM 5025  H HB3  . GLN A 1 38 ? 5.154   2.591   16.655  1.00 0.00 ? 68  GLN A HB3  4  
ATOM 5026  H HG2  . GLN A 1 38 ? 5.965   4.063   15.105  1.00 0.00 ? 68  GLN A HG2  4  
ATOM 5027  H HG3  . GLN A 1 38 ? 4.432   4.166   14.240  1.00 0.00 ? 68  GLN A HG3  4  
ATOM 5028  H HE21 . GLN A 1 38 ? 5.819   4.919   17.418  1.00 0.00 ? 68  GLN A HE21 4  
ATOM 5029  H HE22 . GLN A 1 38 ? 4.994   6.423   17.613  1.00 0.00 ? 68  GLN A HE22 4  
ATOM 5030  N N    . SER A 1 39 ? 4.064   -0.710  15.130  1.00 0.00 ? 69  SER A N    4  
ATOM 5031  C CA   . SER A 1 39 ? 4.434   -2.025  15.639  1.00 0.00 ? 69  SER A CA   4  
ATOM 5032  C C    . SER A 1 39 ? 5.311   -2.769  14.637  1.00 0.00 ? 69  SER A C    4  
ATOM 5033  O O    . SER A 1 39 ? 6.351   -3.322  14.998  1.00 0.00 ? 69  SER A O    4  
ATOM 5034  C CB   . SER A 1 39 ? 3.180   -2.847  15.946  1.00 0.00 ? 69  SER A CB   4  
ATOM 5035  O OG   . SER A 1 39 ? 2.098   -2.009  16.312  1.00 0.00 ? 69  SER A OG   4  
ATOM 5036  H H    . SER A 1 39 ? 3.423   -0.647  14.392  1.00 0.00 ? 69  SER A H    4  
ATOM 5037  H HA   . SER A 1 39 ? 4.992   -1.882  16.552  1.00 0.00 ? 69  SER A HA   4  
ATOM 5038  H HB2  . SER A 1 39 ? 2.900   -3.412  15.070  1.00 0.00 ? 69  SER A HB2  4  
ATOM 5039  H HB3  . SER A 1 39 ? 3.387   -3.525  16.761  1.00 0.00 ? 69  SER A HB3  4  
ATOM 5040  H HG   . SER A 1 39 ? 2.406   -1.338  16.926  1.00 0.00 ? 69  SER A HG   4  
ATOM 5041  N N    . ILE A 1 40 ? 4.885   -2.780  13.378  1.00 0.00 ? 70  ILE A N    4  
ATOM 5042  C CA   . ILE A 1 40 ? 5.631   -3.454  12.324  1.00 0.00 ? 70  ILE A CA   4  
ATOM 5043  C C    . ILE A 1 40 ? 6.684   -2.531  11.720  1.00 0.00 ? 70  ILE A C    4  
ATOM 5044  O O    . ILE A 1 40 ? 6.580   -1.308  11.815  1.00 0.00 ? 70  ILE A O    4  
ATOM 5045  C CB   . ILE A 1 40 ? 4.695   -3.959  11.207  1.00 0.00 ? 70  ILE A CB   4  
ATOM 5046  C CG1  . ILE A 1 40 ? 5.485   -4.763  10.171  1.00 0.00 ? 70  ILE A CG1  4  
ATOM 5047  C CG2  . ILE A 1 40 ? 3.975   -2.792  10.545  1.00 0.00 ? 70  ILE A CG2  4  
ATOM 5048  C CD1  . ILE A 1 40 ? 4.609   -5.507  9.187   1.00 0.00 ? 70  ILE A CD1  4  
ATOM 5049  H H    . ILE A 1 40 ? 4.048   -2.321  13.153  1.00 0.00 ? 70  ILE A H    4  
ATOM 5050  H HA   . ILE A 1 40 ? 6.126   -4.309  12.763  1.00 0.00 ? 70  ILE A HA   4  
ATOM 5051  H HB   . ILE A 1 40 ? 3.951   -4.599  11.655  1.00 0.00 ? 70  ILE A HB   4  
ATOM 5052  H HG12 . ILE A 1 40 ? 6.117   -4.090  9.608   1.00 0.00 ? 70  ILE A HG12 4  
ATOM 5053  H HG13 . ILE A 1 40 ? 6.103   -5.487  10.681  1.00 0.00 ? 70  ILE A HG13 4  
ATOM 5054  H HG21 . ILE A 1 40 ? 4.462   -2.551  9.612   1.00 0.00 ? 70  ILE A HG21 4  
ATOM 5055  H HG22 . ILE A 1 40 ? 4.005   -1.933  11.199  1.00 0.00 ? 70  ILE A HG22 4  
ATOM 5056  H HG23 . ILE A 1 40 ? 2.948   -3.065  10.355  1.00 0.00 ? 70  ILE A HG23 4  
ATOM 5057  H HD11 . ILE A 1 40 ? 4.673   -5.034  8.218   1.00 0.00 ? 70  ILE A HD11 4  
ATOM 5058  H HD12 . ILE A 1 40 ? 3.586   -5.487  9.530   1.00 0.00 ? 70  ILE A HD12 4  
ATOM 5059  H HD13 . ILE A 1 40 ? 4.944   -6.531  9.110   1.00 0.00 ? 70  ILE A HD13 4  
ATOM 5060  N N    . ASP A 1 41 ? 7.699   -3.124  11.098  1.00 0.00 ? 71  ASP A N    4  
ATOM 5061  C CA   . ASP A 1 41 ? 8.772   -2.353  10.479  1.00 0.00 ? 71  ASP A CA   4  
ATOM 5062  C C    . ASP A 1 41 ? 8.439   -2.025  9.027   1.00 0.00 ? 71  ASP A C    4  
ATOM 5063  O O    . ASP A 1 41 ? 7.363   -2.363  8.535   1.00 0.00 ? 71  ASP A O    4  
ATOM 5064  C CB   . ASP A 1 41 ? 10.090  -3.127  10.551  1.00 0.00 ? 71  ASP A CB   4  
ATOM 5065  C CG   . ASP A 1 41 ? 10.517  -3.412  11.977  1.00 0.00 ? 71  ASP A CG   4  
ATOM 5066  O OD1  . ASP A 1 41 ? 9.651   -3.795  12.790  1.00 0.00 ? 71  ASP A OD1  4  
ATOM 5067  O OD2  . ASP A 1 41 ? 11.717  -3.251  12.281  1.00 0.00 ? 71  ASP A OD2  4  
ATOM 5068  H H    . ASP A 1 41 ? 7.727   -4.102  11.056  1.00 0.00 ? 71  ASP A H    4  
ATOM 5069  H HA   . ASP A 1 41 ? 8.876   -1.430  11.030  1.00 0.00 ? 71  ASP A HA   4  
ATOM 5070  H HB2  . ASP A 1 41 ? 9.977   -4.067  10.034  1.00 0.00 ? 71  ASP A HB2  4  
ATOM 5071  H HB3  . ASP A 1 41 ? 10.865  -2.548  10.070  1.00 0.00 ? 71  ASP A HB3  4  
ATOM 5072  N N    . THR A 1 42 ? 9.370   -1.364  8.348   1.00 0.00 ? 72  THR A N    4  
ATOM 5073  C CA   . THR A 1 42 ? 9.177   -0.988  6.952   1.00 0.00 ? 72  THR A CA   4  
ATOM 5074  C C    . THR A 1 42 ? 9.273   -2.209  6.039   1.00 0.00 ? 72  THR A C    4  
ATOM 5075  O O    . THR A 1 42 ? 8.386   -2.449  5.219   1.00 0.00 ? 72  THR A O    4  
ATOM 5076  C CB   . THR A 1 42 ? 10.211  0.061   6.534   1.00 0.00 ? 72  THR A CB   4  
ATOM 5077  O OG1  . THR A 1 42 ? 10.838  0.630   7.670   1.00 0.00 ? 72  THR A OG1  4  
ATOM 5078  C CG2  . THR A 1 42 ? 9.620   1.193   5.722   1.00 0.00 ? 72  THR A CG2  4  
ATOM 5079  H H    . THR A 1 42 ? 10.207  -1.122  8.797   1.00 0.00 ? 72  THR A H    4  
ATOM 5080  H HA   . THR A 1 42 ? 8.190   -0.562  6.859   1.00 0.00 ? 72  THR A HA   4  
ATOM 5081  H HB   . THR A 1 42 ? 10.972  -0.416  5.931   1.00 0.00 ? 72  THR A HB   4  
ATOM 5082  H HG1  . THR A 1 42 ? 11.478  1.287   7.388   1.00 0.00 ? 72  THR A HG1  4  
ATOM 5083  H HG21 . THR A 1 42 ? 10.304  1.464   4.932   1.00 0.00 ? 72  THR A HG21 4  
ATOM 5084  H HG22 . THR A 1 42 ? 9.455   2.046   6.362   1.00 0.00 ? 72  THR A HG22 4  
ATOM 5085  H HG23 . THR A 1 42 ? 8.681   0.877   5.294   1.00 0.00 ? 72  THR A HG23 4  
ATOM 5086  N N    . PRO A 1 43 ? 10.352  -3.002  6.169   1.00 0.00 ? 73  PRO A N    4  
ATOM 5087  C CA   . PRO A 1 43 ? 10.554  -4.201  5.349   1.00 0.00 ? 73  PRO A CA   4  
ATOM 5088  C C    . PRO A 1 43 ? 9.325   -5.103  5.329   1.00 0.00 ? 73  PRO A C    4  
ATOM 5089  O O    . PRO A 1 43 ? 9.036   -5.754  4.323   1.00 0.00 ? 73  PRO A O    4  
ATOM 5090  C CB   . PRO A 1 43 ? 11.724  -4.906  6.036   1.00 0.00 ? 73  PRO A CB   4  
ATOM 5091  C CG   . PRO A 1 43 ? 12.483  -3.812  6.703   1.00 0.00 ? 73  PRO A CG   4  
ATOM 5092  C CD   . PRO A 1 43 ? 11.460  -2.791  7.122   1.00 0.00 ? 73  PRO A CD   4  
ATOM 5093  H HA   . PRO A 1 43 ? 10.828  -3.946  4.336   1.00 0.00 ? 73  PRO A HA   4  
ATOM 5094  H HB2  . PRO A 1 43 ? 11.346  -5.621  6.753   1.00 0.00 ? 73  PRO A HB2  4  
ATOM 5095  H HB3  . PRO A 1 43 ? 12.329  -5.411  5.297   1.00 0.00 ? 73  PRO A HB3  4  
ATOM 5096  H HG2  . PRO A 1 43 ? 13.001  -4.200  7.568   1.00 0.00 ? 73  PRO A HG2  4  
ATOM 5097  H HG3  . PRO A 1 43 ? 13.186  -3.376  6.010   1.00 0.00 ? 73  PRO A HG3  4  
ATOM 5098  H HD2  . PRO A 1 43 ? 11.135  -2.976  8.136   1.00 0.00 ? 73  PRO A HD2  4  
ATOM 5099  H HD3  . PRO A 1 43 ? 11.863  -1.794  7.030   1.00 0.00 ? 73  PRO A HD3  4  
ATOM 5100  N N    . GLY A 1 44 ? 8.603   -5.137  6.444   1.00 0.00 ? 74  GLY A N    4  
ATOM 5101  C CA   . GLY A 1 44 ? 7.412   -5.962  6.531   1.00 0.00 ? 74  GLY A CA   4  
ATOM 5102  C C    . GLY A 1 44 ? 6.273   -5.423  5.689   1.00 0.00 ? 74  GLY A C    4  
ATOM 5103  O O    . GLY A 1 44 ? 5.448   -6.186  5.186   1.00 0.00 ? 74  GLY A O    4  
ATOM 5104  H H    . GLY A 1 44 ? 8.881   -4.597  7.213   1.00 0.00 ? 74  GLY A H    4  
ATOM 5105  H HA2  . GLY A 1 44 ? 7.653   -6.959  6.195   1.00 0.00 ? 74  GLY A HA2  4  
ATOM 5106  H HA3  . GLY A 1 44 ? 7.093   -6.007  7.562   1.00 0.00 ? 74  GLY A HA3  4  
ATOM 5107  N N    . VAL A 1 45 ? 6.228   -4.104  5.534   1.00 0.00 ? 75  VAL A N    4  
ATOM 5108  C CA   . VAL A 1 45 ? 5.183   -3.462  4.746   1.00 0.00 ? 75  VAL A CA   4  
ATOM 5109  C C    . VAL A 1 45 ? 5.397   -3.698  3.255   1.00 0.00 ? 75  VAL A C    4  
ATOM 5110  O O    . VAL A 1 45 ? 4.439   -3.857  2.498   1.00 0.00 ? 75  VAL A O    4  
ATOM 5111  C CB   . VAL A 1 45 ? 5.132   -1.945  5.009   1.00 0.00 ? 75  VAL A CB   4  
ATOM 5112  C CG1  . VAL A 1 45 ? 3.916   -1.326  4.336   1.00 0.00 ? 75  VAL A CG1  4  
ATOM 5113  C CG2  . VAL A 1 45 ? 5.123   -1.663  6.505   1.00 0.00 ? 75  VAL A CG2  4  
ATOM 5114  H H    . VAL A 1 45 ? 6.915   -3.549  5.958   1.00 0.00 ? 75  VAL A H    4  
ATOM 5115  H HA   . VAL A 1 45 ? 4.235   -3.890  5.037   1.00 0.00 ? 75  VAL A HA   4  
ATOM 5116  H HB   . VAL A 1 45 ? 6.018   -1.496  4.585   1.00 0.00 ? 75  VAL A HB   4  
ATOM 5117  H HG11 . VAL A 1 45 ? 4.025   -1.395  3.264   1.00 0.00 ? 75  VAL A HG11 4  
ATOM 5118  H HG12 . VAL A 1 45 ? 3.836   -0.288  4.623   1.00 0.00 ? 75  VAL A HG12 4  
ATOM 5119  H HG13 . VAL A 1 45 ? 3.026   -1.854  4.642   1.00 0.00 ? 75  VAL A HG13 4  
ATOM 5120  H HG21 . VAL A 1 45 ? 4.754   -2.530  7.032   1.00 0.00 ? 75  VAL A HG21 4  
ATOM 5121  H HG22 . VAL A 1 45 ? 4.484   -0.817  6.708   1.00 0.00 ? 75  VAL A HG22 4  
ATOM 5122  H HG23 . VAL A 1 45 ? 6.128   -1.442  6.835   1.00 0.00 ? 75  VAL A HG23 4  
ATOM 5123  N N    . ILE A 1 46 ? 6.659   -3.721  2.840   1.00 0.00 ? 76  ILE A N    4  
ATOM 5124  C CA   . ILE A 1 46 ? 6.998   -3.938  1.440   1.00 0.00 ? 76  ILE A CA   4  
ATOM 5125  C C    . ILE A 1 46 ? 6.647   -5.358  1.005   1.00 0.00 ? 76  ILE A C    4  
ATOM 5126  O O    . ILE A 1 46 ? 6.052   -5.564  -0.052  1.00 0.00 ? 76  ILE A O    4  
ATOM 5127  C CB   . ILE A 1 46 ? 8.495   -3.688  1.176   1.00 0.00 ? 76  ILE A CB   4  
ATOM 5128  C CG1  . ILE A 1 46 ? 8.913   -2.325  1.734   1.00 0.00 ? 76  ILE A CG1  4  
ATOM 5129  C CG2  . ILE A 1 46 ? 8.794   -3.769  -0.313  1.00 0.00 ? 76  ILE A CG2  4  
ATOM 5130  C CD1  . ILE A 1 46 ? 8.198   -1.161  1.084   1.00 0.00 ? 76  ILE A CD1  4  
ATOM 5131  H H    . ILE A 1 46 ? 7.379   -3.588  3.491   1.00 0.00 ? 76  ILE A H    4  
ATOM 5132  H HA   . ILE A 1 46 ? 6.427   -3.239  0.846   1.00 0.00 ? 76  ILE A HA   4  
ATOM 5133  H HB   . ILE A 1 46 ? 9.060   -4.460  1.674   1.00 0.00 ? 76  ILE A HB   4  
ATOM 5134  H HG12 . ILE A 1 46 ? 8.702   -2.295  2.792   1.00 0.00 ? 76  ILE A HG12 4  
ATOM 5135  H HG13 . ILE A 1 46 ? 9.975   -2.191  1.580   1.00 0.00 ? 76  ILE A HG13 4  
ATOM 5136  H HG21 . ILE A 1 46 ? 8.349   -4.664  -0.722  1.00 0.00 ? 76  ILE A HG21 4  
ATOM 5137  H HG22 . ILE A 1 46 ? 9.864   -3.798  -0.465  1.00 0.00 ? 76  ILE A HG22 4  
ATOM 5138  H HG23 . ILE A 1 46 ? 8.384   -2.903  -0.811  1.00 0.00 ? 76  ILE A HG23 4  
ATOM 5139  H HD11 . ILE A 1 46 ? 8.871   -0.318  1.013   1.00 0.00 ? 76  ILE A HD11 4  
ATOM 5140  H HD12 . ILE A 1 46 ? 7.340   -0.888  1.680   1.00 0.00 ? 76  ILE A HD12 4  
ATOM 5141  H HD13 . ILE A 1 46 ? 7.873   -1.445  0.094   1.00 0.00 ? 76  ILE A HD13 4  
ATOM 5142  N N    . ARG A 1 47 ? 7.020   -6.333  1.827   1.00 0.00 ? 77  ARG A N    4  
ATOM 5143  C CA   . ARG A 1 47 ? 6.743   -7.734  1.526   1.00 0.00 ? 77  ARG A CA   4  
ATOM 5144  C C    . ARG A 1 47 ? 5.240   -7.996  1.497   1.00 0.00 ? 77  ARG A C    4  
ATOM 5145  O O    . ARG A 1 47 ? 4.754   -8.789  0.689   1.00 0.00 ? 77  ARG A O    4  
ATOM 5146  C CB   . ARG A 1 47 ? 7.416   -8.641  2.558   1.00 0.00 ? 77  ARG A CB   4  
ATOM 5147  C CG   . ARG A 1 47 ? 8.634   -9.373  2.018   1.00 0.00 ? 77  ARG A CG   4  
ATOM 5148  C CD   . ARG A 1 47 ? 9.604   -9.738  3.131   1.00 0.00 ? 77  ARG A CD   4  
ATOM 5149  N NE   . ARG A 1 47 ? 10.971  -9.889  2.636   1.00 0.00 ? 77  ARG A NE   4  
ATOM 5150  C CZ   . ARG A 1 47 ? 11.781  -8.867  2.371   1.00 0.00 ? 77  ARG A CZ   4  
ATOM 5151  N NH1  . ARG A 1 47 ? 11.368  -7.619  2.553   1.00 0.00 ? 77  ARG A NH1  4  
ATOM 5152  N NH2  . ARG A 1 47 ? 13.009  -9.094  1.924   1.00 0.00 ? 77  ARG A NH2  4  
ATOM 5153  H H    . ARG A 1 47 ? 7.491   -6.106  2.656   1.00 0.00 ? 77  ARG A H    4  
ATOM 5154  H HA   . ARG A 1 47 ? 7.152   -7.948  0.550   1.00 0.00 ? 77  ARG A HA   4  
ATOM 5155  H HB2  . ARG A 1 47 ? 7.728   -8.042  3.400   1.00 0.00 ? 77  ARG A HB2  4  
ATOM 5156  H HB3  . ARG A 1 47 ? 6.702   -9.378  2.897   1.00 0.00 ? 77  ARG A HB3  4  
ATOM 5157  H HG2  . ARG A 1 47 ? 8.310   -10.278 1.527   1.00 0.00 ? 77  ARG A HG2  4  
ATOM 5158  H HG3  . ARG A 1 47 ? 9.139   -8.736  1.306   1.00 0.00 ? 77  ARG A HG3  4  
ATOM 5159  H HD2  . ARG A 1 47 ? 9.586   -8.958  3.877   1.00 0.00 ? 77  ARG A HD2  4  
ATOM 5160  H HD3  . ARG A 1 47 ? 9.287   -10.669 3.576   1.00 0.00 ? 77  ARG A HD3  4  
ATOM 5161  H HE   . ARG A 1 47 ? 11.303  -10.801 2.494   1.00 0.00 ? 77  ARG A HE   4  
ATOM 5162  H HH11 . ARG A 1 47 ? 10.443  -7.442  2.890   1.00 0.00 ? 77  ARG A HH11 4  
ATOM 5163  H HH12 . ARG A 1 47 ? 11.981  -6.855  2.352   1.00 0.00 ? 77  ARG A HH12 4  
ATOM 5164  H HH21 . ARG A 1 47 ? 13.326  -10.031 1.786   1.00 0.00 ? 77  ARG A HH21 4  
ATOM 5165  H HH22 . ARG A 1 47 ? 13.618  -8.326  1.725   1.00 0.00 ? 77  ARG A HH22 4  
ATOM 5166  N N    . ARG A 1 48 ? 4.510   -7.326  2.382   1.00 0.00 ? 78  ARG A N    4  
ATOM 5167  C CA   . ARG A 1 48 ? 3.062   -7.488  2.456   1.00 0.00 ? 78  ARG A CA   4  
ATOM 5168  C C    . ARG A 1 48 ? 2.396   -7.026  1.164   1.00 0.00 ? 78  ARG A C    4  
ATOM 5169  O O    . ARG A 1 48 ? 1.632   -7.769  0.549   1.00 0.00 ? 78  ARG A O    4  
ATOM 5170  C CB   . ARG A 1 48 ? 2.500   -6.702  3.643   1.00 0.00 ? 78  ARG A CB   4  
ATOM 5171  C CG   . ARG A 1 48 ? 2.693   -7.401  4.980   1.00 0.00 ? 78  ARG A CG   4  
ATOM 5172  C CD   . ARG A 1 48 ? 1.369   -7.620  5.695   1.00 0.00 ? 78  ARG A CD   4  
ATOM 5173  N NE   . ARG A 1 48 ? 1.455   -8.681  6.695   1.00 0.00 ? 78  ARG A NE   4  
ATOM 5174  C CZ   . ARG A 1 48 ? 0.399   -9.201  7.317   1.00 0.00 ? 78  ARG A CZ   4  
ATOM 5175  N NH1  . ARG A 1 48 ? -0.824  -8.762  7.044   1.00 0.00 ? 78  ARG A NH1  4  
ATOM 5176  N NH2  . ARG A 1 48 ? 0.566   -10.163 8.215   1.00 0.00 ? 78  ARG A NH2  4  
ATOM 5177  H H    . ARG A 1 48 ? 4.954   -6.709  2.999   1.00 0.00 ? 78  ARG A H    4  
ATOM 5178  H HA   . ARG A 1 48 ? 2.853   -8.537  2.599   1.00 0.00 ? 78  ARG A HA   4  
ATOM 5179  H HB2  . ARG A 1 48 ? 2.991   -5.742  3.689   1.00 0.00 ? 78  ARG A HB2  4  
ATOM 5180  H HB3  . ARG A 1 48 ? 1.442   -6.549  3.490   1.00 0.00 ? 78  ARG A HB3  4  
ATOM 5181  H HG2  . ARG A 1 48 ? 3.160   -8.359  4.811   1.00 0.00 ? 78  ARG A HG2  4  
ATOM 5182  H HG3  . ARG A 1 48 ? 3.332   -6.792  5.604   1.00 0.00 ? 78  ARG A HG3  4  
ATOM 5183  H HD2  . ARG A 1 48 ? 1.081   -6.701  6.183   1.00 0.00 ? 78  ARG A HD2  4  
ATOM 5184  H HD3  . ARG A 1 48 ? 0.620   -7.887  4.963   1.00 0.00 ? 78  ARG A HD3  4  
ATOM 5185  H HE   . ARG A 1 48 ? 2.346   -9.023  6.916   1.00 0.00 ? 78  ARG A HE   4  
ATOM 5186  H HH11 . ARG A 1 48 ? -0.956  -8.037  6.368   1.00 0.00 ? 78  ARG A HH11 4  
ATOM 5187  H HH12 . ARG A 1 48 ? -1.613  -9.157  7.513   1.00 0.00 ? 78  ARG A HH12 4  
ATOM 5188  H HH21 . ARG A 1 48 ? 1.484   -10.498 8.424   1.00 0.00 ? 78  ARG A HH21 4  
ATOM 5189  H HH22 . ARG A 1 48 ? -0.228  -10.554 8.681   1.00 0.00 ? 78  ARG A HH22 4  
ATOM 5190  N N    . VAL A 1 49 ? 2.688   -5.794  0.760   1.00 0.00 ? 79  VAL A N    4  
ATOM 5191  C CA   . VAL A 1 49 ? 2.116   -5.235  -0.459  1.00 0.00 ? 79  VAL A CA   4  
ATOM 5192  C C    . VAL A 1 49 ? 2.626   -5.970  -1.695  1.00 0.00 ? 79  VAL A C    4  
ATOM 5193  O O    . VAL A 1 49 ? 1.846   -6.352  -2.568  1.00 0.00 ? 79  VAL A O    4  
ATOM 5194  C CB   . VAL A 1 49 ? 2.439   -3.734  -0.596  1.00 0.00 ? 79  VAL A CB   4  
ATOM 5195  C CG1  . VAL A 1 49 ? 1.749   -3.145  -1.818  1.00 0.00 ? 79  VAL A CG1  4  
ATOM 5196  C CG2  . VAL A 1 49 ? 2.037   -2.983  0.665   1.00 0.00 ? 79  VAL A CG2  4  
ATOM 5197  H H    . VAL A 1 49 ? 3.304   -5.248  1.293   1.00 0.00 ? 79  VAL A H    4  
ATOM 5198  H HA   . VAL A 1 49 ? 1.042   -5.346  -0.405  1.00 0.00 ? 79  VAL A HA   4  
ATOM 5199  H HB   . VAL A 1 49 ? 3.506   -3.626  -0.728  1.00 0.00 ? 79  VAL A HB   4  
ATOM 5200  H HG11 . VAL A 1 49 ? 0.871   -3.728  -2.052  1.00 0.00 ? 79  VAL A HG11 4  
ATOM 5201  H HG12 . VAL A 1 49 ? 2.427   -3.161  -2.658  1.00 0.00 ? 79  VAL A HG12 4  
ATOM 5202  H HG13 . VAL A 1 49 ? 1.459   -2.125  -1.610  1.00 0.00 ? 79  VAL A HG13 4  
ATOM 5203  H HG21 . VAL A 1 49 ? 1.561   -2.052  0.395   1.00 0.00 ? 79  VAL A HG21 4  
ATOM 5204  H HG22 . VAL A 1 49 ? 2.916   -2.779  1.258   1.00 0.00 ? 79  VAL A HG22 4  
ATOM 5205  H HG23 . VAL A 1 49 ? 1.349   -3.586  1.240   1.00 0.00 ? 79  VAL A HG23 4  
ATOM 5206  N N    . SER A 1 50 ? 3.939   -6.165  -1.765  1.00 0.00 ? 80  SER A N    4  
ATOM 5207  C CA   . SER A 1 50 ? 4.550   -6.855  -2.895  1.00 0.00 ? 80  SER A CA   4  
ATOM 5208  C C    . SER A 1 50 ? 3.979   -8.261  -3.056  1.00 0.00 ? 80  SER A C    4  
ATOM 5209  O O    . SER A 1 50 ? 4.023   -8.839  -4.141  1.00 0.00 ? 80  SER A O    4  
ATOM 5210  C CB   . SER A 1 50 ? 6.068   -6.923  -2.723  1.00 0.00 ? 80  SER A CB   4  
ATOM 5211  O OG   . SER A 1 50 ? 6.415   -7.605  -1.529  1.00 0.00 ? 80  SER A OG   4  
ATOM 5212  H H    . SER A 1 50 ? 4.510   -5.837  -1.039  1.00 0.00 ? 80  SER A H    4  
ATOM 5213  H HA   . SER A 1 50 ? 4.324   -6.290  -3.785  1.00 0.00 ? 80  SER A HA   4  
ATOM 5214  H HB2  . SER A 1 50 ? 6.501   -7.448  -3.561  1.00 0.00 ? 80  SER A HB2  4  
ATOM 5215  H HB3  . SER A 1 50 ? 6.468   -5.920  -2.680  1.00 0.00 ? 80  SER A HB3  4  
ATOM 5216  H HG   . SER A 1 50 ? 5.854   -7.299  -0.812  1.00 0.00 ? 80  SER A HG   4  
ATOM 5217  N N    . GLN A 1 51 ? 3.444   -8.804  -1.968  1.00 0.00 ? 81  GLN A N    4  
ATOM 5218  C CA   . GLN A 1 51 ? 2.863   -10.142 -1.988  1.00 0.00 ? 81  GLN A CA   4  
ATOM 5219  C C    . GLN A 1 51 ? 1.398   -10.086 -2.411  1.00 0.00 ? 81  GLN A C    4  
ATOM 5220  O O    . GLN A 1 51 ? 0.933   -10.922 -3.187  1.00 0.00 ? 81  GLN A O    4  
ATOM 5221  C CB   . GLN A 1 51 ? 2.985   -10.796 -0.611  1.00 0.00 ? 81  GLN A CB   4  
ATOM 5222  C CG   . GLN A 1 51 ? 2.497   -12.235 -0.576  1.00 0.00 ? 81  GLN A CG   4  
ATOM 5223  C CD   . GLN A 1 51 ? 3.527   -13.214 -1.103  1.00 0.00 ? 81  GLN A CD   4  
ATOM 5224  O OE1  . GLN A 1 51 ? 4.331   -13.756 -0.343  1.00 0.00 ? 81  GLN A OE1  4  
ATOM 5225  N NE2  . GLN A 1 51 ? 3.510   -13.444 -2.411  1.00 0.00 ? 81  GLN A NE2  4  
ATOM 5226  H H    . GLN A 1 51 ? 3.438   -8.293  -1.134  1.00 0.00 ? 81  GLN A H    4  
ATOM 5227  H HA   . GLN A 1 51 ? 3.411   -10.731 -2.708  1.00 0.00 ? 81  GLN A HA   4  
ATOM 5228  H HB2  . GLN A 1 51 ? 4.023   -10.784 -0.310  1.00 0.00 ? 81  GLN A HB2  4  
ATOM 5229  H HB3  . GLN A 1 51 ? 2.406   -10.224 0.100   1.00 0.00 ? 81  GLN A HB3  4  
ATOM 5230  H HG2  . GLN A 1 51 ? 2.263   -12.498 0.446   1.00 0.00 ? 81  GLN A HG2  4  
ATOM 5231  H HG3  . GLN A 1 51 ? 1.604   -12.313 -1.179  1.00 0.00 ? 81  GLN A HG3  4  
ATOM 5232  H HE21 . GLN A 1 51 ? 2.843   -12.976 -2.954  1.00 0.00 ? 81  GLN A HE21 4  
ATOM 5233  H HE22 . GLN A 1 51 ? 4.166   -14.072 -2.778  1.00 0.00 ? 81  GLN A HE22 4  
ATOM 5234  N N    . LEU A 1 52 ? 0.677   -9.096  -1.897  1.00 0.00 ? 82  LEU A N    4  
ATOM 5235  C CA   . LEU A 1 52 ? -0.733  -8.927  -2.221  1.00 0.00 ? 82  LEU A CA   4  
ATOM 5236  C C    . LEU A 1 52 ? -0.921  -8.651  -3.709  1.00 0.00 ? 82  LEU A C    4  
ATOM 5237  O O    . LEU A 1 52 ? -1.936  -9.024  -4.297  1.00 0.00 ? 82  LEU A O    4  
ATOM 5238  C CB   . LEU A 1 52 ? -1.331  -7.782  -1.399  1.00 0.00 ? 82  LEU A CB   4  
ATOM 5239  C CG   . LEU A 1 52 ? -2.752  -8.024  -0.887  1.00 0.00 ? 82  LEU A CG   4  
ATOM 5240  C CD1  . LEU A 1 52 ? -2.733  -8.950  0.320   1.00 0.00 ? 82  LEU A CD1  4  
ATOM 5241  C CD2  . LEU A 1 52 ? -3.423  -6.705  -0.536  1.00 0.00 ? 82  LEU A CD2  4  
ATOM 5242  H H    . LEU A 1 52 ? 1.105   -8.462  -1.285  1.00 0.00 ? 82  LEU A H    4  
ATOM 5243  H HA   . LEU A 1 52 ? -1.244  -9.843  -1.968  1.00 0.00 ? 82  LEU A HA   4  
ATOM 5244  H HB2  . LEU A 1 52 ? -0.689  -7.605  -0.548  1.00 0.00 ? 82  LEU A HB2  4  
ATOM 5245  H HB3  . LEU A 1 52 ? -1.341  -6.893  -2.011  1.00 0.00 ? 82  LEU A HB3  4  
ATOM 5246  H HG   . LEU A 1 52 ? -3.332  -8.500  -1.664  1.00 0.00 ? 82  LEU A HG   4  
ATOM 5247  H HD11 . LEU A 1 52 ? -2.356  -9.919  0.024   1.00 0.00 ? 82  LEU A HD11 4  
ATOM 5248  H HD12 . LEU A 1 52 ? -3.735  -9.056  0.708   1.00 0.00 ? 82  LEU A HD12 4  
ATOM 5249  H HD13 . LEU A 1 52 ? -2.093  -8.533  1.083   1.00 0.00 ? 82  LEU A HD13 4  
ATOM 5250  H HD21 . LEU A 1 52 ? -3.920  -6.309  -1.410  1.00 0.00 ? 82  LEU A HD21 4  
ATOM 5251  H HD22 . LEU A 1 52 ? -2.678  -6.000  -0.197  1.00 0.00 ? 82  LEU A HD22 4  
ATOM 5252  H HD23 . LEU A 1 52 ? -4.148  -6.867  0.248   1.00 0.00 ? 82  LEU A HD23 4  
ATOM 5253  N N    . PHE A 1 53 ? 0.066   -7.996  -4.312  1.00 0.00 ? 83  PHE A N    4  
ATOM 5254  C CA   . PHE A 1 53 ? 0.013   -7.668  -5.732  1.00 0.00 ? 83  PHE A CA   4  
ATOM 5255  C C    . PHE A 1 53 ? 1.127   -8.379  -6.495  1.00 0.00 ? 83  PHE A C    4  
ATOM 5256  O O    . PHE A 1 53 ? 1.966   -7.740  -7.132  1.00 0.00 ? 83  PHE A O    4  
ATOM 5257  C CB   . PHE A 1 53 ? 0.124   -6.155  -5.927  1.00 0.00 ? 83  PHE A CB   4  
ATOM 5258  C CG   . PHE A 1 53 ? -0.821  -5.368  -5.064  1.00 0.00 ? 83  PHE A CG   4  
ATOM 5259  C CD1  . PHE A 1 53 ? -2.166  -5.696  -5.012  1.00 0.00 ? 83  PHE A CD1  4  
ATOM 5260  C CD2  . PHE A 1 53 ? -0.364  -4.302  -4.305  1.00 0.00 ? 83  PHE A CD2  4  
ATOM 5261  C CE1  . PHE A 1 53 ? -3.038  -4.974  -4.218  1.00 0.00 ? 83  PHE A CE1  4  
ATOM 5262  C CE2  . PHE A 1 53 ? -1.231  -3.578  -3.510  1.00 0.00 ? 83  PHE A CE2  4  
ATOM 5263  C CZ   . PHE A 1 53 ? -2.570  -3.915  -3.467  1.00 0.00 ? 83  PHE A CZ   4  
ATOM 5264  H H    . PHE A 1 53 ? 0.849   -7.725  -3.789  1.00 0.00 ? 83  PHE A H    4  
ATOM 5265  H HA   . PHE A 1 53 ? -0.939  -8.003  -6.115  1.00 0.00 ? 83  PHE A HA   4  
ATOM 5266  H HB2  . PHE A 1 53 ? 1.130   -5.841  -5.690  1.00 0.00 ? 83  PHE A HB2  4  
ATOM 5267  H HB3  . PHE A 1 53 ? -0.088  -5.915  -6.959  1.00 0.00 ? 83  PHE A HB3  4  
ATOM 5268  H HD1  . PHE A 1 53 ? -2.534  -6.525  -5.598  1.00 0.00 ? 83  PHE A HD1  4  
ATOM 5269  H HD2  . PHE A 1 53 ? 0.683   -4.039  -4.339  1.00 0.00 ? 83  PHE A HD2  4  
ATOM 5270  H HE1  . PHE A 1 53 ? -4.085  -5.240  -4.186  1.00 0.00 ? 83  PHE A HE1  4  
ATOM 5271  H HE2  . PHE A 1 53 ? -0.863  -2.750  -2.923  1.00 0.00 ? 83  PHE A HE2  4  
ATOM 5272  H HZ   . PHE A 1 53 ? -3.250  -3.350  -2.846  1.00 0.00 ? 83  PHE A HZ   4  
ATOM 5273  N N    . HIS A 1 54 ? 1.132   -9.706  -6.422  1.00 0.00 ? 84  HIS A N    4  
ATOM 5274  C CA   . HIS A 1 54 ? 2.142   -10.508 -7.098  1.00 0.00 ? 84  HIS A CA   4  
ATOM 5275  C C    . HIS A 1 54 ? 1.930   -10.503 -8.610  1.00 0.00 ? 84  HIS A C    4  
ATOM 5276  O O    . HIS A 1 54 ? 2.888   -10.581 -9.379  1.00 0.00 ? 84  HIS A O    4  
ATOM 5277  C CB   . HIS A 1 54 ? 2.114   -11.944 -6.574  1.00 0.00 ? 84  HIS A CB   4  
ATOM 5278  C CG   . HIS A 1 54 ? 3.411   -12.671 -6.751  1.00 0.00 ? 84  HIS A CG   4  
ATOM 5279  N ND1  . HIS A 1 54 ? 4.236   -13.006 -5.699  1.00 0.00 ? 84  HIS A ND1  4  
ATOM 5280  C CD2  . HIS A 1 54 ? 4.024   -13.131 -7.868  1.00 0.00 ? 84  HIS A CD2  4  
ATOM 5281  C CE1  . HIS A 1 54 ? 5.301   -13.638 -6.160  1.00 0.00 ? 84  HIS A CE1  4  
ATOM 5282  N NE2  . HIS A 1 54 ? 5.196   -13.727 -7.472  1.00 0.00 ? 84  HIS A NE2  4  
ATOM 5283  H H    . HIS A 1 54 ? 0.442   -10.157 -5.896  1.00 0.00 ? 84  HIS A H    4  
ATOM 5284  H HA   . HIS A 1 54 ? 3.104   -10.074 -6.880  1.00 0.00 ? 84  HIS A HA   4  
ATOM 5285  H HB2  . HIS A 1 54 ? 1.884   -11.931 -5.519  1.00 0.00 ? 84  HIS A HB2  4  
ATOM 5286  H HB3  . HIS A 1 54 ? 1.348   -12.496 -7.098  1.00 0.00 ? 84  HIS A HB3  4  
ATOM 5287  H HD1  . HIS A 1 54 ? 4.068   -12.809 -4.753  1.00 0.00 ? 84  HIS A HD1  4  
ATOM 5288  H HD2  . HIS A 1 54 ? 3.659   -13.044 -8.882  1.00 0.00 ? 84  HIS A HD2  4  
ATOM 5289  H HE1  . HIS A 1 54 ? 6.118   -14.019 -5.563  1.00 0.00 ? 84  HIS A HE1  4  
ATOM 5290  H HE2  . HIS A 1 54 ? 5.886   -14.080 -8.072  1.00 0.00 ? 84  HIS A HE2  4  
ATOM 5291  N N    . GLU A 1 55 ? 0.672   -10.416 -9.028  1.00 0.00 ? 85  GLU A N    4  
ATOM 5292  C CA   . GLU A 1 55 ? 0.339   -10.407 -10.449 1.00 0.00 ? 85  GLU A CA   4  
ATOM 5293  C C    . GLU A 1 55 ? -0.291  -9.078  -10.859 1.00 0.00 ? 85  GLU A C    4  
ATOM 5294  O O    . GLU A 1 55 ? -1.156  -9.034  -11.734 1.00 0.00 ? 85  GLU A O    4  
ATOM 5295  C CB   . GLU A 1 55 ? -0.612  -11.563 -10.775 1.00 0.00 ? 85  GLU A CB   4  
ATOM 5296  C CG   . GLU A 1 55 ? 0.050   -12.698 -11.538 1.00 0.00 ? 85  GLU A CG   4  
ATOM 5297  C CD   . GLU A 1 55 ? 0.231   -12.383 -13.010 1.00 0.00 ? 85  GLU A CD   4  
ATOM 5298  O OE1  . GLU A 1 55 ? -0.789  -12.285 -13.725 1.00 0.00 ? 85  GLU A OE1  4  
ATOM 5299  O OE2  . GLU A 1 55 ? 1.391   -12.234 -13.448 1.00 0.00 ? 85  GLU A OE2  4  
ATOM 5300  H H    . GLU A 1 55 ? -0.050  -10.360 -8.367  1.00 0.00 ? 85  GLU A H    4  
ATOM 5301  H HA   . GLU A 1 55 ? 1.255   -10.542 -11.004 1.00 0.00 ? 85  GLU A HA   4  
ATOM 5302  H HB2  . GLU A 1 55 ? -1.004  -11.961 -9.850  1.00 0.00 ? 85  GLU A HB2  4  
ATOM 5303  H HB3  . GLU A 1 55 ? -1.431  -11.188 -11.370 1.00 0.00 ? 85  GLU A HB3  4  
ATOM 5304  H HG2  . GLU A 1 55 ? 1.021   -12.887 -11.105 1.00 0.00 ? 85  GLU A HG2  4  
ATOM 5305  H HG3  . GLU A 1 55 ? -0.563  -13.583 -11.446 1.00 0.00 ? 85  GLU A HG3  4  
ATOM 5306  N N    . HIS A 1 56 ? 0.149   -7.996  -10.225 1.00 0.00 ? 86  HIS A N    4  
ATOM 5307  C CA   . HIS A 1 56 ? -0.374  -6.669  -10.530 1.00 0.00 ? 86  HIS A CA   4  
ATOM 5308  C C    . HIS A 1 56 ? 0.742   -5.626  -10.530 1.00 0.00 ? 86  HIS A C    4  
ATOM 5309  O O    . HIS A 1 56 ? 0.992   -4.973  -9.518  1.00 0.00 ? 86  HIS A O    4  
ATOM 5310  C CB   . HIS A 1 56 ? -1.453  -6.279  -9.520  1.00 0.00 ? 86  HIS A CB   4  
ATOM 5311  C CG   . HIS A 1 56 ? -2.769  -6.950  -9.763  1.00 0.00 ? 86  HIS A CG   4  
ATOM 5312  N ND1  . HIS A 1 56 ? -3.794  -6.364  -10.475 1.00 0.00 ? 86  HIS A ND1  4  
ATOM 5313  C CD2  . HIS A 1 56 ? -3.224  -8.169  -9.386  1.00 0.00 ? 86  HIS A CD2  4  
ATOM 5314  C CE1  . HIS A 1 56 ? -4.822  -7.192  -10.526 1.00 0.00 ? 86  HIS A CE1  4  
ATOM 5315  N NE2  . HIS A 1 56 ? -4.503  -8.293  -9.874  1.00 0.00 ? 86  HIS A NE2  4  
ATOM 5316  H H    . HIS A 1 56 ? 0.842   -8.092  -9.538  1.00 0.00 ? 86  HIS A H    4  
ATOM 5317  H HA   . HIS A 1 56 ? -0.814  -6.707  -11.516 1.00 0.00 ? 86  HIS A HA   4  
ATOM 5318  H HB2  . HIS A 1 56 ? -1.122  -6.547  -8.528  1.00 0.00 ? 86  HIS A HB2  4  
ATOM 5319  H HB3  . HIS A 1 56 ? -1.610  -5.212  -9.566  1.00 0.00 ? 86  HIS A HB3  4  
ATOM 5320  H HD1  . HIS A 1 56 ? -3.771  -5.473  -10.883 1.00 0.00 ? 86  HIS A HD1  4  
ATOM 5321  H HD2  . HIS A 1 56 ? -2.684  -8.906  -8.809  1.00 0.00 ? 86  HIS A HD2  4  
ATOM 5322  H HE1  . HIS A 1 56 ? -5.764  -7.000  -11.018 1.00 0.00 ? 86  HIS A HE1  4  
ATOM 5323  H HE2  . HIS A 1 56 ? -5.110  -9.042  -9.697  1.00 0.00 ? 86  HIS A HE2  4  
ATOM 5324  N N    . PRO A 1 57 ? 1.429   -5.456  -11.673 1.00 0.00 ? 87  PRO A N    4  
ATOM 5325  C CA   . PRO A 1 57 ? 2.523   -4.487  -11.803 1.00 0.00 ? 87  PRO A CA   4  
ATOM 5326  C C    . PRO A 1 57 ? 2.082   -3.066  -11.464 1.00 0.00 ? 87  PRO A C    4  
ATOM 5327  O O    . PRO A 1 57 ? 2.724   -2.381  -10.668 1.00 0.00 ? 87  PRO A O    4  
ATOM 5328  C CB   . PRO A 1 57 ? 2.918   -4.582  -13.281 1.00 0.00 ? 87  PRO A CB   4  
ATOM 5329  C CG   . PRO A 1 57 ? 2.438   -5.921  -13.723 1.00 0.00 ? 87  PRO A CG   4  
ATOM 5330  C CD   . PRO A 1 57 ? 1.195   -6.197  -12.926 1.00 0.00 ? 87  PRO A CD   4  
ATOM 5331  H HA   . PRO A 1 57 ? 3.366   -4.758  -11.184 1.00 0.00 ? 87  PRO A HA   4  
ATOM 5332  H HB2  . PRO A 1 57 ? 2.439   -3.788  -13.835 1.00 0.00 ? 87  PRO A HB2  4  
ATOM 5333  H HB3  . PRO A 1 57 ? 3.990   -4.497  -13.375 1.00 0.00 ? 87  PRO A HB3  4  
ATOM 5334  H HG2  . PRO A 1 57 ? 2.212   -5.901  -14.778 1.00 0.00 ? 87  PRO A HG2  4  
ATOM 5335  H HG3  . PRO A 1 57 ? 3.190   -6.668  -13.514 1.00 0.00 ? 87  PRO A HG3  4  
ATOM 5336  H HD2  . PRO A 1 57 ? 0.325   -5.817  -13.442 1.00 0.00 ? 87  PRO A HD2  4  
ATOM 5337  H HD3  . PRO A 1 57 ? 1.093   -7.254  -12.737 1.00 0.00 ? 87  PRO A HD3  4  
ATOM 5338  N N    . ASP A 1 58 ? 0.984   -2.631  -12.072 1.00 0.00 ? 88  ASP A N    4  
ATOM 5339  C CA   . ASP A 1 58 ? 0.454   -1.290  -11.838 1.00 0.00 ? 88  ASP A CA   4  
ATOM 5340  C C    . ASP A 1 58 ? 0.194   -1.043  -10.351 1.00 0.00 ? 88  ASP A C    4  
ATOM 5341  O O    . ASP A 1 58 ? 0.089   0.103   -9.915  1.00 0.00 ? 88  ASP A O    4  
ATOM 5342  C CB   . ASP A 1 58 ? -0.836  -1.085  -12.636 1.00 0.00 ? 88  ASP A CB   4  
ATOM 5343  C CG   . ASP A 1 58 ? -0.730  0.064   -13.620 1.00 0.00 ? 88  ASP A CG   4  
ATOM 5344  O OD1  . ASP A 1 58 ? -0.159  -0.140  -14.712 1.00 0.00 ? 88  ASP A OD1  4  
ATOM 5345  O OD2  . ASP A 1 58 ? -1.217  1.169   -13.299 1.00 0.00 ? 88  ASP A OD2  4  
ATOM 5346  H H    . ASP A 1 58 ? 0.516   -3.225  -12.695 1.00 0.00 ? 88  ASP A H    4  
ATOM 5347  H HA   . ASP A 1 58 ? 1.192   -0.581  -12.180 1.00 0.00 ? 88  ASP A HA   4  
ATOM 5348  H HB2  . ASP A 1 58 ? -1.057  -1.986  -13.188 1.00 0.00 ? 88  ASP A HB2  4  
ATOM 5349  H HB3  . ASP A 1 58 ? -1.648  -0.876  -11.954 1.00 0.00 ? 88  ASP A HB3  4  
ATOM 5350  N N    . LEU A 1 59 ? 0.093   -2.120  -9.577  1.00 0.00 ? 89  LEU A N    4  
ATOM 5351  C CA   . LEU A 1 59 ? -0.150  -2.010  -8.145  1.00 0.00 ? 89  LEU A CA   4  
ATOM 5352  C C    . LEU A 1 59 ? 1.166   -1.874  -7.394  1.00 0.00 ? 89  LEU A C    4  
ATOM 5353  O O    . LEU A 1 59 ? 1.388   -0.894  -6.681  1.00 0.00 ? 89  LEU A O    4  
ATOM 5354  C CB   . LEU A 1 59 ? -0.923  -3.229  -7.638  1.00 0.00 ? 89  LEU A CB   4  
ATOM 5355  C CG   . LEU A 1 59 ? -2.447  -3.089  -7.676  1.00 0.00 ? 89  LEU A CG   4  
ATOM 5356  C CD1  . LEU A 1 59 ? -3.110  -4.459  -7.692  1.00 0.00 ? 89  LEU A CD1  4  
ATOM 5357  C CD2  . LEU A 1 59 ? -2.934  -2.269  -6.491  1.00 0.00 ? 89  LEU A CD2  4  
ATOM 5358  H H    . LEU A 1 59 ? 0.190   -3.007  -9.975  1.00 0.00 ? 89  LEU A H    4  
ATOM 5359  H HA   . LEU A 1 59 ? -0.742  -1.122  -7.976  1.00 0.00 ? 89  LEU A HA   4  
ATOM 5360  H HB2  . LEU A 1 59 ? -0.644  -4.081  -8.241  1.00 0.00 ? 89  LEU A HB2  4  
ATOM 5361  H HB3  . LEU A 1 59 ? -0.627  -3.419  -6.618  1.00 0.00 ? 89  LEU A HB3  4  
ATOM 5362  H HG   . LEU A 1 59 ? -2.731  -2.572  -8.581  1.00 0.00 ? 89  LEU A HG   4  
ATOM 5363  H HD11 . LEU A 1 59 ? -2.381  -5.217  -7.444  1.00 0.00 ? 89  LEU A HD11 4  
ATOM 5364  H HD12 . LEU A 1 59 ? -3.511  -4.654  -8.676  1.00 0.00 ? 89  LEU A HD12 4  
ATOM 5365  H HD13 . LEU A 1 59 ? -3.911  -4.481  -6.967  1.00 0.00 ? 89  LEU A HD13 4  
ATOM 5366  H HD21 . LEU A 1 59 ? -2.253  -2.396  -5.662  1.00 0.00 ? 89  LEU A HD21 4  
ATOM 5367  H HD22 . LEU A 1 59 ? -3.919  -2.605  -6.202  1.00 0.00 ? 89  LEU A HD22 4  
ATOM 5368  H HD23 . LEU A 1 59 ? -2.975  -1.227  -6.767  1.00 0.00 ? 89  LEU A HD23 4  
ATOM 5369  N N    . ILE A 1 60 ? 2.044   -2.854  -7.570  1.00 0.00 ? 90  ILE A N    4  
ATOM 5370  C CA   . ILE A 1 60 ? 3.346   -2.834  -6.919  1.00 0.00 ? 90  ILE A CA   4  
ATOM 5371  C C    . ILE A 1 60 ? 4.127   -1.593  -7.342  1.00 0.00 ? 90  ILE A C    4  
ATOM 5372  O O    . ILE A 1 60 ? 4.910   -1.042  -6.568  1.00 0.00 ? 90  ILE A O    4  
ATOM 5373  C CB   . ILE A 1 60 ? 4.167   -4.095  -7.257  1.00 0.00 ? 90  ILE A CB   4  
ATOM 5374  C CG1  . ILE A 1 60 ? 5.494   -4.091  -6.494  1.00 0.00 ? 90  ILE A CG1  4  
ATOM 5375  C CG2  . ILE A 1 60 ? 4.412   -4.187  -8.756  1.00 0.00 ? 90  ILE A CG2  4  
ATOM 5376  C CD1  . ILE A 1 60 ? 6.091   -5.470  -6.313  1.00 0.00 ? 90  ILE A CD1  4  
ATOM 5377  H H    . ILE A 1 60 ? 1.815   -3.603  -8.158  1.00 0.00 ? 90  ILE A H    4  
ATOM 5378  H HA   . ILE A 1 60 ? 3.188   -2.803  -5.851  1.00 0.00 ? 90  ILE A HA   4  
ATOM 5379  H HB   . ILE A 1 60 ? 3.593   -4.959  -6.959  1.00 0.00 ? 90  ILE A HB   4  
ATOM 5380  H HG12 . ILE A 1 60 ? 6.210   -3.490  -7.033  1.00 0.00 ? 90  ILE A HG12 4  
ATOM 5381  H HG13 . ILE A 1 60 ? 5.337   -3.665  -5.514  1.00 0.00 ? 90  ILE A HG13 4  
ATOM 5382  H HG21 . ILE A 1 60 ? 4.885   -5.131  -8.986  1.00 0.00 ? 90  ILE A HG21 4  
ATOM 5383  H HG22 . ILE A 1 60 ? 5.054   -3.377  -9.067  1.00 0.00 ? 90  ILE A HG22 4  
ATOM 5384  H HG23 . ILE A 1 60 ? 3.470   -4.121  -9.280  1.00 0.00 ? 90  ILE A HG23 4  
ATOM 5385  H HD11 . ILE A 1 60 ? 5.316   -6.214  -6.418  1.00 0.00 ? 90  ILE A HD11 4  
ATOM 5386  H HD12 . ILE A 1 60 ? 6.531   -5.546  -5.330  1.00 0.00 ? 90  ILE A HD12 4  
ATOM 5387  H HD13 . ILE A 1 60 ? 6.851   -5.634  -7.062  1.00 0.00 ? 90  ILE A HD13 4  
ATOM 5388  N N    . VAL A 1 61 ? 3.894   -1.154  -8.576  1.00 0.00 ? 91  VAL A N    4  
ATOM 5389  C CA   . VAL A 1 61 ? 4.566   0.027   -9.102  1.00 0.00 ? 91  VAL A CA   4  
ATOM 5390  C C    . VAL A 1 61 ? 3.930   1.297   -8.546  1.00 0.00 ? 91  VAL A C    4  
ATOM 5391  O O    . VAL A 1 61 ? 4.627   2.221   -8.126  1.00 0.00 ? 91  VAL A O    4  
ATOM 5392  C CB   . VAL A 1 61 ? 4.521   0.066   -10.644 1.00 0.00 ? 91  VAL A CB   4  
ATOM 5393  C CG1  . VAL A 1 61 ? 5.257   1.287   -11.178 1.00 0.00 ? 91  VAL A CG1  4  
ATOM 5394  C CG2  . VAL A 1 61 ? 5.106   -1.213  -11.225 1.00 0.00 ? 91  VAL A CG2  4  
ATOM 5395  H H    . VAL A 1 61 ? 3.248   -1.632  -9.143  1.00 0.00 ? 91  VAL A H    4  
ATOM 5396  H HA   . VAL A 1 61 ? 5.601   -0.011  -8.792  1.00 0.00 ? 91  VAL A HA   4  
ATOM 5397  H HB   . VAL A 1 61 ? 3.487   0.135   -10.952 1.00 0.00 ? 91  VAL A HB   4  
ATOM 5398  H HG11 . VAL A 1 61 ? 6.174   0.975   -11.658 1.00 0.00 ? 91  VAL A HG11 4  
ATOM 5399  H HG12 . VAL A 1 61 ? 5.489   1.955   -10.361 1.00 0.00 ? 91  VAL A HG12 4  
ATOM 5400  H HG13 . VAL A 1 61 ? 4.633   1.800   -11.895 1.00 0.00 ? 91  VAL A HG13 4  
ATOM 5401  H HG21 . VAL A 1 61 ? 4.629   -1.430  -12.169 1.00 0.00 ? 91  VAL A HG21 4  
ATOM 5402  H HG22 . VAL A 1 61 ? 4.938   -2.030  -10.540 1.00 0.00 ? 91  VAL A HG22 4  
ATOM 5403  H HG23 . VAL A 1 61 ? 6.168   -1.085  -11.379 1.00 0.00 ? 91  VAL A HG23 4  
ATOM 5404  N N    . GLY A 1 62 ? 2.602   1.331   -8.538  1.00 0.00 ? 92  GLY A N    4  
ATOM 5405  C CA   . GLY A 1 62 ? 1.895   2.487   -8.023  1.00 0.00 ? 92  GLY A CA   4  
ATOM 5406  C C    . GLY A 1 62 ? 2.192   2.727   -6.556  1.00 0.00 ? 92  GLY A C    4  
ATOM 5407  O O    . GLY A 1 62 ? 2.325   3.871   -6.121  1.00 0.00 ? 92  GLY A O    4  
ATOM 5408  H H    . GLY A 1 62 ? 2.097   0.563   -8.881  1.00 0.00 ? 92  GLY A H    4  
ATOM 5409  H HA2  . GLY A 1 62 ? 2.191   3.358   -8.588  1.00 0.00 ? 92  GLY A HA2  4  
ATOM 5410  H HA3  . GLY A 1 62 ? 0.834   2.332   -8.144  1.00 0.00 ? 92  GLY A HA3  4  
ATOM 5411  N N    . PHE A 1 63 ? 2.299   1.642   -5.794  1.00 0.00 ? 93  PHE A N    4  
ATOM 5412  C CA   . PHE A 1 63 ? 2.586   1.734   -4.370  1.00 0.00 ? 93  PHE A CA   4  
ATOM 5413  C C    . PHE A 1 63 ? 4.036   2.129   -4.136  1.00 0.00 ? 93  PHE A C    4  
ATOM 5414  O O    . PHE A 1 63 ? 4.355   2.840   -3.183  1.00 0.00 ? 93  PHE A O    4  
ATOM 5415  C CB   . PHE A 1 63 ? 2.286   0.403   -3.680  1.00 0.00 ? 93  PHE A CB   4  
ATOM 5416  C CG   . PHE A 1 63 ? 2.410   0.460   -2.184  1.00 0.00 ? 93  PHE A CG   4  
ATOM 5417  C CD1  . PHE A 1 63 ? 1.434   1.077   -1.418  1.00 0.00 ? 93  PHE A CD1  4  
ATOM 5418  C CD2  . PHE A 1 63 ? 3.502   -0.103  -1.544  1.00 0.00 ? 93  PHE A CD2  4  
ATOM 5419  C CE1  . PHE A 1 63 ? 1.545   1.131   -0.041  1.00 0.00 ? 93  PHE A CE1  4  
ATOM 5420  C CE2  . PHE A 1 63 ? 3.619   -0.052  -0.168  1.00 0.00 ? 93  PHE A CE2  4  
ATOM 5421  C CZ   . PHE A 1 63 ? 2.640   0.565   0.584   1.00 0.00 ? 93  PHE A CZ   4  
ATOM 5422  H H    . PHE A 1 63 ? 2.184   0.761   -6.199  1.00 0.00 ? 93  PHE A H    4  
ATOM 5423  H HA   . PHE A 1 63 ? 1.951   2.494   -3.959  1.00 0.00 ? 93  PHE A HA   4  
ATOM 5424  H HB2  . PHE A 1 63 ? 1.276   0.101   -3.917  1.00 0.00 ? 93  PHE A HB2  4  
ATOM 5425  H HB3  . PHE A 1 63 ? 2.974   -0.346  -4.043  1.00 0.00 ? 93  PHE A HB3  4  
ATOM 5426  H HD1  . PHE A 1 63 ? 0.578   1.519   -1.906  1.00 0.00 ? 93  PHE A HD1  4  
ATOM 5427  H HD2  . PHE A 1 63 ? 4.269   -0.587  -2.132  1.00 0.00 ? 93  PHE A HD2  4  
ATOM 5428  H HE1  . PHE A 1 63 ? 0.778   1.615   0.545   1.00 0.00 ? 93  PHE A HE1  4  
ATOM 5429  H HE2  . PHE A 1 63 ? 4.476   -0.496  0.318   1.00 0.00 ? 93  PHE A HE2  4  
ATOM 5430  H HZ   . PHE A 1 63 ? 2.728   0.606   1.660   1.00 0.00 ? 93  PHE A HZ   4  
ATOM 5431  N N    . ASN A 1 64 ? 4.908   1.663   -5.018  1.00 0.00 ? 94  ASN A N    4  
ATOM 5432  C CA   . ASN A 1 64 ? 6.332   1.965   -4.922  1.00 0.00 ? 94  ASN A CA   4  
ATOM 5433  C C    . ASN A 1 64 ? 6.599   3.438   -5.219  1.00 0.00 ? 94  ASN A C    4  
ATOM 5434  O O    . ASN A 1 64 ? 7.607   3.996   -4.787  1.00 0.00 ? 94  ASN A O    4  
ATOM 5435  C CB   . ASN A 1 64 ? 7.126   1.085   -5.890  1.00 0.00 ? 94  ASN A CB   4  
ATOM 5436  C CG   . ASN A 1 64 ? 8.623   1.295   -5.767  1.00 0.00 ? 94  ASN A CG   4  
ATOM 5437  O OD1  . ASN A 1 64 ? 9.314   1.513   -6.762  1.00 0.00 ? 94  ASN A OD1  4  
ATOM 5438  N ND2  . ASN A 1 64 ? 9.132   1.229   -4.542  1.00 0.00 ? 94  ASN A ND2  4  
ATOM 5439  H H    . ASN A 1 64 ? 4.584   1.105   -5.754  1.00 0.00 ? 94  ASN A H    4  
ATOM 5440  H HA   . ASN A 1 64 ? 6.649   1.750   -3.913  1.00 0.00 ? 94  ASN A HA   4  
ATOM 5441  H HB2  . ASN A 1 64 ? 6.910   0.047   -5.685  1.00 0.00 ? 94  ASN A HB2  4  
ATOM 5442  H HB3  . ASN A 1 64 ? 6.831   1.318   -6.903  1.00 0.00 ? 94  ASN A HB3  4  
ATOM 5443  H HD21 . ASN A 1 64 ? 8.521   1.051   -3.796  1.00 0.00 ? 94  ASN A HD21 4  
ATOM 5444  H HD22 . ASN A 1 64 ? 10.096  1.360   -4.434  1.00 0.00 ? 94  ASN A HD22 4  
ATOM 5445  N N    . ALA A 1 65 ? 5.688   4.063   -5.961  1.00 0.00 ? 95  ALA A N    4  
ATOM 5446  C CA   . ALA A 1 65 ? 5.822   5.469   -6.318  1.00 0.00 ? 95  ALA A CA   4  
ATOM 5447  C C    . ALA A 1 65 ? 5.693   6.378   -5.096  1.00 0.00 ? 95  ALA A C    4  
ATOM 5448  O O    . ALA A 1 65 ? 5.980   7.573   -5.172  1.00 0.00 ? 95  ALA A O    4  
ATOM 5449  C CB   . ALA A 1 65 ? 4.787   5.846   -7.367  1.00 0.00 ? 95  ALA A CB   4  
ATOM 5450  H H    . ALA A 1 65 ? 4.907   3.565   -6.278  1.00 0.00 ? 95  ALA A H    4  
ATOM 5451  H HA   . ALA A 1 65 ? 6.801   5.605   -6.751  1.00 0.00 ? 95  ALA A HA   4  
ATOM 5452  H HB1  . ALA A 1 65 ? 5.197   6.599   -8.023  1.00 0.00 ? 95  ALA A HB1  4  
ATOM 5453  H HB2  . ALA A 1 65 ? 3.905   6.233   -6.880  1.00 0.00 ? 95  ALA A HB2  4  
ATOM 5454  H HB3  . ALA A 1 65 ? 4.525   4.971   -7.944  1.00 0.00 ? 95  ALA A HB3  4  
ATOM 5455  N N    . PHE A 1 66 ? 5.260   5.813   -3.971  1.00 0.00 ? 96  PHE A N    4  
ATOM 5456  C CA   . PHE A 1 66 ? 5.098   6.585   -2.745  1.00 0.00 ? 96  PHE A CA   4  
ATOM 5457  C C    . PHE A 1 66 ? 6.286   6.381   -1.811  1.00 0.00 ? 96  PHE A C    4  
ATOM 5458  O O    . PHE A 1 66 ? 6.645   7.274   -1.044  1.00 0.00 ? 96  PHE A O    4  
ATOM 5459  C CB   . PHE A 1 66 ? 3.804   6.188   -2.032  1.00 0.00 ? 96  PHE A CB   4  
ATOM 5460  C CG   . PHE A 1 66 ? 2.562   6.500   -2.818  1.00 0.00 ? 96  PHE A CG   4  
ATOM 5461  C CD1  . PHE A 1 66 ? 2.287   5.830   -3.999  1.00 0.00 ? 96  PHE A CD1  4  
ATOM 5462  C CD2  . PHE A 1 66 ? 1.670   7.464   -2.375  1.00 0.00 ? 96  PHE A CD2  4  
ATOM 5463  C CE1  . PHE A 1 66 ? 1.145   6.113   -4.723  1.00 0.00 ? 96  PHE A CE1  4  
ATOM 5464  C CE2  . PHE A 1 66 ? 0.527   7.754   -3.096  1.00 0.00 ? 96  PHE A CE2  4  
ATOM 5465  C CZ   . PHE A 1 66 ? 0.264   7.076   -4.271  1.00 0.00 ? 96  PHE A CZ   4  
ATOM 5466  H H    . PHE A 1 66 ? 5.043   4.858   -3.965  1.00 0.00 ? 96  PHE A H    4  
ATOM 5467  H HA   . PHE A 1 66 ? 5.042   7.629   -3.016  1.00 0.00 ? 96  PHE A HA   4  
ATOM 5468  H HB2  . PHE A 1 66 ? 3.817   5.125   -1.843  1.00 0.00 ? 96  PHE A HB2  4  
ATOM 5469  H HB3  . PHE A 1 66 ? 3.743   6.715   -1.091  1.00 0.00 ? 96  PHE A HB3  4  
ATOM 5470  H HD1  . PHE A 1 66 ? 2.975   5.076   -4.352  1.00 0.00 ? 96  PHE A HD1  4  
ATOM 5471  H HD2  . PHE A 1 66 ? 1.875   7.994   -1.457  1.00 0.00 ? 96  PHE A HD2  4  
ATOM 5472  H HE1  . PHE A 1 66 ? 0.941   5.584   -5.641  1.00 0.00 ? 96  PHE A HE1  4  
ATOM 5473  H HE2  . PHE A 1 66 ? -0.160  8.507   -2.740  1.00 0.00 ? 96  PHE A HE2  4  
ATOM 5474  H HZ   . PHE A 1 66 ? -0.630  7.301   -4.835  1.00 0.00 ? 96  PHE A HZ   4  
ATOM 5475  N N    . LEU A 1 67 ? 6.894   5.201   -1.881  1.00 0.00 ? 97  LEU A N    4  
ATOM 5476  C CA   . LEU A 1 67 ? 8.043   4.883   -1.041  1.00 0.00 ? 97  LEU A CA   4  
ATOM 5477  C C    . LEU A 1 67 ? 9.316   5.520   -1.598  1.00 0.00 ? 97  LEU A C    4  
ATOM 5478  O O    . LEU A 1 67 ? 9.496   5.604   -2.813  1.00 0.00 ? 97  LEU A O    4  
ATOM 5479  C CB   . LEU A 1 67 ? 8.220   3.368   -0.934  1.00 0.00 ? 97  LEU A CB   4  
ATOM 5480  C CG   . LEU A 1 67 ? 7.180   2.654   -0.069  1.00 0.00 ? 97  LEU A CG   4  
ATOM 5481  C CD1  . LEU A 1 67 ? 6.853   1.285   -0.647  1.00 0.00 ? 97  LEU A CD1  4  
ATOM 5482  C CD2  . LEU A 1 67 ? 7.677   2.524   1.363   1.00 0.00 ? 97  LEU A CD2  4  
ATOM 5483  H H    . LEU A 1 67 ? 6.563   4.529   -2.512  1.00 0.00 ? 97  LEU A H    4  
ATOM 5484  H HA   . LEU A 1 67 ? 7.854   5.286   -0.057  1.00 0.00 ? 97  LEU A HA   4  
ATOM 5485  H HB2  . LEU A 1 67 ? 8.179   2.951   -1.930  1.00 0.00 ? 97  LEU A HB2  4  
ATOM 5486  H HB3  . LEU A 1 67 ? 9.197   3.169   -0.519  1.00 0.00 ? 97  LEU A HB3  4  
ATOM 5487  H HG   . LEU A 1 67 ? 6.271   3.236   -0.057  1.00 0.00 ? 97  LEU A HG   4  
ATOM 5488  H HD11 . LEU A 1 67 ? 6.240   1.403   -1.528  1.00 0.00 ? 97  LEU A HD11 4  
ATOM 5489  H HD12 . LEU A 1 67 ? 6.318   0.702   0.089   1.00 0.00 ? 97  LEU A HD12 4  
ATOM 5490  H HD13 . LEU A 1 67 ? 7.770   0.778   -0.911  1.00 0.00 ? 97  LEU A HD13 4  
ATOM 5491  H HD21 . LEU A 1 67 ? 6.849   2.653   2.044   1.00 0.00 ? 97  LEU A HD21 4  
ATOM 5492  H HD22 . LEU A 1 67 ? 8.422   3.282   1.555   1.00 0.00 ? 97  LEU A HD22 4  
ATOM 5493  H HD23 . LEU A 1 67 ? 8.112   1.547   1.506   1.00 0.00 ? 97  LEU A HD23 4  
ATOM 5494  N N    . PRO A 1 68 ? 10.220  5.978   -0.714  1.00 0.00 ? 98  PRO A N    4  
ATOM 5495  C CA   . PRO A 1 68 ? 11.478  6.608   -1.128  1.00 0.00 ? 98  PRO A CA   4  
ATOM 5496  C C    . PRO A 1 68 ? 12.460  5.607   -1.728  1.00 0.00 ? 98  PRO A C    4  
ATOM 5497  O O    . PRO A 1 68 ? 12.316  4.397   -1.548  1.00 0.00 ? 98  PRO A O    4  
ATOM 5498  C CB   . PRO A 1 68 ? 12.033  7.183   0.177   1.00 0.00 ? 98  PRO A CB   4  
ATOM 5499  C CG   . PRO A 1 68 ? 11.450  6.325   1.245   1.00 0.00 ? 98  PRO A CG   4  
ATOM 5500  C CD   . PRO A 1 68 ? 10.088  5.919   0.754   1.00 0.00 ? 98  PRO A CD   4  
ATOM 5501  H HA   . PRO A 1 68 ? 11.306  7.407   -1.834  1.00 0.00 ? 98  PRO A HA   4  
ATOM 5502  H HB2  . PRO A 1 68 ? 13.111  7.129   0.167   1.00 0.00 ? 98  PRO A HB2  4  
ATOM 5503  H HB3  . PRO A 1 68 ? 11.720  8.211   0.283   1.00 0.00 ? 98  PRO A HB3  4  
ATOM 5504  H HG2  . PRO A 1 68 ? 12.071  5.453   1.394   1.00 0.00 ? 98  PRO A HG2  4  
ATOM 5505  H HG3  . PRO A 1 68 ? 11.366  6.887   2.163   1.00 0.00 ? 98  PRO A HG3  4  
ATOM 5506  H HD2  . PRO A 1 68 ? 9.854   4.916   1.080   1.00 0.00 ? 98  PRO A HD2  4  
ATOM 5507  H HD3  . PRO A 1 68 ? 9.339   6.615   1.101   1.00 0.00 ? 98  PRO A HD3  4  
ATOM 5508  N N    . LEU A 1 69 ? 13.458  6.120   -2.440  1.00 0.00 ? 99  LEU A N    4  
ATOM 5509  C CA   . LEU A 1 69 ? 14.466  5.271   -3.066  1.00 0.00 ? 99  LEU A CA   4  
ATOM 5510  C C    . LEU A 1 69 ? 15.211  4.447   -2.020  1.00 0.00 ? 99  LEU A C    4  
ATOM 5511  O O    . LEU A 1 69 ? 15.688  3.349   -2.307  1.00 0.00 ? 99  LEU A O    4  
ATOM 5512  C CB   . LEU A 1 69 ? 15.457  6.123   -3.861  1.00 0.00 ? 99  LEU A CB   4  
ATOM 5513  C CG   . LEU A 1 69 ? 15.985  5.475   -5.144  1.00 0.00 ? 99  LEU A CG   4  
ATOM 5514  C CD1  . LEU A 1 69 ? 15.804  6.407   -6.332  1.00 0.00 ? 99  LEU A CD1  4  
ATOM 5515  C CD2  . LEU A 1 69 ? 17.450  5.090   -4.986  1.00 0.00 ? 99  LEU A CD2  4  
ATOM 5516  H H    . LEU A 1 69 ? 13.520  7.092   -2.546  1.00 0.00 ? 99  LEU A H    4  
ATOM 5517  H HA   . LEU A 1 69 ? 13.960  4.600   -3.742  1.00 0.00 ? 99  LEU A HA   4  
ATOM 5518  H HB2  . LEU A 1 69 ? 14.970  7.052   -4.123  1.00 0.00 ? 99  LEU A HB2  4  
ATOM 5519  H HB3  . LEU A 1 69 ? 16.299  6.348   -3.224  1.00 0.00 ? 99  LEU A HB3  4  
ATOM 5520  H HG   . LEU A 1 69 ? 15.422  4.572   -5.340  1.00 0.00 ? 99  LEU A HG   4  
ATOM 5521  H HD11 . LEU A 1 69 ? 16.217  5.947   -7.217  1.00 0.00 ? 99  LEU A HD11 4  
ATOM 5522  H HD12 . LEU A 1 69 ? 16.314  7.339   -6.139  1.00 0.00 ? 99  LEU A HD12 4  
ATOM 5523  H HD13 . LEU A 1 69 ? 14.750  6.597   -6.482  1.00 0.00 ? 99  LEU A HD13 4  
ATOM 5524  H HD21 . LEU A 1 69 ? 17.928  5.773   -4.298  1.00 0.00 ? 99  LEU A HD21 4  
ATOM 5525  H HD22 . LEU A 1 69 ? 17.941  5.143   -5.946  1.00 0.00 ? 99  LEU A HD22 4  
ATOM 5526  H HD23 . LEU A 1 69 ? 17.518  4.084   -4.601  1.00 0.00 ? 99  LEU A HD23 4  
ATOM 5527  N N    . GLY A 1 70 ? 15.304  4.982   -0.807  1.00 0.00 ? 100 GLY A N    4  
ATOM 5528  C CA   . GLY A 1 70 ? 15.991  4.281   0.262   1.00 0.00 ? 100 GLY A CA   4  
ATOM 5529  C C    . GLY A 1 70 ? 15.386  2.920   0.545   1.00 0.00 ? 100 GLY A C    4  
ATOM 5530  O O    . GLY A 1 70 ? 16.075  2.011   1.008   1.00 0.00 ? 100 GLY A O    4  
ATOM 5531  H H    . GLY A 1 70 ? 14.904  5.861   -0.636  1.00 0.00 ? 100 GLY A H    4  
ATOM 5532  H HA2  . GLY A 1 70 ? 17.027  4.153   -0.013  1.00 0.00 ? 100 GLY A HA2  4  
ATOM 5533  H HA3  . GLY A 1 70 ? 15.939  4.879   1.161   1.00 0.00 ? 100 GLY A HA3  4  
ATOM 5534  N N    . TYR A 1 71 ? 14.094  2.779   0.265   1.00 0.00 ? 101 TYR A N    4  
ATOM 5535  C CA   . TYR A 1 71 ? 13.395  1.519   0.490   1.00 0.00 ? 101 TYR A CA   4  
ATOM 5536  C C    . TYR A 1 71 ? 13.008  0.868   -0.834  1.00 0.00 ? 101 TYR A C    4  
ATOM 5537  O O    . TYR A 1 71 ? 12.037  1.272   -1.474  1.00 0.00 ? 101 TYR A O    4  
ATOM 5538  C CB   . TYR A 1 71 ? 12.147  1.749   1.343   1.00 0.00 ? 101 TYR A CB   4  
ATOM 5539  C CG   . TYR A 1 71 ? 12.438  1.860   2.823   1.00 0.00 ? 101 TYR A CG   4  
ATOM 5540  C CD1  . TYR A 1 71 ? 13.054  0.822   3.508   1.00 0.00 ? 101 TYR A CD1  4  
ATOM 5541  C CD2  . TYR A 1 71 ? 12.095  3.004   3.533   1.00 0.00 ? 101 TYR A CD2  4  
ATOM 5542  C CE1  . TYR A 1 71 ? 13.322  0.919   4.861   1.00 0.00 ? 101 TYR A CE1  4  
ATOM 5543  C CE2  . TYR A 1 71 ? 12.359  3.110   4.886   1.00 0.00 ? 101 TYR A CE2  4  
ATOM 5544  C CZ   . TYR A 1 71 ? 12.973  2.065   5.545   1.00 0.00 ? 101 TYR A CZ   4  
ATOM 5545  O OH   . TYR A 1 71 ? 13.237  2.166   6.891   1.00 0.00 ? 101 TYR A OH   4  
ATOM 5546  H H    . TYR A 1 71 ? 13.599  3.540   -0.103  1.00 0.00 ? 101 TYR A H    4  
ATOM 5547  H HA   . TYR A 1 71 ? 14.066  0.858   1.019   1.00 0.00 ? 101 TYR A HA   4  
ATOM 5548  H HB2  . TYR A 1 71 ? 11.669  2.665   1.030   1.00 0.00 ? 101 TYR A HB2  4  
ATOM 5549  H HB3  . TYR A 1 71 ? 11.465  0.924   1.199   1.00 0.00 ? 101 TYR A HB3  4  
ATOM 5550  H HD1  . TYR A 1 71 ? 13.327  -0.074  2.970   1.00 0.00 ? 101 TYR A HD1  4  
ATOM 5551  H HD2  . TYR A 1 71 ? 11.614  3.819   3.015   1.00 0.00 ? 101 TYR A HD2  4  
ATOM 5552  H HE1  . TYR A 1 71 ? 13.802  0.101   5.377   1.00 0.00 ? 101 TYR A HE1  4  
ATOM 5553  H HE2  . TYR A 1 71 ? 12.085  4.006   5.420   1.00 0.00 ? 101 TYR A HE2  4  
ATOM 5554  H HH   . TYR A 1 71 ? 14.067  2.631   7.020   1.00 0.00 ? 101 TYR A HH   4  
ATOM 5555  N N    . ARG A 1 72 ? 13.772  -0.140  -1.238  1.00 0.00 ? 102 ARG A N    4  
ATOM 5556  C CA   . ARG A 1 72 ? 13.509  -0.847  -2.487  1.00 0.00 ? 102 ARG A CA   4  
ATOM 5557  C C    . ARG A 1 72 ? 12.350  -1.825  -2.323  1.00 0.00 ? 102 ARG A C    4  
ATOM 5558  O O    . ARG A 1 72 ? 12.214  -2.475  -1.286  1.00 0.00 ? 102 ARG A O    4  
ATOM 5559  C CB   . ARG A 1 72 ? 14.764  -1.590  -2.949  1.00 0.00 ? 102 ARG A CB   4  
ATOM 5560  C CG   . ARG A 1 72 ? 15.109  -1.351  -4.409  1.00 0.00 ? 102 ARG A CG   4  
ATOM 5561  C CD   . ARG A 1 72 ? 16.112  -0.218  -4.566  1.00 0.00 ? 102 ARG A CD   4  
ATOM 5562  N NE   . ARG A 1 72 ? 17.132  -0.525  -5.566  1.00 0.00 ? 102 ARG A NE   4  
ATOM 5563  C CZ   . ARG A 1 72 ? 18.301  0.106   -5.650  1.00 0.00 ? 102 ARG A CZ   4  
ATOM 5564  N NH1  . ARG A 1 72 ? 18.601  1.079   -4.798  1.00 0.00 ? 102 ARG A NH1  4  
ATOM 5565  N NH2  . ARG A 1 72 ? 19.172  -0.236  -6.591  1.00 0.00 ? 102 ARG A NH2  4  
ATOM 5566  H H    . ARG A 1 72 ? 14.532  -0.416  -0.684  1.00 0.00 ? 102 ARG A H    4  
ATOM 5567  H HA   . ARG A 1 72 ? 13.241  -0.112  -3.232  1.00 0.00 ? 102 ARG A HA   4  
ATOM 5568  H HB2  . ARG A 1 72 ? 15.600  -1.270  -2.347  1.00 0.00 ? 102 ARG A HB2  4  
ATOM 5569  H HB3  . ARG A 1 72 ? 14.615  -2.651  -2.807  1.00 0.00 ? 102 ARG A HB3  4  
ATOM 5570  H HG2  . ARG A 1 72 ? 15.533  -2.253  -4.823  1.00 0.00 ? 102 ARG A HG2  4  
ATOM 5571  H HG3  . ARG A 1 72 ? 14.206  -1.097  -4.946  1.00 0.00 ? 102 ARG A HG3  4  
ATOM 5572  H HD2  . ARG A 1 72 ? 15.584  0.674   -4.868  1.00 0.00 ? 102 ARG A HD2  4  
ATOM 5573  H HD3  . ARG A 1 72 ? 16.594  -0.046  -3.615  1.00 0.00 ? 102 ARG A HD3  4  
ATOM 5574  H HE   . ARG A 1 72 ? 16.936  -1.239  -6.209  1.00 0.00 ? 102 ARG A HE   4  
ATOM 5575  H HH11 . ARG A 1 72 ? 17.949  1.342   -4.088  1.00 0.00 ? 102 ARG A HH11 4  
ATOM 5576  H HH12 . ARG A 1 72 ? 19.481  1.549   -4.867  1.00 0.00 ? 102 ARG A HH12 4  
ATOM 5577  H HH21 . ARG A 1 72 ? 18.949  -0.967  -7.235  1.00 0.00 ? 102 ARG A HH21 4  
ATOM 5578  H HH22 . ARG A 1 72 ? 20.049  0.238   -6.655  1.00 0.00 ? 102 ARG A HH22 4  
ATOM 5579  N N    . ILE A 1 73 ? 11.517  -1.926  -3.354  1.00 0.00 ? 103 ILE A N    4  
ATOM 5580  C CA   . ILE A 1 73 ? 10.371  -2.827  -3.326  1.00 0.00 ? 103 ILE A CA   4  
ATOM 5581  C C    . ILE A 1 73 ? 10.757  -4.222  -3.808  1.00 0.00 ? 103 ILE A C    4  
ATOM 5582  O O    . ILE A 1 73 ? 11.058  -4.422  -4.984  1.00 0.00 ? 103 ILE A O    4  
ATOM 5583  C CB   . ILE A 1 73 ? 9.213   -2.290  -4.193  1.00 0.00 ? 103 ILE A CB   4  
ATOM 5584  C CG1  . ILE A 1 73 ? 7.982   -3.193  -4.064  1.00 0.00 ? 103 ILE A CG1  4  
ATOM 5585  C CG2  . ILE A 1 73 ? 9.645   -2.172  -5.648  1.00 0.00 ? 103 ILE A CG2  4  
ATOM 5586  C CD1  . ILE A 1 73 ? 6.757   -2.472  -3.542  1.00 0.00 ? 103 ILE A CD1  4  
ATOM 5587  H H    . ILE A 1 73 ? 11.678  -1.382  -4.153  1.00 0.00 ? 103 ILE A H    4  
ATOM 5588  H HA   . ILE A 1 73 ? 10.027  -2.893  -2.303  1.00 0.00 ? 103 ILE A HA   4  
ATOM 5589  H HB   . ILE A 1 73 ? 8.961   -1.300  -3.840  1.00 0.00 ? 103 ILE A HB   4  
ATOM 5590  H HG12 . ILE A 1 73 ? 7.737   -3.598  -5.034  1.00 0.00 ? 103 ILE A HG12 4  
ATOM 5591  H HG13 . ILE A 1 73 ? 8.206   -4.003  -3.386  1.00 0.00 ? 103 ILE A HG13 4  
ATOM 5592  H HG21 . ILE A 1 73 ? 9.238   -2.997  -6.212  1.00 0.00 ? 103 ILE A HG21 4  
ATOM 5593  H HG22 . ILE A 1 73 ? 10.723  -2.193  -5.707  1.00 0.00 ? 103 ILE A HG22 4  
ATOM 5594  H HG23 . ILE A 1 73 ? 9.280   -1.242  -6.058  1.00 0.00 ? 103 ILE A HG23 4  
ATOM 5595  H HD11 . ILE A 1 73 ? 6.999   -1.981  -2.611  1.00 0.00 ? 103 ILE A HD11 4  
ATOM 5596  H HD12 . ILE A 1 73 ? 5.964   -3.186  -3.377  1.00 0.00 ? 103 ILE A HD12 4  
ATOM 5597  H HD13 . ILE A 1 73 ? 6.436   -1.737  -4.264  1.00 0.00 ? 103 ILE A HD13 4  
ATOM 5598  N N    . ASP A 1 74 ? 10.747  -5.184  -2.890  1.00 0.00 ? 104 ASP A N    4  
ATOM 5599  C CA   . ASP A 1 74 ? 11.095  -6.560  -3.222  1.00 0.00 ? 104 ASP A CA   4  
ATOM 5600  C C    . ASP A 1 74 ? 9.868   -7.464  -3.153  1.00 0.00 ? 104 ASP A C    4  
ATOM 5601  O O    . ASP A 1 74 ? 8.824   -7.070  -2.634  1.00 0.00 ? 104 ASP A O    4  
ATOM 5602  C CB   . ASP A 1 74 ? 12.179  -7.077  -2.273  1.00 0.00 ? 104 ASP A CB   4  
ATOM 5603  C CG   . ASP A 1 74 ? 13.223  -7.913  -2.987  1.00 0.00 ? 104 ASP A CG   4  
ATOM 5604  O OD1  . ASP A 1 74 ? 12.835  -8.835  -3.736  1.00 0.00 ? 104 ASP A OD1  4  
ATOM 5605  O OD2  . ASP A 1 74 ? 14.429  -7.649  -2.796  1.00 0.00 ? 104 ASP A OD2  4  
ATOM 5606  H H    . ASP A 1 74 ? 10.498  -4.963  -1.969  1.00 0.00 ? 104 ASP A H    4  
ATOM 5607  H HA   . ASP A 1 74 ? 11.479  -6.571  -4.231  1.00 0.00 ? 104 ASP A HA   4  
ATOM 5608  H HB2  . ASP A 1 74 ? 12.674  -6.237  -1.810  1.00 0.00 ? 104 ASP A HB2  4  
ATOM 5609  H HB3  . ASP A 1 74 ? 11.720  -7.684  -1.507  1.00 0.00 ? 104 ASP A HB3  4  
ATOM 5610  N N    . ILE A 1 75 ? 10.001  -8.677  -3.680  1.00 0.00 ? 105 ILE A N    4  
ATOM 5611  C CA   . ILE A 1 75 ? 8.902   -9.635  -3.678  1.00 0.00 ? 105 ILE A CA   4  
ATOM 5612  C C    . ILE A 1 75 ? 9.339   -10.975 -3.089  1.00 0.00 ? 105 ILE A C    4  
ATOM 5613  O O    . ILE A 1 75 ? 10.351  -11.541 -3.505  1.00 0.00 ? 105 ILE A O    4  
ATOM 5614  C CB   . ILE A 1 75 ? 8.358   -9.868  -5.100  1.00 0.00 ? 105 ILE A CB   4  
ATOM 5615  C CG1  . ILE A 1 75 ? 9.506   -10.167 -6.067  1.00 0.00 ? 105 ILE A CG1  4  
ATOM 5616  C CG2  . ILE A 1 75 ? 7.565   -8.657  -5.568  1.00 0.00 ? 105 ILE A CG2  4  
ATOM 5617  C CD1  . ILE A 1 75 ? 9.190   -11.267 -7.057  1.00 0.00 ? 105 ILE A CD1  4  
ATOM 5618  H H    . ILE A 1 75 ? 10.858  -8.933  -4.080  1.00 0.00 ? 105 ILE A H    4  
ATOM 5619  H HA   . ILE A 1 75 ? 8.106   -9.225  -3.073  1.00 0.00 ? 105 ILE A HA   4  
ATOM 5620  H HB   . ILE A 1 75 ? 7.690   -10.715 -5.072  1.00 0.00 ? 105 ILE A HB   4  
ATOM 5621  H HG12 . ILE A 1 75 ? 9.737   -9.274  -6.628  1.00 0.00 ? 105 ILE A HG12 4  
ATOM 5622  H HG13 . ILE A 1 75 ? 10.375  -10.468 -5.502  1.00 0.00 ? 105 ILE A HG13 4  
ATOM 5623  H HG21 . ILE A 1 75 ? 6.514   -8.817  -5.374  1.00 0.00 ? 105 ILE A HG21 4  
ATOM 5624  H HG22 . ILE A 1 75 ? 7.716   -8.515  -6.628  1.00 0.00 ? 105 ILE A HG22 4  
ATOM 5625  H HG23 . ILE A 1 75 ? 7.900   -7.779  -5.036  1.00 0.00 ? 105 ILE A HG23 4  
ATOM 5626  H HD11 . ILE A 1 75 ? 8.373   -11.866 -6.682  1.00 0.00 ? 105 ILE A HD11 4  
ATOM 5627  H HD12 . ILE A 1 75 ? 10.062  -11.890 -7.192  1.00 0.00 ? 105 ILE A HD12 4  
ATOM 5628  H HD13 . ILE A 1 75 ? 8.910   -10.830 -8.004  1.00 0.00 ? 105 ILE A HD13 4  
ATOM 5629  N N    . PRO A 1 76 ? 8.583   -11.506 -2.109  1.00 0.00 ? 106 PRO A N    4  
ATOM 5630  C CA   . PRO A 1 76 ? 8.907   -12.787 -1.472  1.00 0.00 ? 106 PRO A CA   4  
ATOM 5631  C C    . PRO A 1 76 ? 8.619   -13.975 -2.383  1.00 0.00 ? 106 PRO A C    4  
ATOM 5632  O O    . PRO A 1 76 ? 7.571   -14.039 -3.026  1.00 0.00 ? 106 PRO A O    4  
ATOM 5633  C CB   . PRO A 1 76 ? 7.987   -12.814 -0.251  1.00 0.00 ? 106 PRO A CB   4  
ATOM 5634  C CG   . PRO A 1 76 ? 6.818   -11.981 -0.644  1.00 0.00 ? 106 PRO A CG   4  
ATOM 5635  C CD   . PRO A 1 76 ? 7.357   -10.905 -1.548  1.00 0.00 ? 106 PRO A CD   4  
ATOM 5636  H HA   . PRO A 1 76 ? 9.938   -12.821 -1.152  1.00 0.00 ? 106 PRO A HA   4  
ATOM 5637  H HB2  . PRO A 1 76 ? 7.696   -13.832 -0.038  1.00 0.00 ? 106 PRO A HB2  4  
ATOM 5638  H HB3  . PRO A 1 76 ? 8.502   -12.395 0.601   1.00 0.00 ? 106 PRO A HB3  4  
ATOM 5639  H HG2  . PRO A 1 76 ? 6.097   -12.587 -1.173  1.00 0.00 ? 106 PRO A HG2  4  
ATOM 5640  H HG3  . PRO A 1 76 ? 6.368   -11.542 0.234   1.00 0.00 ? 106 PRO A HG3  4  
ATOM 5641  H HD2  . PRO A 1 76 ? 6.647   -10.677 -2.328  1.00 0.00 ? 106 PRO A HD2  4  
ATOM 5642  H HD3  . PRO A 1 76 ? 7.591   -10.018 -0.978  1.00 0.00 ? 106 PRO A HD3  4  
ATOM 5643  N N    . LYS A 1 77 ? 9.557   -14.915 -2.434  1.00 0.00 ? 107 LYS A N    4  
ATOM 5644  C CA   . LYS A 1 77 ? 9.404   -16.103 -3.266  1.00 0.00 ? 107 LYS A CA   4  
ATOM 5645  C C    . LYS A 1 77 ? 8.175   -16.905 -2.852  1.00 0.00 ? 107 LYS A C    4  
ATOM 5646  O O    . LYS A 1 77 ? 7.271   -17.078 -3.696  1.00 0.00 ? 107 LYS A O    4  
ATOM 5647  C CB   . LYS A 1 77 ? 10.655  -16.979 -3.174  1.00 0.00 ? 107 LYS A CB   4  
ATOM 5648  C CG   . LYS A 1 77 ? 11.940  -16.244 -3.516  1.00 0.00 ? 107 LYS A CG   4  
ATOM 5649  C CD   . LYS A 1 77 ? 13.159  -17.130 -3.320  1.00 0.00 ? 107 LYS A CD   4  
ATOM 5650  C CE   . LYS A 1 77 ? 14.323  -16.352 -2.729  1.00 0.00 ? 107 LYS A CE   4  
ATOM 5651  N NZ   . LYS A 1 77 ? 15.090  -17.163 -1.742  1.00 0.00 ? 107 LYS A NZ   4  
ATOM 5652  O OXT  . LYS A 1 77 ? 8.126   -17.353 -1.688  1.00 0.00 ? 107 LYS A OXT  4  
ATOM 5653  H H    . LYS A 1 77 ? 10.371  -14.808 -1.898  1.00 0.00 ? 107 LYS A H    4  
ATOM 5654  H HA   . LYS A 1 77 ? 9.280   -15.777 -4.288  1.00 0.00 ? 107 LYS A HA   4  
ATOM 5655  H HB2  . LYS A 1 77 ? 10.741  -17.359 -2.166  1.00 0.00 ? 107 LYS A HB2  4  
ATOM 5656  H HB3  . LYS A 1 77 ? 10.549  -17.812 -3.854  1.00 0.00 ? 107 LYS A HB3  4  
ATOM 5657  H HG2  . LYS A 1 77 ? 11.898  -15.929 -4.548  1.00 0.00 ? 107 LYS A HG2  4  
ATOM 5658  H HG3  . LYS A 1 77 ? 12.028  -15.378 -2.877  1.00 0.00 ? 107 LYS A HG3  4  
ATOM 5659  H HD2  . LYS A 1 77 ? 12.902  -17.937 -2.651  1.00 0.00 ? 107 LYS A HD2  4  
ATOM 5660  H HD3  . LYS A 1 77 ? 13.455  -17.534 -4.278  1.00 0.00 ? 107 LYS A HD3  4  
ATOM 5661  H HE2  . LYS A 1 77 ? 14.986  -16.057 -3.529  1.00 0.00 ? 107 LYS A HE2  4  
ATOM 5662  H HE3  . LYS A 1 77 ? 13.939  -15.471 -2.238  1.00 0.00 ? 107 LYS A HE3  4  
ATOM 5663  H HZ1  . LYS A 1 77 ? 14.537  -17.278 -0.869  1.00 0.00 ? 107 LYS A HZ1  4  
ATOM 5664  H HZ2  . LYS A 1 77 ? 15.988  -16.691 -1.512  1.00 0.00 ? 107 LYS A HZ2  4  
ATOM 5665  H HZ3  . LYS A 1 77 ? 15.296  -18.103 -2.136  1.00 0.00 ? 107 LYS A HZ3  4  
ATOM 5666  N N    . ALA B 2 1  ? 8.029   5.190   7.615   1.00 0.00 ? 43  ALA B N    4  
ATOM 5667  C CA   . ALA B 2 1  ? 8.073   6.380   6.726   1.00 0.00 ? 43  ALA B CA   4  
ATOM 5668  C C    . ALA B 2 1  ? 6.846   7.262   6.931   1.00 0.00 ? 43  ALA B C    4  
ATOM 5669  O O    . ALA B 2 1  ? 5.803   6.793   7.388   1.00 0.00 ? 43  ALA B O    4  
ATOM 5670  C CB   . ALA B 2 1  ? 8.175   5.946   5.271   1.00 0.00 ? 43  ALA B CB   4  
ATOM 5671  H H1   . ALA B 2 1  ? 7.362   4.509   7.201   1.00 0.00 ? 43  ALA B H1   4  
ATOM 5672  H H2   . ALA B 2 1  ? 7.710   5.508   8.553   1.00 0.00 ? 43  ALA B H2   4  
ATOM 5673  H H3   . ALA B 2 1  ? 8.989   4.791   7.659   1.00 0.00 ? 43  ALA B H3   4  
ATOM 5674  H HA   . ALA B 2 1  ? 8.958   6.952   6.967   1.00 0.00 ? 43  ALA B HA   4  
ATOM 5675  H HB1  . ALA B 2 1  ? 8.515   4.922   5.223   1.00 0.00 ? 43  ALA B HB1  4  
ATOM 5676  H HB2  . ALA B 2 1  ? 8.877   6.583   4.753   1.00 0.00 ? 43  ALA B HB2  4  
ATOM 5677  H HB3  . ALA B 2 1  ? 7.205   6.026   4.803   1.00 0.00 ? 43  ALA B HB3  4  
ATOM 5678  N N    . PRO B 2 2  ? 6.952   8.560   6.595   1.00 0.00 ? 44  PRO B N    4  
ATOM 5679  C CA   . PRO B 2 2  ? 5.845   9.509   6.744   1.00 0.00 ? 44  PRO B CA   4  
ATOM 5680  C C    . PRO B 2 2  ? 4.719   9.248   5.748   1.00 0.00 ? 44  PRO B C    4  
ATOM 5681  O O    . PRO B 2 2  ? 3.561   9.579   6.003   1.00 0.00 ? 44  PRO B O    4  
ATOM 5682  C CB   . PRO B 2 2  ? 6.497   10.865  6.470   1.00 0.00 ? 44  PRO B CB   4  
ATOM 5683  C CG   . PRO B 2 2  ? 7.668   10.553  5.604   1.00 0.00 ? 44  PRO B CG   4  
ATOM 5684  C CD   . PRO B 2 2  ? 8.161   9.202   6.042   1.00 0.00 ? 44  PRO B CD   4  
ATOM 5685  H HA   . PRO B 2 2  ? 5.445   9.494   7.748   1.00 0.00 ? 44  PRO B HA   4  
ATOM 5686  H HB2  . PRO B 2 2  ? 5.794   11.511  5.966   1.00 0.00 ? 44  PRO B HB2  4  
ATOM 5687  H HB3  . PRO B 2 2  ? 6.806   11.315  7.402   1.00 0.00 ? 44  PRO B HB3  4  
ATOM 5688  H HG2  . PRO B 2 2  ? 7.362   10.523  4.568   1.00 0.00 ? 44  PRO B HG2  4  
ATOM 5689  H HG3  . PRO B 2 2  ? 8.439   11.297  5.746   1.00 0.00 ? 44  PRO B HG3  4  
ATOM 5690  H HD2  . PRO B 2 2  ? 8.540   8.646   5.196   1.00 0.00 ? 44  PRO B HD2  4  
ATOM 5691  H HD3  . PRO B 2 2  ? 8.923   9.305   6.800   1.00 0.00 ? 44  PRO B HD3  4  
ATOM 5692  N N    . GLN B 2 3  ? 5.066   8.649   4.613   1.00 0.00 ? 45  GLN B N    4  
ATOM 5693  C CA   . GLN B 2 3  ? 4.082   8.342   3.584   1.00 0.00 ? 45  GLN B CA   4  
ATOM 5694  C C    . GLN B 2 3  ? 3.263   7.118   3.969   1.00 0.00 ? 45  GLN B C    4  
ATOM 5695  O O    . GLN B 2 3  ? 2.143   6.931   3.493   1.00 0.00 ? 45  GLN B O    4  
ATOM 5696  C CB   . GLN B 2 3  ? 4.773   8.109   2.239   1.00 0.00 ? 45  GLN B CB   4  
ATOM 5697  C CG   . GLN B 2 3  ? 5.009   9.385   1.447   1.00 0.00 ? 45  GLN B CG   4  
ATOM 5698  C CD   . GLN B 2 3  ? 6.373   9.990   1.709   1.00 0.00 ? 45  GLN B CD   4  
ATOM 5699  O OE1  . GLN B 2 3  ? 7.388   9.502   1.210   1.00 0.00 ? 45  GLN B OE1  4  
ATOM 5700  N NE2  . GLN B 2 3  ? 6.406   11.058  2.495   1.00 0.00 ? 45  GLN B NE2  4  
ATOM 5701  H H    . GLN B 2 3  ? 6.002   8.403   4.467   1.00 0.00 ? 45  GLN B H    4  
ATOM 5702  H HA   . GLN B 2 3  ? 3.420   9.188   3.498   1.00 0.00 ? 45  GLN B HA   4  
ATOM 5703  H HB2  . GLN B 2 3  ? 5.728   7.637   2.414   1.00 0.00 ? 45  GLN B HB2  4  
ATOM 5704  H HB3  . GLN B 2 3  ? 4.160   7.449   1.641   1.00 0.00 ? 45  GLN B HB3  4  
ATOM 5705  H HG2  . GLN B 2 3  ? 4.927   9.161   0.394   1.00 0.00 ? 45  GLN B HG2  4  
ATOM 5706  H HG3  . GLN B 2 3  ? 4.253   10.107  1.720   1.00 0.00 ? 45  GLN B HG3  4  
ATOM 5707  H HE21 . GLN B 2 3  ? 5.558   11.393  2.858   1.00 0.00 ? 45  GLN B HE21 4  
ATOM 5708  H HE22 . GLN B 2 3  ? 7.276   11.470  2.683   1.00 0.00 ? 45  GLN B HE22 4  
ATOM 5709  N N    . LEU B 2 4  ? 3.826   6.287   4.837   1.00 0.00 ? 46  LEU B N    4  
ATOM 5710  C CA   . LEU B 2 4  ? 3.143   5.086   5.291   1.00 0.00 ? 46  LEU B CA   4  
ATOM 5711  C C    . LEU B 2 4  ? 2.078   5.440   6.321   1.00 0.00 ? 46  LEU B C    4  
ATOM 5712  O O    . LEU B 2 4  ? 1.010   4.830   6.361   1.00 0.00 ? 46  LEU B O    4  
ATOM 5713  C CB   . LEU B 2 4  ? 4.141   4.092   5.885   1.00 0.00 ? 46  LEU B CB   4  
ATOM 5714  C CG   . LEU B 2 4  ? 4.874   3.220   4.862   1.00 0.00 ? 46  LEU B CG   4  
ATOM 5715  C CD1  . LEU B 2 4  ? 5.781   2.223   5.565   1.00 0.00 ? 46  LEU B CD1  4  
ATOM 5716  C CD2  . LEU B 2 4  ? 3.875   2.499   3.969   1.00 0.00 ? 46  LEU B CD2  4  
ATOM 5717  H H    . LEU B 2 4  ? 4.718   6.490   5.184   1.00 0.00 ? 46  LEU B H    4  
ATOM 5718  H HA   . LEU B 2 4  ? 2.663   4.639   4.435   1.00 0.00 ? 46  LEU B HA   4  
ATOM 5719  H HB2  . LEU B 2 4  ? 4.879   4.647   6.447   1.00 0.00 ? 46  LEU B HB2  4  
ATOM 5720  H HB3  . LEU B 2 4  ? 3.610   3.442   6.564   1.00 0.00 ? 46  LEU B HB3  4  
ATOM 5721  H HG   . LEU B 2 4  ? 5.490   3.850   4.238   1.00 0.00 ? 46  LEU B HG   4  
ATOM 5722  H HD11 . LEU B 2 4  ? 6.717   2.699   5.812   1.00 0.00 ? 46  LEU B HD11 4  
ATOM 5723  H HD12 . LEU B 2 4  ? 5.967   1.383   4.910   1.00 0.00 ? 46  LEU B HD12 4  
ATOM 5724  H HD13 . LEU B 2 4  ? 5.304   1.876   6.468   1.00 0.00 ? 46  LEU B HD13 4  
ATOM 5725  H HD21 . LEU B 2 4  ? 2.992   2.253   4.539   1.00 0.00 ? 46  LEU B HD21 4  
ATOM 5726  H HD22 . LEU B 2 4  ? 4.323   1.592   3.589   1.00 0.00 ? 46  LEU B HD22 4  
ATOM 5727  H HD23 . LEU B 2 4  ? 3.604   3.139   3.142   1.00 0.00 ? 46  LEU B HD23 4  
ATOM 5728  N N    . ILE B 2 5  ? 2.374   6.439   7.145   1.00 0.00 ? 47  ILE B N    4  
ATOM 5729  C CA   . ILE B 2 5  ? 1.438   6.885   8.167   1.00 0.00 ? 47  ILE B CA   4  
ATOM 5730  C C    . ILE B 2 5  ? 0.278   7.641   7.532   1.00 0.00 ? 47  ILE B C    4  
ATOM 5731  O O    . ILE B 2 5  ? -0.872  7.500   7.948   1.00 0.00 ? 47  ILE B O    4  
ATOM 5732  C CB   . ILE B 2 5  ? 2.124   7.795   9.205   1.00 0.00 ? 47  ILE B CB   4  
ATOM 5733  C CG1  . ILE B 2 5  ? 3.402   7.137   9.726   1.00 0.00 ? 47  ILE B CG1  4  
ATOM 5734  C CG2  . ILE B 2 5  ? 1.173   8.100   10.353  1.00 0.00 ? 47  ILE B CG2  4  
ATOM 5735  C CD1  . ILE B 2 5  ? 4.199   8.021   10.661  1.00 0.00 ? 47  ILE B CD1  4  
ATOM 5736  H H    . ILE B 2 5  ? 3.238   6.892   7.057   1.00 0.00 ? 47  ILE B H    4  
ATOM 5737  H HA   . ILE B 2 5  ? 1.054   6.013   8.676   1.00 0.00 ? 47  ILE B HA   4  
ATOM 5738  H HB   . ILE B 2 5  ? 2.377   8.727   8.723   1.00 0.00 ? 47  ILE B HB   4  
ATOM 5739  H HG12 . ILE B 2 5  ? 3.144   6.237   10.261  1.00 0.00 ? 47  ILE B HG12 4  
ATOM 5740  H HG13 . ILE B 2 5  ? 4.036   6.884   8.888   1.00 0.00 ? 47  ILE B HG13 4  
ATOM 5741  H HG21 . ILE B 2 5  ? 1.379   7.434   11.178  1.00 0.00 ? 47  ILE B HG21 4  
ATOM 5742  H HG22 . ILE B 2 5  ? 0.154   7.960   10.023  1.00 0.00 ? 47  ILE B HG22 4  
ATOM 5743  H HG23 . ILE B 2 5  ? 1.311   9.122   10.673  1.00 0.00 ? 47  ILE B HG23 4  
ATOM 5744  H HD11 . ILE B 2 5  ? 5.153   7.560   10.868  1.00 0.00 ? 47  ILE B HD11 4  
ATOM 5745  H HD12 . ILE B 2 5  ? 3.654   8.149   11.585  1.00 0.00 ? 47  ILE B HD12 4  
ATOM 5746  H HD13 . ILE B 2 5  ? 4.357   8.984   10.199  1.00 0.00 ? 47  ILE B HD13 4  
ATOM 5747  N N    . MET B 2 6  ? 0.588   8.440   6.515   1.00 0.00 ? 48  MET B N    4  
ATOM 5748  C CA   . MET B 2 6  ? -0.429  9.213   5.815   1.00 0.00 ? 48  MET B CA   4  
ATOM 5749  C C    . MET B 2 6  ? -1.289  8.309   4.939   1.00 0.00 ? 48  MET B C    4  
ATOM 5750  O O    . MET B 2 6  ? -2.451  8.609   4.667   1.00 0.00 ? 48  MET B O    4  
ATOM 5751  C CB   . MET B 2 6  ? 0.222   10.316  4.971   1.00 0.00 ? 48  MET B CB   4  
ATOM 5752  C CG   . MET B 2 6  ? 0.804   9.826   3.654   1.00 0.00 ? 48  MET B CG   4  
ATOM 5753  S SD   . MET B 2 6  ? -0.238  10.230  2.239   1.00 0.00 ? 48  MET B SD   4  
ATOM 5754  C CE   . MET B 2 6  ? 0.651   9.409   0.918   1.00 0.00 ? 48  MET B CE   4  
ATOM 5755  H H    . MET B 2 6  ? 1.523   8.507   6.227   1.00 0.00 ? 48  MET B H    4  
ATOM 5756  H HA   . MET B 2 6  ? -1.061  9.667   6.558   1.00 0.00 ? 48  MET B HA   4  
ATOM 5757  H HB2  . MET B 2 6  ? -0.520  11.070  4.752   1.00 0.00 ? 48  MET B HB2  4  
ATOM 5758  H HB3  . MET B 2 6  ? 1.019   10.767  5.545   1.00 0.00 ? 48  MET B HB3  4  
ATOM 5759  H HG2  . MET B 2 6  ? 1.771   10.285  3.511   1.00 0.00 ? 48  MET B HG2  4  
ATOM 5760  H HG3  . MET B 2 6  ? 0.920   8.754   3.704   1.00 0.00 ? 48  MET B HG3  4  
ATOM 5761  H HE1  . MET B 2 6  ? 0.026   9.363   0.038   1.00 0.00 ? 48  MET B HE1  4  
ATOM 5762  H HE2  . MET B 2 6  ? 0.911   8.408   1.227   1.00 0.00 ? 48  MET B HE2  4  
ATOM 5763  H HE3  . MET B 2 6  ? 1.550   9.961   0.692   1.00 0.00 ? 48  MET B HE3  4  
ATOM 5764  N N    . LEU B 2 7  ? -0.709  7.196   4.505   1.00 0.00 ? 49  LEU B N    4  
ATOM 5765  C CA   . LEU B 2 7  ? -1.421  6.240   3.666   1.00 0.00 ? 49  LEU B CA   4  
ATOM 5766  C C    . LEU B 2 7  ? -2.491  5.514   4.473   1.00 0.00 ? 49  LEU B C    4  
ATOM 5767  O O    . LEU B 2 7  ? -3.626  5.356   4.021   1.00 0.00 ? 49  LEU B O    4  
ATOM 5768  C CB   . LEU B 2 7  ? -0.443  5.231   3.059   1.00 0.00 ? 49  LEU B CB   4  
ATOM 5769  C CG   . LEU B 2 7  ? 0.034   5.562   1.644   1.00 0.00 ? 49  LEU B CG   4  
ATOM 5770  C CD1  . LEU B 2 7  ? 1.461   5.080   1.435   1.00 0.00 ? 49  LEU B CD1  4  
ATOM 5771  C CD2  . LEU B 2 7  ? -0.897  4.943   0.612   1.00 0.00 ? 49  LEU B CD2  4  
ATOM 5772  H H    . LEU B 2 7  ? 0.218   7.010   4.761   1.00 0.00 ? 49  LEU B H    4  
ATOM 5773  H HA   . LEU B 2 7  ? -1.900  6.791   2.870   1.00 0.00 ? 49  LEU B HA   4  
ATOM 5774  H HB2  . LEU B 2 7  ? 0.422   5.169   3.704   1.00 0.00 ? 49  LEU B HB2  4  
ATOM 5775  H HB3  . LEU B 2 7  ? -0.923  4.264   3.035   1.00 0.00 ? 49  LEU B HB3  4  
ATOM 5776  H HG   . LEU B 2 7  ? 0.020   6.634   1.508   1.00 0.00 ? 49  LEU B HG   4  
ATOM 5777  H HD11 . LEU B 2 7  ? 1.954   4.991   2.391   1.00 0.00 ? 49  LEU B HD11 4  
ATOM 5778  H HD12 . LEU B 2 7  ? 1.993   5.790   0.819   1.00 0.00 ? 49  LEU B HD12 4  
ATOM 5779  H HD13 . LEU B 2 7  ? 1.447   4.118   0.945   1.00 0.00 ? 49  LEU B HD13 4  
ATOM 5780  H HD21 . LEU B 2 7  ? -1.804  5.526   0.550   1.00 0.00 ? 49  LEU B HD21 4  
ATOM 5781  H HD22 . LEU B 2 7  ? -1.138  3.932   0.905   1.00 0.00 ? 49  LEU B HD22 4  
ATOM 5782  H HD23 . LEU B 2 7  ? -0.409  4.932   -0.352  1.00 0.00 ? 49  LEU B HD23 4  
ATOM 5783  N N    . ALA B 2 8  ? -2.122  5.075   5.672   1.00 0.00 ? 50  ALA B N    4  
ATOM 5784  C CA   . ALA B 2 8  ? -3.046  4.368   6.546   1.00 0.00 ? 50  ALA B CA   4  
ATOM 5785  C C    . ALA B 2 8  ? -4.162  5.292   7.021   1.00 0.00 ? 50  ALA B C    4  
ATOM 5786  O O    . ALA B 2 8  ? -5.304  4.864   7.198   1.00 0.00 ? 50  ALA B O    4  
ATOM 5787  C CB   . ALA B 2 8  ? -2.303  3.781   7.736   1.00 0.00 ? 50  ALA B CB   4  
ATOM 5788  H H    . ALA B 2 8  ? -1.206  5.233   5.976   1.00 0.00 ? 50  ALA B H    4  
ATOM 5789  H HA   . ALA B 2 8  ? -3.479  3.555   5.983   1.00 0.00 ? 50  ALA B HA   4  
ATOM 5790  H HB1  . ALA B 2 8  ? -1.400  3.296   7.393   1.00 0.00 ? 50  ALA B HB1  4  
ATOM 5791  H HB2  . ALA B 2 8  ? -2.933  3.057   8.232   1.00 0.00 ? 50  ALA B HB2  4  
ATOM 5792  H HB3  . ALA B 2 8  ? -2.047  4.570   8.426   1.00 0.00 ? 50  ALA B HB3  4  
ATOM 5793  N N    . ASN B 2 9  ? -3.825  6.562   7.224   1.00 0.00 ? 51  ASN B N    4  
ATOM 5794  C CA   . ASN B 2 9  ? -4.800  7.547   7.677   1.00 0.00 ? 51  ASN B CA   4  
ATOM 5795  C C    . ASN B 2 9  ? -5.890  7.752   6.631   1.00 0.00 ? 51  ASN B C    4  
ATOM 5796  O O    . ASN B 2 9  ? -7.079  7.745   6.948   1.00 0.00 ? 51  ASN B O    4  
ATOM 5797  C CB   . ASN B 2 9  ? -4.110  8.878   7.981   1.00 0.00 ? 51  ASN B CB   4  
ATOM 5798  C CG   . ASN B 2 9  ? -5.063  9.907   8.557   1.00 0.00 ? 51  ASN B CG   4  
ATOM 5799  O OD1  . ASN B 2 9  ? -5.158  11.029  8.060   1.00 0.00 ? 51  ASN B OD1  4  
ATOM 5800  N ND2  . ASN B 2 9  ? -5.776  9.527   9.611   1.00 0.00 ? 51  ASN B ND2  4  
ATOM 5801  H H    . ASN B 2 9  ? -2.899  6.844   7.065   1.00 0.00 ? 51  ASN B H    4  
ATOM 5802  H HA   . ASN B 2 9  ? -5.254  7.172   8.583   1.00 0.00 ? 51  ASN B HA   4  
ATOM 5803  H HB2  . ASN B 2 9  ? -3.317  8.711   8.694   1.00 0.00 ? 51  ASN B HB2  4  
ATOM 5804  H HB3  . ASN B 2 9  ? -3.690  9.275   7.068   1.00 0.00 ? 51  ASN B HB3  4  
ATOM 5805  H HD21 . ASN B 2 9  ? -5.647  8.618   9.954   1.00 0.00 ? 51  ASN B HD21 4  
ATOM 5806  H HD22 . ASN B 2 9  ? -6.400  10.172  10.005  1.00 0.00 ? 51  ASN B HD22 4  
ATOM 5807  N N    . VAL B 2 10 ? -5.476  7.932   5.380   1.00 0.00 ? 52  VAL B N    4  
ATOM 5808  C CA   . VAL B 2 10 ? -6.417  8.136   4.287   1.00 0.00 ? 52  VAL B CA   4  
ATOM 5809  C C    . VAL B 2 10 ? -7.255  6.884   4.046   1.00 0.00 ? 52  VAL B C    4  
ATOM 5810  O O    . VAL B 2 10 ? -8.394  6.967   3.587   1.00 0.00 ? 52  VAL B O    4  
ATOM 5811  C CB   . VAL B 2 10 ? -5.692  8.516   2.982   1.00 0.00 ? 52  VAL B CB   4  
ATOM 5812  C CG1  . VAL B 2 10 ? -6.695  8.858   1.891   1.00 0.00 ? 52  VAL B CG1  4  
ATOM 5813  C CG2  . VAL B 2 10 ? -4.738  9.677   3.220   1.00 0.00 ? 52  VAL B CG2  4  
ATOM 5814  H H    . VAL B 2 10 ? -4.516  7.926   5.189   1.00 0.00 ? 52  VAL B H    4  
ATOM 5815  H HA   . VAL B 2 10 ? -7.076  8.949   4.561   1.00 0.00 ? 52  VAL B HA   4  
ATOM 5816  H HB   . VAL B 2 10 ? -5.114  7.664   2.654   1.00 0.00 ? 52  VAL B HB   4  
ATOM 5817  H HG11 . VAL B 2 10 ? -6.291  9.636   1.261   1.00 0.00 ? 52  VAL B HG11 4  
ATOM 5818  H HG12 . VAL B 2 10 ? -7.614  9.201   2.342   1.00 0.00 ? 52  VAL B HG12 4  
ATOM 5819  H HG13 . VAL B 2 10 ? -6.892  7.978   1.295   1.00 0.00 ? 52  VAL B HG13 4  
ATOM 5820  H HG21 . VAL B 2 10 ? -4.524  9.758   4.275   1.00 0.00 ? 52  VAL B HG21 4  
ATOM 5821  H HG22 . VAL B 2 10 ? -5.192  10.594  2.872   1.00 0.00 ? 52  VAL B HG22 4  
ATOM 5822  H HG23 . VAL B 2 10 ? -3.818  9.504   2.680   1.00 0.00 ? 52  VAL B HG23 4  
ATOM 5823  N N    . ALA B 2 11 ? -6.688  5.725   4.366   1.00 0.00 ? 53  ALA B N    4  
ATOM 5824  C CA   . ALA B 2 11 ? -7.384  4.463   4.192   1.00 0.00 ? 53  ALA B CA   4  
ATOM 5825  C C    . ALA B 2 11 ? -8.371  4.245   5.327   1.00 0.00 ? 53  ALA B C    4  
ATOM 5826  O O    . ALA B 2 11 ? -9.458  3.704   5.127   1.00 0.00 ? 53  ALA B O    4  
ATOM 5827  C CB   . ALA B 2 11 ? -6.390  3.314   4.120   1.00 0.00 ? 53  ALA B CB   4  
ATOM 5828  H H    . ALA B 2 11 ? -5.785  5.720   4.732   1.00 0.00 ? 53  ALA B H    4  
ATOM 5829  H HA   . ALA B 2 11 ? -7.919  4.508   3.259   1.00 0.00 ? 53  ALA B HA   4  
ATOM 5830  H HB1  . ALA B 2 11 ? -6.084  3.166   3.095   1.00 0.00 ? 53  ALA B HB1  4  
ATOM 5831  H HB2  . ALA B 2 11 ? -6.856  2.413   4.490   1.00 0.00 ? 53  ALA B HB2  4  
ATOM 5832  H HB3  . ALA B 2 11 ? -5.526  3.547   4.725   1.00 0.00 ? 53  ALA B HB3  4  
ATOM 5833  N N    . LEU B 2 12 ? -7.983  4.679   6.521   1.00 0.00 ? 54  LEU B N    4  
ATOM 5834  C CA   . LEU B 2 12 ? -8.827  4.543   7.693   1.00 0.00 ? 54  LEU B CA   4  
ATOM 5835  C C    . LEU B 2 12 ? -9.827  5.693   7.782   1.00 0.00 ? 54  LEU B C    4  
ATOM 5836  O O    . LEU B 2 12 ? -10.859 5.583   8.443   1.00 0.00 ? 54  LEU B O    4  
ATOM 5837  C CB   . LEU B 2 12 ? -7.972  4.489   8.962   1.00 0.00 ? 54  LEU B CB   4  
ATOM 5838  C CG   . LEU B 2 12 ? -7.670  3.081   9.480   1.00 0.00 ? 54  LEU B CG   4  
ATOM 5839  C CD1  . LEU B 2 12 ? -6.978  2.255   8.407   1.00 0.00 ? 54  LEU B CD1  4  
ATOM 5840  C CD2  . LEU B 2 12 ? -6.817  3.148   10.737  1.00 0.00 ? 54  LEU B CD2  4  
ATOM 5841  H H    . LEU B 2 12 ? -7.110  5.104   6.614   1.00 0.00 ? 54  LEU B H    4  
ATOM 5842  H HA   . LEU B 2 12 ? -9.364  3.622   7.593   1.00 0.00 ? 54  LEU B HA   4  
ATOM 5843  H HB2  . LEU B 2 12 ? -7.033  4.984   8.759   1.00 0.00 ? 54  LEU B HB2  4  
ATOM 5844  H HB3  . LEU B 2 12 ? -8.484  5.032   9.742   1.00 0.00 ? 54  LEU B HB3  4  
ATOM 5845  H HG   . LEU B 2 12 ? -8.599  2.591   9.731   1.00 0.00 ? 54  LEU B HG   4  
ATOM 5846  H HD11 . LEU B 2 12 ? -7.330  1.235   8.456   1.00 0.00 ? 54  LEU B HD11 4  
ATOM 5847  H HD12 . LEU B 2 12 ? -5.910  2.276   8.570   1.00 0.00 ? 54  LEU B HD12 4  
ATOM 5848  H HD13 . LEU B 2 12 ? -7.203  2.667   7.434   1.00 0.00 ? 54  LEU B HD13 4  
ATOM 5849  H HD21 . LEU B 2 12 ? -6.920  4.122   11.192  1.00 0.00 ? 54  LEU B HD21 4  
ATOM 5850  H HD22 . LEU B 2 12 ? -5.782  2.979   10.480  1.00 0.00 ? 54  LEU B HD22 4  
ATOM 5851  H HD23 . LEU B 2 12 ? -7.143  2.389   11.434  1.00 0.00 ? 54  LEU B HD23 4  
ATOM 5852  N N    . THR B 2 13 ? -9.513  6.797   7.110   1.00 0.00 ? 55  THR B N    4  
ATOM 5853  C CA   . THR B 2 13 ? -10.380 7.969   7.109   1.00 0.00 ? 55  THR B CA   4  
ATOM 5854  C C    . THR B 2 13 ? -9.878  9.014   6.117   1.00 0.00 ? 55  THR B C    4  
ATOM 5855  O O    . THR B 2 13 ? -9.027  9.839   6.446   1.00 0.00 ? 55  THR B O    4  
ATOM 5856  C CB   . THR B 2 13 ? -10.463 8.576   8.514   1.00 0.00 ? 55  THR B CB   4  
ATOM 5857  O OG1  . THR B 2 13 ? -9.621  7.878   9.415   1.00 0.00 ? 55  THR B OG1  4  
ATOM 5858  C CG2  . THR B 2 13 ? -11.862 8.560   9.089   1.00 0.00 ? 55  THR B CG2  4  
ATOM 5859  H H    . THR B 2 13 ? -8.678  6.824   6.602   1.00 0.00 ? 55  THR B H    4  
ATOM 5860  H HA   . THR B 2 13 ? -11.363 7.649   6.806   1.00 0.00 ? 55  THR B HA   4  
ATOM 5861  H HB   . THR B 2 13 ? -10.134 9.604   8.471   1.00 0.00 ? 55  THR B HB   4  
ATOM 5862  H HG1  . THR B 2 13 ? -8.709  7.946   9.121   1.00 0.00 ? 55  THR B HG1  4  
ATOM 5863  H HG21 . THR B 2 13 ? -11.837 8.140   10.084  1.00 0.00 ? 55  THR B HG21 4  
ATOM 5864  H HG22 . THR B 2 13 ? -12.504 7.961   8.461   1.00 0.00 ? 55  THR B HG22 4  
ATOM 5865  H HG23 . THR B 2 13 ? -12.244 9.570   9.134   1.00 0.00 ? 55  THR B HG23 4  
ATOM 5866  N N    . GLY B 2 14 ? -10.411 8.970   4.900   1.00 0.00 ? 56  GLY B N    4  
ATOM 5867  C CA   . GLY B 2 14 ? -10.004 9.917   3.878   1.00 0.00 ? 56  GLY B CA   4  
ATOM 5868  C C    . GLY B 2 14 ? -10.907 11.135  3.822   1.00 0.00 ? 56  GLY B C    4  
ATOM 5869  O O    . GLY B 2 14 ? -11.303 11.573  2.741   1.00 0.00 ? 56  GLY B O    4  
ATOM 5870  H H    . GLY B 2 14 ? -11.085 8.289   4.694   1.00 0.00 ? 56  GLY B H    4  
ATOM 5871  H HA2  . GLY B 2 14 ? -8.995  10.241  4.083   1.00 0.00 ? 56  GLY B HA2  4  
ATOM 5872  H HA3  . GLY B 2 14 ? -10.024 9.424   2.918   1.00 0.00 ? 56  GLY B HA3  4  
ATOM 5873  N N    . GLU B 2 15 ? -11.233 11.682  4.988   1.00 0.00 ? 57  GLU B N    4  
ATOM 5874  C CA   . GLU B 2 15 ? -12.094 12.856  5.067   1.00 0.00 ? 57  GLU B CA   4  
ATOM 5875  C C    . GLU B 2 15 ? -11.461 14.046  4.352   1.00 0.00 ? 57  GLU B C    4  
ATOM 5876  O O    . GLU B 2 15 ? -10.219 14.066  4.225   1.00 0.00 ? 57  GLU B O    4  
ATOM 5877  C CB   . GLU B 2 15 ? -12.371 13.213  6.529   1.00 0.00 ? 57  GLU B CB   4  
ATOM 5878  C CG   . GLU B 2 15 ? -13.320 12.249  7.220   1.00 0.00 ? 57  GLU B CG   4  
ATOM 5879  C CD   . GLU B 2 15 ? -14.766 12.462  6.815   1.00 0.00 ? 57  GLU B CD   4  
ATOM 5880  O OE1  . GLU B 2 15 ? -15.010 12.783  5.633   1.00 0.00 ? 57  GLU B OE1  4  
ATOM 5881  O OE2  . GLU B 2 15 ? -15.654 12.309  7.680   1.00 0.00 ? 57  GLU B OE2  4  
ATOM 5882  O OXT  . GLU B 2 15 ? -12.213 14.946  3.923   1.00 0.00 ? 57  GLU B OXT  4  
ATOM 5883  H H    . GLU B 2 15 ? -10.887 11.288  5.814   1.00 0.00 ? 57  GLU B H    4  
ATOM 5884  H HA   . GLU B 2 15 ? -13.027 12.614  4.582   1.00 0.00 ? 57  GLU B HA   4  
ATOM 5885  H HB2  . GLU B 2 15 ? -11.437 13.216  7.070   1.00 0.00 ? 57  GLU B HB2  4  
ATOM 5886  H HB3  . GLU B 2 15 ? -12.804 14.202  6.570   1.00 0.00 ? 57  GLU B HB3  4  
ATOM 5887  H HG2  . GLU B 2 15 ? -13.037 11.239  6.964   1.00 0.00 ? 57  GLU B HG2  4  
ATOM 5888  H HG3  . GLU B 2 15 ? -13.237 12.386  8.289   1.00 0.00 ? 57  GLU B HG3  4  
ATOM 5889  N N    . PRO A 1 1  ? 1.098   15.497  -7.114  1.00 0.00 ? 31  PRO A N    5  
ATOM 5890  C CA   . PRO A 1 1  ? 1.170   15.850  -5.670  1.00 0.00 ? 31  PRO A CA   5  
ATOM 5891  C C    . PRO A 1 1  ? 0.684   14.705  -4.784  1.00 0.00 ? 31  PRO A C    5  
ATOM 5892  O O    . PRO A 1 1  ? -0.516  14.456  -4.675  1.00 0.00 ? 31  PRO A O    5  
ATOM 5893  C CB   . PRO A 1 1  ? 0.307   17.090  -5.456  1.00 0.00 ? 31  PRO A CB   5  
ATOM 5894  C CG   . PRO A 1 1  ? -0.112  17.491  -6.832  1.00 0.00 ? 31  PRO A CG   5  
ATOM 5895  C CD   . PRO A 1 1  ? -0.033  16.247  -7.682  1.00 0.00 ? 31  PRO A CD   5  
ATOM 5896  H H2   . PRO A 1 1  ? 1.046   14.465  -7.092  1.00 0.00 ? 31  PRO A H2   5  
ATOM 5897  H H3   . PRO A 1 1  ? 2.076   15.704  -7.426  1.00 0.00 ? 31  PRO A H3   5  
ATOM 5898  H HA   . PRO A 1 1  ? 2.194   16.081  -5.421  1.00 0.00 ? 31  PRO A HA   5  
ATOM 5899  H HB2  . PRO A 1 1  ? -0.545  16.840  -4.839  1.00 0.00 ? 31  PRO A HB2  5  
ATOM 5900  H HB3  . PRO A 1 1  ? 0.891   17.863  -4.981  1.00 0.00 ? 31  PRO A HB3  5  
ATOM 5901  H HG2  . PRO A 1 1  ? -1.125  17.866  -6.810  1.00 0.00 ? 31  PRO A HG2  5  
ATOM 5902  H HG3  . PRO A 1 1  ? 0.558   18.247  -7.212  1.00 0.00 ? 31  PRO A HG3  5  
ATOM 5903  H HD2  . PRO A 1 1  ? -0.948  15.678  -7.602  1.00 0.00 ? 31  PRO A HD2  5  
ATOM 5904  H HD3  . PRO A 1 1  ? 0.160   16.507  -8.712  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 5905  N N    . VAL A 1 2  ? 1.626   14.011  -4.152  1.00 0.00 ? 32  VAL A N    5  
ATOM 5906  C CA   . VAL A 1 2  ? 1.304   12.899  -3.280  1.00 0.00 ? 32  VAL A CA   5  
ATOM 5907  C C    . VAL A 1 2  ? 0.535   13.367  -2.049  1.00 0.00 ? 32  VAL A C    5  
ATOM 5908  O O    . VAL A 1 2  ? 1.096   13.485  -0.960  1.00 0.00 ? 32  VAL A O    5  
ATOM 5909  C CB   . VAL A 1 2  ? 2.582   12.170  -2.832  1.00 0.00 ? 32  VAL A CB   5  
ATOM 5910  C CG1  . VAL A 1 2  ? 3.105   11.272  -3.942  1.00 0.00 ? 32  VAL A CG1  5  
ATOM 5911  C CG2  . VAL A 1 2  ? 3.646   13.165  -2.392  1.00 0.00 ? 32  VAL A CG2  5  
ATOM 5912  H H    . VAL A 1 2  ? 2.564   14.251  -4.275  1.00 0.00 ? 32  VAL A H    5  
ATOM 5913  H HA   . VAL A 1 2  ? 0.692   12.202  -3.835  1.00 0.00 ? 32  VAL A HA   5  
ATOM 5914  H HB   . VAL A 1 2  ? 2.333   11.555  -1.992  1.00 0.00 ? 32  VAL A HB   5  
ATOM 5915  H HG11 . VAL A 1 2  ? 3.566   11.878  -4.708  1.00 0.00 ? 32  VAL A HG11 5  
ATOM 5916  H HG12 . VAL A 1 2  ? 2.285   10.712  -4.368  1.00 0.00 ? 32  VAL A HG12 5  
ATOM 5917  H HG13 . VAL A 1 2  ? 3.835   10.587  -3.536  1.00 0.00 ? 32  VAL A HG13 5  
ATOM 5918  H HG21 . VAL A 1 2  ? 4.181   13.526  -3.258  1.00 0.00 ? 32  VAL A HG21 5  
ATOM 5919  H HG22 . VAL A 1 2  ? 4.336   12.680  -1.718  1.00 0.00 ? 32  VAL A HG22 5  
ATOM 5920  H HG23 . VAL A 1 2  ? 3.176   13.996  -1.887  1.00 0.00 ? 32  VAL A HG23 5  
ATOM 5921  N N    . HIS A 1 3  ? -0.755  13.634  -2.231  1.00 0.00 ? 33  HIS A N    5  
ATOM 5922  C CA   . HIS A 1 3  ? -1.605  14.090  -1.136  1.00 0.00 ? 33  HIS A CA   5  
ATOM 5923  C C    . HIS A 1 3  ? -2.804  13.165  -0.960  1.00 0.00 ? 33  HIS A C    5  
ATOM 5924  O O    . HIS A 1 3  ? -2.863  12.089  -1.555  1.00 0.00 ? 33  HIS A O    5  
ATOM 5925  C CB   . HIS A 1 3  ? -2.077  15.523  -1.398  1.00 0.00 ? 33  HIS A CB   5  
ATOM 5926  C CG   . HIS A 1 3  ? -1.378  16.545  -0.556  1.00 0.00 ? 33  HIS A CG   5  
ATOM 5927  N ND1  . HIS A 1 3  ? -0.040  16.847  -0.695  1.00 0.00 ? 33  HIS A ND1  5  
ATOM 5928  C CD2  . HIS A 1 3  ? -1.840  17.339  0.440   1.00 0.00 ? 33  HIS A CD2  5  
ATOM 5929  C CE1  . HIS A 1 3  ? 0.291   17.781  0.179   1.00 0.00 ? 33  HIS A CE1  5  
ATOM 5930  N NE2  . HIS A 1 3  ? -0.782  18.096  0.879   1.00 0.00 ? 33  HIS A NE2  5  
ATOM 5931  H H    . HIS A 1 3  ? -1.144  13.522  -3.123  1.00 0.00 ? 33  HIS A H    5  
ATOM 5932  H HA   . HIS A 1 3  ? -1.016  14.074  -0.232  1.00 0.00 ? 33  HIS A HA   5  
ATOM 5933  H HB2  . HIS A 1 3  ? -1.899  15.770  -2.434  1.00 0.00 ? 33  HIS A HB2  5  
ATOM 5934  H HB3  . HIS A 1 3  ? -3.135  15.591  -1.194  1.00 0.00 ? 33  HIS A HB3  5  
ATOM 5935  H HD1  . HIS A 1 3  ? 0.576   16.437  -1.337  1.00 0.00 ? 33  HIS A HD1  5  
ATOM 5936  H HD2  . HIS A 1 3  ? -2.852  17.370  0.818   1.00 0.00 ? 33  HIS A HD2  5  
ATOM 5937  H HE1  . HIS A 1 3  ? 1.274   18.213  0.300   1.00 0.00 ? 33  HIS A HE1  5  
ATOM 5938  H HE2  . HIS A 1 3  ? -0.836  18.822  1.535   1.00 0.00 ? 33  HIS A HE2  5  
ATOM 5939  N N    . VAL A 1 4  ? -3.760  13.589  -0.137  1.00 0.00 ? 34  VAL A N    5  
ATOM 5940  C CA   . VAL A 1 4  ? -4.960  12.798  0.119   1.00 0.00 ? 34  VAL A CA   5  
ATOM 5941  C C    . VAL A 1 4  ? -5.589  12.305  -1.183  1.00 0.00 ? 34  VAL A C    5  
ATOM 5942  O O    . VAL A 1 4  ? -6.235  11.258  -1.213  1.00 0.00 ? 34  VAL A O    5  
ATOM 5943  C CB   . VAL A 1 4  ? -6.009  13.606  0.906   1.00 0.00 ? 34  VAL A CB   5  
ATOM 5944  C CG1  . VAL A 1 4  ? -7.164  12.714  1.331   1.00 0.00 ? 34  VAL A CG1  5  
ATOM 5945  C CG2  . VAL A 1 4  ? -5.370  14.276  2.113   1.00 0.00 ? 34  VAL A CG2  5  
ATOM 5946  H H    . VAL A 1 4  ? -3.657  14.456  0.309   1.00 0.00 ? 34  VAL A H    5  
ATOM 5947  H HA   . VAL A 1 4  ? -4.675  11.943  0.715   1.00 0.00 ? 34  VAL A HA   5  
ATOM 5948  H HB   . VAL A 1 4  ? -6.399  14.378  0.258   1.00 0.00 ? 34  VAL A HB   5  
ATOM 5949  H HG11 . VAL A 1 4  ? -7.909  12.692  0.549   1.00 0.00 ? 34  VAL A HG11 5  
ATOM 5950  H HG12 . VAL A 1 4  ? -7.604  13.102  2.237   1.00 0.00 ? 34  VAL A HG12 5  
ATOM 5951  H HG13 . VAL A 1 4  ? -6.800  11.713  1.509   1.00 0.00 ? 34  VAL A HG13 5  
ATOM 5952  H HG21 . VAL A 1 4  ? -6.122  14.445  2.870   1.00 0.00 ? 34  VAL A HG21 5  
ATOM 5953  H HG22 . VAL A 1 4  ? -4.941  15.221  1.815   1.00 0.00 ? 34  VAL A HG22 5  
ATOM 5954  H HG23 . VAL A 1 4  ? -4.596  13.637  2.511   1.00 0.00 ? 34  VAL A HG23 5  
ATOM 5955  N N    . GLU A 1 5  ? -5.391  13.064  -2.255  1.00 0.00 ? 35  GLU A N    5  
ATOM 5956  C CA   . GLU A 1 5  ? -5.936  12.702  -3.559  1.00 0.00 ? 35  GLU A CA   5  
ATOM 5957  C C    . GLU A 1 5  ? -5.195  11.501  -4.139  1.00 0.00 ? 35  GLU A C    5  
ATOM 5958  O O    . GLU A 1 5  ? -5.803  10.618  -4.745  1.00 0.00 ? 35  GLU A O    5  
ATOM 5959  C CB   . GLU A 1 5  ? -5.844  13.886  -4.521  1.00 0.00 ? 35  GLU A CB   5  
ATOM 5960  C CG   . GLU A 1 5  ? -6.737  15.054  -4.135  1.00 0.00 ? 35  GLU A CG   5  
ATOM 5961  C CD   . GLU A 1 5  ? -7.425  15.683  -5.331  1.00 0.00 ? 35  GLU A CD   5  
ATOM 5962  O OE1  . GLU A 1 5  ? -8.351  15.053  -5.883  1.00 0.00 ? 35  GLU A OE1  5  
ATOM 5963  O OE2  . GLU A 1 5  ? -7.036  16.805  -5.717  1.00 0.00 ? 35  GLU A OE2  5  
ATOM 5964  H H    . GLU A 1 5  ? -4.865  13.887  -2.169  1.00 0.00 ? 35  GLU A H    5  
ATOM 5965  H HA   . GLU A 1 5  ? -6.974  12.438  -3.422  1.00 0.00 ? 35  GLU A HA   5  
ATOM 5966  H HB2  . GLU A 1 5  ? -4.823  14.236  -4.549  1.00 0.00 ? 35  GLU A HB2  5  
ATOM 5967  H HB3  . GLU A 1 5  ? -6.129  13.554  -5.510  1.00 0.00 ? 35  GLU A HB3  5  
ATOM 5968  H HG2  . GLU A 1 5  ? -7.493  14.702  -3.449  1.00 0.00 ? 35  GLU A HG2  5  
ATOM 5969  H HG3  . GLU A 1 5  ? -6.134  15.806  -3.648  1.00 0.00 ? 35  GLU A HG3  5  
ATOM 5970  N N    . ASP A 1 6  ? -3.881  11.473  -3.947  1.00 0.00 ? 36  ASP A N    5  
ATOM 5971  C CA   . ASP A 1 6  ? -3.057  10.380  -4.448  1.00 0.00 ? 36  ASP A CA   5  
ATOM 5972  C C    . ASP A 1 6  ? -3.342  9.092   -3.682  1.00 0.00 ? 36  ASP A C    5  
ATOM 5973  O O    . ASP A 1 6  ? -3.362  8.005   -4.260  1.00 0.00 ? 36  ASP A O    5  
ATOM 5974  C CB   . ASP A 1 6  ? -1.573  10.740  -4.339  1.00 0.00 ? 36  ASP A CB   5  
ATOM 5975  C CG   . ASP A 1 6  ? -0.877  10.739  -5.687  1.00 0.00 ? 36  ASP A CG   5  
ATOM 5976  O OD1  . ASP A 1 6  ? -0.513  9.644   -6.166  1.00 0.00 ? 36  ASP A OD1  5  
ATOM 5977  O OD2  . ASP A 1 6  ? -0.696  11.832  -6.262  1.00 0.00 ? 36  ASP A OD2  5  
ATOM 5978  H H    . ASP A 1 6  ? -3.454  12.205  -3.454  1.00 0.00 ? 36  ASP A H    5  
ATOM 5979  H HA   . ASP A 1 6  ? -3.306  10.228  -5.489  1.00 0.00 ? 36  ASP A HA   5  
ATOM 5980  H HB2  . ASP A 1 6  ? -1.478  11.725  -3.908  1.00 0.00 ? 36  ASP A HB2  5  
ATOM 5981  H HB3  . ASP A 1 6  ? -1.079  10.023  -3.699  1.00 0.00 ? 36  ASP A HB3  5  
ATOM 5982  N N    . ALA A 1 7  ? -3.565  9.224   -2.378  1.00 0.00 ? 37  ALA A N    5  
ATOM 5983  C CA   . ALA A 1 7  ? -3.852  8.071   -1.534  1.00 0.00 ? 37  ALA A CA   5  
ATOM 5984  C C    . ALA A 1 7  ? -5.270  7.563   -1.771  1.00 0.00 ? 37  ALA A C    5  
ATOM 5985  O O    . ALA A 1 7  ? -5.531  6.362   -1.703  1.00 0.00 ? 37  ALA A O    5  
ATOM 5986  C CB   . ALA A 1 7  ? -3.655  8.428   -0.069  1.00 0.00 ? 37  ALA A CB   5  
ATOM 5987  H H    . ALA A 1 7  ? -3.537  10.116  -1.976  1.00 0.00 ? 37  ALA A H    5  
ATOM 5988  H HA   . ALA A 1 7  ? -3.153  7.288   -1.789  1.00 0.00 ? 37  ALA A HA   5  
ATOM 5989  H HB1  . ALA A 1 7  ? -2.646  8.181   0.229   1.00 0.00 ? 37  ALA A HB1  5  
ATOM 5990  H HB2  . ALA A 1 7  ? -4.356  7.871   0.535   1.00 0.00 ? 37  ALA A HB2  5  
ATOM 5991  H HB3  . ALA A 1 7  ? -3.821  9.487   0.069   1.00 0.00 ? 37  ALA A HB3  5  
ATOM 5992  N N    . LEU A 1 8  ? -6.184  8.488   -2.051  1.00 0.00 ? 38  LEU A N    5  
ATOM 5993  C CA   . LEU A 1 8  ? -7.575  8.139   -2.298  1.00 0.00 ? 38  LEU A CA   5  
ATOM 5994  C C    . LEU A 1 8  ? -7.721  7.372   -3.610  1.00 0.00 ? 38  LEU A C    5  
ATOM 5995  O O    . LEU A 1 8  ? -8.353  6.318   -3.657  1.00 0.00 ? 38  LEU A O    5  
ATOM 5996  C CB   . LEU A 1 8  ? -8.442  9.400   -2.327  1.00 0.00 ? 38  LEU A CB   5  
ATOM 5997  C CG   . LEU A 1 8  ? -9.267  9.647   -1.062  1.00 0.00 ? 38  LEU A CG   5  
ATOM 5998  C CD1  . LEU A 1 8  ? -9.976  10.990  -1.142  1.00 0.00 ? 38  LEU A CD1  5  
ATOM 5999  C CD2  . LEU A 1 8  ? -10.271 8.523   -0.854  1.00 0.00 ? 38  LEU A CD2  5  
ATOM 6000  H H    . LEU A 1 8  ? -5.915  9.427   -2.090  1.00 0.00 ? 38  LEU A H    5  
ATOM 6001  H HA   . LEU A 1 8  ? -7.904  7.507   -1.488  1.00 0.00 ? 38  LEU A HA   5  
ATOM 6002  H HB2  . LEU A 1 8  ? -7.796  10.252  -2.483  1.00 0.00 ? 38  LEU A HB2  5  
ATOM 6003  H HB3  . LEU A 1 8  ? -9.122  9.328   -3.163  1.00 0.00 ? 38  LEU A HB3  5  
ATOM 6004  H HG   . LEU A 1 8  ? -8.605  9.669   -0.208  1.00 0.00 ? 38  LEU A HG   5  
ATOM 6005  H HD11 . LEU A 1 8  ? -10.596 11.121  -0.267  1.00 0.00 ? 38  LEU A HD11 5  
ATOM 6006  H HD12 . LEU A 1 8  ? -10.592 11.020  -2.028  1.00 0.00 ? 38  LEU A HD12 5  
ATOM 6007  H HD13 . LEU A 1 8  ? -9.244  11.782  -1.186  1.00 0.00 ? 38  LEU A HD13 5  
ATOM 6008  H HD21 . LEU A 1 8  ? -10.521 8.083   -1.808  1.00 0.00 ? 38  LEU A HD21 5  
ATOM 6009  H HD22 . LEU A 1 8  ? -11.163 8.919   -0.394  1.00 0.00 ? 38  LEU A HD22 5  
ATOM 6010  H HD23 . LEU A 1 8  ? -9.839  7.770   -0.212  1.00 0.00 ? 38  LEU A HD23 5  
ATOM 6011  N N    . THR A 1 9  ? -7.134  7.911   -4.674  1.00 0.00 ? 39  THR A N    5  
ATOM 6012  C CA   . THR A 1 9  ? -7.201  7.278   -5.986  1.00 0.00 ? 39  THR A CA   5  
ATOM 6013  C C    . THR A 1 9  ? -6.596  5.878   -5.947  1.00 0.00 ? 39  THR A C    5  
ATOM 6014  O O    . THR A 1 9  ? -7.160  4.931   -6.492  1.00 0.00 ? 39  THR A O    5  
ATOM 6015  C CB   . THR A 1 9  ? -6.482  8.135   -7.034  1.00 0.00 ? 39  THR A CB   5  
ATOM 6016  O OG1  . THR A 1 9  ? -6.924  7.806   -8.338  1.00 0.00 ? 39  THR A OG1  5  
ATOM 6017  C CG2  . THR A 1 9  ? -4.971  7.986   -7.012  1.00 0.00 ? 39  THR A CG2  5  
ATOM 6018  H H    . THR A 1 9  ? -6.645  8.755   -4.575  1.00 0.00 ? 39  THR A H    5  
ATOM 6019  H HA   . THR A 1 9  ? -8.243  7.196   -6.258  1.00 0.00 ? 39  THR A HA   5  
ATOM 6020  H HB   . THR A 1 9  ? -6.713  9.175   -6.851  1.00 0.00 ? 39  THR A HB   5  
ATOM 6021  H HG1  . THR A 1 9  ? -6.703  6.892   -8.530  1.00 0.00 ? 39  THR A HG1  5  
ATOM 6022  H HG21 . THR A 1 9  ? -4.589  8.347   -6.070  1.00 0.00 ? 39  THR A HG21 5  
ATOM 6023  H HG22 . THR A 1 9  ? -4.542  8.560   -7.819  1.00 0.00 ? 39  THR A HG22 5  
ATOM 6024  H HG23 . THR A 1 9  ? -4.709  6.943   -7.133  1.00 0.00 ? 39  THR A HG23 5  
ATOM 6025  N N    . TYR A 1 10 ? -5.438  5.760   -5.302  1.00 0.00 ? 40  TYR A N    5  
ATOM 6026  C CA   . TYR A 1 10 ? -4.752  4.479   -5.199  1.00 0.00 ? 40  TYR A CA   5  
ATOM 6027  C C    . TYR A 1 10 ? -5.671  3.413   -4.610  1.00 0.00 ? 40  TYR A C    5  
ATOM 6028  O O    . TYR A 1 10 ? -5.825  2.330   -5.174  1.00 0.00 ? 40  TYR A O    5  
ATOM 6029  C CB   . TYR A 1 10 ? -3.492  4.614   -4.339  1.00 0.00 ? 40  TYR A CB   5  
ATOM 6030  C CG   . TYR A 1 10 ? -2.732  3.317   -4.163  1.00 0.00 ? 40  TYR A CG   5  
ATOM 6031  C CD1  . TYR A 1 10 ? -2.642  2.394   -5.200  1.00 0.00 ? 40  TYR A CD1  5  
ATOM 6032  C CD2  . TYR A 1 10 ? -2.106  3.015   -2.960  1.00 0.00 ? 40  TYR A CD2  5  
ATOM 6033  C CE1  . TYR A 1 10 ? -1.949  1.209   -5.041  1.00 0.00 ? 40  TYR A CE1  5  
ATOM 6034  C CE2  . TYR A 1 10 ? -1.411  1.830   -2.794  1.00 0.00 ? 40  TYR A CE2  5  
ATOM 6035  C CZ   . TYR A 1 10 ? -1.337  0.931   -3.837  1.00 0.00 ? 40  TYR A CZ   5  
ATOM 6036  O OH   . TYR A 1 10 ? -0.648  -0.248  -3.676  1.00 0.00 ? 40  TYR A OH   5  
ATOM 6037  H H    . TYR A 1 10 ? -5.036  6.554   -4.891  1.00 0.00 ? 40  TYR A H    5  
ATOM 6038  H HA   . TYR A 1 10 ? -4.465  4.182   -6.197  1.00 0.00 ? 40  TYR A HA   5  
ATOM 6039  H HB2  . TYR A 1 10 ? -2.826  5.328   -4.801  1.00 0.00 ? 40  TYR A HB2  5  
ATOM 6040  H HB3  . TYR A 1 10 ? -3.771  4.972   -3.359  1.00 0.00 ? 40  TYR A HB3  5  
ATOM 6041  H HD1  . TYR A 1 10 ? -3.123  2.614   -6.140  1.00 0.00 ? 40  TYR A HD1  5  
ATOM 6042  H HD2  . TYR A 1 10 ? -2.167  3.720   -2.145  1.00 0.00 ? 40  TYR A HD2  5  
ATOM 6043  H HE1  . TYR A 1 10 ? -1.890  0.505   -5.858  1.00 0.00 ? 40  TYR A HE1  5  
ATOM 6044  H HE2  . TYR A 1 10 ? -0.931  1.614   -1.851  1.00 0.00 ? 40  TYR A HE2  5  
ATOM 6045  H HH   . TYR A 1 10 ? -0.978  -0.709  -2.901  1.00 0.00 ? 40  TYR A HH   5  
ATOM 6046  N N    . LEU A 1 11 ? -6.283  3.732   -3.474  1.00 0.00 ? 41  LEU A N    5  
ATOM 6047  C CA   . LEU A 1 11 ? -7.189  2.804   -2.809  1.00 0.00 ? 41  LEU A CA   5  
ATOM 6048  C C    . LEU A 1 11 ? -8.428  2.550   -3.662  1.00 0.00 ? 41  LEU A C    5  
ATOM 6049  O O    . LEU A 1 11 ? -9.009  1.465   -3.622  1.00 0.00 ? 41  LEU A O    5  
ATOM 6050  C CB   . LEU A 1 11 ? -7.601  3.353   -1.441  1.00 0.00 ? 41  LEU A CB   5  
ATOM 6051  C CG   . LEU A 1 11 ? -6.439  3.748   -0.527  1.00 0.00 ? 41  LEU A CG   5  
ATOM 6052  C CD1  . LEU A 1 11 ? -6.874  4.830   0.450   1.00 0.00 ? 41  LEU A CD1  5  
ATOM 6053  C CD2  . LEU A 1 11 ? -5.914  2.533   0.222   1.00 0.00 ? 41  LEU A CD2  5  
ATOM 6054  H H    . LEU A 1 11 ? -6.122  4.612   -3.074  1.00 0.00 ? 41  LEU A H    5  
ATOM 6055  H HA   . LEU A 1 11 ? -6.665  1.870   -2.670  1.00 0.00 ? 41  LEU A HA   5  
ATOM 6056  H HB2  . LEU A 1 11 ? -8.221  4.223   -1.597  1.00 0.00 ? 41  LEU A HB2  5  
ATOM 6057  H HB3  . LEU A 1 11 ? -8.186  2.600   -0.935  1.00 0.00 ? 41  LEU A HB3  5  
ATOM 6058  H HG   . LEU A 1 11 ? -5.635  4.146   -1.129  1.00 0.00 ? 41  LEU A HG   5  
ATOM 6059  H HD11 . LEU A 1 11 ? -6.059  5.524   0.603   1.00 0.00 ? 41  LEU A HD11 5  
ATOM 6060  H HD12 . LEU A 1 11 ? -7.142  4.377   1.392   1.00 0.00 ? 41  LEU A HD12 5  
ATOM 6061  H HD13 . LEU A 1 11 ? -7.726  5.358   0.047   1.00 0.00 ? 41  LEU A HD13 5  
ATOM 6062  H HD21 . LEU A 1 11 ? -6.743  1.916   0.536   1.00 0.00 ? 41  LEU A HD21 5  
ATOM 6063  H HD22 . LEU A 1 11 ? -5.357  2.856   1.088   1.00 0.00 ? 41  LEU A HD22 5  
ATOM 6064  H HD23 . LEU A 1 11 ? -5.267  1.961   -0.429  1.00 0.00 ? 41  LEU A HD23 5  
ATOM 6065  N N    . ASP A 1 12 ? -8.826  3.556   -4.434  1.00 0.00 ? 42  ASP A N    5  
ATOM 6066  C CA   . ASP A 1 12 ? -9.996  3.438   -5.297  1.00 0.00 ? 42  ASP A CA   5  
ATOM 6067  C C    . ASP A 1 12 ? -9.711  2.506   -6.467  1.00 0.00 ? 42  ASP A C    5  
ATOM 6068  O O    . ASP A 1 12 ? -10.597 1.794   -6.941  1.00 0.00 ? 42  ASP A O    5  
ATOM 6069  C CB   . ASP A 1 12 ? -10.420 4.817   -5.811  1.00 0.00 ? 42  ASP A CB   5  
ATOM 6070  C CG   . ASP A 1 12 ? -11.828 5.185   -5.384  1.00 0.00 ? 42  ASP A CG   5  
ATOM 6071  O OD1  . ASP A 1 12 ? -12.069 5.289   -4.162  1.00 0.00 ? 42  ASP A OD1  5  
ATOM 6072  O OD2  . ASP A 1 12 ? -12.689 5.366   -6.270  1.00 0.00 ? 42  ASP A OD2  5  
ATOM 6073  H H    . ASP A 1 12 ? -8.322  4.396   -4.424  1.00 0.00 ? 42  ASP A H    5  
ATOM 6074  H HA   . ASP A 1 12 ? -10.793 3.020   -4.711  1.00 0.00 ? 42  ASP A HA   5  
ATOM 6075  H HB2  . ASP A 1 12 ? -9.742  5.562   -5.424  1.00 0.00 ? 42  ASP A HB2  5  
ATOM 6076  H HB3  . ASP A 1 12 ? -10.377 4.824   -6.890  1.00 0.00 ? 42  ASP A HB3  5  
ATOM 6077  N N    . GLN A 1 13 ? -8.468  2.513   -6.920  1.00 0.00 ? 43  GLN A N    5  
ATOM 6078  C CA   . GLN A 1 13 ? -8.052  1.666   -8.032  1.00 0.00 ? 43  GLN A CA   5  
ATOM 6079  C C    . GLN A 1 13 ? -7.811  0.240   -7.560  1.00 0.00 ? 43  GLN A C    5  
ATOM 6080  O O    . GLN A 1 13 ? -8.023  -0.720  -8.303  1.00 0.00 ? 43  GLN A O    5  
ATOM 6081  C CB   . GLN A 1 13 ? -6.786  2.225   -8.685  1.00 0.00 ? 43  GLN A CB   5  
ATOM 6082  C CG   . GLN A 1 13 ? -6.675  1.906   -10.167 1.00 0.00 ? 43  GLN A CG   5  
ATOM 6083  C CD   . GLN A 1 13 ? -7.380  2.926   -11.038 1.00 0.00 ? 43  GLN A CD   5  
ATOM 6084  O OE1  . GLN A 1 13 ? -7.414  4.115   -10.718 1.00 0.00 ? 43  GLN A OE1  5  
ATOM 6085  N NE2  . GLN A 1 13 ? -7.949  2.466   -12.146 1.00 0.00 ? 43  GLN A NE2  5  
ATOM 6086  H H    . GLN A 1 13 ? -7.813  3.100   -6.493  1.00 0.00 ? 43  GLN A H    5  
ATOM 6087  H HA   . GLN A 1 13 ? -8.848  1.660   -8.755  1.00 0.00 ? 43  GLN A HA   5  
ATOM 6088  H HB2  . GLN A 1 13 ? -6.778  3.298   -8.568  1.00 0.00 ? 43  GLN A HB2  5  
ATOM 6089  H HB3  . GLN A 1 13 ? -5.924  1.810   -8.183  1.00 0.00 ? 43  GLN A HB3  5  
ATOM 6090  H HG2  . GLN A 1 13 ? -5.630  1.883   -10.439 1.00 0.00 ? 43  GLN A HG2  5  
ATOM 6091  H HG3  . GLN A 1 13 ? -7.113  0.935   -10.347 1.00 0.00 ? 43  GLN A HG3  5  
ATOM 6092  H HE21 . GLN A 1 13 ? -7.883  1.507   -12.336 1.00 0.00 ? 43  GLN A HE21 5  
ATOM 6093  H HE22 . GLN A 1 13 ? -8.413  3.105   -12.727 1.00 0.00 ? 43  GLN A HE22 5  
ATOM 6094  N N    . VAL A 1 14 ? -7.376  0.112   -6.316  1.00 0.00 ? 44  VAL A N    5  
ATOM 6095  C CA   . VAL A 1 14 ? -7.109  -1.193  -5.726  1.00 0.00 ? 44  VAL A CA   5  
ATOM 6096  C C    . VAL A 1 14 ? -8.407  -1.868  -5.298  1.00 0.00 ? 44  VAL A C    5  
ATOM 6097  O O    . VAL A 1 14 ? -8.512  -3.095  -5.299  1.00 0.00 ? 44  VAL A O    5  
ATOM 6098  C CB   . VAL A 1 14 ? -6.174  -1.079  -4.506  1.00 0.00 ? 44  VAL A CB   5  
ATOM 6099  C CG1  . VAL A 1 14 ? -5.771  -2.460  -4.010  1.00 0.00 ? 44  VAL A CG1  5  
ATOM 6100  C CG2  . VAL A 1 14 ? -4.946  -0.248  -4.847  1.00 0.00 ? 44  VAL A CG2  5  
ATOM 6101  H H    . VAL A 1 14 ? -7.236  0.918   -5.778  1.00 0.00 ? 44  VAL A H    5  
ATOM 6102  H HA   . VAL A 1 14 ? -6.624  -1.805  -6.472  1.00 0.00 ? 44  VAL A HA   5  
ATOM 6103  H HB   . VAL A 1 14 ? -6.710  -0.580  -3.712  1.00 0.00 ? 44  VAL A HB   5  
ATOM 6104  H HG11 . VAL A 1 14 ? -6.532  -2.841  -3.346  1.00 0.00 ? 44  VAL A HG11 5  
ATOM 6105  H HG12 . VAL A 1 14 ? -4.831  -2.392  -3.482  1.00 0.00 ? 44  VAL A HG12 5  
ATOM 6106  H HG13 . VAL A 1 14 ? -5.662  -3.127  -4.853  1.00 0.00 ? 44  VAL A HG13 5  
ATOM 6107  H HG21 . VAL A 1 14 ? -4.758  0.459   -4.052  1.00 0.00 ? 44  VAL A HG21 5  
ATOM 6108  H HG22 . VAL A 1 14 ? -5.115  0.285   -5.770  1.00 0.00 ? 44  VAL A HG22 5  
ATOM 6109  H HG23 . VAL A 1 14 ? -4.090  -0.897  -4.959  1.00 0.00 ? 44  VAL A HG23 5  
ATOM 6110  N N    . LYS A 1 15 ? -9.397  -1.056  -4.936  1.00 0.00 ? 45  LYS A N    5  
ATOM 6111  C CA   . LYS A 1 15 ? -10.692 -1.572  -4.511  1.00 0.00 ? 45  LYS A CA   5  
ATOM 6112  C C    . LYS A 1 15 ? -11.472 -2.116  -5.701  1.00 0.00 ? 45  LYS A C    5  
ATOM 6113  O O    . LYS A 1 15 ? -11.995 -3.231  -5.657  1.00 0.00 ? 45  LYS A O    5  
ATOM 6114  C CB   . LYS A 1 15 ? -11.498 -0.472  -3.816  1.00 0.00 ? 45  LYS A CB   5  
ATOM 6115  C CG   . LYS A 1 15 ? -12.610 -1.003  -2.926  1.00 0.00 ? 45  LYS A CG   5  
ATOM 6116  C CD   . LYS A 1 15 ? -12.902 -0.057  -1.772  1.00 0.00 ? 45  LYS A CD   5  
ATOM 6117  C CE   . LYS A 1 15 ? -14.397 0.119   -1.555  1.00 0.00 ? 45  LYS A CE   5  
ATOM 6118  N NZ   . LYS A 1 15 ? -14.829 1.526   -1.777  1.00 0.00 ? 45  LYS A NZ   5  
ATOM 6119  H H    . LYS A 1 15 ? -9.253  -0.087  -4.959  1.00 0.00 ? 45  LYS A H    5  
ATOM 6120  H HA   . LYS A 1 15 ? -10.517 -2.375  -3.811  1.00 0.00 ? 45  LYS A HA   5  
ATOM 6121  H HB2  . LYS A 1 15 ? -10.830 0.118   -3.206  1.00 0.00 ? 45  LYS A HB2  5  
ATOM 6122  H HB3  . LYS A 1 15 ? -11.941 0.163   -4.568  1.00 0.00 ? 45  LYS A HB3  5  
ATOM 6123  H HG2  . LYS A 1 15 ? -13.506 -1.120  -3.518  1.00 0.00 ? 45  LYS A HG2  5  
ATOM 6124  H HG3  . LYS A 1 15 ? -12.312 -1.962  -2.528  1.00 0.00 ? 45  LYS A HG3  5  
ATOM 6125  H HD2  . LYS A 1 15 ? -12.463 -0.458  -0.871  1.00 0.00 ? 45  LYS A HD2  5  
ATOM 6126  H HD3  . LYS A 1 15 ? -12.463 0.906   -1.990  1.00 0.00 ? 45  LYS A HD3  5  
ATOM 6127  H HE2  . LYS A 1 15 ? -14.927 -0.523  -2.243  1.00 0.00 ? 45  LYS A HE2  5  
ATOM 6128  H HE3  . LYS A 1 15 ? -14.636 -0.167  -0.542  1.00 0.00 ? 45  LYS A HE3  5  
ATOM 6129  H HZ1  . LYS A 1 15 ? -15.867 1.591   -1.748  1.00 0.00 ? 45  LYS A HZ1  5  
ATOM 6130  H HZ2  . LYS A 1 15 ? -14.496 1.860   -2.705  1.00 0.00 ? 45  LYS A HZ2  5  
ATOM 6131  H HZ3  . LYS A 1 15 ? -14.434 2.143   -1.038  1.00 0.00 ? 45  LYS A HZ3  5  
ATOM 6132  N N    . ILE A 1 16 ? -11.547 -1.324  -6.766  1.00 0.00 ? 46  ILE A N    5  
ATOM 6133  C CA   . ILE A 1 16 ? -12.261 -1.728  -7.970  1.00 0.00 ? 46  ILE A CA   5  
ATOM 6134  C C    . ILE A 1 16 ? -11.611 -2.955  -8.602  1.00 0.00 ? 46  ILE A C    5  
ATOM 6135  O O    . ILE A 1 16 ? -12.298 -3.871  -9.052  1.00 0.00 ? 46  ILE A O    5  
ATOM 6136  C CB   . ILE A 1 16 ? -12.309 -0.588  -9.007  1.00 0.00 ? 46  ILE A CB   5  
ATOM 6137  C CG1  . ILE A 1 16 ? -12.891 0.680   -8.379  1.00 0.00 ? 46  ILE A CG1  5  
ATOM 6138  C CG2  . ILE A 1 16 ? -13.130 -1.005  -10.221 1.00 0.00 ? 46  ILE A CG2  5  
ATOM 6139  C CD1  . ILE A 1 16 ? -12.512 1.947   -9.116  1.00 0.00 ? 46  ILE A CD1  5  
ATOM 6140  H H    . ILE A 1 16 ? -11.109 -0.448  -6.741  1.00 0.00 ? 46  ILE A H    5  
ATOM 6141  H HA   . ILE A 1 16 ? -13.274 -1.975  -7.689  1.00 0.00 ? 46  ILE A HA   5  
ATOM 6142  H HB   . ILE A 1 16 ? -11.302 -0.388  -9.338  1.00 0.00 ? 46  ILE A HB   5  
ATOM 6143  H HG12 . ILE A 1 16 ? -13.968 0.611   -8.374  1.00 0.00 ? 46  ILE A HG12 5  
ATOM 6144  H HG13 . ILE A 1 16 ? -12.535 0.767   -7.363  1.00 0.00 ? 46  ILE A HG13 5  
ATOM 6145  H HG21 . ILE A 1 16 ? -13.041 -0.253  -10.990 1.00 0.00 ? 46  ILE A HG21 5  
ATOM 6146  H HG22 . ILE A 1 16 ? -14.166 -1.108  -9.936  1.00 0.00 ? 46  ILE A HG22 5  
ATOM 6147  H HG23 . ILE A 1 16 ? -12.763 -1.949  -10.595 1.00 0.00 ? 46  ILE A HG23 5  
ATOM 6148  H HD11 . ILE A 1 16 ? -12.724 1.829   -10.168 1.00 0.00 ? 46  ILE A HD11 5  
ATOM 6149  H HD12 . ILE A 1 16 ? -11.458 2.141   -8.980  1.00 0.00 ? 46  ILE A HD12 5  
ATOM 6150  H HD13 . ILE A 1 16 ? -13.084 2.775   -8.723  1.00 0.00 ? 46  ILE A HD13 5  
ATOM 6151  N N    . ARG A 1 17 ? -10.281 -2.965  -8.632  1.00 0.00 ? 47  ARG A N    5  
ATOM 6152  C CA   . ARG A 1 17 ? -9.537  -4.080  -9.207  1.00 0.00 ? 47  ARG A CA   5  
ATOM 6153  C C    . ARG A 1 17 ? -9.881  -5.387  -8.497  1.00 0.00 ? 47  ARG A C    5  
ATOM 6154  O O    . ARG A 1 17 ? -9.808  -6.464  -9.088  1.00 0.00 ? 47  ARG A O    5  
ATOM 6155  C CB   . ARG A 1 17 ? -8.032  -3.815  -9.119  1.00 0.00 ? 47  ARG A CB   5  
ATOM 6156  C CG   . ARG A 1 17 ? -7.378  -3.572  -10.469 1.00 0.00 ? 47  ARG A CG   5  
ATOM 6157  C CD   . ARG A 1 17 ? -7.816  -2.246  -11.070 1.00 0.00 ? 47  ARG A CD   5  
ATOM 6158  N NE   . ARG A 1 17 ? -7.474  -2.148  -12.487 1.00 0.00 ? 47  ARG A NE   5  
ATOM 6159  C CZ   . ARG A 1 17 ? -6.246  -1.894  -12.937 1.00 0.00 ? 47  ARG A CZ   5  
ATOM 6160  N NH1  . ARG A 1 17 ? -5.244  -1.713  -12.087 1.00 0.00 ? 47  ARG A NH1  5  
ATOM 6161  N NH2  . ARG A 1 17 ? -6.022  -1.822  -14.242 1.00 0.00 ? 47  ARG A NH2  5  
ATOM 6162  H H    . ARG A 1 17 ? -9.789  -2.205  -8.256  1.00 0.00 ? 47  ARG A H    5  
ATOM 6163  H HA   . ARG A 1 17 ? -9.820  -4.165  -10.246 1.00 0.00 ? 47  ARG A HA   5  
ATOM 6164  H HB2  . ARG A 1 17 ? -7.867  -2.944  -8.502  1.00 0.00 ? 47  ARG A HB2  5  
ATOM 6165  H HB3  . ARG A 1 17 ? -7.552  -4.666  -8.659  1.00 0.00 ? 47  ARG A HB3  5  
ATOM 6166  H HG2  . ARG A 1 17 ? -6.305  -3.561  -10.342 1.00 0.00 ? 47  ARG A HG2  5  
ATOM 6167  H HG3  . ARG A 1 17 ? -7.654  -4.371  -11.142 1.00 0.00 ? 47  ARG A HG3  5  
ATOM 6168  H HD2  . ARG A 1 17 ? -8.886  -2.152  -10.961 1.00 0.00 ? 47  ARG A HD2  5  
ATOM 6169  H HD3  . ARG A 1 17 ? -7.328  -1.445  -10.535 1.00 0.00 ? 47  ARG A HD3  5  
ATOM 6170  H HE   . ARG A 1 17 ? -8.195  -2.277  -13.137 1.00 0.00 ? 47  ARG A HE   5  
ATOM 6171  H HH11 . ARG A 1 17 ? -5.407  -1.766  -11.101 1.00 0.00 ? 47  ARG A HH11 5  
ATOM 6172  H HH12 . ARG A 1 17 ? -4.325  -1.523  -12.431 1.00 0.00 ? 47  ARG A HH12 5  
ATOM 6173  H HH21 . ARG A 1 17 ? -6.774  -1.958  -14.887 1.00 0.00 ? 47  ARG A HH21 5  
ATOM 6174  H HH22 . ARG A 1 17 ? -5.101  -1.632  -14.581 1.00 0.00 ? 47  ARG A HH22 5  
ATOM 6175  N N    . PHE A 1 18 ? -10.257 -5.283  -7.225  1.00 0.00 ? 48  PHE A N    5  
ATOM 6176  C CA   . PHE A 1 18 ? -10.612 -6.456  -6.434  1.00 0.00 ? 48  PHE A CA   5  
ATOM 6177  C C    . PHE A 1 18 ? -12.067 -6.387  -5.984  1.00 0.00 ? 48  PHE A C    5  
ATOM 6178  O O    . PHE A 1 18 ? -12.397 -6.743  -4.852  1.00 0.00 ? 48  PHE A O    5  
ATOM 6179  C CB   . PHE A 1 18 ? -9.692  -6.572  -5.217  1.00 0.00 ? 48  PHE A CB   5  
ATOM 6180  C CG   . PHE A 1 18 ? -8.233  -6.601  -5.569  1.00 0.00 ? 48  PHE A CG   5  
ATOM 6181  C CD1  . PHE A 1 18 ? -7.765  -7.435  -6.572  1.00 0.00 ? 48  PHE A CD1  5  
ATOM 6182  C CD2  . PHE A 1 18 ? -7.328  -5.793  -4.897  1.00 0.00 ? 48  PHE A CD2  5  
ATOM 6183  C CE1  . PHE A 1 18 ? -6.422  -7.463  -6.899  1.00 0.00 ? 48  PHE A CE1  5  
ATOM 6184  C CE2  . PHE A 1 18 ? -5.985  -5.816  -5.220  1.00 0.00 ? 48  PHE A CE2  5  
ATOM 6185  C CZ   . PHE A 1 18 ? -5.532  -6.653  -6.222  1.00 0.00 ? 48  PHE A CZ   5  
ATOM 6186  H H    . PHE A 1 18 ? -10.296 -4.397  -6.809  1.00 0.00 ? 48  PHE A H    5  
ATOM 6187  H HA   . PHE A 1 18 ? -10.481 -7.328  -7.057  1.00 0.00 ? 48  PHE A HA   5  
ATOM 6188  H HB2  . PHE A 1 18 ? -9.860  -5.727  -4.566  1.00 0.00 ? 48  PHE A HB2  5  
ATOM 6189  H HB3  . PHE A 1 18 ? -9.925  -7.483  -4.685  1.00 0.00 ? 48  PHE A HB3  5  
ATOM 6190  H HD1  . PHE A 1 18 ? -8.461  -8.068  -7.101  1.00 0.00 ? 48  PHE A HD1  5  
ATOM 6191  H HD2  . PHE A 1 18 ? -7.682  -5.140  -4.114  1.00 0.00 ? 48  PHE A HD2  5  
ATOM 6192  H HE1  . PHE A 1 18 ? -6.070  -8.117  -7.681  1.00 0.00 ? 48  PHE A HE1  5  
ATOM 6193  H HE2  . PHE A 1 18 ? -5.290  -5.182  -4.690  1.00 0.00 ? 48  PHE A HE2  5  
ATOM 6194  H HZ   . PHE A 1 18 ? -4.483  -6.672  -6.475  1.00 0.00 ? 48  PHE A HZ   5  
ATOM 6195  N N    . GLY A 1 19 ? -12.935 -5.926  -6.879  1.00 0.00 ? 49  GLY A N    5  
ATOM 6196  C CA   . GLY A 1 19 ? -14.347 -5.816  -6.559  1.00 0.00 ? 49  GLY A CA   5  
ATOM 6197  C C    . GLY A 1 19 ? -14.943 -7.132  -6.097  1.00 0.00 ? 49  GLY A C    5  
ATOM 6198  O O    . GLY A 1 19 ? -15.907 -7.150  -5.332  1.00 0.00 ? 49  GLY A O    5  
ATOM 6199  H H    . GLY A 1 19 ? -12.614 -5.656  -7.765  1.00 0.00 ? 49  GLY A H    5  
ATOM 6200  H HA2  . GLY A 1 19 ? -14.471 -5.084  -5.775  1.00 0.00 ? 49  GLY A HA2  5  
ATOM 6201  H HA3  . GLY A 1 19 ? -14.879 -5.481  -7.437  1.00 0.00 ? 49  GLY A HA3  5  
ATOM 6202  N N    . SER A 1 20 ? -14.368 -8.236  -6.563  1.00 0.00 ? 50  SER A N    5  
ATOM 6203  C CA   . SER A 1 20 ? -14.848 -9.563  -6.192  1.00 0.00 ? 50  SER A CA   5  
ATOM 6204  C C    . SER A 1 20 ? -13.821 -10.302 -5.335  1.00 0.00 ? 50  SER A C    5  
ATOM 6205  O O    . SER A 1 20 ? -13.892 -11.522 -5.182  1.00 0.00 ? 50  SER A O    5  
ATOM 6206  C CB   . SER A 1 20 ? -15.167 -10.379 -7.448  1.00 0.00 ? 50  SER A CB   5  
ATOM 6207  O OG   . SER A 1 20 ? -16.566 -10.523 -7.620  1.00 0.00 ? 50  SER A OG   5  
ATOM 6208  H H    . SER A 1 20 ? -13.602 -8.157  -7.169  1.00 0.00 ? 50  SER A H    5  
ATOM 6209  H HA   . SER A 1 20 ? -15.753 -9.438  -5.618  1.00 0.00 ? 50  SER A HA   5  
ATOM 6210  H HB2  . SER A 1 20 ? -14.760 -9.878  -8.313  1.00 0.00 ? 50  SER A HB2  5  
ATOM 6211  H HB3  . SER A 1 20 ? -14.725 -11.362 -7.359  1.00 0.00 ? 50  SER A HB3  5  
ATOM 6212  H HG   . SER A 1 20 ? -16.845 -10.028 -8.394  1.00 0.00 ? 50  SER A HG   5  
ATOM 6213  N N    . ASP A 1 21 ? -12.869 -9.559  -4.776  1.00 0.00 ? 51  ASP A N    5  
ATOM 6214  C CA   . ASP A 1 21 ? -11.839 -10.145 -3.937  1.00 0.00 ? 51  ASP A CA   5  
ATOM 6215  C C    . ASP A 1 21 ? -11.537 -9.249  -2.737  1.00 0.00 ? 51  ASP A C    5  
ATOM 6216  O O    . ASP A 1 21 ? -10.421 -8.750  -2.587  1.00 0.00 ? 51  ASP A O    5  
ATOM 6217  C CB   . ASP A 1 21 ? -10.565 -10.388 -4.749  1.00 0.00 ? 51  ASP A CB   5  
ATOM 6218  C CG   . ASP A 1 21 ? -9.829  -11.639 -4.311  1.00 0.00 ? 51  ASP A CG   5  
ATOM 6219  O OD1  . ASP A 1 21 ? -10.493 -12.575 -3.817  1.00 0.00 ? 51  ASP A OD1  5  
ATOM 6220  O OD2  . ASP A 1 21 ? -8.591  -11.684 -4.463  1.00 0.00 ? 51  ASP A OD2  5  
ATOM 6221  H H    . ASP A 1 21 ? -12.863 -8.598  -4.927  1.00 0.00 ? 51  ASP A H    5  
ATOM 6222  H HA   . ASP A 1 21 ? -12.213 -11.086 -3.580  1.00 0.00 ? 51  ASP A HA   5  
ATOM 6223  H HB2  . ASP A 1 21 ? -10.824 -10.492 -5.792  1.00 0.00 ? 51  ASP A HB2  5  
ATOM 6224  H HB3  . ASP A 1 21 ? -9.902  -9.542  -4.630  1.00 0.00 ? 51  ASP A HB3  5  
ATOM 6225  N N    . PRO A 1 22 ? -12.534 -9.030  -1.861  1.00 0.00 ? 52  PRO A N    5  
ATOM 6226  C CA   . PRO A 1 22 ? -12.368 -8.188  -0.671  1.00 0.00 ? 52  PRO A CA   5  
ATOM 6227  C C    . PRO A 1 22 ? -11.178 -8.614  0.183   1.00 0.00 ? 52  PRO A C    5  
ATOM 6228  O O    . PRO A 1 22 ? -10.633 -7.816  0.947   1.00 0.00 ? 52  PRO A O    5  
ATOM 6229  C CB   . PRO A 1 22 ? -13.676 -8.393  0.098   1.00 0.00 ? 52  PRO A CB   5  
ATOM 6230  C CG   . PRO A 1 22 ? -14.667 -8.798  -0.937  1.00 0.00 ? 52  PRO A CG   5  
ATOM 6231  C CD   . PRO A 1 22 ? -13.896 -9.584  -1.962  1.00 0.00 ? 52  PRO A CD   5  
ATOM 6232  H HA   . PRO A 1 22 ? -12.264 -7.146  -0.936  1.00 0.00 ? 52  PRO A HA   5  
ATOM 6233  H HB2  . PRO A 1 22 ? -13.542 -9.166  0.842   1.00 0.00 ? 52  PRO A HB2  5  
ATOM 6234  H HB3  . PRO A 1 22 ? -13.963 -7.470  0.578   1.00 0.00 ? 52  PRO A HB3  5  
ATOM 6235  H HG2  . PRO A 1 22 ? -15.434 -9.414  -0.491  1.00 0.00 ? 52  PRO A HG2  5  
ATOM 6236  H HG3  . PRO A 1 22 ? -15.105 -7.921  -1.389  1.00 0.00 ? 52  PRO A HG3  5  
ATOM 6237  H HD2  . PRO A 1 22 ? -13.906 -10.635 -1.716  1.00 0.00 ? 52  PRO A HD2  5  
ATOM 6238  H HD3  . PRO A 1 22 ? -14.307 -9.421  -2.947  1.00 0.00 ? 52  PRO A HD3  5  
ATOM 6239  N N    . ALA A 1 23 ? -10.777 -9.876  0.050   1.00 0.00 ? 53  ALA A N    5  
ATOM 6240  C CA   . ALA A 1 23 ? -9.651  -10.406 0.810   1.00 0.00 ? 53  ALA A CA   5  
ATOM 6241  C C    . ALA A 1 23 ? -8.394  -9.570  0.596   1.00 0.00 ? 53  ALA A C    5  
ATOM 6242  O O    . ALA A 1 23 ? -7.728  -9.174  1.553   1.00 0.00 ? 53  ALA A O    5  
ATOM 6243  C CB   . ALA A 1 23 ? -9.393  -11.855 0.427   1.00 0.00 ? 53  ALA A CB   5  
ATOM 6244  H H    . ALA A 1 23 ? -11.251 -10.464 -0.574  1.00 0.00 ? 53  ALA A H    5  
ATOM 6245  H HA   . ALA A 1 23 ? -9.914  -10.378 1.858   1.00 0.00 ? 53  ALA A HA   5  
ATOM 6246  H HB1  . ALA A 1 23 ? -10.313 -12.306 0.083   1.00 0.00 ? 53  ALA A HB1  5  
ATOM 6247  H HB2  . ALA A 1 23 ? -9.027  -12.396 1.286   1.00 0.00 ? 53  ALA A HB2  5  
ATOM 6248  H HB3  . ALA A 1 23 ? -8.658  -11.893 -0.363  1.00 0.00 ? 53  ALA A HB3  5  
ATOM 6249  N N    . THR A 1 24 ? -8.074  -9.303  -0.667  1.00 0.00 ? 54  THR A N    5  
ATOM 6250  C CA   . THR A 1 24 ? -6.897  -8.513  -1.007  1.00 0.00 ? 54  THR A CA   5  
ATOM 6251  C C    . THR A 1 24 ? -6.985  -7.115  -0.404  1.00 0.00 ? 54  THR A C    5  
ATOM 6252  O O    . THR A 1 24 ? -6.031  -6.627  0.201   1.00 0.00 ? 54  THR A O    5  
ATOM 6253  C CB   . THR A 1 24 ? -6.744  -8.418  -2.526  1.00 0.00 ? 54  THR A CB   5  
ATOM 6254  O OG1  . THR A 1 24 ? -7.111  -9.638  -3.145  1.00 0.00 ? 54  THR A OG1  5  
ATOM 6255  C CG2  . THR A 1 24 ? -5.334  -8.086  -2.967  1.00 0.00 ? 54  THR A CG2  5  
ATOM 6256  H H    . THR A 1 24 ? -8.644  -9.647  -1.386  1.00 0.00 ? 54  THR A H    5  
ATOM 6257  H HA   . THR A 1 24 ? -6.032  -9.015  -0.599  1.00 0.00 ? 54  THR A HA   5  
ATOM 6258  H HB   . THR A 1 24 ? -7.397  -7.641  -2.895  1.00 0.00 ? 54  THR A HB   5  
ATOM 6259  H HG1  . THR A 1 24 ? -6.468  -10.316 -2.924  1.00 0.00 ? 54  THR A HG1  5  
ATOM 6260  H HG21 . THR A 1 24 ? -4.998  -7.197  -2.455  1.00 0.00 ? 54  THR A HG21 5  
ATOM 6261  H HG22 . THR A 1 24 ? -5.322  -7.914  -4.033  1.00 0.00 ? 54  THR A HG22 5  
ATOM 6262  H HG23 . THR A 1 24 ? -4.679  -8.910  -2.726  1.00 0.00 ? 54  THR A HG23 5  
ATOM 6263  N N    . TYR A 1 25 ? -8.137  -6.475  -0.574  1.00 0.00 ? 55  TYR A N    5  
ATOM 6264  C CA   . TYR A 1 25 ? -8.351  -5.131  -0.048  1.00 0.00 ? 55  TYR A CA   5  
ATOM 6265  C C    . TYR A 1 25 ? -8.266  -5.124  1.475   1.00 0.00 ? 55  TYR A C    5  
ATOM 6266  O O    . TYR A 1 25 ? -7.655  -4.234  2.069   1.00 0.00 ? 55  TYR A O    5  
ATOM 6267  C CB   . TYR A 1 25 ? -9.711  -4.595  -0.497  1.00 0.00 ? 55  TYR A CB   5  
ATOM 6268  C CG   . TYR A 1 25 ? -9.806  -3.087  -0.479  1.00 0.00 ? 55  TYR A CG   5  
ATOM 6269  C CD1  . TYR A 1 25 ? -9.268  -2.325  -1.509  1.00 0.00 ? 55  TYR A CD1  5  
ATOM 6270  C CD2  . TYR A 1 25 ? -10.432 -2.423  0.569   1.00 0.00 ? 55  TYR A CD2  5  
ATOM 6271  C CE1  . TYR A 1 25 ? -9.353  -0.946  -1.497  1.00 0.00 ? 55  TYR A CE1  5  
ATOM 6272  C CE2  . TYR A 1 25 ? -10.521 -1.044  0.589   1.00 0.00 ? 55  TYR A CE2  5  
ATOM 6273  C CZ   . TYR A 1 25 ? -9.980  -0.311  -0.446  1.00 0.00 ? 55  TYR A CZ   5  
ATOM 6274  O OH   . TYR A 1 25 ? -10.066 1.062   -0.429  1.00 0.00 ? 55  TYR A OH   5  
ATOM 6275  H H    . TYR A 1 25 ? -8.861  -6.915  -1.066  1.00 0.00 ? 55  TYR A H    5  
ATOM 6276  H HA   . TYR A 1 25 ? -7.574  -4.494  -0.442  1.00 0.00 ? 55  TYR A HA   5  
ATOM 6277  H HB2  . TYR A 1 25 ? -9.905  -4.927  -1.506  1.00 0.00 ? 55  TYR A HB2  5  
ATOM 6278  H HB3  . TYR A 1 25 ? -10.478 -4.985  0.158   1.00 0.00 ? 55  TYR A HB3  5  
ATOM 6279  H HD1  . TYR A 1 25 ? -8.778  -2.826  -2.331  1.00 0.00 ? 55  TYR A HD1  5  
ATOM 6280  H HD2  . TYR A 1 25 ? -10.856 -3.000  1.378   1.00 0.00 ? 55  TYR A HD2  5  
ATOM 6281  H HE1  . TYR A 1 25 ? -8.928  -0.372  -2.307  1.00 0.00 ? 55  TYR A HE1  5  
ATOM 6282  H HE2  . TYR A 1 25 ? -11.012 -0.547  1.412   1.00 0.00 ? 55  TYR A HE2  5  
ATOM 6283  H HH   . TYR A 1 25 ? -10.259 1.382   -1.314  1.00 0.00 ? 55  TYR A HH   5  
ATOM 6284  N N    . ASN A 1 26 ? -8.883  -6.121  2.103   1.00 0.00 ? 56  ASN A N    5  
ATOM 6285  C CA   . ASN A 1 26 ? -8.877  -6.228  3.557   1.00 0.00 ? 56  ASN A CA   5  
ATOM 6286  C C    . ASN A 1 26 ? -7.452  -6.351  4.089   1.00 0.00 ? 56  ASN A C    5  
ATOM 6287  O O    . ASN A 1 26 ? -7.086  -5.701  5.068   1.00 0.00 ? 56  ASN A O    5  
ATOM 6288  C CB   . ASN A 1 26 ? -9.706  -7.434  4.003   1.00 0.00 ? 56  ASN A CB   5  
ATOM 6289  C CG   . ASN A 1 26 ? -10.496 -7.155  5.267   1.00 0.00 ? 56  ASN A CG   5  
ATOM 6290  O OD1  . ASN A 1 26 ? -11.700 -7.405  5.328   1.00 0.00 ? 56  ASN A OD1  5  
ATOM 6291  N ND2  . ASN A 1 26 ? -9.820  -6.635  6.284   1.00 0.00 ? 56  ASN A ND2  5  
ATOM 6292  H H    . ASN A 1 26 ? -9.353  -6.799  1.575   1.00 0.00 ? 56  ASN A H    5  
ATOM 6293  H HA   . ASN A 1 26 ? -9.321  -5.329  3.957   1.00 0.00 ? 56  ASN A HA   5  
ATOM 6294  H HB2  . ASN A 1 26 ? -10.401 -7.695  3.219   1.00 0.00 ? 56  ASN A HB2  5  
ATOM 6295  H HB3  . ASN A 1 26 ? -9.047  -8.268  4.188   1.00 0.00 ? 56  ASN A HB3  5  
ATOM 6296  H HD21 . ASN A 1 26 ? -8.863  -6.461  6.164   1.00 0.00 ? 56  ASN A HD21 5  
ATOM 6297  H HD22 . ASN A 1 26 ? -10.306 -6.445  7.114   1.00 0.00 ? 56  ASN A HD22 5  
ATOM 6298  N N    . GLY A 1 27 ? -6.653  -7.188  3.436   1.00 0.00 ? 57  GLY A N    5  
ATOM 6299  C CA   . GLY A 1 27 ? -5.278  -7.379  3.857   1.00 0.00 ? 57  GLY A CA   5  
ATOM 6300  C C    . GLY A 1 27 ? -4.466  -6.100  3.789   1.00 0.00 ? 57  GLY A C    5  
ATOM 6301  O O    . GLY A 1 27 ? -3.705  -5.789  4.705   1.00 0.00 ? 57  GLY A O    5  
ATOM 6302  H H    . GLY A 1 27 ? -6.999  -7.679  2.662   1.00 0.00 ? 57  GLY A H    5  
ATOM 6303  H HA2  . GLY A 1 27 ? -5.272  -7.742  4.875   1.00 0.00 ? 57  GLY A HA2  5  
ATOM 6304  H HA3  . GLY A 1 27 ? -4.817  -8.120  3.221   1.00 0.00 ? 57  GLY A HA3  5  
ATOM 6305  N N    . PHE A 1 28 ? -4.630  -5.357  2.698   1.00 0.00 ? 58  PHE A N    5  
ATOM 6306  C CA   . PHE A 1 28 ? -3.907  -4.104  2.514   1.00 0.00 ? 58  PHE A CA   5  
ATOM 6307  C C    . PHE A 1 28 ? -4.212  -3.128  3.645   1.00 0.00 ? 58  PHE A C    5  
ATOM 6308  O O    . PHE A 1 28 ? -3.313  -2.472  4.172   1.00 0.00 ? 58  PHE A O    5  
ATOM 6309  C CB   . PHE A 1 28 ? -4.272  -3.474  1.168   1.00 0.00 ? 58  PHE A CB   5  
ATOM 6310  C CG   . PHE A 1 28 ? -3.436  -2.273  0.824   1.00 0.00 ? 58  PHE A CG   5  
ATOM 6311  C CD1  . PHE A 1 28 ? -2.125  -2.424  0.403   1.00 0.00 ? 58  PHE A CD1  5  
ATOM 6312  C CD2  . PHE A 1 28 ? -3.963  -0.996  0.921   1.00 0.00 ? 58  PHE A CD2  5  
ATOM 6313  C CE1  . PHE A 1 28 ? -1.354  -1.322  0.086   1.00 0.00 ? 58  PHE A CE1  5  
ATOM 6314  C CE2  . PHE A 1 28 ? -3.196  0.110   0.605   1.00 0.00 ? 58  PHE A CE2  5  
ATOM 6315  C CZ   . PHE A 1 28 ? -1.890  -0.053  0.186   1.00 0.00 ? 58  PHE A CZ   5  
ATOM 6316  H H    . PHE A 1 28 ? -5.252  -5.658  2.004   1.00 0.00 ? 58  PHE A H    5  
ATOM 6317  H HA   . PHE A 1 28 ? -2.851  -4.328  2.521   1.00 0.00 ? 58  PHE A HA   5  
ATOM 6318  H HB2  . PHE A 1 28 ? -4.138  -4.206  0.387   1.00 0.00 ? 58  PHE A HB2  5  
ATOM 6319  H HB3  . PHE A 1 28 ? -5.306  -3.164  1.193   1.00 0.00 ? 58  PHE A HB3  5  
ATOM 6320  H HD1  . PHE A 1 28 ? -1.704  -3.416  0.323   1.00 0.00 ? 58  PHE A HD1  5  
ATOM 6321  H HD2  . PHE A 1 28 ? -4.984  -0.867  1.248   1.00 0.00 ? 58  PHE A HD2  5  
ATOM 6322  H HE1  . PHE A 1 28 ? -0.332  -1.453  -0.241  1.00 0.00 ? 58  PHE A HE1  5  
ATOM 6323  H HE2  . PHE A 1 28 ? -3.618  1.102   0.685   1.00 0.00 ? 58  PHE A HE2  5  
ATOM 6324  H HZ   . PHE A 1 28 ? -1.289  0.809   -0.061  1.00 0.00 ? 58  PHE A HZ   5  
ATOM 6325  N N    . LEU A 1 29 ? -5.485  -3.039  4.015   1.00 0.00 ? 59  LEU A N    5  
ATOM 6326  C CA   . LEU A 1 29 ? -5.908  -2.145  5.087   1.00 0.00 ? 59  LEU A CA   5  
ATOM 6327  C C    . LEU A 1 29 ? -5.248  -2.528  6.407   1.00 0.00 ? 59  LEU A C    5  
ATOM 6328  O O    . LEU A 1 29 ? -4.885  -1.663  7.205   1.00 0.00 ? 59  LEU A O    5  
ATOM 6329  C CB   . LEU A 1 29 ? -7.430  -2.179  5.236   1.00 0.00 ? 59  LEU A CB   5  
ATOM 6330  C CG   . LEU A 1 29 ? -8.206  -1.447  4.140   1.00 0.00 ? 59  LEU A CG   5  
ATOM 6331  C CD1  . LEU A 1 29 ? -9.704  -1.582  4.365   1.00 0.00 ? 59  LEU A CD1  5  
ATOM 6332  C CD2  . LEU A 1 29 ? -7.802  0.019   4.092   1.00 0.00 ? 59  LEU A CD2  5  
ATOM 6333  H H    . LEU A 1 29 ? -6.156  -3.590  3.559   1.00 0.00 ? 59  LEU A H    5  
ATOM 6334  H HA   . LEU A 1 29 ? -5.604  -1.144  4.822   1.00 0.00 ? 59  LEU A HA   5  
ATOM 6335  H HB2  . LEU A 1 29 ? -7.747  -3.213  5.244   1.00 0.00 ? 59  LEU A HB2  5  
ATOM 6336  H HB3  . LEU A 1 29 ? -7.688  -1.735  6.186   1.00 0.00 ? 59  LEU A HB3  5  
ATOM 6337  H HG   . LEU A 1 29 ? -7.972  -1.891  3.184   1.00 0.00 ? 59  LEU A HG   5  
ATOM 6338  H HD11 . LEU A 1 29 ? -10.201 -0.682  4.035   1.00 0.00 ? 59  LEU A HD11 5  
ATOM 6339  H HD12 . LEU A 1 29 ? -9.897  -1.733  5.417   1.00 0.00 ? 59  LEU A HD12 5  
ATOM 6340  H HD13 . LEU A 1 29 ? -10.078 -2.427  3.806   1.00 0.00 ? 59  LEU A HD13 5  
ATOM 6341  H HD21 . LEU A 1 29 ? -7.015  0.151   3.365   1.00 0.00 ? 59  LEU A HD21 5  
ATOM 6342  H HD22 . LEU A 1 29 ? -7.450  0.328   5.065   1.00 0.00 ? 59  LEU A HD22 5  
ATOM 6343  H HD23 . LEU A 1 29 ? -8.656  0.618   3.812   1.00 0.00 ? 59  LEU A HD23 5  
ATOM 6344  N N    . GLU A 1 30 ? -5.093  -3.829  6.628   1.00 0.00 ? 60  GLU A N    5  
ATOM 6345  C CA   . GLU A 1 30 ? -4.474  -4.328  7.851   1.00 0.00 ? 60  GLU A CA   5  
ATOM 6346  C C    . GLU A 1 30 ? -3.042  -3.821  7.981   1.00 0.00 ? 60  GLU A C    5  
ATOM 6347  O O    . GLU A 1 30 ? -2.617  -3.401  9.057   1.00 0.00 ? 60  GLU A O    5  
ATOM 6348  C CB   . GLU A 1 30 ? -4.493  -5.858  7.869   1.00 0.00 ? 60  GLU A CB   5  
ATOM 6349  C CG   . GLU A 1 30 ? -4.879  -6.446  9.217   1.00 0.00 ? 60  GLU A CG   5  
ATOM 6350  C CD   . GLU A 1 30 ? -4.442  -7.889  9.370   1.00 0.00 ? 60  GLU A CD   5  
ATOM 6351  O OE1  . GLU A 1 30 ? -4.282  -8.574  8.338   1.00 0.00 ? 60  GLU A OE1  5  
ATOM 6352  O OE2  . GLU A 1 30 ? -4.260  -8.336  10.522  1.00 0.00 ? 60  GLU A OE2  5  
ATOM 6353  H H    . GLU A 1 30 ? -5.401  -4.469  5.954   1.00 0.00 ? 60  GLU A H    5  
ATOM 6354  H HA   . GLU A 1 30 ? -5.050  -3.960  8.686   1.00 0.00 ? 60  GLU A HA   5  
ATOM 6355  H HB2  . GLU A 1 30 ? -5.201  -6.207  7.132   1.00 0.00 ? 60  GLU A HB2  5  
ATOM 6356  H HB3  . GLU A 1 30 ? -3.510  -6.223  7.610   1.00 0.00 ? 60  GLU A HB3  5  
ATOM 6357  H HG2  . GLU A 1 30 ? -4.415  -5.861  9.996   1.00 0.00 ? 60  GLU A HG2  5  
ATOM 6358  H HG3  . GLU A 1 30 ? -5.953  -6.396  9.321   1.00 0.00 ? 60  GLU A HG3  5  
ATOM 6359  N N    . ILE A 1 31 ? -2.302  -3.862  6.877   1.00 0.00 ? 61  ILE A N    5  
ATOM 6360  C CA   . ILE A 1 31 ? -0.918  -3.407  6.869   1.00 0.00 ? 61  ILE A CA   5  
ATOM 6361  C C    . ILE A 1 31 ? -0.821  -1.937  7.265   1.00 0.00 ? 61  ILE A C    5  
ATOM 6362  O O    . ILE A 1 31 ? -0.164  -1.590  8.247   1.00 0.00 ? 61  ILE A O    5  
ATOM 6363  C CB   . ILE A 1 31 ? -0.269  -3.600  5.484   1.00 0.00 ? 61  ILE A CB   5  
ATOM 6364  C CG1  . ILE A 1 31 ? -0.447  -5.042  5.009   1.00 0.00 ? 61  ILE A CG1  5  
ATOM 6365  C CG2  . ILE A 1 31 ? 1.208   -3.233  5.533   1.00 0.00 ? 61  ILE A CG2  5  
ATOM 6366  C CD1  . ILE A 1 31 ? -0.732  -5.158  3.527   1.00 0.00 ? 61  ILE A CD1  5  
ATOM 6367  H H    . ILE A 1 31 ? -2.698  -4.208  6.050   1.00 0.00 ? 61  ILE A H    5  
ATOM 6368  H HA   . ILE A 1 31 ? -0.368  -3.999  7.587   1.00 0.00 ? 61  ILE A HA   5  
ATOM 6369  H HB   . ILE A 1 31 ? -0.756  -2.935  4.787   1.00 0.00 ? 61  ILE A HB   5  
ATOM 6370  H HG12 . ILE A 1 31 ? 0.456   -5.596  5.216   1.00 0.00 ? 61  ILE A HG12 5  
ATOM 6371  H HG13 . ILE A 1 31 ? -1.271  -5.492  5.542   1.00 0.00 ? 61  ILE A HG13 5  
ATOM 6372  H HG21 . ILE A 1 31 ? 1.581   -3.373  6.535   1.00 0.00 ? 61  ILE A HG21 5  
ATOM 6373  H HG22 . ILE A 1 31 ? 1.331   -2.199  5.243   1.00 0.00 ? 61  ILE A HG22 5  
ATOM 6374  H HG23 . ILE A 1 31 ? 1.758   -3.865  4.852   1.00 0.00 ? 61  ILE A HG23 5  
ATOM 6375  H HD11 . ILE A 1 31 ? -0.952  -4.179  3.126   1.00 0.00 ? 61  ILE A HD11 5  
ATOM 6376  H HD12 . ILE A 1 31 ? -1.579  -5.810  3.373   1.00 0.00 ? 61  ILE A HD12 5  
ATOM 6377  H HD13 . ILE A 1 31 ? 0.133   -5.566  3.025   1.00 0.00 ? 61  ILE A HD13 5  
ATOM 6378  N N    . MET A 1 32 ? -1.481  -1.077  6.494   1.00 0.00 ? 62  MET A N    5  
ATOM 6379  C CA   . MET A 1 32 ? -1.468  0.356   6.765   1.00 0.00 ? 62  MET A CA   5  
ATOM 6380  C C    . MET A 1 32 ? -2.023  0.652   8.156   1.00 0.00 ? 62  MET A C    5  
ATOM 6381  O O    . MET A 1 32 ? -1.451  1.440   8.908   1.00 0.00 ? 62  MET A O    5  
ATOM 6382  C CB   . MET A 1 32 ? -2.280  1.104   5.705   1.00 0.00 ? 62  MET A CB   5  
ATOM 6383  C CG   . MET A 1 32 ? -1.423  1.908   4.739   1.00 0.00 ? 62  MET A CG   5  
ATOM 6384  S SD   . MET A 1 32 ? -1.515  1.295   3.044   1.00 0.00 ? 62  MET A SD   5  
ATOM 6385  C CE   . MET A 1 32 ? -0.482  -0.164  3.156   1.00 0.00 ? 62  MET A CE   5  
ATOM 6386  H H    . MET A 1 32 ? -1.986  -1.414  5.726   1.00 0.00 ? 62  MET A H    5  
ATOM 6387  H HA   . MET A 1 32 ? -0.443  0.692   6.723   1.00 0.00 ? 62  MET A HA   5  
ATOM 6388  H HB2  . MET A 1 32 ? -2.852  0.386   5.134   1.00 0.00 ? 62  MET A HB2  5  
ATOM 6389  H HB3  . MET A 1 32 ? -2.962  1.781   6.197   1.00 0.00 ? 62  MET A HB3  5  
ATOM 6390  H HG2  . MET A 1 32 ? -1.757  2.934   4.752   1.00 0.00 ? 62  MET A HG2  5  
ATOM 6391  H HG3  . MET A 1 32 ? -0.396  1.861   5.069   1.00 0.00 ? 62  MET A HG3  5  
ATOM 6392  H HE1  . MET A 1 32 ? 0.467   0.030   2.677   1.00 0.00 ? 62  MET A HE1  5  
ATOM 6393  H HE2  . MET A 1 32 ? -0.972  -0.990  2.663   1.00 0.00 ? 62  MET A HE2  5  
ATOM 6394  H HE3  . MET A 1 32 ? -0.317  -0.410  4.194   1.00 0.00 ? 62  MET A HE3  5  
ATOM 6395  N N    . LYS A 1 33 ? -3.141  0.014   8.490   1.00 0.00 ? 63  LYS A N    5  
ATOM 6396  C CA   . LYS A 1 33 ? -3.771  0.209   9.791   1.00 0.00 ? 63  LYS A CA   5  
ATOM 6397  C C    . LYS A 1 33 ? -2.868  -0.289  10.914  1.00 0.00 ? 63  LYS A C    5  
ATOM 6398  O O    . LYS A 1 33 ? -2.791  0.321   11.980  1.00 0.00 ? 63  LYS A O    5  
ATOM 6399  C CB   . LYS A 1 33 ? -5.117  -0.516  9.842   1.00 0.00 ? 63  LYS A CB   5  
ATOM 6400  C CG   . LYS A 1 33 ? -5.859  -0.325  11.156  1.00 0.00 ? 63  LYS A CG   5  
ATOM 6401  C CD   . LYS A 1 33 ? -7.271  0.195   10.932  1.00 0.00 ? 63  LYS A CD   5  
ATOM 6402  C CE   . LYS A 1 33 ? -8.211  -0.917  10.497  1.00 0.00 ? 63  LYS A CE   5  
ATOM 6403  N NZ   . LYS A 1 33 ? -9.032  -1.425  11.630  1.00 0.00 ? 63  LYS A NZ   5  
ATOM 6404  H H    . LYS A 1 33 ? -3.550  -0.602  7.848   1.00 0.00 ? 63  LYS A H    5  
ATOM 6405  H HA   . LYS A 1 33 ? -3.937  1.268   9.922   1.00 0.00 ? 63  LYS A HA   5  
ATOM 6406  H HB2  . LYS A 1 33 ? -5.742  -0.148  9.042   1.00 0.00 ? 63  LYS A HB2  5  
ATOM 6407  H HB3  . LYS A 1 33 ? -4.949  -1.573  9.699   1.00 0.00 ? 63  LYS A HB3  5  
ATOM 6408  H HG2  . LYS A 1 33 ? -5.915  -1.274  11.669  1.00 0.00 ? 63  LYS A HG2  5  
ATOM 6409  H HG3  . LYS A 1 33 ? -5.317  0.384   11.765  1.00 0.00 ? 63  LYS A HG3  5  
ATOM 6410  H HD2  . LYS A 1 33 ? -7.638  0.623   11.853  1.00 0.00 ? 63  LYS A HD2  5  
ATOM 6411  H HD3  . LYS A 1 33 ? -7.247  0.954   10.164  1.00 0.00 ? 63  LYS A HD3  5  
ATOM 6412  H HE2  . LYS A 1 33 ? -8.871  -0.535  9.731   1.00 0.00 ? 63  LYS A HE2  5  
ATOM 6413  H HE3  . LYS A 1 33 ? -7.626  -1.730  10.094  1.00 0.00 ? 63  LYS A HE3  5  
ATOM 6414  H HZ1  . LYS A 1 33 ? -9.674  -0.681  11.969  1.00 0.00 ? 63  LYS A HZ1  5  
ATOM 6415  H HZ2  . LYS A 1 33 ? -8.415  -1.719  12.414  1.00 0.00 ? 63  LYS A HZ2  5  
ATOM 6416  H HZ3  . LYS A 1 33 ? -9.597  -2.243  11.325  1.00 0.00 ? 63  LYS A HZ3  5  
ATOM 6417  N N    . GLU A 1 34 ? -2.184  -1.402  10.666  1.00 0.00 ? 64  GLU A N    5  
ATOM 6418  C CA   . GLU A 1 34 ? -1.286  -1.984  11.657  1.00 0.00 ? 64  GLU A CA   5  
ATOM 6419  C C    . GLU A 1 34 ? 0.015   -1.192  11.741  1.00 0.00 ? 64  GLU A C    5  
ATOM 6420  O O    . GLU A 1 34 ? 0.621   -1.086  12.806  1.00 0.00 ? 64  GLU A O    5  
ATOM 6421  C CB   . GLU A 1 34 ? -0.986  -3.443  11.313  1.00 0.00 ? 64  GLU A CB   5  
ATOM 6422  C CG   . GLU A 1 34 ? -0.249  -4.189  12.413  1.00 0.00 ? 64  GLU A CG   5  
ATOM 6423  C CD   . GLU A 1 34 ? -0.059  -5.659  12.095  1.00 0.00 ? 64  GLU A CD   5  
ATOM 6424  O OE1  . GLU A 1 34 ? -1.053  -6.414  12.159  1.00 0.00 ? 64  GLU A OE1  5  
ATOM 6425  O OE2  . GLU A 1 34 ? 1.083   -6.056  11.782  1.00 0.00 ? 64  GLU A OE2  5  
ATOM 6426  H H    . GLU A 1 34 ? -2.288  -1.844  9.797   1.00 0.00 ? 64  GLU A H    5  
ATOM 6427  H HA   . GLU A 1 34 ? -1.779  -1.943  12.616  1.00 0.00 ? 64  GLU A HA   5  
ATOM 6428  H HB2  . GLU A 1 34 ? -1.918  -3.955  11.122  1.00 0.00 ? 64  GLU A HB2  5  
ATOM 6429  H HB3  . GLU A 1 34 ? -0.380  -3.474  10.418  1.00 0.00 ? 64  GLU A HB3  5  
ATOM 6430  H HG2  . GLU A 1 34 ? 0.722   -3.737  12.549  1.00 0.00 ? 64  GLU A HG2  5  
ATOM 6431  H HG3  . GLU A 1 34 ? -0.816  -4.104  13.329  1.00 0.00 ? 64  GLU A HG3  5  
ATOM 6432  N N    . PHE A 1 35 ? 0.439   -0.639  10.609  1.00 0.00 ? 65  PHE A N    5  
ATOM 6433  C CA   . PHE A 1 35 ? 1.668   0.143   10.555  1.00 0.00 ? 65  PHE A CA   5  
ATOM 6434  C C    . PHE A 1 35 ? 1.532   1.426   11.371  1.00 0.00 ? 65  PHE A C    5  
ATOM 6435  O O    . PHE A 1 35 ? 2.489   1.875   12.002  1.00 0.00 ? 65  PHE A O    5  
ATOM 6436  C CB   . PHE A 1 35 ? 2.019   0.482   9.105   1.00 0.00 ? 65  PHE A CB   5  
ATOM 6437  C CG   . PHE A 1 35 ? 3.334   1.195   8.957   1.00 0.00 ? 65  PHE A CG   5  
ATOM 6438  C CD1  . PHE A 1 35 ? 4.516   0.479   8.847   1.00 0.00 ? 65  PHE A CD1  5  
ATOM 6439  C CD2  . PHE A 1 35 ? 3.387   2.579   8.926   1.00 0.00 ? 65  PHE A CD2  5  
ATOM 6440  C CE1  . PHE A 1 35 ? 5.727   1.132   8.711   1.00 0.00 ? 65  PHE A CE1  5  
ATOM 6441  C CE2  . PHE A 1 35 ? 4.595   3.237   8.790   1.00 0.00 ? 65  PHE A CE2  5  
ATOM 6442  C CZ   . PHE A 1 35 ? 5.765   2.513   8.682   1.00 0.00 ? 65  PHE A CZ   5  
ATOM 6443  H H    . PHE A 1 35 ? -0.087  -0.758  9.791   1.00 0.00 ? 65  PHE A H    5  
ATOM 6444  H HA   . PHE A 1 35 ? 2.461   -0.456  10.977  1.00 0.00 ? 65  PHE A HA   5  
ATOM 6445  H HB2  . PHE A 1 35 ? 2.070   -0.431  8.531   1.00 0.00 ? 65  PHE A HB2  5  
ATOM 6446  H HB3  . PHE A 1 35 ? 1.248   1.118   8.695   1.00 0.00 ? 65  PHE A HB3  5  
ATOM 6447  H HD1  . PHE A 1 35 ? 4.486   -0.599  8.870   1.00 0.00 ? 65  PHE A HD1  5  
ATOM 6448  H HD2  . PHE A 1 35 ? 2.472   3.147   9.012   1.00 0.00 ? 65  PHE A HD2  5  
ATOM 6449  H HE1  . PHE A 1 35 ? 6.640   0.563   8.626   1.00 0.00 ? 65  PHE A HE1  5  
ATOM 6450  H HE2  . PHE A 1 35 ? 4.623   4.316   8.768   1.00 0.00 ? 65  PHE A HE2  5  
ATOM 6451  H HZ   . PHE A 1 35 ? 6.711   3.025   8.576   1.00 0.00 ? 65  PHE A HZ   5  
ATOM 6452  N N    . LYS A 1 36 ? 0.338   2.009   11.354  1.00 0.00 ? 66  LYS A N    5  
ATOM 6453  C CA   . LYS A 1 36 ? 0.077   3.239   12.093  1.00 0.00 ? 66  LYS A CA   5  
ATOM 6454  C C    . LYS A 1 36 ? 0.335   3.039   13.583  1.00 0.00 ? 66  LYS A C    5  
ATOM 6455  O O    . LYS A 1 36 ? 0.749   3.965   14.282  1.00 0.00 ? 66  LYS A O    5  
ATOM 6456  C CB   . LYS A 1 36 ? -1.365  3.699   11.866  1.00 0.00 ? 66  LYS A CB   5  
ATOM 6457  C CG   . LYS A 1 36 ? -1.479  4.915   10.962  1.00 0.00 ? 66  LYS A CG   5  
ATOM 6458  C CD   . LYS A 1 36 ? -2.913  5.414   10.879  1.00 0.00 ? 66  LYS A CD   5  
ATOM 6459  C CE   . LYS A 1 36 ? -2.968  6.919   10.674  1.00 0.00 ? 66  LYS A CE   5  
ATOM 6460  N NZ   . LYS A 1 36 ? -2.541  7.661   11.891  1.00 0.00 ? 66  LYS A NZ   5  
ATOM 6461  H H    . LYS A 1 36 ? -0.385  1.602   10.831  1.00 0.00 ? 66  LYS A H    5  
ATOM 6462  H HA   . LYS A 1 36 ? 0.751   3.997   11.722  1.00 0.00 ? 66  LYS A HA   5  
ATOM 6463  H HB2  . LYS A 1 36 ? -1.921  2.889   11.416  1.00 0.00 ? 66  LYS A HB2  5  
ATOM 6464  H HB3  . LYS A 1 36 ? -1.810  3.942   12.820  1.00 0.00 ? 66  LYS A HB3  5  
ATOM 6465  H HG2  . LYS A 1 36 ? -0.858  5.705   11.357  1.00 0.00 ? 66  LYS A HG2  5  
ATOM 6466  H HG3  . LYS A 1 36 ? -1.141  4.649   9.972   1.00 0.00 ? 66  LYS A HG3  5  
ATOM 6467  H HD2  . LYS A 1 36 ? -3.405  4.930   10.049  1.00 0.00 ? 66  LYS A HD2  5  
ATOM 6468  H HD3  . LYS A 1 36 ? -3.425  5.166   11.797  1.00 0.00 ? 66  LYS A HD3  5  
ATOM 6469  H HE2  . LYS A 1 36 ? -2.314  7.182   9.855   1.00 0.00 ? 66  LYS A HE2  5  
ATOM 6470  H HE3  . LYS A 1 36 ? -3.982  7.200   10.429  1.00 0.00 ? 66  LYS A HE3  5  
ATOM 6471  H HZ1  . LYS A 1 36 ? -2.025  8.523   11.622  1.00 0.00 ? 66  LYS A HZ1  5  
ATOM 6472  H HZ2  . LYS A 1 36 ? -1.919  7.065   12.474  1.00 0.00 ? 66  LYS A HZ2  5  
ATOM 6473  H HZ3  . LYS A 1 36 ? -3.372  7.931   12.455  1.00 0.00 ? 66  LYS A HZ3  5  
ATOM 6474  N N    . SER A 1 37 ? 0.088   1.825   14.063  1.00 0.00 ? 67  SER A N    5  
ATOM 6475  C CA   . SER A 1 37 ? 0.293   1.501   15.470  1.00 0.00 ? 67  SER A CA   5  
ATOM 6476  C C    . SER A 1 37 ? 1.767   1.614   15.856  1.00 0.00 ? 67  SER A C    5  
ATOM 6477  O O    . SER A 1 37 ? 2.103   1.684   17.038  1.00 0.00 ? 67  SER A O    5  
ATOM 6478  C CB   . SER A 1 37 ? -0.217  0.090   15.769  1.00 0.00 ? 67  SER A CB   5  
ATOM 6479  O OG   . SER A 1 37 ? -0.834  0.031   17.042  1.00 0.00 ? 67  SER A OG   5  
ATOM 6480  H H    . SER A 1 37 ? -0.240  1.130   13.457  1.00 0.00 ? 67  SER A H    5  
ATOM 6481  H HA   . SER A 1 37 ? -0.273  2.208   16.054  1.00 0.00 ? 67  SER A HA   5  
ATOM 6482  H HB2  . SER A 1 37 ? -0.939  -0.196  15.018  1.00 0.00 ? 67  SER A HB2  5  
ATOM 6483  H HB3  . SER A 1 37 ? 0.613   -0.601  15.751  1.00 0.00 ? 67  SER A HB3  5  
ATOM 6484  H HG   . SER A 1 37 ? -1.340  -0.782  17.116  1.00 0.00 ? 67  SER A HG   5  
ATOM 6485  N N    . GLN A 1 38 ? 2.644   1.630   14.854  1.00 0.00 ? 68  GLN A N    5  
ATOM 6486  C CA   . GLN A 1 38 ? 4.080   1.732   15.093  1.00 0.00 ? 68  GLN A CA   5  
ATOM 6487  C C    . GLN A 1 38 ? 4.618   0.453   15.729  1.00 0.00 ? 68  GLN A C    5  
ATOM 6488  O O    . GLN A 1 38 ? 5.451   0.500   16.634  1.00 0.00 ? 68  GLN A O    5  
ATOM 6489  C CB   . GLN A 1 38 ? 4.389   2.936   15.989  1.00 0.00 ? 68  GLN A CB   5  
ATOM 6490  C CG   . GLN A 1 38 ? 5.512   3.815   15.461  1.00 0.00 ? 68  GLN A CG   5  
ATOM 6491  C CD   . GLN A 1 38 ? 6.822   3.065   15.315  1.00 0.00 ? 68  GLN A CD   5  
ATOM 6492  O OE1  . GLN A 1 38 ? 7.568   2.903   16.281  1.00 0.00 ? 68  GLN A OE1  5  
ATOM 6493  N NE2  . GLN A 1 38 ? 7.107   2.605   14.104  1.00 0.00 ? 68  GLN A NE2  5  
ATOM 6494  H H    . GLN A 1 38 ? 2.318   1.570   13.932  1.00 0.00 ? 68  GLN A H    5  
ATOM 6495  H HA   . GLN A 1 38 ? 4.564   1.873   14.138  1.00 0.00 ? 68  GLN A HA   5  
ATOM 6496  H HB2  . GLN A 1 38 ? 3.499   3.542   16.079  1.00 0.00 ? 68  GLN A HB2  5  
ATOM 6497  H HB3  . GLN A 1 38 ? 4.671   2.579   16.970  1.00 0.00 ? 68  GLN A HB3  5  
ATOM 6498  H HG2  . GLN A 1 38 ? 5.226   4.200   14.494  1.00 0.00 ? 68  GLN A HG2  5  
ATOM 6499  H HG3  . GLN A 1 38 ? 5.659   4.638   16.146  1.00 0.00 ? 68  GLN A HG3  5  
ATOM 6500  H HE21 . GLN A 1 38 ? 6.465   2.772   13.383  1.00 0.00 ? 68  GLN A HE21 5  
ATOM 6501  H HE22 . GLN A 1 38 ? 7.947   2.115   13.981  1.00 0.00 ? 68  GLN A HE22 5  
ATOM 6502  N N    . SER A 1 39 ? 4.135   -0.688  15.248  1.00 0.00 ? 69  SER A N    5  
ATOM 6503  C CA   . SER A 1 39 ? 4.567   -1.981  15.767  1.00 0.00 ? 69  SER A CA   5  
ATOM 6504  C C    . SER A 1 39 ? 5.351   -2.755  14.713  1.00 0.00 ? 69  SER A C    5  
ATOM 6505  O O    . SER A 1 39 ? 6.434   -3.272  14.986  1.00 0.00 ? 69  SER A O    5  
ATOM 6506  C CB   . SER A 1 39 ? 3.359   -2.799  16.227  1.00 0.00 ? 69  SER A CB   5  
ATOM 6507  O OG   . SER A 1 39 ? 2.656   -3.336  15.120  1.00 0.00 ? 69  SER A OG   5  
ATOM 6508  H H    . SER A 1 39 ? 3.473   -0.661  14.525  1.00 0.00 ? 69  SER A H    5  
ATOM 6509  H HA   . SER A 1 39 ? 5.211   -1.799  16.616  1.00 0.00 ? 69  SER A HA   5  
ATOM 6510  H HB2  . SER A 1 39 ? 3.695   -3.612  16.853  1.00 0.00 ? 69  SER A HB2  5  
ATOM 6511  H HB3  . SER A 1 39 ? 2.690   -2.165  16.789  1.00 0.00 ? 69  SER A HB3  5  
ATOM 6512  H HG   . SER A 1 39 ? 1.763   -2.984  15.106  1.00 0.00 ? 69  SER A HG   5  
ATOM 6513  N N    . ILE A 1 40 ? 4.795   -2.831  13.507  1.00 0.00 ? 70  ILE A N    5  
ATOM 6514  C CA   . ILE A 1 40 ? 5.443   -3.543  12.413  1.00 0.00 ? 70  ILE A CA   5  
ATOM 6515  C C    . ILE A 1 40 ? 6.556   -2.700  11.794  1.00 0.00 ? 70  ILE A C    5  
ATOM 6516  O O    . ILE A 1 40 ? 6.548   -1.474  11.895  1.00 0.00 ? 70  ILE A O    5  
ATOM 6517  C CB   . ILE A 1 40 ? 4.428   -3.930  11.316  1.00 0.00 ? 70  ILE A CB   5  
ATOM 6518  C CG1  . ILE A 1 40 ? 5.106   -4.772  10.234  1.00 0.00 ? 70  ILE A CG1  5  
ATOM 6519  C CG2  . ILE A 1 40 ? 3.795   -2.686  10.709  1.00 0.00 ? 70  ILE A CG2  5  
ATOM 6520  C CD1  . ILE A 1 40 ? 4.141   -5.621  9.435   1.00 0.00 ? 70  ILE A CD1  5  
ATOM 6521  H H    . ILE A 1 40 ? 3.930   -2.398  13.352  1.00 0.00 ? 70  ILE A H    5  
ATOM 6522  H HA   . ILE A 1 40 ? 5.872   -4.449  12.813  1.00 0.00 ? 70  ILE A HA   5  
ATOM 6523  H HB   . ILE A 1 40 ? 3.644   -4.513  11.775  1.00 0.00 ? 70  ILE A HB   5  
ATOM 6524  H HG12 . ILE A 1 40 ? 5.619   -4.118  9.545   1.00 0.00 ? 70  ILE A HG12 5  
ATOM 6525  H HG13 . ILE A 1 40 ? 5.825   -5.433  10.697  1.00 0.00 ? 70  ILE A HG13 5  
ATOM 6526  H HG21 . ILE A 1 40 ? 4.344   -2.396  9.826   1.00 0.00 ? 70  ILE A HG21 5  
ATOM 6527  H HG22 . ILE A 1 40 ? 3.821   -1.881  11.430  1.00 0.00 ? 70  ILE A HG22 5  
ATOM 6528  H HG23 . ILE A 1 40 ? 2.770   -2.897  10.442  1.00 0.00 ? 70  ILE A HG23 5  
ATOM 6529  H HD11 . ILE A 1 40 ? 4.477   -5.682  8.411   1.00 0.00 ? 70  ILE A HD11 5  
ATOM 6530  H HD12 . ILE A 1 40 ? 3.159   -5.173  9.465   1.00 0.00 ? 70  ILE A HD12 5  
ATOM 6531  H HD13 . ILE A 1 40 ? 4.097   -6.613  9.860   1.00 0.00 ? 70  ILE A HD13 5  
ATOM 6532  N N    . ASP A 1 41 ? 7.512   -3.368  11.157  1.00 0.00 ? 71  ASP A N    5  
ATOM 6533  C CA   . ASP A 1 41 ? 8.632   -2.681  10.525  1.00 0.00 ? 71  ASP A CA   5  
ATOM 6534  C C    . ASP A 1 41 ? 8.284   -2.266  9.100   1.00 0.00 ? 71  ASP A C    5  
ATOM 6535  O O    . ASP A 1 41 ? 7.224   -2.618  8.581   1.00 0.00 ? 71  ASP A O    5  
ATOM 6536  C CB   . ASP A 1 41 ? 9.870   -3.581  10.518  1.00 0.00 ? 71  ASP A CB   5  
ATOM 6537  C CG   . ASP A 1 41 ? 11.142  -2.814  10.823  1.00 0.00 ? 71  ASP A CG   5  
ATOM 6538  O OD1  . ASP A 1 41 ? 11.460  -1.868  10.071  1.00 0.00 ? 71  ASP A OD1  5  
ATOM 6539  O OD2  . ASP A 1 41 ? 11.822  -3.160  11.812  1.00 0.00 ? 71  ASP A OD2  5  
ATOM 6540  H H    . ASP A 1 41 ? 7.464   -4.346  11.112  1.00 0.00 ? 71  ASP A H    5  
ATOM 6541  H HA   . ASP A 1 41 ? 8.846   -1.795  11.103  1.00 0.00 ? 71  ASP A HA   5  
ATOM 6542  H HB2  . ASP A 1 41 ? 9.751   -4.353  11.263  1.00 0.00 ? 71  ASP A HB2  5  
ATOM 6543  H HB3  . ASP A 1 41 ? 9.971   -4.037  9.545   1.00 0.00 ? 71  ASP A HB3  5  
ATOM 6544  N N    . THR A 1 42 ? 9.182   -1.515  8.471   1.00 0.00 ? 72  THR A N    5  
ATOM 6545  C CA   . THR A 1 42 ? 8.972   -1.051  7.104   1.00 0.00 ? 72  THR A CA   5  
ATOM 6546  C C    . THR A 1 42 ? 9.110   -2.202  6.110   1.00 0.00 ? 72  THR A C    5  
ATOM 6547  O O    . THR A 1 42 ? 8.226   -2.425  5.281   1.00 0.00 ? 72  THR A O    5  
ATOM 6548  C CB   . THR A 1 42 ? 9.966   0.061   6.759   1.00 0.00 ? 72  THR A CB   5  
ATOM 6549  O OG1  . THR A 1 42 ? 10.601  0.551   7.928   1.00 0.00 ? 72  THR A OG1  5  
ATOM 6550  C CG2  . THR A 1 42 ? 9.325   1.239   6.059   1.00 0.00 ? 72  THR A CG2  5  
ATOM 6551  H H    . THR A 1 42 ? 10.009  -1.269  8.938   1.00 0.00 ? 72  THR A H    5  
ATOM 6552  H HA   . THR A 1 42 ? 7.970   -0.656  7.042   1.00 0.00 ? 72  THR A HA   5  
ATOM 6553  H HB   . THR A 1 42 ? 10.727  -0.339  6.103   1.00 0.00 ? 72  THR A HB   5  
ATOM 6554  H HG1  . THR A 1 42 ? 11.458  0.130   8.028   1.00 0.00 ? 72  THR A HG1  5  
ATOM 6555  H HG21 . THR A 1 42 ? 10.067  2.004   5.886   1.00 0.00 ? 72  THR A HG21 5  
ATOM 6556  H HG22 . THR A 1 42 ? 8.535   1.638   6.677   1.00 0.00 ? 72  THR A HG22 5  
ATOM 6557  H HG23 . THR A 1 42 ? 8.914   0.916   5.113   1.00 0.00 ? 72  THR A HG23 5  
ATOM 6558  N N    . PRO A 1 43 ? 10.223  -2.954  6.179   1.00 0.00 ? 73  PRO A N    5  
ATOM 6559  C CA   . PRO A 1 43 ? 10.467  -4.087  5.279   1.00 0.00 ? 73  PRO A CA   5  
ATOM 6560  C C    . PRO A 1 43 ? 9.277   -5.036  5.206   1.00 0.00 ? 73  PRO A C    5  
ATOM 6561  O O    . PRO A 1 43 ? 8.989   -5.606  4.153   1.00 0.00 ? 73  PRO A O    5  
ATOM 6562  C CB   . PRO A 1 43 ? 11.672  -4.785  5.910   1.00 0.00 ? 73  PRO A CB   5  
ATOM 6563  C CG   . PRO A 1 43 ? 12.390  -3.708  6.646   1.00 0.00 ? 73  PRO A CG   5  
ATOM 6564  C CD   . PRO A 1 43 ? 11.329  -2.761  7.138   1.00 0.00 ? 73  PRO A CD   5  
ATOM 6565  H HA   . PRO A 1 43 ? 10.722  -3.752  4.284   1.00 0.00 ? 73  PRO A HA   5  
ATOM 6566  H HB2  . PRO A 1 43 ? 11.331  -5.562  6.579   1.00 0.00 ? 73  PRO A HB2  5  
ATOM 6567  H HB3  . PRO A 1 43 ? 12.291  -5.214  5.136   1.00 0.00 ? 73  PRO A HB3  5  
ATOM 6568  H HG2  . PRO A 1 43 ? 12.931  -4.130  7.481   1.00 0.00 ? 73  PRO A HG2  5  
ATOM 6569  H HG3  . PRO A 1 43 ? 13.067  -3.195  5.980   1.00 0.00 ? 73  PRO A HG3  5  
ATOM 6570  H HD2  . PRO A 1 43 ? 11.021  -3.027  8.138   1.00 0.00 ? 73  PRO A HD2  5  
ATOM 6571  H HD3  . PRO A 1 43 ? 11.689  -1.744  7.111   1.00 0.00 ? 73  PRO A HD3  5  
ATOM 6572  N N    . GLY A 1 44 ? 8.589   -5.201  6.331   1.00 0.00 ? 74  GLY A N    5  
ATOM 6573  C CA   . GLY A 1 44 ? 7.437   -6.082  6.373   1.00 0.00 ? 74  GLY A CA   5  
ATOM 6574  C C    . GLY A 1 44 ? 6.260   -5.532  5.592   1.00 0.00 ? 74  GLY A C    5  
ATOM 6575  O O    . GLY A 1 44 ? 5.452   -6.291  5.056   1.00 0.00 ? 74  GLY A O    5  
ATOM 6576  H H    . GLY A 1 44 ? 8.866   -4.721  7.139   1.00 0.00 ? 74  GLY A H    5  
ATOM 6577  H HA2  . GLY A 1 44 ? 7.714   -7.040  5.959   1.00 0.00 ? 74  GLY A HA2  5  
ATOM 6578  H HA3  . GLY A 1 44 ? 7.140   -6.219  7.402   1.00 0.00 ? 74  GLY A HA3  5  
ATOM 6579  N N    . VAL A 1 45 ? 6.163   -4.208  5.528   1.00 0.00 ? 75  VAL A N    5  
ATOM 6580  C CA   . VAL A 1 45 ? 5.078   -3.555  4.808   1.00 0.00 ? 75  VAL A CA   5  
ATOM 6581  C C    . VAL A 1 45 ? 5.242   -3.723  3.300   1.00 0.00 ? 75  VAL A C    5  
ATOM 6582  O O    . VAL A 1 45 ? 4.293   -4.068  2.598   1.00 0.00 ? 75  VAL A O    5  
ATOM 6583  C CB   . VAL A 1 45 ? 5.006   -2.051  5.140   1.00 0.00 ? 75  VAL A CB   5  
ATOM 6584  C CG1  . VAL A 1 45 ? 3.782   -1.417  4.497   1.00 0.00 ? 75  VAL A CG1  5  
ATOM 6585  C CG2  . VAL A 1 45 ? 4.999   -1.837  6.647   1.00 0.00 ? 75  VAL A CG2  5  
ATOM 6586  H H    . VAL A 1 45 ? 6.839   -3.658  5.976   1.00 0.00 ? 75  VAL A H    5  
ATOM 6587  H HA   . VAL A 1 45 ? 4.149   -4.014  5.113   1.00 0.00 ? 75  VAL A HA   5  
ATOM 6588  H HB   . VAL A 1 45 ? 5.886   -1.572  4.735   1.00 0.00 ? 75  VAL A HB   5  
ATOM 6589  H HG11 . VAL A 1 45 ? 3.330   -0.721  5.189   1.00 0.00 ? 75  VAL A HG11 5  
ATOM 6590  H HG12 . VAL A 1 45 ? 3.068   -2.188  4.244   1.00 0.00 ? 75  VAL A HG12 5  
ATOM 6591  H HG13 . VAL A 1 45 ? 4.077   -0.893  3.601   1.00 0.00 ? 75  VAL A HG13 5  
ATOM 6592  H HG21 . VAL A 1 45 ? 3.991   -1.628  6.976   1.00 0.00 ? 75  VAL A HG21 5  
ATOM 6593  H HG22 . VAL A 1 45 ? 5.638   -1.002  6.895   1.00 0.00 ? 75  VAL A HG22 5  
ATOM 6594  H HG23 . VAL A 1 45 ? 5.361   -2.727  7.141   1.00 0.00 ? 75  VAL A HG23 5  
ATOM 6595  N N    . ILE A 1 46 ? 6.452   -3.475  2.812   1.00 0.00 ? 76  ILE A N    5  
ATOM 6596  C CA   . ILE A 1 46 ? 6.741   -3.598  1.388   1.00 0.00 ? 76  ILE A CA   5  
ATOM 6597  C C    . ILE A 1 46 ? 6.628   -5.049  0.929   1.00 0.00 ? 76  ILE A C    5  
ATOM 6598  O O    . ILE A 1 46 ? 6.245   -5.322  -0.208  1.00 0.00 ? 76  ILE A O    5  
ATOM 6599  C CB   . ILE A 1 46 ? 8.150   -3.071  1.051   1.00 0.00 ? 76  ILE A CB   5  
ATOM 6600  C CG1  . ILE A 1 46 ? 8.349   -1.669  1.630   1.00 0.00 ? 76  ILE A CG1  5  
ATOM 6601  C CG2  . ILE A 1 46 ? 8.368   -3.062  -0.454  1.00 0.00 ? 76  ILE A CG2  5  
ATOM 6602  C CD1  . ILE A 1 46 ? 9.763   -1.404  2.100   1.00 0.00 ? 76  ILE A CD1  5  
ATOM 6603  H H    . ILE A 1 46 ? 7.168   -3.203  3.422   1.00 0.00 ? 76  ILE A H    5  
ATOM 6604  H HA   . ILE A 1 46 ? 6.018   -3.003  0.848   1.00 0.00 ? 76  ILE A HA   5  
ATOM 6605  H HB   . ILE A 1 46 ? 8.874   -3.740  1.490   1.00 0.00 ? 76  ILE A HB   5  
ATOM 6606  H HG12 . ILE A 1 46 ? 8.111   -0.937  0.873   1.00 0.00 ? 76  ILE A HG12 5  
ATOM 6607  H HG13 . ILE A 1 46 ? 7.687   -1.536  2.473   1.00 0.00 ? 76  ILE A HG13 5  
ATOM 6608  H HG21 . ILE A 1 46 ? 9.375   -3.386  -0.675  1.00 0.00 ? 76  ILE A HG21 5  
ATOM 6609  H HG22 . ILE A 1 46 ? 8.220   -2.062  -0.834  1.00 0.00 ? 76  ILE A HG22 5  
ATOM 6610  H HG23 . ILE A 1 46 ? 7.664   -3.733  -0.925  1.00 0.00 ? 76  ILE A HG23 5  
ATOM 6611  H HD11 . ILE A 1 46 ? 9.818   -0.418  2.537   1.00 0.00 ? 76  ILE A HD11 5  
ATOM 6612  H HD12 . ILE A 1 46 ? 10.438  -1.465  1.260   1.00 0.00 ? 76  ILE A HD12 5  
ATOM 6613  H HD13 . ILE A 1 46 ? 10.040  -2.142  2.840   1.00 0.00 ? 76  ILE A HD13 5  
ATOM 6614  N N    . ARG A 1 47 ? 6.964   -5.975  1.821   1.00 0.00 ? 77  ARG A N    5  
ATOM 6615  C CA   . ARG A 1 47 ? 6.900   -7.398  1.506   1.00 0.00 ? 77  ARG A CA   5  
ATOM 6616  C C    . ARG A 1 47 ? 5.453   -7.852  1.344   1.00 0.00 ? 77  ARG A C    5  
ATOM 6617  O O    . ARG A 1 47 ? 5.103   -8.503  0.359   1.00 0.00 ? 77  ARG A O    5  
ATOM 6618  C CB   . ARG A 1 47 ? 7.589   -8.217  2.600   1.00 0.00 ? 77  ARG A CB   5  
ATOM 6619  C CG   . ARG A 1 47 ? 8.552   -9.262  2.061   1.00 0.00 ? 77  ARG A CG   5  
ATOM 6620  C CD   . ARG A 1 47 ? 8.514   -10.537 2.887   1.00 0.00 ? 77  ARG A CD   5  
ATOM 6621  N NE   . ARG A 1 47 ? 9.560   -10.560 3.908   1.00 0.00 ? 77  ARG A NE   5  
ATOM 6622  C CZ   . ARG A 1 47 ? 9.979   -11.669 4.514   1.00 0.00 ? 77  ARG A CZ   5  
ATOM 6623  N NH1  . ARG A 1 47 ? 9.445   -12.845 4.208   1.00 0.00 ? 77  ARG A NH1  5  
ATOM 6624  N NH2  . ARG A 1 47 ? 10.935  -11.601 5.431   1.00 0.00 ? 77  ARG A NH2  5  
ATOM 6625  H H    . ARG A 1 47 ? 7.262   -5.695  2.712   1.00 0.00 ? 77  ARG A H    5  
ATOM 6626  H HA   . ARG A 1 47 ? 7.419   -7.553  0.573   1.00 0.00 ? 77  ARG A HA   5  
ATOM 6627  H HB2  . ARG A 1 47 ? 8.143   -7.546  3.241   1.00 0.00 ? 77  ARG A HB2  5  
ATOM 6628  H HB3  . ARG A 1 47 ? 6.836   -8.722  3.187   1.00 0.00 ? 77  ARG A HB3  5  
ATOM 6629  H HG2  . ARG A 1 47 ? 8.280   -9.497  1.042   1.00 0.00 ? 77  ARG A HG2  5  
ATOM 6630  H HG3  . ARG A 1 47 ? 9.555   -8.858  2.083   1.00 0.00 ? 77  ARG A HG3  5  
ATOM 6631  H HD2  . ARG A 1 47 ? 7.551   -10.608 3.371   1.00 0.00 ? 77  ARG A HD2  5  
ATOM 6632  H HD3  . ARG A 1 47 ? 8.648   -11.382 2.228   1.00 0.00 ? 77  ARG A HD3  5  
ATOM 6633  H HE   . ARG A 1 47 ? 9.971   -9.706  4.154   1.00 0.00 ? 77  ARG A HE   5  
ATOM 6634  H HH11 . ARG A 1 47 ? 8.724   -12.903 3.518   1.00 0.00 ? 77  ARG A HH11 5  
ATOM 6635  H HH12 . ARG A 1 47 ? 9.765   -13.672 4.667   1.00 0.00 ? 77  ARG A HH12 5  
ATOM 6636  H HH21 . ARG A 1 47 ? 11.340  -10.717 5.666   1.00 0.00 ? 77  ARG A HH21 5  
ATOM 6637  H HH22 . ARG A 1 47 ? 11.250  -12.433 5.887   1.00 0.00 ? 77  ARG A HH22 5  
ATOM 6638  N N    . ARG A 1 48 ? 4.616   -7.506  2.316   1.00 0.00 ? 78  ARG A N    5  
ATOM 6639  C CA   . ARG A 1 48 ? 3.207   -7.878  2.279   1.00 0.00 ? 78  ARG A CA   5  
ATOM 6640  C C    . ARG A 1 48 ? 2.527   -7.306  1.039   1.00 0.00 ? 78  ARG A C    5  
ATOM 6641  O O    . ARG A 1 48 ? 1.790   -8.006  0.345   1.00 0.00 ? 78  ARG A O    5  
ATOM 6642  C CB   . ARG A 1 48 ? 2.495   -7.390  3.544   1.00 0.00 ? 78  ARG A CB   5  
ATOM 6643  C CG   . ARG A 1 48 ? 2.169   -8.504  4.525   1.00 0.00 ? 78  ARG A CG   5  
ATOM 6644  C CD   . ARG A 1 48 ? 0.977   -8.146  5.399   1.00 0.00 ? 78  ARG A CD   5  
ATOM 6645  N NE   . ARG A 1 48 ? 0.271   -9.333  5.875   1.00 0.00 ? 78  ARG A NE   5  
ATOM 6646  C CZ   . ARG A 1 48 ? -0.608  -10.016 5.146   1.00 0.00 ? 78  ARG A CZ   5  
ATOM 6647  N NH1  . ARG A 1 48 ? -0.889  -9.636  3.905   1.00 0.00 ? 78  ARG A NH1  5  
ATOM 6648  N NH2  . ARG A 1 48 ? -1.209  -11.081 5.658   1.00 0.00 ? 78  ARG A NH2  5  
ATOM 6649  H H    . ARG A 1 48 ? 4.954   -6.986  3.076   1.00 0.00 ? 78  ARG A H    5  
ATOM 6650  H HA   . ARG A 1 48 ? 3.151   -8.956  2.240   1.00 0.00 ? 78  ARG A HA   5  
ATOM 6651  H HB2  . ARG A 1 48 ? 3.128   -6.673  4.045   1.00 0.00 ? 78  ARG A HB2  5  
ATOM 6652  H HB3  . ARG A 1 48 ? 1.571   -6.907  3.261   1.00 0.00 ? 78  ARG A HB3  5  
ATOM 6653  H HG2  . ARG A 1 48 ? 1.938   -9.402  3.971   1.00 0.00 ? 78  ARG A HG2  5  
ATOM 6654  H HG3  . ARG A 1 48 ? 3.028   -8.679  5.156   1.00 0.00 ? 78  ARG A HG3  5  
ATOM 6655  H HD2  . ARG A 1 48 ? 1.329   -7.582  6.250   1.00 0.00 ? 78  ARG A HD2  5  
ATOM 6656  H HD3  . ARG A 1 48 ? 0.294   -7.539  4.823   1.00 0.00 ? 78  ARG A HD3  5  
ATOM 6657  H HE   . ARG A 1 48 ? 0.461   -9.636  6.788   1.00 0.00 ? 78  ARG A HE   5  
ATOM 6658  H HH11 . ARG A 1 48 ? -0.441  -8.834  3.512   1.00 0.00 ? 78  ARG A HH11 5  
ATOM 6659  H HH12 . ARG A 1 48 ? -1.551  -10.155 3.363   1.00 0.00 ? 78  ARG A HH12 5  
ATOM 6660  H HH21 . ARG A 1 48 ? -1.000  -11.373 6.591   1.00 0.00 ? 78  ARG A HH21 5  
ATOM 6661  H HH22 . ARG A 1 48 ? -1.869  -11.595 5.110   1.00 0.00 ? 78  ARG A HH22 5  
ATOM 6662  N N    . VAL A 1 49 ? 2.784   -6.031  0.764   1.00 0.00 ? 79  VAL A N    5  
ATOM 6663  C CA   . VAL A 1 49 ? 2.199   -5.368  -0.396  1.00 0.00 ? 79  VAL A CA   5  
ATOM 6664  C C    . VAL A 1 49 ? 2.602   -6.075  -1.687  1.00 0.00 ? 79  VAL A C    5  
ATOM 6665  O O    . VAL A 1 49 ? 1.765   -6.333  -2.552  1.00 0.00 ? 79  VAL A O    5  
ATOM 6666  C CB   . VAL A 1 49 ? 2.627   -3.889  -0.476  1.00 0.00 ? 79  VAL A CB   5  
ATOM 6667  C CG1  . VAL A 1 49 ? 1.914   -3.184  -1.621  1.00 0.00 ? 79  VAL A CG1  5  
ATOM 6668  C CG2  . VAL A 1 49 ? 2.356   -3.181  0.844   1.00 0.00 ? 79  VAL A CG2  5  
ATOM 6669  H H    . VAL A 1 49 ? 3.382   -5.525  1.353   1.00 0.00 ? 79  VAL A H    5  
ATOM 6670  H HA   . VAL A 1 49 ? 1.125   -5.407  -0.296  1.00 0.00 ? 79  VAL A HA   5  
ATOM 6671  H HB   . VAL A 1 49 ? 3.689   -3.853  -0.667  1.00 0.00 ? 79  VAL A HB   5  
ATOM 6672  H HG11 . VAL A 1 49 ? 1.083   -2.616  -1.233  1.00 0.00 ? 79  VAL A HG11 5  
ATOM 6673  H HG12 . VAL A 1 49 ? 1.551   -3.918  -2.326  1.00 0.00 ? 79  VAL A HG12 5  
ATOM 6674  H HG13 . VAL A 1 49 ? 2.604   -2.519  -2.118  1.00 0.00 ? 79  VAL A HG13 5  
ATOM 6675  H HG21 . VAL A 1 49 ? 3.207   -2.571  1.105   1.00 0.00 ? 79  VAL A HG21 5  
ATOM 6676  H HG22 . VAL A 1 49 ? 2.187   -3.915  1.619   1.00 0.00 ? 79  VAL A HG22 5  
ATOM 6677  H HG23 . VAL A 1 49 ? 1.482   -2.555  0.743   1.00 0.00 ? 79  VAL A HG23 5  
ATOM 6678  N N    . SER A 1 50 ? 3.889   -6.386  -1.808  1.00 0.00 ? 80  SER A N    5  
ATOM 6679  C CA   . SER A 1 50 ? 4.402   -7.065  -2.992  1.00 0.00 ? 80  SER A CA   5  
ATOM 6680  C C    . SER A 1 50 ? 3.764   -8.440  -3.152  1.00 0.00 ? 80  SER A C    5  
ATOM 6681  O O    . SER A 1 50 ? 3.684   -8.975  -4.259  1.00 0.00 ? 80  SER A O    5  
ATOM 6682  C CB   . SER A 1 50 ? 5.923   -7.200  -2.911  1.00 0.00 ? 80  SER A CB   5  
ATOM 6683  O OG   . SER A 1 50 ? 6.301   -8.114  -1.898  1.00 0.00 ? 80  SER A OG   5  
ATOM 6684  H H    . SER A 1 50 ? 4.508   -6.155  -1.085  1.00 0.00 ? 80  SER A H    5  
ATOM 6685  H HA   . SER A 1 50 ? 4.147   -6.465  -3.849  1.00 0.00 ? 80  SER A HA   5  
ATOM 6686  H HB2  . SER A 1 50 ? 6.301   -7.556  -3.858  1.00 0.00 ? 80  SER A HB2  5  
ATOM 6687  H HB3  . SER A 1 50 ? 6.357   -6.235  -2.691  1.00 0.00 ? 80  SER A HB3  5  
ATOM 6688  H HG   . SER A 1 50 ? 6.214   -7.693  -1.038  1.00 0.00 ? 80  SER A HG   5  
ATOM 6689  N N    . GLN A 1 51 ? 3.307   -9.005  -2.041  1.00 0.00 ? 81  GLN A N    5  
ATOM 6690  C CA   . GLN A 1 51 ? 2.672   -10.318 -2.055  1.00 0.00 ? 81  GLN A CA   5  
ATOM 6691  C C    . GLN A 1 51 ? 1.236   -10.217 -2.557  1.00 0.00 ? 81  GLN A C    5  
ATOM 6692  O O    . GLN A 1 51 ? 0.810   -10.993 -3.412  1.00 0.00 ? 81  GLN A O    5  
ATOM 6693  C CB   . GLN A 1 51 ? 2.694   -10.934 -0.656  1.00 0.00 ? 81  GLN A CB   5  
ATOM 6694  C CG   . GLN A 1 51 ? 2.580   -12.450 -0.657  1.00 0.00 ? 81  GLN A CG   5  
ATOM 6695  C CD   . GLN A 1 51 ? 2.408   -13.022 0.737   1.00 0.00 ? 81  GLN A CD   5  
ATOM 6696  O OE1  . GLN A 1 51 ? 1.512   -12.620 1.480   1.00 0.00 ? 81  GLN A OE1  5  
ATOM 6697  N NE2  . GLN A 1 51 ? 3.268   -13.967 1.099   1.00 0.00 ? 81  GLN A NE2  5  
ATOM 6698  H H    . GLN A 1 51 ? 3.399   -8.527  -1.193  1.00 0.00 ? 81  GLN A H    5  
ATOM 6699  H HA   . GLN A 1 51 ? 3.232   -10.951 -2.727  1.00 0.00 ? 81  GLN A HA   5  
ATOM 6700  H HB2  . GLN A 1 51 ? 3.619   -10.664 -0.170  1.00 0.00 ? 81  GLN A HB2  5  
ATOM 6701  H HB3  . GLN A 1 51 ? 1.867   -10.533 -0.085  1.00 0.00 ? 81  GLN A HB3  5  
ATOM 6702  H HG2  . GLN A 1 51 ? 1.726   -12.734 -1.254  1.00 0.00 ? 81  GLN A HG2  5  
ATOM 6703  H HG3  . GLN A 1 51 ? 3.478   -12.865 -1.092  1.00 0.00 ? 81  GLN A HG3  5  
ATOM 6704  H HE21 . GLN A 1 51 ? 3.957   -14.237 0.457   1.00 0.00 ? 81  GLN A HE21 5  
ATOM 6705  H HE22 . GLN A 1 51 ? 3.180   -14.354 1.995   1.00 0.00 ? 81  GLN A HE22 5  
ATOM 6706  N N    . LEU A 1 52 ? 0.495   -9.253  -2.021  1.00 0.00 ? 82  LEU A N    5  
ATOM 6707  C CA   . LEU A 1 52 ? -0.894  -9.045  -2.415  1.00 0.00 ? 82  LEU A CA   5  
ATOM 6708  C C    . LEU A 1 52 ? -0.994  -8.732  -3.906  1.00 0.00 ? 82  LEU A C    5  
ATOM 6709  O O    . LEU A 1 52 ? -2.000  -9.032  -4.547  1.00 0.00 ? 82  LEU A O    5  
ATOM 6710  C CB   . LEU A 1 52 ? -1.512  -7.908  -1.596  1.00 0.00 ? 82  LEU A CB   5  
ATOM 6711  C CG   . LEU A 1 52 ? -2.613  -8.334  -0.624  1.00 0.00 ? 82  LEU A CG   5  
ATOM 6712  C CD1  . LEU A 1 52 ? -2.082  -9.355  0.370   1.00 0.00 ? 82  LEU A CD1  5  
ATOM 6713  C CD2  . LEU A 1 52 ? -3.178  -7.123  0.103   1.00 0.00 ? 82  LEU A CD2  5  
ATOM 6714  H H    . LEU A 1 52 ? 0.893   -8.665  -1.346  1.00 0.00 ? 82  LEU A H    5  
ATOM 6715  H HA   . LEU A 1 52 ? -1.434  -9.957  -2.214  1.00 0.00 ? 82  LEU A HA   5  
ATOM 6716  H HB2  . LEU A 1 52 ? -0.724  -7.433  -1.029  1.00 0.00 ? 82  LEU A HB2  5  
ATOM 6717  H HB3  . LEU A 1 52 ? -1.926  -7.182  -2.278  1.00 0.00 ? 82  LEU A HB3  5  
ATOM 6718  H HG   . LEU A 1 52 ? -3.415  -8.796  -1.181  1.00 0.00 ? 82  LEU A HG   5  
ATOM 6719  H HD11 . LEU A 1 52 ? -1.311  -8.902  0.974   1.00 0.00 ? 82  LEU A HD11 5  
ATOM 6720  H HD12 . LEU A 1 52 ? -1.671  -10.199 -0.166  1.00 0.00 ? 82  LEU A HD12 5  
ATOM 6721  H HD13 . LEU A 1 52 ? -2.888  -9.691  1.006   1.00 0.00 ? 82  LEU A HD13 5  
ATOM 6722  H HD21 . LEU A 1 52 ? -3.998  -7.432  0.735   1.00 0.00 ? 82  LEU A HD21 5  
ATOM 6723  H HD22 . LEU A 1 52 ? -3.532  -6.403  -0.619  1.00 0.00 ? 82  LEU A HD22 5  
ATOM 6724  H HD23 . LEU A 1 52 ? -2.406  -6.675  0.711   1.00 0.00 ? 82  LEU A HD23 5  
ATOM 6725  N N    . PHE A 1 53 ? 0.057   -8.125  -4.449  1.00 0.00 ? 83  PHE A N    5  
ATOM 6726  C CA   . PHE A 1 53 ? 0.089   -7.769  -5.863  1.00 0.00 ? 83  PHE A CA   5  
ATOM 6727  C C    . PHE A 1 53 ? 1.119   -8.611  -6.612  1.00 0.00 ? 83  PHE A C    5  
ATOM 6728  O O    . PHE A 1 53 ? 2.000   -8.079  -7.289  1.00 0.00 ? 83  PHE A O    5  
ATOM 6729  C CB   . PHE A 1 53 ? 0.409   -6.280  -6.025  1.00 0.00 ? 83  PHE A CB   5  
ATOM 6730  C CG   . PHE A 1 53 ? -0.356  -5.389  -5.085  1.00 0.00 ? 83  PHE A CG   5  
ATOM 6731  C CD1  . PHE A 1 53 ? -1.661  -5.691  -4.723  1.00 0.00 ? 83  PHE A CD1  5  
ATOM 6732  C CD2  . PHE A 1 53 ? 0.231   -4.246  -4.564  1.00 0.00 ? 83  PHE A CD2  5  
ATOM 6733  C CE1  . PHE A 1 53 ? -2.363  -4.872  -3.860  1.00 0.00 ? 83  PHE A CE1  5  
ATOM 6734  C CE2  . PHE A 1 53 ? -0.467  -3.423  -3.701  1.00 0.00 ? 83  PHE A CE2  5  
ATOM 6735  C CZ   . PHE A 1 53 ? -1.765  -3.736  -3.349  1.00 0.00 ? 83  PHE A CZ   5  
ATOM 6736  H H    . PHE A 1 53 ? 0.830   -7.911  -3.886  1.00 0.00 ? 83  PHE A H    5  
ATOM 6737  H HA   . PHE A 1 53 ? -0.889  -7.966  -6.278  1.00 0.00 ? 83  PHE A HA   5  
ATOM 6738  H HB2  . PHE A 1 53 ? 1.462   -6.125  -5.845  1.00 0.00 ? 83  PHE A HB2  5  
ATOM 6739  H HB3  . PHE A 1 53 ? 0.175   -5.978  -7.035  1.00 0.00 ? 83  PHE A HB3  5  
ATOM 6740  H HD1  . PHE A 1 53 ? -2.128  -6.579  -5.122  1.00 0.00 ? 83  PHE A HD1  5  
ATOM 6741  H HD2  . PHE A 1 53 ? 1.246   -4.000  -4.839  1.00 0.00 ? 83  PHE A HD2  5  
ATOM 6742  H HE1  . PHE A 1 53 ? -3.377  -5.119  -3.587  1.00 0.00 ? 83  PHE A HE1  5  
ATOM 6743  H HE2  . PHE A 1 53 ? 0.003   -2.536  -3.302  1.00 0.00 ? 83  PHE A HE2  5  
ATOM 6744  H HZ   . PHE A 1 53 ? -2.313  -3.095  -2.674  1.00 0.00 ? 83  PHE A HZ   5  
ATOM 6745  N N    . HIS A 1 54 ? 1.002   -9.929  -6.486  1.00 0.00 ? 84  HIS A N    5  
ATOM 6746  C CA   . HIS A 1 54 ? 1.921   -10.846 -7.147  1.00 0.00 ? 84  HIS A CA   5  
ATOM 6747  C C    . HIS A 1 54 ? 1.747   -10.800 -8.662  1.00 0.00 ? 84  HIS A C    5  
ATOM 6748  O O    . HIS A 1 54 ? 2.726   -10.784 -9.408  1.00 0.00 ? 84  HIS A O    5  
ATOM 6749  C CB   . HIS A 1 54 ? 1.704   -12.273 -6.640  1.00 0.00 ? 84  HIS A CB   5  
ATOM 6750  C CG   . HIS A 1 54 ? 2.973   -13.048 -6.471  1.00 0.00 ? 84  HIS A CG   5  
ATOM 6751  N ND1  . HIS A 1 54 ? 3.163   -13.973 -5.466  1.00 0.00 ? 84  HIS A ND1  5  
ATOM 6752  C CD2  . HIS A 1 54 ? 4.123   -13.031 -7.187  1.00 0.00 ? 84  HIS A CD2  5  
ATOM 6753  C CE1  . HIS A 1 54 ? 4.375   -14.491 -5.570  1.00 0.00 ? 84  HIS A CE1  5  
ATOM 6754  N NE2  . HIS A 1 54 ? 4.976   -13.938 -6.606  1.00 0.00 ? 84  HIS A NE2  5  
ATOM 6755  H H    . HIS A 1 54 ? 0.282   -10.294 -5.932  1.00 0.00 ? 84  HIS A H    5  
ATOM 6756  H HA   . HIS A 1 54 ? 2.924   -10.537 -6.903  1.00 0.00 ? 84  HIS A HA   5  
ATOM 6757  H HB2  . HIS A 1 54 ? 1.207   -12.236 -5.681  1.00 0.00 ? 84  HIS A HB2  5  
ATOM 6758  H HB3  . HIS A 1 54 ? 1.078   -12.806 -7.342  1.00 0.00 ? 84  HIS A HB3  5  
ATOM 6759  H HD1  . HIS A 1 54 ? 2.508   -14.214 -4.778  1.00 0.00 ? 84  HIS A HD1  5  
ATOM 6760  H HD2  . HIS A 1 54 ? 4.330   -12.420 -8.054  1.00 0.00 ? 84  HIS A HD2  5  
ATOM 6761  H HE1  . HIS A 1 54 ? 4.799   -15.241 -4.919  1.00 0.00 ? 84  HIS A HE1  5  
ATOM 6762  H HE2  . HIS A 1 54 ? 5.850   -14.203 -6.959  1.00 0.00 ? 84  HIS A HE2  5  
ATOM 6763  N N    . GLU A 1 55 ? 0.495   -10.782 -9.111  1.00 0.00 ? 85  GLU A N    5  
ATOM 6764  C CA   . GLU A 1 55 ? 0.197   -10.741 -10.539 1.00 0.00 ? 85  GLU A CA   5  
ATOM 6765  C C    . GLU A 1 55 ? -0.399  -9.394  -10.938 1.00 0.00 ? 85  GLU A C    5  
ATOM 6766  O O    . GLU A 1 55 ? -1.148  -9.299  -11.910 1.00 0.00 ? 85  GLU A O    5  
ATOM 6767  C CB   . GLU A 1 55 ? -0.771  -11.867 -10.910 1.00 0.00 ? 85  GLU A CB   5  
ATOM 6768  C CG   . GLU A 1 55 ? -0.077  -13.159 -11.310 1.00 0.00 ? 85  GLU A CG   5  
ATOM 6769  C CD   . GLU A 1 55 ? -1.057  -14.267 -11.644 1.00 0.00 ? 85  GLU A CD   5  
ATOM 6770  O OE1  . GLU A 1 55 ? -2.233  -13.956 -11.923 1.00 0.00 ? 85  GLU A OE1  5  
ATOM 6771  O OE2  . GLU A 1 55 ? -0.647  -15.447 -11.627 1.00 0.00 ? 85  GLU A OE2  5  
ATOM 6772  H H    . GLU A 1 55 ? -0.244  -10.798 -8.468  1.00 0.00 ? 85  GLU A H    5  
ATOM 6773  H HA   . GLU A 1 55 ? 1.123   -10.885 -11.075 1.00 0.00 ? 85  GLU A HA   5  
ATOM 6774  H HB2  . GLU A 1 55 ? -1.407  -12.074 -10.061 1.00 0.00 ? 85  GLU A HB2  5  
ATOM 6775  H HB3  . GLU A 1 55 ? -1.384  -11.542 -11.737 1.00 0.00 ? 85  GLU A HB3  5  
ATOM 6776  H HG2  . GLU A 1 55 ? 0.536   -12.968 -12.178 1.00 0.00 ? 85  GLU A HG2  5  
ATOM 6777  H HG3  . GLU A 1 55 ? 0.548   -13.485 -10.491 1.00 0.00 ? 85  GLU A HG3  5  
ATOM 6778  N N    . HIS A 1 56 ? -0.062  -8.352  -10.182 1.00 0.00 ? 86  HIS A N    5  
ATOM 6779  C CA   . HIS A 1 56 ? -0.566  -7.012  -10.461 1.00 0.00 ? 86  HIS A CA   5  
ATOM 6780  C C    . HIS A 1 56 ? 0.580   -6.002  -10.518 1.00 0.00 ? 86  HIS A C    5  
ATOM 6781  O O    . HIS A 1 56 ? 0.992   -5.463  -9.490  1.00 0.00 ? 86  HIS A O    5  
ATOM 6782  C CB   . HIS A 1 56 ? -1.577  -6.592  -9.391  1.00 0.00 ? 86  HIS A CB   5  
ATOM 6783  C CG   . HIS A 1 56 ? -2.497  -7.694  -8.962  1.00 0.00 ? 86  HIS A CG   5  
ATOM 6784  N ND1  . HIS A 1 56 ? -2.901  -7.871  -7.656  1.00 0.00 ? 86  HIS A ND1  5  
ATOM 6785  C CD2  . HIS A 1 56 ? -3.092  -8.680  -9.674  1.00 0.00 ? 86  HIS A CD2  5  
ATOM 6786  C CE1  . HIS A 1 56 ? -3.704  -8.918  -7.583  1.00 0.00 ? 86  HIS A CE1  5  
ATOM 6787  N NE2  . HIS A 1 56 ? -3.835  -9.426  -8.794  1.00 0.00 ? 86  HIS A NE2  5  
ATOM 6788  H H    . HIS A 1 56 ? 0.538   -8.488  -9.420  1.00 0.00 ? 86  HIS A H    5  
ATOM 6789  H HA   . HIS A 1 56 ? -1.060  -7.036  -11.420 1.00 0.00 ? 86  HIS A HA   5  
ATOM 6790  H HB2  . HIS A 1 56 ? -1.044  -6.248  -8.519  1.00 0.00 ? 86  HIS A HB2  5  
ATOM 6791  H HB3  . HIS A 1 56 ? -2.183  -5.784  -9.777  1.00 0.00 ? 86  HIS A HB3  5  
ATOM 6792  H HD1  . HIS A 1 56 ? -2.640  -7.312  -6.895  1.00 0.00 ? 86  HIS A HD1  5  
ATOM 6793  H HD2  . HIS A 1 56 ? -2.998  -8.847  -10.737 1.00 0.00 ? 86  HIS A HD2  5  
ATOM 6794  H HE1  . HIS A 1 56 ? -4.174  -9.294  -6.686  1.00 0.00 ? 86  HIS A HE1  5  
ATOM 6795  H HE2  . HIS A 1 56 ? -4.433  -10.164 -9.036  1.00 0.00 ? 86  HIS A HE2  5  
ATOM 6796  N N    . PRO A 1 57 ? 1.114   -5.734  -11.723 1.00 0.00 ? 87  PRO A N    5  
ATOM 6797  C CA   . PRO A 1 57 ? 2.220   -4.786  -11.901 1.00 0.00 ? 87  PRO A CA   5  
ATOM 6798  C C    . PRO A 1 57 ? 1.815   -3.348  -11.587 1.00 0.00 ? 87  PRO A C    5  
ATOM 6799  O O    . PRO A 1 57 ? 2.473   -2.667  -10.803 1.00 0.00 ? 87  PRO A O    5  
ATOM 6800  C CB   . PRO A 1 57 ? 2.586   -4.927  -13.381 1.00 0.00 ? 87  PRO A CB   5  
ATOM 6801  C CG   . PRO A 1 57 ? 1.359   -5.469  -14.032 1.00 0.00 ? 87  PRO A CG   5  
ATOM 6802  C CD   . PRO A 1 57 ? 0.688   -6.332  -13.001 1.00 0.00 ? 87  PRO A CD   5  
ATOM 6803  H HA   . PRO A 1 57 ? 3.071   -5.056  -11.292 1.00 0.00 ? 87  PRO A HA   5  
ATOM 6804  H HB2  . PRO A 1 57 ? 2.851   -3.960  -13.783 1.00 0.00 ? 87  PRO A HB2  5  
ATOM 6805  H HB3  . PRO A 1 57 ? 3.418   -5.606  -13.486 1.00 0.00 ? 87  PRO A HB3  5  
ATOM 6806  H HG2  . PRO A 1 57 ? 0.708   -4.658  -14.322 1.00 0.00 ? 87  PRO A HG2  5  
ATOM 6807  H HG3  . PRO A 1 57 ? 1.632   -6.059  -14.894 1.00 0.00 ? 87  PRO A HG3  5  
ATOM 6808  H HD2  . PRO A 1 57 ? -0.386  -6.285  -13.110 1.00 0.00 ? 87  PRO A HD2  5  
ATOM 6809  H HD3  . PRO A 1 57 ? 1.032   -7.353  -13.082 1.00 0.00 ? 87  PRO A HD3  5  
ATOM 6810  N N    . ASP A 1 58 ? 0.727   -2.896  -12.203 1.00 0.00 ? 88  ASP A N    5  
ATOM 6811  C CA   . ASP A 1 58 ? 0.232   -1.538  -11.990 1.00 0.00 ? 88  ASP A CA   5  
ATOM 6812  C C    . ASP A 1 58 ? -0.044  -1.269  -10.511 1.00 0.00 ? 88  ASP A C    5  
ATOM 6813  O O    . ASP A 1 58 ? -0.126  -0.116  -10.086 1.00 0.00 ? 88  ASP A O    5  
ATOM 6814  C CB   . ASP A 1 58 ? -1.040  -1.305  -12.808 1.00 0.00 ? 88  ASP A CB   5  
ATOM 6815  C CG   . ASP A 1 58 ? -0.760  -0.606  -14.124 1.00 0.00 ? 88  ASP A CG   5  
ATOM 6816  O OD1  . ASP A 1 58 ? -0.706  0.642   -14.133 1.00 0.00 ? 88  ASP A OD1  5  
ATOM 6817  O OD2  . ASP A 1 58 ? -0.595  -1.307  -15.145 1.00 0.00 ? 88  ASP A OD2  5  
ATOM 6818  H H    . ASP A 1 58 ? 0.244   -3.488  -12.815 1.00 0.00 ? 88  ASP A H    5  
ATOM 6819  H HA   . ASP A 1 58 ? 0.995   -0.853  -12.328 1.00 0.00 ? 88  ASP A HA   5  
ATOM 6820  H HB2  . ASP A 1 58 ? -1.503  -2.256  -13.019 1.00 0.00 ? 88  ASP A HB2  5  
ATOM 6821  H HB3  . ASP A 1 58 ? -1.723  -0.695  -12.235 1.00 0.00 ? 88  ASP A HB3  5  
ATOM 6822  N N    . LEU A 1 59 ? -0.182  -2.336  -9.728  1.00 0.00 ? 89  LEU A N    5  
ATOM 6823  C CA   . LEU A 1 59 ? -0.443  -2.207  -8.301  1.00 0.00 ? 89  LEU A CA   5  
ATOM 6824  C C    . LEU A 1 59 ? 0.860   -2.008  -7.545  1.00 0.00 ? 89  LEU A C    5  
ATOM 6825  O O    . LEU A 1 59 ? 1.028   -1.026  -6.822  1.00 0.00 ? 89  LEU A O    5  
ATOM 6826  C CB   . LEU A 1 59 ? -1.175  -3.444  -7.779  1.00 0.00 ? 89  LEU A CB   5  
ATOM 6827  C CG   . LEU A 1 59 ? -2.664  -3.505  -8.123  1.00 0.00 ? 89  LEU A CG   5  
ATOM 6828  C CD1  . LEU A 1 59 ? -3.283  -4.793  -7.599  1.00 0.00 ? 89  LEU A CD1  5  
ATOM 6829  C CD2  . LEU A 1 59 ? -3.388  -2.291  -7.558  1.00 0.00 ? 89  LEU A CD2  5  
ATOM 6830  H H    . LEU A 1 59 ? -0.099  -3.228  -10.117 1.00 0.00 ? 89  LEU A H    5  
ATOM 6831  H HA   . LEU A 1 59 ? -1.068  -1.338  -8.155  1.00 0.00 ? 89  LEU A HA   5  
ATOM 6832  H HB2  . LEU A 1 59 ? -0.695  -4.320  -8.190  1.00 0.00 ? 89  LEU A HB2  5  
ATOM 6833  H HB3  . LEU A 1 59 ? -1.075  -3.469  -6.704  1.00 0.00 ? 89  LEU A HB3  5  
ATOM 6834  H HG   . LEU A 1 59 ? -2.779  -3.494  -9.196  1.00 0.00 ? 89  LEU A HG   5  
ATOM 6835  H HD11 . LEU A 1 59 ? -3.607  -5.401  -8.430  1.00 0.00 ? 89  LEU A HD11 5  
ATOM 6836  H HD12 . LEU A 1 59 ? -4.134  -4.558  -6.975  1.00 0.00 ? 89  LEU A HD12 5  
ATOM 6837  H HD13 . LEU A 1 59 ? -2.552  -5.336  -7.019  1.00 0.00 ? 89  LEU A HD13 5  
ATOM 6838  H HD21 . LEU A 1 59 ? -4.453  -2.472  -7.563  1.00 0.00 ? 89  LEU A HD21 5  
ATOM 6839  H HD22 . LEU A 1 59 ? -3.168  -1.426  -8.166  1.00 0.00 ? 89  LEU A HD22 5  
ATOM 6840  H HD23 . LEU A 1 59 ? -3.058  -2.113  -6.546  1.00 0.00 ? 89  LEU A HD23 5  
ATOM 6841  N N    . ILE A 1 60 ? 1.791   -2.937  -7.733  1.00 0.00 ? 90  ILE A N    5  
ATOM 6842  C CA   . ILE A 1 60 ? 3.090   -2.847  -7.083  1.00 0.00 ? 90  ILE A CA   5  
ATOM 6843  C C    . ILE A 1 60 ? 3.796   -1.562  -7.500  1.00 0.00 ? 90  ILE A C    5  
ATOM 6844  O O    . ILE A 1 60 ? 4.591   -1.002  -6.744  1.00 0.00 ? 90  ILE A O    5  
ATOM 6845  C CB   . ILE A 1 60 ? 3.981   -4.059  -7.428  1.00 0.00 ? 90  ILE A CB   5  
ATOM 6846  C CG1  . ILE A 1 60 ? 5.303   -3.984  -6.661  1.00 0.00 ? 90  ILE A CG1  5  
ATOM 6847  C CG2  . ILE A 1 60 ? 4.234   -4.124  -8.927  1.00 0.00 ? 90  ILE A CG2  5  
ATOM 6848  C CD1  . ILE A 1 60 ? 6.128   -5.250  -6.753  1.00 0.00 ? 90  ILE A CD1  5  
ATOM 6849  H H    . ILE A 1 60 ? 1.605   -3.690  -8.333  1.00 0.00 ? 90  ILE A H    5  
ATOM 6850  H HA   . ILE A 1 60 ? 2.930   -2.832  -6.015  1.00 0.00 ? 90  ILE A HA   5  
ATOM 6851  H HB   . ILE A 1 60 ? 3.456   -4.957  -7.138  1.00 0.00 ? 90  ILE A HB   5  
ATOM 6852  H HG12 . ILE A 1 60 ? 5.897   -3.174  -7.057  1.00 0.00 ? 90  ILE A HG12 5  
ATOM 6853  H HG13 . ILE A 1 60 ? 5.096   -3.797  -5.618  1.00 0.00 ? 90  ILE A HG13 5  
ATOM 6854  H HG21 . ILE A 1 60 ? 4.580   -3.164  -9.277  1.00 0.00 ? 90  ILE A HG21 5  
ATOM 6855  H HG22 . ILE A 1 60 ? 3.316   -4.383  -9.436  1.00 0.00 ? 90  ILE A HG22 5  
ATOM 6856  H HG23 . ILE A 1 60 ? 4.983   -4.875  -9.133  1.00 0.00 ? 90  ILE A HG23 5  
ATOM 6857  H HD11 . ILE A 1 60 ? 5.583   -5.994  -7.315  1.00 0.00 ? 90  ILE A HD11 5  
ATOM 6858  H HD12 . ILE A 1 60 ? 6.325   -5.624  -5.759  1.00 0.00 ? 90  ILE A HD12 5  
ATOM 6859  H HD13 . ILE A 1 60 ? 7.062   -5.035  -7.250  1.00 0.00 ? 90  ILE A HD13 5  
ATOM 6860  N N    . VAL A 1 61 ? 3.485   -1.092  -8.707  1.00 0.00 ? 91  VAL A N    5  
ATOM 6861  C CA   . VAL A 1 61 ? 4.078   0.136   -9.219  1.00 0.00 ? 91  VAL A CA   5  
ATOM 6862  C C    . VAL A 1 61 ? 3.476   1.349   -8.520  1.00 0.00 ? 91  VAL A C    5  
ATOM 6863  O O    . VAL A 1 61 ? 4.195   2.248   -8.084  1.00 0.00 ? 91  VAL A O    5  
ATOM 6864  C CB   . VAL A 1 61 ? 3.878   0.272   -10.743 1.00 0.00 ? 91  VAL A CB   5  
ATOM 6865  C CG1  . VAL A 1 61 ? 4.512   1.557   -11.261 1.00 0.00 ? 91  VAL A CG1  5  
ATOM 6866  C CG2  . VAL A 1 61 ? 4.450   -0.939  -11.465 1.00 0.00 ? 91  VAL A CG2  5  
ATOM 6867  H H    . VAL A 1 61 ? 2.831   -1.578  -9.259  1.00 0.00 ? 91  VAL A H    5  
ATOM 6868  H HA   . VAL A 1 61 ? 5.139   0.105   -9.015  1.00 0.00 ? 91  VAL A HA   5  
ATOM 6869  H HB   . VAL A 1 61 ? 2.817   0.315   -10.943 1.00 0.00 ? 91  VAL A HB   5  
ATOM 6870  H HG11 . VAL A 1 61 ? 5.352   1.316   -11.894 1.00 0.00 ? 91  VAL A HG11 5  
ATOM 6871  H HG12 . VAL A 1 61 ? 4.850   2.155   -10.427 1.00 0.00 ? 91  VAL A HG12 5  
ATOM 6872  H HG13 . VAL A 1 61 ? 3.782   2.114   -11.830 1.00 0.00 ? 91  VAL A HG13 5  
ATOM 6873  H HG21 . VAL A 1 61 ? 4.529   -1.766  -10.775 1.00 0.00 ? 91  VAL A HG21 5  
ATOM 6874  H HG22 . VAL A 1 61 ? 5.430   -0.698  -11.851 1.00 0.00 ? 91  VAL A HG22 5  
ATOM 6875  H HG23 . VAL A 1 61 ? 3.799   -1.212  -12.281 1.00 0.00 ? 91  VAL A HG23 5  
ATOM 6876  N N    . GLY A 1 62 ? 2.151   1.361   -8.406  1.00 0.00 ? 92  GLY A N    5  
ATOM 6877  C CA   . GLY A 1 62 ? 1.475   2.463   -7.749  1.00 0.00 ? 92  GLY A CA   5  
ATOM 6878  C C    . GLY A 1 62 ? 1.925   2.631   -6.311  1.00 0.00 ? 92  GLY A C    5  
ATOM 6879  O O    . GLY A 1 62 ? 2.017   3.749   -5.807  1.00 0.00 ? 92  GLY A O    5  
ATOM 6880  H H    . GLY A 1 62 ? 1.629   0.614   -8.768  1.00 0.00 ? 92  GLY A H    5  
ATOM 6881  H HA2  . GLY A 1 62 ? 1.684   3.375   -8.290  1.00 0.00 ? 92  GLY A HA2  5  
ATOM 6882  H HA3  . GLY A 1 62 ? 0.411   2.282   -7.764  1.00 0.00 ? 92  GLY A HA3  5  
ATOM 6883  N N    . PHE A 1 63 ? 2.207   1.510   -5.651  1.00 0.00 ? 93  PHE A N    5  
ATOM 6884  C CA   . PHE A 1 63 ? 2.653   1.531   -4.266  1.00 0.00 ? 93  PHE A CA   5  
ATOM 6885  C C    . PHE A 1 63 ? 4.083   2.043   -4.167  1.00 0.00 ? 93  PHE A C    5  
ATOM 6886  O O    . PHE A 1 63 ? 4.447   2.731   -3.214  1.00 0.00 ? 93  PHE A O    5  
ATOM 6887  C CB   . PHE A 1 63 ? 2.553   0.133   -3.653  1.00 0.00 ? 93  PHE A CB   5  
ATOM 6888  C CG   . PHE A 1 63 ? 2.751   0.113   -2.165  1.00 0.00 ? 93  PHE A CG   5  
ATOM 6889  C CD1  . PHE A 1 63 ? 1.680   0.304   -1.307  1.00 0.00 ? 93  PHE A CD1  5  
ATOM 6890  C CD2  . PHE A 1 63 ? 4.009   -0.098  -1.622  1.00 0.00 ? 93  PHE A CD2  5  
ATOM 6891  C CE1  . PHE A 1 63 ? 1.859   0.286   0.064   1.00 0.00 ? 93  PHE A CE1  5  
ATOM 6892  C CE2  . PHE A 1 63 ? 4.195   -0.116  -0.254  1.00 0.00 ? 93  PHE A CE2  5  
ATOM 6893  C CZ   . PHE A 1 63 ? 3.118   0.075   0.591   1.00 0.00 ? 93  PHE A CZ   5  
ATOM 6894  H H    . PHE A 1 63 ? 2.116   0.651   -6.108  1.00 0.00 ? 93  PHE A H    5  
ATOM 6895  H HA   . PHE A 1 63 ? 2.009   2.198   -3.728  1.00 0.00 ? 93  PHE A HA   5  
ATOM 6896  H HB2  . PHE A 1 63 ? 1.575   -0.275  -3.863  1.00 0.00 ? 93  PHE A HB2  5  
ATOM 6897  H HB3  . PHE A 1 63 ? 3.306   -0.502  -4.098  1.00 0.00 ? 93  PHE A HB3  5  
ATOM 6898  H HD1  . PHE A 1 63 ? 0.695   0.469   -1.718  1.00 0.00 ? 93  PHE A HD1  5  
ATOM 6899  H HD2  . PHE A 1 63 ? 4.852   -0.246  -2.282  1.00 0.00 ? 93  PHE A HD2  5  
ATOM 6900  H HE1  . PHE A 1 63 ? 1.016   0.436   0.721   1.00 0.00 ? 93  PHE A HE1  5  
ATOM 6901  H HE2  . PHE A 1 63 ? 5.180   -0.281  0.156   1.00 0.00 ? 93  PHE A HE2  5  
ATOM 6902  H HZ   . PHE A 1 63 ? 3.261   0.060   1.661   1.00 0.00 ? 93  PHE A HZ   5  
ATOM 6903  N N    . ASN A 1 64 ? 4.883   1.702   -5.166  1.00 0.00 ? 94  ASN A N    5  
ATOM 6904  C CA   . ASN A 1 64 ? 6.279   2.125   -5.209  1.00 0.00 ? 94  ASN A CA   5  
ATOM 6905  C C    . ASN A 1 64 ? 6.384   3.636   -5.390  1.00 0.00 ? 94  ASN A C    5  
ATOM 6906  O O    . ASN A 1 64 ? 7.361   4.256   -4.973  1.00 0.00 ? 94  ASN A O    5  
ATOM 6907  C CB   . ASN A 1 64 ? 7.015   1.410   -6.343  1.00 0.00 ? 94  ASN A CB   5  
ATOM 6908  C CG   . ASN A 1 64 ? 8.497   1.732   -6.364  1.00 0.00 ? 94  ASN A CG   5  
ATOM 6909  O OD1  . ASN A 1 64 ? 9.048   2.109   -7.397  1.00 0.00 ? 94  ASN A OD1  5  
ATOM 6910  N ND2  . ASN A 1 64 ? 9.150   1.582   -5.218  1.00 0.00 ? 94  ASN A ND2  5  
ATOM 6911  H H    . ASN A 1 64 ? 4.524   1.155   -5.894  1.00 0.00 ? 94  ASN A H    5  
ATOM 6912  H HA   . ASN A 1 64 ? 6.736   1.855   -4.269  1.00 0.00 ? 94  ASN A HA   5  
ATOM 6913  H HB2  . ASN A 1 64 ? 6.899   0.344   -6.224  1.00 0.00 ? 94  ASN A HB2  5  
ATOM 6914  H HB3  . ASN A 1 64 ? 6.587   1.712   -7.288  1.00 0.00 ? 94  ASN A HB3  5  
ATOM 6915  H HD21 . ASN A 1 64 ? 8.646   1.278   -4.434  1.00 0.00 ? 94  ASN A HD21 5  
ATOM 6916  H HD22 . ASN A 1 64 ? 10.109  1.784   -5.201  1.00 0.00 ? 94  ASN A HD22 5  
ATOM 6917  N N    . ALA A 1 65 ? 5.369   4.224   -6.017  1.00 0.00 ? 95  ALA A N    5  
ATOM 6918  C CA   . ALA A 1 65 ? 5.344   5.662   -6.255  1.00 0.00 ? 95  ALA A CA   5  
ATOM 6919  C C    . ALA A 1 65 ? 5.340   6.447   -4.945  1.00 0.00 ? 95  ALA A C    5  
ATOM 6920  O O    . ALA A 1 65 ? 5.625   7.645   -4.931  1.00 0.00 ? 95  ALA A O    5  
ATOM 6921  C CB   . ALA A 1 65 ? 4.132   6.035   -7.097  1.00 0.00 ? 95  ALA A CB   5  
ATOM 6922  H H    . ALA A 1 65 ? 4.618   3.677   -6.329  1.00 0.00 ? 95  ALA A H    5  
ATOM 6923  H HA   . ALA A 1 65 ? 6.231   5.921   -6.814  1.00 0.00 ? 95  ALA A HA   5  
ATOM 6924  H HB1  . ALA A 1 65 ? 4.103   5.415   -7.980  1.00 0.00 ? 95  ALA A HB1  5  
ATOM 6925  H HB2  . ALA A 1 65 ? 4.200   7.073   -7.387  1.00 0.00 ? 95  ALA A HB2  5  
ATOM 6926  H HB3  . ALA A 1 65 ? 3.232   5.880   -6.519  1.00 0.00 ? 95  ALA A HB3  5  
ATOM 6927  N N    . PHE A 1 66 ? 5.015   5.770   -3.846  1.00 0.00 ? 96  PHE A N    5  
ATOM 6928  C CA   . PHE A 1 66 ? 4.976   6.414   -2.537  1.00 0.00 ? 96  PHE A CA   5  
ATOM 6929  C C    . PHE A 1 66 ? 6.247   6.121   -1.748  1.00 0.00 ? 96  PHE A C    5  
ATOM 6930  O O    . PHE A 1 66 ? 6.682   6.933   -0.930  1.00 0.00 ? 96  PHE A O    5  
ATOM 6931  C CB   . PHE A 1 66 ? 3.753   5.941   -1.748  1.00 0.00 ? 96  PHE A CB   5  
ATOM 6932  C CG   . PHE A 1 66 ? 2.448   6.214   -2.440  1.00 0.00 ? 96  PHE A CG   5  
ATOM 6933  C CD1  . PHE A 1 66 ? 1.869   7.471   -2.383  1.00 0.00 ? 96  PHE A CD1  5  
ATOM 6934  C CD2  . PHE A 1 66 ? 1.801   5.214   -3.147  1.00 0.00 ? 96  PHE A CD2  5  
ATOM 6935  C CE1  . PHE A 1 66 ? 0.669   7.726   -3.018  1.00 0.00 ? 96  PHE A CE1  5  
ATOM 6936  C CE2  . PHE A 1 66 ? 0.600   5.462   -3.784  1.00 0.00 ? 96  PHE A CE2  5  
ATOM 6937  C CZ   . PHE A 1 66 ? 0.033   6.720   -3.719  1.00 0.00 ? 96  PHE A CZ   5  
ATOM 6938  H H    . PHE A 1 66 ? 4.794   4.819   -3.915  1.00 0.00 ? 96  PHE A H    5  
ATOM 6939  H HA   . PHE A 1 66 ? 4.900   7.480   -2.694  1.00 0.00 ? 96  PHE A HA   5  
ATOM 6940  H HB2  . PHE A 1 66 ? 3.827   4.876   -1.589  1.00 0.00 ? 96  PHE A HB2  5  
ATOM 6941  H HB3  . PHE A 1 66 ? 3.735   6.441   -0.792  1.00 0.00 ? 96  PHE A HB3  5  
ATOM 6942  H HD1  . PHE A 1 66 ? 2.365   8.259   -1.835  1.00 0.00 ? 96  PHE A HD1  5  
ATOM 6943  H HD2  . PHE A 1 66 ? 2.244   4.229   -3.198  1.00 0.00 ? 96  PHE A HD2  5  
ATOM 6944  H HE1  . PHE A 1 66 ? 0.227   8.711   -2.965  1.00 0.00 ? 96  PHE A HE1  5  
ATOM 6945  H HE2  . PHE A 1 66 ? 0.105   4.673   -4.331  1.00 0.00 ? 96  PHE A HE2  5  
ATOM 6946  H HZ   . PHE A 1 66 ? -0.905  6.917   -4.216  1.00 0.00 ? 96  PHE A HZ   5  
ATOM 6947  N N    . LEU A 1 67 ? 6.840   4.959   -1.997  1.00 0.00 ? 97  LEU A N    5  
ATOM 6948  C CA   . LEU A 1 67 ? 8.063   4.563   -1.308  1.00 0.00 ? 97  LEU A CA   5  
ATOM 6949  C C    . LEU A 1 67 ? 9.239   5.432   -1.747  1.00 0.00 ? 97  LEU A C    5  
ATOM 6950  O O    . LEU A 1 67 ? 9.300   5.875   -2.894  1.00 0.00 ? 97  LEU A O    5  
ATOM 6951  C CB   . LEU A 1 67 ? 8.372   3.089   -1.581  1.00 0.00 ? 97  LEU A CB   5  
ATOM 6952  C CG   . LEU A 1 67 ? 7.376   2.097   -0.978  1.00 0.00 ? 97  LEU A CG   5  
ATOM 6953  C CD1  . LEU A 1 67 ? 7.539   0.725   -1.613  1.00 0.00 ? 97  LEU A CD1  5  
ATOM 6954  C CD2  . LEU A 1 67 ? 7.555   2.013   0.531   1.00 0.00 ? 97  LEU A CD2  5  
ATOM 6955  H H    . LEU A 1 67 ? 6.447   4.353   -2.660  1.00 0.00 ? 97  LEU A H    5  
ATOM 6956  H HA   . LEU A 1 67 ? 7.905   4.698   -0.249  1.00 0.00 ? 97  LEU A HA   5  
ATOM 6957  H HB2  . LEU A 1 67 ? 8.395   2.940   -2.650  1.00 0.00 ? 97  LEU A HB2  5  
ATOM 6958  H HB3  . LEU A 1 67 ? 9.351   2.869   -1.182  1.00 0.00 ? 97  LEU A HB3  5  
ATOM 6959  H HG   . LEU A 1 67 ? 6.371   2.439   -1.178  1.00 0.00 ? 97  LEU A HG   5  
ATOM 6960  H HD11 . LEU A 1 67 ? 6.751   0.072   -1.268  1.00 0.00 ? 97  LEU A HD11 5  
ATOM 6961  H HD12 . LEU A 1 67 ? 8.498   0.311   -1.336  1.00 0.00 ? 97  LEU A HD12 5  
ATOM 6962  H HD13 . LEU A 1 67 ? 7.485   0.817   -2.688  1.00 0.00 ? 97  LEU A HD13 5  
ATOM 6963  H HD21 . LEU A 1 67 ? 8.182   1.167   0.771   1.00 0.00 ? 97  LEU A HD21 5  
ATOM 6964  H HD22 . LEU A 1 67 ? 6.591   1.892   1.002   1.00 0.00 ? 97  LEU A HD22 5  
ATOM 6965  H HD23 . LEU A 1 67 ? 8.020   2.919   0.889   1.00 0.00 ? 97  LEU A HD23 5  
ATOM 6966  N N    . PRO A 1 68 ? 10.195  5.687   -0.836  1.00 0.00 ? 98  PRO A N    5  
ATOM 6967  C CA   . PRO A 1 68 ? 11.374  6.507   -1.137  1.00 0.00 ? 98  PRO A CA   5  
ATOM 6968  C C    . PRO A 1 68 ? 12.340  5.807   -2.087  1.00 0.00 ? 98  PRO A C    5  
ATOM 6969  O O    . PRO A 1 68 ? 12.158  4.636   -2.422  1.00 0.00 ? 98  PRO A O    5  
ATOM 6970  C CB   . PRO A 1 68 ? 12.024  6.710   0.233   1.00 0.00 ? 98  PRO A CB   5  
ATOM 6971  C CG   . PRO A 1 68 ? 11.586  5.536   1.038   1.00 0.00 ? 98  PRO A CG   5  
ATOM 6972  C CD   . PRO A 1 68 ? 10.202  5.196   0.555   1.00 0.00 ? 98  PRO A CD   5  
ATOM 6973  H HA   . PRO A 1 68 ? 11.093  7.464   -1.551  1.00 0.00 ? 98  PRO A HA   5  
ATOM 6974  H HB2  . PRO A 1 68 ? 13.098  6.737   0.124   1.00 0.00 ? 98  PRO A HB2  5  
ATOM 6975  H HB3  . PRO A 1 68 ? 11.677  7.636   0.666   1.00 0.00 ? 98  PRO A HB3  5  
ATOM 6976  H HG2  . PRO A 1 68 ? 12.256  4.706   0.870   1.00 0.00 ? 98  PRO A HG2  5  
ATOM 6977  H HG3  . PRO A 1 68 ? 11.564  5.796   2.085   1.00 0.00 ? 98  PRO A HG3  5  
ATOM 6978  H HD2  . PRO A 1 68 ? 10.044  4.128   0.589   1.00 0.00 ? 98  PRO A HD2  5  
ATOM 6979  H HD3  . PRO A 1 68 ? 9.460   5.709   1.147   1.00 0.00 ? 98  PRO A HD3  5  
ATOM 6980  N N    . LEU A 1 69 ? 13.367  6.532   -2.517  1.00 0.00 ? 99  LEU A N    5  
ATOM 6981  C CA   . LEU A 1 69 ? 14.362  5.980   -3.429  1.00 0.00 ? 99  LEU A CA   5  
ATOM 6982  C C    . LEU A 1 69 ? 15.211  4.923   -2.733  1.00 0.00 ? 99  LEU A C    5  
ATOM 6983  O O    . LEU A 1 69 ? 15.681  3.975   -3.362  1.00 0.00 ? 99  LEU A O    5  
ATOM 6984  C CB   . LEU A 1 69 ? 15.257  7.094   -3.975  1.00 0.00 ? 99  LEU A CB   5  
ATOM 6985  C CG   . LEU A 1 69 ? 16.287  6.647   -5.015  1.00 0.00 ? 99  LEU A CG   5  
ATOM 6986  C CD1  . LEU A 1 69 ? 16.370  7.652   -6.154  1.00 0.00 ? 99  LEU A CD1  5  
ATOM 6987  C CD2  . LEU A 1 69 ? 17.651  6.457   -4.368  1.00 0.00 ? 99  LEU A CD2  5  
ATOM 6988  H H    . LEU A 1 69 ? 13.457  7.459   -2.215  1.00 0.00 ? 99  LEU A H    5  
ATOM 6989  H HA   . LEU A 1 69 ? 13.837  5.517   -4.252  1.00 0.00 ? 99  LEU A HA   5  
ATOM 6990  H HB2  . LEU A 1 69 ? 14.625  7.847   -4.423  1.00 0.00 ? 99  LEU A HB2  5  
ATOM 6991  H HB3  . LEU A 1 69 ? 15.786  7.540   -3.146  1.00 0.00 ? 99  LEU A HB3  5  
ATOM 6992  H HG   . LEU A 1 69 ? 15.979  5.698   -5.432  1.00 0.00 ? 99  LEU A HG   5  
ATOM 6993  H HD11 . LEU A 1 69 ? 16.106  8.633   -5.787  1.00 0.00 ? 99  LEU A HD11 5  
ATOM 6994  H HD12 . LEU A 1 69 ? 15.687  7.365   -6.938  1.00 0.00 ? 99  LEU A HD12 5  
ATOM 6995  H HD13 . LEU A 1 69 ? 17.377  7.672   -6.543  1.00 0.00 ? 99  LEU A HD13 5  
ATOM 6996  H HD21 . LEU A 1 69 ? 18.405  6.373   -5.136  1.00 0.00 ? 99  LEU A HD21 5  
ATOM 6997  H HD22 . LEU A 1 69 ? 17.644  5.557   -3.770  1.00 0.00 ? 99  LEU A HD22 5  
ATOM 6998  H HD23 . LEU A 1 69 ? 17.871  7.306   -3.738  1.00 0.00 ? 99  LEU A HD23 5  
ATOM 6999  N N    . GLY A 1 70 ? 15.406  5.092   -1.428  1.00 0.00 ? 100 GLY A N    5  
ATOM 7000  C CA   . GLY A 1 70 ? 16.198  4.144   -0.668  1.00 0.00 ? 100 GLY A CA   5  
ATOM 7001  C C    . GLY A 1 70 ? 15.520  2.795   -0.539  1.00 0.00 ? 100 GLY A C    5  
ATOM 7002  O O    . GLY A 1 70 ? 16.016  1.792   -1.050  1.00 0.00 ? 100 GLY A O    5  
ATOM 7003  H H    . GLY A 1 70 ? 15.007  5.867   -0.980  1.00 0.00 ? 100 GLY A H    5  
ATOM 7004  H HA2  . GLY A 1 70 ? 17.150  4.011   -1.160  1.00 0.00 ? 100 GLY A HA2  5  
ATOM 7005  H HA3  . GLY A 1 70 ? 16.369  4.545   0.321   1.00 0.00 ? 100 GLY A HA3  5  
ATOM 7006  N N    . TYR A 1 71 ? 14.381  2.770   0.147   1.00 0.00 ? 101 TYR A N    5  
ATOM 7007  C CA   . TYR A 1 71 ? 13.632  1.535   0.342   1.00 0.00 ? 101 TYR A CA   5  
ATOM 7008  C C    . TYR A 1 71 ? 12.835  1.180   -0.909  1.00 0.00 ? 101 TYR A C    5  
ATOM 7009  O O    . TYR A 1 71 ? 11.654  1.509   -1.019  1.00 0.00 ? 101 TYR A O    5  
ATOM 7010  C CB   . TYR A 1 71 ? 12.690  1.668   1.540   1.00 0.00 ? 101 TYR A CB   5  
ATOM 7011  C CG   . TYR A 1 71 ? 13.347  1.354   2.865   1.00 0.00 ? 101 TYR A CG   5  
ATOM 7012  C CD1  . TYR A 1 71 ? 14.622  1.821   3.158   1.00 0.00 ? 101 TYR A CD1  5  
ATOM 7013  C CD2  . TYR A 1 71 ? 12.692  0.592   3.825   1.00 0.00 ? 101 TYR A CD2  5  
ATOM 7014  C CE1  . TYR A 1 71 ? 15.226  1.536   4.368   1.00 0.00 ? 101 TYR A CE1  5  
ATOM 7015  C CE2  . TYR A 1 71 ? 13.288  0.304   5.037   1.00 0.00 ? 101 TYR A CE2  5  
ATOM 7016  C CZ   . TYR A 1 71 ? 14.555  0.778   5.304   1.00 0.00 ? 101 TYR A CZ   5  
ATOM 7017  O OH   . TYR A 1 71 ? 15.153  0.493   6.510   1.00 0.00 ? 101 TYR A OH   5  
ATOM 7018  H H    . TYR A 1 71 ? 14.036  3.604   0.531   1.00 0.00 ? 101 TYR A H    5  
ATOM 7019  H HA   . TYR A 1 71 ? 14.341  0.745   0.539   1.00 0.00 ? 101 TYR A HA   5  
ATOM 7020  H HB2  . TYR A 1 71 ? 12.319  2.681   1.587   1.00 0.00 ? 101 TYR A HB2  5  
ATOM 7021  H HB3  . TYR A 1 71 ? 11.859  0.990   1.412   1.00 0.00 ? 101 TYR A HB3  5  
ATOM 7022  H HD1  . TYR A 1 71 ? 15.146  2.414   2.423   1.00 0.00 ? 101 TYR A HD1  5  
ATOM 7023  H HD2  . TYR A 1 71 ? 11.700  0.222   3.612   1.00 0.00 ? 101 TYR A HD2  5  
ATOM 7024  H HE1  . TYR A 1 71 ? 16.219  1.908   4.577   1.00 0.00 ? 101 TYR A HE1  5  
ATOM 7025  H HE2  . TYR A 1 71 ? 12.763  -0.290  5.770   1.00 0.00 ? 101 TYR A HE2  5  
ATOM 7026  H HH   . TYR A 1 71 ? 14.953  -0.412  6.761   1.00 0.00 ? 101 TYR A HH   5  
ATOM 7027  N N    . ARG A 1 72 ? 13.489  0.507   -1.850  1.00 0.00 ? 102 ARG A N    5  
ATOM 7028  C CA   . ARG A 1 72 ? 12.841  0.109   -3.095  1.00 0.00 ? 102 ARG A CA   5  
ATOM 7029  C C    . ARG A 1 72 ? 12.066  -1.192  -2.913  1.00 0.00 ? 102 ARG A C    5  
ATOM 7030  O O    . ARG A 1 72 ? 12.461  -2.057  -2.131  1.00 0.00 ? 102 ARG A O    5  
ATOM 7031  C CB   . ARG A 1 72 ? 13.882  -0.052  -4.206  1.00 0.00 ? 102 ARG A CB   5  
ATOM 7032  C CG   . ARG A 1 72 ? 13.428  0.497   -5.548  1.00 0.00 ? 102 ARG A CG   5  
ATOM 7033  C CD   . ARG A 1 72 ? 14.074  1.839   -5.851  1.00 0.00 ? 102 ARG A CD   5  
ATOM 7034  N NE   . ARG A 1 72 ? 15.533  1.762   -5.826  1.00 0.00 ? 102 ARG A NE   5  
ATOM 7035  C CZ   . ARG A 1 72 ? 16.263  1.229   -6.804  1.00 0.00 ? 102 ARG A CZ   5  
ATOM 7036  N NH1  . ARG A 1 72 ? 15.675  0.730   -7.884  1.00 0.00 ? 102 ARG A NH1  5  
ATOM 7037  N NH2  . ARG A 1 72 ? 17.585  1.196   -6.702  1.00 0.00 ? 102 ARG A NH2  5  
ATOM 7038  H H    . ARG A 1 72 ? 14.430  0.275   -1.705  1.00 0.00 ? 102 ARG A H    5  
ATOM 7039  H HA   . ARG A 1 72 ? 12.150  0.890   -3.372  1.00 0.00 ? 102 ARG A HA   5  
ATOM 7040  H HB2  . ARG A 1 72 ? 14.784  0.465   -3.916  1.00 0.00 ? 102 ARG A HB2  5  
ATOM 7041  H HB3  . ARG A 1 72 ? 14.103  -1.102  -4.326  1.00 0.00 ? 102 ARG A HB3  5  
ATOM 7042  H HG2  . ARG A 1 72 ? 13.699  -0.204  -6.323  1.00 0.00 ? 102 ARG A HG2  5  
ATOM 7043  H HG3  . ARG A 1 72 ? 12.354  0.620   -5.531  1.00 0.00 ? 102 ARG A HG3  5  
ATOM 7044  H HD2  . ARG A 1 72 ? 13.757  2.165   -6.831  1.00 0.00 ? 102 ARG A HD2  5  
ATOM 7045  H HD3  . ARG A 1 72 ? 13.748  2.556   -5.111  1.00 0.00 ? 102 ARG A HD3  5  
ATOM 7046  H HE   . ARG A 1 72 ? 15.992  2.125   -5.041  1.00 0.00 ? 102 ARG A HE   5  
ATOM 7047  H HH11 . ARG A 1 72 ? 14.679  0.753   -7.969  1.00 0.00 ? 102 ARG A HH11 5  
ATOM 7048  H HH12 . ARG A 1 72 ? 16.229  0.332   -8.616  1.00 0.00 ? 102 ARG A HH12 5  
ATOM 7049  H HH21 . ARG A 1 72 ? 18.033  1.571   -5.890  1.00 0.00 ? 102 ARG A HH21 5  
ATOM 7050  H HH22 . ARG A 1 72 ? 18.133  0.795   -7.436  1.00 0.00 ? 102 ARG A HH22 5  
ATOM 7051  N N    . ILE A 1 73 ? 10.964  -1.324  -3.643  1.00 0.00 ? 103 ILE A N    5  
ATOM 7052  C CA   . ILE A 1 73 ? 10.135  -2.520  -3.564  1.00 0.00 ? 103 ILE A CA   5  
ATOM 7053  C C    . ILE A 1 73 ? 10.601  -3.576  -4.561  1.00 0.00 ? 103 ILE A C    5  
ATOM 7054  O O    . ILE A 1 73 ? 10.787  -3.288  -5.744  1.00 0.00 ? 103 ILE A O    5  
ATOM 7055  C CB   . ILE A 1 73 ? 8.649   -2.194  -3.823  1.00 0.00 ? 103 ILE A CB   5  
ATOM 7056  C CG1  . ILE A 1 73 ? 7.783   -3.437  -3.606  1.00 0.00 ? 103 ILE A CG1  5  
ATOM 7057  C CG2  . ILE A 1 73 ? 8.457   -1.648  -5.231  1.00 0.00 ? 103 ILE A CG2  5  
ATOM 7058  C CD1  . ILE A 1 73 ? 6.358   -3.120  -3.207  1.00 0.00 ? 103 ILE A CD1  5  
ATOM 7059  H H    . ILE A 1 73 ? 10.702  -0.600  -4.249  1.00 0.00 ? 103 ILE A H    5  
ATOM 7060  H HA   . ILE A 1 73 ? 10.224  -2.921  -2.564  1.00 0.00 ? 103 ILE A HA   5  
ATOM 7061  H HB   . ILE A 1 73 ? 8.345   -1.429  -3.125  1.00 0.00 ? 103 ILE A HB   5  
ATOM 7062  H HG12 . ILE A 1 73 ? 7.751   -4.010  -4.521  1.00 0.00 ? 103 ILE A HG12 5  
ATOM 7063  H HG13 . ILE A 1 73 ? 8.221   -4.041  -2.824  1.00 0.00 ? 103 ILE A HG13 5  
ATOM 7064  H HG21 . ILE A 1 73 ? 8.748   -2.398  -5.952  1.00 0.00 ? 103 ILE A HG21 5  
ATOM 7065  H HG22 . ILE A 1 73 ? 9.069   -0.767  -5.363  1.00 0.00 ? 103 ILE A HG22 5  
ATOM 7066  H HG23 . ILE A 1 73 ? 7.420   -1.389  -5.379  1.00 0.00 ? 103 ILE A HG23 5  
ATOM 7067  H HD11 . ILE A 1 73 ? 5.883   -4.013  -2.829  1.00 0.00 ? 103 ILE A HD11 5  
ATOM 7068  H HD12 . ILE A 1 73 ? 5.816   -2.760  -4.068  1.00 0.00 ? 103 ILE A HD12 5  
ATOM 7069  H HD13 . ILE A 1 73 ? 6.360   -2.360  -2.440  1.00 0.00 ? 103 ILE A HD13 5  
ATOM 7070  N N    . ASP A 1 74 ? 10.788  -4.800  -4.077  1.00 0.00 ? 104 ASP A N    5  
ATOM 7071  C CA   . ASP A 1 74 ? 11.234  -5.897  -4.928  1.00 0.00 ? 104 ASP A CA   5  
ATOM 7072  C C    . ASP A 1 74 ? 10.408  -7.154  -4.675  1.00 0.00 ? 104 ASP A C    5  
ATOM 7073  O O    . ASP A 1 74 ? 9.424   -7.125  -3.935  1.00 0.00 ? 104 ASP A O    5  
ATOM 7074  C CB   . ASP A 1 74 ? 12.717  -6.188  -4.684  1.00 0.00 ? 104 ASP A CB   5  
ATOM 7075  C CG   . ASP A 1 74 ? 13.486  -6.388  -5.976  1.00 0.00 ? 104 ASP A CG   5  
ATOM 7076  O OD1  . ASP A 1 74 ? 13.867  -5.378  -6.602  1.00 0.00 ? 104 ASP A OD1  5  
ATOM 7077  O OD2  . ASP A 1 74 ? 13.708  -7.557  -6.359  1.00 0.00 ? 104 ASP A OD2  5  
ATOM 7078  H H    . ASP A 1 74 ? 10.624  -4.969  -3.126  1.00 0.00 ? 104 ASP A H    5  
ATOM 7079  H HA   . ASP A 1 74 ? 11.101  -5.595  -5.956  1.00 0.00 ? 104 ASP A HA   5  
ATOM 7080  H HB2  . ASP A 1 74 ? 13.156  -5.359  -4.151  1.00 0.00 ? 104 ASP A HB2  5  
ATOM 7081  H HB3  . ASP A 1 74 ? 12.809  -7.085  -4.088  1.00 0.00 ? 104 ASP A HB3  5  
ATOM 7082  N N    . ILE A 1 75 ? 10.815  -8.257  -5.296  1.00 0.00 ? 105 ILE A N    5  
ATOM 7083  C CA   . ILE A 1 75 ? 10.114  -9.525  -5.140  1.00 0.00 ? 105 ILE A CA   5  
ATOM 7084  C C    . ILE A 1 75 ? 11.035  -10.703 -5.450  1.00 0.00 ? 105 ILE A C    5  
ATOM 7085  O O    . ILE A 1 75 ? 11.209  -11.076 -6.610  1.00 0.00 ? 105 ILE A O    5  
ATOM 7086  C CB   . ILE A 1 75 ? 8.880   -9.601  -6.059  1.00 0.00 ? 105 ILE A CB   5  
ATOM 7087  C CG1  . ILE A 1 75 ? 9.250   -9.190  -7.485  1.00 0.00 ? 105 ILE A CG1  5  
ATOM 7088  C CG2  . ILE A 1 75 ? 7.763   -8.720  -5.520  1.00 0.00 ? 105 ILE A CG2  5  
ATOM 7089  C CD1  . ILE A 1 75 ? 8.586   -10.035 -8.549  1.00 0.00 ? 105 ILE A CD1  5  
ATOM 7090  H H    . ILE A 1 75 ? 11.606  -8.216  -5.873  1.00 0.00 ? 105 ILE A H    5  
ATOM 7091  H HA   . ILE A 1 75 ? 9.779   -9.600  -4.116  1.00 0.00 ? 105 ILE A HA   5  
ATOM 7092  H HB   . ILE A 1 75 ? 8.526   -10.621 -6.067  1.00 0.00 ? 105 ILE A HB   5  
ATOM 7093  H HG12 . ILE A 1 75 ? 8.954   -8.164  -7.646  1.00 0.00 ? 105 ILE A HG12 5  
ATOM 7094  H HG13 . ILE A 1 75 ? 10.319  -9.275  -7.612  1.00 0.00 ? 105 ILE A HG13 5  
ATOM 7095  H HG21 . ILE A 1 75 ? 7.634   -8.907  -4.464  1.00 0.00 ? 105 ILE A HG21 5  
ATOM 7096  H HG22 . ILE A 1 75 ? 6.843   -8.946  -6.041  1.00 0.00 ? 105 ILE A HG22 5  
ATOM 7097  H HG23 . ILE A 1 75 ? 8.016   -7.682  -5.674  1.00 0.00 ? 105 ILE A HG23 5  
ATOM 7098  H HD11 . ILE A 1 75 ? 8.442   -11.038 -8.175  1.00 0.00 ? 105 ILE A HD11 5  
ATOM 7099  H HD12 . ILE A 1 75 ? 9.213   -10.065 -9.428  1.00 0.00 ? 105 ILE A HD12 5  
ATOM 7100  H HD13 . ILE A 1 75 ? 7.628   -9.605  -8.805  1.00 0.00 ? 105 ILE A HD13 5  
ATOM 7101  N N    . PRO A 1 76 ? 11.641  -11.310 -4.413  1.00 0.00 ? 106 PRO A N    5  
ATOM 7102  C CA   . PRO A 1 76 ? 12.548  -12.450 -4.586  1.00 0.00 ? 106 PRO A CA   5  
ATOM 7103  C C    . PRO A 1 76 ? 11.950  -13.539 -5.470  1.00 0.00 ? 106 PRO A C    5  
ATOM 7104  O O    . PRO A 1 76 ? 10.875  -14.066 -5.182  1.00 0.00 ? 106 PRO A O    5  
ATOM 7105  C CB   . PRO A 1 76 ? 12.742  -12.964 -3.159  1.00 0.00 ? 106 PRO A CB   5  
ATOM 7106  C CG   . PRO A 1 76 ? 12.529  -11.770 -2.295  1.00 0.00 ? 106 PRO A CG   5  
ATOM 7107  C CD   . PRO A 1 76 ? 11.493  -10.932 -2.993  1.00 0.00 ? 106 PRO A CD   5  
ATOM 7108  H HA   . PRO A 1 76 ? 13.499  -12.140 -4.992  1.00 0.00 ? 106 PRO A HA   5  
ATOM 7109  H HB2  . PRO A 1 76 ? 12.018  -13.739 -2.951  1.00 0.00 ? 106 PRO A HB2  5  
ATOM 7110  H HB3  . PRO A 1 76 ? 13.741  -13.359 -3.048  1.00 0.00 ? 106 PRO A HB3  5  
ATOM 7111  H HG2  . PRO A 1 76 ? 12.170  -12.079 -1.325  1.00 0.00 ? 106 PRO A HG2  5  
ATOM 7112  H HG3  . PRO A 1 76 ? 13.452  -11.219 -2.196  1.00 0.00 ? 106 PRO A HG3  5  
ATOM 7113  H HD2  . PRO A 1 76 ? 10.504  -11.176 -2.631  1.00 0.00 ? 106 PRO A HD2  5  
ATOM 7114  H HD3  . PRO A 1 76 ? 11.700  -9.881  -2.851  1.00 0.00 ? 106 PRO A HD3  5  
ATOM 7115  N N    . LYS A 1 77 ? 12.653  -13.872 -6.546  1.00 0.00 ? 107 LYS A N    5  
ATOM 7116  C CA   . LYS A 1 77 ? 12.193  -14.899 -7.473  1.00 0.00 ? 107 LYS A CA   5  
ATOM 7117  C C    . LYS A 1 77 ? 13.224  -15.144 -8.570  1.00 0.00 ? 107 LYS A C    5  
ATOM 7118  O O    . LYS A 1 77 ? 14.216  -14.387 -8.628  1.00 0.00 ? 107 LYS A O    5  
ATOM 7119  C CB   . LYS A 1 77 ? 10.855  -14.492 -8.094  1.00 0.00 ? 107 LYS A CB   5  
ATOM 7120  C CG   . LYS A 1 77 ? 10.254  -15.557 -8.999  1.00 0.00 ? 107 LYS A CG   5  
ATOM 7121  C CD   . LYS A 1 77 ? 8.753   -15.374 -9.152  1.00 0.00 ? 107 LYS A CD   5  
ATOM 7122  C CE   . LYS A 1 77 ? 7.983   -16.267 -8.194  1.00 0.00 ? 107 LYS A CE   5  
ATOM 7123  N NZ   . LYS A 1 77 ? 6.739   -16.804 -8.812  1.00 0.00 ? 107 LYS A NZ   5  
ATOM 7124  O OXT  . LYS A 1 77 ? 13.030  -16.090 -9.362  1.00 0.00 ? 107 LYS A OXT  5  
ATOM 7125  H H    . LYS A 1 77 ? 13.502  -13.417 -6.722  1.00 0.00 ? 107 LYS A H    5  
ATOM 7126  H HA   . LYS A 1 77 ? 12.056  -15.812 -6.914  1.00 0.00 ? 107 LYS A HA   5  
ATOM 7127  H HB2  . LYS A 1 77 ? 10.152  -14.286 -7.302  1.00 0.00 ? 107 LYS A HB2  5  
ATOM 7128  H HB3  . LYS A 1 77 ? 11.000  -13.595 -8.678  1.00 0.00 ? 107 LYS A HB3  5  
ATOM 7129  H HG2  . LYS A 1 77 ? 10.717  -15.491 -9.972  1.00 0.00 ? 107 LYS A HG2  5  
ATOM 7130  H HG3  . LYS A 1 77 ? 10.449  -16.529 -8.570  1.00 0.00 ? 107 LYS A HG3  5  
ATOM 7131  H HD2  . LYS A 1 77 ? 8.503   -14.344 -8.950  1.00 0.00 ? 107 LYS A HD2  5  
ATOM 7132  H HD3  . LYS A 1 77 ? 8.473   -15.623 -10.166 1.00 0.00 ? 107 LYS A HD3  5  
ATOM 7133  H HE2  . LYS A 1 77 ? 8.615   -17.093 -7.903  1.00 0.00 ? 107 LYS A HE2  5  
ATOM 7134  H HE3  . LYS A 1 77 ? 7.719   -15.691 -7.319  1.00 0.00 ? 107 LYS A HE3  5  
ATOM 7135  H HZ1  . LYS A 1 77 ? 6.001   -16.920 -8.089  1.00 0.00 ? 107 LYS A HZ1  5  
ATOM 7136  H HZ2  . LYS A 1 77 ? 6.928   -17.728 -9.252  1.00 0.00 ? 107 LYS A HZ2  5  
ATOM 7137  H HZ3  . LYS A 1 77 ? 6.392   -16.151 -9.543  1.00 0.00 ? 107 LYS A HZ3  5  
ATOM 7138  N N    . ALA B 2 1  ? 8.577   5.712   6.838   1.00 0.00 ? 43  ALA B N    5  
ATOM 7139  C CA   . ALA B 2 1  ? 8.358   6.816   5.868   1.00 0.00 ? 43  ALA B CA   5  
ATOM 7140  C C    . ALA B 2 1  ? 7.080   7.584   6.192   1.00 0.00 ? 43  ALA B C    5  
ATOM 7141  O O    . ALA B 2 1  ? 6.118   7.015   6.706   1.00 0.00 ? 43  ALA B O    5  
ATOM 7142  C CB   . ALA B 2 1  ? 8.299   6.267   4.451   1.00 0.00 ? 43  ALA B CB   5  
ATOM 7143  H H1   . ALA B 2 1  ? 9.275   5.060   6.426   1.00 0.00 ? 43  ALA B H1   5  
ATOM 7144  H H2   . ALA B 2 1  ? 7.664   5.238   6.991   1.00 0.00 ? 43  ALA B H2   5  
ATOM 7145  H H3   . ALA B 2 1  ? 8.935   6.131   7.721   1.00 0.00 ? 43  ALA B H3   5  
ATOM 7146  H HA   . ALA B 2 1  ? 9.198   7.494   5.931   1.00 0.00 ? 43  ALA B HA   5  
ATOM 7147  H HB1  . ALA B 2 1  ? 8.072   7.069   3.764   1.00 0.00 ? 43  ALA B HB1  5  
ATOM 7148  H HB2  . ALA B 2 1  ? 7.529   5.512   4.389   1.00 0.00 ? 43  ALA B HB2  5  
ATOM 7149  H HB3  . ALA B 2 1  ? 9.253   5.831   4.193   1.00 0.00 ? 43  ALA B HB3  5  
ATOM 7150  N N    . PRO B 2 2  ? 7.053   8.895   5.894   1.00 0.00 ? 44  PRO B N    5  
ATOM 7151  C CA   . PRO B 2 2  ? 5.882   9.738   6.157   1.00 0.00 ? 44  PRO B CA   5  
ATOM 7152  C C    . PRO B 2 2  ? 4.736   9.461   5.190   1.00 0.00 ? 44  PRO B C    5  
ATOM 7153  O O    . PRO B 2 2  ? 3.582   9.789   5.471   1.00 0.00 ? 44  PRO B O    5  
ATOM 7154  C CB   . PRO B 2 2  ? 6.419   11.156  5.957   1.00 0.00 ? 44  PRO B CB   5  
ATOM 7155  C CG   . PRO B 2 2  ? 7.543   11.000  4.991   1.00 0.00 ? 44  PRO B CG   5  
ATOM 7156  C CD   . PRO B 2 2  ? 8.157   9.656   5.279   1.00 0.00 ? 44  PRO B CD   5  
ATOM 7157  H HA   . PRO B 2 2  ? 5.533   9.623   7.171   1.00 0.00 ? 44  PRO B HA   5  
ATOM 7158  H HB2  . PRO B 2 2  ? 5.638   11.787  5.559   1.00 0.00 ? 44  PRO B HB2  5  
ATOM 7159  H HB3  . PRO B 2 2  ? 6.764   11.550  6.902   1.00 0.00 ? 44  PRO B HB3  5  
ATOM 7160  H HG2  . PRO B 2 2  ? 7.164   11.031  3.981   1.00 0.00 ? 44  PRO B HG2  5  
ATOM 7161  H HG3  . PRO B 2 2  ? 8.269   11.784  5.144   1.00 0.00 ? 44  PRO B HG3  5  
ATOM 7162  H HD2  . PRO B 2 2  ? 8.483   9.187   4.361   1.00 0.00 ? 44  PRO B HD2  5  
ATOM 7163  H HD3  . PRO B 2 2  ? 8.984   9.759   5.966   1.00 0.00 ? 44  PRO B HD3  5  
ATOM 7164  N N    . GLN B 2 3  ? 5.056   8.853   4.051   1.00 0.00 ? 45  GLN B N    5  
ATOM 7165  C CA   . GLN B 2 3  ? 4.049   8.532   3.049   1.00 0.00 ? 45  GLN B CA   5  
ATOM 7166  C C    . GLN B 2 3  ? 3.260   7.293   3.453   1.00 0.00 ? 45  GLN B C    5  
ATOM 7167  O O    . GLN B 2 3  ? 2.119   7.105   3.034   1.00 0.00 ? 45  GLN B O    5  
ATOM 7168  C CB   . GLN B 2 3  ? 4.705   8.312   1.684   1.00 0.00 ? 45  GLN B CB   5  
ATOM 7169  C CG   . GLN B 2 3  ? 5.539   9.492   1.214   1.00 0.00 ? 45  GLN B CG   5  
ATOM 7170  C CD   . GLN B 2 3  ? 4.758   10.443  0.328   1.00 0.00 ? 45  GLN B CD   5  
ATOM 7171  O OE1  . GLN B 2 3  ? 5.008   10.537  -0.873  1.00 0.00 ? 45  GLN B OE1  5  
ATOM 7172  N NE2  . GLN B 2 3  ? 3.806   11.155  0.920   1.00 0.00 ? 45  GLN B NE2  5  
ATOM 7173  H H    . GLN B 2 3  ? 5.990   8.612   3.883   1.00 0.00 ? 45  GLN B H    5  
ATOM 7174  H HA   . GLN B 2 3  ? 3.371   9.366   2.984   1.00 0.00 ? 45  GLN B HA   5  
ATOM 7175  H HB2  . GLN B 2 3  ? 5.347   7.446   1.742   1.00 0.00 ? 45  GLN B HB2  5  
ATOM 7176  H HB3  . GLN B 2 3  ? 3.933   8.130   0.952   1.00 0.00 ? 45  GLN B HB3  5  
ATOM 7177  H HG2  . GLN B 2 3  ? 5.890   10.036  2.079   1.00 0.00 ? 45  GLN B HG2  5  
ATOM 7178  H HG3  . GLN B 2 3  ? 6.387   9.119   0.658   1.00 0.00 ? 45  GLN B HG3  5  
ATOM 7179  H HE21 . GLN B 2 3  ? 3.663   11.029  1.881   1.00 0.00 ? 45  GLN B HE21 5  
ATOM 7180  H HE22 . GLN B 2 3  ? 3.285   11.778  0.371   1.00 0.00 ? 45  GLN B HE22 5  
ATOM 7181  N N    . LEU B 2 4  ? 3.876   6.453   4.275   1.00 0.00 ? 46  LEU B N    5  
ATOM 7182  C CA   . LEU B 2 4  ? 3.230   5.235   4.740   1.00 0.00 ? 46  LEU B CA   5  
ATOM 7183  C C    . LEU B 2 4  ? 2.202   5.555   5.817   1.00 0.00 ? 46  LEU B C    5  
ATOM 7184  O O    . LEU B 2 4  ? 1.123   4.965   5.856   1.00 0.00 ? 46  LEU B O    5  
ATOM 7185  C CB   . LEU B 2 4  ? 4.268   4.249   5.279   1.00 0.00 ? 46  LEU B CB   5  
ATOM 7186  C CG   . LEU B 2 4  ? 4.977   3.411   4.214   1.00 0.00 ? 46  LEU B CG   5  
ATOM 7187  C CD1  . LEU B 2 4  ? 5.964   2.451   4.860   1.00 0.00 ? 46  LEU B CD1  5  
ATOM 7188  C CD2  . LEU B 2 4  ? 3.963   2.650   3.373   1.00 0.00 ? 46  LEU B CD2  5  
ATOM 7189  H H    . LEU B 2 4  ? 4.784   6.660   4.577   1.00 0.00 ? 46  LEU B H    5  
ATOM 7190  H HA   . LEU B 2 4  ? 2.722   4.791   3.898   1.00 0.00 ? 46  LEU B HA   5  
ATOM 7191  H HB2  . LEU B 2 4  ? 5.015   4.808   5.824   1.00 0.00 ? 46  LEU B HB2  5  
ATOM 7192  H HB3  . LEU B 2 4  ? 3.774   3.576   5.963   1.00 0.00 ? 46  LEU B HB3  5  
ATOM 7193  H HG   . LEU B 2 4  ? 5.532   4.068   3.558   1.00 0.00 ? 46  LEU B HG   5  
ATOM 7194  H HD11 . LEU B 2 4  ? 5.443   1.562   5.180   1.00 0.00 ? 46  LEU B HD11 5  
ATOM 7195  H HD12 . LEU B 2 4  ? 6.423   2.927   5.713   1.00 0.00 ? 46  LEU B HD12 5  
ATOM 7196  H HD13 . LEU B 2 4  ? 6.727   2.183   4.144   1.00 0.00 ? 46  LEU B HD13 5  
ATOM 7197  H HD21 . LEU B 2 4  ? 4.428   1.769   2.957   1.00 0.00 ? 46  LEU B HD21 5  
ATOM 7198  H HD22 . LEU B 2 4  ? 3.612   3.284   2.572   1.00 0.00 ? 46  LEU B HD22 5  
ATOM 7199  H HD23 . LEU B 2 4  ? 3.128   2.359   3.993   1.00 0.00 ? 46  LEU B HD23 5  
ATOM 7200  N N    . ILE B 2 5  ? 2.541   6.503   6.684   1.00 0.00 ? 47  ILE B N    5  
ATOM 7201  C CA   . ILE B 2 5  ? 1.643   6.911   7.755   1.00 0.00 ? 47  ILE B CA   5  
ATOM 7202  C C    . ILE B 2 5  ? 0.453   7.674   7.189   1.00 0.00 ? 47  ILE B C    5  
ATOM 7203  O O    . ILE B 2 5  ? -0.682  7.499   7.636   1.00 0.00 ? 47  ILE B O    5  
ATOM 7204  C CB   . ILE B 2 5  ? 2.364   7.794   8.793   1.00 0.00 ? 47  ILE B CB   5  
ATOM 7205  C CG1  . ILE B 2 5  ? 3.660   7.124   9.253   1.00 0.00 ? 47  ILE B CG1  5  
ATOM 7206  C CG2  . ILE B 2 5  ? 1.452   8.070   9.978   1.00 0.00 ? 47  ILE B CG2  5  
ATOM 7207  C CD1  . ILE B 2 5  ? 4.487   7.985   10.183  1.00 0.00 ? 47  ILE B CD1  5  
ATOM 7208  H H    . ILE B 2 5  ? 3.412   6.942   6.597   1.00 0.00 ? 47  ILE B H    5  
ATOM 7209  H HA   . ILE B 2 5  ? 1.286   6.020   8.252   1.00 0.00 ? 47  ILE B HA   5  
ATOM 7210  H HB   . ILE B 2 5  ? 2.602   8.738   8.325   1.00 0.00 ? 47  ILE B HB   5  
ATOM 7211  H HG12 . ILE B 2 5  ? 3.419   6.210   9.777   1.00 0.00 ? 47  ILE B HG12 5  
ATOM 7212  H HG13 . ILE B 2 5  ? 4.264   6.890   8.390   1.00 0.00 ? 47  ILE B HG13 5  
ATOM 7213  H HG21 . ILE B 2 5  ? 0.893   7.177   10.218  1.00 0.00 ? 47  ILE B HG21 5  
ATOM 7214  H HG22 . ILE B 2 5  ? 0.768   8.868   9.730   1.00 0.00 ? 47  ILE B HG22 5  
ATOM 7215  H HG23 . ILE B 2 5  ? 2.049   8.360   10.831  1.00 0.00 ? 47  ILE B HG23 5  
ATOM 7216  H HD11 . ILE B 2 5  ? 4.893   7.374   10.975  1.00 0.00 ? 47  ILE B HD11 5  
ATOM 7217  H HD12 . ILE B 2 5  ? 3.865   8.758   10.607  1.00 0.00 ? 47  ILE B HD12 5  
ATOM 7218  H HD13 . ILE B 2 5  ? 5.296   8.438   9.629   1.00 0.00 ? 47  ILE B HD13 5  
ATOM 7219  N N    . MET B 2 6  ? 0.718   8.518   6.195   1.00 0.00 ? 48  MET B N    5  
ATOM 7220  C CA   . MET B 2 6  ? -0.332  9.302   5.561   1.00 0.00 ? 48  MET B CA   5  
ATOM 7221  C C    . MET B 2 6  ? -1.228  8.413   4.705   1.00 0.00 ? 48  MET B C    5  
ATOM 7222  O O    . MET B 2 6  ? -2.404  8.713   4.498   1.00 0.00 ? 48  MET B O    5  
ATOM 7223  C CB   . MET B 2 6  ? 0.275   10.428  4.714   1.00 0.00 ? 48  MET B CB   5  
ATOM 7224  C CG   . MET B 2 6  ? 0.764   9.981   3.344   1.00 0.00 ? 48  MET B CG   5  
ATOM 7225  S SD   . MET B 2 6  ? -0.375  10.427  2.019   1.00 0.00 ? 48  MET B SD   5  
ATOM 7226  C CE   . MET B 2 6  ? 0.052   9.206   0.780   1.00 0.00 ? 48  MET B CE   5  
ATOM 7227  H H    . MET B 2 6  ? 1.642   8.609   5.879   1.00 0.00 ? 48  MET B H    5  
ATOM 7228  H HA   . MET B 2 6  ? -0.930  9.737   6.344   1.00 0.00 ? 48  MET B HA   5  
ATOM 7229  H HB2  . MET B 2 6  ? -0.470  11.197  4.572   1.00 0.00 ? 48  MET B HB2  5  
ATOM 7230  H HB3  . MET B 2 6  ? 1.114   10.850  5.248   1.00 0.00 ? 48  MET B HB3  5  
ATOM 7231  H HG2  . MET B 2 6  ? 1.719   10.445  3.148   1.00 0.00 ? 48  MET B HG2  5  
ATOM 7232  H HG3  . MET B 2 6  ? 0.881   8.908   3.353   1.00 0.00 ? 48  MET B HG3  5  
ATOM 7233  H HE1  . MET B 2 6  ? -0.718  8.450   0.740   1.00 0.00 ? 48  MET B HE1  5  
ATOM 7234  H HE2  . MET B 2 6  ? 0.996   8.746   1.038   1.00 0.00 ? 48  MET B HE2  5  
ATOM 7235  H HE3  . MET B 2 6  ? 0.136   9.685   -0.184  1.00 0.00 ? 48  MET B HE3  5  
ATOM 7236  N N    . LEU B 2 7  ? -0.664  7.314   4.219   1.00 0.00 ? 49  LEU B N    5  
ATOM 7237  C CA   . LEU B 2 7  ? -1.411  6.375   3.393   1.00 0.00 ? 49  LEU B CA   5  
ATOM 7238  C C    . LEU B 2 7  ? -2.472  5.659   4.221   1.00 0.00 ? 49  LEU B C    5  
ATOM 7239  O O    . LEU B 2 7  ? -3.626  5.544   3.808   1.00 0.00 ? 49  LEU B O    5  
ATOM 7240  C CB   . LEU B 2 7  ? -0.463  5.354   2.758   1.00 0.00 ? 49  LEU B CB   5  
ATOM 7241  C CG   . LEU B 2 7  ? 0.018   5.706   1.349   1.00 0.00 ? 49  LEU B CG   5  
ATOM 7242  C CD1  . LEU B 2 7  ? 1.312   4.976   1.029   1.00 0.00 ? 49  LEU B CD1  5  
ATOM 7243  C CD2  . LEU B 2 7  ? -1.054  5.368   0.323   1.00 0.00 ? 49  LEU B CD2  5  
ATOM 7244  H H    . LEU B 2 7  ? 0.276   7.129   4.425   1.00 0.00 ? 49  LEU B H    5  
ATOM 7245  H HA   . LEU B 2 7  ? -1.899  6.936   2.610   1.00 0.00 ? 49  LEU B HA   5  
ATOM 7246  H HB2  . LEU B 2 7  ? 0.403   5.254   3.396   1.00 0.00 ? 49  LEU B HB2  5  
ATOM 7247  H HB3  . LEU B 2 7  ? -0.968  4.402   2.713   1.00 0.00 ? 49  LEU B HB3  5  
ATOM 7248  H HG   . LEU B 2 7  ? 0.211   6.767   1.296   1.00 0.00 ? 49  LEU B HG   5  
ATOM 7249  H HD11 . LEU B 2 7  ? 2.071   5.258   1.744   1.00 0.00 ? 49  LEU B HD11 5  
ATOM 7250  H HD12 . LEU B 2 7  ? 1.640   5.242   0.035   1.00 0.00 ? 49  LEU B HD12 5  
ATOM 7251  H HD13 . LEU B 2 7  ? 1.147   3.910   1.082   1.00 0.00 ? 49  LEU B HD13 5  
ATOM 7252  H HD21 . LEU B 2 7  ? -2.017  5.698   0.686   1.00 0.00 ? 49  LEU B HD21 5  
ATOM 7253  H HD22 . LEU B 2 7  ? -1.076  4.301   0.163   1.00 0.00 ? 49  LEU B HD22 5  
ATOM 7254  H HD23 . LEU B 2 7  ? -0.831  5.868   -0.609  1.00 0.00 ? 49  LEU B HD23 5  
ATOM 7255  N N    . ALA B 2 8  ? -2.072  5.182   5.396   1.00 0.00 ? 50  ALA B N    5  
ATOM 7256  C CA   . ALA B 2 8  ? -2.985  4.481   6.286   1.00 0.00 ? 50  ALA B CA   5  
ATOM 7257  C C    . ALA B 2 8  ? -4.082  5.412   6.789   1.00 0.00 ? 50  ALA B C    5  
ATOM 7258  O O    . ALA B 2 8  ? -5.232  5.003   6.953   1.00 0.00 ? 50  ALA B O    5  
ATOM 7259  C CB   . ALA B 2 8  ? -2.224  3.880   7.459   1.00 0.00 ? 50  ALA B CB   5  
ATOM 7260  H H    . ALA B 2 8  ? -1.141  5.307   5.670   1.00 0.00 ? 50  ALA B H    5  
ATOM 7261  H HA   . ALA B 2 8  ? -3.437  3.673   5.730   1.00 0.00 ? 50  ALA B HA   5  
ATOM 7262  H HB1  . ALA B 2 8  ? -2.763  3.025   7.839   1.00 0.00 ? 50  ALA B HB1  5  
ATOM 7263  H HB2  . ALA B 2 8  ? -2.124  4.619   8.240   1.00 0.00 ? 50  ALA B HB2  5  
ATOM 7264  H HB3  . ALA B 2 8  ? -1.243  3.569   7.130   1.00 0.00 ? 50  ALA B HB3  5  
ATOM 7265  N N    . ASN B 2 9  ? -3.721  6.669   7.028   1.00 0.00 ? 51  ASN B N    5  
ATOM 7266  C CA   . ASN B 2 9  ? -4.678  7.658   7.509   1.00 0.00 ? 51  ASN B CA   5  
ATOM 7267  C C    . ASN B 2 9  ? -5.796  7.864   6.494   1.00 0.00 ? 51  ASN B C    5  
ATOM 7268  O O    . ASN B 2 9  ? -6.975  7.888   6.849   1.00 0.00 ? 51  ASN B O    5  
ATOM 7269  C CB   . ASN B 2 9  ? -3.975  8.988   7.789   1.00 0.00 ? 51  ASN B CB   5  
ATOM 7270  C CG   . ASN B 2 9  ? -4.893  10.001  8.444   1.00 0.00 ? 51  ASN B CG   5  
ATOM 7271  O OD1  . ASN B 2 9  ? -6.110  9.962   8.262   1.00 0.00 ? 51  ASN B OD1  5  
ATOM 7272  N ND2  . ASN B 2 9  ? -4.313  10.915  9.212   1.00 0.00 ? 51  ASN B ND2  5  
ATOM 7273  H H    . ASN B 2 9  ? -2.790  6.938   6.876   1.00 0.00 ? 51  ASN B H    5  
ATOM 7274  H HA   . ASN B 2 9  ? -5.106  7.287   8.428   1.00 0.00 ? 51  ASN B HA   5  
ATOM 7275  H HB2  . ASN B 2 9  ? -3.136  8.813   8.445   1.00 0.00 ? 51  ASN B HB2  5  
ATOM 7276  H HB3  . ASN B 2 9  ? -3.618  9.403   6.857   1.00 0.00 ? 51  ASN B HB3  5  
ATOM 7277  H HD21 . ASN B 2 9  ? -3.338  10.886  9.311   1.00 0.00 ? 51  ASN B HD21 5  
ATOM 7278  H HD22 . ASN B 2 9  ? -4.882  11.582  9.650   1.00 0.00 ? 51  ASN B HD22 5  
ATOM 7279  N N    . VAL B 2 10 ? -5.418  8.007   5.228   1.00 0.00 ? 52  VAL B N    5  
ATOM 7280  C CA   . VAL B 2 10 ? -6.387  8.205   4.159   1.00 0.00 ? 52  VAL B CA   5  
ATOM 7281  C C    . VAL B 2 10 ? -7.239  6.956   3.958   1.00 0.00 ? 52  VAL B C    5  
ATOM 7282  O O    . VAL B 2 10 ? -8.388  7.040   3.523   1.00 0.00 ? 52  VAL B O    5  
ATOM 7283  C CB   . VAL B 2 10 ? -5.694  8.564   2.831   1.00 0.00 ? 52  VAL B CB   5  
ATOM 7284  C CG1  . VAL B 2 10 ? -6.722  8.874   1.753   1.00 0.00 ? 52  VAL B CG1  5  
ATOM 7285  C CG2  . VAL B 2 10 ? -4.743  9.735   3.025   1.00 0.00 ? 52  VAL B CG2  5  
ATOM 7286  H H    . VAL B 2 10 ? -4.464  7.975   5.008   1.00 0.00 ? 52  VAL B H    5  
ATOM 7287  H HA   . VAL B 2 10 ? -7.033  9.027   4.440   1.00 0.00 ? 52  VAL B HA   5  
ATOM 7288  H HB   . VAL B 2 10 ? -5.116  7.710   2.509   1.00 0.00 ? 52  VAL B HB   5  
ATOM 7289  H HG11 . VAL B 2 10 ? -7.356  8.014   1.602   1.00 0.00 ? 52  VAL B HG11 5  
ATOM 7290  H HG12 . VAL B 2 10 ? -6.215  9.116   0.831   1.00 0.00 ? 52  VAL B HG12 5  
ATOM 7291  H HG13 . VAL B 2 10 ? -7.324  9.717   2.063   1.00 0.00 ? 52  VAL B HG13 5  
ATOM 7292  H HG21 . VAL B 2 10 ? -3.926  9.656   2.324   1.00 0.00 ? 52  VAL B HG21 5  
ATOM 7293  H HG22 . VAL B 2 10 ? -4.356  9.722   4.033   1.00 0.00 ? 52  VAL B HG22 5  
ATOM 7294  H HG23 . VAL B 2 10 ? -5.275  10.661  2.857   1.00 0.00 ? 52  VAL B HG23 5  
ATOM 7295  N N    . ALA B 2 11 ? -6.673  5.798   4.285   1.00 0.00 ? 53  ALA B N    5  
ATOM 7296  C CA   . ALA B 2 11 ? -7.382  4.540   4.148   1.00 0.00 ? 53  ALA B CA   5  
ATOM 7297  C C    . ALA B 2 11 ? -8.363  4.361   5.296   1.00 0.00 ? 53  ALA B C    5  
ATOM 7298  O O    . ALA B 2 11 ? -9.451  3.813   5.122   1.00 0.00 ? 53  ALA B O    5  
ATOM 7299  C CB   . ALA B 2 11 ? -6.400  3.379   4.099   1.00 0.00 ? 53  ALA B CB   5  
ATOM 7300  H H    . ALA B 2 11 ? -5.762  5.792   4.632   1.00 0.00 ? 53  ALA B H    5  
ATOM 7301  H HA   . ALA B 2 11 ? -7.925  4.564   3.219   1.00 0.00 ? 53  ALA B HA   5  
ATOM 7302  H HB1  . ALA B 2 11 ? -5.492  3.652   4.616   1.00 0.00 ? 53  ALA B HB1  5  
ATOM 7303  H HB2  . ALA B 2 11 ? -6.172  3.144   3.070   1.00 0.00 ? 53  ALA B HB2  5  
ATOM 7304  H HB3  . ALA B 2 11 ? -6.839  2.515   4.576   1.00 0.00 ? 53  ALA B HB3  5  
ATOM 7305  N N    . LEU B 2 12 ? -7.968  4.839   6.471   1.00 0.00 ? 54  LEU B N    5  
ATOM 7306  C CA   . LEU B 2 12 ? -8.805  4.746   7.651   1.00 0.00 ? 54  LEU B CA   5  
ATOM 7307  C C    . LEU B 2 12 ? -9.769  5.927   7.727   1.00 0.00 ? 54  LEU B C    5  
ATOM 7308  O O    . LEU B 2 12 ? -10.812 5.851   8.377   1.00 0.00 ? 54  LEU B O    5  
ATOM 7309  C CB   . LEU B 2 12 ? -7.943  4.690   8.915   1.00 0.00 ? 54  LEU B CB   5  
ATOM 7310  C CG   . LEU B 2 12 ? -7.468  3.293   9.314   1.00 0.00 ? 54  LEU B CG   5  
ATOM 7311  C CD1  . LEU B 2 12 ? -6.746  2.622   8.154   1.00 0.00 ? 54  LEU B CD1  5  
ATOM 7312  C CD2  . LEU B 2 12 ? -6.563  3.367   10.535  1.00 0.00 ? 54  LEU B CD2  5  
ATOM 7313  H H    . LEU B 2 12 ? -7.095  5.266   6.543   1.00 0.00 ? 54  LEU B H    5  
ATOM 7314  H HA   . LEU B 2 12 ? -9.369  3.839   7.572   1.00 0.00 ? 54  LEU B HA   5  
ATOM 7315  H HB2  . LEU B 2 12 ? -7.074  5.313   8.759   1.00 0.00 ? 54  LEU B HB2  5  
ATOM 7316  H HB3  . LEU B 2 12 ? -8.515  5.099   9.734   1.00 0.00 ? 54  LEU B HB3  5  
ATOM 7317  H HG   . LEU B 2 12 ? -8.325  2.686   9.568   1.00 0.00 ? 54  LEU B HG   5  
ATOM 7318  H HD11 . LEU B 2 12 ? -6.596  1.577   8.380   1.00 0.00 ? 54  LEU B HD11 5  
ATOM 7319  H HD12 . LEU B 2 12 ? -5.789  3.099   8.002   1.00 0.00 ? 54  LEU B HD12 5  
ATOM 7320  H HD13 . LEU B 2 12 ? -7.341  2.715   7.259   1.00 0.00 ? 54  LEU B HD13 5  
ATOM 7321  H HD21 . LEU B 2 12 ? -5.801  2.605   10.466  1.00 0.00 ? 54  LEU B HD21 5  
ATOM 7322  H HD22 . LEU B 2 12 ? -7.150  3.212   11.428  1.00 0.00 ? 54  LEU B HD22 5  
ATOM 7323  H HD23 . LEU B 2 12 ? -6.095  4.340   10.577  1.00 0.00 ? 54  LEU B HD23 5  
ATOM 7324  N N    . THR B 2 13 ? -9.411  7.017   7.057   1.00 0.00 ? 55  THR B N    5  
ATOM 7325  C CA   . THR B 2 13 ? -10.236 8.217   7.041   1.00 0.00 ? 55  THR B CA   5  
ATOM 7326  C C    . THR B 2 13 ? -9.754  9.191   5.969   1.00 0.00 ? 55  THR B C    5  
ATOM 7327  O O    . THR B 2 13 ? -9.192  10.242  6.277   1.00 0.00 ? 55  THR B O    5  
ATOM 7328  C CB   . THR B 2 13 ? -10.221 8.896   8.412   1.00 0.00 ? 55  THR B CB   5  
ATOM 7329  O OG1  . THR B 2 13 ? -9.116  8.451   9.184   1.00 0.00 ? 55  THR B OG1  5  
ATOM 7330  C CG2  . THR B 2 13 ? -11.478 8.645   9.218   1.00 0.00 ? 55  THR B CG2  5  
ATOM 7331  H H    . THR B 2 13 ? -8.571  7.014   6.559   1.00 0.00 ? 55  THR B H    5  
ATOM 7332  H HA   . THR B 2 13 ? -11.245 7.916   6.808   1.00 0.00 ? 55  THR B HA   5  
ATOM 7333  H HB   . THR B 2 13 ? -10.126 9.963   8.272   1.00 0.00 ? 55  THR B HB   5  
ATOM 7334  H HG1  . THR B 2 13 ? -9.294  7.570   9.523   1.00 0.00 ? 55  THR B HG1  5  
ATOM 7335  H HG21 . THR B 2 13 ? -11.567 9.396   9.989   1.00 0.00 ? 55  THR B HG21 5  
ATOM 7336  H HG22 . THR B 2 13 ? -11.425 7.666   9.671   1.00 0.00 ? 55  THR B HG22 5  
ATOM 7337  H HG23 . THR B 2 13 ? -12.338 8.694   8.566   1.00 0.00 ? 55  THR B HG23 5  
ATOM 7338  N N    . GLY B 2 14 ? -9.976  8.834   4.708   1.00 0.00 ? 56  GLY B N    5  
ATOM 7339  C CA   . GLY B 2 14 ? -9.558  9.687   3.612   1.00 0.00 ? 56  GLY B CA   5  
ATOM 7340  C C    . GLY B 2 14 ? -10.725 10.377  2.936   1.00 0.00 ? 56  GLY B C    5  
ATOM 7341  O O    . GLY B 2 14 ? -10.612 11.523  2.502   1.00 0.00 ? 56  GLY B O    5  
ATOM 7342  H H    . GLY B 2 14 ? -10.427 7.984   4.521   1.00 0.00 ? 56  GLY B H    5  
ATOM 7343  H HA2  . GLY B 2 14 ? -8.880  10.438  3.993   1.00 0.00 ? 56  GLY B HA2  5  
ATOM 7344  H HA3  . GLY B 2 14 ? -9.037  9.085   2.881   1.00 0.00 ? 56  GLY B HA3  5  
ATOM 7345  N N    . GLU B 2 15 ? -11.851 9.677   2.847   1.00 0.00 ? 57  GLU B N    5  
ATOM 7346  C CA   . GLU B 2 15 ? -13.046 10.228  2.219   1.00 0.00 ? 57  GLU B CA   5  
ATOM 7347  C C    . GLU B 2 15 ? -13.531 11.467  2.964   1.00 0.00 ? 57  GLU B C    5  
ATOM 7348  O O    . GLU B 2 15 ? -14.131 11.308  4.048   1.00 0.00 ? 57  GLU B O    5  
ATOM 7349  C CB   . GLU B 2 15 ? -14.156 9.175   2.178   1.00 0.00 ? 57  GLU B CB   5  
ATOM 7350  C CG   . GLU B 2 15 ? -14.011 8.185   1.034   1.00 0.00 ? 57  GLU B CG   5  
ATOM 7351  C CD   . GLU B 2 15 ? -15.257 7.346   0.828   1.00 0.00 ? 57  GLU B CD   5  
ATOM 7352  O OE1  . GLU B 2 15 ? -15.431 6.353   1.564   1.00 0.00 ? 57  GLU B OE1  5  
ATOM 7353  O OE2  . GLU B 2 15 ? -16.058 7.682   -0.069  1.00 0.00 ? 57  GLU B OE2  5  
ATOM 7354  O OXT  . GLU B 2 15 ? -13.306 12.587  2.458   1.00 0.00 ? 57  GLU B OXT  5  
ATOM 7355  H H    . GLU B 2 15 ? -11.878 8.769   3.212   1.00 0.00 ? 57  GLU B H    5  
ATOM 7356  H HA   . GLU B 2 15 ? -12.790 10.507  1.209   1.00 0.00 ? 57  GLU B HA   5  
ATOM 7357  H HB2  . GLU B 2 15 ? -14.147 8.623   3.106   1.00 0.00 ? 57  GLU B HB2  5  
ATOM 7358  H HB3  . GLU B 2 15 ? -15.107 9.676   2.075   1.00 0.00 ? 57  GLU B HB3  5  
ATOM 7359  H HG2  . GLU B 2 15 ? -13.811 8.733   0.124   1.00 0.00 ? 57  GLU B HG2  5  
ATOM 7360  H HG3  . GLU B 2 15 ? -13.182 7.527   1.247   1.00 0.00 ? 57  GLU B HG3  5  
ATOM 7361  N N    . PRO A 1 1  ? 1.983   14.859  -6.426  1.00 0.00 ? 31  PRO A N    6  
ATOM 7362  C CA   . PRO A 1 1  ? 1.535   15.343  -5.093  1.00 0.00 ? 31  PRO A CA   6  
ATOM 7363  C C    . PRO A 1 1  ? 1.035   14.198  -4.214  1.00 0.00 ? 31  PRO A C    6  
ATOM 7364  O O    . PRO A 1 1  ? -0.155  13.885  -4.201  1.00 0.00 ? 31  PRO A O    6  
ATOM 7365  C CB   . PRO A 1 1  ? 0.422   16.361  -5.323  1.00 0.00 ? 31  PRO A CB   6  
ATOM 7366  C CG   . PRO A 1 1  ? 0.376   16.531  -6.805  1.00 0.00 ? 31  PRO A CG   6  
ATOM 7367  C CD   . PRO A 1 1  ? 0.958   15.271  -7.399  1.00 0.00 ? 31  PRO A CD   6  
ATOM 7368  H H2   . PRO A 1 1  ? 2.130   13.849  -6.263  1.00 0.00 ? 31  PRO A H2   6  
ATOM 7369  H H3   . PRO A 1 1  ? 2.949   15.260  -6.479  1.00 0.00 ? 31  PRO A H3   6  
ATOM 7370  H HA   . PRO A 1 1  ? 2.366   15.828  -4.604  1.00 0.00 ? 31  PRO A HA   6  
ATOM 7371  H HB2  . PRO A 1 1  ? -0.512  15.975  -4.938  1.00 0.00 ? 31  PRO A HB2  6  
ATOM 7372  H HB3  . PRO A 1 1  ? 0.668   17.288  -4.828  1.00 0.00 ? 31  PRO A HB3  6  
ATOM 7373  H HG2  . PRO A 1 1  ? -0.648  16.657  -7.127  1.00 0.00 ? 31  PRO A HG2  6  
ATOM 7374  H HG3  . PRO A 1 1  ? 0.967   17.388  -7.093  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 7375  H HD2  . PRO A 1 1  ? 0.194   14.513  -7.494  1.00 0.00 ? 31  PRO A HD2  6  
ATOM 7376  H HD3  . PRO A 1 1  ? 1.405   15.479  -8.359  1.00 0.00 ? 31  PRO A HD3  6  
ATOM 7377  N N    . VAL A 1 2  ? 1.954   13.576  -3.482  1.00 0.00 ? 32  VAL A N    6  
ATOM 7378  C CA   . VAL A 1 2  ? 1.607   12.467  -2.602  1.00 0.00 ? 32  VAL A CA   6  
ATOM 7379  C C    . VAL A 1 2  ? 0.796   12.949  -1.404  1.00 0.00 ? 32  VAL A C    6  
ATOM 7380  O O    . VAL A 1 2  ? 1.349   13.239  -0.342  1.00 0.00 ? 32  VAL A O    6  
ATOM 7381  C CB   . VAL A 1 2  ? 2.867   11.736  -2.095  1.00 0.00 ? 32  VAL A CB   6  
ATOM 7382  C CG1  . VAL A 1 2  ? 2.484   10.486  -1.314  1.00 0.00 ? 32  VAL A CG1  6  
ATOM 7383  C CG2  . VAL A 1 2  ? 3.788   11.388  -3.256  1.00 0.00 ? 32  VAL A CG2  6  
ATOM 7384  H H    . VAL A 1 2  ? 2.888   13.871  -3.535  1.00 0.00 ? 32  VAL A H    6  
ATOM 7385  H HA   . VAL A 1 2  ? 1.013   11.765  -3.168  1.00 0.00 ? 32  VAL A HA   6  
ATOM 7386  H HB   . VAL A 1 2  ? 3.398   12.399  -1.428  1.00 0.00 ? 32  VAL A HB   6  
ATOM 7387  H HG11 . VAL A 1 2  ? 1.444   10.256  -1.490  1.00 0.00 ? 32  VAL A HG11 6  
ATOM 7388  H HG12 . VAL A 1 2  ? 2.641   10.658  -0.260  1.00 0.00 ? 32  VAL A HG12 6  
ATOM 7389  H HG13 . VAL A 1 2  ? 3.095   9.656   -1.638  1.00 0.00 ? 32  VAL A HG13 6  
ATOM 7390  H HG21 . VAL A 1 2  ? 3.685   10.341  -3.496  1.00 0.00 ? 32  VAL A HG21 6  
ATOM 7391  H HG22 . VAL A 1 2  ? 4.811   11.596  -2.978  1.00 0.00 ? 32  VAL A HG22 6  
ATOM 7392  H HG23 . VAL A 1 2  ? 3.523   11.982  -4.118  1.00 0.00 ? 32  VAL A HG23 6  
ATOM 7393  N N    . HIS A 1 3  ? -0.519  13.032  -1.583  1.00 0.00 ? 33  HIS A N    6  
ATOM 7394  C CA   . HIS A 1 3  ? -1.409  13.479  -0.518  1.00 0.00 ? 33  HIS A CA   6  
ATOM 7395  C C    . HIS A 1 3  ? -2.700  12.664  -0.513  1.00 0.00 ? 33  HIS A C    6  
ATOM 7396  O O    . HIS A 1 3  ? -2.805  11.649  -1.200  1.00 0.00 ? 33  HIS A O    6  
ATOM 7397  C CB   . HIS A 1 3  ? -1.724  14.968  -0.683  1.00 0.00 ? 33  HIS A CB   6  
ATOM 7398  C CG   . HIS A 1 3  ? -1.016  15.844  0.304   1.00 0.00 ? 33  HIS A CG   6  
ATOM 7399  N ND1  . HIS A 1 3  ? -1.030  17.221  0.234   1.00 0.00 ? 33  HIS A ND1  6  
ATOM 7400  C CD2  . HIS A 1 3  ? -0.267  15.533  1.389   1.00 0.00 ? 33  HIS A CD2  6  
ATOM 7401  C CE1  . HIS A 1 3  ? -0.322  17.719  1.232   1.00 0.00 ? 33  HIS A CE1  6  
ATOM 7402  N NE2  . HIS A 1 3  ? 0.151   16.716  1.948   1.00 0.00 ? 33  HIS A NE2  6  
ATOM 7403  H H    . HIS A 1 3  ? -0.899  12.786  -2.452  1.00 0.00 ? 33  HIS A H    6  
ATOM 7404  H HA   . HIS A 1 3  ? -0.901  13.330  0.424   1.00 0.00 ? 33  HIS A HA   6  
ATOM 7405  H HB2  . HIS A 1 3  ? -1.432  15.282  -1.673  1.00 0.00 ? 33  HIS A HB2  6  
ATOM 7406  H HB3  . HIS A 1 3  ? -2.787  15.122  -0.562  1.00 0.00 ? 33  HIS A HB3  6  
ATOM 7407  H HD1  . HIS A 1 3  ? -1.491  17.755  -0.447  1.00 0.00 ? 33  HIS A HD1  6  
ATOM 7408  H HD2  . HIS A 1 3  ? -0.043  14.538  1.749   1.00 0.00 ? 33  HIS A HD2  6  
ATOM 7409  H HE1  . HIS A 1 3  ? -0.158  18.768  1.429   1.00 0.00 ? 33  HIS A HE1  6  
ATOM 7410  H HE2  . HIS A 1 3  ? 0.783   16.801  2.692   1.00 0.00 ? 33  HIS A HE2  6  
ATOM 7411  N N    . VAL A 1 4  ? -3.680  13.116  0.266   1.00 0.00 ? 34  VAL A N    6  
ATOM 7412  C CA   . VAL A 1 4  ? -4.965  12.428  0.359   1.00 0.00 ? 34  VAL A CA   6  
ATOM 7413  C C    . VAL A 1 4  ? -5.517  12.091  -1.024  1.00 0.00 ? 34  VAL A C    6  
ATOM 7414  O O    . VAL A 1 4  ? -6.240  11.109  -1.192  1.00 0.00 ? 34  VAL A O    6  
ATOM 7415  C CB   . VAL A 1 4  ? -6.002  13.277  1.119   1.00 0.00 ? 34  VAL A CB   6  
ATOM 7416  C CG1  . VAL A 1 4  ? -7.265  12.470  1.382   1.00 0.00 ? 34  VAL A CG1  6  
ATOM 7417  C CG2  . VAL A 1 4  ? -5.414  13.803  2.422   1.00 0.00 ? 34  VAL A CG2  6  
ATOM 7418  H H    . VAL A 1 4  ? -3.536  13.930  0.790   1.00 0.00 ? 34  VAL A H    6  
ATOM 7419  H HA   . VAL A 1 4  ? -4.811  11.510  0.908   1.00 0.00 ? 34  VAL A HA   6  
ATOM 7420  H HB   . VAL A 1 4  ? -6.266  14.122  0.501   1.00 0.00 ? 34  VAL A HB   6  
ATOM 7421  H HG11 . VAL A 1 4  ? -7.266  12.125  2.404   1.00 0.00 ? 34  VAL A HG11 6  
ATOM 7422  H HG12 . VAL A 1 4  ? -7.296  11.620  0.715   1.00 0.00 ? 34  VAL A HG12 6  
ATOM 7423  H HG13 . VAL A 1 4  ? -8.131  13.092  1.211   1.00 0.00 ? 34  VAL A HG13 6  
ATOM 7424  H HG21 . VAL A 1 4  ? -6.034  13.492  3.250   1.00 0.00 ? 34  VAL A HG21 6  
ATOM 7425  H HG22 . VAL A 1 4  ? -5.375  14.882  2.388   1.00 0.00 ? 34  VAL A HG22 6  
ATOM 7426  H HG23 . VAL A 1 4  ? -4.416  13.412  2.552   1.00 0.00 ? 34  VAL A HG23 6  
ATOM 7427  N N    . GLU A 1 5  ? -5.167  12.909  -2.011  1.00 0.00 ? 35  GLU A N    6  
ATOM 7428  C CA   . GLU A 1 5  ? -5.626  12.695  -3.378  1.00 0.00 ? 35  GLU A CA   6  
ATOM 7429  C C    . GLU A 1 5  ? -4.972  11.455  -3.982  1.00 0.00 ? 35  GLU A C    6  
ATOM 7430  O O    . GLU A 1 5  ? -5.622  10.673  -4.675  1.00 0.00 ? 35  GLU A O    6  
ATOM 7431  C CB   . GLU A 1 5  ? -5.318  13.922  -4.240  1.00 0.00 ? 35  GLU A CB   6  
ATOM 7432  C CG   . GLU A 1 5  ? -6.503  14.859  -4.408  1.00 0.00 ? 35  GLU A CG   6  
ATOM 7433  C CD   . GLU A 1 5  ? -6.377  16.115  -3.567  1.00 0.00 ? 35  GLU A CD   6  
ATOM 7434  O OE1  . GLU A 1 5  ? -5.895  16.014  -2.419  1.00 0.00 ? 35  GLU A OE1  6  
ATOM 7435  O OE2  . GLU A 1 5  ? -6.761  17.198  -4.056  1.00 0.00 ? 35  GLU A OE2  6  
ATOM 7436  H H    . GLU A 1 5  ? -4.586  13.673  -1.816  1.00 0.00 ? 35  GLU A H    6  
ATOM 7437  H HA   . GLU A 1 5  ? -6.695  12.545  -3.350  1.00 0.00 ? 35  GLU A HA   6  
ATOM 7438  H HB2  . GLU A 1 5  ? -4.511  14.475  -3.783  1.00 0.00 ? 35  GLU A HB2  6  
ATOM 7439  H HB3  . GLU A 1 5  ? -5.007  13.592  -5.220  1.00 0.00 ? 35  GLU A HB3  6  
ATOM 7440  H HG2  . GLU A 1 5  ? -6.574  15.147  -5.446  1.00 0.00 ? 35  GLU A HG2  6  
ATOM 7441  H HG3  . GLU A 1 5  ? -7.402  14.337  -4.117  1.00 0.00 ? 35  GLU A HG3  6  
ATOM 7442  N N    . ASP A 1 6  ? -3.682  11.283  -3.711  1.00 0.00 ? 36  ASP A N    6  
ATOM 7443  C CA   . ASP A 1 6  ? -2.939  10.138  -4.225  1.00 0.00 ? 36  ASP A CA   6  
ATOM 7444  C C    . ASP A 1 6  ? -3.411  8.846   -3.567  1.00 0.00 ? 36  ASP A C    6  
ATOM 7445  O O    . ASP A 1 6  ? -3.508  7.805   -4.218  1.00 0.00 ? 36  ASP A O    6  
ATOM 7446  C CB   . ASP A 1 6  ? -1.440  10.326  -3.987  1.00 0.00 ? 36  ASP A CB   6  
ATOM 7447  C CG   . ASP A 1 6  ? -0.759  11.051  -5.132  1.00 0.00 ? 36  ASP A CG   6  
ATOM 7448  O OD1  . ASP A 1 6  ? -1.296  12.085  -5.583  1.00 0.00 ? 36  ASP A OD1  6  
ATOM 7449  O OD2  . ASP A 1 6  ? 0.310   10.584  -5.578  1.00 0.00 ? 36  ASP A OD2  6  
ATOM 7450  H H    . ASP A 1 6  ? -3.218  11.940  -3.151  1.00 0.00 ? 36  ASP A H    6  
ATOM 7451  H HA   . ASP A 1 6  ? -3.121  10.074  -5.287  1.00 0.00 ? 36  ASP A HA   6  
ATOM 7452  H HB2  . ASP A 1 6  ? -1.294  10.902  -3.085  1.00 0.00 ? 36  ASP A HB2  6  
ATOM 7453  H HB3  . ASP A 1 6  ? -0.976  9.358   -3.870  1.00 0.00 ? 36  ASP A HB3  6  
ATOM 7454  N N    . ALA A 1 7  ? -3.705  8.920   -2.273  1.00 0.00 ? 37  ALA A N    6  
ATOM 7455  C CA   . ALA A 1 7  ? -4.170  7.757   -1.527  1.00 0.00 ? 37  ALA A CA   6  
ATOM 7456  C C    . ALA A 1 7  ? -5.608  7.411   -1.893  1.00 0.00 ? 37  ALA A C    6  
ATOM 7457  O O    . ALA A 1 7  ? -5.994  6.241   -1.904  1.00 0.00 ? 37  ALA A O    6  
ATOM 7458  C CB   . ALA A 1 7  ? -4.048  8.007   -0.032  1.00 0.00 ? 37  ALA A CB   6  
ATOM 7459  H H    . ALA A 1 7  ? -3.610  9.778   -1.810  1.00 0.00 ? 37  ALA A H    6  
ATOM 7460  H HA   . ALA A 1 7  ? -3.533  6.923   -1.782  1.00 0.00 ? 37  ALA A HA   6  
ATOM 7461  H HB1  . ALA A 1 7  ? -4.844  7.492   0.485   1.00 0.00 ? 37  ALA A HB1  6  
ATOM 7462  H HB2  . ALA A 1 7  ? -4.118  9.067   0.163   1.00 0.00 ? 37  ALA A HB2  6  
ATOM 7463  H HB3  . ALA A 1 7  ? -3.094  7.639   0.318   1.00 0.00 ? 37  ALA A HB3  6  
ATOM 7464  N N    . LEU A 1 8  ? -6.400  8.436   -2.192  1.00 0.00 ? 38  LEU A N    6  
ATOM 7465  C CA   . LEU A 1 8  ? -7.797  8.243   -2.559  1.00 0.00 ? 38  LEU A CA   6  
ATOM 7466  C C    . LEU A 1 8  ? -7.914  7.412   -3.834  1.00 0.00 ? 38  LEU A C    6  
ATOM 7467  O O    . LEU A 1 8  ? -8.606  6.394   -3.862  1.00 0.00 ? 38  LEU A O    6  
ATOM 7468  C CB   . LEU A 1 8  ? -8.488  9.596   -2.748  1.00 0.00 ? 38  LEU A CB   6  
ATOM 7469  C CG   . LEU A 1 8  ? -9.473  9.979   -1.643  1.00 0.00 ? 38  LEU A CG   6  
ATOM 7470  C CD1  . LEU A 1 8  ? -9.943  11.414  -1.821  1.00 0.00 ? 38  LEU A CD1  6  
ATOM 7471  C CD2  . LEU A 1 8  ? -10.659 9.025   -1.633  1.00 0.00 ? 38  LEU A CD2  6  
ATOM 7472  H H    . LEU A 1 8  ? -6.034  9.345   -2.166  1.00 0.00 ? 38  LEU A H    6  
ATOM 7473  H HA   . LEU A 1 8  ? -8.280  7.712   -1.752  1.00 0.00 ? 38  LEU A HA   6  
ATOM 7474  H HB2  . LEU A 1 8  ? -7.726  10.360  -2.803  1.00 0.00 ? 38  LEU A HB2  6  
ATOM 7475  H HB3  . LEU A 1 8  ? -9.024  9.578   -3.685  1.00 0.00 ? 38  LEU A HB3  6  
ATOM 7476  H HG   . LEU A 1 8  ? -8.977  9.908   -0.686  1.00 0.00 ? 38  LEU A HG   6  
ATOM 7477  H HD11 . LEU A 1 8  ? -10.723 11.629  -1.106  1.00 0.00 ? 38  LEU A HD11 6  
ATOM 7478  H HD12 . LEU A 1 8  ? -10.327 11.546  -2.822  1.00 0.00 ? 38  LEU A HD12 6  
ATOM 7479  H HD13 . LEU A 1 8  ? -9.114  12.087  -1.662  1.00 0.00 ? 38  LEU A HD13 6  
ATOM 7480  H HD21 . LEU A 1 8  ? -10.373 8.091   -2.093  1.00 0.00 ? 38  LEU A HD21 6  
ATOM 7481  H HD22 . LEU A 1 8  ? -11.478 9.463   -2.185  1.00 0.00 ? 38  LEU A HD22 6  
ATOM 7482  H HD23 . LEU A 1 8  ? -10.968 8.845   -0.613  1.00 0.00 ? 38  LEU A HD23 6  
ATOM 7483  N N    . THR A 1 9  ? -7.234  7.854   -4.887  1.00 0.00 ? 39  THR A N    6  
ATOM 7484  C CA   . THR A 1 9  ? -7.263  7.151   -6.164  1.00 0.00 ? 39  THR A CA   6  
ATOM 7485  C C    . THR A 1 9  ? -6.724  5.732   -6.017  1.00 0.00 ? 39  THR A C    6  
ATOM 7486  O O    . THR A 1 9  ? -7.300  4.779   -6.541  1.00 0.00 ? 39  THR A O    6  
ATOM 7487  C CB   . THR A 1 9  ? -6.447  7.916   -7.213  1.00 0.00 ? 39  THR A CB   6  
ATOM 7488  O OG1  . THR A 1 9  ? -6.826  7.529   -8.521  1.00 0.00 ? 39  THR A OG1  6  
ATOM 7489  C CG2  . THR A 1 9  ? -4.949  7.709   -7.090  1.00 0.00 ? 39  THR A CG2  6  
ATOM 7490  H H    . THR A 1 9  ? -6.701  8.672   -4.803  1.00 0.00 ? 39  THR A H    6  
ATOM 7491  H HA   . THR A 1 9  ? -8.290  7.100   -6.490  1.00 0.00 ? 39  THR A HA   6  
ATOM 7492  H HB   . THR A 1 9  ? -6.643  8.973   -7.104  1.00 0.00 ? 39  THR A HB   6  
ATOM 7493  H HG1  . THR A 1 9  ? -6.347  8.058   -9.164  1.00 0.00 ? 39  THR A HG1  6  
ATOM 7494  H HG21 . THR A 1 9  ? -4.724  6.652   -7.151  1.00 0.00 ? 39  THR A HG21 6  
ATOM 7495  H HG22 . THR A 1 9  ? -4.609  8.095   -6.140  1.00 0.00 ? 39  THR A HG22 6  
ATOM 7496  H HG23 . THR A 1 9  ? -4.447  8.231   -7.890  1.00 0.00 ? 39  THR A HG23 6  
ATOM 7497  N N    . TYR A 1 10 ? -5.608  5.604   -5.305  1.00 0.00 ? 40  TYR A N    6  
ATOM 7498  C CA   . TYR A 1 10 ? -4.981  4.307   -5.094  1.00 0.00 ? 40  TYR A CA   6  
ATOM 7499  C C    . TYR A 1 10 ? -5.965  3.316   -4.478  1.00 0.00 ? 40  TYR A C    6  
ATOM 7500  O O    . TYR A 1 10 ? -6.119  2.195   -4.962  1.00 0.00 ? 40  TYR A O    6  
ATOM 7501  C CB   . TYR A 1 10 ? -3.752  4.450   -4.194  1.00 0.00 ? 40  TYR A CB   6  
ATOM 7502  C CG   . TYR A 1 10 ? -2.874  3.219   -4.168  1.00 0.00 ? 40  TYR A CG   6  
ATOM 7503  C CD1  . TYR A 1 10 ? -1.979  2.959   -5.199  1.00 0.00 ? 40  TYR A CD1  6  
ATOM 7504  C CD2  . TYR A 1 10 ? -2.939  2.317   -3.113  1.00 0.00 ? 40  TYR A CD2  6  
ATOM 7505  C CE1  . TYR A 1 10 ? -1.175  1.835   -5.180  1.00 0.00 ? 40  TYR A CE1  6  
ATOM 7506  C CE2  . TYR A 1 10 ? -2.137  1.192   -3.086  1.00 0.00 ? 40  TYR A CE2  6  
ATOM 7507  C CZ   . TYR A 1 10 ? -1.258  0.956   -4.121  1.00 0.00 ? 40  TYR A CZ   6  
ATOM 7508  O OH   . TYR A 1 10 ? -0.459  -0.164  -4.098  1.00 0.00 ? 40  TYR A OH   6  
ATOM 7509  H H    . TYR A 1 10 ? -5.193  6.403   -4.919  1.00 0.00 ? 40  TYR A H    6  
ATOM 7510  H HA   . TYR A 1 10 ? -4.667  3.936   -6.058  1.00 0.00 ? 40  TYR A HA   6  
ATOM 7511  H HB2  . TYR A 1 10 ? -3.154  5.277   -4.544  1.00 0.00 ? 40  TYR A HB2  6  
ATOM 7512  H HB3  . TYR A 1 10 ? -4.076  4.649   -3.184  1.00 0.00 ? 40  TYR A HB3  6  
ATOM 7513  H HD1  . TYR A 1 10 ? -1.916  3.651   -6.026  1.00 0.00 ? 40  TYR A HD1  6  
ATOM 7514  H HD2  . TYR A 1 10 ? -3.629  2.506   -2.304  1.00 0.00 ? 40  TYR A HD2  6  
ATOM 7515  H HE1  . TYR A 1 10 ? -0.487  1.650   -5.991  1.00 0.00 ? 40  TYR A HE1  6  
ATOM 7516  H HE2  . TYR A 1 10 ? -2.202  0.503   -2.257  1.00 0.00 ? 40  TYR A HE2  6  
ATOM 7517  H HH   . TYR A 1 10 ? -0.159  -0.325  -3.201  1.00 0.00 ? 40  TYR A HH   6  
ATOM 7518  N N    . LEU A 1 11 ? -6.628  3.740   -3.406  1.00 0.00 ? 41  LEU A N    6  
ATOM 7519  C CA   . LEU A 1 11 ? -7.598  2.892   -2.724  1.00 0.00 ? 41  LEU A CA   6  
ATOM 7520  C C    . LEU A 1 11 ? -8.792  2.598   -3.624  1.00 0.00 ? 41  LEU A C    6  
ATOM 7521  O O    . LEU A 1 11 ? -9.362  1.507   -3.580  1.00 0.00 ? 41  LEU A O    6  
ATOM 7522  C CB   . LEU A 1 11 ? -8.072  3.562   -1.432  1.00 0.00 ? 41  LEU A CB   6  
ATOM 7523  C CG   . LEU A 1 11 ? -6.993  3.742   -0.363  1.00 0.00 ? 41  LEU A CG   6  
ATOM 7524  C CD1  . LEU A 1 11 ? -7.472  4.694   0.723   1.00 0.00 ? 41  LEU A CD1  6  
ATOM 7525  C CD2  . LEU A 1 11 ? -6.607  2.397   0.235   1.00 0.00 ? 41  LEU A CD2  6  
ATOM 7526  H H    . LEU A 1 11 ? -6.462  4.645   -3.068  1.00 0.00 ? 41  LEU A H    6  
ATOM 7527  H HA   . LEU A 1 11 ? -7.109  1.961   -2.478  1.00 0.00 ? 41  LEU A HA   6  
ATOM 7528  H HB2  . LEU A 1 11 ? -8.469  4.535   -1.681  1.00 0.00 ? 41  LEU A HB2  6  
ATOM 7529  H HB3  . LEU A 1 11 ? -8.867  2.964   -1.012  1.00 0.00 ? 41  LEU A HB3  6  
ATOM 7530  H HG   . LEU A 1 11 ? -6.112  4.172   -0.818  1.00 0.00 ? 41  LEU A HG   6  
ATOM 7531  H HD11 . LEU A 1 11 ? -8.249  5.331   0.326   1.00 0.00 ? 41  LEU A HD11 6  
ATOM 7532  H HD12 . LEU A 1 11 ? -6.645  5.301   1.060   1.00 0.00 ? 41  LEU A HD12 6  
ATOM 7533  H HD13 . LEU A 1 11 ? -7.862  4.125   1.554   1.00 0.00 ? 41  LEU A HD13 6  
ATOM 7534  H HD21 . LEU A 1 11 ? -6.529  1.663   -0.552  1.00 0.00 ? 41  LEU A HD21 6  
ATOM 7535  H HD22 . LEU A 1 11 ? -7.363  2.088   0.942   1.00 0.00 ? 41  LEU A HD22 6  
ATOM 7536  H HD23 . LEU A 1 11 ? -5.658  2.487   0.741   1.00 0.00 ? 41  LEU A HD23 6  
ATOM 7537  N N    . ASP A 1 12 ? -9.167  3.576   -4.442  1.00 0.00 ? 42  ASP A N    6  
ATOM 7538  C CA   . ASP A 1 12 ? -10.294 3.421   -5.354  1.00 0.00 ? 42  ASP A CA   6  
ATOM 7539  C C    . ASP A 1 12 ? -9.952  2.458   -6.483  1.00 0.00 ? 42  ASP A C    6  
ATOM 7540  O O    . ASP A 1 12 ? -10.831 1.799   -7.040  1.00 0.00 ? 42  ASP A O    6  
ATOM 7541  C CB   . ASP A 1 12 ? -10.705 4.776   -5.928  1.00 0.00 ? 42  ASP A CB   6  
ATOM 7542  C CG   . ASP A 1 12 ? -11.612 5.551   -4.991  1.00 0.00 ? 42  ASP A CG   6  
ATOM 7543  O OD1  . ASP A 1 12 ? -12.436 4.914   -4.302  1.00 0.00 ? 42  ASP A OD1  6  
ATOM 7544  O OD2  . ASP A 1 12 ? -11.496 6.793   -4.945  1.00 0.00 ? 42  ASP A OD2  6  
ATOM 7545  H H    . ASP A 1 12 ? -8.673  4.423   -4.432  1.00 0.00 ? 42  ASP A H    6  
ATOM 7546  H HA   . ASP A 1 12 ? -11.116 3.014   -4.791  1.00 0.00 ? 42  ASP A HA   6  
ATOM 7547  H HB2  . ASP A 1 12 ? -9.820  5.367   -6.111  1.00 0.00 ? 42  ASP A HB2  6  
ATOM 7548  H HB3  . ASP A 1 12 ? -11.229 4.622   -6.860  1.00 0.00 ? 42  ASP A HB3  6  
ATOM 7549  N N    . GLN A 1 13 ? -8.670  2.378   -6.813  1.00 0.00 ? 43  GLN A N    6  
ATOM 7550  C CA   . GLN A 1 13 ? -8.207  1.493   -7.874  1.00 0.00 ? 43  GLN A CA   6  
ATOM 7551  C C    . GLN A 1 13 ? -8.062  0.066   -7.364  1.00 0.00 ? 43  GLN A C    6  
ATOM 7552  O O    . GLN A 1 13 ? -8.249  -0.896  -8.108  1.00 0.00 ? 43  GLN A O    6  
ATOM 7553  C CB   . GLN A 1 13 ? -6.873  1.987   -8.437  1.00 0.00 ? 43  GLN A CB   6  
ATOM 7554  C CG   . GLN A 1 13 ? -6.724  1.765   -9.933  1.00 0.00 ? 43  GLN A CG   6  
ATOM 7555  C CD   . GLN A 1 13 ? -6.235  3.002   -10.661 1.00 0.00 ? 43  GLN A CD   6  
ATOM 7556  O OE1  . GLN A 1 13 ? -5.138  3.015   -11.220 1.00 0.00 ? 43  GLN A OE1  6  
ATOM 7557  N NE2  . GLN A 1 13 ? -7.049  4.051   -10.658 1.00 0.00 ? 43  GLN A NE2  6  
ATOM 7558  H H    . GLN A 1 13 ? -8.021  2.926   -6.328  1.00 0.00 ? 43  GLN A H    6  
ATOM 7559  H HA   . GLN A 1 13 ? -8.945  1.505   -8.656  1.00 0.00 ? 43  GLN A HA   6  
ATOM 7560  H HB2  . GLN A 1 13 ? -6.783  3.045   -8.240  1.00 0.00 ? 43  GLN A HB2  6  
ATOM 7561  H HB3  . GLN A 1 13 ? -6.070  1.466   -7.936  1.00 0.00 ? 43  GLN A HB3  6  
ATOM 7562  H HG2  . GLN A 1 13 ? -6.016  0.967   -10.097 1.00 0.00 ? 43  GLN A HG2  6  
ATOM 7563  H HG3  . GLN A 1 13 ? -7.684  1.482   -10.340 1.00 0.00 ? 43  GLN A HG3  6  
ATOM 7564  H HE21 . GLN A 1 13 ? -7.908  3.969   -10.192 1.00 0.00 ? 43  GLN A HE21 6  
ATOM 7565  H HE22 . GLN A 1 13 ? -6.758  4.864   -11.121 1.00 0.00 ? 43  GLN A HE22 6  
ATOM 7566  N N    . VAL A 1 14 ? -7.734  -0.058  -6.086  1.00 0.00 ? 44  VAL A N    6  
ATOM 7567  C CA   . VAL A 1 14 ? -7.564  -1.364  -5.461  1.00 0.00 ? 44  VAL A CA   6  
ATOM 7568  C C    . VAL A 1 14 ? -8.912  -1.952  -5.056  1.00 0.00 ? 44  VAL A C    6  
ATOM 7569  O O    . VAL A 1 14 ? -9.095  -3.169  -5.058  1.00 0.00 ? 44  VAL A O    6  
ATOM 7570  C CB   . VAL A 1 14 ? -6.658  -1.279  -4.218  1.00 0.00 ? 44  VAL A CB   6  
ATOM 7571  C CG1  . VAL A 1 14 ? -6.369  -2.668  -3.670  1.00 0.00 ? 44  VAL A CG1  6  
ATOM 7572  C CG2  . VAL A 1 14 ? -5.364  -0.549  -4.547  1.00 0.00 ? 44  VAL A CG2  6  
ATOM 7573  H H    . VAL A 1 14 ? -7.605  0.750   -5.551  1.00 0.00 ? 44  VAL A H    6  
ATOM 7574  H HA   . VAL A 1 14 ? -7.097  -2.021  -6.179  1.00 0.00 ? 44  VAL A HA   6  
ATOM 7575  H HB   . VAL A 1 14 ? -7.178  -0.718  -3.456  1.00 0.00 ? 44  VAL A HB   6  
ATOM 7576  H HG11 . VAL A 1 14 ? -5.552  -2.614  -2.965  1.00 0.00 ? 44  VAL A HG11 6  
ATOM 7577  H HG12 . VAL A 1 14 ? -6.100  -3.327  -4.483  1.00 0.00 ? 44  VAL A HG12 6  
ATOM 7578  H HG13 . VAL A 1 14 ? -7.249  -3.050  -3.174  1.00 0.00 ? 44  VAL A HG13 6  
ATOM 7579  H HG21 . VAL A 1 14 ? -4.572  -1.269  -4.690  1.00 0.00 ? 44  VAL A HG21 6  
ATOM 7580  H HG22 . VAL A 1 14 ? -5.107  0.112   -3.734  1.00 0.00 ? 44  VAL A HG22 6  
ATOM 7581  H HG23 . VAL A 1 14 ? -5.494  0.026   -5.451  1.00 0.00 ? 44  VAL A HG23 6  
ATOM 7582  N N    . LYS A 1 15 ? -9.852  -1.078  -4.711  1.00 0.00 ? 45  LYS A N    6  
ATOM 7583  C CA   . LYS A 1 15 ? -11.184 -1.509  -4.306  1.00 0.00 ? 45  LYS A CA   6  
ATOM 7584  C C    . LYS A 1 15 ? -11.985 -1.993  -5.509  1.00 0.00 ? 45  LYS A C    6  
ATOM 7585  O O    . LYS A 1 15 ? -12.578 -3.072  -5.480  1.00 0.00 ? 45  LYS A O    6  
ATOM 7586  C CB   . LYS A 1 15 ? -11.924 -0.366  -3.610  1.00 0.00 ? 45  LYS A CB   6  
ATOM 7587  C CG   . LYS A 1 15 ? -13.268 -0.775  -3.027  1.00 0.00 ? 45  LYS A CG   6  
ATOM 7588  C CD   . LYS A 1 15 ? -13.507 -0.134  -1.670  1.00 0.00 ? 45  LYS A CD   6  
ATOM 7589  C CE   . LYS A 1 15 ? -14.329 -1.036  -0.764  1.00 0.00 ? 45  LYS A CE   6  
ATOM 7590  N NZ   . LYS A 1 15 ? -15.786 -0.934  -1.051  1.00 0.00 ? 45  LYS A NZ   6  
ATOM 7591  H H    . LYS A 1 15 ? -9.645  -0.120  -4.731  1.00 0.00 ? 45  LYS A H    6  
ATOM 7592  H HA   . LYS A 1 15 ? -11.070 -2.328  -3.611  1.00 0.00 ? 45  LYS A HA   6  
ATOM 7593  H HB2  . LYS A 1 15 ? -11.307 0.011   -2.808  1.00 0.00 ? 45  LYS A HB2  6  
ATOM 7594  H HB3  . LYS A 1 15 ? -12.092 0.427   -4.325  1.00 0.00 ? 45  LYS A HB3  6  
ATOM 7595  H HG2  . LYS A 1 15 ? -14.051 -0.467  -3.703  1.00 0.00 ? 45  LYS A HG2  6  
ATOM 7596  H HG3  . LYS A 1 15 ? -13.287 -1.850  -2.917  1.00 0.00 ? 45  LYS A HG3  6  
ATOM 7597  H HD2  . LYS A 1 15 ? -12.555 0.060   -1.201  1.00 0.00 ? 45  LYS A HD2  6  
ATOM 7598  H HD3  . LYS A 1 15 ? -14.036 0.798   -1.811  1.00 0.00 ? 45  LYS A HD3  6  
ATOM 7599  H HE2  . LYS A 1 15 ? -14.013 -2.059  -0.914  1.00 0.00 ? 45  LYS A HE2  6  
ATOM 7600  H HE3  . LYS A 1 15 ? -14.151 -0.752  0.262   1.00 0.00 ? 45  LYS A HE3  6  
ATOM 7601  H HZ1  . LYS A 1 15 ? -16.330 -1.436  -0.321  1.00 0.00 ? 45  LYS A HZ1  6  
ATOM 7602  H HZ2  . LYS A 1 15 ? -15.998 -1.355  -1.978  1.00 0.00 ? 45  LYS A HZ2  6  
ATOM 7603  H HZ3  . LYS A 1 15 ? -16.079 0.064   -1.062  1.00 0.00 ? 45  LYS A HZ3  6  
ATOM 7604  N N    . ILE A 1 16 ? -11.999 -1.189  -6.568  1.00 0.00 ? 46  ILE A N    6  
ATOM 7605  C CA   . ILE A 1 16 ? -12.725 -1.536  -7.781  1.00 0.00 ? 46  ILE A CA   6  
ATOM 7606  C C    . ILE A 1 16 ? -12.109 -2.756  -8.458  1.00 0.00 ? 46  ILE A C    6  
ATOM 7607  O O    . ILE A 1 16 ? -12.820 -3.671  -8.876  1.00 0.00 ? 46  ILE A O    6  
ATOM 7608  C CB   . ILE A 1 16 ? -12.750 -0.361  -8.780  1.00 0.00 ? 46  ILE A CB   6  
ATOM 7609  C CG1  . ILE A 1 16 ? -13.280 0.904   -8.102  1.00 0.00 ? 46  ILE A CG1  6  
ATOM 7610  C CG2  . ILE A 1 16 ? -13.600 -0.712  -9.994  1.00 0.00 ? 46  ILE A CG2  6  
ATOM 7611  C CD1  . ILE A 1 16 ? -12.885 2.181   -8.812  1.00 0.00 ? 46  ILE A CD1  6  
ATOM 7612  H H    . ILE A 1 16 ? -11.508 -0.343  -6.532  1.00 0.00 ? 46  ILE A H    6  
ATOM 7613  H HA   . ILE A 1 16 ? -13.743 -1.766  -7.503  1.00 0.00 ? 46  ILE A HA   6  
ATOM 7614  H HB   . ILE A 1 16 ? -11.741 -0.183  -9.118  1.00 0.00 ? 46  ILE A HB   6  
ATOM 7615  H HG12 . ILE A 1 16 ? -14.360 0.862   -8.073  1.00 0.00 ? 46  ILE A HG12 6  
ATOM 7616  H HG13 . ILE A 1 16 ? -12.899 0.951   -7.093  1.00 0.00 ? 46  ILE A HG13 6  
ATOM 7617  H HG21 . ILE A 1 16 ? -14.104 0.174   -10.349 1.00 0.00 ? 46  ILE A HG21 6  
ATOM 7618  H HG22 . ILE A 1 16 ? -14.332 -1.457  -9.717  1.00 0.00 ? 46  ILE A HG22 6  
ATOM 7619  H HG23 . ILE A 1 16 ? -12.966 -1.105  -10.775 1.00 0.00 ? 46  ILE A HG23 6  
ATOM 7620  H HD11 . ILE A 1 16 ? -13.492 2.305   -9.696  1.00 0.00 ? 46  ILE A HD11 6  
ATOM 7621  H HD12 . ILE A 1 16 ? -11.844 2.127   -9.095  1.00 0.00 ? 46  ILE A HD12 6  
ATOM 7622  H HD13 . ILE A 1 16 ? -13.035 3.021   -8.150  1.00 0.00 ? 46  ILE A HD13 6  
ATOM 7623  N N    . ARG A 1 17 ? -10.784 -2.763  -8.563  1.00 0.00 ? 47  ARG A N    6  
ATOM 7624  C CA   . ARG A 1 17 ? -10.075 -3.873  -9.189  1.00 0.00 ? 47  ARG A CA   6  
ATOM 7625  C C    . ARG A 1 17 ? -10.299 -5.168  -8.417  1.00 0.00 ? 47  ARG A C    6  
ATOM 7626  O O    . ARG A 1 17 ? -10.340 -6.251  -9.001  1.00 0.00 ? 47  ARG A O    6  
ATOM 7627  C CB   . ARG A 1 17 ? -8.578  -3.566  -9.273  1.00 0.00 ? 47  ARG A CB   6  
ATOM 7628  C CG   . ARG A 1 17 ? -7.824  -4.469  -10.237 1.00 0.00 ? 47  ARG A CG   6  
ATOM 7629  C CD   . ARG A 1 17 ? -6.771  -3.697  -11.015 1.00 0.00 ? 47  ARG A CD   6  
ATOM 7630  N NE   . ARG A 1 17 ? -7.346  -2.975  -12.147 1.00 0.00 ? 47  ARG A NE   6  
ATOM 7631  C CZ   . ARG A 1 17 ? -6.741  -1.965  -12.768 1.00 0.00 ? 47  ARG A CZ   6  
ATOM 7632  N NH1  . ARG A 1 17 ? -5.541  -1.556  -12.370 1.00 0.00 ? 47  ARG A NH1  6  
ATOM 7633  N NH2  . ARG A 1 17 ? -7.333  -1.364  -13.790 1.00 0.00 ? 47  ARG A NH2  6  
ATOM 7634  H H    . ARG A 1 17 ? -10.272 -2.005  -8.211  1.00 0.00 ? 47  ARG A H    6  
ATOM 7635  H HA   . ARG A 1 17 ? -10.465 -3.991  -10.189 1.00 0.00 ? 47  ARG A HA   6  
ATOM 7636  H HB2  . ARG A 1 17 ? -8.449  -2.543  -9.596  1.00 0.00 ? 47  ARG A HB2  6  
ATOM 7637  H HB3  . ARG A 1 17 ? -8.144  -3.682  -8.290  1.00 0.00 ? 47  ARG A HB3  6  
ATOM 7638  H HG2  . ARG A 1 17 ? -7.340  -5.253  -9.676  1.00 0.00 ? 47  ARG A HG2  6  
ATOM 7639  H HG3  . ARG A 1 17 ? -8.528  -4.902  -10.933 1.00 0.00 ? 47  ARG A HG3  6  
ATOM 7640  H HD2  . ARG A 1 17 ? -6.299  -2.988  -10.351 1.00 0.00 ? 47  ARG A HD2  6  
ATOM 7641  H HD3  . ARG A 1 17 ? -6.031  -4.393  -11.381 1.00 0.00 ? 47  ARG A HD3  6  
ATOM 7642  H HE   . ARG A 1 17 ? -8.231  -3.257  -12.461 1.00 0.00 ? 47  ARG A HE   6  
ATOM 7643  H HH11 . ARG A 1 17 ? -5.088  -2.006  -11.601 1.00 0.00 ? 47  ARG A HH11 6  
ATOM 7644  H HH12 . ARG A 1 17 ? -5.091  -0.797  -12.841 1.00 0.00 ? 47  ARG A HH12 6  
ATOM 7645  H HH21 . ARG A 1 17 ? -8.237  -1.669  -14.093 1.00 0.00 ? 47  ARG A HH21 6  
ATOM 7646  H HH22 . ARG A 1 17 ? -6.879  -0.606  -14.257 1.00 0.00 ? 47  ARG A HH22 6  
ATOM 7647  N N    . PHE A 1 18 ? -10.443 -5.050  -7.100  1.00 0.00 ? 48  PHE A N    6  
ATOM 7648  C CA   . PHE A 1 18 ? -10.663 -6.213  -6.249  1.00 0.00 ? 48  PHE A CA   6  
ATOM 7649  C C    . PHE A 1 18 ? -11.998 -6.110  -5.519  1.00 0.00 ? 48  PHE A C    6  
ATOM 7650  O O    . PHE A 1 18 ? -12.105 -6.465  -4.345  1.00 0.00 ? 48  PHE A O    6  
ATOM 7651  C CB   . PHE A 1 18 ? -9.524  -6.354  -5.236  1.00 0.00 ? 48  PHE A CB   6  
ATOM 7652  C CG   . PHE A 1 18 ? -8.257  -6.901  -5.831  1.00 0.00 ? 48  PHE A CG   6  
ATOM 7653  C CD1  . PHE A 1 18 ? -8.220  -8.184  -6.354  1.00 0.00 ? 48  PHE A CD1  6  
ATOM 7654  C CD2  . PHE A 1 18 ? -7.105  -6.132  -5.866  1.00 0.00 ? 48  PHE A CD2  6  
ATOM 7655  C CE1  . PHE A 1 18 ? -7.055  -8.689  -6.902  1.00 0.00 ? 48  PHE A CE1  6  
ATOM 7656  C CE2  . PHE A 1 18 ? -5.938  -6.633  -6.412  1.00 0.00 ? 48  PHE A CE2  6  
ATOM 7657  C CZ   . PHE A 1 18 ? -5.914  -7.912  -6.931  1.00 0.00 ? 48  PHE A CZ   6  
ATOM 7658  H H    . PHE A 1 18 ? -10.400 -4.160  -6.693  1.00 0.00 ? 48  PHE A H    6  
ATOM 7659  H HA   . PHE A 1 18 ? -10.680 -7.088  -6.881  1.00 0.00 ? 48  PHE A HA   6  
ATOM 7660  H HB2  . PHE A 1 18 ? -9.303  -5.384  -4.817  1.00 0.00 ? 48  PHE A HB2  6  
ATOM 7661  H HB3  . PHE A 1 18 ? -9.836  -7.020  -4.445  1.00 0.00 ? 48  PHE A HB3  6  
ATOM 7662  H HD1  . PHE A 1 18 ? -9.112  -8.791  -6.333  1.00 0.00 ? 48  PHE A HD1  6  
ATOM 7663  H HD2  . PHE A 1 18 ? -7.123  -5.131  -5.461  1.00 0.00 ? 48  PHE A HD2  6  
ATOM 7664  H HE1  . PHE A 1 18 ? -7.039  -9.690  -7.306  1.00 0.00 ? 48  PHE A HE1  6  
ATOM 7665  H HE2  . PHE A 1 18 ? -5.047  -6.024  -6.433  1.00 0.00 ? 48  PHE A HE2  6  
ATOM 7666  H HZ   . PHE A 1 18 ? -5.003  -8.305  -7.358  1.00 0.00 ? 48  PHE A HZ   6  
ATOM 7667  N N    . GLY A 1 19 ? -13.015 -5.624  -6.223  1.00 0.00 ? 49  GLY A N    6  
ATOM 7668  C CA   . GLY A 1 19 ? -14.330 -5.485  -5.627  1.00 0.00 ? 49  GLY A CA   6  
ATOM 7669  C C    . GLY A 1 19 ? -15.008 -6.823  -5.402  1.00 0.00 ? 49  GLY A C    6  
ATOM 7670  O O    . GLY A 1 19 ? -15.594 -7.060  -4.346  1.00 0.00 ? 49  GLY A O    6  
ATOM 7671  H H    . GLY A 1 19 ? -12.871 -5.359  -7.156  1.00 0.00 ? 49  GLY A H    6  
ATOM 7672  H HA2  . GLY A 1 19 ? -14.232 -4.980  -4.677  1.00 0.00 ? 49  GLY A HA2  6  
ATOM 7673  H HA3  . GLY A 1 19 ? -14.948 -4.886  -6.279  1.00 0.00 ? 49  GLY A HA3  6  
ATOM 7674  N N    . SER A 1 20 ? -14.927 -7.699  -6.399  1.00 0.00 ? 50  SER A N    6  
ATOM 7675  C CA   . SER A 1 20 ? -15.536 -9.021  -6.308  1.00 0.00 ? 50  SER A CA   6  
ATOM 7676  C C    . SER A 1 20 ? -14.850 -9.874  -5.241  1.00 0.00 ? 50  SER A C    6  
ATOM 7677  O O    . SER A 1 20 ? -15.392 -10.889 -4.805  1.00 0.00 ? 50  SER A O    6  
ATOM 7678  C CB   . SER A 1 20 ? -15.470 -9.729  -7.662  1.00 0.00 ? 50  SER A CB   6  
ATOM 7679  O OG   . SER A 1 20 ? -16.175 -9.002  -8.652  1.00 0.00 ? 50  SER A OG   6  
ATOM 7680  H H    . SER A 1 20 ? -14.444 -7.451  -7.215  1.00 0.00 ? 50  SER A H    6  
ATOM 7681  H HA   . SER A 1 20 ? -16.570 -8.889  -6.032  1.00 0.00 ? 50  SER A HA   6  
ATOM 7682  H HB2  . SER A 1 20 ? -14.439 -9.822  -7.968  1.00 0.00 ? 50  SER A HB2  6  
ATOM 7683  H HB3  . SER A 1 20 ? -15.909 -10.712 -7.573  1.00 0.00 ? 50  SER A HB3  6  
ATOM 7684  H HG   . SER A 1 20 ? -16.769 -9.594  -9.121  1.00 0.00 ? 50  SER A HG   6  
ATOM 7685  N N    . ASP A 1 21 ? -13.657 -9.457  -4.824  1.00 0.00 ? 51  ASP A N    6  
ATOM 7686  C CA   . ASP A 1 21 ? -12.906 -10.181 -3.813  1.00 0.00 ? 51  ASP A CA   6  
ATOM 7687  C C    . ASP A 1 21 ? -12.377 -9.230  -2.741  1.00 0.00 ? 51  ASP A C    6  
ATOM 7688  O O    . ASP A 1 21 ? -11.293 -8.664  -2.886  1.00 0.00 ? 51  ASP A O    6  
ATOM 7689  C CB   . ASP A 1 21 ? -11.746 -10.945 -4.455  1.00 0.00 ? 51  ASP A CB   6  
ATOM 7690  C CG   . ASP A 1 21 ? -11.294 -12.122 -3.612  1.00 0.00 ? 51  ASP A CG   6  
ATOM 7691  O OD1  . ASP A 1 21 ? -12.098 -13.058 -3.421  1.00 0.00 ? 51  ASP A OD1  6  
ATOM 7692  O OD2  . ASP A 1 21 ? -10.136 -12.106 -3.144  1.00 0.00 ? 51  ASP A OD2  6  
ATOM 7693  H H    . ASP A 1 21 ? -13.275 -8.648  -5.202  1.00 0.00 ? 51  ASP A H    6  
ATOM 7694  H HA   . ASP A 1 21 ? -13.577 -10.883 -3.357  1.00 0.00 ? 51  ASP A HA   6  
ATOM 7695  H HB2  . ASP A 1 21 ? -12.057 -11.315 -5.421  1.00 0.00 ? 51  ASP A HB2  6  
ATOM 7696  H HB3  . ASP A 1 21 ? -10.909 -10.274 -4.583  1.00 0.00 ? 51  ASP A HB3  6  
ATOM 7697  N N    . PRO A 1 22 ? -13.136 -9.041  -1.648  1.00 0.00 ? 52  PRO A N    6  
ATOM 7698  C CA   . PRO A 1 22 ? -12.733 -8.153  -0.552  1.00 0.00 ? 52  PRO A CA   6  
ATOM 7699  C C    . PRO A 1 22 ? -11.521 -8.681  0.212   1.00 0.00 ? 52  PRO A C    6  
ATOM 7700  O O    . PRO A 1 22 ? -10.919 -7.961  1.008   1.00 0.00 ? 52  PRO A O    6  
ATOM 7701  C CB   . PRO A 1 22 ? -13.965 -8.120  0.356   1.00 0.00 ? 52  PRO A CB   6  
ATOM 7702  C CG   . PRO A 1 22 ? -14.689 -9.389  0.063   1.00 0.00 ? 52  PRO A CG   6  
ATOM 7703  C CD   . PRO A 1 22 ? -14.443 -9.677  -1.392  1.00 0.00 ? 52  PRO A CD   6  
ATOM 7704  H HA   . PRO A 1 22 ? -12.521 -7.157  -0.910  1.00 0.00 ? 52  PRO A HA   6  
ATOM 7705  H HB2  . PRO A 1 22 ? -13.653 -8.074  1.389   1.00 0.00 ? 52  PRO A HB2  6  
ATOM 7706  H HB3  . PRO A 1 22 ? -14.570 -7.258  0.117   1.00 0.00 ? 52  PRO A HB3  6  
ATOM 7707  H HG2  . PRO A 1 22 ? -14.295 -10.186 0.675   1.00 0.00 ? 52  PRO A HG2  6  
ATOM 7708  H HG3  . PRO A 1 22 ? -15.745 -9.260  0.246   1.00 0.00 ? 52  PRO A HG3  6  
ATOM 7709  H HD2  . PRO A 1 22 ? -14.394 -10.742 -1.562  1.00 0.00 ? 52  PRO A HD2  6  
ATOM 7710  H HD3  . PRO A 1 22 ? -15.214 -9.230  -2.002  1.00 0.00 ? 52  PRO A HD3  6  
ATOM 7711  N N    . ALA A 1 23 ? -11.169 -9.940  -0.033  1.00 0.00 ? 53  ALA A N    6  
ATOM 7712  C CA   . ALA A 1 23 ? -10.028 -10.559 0.635   1.00 0.00 ? 53  ALA A CA   6  
ATOM 7713  C C    . ALA A 1 23 ? -8.757  -9.745  0.420   1.00 0.00 ? 53  ALA A C    6  
ATOM 7714  O O    . ALA A 1 23 ? -8.010  -9.481  1.363   1.00 0.00 ? 53  ALA A O    6  
ATOM 7715  C CB   . ALA A 1 23 ? -9.836  -11.983 0.136   1.00 0.00 ? 53  ALA A CB   6  
ATOM 7716  H H    . ALA A 1 23 ? -11.686 -10.466 -0.678  1.00 0.00 ? 53  ALA A H    6  
ATOM 7717  H HA   . ALA A 1 23 ? -10.243 -10.599 1.692   1.00 0.00 ? 53  ALA A HA   6  
ATOM 7718  H HB1  . ALA A 1 23 ? -10.790 -12.489 0.112   1.00 0.00 ? 53  ALA A HB1  6  
ATOM 7719  H HB2  . ALA A 1 23 ? -9.166  -12.509 0.799   1.00 0.00 ? 53  ALA A HB2  6  
ATOM 7720  H HB3  . ALA A 1 23 ? -9.415  -11.962 -0.858  1.00 0.00 ? 53  ALA A HB3  6  
ATOM 7721  N N    . THR A 1 24 ? -8.516  -9.350  -0.826  1.00 0.00 ? 54  THR A N    6  
ATOM 7722  C CA   . THR A 1 24 ? -7.335  -8.565  -1.163  1.00 0.00 ? 54  THR A CA   6  
ATOM 7723  C C    . THR A 1 24 ? -7.430  -7.161  -0.576  1.00 0.00 ? 54  THR A C    6  
ATOM 7724  O O    . THR A 1 24 ? -6.430  -6.591  -0.136  1.00 0.00 ? 54  THR A O    6  
ATOM 7725  C CB   . THR A 1 24 ? -7.167  -8.485  -2.682  1.00 0.00 ? 54  THR A CB   6  
ATOM 7726  O OG1  . THR A 1 24 ? -7.098  -9.782  -3.248  1.00 0.00 ? 54  THR A OG1  6  
ATOM 7727  C CG2  . THR A 1 24 ? -5.927  -7.731  -3.108  1.00 0.00 ? 54  THR A CG2  6  
ATOM 7728  H H    . THR A 1 24 ? -9.149  -9.591  -1.535  1.00 0.00 ? 54  THR A H    6  
ATOM 7729  H HA   . THR A 1 24 ? -6.475  -9.061  -0.741  1.00 0.00 ? 54  THR A HA   6  
ATOM 7730  H HB   . THR A 1 24 ? -8.024  -7.978  -3.102  1.00 0.00 ? 54  THR A HB   6  
ATOM 7731  H HG1  . THR A 1 24 ? -7.881  -10.281 -3.003  1.00 0.00 ? 54  THR A HG1  6  
ATOM 7732  H HG21 . THR A 1 24 ? -6.185  -6.703  -3.317  1.00 0.00 ? 54  THR A HG21 6  
ATOM 7733  H HG22 . THR A 1 24 ? -5.515  -8.187  -3.997  1.00 0.00 ? 54  THR A HG22 6  
ATOM 7734  H HG23 . THR A 1 24 ? -5.195  -7.764  -2.315  1.00 0.00 ? 54  THR A HG23 6  
ATOM 7735  N N    . TYR A 1 25 ? -8.639  -6.608  -0.571  1.00 0.00 ? 55  TYR A N    6  
ATOM 7736  C CA   . TYR A 1 25 ? -8.865  -5.270  -0.037  1.00 0.00 ? 55  TYR A CA   6  
ATOM 7737  C C    . TYR A 1 25 ? -8.607  -5.234  1.465   1.00 0.00 ? 55  TYR A C    6  
ATOM 7738  O O    . TYR A 1 25 ? -7.878  -4.373  1.960   1.00 0.00 ? 55  TYR A O    6  
ATOM 7739  C CB   . TYR A 1 25 ? -10.297 -4.817  -0.330  1.00 0.00 ? 55  TYR A CB   6  
ATOM 7740  C CG   . TYR A 1 25 ? -10.573 -3.385  0.067   1.00 0.00 ? 55  TYR A CG   6  
ATOM 7741  C CD1  . TYR A 1 25 ? -9.791  -2.345  -0.419  1.00 0.00 ? 55  TYR A CD1  6  
ATOM 7742  C CD2  . TYR A 1 25 ? -11.618 -3.072  0.929   1.00 0.00 ? 55  TYR A CD2  6  
ATOM 7743  C CE1  . TYR A 1 25 ? -10.040 -1.035  -0.058  1.00 0.00 ? 55  TYR A CE1  6  
ATOM 7744  C CE2  . TYR A 1 25 ? -11.874 -1.764  1.293   1.00 0.00 ? 55  TYR A CE2  6  
ATOM 7745  C CZ   . TYR A 1 25 ? -11.083 -0.750  0.798   1.00 0.00 ? 55  TYR A CZ   6  
ATOM 7746  O OH   . TYR A 1 25 ? -11.335 0.554   1.160   1.00 0.00 ? 55  TYR A OH   6  
ATOM 7747  H H    . TYR A 1 25 ? -9.396  -7.111  -0.935  1.00 0.00 ? 55  TYR A H    6  
ATOM 7748  H HA   . TYR A 1 25 ? -8.177  -4.597  -0.526  1.00 0.00 ? 55  TYR A HA   6  
ATOM 7749  H HB2  . TYR A 1 25 ? -10.486 -4.908  -1.389  1.00 0.00 ? 55  TYR A HB2  6  
ATOM 7750  H HB3  . TYR A 1 25 ? -10.985 -5.451  0.210   1.00 0.00 ? 55  TYR A HB3  6  
ATOM 7751  H HD1  . TYR A 1 25 ? -8.975  -2.572  -1.090  1.00 0.00 ? 55  TYR A HD1  6  
ATOM 7752  H HD2  . TYR A 1 25 ? -12.236 -3.869  1.315   1.00 0.00 ? 55  TYR A HD2  6  
ATOM 7753  H HE1  . TYR A 1 25 ? -9.420  -0.240  -0.446  1.00 0.00 ? 55  TYR A HE1  6  
ATOM 7754  H HE2  . TYR A 1 25 ? -12.691 -1.541  1.964   1.00 0.00 ? 55  TYR A HE2  6  
ATOM 7755  H HH   . TYR A 1 25 ? -11.471 0.601   2.109   1.00 0.00 ? 55  TYR A HH   6  
ATOM 7756  N N    . ASN A 1 26 ? -9.206  -6.176  2.187   1.00 0.00 ? 56  ASN A N    6  
ATOM 7757  C CA   . ASN A 1 26 ? -9.040  -6.253  3.633   1.00 0.00 ? 56  ASN A CA   6  
ATOM 7758  C C    . ASN A 1 26 ? -7.575  -6.463  4.002   1.00 0.00 ? 56  ASN A C    6  
ATOM 7759  O O    . ASN A 1 26 ? -7.110  -5.987  5.037   1.00 0.00 ? 56  ASN A O    6  
ATOM 7760  C CB   . ASN A 1 26 ? -9.890  -7.388  4.207   1.00 0.00 ? 56  ASN A CB   6  
ATOM 7761  C CG   . ASN A 1 26 ? -10.132 -7.235  5.695   1.00 0.00 ? 56  ASN A CG   6  
ATOM 7762  O OD1  . ASN A 1 26 ? -9.429  -6.490  6.377   1.00 0.00 ? 56  ASN A OD1  6  
ATOM 7763  N ND2  . ASN A 1 26 ? -11.134 -7.940  6.207   1.00 0.00 ? 56  ASN A ND2  6  
ATOM 7764  H H    . ASN A 1 26 ? -9.773  -6.834  1.736   1.00 0.00 ? 56  ASN A H    6  
ATOM 7765  H HA   . ASN A 1 26 ? -9.375  -5.317  4.056   1.00 0.00 ? 56  ASN A HA   6  
ATOM 7766  H HB2  . ASN A 1 26 ? -10.846 -7.403  3.704   1.00 0.00 ? 56  ASN A HB2  6  
ATOM 7767  H HB3  . ASN A 1 26 ? -9.385  -8.328  4.037   1.00 0.00 ? 56  ASN A HB3  6  
ATOM 7768  H HD21 . ASN A 1 26 ? -11.653 -8.513  5.604   1.00 0.00 ? 56  ASN A HD21 6  
ATOM 7769  H HD22 . ASN A 1 26 ? -11.314 -7.860  7.167   1.00 0.00 ? 56  ASN A HD22 6  
ATOM 7770  N N    . GLY A 1 27 ? -6.852  -7.179  3.146   1.00 0.00 ? 57  GLY A N    6  
ATOM 7771  C CA   . GLY A 1 27 ? -5.447  -7.439  3.399   1.00 0.00 ? 57  GLY A CA   6  
ATOM 7772  C C    . GLY A 1 27 ? -4.616  -6.171  3.410   1.00 0.00 ? 57  GLY A C    6  
ATOM 7773  O O    . GLY A 1 27 ? -3.867  -5.921  4.354   1.00 0.00 ? 57  GLY A O    6  
ATOM 7774  H H    . GLY A 1 27 ? -7.276  -7.533  2.336   1.00 0.00 ? 57  GLY A H    6  
ATOM 7775  H HA2  . GLY A 1 27 ? -5.350  -7.929  4.356   1.00 0.00 ? 57  GLY A HA2  6  
ATOM 7776  H HA3  . GLY A 1 27 ? -5.070  -8.096  2.630   1.00 0.00 ? 57  GLY A HA3  6  
ATOM 7777  N N    . PHE A 1 28 ? -4.750  -5.368  2.360   1.00 0.00 ? 58  PHE A N    6  
ATOM 7778  C CA   . PHE A 1 28 ? -4.006  -4.119  2.251   1.00 0.00 ? 58  PHE A CA   6  
ATOM 7779  C C    . PHE A 1 28 ? -4.322  -3.194  3.422   1.00 0.00 ? 58  PHE A C    6  
ATOM 7780  O O    . PHE A 1 28 ? -3.428  -2.571  3.994   1.00 0.00 ? 58  PHE A O    6  
ATOM 7781  C CB   . PHE A 1 28 ? -4.333  -3.420  0.931   1.00 0.00 ? 58  PHE A CB   6  
ATOM 7782  C CG   . PHE A 1 28 ? -3.487  -2.206  0.668   1.00 0.00 ? 58  PHE A CG   6  
ATOM 7783  C CD1  . PHE A 1 28 ? -2.106  -2.276  0.759   1.00 0.00 ? 58  PHE A CD1  6  
ATOM 7784  C CD2  . PHE A 1 28 ? -4.072  -0.997  0.331   1.00 0.00 ? 58  PHE A CD2  6  
ATOM 7785  C CE1  . PHE A 1 28 ? -1.325  -1.162  0.519   1.00 0.00 ? 58  PHE A CE1  6  
ATOM 7786  C CE2  . PHE A 1 28 ? -3.297  0.120   0.088   1.00 0.00 ? 58  PHE A CE2  6  
ATOM 7787  C CZ   . PHE A 1 28 ? -1.921  0.039   0.182   1.00 0.00 ? 58  PHE A CZ   6  
ATOM 7788  H H    . PHE A 1 28 ? -5.365  -5.623  1.639   1.00 0.00 ? 58  PHE A H    6  
ATOM 7789  H HA   . PHE A 1 28 ? -2.953  -4.357  2.271   1.00 0.00 ? 58  PHE A HA   6  
ATOM 7790  H HB2  . PHE A 1 28 ? -4.180  -4.113  0.117   1.00 0.00 ? 58  PHE A HB2  6  
ATOM 7791  H HB3  . PHE A 1 28 ? -5.367  -3.108  0.943   1.00 0.00 ? 58  PHE A HB3  6  
ATOM 7792  H HD1  . PHE A 1 28 ? -1.638  -3.214  1.022   1.00 0.00 ? 58  PHE A HD1  6  
ATOM 7793  H HD2  . PHE A 1 28 ? -5.148  -0.931  0.257   1.00 0.00 ? 58  PHE A HD2  6  
ATOM 7794  H HE1  . PHE A 1 28 ? -0.249  -1.228  0.593   1.00 0.00 ? 58  PHE A HE1  6  
ATOM 7795  H HE2  . PHE A 1 28 ? -3.766  1.057   -0.175  1.00 0.00 ? 58  PHE A HE2  6  
ATOM 7796  H HZ   . PHE A 1 28 ? -1.313  0.911   -0.006  1.00 0.00 ? 58  PHE A HZ   6  
ATOM 7797  N N    . LEU A 1 29 ? -5.601  -3.109  3.774   1.00 0.00 ? 59  LEU A N    6  
ATOM 7798  C CA   . LEU A 1 29 ? -6.037  -2.260  4.877   1.00 0.00 ? 59  LEU A CA   6  
ATOM 7799  C C    . LEU A 1 29 ? -5.368  -2.680  6.182   1.00 0.00 ? 59  LEU A C    6  
ATOM 7800  O O    . LEU A 1 29 ? -4.961  -1.839  6.983   1.00 0.00 ? 59  LEU A O    6  
ATOM 7801  C CB   . LEU A 1 29 ? -7.558  -2.322  5.027   1.00 0.00 ? 59  LEU A CB   6  
ATOM 7802  C CG   . LEU A 1 29 ? -8.348  -1.769  3.841   1.00 0.00 ? 59  LEU A CG   6  
ATOM 7803  C CD1  . LEU A 1 29 ? -9.841  -1.813  4.127   1.00 0.00 ? 59  LEU A CD1  6  
ATOM 7804  C CD2  . LEU A 1 29 ? -7.907  -0.348  3.523   1.00 0.00 ? 59  LEU A CD2  6  
ATOM 7805  H H    . LEU A 1 29 ? -6.269  -3.631  3.280   1.00 0.00 ? 59  LEU A H    6  
ATOM 7806  H HA   . LEU A 1 29 ? -5.747  -1.246  4.649   1.00 0.00 ? 59  LEU A HA   6  
ATOM 7807  H HB2  . LEU A 1 29 ? -7.842  -3.354  5.173   1.00 0.00 ? 59  LEU A HB2  6  
ATOM 7808  H HB3  . LEU A 1 29 ? -7.835  -1.761  5.907   1.00 0.00 ? 59  LEU A HB3  6  
ATOM 7809  H HG   . LEU A 1 29 ? -8.157  -2.382  2.972   1.00 0.00 ? 59  LEU A HG   6  
ATOM 7810  H HD11 . LEU A 1 29 ? -10.141 -2.834  4.318   1.00 0.00 ? 59  LEU A HD11 6  
ATOM 7811  H HD12 . LEU A 1 29 ? -10.384 -1.432  3.274   1.00 0.00 ? 59  LEU A HD12 6  
ATOM 7812  H HD13 . LEU A 1 29 ? -10.061 -1.206  4.992   1.00 0.00 ? 59  LEU A HD13 6  
ATOM 7813  H HD21 . LEU A 1 29 ? -7.517  0.117   4.417   1.00 0.00 ? 59  LEU A HD21 6  
ATOM 7814  H HD22 . LEU A 1 29 ? -8.753  0.219   3.162   1.00 0.00 ? 59  LEU A HD22 6  
ATOM 7815  H HD23 . LEU A 1 29 ? -7.139  -0.370  2.764   1.00 0.00 ? 59  LEU A HD23 6  
ATOM 7816  N N    . GLU A 1 30 ? -5.257  -3.989  6.389   1.00 0.00 ? 60  GLU A N    6  
ATOM 7817  C CA   . GLU A 1 30 ? -4.638  -4.522  7.596   1.00 0.00 ? 60  GLU A CA   6  
ATOM 7818  C C    . GLU A 1 30 ? -3.181  -4.080  7.700   1.00 0.00 ? 60  GLU A C    6  
ATOM 7819  O O    . GLU A 1 30 ? -2.712  -3.701  8.773   1.00 0.00 ? 60  GLU A O    6  
ATOM 7820  C CB   . GLU A 1 30 ? -4.726  -6.050  7.607   1.00 0.00 ? 60  GLU A CB   6  
ATOM 7821  C CG   . GLU A 1 30 ? -5.304  -6.618  8.893   1.00 0.00 ? 60  GLU A CG   6  
ATOM 7822  C CD   . GLU A 1 30 ? -4.573  -6.127  10.128  1.00 0.00 ? 60  GLU A CD   6  
ATOM 7823  O OE1  . GLU A 1 30 ? -4.939  -5.050  10.645  1.00 0.00 ? 60  GLU A OE1  6  
ATOM 7824  O OE2  . GLU A 1 30 ? -3.635  -6.820  10.577  1.00 0.00 ? 60  GLU A OE2  6  
ATOM 7825  H H    . GLU A 1 30 ? -5.600  -4.610  5.714   1.00 0.00 ? 60  GLU A H    6  
ATOM 7826  H HA   . GLU A 1 30 ? -5.180  -4.134  8.445   1.00 0.00 ? 60  GLU A HA   6  
ATOM 7827  H HB2  . GLU A 1 30 ? -5.350  -6.369  6.786   1.00 0.00 ? 60  GLU A HB2  6  
ATOM 7828  H HB3  . GLU A 1 30 ? -3.734  -6.460  7.473   1.00 0.00 ? 60  GLU A HB3  6  
ATOM 7829  H HG2  . GLU A 1 30 ? -6.340  -6.324  8.967   1.00 0.00 ? 60  GLU A HG2  6  
ATOM 7830  H HG3  . GLU A 1 30 ? -5.238  -7.696  8.858   1.00 0.00 ? 60  GLU A HG3  6  
ATOM 7831  N N    . ILE A 1 31 ? -2.472  -4.131  6.577   1.00 0.00 ? 61  ILE A N    6  
ATOM 7832  C CA   . ILE A 1 31 ? -1.069  -3.736  6.540   1.00 0.00 ? 61  ILE A CA   6  
ATOM 7833  C C    . ILE A 1 31 ? -0.913  -2.246  6.828   1.00 0.00 ? 61  ILE A C    6  
ATOM 7834  O O    . ILE A 1 31 ? 0.031   -1.829  7.500   1.00 0.00 ? 61  ILE A O    6  
ATOM 7835  C CB   . ILE A 1 31 ? -0.430  -4.054  5.175   1.00 0.00 ? 61  ILE A CB   6  
ATOM 7836  C CG1  . ILE A 1 31 ? -0.701  -5.508  4.783   1.00 0.00 ? 61  ILE A CG1  6  
ATOM 7837  C CG2  . ILE A 1 31 ? 1.066   -3.781  5.212   1.00 0.00 ? 61  ILE A CG2  6  
ATOM 7838  C CD1  . ILE A 1 31 ? -0.974  -5.695  3.307   1.00 0.00 ? 61  ILE A CD1  6  
ATOM 7839  H H    . ILE A 1 31 ? -2.903  -4.441  5.753   1.00 0.00 ? 61  ILE A H    6  
ATOM 7840  H HA   . ILE A 1 31 ? -0.544  -4.296  7.300   1.00 0.00 ? 61  ILE A HA   6  
ATOM 7841  H HB   . ILE A 1 31 ? -0.871  -3.402  4.436   1.00 0.00 ? 61  ILE A HB   6  
ATOM 7842  H HG12 . ILE A 1 31 ? 0.160   -6.109  5.039   1.00 0.00 ? 61  ILE A HG12 6  
ATOM 7843  H HG13 . ILE A 1 31 ? -1.560  -5.868  5.330   1.00 0.00 ? 61  ILE A HG13 6  
ATOM 7844  H HG21 . ILE A 1 31 ? 1.444   -3.704  4.203   1.00 0.00 ? 61  ILE A HG21 6  
ATOM 7845  H HG22 . ILE A 1 31 ? 1.567   -4.589  5.724   1.00 0.00 ? 61  ILE A HG22 6  
ATOM 7846  H HG23 . ILE A 1 31 ? 1.250   -2.855  5.736   1.00 0.00 ? 61  ILE A HG23 6  
ATOM 7847  H HD11 . ILE A 1 31 ? -0.254  -6.383  2.891   1.00 0.00 ? 61  ILE A HD11 6  
ATOM 7848  H HD12 . ILE A 1 31 ? -0.897  -4.744  2.803   1.00 0.00 ? 61  ILE A HD12 6  
ATOM 7849  H HD13 . ILE A 1 31 ? -1.969  -6.093  3.173   1.00 0.00 ? 61  ILE A HD13 6  
ATOM 7850  N N    . MET A 1 32 ? -1.845  -1.449  6.316   1.00 0.00 ? 62  MET A N    6  
ATOM 7851  C CA   . MET A 1 32 ? -1.811  -0.006  6.518   1.00 0.00 ? 62  MET A CA   6  
ATOM 7852  C C    . MET A 1 32 ? -2.095  0.346   7.975   1.00 0.00 ? 62  MET A C    6  
ATOM 7853  O O    . MET A 1 32 ? -1.299  1.025   8.626   1.00 0.00 ? 62  MET A O    6  
ATOM 7854  C CB   . MET A 1 32 ? -2.832  0.681   5.608   1.00 0.00 ? 62  MET A CB   6  
ATOM 7855  C CG   . MET A 1 32 ? -2.412  0.724   4.148   1.00 0.00 ? 62  MET A CG   6  
ATOM 7856  S SD   . MET A 1 32 ? -0.866  1.618   3.895   1.00 0.00 ? 62  MET A SD   6  
ATOM 7857  C CE   . MET A 1 32 ? 0.130   0.354   3.110   1.00 0.00 ? 62  MET A CE   6  
ATOM 7858  H H    . MET A 1 32 ? -2.573  -1.842  5.790   1.00 0.00 ? 62  MET A H    6  
ATOM 7859  H HA   . MET A 1 32 ? -0.822  0.342   6.261   1.00 0.00 ? 62  MET A HA   6  
ATOM 7860  H HB2  . MET A 1 32 ? -3.771  0.152   5.675   1.00 0.00 ? 62  MET A HB2  6  
ATOM 7861  H HB3  . MET A 1 32 ? -2.975  1.696   5.949   1.00 0.00 ? 62  MET A HB3  6  
ATOM 7862  H HG2  . MET A 1 32 ? -2.288  -0.287  3.793   1.00 0.00 ? 62  MET A HG2  6  
ATOM 7863  H HG3  . MET A 1 32 ? -3.190  1.210   3.578   1.00 0.00 ? 62  MET A HG3  6  
ATOM 7864  H HE1  . MET A 1 32 ? 0.848   -0.031  3.819   1.00 0.00 ? 62  MET A HE1  6  
ATOM 7865  H HE2  . MET A 1 32 ? 0.652   0.781   2.266   1.00 0.00 ? 62  MET A HE2  6  
ATOM 7866  H HE3  . MET A 1 32 ? -0.507  -0.448  2.770   1.00 0.00 ? 62  MET A HE3  6  
ATOM 7867  N N    . LYS A 1 33 ? -3.231  -0.120  8.482   1.00 0.00 ? 63  LYS A N    6  
ATOM 7868  C CA   . LYS A 1 33 ? -3.618  0.145   9.862   1.00 0.00 ? 63  LYS A CA   6  
ATOM 7869  C C    . LYS A 1 33 ? -2.584  -0.418  10.832  1.00 0.00 ? 63  LYS A C    6  
ATOM 7870  O O    . LYS A 1 33 ? -2.374  0.128   11.916  1.00 0.00 ? 63  LYS A O    6  
ATOM 7871  C CB   . LYS A 1 33 ? -4.992  -0.463  10.154  1.00 0.00 ? 63  LYS A CB   6  
ATOM 7872  C CG   . LYS A 1 33 ? -5.542  -0.093  11.522  1.00 0.00 ? 63  LYS A CG   6  
ATOM 7873  C CD   . LYS A 1 33 ? -6.985  -0.546  11.684  1.00 0.00 ? 63  LYS A CD   6  
ATOM 7874  C CE   . LYS A 1 33 ? -7.828  0.513   12.376  1.00 0.00 ? 63  LYS A CE   6  
ATOM 7875  N NZ   . LYS A 1 33 ? -9.085  -0.057  12.936  1.00 0.00 ? 63  LYS A NZ   6  
ATOM 7876  H H    . LYS A 1 33 ? -3.824  -0.655  7.913   1.00 0.00 ? 63  LYS A H    6  
ATOM 7877  H HA   . LYS A 1 33 ? -3.672  1.214   9.992   1.00 0.00 ? 63  LYS A HA   6  
ATOM 7878  H HB2  . LYS A 1 33 ? -5.691  -0.120  9.404   1.00 0.00 ? 63  LYS A HB2  6  
ATOM 7879  H HB3  . LYS A 1 33 ? -4.917  -1.538  10.099  1.00 0.00 ? 63  LYS A HB3  6  
ATOM 7880  H HG2  . LYS A 1 33 ? -4.940  -0.568  12.282  1.00 0.00 ? 63  LYS A HG2  6  
ATOM 7881  H HG3  . LYS A 1 33 ? -5.495  0.979   11.640  1.00 0.00 ? 63  LYS A HG3  6  
ATOM 7882  H HD2  . LYS A 1 33 ? -7.403  -0.741  10.707  1.00 0.00 ? 63  LYS A HD2  6  
ATOM 7883  H HD3  . LYS A 1 33 ? -7.004  -1.452  12.272  1.00 0.00 ? 63  LYS A HD3  6  
ATOM 7884  H HE2  . LYS A 1 33 ? -7.251  0.945   13.180  1.00 0.00 ? 63  LYS A HE2  6  
ATOM 7885  H HE3  . LYS A 1 33 ? -8.078  1.281   11.660  1.00 0.00 ? 63  LYS A HE3  6  
ATOM 7886  H HZ1  . LYS A 1 33 ? -8.866  -0.848  13.576  1.00 0.00 ? 63  LYS A HZ1  6  
ATOM 7887  H HZ2  . LYS A 1 33 ? -9.693  -0.405  12.168  1.00 0.00 ? 63  LYS A HZ2  6  
ATOM 7888  H HZ3  . LYS A 1 33 ? -9.602  0.672   13.468  1.00 0.00 ? 63  LYS A HZ3  6  
ATOM 7889  N N    . GLU A 1 34 ? -1.942  -1.512  10.437  1.00 0.00 ? 64  GLU A N    6  
ATOM 7890  C CA   . GLU A 1 34 ? -0.929  -2.148  11.271  1.00 0.00 ? 64  GLU A CA   6  
ATOM 7891  C C    . GLU A 1 34 ? 0.299   -1.255  11.412  1.00 0.00 ? 64  GLU A C    6  
ATOM 7892  O O    . GLU A 1 34 ? 0.876   -1.144  12.494  1.00 0.00 ? 64  GLU A O    6  
ATOM 7893  C CB   . GLU A 1 34 ? -0.527  -3.500  10.678  1.00 0.00 ? 64  GLU A CB   6  
ATOM 7894  C CG   . GLU A 1 34 ? -1.376  -4.658  11.176  1.00 0.00 ? 64  GLU A CG   6  
ATOM 7895  C CD   . GLU A 1 34 ? -0.985  -5.980  10.544  1.00 0.00 ? 64  GLU A CD   6  
ATOM 7896  O OE1  . GLU A 1 34 ? -1.316  -6.193  9.358   1.00 0.00 ? 64  GLU A OE1  6  
ATOM 7897  O OE2  . GLU A 1 34 ? -0.349  -6.804  11.235  1.00 0.00 ? 64  GLU A OE2  6  
ATOM 7898  H H    . GLU A 1 34 ? -2.153  -1.900  9.562   1.00 0.00 ? 64  GLU A H    6  
ATOM 7899  H HA   . GLU A 1 34 ? -1.359  -2.307  12.248  1.00 0.00 ? 64  GLU A HA   6  
ATOM 7900  H HB2  . GLU A 1 34 ? -0.619  -3.450  9.603   1.00 0.00 ? 64  GLU A HB2  6  
ATOM 7901  H HB3  . GLU A 1 34 ? 0.502   -3.700  10.934  1.00 0.00 ? 64  GLU A HB3  6  
ATOM 7902  H HG2  . GLU A 1 34 ? -1.258  -4.741  12.246  1.00 0.00 ? 64  GLU A HG2  6  
ATOM 7903  H HG3  . GLU A 1 34 ? -2.411  -4.456  10.943  1.00 0.00 ? 64  GLU A HG3  6  
ATOM 7904  N N    . PHE A 1 35 ? 0.693   -0.620  10.313  1.00 0.00 ? 65  PHE A N    6  
ATOM 7905  C CA   . PHE A 1 35 ? 1.854   0.264   10.316  1.00 0.00 ? 65  PHE A CA   6  
ATOM 7906  C C    . PHE A 1 35 ? 1.594   1.499   11.171  1.00 0.00 ? 65  PHE A C    6  
ATOM 7907  O O    . PHE A 1 35 ? 2.445   1.911   11.959  1.00 0.00 ? 65  PHE A O    6  
ATOM 7908  C CB   . PHE A 1 35 ? 2.206   0.683   8.887   1.00 0.00 ? 65  PHE A CB   6  
ATOM 7909  C CG   . PHE A 1 35 ? 3.561   1.321   8.768   1.00 0.00 ? 65  PHE A CG   6  
ATOM 7910  C CD1  . PHE A 1 35 ? 4.707   0.544   8.737   1.00 0.00 ? 65  PHE A CD1  6  
ATOM 7911  C CD2  . PHE A 1 35 ? 3.687   2.699   8.686   1.00 0.00 ? 65  PHE A CD2  6  
ATOM 7912  C CE1  . PHE A 1 35 ? 5.955   1.128   8.627   1.00 0.00 ? 65  PHE A CE1  6  
ATOM 7913  C CE2  . PHE A 1 35 ? 4.932   3.289   8.576   1.00 0.00 ? 65  PHE A CE2  6  
ATOM 7914  C CZ   . PHE A 1 35 ? 6.067   2.503   8.546   1.00 0.00 ? 65  PHE A CZ   6  
ATOM 7915  H H    . PHE A 1 35 ? 0.192   -0.749  9.481   1.00 0.00 ? 65  PHE A H    6  
ATOM 7916  H HA   . PHE A 1 35 ? 2.685   -0.282  10.738  1.00 0.00 ? 65  PHE A HA   6  
ATOM 7917  H HB2  . PHE A 1 35 ? 2.193   -0.189  8.250   1.00 0.00 ? 65  PHE A HB2  6  
ATOM 7918  H HB3  . PHE A 1 35 ? 1.471   1.391   8.536   1.00 0.00 ? 65  PHE A HB3  6  
ATOM 7919  H HD1  . PHE A 1 35 ? 4.620   -0.531  8.800   1.00 0.00 ? 65  PHE A HD1  6  
ATOM 7920  H HD2  . PHE A 1 35 ? 2.800   3.314   8.709   1.00 0.00 ? 65  PHE A HD2  6  
ATOM 7921  H HE1  . PHE A 1 35 ? 6.841   0.511   8.603   1.00 0.00 ? 65  PHE A HE1  6  
ATOM 7922  H HE2  . PHE A 1 35 ? 5.016   4.364   8.512   1.00 0.00 ? 65  PHE A HE2  6  
ATOM 7923  H HZ   . PHE A 1 35 ? 7.041   2.961   8.460   1.00 0.00 ? 65  PHE A HZ   6  
ATOM 7924  N N    . LYS A 1 36 ? 0.411   2.086   11.012  1.00 0.00 ? 66  LYS A N    6  
ATOM 7925  C CA   . LYS A 1 36 ? 0.041   3.275   11.773  1.00 0.00 ? 66  LYS A CA   6  
ATOM 7926  C C    . LYS A 1 36 ? 0.100   2.995   13.270  1.00 0.00 ? 66  LYS A C    6  
ATOM 7927  O O    . LYS A 1 36 ? 0.589   3.816   14.046  1.00 0.00 ? 66  LYS A O    6  
ATOM 7928  C CB   . LYS A 1 36 ? -1.362  3.741   11.382  1.00 0.00 ? 66  LYS A CB   6  
ATOM 7929  C CG   . LYS A 1 36 ? -1.784  5.034   12.063  1.00 0.00 ? 66  LYS A CG   6  
ATOM 7930  C CD   . LYS A 1 36 ? -2.302  6.052   11.060  1.00 0.00 ? 66  LYS A CD   6  
ATOM 7931  C CE   . LYS A 1 36 ? -2.907  7.261   11.755  1.00 0.00 ? 66  LYS A CE   6  
ATOM 7932  N NZ   . LYS A 1 36 ? -4.058  7.820   10.993  1.00 0.00 ? 66  LYS A NZ   6  
ATOM 7933  H H    . LYS A 1 36 ? -0.227  1.711   10.370  1.00 0.00 ? 66  LYS A H    6  
ATOM 7934  H HA   . LYS A 1 36 ? 0.750   4.053   11.537  1.00 0.00 ? 66  LYS A HA   6  
ATOM 7935  H HB2  . LYS A 1 36 ? -1.394  3.893   10.313  1.00 0.00 ? 66  LYS A HB2  6  
ATOM 7936  H HB3  . LYS A 1 36 ? -2.072  2.971   11.648  1.00 0.00 ? 66  LYS A HB3  6  
ATOM 7937  H HG2  . LYS A 1 36 ? -2.568  4.815   12.774  1.00 0.00 ? 66  LYS A HG2  6  
ATOM 7938  H HG3  . LYS A 1 36 ? -0.933  5.450   12.580  1.00 0.00 ? 66  LYS A HG3  6  
ATOM 7939  H HD2  . LYS A 1 36 ? -1.482  6.380   10.440  1.00 0.00 ? 66  LYS A HD2  6  
ATOM 7940  H HD3  . LYS A 1 36 ? -3.057  5.585   10.445  1.00 0.00 ? 66  LYS A HD3  6  
ATOM 7941  H HE2  . LYS A 1 36 ? -3.249  6.963   12.736  1.00 0.00 ? 66  LYS A HE2  6  
ATOM 7942  H HE3  . LYS A 1 36 ? -2.147  8.021   11.854  1.00 0.00 ? 66  LYS A HE3  6  
ATOM 7943  H HZ1  . LYS A 1 36 ? -4.541  7.064   10.468  1.00 0.00 ? 66  LYS A HZ1  6  
ATOM 7944  H HZ2  . LYS A 1 36 ? -3.724  8.537   10.317  1.00 0.00 ? 66  LYS A HZ2  6  
ATOM 7945  H HZ3  . LYS A 1 36 ? -4.737  8.263   11.644  1.00 0.00 ? 66  LYS A HZ3  6  
ATOM 7946  N N    . SER A 1 37 ? -0.396  1.829   13.669  1.00 0.00 ? 67  SER A N    6  
ATOM 7947  C CA   . SER A 1 37 ? -0.395  1.436   15.072  1.00 0.00 ? 67  SER A CA   6  
ATOM 7948  C C    . SER A 1 37 ? 1.032   1.308   15.602  1.00 0.00 ? 67  SER A C    6  
ATOM 7949  O O    . SER A 1 37 ? 1.254   1.285   16.813  1.00 0.00 ? 67  SER A O    6  
ATOM 7950  C CB   . SER A 1 37 ? -1.139  0.113   15.254  1.00 0.00 ? 67  SER A CB   6  
ATOM 7951  O OG   . SER A 1 37 ? -0.407  -0.965  14.696  1.00 0.00 ? 67  SER A OG   6  
ATOM 7952  H H    . SER A 1 37 ? -0.768  1.215   13.002  1.00 0.00 ? 67  SER A H    6  
ATOM 7953  H HA   . SER A 1 37 ? -0.905  2.205   15.630  1.00 0.00 ? 67  SER A HA   6  
ATOM 7954  H HB2  . SER A 1 37 ? -1.285  -0.075  16.307  1.00 0.00 ? 67  SER A HB2  6  
ATOM 7955  H HB3  . SER A 1 37 ? -2.100  0.172   14.762  1.00 0.00 ? 67  SER A HB3  6  
ATOM 7956  H HG   . SER A 1 37 ? -0.883  -1.786  14.844  1.00 0.00 ? 67  SER A HG   6  
ATOM 7957  N N    . GLN A 1 38 ? 1.998   1.223   14.688  1.00 0.00 ? 68  GLN A N    6  
ATOM 7958  C CA   . GLN A 1 38 ? 3.404   1.096   15.059  1.00 0.00 ? 68  GLN A CA   6  
ATOM 7959  C C    . GLN A 1 38 ? 3.711   -0.317  15.545  1.00 0.00 ? 68  GLN A C    6  
ATOM 7960  O O    . GLN A 1 38 ? 4.404   -0.505  16.547  1.00 0.00 ? 68  GLN A O    6  
ATOM 7961  C CB   . GLN A 1 38 ? 3.773   2.117   16.141  1.00 0.00 ? 68  GLN A CB   6  
ATOM 7962  C CG   . GLN A 1 38 ? 5.137   2.758   15.933  1.00 0.00 ? 68  GLN A CG   6  
ATOM 7963  C CD   . GLN A 1 38 ? 6.096   2.472   17.072  1.00 0.00 ? 68  GLN A CD   6  
ATOM 7964  O OE1  . GLN A 1 38 ? 6.727   3.382   17.611  1.00 0.00 ? 68  GLN A OE1  6  
ATOM 7965  N NE2  . GLN A 1 38 ? 6.212   1.202   17.444  1.00 0.00 ? 68  GLN A NE2  6  
ATOM 7966  H H    . GLN A 1 38 ? 1.760   1.245   13.738  1.00 0.00 ? 68  GLN A H    6  
ATOM 7967  H HA   . GLN A 1 38 ? 3.995   1.293   14.176  1.00 0.00 ? 68  GLN A HA   6  
ATOM 7968  H HB2  . GLN A 1 38 ? 3.029   2.899   16.148  1.00 0.00 ? 68  GLN A HB2  6  
ATOM 7969  H HB3  . GLN A 1 38 ? 3.772   1.623   17.101  1.00 0.00 ? 68  GLN A HB3  6  
ATOM 7970  H HG2  . GLN A 1 38 ? 5.564   2.376   15.018  1.00 0.00 ? 68  GLN A HG2  6  
ATOM 7971  H HG3  . GLN A 1 38 ? 5.007   3.827   15.849  1.00 0.00 ? 68  GLN A HG3  6  
ATOM 7972  H HE21 . GLN A 1 38 ? 5.679   0.531   16.969  1.00 0.00 ? 68  GLN A HE21 6  
ATOM 7973  H HE22 . GLN A 1 38 ? 6.825   0.990   18.178  1.00 0.00 ? 68  GLN A HE22 6  
ATOM 7974  N N    . SER A 1 39 ? 3.192   -1.309  14.829  1.00 0.00 ? 69  SER A N    6  
ATOM 7975  C CA   . SER A 1 39 ? 3.410   -2.706  15.185  1.00 0.00 ? 69  SER A CA   6  
ATOM 7976  C C    . SER A 1 39 ? 4.092   -3.469  14.050  1.00 0.00 ? 69  SER A C    6  
ATOM 7977  O O    . SER A 1 39 ? 4.117   -4.700  14.049  1.00 0.00 ? 69  SER A O    6  
ATOM 7978  C CB   . SER A 1 39 ? 2.080   -3.376  15.536  1.00 0.00 ? 69  SER A CB   6  
ATOM 7979  O OG   . SER A 1 39 ? 2.264   -4.403  16.495  1.00 0.00 ? 69  SER A OG   6  
ATOM 7980  H H    . SER A 1 39 ? 2.649   -1.096  14.041  1.00 0.00 ? 69  SER A H    6  
ATOM 7981  H HA   . SER A 1 39 ? 4.052   -2.730  16.053  1.00 0.00 ? 69  SER A HA   6  
ATOM 7982  H HB2  . SER A 1 39 ? 1.404   -2.639  15.942  1.00 0.00 ? 69  SER A HB2  6  
ATOM 7983  H HB3  . SER A 1 39 ? 1.650   -3.807  14.644  1.00 0.00 ? 69  SER A HB3  6  
ATOM 7984  H HG   . SER A 1 39 ? 2.181   -5.260  16.069  1.00 0.00 ? 69  SER A HG   6  
ATOM 7985  N N    . ILE A 1 40 ? 4.645   -2.736  13.087  1.00 0.00 ? 70  ILE A N    6  
ATOM 7986  C CA   . ILE A 1 40 ? 5.325   -3.354  11.956  1.00 0.00 ? 70  ILE A CA   6  
ATOM 7987  C C    . ILE A 1 40 ? 6.358   -2.406  11.353  1.00 0.00 ? 70  ILE A C    6  
ATOM 7988  O O    . ILE A 1 40 ? 6.164   -1.190  11.333  1.00 0.00 ? 70  ILE A O    6  
ATOM 7989  C CB   . ILE A 1 40 ? 4.325   -3.780  10.861  1.00 0.00 ? 70  ILE A CB   6  
ATOM 7990  C CG1  . ILE A 1 40 ? 5.051   -4.503  9.725   1.00 0.00 ? 70  ILE A CG1  6  
ATOM 7991  C CG2  . ILE A 1 40 ? 3.567   -2.571  10.331  1.00 0.00 ? 70  ILE A CG2  6  
ATOM 7992  C CD1  . ILE A 1 40 ? 4.119   -5.229  8.778   1.00 0.00 ? 70  ILE A CD1  6  
ATOM 7993  H H    . ILE A 1 40 ? 4.597   -1.759  13.140  1.00 0.00 ? 70  ILE A H    6  
ATOM 7994  H HA   . ILE A 1 40 ? 5.831   -4.239  12.315  1.00 0.00 ? 70  ILE A HA   6  
ATOM 7995  H HB   . ILE A 1 40 ? 3.608   -4.454  11.306  1.00 0.00 ? 70  ILE A HB   6  
ATOM 7996  H HG12 . ILE A 1 40 ? 5.612   -3.783  9.149   1.00 0.00 ? 70  ILE A HG12 6  
ATOM 7997  H HG13 . ILE A 1 40 ? 5.730   -5.230  10.146  1.00 0.00 ? 70  ILE A HG13 6  
ATOM 7998  H HG21 . ILE A 1 40 ? 3.450   -2.660  9.261   1.00 0.00 ? 70  ILE A HG21 6  
ATOM 7999  H HG22 . ILE A 1 40 ? 4.118   -1.671  10.559  1.00 0.00 ? 70  ILE A HG22 6  
ATOM 8000  H HG23 . ILE A 1 40 ? 2.593   -2.524  10.796  1.00 0.00 ? 70  ILE A HG23 6  
ATOM 8001  H HD11 . ILE A 1 40 ? 4.169   -6.291  8.968   1.00 0.00 ? 70  ILE A HD11 6  
ATOM 8002  H HD12 . ILE A 1 40 ? 4.417   -5.032  7.758   1.00 0.00 ? 70  ILE A HD12 6  
ATOM 8003  H HD13 . ILE A 1 40 ? 3.108   -4.882  8.931   1.00 0.00 ? 70  ILE A HD13 6  
ATOM 8004  N N    . ASP A 1 41 ? 7.458   -2.971  10.865  1.00 0.00 ? 71  ASP A N    6  
ATOM 8005  C CA   . ASP A 1 41 ? 8.523   -2.176  10.263  1.00 0.00 ? 71  ASP A CA   6  
ATOM 8006  C C    . ASP A 1 41 ? 8.222   -1.885  8.796   1.00 0.00 ? 71  ASP A C    6  
ATOM 8007  O O    . ASP A 1 41 ? 7.208   -2.329  8.260   1.00 0.00 ? 71  ASP A O    6  
ATOM 8008  C CB   . ASP A 1 41 ? 9.863   -2.904  10.387  1.00 0.00 ? 71  ASP A CB   6  
ATOM 8009  C CG   . ASP A 1 41 ? 11.027  -1.947  10.555  1.00 0.00 ? 71  ASP A CG   6  
ATOM 8010  O OD1  . ASP A 1 41 ? 10.910  -1.006  11.369  1.00 0.00 ? 71  ASP A OD1  6  
ATOM 8011  O OD2  . ASP A 1 41 ? 12.056  -2.138  9.874   1.00 0.00 ? 71  ASP A OD2  6  
ATOM 8012  H H    . ASP A 1 41 ? 7.557   -3.944  10.911  1.00 0.00 ? 71  ASP A H    6  
ATOM 8013  H HA   . ASP A 1 41 ? 8.581   -1.241  10.798  1.00 0.00 ? 71  ASP A HA   6  
ATOM 8014  H HB2  . ASP A 1 41 ? 9.831   -3.558  11.247  1.00 0.00 ? 71  ASP A HB2  6  
ATOM 8015  H HB3  . ASP A 1 41 ? 10.029  -3.493  9.497   1.00 0.00 ? 71  ASP A HB3  6  
ATOM 8016  N N    . THR A 1 42 ? 9.112   -1.136  8.153   1.00 0.00 ? 72  THR A N    6  
ATOM 8017  C CA   . THR A 1 42 ? 8.943   -0.786  6.746   1.00 0.00 ? 72  THR A CA   6  
ATOM 8018  C C    . THR A 1 42 ? 9.098   -2.017  5.855   1.00 0.00 ? 72  THR A C    6  
ATOM 8019  O O    . THR A 1 42 ? 8.227   -2.315  5.038   1.00 0.00 ? 72  THR A O    6  
ATOM 8020  C CB   . THR A 1 42 ? 9.954   0.290   6.338   1.00 0.00 ? 72  THR A CB   6  
ATOM 8021  O OG1  . THR A 1 42 ? 10.813  0.612   7.418   1.00 0.00 ? 72  THR A OG1  6  
ATOM 8022  C CG2  . THR A 1 42 ? 9.302   1.574   5.872   1.00 0.00 ? 72  THR A CG2  6  
ATOM 8023  H H    . THR A 1 42 ? 9.902   -0.813  8.634   1.00 0.00 ? 72  THR A H    6  
ATOM 8024  H HA   . THR A 1 42 ? 7.945   -0.393  6.624   1.00 0.00 ? 72  THR A HA   6  
ATOM 8025  H HB   . THR A 1 42 ? 10.559  -0.087  5.525   1.00 0.00 ? 72  THR A HB   6  
ATOM 8026  H HG1  . THR A 1 42 ? 10.314  1.067   8.100   1.00 0.00 ? 72  THR A HG1  6  
ATOM 8027  H HG21 . THR A 1 42 ? 8.229   1.474   5.931   1.00 0.00 ? 72  THR A HG21 6  
ATOM 8028  H HG22 . THR A 1 42 ? 9.590   1.774   4.850   1.00 0.00 ? 72  THR A HG22 6  
ATOM 8029  H HG23 . THR A 1 42 ? 9.623   2.390   6.503   1.00 0.00 ? 72  THR A HG23 6  
ATOM 8030  N N    . PRO A 1 43 ? 10.216  -2.752  6.001   1.00 0.00 ? 73  PRO A N    6  
ATOM 8031  C CA   . PRO A 1 43 ? 10.479  -3.956  5.205   1.00 0.00 ? 73  PRO A CA   6  
ATOM 8032  C C    . PRO A 1 43 ? 9.292   -4.911  5.187   1.00 0.00 ? 73  PRO A C    6  
ATOM 8033  O O    . PRO A 1 43 ? 8.995   -5.531  4.166   1.00 0.00 ? 73  PRO A O    6  
ATOM 8034  C CB   . PRO A 1 43 ? 11.671  -4.595  5.917   1.00 0.00 ? 73  PRO A CB   6  
ATOM 8035  C CG   . PRO A 1 43 ? 12.377  -3.455  6.566   1.00 0.00 ? 73  PRO A CG   6  
ATOM 8036  C CD   . PRO A 1 43 ? 11.308  -2.468  6.953   1.00 0.00 ? 73  PRO A CD   6  
ATOM 8037  H HA   . PRO A 1 43 ? 10.754  -3.705  4.191   1.00 0.00 ? 73  PRO A HA   6  
ATOM 8038  H HB2  . PRO A 1 43 ? 11.317  -5.309  6.646   1.00 0.00 ? 73  PRO A HB2  6  
ATOM 8039  H HB3  . PRO A 1 43 ? 12.303  -5.090  5.196   1.00 0.00 ? 73  PRO A HB3  6  
ATOM 8040  H HG2  . PRO A 1 43 ? 12.902  -3.802  7.445   1.00 0.00 ? 73  PRO A HG2  6  
ATOM 8041  H HG3  . PRO A 1 43 ? 13.067  -3.006  5.868   1.00 0.00 ? 73  PRO A HG3  6  
ATOM 8042  H HD2  . PRO A 1 43 ? 10.987  -2.640  7.969   1.00 0.00 ? 73  PRO A HD2  6  
ATOM 8043  H HD3  . PRO A 1 43 ? 11.668  -1.458  6.835   1.00 0.00 ? 73  PRO A HD3  6  
ATOM 8044  N N    . GLY A 1 44 ? 8.614   -5.026  6.326   1.00 0.00 ? 74  GLY A N    6  
ATOM 8045  C CA   . GLY A 1 44 ? 7.466   -5.908  6.419   1.00 0.00 ? 74  GLY A CA   6  
ATOM 8046  C C    . GLY A 1 44 ? 6.281   -5.399  5.621   1.00 0.00 ? 74  GLY A C    6  
ATOM 8047  O O    . GLY A 1 44 ? 5.468   -6.185  5.134   1.00 0.00 ? 74  GLY A O    6  
ATOM 8048  H H    . GLY A 1 44 ? 8.895   -4.507  7.107   1.00 0.00 ? 74  GLY A H    6  
ATOM 8049  H HA2  . GLY A 1 44 ? 7.743   -6.883  6.049   1.00 0.00 ? 74  GLY A HA2  6  
ATOM 8050  H HA3  . GLY A 1 44 ? 7.177   -5.996  7.455   1.00 0.00 ? 74  GLY A HA3  6  
ATOM 8051  N N    . VAL A 1 45 ? 6.184   -4.081  5.487   1.00 0.00 ? 75  VAL A N    6  
ATOM 8052  C CA   . VAL A 1 45 ? 5.092   -3.465  4.743   1.00 0.00 ? 75  VAL A CA   6  
ATOM 8053  C C    . VAL A 1 45 ? 5.294   -3.629  3.241   1.00 0.00 ? 75  VAL A C    6  
ATOM 8054  O O    . VAL A 1 45 ? 4.331   -3.776  2.488   1.00 0.00 ? 75  VAL A O    6  
ATOM 8055  C CB   . VAL A 1 45 ? 4.963   -1.966  5.072   1.00 0.00 ? 75  VAL A CB   6  
ATOM 8056  C CG1  . VAL A 1 45 ? 3.716   -1.382  4.426   1.00 0.00 ? 75  VAL A CG1  6  
ATOM 8057  C CG2  . VAL A 1 45 ? 4.944   -1.746  6.578   1.00 0.00 ? 75  VAL A CG2  6  
ATOM 8058  H H    . VAL A 1 45 ? 6.865   -3.508  5.899   1.00 0.00 ? 75  VAL A H    6  
ATOM 8059  H HA   . VAL A 1 45 ? 4.174   -3.957  5.030   1.00 0.00 ? 75  VAL A HA   6  
ATOM 8060  H HB   . VAL A 1 45 ? 5.822   -1.454  4.666   1.00 0.00 ? 75  VAL A HB   6  
ATOM 8061  H HG11 . VAL A 1 45 ? 2.885   -2.057  4.571   1.00 0.00 ? 75  VAL A HG11 6  
ATOM 8062  H HG12 . VAL A 1 45 ? 3.888   -1.246  3.369   1.00 0.00 ? 75  VAL A HG12 6  
ATOM 8063  H HG13 . VAL A 1 45 ? 3.487   -0.429  4.880   1.00 0.00 ? 75  VAL A HG13 6  
ATOM 8064  H HG21 . VAL A 1 45 ? 3.935   -1.529  6.898   1.00 0.00 ? 75  VAL A HG21 6  
ATOM 8065  H HG22 . VAL A 1 45 ? 5.587   -0.915  6.828   1.00 0.00 ? 75  VAL A HG22 6  
ATOM 8066  H HG23 . VAL A 1 45 ? 5.296   -2.636  7.079   1.00 0.00 ? 75  VAL A HG23 6  
ATOM 8067  N N    . ILE A 1 46 ? 6.551   -3.602  2.813   1.00 0.00 ? 76  ILE A N    6  
ATOM 8068  C CA   . ILE A 1 46 ? 6.882   -3.747  1.401   1.00 0.00 ? 76  ILE A CA   6  
ATOM 8069  C C    . ILE A 1 46 ? 6.648   -5.177  0.925   1.00 0.00 ? 76  ILE A C    6  
ATOM 8070  O O    . ILE A 1 46 ? 6.087   -5.400  -0.147  1.00 0.00 ? 76  ILE A O    6  
ATOM 8071  C CB   . ILE A 1 46 ? 8.346   -3.357  1.124   1.00 0.00 ? 76  ILE A CB   6  
ATOM 8072  C CG1  . ILE A 1 46 ? 8.665   -2.002  1.758   1.00 0.00 ? 76  ILE A CG1  6  
ATOM 8073  C CG2  . ILE A 1 46 ? 8.611   -3.324  -0.374  1.00 0.00 ? 76  ILE A CG2  6  
ATOM 8074  C CD1  . ILE A 1 46 ? 10.089  -1.545  1.525   1.00 0.00 ? 76  ILE A CD1  6  
ATOM 8075  H H    . ILE A 1 46 ? 7.274   -3.482  3.463   1.00 0.00 ? 76  ILE A H    6  
ATOM 8076  H HA   . ILE A 1 46 ? 6.242   -3.082  0.839   1.00 0.00 ? 76  ILE A HA   6  
ATOM 8077  H HB   . ILE A 1 46 ? 8.985   -4.110  1.561   1.00 0.00 ? 76  ILE A HB   6  
ATOM 8078  H HG12 . ILE A 1 46 ? 8.006   -1.254  1.344   1.00 0.00 ? 76  ILE A HG12 6  
ATOM 8079  H HG13 . ILE A 1 46 ? 8.506   -2.064  2.825   1.00 0.00 ? 76  ILE A HG13 6  
ATOM 8080  H HG21 . ILE A 1 46 ? 9.662   -3.146  -0.549  1.00 0.00 ? 76  ILE A HG21 6  
ATOM 8081  H HG22 . ILE A 1 46 ? 8.032   -2.532  -0.825  1.00 0.00 ? 76  ILE A HG22 6  
ATOM 8082  H HG23 . ILE A 1 46 ? 8.329   -4.270  -0.811  1.00 0.00 ? 76  ILE A HG23 6  
ATOM 8083  H HD11 . ILE A 1 46 ? 10.088  -0.510  1.215   1.00 0.00 ? 76  ILE A HD11 6  
ATOM 8084  H HD12 . ILE A 1 46 ? 10.541  -2.151  0.755   1.00 0.00 ? 76  ILE A HD12 6  
ATOM 8085  H HD13 . ILE A 1 46 ? 10.654  -1.646  2.441   1.00 0.00 ? 76  ILE A HD13 6  
ATOM 8086  N N    . ARG A 1 47 ? 7.083   -6.141  1.729   1.00 0.00 ? 77  ARG A N    6  
ATOM 8087  C CA   . ARG A 1 47 ? 6.920   -7.550  1.390   1.00 0.00 ? 77  ARG A CA   6  
ATOM 8088  C C    . ARG A 1 47 ? 5.444   -7.927  1.332   1.00 0.00 ? 77  ARG A C    6  
ATOM 8089  O O    . ARG A 1 47 ? 5.007   -8.631  0.419   1.00 0.00 ? 77  ARG A O    6  
ATOM 8090  C CB   . ARG A 1 47 ? 7.643   -8.431  2.411   1.00 0.00 ? 77  ARG A CB   6  
ATOM 8091  C CG   . ARG A 1 47 ? 9.066   -7.982  2.703   1.00 0.00 ? 77  ARG A CG   6  
ATOM 8092  C CD   . ARG A 1 47 ? 10.086  -9.008  2.234   1.00 0.00 ? 77  ARG A CD   6  
ATOM 8093  N NE   . ARG A 1 47 ? 11.366  -8.863  2.922   1.00 0.00 ? 77  ARG A NE   6  
ATOM 8094  C CZ   . ARG A 1 47 ? 11.584  -9.257  4.174   1.00 0.00 ? 77  ARG A CZ   6  
ATOM 8095  N NH1  . ARG A 1 47 ? 10.611  -9.820  4.879   1.00 0.00 ? 77  ARG A NH1  6  
ATOM 8096  N NH2  . ARG A 1 47 ? 12.779  -9.088  4.724   1.00 0.00 ? 77  ARG A NH2  6  
ATOM 8097  H H    . ARG A 1 47 ? 7.522   -5.900  2.572   1.00 0.00 ? 77  ARG A H    6  
ATOM 8098  H HA   . ARG A 1 47 ? 7.359   -7.709  0.416   1.00 0.00 ? 77  ARG A HA   6  
ATOM 8099  H HB2  . ARG A 1 47 ? 7.087   -8.417  3.337   1.00 0.00 ? 77  ARG A HB2  6  
ATOM 8100  H HB3  . ARG A 1 47 ? 7.675   -9.443  2.037   1.00 0.00 ? 77  ARG A HB3  6  
ATOM 8101  H HG2  . ARG A 1 47 ? 9.251   -7.049  2.193   1.00 0.00 ? 77  ARG A HG2  6  
ATOM 8102  H HG3  . ARG A 1 47 ? 9.176   -7.840  3.769   1.00 0.00 ? 77  ARG A HG3  6  
ATOM 8103  H HD2  . ARG A 1 47 ? 9.696   -9.998  2.426   1.00 0.00 ? 77  ARG A HD2  6  
ATOM 8104  H HD3  . ARG A 1 47 ? 10.241  -8.884  1.172   1.00 0.00 ? 77  ARG A HD3  6  
ATOM 8105  H HE   . ARG A 1 47 ? 12.103  -8.450  2.424   1.00 0.00 ? 77  ARG A HE   6  
ATOM 8106  H HH11 . ARG A 1 47 ? 9.708   -9.951  4.471   1.00 0.00 ? 77  ARG A HH11 6  
ATOM 8107  H HH12 . ARG A 1 47 ? 10.782  -10.114 5.820   1.00 0.00 ? 77  ARG A HH12 6  
ATOM 8108  H HH21 . ARG A 1 47 ? 13.516  -8.665  4.197   1.00 0.00 ? 77  ARG A HH21 6  
ATOM 8109  H HH22 . ARG A 1 47 ? 12.943  -9.384  5.664   1.00 0.00 ? 77  ARG A HH22 6  
ATOM 8110  N N    . ARG A 1 48 ? 4.678   -7.454  2.310   1.00 0.00 ? 78  ARG A N    6  
ATOM 8111  C CA   . ARG A 1 48 ? 3.250   -7.740  2.372   1.00 0.00 ? 78  ARG A CA   6  
ATOM 8112  C C    . ARG A 1 48 ? 2.544   -7.266  1.105   1.00 0.00 ? 78  ARG A C    6  
ATOM 8113  O O    . ARG A 1 48 ? 1.761   -8.004  0.506   1.00 0.00 ? 78  ARG A O    6  
ATOM 8114  C CB   . ARG A 1 48 ? 2.628   -7.071  3.601   1.00 0.00 ? 78  ARG A CB   6  
ATOM 8115  C CG   . ARG A 1 48 ? 2.405   -8.023  4.765   1.00 0.00 ? 78  ARG A CG   6  
ATOM 8116  C CD   . ARG A 1 48 ? 3.699   -8.699  5.190   1.00 0.00 ? 78  ARG A CD   6  
ATOM 8117  N NE   . ARG A 1 48 ? 3.872   -8.685  6.641   1.00 0.00 ? 78  ARG A NE   6  
ATOM 8118  C CZ   . ARG A 1 48 ? 3.246   -9.517  7.469   1.00 0.00 ? 78  ARG A CZ   6  
ATOM 8119  N NH1  . ARG A 1 48 ? 2.407   -10.431 6.997   1.00 0.00 ? 78  ARG A NH1  6  
ATOM 8120  N NH2  . ARG A 1 48 ? 3.461   -9.437  8.776   1.00 0.00 ? 78  ARG A NH2  6  
ATOM 8121  H H    . ARG A 1 48 ? 5.085   -6.898  3.008   1.00 0.00 ? 78  ARG A H    6  
ATOM 8122  H HA   . ARG A 1 48 ? 3.130   -8.810  2.457   1.00 0.00 ? 78  ARG A HA   6  
ATOM 8123  H HB2  . ARG A 1 48 ? 3.282   -6.278  3.933   1.00 0.00 ? 78  ARG A HB2  6  
ATOM 8124  H HB3  . ARG A 1 48 ? 1.674   -6.646  3.324   1.00 0.00 ? 78  ARG A HB3  6  
ATOM 8125  H HG2  . ARG A 1 48 ? 2.010   -7.466  5.602   1.00 0.00 ? 78  ARG A HG2  6  
ATOM 8126  H HG3  . ARG A 1 48 ? 1.695   -8.781  4.466   1.00 0.00 ? 78  ARG A HG3  6  
ATOM 8127  H HD2  . ARG A 1 48 ? 3.684   -9.724  4.849   1.00 0.00 ? 78  ARG A HD2  6  
ATOM 8128  H HD3  . ARG A 1 48 ? 4.529   -8.180  4.733   1.00 0.00 ? 78  ARG A HD3  6  
ATOM 8129  H HE   . ARG A 1 48 ? 4.487   -8.021  7.017   1.00 0.00 ? 78  ARG A HE   6  
ATOM 8130  H HH11 . ARG A 1 48 ? 2.240   -10.496 6.014   1.00 0.00 ? 78  ARG A HH11 6  
ATOM 8131  H HH12 . ARG A 1 48 ? 1.940   -11.053 7.625   1.00 0.00 ? 78  ARG A HH12 6  
ATOM 8132  H HH21 . ARG A 1 48 ? 4.093   -8.751  9.137   1.00 0.00 ? 78  ARG A HH21 6  
ATOM 8133  H HH22 . ARG A 1 48 ? 2.991   -10.063 9.400   1.00 0.00 ? 78  ARG A HH22 6  
ATOM 8134  N N    . VAL A 1 49 ? 2.825   -6.030  0.703   1.00 0.00 ? 79  VAL A N    6  
ATOM 8135  C CA   . VAL A 1 49 ? 2.217   -5.460  -0.494  1.00 0.00 ? 79  VAL A CA   6  
ATOM 8136  C C    . VAL A 1 49 ? 2.804   -6.082  -1.757  1.00 0.00 ? 79  VAL A C    6  
ATOM 8137  O O    . VAL A 1 49 ? 2.107   -6.255  -2.756  1.00 0.00 ? 79  VAL A O    6  
ATOM 8138  C CB   . VAL A 1 49 ? 2.409   -3.932  -0.549  1.00 0.00 ? 79  VAL A CB   6  
ATOM 8139  C CG1  . VAL A 1 49 ? 1.649   -3.339  -1.726  1.00 0.00 ? 79  VAL A CG1  6  
ATOM 8140  C CG2  . VAL A 1 49 ? 1.966   -3.290  0.758   1.00 0.00 ? 79  VAL A CG2  6  
ATOM 8141  H H    . VAL A 1 49 ? 3.458   -5.491  1.222   1.00 0.00 ? 79  VAL A H    6  
ATOM 8142  H HA   . VAL A 1 49 ? 1.158   -5.668  -0.460  1.00 0.00 ? 79  VAL A HA   6  
ATOM 8143  H HB   . VAL A 1 49 ? 3.460   -3.725  -0.687  1.00 0.00 ? 79  VAL A HB   6  
ATOM 8144  H HG11 . VAL A 1 49 ? 0.589   -3.360  -1.516  1.00 0.00 ? 79  VAL A HG11 6  
ATOM 8145  H HG12 . VAL A 1 49 ? 1.851   -3.918  -2.614  1.00 0.00 ? 79  VAL A HG12 6  
ATOM 8146  H HG13 . VAL A 1 49 ? 1.965   -2.319  -1.882  1.00 0.00 ? 79  VAL A HG13 6  
ATOM 8147  H HG21 . VAL A 1 49 ? 1.920   -4.041  1.532   1.00 0.00 ? 79  VAL A HG21 6  
ATOM 8148  H HG22 . VAL A 1 49 ? 0.990   -2.847  0.629   1.00 0.00 ? 79  VAL A HG22 6  
ATOM 8149  H HG23 . VAL A 1 49 ? 2.674   -2.525  1.041   1.00 0.00 ? 79  VAL A HG23 6  
ATOM 8150  N N    . SER A 1 50 ? 4.090   -6.416  -1.706  1.00 0.00 ? 80  SER A N    6  
ATOM 8151  C CA   . SER A 1 50 ? 4.768   -7.019  -2.847  1.00 0.00 ? 80  SER A CA   6  
ATOM 8152  C C    . SER A 1 50 ? 4.150   -8.365  -3.203  1.00 0.00 ? 80  SER A C    6  
ATOM 8153  O O    . SER A 1 50 ? 4.229   -8.814  -4.346  1.00 0.00 ? 80  SER A O    6  
ATOM 8154  C CB   . SER A 1 50 ? 6.259   -7.190  -2.549  1.00 0.00 ? 80  SER A CB   6  
ATOM 8155  O OG   . SER A 1 50 ? 6.866   -8.075  -3.476  1.00 0.00 ? 80  SER A OG   6  
ATOM 8156  H H    . SER A 1 50 ? 4.594   -6.253  -0.881  1.00 0.00 ? 80  SER A H    6  
ATOM 8157  H HA   . SER A 1 50 ? 4.653   -6.354  -3.685  1.00 0.00 ? 80  SER A HA   6  
ATOM 8158  H HB2  . SER A 1 50 ? 6.750   -6.231  -2.612  1.00 0.00 ? 80  SER A HB2  6  
ATOM 8159  H HB3  . SER A 1 50 ? 6.381   -7.592  -1.554  1.00 0.00 ? 80  SER A HB3  6  
ATOM 8160  H HG   . SER A 1 50 ? 7.621   -7.643  -3.883  1.00 0.00 ? 80  SER A HG   6  
ATOM 8161  N N    . GLN A 1 51 ? 3.535   -9.004  -2.217  1.00 0.00 ? 81  GLN A N    6  
ATOM 8162  C CA   . GLN A 1 51 ? 2.901   -10.301 -2.422  1.00 0.00 ? 81  GLN A CA   6  
ATOM 8163  C C    . GLN A 1 51 ? 1.401   -10.143 -2.648  1.00 0.00 ? 81  GLN A C    6  
ATOM 8164  O O    . GLN A 1 51 ? 0.788   -10.919 -3.382  1.00 0.00 ? 81  GLN A O    6  
ATOM 8165  C CB   . GLN A 1 51 ? 3.154   -11.213 -1.219  1.00 0.00 ? 81  GLN A CB   6  
ATOM 8166  C CG   . GLN A 1 51 ? 3.300   -12.680 -1.588  1.00 0.00 ? 81  GLN A CG   6  
ATOM 8167  C CD   . GLN A 1 51 ? 2.548   -13.598 -0.644  1.00 0.00 ? 81  GLN A CD   6  
ATOM 8168  O OE1  . GLN A 1 51 ? 2.918   -13.746 0.521   1.00 0.00 ? 81  GLN A OE1  6  
ATOM 8169  N NE2  . GLN A 1 51 ? 1.485   -14.219 -1.142  1.00 0.00 ? 81  GLN A NE2  6  
ATOM 8170  H H    . GLN A 1 51 ? 3.507   -8.594  -1.329  1.00 0.00 ? 81  GLN A H    6  
ATOM 8171  H HA   . GLN A 1 51 ? 3.340   -10.750 -3.300  1.00 0.00 ? 81  GLN A HA   6  
ATOM 8172  H HB2  . GLN A 1 51 ? 4.061   -10.896 -0.726  1.00 0.00 ? 81  GLN A HB2  6  
ATOM 8173  H HB3  . GLN A 1 51 ? 2.328   -11.117 -0.530  1.00 0.00 ? 81  GLN A HB3  6  
ATOM 8174  H HG2  . GLN A 1 51 ? 2.917   -12.827 -2.587  1.00 0.00 ? 81  GLN A HG2  6  
ATOM 8175  H HG3  . GLN A 1 51 ? 4.347   -12.942 -1.563  1.00 0.00 ? 81  GLN A HG3  6  
ATOM 8176  H HE21 . GLN A 1 51 ? 1.250   -14.054 -2.080  1.00 0.00 ? 81  GLN A HE21 6  
ATOM 8177  H HE22 . GLN A 1 51 ? 0.981   -14.817 -0.554  1.00 0.00 ? 81  GLN A HE22 6  
ATOM 8178  N N    . LEU A 1 52 ? 0.816   -9.134  -2.012  1.00 0.00 ? 82  LEU A N    6  
ATOM 8179  C CA   . LEU A 1 52 ? -0.612  -8.873  -2.141  1.00 0.00 ? 82  LEU A CA   6  
ATOM 8180  C C    . LEU A 1 52 ? -0.981  -8.554  -3.587  1.00 0.00 ? 82  LEU A C    6  
ATOM 8181  O O    . LEU A 1 52 ? -2.077  -8.879  -4.044  1.00 0.00 ? 82  LEU A O    6  
ATOM 8182  C CB   . LEU A 1 52 ? -1.023  -7.713  -1.231  1.00 0.00 ? 82  LEU A CB   6  
ATOM 8183  C CG   . LEU A 1 52 ? -2.480  -7.741  -0.765  1.00 0.00 ? 82  LEU A CG   6  
ATOM 8184  C CD1  . LEU A 1 52 ? -2.652  -8.715  0.390   1.00 0.00 ? 82  LEU A CD1  6  
ATOM 8185  C CD2  . LEU A 1 52 ? -2.936  -6.347  -0.362  1.00 0.00 ? 82  LEU A CD2  6  
ATOM 8186  H H    . LEU A 1 52 ? 1.358   -8.550  -1.440  1.00 0.00 ? 82  LEU A H    6  
ATOM 8187  H HA   . LEU A 1 52 ? -1.140  -9.763  -1.835  1.00 0.00 ? 82  LEU A HA   6  
ATOM 8188  H HB2  . LEU A 1 52 ? -0.387  -7.726  -0.358  1.00 0.00 ? 82  LEU A HB2  6  
ATOM 8189  H HB3  . LEU A 1 52 ? -0.858  -6.789  -1.763  1.00 0.00 ? 82  LEU A HB3  6  
ATOM 8190  H HG   . LEU A 1 52 ? -3.105  -8.076  -1.580  1.00 0.00 ? 82  LEU A HG   6  
ATOM 8191  H HD11 . LEU A 1 52 ? -3.578  -8.503  0.905   1.00 0.00 ? 82  LEU A HD11 6  
ATOM 8192  H HD12 . LEU A 1 52 ? -1.825  -8.609  1.077   1.00 0.00 ? 82  LEU A HD12 6  
ATOM 8193  H HD13 . LEU A 1 52 ? -2.675  -9.725  0.008   1.00 0.00 ? 82  LEU A HD13 6  
ATOM 8194  H HD21 . LEU A 1 52 ? -2.085  -5.775  -0.022  1.00 0.00 ? 82  LEU A HD21 6  
ATOM 8195  H HD22 . LEU A 1 52 ? -3.660  -6.422  0.435   1.00 0.00 ? 82  LEU A HD22 6  
ATOM 8196  H HD23 . LEU A 1 52 ? -3.384  -5.855  -1.212  1.00 0.00 ? 82  LEU A HD23 6  
ATOM 8197  N N    . PHE A 1 53 ? -0.058  -7.918  -4.302  1.00 0.00 ? 83  PHE A N    6  
ATOM 8198  C CA   . PHE A 1 53 ? -0.287  -7.554  -5.696  1.00 0.00 ? 83  PHE A CA   6  
ATOM 8199  C C    . PHE A 1 53 ? 0.808   -8.123  -6.594  1.00 0.00 ? 83  PHE A C    6  
ATOM 8200  O O    . PHE A 1 53 ? 1.368   -7.416  -7.433  1.00 0.00 ? 83  PHE A O    6  
ATOM 8201  C CB   . PHE A 1 53 ? -0.349  -6.033  -5.844  1.00 0.00 ? 83  PHE A CB   6  
ATOM 8202  C CG   . PHE A 1 53 ? -1.276  -5.372  -4.862  1.00 0.00 ? 83  PHE A CG   6  
ATOM 8203  C CD1  . PHE A 1 53 ? -2.617  -5.717  -4.816  1.00 0.00 ? 83  PHE A CD1  6  
ATOM 8204  C CD2  . PHE A 1 53 ? -0.805  -4.407  -3.987  1.00 0.00 ? 83  PHE A CD2  6  
ATOM 8205  C CE1  . PHE A 1 53 ? -3.471  -5.110  -3.915  1.00 0.00 ? 83  PHE A CE1  6  
ATOM 8206  C CE2  . PHE A 1 53 ? -1.654  -3.798  -3.083  1.00 0.00 ? 83  PHE A CE2  6  
ATOM 8207  C CZ   . PHE A 1 53 ? -2.990  -4.149  -3.048  1.00 0.00 ? 83  PHE A CZ   6  
ATOM 8208  H H    . PHE A 1 53 ? 0.796   -7.684  -3.882  1.00 0.00 ? 83  PHE A H    6  
ATOM 8209  H HA   . PHE A 1 53 ? -1.236  -7.975  -5.996  1.00 0.00 ? 83  PHE A HA   6  
ATOM 8210  H HB2  . PHE A 1 53 ? 0.639   -5.623  -5.694  1.00 0.00 ? 83  PHE A HB2  6  
ATOM 8211  H HB3  . PHE A 1 53 ? -0.689  -5.789  -6.840  1.00 0.00 ? 83  PHE A HB3  6  
ATOM 8212  H HD1  . PHE A 1 53 ? -2.995  -6.468  -5.494  1.00 0.00 ? 83  PHE A HD1  6  
ATOM 8213  H HD2  . PHE A 1 53 ? 0.239   -4.131  -4.014  1.00 0.00 ? 83  PHE A HD2  6  
ATOM 8214  H HE1  . PHE A 1 53 ? -4.515  -5.387  -3.889  1.00 0.00 ? 83  PHE A HE1  6  
ATOM 8215  H HE2  . PHE A 1 53 ? -1.275  -3.047  -2.406  1.00 0.00 ? 83  PHE A HE2  6  
ATOM 8216  H HZ   . PHE A 1 53 ? -3.655  -3.675  -2.343  1.00 0.00 ? 83  PHE A HZ   6  
ATOM 8217  N N    . HIS A 1 54 ? 1.109   -9.405  -6.412  1.00 0.00 ? 84  HIS A N    6  
ATOM 8218  C CA   . HIS A 1 54 ? 2.137   -10.069 -7.203  1.00 0.00 ? 84  HIS A CA   6  
ATOM 8219  C C    . HIS A 1 54 ? 1.683   -10.283 -8.648  1.00 0.00 ? 84  HIS A C    6  
ATOM 8220  O O    . HIS A 1 54 ? 2.481   -10.669 -9.502  1.00 0.00 ? 84  HIS A O    6  
ATOM 8221  C CB   . HIS A 1 54 ? 2.511   -11.411 -6.570  1.00 0.00 ? 84  HIS A CB   6  
ATOM 8222  C CG   . HIS A 1 54 ? 1.346   -12.333 -6.380  1.00 0.00 ? 84  HIS A CG   6  
ATOM 8223  N ND1  . HIS A 1 54 ? 1.475   -13.616 -5.889  1.00 0.00 ? 84  HIS A ND1  6  
ATOM 8224  C CD2  . HIS A 1 54 ? 0.024   -12.157 -6.616  1.00 0.00 ? 84  HIS A CD2  6  
ATOM 8225  C CE1  . HIS A 1 54 ? 0.285   -14.186 -5.832  1.00 0.00 ? 84  HIS A CE1  6  
ATOM 8226  N NE2  . HIS A 1 54 ? -0.612  -13.322 -6.267  1.00 0.00 ? 84  HIS A NE2  6  
ATOM 8227  H H    . HIS A 1 54 ? 0.630   -9.915  -5.729  1.00 0.00 ? 84  HIS A H    6  
ATOM 8228  H HA   . HIS A 1 54 ? 3.006   -9.432  -7.204  1.00 0.00 ? 84  HIS A HA   6  
ATOM 8229  H HB2  . HIS A 1 54 ? 3.228   -11.911 -7.204  1.00 0.00 ? 84  HIS A HB2  6  
ATOM 8230  H HB3  . HIS A 1 54 ? 2.956   -11.232 -5.602  1.00 0.00 ? 84  HIS A HB3  6  
ATOM 8231  H HD1  . HIS A 1 54 ? 2.315   -14.044 -5.621  1.00 0.00 ? 84  HIS A HD1  6  
ATOM 8232  H HD2  . HIS A 1 54 ? -0.443  -11.263 -7.005  1.00 0.00 ? 84  HIS A HD2  6  
ATOM 8233  H HE1  . HIS A 1 54 ? 0.080   -15.190 -5.487  1.00 0.00 ? 84  HIS A HE1  6  
ATOM 8234  H HE2  . HIS A 1 54 ? -1.583  -13.455 -6.243  1.00 0.00 ? 84  HIS A HE2  6  
ATOM 8235  N N    . GLU A 1 55 ? 0.405   -10.032 -8.918  1.00 0.00 ? 85  GLU A N    6  
ATOM 8236  C CA   . GLU A 1 55 ? -0.137  -10.202 -10.262 1.00 0.00 ? 85  GLU A CA   6  
ATOM 8237  C C    . GLU A 1 55 ? -0.319  -8.855  -10.954 1.00 0.00 ? 85  GLU A C    6  
ATOM 8238  O O    . GLU A 1 55 ? -0.232  -8.758  -12.177 1.00 0.00 ? 85  GLU A O    6  
ATOM 8239  C CB   . GLU A 1 55 ? -1.474  -10.945 -10.204 1.00 0.00 ? 85  GLU A CB   6  
ATOM 8240  C CG   . GLU A 1 55 ? -1.342  -12.449 -10.376 1.00 0.00 ? 85  GLU A CG   6  
ATOM 8241  C CD   . GLU A 1 55 ? -2.447  -13.216 -9.675  1.00 0.00 ? 85  GLU A CD   6  
ATOM 8242  O OE1  . GLU A 1 55 ? -2.428  -13.275 -8.429  1.00 0.00 ? 85  GLU A OE1  6  
ATOM 8243  O OE2  . GLU A 1 55 ? -3.329  -13.756 -10.374 1.00 0.00 ? 85  GLU A OE2  6  
ATOM 8244  H H    . GLU A 1 55 ? -0.188  -9.727  -8.201  1.00 0.00 ? 85  GLU A H    6  
ATOM 8245  H HA   . GLU A 1 55 ? 0.567   -10.792 -10.829 1.00 0.00 ? 85  GLU A HA   6  
ATOM 8246  H HB2  . GLU A 1 55 ? -1.939  -10.753 -9.249  1.00 0.00 ? 85  GLU A HB2  6  
ATOM 8247  H HB3  . GLU A 1 55 ? -2.115  -10.569 -10.988 1.00 0.00 ? 85  GLU A HB3  6  
ATOM 8248  H HG2  . GLU A 1 55 ? -1.376  -12.682 -11.431 1.00 0.00 ? 85  GLU A HG2  6  
ATOM 8249  H HG3  . GLU A 1 55 ? -0.392  -12.762 -9.971  1.00 0.00 ? 85  GLU A HG3  6  
ATOM 8250  N N    . HIS A 1 56 ? -0.572  -7.816  -10.163 1.00 0.00 ? 86  HIS A N    6  
ATOM 8251  C CA   . HIS A 1 56 ? -0.767  -6.475  -10.703 1.00 0.00 ? 86  HIS A CA   6  
ATOM 8252  C C    . HIS A 1 56 ? 0.504   -5.639  -10.559 1.00 0.00 ? 86  HIS A C    6  
ATOM 8253  O O    . HIS A 1 56 ? 0.865   -5.234  -9.454  1.00 0.00 ? 86  HIS A O    6  
ATOM 8254  C CB   . HIS A 1 56 ? -1.927  -5.781  -9.987  1.00 0.00 ? 86  HIS A CB   6  
ATOM 8255  C CG   . HIS A 1 56 ? -3.244  -6.468  -10.175 1.00 0.00 ? 86  HIS A CG   6  
ATOM 8256  N ND1  . HIS A 1 56 ? -3.727  -6.845  -11.411 1.00 0.00 ? 86  HIS A ND1  6  
ATOM 8257  C CD2  . HIS A 1 56 ? -4.183  -6.846  -9.276  1.00 0.00 ? 86  HIS A CD2  6  
ATOM 8258  C CE1  . HIS A 1 56 ? -4.906  -7.424  -11.264 1.00 0.00 ? 86  HIS A CE1  6  
ATOM 8259  N NE2  . HIS A 1 56 ? -5.204  -7.438  -9.978  1.00 0.00 ? 86  HIS A NE2  6  
ATOM 8260  H H    . HIS A 1 56 ? -0.630  -7.956  -9.195  1.00 0.00 ? 86  HIS A H    6  
ATOM 8261  H HA   . HIS A 1 56 ? -1.009  -6.572  -11.749 1.00 0.00 ? 86  HIS A HA   6  
ATOM 8262  H HB2  . HIS A 1 56 ? -1.719  -5.748  -8.929  1.00 0.00 ? 86  HIS A HB2  6  
ATOM 8263  H HB3  . HIS A 1 56 ? -2.020  -4.773  -10.363 1.00 0.00 ? 86  HIS A HB3  6  
ATOM 8264  H HD1  . HIS A 1 56 ? -3.274  -6.708  -12.270 1.00 0.00 ? 86  HIS A HD1  6  
ATOM 8265  H HD2  . HIS A 1 56 ? -4.136  -6.708  -8.205  1.00 0.00 ? 86  HIS A HD2  6  
ATOM 8266  H HE1  . HIS A 1 56 ? -5.520  -7.820  -12.058 1.00 0.00 ? 86  HIS A HE1  6  
ATOM 8267  H HE2  . HIS A 1 56 ? -5.981  -7.886  -9.583  1.00 0.00 ? 86  HIS A HE2  6  
ATOM 8268  N N    . PRO A 1 57 ? 1.203   -5.365  -11.676 1.00 0.00 ? 87  PRO A N    6  
ATOM 8269  C CA   . PRO A 1 57 ? 2.436   -4.569  -11.657 1.00 0.00 ? 87  PRO A CA   6  
ATOM 8270  C C    . PRO A 1 57 ? 2.172   -3.105  -11.327 1.00 0.00 ? 87  PRO A C    6  
ATOM 8271  O O    . PRO A 1 57 ? 2.900   -2.492  -10.546 1.00 0.00 ? 87  PRO A O    6  
ATOM 8272  C CB   . PRO A 1 57 ? 2.973   -4.707  -13.083 1.00 0.00 ? 87  PRO A CB   6  
ATOM 8273  C CG   . PRO A 1 57 ? 1.773   -4.998  -13.914 1.00 0.00 ? 87  PRO A CG   6  
ATOM 8274  C CD   . PRO A 1 57 ? 0.850   -5.803  -13.041 1.00 0.00 ? 87  PRO A CD   6  
ATOM 8275  H HA   . PRO A 1 57 ? 3.154   -4.970  -10.957 1.00 0.00 ? 87  PRO A HA   6  
ATOM 8276  H HB2  . PRO A 1 57 ? 3.449   -3.785  -13.383 1.00 0.00 ? 87  PRO A HB2  6  
ATOM 8277  H HB3  . PRO A 1 57 ? 3.687   -5.517  -13.126 1.00 0.00 ? 87  PRO A HB3  6  
ATOM 8278  H HG2  . PRO A 1 57 ? 1.297   -4.073  -14.209 1.00 0.00 ? 87  PRO A HG2  6  
ATOM 8279  H HG3  . PRO A 1 57 ? 2.057   -5.569  -14.785 1.00 0.00 ? 87  PRO A HG3  6  
ATOM 8280  H HD2  . PRO A 1 57 ? -0.180  -5.572  -13.265 1.00 0.00 ? 87  PRO A HD2  6  
ATOM 8281  H HD3  . PRO A 1 57 ? 1.038   -6.859  -13.165 1.00 0.00 ? 87  PRO A HD3  6  
ATOM 8282  N N    . ASP A 1 58 ? 1.123   -2.548  -11.924 1.00 0.00 ? 88  ASP A N    6  
ATOM 8283  C CA   . ASP A 1 58 ? 0.759   -1.153  -11.693 1.00 0.00 ? 88  ASP A CA   6  
ATOM 8284  C C    . ASP A 1 58 ? 0.464   -0.894  -10.217 1.00 0.00 ? 88  ASP A C    6  
ATOM 8285  O O    . ASP A 1 58 ? 0.462   0.253   -9.769  1.00 0.00 ? 88  ASP A O    6  
ATOM 8286  C CB   . ASP A 1 58 ? -0.456  -0.775  -12.541 1.00 0.00 ? 88  ASP A CB   6  
ATOM 8287  C CG   . ASP A 1 58 ? -0.098  -0.552  -13.998 1.00 0.00 ? 88  ASP A CG   6  
ATOM 8288  O OD1  . ASP A 1 58 ? 1.061   -0.177  -14.273 1.00 0.00 ? 88  ASP A OD1  6  
ATOM 8289  O OD2  . ASP A 1 58 ? -0.976  -0.754  -14.862 1.00 0.00 ? 88  ASP A OD2  6  
ATOM 8290  H H    . ASP A 1 58 ? 0.579   -3.088  -12.534 1.00 0.00 ? 88  ASP A H    6  
ATOM 8291  H HA   . ASP A 1 58 ? 1.596   -0.542  -11.991 1.00 0.00 ? 88  ASP A HA   6  
ATOM 8292  H HB2  . ASP A 1 58 ? -1.187  -1.569  -12.487 1.00 0.00 ? 88  ASP A HB2  6  
ATOM 8293  H HB3  . ASP A 1 58 ? -0.890  0.134   -12.153 1.00 0.00 ? 88  ASP A HB3  6  
ATOM 8294  N N    . LEU A 1 59 ? 0.220   -1.963  -9.462  1.00 0.00 ? 89  LEU A N    6  
ATOM 8295  C CA   . LEU A 1 59 ? -0.069  -1.842  -8.039  1.00 0.00 ? 89  LEU A CA   6  
ATOM 8296  C C    . LEU A 1 59 ? 1.223   -1.865  -7.235  1.00 0.00 ? 89  LEU A C    6  
ATOM 8297  O O    . LEU A 1 59 ? 1.517   -0.935  -6.484  1.00 0.00 ? 89  LEU A O    6  
ATOM 8298  C CB   . LEU A 1 59 ? -0.992  -2.974  -7.582  1.00 0.00 ? 89  LEU A CB   6  
ATOM 8299  C CG   . LEU A 1 59 ? -2.475  -2.772  -7.903  1.00 0.00 ? 89  LEU A CG   6  
ATOM 8300  C CD1  . LEU A 1 59 ? -3.307  -3.899  -7.310  1.00 0.00 ? 89  LEU A CD1  6  
ATOM 8301  C CD2  . LEU A 1 59 ? -2.953  -1.424  -7.385  1.00 0.00 ? 89  LEU A CD2  6  
ATOM 8302  H H    . LEU A 1 59 ? 0.242   -2.852  -9.868  1.00 0.00 ? 89  LEU A H    6  
ATOM 8303  H HA   . LEU A 1 59 ? -0.565  -0.896  -7.879  1.00 0.00 ? 89  LEU A HA   6  
ATOM 8304  H HB2  . LEU A 1 59 ? -0.664  -3.890  -8.054  1.00 0.00 ? 89  LEU A HB2  6  
ATOM 8305  H HB3  . LEU A 1 59 ? -0.890  -3.084  -6.512  1.00 0.00 ? 89  LEU A HB3  6  
ATOM 8306  H HG   . LEU A 1 59 ? -2.609  -2.787  -8.974  1.00 0.00 ? 89  LEU A HG   6  
ATOM 8307  H HD11 . LEU A 1 59 ? -4.309  -3.854  -7.710  1.00 0.00 ? 89  LEU A HD11 6  
ATOM 8308  H HD12 . LEU A 1 59 ? -3.343  -3.792  -6.236  1.00 0.00 ? 89  LEU A HD12 6  
ATOM 8309  H HD13 . LEU A 1 59 ? -2.859  -4.848  -7.562  1.00 0.00 ? 89  LEU A HD13 6  
ATOM 8310  H HD21 . LEU A 1 59 ? -2.497  -1.224  -6.427  1.00 0.00 ? 89  LEU A HD21 6  
ATOM 8311  H HD22 . LEU A 1 59 ? -4.027  -1.441  -7.275  1.00 0.00 ? 89  LEU A HD22 6  
ATOM 8312  H HD23 . LEU A 1 59 ? -2.676  -0.651  -8.085  1.00 0.00 ? 89  LEU A HD23 6  
ATOM 8313  N N    . ILE A 1 60 ? 2.000   -2.928  -7.411  1.00 0.00 ? 90  ILE A N    6  
ATOM 8314  C CA   . ILE A 1 60 ? 3.271   -3.061  -6.715  1.00 0.00 ? 90  ILE A CA   6  
ATOM 8315  C C    . ILE A 1 60 ? 4.203   -1.918  -7.097  1.00 0.00 ? 90  ILE A C    6  
ATOM 8316  O O    . ILE A 1 60 ? 4.998   -1.447  -6.282  1.00 0.00 ? 90  ILE A O    6  
ATOM 8317  C CB   . ILE A 1 60 ? 3.952   -4.408  -7.038  1.00 0.00 ? 90  ILE A CB   6  
ATOM 8318  C CG1  . ILE A 1 60 ? 5.238   -4.565  -6.224  1.00 0.00 ? 90  ILE A CG1  6  
ATOM 8319  C CG2  . ILE A 1 60 ? 4.244   -4.514  -8.527  1.00 0.00 ? 90  ILE A CG2  6  
ATOM 8320  C CD1  . ILE A 1 60 ? 5.657   -6.007  -6.028  1.00 0.00 ? 90  ILE A CD1  6  
ATOM 8321  H H    . ILE A 1 60 ? 1.718   -3.631  -8.032  1.00 0.00 ? 90  ILE A H    6  
ATOM 8322  H HA   . ILE A 1 60 ? 3.078   -3.020  -5.652  1.00 0.00 ? 90  ILE A HA   6  
ATOM 8323  H HB   . ILE A 1 60 ? 3.269   -5.202  -6.773  1.00 0.00 ? 90  ILE A HB   6  
ATOM 8324  H HG12 . ILE A 1 60 ? 6.042   -4.053  -6.730  1.00 0.00 ? 90  ILE A HG12 6  
ATOM 8325  H HG13 . ILE A 1 60 ? 5.095   -4.124  -5.248  1.00 0.00 ? 90  ILE A HG13 6  
ATOM 8326  H HG21 . ILE A 1 60 ? 3.348   -4.290  -9.086  1.00 0.00 ? 90  ILE A HG21 6  
ATOM 8327  H HG22 . ILE A 1 60 ? 4.571   -5.517  -8.759  1.00 0.00 ? 90  ILE A HG22 6  
ATOM 8328  H HG23 . ILE A 1 60 ? 5.020   -3.813  -8.794  1.00 0.00 ? 90  ILE A HG23 6  
ATOM 8329  H HD11 . ILE A 1 60 ? 4.793   -6.648  -6.121  1.00 0.00 ? 90  ILE A HD11 6  
ATOM 8330  H HD12 . ILE A 1 60 ? 6.089   -6.125  -5.046  1.00 0.00 ? 90  ILE A HD12 6  
ATOM 8331  H HD13 . ILE A 1 60 ? 6.388   -6.273  -6.777  1.00 0.00 ? 90  ILE A HD13 6  
ATOM 8332  N N    . VAL A 1 61 ? 4.086   -1.465  -8.342  1.00 0.00 ? 91  VAL A N    6  
ATOM 8333  C CA   . VAL A 1 61 ? 4.907   -0.365  -8.831  1.00 0.00 ? 91  VAL A CA   6  
ATOM 8334  C C    . VAL A 1 61 ? 4.383   0.966   -8.304  1.00 0.00 ? 91  VAL A C    6  
ATOM 8335  O O    . VAL A 1 61 ? 5.154   1.819   -7.864  1.00 0.00 ? 91  VAL A O    6  
ATOM 8336  C CB   . VAL A 1 61 ? 4.945   -0.326  -10.372 1.00 0.00 ? 91  VAL A CB   6  
ATOM 8337  C CG1  . VAL A 1 61 ? 5.810   0.828   -10.862 1.00 0.00 ? 91  VAL A CG1  6  
ATOM 8338  C CG2  . VAL A 1 61 ? 5.452   -1.649  -10.927 1.00 0.00 ? 91  VAL A CG2  6  
ATOM 8339  H H    . VAL A 1 61 ? 3.422   -1.874  -8.942  1.00 0.00 ? 91  VAL A H    6  
ATOM 8340  H HA   . VAL A 1 61 ? 5.914   -0.514  -8.469  1.00 0.00 ? 91  VAL A HA   6  
ATOM 8341  H HB   . VAL A 1 61 ? 3.940   -0.170  -10.734 1.00 0.00 ? 91  VAL A HB   6  
ATOM 8342  H HG11 . VAL A 1 61 ? 6.333   0.531   -11.759 1.00 0.00 ? 91  VAL A HG11 6  
ATOM 8343  H HG12 . VAL A 1 61 ? 6.527   1.090   -10.097 1.00 0.00 ? 91  VAL A HG12 6  
ATOM 8344  H HG13 . VAL A 1 61 ? 5.184   1.682   -11.076 1.00 0.00 ? 91  VAL A HG13 6  
ATOM 8345  H HG21 . VAL A 1 61 ? 5.133   -2.454  -10.282 1.00 0.00 ? 91  VAL A HG21 6  
ATOM 8346  H HG22 . VAL A 1 61 ? 6.530   -1.631  -10.973 1.00 0.00 ? 91  VAL A HG22 6  
ATOM 8347  H HG23 . VAL A 1 61 ? 5.052   -1.801  -11.919 1.00 0.00 ? 91  VAL A HG23 6  
ATOM 8348  N N    . GLY A 1 62 ? 3.065   1.131   -8.342  1.00 0.00 ? 92  GLY A N    6  
ATOM 8349  C CA   . GLY A 1 62 ? 2.460   2.355   -7.856  1.00 0.00 ? 92  GLY A CA   6  
ATOM 8350  C C    . GLY A 1 62 ? 2.767   2.598   -6.392  1.00 0.00 ? 92  GLY A C    6  
ATOM 8351  O O    . GLY A 1 62 ? 2.939   3.739   -5.967  1.00 0.00 ? 92  GLY A O    6  
ATOM 8352  H H    . GLY A 1 62 ? 2.499   0.413   -8.696  1.00 0.00 ? 92  GLY A H    6  
ATOM 8353  H HA2  . GLY A 1 62 ? 2.834   3.185   -8.436  1.00 0.00 ? 92  GLY A HA2  6  
ATOM 8354  H HA3  . GLY A 1 62 ? 1.389   2.292   -7.983  1.00 0.00 ? 92  GLY A HA3  6  
ATOM 8355  N N    . PHE A 1 63 ? 2.838   1.517   -5.620  1.00 0.00 ? 93  PHE A N    6  
ATOM 8356  C CA   . PHE A 1 63 ? 3.129   1.610   -4.198  1.00 0.00 ? 93  PHE A CA   6  
ATOM 8357  C C    . PHE A 1 63 ? 4.599   1.934   -3.972  1.00 0.00 ? 93  PHE A C    6  
ATOM 8358  O O    . PHE A 1 63 ? 4.950   2.710   -3.084  1.00 0.00 ? 93  PHE A O    6  
ATOM 8359  C CB   . PHE A 1 63 ? 2.764   0.304   -3.492  1.00 0.00 ? 93  PHE A CB   6  
ATOM 8360  C CG   . PHE A 1 63 ? 2.924   0.364   -1.999  1.00 0.00 ? 93  PHE A CG   6  
ATOM 8361  C CD1  . PHE A 1 63 ? 2.057   1.119   -1.226  1.00 0.00 ? 93  PHE A CD1  6  
ATOM 8362  C CD2  . PHE A 1 63 ? 3.942   -0.334  -1.369  1.00 0.00 ? 93  PHE A CD2  6  
ATOM 8363  C CE1  . PHE A 1 63 ? 2.201   1.176   0.147   1.00 0.00 ? 93  PHE A CE1  6  
ATOM 8364  C CE2  . PHE A 1 63 ? 4.092   -0.281  0.003   1.00 0.00 ? 93  PHE A CE2  6  
ATOM 8365  C CZ   . PHE A 1 63 ? 3.220   0.475   0.763   1.00 0.00 ? 93  PHE A CZ   6  
ATOM 8366  H H    . PHE A 1 63 ? 2.692   0.635   -6.018  1.00 0.00 ? 93  PHE A H    6  
ATOM 8367  H HA   . PHE A 1 63 ? 2.536   2.406   -3.798  1.00 0.00 ? 93  PHE A HA   6  
ATOM 8368  H HB2  . PHE A 1 63 ? 1.733   0.064   -3.704  1.00 0.00 ? 93  PHE A HB2  6  
ATOM 8369  H HB3  . PHE A 1 63 ? 3.398   -0.488  -3.863  1.00 0.00 ? 93  PHE A HB3  6  
ATOM 8370  H HD1  . PHE A 1 63 ? 1.259   1.667   -1.707  1.00 0.00 ? 93  PHE A HD1  6  
ATOM 8371  H HD2  . PHE A 1 63 ? 4.624   -0.925  -1.963  1.00 0.00 ? 93  PHE A HD2  6  
ATOM 8372  H HE1  . PHE A 1 63 ? 1.519   1.768   0.739   1.00 0.00 ? 93  PHE A HE1  6  
ATOM 8373  H HE2  . PHE A 1 63 ? 4.888   -0.830  0.481   1.00 0.00 ? 93  PHE A HE2  6  
ATOM 8374  H HZ   . PHE A 1 63 ? 3.335   0.517   1.835   1.00 0.00 ? 93  PHE A HZ   6  
ATOM 8375  N N    . ASN A 1 64 ? 5.448   1.334   -4.791  1.00 0.00 ? 94  ASN A N    6  
ATOM 8376  C CA   . ASN A 1 64 ? 6.887   1.553   -4.697  1.00 0.00 ? 94  ASN A CA   6  
ATOM 8377  C C    . ASN A 1 64 ? 7.235   3.007   -5.009  1.00 0.00 ? 94  ASN A C    6  
ATOM 8378  O O    . ASN A 1 64 ? 8.273   3.513   -4.581  1.00 0.00 ? 94  ASN A O    6  
ATOM 8379  C CB   . ASN A 1 64 ? 7.630   0.621   -5.657  1.00 0.00 ? 94  ASN A CB   6  
ATOM 8380  C CG   . ASN A 1 64 ? 9.118   0.569   -5.375  1.00 0.00 ? 94  ASN A CG   6  
ATOM 8381  O OD1  . ASN A 1 64 ? 9.551   0.015   -4.365  1.00 0.00 ? 94  ASN A OD1  6  
ATOM 8382  N ND2  . ASN A 1 64 ? 9.911   1.147   -6.270  1.00 0.00 ? 94  ASN A ND2  6  
ATOM 8383  H H    . ASN A 1 64 ? 5.098   0.731   -5.478  1.00 0.00 ? 94  ASN A H    6  
ATOM 8384  H HA   . ASN A 1 64 ? 7.191   1.332   -3.686  1.00 0.00 ? 94  ASN A HA   6  
ATOM 8385  H HB2  . ASN A 1 64 ? 7.229   -0.377  -5.562  1.00 0.00 ? 94  ASN A HB2  6  
ATOM 8386  H HB3  . ASN A 1 64 ? 7.485   0.969   -6.669  1.00 0.00 ? 94  ASN A HB3  6  
ATOM 8387  H HD21 . ASN A 1 64 ? 9.497   1.569   -7.052  1.00 0.00 ? 94  ASN A HD21 6  
ATOM 8388  H HD22 . ASN A 1 64 ? 10.878  1.127   -6.113  1.00 0.00 ? 94  ASN A HD22 6  
ATOM 8389  N N    . ALA A 1 65 ? 6.360   3.673   -5.758  1.00 0.00 ? 95  ALA A N    6  
ATOM 8390  C CA   . ALA A 1 65 ? 6.571   5.066   -6.130  1.00 0.00 ? 95  ALA A CA   6  
ATOM 8391  C C    . ALA A 1 65 ? 6.459   5.999   -4.925  1.00 0.00 ? 95  ALA A C    6  
ATOM 8392  O O    . ALA A 1 65 ? 6.777   7.185   -5.019  1.00 0.00 ? 95  ALA A O    6  
ATOM 8393  C CB   . ALA A 1 65 ? 5.579   5.476   -7.208  1.00 0.00 ? 95  ALA A CB   6  
ATOM 8394  H H    . ALA A 1 65 ? 5.553   3.216   -6.071  1.00 0.00 ? 95  ALA A H    6  
ATOM 8395  H HA   . ALA A 1 65 ? 7.565   5.149   -6.544  1.00 0.00 ? 95  ALA A HA   6  
ATOM 8396  H HB1  . ALA A 1 65 ? 4.748   5.995   -6.753  1.00 0.00 ? 95  ALA A HB1  6  
ATOM 8397  H HB2  . ALA A 1 65 ? 5.218   4.596   -7.718  1.00 0.00 ? 95  ALA A HB2  6  
ATOM 8398  H HB3  . ALA A 1 65 ? 6.067   6.128   -7.917  1.00 0.00 ? 95  ALA A HB3  6  
ATOM 8399  N N    . PHE A 1 66 ? 6.005   5.466   -3.792  1.00 0.00 ? 96  PHE A N    6  
ATOM 8400  C CA   . PHE A 1 66 ? 5.854   6.265   -2.580  1.00 0.00 ? 96  PHE A CA   6  
ATOM 8401  C C    . PHE A 1 66 ? 7.031   6.048   -1.635  1.00 0.00 ? 96  PHE A C    6  
ATOM 8402  O O    . PHE A 1 66 ? 7.397   6.939   -0.869  1.00 0.00 ? 96  PHE A O    6  
ATOM 8403  C CB   . PHE A 1 66 ? 4.545   5.913   -1.871  1.00 0.00 ? 96  PHE A CB   6  
ATOM 8404  C CG   . PHE A 1 66 ? 3.318   6.294   -2.649  1.00 0.00 ? 96  PHE A CG   6  
ATOM 8405  C CD1  . PHE A 1 66 ? 3.031   5.680   -3.857  1.00 0.00 ? 96  PHE A CD1  6  
ATOM 8406  C CD2  . PHE A 1 66 ? 2.452   7.265   -2.171  1.00 0.00 ? 96  PHE A CD2  6  
ATOM 8407  C CE1  . PHE A 1 66 ? 1.902   6.027   -4.575  1.00 0.00 ? 96  PHE A CE1  6  
ATOM 8408  C CE2  . PHE A 1 66 ? 1.322   7.617   -2.884  1.00 0.00 ? 96  PHE A CE2  6  
ATOM 8409  C CZ   . PHE A 1 66 ? 1.047   6.997   -4.088  1.00 0.00 ? 96  PHE A CZ   6  
ATOM 8410  H H    . PHE A 1 66 ? 5.762   4.518   -3.771  1.00 0.00 ? 96  PHE A H    6  
ATOM 8411  H HA   . PHE A 1 66 ? 5.828   7.305   -2.870  1.00 0.00 ? 96  PHE A HA   6  
ATOM 8412  H HB2  . PHE A 1 66 ? 4.512   4.847   -1.700  1.00 0.00 ? 96  PHE A HB2  6  
ATOM 8413  H HB3  . PHE A 1 66 ? 4.510   6.426   -0.921  1.00 0.00 ? 96  PHE A HB3  6  
ATOM 8414  H HD1  . PHE A 1 66 ? 3.699   4.921   -4.237  1.00 0.00 ? 96  PHE A HD1  6  
ATOM 8415  H HD2  . PHE A 1 66 ? 2.667   7.749   -1.230  1.00 0.00 ? 96  PHE A HD2  6  
ATOM 8416  H HE1  . PHE A 1 66 ? 1.689   5.542   -5.516  1.00 0.00 ? 96  PHE A HE1  6  
ATOM 8417  H HE2  . PHE A 1 66 ? 0.656   8.375   -2.502  1.00 0.00 ? 96  PHE A HE2  6  
ATOM 8418  H HZ   . PHE A 1 66 ? 0.165   7.270   -4.647  1.00 0.00 ? 96  PHE A HZ   6  
ATOM 8419  N N    . LEU A 1 67 ? 7.621   4.858   -1.692  1.00 0.00 ? 97  LEU A N    6  
ATOM 8420  C CA   . LEU A 1 67 ? 8.757   4.528   -0.840  1.00 0.00 ? 97  LEU A CA   6  
ATOM 8421  C C    . LEU A 1 67 ? 10.067  4.984   -1.480  1.00 0.00 ? 97  LEU A C    6  
ATOM 8422  O O    . LEU A 1 67 ? 10.176  5.057   -2.704  1.00 0.00 ? 97  LEU A O    6  
ATOM 8423  C CB   . LEU A 1 67 ? 8.801   3.023   -0.574  1.00 0.00 ? 97  LEU A CB   6  
ATOM 8424  C CG   . LEU A 1 67 ? 7.494   2.420   -0.058  1.00 0.00 ? 97  LEU A CG   6  
ATOM 8425  C CD1  . LEU A 1 67 ? 7.309   1.008   -0.593  1.00 0.00 ? 97  LEU A CD1  6  
ATOM 8426  C CD2  . LEU A 1 67 ? 7.471   2.422   1.464   1.00 0.00 ? 97  LEU A CD2  6  
ATOM 8427  H H    . LEU A 1 67 ? 7.286   4.188   -2.323  1.00 0.00 ? 97  LEU A H    6  
ATOM 8428  H HA   . LEU A 1 67 ? 8.629   5.047   0.098   1.00 0.00 ? 97  LEU A HA   6  
ATOM 8429  H HB2  . LEU A 1 67 ? 9.066   2.523   -1.496  1.00 0.00 ? 97  LEU A HB2  6  
ATOM 8430  H HB3  . LEU A 1 67 ? 9.573   2.830   0.155   1.00 0.00 ? 97  LEU A HB3  6  
ATOM 8431  H HG   . LEU A 1 67 ? 6.666   3.020   -0.406  1.00 0.00 ? 97  LEU A HG   6  
ATOM 8432  H HD11 . LEU A 1 67 ? 7.872   0.893   -1.507  1.00 0.00 ? 97  LEU A HD11 6  
ATOM 8433  H HD12 . LEU A 1 67 ? 6.261   0.832   -0.790  1.00 0.00 ? 97  LEU A HD12 6  
ATOM 8434  H HD13 . LEU A 1 67 ? 7.661   0.296   0.140   1.00 0.00 ? 97  LEU A HD13 6  
ATOM 8435  H HD21 . LEU A 1 67 ? 8.362   1.939   1.838   1.00 0.00 ? 97  LEU A HD21 6  
ATOM 8436  H HD22 . LEU A 1 67 ? 6.599   1.889   1.812   1.00 0.00 ? 97  LEU A HD22 6  
ATOM 8437  H HD23 . LEU A 1 67 ? 7.436   3.441   1.821   1.00 0.00 ? 97  LEU A HD23 6  
ATOM 8438  N N    . PRO A 1 68 ? 11.081  5.296   -0.656  1.00 0.00 ? 98  PRO A N    6  
ATOM 8439  C CA   . PRO A 1 68 ? 12.387  5.747   -1.149  1.00 0.00 ? 98  PRO A CA   6  
ATOM 8440  C C    . PRO A 1 68 ? 13.141  4.643   -1.883  1.00 0.00 ? 98  PRO A C    6  
ATOM 8441  O O    . PRO A 1 68 ? 12.858  3.459   -1.702  1.00 0.00 ? 98  PRO A O    6  
ATOM 8442  C CB   . PRO A 1 68 ? 13.135  6.147   0.126   1.00 0.00 ? 98  PRO A CB   6  
ATOM 8443  C CG   . PRO A 1 68 ? 12.480  5.367   1.213   1.00 0.00 ? 98  PRO A CG   6  
ATOM 8444  C CD   . PRO A 1 68 ? 11.035  5.238   0.816   1.00 0.00 ? 98  PRO A CD   6  
ATOM 8445  H HA   . PRO A 1 68 ? 12.290  6.605   -1.797  1.00 0.00 ? 98  PRO A HA   6  
ATOM 8446  H HB2  . PRO A 1 68 ? 14.179  5.891   0.030   1.00 0.00 ? 98  PRO A HB2  6  
ATOM 8447  H HB3  . PRO A 1 68 ? 13.031  7.210   0.288   1.00 0.00 ? 98  PRO A HB3  6  
ATOM 8448  H HG2  . PRO A 1 68 ? 12.937  4.391   1.290   1.00 0.00 ? 98  PRO A HG2  6  
ATOM 8449  H HG3  . PRO A 1 68 ? 12.565  5.897   2.149   1.00 0.00 ? 98  PRO A HG3  6  
ATOM 8450  H HD2  . PRO A 1 68 ? 10.635  4.292   1.153   1.00 0.00 ? 98  PRO A HD2  6  
ATOM 8451  H HD3  . PRO A 1 68 ? 10.459  6.058   1.218   1.00 0.00 ? 98  PRO A HD3  6  
ATOM 8452  N N    . LEU A 1 69 ? 14.099  5.040   -2.714  1.00 0.00 ? 99  LEU A N    6  
ATOM 8453  C CA   . LEU A 1 69 ? 14.894  4.085   -3.478  1.00 0.00 ? 99  LEU A CA   6  
ATOM 8454  C C    . LEU A 1 69 ? 15.640  3.130   -2.550  1.00 0.00 ? 99  LEU A C    6  
ATOM 8455  O O    . LEU A 1 69 ? 15.945  1.998   -2.925  1.00 0.00 ? 99  LEU A O    6  
ATOM 8456  C CB   . LEU A 1 69 ? 15.885  4.824   -4.381  1.00 0.00 ? 99  LEU A CB   6  
ATOM 8457  C CG   . LEU A 1 69 ? 15.732  4.543   -5.876  1.00 0.00 ? 99  LEU A CG   6  
ATOM 8458  C CD1  . LEU A 1 69 ? 15.846  3.052   -6.153  1.00 0.00 ? 99  LEU A CD1  6  
ATOM 8459  C CD2  . LEU A 1 69 ? 14.403  5.082   -6.384  1.00 0.00 ? 99  LEU A CD2  6  
ATOM 8460  H H    . LEU A 1 69 ? 14.277  5.999   -2.815  1.00 0.00 ? 99  LEU A H    6  
ATOM 8461  H HA   . LEU A 1 69 ? 14.218  3.512   -4.094  1.00 0.00 ? 99  LEU A HA   6  
ATOM 8462  H HB2  . LEU A 1 69 ? 15.763  5.886   -4.221  1.00 0.00 ? 99  LEU A HB2  6  
ATOM 8463  H HB3  . LEU A 1 69 ? 16.888  4.547   -4.088  1.00 0.00 ? 99  LEU A HB3  6  
ATOM 8464  H HG   . LEU A 1 69 ? 16.524  5.045   -6.413  1.00 0.00 ? 99  LEU A HG   6  
ATOM 8465  H HD11 . LEU A 1 69 ? 16.421  2.583   -5.370  1.00 0.00 ? 99  LEU A HD11 6  
ATOM 8466  H HD12 . LEU A 1 69 ? 16.339  2.900   -7.102  1.00 0.00 ? 99  LEU A HD12 6  
ATOM 8467  H HD13 . LEU A 1 69 ? 14.859  2.615   -6.187  1.00 0.00 ? 99  LEU A HD13 6  
ATOM 8468  H HD21 . LEU A 1 69 ? 13.686  5.092   -5.576  1.00 0.00 ? 99  LEU A HD21 6  
ATOM 8469  H HD22 . LEU A 1 69 ? 14.039  4.449   -7.180  1.00 0.00 ? 99  LEU A HD22 6  
ATOM 8470  H HD23 . LEU A 1 69 ? 14.540  6.086   -6.757  1.00 0.00 ? 99  LEU A HD23 6  
ATOM 8471  N N    . GLY A 1 70 ? 15.933  3.594   -1.338  1.00 0.00 ? 100 GLY A N    6  
ATOM 8472  C CA   . GLY A 1 70 ? 16.642  2.768   -0.378  1.00 0.00 ? 100 GLY A CA   6  
ATOM 8473  C C    . GLY A 1 70 ? 15.941  1.449   -0.113  1.00 0.00 ? 100 GLY A C    6  
ATOM 8474  O O    . GLY A 1 70 ? 16.548  0.383   -0.217  1.00 0.00 ? 100 GLY A O    6  
ATOM 8475  H H    . GLY A 1 70 ? 15.666  4.505   -1.094  1.00 0.00 ? 100 GLY A H    6  
ATOM 8476  H HA2  . GLY A 1 70 ? 17.634  2.565   -0.757  1.00 0.00 ? 100 GLY A HA2  6  
ATOM 8477  H HA3  . GLY A 1 70 ? 16.728  3.309   0.552   1.00 0.00 ? 100 GLY A HA3  6  
ATOM 8478  N N    . TYR A 1 71 ? 14.659  1.522   0.231   1.00 0.00 ? 101 TYR A N    6  
ATOM 8479  C CA   . TYR A 1 71 ? 13.874  0.325   0.512   1.00 0.00 ? 101 TYR A CA   6  
ATOM 8480  C C    . TYR A 1 71 ? 12.937  0.005   -0.650  1.00 0.00 ? 101 TYR A C    6  
ATOM 8481  O O    . TYR A 1 71 ? 11.717  0.124   -0.530  1.00 0.00 ? 101 TYR A O    6  
ATOM 8482  C CB   . TYR A 1 71 ? 13.069  0.509   1.800   1.00 0.00 ? 101 TYR A CB   6  
ATOM 8483  C CG   . TYR A 1 71 ? 13.886  1.044   2.954   1.00 0.00 ? 101 TYR A CG   6  
ATOM 8484  C CD1  . TYR A 1 71 ? 15.082  0.439   3.322   1.00 0.00 ? 101 TYR A CD1  6  
ATOM 8485  C CD2  . TYR A 1 71 ? 13.461  2.152   3.676   1.00 0.00 ? 101 TYR A CD2  6  
ATOM 8486  C CE1  . TYR A 1 71 ? 15.831  0.926   4.378   1.00 0.00 ? 101 TYR A CE1  6  
ATOM 8487  C CE2  . TYR A 1 71 ? 14.205  2.644   4.732   1.00 0.00 ? 101 TYR A CE2  6  
ATOM 8488  C CZ   . TYR A 1 71 ? 15.388  2.028   5.079   1.00 0.00 ? 101 TYR A CZ   6  
ATOM 8489  O OH   . TYR A 1 71 ? 16.131  2.515   6.128   1.00 0.00 ? 101 TYR A OH   6  
ATOM 8490  H H    . TYR A 1 71 ? 14.230  2.401   0.298   1.00 0.00 ? 101 TYR A H    6  
ATOM 8491  H HA   . TYR A 1 71 ? 14.561  -0.498  0.641   1.00 0.00 ? 101 TYR A HA   6  
ATOM 8492  H HB2  . TYR A 1 71 ? 12.262  1.203   1.616   1.00 0.00 ? 101 TYR A HB2  6  
ATOM 8493  H HB3  . TYR A 1 71 ? 12.656  -0.444  2.097   1.00 0.00 ? 101 TYR A HB3  6  
ATOM 8494  H HD1  . TYR A 1 71 ? 15.426  -0.423  2.771   1.00 0.00 ? 101 TYR A HD1  6  
ATOM 8495  H HD2  . TYR A 1 71 ? 12.533  2.633   3.403   1.00 0.00 ? 101 TYR A HD2  6  
ATOM 8496  H HE1  . TYR A 1 71 ? 16.757  0.442   4.648   1.00 0.00 ? 101 TYR A HE1  6  
ATOM 8497  H HE2  . TYR A 1 71 ? 13.858  3.508   5.281   1.00 0.00 ? 101 TYR A HE2  6  
ATOM 8498  H HH   . TYR A 1 71 ? 16.170  3.473   6.077   1.00 0.00 ? 101 TYR A HH   6  
ATOM 8499  N N    . ARG A 1 72 ? 13.517  -0.401  -1.775  1.00 0.00 ? 102 ARG A N    6  
ATOM 8500  C CA   . ARG A 1 72 ? 12.734  -0.738  -2.958  1.00 0.00 ? 102 ARG A CA   6  
ATOM 8501  C C    . ARG A 1 72 ? 11.837  -1.943  -2.694  1.00 0.00 ? 102 ARG A C    6  
ATOM 8502  O O    . ARG A 1 72 ? 11.923  -2.574  -1.641  1.00 0.00 ? 102 ARG A O    6  
ATOM 8503  C CB   . ARG A 1 72 ? 13.661  -1.024  -4.143  1.00 0.00 ? 102 ARG A CB   6  
ATOM 8504  C CG   . ARG A 1 72 ? 13.182  -0.413  -5.450  1.00 0.00 ? 102 ARG A CG   6  
ATOM 8505  C CD   . ARG A 1 72 ? 14.201  -0.604  -6.562  1.00 0.00 ? 102 ARG A CD   6  
ATOM 8506  N NE   . ARG A 1 72 ? 13.592  -0.500  -7.886  1.00 0.00 ? 102 ARG A NE   6  
ATOM 8507  C CZ   . ARG A 1 72 ? 14.156  -0.961  -8.999  1.00 0.00 ? 102 ARG A CZ   6  
ATOM 8508  N NH1  . ARG A 1 72 ? 15.339  -1.560  -8.955  1.00 0.00 ? 102 ARG A NH1  6  
ATOM 8509  N NH2  . ARG A 1 72 ? 13.534  -0.823  -10.163 1.00 0.00 ? 102 ARG A NH2  6  
ATOM 8510  H H    . ARG A 1 72 ? 14.493  -0.476  -1.810  1.00 0.00 ? 102 ARG A H    6  
ATOM 8511  H HA   . ARG A 1 72 ? 12.113  0.112   -3.198  1.00 0.00 ? 102 ARG A HA   6  
ATOM 8512  H HB2  . ARG A 1 72 ? 14.640  -0.626  -3.923  1.00 0.00 ? 102 ARG A HB2  6  
ATOM 8513  H HB3  . ARG A 1 72 ? 13.738  -2.092  -4.277  1.00 0.00 ? 102 ARG A HB3  6  
ATOM 8514  H HG2  . ARG A 1 72 ? 12.256  -0.887  -5.739  1.00 0.00 ? 102 ARG A HG2  6  
ATOM 8515  H HG3  . ARG A 1 72 ? 13.017  0.644   -5.303  1.00 0.00 ? 102 ARG A HG3  6  
ATOM 8516  H HD2  . ARG A 1 72 ? 14.965  0.153   -6.467  1.00 0.00 ? 102 ARG A HD2  6  
ATOM 8517  H HD3  . ARG A 1 72 ? 14.649  -1.581  -6.458  1.00 0.00 ? 102 ARG A HD3  6  
ATOM 8518  H HE   . ARG A 1 72 ? 12.717  -0.062  -7.948  1.00 0.00 ? 102 ARG A HE   6  
ATOM 8519  H HH11 . ARG A 1 72 ? 15.813  -1.668  -8.081  1.00 0.00 ? 102 ARG A HH11 6  
ATOM 8520  H HH12 . ARG A 1 72 ? 15.757  -1.905  -9.795  1.00 0.00 ? 102 ARG A HH12 6  
ATOM 8521  H HH21 . ARG A 1 72 ? 12.642  -0.372  -10.202 1.00 0.00 ? 102 ARG A HH21 6  
ATOM 8522  H HH22 . ARG A 1 72 ? 13.956  -1.168  -11.001 1.00 0.00 ? 102 ARG A HH22 6  
ATOM 8523  N N    . ILE A 1 73 ? 10.976  -2.257  -3.657  1.00 0.00 ? 103 ILE A N    6  
ATOM 8524  C CA   . ILE A 1 73 ? 10.062  -3.386  -3.527  1.00 0.00 ? 103 ILE A CA   6  
ATOM 8525  C C    . ILE A 1 73 ? 10.621  -4.628  -4.214  1.00 0.00 ? 103 ILE A C    6  
ATOM 8526  O O    . ILE A 1 73 ? 11.042  -4.575  -5.369  1.00 0.00 ? 103 ILE A O    6  
ATOM 8527  C CB   . ILE A 1 73 ? 8.676   -3.057  -4.120  1.00 0.00 ? 103 ILE A CB   6  
ATOM 8528  C CG1  . ILE A 1 73 ? 7.690   -4.197  -3.844  1.00 0.00 ? 103 ILE A CG1  6  
ATOM 8529  C CG2  . ILE A 1 73 ? 8.782   -2.787  -5.614  1.00 0.00 ? 103 ILE A CG2  6  
ATOM 8530  C CD1  . ILE A 1 73 ? 6.411   -3.741  -3.177  1.00 0.00 ? 103 ILE A CD1  6  
ATOM 8531  H H    . ILE A 1 73 ? 10.954  -1.715  -4.474  1.00 0.00 ? 103 ILE A H    6  
ATOM 8532  H HA   . ILE A 1 73 ? 9.940   -3.595  -2.474  1.00 0.00 ? 103 ILE A HA   6  
ATOM 8533  H HB   . ILE A 1 73 ? 8.313   -2.158  -3.644  1.00 0.00 ? 103 ILE A HB   6  
ATOM 8534  H HG12 . ILE A 1 73 ? 7.425   -4.670  -4.778  1.00 0.00 ? 103 ILE A HG12 6  
ATOM 8535  H HG13 . ILE A 1 73 ? 8.161   -4.925  -3.199  1.00 0.00 ? 103 ILE A HG13 6  
ATOM 8536  H HG21 . ILE A 1 73 ? 7.811   -2.517  -6.002  1.00 0.00 ? 103 ILE A HG21 6  
ATOM 8537  H HG22 . ILE A 1 73 ? 9.135   -3.676  -6.116  1.00 0.00 ? 103 ILE A HG22 6  
ATOM 8538  H HG23 . ILE A 1 73 ? 9.476   -1.977  -5.786  1.00 0.00 ? 103 ILE A HG23 6  
ATOM 8539  H HD11 . ILE A 1 73 ? 5.701   -4.554  -3.166  1.00 0.00 ? 103 ILE A HD11 6  
ATOM 8540  H HD12 . ILE A 1 73 ? 5.996   -2.907  -3.724  1.00 0.00 ? 103 ILE A HD12 6  
ATOM 8541  H HD13 . ILE A 1 73 ? 6.623   -3.436  -2.163  1.00 0.00 ? 103 ILE A HD13 6  
ATOM 8542  N N    . ASP A 1 74 ? 10.623  -5.746  -3.495  1.00 0.00 ? 104 ASP A N    6  
ATOM 8543  C CA   . ASP A 1 74 ? 11.130  -7.002  -4.034  1.00 0.00 ? 104 ASP A CA   6  
ATOM 8544  C C    . ASP A 1 74 ? 10.119  -7.637  -4.982  1.00 0.00 ? 104 ASP A C    6  
ATOM 8545  O O    . ASP A 1 74 ? 9.009   -7.132  -5.151  1.00 0.00 ? 104 ASP A O    6  
ATOM 8546  C CB   . ASP A 1 74 ? 11.463  -7.973  -2.899  1.00 0.00 ? 104 ASP A CB   6  
ATOM 8547  C CG   . ASP A 1 74 ? 10.311  -8.142  -1.928  1.00 0.00 ? 104 ASP A CG   6  
ATOM 8548  O OD1  . ASP A 1 74 ? 9.343   -8.852  -2.273  1.00 0.00 ? 104 ASP A OD1  6  
ATOM 8549  O OD2  . ASP A 1 74 ? 10.378  -7.566  -0.822  1.00 0.00 ? 104 ASP A OD2  6  
ATOM 8550  H H    . ASP A 1 74 ? 10.275  -5.726  -2.579  1.00 0.00 ? 104 ASP A H    6  
ATOM 8551  H HA   . ASP A 1 74 ? 12.033  -6.784  -4.585  1.00 0.00 ? 104 ASP A HA   6  
ATOM 8552  H HB2  . ASP A 1 74 ? 11.702  -8.938  -3.318  1.00 0.00 ? 104 ASP A HB2  6  
ATOM 8553  H HB3  . ASP A 1 74 ? 12.317  -7.600  -2.354  1.00 0.00 ? 104 ASP A HB3  6  
ATOM 8554  N N    . ILE A 1 75 ? 10.509  -8.749  -5.598  1.00 0.00 ? 105 ILE A N    6  
ATOM 8555  C CA   . ILE A 1 75 ? 9.637   -9.455  -6.530  1.00 0.00 ? 105 ILE A CA   6  
ATOM 8556  C C    . ILE A 1 75 ? 10.005  -10.934 -6.615  1.00 0.00 ? 105 ILE A C    6  
ATOM 8557  O O    . ILE A 1 75 ? 10.746  -11.346 -7.506  1.00 0.00 ? 105 ILE A O    6  
ATOM 8558  C CB   . ILE A 1 75 ? 9.703   -8.839  -7.940  1.00 0.00 ? 105 ILE A CB   6  
ATOM 8559  C CG1  . ILE A 1 75 ? 11.157  -8.595  -8.349  1.00 0.00 ? 105 ILE A CG1  6  
ATOM 8560  C CG2  . ILE A 1 75 ? 8.909   -7.542  -7.991  1.00 0.00 ? 105 ILE A CG2  6  
ATOM 8561  C CD1  . ILE A 1 75 ? 11.356  -8.496  -9.846  1.00 0.00 ? 105 ILE A CD1  6  
ATOM 8562  H H    . ILE A 1 75 ? 11.405  -9.103  -5.421  1.00 0.00 ? 105 ILE A H    6  
ATOM 8563  H HA   . ILE A 1 75 ? 8.623   -9.366  -6.168  1.00 0.00 ? 105 ILE A HA   6  
ATOM 8564  H HB   . ILE A 1 75 ? 9.254   -9.534  -8.634  1.00 0.00 ? 105 ILE A HB   6  
ATOM 8565  H HG12 . ILE A 1 75 ? 11.498  -7.670  -7.909  1.00 0.00 ? 105 ILE A HG12 6  
ATOM 8566  H HG13 . ILE A 1 75 ? 11.768  -9.408  -7.985  1.00 0.00 ? 105 ILE A HG13 6  
ATOM 8567  H HG21 . ILE A 1 75 ? 8.894   -7.167  -9.004  1.00 0.00 ? 105 ILE A HG21 6  
ATOM 8568  H HG22 . ILE A 1 75 ? 9.371   -6.811  -7.343  1.00 0.00 ? 105 ILE A HG22 6  
ATOM 8569  H HG23 . ILE A 1 75 ? 7.897   -7.727  -7.661  1.00 0.00 ? 105 ILE A HG23 6  
ATOM 8570  H HD11 . ILE A 1 75 ? 12.286  -7.987  -10.053 1.00 0.00 ? 105 ILE A HD11 6  
ATOM 8571  H HD12 . ILE A 1 75 ? 10.538  -7.944  -10.283 1.00 0.00 ? 105 ILE A HD12 6  
ATOM 8572  H HD13 . ILE A 1 75 ? 11.388  -9.489  -10.271 1.00 0.00 ? 105 ILE A HD13 6  
ATOM 8573  N N    . PRO A 1 76 ? 9.488   -11.755 -5.685  1.00 0.00 ? 106 PRO A N    6  
ATOM 8574  C CA   . PRO A 1 76 ? 9.766   -13.194 -5.659  1.00 0.00 ? 106 PRO A CA   6  
ATOM 8575  C C    . PRO A 1 76 ? 9.497   -13.859 -7.006  1.00 0.00 ? 106 PRO A C    6  
ATOM 8576  O O    . PRO A 1 76 ? 8.406   -13.737 -7.562  1.00 0.00 ? 106 PRO A O    6  
ATOM 8577  C CB   . PRO A 1 76 ? 8.800   -13.725 -4.599  1.00 0.00 ? 106 PRO A CB   6  
ATOM 8578  C CG   . PRO A 1 76 ? 8.542   -12.563 -3.706  1.00 0.00 ? 106 PRO A CG   6  
ATOM 8579  C CD   . PRO A 1 76 ? 8.594   -11.344 -4.585  1.00 0.00 ? 106 PRO A CD   6  
ATOM 8580  H HA   . PRO A 1 76 ? 10.784  -13.395 -5.358  1.00 0.00 ? 106 PRO A HA   6  
ATOM 8581  H HB2  . PRO A 1 76 ? 7.893   -14.070 -5.074  1.00 0.00 ? 106 PRO A HB2  6  
ATOM 8582  H HB3  . PRO A 1 76 ? 9.263   -14.540 -4.062  1.00 0.00 ? 106 PRO A HB3  6  
ATOM 8583  H HG2  . PRO A 1 76 ? 7.565   -12.657 -3.253  1.00 0.00 ? 106 PRO A HG2  6  
ATOM 8584  H HG3  . PRO A 1 76 ? 9.305   -12.507 -2.944  1.00 0.00 ? 106 PRO A HG3  6  
ATOM 8585  H HD2  . PRO A 1 76 ? 7.608   -11.107 -4.959  1.00 0.00 ? 106 PRO A HD2  6  
ATOM 8586  H HD3  . PRO A 1 76 ? 9.006   -10.506 -4.045  1.00 0.00 ? 106 PRO A HD3  6  
ATOM 8587  N N    . LYS A 1 77 ? 10.499  -14.564 -7.524  1.00 0.00 ? 107 LYS A N    6  
ATOM 8588  C CA   . LYS A 1 77 ? 10.370  -15.248 -8.805  1.00 0.00 ? 107 LYS A CA   6  
ATOM 8589  C C    . LYS A 1 77 ? 11.634  -16.038 -9.127  1.00 0.00 ? 107 LYS A C    6  
ATOM 8590  O O    . LYS A 1 77 ? 12.739  -15.475 -8.977  1.00 0.00 ? 107 LYS A O    6  
ATOM 8591  C CB   . LYS A 1 77 ? 10.082  -14.239 -9.919  1.00 0.00 ? 107 LYS A CB   6  
ATOM 8592  C CG   . LYS A 1 77 ? 8.816   -14.543 -10.703 1.00 0.00 ? 107 LYS A CG   6  
ATOM 8593  C CD   . LYS A 1 77 ? 8.212   -13.282 -11.297 1.00 0.00 ? 107 LYS A CD   6  
ATOM 8594  C CE   . LYS A 1 77 ? 6.715   -13.433 -11.520 1.00 0.00 ? 107 LYS A CE   6  
ATOM 8595  N NZ   . LYS A 1 77 ? 6.395   -13.761 -12.937 1.00 0.00 ? 107 LYS A NZ   6  
ATOM 8596  O OXT  . LYS A 1 77 ? 11.509  -17.216 -9.527  1.00 0.00 ? 107 LYS A OXT  6  
ATOM 8597  H H    . LYS A 1 77 ? 11.344  -14.624 -7.032  1.00 0.00 ? 107 LYS A H    6  
ATOM 8598  H HA   . LYS A 1 77 ? 9.540   -15.935 -8.730  1.00 0.00 ? 107 LYS A HA   6  
ATOM 8599  H HB2  . LYS A 1 77 ? 9.979   -13.256 -9.481  1.00 0.00 ? 107 LYS A HB2  6  
ATOM 8600  H HB3  . LYS A 1 77 ? 10.914  -14.230 -10.608 1.00 0.00 ? 107 LYS A HB3  6  
ATOM 8601  H HG2  . LYS A 1 77 ? 9.057   -15.226 -11.504 1.00 0.00 ? 107 LYS A HG2  6  
ATOM 8602  H HG3  . LYS A 1 77 ? 8.096   -15.002 -10.041 1.00 0.00 ? 107 LYS A HG3  6  
ATOM 8603  H HD2  . LYS A 1 77 ? 8.382   -12.458 -10.619 1.00 0.00 ? 107 LYS A HD2  6  
ATOM 8604  H HD3  . LYS A 1 77 ? 8.689   -13.076 -12.243 1.00 0.00 ? 107 LYS A HD3  6  
ATOM 8605  H HE2  . LYS A 1 77 ? 6.348   -14.225 -10.885 1.00 0.00 ? 107 LYS A HE2  6  
ATOM 8606  H HE3  . LYS A 1 77 ? 6.229   -12.505 -11.255 1.00 0.00 ? 107 LYS A HE3  6  
ATOM 8607  H HZ1  . LYS A 1 77 ? 7.058   -13.275 -13.575 1.00 0.00 ? 107 LYS A HZ1  6  
ATOM 8608  H HZ2  . LYS A 1 77 ? 5.427   -13.459 -13.164 1.00 0.00 ? 107 LYS A HZ2  6  
ATOM 8609  H HZ3  . LYS A 1 77 ? 6.471   -14.787 -13.092 1.00 0.00 ? 107 LYS A HZ3  6  
ATOM 8610  N N    . ALA B 2 1  ? 9.521   8.018   6.541   1.00 0.00 ? 43  ALA B N    6  
ATOM 8611  C CA   . ALA B 2 1  ? 8.586   7.844   5.400   1.00 0.00 ? 43  ALA B CA   6  
ATOM 8612  C C    . ALA B 2 1  ? 7.199   8.383   5.739   1.00 0.00 ? 43  ALA B C    6  
ATOM 8613  O O    . ALA B 2 1  ? 6.333   7.641   6.202   1.00 0.00 ? 43  ALA B O    6  
ATOM 8614  C CB   . ALA B 2 1  ? 8.500   6.376   5.008   1.00 0.00 ? 43  ALA B CB   6  
ATOM 8615  H H1   . ALA B 2 1  ? 9.034   7.695   7.401   1.00 0.00 ? 43  ALA B H1   6  
ATOM 8616  H H2   . ALA B 2 1  ? 9.760   9.030   6.602   1.00 0.00 ? 43  ALA B H2   6  
ATOM 8617  H H3   . ALA B 2 1  ? 10.365  7.443   6.351   1.00 0.00 ? 43  ALA B H3   6  
ATOM 8618  H HA   . ALA B 2 1  ? 8.975   8.393   4.555   1.00 0.00 ? 43  ALA B HA   6  
ATOM 8619  H HB1  . ALA B 2 1  ? 9.402   6.089   4.485   1.00 0.00 ? 43  ALA B HB1  6  
ATOM 8620  H HB2  . ALA B 2 1  ? 7.647   6.224   4.365   1.00 0.00 ? 43  ALA B HB2  6  
ATOM 8621  H HB3  . ALA B 2 1  ? 8.393   5.772   5.897   1.00 0.00 ? 43  ALA B HB3  6  
ATOM 8622  N N    . PRO B 2 2  ? 6.970   9.687   5.512   1.00 0.00 ? 44  PRO B N    6  
ATOM 8623  C CA   . PRO B 2 2  ? 5.680   10.324  5.797   1.00 0.00 ? 44  PRO B CA   6  
ATOM 8624  C C    . PRO B 2 2  ? 4.580   9.878   4.836   1.00 0.00 ? 44  PRO B C    6  
ATOM 8625  O O    . PRO B 2 2  ? 3.403   10.175  5.048   1.00 0.00 ? 44  PRO B O    6  
ATOM 8626  C CB   . PRO B 2 2  ? 5.973   11.816  5.616   1.00 0.00 ? 44  PRO B CB   6  
ATOM 8627  C CG   . PRO B 2 2  ? 7.121   11.863  4.669   1.00 0.00 ? 44  PRO B CG   6  
ATOM 8628  C CD   . PRO B 2 2  ? 7.950   10.643  4.960   1.00 0.00 ? 44  PRO B CD   6  
ATOM 8629  H HA   . PRO B 2 2  ? 5.364   10.138  6.812   1.00 0.00 ? 44  PRO B HA   6  
ATOM 8630  H HB2  . PRO B 2 2  ? 5.103   12.309  5.209   1.00 0.00 ? 44  PRO B HB2  6  
ATOM 8631  H HB3  . PRO B 2 2  ? 6.230   12.253  6.570   1.00 0.00 ? 44  PRO B HB3  6  
ATOM 8632  H HG2  . PRO B 2 2  ? 6.759   11.837  3.652   1.00 0.00 ? 44  PRO B HG2  6  
ATOM 8633  H HG3  . PRO B 2 2  ? 7.700   12.759  4.839   1.00 0.00 ? 44  PRO B HG3  6  
ATOM 8634  H HD2  . PRO B 2 2  ? 8.391   10.261  4.052   1.00 0.00 ? 44  PRO B HD2  6  
ATOM 8635  H HD3  . PRO B 2 2  ? 8.716   10.872  5.688   1.00 0.00 ? 44  PRO B HD3  6  
ATOM 8636  N N    . GLN B 2 3  ? 4.964   9.161   3.784   1.00 0.00 ? 45  GLN B N    6  
ATOM 8637  C CA   . GLN B 2 3  ? 4.003   8.676   2.802   1.00 0.00 ? 45  GLN B CA   6  
ATOM 8638  C C    . GLN B 2 3  ? 3.258   7.461   3.335   1.00 0.00 ? 45  GLN B C    6  
ATOM 8639  O O    . GLN B 2 3  ? 2.118   7.199   2.952   1.00 0.00 ? 45  GLN B O    6  
ATOM 8640  C CB   . GLN B 2 3  ? 4.709   8.327   1.491   1.00 0.00 ? 45  GLN B CB   6  
ATOM 8641  C CG   . GLN B 2 3  ? 5.072   9.543   0.653   1.00 0.00 ? 45  GLN B CG   6  
ATOM 8642  C CD   . GLN B 2 3  ? 6.556   9.623   0.350   1.00 0.00 ? 45  GLN B CD   6  
ATOM 8643  O OE1  . GLN B 2 3  ? 6.984   9.393   -0.780  1.00 0.00 ? 45  GLN B OE1  6  
ATOM 8644  N NE2  . GLN B 2 3  ? 7.350   9.951   1.364   1.00 0.00 ? 45  GLN B NE2  6  
ATOM 8645  H H    . GLN B 2 3  ? 5.912   8.947   3.667   1.00 0.00 ? 45  GLN B H    6  
ATOM 8646  H HA   . GLN B 2 3  ? 3.292   9.464   2.621   1.00 0.00 ? 45  GLN B HA   6  
ATOM 8647  H HB2  . GLN B 2 3  ? 5.617   7.787   1.717   1.00 0.00 ? 45  GLN B HB2  6  
ATOM 8648  H HB3  . GLN B 2 3  ? 4.061   7.693   0.904   1.00 0.00 ? 45  GLN B HB3  6  
ATOM 8649  H HG2  . GLN B 2 3  ? 4.533   9.493   -0.281  1.00 0.00 ? 45  GLN B HG2  6  
ATOM 8650  H HG3  . GLN B 2 3  ? 4.780   10.433  1.189   1.00 0.00 ? 45  GLN B HG3  6  
ATOM 8651  H HE21 . GLN B 2 3  ? 6.938   10.120  2.238   1.00 0.00 ? 45  GLN B HE21 6  
ATOM 8652  H HE22 . GLN B 2 3  ? 8.312   10.010  1.196   1.00 0.00 ? 45  GLN B HE22 6  
ATOM 8653  N N    . LEU B 2 4  ? 3.908   6.729   4.227   1.00 0.00 ? 46  LEU B N    6  
ATOM 8654  C CA   . LEU B 2 4  ? 3.307   5.546   4.822   1.00 0.00 ? 46  LEU B CA   6  
ATOM 8655  C C    . LEU B 2 4  ? 2.273   5.945   5.866   1.00 0.00 ? 46  LEU B C    6  
ATOM 8656  O O    . LEU B 2 4  ? 1.257   5.271   6.041   1.00 0.00 ? 46  LEU B O    6  
ATOM 8657  C CB   . LEU B 2 4  ? 4.382   4.658   5.455   1.00 0.00 ? 46  LEU B CB   6  
ATOM 8658  C CG   . LEU B 2 4  ? 5.169   3.791   4.472   1.00 0.00 ? 46  LEU B CG   6  
ATOM 8659  C CD1  . LEU B 2 4  ? 6.184   2.934   5.211   1.00 0.00 ? 46  LEU B CD1  6  
ATOM 8660  C CD2  . LEU B 2 4  ? 4.226   2.921   3.656   1.00 0.00 ? 46  LEU B CD2  6  
ATOM 8661  H H    . LEU B 2 4  ? 4.811   6.994   4.495   1.00 0.00 ? 46  LEU B H    6  
ATOM 8662  H HA   . LEU B 2 4  ? 2.814   4.997   4.036   1.00 0.00 ? 46  LEU B HA   6  
ATOM 8663  H HB2  . LEU B 2 4  ? 5.078   5.295   5.982   1.00 0.00 ? 46  LEU B HB2  6  
ATOM 8664  H HB3  . LEU B 2 4  ? 3.904   4.006   6.172   1.00 0.00 ? 46  LEU B HB3  6  
ATOM 8665  H HG   . LEU B 2 4  ? 5.708   4.433   3.789   1.00 0.00 ? 46  LEU B HG   6  
ATOM 8666  H HD11 . LEU B 2 4  ? 5.715   2.483   6.073   1.00 0.00 ? 46  LEU B HD11 6  
ATOM 8667  H HD12 . LEU B 2 4  ? 7.011   3.550   5.531   1.00 0.00 ? 46  LEU B HD12 6  
ATOM 8668  H HD13 . LEU B 2 4  ? 6.548   2.159   4.552   1.00 0.00 ? 46  LEU B HD13 6  
ATOM 8669  H HD21 . LEU B 2 4  ? 3.481   2.487   4.309   1.00 0.00 ? 46  LEU B HD21 6  
ATOM 8670  H HD22 . LEU B 2 4  ? 4.787   2.133   3.176   1.00 0.00 ? 46  LEU B HD22 6  
ATOM 8671  H HD23 . LEU B 2 4  ? 3.737   3.524   2.905   1.00 0.00 ? 46  LEU B HD23 6  
ATOM 8672  N N    . ILE B 2 5  ? 2.535   7.052   6.550   1.00 0.00 ? 47  ILE B N    6  
ATOM 8673  C CA   . ILE B 2 5  ? 1.624   7.551   7.570   1.00 0.00 ? 47  ILE B CA   6  
ATOM 8674  C C    . ILE B 2 5  ? 0.385   8.159   6.925   1.00 0.00 ? 47  ILE B C    6  
ATOM 8675  O O    . ILE B 2 5  ? -0.730  8.004   7.428   1.00 0.00 ? 47  ILE B O    6  
ATOM 8676  C CB   . ILE B 2 5  ? 2.300   8.610   8.462   1.00 0.00 ? 47  ILE B CB   6  
ATOM 8677  C CG1  . ILE B 2 5  ? 3.649   8.097   8.967   1.00 0.00 ? 47  ILE B CG1  6  
ATOM 8678  C CG2  . ILE B 2 5  ? 1.394   8.974   9.629   1.00 0.00 ? 47  ILE B CG2  6  
ATOM 8679  C CD1  . ILE B 2 5  ? 3.551   6.806   9.751   1.00 0.00 ? 47  ILE B CD1  6  
ATOM 8680  H H    . ILE B 2 5  ? 3.358   7.550   6.360   1.00 0.00 ? 47  ILE B H    6  
ATOM 8681  H HA   . ILE B 2 5  ? 1.326   6.719   8.191   1.00 0.00 ? 47  ILE B HA   6  
ATOM 8682  H HB   . ILE B 2 5  ? 2.458   9.499   7.871   1.00 0.00 ? 47  ILE B HB   6  
ATOM 8683  H HG12 . ILE B 2 5  ? 4.299   7.923   8.123   1.00 0.00 ? 47  ILE B HG12 6  
ATOM 8684  H HG13 . ILE B 2 5  ? 4.093   8.843   9.609   1.00 0.00 ? 47  ILE B HG13 6  
ATOM 8685  H HG21 . ILE B 2 5  ? 0.860   8.095   9.958   1.00 0.00 ? 47  ILE B HG21 6  
ATOM 8686  H HG22 . ILE B 2 5  ? 0.688   9.728   9.316   1.00 0.00 ? 47  ILE B HG22 6  
ATOM 8687  H HG23 . ILE B 2 5  ? 1.992   9.357   10.443  1.00 0.00 ? 47  ILE B HG23 6  
ATOM 8688  H HD11 . ILE B 2 5  ? 2.514   6.597   9.971   1.00 0.00 ? 47  ILE B HD11 6  
ATOM 8689  H HD12 . ILE B 2 5  ? 4.103   6.903   10.673  1.00 0.00 ? 47  ILE B HD12 6  
ATOM 8690  H HD13 . ILE B 2 5  ? 3.965   5.998   9.166   1.00 0.00 ? 47  ILE B HD13 6  
ATOM 8691  N N    . MET B 2 6  ? 0.585   8.848   5.806   1.00 0.00 ? 48  MET B N    6  
ATOM 8692  C CA   . MET B 2 6  ? -0.518  9.474   5.089   1.00 0.00 ? 48  MET B CA   6  
ATOM 8693  C C    . MET B 2 6  ? -1.370  8.424   4.384   1.00 0.00 ? 48  MET B C    6  
ATOM 8694  O O    . MET B 2 6  ? -2.565  8.623   4.165   1.00 0.00 ? 48  MET B O    6  
ATOM 8695  C CB   . MET B 2 6  ? 0.010   10.504  4.082   1.00 0.00 ? 48  MET B CB   6  
ATOM 8696  C CG   . MET B 2 6  ? 0.532   9.897   2.788   1.00 0.00 ? 48  MET B CG   6  
ATOM 8697  S SD   . MET B 2 6  ? -0.551  10.217  1.381   1.00 0.00 ? 48  MET B SD   6  
ATOM 8698  C CE   . MET B 2 6  ? -0.339  8.710   0.438   1.00 0.00 ? 48  MET B CE   6  
ATOM 8699  H H    . MET B 2 6  ? 1.496   8.933   5.452   1.00 0.00 ? 48  MET B H    6  
ATOM 8700  H HA   . MET B 2 6  ? -1.132  9.978   5.816   1.00 0.00 ? 48  MET B HA   6  
ATOM 8701  H HB2  . MET B 2 6  ? -0.786  11.190  3.837   1.00 0.00 ? 48  MET B HB2  6  
ATOM 8702  H HB3  . MET B 2 6  ? 0.816   11.056  4.543   1.00 0.00 ? 48  MET B HB3  6  
ATOM 8703  H HG2  . MET B 2 6  ? 1.504   10.315  2.575   1.00 0.00 ? 48  MET B HG2  6  
ATOM 8704  H HG3  . MET B 2 6  ? 0.622   8.829   2.918   1.00 0.00 ? 48  MET B HG3  6  
ATOM 8705  H HE1  . MET B 2 6  ? -0.681  8.868   -0.574  1.00 0.00 ? 48  MET B HE1  6  
ATOM 8706  H HE2  . MET B 2 6  ? -0.914  7.917   0.892   1.00 0.00 ? 48  MET B HE2  6  
ATOM 8707  H HE3  . MET B 2 6  ? 0.705   8.438   0.426   1.00 0.00 ? 48  MET B HE3  6  
ATOM 8708  N N    . LEU B 2 7  ? -0.747  7.304   4.038   1.00 0.00 ? 49  LEU B N    6  
ATOM 8709  C CA   . LEU B 2 7  ? -1.448  6.219   3.366   1.00 0.00 ? 49  LEU B CA   6  
ATOM 8710  C C    . LEU B 2 7  ? -2.437  5.554   4.317   1.00 0.00 ? 49  LEU B C    6  
ATOM 8711  O O    . LEU B 2 7  ? -3.623  5.427   4.011   1.00 0.00 ? 49  LEU B O    6  
ATOM 8712  C CB   . LEU B 2 7  ? -0.451  5.183   2.841   1.00 0.00 ? 49  LEU B CB   6  
ATOM 8713  C CG   . LEU B 2 7  ? 0.218   5.544   1.514   1.00 0.00 ? 49  LEU B CG   6  
ATOM 8714  C CD1  . LEU B 2 7  ? 1.518   4.771   1.345   1.00 0.00 ? 49  LEU B CD1  6  
ATOM 8715  C CD2  . LEU B 2 7  ? -0.724  5.268   0.352   1.00 0.00 ? 49  LEU B CD2  6  
ATOM 8716  H H    . LEU B 2 7  ? 0.206   7.204   4.246   1.00 0.00 ? 49  LEU B H    6  
ATOM 8717  H HA   . LEU B 2 7  ? -1.993  6.639   2.533   1.00 0.00 ? 49  LEU B HA   6  
ATOM 8718  H HB2  . LEU B 2 7  ? 0.320   5.048   3.585   1.00 0.00 ? 49  LEU B HB2  6  
ATOM 8719  H HB3  . LEU B 2 7  ? -0.971  4.246   2.712   1.00 0.00 ? 49  LEU B HB3  6  
ATOM 8720  H HG   . LEU B 2 7  ? 0.454   6.598   1.512   1.00 0.00 ? 49  LEU B HG   6  
ATOM 8721  H HD11 . LEU B 2 7  ? 1.635   4.485   0.309   1.00 0.00 ? 49  LEU B HD11 6  
ATOM 8722  H HD12 . LEU B 2 7  ? 1.493   3.886   1.962   1.00 0.00 ? 49  LEU B HD12 6  
ATOM 8723  H HD13 . LEU B 2 7  ? 2.348   5.395   1.641   1.00 0.00 ? 49  LEU B HD13 6  
ATOM 8724  H HD21 . LEU B 2 7  ? -0.879  4.204   0.258   1.00 0.00 ? 49  LEU B HD21 6  
ATOM 8725  H HD22 . LEU B 2 7  ? -0.292  5.652   -0.561  1.00 0.00 ? 49  LEU B HD22 6  
ATOM 8726  H HD23 . LEU B 2 7  ? -1.671  5.755   0.533   1.00 0.00 ? 49  LEU B HD23 6  
ATOM 8727  N N    . ALA B 2 8  ? -1.938  5.136   5.477   1.00 0.00 ? 50  ALA B N    6  
ATOM 8728  C CA   . ALA B 2 8  ? -2.773  4.490   6.479   1.00 0.00 ? 50  ALA B CA   6  
ATOM 8729  C C    . ALA B 2 8  ? -3.815  5.457   7.032   1.00 0.00 ? 50  ALA B C    6  
ATOM 8730  O O    . ALA B 2 8  ? -4.877  5.040   7.493   1.00 0.00 ? 50  ALA B O    6  
ATOM 8731  C CB   . ALA B 2 8  ? -1.913  3.938   7.605   1.00 0.00 ? 50  ALA B CB   6  
ATOM 8732  H H    . ALA B 2 8  ? -0.988  5.269   5.663   1.00 0.00 ? 50  ALA B H    6  
ATOM 8733  H HA   . ALA B 2 8  ? -3.279  3.663   6.006   1.00 0.00 ? 50  ALA B HA   6  
ATOM 8734  H HB1  . ALA B 2 8  ? -1.452  3.014   7.286   1.00 0.00 ? 50  ALA B HB1  6  
ATOM 8735  H HB2  . ALA B 2 8  ? -2.529  3.751   8.472   1.00 0.00 ? 50  ALA B HB2  6  
ATOM 8736  H HB3  . ALA B 2 8  ? -1.144  4.654   7.856   1.00 0.00 ? 50  ALA B HB3  6  
ATOM 8737  N N    . ASN B 2 9  ? -3.506  6.750   6.981   1.00 0.00 ? 51  ASN B N    6  
ATOM 8738  C CA   . ASN B 2 9  ? -4.421  7.771   7.477   1.00 0.00 ? 51  ASN B CA   6  
ATOM 8739  C C    . ASN B 2 9  ? -5.668  7.844   6.604   1.00 0.00 ? 51  ASN B C    6  
ATOM 8740  O O    . ASN B 2 9  ? -6.781  7.607   7.072   1.00 0.00 ? 51  ASN B O    6  
ATOM 8741  C CB   . ASN B 2 9  ? -3.726  9.134   7.514   1.00 0.00 ? 51  ASN B CB   6  
ATOM 8742  C CG   . ASN B 2 9  ? -4.548  10.181  8.239   1.00 0.00 ? 51  ASN B CG   6  
ATOM 8743  O OD1  . ASN B 2 9  ? -5.759  10.284  8.043   1.00 0.00 ? 51  ASN B OD1  6  
ATOM 8744  N ND2  . ASN B 2 9  ? -3.890  10.970  9.082   1.00 0.00 ? 51  ASN B ND2  6  
ATOM 8745  H H    . ASN B 2 9  ? -2.645  7.025   6.601   1.00 0.00 ? 51  ASN B H    6  
ATOM 8746  H HA   . ASN B 2 9  ? -4.714  7.496   8.478   1.00 0.00 ? 51  ASN B HA   6  
ATOM 8747  H HB2  . ASN B 2 9  ? -2.778  9.034   8.020   1.00 0.00 ? 51  ASN B HB2  6  
ATOM 8748  H HB3  . ASN B 2 9  ? -3.557  9.472   6.502   1.00 0.00 ? 51  ASN B HB3  6  
ATOM 8749  H HD21 . ASN B 2 9  ? -2.925  10.831  9.187   1.00 0.00 ? 51  ASN B HD21 6  
ATOM 8750  H HD22 . ASN B 2 9  ? -4.395  11.655  9.564   1.00 0.00 ? 51  ASN B HD22 6  
ATOM 8751  N N    . VAL B 2 10 ? -5.472  8.168   5.330   1.00 0.00 ? 52  VAL B N    6  
ATOM 8752  C CA   . VAL B 2 10 ? -6.583  8.264   4.390   1.00 0.00 ? 52  VAL B CA   6  
ATOM 8753  C C    . VAL B 2 10 ? -7.329  6.938   4.295   1.00 0.00 ? 52  VAL B C    6  
ATOM 8754  O O    . VAL B 2 10 ? -8.514  6.905   3.965   1.00 0.00 ? 52  VAL B O    6  
ATOM 8755  C CB   . VAL B 2 10 ? -6.100  8.676   2.986   1.00 0.00 ? 52  VAL B CB   6  
ATOM 8756  C CG1  . VAL B 2 10 ? -7.282  8.902   2.057   1.00 0.00 ? 52  VAL B CG1  6  
ATOM 8757  C CG2  . VAL B 2 10 ? -5.230  9.923   3.064   1.00 0.00 ? 52  VAL B CG2  6  
ATOM 8758  H H    . VAL B 2 10 ? -4.560  8.340   5.014   1.00 0.00 ? 52  VAL B H    6  
ATOM 8759  H HA   . VAL B 2 10 ? -7.264  9.022   4.754   1.00 0.00 ? 52  VAL B HA   6  
ATOM 8760  H HB   . VAL B 2 10 ? -5.502  7.872   2.582   1.00 0.00 ? 52  VAL B HB   6  
ATOM 8761  H HG11 . VAL B 2 10 ? -7.054  9.704   1.370   1.00 0.00 ? 52  VAL B HG11 6  
ATOM 8762  H HG12 . VAL B 2 10 ? -8.153  9.165   2.639   1.00 0.00 ? 52  VAL B HG12 6  
ATOM 8763  H HG13 . VAL B 2 10 ? -7.481  7.998   1.500   1.00 0.00 ? 52  VAL B HG13 6  
ATOM 8764  H HG21 . VAL B 2 10 ? -4.895  10.066  4.081   1.00 0.00 ? 52  VAL B HG21 6  
ATOM 8765  H HG22 . VAL B 2 10 ? -5.802  10.783  2.750   1.00 0.00 ? 52  VAL B HG22 6  
ATOM 8766  H HG23 . VAL B 2 10 ? -4.373  9.805   2.415   1.00 0.00 ? 52  VAL B HG23 6  
ATOM 8767  N N    . ALA B 2 11 ? -6.633  5.848   4.604   1.00 0.00 ? 53  ALA B N    6  
ATOM 8768  C CA   . ALA B 2 11 ? -7.236  4.530   4.571   1.00 0.00 ? 53  ALA B CA   6  
ATOM 8769  C C    . ALA B 2 11 ? -8.172  4.365   5.757   1.00 0.00 ? 53  ALA B C    6  
ATOM 8770  O O    . ALA B 2 11 ? -9.187  3.674   5.676   1.00 0.00 ? 53  ALA B O    6  
ATOM 8771  C CB   . ALA B 2 11 ? -6.164  3.451   4.580   1.00 0.00 ? 53  ALA B CB   6  
ATOM 8772  H H    . ALA B 2 11 ? -5.701  5.934   4.875   1.00 0.00 ? 53  ALA B H    6  
ATOM 8773  H HA   . ALA B 2 11 ? -7.801  4.443   3.658   1.00 0.00 ? 53  ALA B HA   6  
ATOM 8774  H HB1  . ALA B 2 11 ? -6.516  2.597   5.138   1.00 0.00 ? 53  ALA B HB1  6  
ATOM 8775  H HB2  . ALA B 2 11 ? -5.267  3.839   5.042   1.00 0.00 ? 53  ALA B HB2  6  
ATOM 8776  H HB3  . ALA B 2 11 ? -5.944  3.153   3.565   1.00 0.00 ? 53  ALA B HB3  6  
ATOM 8777  N N    . LEU B 2 12 ? -7.820  5.019   6.861   1.00 0.00 ? 54  LEU B N    6  
ATOM 8778  C CA   . LEU B 2 12 ? -8.620  4.966   8.066   1.00 0.00 ? 54  LEU B CA   6  
ATOM 8779  C C    . LEU B 2 12 ? -9.511  6.202   8.187   1.00 0.00 ? 54  LEU B C    6  
ATOM 8780  O O    . LEU B 2 12 ? -10.125 6.434   9.227   1.00 0.00 ? 54  LEU B O    6  
ATOM 8781  C CB   . LEU B 2 12 ? -7.720  4.846   9.298   1.00 0.00 ? 54  LEU B CB   6  
ATOM 8782  C CG   . LEU B 2 12 ? -7.350  3.417   9.697   1.00 0.00 ? 54  LEU B CG   6  
ATOM 8783  C CD1  . LEU B 2 12 ? -6.763  2.666   8.511   1.00 0.00 ? 54  LEU B CD1  6  
ATOM 8784  C CD2  . LEU B 2 12 ? -6.371  3.426   10.862  1.00 0.00 ? 54  LEU B CD2  6  
ATOM 8785  H H    . LEU B 2 12 ? -7.006  5.554   6.859   1.00 0.00 ? 54  LEU B H    6  
ATOM 8786  H HA   . LEU B 2 12 ? -9.237  4.094   7.997   1.00 0.00 ? 54  LEU B HA   6  
ATOM 8787  H HB2  . LEU B 2 12 ? -6.806  5.392   9.104   1.00 0.00 ? 54  LEU B HB2  6  
ATOM 8788  H HB3  . LEU B 2 12 ? -8.224  5.310   10.132  1.00 0.00 ? 54  LEU B HB3  6  
ATOM 8789  H HG   . LEU B 2 12 ? -8.243  2.896   10.012  1.00 0.00 ? 54  LEU B HG   6  
ATOM 8790  H HD11 . LEU B 2 12 ? -5.990  1.995   8.857   1.00 0.00 ? 54  LEU B HD11 6  
ATOM 8791  H HD12 . LEU B 2 12 ? -6.341  3.371   7.811   1.00 0.00 ? 54  LEU B HD12 6  
ATOM 8792  H HD13 . LEU B 2 12 ? -7.542  2.097   8.025   1.00 0.00 ? 54  LEU B HD13 6  
ATOM 8793  H HD21 . LEU B 2 12 ? -6.437  4.372   11.380  1.00 0.00 ? 54  LEU B HD21 6  
ATOM 8794  H HD22 . LEU B 2 12 ? -5.367  3.290   10.489  1.00 0.00 ? 54  LEU B HD22 6  
ATOM 8795  H HD23 . LEU B 2 12 ? -6.616  2.625   11.543  1.00 0.00 ? 54  LEU B HD23 6  
ATOM 8796  N N    . THR B 2 13 ? -9.576  6.993   7.116   1.00 0.00 ? 55  THR B N    6  
ATOM 8797  C CA   . THR B 2 13 ? -10.391 8.200   7.105   1.00 0.00 ? 55  THR B CA   6  
ATOM 8798  C C    . THR B 2 13 ? -10.468 8.795   5.702   1.00 0.00 ? 55  THR B C    6  
ATOM 8799  O O    . THR B 2 13 ? -9.901  9.855   5.432   1.00 0.00 ? 55  THR B O    6  
ATOM 8800  C CB   . THR B 2 13 ? -9.826  9.233   8.084   1.00 0.00 ? 55  THR B CB   6  
ATOM 8801  O OG1  . THR B 2 13 ? -10.654 10.380  8.135   1.00 0.00 ? 55  THR B OG1  6  
ATOM 8802  C CG2  . THR B 2 13 ? -8.428  9.691   7.732   1.00 0.00 ? 55  THR B CG2  6  
ATOM 8803  H H    . THR B 2 13 ? -9.066  6.759   6.314   1.00 0.00 ? 55  THR B H    6  
ATOM 8804  H HA   . THR B 2 13 ? -11.384 7.929   7.419   1.00 0.00 ? 55  THR B HA   6  
ATOM 8805  H HB   . THR B 2 13 ? -9.791  8.795   9.070   1.00 0.00 ? 55  THR B HB   6  
ATOM 8806  H HG1  . THR B 2 13 ? -11.061 10.443  9.002   1.00 0.00 ? 55  THR B HG1  6  
ATOM 8807  H HG21 . THR B 2 13 ? -8.388  10.771  7.744   1.00 0.00 ? 55  THR B HG21 6  
ATOM 8808  H HG22 . THR B 2 13 ? -8.169  9.334   6.746   1.00 0.00 ? 55  THR B HG22 6  
ATOM 8809  H HG23 . THR B 2 13 ? -7.727  9.297   8.453   1.00 0.00 ? 55  THR B HG23 6  
ATOM 8810  N N    . GLY B 2 14 ? -11.173 8.105   4.812   1.00 0.00 ? 56  GLY B N    6  
ATOM 8811  C CA   . GLY B 2 14 ? -11.312 8.578   3.447   1.00 0.00 ? 56  GLY B CA   6  
ATOM 8812  C C    . GLY B 2 14 ? -11.843 7.509   2.514   1.00 0.00 ? 56  GLY B C    6  
ATOM 8813  O O    . GLY B 2 14 ? -12.552 7.809   1.552   1.00 0.00 ? 56  GLY B O    6  
ATOM 8814  H H    . GLY B 2 14 ? -11.603 7.267   5.084   1.00 0.00 ? 56  GLY B H    6  
ATOM 8815  H HA2  . GLY B 2 14 ? -11.990 9.420   3.437   1.00 0.00 ? 56  GLY B HA2  6  
ATOM 8816  H HA3  . GLY B 2 14 ? -10.347 8.904   3.091   1.00 0.00 ? 56  GLY B HA3  6  
ATOM 8817  N N    . GLU B 2 15 ? -11.502 6.256   2.797   1.00 0.00 ? 57  GLU B N    6  
ATOM 8818  C CA   . GLU B 2 15 ? -11.949 5.137   1.977   1.00 0.00 ? 57  GLU B CA   6  
ATOM 8819  C C    . GLU B 2 15 ? -13.471 5.045   1.964   1.00 0.00 ? 57  GLU B C    6  
ATOM 8820  O O    . GLU B 2 15 ? -14.014 4.366   1.068   1.00 0.00 ? 57  GLU B O    6  
ATOM 8821  C CB   . GLU B 2 15 ? -11.352 3.828   2.495   1.00 0.00 ? 57  GLU B CB   6  
ATOM 8822  C CG   . GLU B 2 15 ? -11.682 3.540   3.950   1.00 0.00 ? 57  GLU B CG   6  
ATOM 8823  C CD   . GLU B 2 15 ? -11.401 2.103   4.341   1.00 0.00 ? 57  GLU B CD   6  
ATOM 8824  O OE1  . GLU B 2 15 ? -10.288 1.617   4.052   1.00 0.00 ? 57  GLU B OE1  6  
ATOM 8825  O OE2  . GLU B 2 15 ? -12.295 1.463   4.933   1.00 0.00 ? 57  GLU B OE2  6  
ATOM 8826  O OXT  . GLU B 2 15 ? -14.108 5.653   2.851   1.00 0.00 ? 57  GLU B OXT  6  
ATOM 8827  H H    . GLU B 2 15 ? -10.936 6.080   3.578   1.00 0.00 ? 57  GLU B H    6  
ATOM 8828  H HA   . GLU B 2 15 ? -11.602 5.306   0.969   1.00 0.00 ? 57  GLU B HA   6  
ATOM 8829  H HB2  . GLU B 2 15 ? -11.728 3.011   1.896   1.00 0.00 ? 57  GLU B HB2  6  
ATOM 8830  H HB3  . GLU B 2 15 ? -10.277 3.870   2.394   1.00 0.00 ? 57  GLU B HB3  6  
ATOM 8831  H HG2  . GLU B 2 15 ? -11.088 4.190   4.577   1.00 0.00 ? 57  GLU B HG2  6  
ATOM 8832  H HG3  . GLU B 2 15 ? -12.730 3.745   4.115   1.00 0.00 ? 57  GLU B HG3  6  
ATOM 8833  N N    . PRO A 1 1  ? 2.480   13.217  -7.412  1.00 0.00 ? 31  PRO A N    7  
ATOM 8834  C CA   . PRO A 1 1  ? 1.577   13.964  -6.495  1.00 0.00 ? 31  PRO A CA   7  
ATOM 8835  C C    . PRO A 1 1  ? 1.146   13.110  -5.302  1.00 0.00 ? 31  PRO A C    7  
ATOM 8836  O O    . PRO A 1 1  ? -0.044  12.958  -5.029  1.00 0.00 ? 31  PRO A O    7  
ATOM 8837  C CB   . PRO A 1 1  ? 0.360   14.404  -7.307  1.00 0.00 ? 31  PRO A CB   7  
ATOM 8838  C CG   . PRO A 1 1  ? 0.710   14.050  -8.714  1.00 0.00 ? 31  PRO A CG   7  
ATOM 8839  C CD   . PRO A 1 1  ? 1.707   12.919  -8.630  1.00 0.00 ? 31  PRO A CD   7  
ATOM 8840  H H2   . PRO A 1 1  ? 2.797   12.427  -6.826  1.00 0.00 ? 31  PRO A H2   7  
ATOM 8841  H H3   . PRO A 1 1  ? 3.306   13.857  -7.459  1.00 0.00 ? 31  PRO A H3   7  
ATOM 8842  H HA   . PRO A 1 1  ? 2.099   14.837  -6.135  1.00 0.00 ? 31  PRO A HA   7  
ATOM 8843  H HB2  . PRO A 1 1  ? -0.517  13.872  -6.970  1.00 0.00 ? 31  PRO A HB2  7  
ATOM 8844  H HB3  . PRO A 1 1  ? 0.212   15.467  -7.195  1.00 0.00 ? 31  PRO A HB3  7  
ATOM 8845  H HG2  . PRO A 1 1  ? -0.176  13.730  -9.242  1.00 0.00 ? 31  PRO A HG2  7  
ATOM 8846  H HG3  . PRO A 1 1  ? 1.153   14.903  -9.206  1.00 0.00 ? 31  PRO A HG3  7  
ATOM 8847  H HD2  . PRO A 1 1  ? 1.194   11.973  -8.536  1.00 0.00 ? 31  PRO A HD2  7  
ATOM 8848  H HD3  . PRO A 1 1  ? 2.347   12.917  -9.498  1.00 0.00 ? 31  PRO A HD3  7  
ATOM 8849  N N    . VAL A 1 2  ? 2.126   12.554  -4.596  1.00 0.00 ? 32  VAL A N    7  
ATOM 8850  C CA   . VAL A 1 2  ? 1.861   11.721  -3.440  1.00 0.00 ? 32  VAL A CA   7  
ATOM 8851  C C    . VAL A 1 2  ? 1.173   12.513  -2.334  1.00 0.00 ? 32  VAL A C    7  
ATOM 8852  O O    . VAL A 1 2  ? 1.832   13.119  -1.489  1.00 0.00 ? 32  VAL A O    7  
ATOM 8853  C CB   . VAL A 1 2  ? 3.166   11.120  -2.894  1.00 0.00 ? 32  VAL A CB   7  
ATOM 8854  C CG1  . VAL A 1 2  ? 3.634   9.966   -3.765  1.00 0.00 ? 32  VAL A CG1  7  
ATOM 8855  C CG2  . VAL A 1 2  ? 4.247   12.186  -2.780  1.00 0.00 ? 32  VAL A CG2  7  
ATOM 8856  H H    . VAL A 1 2  ? 3.055   12.708  -4.856  1.00 0.00 ? 32  VAL A H    7  
ATOM 8857  H HA   . VAL A 1 2  ? 1.217   10.911  -3.750  1.00 0.00 ? 32  VAL A HA   7  
ATOM 8858  H HB   . VAL A 1 2  ? 2.969   10.740  -1.912  1.00 0.00 ? 32  VAL A HB   7  
ATOM 8859  H HG11 . VAL A 1 2  ? 3.888   10.337  -4.748  1.00 0.00 ? 32  VAL A HG11 7  
ATOM 8860  H HG12 . VAL A 1 2  ? 2.844   9.235   -3.850  1.00 0.00 ? 32  VAL A HG12 7  
ATOM 8861  H HG13 . VAL A 1 2  ? 4.504   9.507   -3.319  1.00 0.00 ? 32  VAL A HG13 7  
ATOM 8862  H HG21 . VAL A 1 2  ? 4.925   12.101  -3.616  1.00 0.00 ? 32  VAL A HG21 7  
ATOM 8863  H HG22 . VAL A 1 2  ? 4.792   12.049  -1.858  1.00 0.00 ? 32  VAL A HG22 7  
ATOM 8864  H HG23 . VAL A 1 2  ? 3.790   13.165  -2.786  1.00 0.00 ? 32  VAL A HG23 7  
ATOM 8865  N N    . HIS A 1 3  ? -0.156  12.504  -2.345  1.00 0.00 ? 33  HIS A N    7  
ATOM 8866  C CA   . HIS A 1 3  ? -0.933  13.222  -1.342  1.00 0.00 ? 33  HIS A CA   7  
ATOM 8867  C C    . HIS A 1 3  ? -2.220  12.473  -1.012  1.00 0.00 ? 33  HIS A C    7  
ATOM 8868  O O    . HIS A 1 3  ? -2.395  11.318  -1.401  1.00 0.00 ? 33  HIS A O    7  
ATOM 8869  C CB   . HIS A 1 3  ? -1.258  14.634  -1.833  1.00 0.00 ? 33  HIS A CB   7  
ATOM 8870  C CG   . HIS A 1 3  ? -0.997  15.697  -0.811  1.00 0.00 ? 33  HIS A CG   7  
ATOM 8871  N ND1  . HIS A 1 3  ? 0.046   15.635  0.089   1.00 0.00 ? 33  HIS A ND1  7  
ATOM 8872  C CD2  . HIS A 1 3  ? -1.650  16.854  -0.548  1.00 0.00 ? 33  HIS A CD2  7  
ATOM 8873  C CE1  . HIS A 1 3  ? 0.023   16.706  0.861   1.00 0.00 ? 33  HIS A CE1  7  
ATOM 8874  N NE2  . HIS A 1 3  ? -0.996  17.462  0.495   1.00 0.00 ? 33  HIS A NE2  7  
ATOM 8875  H H    . HIS A 1 3  ? -0.625  12.002  -3.044  1.00 0.00 ? 33  HIS A H    7  
ATOM 8876  H HA   . HIS A 1 3  ? -0.333  13.291  -0.447  1.00 0.00 ? 33  HIS A HA   7  
ATOM 8877  H HB2  . HIS A 1 3  ? -0.654  14.855  -2.701  1.00 0.00 ? 33  HIS A HB2  7  
ATOM 8878  H HB3  . HIS A 1 3  ? -2.302  14.683  -2.106  1.00 0.00 ? 33  HIS A HB3  7  
ATOM 8879  H HD1  . HIS A 1 3  ? 0.705   14.912  0.153   1.00 0.00 ? 33  HIS A HD1  7  
ATOM 8880  H HD2  . HIS A 1 3  ? -2.523  17.230  -1.063  1.00 0.00 ? 33  HIS A HD2  7  
ATOM 8881  H HE1  . HIS A 1 3  ? 0.720   16.928  1.657   1.00 0.00 ? 33  HIS A HE1  7  
ATOM 8882  H HE2  . HIS A 1 3  ? -1.185  18.359  0.841   1.00 0.00 ? 33  HIS A HE2  7  
ATOM 8883  N N    . VAL A 1 4  ? -3.118  13.139  -0.294  1.00 0.00 ? 34  VAL A N    7  
ATOM 8884  C CA   . VAL A 1 4  ? -4.389  12.538  0.090   1.00 0.00 ? 34  VAL A CA   7  
ATOM 8885  C C    . VAL A 1 4  ? -5.179  12.094  -1.136  1.00 0.00 ? 34  VAL A C    7  
ATOM 8886  O O    . VAL A 1 4  ? -5.933  11.123  -1.084  1.00 0.00 ? 34  VAL A O    7  
ATOM 8887  C CB   . VAL A 1 4  ? -5.247  13.516  0.913   1.00 0.00 ? 34  VAL A CB   7  
ATOM 8888  C CG1  . VAL A 1 4  ? -6.473  12.813  1.473   1.00 0.00 ? 34  VAL A CG1  7  
ATOM 8889  C CG2  . VAL A 1 4  ? -4.422  14.138  2.031   1.00 0.00 ? 34  VAL A CG2  7  
ATOM 8890  H H    . VAL A 1 4  ? -2.920  14.058  -0.014  1.00 0.00 ? 34  VAL A H    7  
ATOM 8891  H HA   . VAL A 1 4  ? -4.179  11.673  0.702   1.00 0.00 ? 34  VAL A HA   7  
ATOM 8892  H HB   . VAL A 1 4  ? -5.582  14.308  0.259   1.00 0.00 ? 34  VAL A HB   7  
ATOM 8893  H HG11 . VAL A 1 4  ? -6.695  11.942  0.872   1.00 0.00 ? 34  VAL A HG11 7  
ATOM 8894  H HG12 . VAL A 1 4  ? -7.316  13.488  1.453   1.00 0.00 ? 34  VAL A HG12 7  
ATOM 8895  H HG13 . VAL A 1 4  ? -6.280  12.507  2.491   1.00 0.00 ? 34  VAL A HG13 7  
ATOM 8896  H HG21 . VAL A 1 4  ? -5.050  14.298  2.895   1.00 0.00 ? 34  VAL A HG21 7  
ATOM 8897  H HG22 . VAL A 1 4  ? -4.020  15.083  1.698   1.00 0.00 ? 34  VAL A HG22 7  
ATOM 8898  H HG23 . VAL A 1 4  ? -3.612  13.474  2.292   1.00 0.00 ? 34  VAL A HG23 7  
ATOM 8899  N N    . GLU A 1 5  ? -5.001  12.813  -2.241  1.00 0.00 ? 35  GLU A N    7  
ATOM 8900  C CA   . GLU A 1 5  ? -5.697  12.492  -3.481  1.00 0.00 ? 35  GLU A CA   7  
ATOM 8901  C C    . GLU A 1 5  ? -5.104  11.245  -4.128  1.00 0.00 ? 35  GLU A C    7  
ATOM 8902  O O    . GLU A 1 5  ? -5.826  10.423  -4.693  1.00 0.00 ? 35  GLU A O    7  
ATOM 8903  C CB   . GLU A 1 5  ? -5.625  13.672  -4.453  1.00 0.00 ? 35  GLU A CB   7  
ATOM 8904  C CG   . GLU A 1 5  ? -6.939  13.956  -5.162  1.00 0.00 ? 35  GLU A CG   7  
ATOM 8905  C CD   . GLU A 1 5  ? -6.825  13.845  -6.670  1.00 0.00 ? 35  GLU A CD   7  
ATOM 8906  O OE1  . GLU A 1 5  ? -6.568  12.729  -7.166  1.00 0.00 ? 35  GLU A OE1  7  
ATOM 8907  O OE2  . GLU A 1 5  ? -6.993  14.877  -7.355  1.00 0.00 ? 35  GLU A OE2  7  
ATOM 8908  H H    . GLU A 1 5  ? -4.386  13.576  -2.221  1.00 0.00 ? 35  GLU A H    7  
ATOM 8909  H HA   . GLU A 1 5  ? -6.732  12.300  -3.239  1.00 0.00 ? 35  GLU A HA   7  
ATOM 8910  H HB2  . GLU A 1 5  ? -5.338  14.557  -3.903  1.00 0.00 ? 35  GLU A HB2  7  
ATOM 8911  H HB3  . GLU A 1 5  ? -4.873  13.465  -5.200  1.00 0.00 ? 35  GLU A HB3  7  
ATOM 8912  H HG2  . GLU A 1 5  ? -7.678  13.247  -4.821  1.00 0.00 ? 35  GLU A HG2  7  
ATOM 8913  H HG3  . GLU A 1 5  ? -7.259  14.957  -4.912  1.00 0.00 ? 35  GLU A HG3  7  
ATOM 8914  N N    . ASP A 1 6  ? -3.785  11.109  -4.040  1.00 0.00 ? 36  ASP A N    7  
ATOM 8915  C CA   . ASP A 1 6  ? -3.094  9.960   -4.616  1.00 0.00 ? 36  ASP A CA   7  
ATOM 8916  C C    . ASP A 1 6  ? -3.467  8.680   -3.877  1.00 0.00 ? 36  ASP A C    7  
ATOM 8917  O O    . ASP A 1 6  ? -3.723  7.646   -4.496  1.00 0.00 ? 36  ASP A O    7  
ATOM 8918  C CB   . ASP A 1 6  ? -1.580  10.170  -4.566  1.00 0.00 ? 36  ASP A CB   7  
ATOM 8919  C CG   . ASP A 1 6  ? -0.823  9.115   -5.352  1.00 0.00 ? 36  ASP A CG   7  
ATOM 8920  O OD1  . ASP A 1 6  ? -1.434  8.084   -5.704  1.00 0.00 ? 36  ASP A OD1  7  
ATOM 8921  O OD2  . ASP A 1 6  ? 0.380   9.322   -5.615  1.00 0.00 ? 36  ASP A OD2  7  
ATOM 8922  H H    . ASP A 1 6  ? -3.263  11.796  -3.576  1.00 0.00 ? 36  ASP A H    7  
ATOM 8923  H HA   . ASP A 1 6  ? -3.403  9.870   -5.646  1.00 0.00 ? 36  ASP A HA   7  
ATOM 8924  H HB2  . ASP A 1 6  ? -1.344  11.138  -4.980  1.00 0.00 ? 36  ASP A HB2  7  
ATOM 8925  H HB3  . ASP A 1 6  ? -1.251  10.131  -3.538  1.00 0.00 ? 36  ASP A HB3  7  
ATOM 8926  N N    . ALA A 1 7  ? -3.496  8.755   -2.551  1.00 0.00 ? 37  ALA A N    7  
ATOM 8927  C CA   . ALA A 1 7  ? -3.839  7.602   -1.729  1.00 0.00 ? 37  ALA A CA   7  
ATOM 8928  C C    . ALA A 1 7  ? -5.315  7.249   -1.868  1.00 0.00 ? 37  ALA A C    7  
ATOM 8929  O O    . ALA A 1 7  ? -5.687  6.075   -1.859  1.00 0.00 ? 37  ALA A O    7  
ATOM 8930  C CB   . ALA A 1 7  ? -3.493  7.872   -0.272  1.00 0.00 ? 37  ALA A CB   7  
ATOM 8931  H H    . ALA A 1 7  ? -3.283  9.607   -2.115  1.00 0.00 ? 37  ALA A H    7  
ATOM 8932  H HA   . ALA A 1 7  ? -3.246  6.764   -2.066  1.00 0.00 ? 37  ALA A HA   7  
ATOM 8933  H HB1  . ALA A 1 7  ? -3.542  8.934   -0.082  1.00 0.00 ? 37  ALA A HB1  7  
ATOM 8934  H HB2  . ALA A 1 7  ? -2.495  7.513   -0.066  1.00 0.00 ? 37  ALA A HB2  7  
ATOM 8935  H HB3  . ALA A 1 7  ? -4.199  7.359   0.366   1.00 0.00 ? 37  ALA A HB3  7  
ATOM 8936  N N    . LEU A 1 8  ? -6.154  8.272   -1.995  1.00 0.00 ? 38  LEU A N    7  
ATOM 8937  C CA   . LEU A 1 8  ? -7.591  8.070   -2.136  1.00 0.00 ? 38  LEU A CA   7  
ATOM 8938  C C    . LEU A 1 8  ? -7.909  7.289   -3.408  1.00 0.00 ? 38  LEU A C    7  
ATOM 8939  O O    . LEU A 1 8  ? -8.559  6.244   -3.360  1.00 0.00 ? 38  LEU A O    7  
ATOM 8940  C CB   . LEU A 1 8  ? -8.318  9.417   -2.152  1.00 0.00 ? 38  LEU A CB   7  
ATOM 8941  C CG   . LEU A 1 8  ? -9.079  9.756   -0.868  1.00 0.00 ? 38  LEU A CG   7  
ATOM 8942  C CD1  . LEU A 1 8  ? -9.615  11.178  -0.925  1.00 0.00 ? 38  LEU A CD1  7  
ATOM 8943  C CD2  . LEU A 1 8  ? -10.211 8.766   -0.643  1.00 0.00 ? 38  LEU A CD2  7  
ATOM 8944  H H    . LEU A 1 8  ? -5.798  9.185   -1.995  1.00 0.00 ? 38  LEU A H    7  
ATOM 8945  H HA   . LEU A 1 8  ? -7.929  7.499   -1.285  1.00 0.00 ? 38  LEU A HA   7  
ATOM 8946  H HB2  . LEU A 1 8  ? -7.589  10.194  -2.328  1.00 0.00 ? 38  LEU A HB2  7  
ATOM 8947  H HB3  . LEU A 1 8  ? -9.023  9.416   -2.970  1.00 0.00 ? 38  LEU A HB3  7  
ATOM 8948  H HG   . LEU A 1 8  ? -8.402  9.689   -0.027  1.00 0.00 ? 38  LEU A HG   7  
ATOM 8949  H HD11 . LEU A 1 8  ? -9.780  11.541  0.079   1.00 0.00 ? 38  LEU A HD11 7  
ATOM 8950  H HD12 . LEU A 1 8  ? -10.549 11.189  -1.470  1.00 0.00 ? 38  LEU A HD12 7  
ATOM 8951  H HD13 . LEU A 1 8  ? -8.899  11.814  -1.425  1.00 0.00 ? 38  LEU A HD13 7  
ATOM 8952  H HD21 . LEU A 1 8  ? -10.900 8.812   -1.474  1.00 0.00 ? 38  LEU A HD21 7  
ATOM 8953  H HD22 . LEU A 1 8  ? -10.731 9.015   0.270   1.00 0.00 ? 38  LEU A HD22 7  
ATOM 8954  H HD23 . LEU A 1 8  ? -9.806  7.768   -0.566  1.00 0.00 ? 38  LEU A HD23 7  
ATOM 8955  N N    . THR A 1 9  ? -7.446  7.801   -4.543  1.00 0.00 ? 39  THR A N    7  
ATOM 8956  C CA   . THR A 1 9  ? -7.682  7.151   -5.828  1.00 0.00 ? 39  THR A CA   7  
ATOM 8957  C C    . THR A 1 9  ? -7.110  5.737   -5.835  1.00 0.00 ? 39  THR A C    7  
ATOM 8958  O O    . THR A 1 9  ? -7.753  4.796   -6.301  1.00 0.00 ? 39  THR A O    7  
ATOM 8959  C CB   . THR A 1 9  ? -7.064  7.972   -6.964  1.00 0.00 ? 39  THR A CB   7  
ATOM 8960  O OG1  . THR A 1 9  ? -7.644  7.620   -8.208  1.00 0.00 ? 39  THR A OG1  7  
ATOM 8961  C CG2  . THR A 1 9  ? -5.563  7.800   -7.094  1.00 0.00 ? 39  THR A CG2  7  
ATOM 8962  H H    . THR A 1 9  ? -6.934  8.637   -4.519  1.00 0.00 ? 39  THR A H    7  
ATOM 8963  H HA   . THR A 1 9  ? -8.750  7.093   -5.977  1.00 0.00 ? 39  THR A HA   7  
ATOM 8964  H HB   . THR A 1 9  ? -7.262  9.019   -6.784  1.00 0.00 ? 39  THR A HB   7  
ATOM 8965  H HG1  . THR A 1 9  ? -7.247  8.145   -8.906  1.00 0.00 ? 39  THR A HG1  7  
ATOM 8966  H HG21 . THR A 1 9  ? -5.081  8.160   -6.198  1.00 0.00 ? 39  THR A HG21 7  
ATOM 8967  H HG22 . THR A 1 9  ? -5.209  8.362   -7.945  1.00 0.00 ? 39  THR A HG22 7  
ATOM 8968  H HG23 . THR A 1 9  ? -5.330  6.752   -7.232  1.00 0.00 ? 39  THR A HG23 7  
ATOM 8969  N N    . TYR A 1 10 ? -5.892  5.598   -5.323  1.00 0.00 ? 40  TYR A N    7  
ATOM 8970  C CA   . TYR A 1 10 ? -5.222  4.305   -5.276  1.00 0.00 ? 40  TYR A CA   7  
ATOM 8971  C C    . TYR A 1 10 ? -6.100  3.256   -4.599  1.00 0.00 ? 40  TYR A C    7  
ATOM 8972  O O    . TYR A 1 10 ? -6.128  2.096   -5.012  1.00 0.00 ? 40  TYR A O    7  
ATOM 8973  C CB   . TYR A 1 10 ? -3.888  4.423   -4.538  1.00 0.00 ? 40  TYR A CB   7  
ATOM 8974  C CG   . TYR A 1 10 ? -3.089  3.139   -4.522  1.00 0.00 ? 40  TYR A CG   7  
ATOM 8975  C CD1  . TYR A 1 10 ? -2.186  2.848   -5.536  1.00 0.00 ? 40  TYR A CD1  7  
ATOM 8976  C CD2  . TYR A 1 10 ? -3.239  2.218   -3.492  1.00 0.00 ? 40  TYR A CD2  7  
ATOM 8977  C CE1  . TYR A 1 10 ? -1.456  1.675   -5.526  1.00 0.00 ? 40  TYR A CE1  7  
ATOM 8978  C CE2  . TYR A 1 10 ? -2.511  1.043   -3.474  1.00 0.00 ? 40  TYR A CE2  7  
ATOM 8979  C CZ   . TYR A 1 10 ? -1.621  0.776   -4.493  1.00 0.00 ? 40  TYR A CZ   7  
ATOM 8980  O OH   . TYR A 1 10 ? -0.895  -0.391  -4.479  1.00 0.00 ? 40  TYR A OH   7  
ATOM 8981  H H    . TYR A 1 10 ? -5.429  6.388   -4.972  1.00 0.00 ? 40  TYR A H    7  
ATOM 8982  H HA   . TYR A 1 10 ? -5.033  3.999   -6.294  1.00 0.00 ? 40  TYR A HA   7  
ATOM 8983  H HB2  . TYR A 1 10 ? -3.286  5.182   -5.015  1.00 0.00 ? 40  TYR A HB2  7  
ATOM 8984  H HB3  . TYR A 1 10 ? -4.075  4.711   -3.513  1.00 0.00 ? 40  TYR A HB3  7  
ATOM 8985  H HD1  . TYR A 1 10 ? -2.058  3.554   -6.343  1.00 0.00 ? 40  TYR A HD1  7  
ATOM 8986  H HD2  . TYR A 1 10 ? -3.938  2.430   -2.697  1.00 0.00 ? 40  TYR A HD2  7  
ATOM 8987  H HE1  . TYR A 1 10 ? -0.758  1.467   -6.323  1.00 0.00 ? 40  TYR A HE1  7  
ATOM 8988  H HE2  . TYR A 1 10 ? -2.642  0.340   -2.666  1.00 0.00 ? 40  TYR A HE2  7  
ATOM 8989  H HH   . TYR A 1 10 ? 0.005   -0.214  -4.763  1.00 0.00 ? 40  TYR A HH   7  
ATOM 8990  N N    . LEU A 1 11 ? -6.814  3.671   -3.558  1.00 0.00 ? 41  LEU A N    7  
ATOM 8991  C CA   . LEU A 1 11 ? -7.693  2.766   -2.823  1.00 0.00 ? 41  LEU A CA   7  
ATOM 8992  C C    . LEU A 1 11 ? -8.935  2.430   -3.641  1.00 0.00 ? 41  LEU A C    7  
ATOM 8993  O O    . LEU A 1 11 ? -9.319  1.266   -3.753  1.00 0.00 ? 41  LEU A O    7  
ATOM 8994  C CB   . LEU A 1 11 ? -8.101  3.391   -1.488  1.00 0.00 ? 41  LEU A CB   7  
ATOM 8995  C CG   . LEU A 1 11 ? -7.095  3.204   -0.351  1.00 0.00 ? 41  LEU A CG   7  
ATOM 8996  C CD1  . LEU A 1 11 ? -7.249  4.308   0.684   1.00 0.00 ? 41  LEU A CD1  7  
ATOM 8997  C CD2  . LEU A 1 11 ? -7.271  1.838   0.295   1.00 0.00 ? 41  LEU A CD2  7  
ATOM 8998  H H    . LEU A 1 11 ? -6.749  4.607   -3.277  1.00 0.00 ? 41  LEU A H    7  
ATOM 8999  H HA   . LEU A 1 11 ? -7.144  1.856   -2.632  1.00 0.00 ? 41  LEU A HA   7  
ATOM 9000  H HB2  . LEU A 1 11 ? -8.248  4.451   -1.641  1.00 0.00 ? 41  LEU A HB2  7  
ATOM 9001  H HB3  . LEU A 1 11 ? -9.040  2.955   -1.183  1.00 0.00 ? 41  LEU A HB3  7  
ATOM 9002  H HG   . LEU A 1 11 ? -6.093  3.260   -0.751  1.00 0.00 ? 41  LEU A HG   7  
ATOM 9003  H HD11 . LEU A 1 11 ? -7.710  5.170   0.225   1.00 0.00 ? 41  LEU A HD11 7  
ATOM 9004  H HD12 . LEU A 1 11 ? -6.277  4.581   1.065   1.00 0.00 ? 41  LEU A HD12 7  
ATOM 9005  H HD13 . LEU A 1 11 ? -7.868  3.958   1.496   1.00 0.00 ? 41  LEU A HD13 7  
ATOM 9006  H HD21 . LEU A 1 11 ? -6.778  1.089   -0.308  1.00 0.00 ? 41  LEU A HD21 7  
ATOM 9007  H HD22 . LEU A 1 11 ? -8.323  1.606   0.367   1.00 0.00 ? 41  LEU A HD22 7  
ATOM 9008  H HD23 . LEU A 1 11 ? -6.836  1.848   1.283   1.00 0.00 ? 41  LEU A HD23 7  
ATOM 9009  N N    . ASP A 1 12 ? -9.561  3.456   -4.210  1.00 0.00 ? 42  ASP A N    7  
ATOM 9010  C CA   . ASP A 1 12 ? -10.761 3.265   -5.015  1.00 0.00 ? 42  ASP A CA   7  
ATOM 9011  C C    . ASP A 1 12 ? -10.483 2.348   -6.198  1.00 0.00 ? 42  ASP A C    7  
ATOM 9012  O O    . ASP A 1 12 ? -11.358 1.606   -6.645  1.00 0.00 ? 42  ASP A O    7  
ATOM 9013  C CB   . ASP A 1 12 ? -11.288 4.613   -5.511  1.00 0.00 ? 42  ASP A CB   7  
ATOM 9014  C CG   . ASP A 1 12 ? -12.179 5.297   -4.492  1.00 0.00 ? 42  ASP A CG   7  
ATOM 9015  O OD1  . ASP A 1 12 ? -11.662 5.702   -3.429  1.00 0.00 ? 42  ASP A OD1  7  
ATOM 9016  O OD2  . ASP A 1 12 ? -13.392 5.428   -4.756  1.00 0.00 ? 42  ASP A OD2  7  
ATOM 9017  H H    . ASP A 1 12 ? -9.208  4.361   -4.083  1.00 0.00 ? 42  ASP A H    7  
ATOM 9018  H HA   . ASP A 1 12 ? -11.506 2.806   -4.391  1.00 0.00 ? 42  ASP A HA   7  
ATOM 9019  H HB2  . ASP A 1 12 ? -10.453 5.263   -5.725  1.00 0.00 ? 42  ASP A HB2  7  
ATOM 9020  H HB3  . ASP A 1 12 ? -11.860 4.458   -6.415  1.00 0.00 ? 42  ASP A HB3  7  
ATOM 9021  N N    . GLN A 1 13 ? -9.258  2.404   -6.696  1.00 0.00 ? 43  GLN A N    7  
ATOM 9022  C CA   . GLN A 1 13 ? -8.852  1.579   -7.827  1.00 0.00 ? 43  GLN A CA   7  
ATOM 9023  C C    . GLN A 1 13 ? -8.685  0.129   -7.404  1.00 0.00 ? 43  GLN A C    7  
ATOM 9024  O O    . GLN A 1 13 ? -9.168  -0.788  -8.068  1.00 0.00 ? 43  GLN A O    7  
ATOM 9025  C CB   . GLN A 1 13 ? -7.546  2.103   -8.428  1.00 0.00 ? 43  GLN A CB   7  
ATOM 9026  C CG   . GLN A 1 13 ? -7.738  3.289   -9.359  1.00 0.00 ? 43  GLN A CG   7  
ATOM 9027  C CD   . GLN A 1 13 ? -6.611  3.426   -10.364 1.00 0.00 ? 43  GLN A CD   7  
ATOM 9028  O OE1  . GLN A 1 13 ? -5.555  2.813   -10.218 1.00 0.00 ? 43  GLN A OE1  7  
ATOM 9029  N NE2  . GLN A 1 13 ? -6.833  4.235   -11.394 1.00 0.00 ? 43  GLN A NE2  7  
ATOM 9030  H H    . GLN A 1 13 ? -8.609  3.015   -6.290  1.00 0.00 ? 43  GLN A H    7  
ATOM 9031  H HA   . GLN A 1 13 ? -9.626  1.632   -8.567  1.00 0.00 ? 43  GLN A HA   7  
ATOM 9032  H HB2  . GLN A 1 13 ? -6.890  2.404   -7.625  1.00 0.00 ? 43  GLN A HB2  7  
ATOM 9033  H HB3  . GLN A 1 13 ? -7.076  1.306   -8.986  1.00 0.00 ? 43  GLN A HB3  7  
ATOM 9034  H HG2  . GLN A 1 13 ? -8.666  3.164   -9.896  1.00 0.00 ? 43  GLN A HG2  7  
ATOM 9035  H HG3  . GLN A 1 13 ? -7.784  4.191   -8.766  1.00 0.00 ? 43  GLN A HG3  7  
ATOM 9036  H HE21 . GLN A 1 13 ? -7.699  4.691   -11.448 1.00 0.00 ? 43  GLN A HE21 7  
ATOM 9037  H HE22 . GLN A 1 13 ? -6.122  4.342   -12.060 1.00 0.00 ? 43  GLN A HE22 7  
ATOM 9038  N N    . VAL A 1 14 ? -8.002  -0.063  -6.290  1.00 0.00 ? 44  VAL A N    7  
ATOM 9039  C CA   . VAL A 1 14 ? -7.762  -1.398  -5.754  1.00 0.00 ? 44  VAL A CA   7  
ATOM 9040  C C    . VAL A 1 14 ? -9.063  -2.058  -5.306  1.00 0.00 ? 44  VAL A C    7  
ATOM 9041  O O    . VAL A 1 14 ? -9.118  -3.272  -5.115  1.00 0.00 ? 44  VAL A O    7  
ATOM 9042  C CB   . VAL A 1 14 ? -6.783  -1.359  -4.564  1.00 0.00 ? 44  VAL A CB   7  
ATOM 9043  C CG1  . VAL A 1 14 ? -6.427  -2.771  -4.120  1.00 0.00 ? 44  VAL A CG1  7  
ATOM 9044  C CG2  . VAL A 1 14 ? -5.530  -0.575  -4.927  1.00 0.00 ? 44  VAL A CG2  7  
ATOM 9045  H H    . VAL A 1 14 ? -7.654  0.716   -5.814  1.00 0.00 ? 44  VAL A H    7  
ATOM 9046  H HA   . VAL A 1 14 ? -7.320  -1.996  -6.538  1.00 0.00 ? 44  VAL A HA   7  
ATOM 9047  H HB   . VAL A 1 14 ? -7.269  -0.859  -3.741  1.00 0.00 ? 44  VAL A HB   7  
ATOM 9048  H HG11 . VAL A 1 14 ? -6.581  -3.456  -4.940  1.00 0.00 ? 44  VAL A HG11 7  
ATOM 9049  H HG12 . VAL A 1 14 ? -7.055  -3.055  -3.289  1.00 0.00 ? 44  VAL A HG12 7  
ATOM 9050  H HG13 . VAL A 1 14 ? -5.392  -2.801  -3.814  1.00 0.00 ? 44  VAL A HG13 7  
ATOM 9051  H HG21 . VAL A 1 14 ? -5.725  0.034   -5.798  1.00 0.00 ? 44  VAL A HG21 7  
ATOM 9052  H HG22 . VAL A 1 14 ? -4.725  -1.263  -5.141  1.00 0.00 ? 44  VAL A HG22 7  
ATOM 9053  H HG23 . VAL A 1 14 ? -5.251  0.060   -4.099  1.00 0.00 ? 44  VAL A HG23 7  
ATOM 9054  N N    . LYS A 1 15 ? -10.109 -1.253  -5.138  1.00 0.00 ? 45  LYS A N    7  
ATOM 9055  C CA   . LYS A 1 15 ? -11.406 -1.766  -4.711  1.00 0.00 ? 45  LYS A CA   7  
ATOM 9056  C C    . LYS A 1 15 ? -12.215 -2.269  -5.904  1.00 0.00 ? 45  LYS A C    7  
ATOM 9057  O O    . LYS A 1 15 ? -12.830 -3.333  -5.844  1.00 0.00 ? 45  LYS A O    7  
ATOM 9058  C CB   . LYS A 1 15 ? -12.187 -0.679  -3.973  1.00 0.00 ? 45  LYS A CB   7  
ATOM 9059  C CG   . LYS A 1 15 ? -13.383 -1.209  -3.197  1.00 0.00 ? 45  LYS A CG   7  
ATOM 9060  C CD   . LYS A 1 15 ? -14.022 -0.121  -2.350  1.00 0.00 ? 45  LYS A CD   7  
ATOM 9061  C CE   . LYS A 1 15 ? -14.818 -0.709  -1.195  1.00 0.00 ? 45  LYS A CE   7  
ATOM 9062  N NZ   . LYS A 1 15 ? -14.636 0.072   0.059   1.00 0.00 ? 45  LYS A NZ   7  
ATOM 9063  H H    . LYS A 1 15 ? -10.008 -0.293  -5.303  1.00 0.00 ? 45  LYS A H    7  
ATOM 9064  H HA   . LYS A 1 15 ? -11.230 -2.592  -4.037  1.00 0.00 ? 45  LYS A HA   7  
ATOM 9065  H HB2  . LYS A 1 15 ? -11.525 -0.185  -3.277  1.00 0.00 ? 45  LYS A HB2  7  
ATOM 9066  H HB3  . LYS A 1 15 ? -12.544 0.044   -4.692  1.00 0.00 ? 45  LYS A HB3  7  
ATOM 9067  H HG2  . LYS A 1 15 ? -14.116 -1.584  -3.896  1.00 0.00 ? 45  LYS A HG2  7  
ATOM 9068  H HG3  . LYS A 1 15 ? -13.055 -2.010  -2.551  1.00 0.00 ? 45  LYS A HG3  7  
ATOM 9069  H HD2  . LYS A 1 15 ? -13.247 0.514   -1.951  1.00 0.00 ? 45  LYS A HD2  7  
ATOM 9070  H HD3  . LYS A 1 15 ? -14.686 0.463   -2.971  1.00 0.00 ? 45  LYS A HD3  7  
ATOM 9071  H HE2  . LYS A 1 15 ? -15.865 -0.710  -1.460  1.00 0.00 ? 45  LYS A HE2  7  
ATOM 9072  H HE3  . LYS A 1 15 ? -14.489 -1.725  -1.029  1.00 0.00 ? 45  LYS A HE3  7  
ATOM 9073  H HZ1  . LYS A 1 15 ? -13.640 0.354   0.164   1.00 0.00 ? 45  LYS A HZ1  7  
ATOM 9074  H HZ2  . LYS A 1 15 ? -14.911 -0.504  0.881   1.00 0.00 ? 45  LYS A HZ2  7  
ATOM 9075  H HZ3  . LYS A 1 15 ? -15.226 0.928   0.037   1.00 0.00 ? 45  LYS A HZ3  7  
ATOM 9076  N N    . ILE A 1 16 ? -12.214 -1.493  -6.983  1.00 0.00 ? 46  ILE A N    7  
ATOM 9077  C CA   . ILE A 1 16 ? -12.952 -1.857  -8.186  1.00 0.00 ? 46  ILE A CA   7  
ATOM 9078  C C    . ILE A 1 16 ? -12.368 -3.108  -8.841  1.00 0.00 ? 46  ILE A C    7  
ATOM 9079  O O    . ILE A 1 16 ? -13.075 -4.093  -9.056  1.00 0.00 ? 46  ILE A O    7  
ATOM 9080  C CB   . ILE A 1 16 ? -12.959 -0.707  -9.213  1.00 0.00 ? 46  ILE A CB   7  
ATOM 9081  C CG1  . ILE A 1 16 ? -13.458 0.584   -8.561  1.00 0.00 ? 46  ILE A CG1  7  
ATOM 9082  C CG2  . ILE A 1 16 ? -13.825 -1.068  -10.411 1.00 0.00 ? 46  ILE A CG2  7  
ATOM 9083  C CD1  . ILE A 1 16 ? -12.942 1.838   -9.232  1.00 0.00 ? 46  ILE A CD1  7  
ATOM 9084  H H    . ILE A 1 16 ? -11.709 -0.654  -6.969  1.00 0.00 ? 46  ILE A H    7  
ATOM 9085  H HA   . ILE A 1 16 ? -13.972 -2.059  -7.899  1.00 0.00 ? 46  ILE A HA   7  
ATOM 9086  H HB   . ILE A 1 16 ? -11.948 -0.559  -9.562  1.00 0.00 ? 46  ILE A HB   7  
ATOM 9087  H HG12 . ILE A 1 16 ? -14.536 0.607   -8.602  1.00 0.00 ? 46  ILE A HG12 7  
ATOM 9088  H HG13 . ILE A 1 16 ? -13.140 0.605   -7.528  1.00 0.00 ? 46  ILE A HG13 7  
ATOM 9089  H HG21 . ILE A 1 16 ? -14.244 -0.167  -10.836 1.00 0.00 ? 46  ILE A HG21 7  
ATOM 9090  H HG22 . ILE A 1 16 ? -14.624 -1.722  -10.095 1.00 0.00 ? 46  ILE A HG22 7  
ATOM 9091  H HG23 . ILE A 1 16 ? -13.222 -1.568  -11.154 1.00 0.00 ? 46  ILE A HG23 7  
ATOM 9092  H HD11 . ILE A 1 16 ? -13.762 2.522   -9.394  1.00 0.00 ? 46  ILE A HD11 7  
ATOM 9093  H HD12 . ILE A 1 16 ? -12.496 1.581   -10.182 1.00 0.00 ? 46  ILE A HD12 7  
ATOM 9094  H HD13 . ILE A 1 16 ? -12.202 2.306   -8.601  1.00 0.00 ? 46  ILE A HD13 7  
ATOM 9095  N N    . ARG A 1 17 ? -11.079 -3.059  -9.164  1.00 0.00 ? 47  ARG A N    7  
ATOM 9096  C CA   . ARG A 1 17 ? -10.408 -4.188  -9.803  1.00 0.00 ? 47  ARG A CA   7  
ATOM 9097  C C    . ARG A 1 17 ? -10.541 -5.457  -8.966  1.00 0.00 ? 47  ARG A C    7  
ATOM 9098  O O    . ARG A 1 17 ? -10.533 -6.566  -9.501  1.00 0.00 ? 47  ARG A O    7  
ATOM 9099  C CB   . ARG A 1 17 ? -8.931  -3.867  -10.038 1.00 0.00 ? 47  ARG A CB   7  
ATOM 9100  C CG   . ARG A 1 17 ? -8.178  -3.481  -8.775  1.00 0.00 ? 47  ARG A CG   7  
ATOM 9101  C CD   . ARG A 1 17 ? -7.039  -2.518  -9.075  1.00 0.00 ? 47  ARG A CD   7  
ATOM 9102  N NE   . ARG A 1 17 ? -6.283  -2.914  -10.261 1.00 0.00 ? 47  ARG A NE   7  
ATOM 9103  C CZ   . ARG A 1 17 ? -5.517  -2.081  -10.965 1.00 0.00 ? 47  ARG A CZ   7  
ATOM 9104  N NH1  . ARG A 1 17 ? -5.398  -0.810  -10.601 1.00 0.00 ? 47  ARG A NH1  7  
ATOM 9105  N NH2  . ARG A 1 17 ? -4.869  -2.521  -12.034 1.00 0.00 ? 47  ARG A NH2  7  
ATOM 9106  H H    . ARG A 1 17 ? -10.569 -2.244  -8.973  1.00 0.00 ? 47  ARG A H    7  
ATOM 9107  H HA   . ARG A 1 17 ? -10.884 -4.353  -10.758 1.00 0.00 ? 47  ARG A HA   7  
ATOM 9108  H HB2  . ARG A 1 17 ? -8.450  -4.735  -10.465 1.00 0.00 ? 47  ARG A HB2  7  
ATOM 9109  H HB3  . ARG A 1 17 ? -8.860  -3.047  -10.738 1.00 0.00 ? 47  ARG A HB3  7  
ATOM 9110  H HG2  . ARG A 1 17 ? -8.865  -3.008  -8.089  1.00 0.00 ? 47  ARG A HG2  7  
ATOM 9111  H HG3  . ARG A 1 17 ? -7.773  -4.374  -8.322  1.00 0.00 ? 47  ARG A HG3  7  
ATOM 9112  H HD2  . ARG A 1 17 ? -7.452  -1.534  -9.237  1.00 0.00 ? 47  ARG A HD2  7  
ATOM 9113  H HD3  . ARG A 1 17 ? -6.373  -2.493  -8.226  1.00 0.00 ? 47  ARG A HD3  7  
ATOM 9114  H HE   . ARG A 1 17 ? -6.351  -3.847  -10.551 1.00 0.00 ? 47  ARG A HE   7  
ATOM 9115  H HH11 . ARG A 1 17 ? -5.883  -0.471  -9.795  1.00 0.00 ? 47  ARG A HH11 7  
ATOM 9116  H HH12 . ARG A 1 17 ? -4.820  -0.191  -11.133 1.00 0.00 ? 47  ARG A HH12 7  
ATOM 9117  H HH21 . ARG A 1 17 ? -4.954  -3.477  -12.313 1.00 0.00 ? 47  ARG A HH21 7  
ATOM 9118  H HH22 . ARG A 1 17 ? -4.293  -1.895  -12.562 1.00 0.00 ? 47  ARG A HH22 7  
ATOM 9119  N N    . PHE A 1 18 ? -10.666 -5.291  -7.654  1.00 0.00 ? 48  PHE A N    7  
ATOM 9120  C CA   . PHE A 1 18 ? -10.803 -6.429  -6.750  1.00 0.00 ? 48  PHE A CA   7  
ATOM 9121  C C    . PHE A 1 18 ? -12.148 -6.393  -6.032  1.00 0.00 ? 48  PHE A C    7  
ATOM 9122  O O    . PHE A 1 18 ? -12.238 -6.700  -4.844  1.00 0.00 ? 48  PHE A O    7  
ATOM 9123  C CB   . PHE A 1 18 ? -9.665  -6.439  -5.728  1.00 0.00 ? 48  PHE A CB   7  
ATOM 9124  C CG   . PHE A 1 18 ? -8.376  -6.988  -6.268  1.00 0.00 ? 48  PHE A CG   7  
ATOM 9125  C CD1  . PHE A 1 18 ? -8.287  -8.311  -6.673  1.00 0.00 ? 48  PHE A CD1  7  
ATOM 9126  C CD2  . PHE A 1 18 ? -7.254  -6.183  -6.370  1.00 0.00 ? 48  PHE A CD2  7  
ATOM 9127  C CE1  . PHE A 1 18 ? -7.102  -8.819  -7.171  1.00 0.00 ? 48  PHE A CE1  7  
ATOM 9128  C CE2  . PHE A 1 18 ? -6.066  -6.685  -6.866  1.00 0.00 ? 48  PHE A CE2  7  
ATOM 9129  C CZ   . PHE A 1 18 ? -5.990  -8.006  -7.267  1.00 0.00 ? 48  PHE A CZ   7  
ATOM 9130  H H    . PHE A 1 18 ? -10.667 -4.384  -7.283  1.00 0.00 ? 48  PHE A H    7  
ATOM 9131  H HA   . PHE A 1 18 ? -10.749 -7.331  -7.343  1.00 0.00 ? 48  PHE A HA   7  
ATOM 9132  H HB2  . PHE A 1 18 ? -9.482  -5.430  -5.394  1.00 0.00 ? 48  PHE A HB2  7  
ATOM 9133  H HB3  . PHE A 1 18 ? -9.957  -7.045  -4.882  1.00 0.00 ? 48  PHE A HB3  7  
ATOM 9134  H HD1  . PHE A 1 18 ? -9.157  -8.947  -6.600  1.00 0.00 ? 48  PHE A HD1  7  
ATOM 9135  H HD2  . PHE A 1 18 ? -7.312  -5.151  -6.056  1.00 0.00 ? 48  PHE A HD2  7  
ATOM 9136  H HE1  . PHE A 1 18 ? -7.045  -9.851  -7.483  1.00 0.00 ? 48  PHE A HE1  7  
ATOM 9137  H HE2  . PHE A 1 18 ? -5.197  -6.048  -6.939  1.00 0.00 ? 48  PHE A HE2  7  
ATOM 9138  H HZ   . PHE A 1 18 ? -5.063  -8.401  -7.654  1.00 0.00 ? 48  PHE A HZ   7  
ATOM 9139  N N    . GLY A 1 19 ? -13.191 -6.016  -6.763  1.00 0.00 ? 49  GLY A N    7  
ATOM 9140  C CA   . GLY A 1 19 ? -14.519 -5.945  -6.182  1.00 0.00 ? 49  GLY A CA   7  
ATOM 9141  C C    . GLY A 1 19 ? -15.024 -7.298  -5.721  1.00 0.00 ? 49  GLY A C    7  
ATOM 9142  O O    . GLY A 1 19 ? -15.843 -7.382  -4.806  1.00 0.00 ? 49  GLY A O    7  
ATOM 9143  H H    . GLY A 1 19 ? -13.058 -5.783  -7.706  1.00 0.00 ? 49  GLY A H    7  
ATOM 9144  H HA2  . GLY A 1 19 ? -14.494 -5.274  -5.336  1.00 0.00 ? 49  GLY A HA2  7  
ATOM 9145  H HA3  . GLY A 1 19 ? -15.202 -5.551  -6.920  1.00 0.00 ? 49  GLY A HA3  7  
ATOM 9146  N N    . SER A 1 20 ? -14.535 -8.360  -6.354  1.00 0.00 ? 50  SER A N    7  
ATOM 9147  C CA   . SER A 1 20 ? -14.945 -9.715  -6.001  1.00 0.00 ? 50  SER A CA   7  
ATOM 9148  C C    . SER A 1 20 ? -13.883 -10.409 -5.151  1.00 0.00 ? 50  SER A C    7  
ATOM 9149  O O    . SER A 1 20 ? -13.865 -11.635 -5.047  1.00 0.00 ? 50  SER A O    7  
ATOM 9150  C CB   . SER A 1 20 ? -15.216 -10.532 -7.265  1.00 0.00 ? 50  SER A CB   7  
ATOM 9151  O OG   . SER A 1 20 ? -16.189 -11.533 -7.028  1.00 0.00 ? 50  SER A OG   7  
ATOM 9152  H H    . SER A 1 20 ? -13.886 -8.229  -7.075  1.00 0.00 ? 50  SER A H    7  
ATOM 9153  H HA   . SER A 1 20 ? -15.857 -9.645  -5.428  1.00 0.00 ? 50  SER A HA   7  
ATOM 9154  H HB2  . SER A 1 20 ? -15.574 -9.877  -8.045  1.00 0.00 ? 50  SER A HB2  7  
ATOM 9155  H HB3  . SER A 1 20 ? -14.300 -11.006 -7.587  1.00 0.00 ? 50  SER A HB3  7  
ATOM 9156  H HG   . SER A 1 20 ? -17.058 -11.197 -7.261  1.00 0.00 ? 50  SER A HG   7  
ATOM 9157  N N    . ASP A 1 21 ? -13.002 -9.619  -4.541  1.00 0.00 ? 51  ASP A N    7  
ATOM 9158  C CA   . ASP A 1 21 ? -11.948 -10.161 -3.702  1.00 0.00 ? 51  ASP A CA   7  
ATOM 9159  C C    . ASP A 1 21 ? -11.740 -9.295  -2.460  1.00 0.00 ? 51  ASP A C    7  
ATOM 9160  O O    . ASP A 1 21 ? -10.764 -8.550  -2.367  1.00 0.00 ? 51  ASP A O    7  
ATOM 9161  C CB   . ASP A 1 21 ? -10.642 -10.278 -4.493  1.00 0.00 ? 51  ASP A CB   7  
ATOM 9162  C CG   . ASP A 1 21 ? -9.936  -11.598 -4.249  1.00 0.00 ? 51  ASP A CG   7  
ATOM 9163  O OD1  . ASP A 1 21 ? -9.410  -11.792 -3.133  1.00 0.00 ? 51  ASP A OD1  7  
ATOM 9164  O OD2  . ASP A 1 21 ? -9.909  -12.436 -5.173  1.00 0.00 ? 51  ASP A OD2  7  
ATOM 9165  H H    . ASP A 1 21 ? -13.066 -8.656  -4.653  1.00 0.00 ? 51  ASP A H    7  
ATOM 9166  H HA   . ASP A 1 21 ? -12.258 -11.140 -3.390  1.00 0.00 ? 51  ASP A HA   7  
ATOM 9167  H HB2  . ASP A 1 21 ? -10.860 -10.198 -5.548  1.00 0.00 ? 51  ASP A HB2  7  
ATOM 9168  H HB3  . ASP A 1 21 ? -9.978  -9.476  -4.205  1.00 0.00 ? 51  ASP A HB3  7  
ATOM 9169  N N    . PRO A 1 22 ? -12.662 -9.381  -1.485  1.00 0.00 ? 52  PRO A N    7  
ATOM 9170  C CA   . PRO A 1 22 ? -12.577 -8.601  -0.246  1.00 0.00 ? 52  PRO A CA   7  
ATOM 9171  C C    . PRO A 1 22 ? -11.257 -8.816  0.486   1.00 0.00 ? 52  PRO A C    7  
ATOM 9172  O O    . PRO A 1 22 ? -10.777 -7.932  1.194   1.00 0.00 ? 52  PRO A O    7  
ATOM 9173  C CB   . PRO A 1 22 ? -13.745 -9.128  0.593   1.00 0.00 ? 52  PRO A CB   7  
ATOM 9174  C CG   . PRO A 1 22 ? -14.700 -9.700  -0.397  1.00 0.00 ? 52  PRO A CG   7  
ATOM 9175  C CD   . PRO A 1 22 ? -13.857 -10.243 -1.516  1.00 0.00 ? 52  PRO A CD   7  
ATOM 9176  H HA   . PRO A 1 22 ? -12.713 -7.546  -0.434  1.00 0.00 ? 52  PRO A HA   7  
ATOM 9177  H HB2  . PRO A 1 22 ? -13.388 -9.882  1.278   1.00 0.00 ? 52  PRO A HB2  7  
ATOM 9178  H HB3  . PRO A 1 22 ? -14.191 -8.314  1.145   1.00 0.00 ? 52  PRO A HB3  7  
ATOM 9179  H HG2  . PRO A 1 22 ? -15.272 -10.494 0.061   1.00 0.00 ? 52  PRO A HG2  7  
ATOM 9180  H HG3  . PRO A 1 22 ? -15.356 -8.926  -0.765  1.00 0.00 ? 52  PRO A HG3  7  
ATOM 9181  H HD2  . PRO A 1 22 ? -13.595 -11.273 -1.326  1.00 0.00 ? 52  PRO A HD2  7  
ATOM 9182  H HD3  . PRO A 1 22 ? -14.375 -10.150 -2.459  1.00 0.00 ? 52  PRO A HD3  7  
ATOM 9183  N N    . ALA A 1 23 ? -10.674 -9.998  0.311   1.00 0.00 ? 53  ALA A N    7  
ATOM 9184  C CA   . ALA A 1 23 ? -9.409  -10.329 0.956   1.00 0.00 ? 53  ALA A CA   7  
ATOM 9185  C C    . ALA A 1 23 ? -8.309  -9.359  0.541   1.00 0.00 ? 53  ALA A C    7  
ATOM 9186  O O    . ALA A 1 23 ? -7.559  -8.860  1.380   1.00 0.00 ? 53  ALA A O    7  
ATOM 9187  C CB   . ALA A 1 23 ? -9.006  -11.759 0.624   1.00 0.00 ? 53  ALA A CB   7  
ATOM 9188  H H    . ALA A 1 23 ? -11.105 -10.664 -0.265  1.00 0.00 ? 53  ALA A H    7  
ATOM 9189  H HA   . ALA A 1 23 ? -9.552  -10.260 2.025   1.00 0.00 ? 53  ALA A HA   7  
ATOM 9190  H HB1  . ALA A 1 23 ? -8.592  -11.794 -0.372  1.00 0.00 ? 53  ALA A HB1  7  
ATOM 9191  H HB2  . ALA A 1 23 ? -9.875  -12.398 0.676   1.00 0.00 ? 53  ALA A HB2  7  
ATOM 9192  H HB3  . ALA A 1 23 ? -8.267  -12.097 1.334   1.00 0.00 ? 53  ALA A HB3  7  
ATOM 9193  N N    . THR A 1 24 ? -8.219  -9.095  -0.758  1.00 0.00 ? 54  THR A N    7  
ATOM 9194  C CA   . THR A 1 24 ? -7.209  -8.184  -1.285  1.00 0.00 ? 54  THR A CA   7  
ATOM 9195  C C    . THR A 1 24 ? -7.362  -6.792  -0.681  1.00 0.00 ? 54  THR A C    7  
ATOM 9196  O O    . THR A 1 24 ? -6.401  -6.218  -0.168  1.00 0.00 ? 54  THR A O    7  
ATOM 9197  C CB   . THR A 1 24 ? -7.309  -8.104  -2.809  1.00 0.00 ? 54  THR A CB   7  
ATOM 9198  O OG1  . THR A 1 24 ? -7.574  -9.381  -3.361  1.00 0.00 ? 54  THR A OG1  7  
ATOM 9199  C CG2  . THR A 1 24 ? -6.053  -7.572  -3.464  1.00 0.00 ? 54  THR A CG2  7  
ATOM 9200  H H    . THR A 1 24 ? -8.845  -9.524  -1.377  1.00 0.00 ? 54  THR A H    7  
ATOM 9201  H HA   . THR A 1 24 ? -6.238  -8.574  -1.017  1.00 0.00 ? 54  THR A HA   7  
ATOM 9202  H HB   . THR A 1 24 ? -8.124  -7.445  -3.071  1.00 0.00 ? 54  THR A HB   7  
ATOM 9203  H HG1  . THR A 1 24 ? -7.633  -9.312  -4.317  1.00 0.00 ? 54  THR A HG1  7  
ATOM 9204  H HG21 . THR A 1 24 ? -5.216  -8.204  -3.204  1.00 0.00 ? 54  THR A HG21 7  
ATOM 9205  H HG22 . THR A 1 24 ? -5.865  -6.566  -3.119  1.00 0.00 ? 54  THR A HG22 7  
ATOM 9206  H HG23 . THR A 1 24 ? -6.180  -7.567  -4.536  1.00 0.00 ? 54  THR A HG23 7  
ATOM 9207  N N    . TYR A 1 25 ? -8.576  -6.254  -0.744  1.00 0.00 ? 55  TYR A N    7  
ATOM 9208  C CA   . TYR A 1 25 ? -8.854  -4.928  -0.204  1.00 0.00 ? 55  TYR A CA   7  
ATOM 9209  C C    . TYR A 1 25 ? -8.631  -4.898  1.305   1.00 0.00 ? 55  TYR A C    7  
ATOM 9210  O O    . TYR A 1 25 ? -7.934  -4.026  1.822   1.00 0.00 ? 55  TYR A O    7  
ATOM 9211  C CB   . TYR A 1 25 ? -10.291 -4.515  -0.526  1.00 0.00 ? 55  TYR A CB   7  
ATOM 9212  C CG   . TYR A 1 25 ? -10.579 -3.055  -0.254  1.00 0.00 ? 55  TYR A CG   7  
ATOM 9213  C CD1  . TYR A 1 25 ? -10.282 -2.082  -1.199  1.00 0.00 ? 55  TYR A CD1  7  
ATOM 9214  C CD2  . TYR A 1 25 ? -11.145 -2.652  0.948   1.00 0.00 ? 55  TYR A CD2  7  
ATOM 9215  C CE1  . TYR A 1 25 ? -10.542 -0.746  -0.954  1.00 0.00 ? 55  TYR A CE1  7  
ATOM 9216  C CE2  . TYR A 1 25 ? -11.409 -1.319  1.201   1.00 0.00 ? 55  TYR A CE2  7  
ATOM 9217  C CZ   . TYR A 1 25 ? -11.106 -0.371  0.247   1.00 0.00 ? 55  TYR A CZ   7  
ATOM 9218  O OH   . TYR A 1 25 ? -11.367 0.958   0.495   1.00 0.00 ? 55  TYR A OH   7  
ATOM 9219  H H    . TYR A 1 25 ? -9.302  -6.761  -1.166  1.00 0.00 ? 55  TYR A H    7  
ATOM 9220  H HA   . TYR A 1 25 ? -8.176  -4.231  -0.670  1.00 0.00 ? 55  TYR A HA   7  
ATOM 9221  H HB2  . TYR A 1 25 ? -10.487 -4.701  -1.572  1.00 0.00 ? 55  TYR A HB2  7  
ATOM 9222  H HB3  . TYR A 1 25 ? -10.971 -5.105  0.073   1.00 0.00 ? 55  TYR A HB3  7  
ATOM 9223  H HD1  . TYR A 1 25 ? -9.842  -2.379  -2.140  1.00 0.00 ? 55  TYR A HD1  7  
ATOM 9224  H HD2  . TYR A 1 25 ? -11.381 -3.397  1.694   1.00 0.00 ? 55  TYR A HD2  7  
ATOM 9225  H HE1  . TYR A 1 25 ? -10.305 -0.004  -1.702  1.00 0.00 ? 55  TYR A HE1  7  
ATOM 9226  H HE2  . TYR A 1 25 ? -11.850 -1.025  2.142   1.00 0.00 ? 55  TYR A HE2  7  
ATOM 9227  H HH   . TYR A 1 25 ? -10.882 1.239   1.274   1.00 0.00 ? 55  TYR A HH   7  
ATOM 9228  N N    . ASN A 1 26 ? -9.226  -5.859  2.005   1.00 0.00 ? 56  ASN A N    7  
ATOM 9229  C CA   . ASN A 1 26 ? -9.092  -5.943  3.454   1.00 0.00 ? 56  ASN A CA   7  
ATOM 9230  C C    . ASN A 1 26 ? -7.631  -6.102  3.858   1.00 0.00 ? 56  ASN A C    7  
ATOM 9231  O O    . ASN A 1 26 ? -7.169  -5.480  4.814   1.00 0.00 ? 56  ASN A O    7  
ATOM 9232  C CB   . ASN A 1 26 ? -9.914  -7.115  3.995   1.00 0.00 ? 56  ASN A CB   7  
ATOM 9233  C CG   . ASN A 1 26 ? -11.407 -6.880  3.873   1.00 0.00 ? 56  ASN A CG   7  
ATOM 9234  O OD1  . ASN A 1 26 ? -11.871 -5.740  3.891   1.00 0.00 ? 56  ASN A OD1  7  
ATOM 9235  N ND2  . ASN A 1 26 ? -12.168 -7.961  3.746   1.00 0.00 ? 56  ASN A ND2  7  
ATOM 9236  H H    . ASN A 1 26 ? -9.769  -6.527  1.536   1.00 0.00 ? 56  ASN A H    7  
ATOM 9237  H HA   . ASN A 1 26 ? -9.472  -5.025  3.876   1.00 0.00 ? 56  ASN A HA   7  
ATOM 9238  H HB2  . ASN A 1 26 ? -9.663  -8.008  3.442   1.00 0.00 ? 56  ASN A HB2  7  
ATOM 9239  H HB3  . ASN A 1 26 ? -9.675  -7.263  5.038   1.00 0.00 ? 56  ASN A HB3  7  
ATOM 9240  H HD21 . ASN A 1 26 ? -11.729 -8.837  3.739   1.00 0.00 ? 56  ASN A HD21 7  
ATOM 9241  H HD22 . ASN A 1 26 ? -13.137 -7.838  3.665   1.00 0.00 ? 56  ASN A HD22 7  
ATOM 9242  N N    . GLY A 1 27 ? -6.907  -6.941  3.124   1.00 0.00 ? 57  GLY A N    7  
ATOM 9243  C CA   . GLY A 1 27 ? -5.504  -7.167  3.421   1.00 0.00 ? 57  GLY A CA   7  
ATOM 9244  C C    . GLY A 1 27 ? -4.679  -5.898  3.322   1.00 0.00 ? 57  GLY A C    7  
ATOM 9245  O O    . GLY A 1 27 ? -3.837  -5.628  4.179   1.00 0.00 ? 57  GLY A O    7  
ATOM 9246  H H    . GLY A 1 27 ? -7.328  -7.410  2.374   1.00 0.00 ? 57  GLY A H    7  
ATOM 9247  H HA2  . GLY A 1 27 ? -5.419  -7.560  4.423   1.00 0.00 ? 57  GLY A HA2  7  
ATOM 9248  H HA3  . GLY A 1 27 ? -5.113  -7.893  2.726   1.00 0.00 ? 57  GLY A HA3  7  
ATOM 9249  N N    . PHE A 1 28 ? -4.919  -5.120  2.272   1.00 0.00 ? 58  PHE A N    7  
ATOM 9250  C CA   . PHE A 1 28 ? -4.192  -3.873  2.062   1.00 0.00 ? 58  PHE A CA   7  
ATOM 9251  C C    . PHE A 1 28 ? -4.384  -2.921  3.239   1.00 0.00 ? 58  PHE A C    7  
ATOM 9252  O O    . PHE A 1 28 ? -3.417  -2.386  3.780   1.00 0.00 ? 58  PHE A O    7  
ATOM 9253  C CB   . PHE A 1 28 ? -4.655  -3.201  0.768   1.00 0.00 ? 58  PHE A CB   7  
ATOM 9254  C CG   . PHE A 1 28 ? -3.901  -1.944  0.442   1.00 0.00 ? 58  PHE A CG   7  
ATOM 9255  C CD1  . PHE A 1 28 ? -2.540  -1.985  0.183   1.00 0.00 ? 58  PHE A CD1  7  
ATOM 9256  C CD2  . PHE A 1 28 ? -4.553  -0.722  0.393   1.00 0.00 ? 58  PHE A CD2  7  
ATOM 9257  C CE1  . PHE A 1 28 ? -1.843  -0.829  -0.117  1.00 0.00 ? 58  PHE A CE1  7  
ATOM 9258  C CE2  . PHE A 1 28 ? -3.861  0.436   0.093   1.00 0.00 ? 58  PHE A CE2  7  
ATOM 9259  C CZ   . PHE A 1 28 ? -2.505  0.383   -0.162  1.00 0.00 ? 58  PHE A CZ   7  
ATOM 9260  H H    . PHE A 1 28 ? -5.603  -5.389  1.623   1.00 0.00 ? 58  PHE A H    7  
ATOM 9261  H HA   . PHE A 1 28 ? -3.143  -4.113  1.975   1.00 0.00 ? 58  PHE A HA   7  
ATOM 9262  H HB2  . PHE A 1 28 ? -4.524  -3.889  -0.054  1.00 0.00 ? 58  PHE A HB2  7  
ATOM 9263  H HB3  . PHE A 1 28 ? -5.702  -2.949  0.856   1.00 0.00 ? 58  PHE A HB3  7  
ATOM 9264  H HD1  . PHE A 1 28 ? -2.022  -2.931  0.218   1.00 0.00 ? 58  PHE A HD1  7  
ATOM 9265  H HD2  . PHE A 1 28 ? -5.613  -0.679  0.593   1.00 0.00 ? 58  PHE A HD2  7  
ATOM 9266  H HE1  . PHE A 1 28 ? -0.783  -0.874  -0.317  1.00 0.00 ? 58  PHE A HE1  7  
ATOM 9267  H HE2  . PHE A 1 28 ? -4.381  1.382   0.059   1.00 0.00 ? 58  PHE A HE2  7  
ATOM 9268  H HZ   . PHE A 1 28 ? -1.962  1.287   -0.396  1.00 0.00 ? 58  PHE A HZ   7  
ATOM 9269  N N    . LEU A 1 29 ? -5.638  -2.715  3.628   1.00 0.00 ? 59  LEU A N    7  
ATOM 9270  C CA   . LEU A 1 29 ? -5.957  -1.827  4.740   1.00 0.00 ? 59  LEU A CA   7  
ATOM 9271  C C    . LEU A 1 29 ? -5.279  -2.295  6.025   1.00 0.00 ? 59  LEU A C    7  
ATOM 9272  O O    . LEU A 1 29 ? -4.830  -1.482  6.833   1.00 0.00 ? 59  LEU A O    7  
ATOM 9273  C CB   . LEU A 1 29 ? -7.472  -1.753  4.942   1.00 0.00 ? 59  LEU A CB   7  
ATOM 9274  C CG   . LEU A 1 29 ? -8.100  -0.389  4.636   1.00 0.00 ? 59  LEU A CG   7  
ATOM 9275  C CD1  . LEU A 1 29 ? -8.960  -0.462  3.383   1.00 0.00 ? 59  LEU A CD1  7  
ATOM 9276  C CD2  . LEU A 1 29 ? -8.923  0.099   5.820   1.00 0.00 ? 59  LEU A CD2  7  
ATOM 9277  H H    . LEU A 1 29 ? -6.366  -3.171  3.156   1.00 0.00 ? 59  LEU A H    7  
ATOM 9278  H HA   . LEU A 1 29 ? -5.588  -0.843  4.492   1.00 0.00 ? 59  LEU A HA   7  
ATOM 9279  H HB2  . LEU A 1 29 ? -7.934  -2.492  4.302   1.00 0.00 ? 59  LEU A HB2  7  
ATOM 9280  H HB3  . LEU A 1 29 ? -7.693  -2.004  5.969   1.00 0.00 ? 59  LEU A HB3  7  
ATOM 9281  H HG   . LEU A 1 29 ? -7.313  0.328   4.457   1.00 0.00 ? 59  LEU A HG   7  
ATOM 9282  H HD11 . LEU A 1 29 ? -9.332  -1.469  3.260   1.00 0.00 ? 59  LEU A HD11 7  
ATOM 9283  H HD12 . LEU A 1 29 ? -8.366  -0.190  2.523   1.00 0.00 ? 59  LEU A HD12 7  
ATOM 9284  H HD13 . LEU A 1 29 ? -9.792  0.220   3.477   1.00 0.00 ? 59  LEU A HD13 7  
ATOM 9285  H HD21 . LEU A 1 29 ? -9.213  1.127   5.657   1.00 0.00 ? 59  LEU A HD21 7  
ATOM 9286  H HD22 . LEU A 1 29 ? -8.332  0.030   6.722   1.00 0.00 ? 59  LEU A HD22 7  
ATOM 9287  H HD23 . LEU A 1 29 ? -9.806  -0.513  5.922   1.00 0.00 ? 59  LEU A HD23 7  
ATOM 9288  N N    . GLU A 1 30 ? -5.211  -3.610  6.207   1.00 0.00 ? 60  GLU A N    7  
ATOM 9289  C CA   . GLU A 1 30 ? -4.590  -4.185  7.395   1.00 0.00 ? 60  GLU A CA   7  
ATOM 9290  C C    . GLU A 1 30 ? -3.116  -3.802  7.480   1.00 0.00 ? 60  GLU A C    7  
ATOM 9291  O O    . GLU A 1 30 ? -2.615  -3.458  8.550   1.00 0.00 ? 60  GLU A O    7  
ATOM 9292  C CB   . GLU A 1 30 ? -4.734  -5.708  7.384   1.00 0.00 ? 60  GLU A CB   7  
ATOM 9293  C CG   . GLU A 1 30 ? -6.120  -6.190  7.780   1.00 0.00 ? 60  GLU A CG   7  
ATOM 9294  C CD   . GLU A 1 30 ? -6.237  -6.471  9.266   1.00 0.00 ? 60  GLU A CD   7  
ATOM 9295  O OE1  . GLU A 1 30 ? -5.950  -5.557  10.067  1.00 0.00 ? 60  GLU A OE1  7  
ATOM 9296  O OE2  . GLU A 1 30 ? -6.616  -7.605  9.627   1.00 0.00 ? 60  GLU A OE2  7  
ATOM 9297  H H    . GLU A 1 30 ? -5.587  -4.207  5.529   1.00 0.00 ? 60  GLU A H    7  
ATOM 9298  H HA   . GLU A 1 30 ? -5.102  -3.791  8.259   1.00 0.00 ? 60  GLU A HA   7  
ATOM 9299  H HB2  . GLU A 1 30 ? -4.520  -6.072  6.390   1.00 0.00 ? 60  GLU A HB2  7  
ATOM 9300  H HB3  . GLU A 1 30 ? -4.018  -6.130  8.074   1.00 0.00 ? 60  GLU A HB3  7  
ATOM 9301  H HG2  . GLU A 1 30 ? -6.841  -5.431  7.516   1.00 0.00 ? 60  GLU A HG2  7  
ATOM 9302  H HG3  . GLU A 1 30 ? -6.340  -7.098  7.238   1.00 0.00 ? 60  GLU A HG3  7  
ATOM 9303  N N    . ILE A 1 31 ? -2.426  -3.865  6.345   1.00 0.00 ? 61  ILE A N    7  
ATOM 9304  C CA   . ILE A 1 31 ? -1.008  -3.525  6.293   1.00 0.00 ? 61  ILE A CA   7  
ATOM 9305  C C    . ILE A 1 31 ? -0.773  -2.071  6.690   1.00 0.00 ? 61  ILE A C    7  
ATOM 9306  O O    . ILE A 1 31 ? 0.073   -1.777  7.534   1.00 0.00 ? 61  ILE A O    7  
ATOM 9307  C CB   . ILE A 1 31 ? -0.423  -3.764  4.887   1.00 0.00 ? 61  ILE A CB   7  
ATOM 9308  C CG1  . ILE A 1 31 ? -0.748  -5.181  4.409   1.00 0.00 ? 61  ILE A CG1  7  
ATOM 9309  C CG2  . ILE A 1 31 ? 1.081   -3.533  4.889   1.00 0.00 ? 61  ILE A CG2  7  
ATOM 9310  C CD1  . ILE A 1 31 ? -1.119  -5.256  2.945   1.00 0.00 ? 61  ILE A CD1  7  
ATOM 9311  H H    . ILE A 1 31 ? -2.880  -4.146  5.524   1.00 0.00 ? 61  ILE A H    7  
ATOM 9312  H HA   . ILE A 1 31 ? -0.487  -4.166  6.990   1.00 0.00 ? 61  ILE A HA   7  
ATOM 9313  H HB   . ILE A 1 31 ? -0.871  -3.053  4.209   1.00 0.00 ? 61  ILE A HB   7  
ATOM 9314  H HG12 . ILE A 1 31 ? 0.115   -5.811  4.563   1.00 0.00 ? 61  ILE A HG12 7  
ATOM 9315  H HG13 . ILE A 1 31 ? -1.577  -5.567  4.983   1.00 0.00 ? 61  ILE A HG13 7  
ATOM 9316  H HG21 . ILE A 1 31 ? 1.513   -3.979  5.773   1.00 0.00 ? 61  ILE A HG21 7  
ATOM 9317  H HG22 . ILE A 1 31 ? 1.282   -2.472  4.888   1.00 0.00 ? 61  ILE A HG22 7  
ATOM 9318  H HG23 . ILE A 1 31 ? 1.516   -3.982  4.009   1.00 0.00 ? 61  ILE A HG23 7  
ATOM 9319  H HD11 . ILE A 1 31 ? -2.047  -5.799  2.835   1.00 0.00 ? 61  ILE A HD11 7  
ATOM 9320  H HD12 . ILE A 1 31 ? -0.337  -5.765  2.401   1.00 0.00 ? 61  ILE A HD12 7  
ATOM 9321  H HD13 . ILE A 1 31 ? -1.238  -4.256  2.551   1.00 0.00 ? 61  ILE A HD13 7  
ATOM 9322  N N    . MET A 1 32 ? -1.527  -1.165  6.075   1.00 0.00 ? 62  MET A N    7  
ATOM 9323  C CA   . MET A 1 32 ? -1.398  0.259   6.364   1.00 0.00 ? 62  MET A CA   7  
ATOM 9324  C C    . MET A 1 32 ? -1.690  0.545   7.833   1.00 0.00 ? 62  MET A C    7  
ATOM 9325  O O    . MET A 1 32 ? -0.922  1.231   8.508   1.00 0.00 ? 62  MET A O    7  
ATOM 9326  C CB   . MET A 1 32 ? -2.343  1.070   5.476   1.00 0.00 ? 62  MET A CB   7  
ATOM 9327  C CG   . MET A 1 32 ? -2.170  0.794   3.991   1.00 0.00 ? 62  MET A CG   7  
ATOM 9328  S SD   . MET A 1 32 ? -0.571  1.345   3.365   1.00 0.00 ? 62  MET A SD   7  
ATOM 9329  C CE   . MET A 1 32 ? 0.150   -0.214  2.860   1.00 0.00 ? 62  MET A CE   7  
ATOM 9330  H H    . MET A 1 32 ? -2.183  -1.461  5.410   1.00 0.00 ? 62  MET A H    7  
ATOM 9331  H HA   . MET A 1 32 ? -0.380  0.549   6.149   1.00 0.00 ? 62  MET A HA   7  
ATOM 9332  H HB2  . MET A 1 32 ? -3.362  0.837   5.747   1.00 0.00 ? 62  MET A HB2  7  
ATOM 9333  H HB3  . MET A 1 32 ? -2.166  2.121   5.647   1.00 0.00 ? 62  MET A HB3  7  
ATOM 9334  H HG2  . MET A 1 32 ? -2.258  -0.268  3.824   1.00 0.00 ? 62  MET A HG2  7  
ATOM 9335  H HG3  . MET A 1 32 ? -2.950  1.309   3.450   1.00 0.00 ? 62  MET A HG3  7  
ATOM 9336  H HE1  . MET A 1 32 ? -0.252  -0.504  1.900   1.00 0.00 ? 62  MET A HE1  7  
ATOM 9337  H HE2  . MET A 1 32 ? -0.082  -0.973  3.593   1.00 0.00 ? 62  MET A HE2  7  
ATOM 9338  H HE3  . MET A 1 32 ? 1.223   -0.106  2.782   1.00 0.00 ? 62  MET A HE3  7  
ATOM 9339  N N    . LYS A 1 33 ? -2.806  0.016   8.324   1.00 0.00 ? 63  LYS A N    7  
ATOM 9340  C CA   . LYS A 1 33 ? -3.200  0.215   9.714   1.00 0.00 ? 63  LYS A CA   7  
ATOM 9341  C C    . LYS A 1 33 ? -2.186  -0.418  10.662  1.00 0.00 ? 63  LYS A C    7  
ATOM 9342  O O    . LYS A 1 33 ? -1.970  0.069   11.771  1.00 0.00 ? 63  LYS A O    7  
ATOM 9343  C CB   . LYS A 1 33 ? -4.588  -0.378  9.962   1.00 0.00 ? 63  LYS A CB   7  
ATOM 9344  C CG   . LYS A 1 33 ? -5.099  -0.156  11.377  1.00 0.00 ? 63  LYS A CG   7  
ATOM 9345  C CD   . LYS A 1 33 ? -6.580  0.184   11.390  1.00 0.00 ? 63  LYS A CD   7  
ATOM 9346  C CE   . LYS A 1 33 ? -7.434  -1.032  11.071  1.00 0.00 ? 63  LYS A CE   7  
ATOM 9347  N NZ   . LYS A 1 33 ? -8.649  -1.099  11.929  1.00 0.00 ? 63  LYS A NZ   7  
ATOM 9348  H H    . LYS A 1 33 ? -3.379  -0.521  7.737   1.00 0.00 ? 63  LYS A H    7  
ATOM 9349  H HA   . LYS A 1 33 ? -3.233  1.277   9.899   1.00 0.00 ? 63  LYS A HA   7  
ATOM 9350  H HB2  . LYS A 1 33 ? -5.287  0.073   9.274   1.00 0.00 ? 63  LYS A HB2  7  
ATOM 9351  H HB3  . LYS A 1 33 ? -4.550  -1.442  9.779   1.00 0.00 ? 63  LYS A HB3  7  
ATOM 9352  H HG2  . LYS A 1 33 ? -4.943  -1.058  11.951  1.00 0.00 ? 63  LYS A HG2  7  
ATOM 9353  H HG3  . LYS A 1 33 ? -4.547  0.658   11.825  1.00 0.00 ? 63  LYS A HG3  7  
ATOM 9354  H HD2  . LYS A 1 33 ? -6.847  0.551   12.369  1.00 0.00 ? 63  LYS A HD2  7  
ATOM 9355  H HD3  . LYS A 1 33 ? -6.771  0.950   10.653  1.00 0.00 ? 63  LYS A HD3  7  
ATOM 9356  H HE2  . LYS A 1 33 ? -7.738  -0.981  10.036  1.00 0.00 ? 63  LYS A HE2  7  
ATOM 9357  H HE3  . LYS A 1 33 ? -6.842  -1.923  11.228  1.00 0.00 ? 63  LYS A HE3  7  
ATOM 9358  H HZ1  . LYS A 1 33 ? -8.393  -1.416  12.886  1.00 0.00 ? 63  LYS A HZ1  7  
ATOM 9359  H HZ2  . LYS A 1 33 ? -9.335  -1.769  11.526  1.00 0.00 ? 63  LYS A HZ2  7  
ATOM 9360  H HZ3  . LYS A 1 33 ? -9.093  -0.161  11.994  1.00 0.00 ? 63  LYS A HZ3  7  
ATOM 9361  N N    . GLU A 1 34 ? -1.567  -1.507  10.215  1.00 0.00 ? 64  GLU A N    7  
ATOM 9362  C CA   . GLU A 1 34 ? -0.574  -2.207  11.023  1.00 0.00 ? 64  GLU A CA   7  
ATOM 9363  C C    . GLU A 1 34 ? 0.658   -1.336  11.245  1.00 0.00 ? 64  GLU A C    7  
ATOM 9364  O O    . GLU A 1 34 ? 1.161   -1.230  12.363  1.00 0.00 ? 64  GLU A O    7  
ATOM 9365  C CB   . GLU A 1 34 ? -0.172  -3.519  10.349  1.00 0.00 ? 64  GLU A CB   7  
ATOM 9366  C CG   . GLU A 1 34 ? 0.637   -4.441  11.246  1.00 0.00 ? 64  GLU A CG   7  
ATOM 9367  C CD   . GLU A 1 34 ? 0.860   -5.807  10.629  1.00 0.00 ? 64  GLU A CD   7  
ATOM 9368  O OE1  . GLU A 1 34 ? 1.021   -5.880  9.392   1.00 0.00 ? 64  GLU A OE1  7  
ATOM 9369  O OE2  . GLU A 1 34 ? 0.874   -6.804  11.380  1.00 0.00 ? 64  GLU A OE2  7  
ATOM 9370  H H    . GLU A 1 34 ? -1.781  -1.847  9.322   1.00 0.00 ? 64  GLU A H    7  
ATOM 9371  H HA   . GLU A 1 34 ? -1.023  -2.427  11.981  1.00 0.00 ? 64  GLU A HA   7  
ATOM 9372  H HB2  . GLU A 1 34 ? -1.065  -4.043  10.044  1.00 0.00 ? 64  GLU A HB2  7  
ATOM 9373  H HB3  . GLU A 1 34 ? 0.419   -3.296  9.473   1.00 0.00 ? 64  GLU A HB3  7  
ATOM 9374  H HG2  . GLU A 1 34 ? 1.599   -3.987  11.435  1.00 0.00 ? 64  GLU A HG2  7  
ATOM 9375  H HG3  . GLU A 1 34 ? 0.110   -4.567  12.181  1.00 0.00 ? 64  GLU A HG3  7  
ATOM 9376  N N    . PHE A 1 35 ? 1.139   -0.715  10.173  1.00 0.00 ? 65  PHE A N    7  
ATOM 9377  C CA   . PHE A 1 35 ? 2.313   0.146   10.252  1.00 0.00 ? 65  PHE A CA   7  
ATOM 9378  C C    . PHE A 1 35 ? 2.045   1.350   11.148  1.00 0.00 ? 65  PHE A C    7  
ATOM 9379  O O    . PHE A 1 35 ? 2.878   1.719   11.976  1.00 0.00 ? 65  PHE A O    7  
ATOM 9380  C CB   . PHE A 1 35 ? 2.721   0.616   8.854   1.00 0.00 ? 65  PHE A CB   7  
ATOM 9381  C CG   . PHE A 1 35 ? 4.090   1.232   8.806   1.00 0.00 ? 65  PHE A CG   7  
ATOM 9382  C CD1  . PHE A 1 35 ? 5.219   0.461   9.032   1.00 0.00 ? 65  PHE A CD1  7  
ATOM 9383  C CD2  . PHE A 1 35 ? 4.248   2.581   8.533   1.00 0.00 ? 65  PHE A CD2  7  
ATOM 9384  C CE1  . PHE A 1 35 ? 6.481   1.024   8.988   1.00 0.00 ? 65  PHE A CE1  7  
ATOM 9385  C CE2  . PHE A 1 35 ? 5.507   3.150   8.488   1.00 0.00 ? 65  PHE A CE2  7  
ATOM 9386  C CZ   . PHE A 1 35 ? 6.625   2.370   8.715   1.00 0.00 ? 65  PHE A CZ   7  
ATOM 9387  H H    . PHE A 1 35 ? 0.694   -0.839  9.309   1.00 0.00 ? 65  PHE A H    7  
ATOM 9388  H HA   . PHE A 1 35 ? 3.119   -0.431  10.677  1.00 0.00 ? 65  PHE A HA   7  
ATOM 9389  H HB2  . PHE A 1 35 ? 2.712   -0.227  8.181   1.00 0.00 ? 65  PHE A HB2  7  
ATOM 9390  H HB3  . PHE A 1 35 ? 2.012   1.354   8.509   1.00 0.00 ? 65  PHE A HB3  7  
ATOM 9391  H HD1  . PHE A 1 35 ? 5.108   -0.593  9.245   1.00 0.00 ? 65  PHE A HD1  7  
ATOM 9392  H HD2  . PHE A 1 35 ? 3.376   3.192   8.355   1.00 0.00 ? 65  PHE A HD2  7  
ATOM 9393  H HE1  . PHE A 1 35 ? 7.352   0.412   9.167   1.00 0.00 ? 65  PHE A HE1  7  
ATOM 9394  H HE2  . PHE A 1 35 ? 5.617   4.202   8.274   1.00 0.00 ? 65  PHE A HE2  7  
ATOM 9395  H HZ   . PHE A 1 35 ? 7.609   2.812   8.680   1.00 0.00 ? 65  PHE A HZ   7  
ATOM 9396  N N    . LYS A 1 36 ? 0.874   1.959   10.980  1.00 0.00 ? 66  LYS A N    7  
ATOM 9397  C CA   . LYS A 1 36 ? 0.496   3.122   11.776  1.00 0.00 ? 66  LYS A CA   7  
ATOM 9398  C C    . LYS A 1 36 ? 0.499   2.784   13.263  1.00 0.00 ? 66  LYS A C    7  
ATOM 9399  O O    . LYS A 1 36 ? 0.862   3.615   14.098  1.00 0.00 ? 66  LYS A O    7  
ATOM 9400  C CB   . LYS A 1 36 ? -0.887  3.625   11.359  1.00 0.00 ? 66  LYS A CB   7  
ATOM 9401  C CG   . LYS A 1 36 ? -1.210  5.016   11.875  1.00 0.00 ? 66  LYS A CG   7  
ATOM 9402  C CD   . LYS A 1 36 ? -2.690  5.167   12.185  1.00 0.00 ? 66  LYS A CD   7  
ATOM 9403  C CE   . LYS A 1 36 ? -3.093  6.630   12.285  1.00 0.00 ? 66  LYS A CE   7  
ATOM 9404  N NZ   . LYS A 1 36 ? -3.153  7.094   13.698  1.00 0.00 ? 66  LYS A NZ   7  
ATOM 9405  H H    . LYS A 1 36 ? 0.251   1.618   10.305  1.00 0.00 ? 66  LYS A H    7  
ATOM 9406  H HA   . LYS A 1 36 ? 1.223   3.899   11.593  1.00 0.00 ? 66  LYS A HA   7  
ATOM 9407  H HB2  . LYS A 1 36 ? -0.939  3.643   10.280  1.00 0.00 ? 66  LYS A HB2  7  
ATOM 9408  H HB3  . LYS A 1 36 ? -1.635  2.942   11.734  1.00 0.00 ? 66  LYS A HB3  7  
ATOM 9409  H HG2  . LYS A 1 36 ? -0.643  5.196   12.777  1.00 0.00 ? 66  LYS A HG2  7  
ATOM 9410  H HG3  . LYS A 1 36 ? -0.933  5.742   11.124  1.00 0.00 ? 66  LYS A HG3  7  
ATOM 9411  H HD2  . LYS A 1 36 ? -3.263  4.699   11.398  1.00 0.00 ? 66  LYS A HD2  7  
ATOM 9412  H HD3  . LYS A 1 36 ? -2.902  4.679   13.126  1.00 0.00 ? 66  LYS A HD3  7  
ATOM 9413  H HE2  . LYS A 1 36 ? -2.369  7.226   11.750  1.00 0.00 ? 66  LYS A HE2  7  
ATOM 9414  H HE3  . LYS A 1 36 ? -4.066  6.753   11.832  1.00 0.00 ? 66  LYS A HE3  7  
ATOM 9415  H HZ1  . LYS A 1 36 ? -2.216  7.009   14.143  1.00 0.00 ? 66  LYS A HZ1  7  
ATOM 9416  H HZ2  . LYS A 1 36 ? -3.832  6.519   14.235  1.00 0.00 ? 66  LYS A HZ2  7  
ATOM 9417  H HZ3  . LYS A 1 36 ? -3.452  8.089   13.735  1.00 0.00 ? 66  LYS A HZ3  7  
ATOM 9418  N N    . SER A 1 37 ? 0.095   1.561   13.589  1.00 0.00 ? 67  SER A N    7  
ATOM 9419  C CA   . SER A 1 37 ? 0.054   1.112   14.975  1.00 0.00 ? 67  SER A CA   7  
ATOM 9420  C C    . SER A 1 37 ? 1.451   1.100   15.593  1.00 0.00 ? 67  SER A C    7  
ATOM 9421  O O    . SER A 1 37 ? 1.596   1.058   16.815  1.00 0.00 ? 67  SER A O    7  
ATOM 9422  C CB   . SER A 1 37 ? -0.566  -0.284  15.062  1.00 0.00 ? 67  SER A CB   7  
ATOM 9423  O OG   . SER A 1 37 ? -0.980  -0.576  16.385  1.00 0.00 ? 67  SER A OG   7  
ATOM 9424  H H    . SER A 1 37 ? -0.179  0.945   12.879  1.00 0.00 ? 67  SER A H    7  
ATOM 9425  H HA   . SER A 1 37 ? -0.563  1.803   15.526  1.00 0.00 ? 67  SER A HA   7  
ATOM 9426  H HB2  . SER A 1 37 ? -1.425  -0.336  14.410  1.00 0.00 ? 67  SER A HB2  7  
ATOM 9427  H HB3  . SER A 1 37 ? 0.163   -1.020  14.756  1.00 0.00 ? 67  SER A HB3  7  
ATOM 9428  H HG   . SER A 1 37 ? -1.444  0.181   16.751  1.00 0.00 ? 67  SER A HG   7  
ATOM 9429  N N    . GLN A 1 38 ? 2.476   1.134   14.745  1.00 0.00 ? 68  GLN A N    7  
ATOM 9430  C CA   . GLN A 1 38 ? 3.859   1.125   15.211  1.00 0.00 ? 68  GLN A CA   7  
ATOM 9431  C C    . GLN A 1 38 ? 4.224   -0.233  15.799  1.00 0.00 ? 68  GLN A C    7  
ATOM 9432  O O    . GLN A 1 38 ? 4.918   -0.317  16.812  1.00 0.00 ? 68  GLN A O    7  
ATOM 9433  C CB   . GLN A 1 38 ? 4.082   2.225   16.252  1.00 0.00 ? 68  GLN A CB   7  
ATOM 9434  C CG   . GLN A 1 38 ? 5.491   2.799   16.240  1.00 0.00 ? 68  GLN A CG   7  
ATOM 9435  C CD   . GLN A 1 38 ? 5.530   4.242   15.779  1.00 0.00 ? 68  GLN A CD   7  
ATOM 9436  O OE1  . GLN A 1 38 ? 5.047   5.139   16.470  1.00 0.00 ? 68  GLN A OE1  7  
ATOM 9437  N NE2  . GLN A 1 38 ? 6.106   4.474   14.605  1.00 0.00 ? 68  GLN A NE2  7  
ATOM 9438  H H    . GLN A 1 38 ? 2.299   1.165   13.783  1.00 0.00 ? 68  GLN A H    7  
ATOM 9439  H HA   . GLN A 1 38 ? 4.495   1.316   14.359  1.00 0.00 ? 68  GLN A HA   7  
ATOM 9440  H HB2  . GLN A 1 38 ? 3.387   3.029   16.065  1.00 0.00 ? 68  GLN A HB2  7  
ATOM 9441  H HB3  . GLN A 1 38 ? 3.892   1.818   17.235  1.00 0.00 ? 68  GLN A HB3  7  
ATOM 9442  H HG2  . GLN A 1 38 ? 5.896   2.745   17.240  1.00 0.00 ? 68  GLN A HG2  7  
ATOM 9443  H HG3  . GLN A 1 38 ? 6.100   2.206   15.573  1.00 0.00 ? 68  GLN A HG3  7  
ATOM 9444  H HE21 . GLN A 1 38 ? 6.469   3.711   14.110  1.00 0.00 ? 68  GLN A HE21 7  
ATOM 9445  H HE22 . GLN A 1 38 ? 6.145   5.398   14.283  1.00 0.00 ? 68  GLN A HE22 7  
ATOM 9446  N N    . SER A 1 39 ? 3.749   -1.296  15.157  1.00 0.00 ? 69  SER A N    7  
ATOM 9447  C CA   . SER A 1 39 ? 4.023   -2.653  15.615  1.00 0.00 ? 69  SER A CA   7  
ATOM 9448  C C    . SER A 1 39 ? 4.924   -3.388  14.629  1.00 0.00 ? 69  SER A C    7  
ATOM 9449  O O    . SER A 1 39 ? 5.860   -4.082  15.026  1.00 0.00 ? 69  SER A O    7  
ATOM 9450  C CB   . SER A 1 39 ? 2.715   -3.423  15.802  1.00 0.00 ? 69  SER A CB   7  
ATOM 9451  O OG   . SER A 1 39 ? 2.913   -4.582  16.594  1.00 0.00 ? 69  SER A OG   7  
ATOM 9452  H H    . SER A 1 39 ? 3.202   -1.164  14.355  1.00 0.00 ? 69  SER A H    7  
ATOM 9453  H HA   . SER A 1 39 ? 4.530   -2.586  16.566  1.00 0.00 ? 69  SER A HA   7  
ATOM 9454  H HB2  . SER A 1 39 ? 1.992   -2.788  16.292  1.00 0.00 ? 69  SER A HB2  7  
ATOM 9455  H HB3  . SER A 1 39 ? 2.336   -3.723  14.836  1.00 0.00 ? 69  SER A HB3  7  
ATOM 9456  H HG   . SER A 1 39 ? 2.062   -4.933  16.865  1.00 0.00 ? 69  SER A HG   7  
ATOM 9457  N N    . ILE A 1 40 ? 4.636   -3.232  13.341  1.00 0.00 ? 70  ILE A N    7  
ATOM 9458  C CA   . ILE A 1 40 ? 5.419   -3.881  12.298  1.00 0.00 ? 70  ILE A CA   7  
ATOM 9459  C C    . ILE A 1 40 ? 6.467   -2.930  11.724  1.00 0.00 ? 70  ILE A C    7  
ATOM 9460  O O    . ILE A 1 40 ? 6.334   -1.711  11.828  1.00 0.00 ? 70  ILE A O    7  
ATOM 9461  C CB   . ILE A 1 40 ? 4.520   -4.395  11.155  1.00 0.00 ? 70  ILE A CB   7  
ATOM 9462  C CG1  . ILE A 1 40 ? 5.349   -5.164  10.125  1.00 0.00 ? 70  ILE A CG1  7  
ATOM 9463  C CG2  . ILE A 1 40 ? 3.784   -3.238  10.494  1.00 0.00 ? 70  ILE A CG2  7  
ATOM 9464  C CD1  . ILE A 1 40 ? 4.511   -5.910  9.108   1.00 0.00 ? 70  ILE A CD1  7  
ATOM 9465  H H    . ILE A 1 40 ? 3.878   -2.666  13.087  1.00 0.00 ? 70  ILE A H    7  
ATOM 9466  H HA   . ILE A 1 40 ? 5.924   -4.729  12.739  1.00 0.00 ? 70  ILE A HA   7  
ATOM 9467  H HB   . ILE A 1 40 ? 3.783   -5.060  11.580  1.00 0.00 ? 70  ILE A HB   7  
ATOM 9468  H HG12 . ILE A 1 40 ? 5.979   -4.470  9.588   1.00 0.00 ? 70  ILE A HG12 7  
ATOM 9469  H HG13 . ILE A 1 40 ? 5.970   -5.885  10.637  1.00 0.00 ? 70  ILE A HG13 7  
ATOM 9470  H HG21 . ILE A 1 40 ? 4.501   -2.528  10.109  1.00 0.00 ? 70  ILE A HG21 7  
ATOM 9471  H HG22 . ILE A 1 40 ? 3.151   -2.752  11.223  1.00 0.00 ? 70  ILE A HG22 7  
ATOM 9472  H HG23 . ILE A 1 40 ? 3.178   -3.613  9.684   1.00 0.00 ? 70  ILE A HG23 7  
ATOM 9473  H HD11 . ILE A 1 40 ? 4.148   -5.217  8.364   1.00 0.00 ? 70  ILE A HD11 7  
ATOM 9474  H HD12 . ILE A 1 40 ? 3.673   -6.375  9.606   1.00 0.00 ? 70  ILE A HD12 7  
ATOM 9475  H HD13 . ILE A 1 40 ? 5.114   -6.668  8.632   1.00 0.00 ? 70  ILE A HD13 7  
ATOM 9476  N N    . ASP A 1 41 ? 7.506   -3.496  11.121  1.00 0.00 ? 71  ASP A N    7  
ATOM 9477  C CA   . ASP A 1 41 ? 8.577   -2.699  10.533  1.00 0.00 ? 71  ASP A CA   7  
ATOM 9478  C C    . ASP A 1 41 ? 8.221   -2.275  9.111   1.00 0.00 ? 71  ASP A C    7  
ATOM 9479  O O    . ASP A 1 41 ? 7.183   -2.665  8.578   1.00 0.00 ? 71  ASP A O    7  
ATOM 9480  C CB   . ASP A 1 41 ? 9.886   -3.489  10.529  1.00 0.00 ? 71  ASP A CB   7  
ATOM 9481  C CG   . ASP A 1 41 ? 11.097  -2.601  10.744  1.00 0.00 ? 71  ASP A CG   7  
ATOM 9482  O OD1  . ASP A 1 41 ? 11.014  -1.676  11.579  1.00 0.00 ? 71  ASP A OD1  7  
ATOM 9483  O OD2  . ASP A 1 41 ? 12.128  -2.831  10.076  1.00 0.00 ? 71  ASP A OD2  7  
ATOM 9484  H H    . ASP A 1 41 ? 7.556   -4.474  11.071  1.00 0.00 ? 71  ASP A H    7  
ATOM 9485  H HA   . ASP A 1 41 ? 8.702   -1.814  11.139  1.00 0.00 ? 71  ASP A HA   7  
ATOM 9486  H HB2  . ASP A 1 41 ? 9.859   -4.224  11.320  1.00 0.00 ? 71  ASP A HB2  7  
ATOM 9487  H HB3  . ASP A 1 41 ? 9.994   -3.991  9.579   1.00 0.00 ? 71  ASP A HB3  7  
ATOM 9488  N N    . THR A 1 42 ? 9.091   -1.474  8.503   1.00 0.00 ? 72  THR A N    7  
ATOM 9489  C CA   . THR A 1 42 ? 8.870   -0.996  7.143   1.00 0.00 ? 72  THR A CA   7  
ATOM 9490  C C    . THR A 1 42 ? 8.946   -2.148  6.142   1.00 0.00 ? 72  THR A C    7  
ATOM 9491  O O    . THR A 1 42 ? 8.030   -2.349  5.344   1.00 0.00 ? 72  THR A O    7  
ATOM 9492  C CB   . THR A 1 42 ? 9.896   0.080   6.781   1.00 0.00 ? 72  THR A CB   7  
ATOM 9493  O OG1  . THR A 1 42 ? 10.623  0.489   7.926   1.00 0.00 ? 72  THR A OG1  7  
ATOM 9494  C CG2  . THR A 1 42 ? 9.275   1.317   6.167   1.00 0.00 ? 72  THR A CG2  7  
ATOM 9495  H H    . THR A 1 42 ? 9.900   -1.198  8.981   1.00 0.00 ? 72  THR A H    7  
ATOM 9496  H HA   . THR A 1 42 ? 7.881   -0.565  7.100   1.00 0.00 ? 72  THR A HA   7  
ATOM 9497  H HB   . THR A 1 42 ? 10.596  -0.327  6.063   1.00 0.00 ? 72  THR A HB   7  
ATOM 9498  H HG1  . THR A 1 42 ? 10.021  0.876   8.566   1.00 0.00 ? 72  THR A HG1  7  
ATOM 9499  H HG21 . THR A 1 42 ? 8.264   1.429   6.531   1.00 0.00 ? 72  THR A HG21 7  
ATOM 9500  H HG22 . THR A 1 42 ? 9.261   1.217   5.091   1.00 0.00 ? 72  THR A HG22 7  
ATOM 9501  H HG23 . THR A 1 42 ? 9.854   2.185   6.442   1.00 0.00 ? 72  THR A HG23 7  
ATOM 9502  N N    . PRO A 1 43 ? 10.044  -2.925  6.173   1.00 0.00 ? 73  PRO A N    7  
ATOM 9503  C CA   . PRO A 1 43 ? 10.233  -4.061  5.266   1.00 0.00 ? 73  PRO A CA   7  
ATOM 9504  C C    . PRO A 1 43 ? 9.017   -4.980  5.223   1.00 0.00 ? 73  PRO A C    7  
ATOM 9505  O O    . PRO A 1 43 ? 8.759   -5.640  4.218   1.00 0.00 ? 73  PRO A O    7  
ATOM 9506  C CB   . PRO A 1 43 ? 11.436  -4.792  5.862   1.00 0.00 ? 73  PRO A CB   7  
ATOM 9507  C CG   . PRO A 1 43 ? 12.204  -3.734  6.574   1.00 0.00 ? 73  PRO A CG   7  
ATOM 9508  C CD   . PRO A 1 43 ? 11.185  -2.758  7.095   1.00 0.00 ? 73  PRO A CD   7  
ATOM 9509  H HA   . PRO A 1 43 ? 10.469  -3.732  4.263   1.00 0.00 ? 73  PRO A HA   7  
ATOM 9510  H HB2  . PRO A 1 43 ? 11.093  -5.559  6.542   1.00 0.00 ? 73  PRO A HB2  7  
ATOM 9511  H HB3  . PRO A 1 43 ? 12.020  -5.238  5.071   1.00 0.00 ? 73  PRO A HB3  7  
ATOM 9512  H HG2  . PRO A 1 43 ? 12.758  -4.171  7.393   1.00 0.00 ? 73  PRO A HG2  7  
ATOM 9513  H HG3  . PRO A 1 43 ? 12.876  -3.243  5.886   1.00 0.00 ? 73  PRO A HG3  7  
ATOM 9514  H HD2  . PRO A 1 43 ? 10.903  -3.010  8.106   1.00 0.00 ? 73  PRO A HD2  7  
ATOM 9515  H HD3  . PRO A 1 43 ? 11.570  -1.751  7.050   1.00 0.00 ? 73  PRO A HD3  7  
ATOM 9516  N N    . GLY A 1 44 ? 8.272   -5.015  6.324   1.00 0.00 ? 74  GLY A N    7  
ATOM 9517  C CA   . GLY A 1 44 ? 7.090   -5.853  6.393   1.00 0.00 ? 74  GLY A CA   7  
ATOM 9518  C C    . GLY A 1 44 ? 5.941   -5.303  5.571   1.00 0.00 ? 74  GLY A C    7  
ATOM 9519  O O    . GLY A 1 44 ? 5.135   -6.060  5.031   1.00 0.00 ? 74  GLY A O    7  
ATOM 9520  H H    . GLY A 1 44 ? 8.526   -4.465  7.094   1.00 0.00 ? 74  GLY A H    7  
ATOM 9521  H HA2  . GLY A 1 44 ? 7.340   -6.839  6.028   1.00 0.00 ? 74  GLY A HA2  7  
ATOM 9522  H HA3  . GLY A 1 44 ? 6.777   -5.931  7.423   1.00 0.00 ? 74  GLY A HA3  7  
ATOM 9523  N N    . VAL A 1 45 ? 5.866   -3.979  5.476   1.00 0.00 ? 75  VAL A N    7  
ATOM 9524  C CA   . VAL A 1 45 ? 4.809   -3.326  4.715   1.00 0.00 ? 75  VAL A CA   7  
ATOM 9525  C C    . VAL A 1 45 ? 5.032   -3.493  3.215   1.00 0.00 ? 75  VAL A C    7  
ATOM 9526  O O    . VAL A 1 45 ? 4.101   -3.788  2.468   1.00 0.00 ? 75  VAL A O    7  
ATOM 9527  C CB   . VAL A 1 45 ? 4.721   -1.823  5.047   1.00 0.00 ? 75  VAL A CB   7  
ATOM 9528  C CG1  . VAL A 1 45 ? 3.522   -1.188  4.357   1.00 0.00 ? 75  VAL A CG1  7  
ATOM 9529  C CG2  . VAL A 1 45 ? 4.655   -1.613  6.553   1.00 0.00 ? 75  VAL A CG2  7  
ATOM 9530  H H    . VAL A 1 45 ? 6.539   -3.429  5.929   1.00 0.00 ? 75  VAL A H    7  
ATOM 9531  H HA   . VAL A 1 45 ? 3.870   -3.788  4.982   1.00 0.00 ? 75  VAL A HA   7  
ATOM 9532  H HB   . VAL A 1 45 ? 5.615   -1.342  4.678   1.00 0.00 ? 75  VAL A HB   7  
ATOM 9533  H HG11 . VAL A 1 45 ? 3.866   -0.487  3.610   1.00 0.00 ? 75  VAL A HG11 7  
ATOM 9534  H HG12 . VAL A 1 45 ? 2.918   -0.668  5.087   1.00 0.00 ? 75  VAL A HG12 7  
ATOM 9535  H HG13 . VAL A 1 45 ? 2.930   -1.957  3.883   1.00 0.00 ? 75  VAL A HG13 7  
ATOM 9536  H HG21 . VAL A 1 45 ? 4.993   -2.506  7.059   1.00 0.00 ? 75  VAL A HG21 7  
ATOM 9537  H HG22 . VAL A 1 45 ? 3.637   -1.399  6.843   1.00 0.00 ? 75  VAL A HG22 7  
ATOM 9538  H HG23 . VAL A 1 45 ? 5.289   -0.783  6.829   1.00 0.00 ? 75  VAL A HG23 7  
ATOM 9539  N N    . ILE A 1 46 ? 6.275   -3.303  2.783   1.00 0.00 ? 76  ILE A N    7  
ATOM 9540  C CA   . ILE A 1 46 ? 6.621   -3.434  1.373   1.00 0.00 ? 76  ILE A CA   7  
ATOM 9541  C C    . ILE A 1 46 ? 6.416   -4.866  0.889   1.00 0.00 ? 76  ILE A C    7  
ATOM 9542  O O    . ILE A 1 46 ? 5.814   -5.097  -0.159  1.00 0.00 ? 76  ILE A O    7  
ATOM 9543  C CB   . ILE A 1 46 ? 8.084   -3.023  1.112   1.00 0.00 ? 76  ILE A CB   7  
ATOM 9544  C CG1  . ILE A 1 46 ? 8.375   -1.656  1.738   1.00 0.00 ? 76  ILE A CG1  7  
ATOM 9545  C CG2  . ILE A 1 46 ? 8.370   -2.997  -0.383  1.00 0.00 ? 76  ILE A CG2  7  
ATOM 9546  C CD1  . ILE A 1 46 ? 9.689   -1.602  2.488   1.00 0.00 ? 76  ILE A CD1  7  
ATOM 9547  H H    . ILE A 1 46 ? 6.975   -3.071  3.428   1.00 0.00 ? 76  ILE A H    7  
ATOM 9548  H HA   . ILE A 1 46 ? 5.977   -2.777  0.807   1.00 0.00 ? 76  ILE A HA   7  
ATOM 9549  H HB   . ILE A 1 46 ? 8.728   -3.762  1.563   1.00 0.00 ? 76  ILE A HB   7  
ATOM 9550  H HG12 . ILE A 1 46 ? 8.409   -0.909  0.959   1.00 0.00 ? 76  ILE A HG12 7  
ATOM 9551  H HG13 . ILE A 1 46 ? 7.585   -1.409  2.433   1.00 0.00 ? 76  ILE A HG13 7  
ATOM 9552  H HG21 . ILE A 1 46 ? 7.650   -2.361  -0.876  1.00 0.00 ? 76  ILE A HG21 7  
ATOM 9553  H HG22 . ILE A 1 46 ? 8.296   -3.999  -0.779  1.00 0.00 ? 76  ILE A HG22 7  
ATOM 9554  H HG23 . ILE A 1 46 ? 9.365   -2.615  -0.553  1.00 0.00 ? 76  ILE A HG23 7  
ATOM 9555  H HD11 . ILE A 1 46 ? 10.196  -2.551  2.393   1.00 0.00 ? 76  ILE A HD11 7  
ATOM 9556  H HD12 . ILE A 1 46 ? 9.499   -1.397  3.531   1.00 0.00 ? 76  ILE A HD12 7  
ATOM 9557  H HD13 . ILE A 1 46 ? 10.307  -0.821  2.073   1.00 0.00 ? 76  ILE A HD13 7  
ATOM 9558  N N    . ARG A 1 47 ? 6.923   -5.823  1.659   1.00 0.00 ? 77  ARG A N    7  
ATOM 9559  C CA   . ARG A 1 47 ? 6.797   -7.234  1.310   1.00 0.00 ? 77  ARG A CA   7  
ATOM 9560  C C    . ARG A 1 47 ? 5.331   -7.658  1.275   1.00 0.00 ? 77  ARG A C    7  
ATOM 9561  O O    . ARG A 1 47 ? 4.919   -8.431  0.412   1.00 0.00 ? 77  ARG A O    7  
ATOM 9562  C CB   . ARG A 1 47 ? 7.572   -8.099  2.307   1.00 0.00 ? 77  ARG A CB   7  
ATOM 9563  C CG   . ARG A 1 47 ? 8.651   -8.953  1.661   1.00 0.00 ? 77  ARG A CG   7  
ATOM 9564  C CD   . ARG A 1 47 ? 8.070   -10.217 1.050   1.00 0.00 ? 77  ARG A CD   7  
ATOM 9565  N NE   . ARG A 1 47 ? 8.018   -11.316 2.012   1.00 0.00 ? 77  ARG A NE   7  
ATOM 9566  C CZ   . ARG A 1 47 ? 9.085   -12.006 2.406   1.00 0.00 ? 77  ARG A CZ   7  
ATOM 9567  N NH1  . ARG A 1 47 ? 10.287  -11.716 1.925   1.00 0.00 ? 77  ARG A NH1  7  
ATOM 9568  N NH2  . ARG A 1 47 ? 8.950   -12.990 3.285   1.00 0.00 ? 77  ARG A NH2  7  
ATOM 9569  H H    . ARG A 1 47 ? 7.393   -5.576  2.483   1.00 0.00 ? 77  ARG A H    7  
ATOM 9570  H HA   . ARG A 1 47 ? 7.220   -7.369  0.325   1.00 0.00 ? 77  ARG A HA   7  
ATOM 9571  H HB2  . ARG A 1 47 ? 8.043   -7.454  3.035   1.00 0.00 ? 77  ARG A HB2  7  
ATOM 9572  H HB3  . ARG A 1 47 ? 6.880   -8.755  2.815   1.00 0.00 ? 77  ARG A HB3  7  
ATOM 9573  H HG2  . ARG A 1 47 ? 9.133   -8.379  0.884   1.00 0.00 ? 77  ARG A HG2  7  
ATOM 9574  H HG3  . ARG A 1 47 ? 9.377   -9.227  2.412   1.00 0.00 ? 77  ARG A HG3  7  
ATOM 9575  H HD2  . ARG A 1 47 ? 7.068   -10.007 0.704   1.00 0.00 ? 77  ARG A HD2  7  
ATOM 9576  H HD3  . ARG A 1 47 ? 8.684   -10.514 0.213   1.00 0.00 ? 77  ARG A HD3  7  
ATOM 9577  H HE   . ARG A 1 47 ? 7.142   -11.552 2.383   1.00 0.00 ? 77  ARG A HE   7  
ATOM 9578  H HH11 . ARG A 1 47 ? 10.396  -10.975 1.262   1.00 0.00 ? 77  ARG A HH11 7  
ATOM 9579  H HH12 . ARG A 1 47 ? 11.085  -12.238 2.225   1.00 0.00 ? 77  ARG A HH12 7  
ATOM 9580  H HH21 . ARG A 1 47 ? 8.046   -13.214 3.651   1.00 0.00 ? 77  ARG A HH21 7  
ATOM 9581  H HH22 . ARG A 1 47 ? 9.751   -13.509 3.582   1.00 0.00 ? 77  ARG A HH22 7  
ATOM 9582  N N    . ARG A 1 48 ? 4.549   -7.147  2.221   1.00 0.00 ? 78  ARG A N    7  
ATOM 9583  C CA   . ARG A 1 48 ? 3.130   -7.473  2.298   1.00 0.00 ? 78  ARG A CA   7  
ATOM 9584  C C    . ARG A 1 48 ? 2.408   -7.073  1.015   1.00 0.00 ? 78  ARG A C    7  
ATOM 9585  O O    . ARG A 1 48 ? 1.782   -7.906  0.359   1.00 0.00 ? 78  ARG A O    7  
ATOM 9586  C CB   . ARG A 1 48 ? 2.489   -6.775  3.499   1.00 0.00 ? 78  ARG A CB   7  
ATOM 9587  C CG   . ARG A 1 48 ? 2.650   -7.537  4.804   1.00 0.00 ? 78  ARG A CG   7  
ATOM 9588  C CD   . ARG A 1 48 ? 1.381   -8.289  5.175   1.00 0.00 ? 78  ARG A CD   7  
ATOM 9589  N NE   . ARG A 1 48 ? 0.992   -9.250  4.145   1.00 0.00 ? 78  ARG A NE   7  
ATOM 9590  C CZ   . ARG A 1 48 ? -0.229  -9.767  4.038   1.00 0.00 ? 78  ARG A CZ   7  
ATOM 9591  N NH1  . ARG A 1 48 ? -1.184  -9.418  4.891   1.00 0.00 ? 78  ARG A NH1  7  
ATOM 9592  N NH2  . ARG A 1 48 ? -0.497  -10.638 3.074   1.00 0.00 ? 78  ARG A NH2  7  
ATOM 9593  H H    . ARG A 1 48 ? 4.936   -6.535  2.882   1.00 0.00 ? 78  ARG A H    7  
ATOM 9594  H HA   . ARG A 1 48 ? 3.044   -8.542  2.427   1.00 0.00 ? 78  ARG A HA   7  
ATOM 9595  H HB2  . ARG A 1 48 ? 2.940   -5.801  3.617   1.00 0.00 ? 78  ARG A HB2  7  
ATOM 9596  H HB3  . ARG A 1 48 ? 1.432   -6.651  3.307   1.00 0.00 ? 78  ARG A HB3  7  
ATOM 9597  H HG2  . ARG A 1 48 ? 3.458   -8.246  4.698   1.00 0.00 ? 78  ARG A HG2  7  
ATOM 9598  H HG3  . ARG A 1 48 ? 2.886   -6.837  5.591   1.00 0.00 ? 78  ARG A HG3  7  
ATOM 9599  H HD2  . ARG A 1 48 ? 1.549   -8.819  6.101   1.00 0.00 ? 78  ARG A HD2  7  
ATOM 9600  H HD3  . ARG A 1 48 ? 0.582   -7.576  5.309   1.00 0.00 ? 78  ARG A HD3  7  
ATOM 9601  H HE   . ARG A 1 48 ? 1.678   -9.525  3.501   1.00 0.00 ? 78  ARG A HE   7  
ATOM 9602  H HH11 . ARG A 1 48 ? -0.988  -8.762  5.620   1.00 0.00 ? 78  ARG A HH11 7  
ATOM 9603  H HH12 . ARG A 1 48 ? -2.099  -9.810  4.805   1.00 0.00 ? 78  ARG A HH12 7  
ATOM 9604  H HH21 . ARG A 1 48 ? 0.217   -10.904 2.427   1.00 0.00 ? 78  ARG A HH21 7  
ATOM 9605  H HH22 . ARG A 1 48 ? -1.415  -11.027 2.993   1.00 0.00 ? 78  ARG A HH22 7  
ATOM 9606  N N    . VAL A 1 49 ? 2.502   -5.796  0.662   1.00 0.00 ? 79  VAL A N    7  
ATOM 9607  C CA   . VAL A 1 49 ? 1.859   -5.288  -0.543  1.00 0.00 ? 79  VAL A CA   7  
ATOM 9608  C C    . VAL A 1 49 ? 2.453   -5.927  -1.793  1.00 0.00 ? 79  VAL A C    7  
ATOM 9609  O O    . VAL A 1 49 ? 1.732   -6.260  -2.734  1.00 0.00 ? 79  VAL A O    7  
ATOM 9610  C CB   . VAL A 1 49 ? 1.993   -3.757  -0.651  1.00 0.00 ? 79  VAL A CB   7  
ATOM 9611  C CG1  . VAL A 1 49 ? 1.162   -3.227  -1.810  1.00 0.00 ? 79  VAL A CG1  7  
ATOM 9612  C CG2  . VAL A 1 49 ? 1.586   -3.092  0.655   1.00 0.00 ? 79  VAL A CG2  7  
ATOM 9613  H H    . VAL A 1 49 ? 3.016   -5.180  1.226   1.00 0.00 ? 79  VAL A H    7  
ATOM 9614  H HA   . VAL A 1 49 ? 0.808   -5.533  -0.488  1.00 0.00 ? 79  VAL A HA   7  
ATOM 9615  H HB   . VAL A 1 49 ? 3.029   -3.520  -0.842  1.00 0.00 ? 79  VAL A HB   7  
ATOM 9616  H HG11 . VAL A 1 49 ? 0.223   -2.847  -1.436  1.00 0.00 ? 79  VAL A HG11 7  
ATOM 9617  H HG12 . VAL A 1 49 ? 0.972   -4.027  -2.511  1.00 0.00 ? 79  VAL A HG12 7  
ATOM 9618  H HG13 . VAL A 1 49 ? 1.700   -2.434  -2.306  1.00 0.00 ? 79  VAL A HG13 7  
ATOM 9619  H HG21 . VAL A 1 49 ? 0.945   -3.758  1.214   1.00 0.00 ? 79  VAL A HG21 7  
ATOM 9620  H HG22 . VAL A 1 49 ? 1.054   -2.176  0.443   1.00 0.00 ? 79  VAL A HG22 7  
ATOM 9621  H HG23 . VAL A 1 49 ? 2.469   -2.870  1.236   1.00 0.00 ? 79  VAL A HG23 7  
ATOM 9622  N N    . SER A 1 50 ? 3.771   -6.096  -1.797  1.00 0.00 ? 80  SER A N    7  
ATOM 9623  C CA   . SER A 1 50 ? 4.462   -6.695  -2.933  1.00 0.00 ? 80  SER A CA   7  
ATOM 9624  C C    . SER A 1 50 ? 3.988   -8.125  -3.173  1.00 0.00 ? 80  SER A C    7  
ATOM 9625  O O    . SER A 1 50 ? 4.116   -8.654  -4.278  1.00 0.00 ? 80  SER A O    7  
ATOM 9626  C CB   . SER A 1 50 ? 5.975   -6.678  -2.702  1.00 0.00 ? 80  SER A CB   7  
ATOM 9627  O OG   . SER A 1 50 ? 6.643   -7.501  -3.644  1.00 0.00 ? 80  SER A OG   7  
ATOM 9628  H H    . SER A 1 50 ? 4.292   -5.809  -1.017  1.00 0.00 ? 80  SER A H    7  
ATOM 9629  H HA   . SER A 1 50 ? 4.234   -6.105  -3.804  1.00 0.00 ? 80  SER A HA   7  
ATOM 9630  H HB2  . SER A 1 50 ? 6.340   -5.668  -2.804  1.00 0.00 ? 80  SER A HB2  7  
ATOM 9631  H HB3  . SER A 1 50 ? 6.189   -7.041  -1.708  1.00 0.00 ? 80  SER A HB3  7  
ATOM 9632  H HG   . SER A 1 50 ? 7.503   -7.125  -3.844  1.00 0.00 ? 80  SER A HG   7  
ATOM 9633  N N    . GLN A 1 51 ? 3.442   -8.745  -2.134  1.00 0.00 ? 81  GLN A N    7  
ATOM 9634  C CA   . GLN A 1 51 ? 2.949   -10.114 -2.233  1.00 0.00 ? 81  GLN A CA   7  
ATOM 9635  C C    . GLN A 1 51 ? 1.454   -10.134 -2.538  1.00 0.00 ? 81  GLN A C    7  
ATOM 9636  O O    . GLN A 1 51 ? 0.967   -11.016 -3.245  1.00 0.00 ? 81  GLN A O    7  
ATOM 9637  C CB   . GLN A 1 51 ? 3.229   -10.874 -0.935  1.00 0.00 ? 81  GLN A CB   7  
ATOM 9638  C CG   . GLN A 1 51 ? 3.686   -12.306 -1.154  1.00 0.00 ? 81  GLN A CG   7  
ATOM 9639  C CD   . GLN A 1 51 ? 4.268   -12.931 0.099   1.00 0.00 ? 81  GLN A CD   7  
ATOM 9640  O OE1  . GLN A 1 51 ? 5.469   -12.839 0.351   1.00 0.00 ? 81  GLN A OE1  7  
ATOM 9641  N NE2  . GLN A 1 51 ? 3.416   -13.570 0.892   1.00 0.00 ? 81  GLN A NE2  7  
ATOM 9642  H H    . GLN A 1 51 ? 3.368   -8.271  -1.281  1.00 0.00 ? 81  GLN A H    7  
ATOM 9643  H HA   . GLN A 1 51 ? 3.475   -10.597 -3.042  1.00 0.00 ? 81  GLN A HA   7  
ATOM 9644  H HB2  . GLN A 1 51 ? 4.000   -10.353 -0.387  1.00 0.00 ? 81  GLN A HB2  7  
ATOM 9645  H HB3  . GLN A 1 51 ? 2.327   -10.893 -0.341  1.00 0.00 ? 81  GLN A HB3  7  
ATOM 9646  H HG2  . GLN A 1 51 ? 2.839   -12.896 -1.471  1.00 0.00 ? 81  GLN A HG2  7  
ATOM 9647  H HG3  . GLN A 1 51 ? 4.439   -12.317 -1.928  1.00 0.00 ? 81  GLN A HG3  7  
ATOM 9648  H HE21 . GLN A 1 51 ? 2.473   -13.603 0.628   1.00 0.00 ? 81  GLN A HE21 7  
ATOM 9649  H HE22 . GLN A 1 51 ? 3.765   -13.984 1.709   1.00 0.00 ? 81  GLN A HE22 7  
ATOM 9650  N N    . LEU A 1 52 ? 0.732   -9.156  -2.001  1.00 0.00 ? 82  LEU A N    7  
ATOM 9651  C CA   . LEU A 1 52 ? -0.708  -9.062  -2.216  1.00 0.00 ? 82  LEU A CA   7  
ATOM 9652  C C    . LEU A 1 52 ? -1.027  -8.891  -3.697  1.00 0.00 ? 82  LEU A C    7  
ATOM 9653  O O    . LEU A 1 52 ? -2.019  -9.424  -4.194  1.00 0.00 ? 82  LEU A O    7  
ATOM 9654  C CB   . LEU A 1 52 ? -1.286  -7.892  -1.418  1.00 0.00 ? 82  LEU A CB   7  
ATOM 9655  C CG   . LEU A 1 52 ? -2.789  -7.975  -1.146  1.00 0.00 ? 82  LEU A CG   7  
ATOM 9656  C CD1  . LEU A 1 52 ? -3.065  -8.872  0.051   1.00 0.00 ? 82  LEU A CD1  7  
ATOM 9657  C CD2  . LEU A 1 52 ? -3.366  -6.587  -0.917  1.00 0.00 ? 82  LEU A CD2  7  
ATOM 9658  H H    . LEU A 1 52 ? 1.177   -8.482  -1.447  1.00 0.00 ? 82  LEU A H    7  
ATOM 9659  H HA   . LEU A 1 52 ? -1.155  -9.981  -1.866  1.00 0.00 ? 82  LEU A HA   7  
ATOM 9660  H HB2  . LEU A 1 52 ? -0.771  -7.840  -0.469  1.00 0.00 ? 82  LEU A HB2  7  
ATOM 9661  H HB3  . LEU A 1 52 ? -1.093  -6.981  -1.964  1.00 0.00 ? 82  LEU A HB3  7  
ATOM 9662  H HG   . LEU A 1 52 ? -3.281  -8.406  -2.006  1.00 0.00 ? 82  LEU A HG   7  
ATOM 9663  H HD11 . LEU A 1 52 ? -4.128  -9.038  0.140   1.00 0.00 ? 82  LEU A HD11 7  
ATOM 9664  H HD12 . LEU A 1 52 ? -2.698  -8.398  0.950   1.00 0.00 ? 82  LEU A HD12 7  
ATOM 9665  H HD13 . LEU A 1 52 ? -2.564  -9.819  -0.086  1.00 0.00 ? 82  LEU A HD13 7  
ATOM 9666  H HD21 . LEU A 1 52 ? -4.365  -6.540  -1.326  1.00 0.00 ? 82  LEU A HD21 7  
ATOM 9667  H HD22 . LEU A 1 52 ? -2.742  -5.852  -1.405  1.00 0.00 ? 82  LEU A HD22 7  
ATOM 9668  H HD23 . LEU A 1 52 ? -3.401  -6.381  0.143   1.00 0.00 ? 82  LEU A HD23 7  
ATOM 9669  N N    . PHE A 1 53 ? -0.179  -8.144  -4.398  1.00 0.00 ? 83  PHE A N    7  
ATOM 9670  C CA   . PHE A 1 53 ? -0.370  -7.903  -5.824  1.00 0.00 ? 83  PHE A CA   7  
ATOM 9671  C C    . PHE A 1 53 ? 0.728   -8.576  -6.641  1.00 0.00 ? 83  PHE A C    7  
ATOM 9672  O O    . PHE A 1 53 ? 1.386   -7.939  -7.464  1.00 0.00 ? 83  PHE A O    7  
ATOM 9673  C CB   . PHE A 1 53 ? -0.389  -6.400  -6.108  1.00 0.00 ? 83  PHE A CB   7  
ATOM 9674  C CG   . PHE A 1 53 ? -1.287  -5.626  -5.185  1.00 0.00 ? 83  PHE A CG   7  
ATOM 9675  C CD1  . PHE A 1 53 ? -2.642  -5.908  -5.118  1.00 0.00 ? 83  PHE A CD1  7  
ATOM 9676  C CD2  . PHE A 1 53 ? -0.776  -4.616  -4.386  1.00 0.00 ? 83  PHE A CD2  7  
ATOM 9677  C CE1  . PHE A 1 53 ? -3.471  -5.198  -4.271  1.00 0.00 ? 83  PHE A CE1  7  
ATOM 9678  C CE2  . PHE A 1 53 ? -1.599  -3.902  -3.537  1.00 0.00 ? 83  PHE A CE2  7  
ATOM 9679  C CZ   . PHE A 1 53 ? -2.948  -4.194  -3.479  1.00 0.00 ? 83  PHE A CZ   7  
ATOM 9680  H H    . PHE A 1 53 ? 0.594   -7.747  -3.946  1.00 0.00 ? 83  PHE A H    7  
ATOM 9681  H HA   . PHE A 1 53 ? -1.323  -8.325  -6.106  1.00 0.00 ? 83  PHE A HA   7  
ATOM 9682  H HB2  . PHE A 1 53 ? 0.611   -6.009  -6.003  1.00 0.00 ? 83  PHE A HB2  7  
ATOM 9683  H HB3  . PHE A 1 53 ? -0.730  -6.236  -7.119  1.00 0.00 ? 83  PHE A HB3  7  
ATOM 9684  H HD1  . PHE A 1 53 ? -3.051  -6.694  -5.736  1.00 0.00 ? 83  PHE A HD1  7  
ATOM 9685  H HD2  . PHE A 1 53 ? 0.279   -4.387  -4.431  1.00 0.00 ? 83  PHE A HD2  7  
ATOM 9686  H HE1  . PHE A 1 53 ? -4.525  -5.427  -4.228  1.00 0.00 ? 83  PHE A HE1  7  
ATOM 9687  H HE2  . PHE A 1 53 ? -1.189  -3.118  -2.919  1.00 0.00 ? 83  PHE A HE2  7  
ATOM 9688  H HZ   . PHE A 1 53 ? -3.594  -3.637  -2.816  1.00 0.00 ? 83  PHE A HZ   7  
ATOM 9689  N N    . HIS A 1 54 ? 0.921   -9.870  -6.407  1.00 0.00 ? 84  HIS A N    7  
ATOM 9690  C CA   . HIS A 1 54 ? 1.940   -10.633 -7.117  1.00 0.00 ? 84  HIS A CA   7  
ATOM 9691  C C    . HIS A 1 54 ? 1.666   -10.657 -8.620  1.00 0.00 ? 84  HIS A C    7  
ATOM 9692  O O    . HIS A 1 54 ? 2.584   -10.823 -9.423  1.00 0.00 ? 84  HIS A O    7  
ATOM 9693  C CB   . HIS A 1 54 ? 2.009   -12.063 -6.577  1.00 0.00 ? 84  HIS A CB   7  
ATOM 9694  C CG   . HIS A 1 54 ? 0.666   -12.694 -6.368  1.00 0.00 ? 84  HIS A CG   7  
ATOM 9695  N ND1  . HIS A 1 54 ? 0.244   -13.177 -5.147  1.00 0.00 ? 84  HIS A ND1  7  
ATOM 9696  C CD2  . HIS A 1 54 ? -0.353  -12.917 -7.232  1.00 0.00 ? 84  HIS A CD2  7  
ATOM 9697  C CE1  . HIS A 1 54 ? -0.975  -13.671 -5.269  1.00 0.00 ? 84  HIS A CE1  7  
ATOM 9698  N NE2  . HIS A 1 54 ? -1.360  -13.525 -6.523  1.00 0.00 ? 84  HIS A NE2  7  
ATOM 9699  H H    . HIS A 1 54 ? 0.366   -10.321 -5.738  1.00 0.00 ? 84  HIS A H    7  
ATOM 9700  H HA   . HIS A 1 54 ? 2.890   -10.150 -6.948  1.00 0.00 ? 84  HIS A HA   7  
ATOM 9701  H HB2  . HIS A 1 54 ? 2.557   -12.679 -7.275  1.00 0.00 ? 84  HIS A HB2  7  
ATOM 9702  H HB3  . HIS A 1 54 ? 2.526   -12.057 -5.629  1.00 0.00 ? 84  HIS A HB3  7  
ATOM 9703  H HD1  . HIS A 1 54 ? 0.762   -13.160 -4.315  1.00 0.00 ? 84  HIS A HD1  7  
ATOM 9704  H HD2  . HIS A 1 54 ? -0.369  -12.663 -8.282  1.00 0.00 ? 84  HIS A HD2  7  
ATOM 9705  H HE1  . HIS A 1 54 ? -1.559  -14.117 -4.477  1.00 0.00 ? 84  HIS A HE1  7  
ATOM 9706  H HE2  . HIS A 1 54 ? -2.256  -13.726 -6.867  1.00 0.00 ? 84  HIS A HE2  7  
ATOM 9707  N N    . GLU A 1 55 ? 0.400   -10.494 -8.994  1.00 0.00 ? 85  GLU A N    7  
ATOM 9708  C CA   . GLU A 1 55 ? 0.015   -10.500 -10.401 1.00 0.00 ? 85  GLU A CA   7  
ATOM 9709  C C    . GLU A 1 55 ? -0.479  -9.125  -10.847 1.00 0.00 ? 85  GLU A C    7  
ATOM 9710  O O    . GLU A 1 55 ? -1.254  -9.014  -11.797 1.00 0.00 ? 85  GLU A O    7  
ATOM 9711  C CB   . GLU A 1 55 ? -1.072  -11.547 -10.649 1.00 0.00 ? 85  GLU A CB   7  
ATOM 9712  C CG   . GLU A 1 55 ? -1.379  -11.771 -12.121 1.00 0.00 ? 85  GLU A CG   7  
ATOM 9713  C CD   . GLU A 1 55 ? -0.960  -13.148 -12.602 1.00 0.00 ? 85  GLU A CD   7  
ATOM 9714  O OE1  . GLU A 1 55 ? 0.180   -13.561 -12.301 1.00 0.00 ? 85  GLU A OE1  7  
ATOM 9715  O OE2  . GLU A 1 55 ? -1.772  -13.811 -13.281 1.00 0.00 ? 85  GLU A OE2  7  
ATOM 9716  H H    . GLU A 1 55 ? -0.290  -10.367 -8.311  1.00 0.00 ? 85  GLU A H    7  
ATOM 9717  H HA   . GLU A 1 55 ? 0.887   -10.760 -10.982 1.00 0.00 ? 85  GLU A HA   7  
ATOM 9718  H HB2  . GLU A 1 55 ? -0.754  -12.488 -10.221 1.00 0.00 ? 85  GLU A HB2  7  
ATOM 9719  H HB3  . GLU A 1 55 ? -1.980  -11.230 -10.159 1.00 0.00 ? 85  GLU A HB3  7  
ATOM 9720  H HG2  . GLU A 1 55 ? -2.441  -11.662 -12.275 1.00 0.00 ? 85  GLU A HG2  7  
ATOM 9721  H HG3  . GLU A 1 55 ? -0.853  -11.028 -12.702 1.00 0.00 ? 85  GLU A HG3  7  
ATOM 9722  N N    . HIS A 1 56 ? -0.025  -8.082  -10.160 1.00 0.00 ? 86  HIS A N    7  
ATOM 9723  C CA   . HIS A 1 56 ? -0.424  -6.718  -10.494 1.00 0.00 ? 86  HIS A CA   7  
ATOM 9724  C C    . HIS A 1 56 ? 0.759   -5.759  -10.374 1.00 0.00 ? 86  HIS A C    7  
ATOM 9725  O O    . HIS A 1 56 ? 0.965   -5.142  -9.329  1.00 0.00 ? 86  HIS A O    7  
ATOM 9726  C CB   . HIS A 1 56 ? -1.568  -6.260  -9.586  1.00 0.00 ? 86  HIS A CB   7  
ATOM 9727  C CG   . HIS A 1 56 ? -2.896  -6.221  -10.275 1.00 0.00 ? 86  HIS A CG   7  
ATOM 9728  N ND1  . HIS A 1 56 ? -3.060  -5.773  -11.570 1.00 0.00 ? 86  HIS A ND1  7  
ATOM 9729  C CD2  . HIS A 1 56 ? -4.130  -6.579  -9.845  1.00 0.00 ? 86  HIS A CD2  7  
ATOM 9730  C CE1  . HIS A 1 56 ? -4.335  -5.855  -11.904 1.00 0.00 ? 86  HIS A CE1  7  
ATOM 9731  N NE2  . HIS A 1 56 ? -5.005  -6.342  -10.876 1.00 0.00 ? 86  HIS A NE2  7  
ATOM 9732  H H    . HIS A 1 56 ? 0.592   -8.230  -9.414  1.00 0.00 ? 86  HIS A H    7  
ATOM 9733  H HA   . HIS A 1 56 ? -0.768  -6.718  -11.518 1.00 0.00 ? 86  HIS A HA   7  
ATOM 9734  H HB2  . HIS A 1 56 ? -1.648  -6.938  -8.750  1.00 0.00 ? 86  HIS A HB2  7  
ATOM 9735  H HB3  . HIS A 1 56 ? -1.354  -5.268  -9.220  1.00 0.00 ? 86  HIS A HB3  7  
ATOM 9736  H HD1  . HIS A 1 56 ? -2.347  -5.442  -12.155 1.00 0.00 ? 86  HIS A HD1  7  
ATOM 9737  H HD2  . HIS A 1 56 ? -4.378  -6.976  -8.871  1.00 0.00 ? 86  HIS A HD2  7  
ATOM 9738  H HE1  . HIS A 1 56 ? -4.758  -5.574  -12.858 1.00 0.00 ? 86  HIS A HE1  7  
ATOM 9739  H HE2  . HIS A 1 56 ? -5.960  -6.561  -10.875 1.00 0.00 ? 86  HIS A HE2  7  
ATOM 9740  N N    . PRO A 1 57 ? 1.554   -5.622  -11.449 1.00 0.00 ? 87  PRO A N    7  
ATOM 9741  C CA   . PRO A 1 57 ? 2.723   -4.734  -11.463 1.00 0.00 ? 87  PRO A CA   7  
ATOM 9742  C C    . PRO A 1 57 ? 2.356   -3.284  -11.162 1.00 0.00 ? 87  PRO A C    7  
ATOM 9743  O O    . PRO A 1 57 ? 2.986   -2.635  -10.328 1.00 0.00 ? 87  PRO A O    7  
ATOM 9744  C CB   . PRO A 1 57 ? 3.259   -4.861  -12.893 1.00 0.00 ? 87  PRO A CB   7  
ATOM 9745  C CG   . PRO A 1 57 ? 2.715   -6.154  -13.396 1.00 0.00 ? 87  PRO A CG   7  
ATOM 9746  C CD   . PRO A 1 57 ? 1.379   -6.322  -12.733 1.00 0.00 ? 87  PRO A CD   7  
ATOM 9747  H HA   . PRO A 1 57 ? 3.477   -5.065  -10.763 1.00 0.00 ? 87  PRO A HA   7  
ATOM 9748  H HB2  . PRO A 1 57 ? 2.909   -4.028  -13.485 1.00 0.00 ? 87  PRO A HB2  7  
ATOM 9749  H HB3  . PRO A 1 57 ? 4.339   -4.869  -12.876 1.00 0.00 ? 87  PRO A HB3  7  
ATOM 9750  H HG2  . PRO A 1 57 ? 2.600   -6.112  -14.469 1.00 0.00 ? 87  PRO A HG2  7  
ATOM 9751  H HG3  . PRO A 1 57 ? 3.376   -6.963  -13.120 1.00 0.00 ? 87  PRO A HG3  7  
ATOM 9752  H HD2  . PRO A 1 57 ? 0.602   -5.860  -13.324 1.00 0.00 ? 87  PRO A HD2  7  
ATOM 9753  H HD3  . PRO A 1 57 ? 1.164   -7.369  -12.575 1.00 0.00 ? 87  PRO A HD3  7  
ATOM 9754  N N    . ASP A 1 58 ? 1.335   -2.783  -11.849 1.00 0.00 ? 88  ASP A N    7  
ATOM 9755  C CA   . ASP A 1 58 ? 0.881   -1.406  -11.663 1.00 0.00 ? 88  ASP A CA   7  
ATOM 9756  C C    . ASP A 1 58 ? 0.575   -1.108  -10.196 1.00 0.00 ? 88  ASP A C    7  
ATOM 9757  O O    . ASP A 1 58 ? 0.560   0.052   -9.783  1.00 0.00 ? 88  ASP A O    7  
ATOM 9758  C CB   . ASP A 1 58 ? -0.361  -1.141  -12.516 1.00 0.00 ? 88  ASP A CB   7  
ATOM 9759  C CG   . ASP A 1 58 ? -0.459  0.306   -12.960 1.00 0.00 ? 88  ASP A CG   7  
ATOM 9760  O OD1  . ASP A 1 58 ? -0.584  1.188   -12.086 1.00 0.00 ? 88  ASP A OD1  7  
ATOM 9761  O OD2  . ASP A 1 58 ? -0.409  0.556   -14.184 1.00 0.00 ? 88  ASP A OD2  7  
ATOM 9762  H H    . ASP A 1 58 ? 0.875   -3.352  -12.501 1.00 0.00 ? 88  ASP A H    7  
ATOM 9763  H HA   . ASP A 1 58 ? 1.674   -0.752  -11.991 1.00 0.00 ? 88  ASP A HA   7  
ATOM 9764  H HB2  . ASP A 1 58 ? -0.327  -1.766  -13.396 1.00 0.00 ? 88  ASP A HB2  7  
ATOM 9765  H HB3  . ASP A 1 58 ? -1.243  -1.382  -11.941 1.00 0.00 ? 88  ASP A HB3  7  
ATOM 9766  N N    . LEU A 1 59 ? 0.337   -2.154  -9.411  1.00 0.00 ? 89  LEU A N    7  
ATOM 9767  C CA   . LEU A 1 59 ? 0.036   -1.990  -7.995  1.00 0.00 ? 89  LEU A CA   7  
ATOM 9768  C C    . LEU A 1 59 ? 1.321   -1.939  -7.181  1.00 0.00 ? 89  LEU A C    7  
ATOM 9769  O O    . LEU A 1 59 ? 1.597   -0.952  -6.499  1.00 0.00 ? 89  LEU A O    7  
ATOM 9770  C CB   . LEU A 1 59 ? -0.854  -3.133  -7.501  1.00 0.00 ? 89  LEU A CB   7  
ATOM 9771  C CG   . LEU A 1 59 ? -2.328  -3.020  -7.895  1.00 0.00 ? 89  LEU A CG   7  
ATOM 9772  C CD1  . LEU A 1 59 ? -3.056  -4.328  -7.625  1.00 0.00 ? 89  LEU A CD1  7  
ATOM 9773  C CD2  . LEU A 1 59 ? -2.992  -1.874  -7.149  1.00 0.00 ? 89  LEU A CD2  7  
ATOM 9774  H H    . LEU A 1 59 ? 0.367   -3.055  -9.791  1.00 0.00 ? 89  LEU A H    7  
ATOM 9775  H HA   . LEU A 1 59 ? -0.491  -1.056  -7.873  1.00 0.00 ? 89  LEU A HA   7  
ATOM 9776  H HB2  . LEU A 1 59 ? -0.466  -4.061  -7.897  1.00 0.00 ? 89  LEU A HB2  7  
ATOM 9777  H HB3  . LEU A 1 59 ? -0.794  -3.168  -6.424  1.00 0.00 ? 89  LEU A HB3  7  
ATOM 9778  H HG   . LEU A 1 59 ? -2.395  -2.815  -8.954  1.00 0.00 ? 89  LEU A HG   7  
ATOM 9779  H HD11 . LEU A 1 59 ? -3.703  -4.558  -8.457  1.00 0.00 ? 89  LEU A HD11 7  
ATOM 9780  H HD12 . LEU A 1 59 ? -3.647  -4.232  -6.726  1.00 0.00 ? 89  LEU A HD12 7  
ATOM 9781  H HD13 . LEU A 1 59 ? -2.336  -5.123  -7.498  1.00 0.00 ? 89  LEU A HD13 7  
ATOM 9782  H HD21 . LEU A 1 59 ? -2.308  -1.041  -7.085  1.00 0.00 ? 89  LEU A HD21 7  
ATOM 9783  H HD22 . LEU A 1 59 ? -3.258  -2.197  -6.153  1.00 0.00 ? 89  LEU A HD22 7  
ATOM 9784  H HD23 . LEU A 1 59 ? -3.883  -1.568  -7.677  1.00 0.00 ? 89  LEU A HD23 7  
ATOM 9785  N N    . ILE A 1 60 ? 2.111   -3.004  -7.268  1.00 0.00 ? 90  ILE A N    7  
ATOM 9786  C CA   . ILE A 1 60 ? 3.376   -3.069  -6.550  1.00 0.00 ? 90  ILE A CA   7  
ATOM 9787  C C    . ILE A 1 60 ? 4.279   -1.910  -6.959  1.00 0.00 ? 90  ILE A C    7  
ATOM 9788  O O    . ILE A 1 60 ? 5.080   -1.420  -6.163  1.00 0.00 ? 90  ILE A O    7  
ATOM 9789  C CB   . ILE A 1 60 ? 4.105   -4.403  -6.812  1.00 0.00 ? 90  ILE A CB   7  
ATOM 9790  C CG1  . ILE A 1 60 ? 5.393   -4.480  -5.989  1.00 0.00 ? 90  ILE A CG1  7  
ATOM 9791  C CG2  . ILE A 1 60 ? 4.406   -4.561  -8.295  1.00 0.00 ? 90  ILE A CG2  7  
ATOM 9792  C CD1  . ILE A 1 60 ? 5.963   -5.878  -5.891  1.00 0.00 ? 90  ILE A CD1  7  
ATOM 9793  H H    . ILE A 1 60 ? 1.842   -3.755  -7.836  1.00 0.00 ? 90  ILE A H    7  
ATOM 9794  H HA   . ILE A 1 60 ? 3.165   -2.996  -5.492  1.00 0.00 ? 90  ILE A HA   7  
ATOM 9795  H HB   . ILE A 1 60 ? 3.449   -5.208  -6.517  1.00 0.00 ? 90  ILE A HB   7  
ATOM 9796  H HG12 . ILE A 1 60 ? 6.141   -3.849  -6.443  1.00 0.00 ? 90  ILE A HG12 7  
ATOM 9797  H HG13 . ILE A 1 60 ? 5.193   -4.131  -4.986  1.00 0.00 ? 90  ILE A HG13 7  
ATOM 9798  H HG21 . ILE A 1 60 ? 3.480   -4.568  -8.851  1.00 0.00 ? 90  ILE A HG21 7  
ATOM 9799  H HG22 . ILE A 1 60 ? 4.931   -5.491  -8.458  1.00 0.00 ? 90  ILE A HG22 7  
ATOM 9800  H HG23 . ILE A 1 60 ? 5.020   -3.738  -8.628  1.00 0.00 ? 90  ILE A HG23 7  
ATOM 9801  H HD11 . ILE A 1 60 ? 5.217   -6.544  -5.484  1.00 0.00 ? 90  ILE A HD11 7  
ATOM 9802  H HD12 . ILE A 1 60 ? 6.828   -5.870  -5.244  1.00 0.00 ? 90  ILE A HD12 7  
ATOM 9803  H HD13 . ILE A 1 60 ? 6.251   -6.219  -6.874  1.00 0.00 ? 90  ILE A HD13 7  
ATOM 9804  N N    . VAL A 1 61 ? 4.129   -1.468  -8.205  1.00 0.00 ? 91  VAL A N    7  
ATOM 9805  C CA   . VAL A 1 61 ? 4.922   -0.356  -8.717  1.00 0.00 ? 91  VAL A CA   7  
ATOM 9806  C C    . VAL A 1 61 ? 4.398   0.967   -8.172  1.00 0.00 ? 91  VAL A C    7  
ATOM 9807  O O    . VAL A 1 61 ? 5.168   1.801   -7.690  1.00 0.00 ? 91  VAL A O    7  
ATOM 9808  C CB   . VAL A 1 61 ? 4.913   -0.316  -10.259 1.00 0.00 ? 91  VAL A CB   7  
ATOM 9809  C CG1  . VAL A 1 61 ? 5.722   0.867   -10.773 1.00 0.00 ? 91  VAL A CG1  7  
ATOM 9810  C CG2  . VAL A 1 61 ? 5.448   -1.620  -10.829 1.00 0.00 ? 91  VAL A CG2  7  
ATOM 9811  H H    . VAL A 1 61 ? 3.464   -1.893  -8.790  1.00 0.00 ? 91  VAL A H    7  
ATOM 9812  H HA   . VAL A 1 61 ? 5.942   -0.493  -8.385  1.00 0.00 ? 91  VAL A HA   7  
ATOM 9813  H HB   . VAL A 1 61 ? 3.892   -0.196  -10.589 1.00 0.00 ? 91  VAL A HB   7  
ATOM 9814  H HG11 . VAL A 1 61 ? 6.470   1.136   -10.043 1.00 0.00 ? 91  VAL A HG11 7  
ATOM 9815  H HG12 . VAL A 1 61 ? 5.064   1.708   -10.941 1.00 0.00 ? 91  VAL A HG12 7  
ATOM 9816  H HG13 . VAL A 1 61 ? 6.204   0.597   -11.701 1.00 0.00 ? 91  VAL A HG13 7  
ATOM 9817  H HG21 . VAL A 1 61 ? 6.519   -1.548  -10.949 1.00 0.00 ? 91  VAL A HG21 7  
ATOM 9818  H HG22 . VAL A 1 61 ? 4.991   -1.808  -11.789 1.00 0.00 ? 91  VAL A HG22 7  
ATOM 9819  H HG23 . VAL A 1 61 ? 5.216   -2.430  -10.154 1.00 0.00 ? 91  VAL A HG23 7  
ATOM 9820  N N    . GLY A 1 62 ? 3.084   1.151   -8.243  1.00 0.00 ? 92  GLY A N    7  
ATOM 9821  C CA   . GLY A 1 62 ? 2.480   2.372   -7.744  1.00 0.00 ? 92  GLY A CA   7  
ATOM 9822  C C    . GLY A 1 62 ? 2.787   2.602   -6.278  1.00 0.00 ? 92  GLY A C    7  
ATOM 9823  O O    . GLY A 1 62 ? 3.001   3.736   -5.851  1.00 0.00 ? 92  GLY A O    7  
ATOM 9824  H H    . GLY A 1 62 ? 2.520   0.450   -8.630  1.00 0.00 ? 92  GLY A H    7  
ATOM 9825  H HA2  . GLY A 1 62 ? 2.856   3.207   -8.316  1.00 0.00 ? 92  GLY A HA2  7  
ATOM 9826  H HA3  . GLY A 1 62 ? 1.410   2.311   -7.872  1.00 0.00 ? 92  GLY A HA3  7  
ATOM 9827  N N    . PHE A 1 63 ? 2.812   1.518   -5.506  1.00 0.00 ? 93  PHE A N    7  
ATOM 9828  C CA   . PHE A 1 63 ? 3.098   1.601   -4.083  1.00 0.00 ? 93  PHE A CA   7  
ATOM 9829  C C    . PHE A 1 63 ? 4.578   1.861   -3.847  1.00 0.00 ? 93  PHE A C    7  
ATOM 9830  O O    . PHE A 1 63 ? 4.960   2.543   -2.896  1.00 0.00 ? 93  PHE A O    7  
ATOM 9831  C CB   . PHE A 1 63 ? 2.671   0.314   -3.375  1.00 0.00 ? 93  PHE A CB   7  
ATOM 9832  C CG   . PHE A 1 63 ? 2.737   0.403   -1.878  1.00 0.00 ? 93  PHE A CG   7  
ATOM 9833  C CD1  . PHE A 1 63 ? 3.926   0.161   -1.208  1.00 0.00 ? 93  PHE A CD1  7  
ATOM 9834  C CD2  . PHE A 1 63 ? 1.611   0.728   -1.140  1.00 0.00 ? 93  PHE A CD2  7  
ATOM 9835  C CE1  . PHE A 1 63 ? 3.990   0.242   0.170   1.00 0.00 ? 93  PHE A CE1  7  
ATOM 9836  C CE2  . PHE A 1 63 ? 1.668   0.811   0.239   1.00 0.00 ? 93  PHE A CE2  7  
ATOM 9837  C CZ   . PHE A 1 63 ? 2.860   0.568   0.894   1.00 0.00 ? 93  PHE A CZ   7  
ATOM 9838  H H    . PHE A 1 63 ? 2.636   0.643   -5.905  1.00 0.00 ? 93  PHE A H    7  
ATOM 9839  H HA   . PHE A 1 63 ? 2.536   2.423   -3.686  1.00 0.00 ? 93  PHE A HA   7  
ATOM 9840  H HB2  . PHE A 1 63 ? 1.653   0.081   -3.650  1.00 0.00 ? 93  PHE A HB2  7  
ATOM 9841  H HB3  . PHE A 1 63 ? 3.317   -0.492  -3.691  1.00 0.00 ? 93  PHE A HB3  7  
ATOM 9842  H HD1  . PHE A 1 63 ? 4.811   -0.094  -1.773  1.00 0.00 ? 93  PHE A HD1  7  
ATOM 9843  H HD2  . PHE A 1 63 ? 0.679   0.920   -1.651  1.00 0.00 ? 93  PHE A HD2  7  
ATOM 9844  H HE1  . PHE A 1 63 ? 4.923   0.050   0.681   1.00 0.00 ? 93  PHE A HE1  7  
ATOM 9845  H HE2  . PHE A 1 63 ? 0.783   1.067   0.802   1.00 0.00 ? 93  PHE A HE2  7  
ATOM 9846  H HZ   . PHE A 1 63 ? 2.907   0.632   1.971   1.00 0.00 ? 93  PHE A HZ   7  
ATOM 9847  N N    . ASN A 1 64 ? 5.405   1.315   -4.726  1.00 0.00 ? 94  ASN A N    7  
ATOM 9848  C CA   . ASN A 1 64 ? 6.849   1.485   -4.631  1.00 0.00 ? 94  ASN A CA   7  
ATOM 9849  C C    . ASN A 1 64 ? 7.240   2.942   -4.866  1.00 0.00 ? 94  ASN A C    7  
ATOM 9850  O O    . ASN A 1 64 ? 8.284   3.398   -4.400  1.00 0.00 ? 94  ASN A O    7  
ATOM 9851  C CB   . ASN A 1 64 ? 7.559   0.585   -5.645  1.00 0.00 ? 94  ASN A CB   7  
ATOM 9852  C CG   . ASN A 1 64 ? 9.068   0.678   -5.545  1.00 0.00 ? 94  ASN A CG   7  
ATOM 9853  O OD1  . ASN A 1 64 ? 9.653   0.388   -4.502  1.00 0.00 ? 94  ASN A OD1  7  
ATOM 9854  N ND2  . ASN A 1 64 ? 9.709   1.084   -6.636  1.00 0.00 ? 94  ASN A ND2  7  
ATOM 9855  H H    . ASN A 1 64 ? 5.031   0.787   -5.462  1.00 0.00 ? 94  ASN A H    7  
ATOM 9856  H HA   . ASN A 1 64 ? 7.152   1.199   -3.634  1.00 0.00 ? 94  ASN A HA   7  
ATOM 9857  H HB2  . ASN A 1 64 ? 7.268   -0.440  -5.471  1.00 0.00 ? 94  ASN A HB2  7  
ATOM 9858  H HB3  . ASN A 1 64 ? 7.262   0.875   -6.642  1.00 0.00 ? 94  ASN A HB3  7  
ATOM 9859  H HD21 . ASN A 1 64 ? 9.178   1.299   -7.431  1.00 0.00 ? 94  ASN A HD21 7  
ATOM 9860  H HD22 . ASN A 1 64 ? 10.685  1.153   -6.600  1.00 0.00 ? 94  ASN A HD22 7  
ATOM 9861  N N    . ALA A 1 65 ? 6.393   3.668   -5.593  1.00 0.00 ? 95  ALA A N    7  
ATOM 9862  C CA   . ALA A 1 65 ? 6.647   5.070   -5.892  1.00 0.00 ? 95  ALA A CA   7  
ATOM 9863  C C    . ALA A 1 65 ? 6.421   5.965   -4.671  1.00 0.00 ? 95  ALA A C    7  
ATOM 9864  O O    . ALA A 1 65 ? 6.645   7.173   -4.734  1.00 0.00 ? 95  ALA A O    7  
ATOM 9865  C CB   . ALA A 1 65 ? 5.769   5.526   -7.048  1.00 0.00 ? 95  ALA A CB   7  
ATOM 9866  H H    . ALA A 1 65 ? 5.581   3.250   -5.938  1.00 0.00 ? 95  ALA A H    7  
ATOM 9867  H HA   . ALA A 1 65 ? 7.676   5.157   -6.202  1.00 0.00 ? 95  ALA A HA   7  
ATOM 9868  H HB1  . ALA A 1 65 ? 5.983   6.560   -7.276  1.00 0.00 ? 95  ALA A HB1  7  
ATOM 9869  H HB2  . ALA A 1 65 ? 4.729   5.425   -6.772  1.00 0.00 ? 95  ALA A HB2  7  
ATOM 9870  H HB3  . ALA A 1 65 ? 5.971   4.917   -7.916  1.00 0.00 ? 95  ALA A HB3  7  
ATOM 9871  N N    . PHE A 1 66 ? 5.977   5.372   -3.565  1.00 0.00 ? 96  PHE A N    7  
ATOM 9872  C CA   . PHE A 1 66 ? 5.725   6.132   -2.345  1.00 0.00 ? 96  PHE A CA   7  
ATOM 9873  C C    . PHE A 1 66 ? 6.887   5.989   -1.367  1.00 0.00 ? 96  PHE A C    7  
ATOM 9874  O O    . PHE A 1 66 ? 7.225   6.930   -0.648  1.00 0.00 ? 96  PHE A O    7  
ATOM 9875  C CB   . PHE A 1 66 ? 4.429   5.660   -1.682  1.00 0.00 ? 96  PHE A CB   7  
ATOM 9876  C CG   . PHE A 1 66 ? 3.193   6.011   -2.459  1.00 0.00 ? 96  PHE A CG   7  
ATOM 9877  C CD1  . PHE A 1 66 ? 2.738   5.182   -3.471  1.00 0.00 ? 96  PHE A CD1  7  
ATOM 9878  C CD2  . PHE A 1 66 ? 2.486   7.167   -2.176  1.00 0.00 ? 96  PHE A CD2  7  
ATOM 9879  C CE1  . PHE A 1 66 ? 1.599   5.501   -4.187  1.00 0.00 ? 96  PHE A CE1  7  
ATOM 9880  C CE2  . PHE A 1 66 ? 1.347   7.492   -2.887  1.00 0.00 ? 96  PHE A CE2  7  
ATOM 9881  C CZ   . PHE A 1 66 ? 0.903   6.657   -3.894  1.00 0.00 ? 96  PHE A CZ   7  
ATOM 9882  H H    . PHE A 1 66 ? 5.812   4.408   -3.567  1.00 0.00 ? 96  PHE A H    7  
ATOM 9883  H HA   . PHE A 1 66 ? 5.623   7.171   -2.617  1.00 0.00 ? 96  PHE A HA   7  
ATOM 9884  H HB2  . PHE A 1 66 ? 4.460   4.586   -1.574  1.00 0.00 ? 96  PHE A HB2  7  
ATOM 9885  H HB3  . PHE A 1 66 ? 4.349   6.112   -0.705  1.00 0.00 ? 96  PHE A HB3  7  
ATOM 9886  H HD1  . PHE A 1 66 ? 3.281   4.278   -3.700  1.00 0.00 ? 96  PHE A HD1  7  
ATOM 9887  H HD2  . PHE A 1 66 ? 2.832   7.821   -1.387  1.00 0.00 ? 96  PHE A HD2  7  
ATOM 9888  H HE1  . PHE A 1 66 ? 1.255   4.846   -4.974  1.00 0.00 ? 96  PHE A HE1  7  
ATOM 9889  H HE2  . PHE A 1 66 ? 0.804   8.397   -2.656  1.00 0.00 ? 96  PHE A HE2  7  
ATOM 9890  H HZ   . PHE A 1 66 ? 0.013   6.909   -4.452  1.00 0.00 ? 96  PHE A HZ   7  
ATOM 9891  N N    . LEU A 1 67 ? 7.496   4.808   -1.346  1.00 0.00 ? 97  LEU A N    7  
ATOM 9892  C CA   . LEU A 1 67 ? 8.621   4.545   -0.457  1.00 0.00 ? 97  LEU A CA   7  
ATOM 9893  C C    . LEU A 1 67 ? 9.895   5.201   -0.983  1.00 0.00 ? 97  LEU A C    7  
ATOM 9894  O O    . LEU A 1 67 ? 10.094  5.304   -2.194  1.00 0.00 ? 97  LEU A O    7  
ATOM 9895  C CB   . LEU A 1 67 ? 8.833   3.038   -0.303  1.00 0.00 ? 97  LEU A CB   7  
ATOM 9896  C CG   . LEU A 1 67 ? 7.735   2.305   0.471   1.00 0.00 ? 97  LEU A CG   7  
ATOM 9897  C CD1  . LEU A 1 67 ? 7.357   1.009   -0.233  1.00 0.00 ? 97  LEU A CD1  7  
ATOM 9898  C CD2  . LEU A 1 67 ? 8.181   2.026   1.898   1.00 0.00 ? 97  LEU A CD2  7  
ATOM 9899  H H    . LEU A 1 67 ? 7.181   4.098   -1.943  1.00 0.00 ? 97  LEU A H    7  
ATOM 9900  H HA   . LEU A 1 67 ? 8.384   4.967   0.509   1.00 0.00 ? 97  LEU A HA   7  
ATOM 9901  H HB2  . LEU A 1 67 ? 8.903   2.604   -1.290  1.00 0.00 ? 97  LEU A HB2  7  
ATOM 9902  H HB3  . LEU A 1 67 ? 9.771   2.879   0.209   1.00 0.00 ? 97  LEU A HB3  7  
ATOM 9903  H HG   . LEU A 1 67 ? 6.854   2.930   0.511   1.00 0.00 ? 97  LEU A HG   7  
ATOM 9904  H HD11 . LEU A 1 67 ? 6.647   1.221   -1.018  1.00 0.00 ? 97  LEU A HD11 7  
ATOM 9905  H HD12 . LEU A 1 67 ? 6.916   0.328   0.480   1.00 0.00 ? 97  LEU A HD12 7  
ATOM 9906  H HD13 . LEU A 1 67 ? 8.242   0.561   -0.659  1.00 0.00 ? 97  LEU A HD13 7  
ATOM 9907  H HD21 . LEU A 1 67 ? 8.553   1.015   1.970   1.00 0.00 ? 97  LEU A HD21 7  
ATOM 9908  H HD22 . LEU A 1 67 ? 7.344   2.150   2.569   1.00 0.00 ? 97  LEU A HD22 7  
ATOM 9909  H HD23 . LEU A 1 67 ? 8.966   2.717   2.172   1.00 0.00 ? 97  LEU A HD23 7  
ATOM 9910  N N    . PRO A 1 68 ? 10.780  5.654   -0.077  1.00 0.00 ? 98  PRO A N    7  
ATOM 9911  C CA   . PRO A 1 68 ? 12.039  6.301   -0.460  1.00 0.00 ? 98  PRO A CA   7  
ATOM 9912  C C    . PRO A 1 68 ? 13.043  5.316   -1.047  1.00 0.00 ? 98  PRO A C    7  
ATOM 9913  O O    . PRO A 1 68 ? 12.789  4.113   -1.100  1.00 0.00 ? 98  PRO A O    7  
ATOM 9914  C CB   . PRO A 1 68 ? 12.559  6.872   0.860   1.00 0.00 ? 98  PRO A CB   7  
ATOM 9915  C CG   . PRO A 1 68 ? 11.969  5.993   1.909   1.00 0.00 ? 98  PRO A CG   7  
ATOM 9916  C CD   . PRO A 1 68 ? 10.622  5.572   1.388   1.00 0.00 ? 98  PRO A CD   7  
ATOM 9917  H HA   . PRO A 1 68 ? 11.872  7.105   -1.162  1.00 0.00 ? 98  PRO A HA   7  
ATOM 9918  H HB2  . PRO A 1 68 ? 13.638  6.835   0.872   1.00 0.00 ? 98  PRO A HB2  7  
ATOM 9919  H HB3  . PRO A 1 68 ? 12.227  7.894   0.971   1.00 0.00 ? 98  PRO A HB3  7  
ATOM 9920  H HG2  . PRO A 1 68 ? 12.600  5.130   2.060   1.00 0.00 ? 98  PRO A HG2  7  
ATOM 9921  H HG3  . PRO A 1 68 ? 11.858  6.546   2.831   1.00 0.00 ? 98  PRO A HG3  7  
ATOM 9922  H HD2  . PRO A 1 68 ? 10.400  4.560   1.696   1.00 0.00 ? 98  PRO A HD2  7  
ATOM 9923  H HD3  . PRO A 1 68 ? 9.856   6.250   1.732   1.00 0.00 ? 98  PRO A HD3  7  
ATOM 9924  N N    . LEU A 1 69 ? 14.184  5.836   -1.488  1.00 0.00 ? 99  LEU A N    7  
ATOM 9925  C CA   . LEU A 1 69 ? 15.229  5.003   -2.073  1.00 0.00 ? 99  LEU A CA   7  
ATOM 9926  C C    . LEU A 1 69 ? 15.947  4.191   -1.001  1.00 0.00 ? 99  LEU A C    7  
ATOM 9927  O O    . LEU A 1 69 ? 16.514  3.135   -1.284  1.00 0.00 ? 99  LEU A O    7  
ATOM 9928  C CB   . LEU A 1 69 ? 16.235  5.870   -2.832  1.00 0.00 ? 99  LEU A CB   7  
ATOM 9929  C CG   . LEU A 1 69 ? 17.286  5.096   -3.630  1.00 0.00 ? 99  LEU A CG   7  
ATOM 9930  C CD1  . LEU A 1 69 ? 16.804  4.853   -5.051  1.00 0.00 ? 99  LEU A CD1  7  
ATOM 9931  C CD2  . LEU A 1 69 ? 18.610  5.844   -3.634  1.00 0.00 ? 99  LEU A CD2  7  
ATOM 9932  H H    . LEU A 1 69 ? 14.326  6.803   -1.419  1.00 0.00 ? 99  LEU A H    7  
ATOM 9933  H HA   . LEU A 1 69 ? 14.759  4.323   -2.769  1.00 0.00 ? 99  LEU A HA   7  
ATOM 9934  H HB2  . LEU A 1 69 ? 15.689  6.505   -3.515  1.00 0.00 ? 99  LEU A HB2  7  
ATOM 9935  H HB3  . LEU A 1 69 ? 16.748  6.497   -2.118  1.00 0.00 ? 99  LEU A HB3  7  
ATOM 9936  H HG   . LEU A 1 69 ? 17.446  4.135   -3.163  1.00 0.00 ? 99  LEU A HG   7  
ATOM 9937  H HD11 . LEU A 1 69 ? 17.009  5.724   -5.655  1.00 0.00 ? 99  LEU A HD11 7  
ATOM 9938  H HD12 . LEU A 1 69 ? 15.740  4.664   -5.043  1.00 0.00 ? 99  LEU A HD12 7  
ATOM 9939  H HD13 . LEU A 1 69 ? 17.319  3.999   -5.464  1.00 0.00 ? 99  LEU A HD13 7  
ATOM 9940  H HD21 . LEU A 1 69 ? 19.223  5.497   -2.816  1.00 0.00 ? 99  LEU A HD21 7  
ATOM 9941  H HD22 . LEU A 1 69 ? 18.426  6.903   -3.521  1.00 0.00 ? 99  LEU A HD22 7  
ATOM 9942  H HD23 . LEU A 1 69 ? 19.121  5.666   -4.568  1.00 0.00 ? 99  LEU A HD23 7  
ATOM 9943  N N    . GLY A 1 70 ? 15.923  4.688   0.233   1.00 0.00 ? 100 GLY A N    7  
ATOM 9944  C CA   . GLY A 1 70 ? 16.577  3.995   1.329   1.00 0.00 ? 100 GLY A CA   7  
ATOM 9945  C C    . GLY A 1 70 ? 16.132  2.550   1.454   1.00 0.00 ? 100 GLY A C    7  
ATOM 9946  O O    . GLY A 1 70 ? 16.876  1.707   1.959   1.00 0.00 ? 100 GLY A O    7  
ATOM 9947  H H    . GLY A 1 70 ? 15.457  5.533   0.401   1.00 0.00 ? 100 GLY A H    7  
ATOM 9948  H HA2  . GLY A 1 70 ? 17.645  4.017   1.167   1.00 0.00 ? 100 GLY A HA2  7  
ATOM 9949  H HA3  . GLY A 1 70 ? 16.352  4.510   2.251   1.00 0.00 ? 100 GLY A HA3  7  
ATOM 9950  N N    . TYR A 1 71 ? 14.919  2.262   0.996   1.00 0.00 ? 101 TYR A N    7  
ATOM 9951  C CA   . TYR A 1 71 ? 14.378  0.910   1.060   1.00 0.00 ? 101 TYR A CA   7  
ATOM 9952  C C    . TYR A 1 71 ? 13.939  0.432   -0.320  1.00 0.00 ? 101 TYR A C    7  
ATOM 9953  O O    . TYR A 1 71 ? 13.005  0.976   -0.909  1.00 0.00 ? 101 TYR A O    7  
ATOM 9954  C CB   . TYR A 1 71 ? 13.196  0.856   2.031   1.00 0.00 ? 101 TYR A CB   7  
ATOM 9955  C CG   . TYR A 1 71 ? 13.585  0.454   3.435   1.00 0.00 ? 101 TYR A CG   7  
ATOM 9956  C CD1  . TYR A 1 71 ? 14.228  -0.752  3.681   1.00 0.00 ? 101 TYR A CD1  7  
ATOM 9957  C CD2  . TYR A 1 71 ? 13.311  1.284   4.517   1.00 0.00 ? 101 TYR A CD2  7  
ATOM 9958  C CE1  . TYR A 1 71 ? 14.585  -1.123  4.963   1.00 0.00 ? 101 TYR A CE1  7  
ATOM 9959  C CE2  . TYR A 1 71 ? 13.665  0.921   5.801   1.00 0.00 ? 101 TYR A CE2  7  
ATOM 9960  C CZ   . TYR A 1 71 ? 14.302  -0.282  6.020   1.00 0.00 ? 101 TYR A CZ   7  
ATOM 9961  O OH   . TYR A 1 71 ? 14.657  -0.647  7.298   1.00 0.00 ? 101 TYR A OH   7  
ATOM 9962  H H    . TYR A 1 71 ? 14.374  2.977   0.605   1.00 0.00 ? 101 TYR A H    7  
ATOM 9963  H HA   . TYR A 1 71 ? 15.158  0.257   1.422   1.00 0.00 ? 101 TYR A HA   7  
ATOM 9964  H HB2  . TYR A 1 71 ? 12.735  1.831   2.081   1.00 0.00 ? 101 TYR A HB2  7  
ATOM 9965  H HB3  . TYR A 1 71 ? 12.473  0.140   1.668   1.00 0.00 ? 101 TYR A HB3  7  
ATOM 9966  H HD1  . TYR A 1 71 ? 14.449  -1.407  2.852   1.00 0.00 ? 101 TYR A HD1  7  
ATOM 9967  H HD2  . TYR A 1 71 ? 12.811  2.225   4.343   1.00 0.00 ? 101 TYR A HD2  7  
ATOM 9968  H HE1  . TYR A 1 71 ? 15.084  -2.065  5.133   1.00 0.00 ? 101 TYR A HE1  7  
ATOM 9969  H HE2  . TYR A 1 71 ? 13.443  1.579   6.628   1.00 0.00 ? 101 TYR A HE2  7  
ATOM 9970  H HH   . TYR A 1 71 ? 15.285  -0.013  7.650   1.00 0.00 ? 101 TYR A HH   7  
ATOM 9971  N N    . ARG A 1 72 ? 14.620  -0.588  -0.833  1.00 0.00 ? 102 ARG A N    7  
ATOM 9972  C CA   . ARG A 1 72 ? 14.301  -1.139  -2.144  1.00 0.00 ? 102 ARG A CA   7  
ATOM 9973  C C    . ARG A 1 72 ? 13.195  -2.185  -2.040  1.00 0.00 ? 102 ARG A C    7  
ATOM 9974  O O    . ARG A 1 72 ? 13.178  -2.994  -1.112  1.00 0.00 ? 102 ARG A O    7  
ATOM 9975  C CB   . ARG A 1 72 ? 15.550  -1.755  -2.779  1.00 0.00 ? 102 ARG A CB   7  
ATOM 9976  C CG   . ARG A 1 72 ? 15.932  -1.121  -4.107  1.00 0.00 ? 102 ARG A CG   7  
ATOM 9977  C CD   . ARG A 1 72 ? 17.160  -0.235  -3.970  1.00 0.00 ? 102 ARG A CD   7  
ATOM 9978  N NE   . ARG A 1 72 ? 18.400  -0.983  -4.171  1.00 0.00 ? 102 ARG A NE   7  
ATOM 9979  C CZ   . ARG A 1 72 ? 19.595  -0.414  -4.311  1.00 0.00 ? 102 ARG A CZ   7  
ATOM 9980  N NH1  . ARG A 1 72 ? 19.717  0.907   -4.273  1.00 0.00 ? 102 ARG A NH1  7  
ATOM 9981  N NH2  . ARG A 1 72 ? 20.671  -1.169  -4.489  1.00 0.00 ? 102 ARG A NH2  7  
ATOM 9982  H H    . ARG A 1 72 ? 15.355  -0.980  -0.315  1.00 0.00 ? 102 ARG A H    7  
ATOM 9983  H HA   . ARG A 1 72 ? 13.954  -0.328  -2.767  1.00 0.00 ? 102 ARG A HA   7  
ATOM 9984  H HB2  . ARG A 1 72 ? 16.380  -1.641  -2.097  1.00 0.00 ? 102 ARG A HB2  7  
ATOM 9985  H HB3  . ARG A 1 72 ? 15.376  -2.808  -2.946  1.00 0.00 ? 102 ARG A HB3  7  
ATOM 9986  H HG2  . ARG A 1 72 ? 16.143  -1.902  -4.821  1.00 0.00 ? 102 ARG A HG2  7  
ATOM 9987  H HG3  . ARG A 1 72 ? 15.105  -0.522  -4.459  1.00 0.00 ? 102 ARG A HG3  7  
ATOM 9988  H HD2  . ARG A 1 72 ? 17.105  0.553   -4.708  1.00 0.00 ? 102 ARG A HD2  7  
ATOM 9989  H HD3  . ARG A 1 72 ? 17.169  0.198   -2.982  1.00 0.00 ? 102 ARG A HD3  7  
ATOM 9990  H HE   . ARG A 1 72 ? 18.337  -1.960  -4.203  1.00 0.00 ? 102 ARG A HE   7  
ATOM 9991  H HH11 . ARG A 1 72 ? 18.910  1.482   -4.138  1.00 0.00 ? 102 ARG A HH11 7  
ATOM 9992  H HH12 . ARG A 1 72 ? 20.618  1.328   -4.379  1.00 0.00 ? 102 ARG A HH12 7  
ATOM 9993  H HH21 . ARG A 1 72 ? 20.584  -2.165  -4.518  1.00 0.00 ? 102 ARG A HH21 7  
ATOM 9994  H HH22 . ARG A 1 72 ? 21.569  -0.742  -4.596  1.00 0.00 ? 102 ARG A HH22 7  
ATOM 9995  N N    . ILE A 1 73 ? 12.274  -2.163  -2.996  1.00 0.00 ? 103 ILE A N    7  
ATOM 9996  C CA   . ILE A 1 73 ? 11.165  -3.110  -3.012  1.00 0.00 ? 103 ILE A CA   7  
ATOM 9997  C C    . ILE A 1 73 ? 11.610  -4.470  -3.540  1.00 0.00 ? 103 ILE A C    7  
ATOM 9998  O O    . ILE A 1 73 ? 12.444  -4.554  -4.442  1.00 0.00 ? 103 ILE A O    7  
ATOM 9999  C CB   . ILE A 1 73 ? 9.993   -2.589  -3.870  1.00 0.00 ? 103 ILE A CB   7  
ATOM 10000 C CG1  . ILE A 1 73 ? 8.790   -3.527  -3.758  1.00 0.00 ? 103 ILE A CG1  7  
ATOM 10001 C CG2  . ILE A 1 73 ? 10.420  -2.437  -5.323  1.00 0.00 ? 103 ILE A CG2  7  
ATOM 10002 C CD1  . ILE A 1 73 ? 7.461   -2.806  -3.733  1.00 0.00 ? 103 ILE A CD1  7  
ATOM 10003 H H    . ILE A 1 73 ? 12.342  -1.495  -3.709  1.00 0.00 ? 103 ILE A H    7  
ATOM 10004 H HA   . ILE A 1 73 ? 10.815  -3.227  -1.996  1.00 0.00 ? 103 ILE A HA   7  
ATOM 10005 H HB   . ILE A 1 73 ? 9.714   -1.613  -3.501  1.00 0.00 ? 103 ILE A HB   7  
ATOM 10006 H HG12 . ILE A 1 73 ? 8.786   -4.200  -4.603  1.00 0.00 ? 103 ILE A HG12 7  
ATOM 10007 H HG13 . ILE A 1 73 ? 8.874   -4.102  -2.847  1.00 0.00 ? 103 ILE A HG13 7  
ATOM 10008 H HG21 . ILE A 1 73 ? 10.309  -3.382  -5.832  1.00 0.00 ? 103 ILE A HG21 7  
ATOM 10009 H HG22 . ILE A 1 73 ? 11.454  -2.127  -5.365  1.00 0.00 ? 103 ILE A HG22 7  
ATOM 10010 H HG23 . ILE A 1 73 ? 9.802   -1.694  -5.805  1.00 0.00 ? 103 ILE A HG23 7  
ATOM 10011 H HD11 . ILE A 1 73 ? 6.716   -3.436  -3.270  1.00 0.00 ? 103 ILE A HD11 7  
ATOM 10012 H HD12 . ILE A 1 73 ? 7.158   -2.573  -4.742  1.00 0.00 ? 103 ILE A HD12 7  
ATOM 10013 H HD13 . ILE A 1 73 ? 7.559   -1.890  -3.166  1.00 0.00 ? 103 ILE A HD13 7  
ATOM 10014 N N    . ASP A 1 74 ? 11.049  -5.532  -2.972  1.00 0.00 ? 104 ASP A N    7  
ATOM 10015 C CA   . ASP A 1 74 ? 11.389  -6.889  -3.384  1.00 0.00 ? 104 ASP A CA   7  
ATOM 10016 C C    . ASP A 1 74 ? 10.352  -7.436  -4.362  1.00 0.00 ? 104 ASP A C    7  
ATOM 10017 O O    . ASP A 1 74 ? 9.150   -7.253  -4.172  1.00 0.00 ? 104 ASP A O    7  
ATOM 10018 C CB   . ASP A 1 74 ? 11.491  -7.805  -2.163  1.00 0.00 ? 104 ASP A CB   7  
ATOM 10019 C CG   . ASP A 1 74 ? 12.913  -7.931  -1.653  1.00 0.00 ? 104 ASP A CG   7  
ATOM 10020 O OD1  . ASP A 1 74 ? 13.647  -8.810  -2.153  1.00 0.00 ? 104 ASP A OD1  7  
ATOM 10021 O OD2  . ASP A 1 74 ? 13.292  -7.153  -0.753  1.00 0.00 ? 104 ASP A OD2  7  
ATOM 10022 H H    . ASP A 1 74 ? 10.392  -5.400  -2.257  1.00 0.00 ? 104 ASP A H    7  
ATOM 10023 H HA   . ASP A 1 74 ? 12.348  -6.855  -3.879  1.00 0.00 ? 104 ASP A HA   7  
ATOM 10024 H HB2  . ASP A 1 74 ? 10.878  -7.406  -1.370  1.00 0.00 ? 104 ASP A HB2  7  
ATOM 10025 H HB3  . ASP A 1 74 ? 11.134  -8.790  -2.429  1.00 0.00 ? 104 ASP A HB3  7  
ATOM 10026 N N    . ILE A 1 75 ? 10.827  -8.106  -5.407  1.00 0.00 ? 105 ILE A N    7  
ATOM 10027 C CA   . ILE A 1 75 ? 9.940   -8.679  -6.412  1.00 0.00 ? 105 ILE A CA   7  
ATOM 10028 C C    . ILE A 1 75 ? 10.444  -10.043 -6.879  1.00 0.00 ? 105 ILE A C    7  
ATOM 10029 O O    . ILE A 1 75 ? 11.204  -10.136 -7.843  1.00 0.00 ? 105 ILE A O    7  
ATOM 10030 C CB   . ILE A 1 75 ? 9.802   -7.751  -7.634  1.00 0.00 ? 105 ILE A CB   7  
ATOM 10031 C CG1  . ILE A 1 75 ? 11.180  -7.413  -8.209  1.00 0.00 ? 105 ILE A CG1  7  
ATOM 10032 C CG2  . ILE A 1 75 ? 9.053   -6.482  -7.253  1.00 0.00 ? 105 ILE A CG2  7  
ATOM 10033 C CD1  . ILE A 1 75 ? 11.411  -7.979  -9.594  1.00 0.00 ? 105 ILE A CD1  7  
ATOM 10034 H H    . ILE A 1 75 ? 11.795  -8.218  -5.503  1.00 0.00 ? 105 ILE A H    7  
ATOM 10035 H HA   . ILE A 1 75 ? 8.963   -8.801  -5.966  1.00 0.00 ? 105 ILE A HA   7  
ATOM 10036 H HB   . ILE A 1 75 ? 9.223   -8.267  -8.386  1.00 0.00 ? 105 ILE A HB   7  
ATOM 10037 H HG12 . ILE A 1 75 ? 11.288  -6.340  -8.269  1.00 0.00 ? 105 ILE A HG12 7  
ATOM 10038 H HG13 . ILE A 1 75 ? 11.944  -7.811  -7.556  1.00 0.00 ? 105 ILE A HG13 7  
ATOM 10039 H HG21 . ILE A 1 75 ? 8.407   -6.186  -8.067  1.00 0.00 ? 105 ILE A HG21 7  
ATOM 10040 H HG22 . ILE A 1 75 ? 9.761   -5.693  -7.050  1.00 0.00 ? 105 ILE A HG22 7  
ATOM 10041 H HG23 . ILE A 1 75 ? 8.457   -6.666  -6.371  1.00 0.00 ? 105 ILE A HG23 7  
ATOM 10042 H HD11 . ILE A 1 75 ? 11.058  -7.277  -10.333 1.00 0.00 ? 105 ILE A HD11 7  
ATOM 10043 H HD12 . ILE A 1 75 ? 10.875  -8.910  -9.696  1.00 0.00 ? 105 ILE A HD12 7  
ATOM 10044 H HD13 . ILE A 1 75 ? 12.468  -8.154  -9.739  1.00 0.00 ? 105 ILE A HD13 7  
ATOM 10045 N N    . PRO A 1 76 ? 10.027  -11.123 -6.197  1.00 0.00 ? 106 PRO A N    7  
ATOM 10046 C CA   . PRO A 1 76 ? 10.440  -12.486 -6.547  1.00 0.00 ? 106 PRO A CA   7  
ATOM 10047 C C    . PRO A 1 76 ? 9.841   -12.951 -7.870  1.00 0.00 ? 106 PRO A C    7  
ATOM 10048 O O    . PRO A 1 76 ? 8.622   -12.977 -8.035  1.00 0.00 ? 106 PRO A O    7  
ATOM 10049 C CB   . PRO A 1 76 ? 9.903   -13.332 -5.390  1.00 0.00 ? 106 PRO A CB   7  
ATOM 10050 C CG   . PRO A 1 76 ? 8.757   -12.550 -4.849  1.00 0.00 ? 106 PRO A CG   7  
ATOM 10051 C CD   . PRO A 1 76 ? 9.120   -11.102 -5.033  1.00 0.00 ? 106 PRO A CD   7  
ATOM 10052 H HA   . PRO A 1 76 ? 11.516  -12.573 -6.591  1.00 0.00 ? 106 PRO A HA   7  
ATOM 10053 H HB2  . PRO A 1 76 ? 9.585   -14.295 -5.763  1.00 0.00 ? 106 PRO A HB2  7  
ATOM 10054 H HB3  . PRO A 1 76 ? 10.675  -13.463 -4.647  1.00 0.00 ? 106 PRO A HB3  7  
ATOM 10055 H HG2  . PRO A 1 76 ? 7.859   -12.784 -5.402  1.00 0.00 ? 106 PRO A HG2  7  
ATOM 10056 H HG3  . PRO A 1 76 ? 8.623   -12.771 -3.800  1.00 0.00 ? 106 PRO A HG3  7  
ATOM 10057 H HD2  . PRO A 1 76 ? 8.237   -10.515 -5.243  1.00 0.00 ? 106 PRO A HD2  7  
ATOM 10058 H HD3  . PRO A 1 76 ? 9.626   -10.725 -4.157  1.00 0.00 ? 106 PRO A HD3  7  
ATOM 10059 N N    . LYS A 1 77 ? 10.707  -13.318 -8.809  1.00 0.00 ? 107 LYS A N    7  
ATOM 10060 C CA   . LYS A 1 77 ? 10.262  -13.782 -10.119 1.00 0.00 ? 107 LYS A CA   7  
ATOM 10061 C C    . LYS A 1 77 ? 9.455   -12.705 -10.833 1.00 0.00 ? 107 LYS A C    7  
ATOM 10062 O O    . LYS A 1 77 ? 8.750   -13.042 -11.808 1.00 0.00 ? 107 LYS A O    7  
ATOM 10063 C CB   . LYS A 1 77 ? 9.423   -15.053 -9.974  1.00 0.00 ? 107 LYS A CB   7  
ATOM 10064 C CG   . LYS A 1 77 ? 10.177  -16.212 -9.342  1.00 0.00 ? 107 LYS A CG   7  
ATOM 10065 C CD   . LYS A 1 77 ? 9.865   -16.339 -7.860  1.00 0.00 ? 107 LYS A CD   7  
ATOM 10066 C CE   . LYS A 1 77 ? 11.104  -16.700 -7.059  1.00 0.00 ? 107 LYS A CE   7  
ATOM 10067 N NZ   . LYS A 1 77 ? 11.840  -17.848 -7.659  1.00 0.00 ? 107 LYS A NZ   7  
ATOM 10068 O OXT  . LYS A 1 77 ? 9.533   -11.531 -10.413 1.00 0.00 ? 107 LYS A OXT  7  
ATOM 10069 H H    . LYS A 1 77 ? 11.667  -13.275 -8.618  1.00 0.00 ? 107 LYS A H    7  
ATOM 10070 H HA   . LYS A 1 77 ? 11.140  -14.006 -10.706 1.00 0.00 ? 107 LYS A HA   7  
ATOM 10071 H HB2  . LYS A 1 77 ? 8.562   -14.834 -9.361  1.00 0.00 ? 107 LYS A HB2  7  
ATOM 10072 H HB3  . LYS A 1 77 ? 9.087   -15.361 -10.953 1.00 0.00 ? 107 LYS A HB3  7  
ATOM 10073 H HG2  . LYS A 1 77 ? 9.893   -17.127 -9.839  1.00 0.00 ? 107 LYS A HG2  7  
ATOM 10074 H HG3  . LYS A 1 77 ? 11.237  -16.047 -9.465  1.00 0.00 ? 107 LYS A HG3  7  
ATOM 10075 H HD2  . LYS A 1 77 ? 9.479   -15.396 -7.500  1.00 0.00 ? 107 LYS A HD2  7  
ATOM 10076 H HD3  . LYS A 1 77 ? 9.121   -17.110 -7.724  1.00 0.00 ? 107 LYS A HD3  7  
ATOM 10077 H HE2  . LYS A 1 77 ? 11.760  -15.842 -7.026  1.00 0.00 ? 107 LYS A HE2  7  
ATOM 10078 H HE3  . LYS A 1 77 ? 10.805  -16.961 -6.054  1.00 0.00 ? 107 LYS A HE3  7  
ATOM 10079 H HZ1  . LYS A 1 77 ? 11.191  -18.429 -8.228  1.00 0.00 ? 107 LYS A HZ1  7  
ATOM 10080 H HZ2  . LYS A 1 77 ? 12.253  -18.438 -6.910  1.00 0.00 ? 107 LYS A HZ2  7  
ATOM 10081 H HZ3  . LYS A 1 77 ? 12.604  -17.500 -8.272  1.00 0.00 ? 107 LYS A HZ3  7  
ATOM 10082 N N    . ALA B 2 1  ? 8.453   5.951   7.578   1.00 0.00 ? 43  ALA B N    7  
ATOM 10083 C CA   . ALA B 2 1  ? 8.249   6.882   6.438   1.00 0.00 ? 43  ALA B CA   7  
ATOM 10084 C C    . ALA B 2 1  ? 7.007   7.745   6.652   1.00 0.00 ? 43  ALA B C    7  
ATOM 10085 O O    . ALA B 2 1  ? 5.998   7.272   7.175   1.00 0.00 ? 43  ALA B O    7  
ATOM 10086 C CB   . ALA B 2 1  ? 8.132   6.102   5.136   1.00 0.00 ? 43  ALA B CB   7  
ATOM 10087 H H1   . ALA B 2 1  ? 7.644   5.299   7.603   1.00 0.00 ? 43  ALA B H1   7  
ATOM 10088 H H2   . ALA B 2 1  ? 8.505   6.522   8.446   1.00 0.00 ? 43  ALA B H2   7  
ATOM 10089 H H3   . ALA B 2 1  ? 9.341   5.438   7.412   1.00 0.00 ? 43  ALA B H3   7  
ATOM 10090 H HA   . ALA B 2 1  ? 9.115   7.524   6.366   1.00 0.00 ? 43  ALA B HA   7  
ATOM 10091 H HB1  . ALA B 2 1  ? 7.771   5.106   5.345   1.00 0.00 ? 43  ALA B HB1  7  
ATOM 10092 H HB2  . ALA B 2 1  ? 9.102   6.043   4.664   1.00 0.00 ? 43  ALA B HB2  7  
ATOM 10093 H HB3  . ALA B 2 1  ? 7.441   6.605   4.476   1.00 0.00 ? 43  ALA B HB3  7  
ATOM 10094 N N    . PRO B 2 2  ? 7.063   9.028   6.251   1.00 0.00 ? 44  PRO B N    7  
ATOM 10095 C CA   . PRO B 2 2  ? 5.935   9.952   6.405   1.00 0.00 ? 44  PRO B CA   7  
ATOM 10096 C C    . PRO B 2 2  ? 4.805   9.658   5.422   1.00 0.00 ? 44  PRO B C    7  
ATOM 10097 O O    . PRO B 2 2  ? 3.641   9.959   5.692   1.00 0.00 ? 44  PRO B O    7  
ATOM 10098 C CB   . PRO B 2 2  ? 6.557   11.317  6.111   1.00 0.00 ? 44  PRO B CB   7  
ATOM 10099 C CG   . PRO B 2 2  ? 7.697   11.022  5.200   1.00 0.00 ? 44  PRO B CG   7  
ATOM 10100 C CD   . PRO B 2 2  ? 8.228   9.678   5.618   1.00 0.00 ? 44  PRO B CD   7  
ATOM 10101 H HA   . PRO B 2 2  ? 5.548   9.938   7.413   1.00 0.00 ? 44  PRO B HA   7  
ATOM 10102 H HB2  . PRO B 2 2  ? 5.825   11.954  5.637   1.00 0.00 ? 44  PRO B HB2  7  
ATOM 10103 H HB3  . PRO B 2 2  ? 6.894   11.768  7.032   1.00 0.00 ? 44  PRO B HB3  7  
ATOM 10104 H HG2  . PRO B 2 2  ? 7.351   10.988  4.177   1.00 0.00 ? 44  PRO B HG2  7  
ATOM 10105 H HG3  . PRO B 2 2  ? 8.462   11.777  5.312   1.00 0.00 ? 44  PRO B HG3  7  
ATOM 10106 H HD2  . PRO B 2 2  ? 8.559   9.119   4.756   1.00 0.00 ? 44  PRO B HD2  7  
ATOM 10107 H HD3  . PRO B 2 2  ? 9.035   9.794   6.326   1.00 0.00 ? 44  PRO B HD3  7  
ATOM 10108 N N    . GLN B 2 3  ? 5.154   9.064   4.285   1.00 0.00 ? 45  GLN B N    7  
ATOM 10109 C CA   . GLN B 2 3  ? 4.167   8.727   3.268   1.00 0.00 ? 45  GLN B CA   7  
ATOM 10110 C C    . GLN B 2 3  ? 3.369   7.499   3.682   1.00 0.00 ? 45  GLN B C    7  
ATOM 10111 O O    . GLN B 2 3  ? 2.245   7.292   3.223   1.00 0.00 ? 45  GLN B O    7  
ATOM 10112 C CB   . GLN B 2 3  ? 4.851   8.481   1.921   1.00 0.00 ? 45  GLN B CB   7  
ATOM 10113 C CG   . GLN B 2 3  ? 5.930   9.500   1.590   1.00 0.00 ? 45  GLN B CG   7  
ATOM 10114 C CD   . GLN B 2 3  ? 5.617   10.300  0.340   1.00 0.00 ? 45  GLN B CD   7  
ATOM 10115 O OE1  . GLN B 2 3  ? 4.454   10.560  0.031   1.00 0.00 ? 45  GLN B OE1  7  
ATOM 10116 N NE2  . GLN B 2 3  ? 6.656   10.694  -0.387  1.00 0.00 ? 45  GLN B NE2  7  
ATOM 10117 H H    . GLN B 2 3  ? 6.094   8.843   4.129   1.00 0.00 ? 45  GLN B H    7  
ATOM 10118 H HA   . GLN B 2 3  ? 3.492   9.563   3.174   1.00 0.00 ? 45  GLN B HA   7  
ATOM 10119 H HB2  . GLN B 2 3  ? 5.303   7.500   1.934   1.00 0.00 ? 45  GLN B HB2  7  
ATOM 10120 H HB3  . GLN B 2 3  ? 4.104   8.513   1.141   1.00 0.00 ? 45  GLN B HB3  7  
ATOM 10121 H HG2  . GLN B 2 3  ? 6.030   10.183  2.420   1.00 0.00 ? 45  GLN B HG2  7  
ATOM 10122 H HG3  . GLN B 2 3  ? 6.865   8.978   1.440   1.00 0.00 ? 45  GLN B HG3  7  
ATOM 10123 H HE21 . GLN B 2 3  ? 7.555   10.451  -0.080  1.00 0.00 ? 45  GLN B HE21 7  
ATOM 10124 H HE22 . GLN B 2 3  ? 6.482   11.213  -1.199  1.00 0.00 ? 45  GLN B HE22 7  
ATOM 10125 N N    . LEU B 2 4  ? 3.954   6.690   4.554   1.00 0.00 ? 46  LEU B N    7  
ATOM 10126 C CA   . LEU B 2 4  ? 3.291   5.487   5.035   1.00 0.00 ? 46  LEU B CA   7  
ATOM 10127 C C    . LEU B 2 4  ? 2.238   5.843   6.075   1.00 0.00 ? 46  LEU B C    7  
ATOM 10128 O O    . LEU B 2 4  ? 1.191   5.201   6.162   1.00 0.00 ? 46  LEU B O    7  
ATOM 10129 C CB   . LEU B 2 4  ? 4.314   4.510   5.623   1.00 0.00 ? 46  LEU B CB   7  
ATOM 10130 C CG   . LEU B 2 4  ? 4.480   3.204   4.846   1.00 0.00 ? 46  LEU B CG   7  
ATOM 10131 C CD1  . LEU B 2 4  ? 5.502   2.304   5.523   1.00 0.00 ? 46  LEU B CD1  7  
ATOM 10132 C CD2  . LEU B 2 4  ? 3.143   2.491   4.715   1.00 0.00 ? 46  LEU B CD2  7  
ATOM 10133 H H    . LEU B 2 4  ? 4.848   6.910   4.887   1.00 0.00 ? 46  LEU B H    7  
ATOM 10134 H HA   . LEU B 2 4  ? 2.805   5.025   4.192   1.00 0.00 ? 46  LEU B HA   7  
ATOM 10135 H HB2  . LEU B 2 4  ? 5.273   5.006   5.662   1.00 0.00 ? 46  LEU B HB2  7  
ATOM 10136 H HB3  . LEU B 2 4  ? 4.013   4.267   6.632   1.00 0.00 ? 46  LEU B HB3  7  
ATOM 10137 H HG   . LEU B 2 4  ? 4.840   3.427   3.852   1.00 0.00 ? 46  LEU B HG   7  
ATOM 10138 H HD11 . LEU B 2 4  ? 5.920   1.623   4.797   1.00 0.00 ? 46  LEU B HD11 7  
ATOM 10139 H HD12 . LEU B 2 4  ? 5.022   1.742   6.310   1.00 0.00 ? 46  LEU B HD12 7  
ATOM 10140 H HD13 . LEU B 2 4  ? 6.292   2.910   5.945   1.00 0.00 ? 46  LEU B HD13 7  
ATOM 10141 H HD21 . LEU B 2 4  ? 3.299   1.506   4.300   1.00 0.00 ? 46  LEU B HD21 7  
ATOM 10142 H HD22 . LEU B 2 4  ? 2.494   3.057   4.064   1.00 0.00 ? 46  LEU B HD22 7  
ATOM 10143 H HD23 . LEU B 2 4  ? 2.685   2.402   5.690   1.00 0.00 ? 46  LEU B HD23 7  
ATOM 10144 N N    . ILE B 2 5  ? 2.518   6.882   6.855   1.00 0.00 ? 47  ILE B N    7  
ATOM 10145 C CA   . ILE B 2 5  ? 1.592   7.336   7.882   1.00 0.00 ? 47  ILE B CA   7  
ATOM 10146 C C    . ILE B 2 5  ? 0.396   8.033   7.247   1.00 0.00 ? 47  ILE B C    7  
ATOM 10147 O O    . ILE B 2 5  ? -0.742  7.866   7.688   1.00 0.00 ? 47  ILE B O    7  
ATOM 10148 C CB   . ILE B 2 5  ? 2.272   8.299   8.872   1.00 0.00 ? 47  ILE B CB   7  
ATOM 10149 C CG1  . ILE B 2 5  ? 3.581   7.697   9.387   1.00 0.00 ? 47  ILE B CG1  7  
ATOM 10150 C CG2  . ILE B 2 5  ? 1.337   8.617   10.030  1.00 0.00 ? 47  ILE B CG2  7  
ATOM 10151 C CD1  . ILE B 2 5  ? 3.404   6.351   10.056  1.00 0.00 ? 47  ILE B CD1  7  
ATOM 10152 H H    . ILE B 2 5  ? 3.365   7.358   6.731   1.00 0.00 ? 47  ILE B H    7  
ATOM 10153 H HA   . ILE B 2 5  ? 1.246   6.470   8.428   1.00 0.00 ? 47  ILE B HA   7  
ATOM 10154 H HB   . ILE B 2 5  ? 2.488   9.222   8.353   1.00 0.00 ? 47  ILE B HB   7  
ATOM 10155 H HG12 . ILE B 2 5  ? 4.261   7.569   8.559   1.00 0.00 ? 47  ILE B HG12 7  
ATOM 10156 H HG13 . ILE B 2 5  ? 4.020   8.371   10.107  1.00 0.00 ? 47  ILE B HG13 7  
ATOM 10157 H HG21 . ILE B 2 5  ? 0.438   9.080   9.650   1.00 0.00 ? 47  ILE B HG21 7  
ATOM 10158 H HG22 . ILE B 2 5  ? 1.828   9.293   10.714  1.00 0.00 ? 47  ILE B HG22 7  
ATOM 10159 H HG23 . ILE B 2 5  ? 1.081   7.704   10.546  1.00 0.00 ? 47  ILE B HG23 7  
ATOM 10160 H HD11 . ILE B 2 5  ? 2.864   6.478   10.982  1.00 0.00 ? 47  ILE B HD11 7  
ATOM 10161 H HD12 . ILE B 2 5  ? 4.373   5.920   10.260  1.00 0.00 ? 47  ILE B HD12 7  
ATOM 10162 H HD13 . ILE B 2 5  ? 2.849   5.695   9.402   1.00 0.00 ? 47  ILE B HD13 7  
ATOM 10163 N N    . MET B 2 6  ? 0.661   8.813   6.202   1.00 0.00 ? 48  MET B N    7  
ATOM 10164 C CA   . MET B 2 6  ? -0.396  9.530   5.502   1.00 0.00 ? 48  MET B CA   7  
ATOM 10165 C C    . MET B 2 6  ? -1.261  8.566   4.698   1.00 0.00 ? 48  MET B C    7  
ATOM 10166 O O    . MET B 2 6  ? -2.452  8.803   4.493   1.00 0.00 ? 48  MET B O    7  
ATOM 10167 C CB   . MET B 2 6  ? 0.201   10.608  4.586   1.00 0.00 ? 48  MET B CB   7  
ATOM 10168 C CG   . MET B 2 6  ? 0.769   10.069  3.281   1.00 0.00 ? 48  MET B CG   7  
ATOM 10169 S SD   . MET B 2 6  ? -0.275  10.442  1.859   1.00 0.00 ? 48  MET B SD   7  
ATOM 10170 C CE   . MET B 2 6  ? 0.579   9.544   0.566   1.00 0.00 ? 48  MET B CE   7  
ATOM 10171 H H    . MET B 2 6  ? 1.588   8.905   5.894   1.00 0.00 ? 48  MET B H    7  
ATOM 10172 H HA   . MET B 2 6  ? -1.014  10.005  6.243   1.00 0.00 ? 48  MET B HA   7  
ATOM 10173 H HB2  . MET B 2 6  ? -0.569  11.326  4.347   1.00 0.00 ? 48  MET B HB2  7  
ATOM 10174 H HB3  . MET B 2 6  ? 0.996   11.111  5.116   1.00 0.00 ? 48  MET B HB3  7  
ATOM 10175 H HG2  . MET B 2 6  ? 1.742   10.508  3.119   1.00 0.00 ? 48  MET B HG2  7  
ATOM 10176 H HG3  . MET B 2 6  ? 0.869   8.997   3.364   1.00 0.00 ? 48  MET B HG3  7  
ATOM 10177 H HE1  . MET B 2 6  ? -0.130  9.240   -0.190  1.00 0.00 ? 48  MET B HE1  7  
ATOM 10178 H HE2  . MET B 2 6  ? 1.051   8.668   0.988   1.00 0.00 ? 48  MET B HE2  7  
ATOM 10179 H HE3  . MET B 2 6  ? 1.330   10.179  0.122   1.00 0.00 ? 48  MET B HE3  7  
ATOM 10180 N N    . LEU B 2 7  ? -0.653  7.473   4.253   1.00 0.00 ? 49  LEU B N    7  
ATOM 10181 C CA   . LEU B 2 7  ? -1.364  6.464   3.478   1.00 0.00 ? 49  LEU B CA   7  
ATOM 10182 C C    . LEU B 2 7  ? -2.387  5.746   4.350   1.00 0.00 ? 49  LEU B C    7  
ATOM 10183 O O    . LEU B 2 7  ? -3.552  5.606   3.974   1.00 0.00 ? 49  LEU B O    7  
ATOM 10184 C CB   . LEU B 2 7  ? -0.378  5.455   2.886   1.00 0.00 ? 49  LEU B CB   7  
ATOM 10185 C CG   . LEU B 2 7  ? 0.122   5.785   1.478   1.00 0.00 ? 49  LEU B CG   7  
ATOM 10186 C CD1  . LEU B 2 7  ? 1.498   5.182   1.245   1.00 0.00 ? 49  LEU B CD1  7  
ATOM 10187 C CD2  . LEU B 2 7  ? -0.866  5.286   0.435   1.00 0.00 ? 49  LEU B CD2  7  
ATOM 10188 H H    . LEU B 2 7  ? 0.297   7.342   4.456   1.00 0.00 ? 49  LEU B H    7  
ATOM 10189 H HA   . LEU B 2 7  ? -1.881  6.966   2.673   1.00 0.00 ? 49  LEU B HA   7  
ATOM 10190 H HB2  . LEU B 2 7  ? 0.478   5.391   3.544   1.00 0.00 ? 49  LEU B HB2  7  
ATOM 10191 H HB3  . LEU B 2 7  ? -0.858  4.488   2.856   1.00 0.00 ? 49  LEU B HB3  7  
ATOM 10192 H HG   . LEU B 2 7  ? 0.205   6.857   1.375   1.00 0.00 ? 49  LEU B HG   7  
ATOM 10193 H HD11 . LEU B 2 7  ? 2.255   5.923   1.451   1.00 0.00 ? 49  LEU B HD11 7  
ATOM 10194 H HD12 . LEU B 2 7  ? 1.580   4.860   0.216   1.00 0.00 ? 49  LEU B HD12 7  
ATOM 10195 H HD13 . LEU B 2 7  ? 1.636   4.335   1.899   1.00 0.00 ? 49  LEU B HD13 7  
ATOM 10196 H HD21 . LEU B 2 7  ? -0.747  4.220   0.307   1.00 0.00 ? 49  LEU B HD21 7  
ATOM 10197 H HD22 . LEU B 2 7  ? -0.679  5.784   -0.505  1.00 0.00 ? 49  LEU B HD22 7  
ATOM 10198 H HD23 . LEU B 2 7  ? -1.873  5.499   0.761   1.00 0.00 ? 49  LEU B HD23 7  
ATOM 10199 N N    . ALA B 2 8  ? -1.946  5.296   5.520   1.00 0.00 ? 50  ALA B N    7  
ATOM 10200 C CA   . ALA B 2 8  ? -2.822  4.598   6.450   1.00 0.00 ? 50  ALA B CA   7  
ATOM 10201 C C    . ALA B 2 8  ? -3.924  5.522   6.955   1.00 0.00 ? 50  ALA B C    7  
ATOM 10202 O O    . ALA B 2 8  ? -5.030  5.076   7.260   1.00 0.00 ? 50  ALA B O    7  
ATOM 10203 C CB   . ALA B 2 8  ? -2.019  4.042   7.615   1.00 0.00 ? 50  ALA B CB   7  
ATOM 10204 H H    . ALA B 2 8  ? -1.010  5.441   5.764   1.00 0.00 ? 50  ALA B H    7  
ATOM 10205 H HA   . ALA B 2 8  ? -3.271  3.770   5.924   1.00 0.00 ? 50  ALA B HA   7  
ATOM 10206 H HB1  . ALA B 2 8  ? -1.965  4.782   8.401   1.00 0.00 ? 50  ALA B HB1  7  
ATOM 10207 H HB2  . ALA B 2 8  ? -1.021  3.799   7.282   1.00 0.00 ? 50  ALA B HB2  7  
ATOM 10208 H HB3  . ALA B 2 8  ? -2.500  3.152   7.992   1.00 0.00 ? 50  ALA B HB3  7  
ATOM 10209 N N    . ASN B 2 9  ? -3.617  6.814   7.038   1.00 0.00 ? 51  ASN B N    7  
ATOM 10210 C CA   . ASN B 2 9  ? -4.584  7.799   7.503   1.00 0.00 ? 51  ASN B CA   7  
ATOM 10211 C C    . ASN B 2 9  ? -5.785  7.854   6.566   1.00 0.00 ? 51  ASN B C    7  
ATOM 10212 O O    . ASN B 2 9  ? -6.933  7.784   7.003   1.00 0.00 ? 51  ASN B O    7  
ATOM 10213 C CB   . ASN B 2 9  ? -3.931  9.180   7.602   1.00 0.00 ? 51  ASN B CB   7  
ATOM 10214 C CG   . ASN B 2 9  ? -4.175  9.838   8.947   1.00 0.00 ? 51  ASN B CG   7  
ATOM 10215 O OD1  . ASN B 2 9  ? -3.966  9.229   9.996   1.00 0.00 ? 51  ASN B OD1  7  
ATOM 10216 N ND2  . ASN B 2 9  ? -4.618  11.089  8.922   1.00 0.00 ? 51  ASN B ND2  7  
ATOM 10217 H H    . ASN B 2 9  ? -2.719  7.110   6.778   1.00 0.00 ? 51  ASN B H    7  
ATOM 10218 H HA   . ASN B 2 9  ? -4.921  7.497   8.483   1.00 0.00 ? 51  ASN B HA   7  
ATOM 10219 H HB2  . ASN B 2 9  ? -2.866  9.078   7.461   1.00 0.00 ? 51  ASN B HB2  7  
ATOM 10220 H HB3  . ASN B 2 9  ? -4.333  9.821   6.830   1.00 0.00 ? 51  ASN B HB3  7  
ATOM 10221 H HD21 . ASN B 2 9  ? -4.763  11.513  8.049   1.00 0.00 ? 51  ASN B HD21 7  
ATOM 10222 H HD22 . ASN B 2 9  ? -4.785  11.539  9.777   1.00 0.00 ? 51  ASN B HD22 7  
ATOM 10223 N N    . VAL B 2 10 ? -5.509  7.973   5.271   1.00 0.00 ? 52  VAL B N    7  
ATOM 10224 C CA   . VAL B 2 10 ? -6.564  8.029   4.268   1.00 0.00 ? 52  VAL B CA   7  
ATOM 10225 C C    . VAL B 2 10 ? -7.325  6.709   4.207   1.00 0.00 ? 52  VAL B C    7  
ATOM 10226 O O    . VAL B 2 10 ? -8.511  6.680   3.879   1.00 0.00 ? 52  VAL B O    7  
ATOM 10227 C CB   . VAL B 2 10 ? -5.996  8.352   2.873   1.00 0.00 ? 52  VAL B CB   7  
ATOM 10228 C CG1  . VAL B 2 10 ? -7.119  8.531   1.863   1.00 0.00 ? 52  VAL B CG1  7  
ATOM 10229 C CG2  . VAL B 2 10 ? -5.116  9.592   2.928   1.00 0.00 ? 52  VAL B CG2  7  
ATOM 10230 H H    . VAL B 2 10 ? -4.572  8.019   4.984   1.00 0.00 ? 52  VAL B H    7  
ATOM 10231 H HA   . VAL B 2 10 ? -7.251  8.816   4.549   1.00 0.00 ? 52  VAL B HA   7  
ATOM 10232 H HB   . VAL B 2 10 ? -5.386  7.519   2.555   1.00 0.00 ? 52  VAL B HB   7  
ATOM 10233 H HG11 . VAL B 2 10 ? -6.799  9.210   1.086   1.00 0.00 ? 52  VAL B HG11 7  
ATOM 10234 H HG12 . VAL B 2 10 ? -7.988  8.937   2.360   1.00 0.00 ? 52  VAL B HG12 7  
ATOM 10235 H HG13 . VAL B 2 10 ? -7.367  7.576   1.426   1.00 0.00 ? 52  VAL B HG13 7  
ATOM 10236 H HG21 . VAL B 2 10 ? -4.255  9.450   2.292   1.00 0.00 ? 52  VAL B HG21 7  
ATOM 10237 H HG22 . VAL B 2 10 ? -4.789  9.757   3.945   1.00 0.00 ? 52  VAL B HG22 7  
ATOM 10238 H HG23 . VAL B 2 10 ? -5.679  10.448  2.588   1.00 0.00 ? 52  VAL B HG23 7  
ATOM 10239 N N    . ALA B 2 11 ? -6.637  5.619   4.533   1.00 0.00 ? 53  ALA B N    7  
ATOM 10240 C CA   . ALA B 2 11 ? -7.249  4.303   4.525   1.00 0.00 ? 53  ALA B CA   7  
ATOM 10241 C C    . ALA B 2 11 ? -8.108  4.116   5.765   1.00 0.00 ? 53  ALA B C    7  
ATOM 10242 O O    . ALA B 2 11 ? -9.149  3.460   5.723   1.00 0.00 ? 53  ALA B O    7  
ATOM 10243 C CB   . ALA B 2 11 ? -6.182  3.220   4.446   1.00 0.00 ? 53  ALA B CB   7  
ATOM 10244 H H    . ALA B 2 11 ? -5.702  5.703   4.794   1.00 0.00 ? 53  ALA B H    7  
ATOM 10245 H HA   . ALA B 2 11 ? -7.871  4.233   3.649   1.00 0.00 ? 53  ALA B HA   7  
ATOM 10246 H HB1  . ALA B 2 11 ? -5.298  3.546   4.974   1.00 0.00 ? 53  ALA B HB1  7  
ATOM 10247 H HB2  . ALA B 2 11 ? -5.936  3.034   3.411   1.00 0.00 ? 53  ALA B HB2  7  
ATOM 10248 H HB3  . ALA B 2 11 ? -6.557  2.313   4.895   1.00 0.00 ? 53  ALA B HB3  7  
ATOM 10249 N N    . LEU B 2 12 ? -7.664  4.707   6.869   1.00 0.00 ? 54  LEU B N    7  
ATOM 10250 C CA   . LEU B 2 12 ? -8.386  4.622   8.124   1.00 0.00 ? 54  LEU B CA   7  
ATOM 10251 C C    . LEU B 2 12 ? -9.440  5.722   8.222   1.00 0.00 ? 54  LEU B C    7  
ATOM 10252 O O    . LEU B 2 12 ? -10.379 5.626   9.012   1.00 0.00 ? 54  LEU B O    7  
ATOM 10253 C CB   . LEU B 2 12 ? -7.417  4.714   9.304   1.00 0.00 ? 54  LEU B CB   7  
ATOM 10254 C CG   . LEU B 2 12 ? -6.908  3.372   9.831   1.00 0.00 ? 54  LEU B CG   7  
ATOM 10255 C CD1  . LEU B 2 12 ? -6.314  2.545   8.700   1.00 0.00 ? 54  LEU B CD1  7  
ATOM 10256 C CD2  . LEU B 2 12 ? -5.881  3.588   10.933  1.00 0.00 ? 54  LEU B CD2  7  
ATOM 10257 H H    . LEU B 2 12 ? -6.834  5.217   6.835   1.00 0.00 ? 54  LEU B H    7  
ATOM 10258 H HA   . LEU B 2 12 ? -8.874  3.668   8.145   1.00 0.00 ? 54  LEU B HA   7  
ATOM 10259 H HB2  . LEU B 2 12 ? -6.566  5.306   8.999   1.00 0.00 ? 54  LEU B HB2  7  
ATOM 10260 H HB3  . LEU B 2 12 ? -7.917  5.225   10.114  1.00 0.00 ? 54  LEU B HB3  7  
ATOM 10261 H HG   . LEU B 2 12 ? -7.737  2.818   10.249  1.00 0.00 ? 54  LEU B HG   7  
ATOM 10262 H HD11 . LEU B 2 12 ? -5.416  2.054   9.045   1.00 0.00 ? 54  LEU B HD11 7  
ATOM 10263 H HD12 . LEU B 2 12 ? -6.074  3.191   7.869   1.00 0.00 ? 54  LEU B HD12 7  
ATOM 10264 H HD13 . LEU B 2 12 ? -7.031  1.802   8.383   1.00 0.00 ? 54  LEU B HD13 7  
ATOM 10265 H HD21 . LEU B 2 12 ? -6.374  3.560   11.894  1.00 0.00 ? 54  LEU B HD21 7  
ATOM 10266 H HD22 . LEU B 2 12 ? -5.407  4.549   10.799  1.00 0.00 ? 54  LEU B HD22 7  
ATOM 10267 H HD23 . LEU B 2 12 ? -5.134  2.809   10.888  1.00 0.00 ? 54  LEU B HD23 7  
ATOM 10268 N N    . THR B 2 13 ? -9.277  6.766   7.412   1.00 0.00 ? 55  THR B N    7  
ATOM 10269 C CA   . THR B 2 13 ? -10.211 7.882   7.406   1.00 0.00 ? 55  THR B CA   7  
ATOM 10270 C C    . THR B 2 13 ? -9.970  8.786   6.201   1.00 0.00 ? 55  THR B C    7  
ATOM 10271 O O    . THR B 2 13 ? -9.265  9.790   6.296   1.00 0.00 ? 55  THR B O    7  
ATOM 10272 C CB   . THR B 2 13 ? -10.087 8.688   8.700   1.00 0.00 ? 55  THR B CB   7  
ATOM 10273 O OG1  . THR B 2 13 ? -8.807  8.510   9.280   1.00 0.00 ? 55  THR B OG1  7  
ATOM 10274 C CG2  . THR B 2 13 ? -11.119 8.311   9.741   1.00 0.00 ? 55  THR B CG2  7  
ATOM 10275 H H    . THR B 2 13 ? -8.513  6.785   6.805   1.00 0.00 ? 55  THR B H    7  
ATOM 10276 H HA   . THR B 2 13 ? -11.205 7.476   7.338   1.00 0.00 ? 55  THR B HA   7  
ATOM 10277 H HB   . THR B 2 13 ? -10.214 9.737   8.474   1.00 0.00 ? 55  THR B HB   7  
ATOM 10278 H HG1  . THR B 2 13 ? -8.540  9.320   9.722   1.00 0.00 ? 55  THR B HG1  7  
ATOM 10279 H HG21 . THR B 2 13 ? -10.628 8.128   10.685  1.00 0.00 ? 55  THR B HG21 7  
ATOM 10280 H HG22 . THR B 2 13 ? -11.639 7.418   9.427   1.00 0.00 ? 55  THR B HG22 7  
ATOM 10281 H HG23 . THR B 2 13 ? -11.828 9.118   9.855   1.00 0.00 ? 55  THR B HG23 7  
ATOM 10282 N N    . GLY B 2 14 ? -10.562 8.422   5.068   1.00 0.00 ? 56  GLY B N    7  
ATOM 10283 C CA   . GLY B 2 14 ? -10.402 9.209   3.860   1.00 0.00 ? 56  GLY B CA   7  
ATOM 10284 C C    . GLY B 2 14 ? -11.605 10.087  3.577   1.00 0.00 ? 56  GLY B C    7  
ATOM 10285 O O    . GLY B 2 14 ? -12.041 10.206  2.431   1.00 0.00 ? 56  GLY B O    7  
ATOM 10286 H H    . GLY B 2 14 ? -11.114 7.612   5.052   1.00 0.00 ? 56  GLY B H    7  
ATOM 10287 H HA2  . GLY B 2 14 ? -9.529  9.836   3.965   1.00 0.00 ? 56  GLY B HA2  7  
ATOM 10288 H HA3  . GLY B 2 14 ? -10.254 8.541   3.024   1.00 0.00 ? 56  GLY B HA3  7  
ATOM 10289 N N    . GLU B 2 15 ? -12.144 10.704  4.624   1.00 0.00 ? 57  GLU B N    7  
ATOM 10290 C CA   . GLU B 2 15 ? -13.304 11.576  4.485   1.00 0.00 ? 57  GLU B CA   7  
ATOM 10291 C C    . GLU B 2 15 ? -13.007 12.731  3.534   1.00 0.00 ? 57  GLU B C    7  
ATOM 10292 O O    . GLU B 2 15 ? -11.850 12.836  3.075   1.00 0.00 ? 57  GLU B O    7  
ATOM 10293 C CB   . GLU B 2 15 ? -13.726 12.121  5.851   1.00 0.00 ? 57  GLU B CB   7  
ATOM 10294 C CG   . GLU B 2 15 ? -12.579 12.729  6.643   1.00 0.00 ? 57  GLU B CG   7  
ATOM 10295 C CD   . GLU B 2 15 ? -12.964 14.029  7.321   1.00 0.00 ? 57  GLU B CD   7  
ATOM 10296 O OE1  . GLU B 2 15 ? -12.980 15.073  6.638   1.00 0.00 ? 57  GLU B OE1  7  
ATOM 10297 O OE2  . GLU B 2 15 ? -13.251 14.002  8.537   1.00 0.00 ? 57  GLU B OE2  7  
ATOM 10298 O OXT  . GLU B 2 15 ? -13.934 13.521  3.255   1.00 0.00 ? 57  GLU B OXT  7  
ATOM 10299 H H    . GLU B 2 15 ? -11.751 10.570  5.512   1.00 0.00 ? 57  GLU B H    7  
ATOM 10300 H HA   . GLU B 2 15 ? -14.113 10.988  4.077   1.00 0.00 ? 57  GLU B HA   7  
ATOM 10301 H HB2  . GLU B 2 15 ? -14.479 12.882  5.706   1.00 0.00 ? 57  GLU B HB2  7  
ATOM 10302 H HB3  . GLU B 2 15 ? -14.149 11.314  6.432   1.00 0.00 ? 57  GLU B HB3  7  
ATOM 10303 H HG2  . GLU B 2 15 ? -12.268 12.025  7.400   1.00 0.00 ? 57  GLU B HG2  7  
ATOM 10304 H HG3  . GLU B 2 15 ? -11.757 12.921  5.971   1.00 0.00 ? 57  GLU B HG3  7  
ATOM 10305 N N    . PRO A 1 1  ? 4.676   12.455  2.568   1.00 0.00 ? 31  PRO A N    8  
ATOM 10306 C CA   . PRO A 1 1  ? 3.311   12.184  2.043   1.00 0.00 ? 31  PRO A CA   8  
ATOM 10307 C C    . PRO A 1 1  ? 3.111   12.785  0.653   1.00 0.00 ? 31  PRO A C    8  
ATOM 10308 O O    . PRO A 1 1  ? 3.252   13.992  0.463   1.00 0.00 ? 31  PRO A O    8  
ATOM 10309 C CB   . PRO A 1 1  ? 2.312   12.782  3.030   1.00 0.00 ? 31  PRO A CB   8  
ATOM 10310 C CG   . PRO A 1 1  ? 3.155   13.272  4.160   1.00 0.00 ? 31  PRO A CG   8  
ATOM 10311 C CD   . PRO A 1 1  ? 4.537   13.499  3.595   1.00 0.00 ? 31  PRO A CD   8  
ATOM 10312 H H2   . PRO A 1 1  ? 5.210   12.674  1.710   1.00 0.00 ? 31  PRO A H2   8  
ATOM 10313 H H3   . PRO A 1 1  ? 4.991   11.492  2.835   1.00 0.00 ? 31  PRO A H3   8  
ATOM 10314 H HA   . PRO A 1 1  ? 3.165   11.115  1.993   1.00 0.00 ? 31  PRO A HA   8  
ATOM 10315 H HB2  . PRO A 1 1  ? 1.772   13.591  2.558   1.00 0.00 ? 31  PRO A HB2  8  
ATOM 10316 H HB3  . PRO A 1 1  ? 1.620   12.021  3.356   1.00 0.00 ? 31  PRO A HB3  8  
ATOM 10317 H HG2  . PRO A 1 1  ? 2.752   14.199  4.542   1.00 0.00 ? 31  PRO A HG2  8  
ATOM 10318 H HG3  . PRO A 1 1  ? 3.189   12.528  4.942   1.00 0.00 ? 31  PRO A HG3  8  
ATOM 10319 H HD2  . PRO A 1 1  ? 4.607   14.482  3.153   1.00 0.00 ? 31  PRO A HD2  8  
ATOM 10320 H HD3  . PRO A 1 1  ? 5.283   13.378  4.366   1.00 0.00 ? 31  PRO A HD3  8  
ATOM 10321 N N    . VAL A 1 2  ? 2.780   11.934  -0.312  1.00 0.00 ? 32  VAL A N    8  
ATOM 10322 C CA   . VAL A 1 2  ? 2.560   12.382  -1.681  1.00 0.00 ? 32  VAL A CA   8  
ATOM 10323 C C    . VAL A 1 2  ? 1.423   13.395  -1.750  1.00 0.00 ? 32  VAL A C    8  
ATOM 10324 O O    . VAL A 1 2  ? 1.655   14.604  -1.789  1.00 0.00 ? 32  VAL A O    8  
ATOM 10325 C CB   . VAL A 1 2  ? 2.263   11.194  -2.622  1.00 0.00 ? 32  VAL A CB   8  
ATOM 10326 C CG1  . VAL A 1 2  ? 2.008   11.677  -4.043  1.00 0.00 ? 32  VAL A CG1  8  
ATOM 10327 C CG2  . VAL A 1 2  ? 3.411   10.196  -2.592  1.00 0.00 ? 32  VAL A CG2  8  
ATOM 10328 H H    . VAL A 1 2  ? 2.681   10.983  -0.100  1.00 0.00 ? 32  VAL A H    8  
ATOM 10329 H HA   . VAL A 1 2  ? 3.460   12.859  -2.020  1.00 0.00 ? 32  VAL A HA   8  
ATOM 10330 H HB   . VAL A 1 2  ? 1.373   10.694  -2.270  1.00 0.00 ? 32  VAL A HB   8  
ATOM 10331 H HG11 . VAL A 1 2  ? 1.160   12.346  -4.048  1.00 0.00 ? 32  VAL A HG11 8  
ATOM 10332 H HG12 . VAL A 1 2  ? 1.803   10.830  -4.680  1.00 0.00 ? 32  VAL A HG12 8  
ATOM 10333 H HG13 . VAL A 1 2  ? 2.881   12.198  -4.408  1.00 0.00 ? 32  VAL A HG13 8  
ATOM 10334 H HG21 . VAL A 1 2  ? 4.335   10.703  -2.824  1.00 0.00 ? 32  VAL A HG21 8  
ATOM 10335 H HG22 . VAL A 1 2  ? 3.233   9.421   -3.323  1.00 0.00 ? 32  VAL A HG22 8  
ATOM 10336 H HG23 . VAL A 1 2  ? 3.479   9.754   -1.609  1.00 0.00 ? 32  VAL A HG23 8  
ATOM 10337 N N    . HIS A 1 3  ? 0.198   12.895  -1.763  1.00 0.00 ? 33  HIS A N    8  
ATOM 10338 C CA   . HIS A 1 3  ? -0.979  13.753  -1.825  1.00 0.00 ? 33  HIS A CA   8  
ATOM 10339 C C    . HIS A 1 3  ? -2.252  12.960  -1.554  1.00 0.00 ? 33  HIS A C    8  
ATOM 10340 O O    . HIS A 1 3  ? -2.356  11.788  -1.916  1.00 0.00 ? 33  HIS A O    8  
ATOM 10341 C CB   . HIS A 1 3  ? -1.067  14.436  -3.192  1.00 0.00 ? 33  HIS A CB   8  
ATOM 10342 C CG   . HIS A 1 3  ? -1.456  15.880  -3.114  1.00 0.00 ? 33  HIS A CG   8  
ATOM 10343 N ND1  . HIS A 1 3  ? -2.014  16.568  -4.170  1.00 0.00 ? 33  HIS A ND1  8  
ATOM 10344 C CD2  . HIS A 1 3  ? -1.367  16.767  -2.094  1.00 0.00 ? 33  HIS A CD2  8  
ATOM 10345 C CE1  . HIS A 1 3  ? -2.250  17.816  -3.805  1.00 0.00 ? 33  HIS A CE1  8  
ATOM 10346 N NE2  . HIS A 1 3  ? -1.867  17.962  -2.551  1.00 0.00 ? 33  HIS A NE2  8  
ATOM 10347 H H    . HIS A 1 3  ? 0.085   11.926  -1.728  1.00 0.00 ? 33  HIS A H    8  
ATOM 10348 H HA   . HIS A 1 3  ? -0.875  14.508  -1.063  1.00 0.00 ? 33  HIS A HA   8  
ATOM 10349 H HB2  . HIS A 1 3  ? -0.106  14.379  -3.678  1.00 0.00 ? 33  HIS A HB2  8  
ATOM 10350 H HB3  . HIS A 1 3  ? -1.803  13.925  -3.796  1.00 0.00 ? 33  HIS A HB3  8  
ATOM 10351 H HD1  . HIS A 1 3  ? -2.208  16.197  -5.056  1.00 0.00 ? 33  HIS A HD1  8  
ATOM 10352 H HD2  . HIS A 1 3  ? -0.976  16.572  -1.106  1.00 0.00 ? 33  HIS A HD2  8  
ATOM 10353 H HE1  . HIS A 1 3  ? -2.683  18.585  -4.428  1.00 0.00 ? 33  HIS A HE1  8  
ATOM 10354 H HE2  . HIS A 1 3  ? -1.852  18.810  -2.060  1.00 0.00 ? 33  HIS A HE2  8  
ATOM 10355 N N    . VAL A 1 4  ? -3.222  13.611  -0.919  1.00 0.00 ? 34  VAL A N    8  
ATOM 10356 C CA   . VAL A 1 4  ? -4.492  12.971  -0.604  1.00 0.00 ? 34  VAL A CA   8  
ATOM 10357 C C    . VAL A 1 4  ? -5.165  12.456  -1.872  1.00 0.00 ? 34  VAL A C    8  
ATOM 10358 O O    . VAL A 1 4  ? -5.753  11.376  -1.882  1.00 0.00 ? 34  VAL A O    8  
ATOM 10359 C CB   . VAL A 1 4  ? -5.450  13.938  0.118   1.00 0.00 ? 34  VAL A CB   8  
ATOM 10360 C CG1  . VAL A 1 4  ? -6.710  13.211  0.565   1.00 0.00 ? 34  VAL A CG1  8  
ATOM 10361 C CG2  . VAL A 1 4  ? -4.755  14.595  1.303   1.00 0.00 ? 34  VAL A CG2  8  
ATOM 10362 H H    . VAL A 1 4  ? -3.081  14.546  -0.660  1.00 0.00 ? 34  VAL A H    8  
ATOM 10363 H HA   . VAL A 1 4  ? -4.293  12.136  0.051   1.00 0.00 ? 34  VAL A HA   8  
ATOM 10364 H HB   . VAL A 1 4  ? -5.737  14.714  -0.577  1.00 0.00 ? 34  VAL A HB   8  
ATOM 10365 H HG11 . VAL A 1 4  ? -6.489  12.608  1.432   1.00 0.00 ? 34  VAL A HG11 8  
ATOM 10366 H HG12 . VAL A 1 4  ? -7.062  12.577  -0.234  1.00 0.00 ? 34  VAL A HG12 8  
ATOM 10367 H HG13 . VAL A 1 4  ? -7.473  13.934  0.814   1.00 0.00 ? 34  VAL A HG13 8  
ATOM 10368 H HG21 . VAL A 1 4  ? -3.688  14.449  1.222   1.00 0.00 ? 34  VAL A HG21 8  
ATOM 10369 H HG22 . VAL A 1 4  ? -5.110  14.149  2.220   1.00 0.00 ? 34  VAL A HG22 8  
ATOM 10370 H HG23 . VAL A 1 4  ? -4.974  15.651  1.308   1.00 0.00 ? 34  VAL A HG23 8  
ATOM 10371 N N    . GLU A 1 5  ? -5.063  13.237  -2.943  1.00 0.00 ? 35  GLU A N    8  
ATOM 10372 C CA   . GLU A 1 5  ? -5.653  12.860  -4.221  1.00 0.00 ? 35  GLU A CA   8  
ATOM 10373 C C    . GLU A 1 5  ? -4.956  11.628  -4.786  1.00 0.00 ? 35  GLU A C    8  
ATOM 10374 O O    . GLU A 1 5  ? -5.597  10.748  -5.363  1.00 0.00 ? 35  GLU A O    8  
ATOM 10375 C CB   . GLU A 1 5  ? -5.554  14.020  -5.214  1.00 0.00 ? 35  GLU A CB   8  
ATOM 10376 C CG   . GLU A 1 5  ? -6.577  13.950  -6.335  1.00 0.00 ? 35  GLU A CG   8  
ATOM 10377 C CD   . GLU A 1 5  ? -6.025  14.444  -7.659  1.00 0.00 ? 35  GLU A CD   8  
ATOM 10378 O OE1  . GLU A 1 5  ? -5.068  13.827  -8.170  1.00 0.00 ? 35  GLU A OE1  8  
ATOM 10379 O OE2  . GLU A 1 5  ? -6.553  15.448  -8.183  1.00 0.00 ? 35  GLU A OE2  8  
ATOM 10380 H H    . GLU A 1 5  ? -4.576  14.084  -2.873  1.00 0.00 ? 35  GLU A H    8  
ATOM 10381 H HA   . GLU A 1 5  ? -6.693  12.628  -4.053  1.00 0.00 ? 35  GLU A HA   8  
ATOM 10382 H HB2  . GLU A 1 5  ? -5.698  14.948  -4.682  1.00 0.00 ? 35  GLU A HB2  8  
ATOM 10383 H HB3  . GLU A 1 5  ? -4.568  14.018  -5.655  1.00 0.00 ? 35  GLU A HB3  8  
ATOM 10384 H HG2  . GLU A 1 5  ? -6.892  12.924  -6.455  1.00 0.00 ? 35  GLU A HG2  8  
ATOM 10385 H HG3  . GLU A 1 5  ? -7.429  14.558  -6.067  1.00 0.00 ? 35  GLU A HG3  8  
ATOM 10386 N N    . ASP A 1 6  ? -3.640  11.570  -4.610  1.00 0.00 ? 36  ASP A N    8  
ATOM 10387 C CA   . ASP A 1 6  ? -2.853  10.443  -5.096  1.00 0.00 ? 36  ASP A CA   8  
ATOM 10388 C C    . ASP A 1 6  ? -3.129  9.198   -4.260  1.00 0.00 ? 36  ASP A C    8  
ATOM 10389 O O    . ASP A 1 6  ? -3.224  8.090   -4.788  1.00 0.00 ? 36  ASP A O    8  
ATOM 10390 C CB   . ASP A 1 6  ? -1.361  10.778  -5.057  1.00 0.00 ? 36  ASP A CB   8  
ATOM 10391 C CG   . ASP A 1 6  ? -1.013  11.966  -5.933  1.00 0.00 ? 36  ASP A CG   8  
ATOM 10392 O OD1  . ASP A 1 6  ? -1.789  12.945  -5.941  1.00 0.00 ? 36  ASP A OD1  8  
ATOM 10393 O OD2  . ASP A 1 6  ? 0.034   11.918  -6.612  1.00 0.00 ? 36  ASP A OD2  8  
ATOM 10394 H H    . ASP A 1 6  ? -3.188  12.300  -4.139  1.00 0.00 ? 36  ASP A H    8  
ATOM 10395 H HA   . ASP A 1 6  ? -3.145  10.249  -6.117  1.00 0.00 ? 36  ASP A HA   8  
ATOM 10396 H HB2  . ASP A 1 6  ? -1.075  11.009  -4.042  1.00 0.00 ? 36  ASP A HB2  8  
ATOM 10397 H HB3  . ASP A 1 6  ? -0.797  9.924   -5.401  1.00 0.00 ? 36  ASP A HB3  8  
ATOM 10398 N N    . ALA A 1 7  ? -3.260  9.390   -2.952  1.00 0.00 ? 37  ALA A N    8  
ATOM 10399 C CA   . ALA A 1 7  ? -3.532  8.282   -2.045  1.00 0.00 ? 37  ALA A CA   8  
ATOM 10400 C C    . ALA A 1 7  ? -4.955  7.765   -2.230  1.00 0.00 ? 37  ALA A C    8  
ATOM 10401 O O    . ALA A 1 7  ? -5.196  6.557   -2.213  1.00 0.00 ? 37  ALA A O    8  
ATOM 10402 C CB   . ALA A 1 7  ? -3.307  8.712   -0.603  1.00 0.00 ? 37  ALA A CB   8  
ATOM 10403 H H    . ALA A 1 7  ? -3.176  10.299  -2.588  1.00 0.00 ? 37  ALA A H    8  
ATOM 10404 H HA   . ALA A 1 7  ? -2.837  7.486   -2.273  1.00 0.00 ? 37  ALA A HA   8  
ATOM 10405 H HB1  . ALA A 1 7  ? -3.357  7.847   0.042   1.00 0.00 ? 37  ALA A HB1  8  
ATOM 10406 H HB2  . ALA A 1 7  ? -4.069  9.420   -0.315  1.00 0.00 ? 37  ALA A HB2  8  
ATOM 10407 H HB3  . ALA A 1 7  ? -2.335  9.173   -0.512  1.00 0.00 ? 37  ALA A HB3  8  
ATOM 10408 N N    . LEU A 1 8  ? -5.895  8.689   -2.406  1.00 0.00 ? 38  LEU A N    8  
ATOM 10409 C CA   . LEU A 1 8  ? -7.296  8.332   -2.595  1.00 0.00 ? 38  LEU A CA   8  
ATOM 10410 C C    . LEU A 1 8  ? -7.494  7.556   -3.893  1.00 0.00 ? 38  LEU A C    8  
ATOM 10411 O O    . LEU A 1 8  ? -8.076  6.471   -3.894  1.00 0.00 ? 38  LEU A O    8  
ATOM 10412 C CB   . LEU A 1 8  ? -8.168  9.590   -2.598  1.00 0.00 ? 38  LEU A CB   8  
ATOM 10413 C CG   . LEU A 1 8  ? -8.897  9.875   -1.283  1.00 0.00 ? 38  LEU A CG   8  
ATOM 10414 C CD1  . LEU A 1 8  ? -9.347  11.326  -1.226  1.00 0.00 ? 38  LEU A CD1  8  
ATOM 10415 C CD2  . LEU A 1 8  ? -10.085 8.939   -1.121  1.00 0.00 ? 38  LEU A CD2  8  
ATOM 10416 H H    . LEU A 1 8  ? -5.640  9.634   -2.409  1.00 0.00 ? 38  LEU A H    8  
ATOM 10417 H HA   . LEU A 1 8  ? -7.588  7.705   -1.766  1.00 0.00 ? 38  LEU A HA   8  
ATOM 10418 H HB2  . LEU A 1 8  ? -7.540  10.438  -2.828  1.00 0.00 ? 38  LEU A HB2  8  
ATOM 10419 H HB3  . LEU A 1 8  ? -8.908  9.489   -3.377  1.00 0.00 ? 38  LEU A HB3  8  
ATOM 10420 H HG   . LEU A 1 8  ? -8.219  9.703   -0.459  1.00 0.00 ? 38  LEU A HG   8  
ATOM 10421 H HD11 . LEU A 1 8  ? -10.251 11.446  -1.805  1.00 0.00 ? 38  LEU A HD11 8  
ATOM 10422 H HD12 . LEU A 1 8  ? -8.573  11.959  -1.633  1.00 0.00 ? 38  LEU A HD12 8  
ATOM 10423 H HD13 . LEU A 1 8  ? -9.538  11.605  -0.200  1.00 0.00 ? 38  LEU A HD13 8  
ATOM 10424 H HD21 . LEU A 1 8  ? -9.798  7.939   -1.412  1.00 0.00 ? 38  LEU A HD21 8  
ATOM 10425 H HD22 . LEU A 1 8  ? -10.897 9.277   -1.746  1.00 0.00 ? 38  LEU A HD22 8  
ATOM 10426 H HD23 . LEU A 1 8  ? -10.402 8.936   -0.089  1.00 0.00 ? 38  LEU A HD23 8  
ATOM 10427 N N    . THR A 1 9  ? -7.009  8.118   -4.997  1.00 0.00 ? 39  THR A N    8  
ATOM 10428 C CA   . THR A 1 9  ? -7.138  7.474   -6.301  1.00 0.00 ? 39  THR A CA   8  
ATOM 10429 C C    . THR A 1 9  ? -6.571  6.059   -6.270  1.00 0.00 ? 39  THR A C    8  
ATOM 10430 O O    . THR A 1 9  ? -7.158  5.131   -6.828  1.00 0.00 ? 39  THR A O    8  
ATOM 10431 C CB   . THR A 1 9  ? -6.432  8.303   -7.381  1.00 0.00 ? 39  THR A CB   8  
ATOM 10432 O OG1  . THR A 1 9  ? -6.923  7.970   -8.667  1.00 0.00 ? 39  THR A OG1  8  
ATOM 10433 C CG2  . THR A 1 9  ? -4.927  8.120   -7.406  1.00 0.00 ? 39  THR A CG2  8  
ATOM 10434 H H    . THR A 1 9  ? -6.556  8.984   -4.934  1.00 0.00 ? 39  THR A H    8  
ATOM 10435 H HA   . THR A 1 9  ? -8.191  7.420   -6.537  1.00 0.00 ? 39  THR A HA   8  
ATOM 10436 H HB   . THR A 1 9  ? -6.634  9.350   -7.204  1.00 0.00 ? 39  THR A HB   8  
ATOM 10437 H HG1  . THR A 1 9  ? -6.644  7.081   -8.896  1.00 0.00 ? 39  THR A HG1  8  
ATOM 10438 H HG21 . THR A 1 9  ? -4.499  8.538   -6.508  1.00 0.00 ? 39  THR A HG21 8  
ATOM 10439 H HG22 . THR A 1 9  ? -4.518  8.626   -8.268  1.00 0.00 ? 39  THR A HG22 8  
ATOM 10440 H HG23 . THR A 1 9  ? -4.690  7.065   -7.462  1.00 0.00 ? 39  THR A HG23 8  
ATOM 10441 N N    . TYR A 1 10 ? -5.422  5.904   -5.618  1.00 0.00 ? 40  TYR A N    8  
ATOM 10442 C CA   . TYR A 1 10 ? -4.774  4.603   -5.520  1.00 0.00 ? 40  TYR A CA   8  
ATOM 10443 C C    . TYR A 1 10 ? -5.729  3.566   -4.935  1.00 0.00 ? 40  TYR A C    8  
ATOM 10444 O O    . TYR A 1 10 ? -5.967  2.517   -5.533  1.00 0.00 ? 40  TYR A O    8  
ATOM 10445 C CB   . TYR A 1 10 ? -3.511  4.695   -4.660  1.00 0.00 ? 40  TYR A CB   8  
ATOM 10446 C CG   . TYR A 1 10 ? -2.841  3.360   -4.419  1.00 0.00 ? 40  TYR A CG   8  
ATOM 10447 C CD1  . TYR A 1 10 ? -2.633  2.468   -5.464  1.00 0.00 ? 40  TYR A CD1  8  
ATOM 10448 C CD2  . TYR A 1 10 ? -2.421  2.990   -3.148  1.00 0.00 ? 40  TYR A CD2  8  
ATOM 10449 C CE1  . TYR A 1 10 ? -2.025  1.246   -5.249  1.00 0.00 ? 40  TYR A CE1  8  
ATOM 10450 C CE2  . TYR A 1 10 ? -1.813  1.769   -2.925  1.00 0.00 ? 40  TYR A CE2  8  
ATOM 10451 C CZ   . TYR A 1 10 ? -1.617  0.901   -3.978  1.00 0.00 ? 40  TYR A CZ   8  
ATOM 10452 O OH   . TYR A 1 10 ? -1.013  -0.316  -3.759  1.00 0.00 ? 40  TYR A OH   8  
ATOM 10453 H H    . TYR A 1 10 ? -5.001  6.681   -5.197  1.00 0.00 ? 40  TYR A H    8  
ATOM 10454 H HA   . TYR A 1 10 ? -4.498  4.302   -6.520  1.00 0.00 ? 40  TYR A HA   8  
ATOM 10455 H HB2  . TYR A 1 10 ? -2.797  5.340   -5.151  1.00 0.00 ? 40  TYR A HB2  8  
ATOM 10456 H HB3  . TYR A 1 10 ? -3.768  5.118   -3.699  1.00 0.00 ? 40  TYR A HB3  8  
ATOM 10457 H HD1  . TYR A 1 10 ? -2.953  2.741   -6.459  1.00 0.00 ? 40  TYR A HD1  8  
ATOM 10458 H HD2  . TYR A 1 10 ? -2.576  3.672   -2.325  1.00 0.00 ? 40  TYR A HD2  8  
ATOM 10459 H HE1  . TYR A 1 10 ? -1.871  0.567   -6.075  1.00 0.00 ? 40  TYR A HE1  8  
ATOM 10460 H HE2  . TYR A 1 10 ? -1.494  1.499   -1.929  1.00 0.00 ? 40  TYR A HE2  8  
ATOM 10461 H HH   . TYR A 1 10 ? -0.467  -0.544  -4.515  1.00 0.00 ? 40  TYR A HH   8  
ATOM 10462 N N    . LEU A 1 11 ? -6.274  3.869   -3.761  1.00 0.00 ? 41  LEU A N    8  
ATOM 10463 C CA   . LEU A 1 11 ? -7.203  2.965   -3.096  1.00 0.00 ? 41  LEU A CA   8  
ATOM 10464 C C    . LEU A 1 11 ? -8.470  2.776   -3.926  1.00 0.00 ? 41  LEU A C    8  
ATOM 10465 O O    . LEU A 1 11 ? -9.102  1.722   -3.880  1.00 0.00 ? 41  LEU A O    8  
ATOM 10466 C CB   . LEU A 1 11 ? -7.564  3.502   -1.710  1.00 0.00 ? 41  LEU A CB   8  
ATOM 10467 C CG   . LEU A 1 11 ? -6.440  3.429   -0.674  1.00 0.00 ? 41  LEU A CG   8  
ATOM 10468 C CD1  . LEU A 1 11 ? -6.574  4.556   0.338   1.00 0.00 ? 41  LEU A CD1  8  
ATOM 10469 C CD2  . LEU A 1 11 ? -6.447  2.079   0.025   1.00 0.00 ? 41  LEU A CD2  8  
ATOM 10470 H H    . LEU A 1 11 ? -6.046  4.721   -3.334  1.00 0.00 ? 41  LEU A H    8  
ATOM 10471 H HA   . LEU A 1 11 ? -6.714  2.009   -2.985  1.00 0.00 ? 41  LEU A HA   8  
ATOM 10472 H HB2  . LEU A 1 11 ? -7.864  4.535   -1.814  1.00 0.00 ? 41  LEU A HB2  8  
ATOM 10473 H HB3  . LEU A 1 11 ? -8.404  2.936   -1.335  1.00 0.00 ? 41  LEU A HB3  8  
ATOM 10474 H HG   . LEU A 1 11 ? -5.490  3.543   -1.176  1.00 0.00 ? 41  LEU A HG   8  
ATOM 10475 H HD11 . LEU A 1 11 ? -5.885  4.392   1.153   1.00 0.00 ? 41  LEU A HD11 8  
ATOM 10476 H HD12 . LEU A 1 11 ? -7.584  4.579   0.720   1.00 0.00 ? 41  LEU A HD12 8  
ATOM 10477 H HD13 . LEU A 1 11 ? -6.349  5.498   -0.141  1.00 0.00 ? 41  LEU A HD13 8  
ATOM 10478 H HD21 . LEU A 1 11 ? -5.771  1.407   -0.483  1.00 0.00 ? 41  LEU A HD21 8  
ATOM 10479 H HD22 . LEU A 1 11 ? -7.446  1.668   0.005   1.00 0.00 ? 41  LEU A HD22 8  
ATOM 10480 H HD23 . LEU A 1 11 ? -6.130  2.203   1.049   1.00 0.00 ? 41  LEU A HD23 8  
ATOM 10481 N N    . ASP A 1 12 ? -8.835  3.806   -4.682  1.00 0.00 ? 42  ASP A N    8  
ATOM 10482 C CA   . ASP A 1 12 ? -10.027 3.753   -5.521  1.00 0.00 ? 42  ASP A CA   8  
ATOM 10483 C C    . ASP A 1 12 ? -9.875  2.715   -6.623  1.00 0.00 ? 42  ASP A C    8  
ATOM 10484 O O    . ASP A 1 12 ? -10.809 1.974   -6.931  1.00 0.00 ? 42  ASP A O    8  
ATOM 10485 C CB   . ASP A 1 12 ? -10.310 5.127   -6.131  1.00 0.00 ? 42  ASP A CB   8  
ATOM 10486 C CG   . ASP A 1 12 ? -11.671 5.194   -6.798  1.00 0.00 ? 42  ASP A CG   8  
ATOM 10487 O OD1  . ASP A 1 12 ? -11.837 4.573   -7.869  1.00 0.00 ? 42  ASP A OD1  8  
ATOM 10488 O OD2  . ASP A 1 12 ? -12.567 5.867   -6.249  1.00 0.00 ? 42  ASP A OD2  8  
ATOM 10489 H H    . ASP A 1 12 ? -8.290  4.622   -4.676  1.00 0.00 ? 42  ASP A H    8  
ATOM 10490 H HA   . ASP A 1 12 ? -10.852 3.470   -4.897  1.00 0.00 ? 42  ASP A HA   8  
ATOM 10491 H HB2  . ASP A 1 12 ? -10.275 5.875   -5.353  1.00 0.00 ? 42  ASP A HB2  8  
ATOM 10492 H HB3  . ASP A 1 12 ? -9.555  5.348   -6.871  1.00 0.00 ? 42  ASP A HB3  8  
ATOM 10493 N N    . GLN A 1 13 ? -8.689  2.667   -7.207  1.00 0.00 ? 43  GLN A N    8  
ATOM 10494 C CA   . GLN A 1 13 ? -8.400  1.720   -8.278  1.00 0.00 ? 43  GLN A CA   8  
ATOM 10495 C C    . GLN A 1 13 ? -8.154  0.325   -7.717  1.00 0.00 ? 43  GLN A C    8  
ATOM 10496 O O    . GLN A 1 13 ? -8.387  -0.678  -8.391  1.00 0.00 ? 43  GLN A O    8  
ATOM 10497 C CB   . GLN A 1 13 ? -7.187  2.183   -9.088  1.00 0.00 ? 43  GLN A CB   8  
ATOM 10498 C CG   . GLN A 1 13 ? -5.924  2.345   -8.259  1.00 0.00 ? 43  GLN A CG   8  
ATOM 10499 C CD   . GLN A 1 13 ? -4.677  2.458   -9.111  1.00 0.00 ? 43  GLN A CD   8  
ATOM 10500 O OE1  . GLN A 1 13 ? -4.632  3.233   -10.067 1.00 0.00 ? 43  GLN A OE1  8  
ATOM 10501 N NE2  . GLN A 1 13 ? -3.654  1.683   -8.771  1.00 0.00 ? 43  GLN A NE2  8  
ATOM 10502 H H    . GLN A 1 13 ? -7.994  3.284   -6.908  1.00 0.00 ? 43  GLN A H    8  
ATOM 10503 H HA   . GLN A 1 13 ? -9.259  1.683   -8.924  1.00 0.00 ? 43  GLN A HA   8  
ATOM 10504 H HB2  . GLN A 1 13 ? -6.990  1.459   -9.865  1.00 0.00 ? 43  GLN A HB2  8  
ATOM 10505 H HB3  . GLN A 1 13 ? -7.416  3.134   -9.545  1.00 0.00 ? 43  GLN A HB3  8  
ATOM 10506 H HG2  . GLN A 1 13 ? -6.014  3.238   -7.659  1.00 0.00 ? 43  GLN A HG2  8  
ATOM 10507 H HG3  . GLN A 1 13 ? -5.822  1.486   -7.610  1.00 0.00 ? 43  GLN A HG3  8  
ATOM 10508 H HE21 . GLN A 1 13 ? -3.760  1.090   -7.998  1.00 0.00 ? 43  GLN A HE21 8  
ATOM 10509 H HE22 . GLN A 1 13 ? -2.834  1.737   -9.305  1.00 0.00 ? 43  GLN A HE22 8  
ATOM 10510 N N    . VAL A 1 14 ? -7.689  0.271   -6.476  1.00 0.00 ? 44  VAL A N    8  
ATOM 10511 C CA   . VAL A 1 14 ? -7.418  -0.999  -5.814  1.00 0.00 ? 44  VAL A CA   8  
ATOM 10512 C C    . VAL A 1 14 ? -8.707  -1.620  -5.289  1.00 0.00 ? 44  VAL A C    8  
ATOM 10513 O O    . VAL A 1 14 ? -8.840  -2.842  -5.225  1.00 0.00 ? 44  VAL A O    8  
ATOM 10514 C CB   . VAL A 1 14 ? -6.428  -0.828  -4.646  1.00 0.00 ? 44  VAL A CB   8  
ATOM 10515 C CG1  . VAL A 1 14 ? -6.051  -2.181  -4.059  1.00 0.00 ? 44  VAL A CG1  8  
ATOM 10516 C CG2  . VAL A 1 14 ? -5.187  -0.073  -5.102  1.00 0.00 ? 44  VAL A CG2  8  
ATOM 10517 H H    . VAL A 1 14 ? -7.530  1.106   -5.992  1.00 0.00 ? 44  VAL A H    8  
ATOM 10518 H HA   . VAL A 1 14 ? -6.978  -1.667  -6.541  1.00 0.00 ? 44  VAL A HA   8  
ATOM 10519 H HB   . VAL A 1 14 ? -6.911  -0.248  -3.874  1.00 0.00 ? 44  VAL A HB   8  
ATOM 10520 H HG11 . VAL A 1 14 ? -6.845  -2.526  -3.414  1.00 0.00 ? 44  VAL A HG11 8  
ATOM 10521 H HG12 . VAL A 1 14 ? -5.140  -2.084  -3.488  1.00 0.00 ? 44  VAL A HG12 8  
ATOM 10522 H HG13 . VAL A 1 14 ? -5.902  -2.890  -4.859  1.00 0.00 ? 44  VAL A HG13 8  
ATOM 10523 H HG21 . VAL A 1 14 ? -4.336  -0.738  -5.095  1.00 0.00 ? 44  VAL A HG21 8  
ATOM 10524 H HG22 . VAL A 1 14 ? -5.003  0.754   -4.432  1.00 0.00 ? 44  VAL A HG22 8  
ATOM 10525 H HG23 . VAL A 1 14 ? -5.340  0.303   -6.103  1.00 0.00 ? 44  VAL A HG23 8  
ATOM 10526 N N    . LYS A 1 15 ? -9.658  -0.767  -4.917  1.00 0.00 ? 45  LYS A N    8  
ATOM 10527 C CA   . LYS A 1 15 ? -10.941 -1.228  -4.401  1.00 0.00 ? 45  LYS A CA   8  
ATOM 10528 C C    . LYS A 1 15 ? -11.786 -1.829  -5.518  1.00 0.00 ? 45  LYS A C    8  
ATOM 10529 O O    . LYS A 1 15 ? -12.318 -2.931  -5.385  1.00 0.00 ? 45  LYS A O    8  
ATOM 10530 C CB   . LYS A 1 15 ? -11.695 -0.074  -3.739  1.00 0.00 ? 45  LYS A CB   8  
ATOM 10531 C CG   . LYS A 1 15 ? -11.398 0.077   -2.256  1.00 0.00 ? 45  LYS A CG   8  
ATOM 10532 C CD   . LYS A 1 15 ? -12.044 1.329   -1.681  1.00 0.00 ? 45  LYS A CD   8  
ATOM 10533 C CE   . LYS A 1 15 ? -11.005 2.374   -1.308  1.00 0.00 ? 45  LYS A CE   8  
ATOM 10534 N NZ   . LYS A 1 15 ? -11.603 3.732   -1.183  1.00 0.00 ? 45  LYS A NZ   8  
ATOM 10535 H H    . LYS A 1 15 ? -9.493  0.196   -4.995  1.00 0.00 ? 45  LYS A H    8  
ATOM 10536 H HA   . LYS A 1 15 ? -10.747 -1.991  -3.662  1.00 0.00 ? 45  LYS A HA   8  
ATOM 10537 H HB2  . LYS A 1 15 ? -11.425 0.848   -4.234  1.00 0.00 ? 45  LYS A HB2  8  
ATOM 10538 H HB3  . LYS A 1 15 ? -12.756 -0.237  -3.857  1.00 0.00 ? 45  LYS A HB3  8  
ATOM 10539 H HG2  . LYS A 1 15 ? -11.782 -0.785  -1.733  1.00 0.00 ? 45  LYS A HG2  8  
ATOM 10540 H HG3  . LYS A 1 15 ? -10.328 0.138   -2.119  1.00 0.00 ? 45  LYS A HG3  8  
ATOM 10541 H HD2  . LYS A 1 15 ? -12.712 1.749   -2.418  1.00 0.00 ? 45  LYS A HD2  8  
ATOM 10542 H HD3  . LYS A 1 15 ? -12.604 1.059   -0.798  1.00 0.00 ? 45  LYS A HD3  8  
ATOM 10543 H HE2  . LYS A 1 15 ? -10.560 2.098   -0.362  1.00 0.00 ? 45  LYS A HE2  8  
ATOM 10544 H HE3  . LYS A 1 15 ? -10.242 2.394   -2.072  1.00 0.00 ? 45  LYS A HE3  8  
ATOM 10545 H HZ1  . LYS A 1 15 ? -11.594 4.212   -2.105  1.00 0.00 ? 45  LYS A HZ1  8  
ATOM 10546 H HZ2  . LYS A 1 15 ? -11.059 4.301   -0.503  1.00 0.00 ? 45  LYS A HZ2  8  
ATOM 10547 H HZ3  . LYS A 1 15 ? -12.585 3.661   -0.850  1.00 0.00 ? 45  LYS A HZ3  8  
ATOM 10548 N N    . ILE A 1 16 ? -11.906 -1.095  -6.621  1.00 0.00 ? 46  ILE A N    8  
ATOM 10549 C CA   . ILE A 1 16 ? -12.685 -1.556  -7.762  1.00 0.00 ? 46  ILE A CA   8  
ATOM 10550 C C    . ILE A 1 16 ? -12.069 -2.809  -8.375  1.00 0.00 ? 46  ILE A C    8  
ATOM 10551 O O    . ILE A 1 16 ? -12.778 -3.746  -8.741  1.00 0.00 ? 46  ILE A O    8  
ATOM 10552 C CB   . ILE A 1 16 ? -12.794 -0.466  -8.848  1.00 0.00 ? 46  ILE A CB   8  
ATOM 10553 C CG1  . ILE A 1 16 ? -13.308 0.842   -8.240  1.00 0.00 ? 46  ILE A CG1  8  
ATOM 10554 C CG2  . ILE A 1 16 ? -13.709 -0.925  -9.974  1.00 0.00 ? 46  ILE A CG2  8  
ATOM 10555 C CD1  . ILE A 1 16 ? -12.843 2.076   -8.982  1.00 0.00 ? 46  ILE A CD1  8  
ATOM 10556 H H    . ILE A 1 16 ? -11.458 -0.226  -6.668  1.00 0.00 ? 46  ILE A H    8  
ATOM 10557 H HA   . ILE A 1 16 ? -13.679 -1.788  -7.414  1.00 0.00 ? 46  ILE A HA   8  
ATOM 10558 H HB   . ILE A 1 16 ? -11.811 -0.300  -9.261  1.00 0.00 ? 46  ILE A HB   8  
ATOM 10559 H HG12 . ILE A 1 16 ? -14.388 0.837   -8.252  1.00 0.00 ? 46  ILE A HG12 8  
ATOM 10560 H HG13 . ILE A 1 16 ? -12.964 0.917   -7.220  1.00 0.00 ? 46  ILE A HG13 8  
ATOM 10561 H HG21 . ILE A 1 16 ? -13.438 -1.928  -10.271 1.00 0.00 ? 46  ILE A HG21 8  
ATOM 10562 H HG22 . ILE A 1 16 ? -13.604 -0.259  -10.818 1.00 0.00 ? 46  ILE A HG22 8  
ATOM 10563 H HG23 . ILE A 1 16 ? -14.734 -0.915  -9.632  1.00 0.00 ? 46  ILE A HG23 8  
ATOM 10564 H HD11 . ILE A 1 16 ? -13.177 2.026   -10.008 1.00 0.00 ? 46  ILE A HD11 8  
ATOM 10565 H HD12 . ILE A 1 16 ? -11.764 2.125   -8.957  1.00 0.00 ? 46  ILE A HD12 8  
ATOM 10566 H HD13 . ILE A 1 16 ? -13.256 2.956   -8.512  1.00 0.00 ? 46  ILE A HD13 8  
ATOM 10567 N N    . ARG A 1 17 ? -10.744 -2.818  -8.482  1.00 0.00 ? 47  ARG A N    8  
ATOM 10568 C CA   . ARG A 1 17 ? -10.030 -3.957  -9.050  1.00 0.00 ? 47  ARG A CA   8  
ATOM 10569 C C    . ARG A 1 17 ? -10.299 -5.224  -8.243  1.00 0.00 ? 47  ARG A C    8  
ATOM 10570 O O    . ARG A 1 17 ? -10.302 -6.329  -8.785  1.00 0.00 ? 47  ARG A O    8  
ATOM 10571 C CB   . ARG A 1 17 ? -8.528  -3.673  -9.094  1.00 0.00 ? 47  ARG A CB   8  
ATOM 10572 C CG   . ARG A 1 17 ? -8.041  -3.178  -10.446 1.00 0.00 ? 47  ARG A CG   8  
ATOM 10573 C CD   . ARG A 1 17 ? -6.523  -3.184  -10.529 1.00 0.00 ? 47  ARG A CD   8  
ATOM 10574 N NE   . ARG A 1 17 ? -6.048  -3.605  -11.845 1.00 0.00 ? 47  ARG A NE   8  
ATOM 10575 C CZ   . ARG A 1 17 ? -6.013  -2.809  -12.910 1.00 0.00 ? 47  ARG A CZ   8  
ATOM 10576 N NH1  . ARG A 1 17 ? -6.427  -1.550  -12.821 1.00 0.00 ? 47  ARG A NH1  8  
ATOM 10577 N NH2  . ARG A 1 17 ? -5.563  -3.271  -14.068 1.00 0.00 ? 47  ARG A NH2  8  
ATOM 10578 H H    . ARG A 1 17 ? -10.233 -2.041  -8.172  1.00 0.00 ? 47  ARG A H    8  
ATOM 10579 H HA   . ARG A 1 17 ? -10.390 -4.104  -10.057 1.00 0.00 ? 47  ARG A HA   8  
ATOM 10580 H HB2  . ARG A 1 17 ? -8.294  -2.921  -8.354  1.00 0.00 ? 47  ARG A HB2  8  
ATOM 10581 H HB3  . ARG A 1 17 ? -7.992  -4.580  -8.853  1.00 0.00 ? 47  ARG A HB3  8  
ATOM 10582 H HG2  . ARG A 1 17 ? -8.437  -3.821  -11.218 1.00 0.00 ? 47  ARG A HG2  8  
ATOM 10583 H HG3  . ARG A 1 17 ? -8.398  -2.169  -10.598 1.00 0.00 ? 47  ARG A HG3  8  
ATOM 10584 H HD2  . ARG A 1 17 ? -6.160  -2.187  -10.328 1.00 0.00 ? 47  ARG A HD2  8  
ATOM 10585 H HD3  . ARG A 1 17 ? -6.138  -3.864  -9.782  1.00 0.00 ? 47  ARG A HD3  8  
ATOM 10586 H HE   . ARG A 1 17 ? -5.738  -4.530  -11.938 1.00 0.00 ? 47  ARG A HE   8  
ATOM 10587 H HH11 . ARG A 1 17 ? -6.766  -1.195  -11.951 1.00 0.00 ? 47  ARG A HH11 8  
ATOM 10588 H HH12 . ARG A 1 17 ? -6.397  -0.957  -13.626 1.00 0.00 ? 47  ARG A HH12 8  
ATOM 10589 H HH21 . ARG A 1 17 ? -5.249  -4.218  -14.141 1.00 0.00 ? 47  ARG A HH21 8  
ATOM 10590 H HH22 . ARG A 1 17 ? -5.536  -2.673  -14.869 1.00 0.00 ? 47  ARG A HH22 8  
ATOM 10591 N N    . PHE A 1 18 ? -10.523 -5.056  -6.943  1.00 0.00 ? 48  PHE A N    8  
ATOM 10592 C CA   . PHE A 1 18 ? -10.792 -6.187  -6.061  1.00 0.00 ? 48  PHE A CA   8  
ATOM 10593 C C    . PHE A 1 18 ? -12.164 -6.054  -5.408  1.00 0.00 ? 48  PHE A C    8  
ATOM 10594 O O    . PHE A 1 18 ? -12.331 -6.355  -4.226  1.00 0.00 ? 48  PHE A O    8  
ATOM 10595 C CB   . PHE A 1 18 ? -9.708  -6.289  -4.986  1.00 0.00 ? 48  PHE A CB   8  
ATOM 10596 C CG   . PHE A 1 18 ? -8.322  -6.452  -5.543  1.00 0.00 ? 48  PHE A CG   8  
ATOM 10597 C CD1  . PHE A 1 18 ? -8.038  -7.468  -6.442  1.00 0.00 ? 48  PHE A CD1  8  
ATOM 10598 C CD2  . PHE A 1 18 ? -7.305  -5.590  -5.168  1.00 0.00 ? 48  PHE A CD2  8  
ATOM 10599 C CE1  . PHE A 1 18 ? -6.764  -7.619  -6.957  1.00 0.00 ? 48  PHE A CE1  8  
ATOM 10600 C CE2  . PHE A 1 18 ? -6.029  -5.738  -5.679  1.00 0.00 ? 48  PHE A CE2  8  
ATOM 10601 C CZ   . PHE A 1 18 ? -5.759  -6.754  -6.575  1.00 0.00 ? 48  PHE A CZ   8  
ATOM 10602 H H    . PHE A 1 18 ? -10.507 -4.151  -6.568  1.00 0.00 ? 48  PHE A H    8  
ATOM 10603 H HA   . PHE A 1 18 ? -10.778 -7.085  -6.661  1.00 0.00 ? 48  PHE A HA   8  
ATOM 10604 H HB2  . PHE A 1 18 ? -9.720  -5.393  -4.386  1.00 0.00 ? 48  PHE A HB2  8  
ATOM 10605 H HB3  . PHE A 1 18 ? -9.916  -7.141  -4.355  1.00 0.00 ? 48  PHE A HB3  8  
ATOM 10606 H HD1  . PHE A 1 18 ? -8.824  -8.145  -6.743  1.00 0.00 ? 48  PHE A HD1  8  
ATOM 10607 H HD2  . PHE A 1 18 ? -7.515  -4.795  -4.468  1.00 0.00 ? 48  PHE A HD2  8  
ATOM 10608 H HE1  . PHE A 1 18 ? -6.555  -8.415  -7.657  1.00 0.00 ? 48  PHE A HE1  8  
ATOM 10609 H HE2  . PHE A 1 18 ? -5.244  -5.059  -5.378  1.00 0.00 ? 48  PHE A HE2  8  
ATOM 10610 H HZ   . PHE A 1 18 ? -4.762  -6.871  -6.975  1.00 0.00 ? 48  PHE A HZ   8  
ATOM 10611 N N    . GLY A 1 19 ? -13.142 -5.602  -6.184  1.00 0.00 ? 49  GLY A N    8  
ATOM 10612 C CA   . GLY A 1 19 ? -14.487 -5.437  -5.664  1.00 0.00 ? 49  GLY A CA   8  
ATOM 10613 C C    . GLY A 1 19 ? -15.158 -6.763  -5.367  1.00 0.00 ? 49  GLY A C    8  
ATOM 10614 O O    . GLY A 1 19 ? -15.881 -6.893  -4.379  1.00 0.00 ? 49  GLY A O    8  
ATOM 10615 H H    . GLY A 1 19 ? -12.949 -5.378  -7.119  1.00 0.00 ? 49  GLY A H    8  
ATOM 10616 H HA2  . GLY A 1 19 ? -14.440 -4.858  -4.753  1.00 0.00 ? 49  GLY A HA2  8  
ATOM 10617 H HA3  . GLY A 1 19 ? -15.080 -4.901  -6.389  1.00 0.00 ? 49  GLY A HA3  8  
ATOM 10618 N N    . SER A 1 20 ? -14.919 -7.750  -6.224  1.00 0.00 ? 50  SER A N    8  
ATOM 10619 C CA   . SER A 1 20 ? -15.507 -9.074  -6.049  1.00 0.00 ? 50  SER A CA   8  
ATOM 10620 C C    . SER A 1 20 ? -14.712 -9.903  -5.042  1.00 0.00 ? 50  SER A C    8  
ATOM 10621 O O    . SER A 1 20 ? -15.211 -10.895 -4.512  1.00 0.00 ? 50  SER A O    8  
ATOM 10622 C CB   . SER A 1 20 ? -15.570 -9.807  -7.390  1.00 0.00 ? 50  SER A CB   8  
ATOM 10623 O OG   . SER A 1 20 ? -15.999 -8.940  -8.426  1.00 0.00 ? 50  SER A OG   8  
ATOM 10624 H H    . SER A 1 20 ? -14.334 -7.584  -6.992  1.00 0.00 ? 50  SER A H    8  
ATOM 10625 H HA   . SER A 1 20 ? -16.509 -8.943  -5.675  1.00 0.00 ? 50  SER A HA   8  
ATOM 10626 H HB2  . SER A 1 20 ? -14.590 -10.186 -7.638  1.00 0.00 ? 50  SER A HB2  8  
ATOM 10627 H HB3  . SER A 1 20 ? -16.266 -10.630 -7.315  1.00 0.00 ? 50  SER A HB3  8  
ATOM 10628 H HG   . SER A 1 20 ? -15.255 -8.724  -8.992  1.00 0.00 ? 50  SER A HG   8  
ATOM 10629 N N    . ASP A 1 21 ? -13.475 -9.491  -4.781  1.00 0.00 ? 51  ASP A N    8  
ATOM 10630 C CA   . ASP A 1 21 ? -12.618 -10.192 -3.842  1.00 0.00 ? 51  ASP A CA   8  
ATOM 10631 C C    . ASP A 1 21 ? -12.082 -9.241  -2.775  1.00 0.00 ? 51  ASP A C    8  
ATOM 10632 O O    . ASP A 1 21 ? -11.020 -8.641  -2.944  1.00 0.00 ? 51  ASP A O    8  
ATOM 10633 C CB   . ASP A 1 21 ? -11.458 -10.864 -4.582  1.00 0.00 ? 51  ASP A CB   8  
ATOM 10634 C CG   . ASP A 1 21 ? -11.391 -12.356 -4.320  1.00 0.00 ? 51  ASP A CG   8  
ATOM 10635 O OD1  . ASP A 1 21 ? -11.286 -12.747 -3.138  1.00 0.00 ? 51  ASP A OD1  8  
ATOM 10636 O OD2  . ASP A 1 21 ? -11.445 -13.133 -5.296  1.00 0.00 ? 51  ASP A OD2  8  
ATOM 10637 H H    . ASP A 1 21 ? -13.132 -8.700  -5.229  1.00 0.00 ? 51  ASP A H    8  
ATOM 10638 H HA   . ASP A 1 21 ? -13.214 -10.946 -3.367  1.00 0.00 ? 51  ASP A HA   8  
ATOM 10639 H HB2  . ASP A 1 21 ? -11.578 -10.710 -5.643  1.00 0.00 ? 51  ASP A HB2  8  
ATOM 10640 H HB3  . ASP A 1 21 ? -10.527 -10.419 -4.261  1.00 0.00 ? 51  ASP A HB3  8  
ATOM 10641 N N    . PRO A 1 22 ? -12.812 -9.090  -1.655  1.00 0.00 ? 52  PRO A N    8  
ATOM 10642 C CA   . PRO A 1 22 ? -12.402 -8.207  -0.558  1.00 0.00 ? 52  PRO A CA   8  
ATOM 10643 C C    . PRO A 1 22 ? -11.191 -8.739  0.203   1.00 0.00 ? 52  PRO A C    8  
ATOM 10644 O O    . PRO A 1 22 ? -10.624 -8.042  1.045   1.00 0.00 ? 52  PRO A O    8  
ATOM 10645 C CB   . PRO A 1 22 ? -13.633 -8.176  0.350   1.00 0.00 ? 52  PRO A CB   8  
ATOM 10646 C CG   . PRO A 1 22 ? -14.335 -9.462  0.080   1.00 0.00 ? 52  PRO A CG   8  
ATOM 10647 C CD   . PRO A 1 22 ? -14.091 -9.768  -1.371  1.00 0.00 ? 52  PRO A CD   8  
ATOM 10648 H HA   . PRO A 1 22 ? -12.191 -7.209  -0.914  1.00 0.00 ? 52  PRO A HA   8  
ATOM 10649 H HB2  . PRO A 1 22 ? -13.320 -8.106  1.382   1.00 0.00 ? 52  PRO A HB2  8  
ATOM 10650 H HB3  . PRO A 1 22 ? -14.251 -7.329  0.097   1.00 0.00 ? 52  PRO A HB3  8  
ATOM 10651 H HG2  . PRO A 1 22 ? -13.923 -10.243 0.702   1.00 0.00 ? 52  PRO A HG2  8  
ATOM 10652 H HG3  . PRO A 1 22 ? -15.392 -9.350  0.267   1.00 0.00 ? 52  PRO A HG3  8  
ATOM 10653 H HD2  . PRO A 1 22 ? -14.004 -10.835 -1.523  1.00 0.00 ? 52  PRO A HD2  8  
ATOM 10654 H HD3  . PRO A 1 22 ? -14.886 -9.363  -1.981  1.00 0.00 ? 52  PRO A HD3  8  
ATOM 10655 N N    . ALA A 1 23 ? -10.798 -9.975  -0.093  1.00 0.00 ? 53  ALA A N    8  
ATOM 10656 C CA   . ALA A 1 23 ? -9.654  -10.593 0.568   1.00 0.00 ? 53  ALA A CA   8  
ATOM 10657 C C    . ALA A 1 23 ? -8.407  -9.724  0.442   1.00 0.00 ? 53  ALA A C    8  
ATOM 10658 O O    . ALA A 1 23 ? -7.622  -9.607  1.383   1.00 0.00 ? 53  ALA A O    8  
ATOM 10659 C CB   . ALA A 1 23 ? -9.393  -11.975 -0.012  1.00 0.00 ? 53  ALA A CB   8  
ATOM 10660 H H    . ALA A 1 23 ? -11.288 -10.485 -0.771  1.00 0.00 ? 53  ALA A H    8  
ATOM 10661 H HA   . ALA A 1 23 ? -9.895  -10.708 1.614   1.00 0.00 ? 53  ALA A HA   8  
ATOM 10662 H HB1  . ALA A 1 23 ? -8.655  -12.485 0.589   1.00 0.00 ? 53  ALA A HB1  8  
ATOM 10663 H HB2  . ALA A 1 23 ? -9.030  -11.878 -1.025  1.00 0.00 ? 53  ALA A HB2  8  
ATOM 10664 H HB3  . ALA A 1 23 ? -10.312 -12.544 -0.012  1.00 0.00 ? 53  ALA A HB3  8  
ATOM 10665 N N    . THR A 1 24 ? -8.231  -9.114  -0.726  1.00 0.00 ? 54  THR A N    8  
ATOM 10666 C CA   . THR A 1 24 ? -7.081  -8.254  -0.974  1.00 0.00 ? 54  THR A CA   8  
ATOM 10667 C C    . THR A 1 24 ? -7.248  -6.909  -0.275  1.00 0.00 ? 54  THR A C    8  
ATOM 10668 O O    . THR A 1 24 ? -6.308  -6.389  0.326   1.00 0.00 ? 54  THR A O    8  
ATOM 10669 C CB   . THR A 1 24 ? -6.892  -8.042  -2.477  1.00 0.00 ? 54  THR A CB   8  
ATOM 10670 O OG1  . THR A 1 24 ? -7.282  -9.196  -3.199  1.00 0.00 ? 54  THR A OG1  8  
ATOM 10671 C CG2  . THR A 1 24 ? -5.464  -7.722  -2.861  1.00 0.00 ? 54  THR A CG2  8  
ATOM 10672 H H    . THR A 1 24 ? -8.892  -9.246  -1.438  1.00 0.00 ? 54  THR A H    8  
ATOM 10673 H HA   . THR A 1 24 ? -6.207  -8.747  -0.576  1.00 0.00 ? 54  THR A HA   8  
ATOM 10674 H HB   . THR A 1 24 ? -7.513  -7.217  -2.795  1.00 0.00 ? 54  THR A HB   8  
ATOM 10675 H HG1  . THR A 1 24 ? -7.153  -9.046  -4.139  1.00 0.00 ? 54  THR A HG1  8  
ATOM 10676 H HG21 . THR A 1 24 ? -5.074  -6.962  -2.200  1.00 0.00 ? 54  THR A HG21 8  
ATOM 10677 H HG22 . THR A 1 24 ? -5.437  -7.361  -3.878  1.00 0.00 ? 54  THR A HG22 8  
ATOM 10678 H HG23 . THR A 1 24 ? -4.861  -8.614  -2.778  1.00 0.00 ? 54  THR A HG23 8  
ATOM 10679 N N    . TYR A 1 25 ? -8.451  -6.351  -0.358  1.00 0.00 ? 55  TYR A N    8  
ATOM 10680 C CA   . TYR A 1 25 ? -8.742  -5.067  0.268   1.00 0.00 ? 55  TYR A CA   8  
ATOM 10681 C C    . TYR A 1 25 ? -8.552  -5.143  1.779   1.00 0.00 ? 55  TYR A C    8  
ATOM 10682 O O    . TYR A 1 25 ? -7.894  -4.292  2.376   1.00 0.00 ? 55  TYR A O    8  
ATOM 10683 C CB   . TYR A 1 25 ? -10.172 -4.630  -0.057  1.00 0.00 ? 55  TYR A CB   8  
ATOM 10684 C CG   . TYR A 1 25 ? -10.483 -3.210  0.361   1.00 0.00 ? 55  TYR A CG   8  
ATOM 10685 C CD1  . TYR A 1 25 ? -9.711  -2.148  -0.091  1.00 0.00 ? 55  TYR A CD1  8  
ATOM 10686 C CD2  . TYR A 1 25 ? -11.549 -2.932  1.208   1.00 0.00 ? 55  TYR A CD2  8  
ATOM 10687 C CE1  . TYR A 1 25 ? -9.991  -0.848  0.287   1.00 0.00 ? 55  TYR A CE1  8  
ATOM 10688 C CE2  . TYR A 1 25 ? -11.837 -1.636  1.590   1.00 0.00 ? 55  TYR A CE2  8  
ATOM 10689 C CZ   . TYR A 1 25 ? -11.055 -0.599  1.128   1.00 0.00 ? 55  TYR A CZ   8  
ATOM 10690 O OH   . TYR A 1 25 ? -11.338 0.694   1.508   1.00 0.00 ? 55  TYR A OH   8  
ATOM 10691 H H    . TYR A 1 25 ? -9.161  -6.814  -0.850  1.00 0.00 ? 55  TYR A H    8  
ATOM 10692 H HA   . TYR A 1 25 ? -8.053  -4.338  -0.133  1.00 0.00 ? 55  TYR A HA   8  
ATOM 10693 H HB2  . TYR A 1 25 ? -10.330 -4.703  -1.121  1.00 0.00 ? 55  TYR A HB2  8  
ATOM 10694 H HB3  . TYR A 1 25 ? -10.864 -5.285  0.451   1.00 0.00 ? 55  TYR A HB3  8  
ATOM 10695 H HD1  . TYR A 1 25 ? -8.877  -2.347  -0.750  1.00 0.00 ? 55  TYR A HD1  8  
ATOM 10696 H HD2  . TYR A 1 25 ? -12.159 -3.747  1.568   1.00 0.00 ? 55  TYR A HD2  8  
ATOM 10697 H HE1  . TYR A 1 25 ? -9.379  -0.036  -0.076  1.00 0.00 ? 55  TYR A HE1  8  
ATOM 10698 H HE2  . TYR A 1 25 ? -12.670 -1.439  2.249   1.00 0.00 ? 55  TYR A HE2  8  
ATOM 10699 H HH   . TYR A 1 25 ? -12.193 0.951   1.155   1.00 0.00 ? 55  TYR A HH   8  
ATOM 10700 N N    . ASN A 1 26 ? -9.134  -6.170  2.391   1.00 0.00 ? 56  ASN A N    8  
ATOM 10701 C CA   . ASN A 1 26 ? -9.029  -6.360  3.832   1.00 0.00 ? 56  ASN A CA   8  
ATOM 10702 C C    . ASN A 1 26 ? -7.575  -6.551  4.251   1.00 0.00 ? 56  ASN A C    8  
ATOM 10703 O O    . ASN A 1 26 ? -7.125  -5.982  5.247   1.00 0.00 ? 56  ASN A O    8  
ATOM 10704 C CB   . ASN A 1 26 ? -9.862  -7.566  4.271   1.00 0.00 ? 56  ASN A CB   8  
ATOM 10705 C CG   . ASN A 1 26 ? -11.264 -7.176  4.694   1.00 0.00 ? 56  ASN A CG   8  
ATOM 10706 O OD1  . ASN A 1 26 ? -11.482 -6.716  5.815   1.00 0.00 ? 56  ASN A OD1  8  
ATOM 10707 N ND2  . ASN A 1 26 ? -12.225 -7.357  3.796   1.00 0.00 ? 56  ASN A ND2  8  
ATOM 10708 H H    . ASN A 1 26 ? -9.645  -6.815  1.860   1.00 0.00 ? 56  ASN A H    8  
ATOM 10709 H HA   . ASN A 1 26 ? -9.415  -5.473  4.312   1.00 0.00 ? 56  ASN A HA   8  
ATOM 10710 H HB2  . ASN A 1 26 ? -9.935  -8.263  3.450   1.00 0.00 ? 56  ASN A HB2  8  
ATOM 10711 H HB3  . ASN A 1 26 ? -9.374  -8.048  5.105   1.00 0.00 ? 56  ASN A HB3  8  
ATOM 10712 H HD21 . ASN A 1 26 ? -11.979 -7.727  2.923   1.00 0.00 ? 56  ASN A HD21 8  
ATOM 10713 H HD22 . ASN A 1 26 ? -13.141 -7.112  4.043   1.00 0.00 ? 56  ASN A HD22 8  
ATOM 10714 N N    . GLY A 1 27 ? -6.844  -7.354  3.486   1.00 0.00 ? 57  GLY A N    8  
ATOM 10715 C CA   . GLY A 1 27 ? -5.448  -7.606  3.794   1.00 0.00 ? 57  GLY A CA   8  
ATOM 10716 C C    . GLY A 1 27 ? -4.614  -6.340  3.770   1.00 0.00 ? 57  GLY A C    8  
ATOM 10717 O O    . GLY A 1 27 ? -3.854  -6.073  4.702   1.00 0.00 ? 57  GLY A O    8  
ATOM 10718 H H    . GLY A 1 27 ? -7.256  -7.780  2.706   1.00 0.00 ? 57  GLY A H    8  
ATOM 10719 H HA2  . GLY A 1 27 ? -5.383  -8.050  4.776   1.00 0.00 ? 57  GLY A HA2  8  
ATOM 10720 H HA3  . GLY A 1 27 ? -5.051  -8.300  3.068   1.00 0.00 ? 57  GLY A HA3  8  
ATOM 10721 N N    . PHE A 1 28 ? -4.755  -5.560  2.705   1.00 0.00 ? 58  PHE A N    8  
ATOM 10722 C CA   . PHE A 1 28 ? -4.008  -4.315  2.564   1.00 0.00 ? 58  PHE A CA   8  
ATOM 10723 C C    . PHE A 1 28 ? -4.348  -3.348  3.693   1.00 0.00 ? 58  PHE A C    8  
ATOM 10724 O O    . PHE A 1 28 ? -3.490  -2.604  4.166   1.00 0.00 ? 58  PHE A O    8  
ATOM 10725 C CB   . PHE A 1 28 ? -4.307  -3.665  1.212   1.00 0.00 ? 58  PHE A CB   8  
ATOM 10726 C CG   . PHE A 1 28 ? -3.465  -2.454  0.929   1.00 0.00 ? 58  PHE A CG   8  
ATOM 10727 C CD1  . PHE A 1 28 ? -2.091  -2.492  1.109   1.00 0.00 ? 58  PHE A CD1  8  
ATOM 10728 C CD2  . PHE A 1 28 ? -4.046  -1.278  0.484   1.00 0.00 ? 58  PHE A CD2  8  
ATOM 10729 C CE1  . PHE A 1 28 ? -1.314  -1.379  0.850   1.00 0.00 ? 58  PHE A CE1  8  
ATOM 10730 C CE2  . PHE A 1 28 ? -3.274  -0.162  0.224   1.00 0.00 ? 58  PHE A CE2  8  
ATOM 10731 C CZ   . PHE A 1 28 ? -1.906  -0.212  0.406   1.00 0.00 ? 58  PHE A CZ   8  
ATOM 10732 H H    . PHE A 1 28 ? -5.376  -5.827  1.995   1.00 0.00 ? 58  PHE A H    8  
ATOM 10733 H HA   . PHE A 1 28 ? -2.955  -4.554  2.615   1.00 0.00 ? 58  PHE A HA   8  
ATOM 10734 H HB2  . PHE A 1 28 ? -4.129  -4.385  0.427   1.00 0.00 ? 58  PHE A HB2  8  
ATOM 10735 H HB3  . PHE A 1 28 ? -5.344  -3.363  1.188   1.00 0.00 ? 58  PHE A HB3  8  
ATOM 10736 H HD1  . PHE A 1 28 ? -1.627  -3.402  1.456   1.00 0.00 ? 58  PHE A HD1  8  
ATOM 10737 H HD2  . PHE A 1 28 ? -5.116  -1.237  0.340   1.00 0.00 ? 58  PHE A HD2  8  
ATOM 10738 H HE1  . PHE A 1 28 ? -0.244  -1.421  0.994   1.00 0.00 ? 58  PHE A HE1  8  
ATOM 10739 H HE2  . PHE A 1 28 ? -3.740  0.749   -0.124  1.00 0.00 ? 58  PHE A HE2  8  
ATOM 10740 H HZ   . PHE A 1 28 ? -1.300  0.659   0.204   1.00 0.00 ? 58  PHE A HZ   8  
ATOM 10741 N N    . LEU A 1 29 ? -5.606  -3.366  4.120   1.00 0.00 ? 59  LEU A N    8  
ATOM 10742 C CA   . LEU A 1 29 ? -6.063  -2.490  5.193   1.00 0.00 ? 59  LEU A CA   8  
ATOM 10743 C C    . LEU A 1 29 ? -5.373  -2.837  6.509   1.00 0.00 ? 59  LEU A C    8  
ATOM 10744 O O    . LEU A 1 29 ? -4.895  -1.956  7.223   1.00 0.00 ? 59  LEU A O    8  
ATOM 10745 C CB   . LEU A 1 29 ? -7.581  -2.596  5.357   1.00 0.00 ? 59  LEU A CB   8  
ATOM 10746 C CG   . LEU A 1 29 ? -8.390  -1.577  4.553   1.00 0.00 ? 59  LEU A CG   8  
ATOM 10747 C CD1  . LEU A 1 29 ? -9.734  -2.164  4.148   1.00 0.00 ? 59  LEU A CD1  8  
ATOM 10748 C CD2  . LEU A 1 29 ? -8.584  -0.299  5.354   1.00 0.00 ? 59  LEU A CD2  8  
ATOM 10749 H H    . LEU A 1 29 ? -6.244  -3.982  3.702   1.00 0.00 ? 59  LEU A H    8  
ATOM 10750 H HA   . LEU A 1 29 ? -5.808  -1.476  4.925   1.00 0.00 ? 59  LEU A HA   8  
ATOM 10751 H HB2  . LEU A 1 29 ? -7.886  -3.587  5.054   1.00 0.00 ? 59  LEU A HB2  8  
ATOM 10752 H HB3  . LEU A 1 29 ? -7.821  -2.466  6.401   1.00 0.00 ? 59  LEU A HB3  8  
ATOM 10753 H HG   . LEU A 1 29 ? -7.850  -1.329  3.651   1.00 0.00 ? 59  LEU A HG   8  
ATOM 10754 H HD11 . LEU A 1 29 ? -10.320 -2.364  5.032   1.00 0.00 ? 59  LEU A HD11 8  
ATOM 10755 H HD12 . LEU A 1 29 ? -9.575  -3.083  3.604   1.00 0.00 ? 59  LEU A HD12 8  
ATOM 10756 H HD13 . LEU A 1 29 ? -10.260 -1.460  3.520   1.00 0.00 ? 59  LEU A HD13 8  
ATOM 10757 H HD21 . LEU A 1 29 ? -8.546  -0.526  6.410   1.00 0.00 ? 59  LEU A HD21 8  
ATOM 10758 H HD22 . LEU A 1 29 ? -9.543  0.135   5.114   1.00 0.00 ? 59  LEU A HD22 8  
ATOM 10759 H HD23 . LEU A 1 29 ? -7.799  0.402   5.110   1.00 0.00 ? 59  LEU A HD23 8  
ATOM 10760 N N    . GLU A 1 30 ? -5.325  -4.128  6.824   1.00 0.00 ? 60  GLU A N    8  
ATOM 10761 C CA   . GLU A 1 30 ? -4.693  -4.591  8.054   1.00 0.00 ? 60  GLU A CA   8  
ATOM 10762 C C    . GLU A 1 30 ? -3.224  -4.182  8.097   1.00 0.00 ? 60  GLU A C    8  
ATOM 10763 O O    . GLU A 1 30 ? -2.694  -3.848  9.157   1.00 0.00 ? 60  GLU A O    8  
ATOM 10764 C CB   . GLU A 1 30 ? -4.819  -6.113  8.175   1.00 0.00 ? 60  GLU A CB   8  
ATOM 10765 C CG   . GLU A 1 30 ? -5.926  -6.557  9.117   1.00 0.00 ? 60  GLU A CG   8  
ATOM 10766 C CD   . GLU A 1 30 ? -7.031  -7.315  8.406   1.00 0.00 ? 60  GLU A CD   8  
ATOM 10767 O OE1  . GLU A 1 30 ? -7.944  -6.660  7.861   1.00 0.00 ? 60  GLU A OE1  8  
ATOM 10768 O OE2  . GLU A 1 30 ? -6.981  -8.562  8.394   1.00 0.00 ? 60  GLU A OE2  8  
ATOM 10769 H H    . GLU A 1 30 ? -5.723  -4.784  6.214   1.00 0.00 ? 60  GLU A H    8  
ATOM 10770 H HA   . GLU A 1 30 ? -5.207  -4.130  8.884   1.00 0.00 ? 60  GLU A HA   8  
ATOM 10771 H HB2  . GLU A 1 30 ? -5.020  -6.524  7.197   1.00 0.00 ? 60  GLU A HB2  8  
ATOM 10772 H HB3  . GLU A 1 30 ? -3.884  -6.513  8.540   1.00 0.00 ? 60  GLU A HB3  8  
ATOM 10773 H HG2  . GLU A 1 30 ? -5.501  -7.199  9.875   1.00 0.00 ? 60  GLU A HG2  8  
ATOM 10774 H HG3  . GLU A 1 30 ? -6.354  -5.683  9.587   1.00 0.00 ? 60  GLU A HG3  8  
ATOM 10775 N N    . ILE A 1 31 ? -2.575  -4.209  6.938   1.00 0.00 ? 61  ILE A N    8  
ATOM 10776 C CA   . ILE A 1 31 ? -1.167  -3.838  6.843   1.00 0.00 ? 61  ILE A CA   8  
ATOM 10777 C C    . ILE A 1 31 ? -0.982  -2.343  7.077   1.00 0.00 ? 61  ILE A C    8  
ATOM 10778 O O    . ILE A 1 31 ? 0.037   -1.910  7.616   1.00 0.00 ? 61  ILE A O    8  
ATOM 10779 C CB   . ILE A 1 31 ? -0.580  -4.210  5.468   1.00 0.00 ? 61  ILE A CB   8  
ATOM 10780 C CG1  . ILE A 1 31 ? -0.887  -5.672  5.134   1.00 0.00 ? 61  ILE A CG1  8  
ATOM 10781 C CG2  . ILE A 1 31 ? 0.921   -3.960  5.445   1.00 0.00 ? 61  ILE A CG2  8  
ATOM 10782 C CD1  . ILE A 1 31 ? -1.035  -5.935  3.651   1.00 0.00 ? 61  ILE A CD1  8  
ATOM 10783 H H    . ILE A 1 31 ? -3.053  -4.482  6.128   1.00 0.00 ? 61  ILE A H    8  
ATOM 10784 H HA   . ILE A 1 31 ? -0.626  -4.383  7.603   1.00 0.00 ? 61  ILE A HA   8  
ATOM 10785 H HB   . ILE A 1 31 ? -1.036  -3.575  4.723   1.00 0.00 ? 61  ILE A HB   8  
ATOM 10786 H HG12 . ILE A 1 31 ? -0.085  -6.294  5.501   1.00 0.00 ? 61  ILE A HG12 8  
ATOM 10787 H HG13 . ILE A 1 31 ? -1.809  -5.959  5.617   1.00 0.00 ? 61  ILE A HG13 8  
ATOM 10788 H HG21 . ILE A 1 31 ? 1.426   -4.760  5.968   1.00 0.00 ? 61  ILE A HG21 8  
ATOM 10789 H HG22 . ILE A 1 31 ? 1.137   -3.020  5.931   1.00 0.00 ? 61  ILE A HG22 8  
ATOM 10790 H HG23 . ILE A 1 31 ? 1.265   -3.926  4.422   1.00 0.00 ? 61  ILE A HG23 8  
ATOM 10791 H HD11 . ILE A 1 31 ? -1.983  -6.417  3.465   1.00 0.00 ? 61  ILE A HD11 8  
ATOM 10792 H HD12 . ILE A 1 31 ? -0.233  -6.576  3.317   1.00 0.00 ? 61  ILE A HD12 8  
ATOM 10793 H HD13 . ILE A 1 31 ? -0.995  -4.999  3.114   1.00 0.00 ? 61  ILE A HD13 8  
ATOM 10794 N N    . MET A 1 32 ? -1.974  -1.559  6.668   1.00 0.00 ? 62  MET A N    8  
ATOM 10795 C CA   . MET A 1 32 ? -1.922  -0.111  6.832   1.00 0.00 ? 62  MET A CA   8  
ATOM 10796 C C    . MET A 1 32 ? -2.183  0.282   8.282   1.00 0.00 ? 62  MET A C    8  
ATOM 10797 O O    . MET A 1 32 ? -1.486  1.128   8.842   1.00 0.00 ? 62  MET A O    8  
ATOM 10798 C CB   . MET A 1 32 ? -2.946  0.562   5.916   1.00 0.00 ? 62  MET A CB   8  
ATOM 10799 C CG   . MET A 1 32 ? -2.594  0.472   4.440   1.00 0.00 ? 62  MET A CG   8  
ATOM 10800 S SD   . MET A 1 32 ? -1.090  1.377   4.027   1.00 0.00 ? 62  MET A SD   8  
ATOM 10801 C CE   . MET A 1 32 ? 0.061   0.027   3.785   1.00 0.00 ? 62  MET A CE   8  
ATOM 10802 H H    . MET A 1 32 ? -2.760  -1.964  6.246   1.00 0.00 ? 62  MET A H    8  
ATOM 10803 H HA   . MET A 1 32 ? -0.932  0.219   6.554   1.00 0.00 ? 62  MET A HA   8  
ATOM 10804 H HB2  . MET A 1 32 ? -3.907  0.094   6.065   1.00 0.00 ? 62  MET A HB2  8  
ATOM 10805 H HB3  . MET A 1 32 ? -3.019  1.606   6.183   1.00 0.00 ? 62  MET A HB3  8  
ATOM 10806 H HG2  . MET A 1 32 ? -2.455  -0.567  4.180   1.00 0.00 ? 62  MET A HG2  8  
ATOM 10807 H HG3  . MET A 1 32 ? -3.412  0.879   3.864   1.00 0.00 ? 62  MET A HG3  8  
ATOM 10808 H HE1  . MET A 1 32 ? 0.539   0.131   2.821   1.00 0.00 ? 62  MET A HE1  8  
ATOM 10809 H HE2  . MET A 1 32 ? -0.471  -0.912  3.824   1.00 0.00 ? 62  MET A HE2  8  
ATOM 10810 H HE3  . MET A 1 32 ? 0.811   0.048   4.562   1.00 0.00 ? 62  MET A HE3  8  
ATOM 10811 N N    . LYS A 1 33 ? -3.190  -0.340  8.886   1.00 0.00 ? 63  LYS A N    8  
ATOM 10812 C CA   . LYS A 1 33 ? -3.542  -0.055  10.273  1.00 0.00 ? 63  LYS A CA   8  
ATOM 10813 C C    . LYS A 1 33 ? -2.461  -0.568  11.219  1.00 0.00 ? 63  LYS A C    8  
ATOM 10814 O O    . LYS A 1 33 ? -2.201  0.030   12.263  1.00 0.00 ? 63  LYS A O    8  
ATOM 10815 C CB   . LYS A 1 33 ? -4.889  -0.688  10.630  1.00 0.00 ? 63  LYS A CB   8  
ATOM 10816 C CG   . LYS A 1 33 ? -5.968  -0.470  9.580   1.00 0.00 ? 63  LYS A CG   8  
ATOM 10817 C CD   . LYS A 1 33 ? -6.892  -1.674  9.470   1.00 0.00 ? 63  LYS A CD   8  
ATOM 10818 C CE   . LYS A 1 33 ? -8.243  -1.399  10.112  1.00 0.00 ? 63  LYS A CE   8  
ATOM 10819 N NZ   . LYS A 1 33 ? -9.284  -1.073  9.098   1.00 0.00 ? 63  LYS A NZ   8  
ATOM 10820 H H    . LYS A 1 33 ? -3.709  -1.008  8.389   1.00 0.00 ? 63  LYS A H    8  
ATOM 10821 H HA   . LYS A 1 33 ? -3.617  1.016   10.381  1.00 0.00 ? 63  LYS A HA   8  
ATOM 10822 H HB2  . LYS A 1 33 ? -4.751  -1.752  10.756  1.00 0.00 ? 63  LYS A HB2  8  
ATOM 10823 H HB3  . LYS A 1 33 ? -5.235  -0.266  11.561  1.00 0.00 ? 63  LYS A HB3  8  
ATOM 10824 H HG2  . LYS A 1 33 ? -6.552  0.395   9.856   1.00 0.00 ? 63  LYS A HG2  8  
ATOM 10825 H HG3  . LYS A 1 33 ? -5.498  -0.300  8.623   1.00 0.00 ? 63  LYS A HG3  8  
ATOM 10826 H HD2  . LYS A 1 33 ? -7.041  -1.907  8.427   1.00 0.00 ? 63  LYS A HD2  8  
ATOM 10827 H HD3  . LYS A 1 33 ? -6.432  -2.516  9.968   1.00 0.00 ? 63  LYS A HD3  8  
ATOM 10828 H HE2  . LYS A 1 33 ? -8.552  -2.275  10.662  1.00 0.00 ? 63  LYS A HE2  8  
ATOM 10829 H HE3  . LYS A 1 33 ? -8.141  -0.565  10.791  1.00 0.00 ? 63  LYS A HE3  8  
ATOM 10830 H HZ1  . LYS A 1 33 ? -10.200 -1.474  9.385   1.00 0.00 ? 63  LYS A HZ1  8  
ATOM 10831 H HZ2  . LYS A 1 33 ? -9.019  -1.469  8.174   1.00 0.00 ? 63  LYS A HZ2  8  
ATOM 10832 H HZ3  . LYS A 1 33 ? -9.383  -0.043  9.005   1.00 0.00 ? 63  LYS A HZ3  8  
ATOM 10833 N N    . GLU A 1 34 ? -1.833  -1.679  10.845  1.00 0.00 ? 64  GLU A N    8  
ATOM 10834 C CA   . GLU A 1 34 ? -0.779  -2.271  11.659  1.00 0.00 ? 64  GLU A CA   8  
ATOM 10835 C C    . GLU A 1 34 ? 0.458   -1.380  11.675  1.00 0.00 ? 64  GLU A C    8  
ATOM 10836 O O    . GLU A 1 34 ? 1.092   -1.199  12.714  1.00 0.00 ? 64  GLU A O    8  
ATOM 10837 C CB   . GLU A 1 34 ? -0.414  -3.659  11.129  1.00 0.00 ? 64  GLU A CB   8  
ATOM 10838 C CG   . GLU A 1 34 ? -1.281  -4.773  11.694  1.00 0.00 ? 64  GLU A CG   8  
ATOM 10839 C CD   . GLU A 1 34 ? -0.485  -6.020  12.024  1.00 0.00 ? 64  GLU A CD   8  
ATOM 10840 O OE1  . GLU A 1 34 ? 0.494   -5.914  12.793  1.00 0.00 ? 64  GLU A OE1  8  
ATOM 10841 O OE2  . GLU A 1 34 ? -0.841  -7.104  11.514  1.00 0.00 ? 64  GLU A OE2  8  
ATOM 10842 H H    . GLU A 1 34 ? -2.084  -2.109  10.001  1.00 0.00 ? 64  GLU A H    8  
ATOM 10843 H HA   . GLU A 1 34 ? -1.152  -2.366  12.667  1.00 0.00 ? 64  GLU A HA   8  
ATOM 10844 H HB2  . GLU A 1 34 ? -0.519  -3.661  10.054  1.00 0.00 ? 64  GLU A HB2  8  
ATOM 10845 H HB3  . GLU A 1 34 ? 0.615   -3.870  11.383  1.00 0.00 ? 64  GLU A HB3  8  
ATOM 10846 H HG2  . GLU A 1 34 ? -1.757  -4.419  12.596  1.00 0.00 ? 64  GLU A HG2  8  
ATOM 10847 H HG3  . GLU A 1 34 ? -2.037  -5.028  10.966  1.00 0.00 ? 64  GLU A HG3  8  
ATOM 10848 N N    . PHE A 1 35 ? 0.793   -0.822  10.516  1.00 0.00 ? 65  PHE A N    8  
ATOM 10849 C CA   . PHE A 1 35 ? 1.954   0.053   10.397  1.00 0.00 ? 65  PHE A CA   8  
ATOM 10850 C C    . PHE A 1 35 ? 1.792   1.290   11.275  1.00 0.00 ? 65  PHE A C    8  
ATOM 10851 O O    . PHE A 1 35 ? 2.714   1.679   11.992  1.00 0.00 ? 65  PHE A O    8  
ATOM 10852 C CB   . PHE A 1 35 ? 2.159   0.472   8.941   1.00 0.00 ? 65  PHE A CB   8  
ATOM 10853 C CG   . PHE A 1 35 ? 3.402   1.286   8.721   1.00 0.00 ? 65  PHE A CG   8  
ATOM 10854 C CD1  . PHE A 1 35 ? 4.648   0.680   8.696   1.00 0.00 ? 65  PHE A CD1  8  
ATOM 10855 C CD2  . PHE A 1 35 ? 3.325   2.658   8.541   1.00 0.00 ? 65  PHE A CD2  8  
ATOM 10856 C CE1  . PHE A 1 35 ? 5.793   1.428   8.496   1.00 0.00 ? 65  PHE A CE1  8  
ATOM 10857 C CE2  . PHE A 1 35 ? 4.467   3.411   8.341   1.00 0.00 ? 65  PHE A CE2  8  
ATOM 10858 C CZ   . PHE A 1 35 ? 5.702   2.794   8.319   1.00 0.00 ? 65  PHE A CZ   8  
ATOM 10859 H H    . PHE A 1 35 ? 0.248   -1.002  9.721   1.00 0.00 ? 65  PHE A H    8  
ATOM 10860 H HA   . PHE A 1 35 ? 2.820   -0.499  10.730  1.00 0.00 ? 65  PHE A HA   8  
ATOM 10861 H HB2  . PHE A 1 35 ? 2.229   -0.413  8.325   1.00 0.00 ? 65  PHE A HB2  8  
ATOM 10862 H HB3  . PHE A 1 35 ? 1.313   1.062   8.619   1.00 0.00 ? 65  PHE A HB3  8  
ATOM 10863 H HD1  . PHE A 1 35 ? 4.720   -0.388  8.835   1.00 0.00 ? 65  PHE A HD1  8  
ATOM 10864 H HD2  . PHE A 1 35 ? 2.359   3.141   8.560   1.00 0.00 ? 65  PHE A HD2  8  
ATOM 10865 H HE1  . PHE A 1 35 ? 6.759   0.943   8.479   1.00 0.00 ? 65  PHE A HE1  8  
ATOM 10866 H HE2  . PHE A 1 35 ? 4.392   4.479   8.202   1.00 0.00 ? 65  PHE A HE2  8  
ATOM 10867 H HZ   . PHE A 1 35 ? 6.595   3.380   8.161   1.00 0.00 ? 65  PHE A HZ   8  
ATOM 10868 N N    . LYS A 1 36 ? 0.614   1.903   11.216  1.00 0.00 ? 66  LYS A N    8  
ATOM 10869 C CA   . LYS A 1 36 ? 0.332   3.095   12.009  1.00 0.00 ? 66  LYS A CA   8  
ATOM 10870 C C    . LYS A 1 36 ? 0.502   2.808   13.497  1.00 0.00 ? 66  LYS A C    8  
ATOM 10871 O O    . LYS A 1 36 ? 1.018   3.639   14.244  1.00 0.00 ? 66  LYS A O    8  
ATOM 10872 C CB   . LYS A 1 36 ? -1.086  3.595   11.732  1.00 0.00 ? 66  LYS A CB   8  
ATOM 10873 C CG   . LYS A 1 36 ? -1.354  4.993   12.267  1.00 0.00 ? 66  LYS A CG   8  
ATOM 10874 C CD   . LYS A 1 36 ? -2.703  5.076   12.964  1.00 0.00 ? 66  LYS A CD   8  
ATOM 10875 C CE   . LYS A 1 36 ? -3.429  6.368   12.625  1.00 0.00 ? 66  LYS A CE   8  
ATOM 10876 N NZ   . LYS A 1 36 ? -4.853  6.337   13.059  1.00 0.00 ? 66  LYS A NZ   8  
ATOM 10877 H H    . LYS A 1 36 ? -0.083  1.545   10.626  1.00 0.00 ? 66  LYS A H    8  
ATOM 10878 H HA   . LYS A 1 36 ? 1.038   3.859   11.719  1.00 0.00 ? 66  LYS A HA   8  
ATOM 10879 H HB2  . LYS A 1 36 ? -1.251  3.604   10.665  1.00 0.00 ? 66  LYS A HB2  8  
ATOM 10880 H HB3  . LYS A 1 36 ? -1.790  2.915   12.190  1.00 0.00 ? 66  LYS A HB3  8  
ATOM 10881 H HG2  . LYS A 1 36 ? -0.580  5.252   12.972  1.00 0.00 ? 66  LYS A HG2  8  
ATOM 10882 H HG3  . LYS A 1 36 ? -1.342  5.692   11.443  1.00 0.00 ? 66  LYS A HG3  8  
ATOM 10883 H HD2  . LYS A 1 36 ? -3.312  4.241   12.651  1.00 0.00 ? 66  LYS A HD2  8  
ATOM 10884 H HD3  . LYS A 1 36 ? -2.548  5.030   14.033  1.00 0.00 ? 66  LYS A HD3  8  
ATOM 10885 H HE2  . LYS A 1 36 ? -2.929  7.187   13.120  1.00 0.00 ? 66  LYS A HE2  8  
ATOM 10886 H HE3  . LYS A 1 36 ? -3.390  6.517   11.556  1.00 0.00 ? 66  LYS A HE3  8  
ATOM 10887 H HZ1  . LYS A 1 36 ? -4.929  5.911   14.004  1.00 0.00 ? 66  LYS A HZ1  8  
ATOM 10888 H HZ2  . LYS A 1 36 ? -5.419  5.775   12.391  1.00 0.00 ? 66  LYS A HZ2  8  
ATOM 10889 H HZ3  . LYS A 1 36 ? -5.237  7.302   13.094  1.00 0.00 ? 66  LYS A HZ3  8  
ATOM 10890 N N    . SER A 1 37 ? 0.070   1.624   13.918  1.00 0.00 ? 67  SER A N    8  
ATOM 10891 C CA   . SER A 1 37 ? 0.179   1.222   15.314  1.00 0.00 ? 67  SER A CA   8  
ATOM 10892 C C    . SER A 1 37 ? 1.641   1.107   15.741  1.00 0.00 ? 67  SER A C    8  
ATOM 10893 O O    . SER A 1 37 ? 1.946   1.065   16.933  1.00 0.00 ? 67  SER A O    8  
ATOM 10894 C CB   . SER A 1 37 ? -0.538  -0.111  15.540  1.00 0.00 ? 67  SER A CB   8  
ATOM 10895 O OG   . SER A 1 37 ? -1.854  0.093   16.027  1.00 0.00 ? 67  SER A OG   8  
ATOM 10896 H H    . SER A 1 37 ? -0.329  1.004   13.273  1.00 0.00 ? 67  SER A H    8  
ATOM 10897 H HA   . SER A 1 37 ? -0.299  1.982   15.913  1.00 0.00 ? 67  SER A HA   8  
ATOM 10898 H HB2  . SER A 1 37 ? -0.595  -0.649  14.605  1.00 0.00 ? 67  SER A HB2  8  
ATOM 10899 H HB3  . SER A 1 37 ? 0.013   -0.697  16.260  1.00 0.00 ? 67  SER A HB3  8  
ATOM 10900 H HG   . SER A 1 37 ? -2.191  -0.729  16.390  1.00 0.00 ? 67  SER A HG   8  
ATOM 10901 N N    . GLN A 1 38 ? 2.543   1.055   14.761  1.00 0.00 ? 68  GLN A N    8  
ATOM 10902 C CA   . GLN A 1 38 ? 3.972   0.942   15.035  1.00 0.00 ? 68  GLN A CA   8  
ATOM 10903 C C    . GLN A 1 38 ? 4.327   -0.465  15.503  1.00 0.00 ? 68  GLN A C    8  
ATOM 10904 O O    . GLN A 1 38 ? 5.126   -0.644  16.422  1.00 0.00 ? 68  GLN A O    8  
ATOM 10905 C CB   . GLN A 1 38 ? 4.405   1.969   16.087  1.00 0.00 ? 68  GLN A CB   8  
ATOM 10906 C CG   . GLN A 1 38 ? 3.797   3.346   15.878  1.00 0.00 ? 68  GLN A CG   8  
ATOM 10907 C CD   . GLN A 1 38 ? 4.562   4.438   16.602  1.00 0.00 ? 68  GLN A CD   8  
ATOM 10908 O OE1  . GLN A 1 38 ? 5.792   4.478   16.565  1.00 0.00 ? 68  GLN A OE1  8  
ATOM 10909 N NE2  . GLN A 1 38 ? 3.836   5.328   17.266  1.00 0.00 ? 68  GLN A NE2  8  
ATOM 10910 H H    . GLN A 1 38 ? 2.240   1.090   13.831  1.00 0.00 ? 68  GLN A H    8  
ATOM 10911 H HA   . GLN A 1 38 ? 4.500   1.143   14.114  1.00 0.00 ? 68  GLN A HA   8  
ATOM 10912 H HB2  . GLN A 1 38 ? 4.111   1.614   17.063  1.00 0.00 ? 68  GLN A HB2  8  
ATOM 10913 H HB3  . GLN A 1 38 ? 5.480   2.066   16.058  1.00 0.00 ? 68  GLN A HB3  8  
ATOM 10914 H HG2  . GLN A 1 38 ? 3.797   3.570   14.821  1.00 0.00 ? 68  GLN A HG2  8  
ATOM 10915 H HG3  . GLN A 1 38 ? 2.781   3.337   16.243  1.00 0.00 ? 68  GLN A HG3  8  
ATOM 10916 H HE21 . GLN A 1 38 ? 2.860   5.233   17.253  1.00 0.00 ? 68  GLN A HE21 8  
ATOM 10917 H HE22 . GLN A 1 38 ? 4.304   6.044   17.745  1.00 0.00 ? 68  GLN A HE22 8  
ATOM 10918 N N    . SER A 1 39 ? 3.725   -1.464  14.864  1.00 0.00 ? 69  SER A N    8  
ATOM 10919 C CA   . SER A 1 39 ? 3.974   -2.857  15.212  1.00 0.00 ? 69  SER A CA   8  
ATOM 10920 C C    . SER A 1 39 ? 4.881   -3.520  14.179  1.00 0.00 ? 69  SER A C    8  
ATOM 10921 O O    . SER A 1 39 ? 5.794   -4.268  14.529  1.00 0.00 ? 69  SER A O    8  
ATOM 10922 C CB   . SER A 1 39 ? 2.654   -3.623  15.316  1.00 0.00 ? 69  SER A CB   8  
ATOM 10923 O OG   . SER A 1 39 ? 2.694   -4.567  16.372  1.00 0.00 ? 69  SER A OG   8  
ATOM 10924 H H    . SER A 1 39 ? 3.098   -1.257  14.139  1.00 0.00 ? 69  SER A H    8  
ATOM 10925 H HA   . SER A 1 39 ? 4.469   -2.876  16.171  1.00 0.00 ? 69  SER A HA   8  
ATOM 10926 H HB2  . SER A 1 39 ? 1.850   -2.927  15.503  1.00 0.00 ? 69  SER A HB2  8  
ATOM 10927 H HB3  . SER A 1 39 ? 2.470   -4.145  14.389  1.00 0.00 ? 69  SER A HB3  8  
ATOM 10928 H HG   . SER A 1 39 ? 1.803   -4.868  16.565  1.00 0.00 ? 69  SER A HG   8  
ATOM 10929 N N    . ILE A 1 40 ? 4.621   -3.240  12.906  1.00 0.00 ? 70  ILE A N    8  
ATOM 10930 C CA   . ILE A 1 40 ? 5.414   -3.809  11.822  1.00 0.00 ? 70  ILE A CA   8  
ATOM 10931 C C    . ILE A 1 40 ? 6.456   -2.813  11.323  1.00 0.00 ? 70  ILE A C    8  
ATOM 10932 O O    . ILE A 1 40 ? 6.232   -1.602  11.342  1.00 0.00 ? 70  ILE A O    8  
ATOM 10933 C CB   . ILE A 1 40 ? 4.521   -4.248  10.643  1.00 0.00 ? 70  ILE A CB   8  
ATOM 10934 C CG1  . ILE A 1 40 ? 5.358   -4.953  9.573   1.00 0.00 ? 70  ILE A CG1  8  
ATOM 10935 C CG2  . ILE A 1 40 ? 3.793   -3.050  10.048  1.00 0.00 ? 70  ILE A CG2  8  
ATOM 10936 C CD1  . ILE A 1 40 ? 4.534   -5.519  8.438   1.00 0.00 ? 70  ILE A CD1  8  
ATOM 10937 H H    . ILE A 1 40 ? 3.880   -2.637  12.690  1.00 0.00 ? 70  ILE A H    8  
ATOM 10938 H HA   . ILE A 1 40 ? 5.922   -4.683  12.206  1.00 0.00 ? 70  ILE A HA   8  
ATOM 10939 H HB   . ILE A 1 40 ? 3.780   -4.936  11.020  1.00 0.00 ? 70  ILE A HB   8  
ATOM 10940 H HG12 . ILE A 1 40 ? 6.061   -4.251  9.154   1.00 0.00 ? 70  ILE A HG12 8  
ATOM 10941 H HG13 . ILE A 1 40 ? 5.899   -5.769  10.030  1.00 0.00 ? 70  ILE A HG13 8  
ATOM 10942 H HG21 . ILE A 1 40 ? 2.765   -3.316  9.850   1.00 0.00 ? 70  ILE A HG21 8  
ATOM 10943 H HG22 . ILE A 1 40 ? 4.274   -2.757  9.126   1.00 0.00 ? 70  ILE A HG22 8  
ATOM 10944 H HG23 . ILE A 1 40 ? 3.823   -2.227  10.747  1.00 0.00 ? 70  ILE A HG23 8  
ATOM 10945 H HD11 . ILE A 1 40 ? 3.485   -5.443  8.681   1.00 0.00 ? 70  ILE A HD11 8  
ATOM 10946 H HD12 . ILE A 1 40 ? 4.793   -6.557  8.286   1.00 0.00 ? 70  ILE A HD12 8  
ATOM 10947 H HD13 . ILE A 1 40 ? 4.735   -4.962  7.534   1.00 0.00 ? 70  ILE A HD13 8  
ATOM 10948 N N    . ASP A 1 41 ? 7.595   -3.330  10.875  1.00 0.00 ? 71  ASP A N    8  
ATOM 10949 C CA   . ASP A 1 41 ? 8.672   -2.487  10.370  1.00 0.00 ? 71  ASP A CA   8  
ATOM 10950 C C    . ASP A 1 41 ? 8.444   -2.133  8.903   1.00 0.00 ? 71  ASP A C    8  
ATOM 10951 O O    . ASP A 1 41 ? 7.546   -2.673  8.256   1.00 0.00 ? 71  ASP A O    8  
ATOM 10952 C CB   . ASP A 1 41 ? 10.019  -3.193  10.534  1.00 0.00 ? 71  ASP A CB   8  
ATOM 10953 C CG   . ASP A 1 41 ? 11.159  -2.219  10.762  1.00 0.00 ? 71  ASP A CG   8  
ATOM 10954 O OD1  . ASP A 1 41 ? 11.356  -1.326  9.910   1.00 0.00 ? 71  ASP A OD1  8  
ATOM 10955 O OD2  . ASP A 1 41 ? 11.853  -2.348  11.791  1.00 0.00 ? 71  ASP A OD2  8  
ATOM 10956 H H    . ASP A 1 41 ? 7.715   -4.303  10.885  1.00 0.00 ? 71  ASP A H    8  
ATOM 10957 H HA   . ASP A 1 41 ? 8.679   -1.576  10.950  1.00 0.00 ? 71  ASP A HA   8  
ATOM 10958 H HB2  . ASP A 1 41 ? 9.967   -3.860  11.381  1.00 0.00 ? 71  ASP A HB2  8  
ATOM 10959 H HB3  . ASP A 1 41 ? 10.230  -3.764  9.643   1.00 0.00 ? 71  ASP A HB3  8  
ATOM 10960 N N    . THR A 1 42 ? 9.263   -1.224  8.385   1.00 0.00 ? 72  THR A N    8  
ATOM 10961 C CA   . THR A 1 42 ? 9.151   -0.798  6.994   1.00 0.00 ? 72  THR A CA   8  
ATOM 10962 C C    . THR A 1 42 ? 9.333   -1.981  6.045   1.00 0.00 ? 72  THR A C    8  
ATOM 10963 O O    . THR A 1 42 ? 8.493   -2.228  5.181   1.00 0.00 ? 72  THR A O    8  
ATOM 10964 C CB   . THR A 1 42 ? 10.182  0.290   6.681   1.00 0.00 ? 72  THR A CB   8  
ATOM 10965 O OG1  . THR A 1 42 ? 10.788  0.766   7.870   1.00 0.00 ? 72  THR A OG1  8  
ATOM 10966 C CG2  . THR A 1 42 ? 9.594   1.481   5.959   1.00 0.00 ? 72  THR A CG2  8  
ATOM 10967 H H    . THR A 1 42 ? 9.960   -0.829  8.951   1.00 0.00 ? 72  THR A H    8  
ATOM 10968 H HA   . THR A 1 42 ? 8.161   -0.392  6.853   1.00 0.00 ? 72  THR A HA   8  
ATOM 10969 H HB   . THR A 1 42 ? 10.955  -0.129  6.053   1.00 0.00 ? 72  THR A HB   8  
ATOM 10970 H HG1  . THR A 1 42 ? 11.598  1.234   7.652   1.00 0.00 ? 72  THR A HG1  8  
ATOM 10971 H HG21 . THR A 1 42 ? 10.284  1.820   5.200   1.00 0.00 ? 72  THR A HG21 8  
ATOM 10972 H HG22 . THR A 1 42 ? 9.416   2.279   6.665   1.00 0.00 ? 72  THR A HG22 8  
ATOM 10973 H HG23 . THR A 1 42 ? 8.661   1.196   5.494   1.00 0.00 ? 72  THR A HG23 8  
ATOM 10974 N N    . PRO A 1 43 ? 10.439  -2.734  6.196   1.00 0.00 ? 73  PRO A N    8  
ATOM 10975 C CA   . PRO A 1 43 ? 10.723  -3.896  5.347   1.00 0.00 ? 73  PRO A CA   8  
ATOM 10976 C C    . PRO A 1 43 ? 9.539   -4.852  5.259   1.00 0.00 ? 73  PRO A C    8  
ATOM 10977 O O    . PRO A 1 43 ? 9.267   -5.424  4.203   1.00 0.00 ? 73  PRO A O    8  
ATOM 10978 C CB   . PRO A 1 43 ? 11.902  -4.568  6.050   1.00 0.00 ? 73  PRO A CB   8  
ATOM 10979 C CG   . PRO A 1 43 ? 12.581  -3.466  6.787   1.00 0.00 ? 73  PRO A CG   8  
ATOM 10980 C CD   . PRO A 1 43 ? 11.494  -2.513  7.203   1.00 0.00 ? 73  PRO A CD   8  
ATOM 10981 H HA   . PRO A 1 43 ? 11.017  -3.595  4.351   1.00 0.00 ? 73  PRO A HA   8  
ATOM 10982 H HB2  . PRO A 1 43 ? 11.537  -5.329  6.725   1.00 0.00 ? 73  PRO A HB2  8  
ATOM 10983 H HB3  . PRO A 1 43 ? 12.558  -5.013  5.316   1.00 0.00 ? 73  PRO A HB3  8  
ATOM 10984 H HG2  . PRO A 1 43 ? 13.086  -3.862  7.656   1.00 0.00 ? 73  PRO A HG2  8  
ATOM 10985 H HG3  . PRO A 1 43 ? 13.286  -2.969  6.137   1.00 0.00 ? 73  PRO A HG3  8  
ATOM 10986 H HD2  . PRO A 1 43 ? 11.139  -2.756  8.194   1.00 0.00 ? 73  PRO A HD2  8  
ATOM 10987 H HD3  . PRO A 1 43 ? 11.852  -1.495  7.169   1.00 0.00 ? 73  PRO A HD3  8  
ATOM 10988 N N    . GLY A 1 44 ? 8.837   -5.021  6.374   1.00 0.00 ? 74  GLY A N    8  
ATOM 10989 C CA   . GLY A 1 44 ? 7.691   -5.908  6.402   1.00 0.00 ? 74  GLY A CA   8  
ATOM 10990 C C    . GLY A 1 44 ? 6.527   -5.376  5.589   1.00 0.00 ? 74  GLY A C    8  
ATOM 10991 O O    . GLY A 1 44 ? 5.811   -6.140  4.943   1.00 0.00 ? 74  GLY A O    8  
ATOM 10992 H H    . GLY A 1 44 ? 9.101   -4.539  7.186   1.00 0.00 ? 74  GLY A H    8  
ATOM 10993 H HA2  . GLY A 1 44 ? 7.982   -6.870  6.005   1.00 0.00 ? 74  GLY A HA2  8  
ATOM 10994 H HA3  . GLY A 1 44 ? 7.371   -6.036  7.426   1.00 0.00 ? 74  GLY A HA3  8  
ATOM 10995 N N    . VAL A 1 45 ? 6.339   -4.060  5.621   1.00 0.00 ? 75  VAL A N    8  
ATOM 10996 C CA   . VAL A 1 45 ? 5.255   -3.426  4.881   1.00 0.00 ? 75  VAL A CA   8  
ATOM 10997 C C    . VAL A 1 45 ? 5.414   -3.646  3.381   1.00 0.00 ? 75  VAL A C    8  
ATOM 10998 O O    . VAL A 1 45 ? 4.474   -4.060  2.701   1.00 0.00 ? 75  VAL A O    8  
ATOM 10999 C CB   . VAL A 1 45 ? 5.192   -1.912  5.163   1.00 0.00 ? 75  VAL A CB   8  
ATOM 11000 C CG1  . VAL A 1 45 ? 3.964   -1.296  4.508   1.00 0.00 ? 75  VAL A CG1  8  
ATOM 11001 C CG2  . VAL A 1 45 ? 5.196   -1.645  6.662   1.00 0.00 ? 75  VAL A CG2  8  
ATOM 11002 H H    . VAL A 1 45 ? 6.944   -3.505  6.154   1.00 0.00 ? 75  VAL A H    8  
ATOM 11003 H HA   . VAL A 1 45 ? 4.325   -3.870  5.205   1.00 0.00 ? 75  VAL A HA   8  
ATOM 11004 H HB   . VAL A 1 45 ? 6.069   -1.451  4.735   1.00 0.00 ? 75  VAL A HB   8  
ATOM 11005 H HG11 . VAL A 1 45 ? 4.222   -0.329  4.100   1.00 0.00 ? 75  VAL A HG11 8  
ATOM 11006 H HG12 . VAL A 1 45 ? 3.184   -1.179  5.246   1.00 0.00 ? 75  VAL A HG12 8  
ATOM 11007 H HG13 . VAL A 1 45 ? 3.617   -1.941  3.715   1.00 0.00 ? 75  VAL A HG13 8  
ATOM 11008 H HG21 . VAL A 1 45 ? 4.195   -1.403  6.987   1.00 0.00 ? 75  VAL A HG21 8  
ATOM 11009 H HG22 . VAL A 1 45 ? 5.855   -0.817  6.878   1.00 0.00 ? 75  VAL A HG22 8  
ATOM 11010 H HG23 . VAL A 1 45 ? 5.541   -2.525  7.184   1.00 0.00 ? 75  VAL A HG23 8  
ATOM 11011 N N    . ILE A 1 46 ? 6.608   -3.367  2.870   1.00 0.00 ? 76  ILE A N    8  
ATOM 11012 C CA   . ILE A 1 46 ? 6.890   -3.535  1.449   1.00 0.00 ? 76  ILE A CA   8  
ATOM 11013 C C    . ILE A 1 46 ? 6.694   -4.986  1.022   1.00 0.00 ? 76  ILE A C    8  
ATOM 11014 O O    . ILE A 1 46 ? 6.110   -5.261  -0.025  1.00 0.00 ? 76  ILE A O    8  
ATOM 11015 C CB   . ILE A 1 46 ? 8.327   -3.098  1.104   1.00 0.00 ? 76  ILE A CB   8  
ATOM 11016 C CG1  . ILE A 1 46 ? 8.606   -1.698  1.654   1.00 0.00 ? 76  ILE A CG1  8  
ATOM 11017 C CG2  . ILE A 1 46 ? 8.547   -3.136  -0.401  1.00 0.00 ? 76  ILE A CG2  8  
ATOM 11018 C CD1  . ILE A 1 46 ? 9.964   -1.566  2.309   1.00 0.00 ? 76  ILE A CD1  8  
ATOM 11019 H H    . ILE A 1 46 ? 7.318   -3.041  3.462   1.00 0.00 ? 76  ILE A H    8  
ATOM 11020 H HA   . ILE A 1 46 ? 6.203   -2.912  0.897   1.00 0.00 ? 76  ILE A HA   8  
ATOM 11021 H HB   . ILE A 1 46 ? 9.012   -3.799  1.559   1.00 0.00 ? 76  ILE A HB   8  
ATOM 11022 H HG12 . ILE A 1 46 ? 8.559   -0.984  0.846   1.00 0.00 ? 76  ILE A HG12 8  
ATOM 11023 H HG13 . ILE A 1 46 ? 7.856   -1.450  2.391   1.00 0.00 ? 76  ILE A HG13 8  
ATOM 11024 H HG21 . ILE A 1 46 ? 7.774   -2.562  -0.891  1.00 0.00 ? 76  ILE A HG21 8  
ATOM 11025 H HG22 . ILE A 1 46 ? 8.508   -4.158  -0.746  1.00 0.00 ? 76  ILE A HG22 8  
ATOM 11026 H HG23 . ILE A 1 46 ? 9.512   -2.713  -0.635  1.00 0.00 ? 76  ILE A HG23 8  
ATOM 11027 H HD11 . ILE A 1 46 ? 9.867   -1.010  3.231   1.00 0.00 ? 76  ILE A HD11 8  
ATOM 11028 H HD12 . ILE A 1 46 ? 10.636  -1.045  1.644   1.00 0.00 ? 76  ILE A HD12 8  
ATOM 11029 H HD13 . ILE A 1 46 ? 10.358  -2.549  2.522   1.00 0.00 ? 76  ILE A HD13 8  
ATOM 11030 N N    . ARG A 1 47 ? 7.186   -5.910  1.841   1.00 0.00 ? 77  ARG A N    8  
ATOM 11031 C CA   . ARG A 1 47 ? 7.063   -7.333  1.548   1.00 0.00 ? 77  ARG A CA   8  
ATOM 11032 C C    . ARG A 1 47 ? 5.597   -7.745  1.464   1.00 0.00 ? 77  ARG A C    8  
ATOM 11033 O O    . ARG A 1 47 ? 5.197   -8.472  0.555   1.00 0.00 ? 77  ARG A O    8  
ATOM 11034 C CB   . ARG A 1 47 ? 7.778   -8.159  2.618   1.00 0.00 ? 77  ARG A CB   8  
ATOM 11035 C CG   . ARG A 1 47 ? 8.311   -9.488  2.105   1.00 0.00 ? 77  ARG A CG   8  
ATOM 11036 C CD   . ARG A 1 47 ? 7.409   -10.644 2.505   1.00 0.00 ? 77  ARG A CD   8  
ATOM 11037 N NE   . ARG A 1 47 ? 8.172   -11.839 2.853   1.00 0.00 ? 77  ARG A NE   8  
ATOM 11038 C CZ   . ARG A 1 47 ? 8.863   -11.975 3.984   1.00 0.00 ? 77  ARG A CZ   8  
ATOM 11039 N NH1  . ARG A 1 47 ? 8.888   -10.992 4.875   1.00 0.00 ? 77  ARG A NH1  8  
ATOM 11040 N NH2  . ARG A 1 47 ? 9.531   -13.096 4.222   1.00 0.00 ? 77  ARG A NH2  8  
ATOM 11041 H H    . ARG A 1 47 ? 7.640   -5.629  2.662   1.00 0.00 ? 77  ARG A H    8  
ATOM 11042 H HA   . ARG A 1 47 ? 7.531   -7.516  0.592   1.00 0.00 ? 77  ARG A HA   8  
ATOM 11043 H HB2  . ARG A 1 47 ? 8.610   -7.588  3.002   1.00 0.00 ? 77  ARG A HB2  8  
ATOM 11044 H HB3  . ARG A 1 47 ? 7.088   -8.360  3.423   1.00 0.00 ? 77  ARG A HB3  8  
ATOM 11045 H HG2  . ARG A 1 47 ? 8.373   -9.448  1.028   1.00 0.00 ? 77  ARG A HG2  8  
ATOM 11046 H HG3  . ARG A 1 47 ? 9.296   -9.652  2.518   1.00 0.00 ? 77  ARG A HG3  8  
ATOM 11047 H HD2  . ARG A 1 47 ? 6.818   -10.345 3.357   1.00 0.00 ? 77  ARG A HD2  8  
ATOM 11048 H HD3  . ARG A 1 47 ? 6.754   -10.875 1.677   1.00 0.00 ? 77  ARG A HD3  8  
ATOM 11049 H HE   . ARG A 1 47 ? 8.170   -12.581 2.212   1.00 0.00 ? 77  ARG A HE   8  
ATOM 11050 H HH11 . ARG A 1 47 ? 8.387   -10.145 4.702   1.00 0.00 ? 77  ARG A HH11 8  
ATOM 11051 H HH12 . ARG A 1 47 ? 9.409   -11.100 5.722   1.00 0.00 ? 77  ARG A HH12 8  
ATOM 11052 H HH21 . ARG A 1 47 ? 9.514   -13.839 3.553   1.00 0.00 ? 77  ARG A HH21 8  
ATOM 11053 H HH22 . ARG A 1 47 ? 10.051  -13.197 5.070   1.00 0.00 ? 77  ARG A HH22 8  
ATOM 11054 N N    . ARG A 1 48 ? 4.801   -7.273  2.418   1.00 0.00 ? 78  ARG A N    8  
ATOM 11055 C CA   . ARG A 1 48 ? 3.378   -7.591  2.451   1.00 0.00 ? 78  ARG A CA   8  
ATOM 11056 C C    . ARG A 1 48 ? 2.685   -7.115  1.179   1.00 0.00 ? 78  ARG A C    8  
ATOM 11057 O O    . ARG A 1 48 ? 1.974   -7.877  0.523   1.00 0.00 ? 78  ARG A O    8  
ATOM 11058 C CB   . ARG A 1 48 ? 2.718   -6.952  3.675   1.00 0.00 ? 78  ARG A CB   8  
ATOM 11059 C CG   . ARG A 1 48 ? 3.292   -7.435  4.997   1.00 0.00 ? 78  ARG A CG   8  
ATOM 11060 C CD   . ARG A 1 48 ? 2.235   -8.111  5.855   1.00 0.00 ? 78  ARG A CD   8  
ATOM 11061 N NE   . ARG A 1 48 ? 1.603   -9.232  5.163   1.00 0.00 ? 78  ARG A NE   8  
ATOM 11062 C CZ   . ARG A 1 48 ? 0.502   -9.844  5.595   1.00 0.00 ? 78  ARG A CZ   8  
ATOM 11063 N NH1  . ARG A 1 48 ? -0.091  -9.448  6.714   1.00 0.00 ? 78  ARG A NH1  8  
ATOM 11064 N NH2  . ARG A 1 48 ? -0.008  -10.855 4.905   1.00 0.00 ? 78  ARG A NH2  8  
ATOM 11065 H H    . ARG A 1 48 ? 5.177   -6.697  3.115   1.00 0.00 ? 78  ARG A H    8  
ATOM 11066 H HA   . ARG A 1 48 ? 3.279   -8.665  2.520   1.00 0.00 ? 78  ARG A HA   8  
ATOM 11067 H HB2  . ARG A 1 48 ? 2.847   -5.882  3.620   1.00 0.00 ? 78  ARG A HB2  8  
ATOM 11068 H HB3  . ARG A 1 48 ? 1.662   -7.180  3.660   1.00 0.00 ? 78  ARG A HB3  8  
ATOM 11069 H HG2  . ARG A 1 48 ? 4.084   -8.142  4.798   1.00 0.00 ? 78  ARG A HG2  8  
ATOM 11070 H HG3  . ARG A 1 48 ? 3.692   -6.588  5.536   1.00 0.00 ? 78  ARG A HG3  8  
ATOM 11071 H HD2  . ARG A 1 48 ? 2.701   -8.475  6.759   1.00 0.00 ? 78  ARG A HD2  8  
ATOM 11072 H HD3  . ARG A 1 48 ? 1.478   -7.384  6.110   1.00 0.00 ? 78  ARG A HD3  8  
ATOM 11073 H HE   . ARG A 1 48 ? 2.019   -9.545  4.333   1.00 0.00 ? 78  ARG A HE   8  
ATOM 11074 H HH11 . ARG A 1 48 ? 0.288   -8.685  7.239   1.00 0.00 ? 78  ARG A HH11 8  
ATOM 11075 H HH12 . ARG A 1 48 ? -0.918  -9.911  7.033   1.00 0.00 ? 78  ARG A HH12 8  
ATOM 11076 H HH21 . ARG A 1 48 ? 0.435   -11.158 4.060   1.00 0.00 ? 78  ARG A HH21 8  
ATOM 11077 H HH22 . ARG A 1 48 ? -0.834  -11.315 5.228   1.00 0.00 ? 78  ARG A HH22 8  
ATOM 11078 N N    . VAL A 1 49 ? 2.899   -5.849  0.833   1.00 0.00 ? 79  VAL A N    8  
ATOM 11079 C CA   . VAL A 1 49 ? 2.297   -5.274  -0.363  1.00 0.00 ? 79  VAL A CA   8  
ATOM 11080 C C    . VAL A 1 49 ? 2.783   -5.991  -1.618  1.00 0.00 ? 79  VAL A C    8  
ATOM 11081 O O    . VAL A 1 49 ? 1.999   -6.285  -2.521  1.00 0.00 ? 79  VAL A O    8  
ATOM 11082 C CB   . VAL A 1 49 ? 2.614   -3.769  -0.485  1.00 0.00 ? 79  VAL A CB   8  
ATOM 11083 C CG1  . VAL A 1 49 ? 1.912   -3.169  -1.695  1.00 0.00 ? 79  VAL A CG1  8  
ATOM 11084 C CG2  . VAL A 1 49 ? 2.218   -3.035  0.788   1.00 0.00 ? 79  VAL A CG2  8  
ATOM 11085 H H    . VAL A 1 49 ? 3.476   -5.291  1.394   1.00 0.00 ? 79  VAL A H    8  
ATOM 11086 H HA   . VAL A 1 49 ? 1.225   -5.390  -0.286  1.00 0.00 ? 79  VAL A HA   8  
ATOM 11087 H HB   . VAL A 1 49 ? 3.679   -3.657  -0.624  1.00 0.00 ? 79  VAL A HB   8  
ATOM 11088 H HG11 . VAL A 1 49 ? 1.502   -2.204  -1.434  1.00 0.00 ? 79  VAL A HG11 8  
ATOM 11089 H HG12 . VAL A 1 49 ? 1.114   -3.825  -2.011  1.00 0.00 ? 79  VAL A HG12 8  
ATOM 11090 H HG13 . VAL A 1 49 ? 2.621   -3.051  -2.501  1.00 0.00 ? 79  VAL A HG13 8  
ATOM 11091 H HG21 . VAL A 1 49 ? 3.097   -2.866  1.393   1.00 0.00 ? 79  VAL A HG21 8  
ATOM 11092 H HG22 . VAL A 1 49 ? 1.509   -3.633  1.343   1.00 0.00 ? 79  VAL A HG22 8  
ATOM 11093 H HG23 . VAL A 1 49 ? 1.768   -2.087  0.533   1.00 0.00 ? 79  VAL A HG23 8  
ATOM 11094 N N    . SER A 1 50 ? 4.082   -6.270  -1.669  1.00 0.00 ? 80  SER A N    8  
ATOM 11095 C CA   . SER A 1 50 ? 4.671   -6.953  -2.814  1.00 0.00 ? 80  SER A CA   8  
ATOM 11096 C C    . SER A 1 50 ? 4.076   -8.347  -2.989  1.00 0.00 ? 80  SER A C    8  
ATOM 11097 O O    . SER A 1 50 ? 4.096   -8.909  -4.083  1.00 0.00 ? 80  SER A O    8  
ATOM 11098 C CB   . SER A 1 50 ? 6.190   -7.052  -2.652  1.00 0.00 ? 80  SER A CB   8  
ATOM 11099 O OG   . SER A 1 50 ? 6.847   -6.903  -3.899  1.00 0.00 ? 80  SER A OG   8  
ATOM 11100 H H    . SER A 1 50 ? 4.656   -6.010  -0.919  1.00 0.00 ? 80  SER A H    8  
ATOM 11101 H HA   . SER A 1 50 ? 4.450   -6.372  -3.693  1.00 0.00 ? 80  SER A HA   8  
ATOM 11102 H HB2  . SER A 1 50 ? 6.529   -6.273  -1.985  1.00 0.00 ? 80  SER A HB2  8  
ATOM 11103 H HB3  . SER A 1 50 ? 6.444   -8.016  -2.238  1.00 0.00 ? 80  SER A HB3  8  
ATOM 11104 H HG   . SER A 1 50 ? 7.735   -7.262  -3.838  1.00 0.00 ? 80  SER A HG   8  
ATOM 11105 N N    . GLN A 1 51 ? 3.544   -8.897  -1.904  1.00 0.00 ? 81  GLN A N    8  
ATOM 11106 C CA   . GLN A 1 51 ? 2.940   -10.224 -1.936  1.00 0.00 ? 81  GLN A CA   8  
ATOM 11107 C C    . GLN A 1 51 ? 1.497   -10.152 -2.425  1.00 0.00 ? 81  GLN A C    8  
ATOM 11108 O O    . GLN A 1 51 ? 1.078   -10.936 -3.276  1.00 0.00 ? 81  GLN A O    8  
ATOM 11109 C CB   . GLN A 1 51 ? 2.991   -10.866 -0.547  1.00 0.00 ? 81  GLN A CB   8  
ATOM 11110 C CG   . GLN A 1 51 ? 3.370   -12.337 -0.572  1.00 0.00 ? 81  GLN A CG   8  
ATOM 11111 C CD   . GLN A 1 51 ? 4.628   -12.631 0.222   1.00 0.00 ? 81  GLN A CD   8  
ATOM 11112 O OE1  . GLN A 1 51 ? 4.563   -12.985 1.400   1.00 0.00 ? 81  GLN A OE1  8  
ATOM 11113 N NE2  . GLN A 1 51 ? 5.780   -12.486 -0.420  1.00 0.00 ? 81  GLN A NE2  8  
ATOM 11114 H H    . GLN A 1 51 ? 3.558   -8.399  -1.062  1.00 0.00 ? 81  GLN A H    8  
ATOM 11115 H HA   . GLN A 1 51 ? 3.510   -10.830 -2.624  1.00 0.00 ? 81  GLN A HA   8  
ATOM 11116 H HB2  . GLN A 1 51 ? 3.718   -10.338 0.053   1.00 0.00 ? 81  GLN A HB2  8  
ATOM 11117 H HB3  . GLN A 1 51 ? 2.021   -10.773 -0.085  1.00 0.00 ? 81  GLN A HB3  8  
ATOM 11118 H HG2  . GLN A 1 51 ? 2.557   -12.912 -0.154  1.00 0.00 ? 81  GLN A HG2  8  
ATOM 11119 H HG3  . GLN A 1 51 ? 3.530   -12.638 -1.597  1.00 0.00 ? 81  GLN A HG3  8  
ATOM 11120 H HE21 . GLN A 1 51 ? 5.756   -12.201 -1.357  1.00 0.00 ? 81  GLN A HE21 8  
ATOM 11121 H HE22 . GLN A 1 51 ? 6.609   -12.670 0.070   1.00 0.00 ? 81  GLN A HE22 8  
ATOM 11122 N N    . LEU A 1 52 ? 0.741   -9.203  -1.881  1.00 0.00 ? 82  LEU A N    8  
ATOM 11123 C CA   . LEU A 1 52 ? -0.656  -9.027  -2.261  1.00 0.00 ? 82  LEU A CA   8  
ATOM 11124 C C    . LEU A 1 52 ? -0.777  -8.708  -3.749  1.00 0.00 ? 82  LEU A C    8  
ATOM 11125 O O    . LEU A 1 52 ? -1.729  -9.125  -4.409  1.00 0.00 ? 82  LEU A O    8  
ATOM 11126 C CB   . LEU A 1 52 ? -1.293  -7.909  -1.431  1.00 0.00 ? 82  LEU A CB   8  
ATOM 11127 C CG   . LEU A 1 52 ? -2.637  -8.264  -0.792  1.00 0.00 ? 82  LEU A CG   8  
ATOM 11128 C CD1  . LEU A 1 52 ? -2.447  -9.284  0.320   1.00 0.00 ? 82  LEU A CD1  8  
ATOM 11129 C CD2  . LEU A 1 52 ? -3.320  -7.012  -0.259  1.00 0.00 ? 82  LEU A CD2  8  
ATOM 11130 H H    . LEU A 1 52 ? 1.132   -8.608  -1.208  1.00 0.00 ? 82  LEU A H    8  
ATOM 11131 H HA   . LEU A 1 52 ? -1.174  -9.952  -2.061  1.00 0.00 ? 82  LEU A HA   8  
ATOM 11132 H HB2  . LEU A 1 52 ? -0.605  -7.639  -0.643  1.00 0.00 ? 82  LEU A HB2  8  
ATOM 11133 H HB3  . LEU A 1 52 ? -1.439  -7.050  -2.068  1.00 0.00 ? 82  LEU A HB3  8  
ATOM 11134 H HG   . LEU A 1 52 ? -3.280  -8.703  -1.542  1.00 0.00 ? 82  LEU A HG   8  
ATOM 11135 H HD11 . LEU A 1 52 ? -3.281  -9.971  0.325   1.00 0.00 ? 82  LEU A HD11 8  
ATOM 11136 H HD12 . LEU A 1 52 ? -2.395  -8.775  1.271   1.00 0.00 ? 82  LEU A HD12 8  
ATOM 11137 H HD13 . LEU A 1 52 ? -1.531  -9.831  0.153   1.00 0.00 ? 82  LEU A HD13 8  
ATOM 11138 H HD21 . LEU A 1 52 ? -4.252  -7.284  0.212   1.00 0.00 ? 82  LEU A HD21 8  
ATOM 11139 H HD22 . LEU A 1 52 ? -3.514  -6.332  -1.076  1.00 0.00 ? 82  LEU A HD22 8  
ATOM 11140 H HD23 . LEU A 1 52 ? -2.677  -6.532  0.464   1.00 0.00 ? 82  LEU A HD23 8  
ATOM 11141 N N    . PHE A 1 53 ? 0.195   -7.966  -4.270  1.00 0.00 ? 83  PHE A N    8  
ATOM 11142 C CA   . PHE A 1 53 ? 0.200   -7.589  -5.679  1.00 0.00 ? 83  PHE A CA   8  
ATOM 11143 C C    . PHE A 1 53 ? 1.260   -8.375  -6.447  1.00 0.00 ? 83  PHE A C    8  
ATOM 11144 O O    . PHE A 1 53 ? 2.107   -7.796  -7.129  1.00 0.00 ? 83  PHE A O    8  
ATOM 11145 C CB   . PHE A 1 53 ? 0.455   -6.087  -5.824  1.00 0.00 ? 83  PHE A CB   8  
ATOM 11146 C CG   . PHE A 1 53 ? -0.420  -5.233  -4.947  1.00 0.00 ? 83  PHE A CG   8  
ATOM 11147 C CD1  . PHE A 1 53 ? -1.731  -5.600  -4.679  1.00 0.00 ? 83  PHE A CD1  8  
ATOM 11148 C CD2  . PHE A 1 53 ? 0.069   -4.062  -4.392  1.00 0.00 ? 83  PHE A CD2  8  
ATOM 11149 C CE1  . PHE A 1 53 ? -2.534  -4.813  -3.874  1.00 0.00 ? 83  PHE A CE1  8  
ATOM 11150 C CE2  . PHE A 1 53 ? -0.729  -3.273  -3.587  1.00 0.00 ? 83  PHE A CE2  8  
ATOM 11151 C CZ   . PHE A 1 53 ? -2.032  -3.649  -3.327  1.00 0.00 ? 83  PHE A CZ   8  
ATOM 11152 H H    . PHE A 1 53 ? 0.927   -7.664  -3.692  1.00 0.00 ? 83  PHE A H    8  
ATOM 11153 H HA   . PHE A 1 53 ? -0.772  -7.823  -6.090  1.00 0.00 ? 83  PHE A HA   8  
ATOM 11154 H HB2  . PHE A 1 53 ? 1.483   -5.878  -5.568  1.00 0.00 ? 83  PHE A HB2  8  
ATOM 11155 H HB3  . PHE A 1 53 ? 0.281   -5.797  -6.850  1.00 0.00 ? 83  PHE A HB3  8  
ATOM 11156 H HD1  . PHE A 1 53 ? -2.124  -6.511  -5.105  1.00 0.00 ? 83  PHE A HD1  8  
ATOM 11157 H HD2  . PHE A 1 53 ? 1.088   -3.766  -4.593  1.00 0.00 ? 83  PHE A HD2  8  
ATOM 11158 H HE1  . PHE A 1 53 ? -3.553  -5.110  -3.674  1.00 0.00 ? 83  PHE A HE1  8  
ATOM 11159 H HE2  . PHE A 1 53 ? -0.335  -2.362  -3.160  1.00 0.00 ? 83  PHE A HE2  8  
ATOM 11160 H HZ   . PHE A 1 53 ? -2.658  -3.033  -2.699  1.00 0.00 ? 83  PHE A HZ   8  
ATOM 11161 N N    . HIS A 1 54 ? 1.209   -9.698  -6.330  1.00 0.00 ? 84  HIS A N    8  
ATOM 11162 C CA   . HIS A 1 54 ? 2.165   -10.564 -7.011  1.00 0.00 ? 84  HIS A CA   8  
ATOM 11163 C C    . HIS A 1 54 ? 2.063   -10.412 -8.526  1.00 0.00 ? 84  HIS A C    8  
ATOM 11164 O O    . HIS A 1 54 ? 3.043   -10.083 -9.194  1.00 0.00 ? 84  HIS A O    8  
ATOM 11165 C CB   . HIS A 1 54 ? 1.935   -12.024 -6.617  1.00 0.00 ? 84  HIS A CB   8  
ATOM 11166 C CG   . HIS A 1 54 ? 3.135   -12.894 -6.822  1.00 0.00 ? 84  HIS A CG   8  
ATOM 11167 N ND1  . HIS A 1 54 ? 3.904   -13.376 -5.782  1.00 0.00 ? 84  HIS A ND1  8  
ATOM 11168 C CD2  . HIS A 1 54 ? 3.701   -13.370 -7.957  1.00 0.00 ? 84  HIS A CD2  8  
ATOM 11169 C CE1  . HIS A 1 54 ? 4.889   -14.108 -6.268  1.00 0.00 ? 84  HIS A CE1  8  
ATOM 11170 N NE2  . HIS A 1 54 ? 4.789   -14.121 -7.584  1.00 0.00 ? 84  HIS A NE2  8  
ATOM 11171 H H    . HIS A 1 54 ? 0.512   -10.102 -5.772  1.00 0.00 ? 84  HIS A H    8  
ATOM 11172 H HA   . HIS A 1 54 ? 3.156   -10.270 -6.700  1.00 0.00 ? 84  HIS A HA   8  
ATOM 11173 H HB2  . HIS A 1 54 ? 1.666   -12.069 -5.572  1.00 0.00 ? 84  HIS A HB2  8  
ATOM 11174 H HB3  . HIS A 1 54 ? 1.125   -12.426 -7.210  1.00 0.00 ? 84  HIS A HB3  8  
ATOM 11175 H HD1  . HIS A 1 54 ? 3.748   -13.205 -4.830  1.00 0.00 ? 84  HIS A HD1  8  
ATOM 11176 H HD2  . HIS A 1 54 ? 3.360   -13.192 -8.966  1.00 0.00 ? 84  HIS A HD2  8  
ATOM 11177 H HE1  . HIS A 1 54 ? 5.648   -14.611 -5.687  1.00 0.00 ? 84  HIS A HE1  8  
ATOM 11178 H HE2  . HIS A 1 54 ? 5.439   -14.525 -8.196  1.00 0.00 ? 84  HIS A HE2  8  
ATOM 11179 N N    . GLU A 1 55 ? 0.871   -10.655 -9.063  1.00 0.00 ? 85  GLU A N    8  
ATOM 11180 C CA   . GLU A 1 55 ? 0.644   -10.548 -10.500 1.00 0.00 ? 85  GLU A CA   8  
ATOM 11181 C C    . GLU A 1 55 ? -0.033  -9.225  -10.852 1.00 0.00 ? 85  GLU A C    8  
ATOM 11182 O O    . GLU A 1 55 ? -0.739  -9.128  -11.856 1.00 0.00 ? 85  GLU A O    8  
ATOM 11183 C CB   . GLU A 1 55 ? -0.214  -11.716 -10.990 1.00 0.00 ? 85  GLU A CB   8  
ATOM 11184 C CG   . GLU A 1 55 ? 0.598   -12.895 -11.501 1.00 0.00 ? 85  GLU A CG   8  
ATOM 11185 C CD   . GLU A 1 55 ? -0.028  -13.549 -12.716 1.00 0.00 ? 85  GLU A CD   8  
ATOM 11186 O OE1  . GLU A 1 55 ? -0.873  -14.451 -12.537 1.00 0.00 ? 85  GLU A OE1  8  
ATOM 11187 O OE2  . GLU A 1 55 ? 0.326   -13.160 -13.849 1.00 0.00 ? 85  GLU A OE2  8  
ATOM 11188 H H    . GLU A 1 55 ? 0.127   -10.915 -8.479  1.00 0.00 ? 85  GLU A H    8  
ATOM 11189 H HA   . GLU A 1 55 ? 1.604   -10.588 -10.991 1.00 0.00 ? 85  GLU A HA   8  
ATOM 11190 H HB2  . GLU A 1 55 ? -0.833  -12.060 -10.175 1.00 0.00 ? 85  GLU A HB2  8  
ATOM 11191 H HB3  . GLU A 1 55 ? -0.850  -11.371 -11.792 1.00 0.00 ? 85  GLU A HB3  8  
ATOM 11192 H HG2  . GLU A 1 55 ? 1.585   -12.549 -11.766 1.00 0.00 ? 85  GLU A HG2  8  
ATOM 11193 H HG3  . GLU A 1 55 ? 0.675   -13.631 -10.713 1.00 0.00 ? 85  GLU A HG3  8  
ATOM 11194 N N    . HIS A 1 56 ? 0.187   -8.210  -10.022 1.00 0.00 ? 86  HIS A N    8  
ATOM 11195 C CA   . HIS A 1 56 ? -0.404  -6.896  -10.249 1.00 0.00 ? 86  HIS A CA   8  
ATOM 11196 C C    . HIS A 1 56 ? 0.671   -5.810  -10.245 1.00 0.00 ? 86  HIS A C    8  
ATOM 11197 O O    . HIS A 1 56 ? 0.981   -5.239  -9.200  1.00 0.00 ? 86  HIS A O    8  
ATOM 11198 C CB   . HIS A 1 56 ? -1.458  -6.592  -9.180  1.00 0.00 ? 86  HIS A CB   8  
ATOM 11199 C CG   . HIS A 1 56 ? -2.305  -7.774  -8.815  1.00 0.00 ? 86  HIS A CG   8  
ATOM 11200 N ND1  . HIS A 1 56 ? -2.781  -7.994  -7.539  1.00 0.00 ? 86  HIS A ND1  8  
ATOM 11201 C CD2  . HIS A 1 56 ? -2.763  -8.803  -9.567  1.00 0.00 ? 86  HIS A CD2  8  
ATOM 11202 C CE1  . HIS A 1 56 ? -3.492  -9.108  -7.522  1.00 0.00 ? 86  HIS A CE1  8  
ATOM 11203 N NE2  . HIS A 1 56 ? -3.497  -9.616  -8.739  1.00 0.00 ? 86  HIS A NE2  8  
ATOM 11204 H H    . HIS A 1 56 ? 0.759   -8.348  -9.239  1.00 0.00 ? 86  HIS A H    8  
ATOM 11205 H HA   . HIS A 1 56 ? -0.881  -6.911  -11.218 1.00 0.00 ? 86  HIS A HA   8  
ATOM 11206 H HB2  . HIS A 1 56 ? -0.964  -6.251  -8.285  1.00 0.00 ? 86  HIS A HB2  8  
ATOM 11207 H HB3  . HIS A 1 56 ? -2.113  -5.813  -9.543  1.00 0.00 ? 86  HIS A HB3  8  
ATOM 11208 H HD1  . HIS A 1 56 ? -2.620  -7.421  -6.762  1.00 0.00 ? 86  HIS A HD1  8  
ATOM 11209 H HD2  . HIS A 1 56 ? -2.583  -8.955  -10.621 1.00 0.00 ? 86  HIS A HD2  8  
ATOM 11210 H HE1  . HIS A 1 56 ? -3.988  -9.528  -6.659  1.00 0.00 ? 86  HIS A HE1  8  
ATOM 11211 H HE2  . HIS A 1 56 ? -4.021  -10.394 -9.023  1.00 0.00 ? 86  HIS A HE2  8  
ATOM 11212 N N    . PRO A 1 57 ? 1.260   -5.512  -11.418 1.00 0.00 ? 87  PRO A N    8  
ATOM 11213 C CA   . PRO A 1 57 ? 2.308   -4.492  -11.540 1.00 0.00 ? 87  PRO A CA   8  
ATOM 11214 C C    . PRO A 1 57 ? 1.799   -3.088  -11.227 1.00 0.00 ? 87  PRO A C    8  
ATOM 11215 O O    . PRO A 1 57 ? 2.388   -2.370  -10.421 1.00 0.00 ? 87  PRO A O    8  
ATOM 11216 C CB   . PRO A 1 57 ? 2.740   -4.588  -13.007 1.00 0.00 ? 87  PRO A CB   8  
ATOM 11217 C CG   . PRO A 1 57 ? 1.585   -5.216  -13.708 1.00 0.00 ? 87  PRO A CG   8  
ATOM 11218 C CD   . PRO A 1 57 ? 0.954   -6.147  -12.713 1.00 0.00 ? 87  PRO A CD   8  
ATOM 11219 H HA   . PRO A 1 57 ? 3.149   -4.715  -10.902 1.00 0.00 ? 87  PRO A HA   8  
ATOM 11220 H HB2  . PRO A 1 57 ? 2.943   -3.597  -13.390 1.00 0.00 ? 87  PRO A HB2  8  
ATOM 11221 H HB3  . PRO A 1 57 ? 3.627   -5.198  -13.085 1.00 0.00 ? 87  PRO A HB3  8  
ATOM 11222 H HG2  . PRO A 1 57 ? 0.879   -4.455  -14.010 1.00 0.00 ? 87  PRO A HG2  8  
ATOM 11223 H HG3  . PRO A 1 57 ? 1.934   -5.767  -14.569 1.00 0.00 ? 87  PRO A HG3  8  
ATOM 11224 H HD2  . PRO A 1 57 ? -0.112  -6.205  -12.874 1.00 0.00 ? 87  PRO A HD2  8  
ATOM 11225 H HD3  . PRO A 1 57 ? 1.402   -7.128  -12.777 1.00 0.00 ? 87  PRO A HD3  8  
ATOM 11226 N N    . ASP A 1 58 ? 0.700   -2.702  -11.869 1.00 0.00 ? 88  ASP A N    8  
ATOM 11227 C CA   . ASP A 1 58 ? 0.112   -1.381  -11.661 1.00 0.00 ? 88  ASP A CA   8  
ATOM 11228 C C    . ASP A 1 58 ? -0.131  -1.103  -10.177 1.00 0.00 ? 88  ASP A C    8  
ATOM 11229 O O    . ASP A 1 58 ? -0.229  0.051   -9.762  1.00 0.00 ? 88  ASP A O    8  
ATOM 11230 C CB   . ASP A 1 58 ? -1.203  -1.260  -12.433 1.00 0.00 ? 88  ASP A CB   8  
ATOM 11231 C CG   . ASP A 1 58 ? -2.199  -2.339  -12.053 1.00 0.00 ? 88  ASP A CG   8  
ATOM 11232 O OD1  . ASP A 1 58 ? -2.742  -2.276  -10.931 1.00 0.00 ? 88  ASP A OD1  8  
ATOM 11233 O OD2  . ASP A 1 58 ? -2.435  -3.245  -12.879 1.00 0.00 ? 88  ASP A OD2  8  
ATOM 11234 H H    . ASP A 1 58 ? 0.274   -3.320  -12.500 1.00 0.00 ? 88  ASP A H    8  
ATOM 11235 H HA   . ASP A 1 58 ? 0.806   -0.647  -12.040 1.00 0.00 ? 88  ASP A HA   8  
ATOM 11236 H HB2  . ASP A 1 58 ? -1.648  -0.298  -12.226 1.00 0.00 ? 88  ASP A HB2  8  
ATOM 11237 H HB3  . ASP A 1 58 ? -1.000  -1.339  -13.491 1.00 0.00 ? 88  ASP A HB3  8  
ATOM 11238 N N    . LEU A 1 59 ? -0.225  -2.165  -9.381  1.00 0.00 ? 89  LEU A N    8  
ATOM 11239 C CA   . LEU A 1 59 ? -0.451  -2.027  -7.949  1.00 0.00 ? 89  LEU A CA   8  
ATOM 11240 C C    . LEU A 1 59 ? 0.869   -1.818  -7.220  1.00 0.00 ? 89  LEU A C    8  
ATOM 11241 O O    . LEU A 1 59 ? 1.064   -0.807  -6.546  1.00 0.00 ? 89  LEU A O    8  
ATOM 11242 C CB   . LEU A 1 59 ? -1.167  -3.263  -7.400  1.00 0.00 ? 89  LEU A CB   8  
ATOM 11243 C CG   . LEU A 1 59 ? -2.538  -3.545  -8.017  1.00 0.00 ? 89  LEU A CG   8  
ATOM 11244 C CD1  . LEU A 1 59 ? -3.192  -4.739  -7.341  1.00 0.00 ? 89  LEU A CD1  8  
ATOM 11245 C CD2  . LEU A 1 59 ? -3.432  -2.317  -7.914  1.00 0.00 ? 89  LEU A CD2  8  
ATOM 11246 H H    . LEU A 1 59 ? -0.132  -3.059  -9.765  1.00 0.00 ? 89  LEU A H    8  
ATOM 11247 H HA   . LEU A 1 59 ? -1.077  -1.159  -7.794  1.00 0.00 ? 89  LEU A HA   8  
ATOM 11248 H HB2  . LEU A 1 59 ? -0.535  -4.123  -7.569  1.00 0.00 ? 89  LEU A HB2  8  
ATOM 11249 H HB3  . LEU A 1 59 ? -1.296  -3.136  -6.336  1.00 0.00 ? 89  LEU A HB3  8  
ATOM 11250 H HG   . LEU A 1 59 ? -2.413  -3.781  -9.064  1.00 0.00 ? 89  LEU A HG   8  
ATOM 11251 H HD11 . LEU A 1 59 ? -3.675  -4.418  -6.430  1.00 0.00 ? 89  LEU A HD11 8  
ATOM 11252 H HD12 . LEU A 1 59 ? -2.439  -5.478  -7.108  1.00 0.00 ? 89  LEU A HD12 8  
ATOM 11253 H HD13 . LEU A 1 59 ? -3.927  -5.171  -8.005  1.00 0.00 ? 89  LEU A HD13 8  
ATOM 11254 H HD21 . LEU A 1 59 ? -3.094  -1.566  -8.613  1.00 0.00 ? 89  LEU A HD21 8  
ATOM 11255 H HD22 . LEU A 1 59 ? -3.385  -1.921  -6.910  1.00 0.00 ? 89  LEU A HD22 8  
ATOM 11256 H HD23 . LEU A 1 59 ? -4.450  -2.593  -8.144  1.00 0.00 ? 89  LEU A HD23 8  
ATOM 11257 N N    . ILE A 1 60 ? 1.780   -2.774  -7.373  1.00 0.00 ? 90  ILE A N    8  
ATOM 11258 C CA   . ILE A 1 60 ? 3.087   -2.684  -6.740  1.00 0.00 ? 90  ILE A CA   8  
ATOM 11259 C C    . ILE A 1 60 ? 3.817   -1.427  -7.204  1.00 0.00 ? 90  ILE A C    8  
ATOM 11260 O O    . ILE A 1 60 ? 4.643   -0.871  -6.480  1.00 0.00 ? 90  ILE A O    8  
ATOM 11261 C CB   . ILE A 1 60 ? 3.953   -3.922  -7.052  1.00 0.00 ? 90  ILE A CB   8  
ATOM 11262 C CG1  . ILE A 1 60 ? 5.290   -3.843  -6.311  1.00 0.00 ? 90  ILE A CG1  8  
ATOM 11263 C CG2  . ILE A 1 60 ? 4.179   -4.052  -8.551  1.00 0.00 ? 90  ILE A CG2  8  
ATOM 11264 C CD1  . ILE A 1 60 ? 6.123   -5.100  -6.432  1.00 0.00 ? 90  ILE A CD1  8  
ATOM 11265 H H    . ILE A 1 60 ? 1.570   -3.552  -7.932  1.00 0.00 ? 90  ILE A H    8  
ATOM 11266 H HA   . ILE A 1 60 ? 2.940   -2.630  -5.671  1.00 0.00 ? 90  ILE A HA   8  
ATOM 11267 H HB   . ILE A 1 60 ? 3.417   -4.799  -6.719  1.00 0.00 ? 90  ILE A HB   8  
ATOM 11268 H HG12 . ILE A 1 60 ? 5.868   -3.023  -6.710  1.00 0.00 ? 90  ILE A HG12 8  
ATOM 11269 H HG13 . ILE A 1 60 ? 5.102   -3.668  -5.262  1.00 0.00 ? 90  ILE A HG13 8  
ATOM 11270 H HG21 . ILE A 1 60 ? 4.863   -3.283  -8.879  1.00 0.00 ? 90  ILE A HG21 8  
ATOM 11271 H HG22 . ILE A 1 60 ? 3.237   -3.939  -9.068  1.00 0.00 ? 90  ILE A HG22 8  
ATOM 11272 H HG23 . ILE A 1 60 ? 4.595   -5.024  -8.771  1.00 0.00 ? 90  ILE A HG23 8  
ATOM 11273 H HD11 . ILE A 1 60 ? 6.488   -5.193  -7.445  1.00 0.00 ? 90  ILE A HD11 8  
ATOM 11274 H HD12 . ILE A 1 60 ? 5.516   -5.960  -6.187  1.00 0.00 ? 90  ILE A HD12 8  
ATOM 11275 H HD13 . ILE A 1 60 ? 6.960   -5.045  -5.752  1.00 0.00 ? 90  ILE A HD13 8  
ATOM 11276 N N    . VAL A 1 61 ? 3.496   -0.978  -8.416  1.00 0.00 ? 91  VAL A N    8  
ATOM 11277 C CA   . VAL A 1 61 ? 4.114   0.220   -8.970  1.00 0.00 ? 91  VAL A CA   8  
ATOM 11278 C C    . VAL A 1 61 ? 3.518   1.472   -8.334  1.00 0.00 ? 91  VAL A C    8  
ATOM 11279 O O    . VAL A 1 61 ? 4.244   2.360   -7.887  1.00 0.00 ? 91  VAL A O    8  
ATOM 11280 C CB   . VAL A 1 61 ? 3.941   0.290   -10.503 1.00 0.00 ? 91  VAL A CB   8  
ATOM 11281 C CG1  . VAL A 1 61 ? 4.549   1.571   -11.061 1.00 0.00 ? 91  VAL A CG1  8  
ATOM 11282 C CG2  . VAL A 1 61 ? 4.562   -0.932  -11.162 1.00 0.00 ? 91  VAL A CG2  8  
ATOM 11283 H H    . VAL A 1 61 ? 2.821   -1.460  -8.944  1.00 0.00 ? 91  VAL A H    8  
ATOM 11284 H HA   . VAL A 1 61 ? 5.170   0.183   -8.747  1.00 0.00 ? 91  VAL A HA   8  
ATOM 11285 H HB   . VAL A 1 61 ? 2.885   0.293   -10.725 1.00 0.00 ? 91  VAL A HB   8  
ATOM 11286 H HG11 . VAL A 1 61 ? 5.349   1.325   -11.743 1.00 0.00 ? 91  VAL A HG11 8  
ATOM 11287 H HG12 . VAL A 1 61 ? 4.940   2.169   -10.250 1.00 0.00 ? 91  VAL A HG12 8  
ATOM 11288 H HG13 . VAL A 1 61 ? 3.789   2.131   -11.585 1.00 0.00 ? 91  VAL A HG13 8  
ATOM 11289 H HG21 . VAL A 1 61 ? 3.946   -1.246  -11.991 1.00 0.00 ? 91  VAL A HG21 8  
ATOM 11290 H HG22 . VAL A 1 61 ? 4.634   -1.734  -10.442 1.00 0.00 ? 91  VAL A HG22 8  
ATOM 11291 H HG23 . VAL A 1 61 ? 5.550   -0.683  -11.523 1.00 0.00 ? 91  VAL A HG23 8  
ATOM 11292 N N    . GLY A 1 62 ? 2.190   1.532   -8.291  1.00 0.00 ? 92  GLY A N    8  
ATOM 11293 C CA   . GLY A 1 62 ? 1.521   2.676   -7.700  1.00 0.00 ? 92  GLY A CA   8  
ATOM 11294 C C    . GLY A 1 62 ? 1.911   2.879   -6.251  1.00 0.00 ? 92  GLY A C    8  
ATOM 11295 O O    . GLY A 1 62 ? 2.082   4.011   -5.799  1.00 0.00 ? 92  GLY A O    8  
ATOM 11296 H H    . GLY A 1 62 ? 1.662   0.792   -8.659  1.00 0.00 ? 92  GLY A H    8  
ATOM 11297 H HA2  . GLY A 1 62 ? 1.781   3.562   -8.262  1.00 0.00 ? 92  GLY A HA2  8  
ATOM 11298 H HA3  . GLY A 1 62 ? 0.453   2.524   -7.757  1.00 0.00 ? 92  GLY A HA3  8  
ATOM 11299 N N    . PHE A 1 63 ? 2.056   1.777   -5.521  1.00 0.00 ? 93  PHE A N    8  
ATOM 11300 C CA   . PHE A 1 63 ? 2.431   1.833   -4.116  1.00 0.00 ? 93  PHE A CA   8  
ATOM 11301 C C    . PHE A 1 63 ? 3.894   2.226   -3.962  1.00 0.00 ? 93  PHE A C    8  
ATOM 11302 O O    . PHE A 1 63 ? 4.273   2.899   -3.004  1.00 0.00 ? 93  PHE A O    8  
ATOM 11303 C CB   . PHE A 1 63 ? 2.177   0.484   -3.443  1.00 0.00 ? 93  PHE A CB   8  
ATOM 11304 C CG   . PHE A 1 63 ? 2.399   0.499   -1.957  1.00 0.00 ? 93  PHE A CG   8  
ATOM 11305 C CD1  . PHE A 1 63 ? 3.654   0.245   -1.428  1.00 0.00 ? 93  PHE A CD1  8  
ATOM 11306 C CD2  . PHE A 1 63 ? 1.352   0.766   -1.090  1.00 0.00 ? 93  PHE A CD2  8  
ATOM 11307 C CE1  . PHE A 1 63 ? 3.861   0.258   -0.062  1.00 0.00 ? 93  PHE A CE1  8  
ATOM 11308 C CE2  . PHE A 1 63 ? 1.552   0.780   0.278   1.00 0.00 ? 93  PHE A CE2  8  
ATOM 11309 C CZ   . PHE A 1 63 ? 2.808   0.525   0.792   1.00 0.00 ? 93  PHE A CZ   8  
ATOM 11310 H H    . PHE A 1 63 ? 1.907   0.906   -5.938  1.00 0.00 ? 93  PHE A H    8  
ATOM 11311 H HA   . PHE A 1 63 ? 1.821   2.580   -3.646  1.00 0.00 ? 93  PHE A HA   8  
ATOM 11312 H HB2  . PHE A 1 63 ? 1.155   0.186   -3.622  1.00 0.00 ? 93  PHE A HB2  8  
ATOM 11313 H HB3  . PHE A 1 63 ? 2.841   -0.253  -3.871  1.00 0.00 ? 93  PHE A HB3  8  
ATOM 11314 H HD1  . PHE A 1 63 ? 4.478   0.037   -2.095  1.00 0.00 ? 93  PHE A HD1  8  
ATOM 11315 H HD2  . PHE A 1 63 ? 0.369   0.965   -1.492  1.00 0.00 ? 93  PHE A HD2  8  
ATOM 11316 H HE1  . PHE A 1 63 ? 4.843   0.058   0.339   1.00 0.00 ? 93  PHE A HE1  8  
ATOM 11317 H HE2  . PHE A 1 63 ? 0.727   0.990   0.942   1.00 0.00 ? 93  PHE A HE2  8  
ATOM 11318 H HZ   . PHE A 1 63 ? 2.967   0.536   1.860   1.00 0.00 ? 93  PHE A HZ   8  
ATOM 11319 N N    . ASN A 1 64 ? 4.706   1.798   -4.916  1.00 0.00 ? 94  ASN A N    8  
ATOM 11320 C CA   . ASN A 1 64 ? 6.133   2.099   -4.901  1.00 0.00 ? 94  ASN A CA   8  
ATOM 11321 C C    . ASN A 1 64 ? 6.370   3.602   -4.992  1.00 0.00 ? 94  ASN A C    8  
ATOM 11322 O O    . ASN A 1 64 ? 7.313   4.129   -4.403  1.00 0.00 ? 94  ASN A O    8  
ATOM 11323 C CB   . ASN A 1 64 ? 6.837   1.385   -6.058  1.00 0.00 ? 94  ASN A CB   8  
ATOM 11324 C CG   . ASN A 1 64 ? 8.331   1.650   -6.083  1.00 0.00 ? 94  ASN A CG   8  
ATOM 11325 O OD1  . ASN A 1 64 ? 8.902   1.940   -7.134  1.00 0.00 ? 94  ASN A OD1  8  
ATOM 11326 N ND2  . ASN A 1 64 ? 8.970   1.551   -4.924  1.00 0.00 ? 94  ASN A ND2  8  
ATOM 11327 H H    . ASN A 1 64 ? 4.335   1.267   -5.650  1.00 0.00 ? 94  ASN A H    8  
ATOM 11328 H HA   . ASN A 1 64 ? 6.537   1.738   -3.967  1.00 0.00 ? 94  ASN A HA   8  
ATOM 11329 H HB2  . ASN A 1 64 ? 6.681   0.321   -5.964  1.00 0.00 ? 94  ASN A HB2  8  
ATOM 11330 H HB3  . ASN A 1 64 ? 6.414   1.725   -6.993  1.00 0.00 ? 94  ASN A HB3  8  
ATOM 11331 H HD21 . ASN A 1 64 ? 8.451   1.316   -4.127  1.00 0.00 ? 94  ASN A HD21 8  
ATOM 11332 H HD22 . ASN A 1 64 ? 9.936   1.717   -4.913  1.00 0.00 ? 94  ASN A HD22 8  
ATOM 11333 N N    . ALA A 1 65 ? 5.507   4.288   -5.735  1.00 0.00 ? 95  ALA A N    8  
ATOM 11334 C CA   . ALA A 1 65 ? 5.620   5.732   -5.904  1.00 0.00 ? 95  ALA A CA   8  
ATOM 11335 C C    . ALA A 1 65 ? 5.575   6.452   -4.558  1.00 0.00 ? 95  ALA A C    8  
ATOM 11336 O O    . ALA A 1 65 ? 6.053   7.580   -4.433  1.00 0.00 ? 95  ALA A O    8  
ATOM 11337 C CB   . ALA A 1 65 ? 4.514   6.244   -6.814  1.00 0.00 ? 95  ALA A CB   8  
ATOM 11338 H H    . ALA A 1 65 ? 4.775   3.811   -6.181  1.00 0.00 ? 95  ALA A H    8  
ATOM 11339 H HA   . ALA A 1 65 ? 6.568   5.937   -6.379  1.00 0.00 ? 95  ALA A HA   8  
ATOM 11340 H HB1  . ALA A 1 65 ? 4.806   7.194   -7.237  1.00 0.00 ? 95  ALA A HB1  8  
ATOM 11341 H HB2  . ALA A 1 65 ? 3.606   6.369   -6.243  1.00 0.00 ? 95  ALA A HB2  8  
ATOM 11342 H HB3  . ALA A 1 65 ? 4.345   5.533   -7.608  1.00 0.00 ? 95  ALA A HB3  8  
ATOM 11343 N N    . PHE A 1 66 ? 5.002   5.795   -3.554  1.00 0.00 ? 96  PHE A N    8  
ATOM 11344 C CA   . PHE A 1 66 ? 4.900   6.377   -2.220  1.00 0.00 ? 96  PHE A CA   8  
ATOM 11345 C C    . PHE A 1 66 ? 5.988   5.827   -1.304  1.00 0.00 ? 96  PHE A C    8  
ATOM 11346 O O    . PHE A 1 66 ? 5.797   5.720   -0.092  1.00 0.00 ? 96  PHE A O    8  
ATOM 11347 C CB   . PHE A 1 66 ? 3.521   6.092   -1.620  1.00 0.00 ? 96  PHE A CB   8  
ATOM 11348 C CG   . PHE A 1 66 ? 2.382   6.545   -2.489  1.00 0.00 ? 96  PHE A CG   8  
ATOM 11349 C CD1  . PHE A 1 66 ? 1.960   5.772   -3.558  1.00 0.00 ? 96  PHE A CD1  8  
ATOM 11350 C CD2  . PHE A 1 66 ? 1.733   7.743   -2.234  1.00 0.00 ? 96  PHE A CD2  8  
ATOM 11351 C CE1  . PHE A 1 66 ? 0.911   6.185   -4.358  1.00 0.00 ? 96  PHE A CE1  8  
ATOM 11352 C CE2  . PHE A 1 66 ? 0.684   8.161   -3.031  1.00 0.00 ? 96  PHE A CE2  8  
ATOM 11353 C CZ   . PHE A 1 66 ? 0.273   7.381   -4.094  1.00 0.00 ? 96  PHE A CZ   8  
ATOM 11354 H H    . PHE A 1 66 ? 4.641   4.898   -3.712  1.00 0.00 ? 96  PHE A H    8  
ATOM 11355 H HA   . PHE A 1 66 ? 5.029   7.444   -2.313  1.00 0.00 ? 96  PHE A HA   8  
ATOM 11356 H HB2  . PHE A 1 66 ? 3.417   5.029   -1.464  1.00 0.00 ? 96  PHE A HB2  8  
ATOM 11357 H HB3  . PHE A 1 66 ? 3.439   6.600   -0.671  1.00 0.00 ? 96  PHE A HB3  8  
ATOM 11358 H HD1  . PHE A 1 66 ? 2.458   4.836   -3.764  1.00 0.00 ? 96  PHE A HD1  8  
ATOM 11359 H HD2  . PHE A 1 66 ? 2.055   8.353   -1.404  1.00 0.00 ? 96  PHE A HD2  8  
ATOM 11360 H HE1  . PHE A 1 66 ? 0.592   5.574   -5.189  1.00 0.00 ? 96  PHE A HE1  8  
ATOM 11361 H HE2  . PHE A 1 66 ? 0.187   9.097   -2.822  1.00 0.00 ? 96  PHE A HE2  8  
ATOM 11362 H HZ   . PHE A 1 66 ? -0.546  7.706   -4.718  1.00 0.00 ? 96  PHE A HZ   8  
ATOM 11363 N N    . LEU A 1 67 ? 7.130   5.482   -1.890  1.00 0.00 ? 97  LEU A N    8  
ATOM 11364 C CA   . LEU A 1 67 ? 8.249   4.944   -1.124  1.00 0.00 ? 97  LEU A CA   8  
ATOM 11365 C C    . LEU A 1 67 ? 9.547   5.676   -1.466  1.00 0.00 ? 97  LEU A C    8  
ATOM 11366 O O    . LEU A 1 67 ? 9.920   5.775   -2.635  1.00 0.00 ? 97  LEU A O    8  
ATOM 11367 C CB   . LEU A 1 67 ? 8.409   3.447   -1.399  1.00 0.00 ? 97  LEU A CB   8  
ATOM 11368 C CG   . LEU A 1 67 ? 7.423   2.544   -0.655  1.00 0.00 ? 97  LEU A CG   8  
ATOM 11369 C CD1  . LEU A 1 67 ? 7.502   1.120   -1.184  1.00 0.00 ? 97  LEU A CD1  8  
ATOM 11370 C CD2  . LEU A 1 67 ? 7.695   2.576   0.842   1.00 0.00 ? 97  LEU A CD2  8  
ATOM 11371 H H    . LEU A 1 67 ? 7.223   5.590   -2.859  1.00 0.00 ? 97  LEU A H    8  
ATOM 11372 H HA   . LEU A 1 67 ? 8.030   5.086   -0.077  1.00 0.00 ? 97  LEU A HA   8  
ATOM 11373 H HB2  . LEU A 1 67 ? 8.287   3.284   -2.460  1.00 0.00 ? 97  LEU A HB2  8  
ATOM 11374 H HB3  . LEU A 1 67 ? 9.410   3.156   -1.119  1.00 0.00 ? 97  LEU A HB3  8  
ATOM 11375 H HG   . LEU A 1 67 ? 6.418   2.905   -0.822  1.00 0.00 ? 97  LEU A HG   8  
ATOM 11376 H HD11 . LEU A 1 67 ? 7.008   0.452   -0.494  1.00 0.00 ? 97  LEU A HD11 8  
ATOM 11377 H HD12 . LEU A 1 67 ? 8.539   0.832   -1.285  1.00 0.00 ? 97  LEU A HD12 8  
ATOM 11378 H HD13 . LEU A 1 67 ? 7.018   1.066   -2.147  1.00 0.00 ? 97  LEU A HD13 8  
ATOM 11379 H HD21 . LEU A 1 67 ? 8.295   1.722   1.116   1.00 0.00 ? 97  LEU A HD21 8  
ATOM 11380 H HD22 . LEU A 1 67 ? 6.759   2.545   1.378   1.00 0.00 ? 97  LEU A HD22 8  
ATOM 11381 H HD23 . LEU A 1 67 ? 8.224   3.484   1.092   1.00 0.00 ? 97  LEU A HD23 8  
ATOM 11382 N N    . PRO A 1 68 ? 10.257  6.200   -0.450  1.00 0.00 ? 98  PRO A N    8  
ATOM 11383 C CA   . PRO A 1 68 ? 11.517  6.922   -0.659  1.00 0.00 ? 98  PRO A CA   8  
ATOM 11384 C C    . PRO A 1 68 ? 12.522  6.111   -1.471  1.00 0.00 ? 98  PRO A C    8  
ATOM 11385 O O    . PRO A 1 68 ? 12.264  4.962   -1.827  1.00 0.00 ? 98  PRO A O    8  
ATOM 11386 C CB   . PRO A 1 68 ? 12.041  7.151   0.761   1.00 0.00 ? 98  PRO A CB   8  
ATOM 11387 C CG   . PRO A 1 68 ? 10.828  7.113   1.625   1.00 0.00 ? 98  PRO A CG   8  
ATOM 11388 C CD   . PRO A 1 68 ? 9.892   6.131   0.979   1.00 0.00 ? 98  PRO A CD   8  
ATOM 11389 H HA   . PRO A 1 68 ? 11.351  7.873   -1.143  1.00 0.00 ? 98  PRO A HA   8  
ATOM 11390 H HB2  . PRO A 1 68 ? 12.737  6.368   1.022   1.00 0.00 ? 98  PRO A HB2  8  
ATOM 11391 H HB3  . PRO A 1 68 ? 12.532  8.111   0.816   1.00 0.00 ? 98  PRO A HB3  8  
ATOM 11392 H HG2  . PRO A 1 68 ? 11.095  6.780   2.617   1.00 0.00 ? 98  PRO A HG2  8  
ATOM 11393 H HG3  . PRO A 1 68 ? 10.375  8.092   1.667   1.00 0.00 ? 98  PRO A HG3  8  
ATOM 11394 H HD2  . PRO A 1 68 ? 10.055  5.138   1.371   1.00 0.00 ? 98  PRO A HD2  8  
ATOM 11395 H HD3  . PRO A 1 68 ? 8.865   6.434   1.128   1.00 0.00 ? 98  PRO A HD3  8  
ATOM 11396 N N    . LEU A 1 69 ? 13.668  6.718   -1.759  1.00 0.00 ? 99  LEU A N    8  
ATOM 11397 C CA   . LEU A 1 69 ? 14.713  6.052   -2.527  1.00 0.00 ? 99  LEU A CA   8  
ATOM 11398 C C    . LEU A 1 69 ? 15.579  5.174   -1.629  1.00 0.00 ? 99  LEU A C    8  
ATOM 11399 O O    . LEU A 1 69 ? 16.129  4.167   -2.074  1.00 0.00 ? 99  LEU A O    8  
ATOM 11400 C CB   . LEU A 1 69 ? 15.586  7.085   -3.244  1.00 0.00 ? 99  LEU A CB   8  
ATOM 11401 C CG   . LEU A 1 69 ? 16.068  6.672   -4.635  1.00 0.00 ? 99  LEU A CG   8  
ATOM 11402 C CD1  . LEU A 1 69 ? 15.117  7.186   -5.705  1.00 0.00 ? 99  LEU A CD1  8  
ATOM 11403 C CD2  . LEU A 1 69 ? 17.478  7.184   -4.884  1.00 0.00 ? 99  LEU A CD2  8  
ATOM 11404 H H    . LEU A 1 69 ? 13.816  7.635   -1.446  1.00 0.00 ? 99  LEU A H    8  
ATOM 11405 H HA   . LEU A 1 69 ? 14.233  5.427   -3.266  1.00 0.00 ? 99  LEU A HA   8  
ATOM 11406 H HB2  . LEU A 1 69 ? 15.017  8.000   -3.339  1.00 0.00 ? 99  LEU A HB2  8  
ATOM 11407 H HB3  . LEU A 1 69 ? 16.452  7.282   -2.630  1.00 0.00 ? 99  LEU A HB3  8  
ATOM 11408 H HG   . LEU A 1 69 ? 16.087  5.593   -4.697  1.00 0.00 ? 99  LEU A HG   8  
ATOM 11409 H HD11 . LEU A 1 69 ? 14.141  7.349   -5.271  1.00 0.00 ? 99  LEU A HD11 8  
ATOM 11410 H HD12 . LEU A 1 69 ? 15.040  6.457   -6.498  1.00 0.00 ? 99  LEU A HD12 8  
ATOM 11411 H HD13 . LEU A 1 69 ? 15.493  8.115   -6.105  1.00 0.00 ? 99  LEU A HD13 8  
ATOM 11412 H HD21 . LEU A 1 69 ? 17.977  7.341   -3.939  1.00 0.00 ? 99  LEU A HD21 8  
ATOM 11413 H HD22 . LEU A 1 69 ? 17.433  8.117   -5.426  1.00 0.00 ? 99  LEU A HD22 8  
ATOM 11414 H HD23 . LEU A 1 69 ? 18.028  6.458   -5.465  1.00 0.00 ? 99  LEU A HD23 8  
ATOM 11415 N N    . GLY A 1 70 ? 15.695  5.562   -0.363  1.00 0.00 ? 100 GLY A N    8  
ATOM 11416 C CA   . GLY A 1 70 ? 16.495  4.798   0.577   1.00 0.00 ? 100 GLY A CA   8  
ATOM 11417 C C    . GLY A 1 70 ? 16.034  3.358   0.699   1.00 0.00 ? 100 GLY A C    8  
ATOM 11418 O O    . GLY A 1 70 ? 16.823  2.471   1.021   1.00 0.00 ? 100 GLY A O    8  
ATOM 11419 H H    . GLY A 1 70 ? 15.233  6.373   -0.064  1.00 0.00 ? 100 GLY A H    8  
ATOM 11420 H HA2  . GLY A 1 70 ? 17.524  4.807   0.247   1.00 0.00 ? 100 GLY A HA2  8  
ATOM 11421 H HA3  . GLY A 1 70 ? 16.436  5.267   1.548   1.00 0.00 ? 100 GLY A HA3  8  
ATOM 11422 N N    . TYR A 1 71 ? 14.750  3.126   0.441   1.00 0.00 ? 101 TYR A N    8  
ATOM 11423 C CA   . TYR A 1 71 ? 14.186  1.784   0.524   1.00 0.00 ? 101 TYR A CA   8  
ATOM 11424 C C    . TYR A 1 71 ? 13.478  1.410   -0.773  1.00 0.00 ? 101 TYR A C    8  
ATOM 11425 O O    . TYR A 1 71 ? 12.312  1.751   -0.977  1.00 0.00 ? 101 TYR A O    8  
ATOM 11426 C CB   . TYR A 1 71 ? 13.207  1.692   1.697   1.00 0.00 ? 101 TYR A CB   8  
ATOM 11427 C CG   . TYR A 1 71 ? 13.870  1.820   3.050   1.00 0.00 ? 101 TYR A CG   8  
ATOM 11428 C CD1  . TYR A 1 71 ? 14.819  0.896   3.470   1.00 0.00 ? 101 TYR A CD1  8  
ATOM 11429 C CD2  . TYR A 1 71 ? 13.545  2.864   3.907   1.00 0.00 ? 101 TYR A CD2  8  
ATOM 11430 C CE1  . TYR A 1 71 ? 15.426  1.010   4.707   1.00 0.00 ? 101 TYR A CE1  8  
ATOM 11431 C CE2  . TYR A 1 71 ? 14.148  2.984   5.145   1.00 0.00 ? 101 TYR A CE2  8  
ATOM 11432 C CZ   . TYR A 1 71 ? 15.087  2.055   5.540   1.00 0.00 ? 101 TYR A CZ   8  
ATOM 11433 O OH   . TYR A 1 71 ? 15.690  2.170   6.772   1.00 0.00 ? 101 TYR A OH   8  
ATOM 11434 H H    . TYR A 1 71 ? 14.170  3.874   0.189   1.00 0.00 ? 101 TYR A H    8  
ATOM 11435 H HA   . TYR A 1 71 ? 14.997  1.092   0.690   1.00 0.00 ? 101 TYR A HA   8  
ATOM 11436 H HB2  . TYR A 1 71 ? 12.476  2.482   1.610   1.00 0.00 ? 101 TYR A HB2  8  
ATOM 11437 H HB3  . TYR A 1 71 ? 12.703  0.737   1.662   1.00 0.00 ? 101 TYR A HB3  8  
ATOM 11438 H HD1  . TYR A 1 71 ? 15.082  0.079   2.815   1.00 0.00 ? 101 TYR A HD1  8  
ATOM 11439 H HD2  . TYR A 1 71 ? 12.810  3.591   3.595   1.00 0.00 ? 101 TYR A HD2  8  
ATOM 11440 H HE1  . TYR A 1 71 ? 16.161  0.281   5.015   1.00 0.00 ? 101 TYR A HE1  8  
ATOM 11441 H HE2  . TYR A 1 71 ? 13.883  3.803   5.798   1.00 0.00 ? 101 TYR A HE2  8  
ATOM 11442 H HH   . TYR A 1 71 ? 15.018  2.165   7.458   1.00 0.00 ? 101 TYR A HH   8  
ATOM 11443 N N    . ARG A 1 72 ? 14.189  0.707   -1.648  1.00 0.00 ? 102 ARG A N    8  
ATOM 11444 C CA   . ARG A 1 72 ? 13.629  0.286   -2.927  1.00 0.00 ? 102 ARG A CA   8  
ATOM 11445 C C    . ARG A 1 72 ? 12.665  -0.881  -2.741  1.00 0.00 ? 102 ARG A C    8  
ATOM 11446 O O    . ARG A 1 72 ? 12.922  -1.793  -1.955  1.00 0.00 ? 102 ARG A O    8  
ATOM 11447 C CB   . ARG A 1 72 ? 14.747  -0.110  -3.892  1.00 0.00 ? 102 ARG A CB   8  
ATOM 11448 C CG   . ARG A 1 72 ? 15.297  1.056   -4.698  1.00 0.00 ? 102 ARG A CG   8  
ATOM 11449 C CD   . ARG A 1 72 ? 14.305  1.528   -5.748  1.00 0.00 ? 102 ARG A CD   8  
ATOM 11450 N NE   . ARG A 1 72 ? 14.941  1.742   -7.046  1.00 0.00 ? 102 ARG A NE   8  
ATOM 11451 C CZ   . ARG A 1 72 ? 15.459  0.765   -7.787  1.00 0.00 ? 102 ARG A CZ   8  
ATOM 11452 N NH1  . ARG A 1 72 ? 15.420  -0.492  -7.361  1.00 0.00 ? 102 ARG A NH1  8  
ATOM 11453 N NH2  . ARG A 1 72 ? 16.019  1.046   -8.956  1.00 0.00 ? 102 ARG A NH2  8  
ATOM 11454 H H    . ARG A 1 72 ? 15.114  0.465   -1.428  1.00 0.00 ? 102 ARG A H    8  
ATOM 11455 H HA   . ARG A 1 72 ? 13.087  1.122   -3.341  1.00 0.00 ? 102 ARG A HA   8  
ATOM 11456 H HB2  . ARG A 1 72 ? 15.559  -0.543  -3.327  1.00 0.00 ? 102 ARG A HB2  8  
ATOM 11457 H HB3  . ARG A 1 72 ? 14.367  -0.848  -4.582  1.00 0.00 ? 102 ARG A HB3  8  
ATOM 11458 H HG2  . ARG A 1 72 ? 15.512  1.875   -4.027  1.00 0.00 ? 102 ARG A HG2  8  
ATOM 11459 H HG3  . ARG A 1 72 ? 16.207  0.744   -5.190  1.00 0.00 ? 102 ARG A HG3  8  
ATOM 11460 H HD2  . ARG A 1 72 ? 13.531  0.783   -5.856  1.00 0.00 ? 102 ARG A HD2  8  
ATOM 11461 H HD3  . ARG A 1 72 ? 13.863  2.458   -5.417  1.00 0.00 ? 102 ARG A HD3  8  
ATOM 11462 H HE   . ARG A 1 72 ? 14.984  2.661   -7.384  1.00 0.00 ? 102 ARG A HE   8  
ATOM 11463 H HH11 . ARG A 1 72 ? 14.999  -0.710  -6.481  1.00 0.00 ? 102 ARG A HH11 8  
ATOM 11464 H HH12 . ARG A 1 72 ? 15.811  -1.221  -7.922  1.00 0.00 ? 102 ARG A HH12 8  
ATOM 11465 H HH21 . ARG A 1 72 ? 16.052  1.990   -9.281  1.00 0.00 ? 102 ARG A HH21 8  
ATOM 11466 H HH22 . ARG A 1 72 ? 16.410  0.311   -9.512  1.00 0.00 ? 102 ARG A HH22 8  
ATOM 11467 N N    . ILE A 1 73 ? 11.553  -0.845  -3.467  1.00 0.00 ? 103 ILE A N    8  
ATOM 11468 C CA   . ILE A 1 73 ? 10.550  -1.899  -3.382  1.00 0.00 ? 103 ILE A CA   8  
ATOM 11469 C C    . ILE A 1 73 ? 11.104  -3.226  -3.892  1.00 0.00 ? 103 ILE A C    8  
ATOM 11470 O O    . ILE A 1 73 ? 11.648  -3.300  -4.994  1.00 0.00 ? 103 ILE A O    8  
ATOM 11471 C CB   . ILE A 1 73 ? 9.283   -1.535  -4.186  1.00 0.00 ? 103 ILE A CB   8  
ATOM 11472 C CG1  . ILE A 1 73 ? 8.206   -2.606  -4.002  1.00 0.00 ? 103 ILE A CG1  8  
ATOM 11473 C CG2  . ILE A 1 73 ? 9.618   -1.358  -5.660  1.00 0.00 ? 103 ILE A CG2  8  
ATOM 11474 C CD1  . ILE A 1 73 ? 6.798   -2.053  -3.995  1.00 0.00 ? 103 ILE A CD1  8  
ATOM 11475 H H    . ILE A 1 73 ? 11.404  -0.091  -4.075  1.00 0.00 ? 103 ILE A H    8  
ATOM 11476 H HA   . ILE A 1 73 ? 10.272  -2.011  -2.345  1.00 0.00 ? 103 ILE A HA   8  
ATOM 11477 H HB   . ILE A 1 73 ? 8.909   -0.593  -3.814  1.00 0.00 ? 103 ILE A HB   8  
ATOM 11478 H HG12 . ILE A 1 73 ? 8.277   -3.321  -4.808  1.00 0.00 ? 103 ILE A HG12 8  
ATOM 11479 H HG13 . ILE A 1 73 ? 8.368   -3.113  -3.062  1.00 0.00 ? 103 ILE A HG13 8  
ATOM 11480 H HG21 . ILE A 1 73 ? 8.740   -1.021  -6.190  1.00 0.00 ? 103 ILE A HG21 8  
ATOM 11481 H HG22 . ILE A 1 73 ? 9.946   -2.303  -6.069  1.00 0.00 ? 103 ILE A HG22 8  
ATOM 11482 H HG23 . ILE A 1 73 ? 10.407  -0.628  -5.764  1.00 0.00 ? 103 ILE A HG23 8  
ATOM 11483 H HD11 . ILE A 1 73 ? 6.775   -1.130  -3.433  1.00 0.00 ? 103 ILE A HD11 8  
ATOM 11484 H HD12 . ILE A 1 73 ? 6.131   -2.769  -3.538  1.00 0.00 ? 103 ILE A HD12 8  
ATOM 11485 H HD13 . ILE A 1 73 ? 6.481   -1.862  -5.010  1.00 0.00 ? 103 ILE A HD13 8  
ATOM 11486 N N    . ASP A 1 74 ? 10.960  -4.271  -3.084  1.00 0.00 ? 104 ASP A N    8  
ATOM 11487 C CA   . ASP A 1 74 ? 11.447  -5.595  -3.454  1.00 0.00 ? 104 ASP A CA   8  
ATOM 11488 C C    . ASP A 1 74 ? 10.439  -6.315  -4.344  1.00 0.00 ? 104 ASP A C    8  
ATOM 11489 O O    . ASP A 1 74 ? 9.325   -6.620  -3.917  1.00 0.00 ? 104 ASP A O    8  
ATOM 11490 C CB   . ASP A 1 74 ? 11.725  -6.427  -2.200  1.00 0.00 ? 104 ASP A CB   8  
ATOM 11491 C CG   . ASP A 1 74 ? 12.727  -5.764  -1.276  1.00 0.00 ? 104 ASP A CG   8  
ATOM 11492 O OD1  . ASP A 1 74 ? 13.944  -5.899  -1.525  1.00 0.00 ? 104 ASP A OD1  8  
ATOM 11493 O OD2  . ASP A 1 74 ? 12.296  -5.109  -0.305  1.00 0.00 ? 104 ASP A OD2  8  
ATOM 11494 H H    . ASP A 1 74 ? 10.517  -4.149  -2.219  1.00 0.00 ? 104 ASP A H    8  
ATOM 11495 H HA   . ASP A 1 74 ? 12.367  -5.468  -4.002  1.00 0.00 ? 104 ASP A HA   8  
ATOM 11496 H HB2  . ASP A 1 74 ? 10.802  -6.568  -1.658  1.00 0.00 ? 104 ASP A HB2  8  
ATOM 11497 H HB3  . ASP A 1 74 ? 12.115  -7.390  -2.495  1.00 0.00 ? 104 ASP A HB3  8  
ATOM 11498 N N    . ILE A 1 75 ? 10.836  -6.583  -5.583  1.00 0.00 ? 105 ILE A N    8  
ATOM 11499 C CA   . ILE A 1 75 ? 9.966   -7.267  -6.533  1.00 0.00 ? 105 ILE A CA   8  
ATOM 11500 C C    . ILE A 1 75 ? 10.350  -8.738  -6.669  1.00 0.00 ? 105 ILE A C    8  
ATOM 11501 O O    . ILE A 1 75 ? 11.526  -9.091  -6.591  1.00 0.00 ? 105 ILE A O    8  
ATOM 11502 C CB   . ILE A 1 75 ? 10.021  -6.604  -7.923  1.00 0.00 ? 105 ILE A CB   8  
ATOM 11503 C CG1  . ILE A 1 75 ? 11.471  -6.455  -8.384  1.00 0.00 ? 105 ILE A CG1  8  
ATOM 11504 C CG2  . ILE A 1 75 ? 9.327   -5.250  -7.892  1.00 0.00 ? 105 ILE A CG2  8  
ATOM 11505 C CD1  . ILE A 1 75 ? 11.609  -6.180  -9.866  1.00 0.00 ? 105 ILE A CD1  8  
ATOM 11506 H H    . ILE A 1 75 ? 11.735  -6.314  -5.866  1.00 0.00 ? 105 ILE A H    8  
ATOM 11507 H HA   . ILE A 1 75 ? 8.953   -7.200  -6.164  1.00 0.00 ? 105 ILE A HA   8  
ATOM 11508 H HB   . ILE A 1 75 ? 9.492   -7.236  -8.619  1.00 0.00 ? 105 ILE A HB   8  
ATOM 11509 H HG12 . ILE A 1 75 ? 11.930  -5.635  -7.853  1.00 0.00 ? 105 ILE A HG12 8  
ATOM 11510 H HG13 . ILE A 1 75 ? 12.008  -7.366  -8.164  1.00 0.00 ? 105 ILE A HG13 8  
ATOM 11511 H HG21 . ILE A 1 75 ? 9.318   -4.873  -6.880  1.00 0.00 ? 105 ILE A HG21 8  
ATOM 11512 H HG22 . ILE A 1 75 ? 8.312   -5.358  -8.244  1.00 0.00 ? 105 ILE A HG22 8  
ATOM 11513 H HG23 . ILE A 1 75 ? 9.858   -4.558  -8.529  1.00 0.00 ? 105 ILE A HG23 8  
ATOM 11514 H HD11 . ILE A 1 75 ? 12.481  -6.691  -10.247 1.00 0.00 ? 105 ILE A HD11 8  
ATOM 11515 H HD12 . ILE A 1 75 ? 11.714  -5.118  -10.027 1.00 0.00 ? 105 ILE A HD12 8  
ATOM 11516 H HD13 . ILE A 1 75 ? 10.729  -6.538  -10.382 1.00 0.00 ? 105 ILE A HD13 8  
ATOM 11517 N N    . PRO A 1 76 ? 9.357   -9.622  -6.876  1.00 0.00 ? 106 PRO A N    8  
ATOM 11518 C CA   . PRO A 1 76 ? 9.601   -11.061 -7.025  1.00 0.00 ? 106 PRO A CA   8  
ATOM 11519 C C    . PRO A 1 76 ? 10.637  -11.364 -8.101  1.00 0.00 ? 106 PRO A C    8  
ATOM 11520 O O    . PRO A 1 76 ? 10.752  -10.636 -9.087  1.00 0.00 ? 106 PRO A O    8  
ATOM 11521 C CB   . PRO A 1 76 ? 8.233   -11.618 -7.427  1.00 0.00 ? 106 PRO A CB   8  
ATOM 11522 C CG   . PRO A 1 76 ? 7.251   -10.632 -6.899  1.00 0.00 ? 106 PRO A CG   8  
ATOM 11523 C CD   . PRO A 1 76 ? 7.924   -9.290  -6.984  1.00 0.00 ? 106 PRO A CD   8  
ATOM 11524 H HA   . PRO A 1 76 ? 9.913   -11.506 -6.090  1.00 0.00 ? 106 PRO A HA   8  
ATOM 11525 H HB2  . PRO A 1 76 ? 8.177   -11.696 -8.504  1.00 0.00 ? 106 PRO A HB2  8  
ATOM 11526 H HB3  . PRO A 1 76 ? 8.092   -12.592 -6.983  1.00 0.00 ? 106 PRO A HB3  8  
ATOM 11527 H HG2  . PRO A 1 76 ? 6.358   -10.642 -7.507  1.00 0.00 ? 106 PRO A HG2  8  
ATOM 11528 H HG3  . PRO A 1 76 ? 7.010   -10.866 -5.873  1.00 0.00 ? 106 PRO A HG3  8  
ATOM 11529 H HD2  . PRO A 1 76 ? 7.707   -8.818  -7.931  1.00 0.00 ? 106 PRO A HD2  8  
ATOM 11530 H HD3  . PRO A 1 76 ? 7.613   -8.660  -6.165  1.00 0.00 ? 106 PRO A HD3  8  
ATOM 11531 N N    . LYS A 1 77 ? 11.389  -12.443 -7.905  1.00 0.00 ? 107 LYS A N    8  
ATOM 11532 C CA   . LYS A 1 77 ? 12.416  -12.843 -8.860  1.00 0.00 ? 107 LYS A CA   8  
ATOM 11533 C C    . LYS A 1 77 ? 13.079  -14.147 -8.429  1.00 0.00 ? 107 LYS A C    8  
ATOM 11534 O O    . LYS A 1 77 ? 13.438  -14.263 -7.239  1.00 0.00 ? 107 LYS A O    8  
ATOM 11535 C CB   . LYS A 1 77 ? 13.468  -11.740 -9.001  1.00 0.00 ? 107 LYS A CB   8  
ATOM 11536 C CG   . LYS A 1 77 ? 13.303  -10.899 -10.257 1.00 0.00 ? 107 LYS A CG   8  
ATOM 11537 C CD   . LYS A 1 77 ? 14.309  -11.291 -11.328 1.00 0.00 ? 107 LYS A CD   8  
ATOM 11538 C CE   . LYS A 1 77 ? 13.835  -10.884 -12.713 1.00 0.00 ? 107 LYS A CE   8  
ATOM 11539 N NZ   . LYS A 1 77 ? 13.750  -9.404  -12.858 1.00 0.00 ? 107 LYS A NZ   8  
ATOM 11540 O OXT  . LYS A 1 77 ? 13.234  -15.043 -9.286  1.00 0.00 ? 107 LYS A OXT  8  
ATOM 11541 H H    . LYS A 1 77 ? 11.249  -12.984 -7.100  1.00 0.00 ? 107 LYS A H    8  
ATOM 11542 H HA   . LYS A 1 77 ? 11.937  -12.996 -9.816  1.00 0.00 ? 107 LYS A HA   8  
ATOM 11543 H HB2  . LYS A 1 77 ? 13.403  -11.085 -8.145  1.00 0.00 ? 107 LYS A HB2  8  
ATOM 11544 H HB3  . LYS A 1 77 ? 14.449  -12.193 -9.023  1.00 0.00 ? 107 LYS A HB3  8  
ATOM 11545 H HG2  . LYS A 1 77 ? 12.307  -11.041 -10.645 1.00 0.00 ? 107 LYS A HG2  8  
ATOM 11546 H HG3  . LYS A 1 77 ? 13.449  -9.859  -10.002 1.00 0.00 ? 107 LYS A HG3  8  
ATOM 11547 H HD2  . LYS A 1 77 ? 15.250  -10.801 -11.122 1.00 0.00 ? 107 LYS A HD2  8  
ATOM 11548 H HD3  . LYS A 1 77 ? 14.447  -12.362 -11.305 1.00 0.00 ? 107 LYS A HD3  8  
ATOM 11549 H HE2  . LYS A 1 77 ? 14.528  -11.269 -13.446 1.00 0.00 ? 107 LYS A HE2  8  
ATOM 11550 H HE3  . LYS A 1 77 ? 12.857  -11.311 -12.884 1.00 0.00 ? 107 LYS A HE3  8  
ATOM 11551 H HZ1  . LYS A 1 77 ? 13.431  -8.975  -11.966 1.00 0.00 ? 107 LYS A HZ1  8  
ATOM 11552 H HZ2  . LYS A 1 77 ? 13.075  -9.157  -13.610 1.00 0.00 ? 107 LYS A HZ2  8  
ATOM 11553 H HZ3  . LYS A 1 77 ? 14.682  -9.014  -13.104 1.00 0.00 ? 107 LYS A HZ3  8  
ATOM 11554 N N    . ALA B 2 1  ? 7.962   5.724   7.705   1.00 0.00 ? 43  ALA B N    8  
ATOM 11555 C CA   . ALA B 2 1  ? 7.898   6.696   6.583   1.00 0.00 ? 43  ALA B CA   8  
ATOM 11556 C C    . ALA B 2 1  ? 6.613   7.520   6.647   1.00 0.00 ? 43  ALA B C    8  
ATOM 11557 O O    . ALA B 2 1  ? 5.577   7.036   7.103   1.00 0.00 ? 43  ALA B O    8  
ATOM 11558 C CB   . ALA B 2 1  ? 7.991   5.968   5.250   1.00 0.00 ? 43  ALA B CB   8  
ATOM 11559 H H1   . ALA B 2 1  ? 7.022   5.293   7.807   1.00 0.00 ? 43  ALA B H1   8  
ATOM 11560 H H2   . ALA B 2 1  ? 8.230   6.249   8.563   1.00 0.00 ? 43  ALA B H2   8  
ATOM 11561 H H3   . ALA B 2 1  ? 8.678   5.009   7.465   1.00 0.00 ? 43  ALA B H3   8  
ATOM 11562 H HA   . ALA B 2 1  ? 8.744   7.362   6.662   1.00 0.00 ? 43  ALA B HA   8  
ATOM 11563 H HB1  . ALA B 2 1  ? 9.021   5.940   4.927   1.00 0.00 ? 43  ALA B HB1  8  
ATOM 11564 H HB2  . ALA B 2 1  ? 7.397   6.487   4.514   1.00 0.00 ? 43  ALA B HB2  8  
ATOM 11565 H HB3  . ALA B 2 1  ? 7.623   4.959   5.364   1.00 0.00 ? 43  ALA B HB3  8  
ATOM 11566 N N    . PRO B 2 2  ? 6.667   8.784   6.191   1.00 0.00 ? 44  PRO B N    8  
ATOM 11567 C CA   . PRO B 2 2  ? 5.503   9.676   6.201   1.00 0.00 ? 44  PRO B CA   8  
ATOM 11568 C C    . PRO B 2 2  ? 4.474   9.309   5.135   1.00 0.00 ? 44  PRO B C    8  
ATOM 11569 O O    . PRO B 2 2  ? 3.303   9.672   5.241   1.00 0.00 ? 44  PRO B O    8  
ATOM 11570 C CB   . PRO B 2 2  ? 6.110   11.047  5.904   1.00 0.00 ? 44  PRO B CB   8  
ATOM 11571 C CG   . PRO B 2 2  ? 7.337   10.752  5.111   1.00 0.00 ? 44  PRO B CG   8  
ATOM 11572 C CD   . PRO B 2 2  ? 7.864   9.442   5.633   1.00 0.00 ? 44  PRO B CD   8  
ATOM 11573 H HA   . PRO B 2 2  ? 5.026   9.694   7.169   1.00 0.00 ? 44  PRO B HA   8  
ATOM 11574 H HB2  . PRO B 2 2  ? 5.407   11.641  5.338   1.00 0.00 ? 44  PRO B HB2  8  
ATOM 11575 H HB3  . PRO B 2 2  ? 6.350   11.547  6.831   1.00 0.00 ? 44  PRO B HB3  8  
ATOM 11576 H HG2  . PRO B 2 2  ? 7.085   10.665  4.065   1.00 0.00 ? 44  PRO B HG2  8  
ATOM 11577 H HG3  . PRO B 2 2  ? 8.066   11.535  5.259   1.00 0.00 ? 44  PRO B HG3  8  
ATOM 11578 H HD2  . PRO B 2 2  ? 8.285   8.858   4.827   1.00 0.00 ? 44  PRO B HD2  8  
ATOM 11579 H HD3  . PRO B 2 2  ? 8.603   9.613   6.402   1.00 0.00 ? 44  PRO B HD3  8  
ATOM 11580 N N    . GLN B 2 3  ? 4.916   8.585   4.110   1.00 0.00 ? 45  GLN B N    8  
ATOM 11581 C CA   . GLN B 2 3  ? 4.028   8.171   3.031   1.00 0.00 ? 45  GLN B CA   8  
ATOM 11582 C C    . GLN B 2 3  ? 3.207   6.958   3.443   1.00 0.00 ? 45  GLN B C    8  
ATOM 11583 O O    . GLN B 2 3  ? 2.097   6.747   2.954   1.00 0.00 ? 45  GLN B O    8  
ATOM 11584 C CB   . GLN B 2 3  ? 4.832   7.858   1.768   1.00 0.00 ? 45  GLN B CB   8  
ATOM 11585 C CG   . GLN B 2 3  ? 5.799   8.963   1.374   1.00 0.00 ? 45  GLN B CG   8  
ATOM 11586 C CD   . GLN B 2 3  ? 7.166   8.795   2.007   1.00 0.00 ? 45  GLN B CD   8  
ATOM 11587 O OE1  . GLN B 2 3  ? 7.520   7.712   2.470   1.00 0.00 ? 45  GLN B OE1  8  
ATOM 11588 N NE2  . GLN B 2 3  ? 7.943   9.872   2.030   1.00 0.00 ? 45  GLN B NE2  8  
ATOM 11589 H H    . GLN B 2 3  ? 5.858   8.322   4.080   1.00 0.00 ? 45  GLN B H    8  
ATOM 11590 H HA   . GLN B 2 3  ? 3.357   8.988   2.827   1.00 0.00 ? 45  GLN B HA   8  
ATOM 11591 H HB2  . GLN B 2 3  ? 5.401   6.954   1.933   1.00 0.00 ? 45  GLN B HB2  8  
ATOM 11592 H HB3  . GLN B 2 3  ? 4.148   7.698   0.950   1.00 0.00 ? 45  GLN B HB3  8  
ATOM 11593 H HG2  . GLN B 2 3  ? 5.913   8.958   0.301   1.00 0.00 ? 45  GLN B HG2  8  
ATOM 11594 H HG3  . GLN B 2 3  ? 5.387   9.911   1.687   1.00 0.00 ? 45  GLN B HG3  8  
ATOM 11595 H HE21 . GLN B 2 3  ? 7.596   10.702  1.642   1.00 0.00 ? 45  GLN B HE21 8  
ATOM 11596 H HE22 . GLN B 2 3  ? 8.833   9.793   2.433   1.00 0.00 ? 45  GLN B HE22 8  
ATOM 11597 N N    . LEU B 2 4  ? 3.757   6.167   4.352   1.00 0.00 ? 46  LEU B N    8  
ATOM 11598 C CA   . LEU B 2 4  ? 3.075   4.977   4.839   1.00 0.00 ? 46  LEU B CA   8  
ATOM 11599 C C    . LEU B 2 4  ? 2.034   5.354   5.886   1.00 0.00 ? 46  LEU B C    8  
ATOM 11600 O O    . LEU B 2 4  ? 0.970   4.740   5.970   1.00 0.00 ? 46  LEU B O    8  
ATOM 11601 C CB   . LEU B 2 4  ? 4.080   3.986   5.429   1.00 0.00 ? 46  LEU B CB   8  
ATOM 11602 C CG   . LEU B 2 4  ? 4.942   3.251   4.401   1.00 0.00 ? 46  LEU B CG   8  
ATOM 11603 C CD1  . LEU B 2 4  ? 5.861   2.255   5.091   1.00 0.00 ? 46  LEU B CD1  8  
ATOM 11604 C CD2  . LEU B 2 4  ? 4.064   2.547   3.377   1.00 0.00 ? 46  LEU B CD2  8  
ATOM 11605 H H    . LEU B 2 4  ? 4.640   6.392   4.708   1.00 0.00 ? 46  LEU B H    8  
ATOM 11606 H HA   . LEU B 2 4  ? 2.575   4.519   4.001   1.00 0.00 ? 46  LEU B HA   8  
ATOM 11607 H HB2  . LEU B 2 4  ? 4.734   4.524   6.099   1.00 0.00 ? 46  LEU B HB2  8  
ATOM 11608 H HB3  . LEU B 2 4  ? 3.534   3.250   6.000   1.00 0.00 ? 46  LEU B HB3  8  
ATOM 11609 H HG   . LEU B 2 4  ? 5.559   3.968   3.880   1.00 0.00 ? 46  LEU B HG   8  
ATOM 11610 H HD11 . LEU B 2 4  ? 5.279   1.425   5.464   1.00 0.00 ? 46  LEU B HD11 8  
ATOM 11611 H HD12 . LEU B 2 4  ? 6.364   2.741   5.915   1.00 0.00 ? 46  LEU B HD12 8  
ATOM 11612 H HD13 . LEU B 2 4  ? 6.594   1.892   4.386   1.00 0.00 ? 46  LEU B HD13 8  
ATOM 11613 H HD21 . LEU B 2 4  ? 4.543   1.632   3.061   1.00 0.00 ? 46  LEU B HD21 8  
ATOM 11614 H HD22 . LEU B 2 4  ? 3.921   3.192   2.523   1.00 0.00 ? 46  LEU B HD22 8  
ATOM 11615 H HD23 . LEU B 2 4  ? 3.106   2.318   3.819   1.00 0.00 ? 46  LEU B HD23 8  
ATOM 11616 N N    . ILE B 2 5  ? 2.345   6.377   6.674   1.00 0.00 ? 47  ILE B N    8  
ATOM 11617 C CA   . ILE B 2 5  ? 1.433   6.848   7.707   1.00 0.00 ? 47  ILE B CA   8  
ATOM 11618 C C    . ILE B 2 5  ? 0.283   7.630   7.087   1.00 0.00 ? 47  ILE B C    8  
ATOM 11619 O O    . ILE B 2 5  ? -0.842  7.603   7.587   1.00 0.00 ? 47  ILE B O    8  
ATOM 11620 C CB   . ILE B 2 5  ? 2.155   7.739   8.736   1.00 0.00 ? 47  ILE B CB   8  
ATOM 11621 C CG1  . ILE B 2 5  ? 3.414   7.041   9.255   1.00 0.00 ? 47  ILE B CG1  8  
ATOM 11622 C CG2  . ILE B 2 5  ? 1.223   8.085   9.886   1.00 0.00 ? 47  ILE B CG2  8  
ATOM 11623 C CD1  . ILE B 2 5  ? 4.453   7.996   9.804   1.00 0.00 ? 47  ILE B CD1  8  
ATOM 11624 H H    . ILE B 2 5  ? 3.205   6.831   6.553   1.00 0.00 ? 47  ILE B H    8  
ATOM 11625 H HA   . ILE B 2 5  ? 1.035   5.984   8.222   1.00 0.00 ? 47  ILE B HA   8  
ATOM 11626 H HB   . ILE B 2 5  ? 2.439   8.659   8.246   1.00 0.00 ? 47  ILE B HB   8  
ATOM 11627 H HG12 . ILE B 2 5  ? 3.140   6.362   10.047  1.00 0.00 ? 47  ILE B HG12 8  
ATOM 11628 H HG13 . ILE B 2 5  ? 3.867   6.483   8.449   1.00 0.00 ? 47  ILE B HG13 8  
ATOM 11629 H HG21 . ILE B 2 5  ? 0.465   7.321   9.977   1.00 0.00 ? 47  ILE B HG21 8  
ATOM 11630 H HG22 . ILE B 2 5  ? 0.751   9.037   9.694   1.00 0.00 ? 47  ILE B HG22 8  
ATOM 11631 H HG23 . ILE B 2 5  ? 1.788   8.142   10.805  1.00 0.00 ? 47  ILE B HG23 8  
ATOM 11632 H HD11 . ILE B 2 5  ? 3.992   8.950   10.009  1.00 0.00 ? 47  ILE B HD11 8  
ATOM 11633 H HD12 . ILE B 2 5  ? 5.241   8.125   9.076   1.00 0.00 ? 47  ILE B HD12 8  
ATOM 11634 H HD13 . ILE B 2 5  ? 4.867   7.592   10.715  1.00 0.00 ? 47  ILE B HD13 8  
ATOM 11635 N N    . MET B 2 6  ? 0.573   8.325   5.992   1.00 0.00 ? 48  MET B N    8  
ATOM 11636 C CA   . MET B 2 6  ? -0.438  9.112   5.297   1.00 0.00 ? 48  MET B CA   8  
ATOM 11637 C C    . MET B 2 6  ? -1.345  8.214   4.466   1.00 0.00 ? 48  MET B C    8  
ATOM 11638 O O    . MET B 2 6  ? -2.523  8.514   4.267   1.00 0.00 ? 48  MET B O    8  
ATOM 11639 C CB   . MET B 2 6  ? 0.224   10.175  4.411   1.00 0.00 ? 48  MET B CB   8  
ATOM 11640 C CG   . MET B 2 6  ? 0.751   9.639   3.089   1.00 0.00 ? 48  MET B CG   8  
ATOM 11641 S SD   . MET B 2 6  ? -0.346  10.004  1.704   1.00 0.00 ? 48  MET B SD   8  
ATOM 11642 C CE   . MET B 2 6  ? 0.477   9.123   0.379   1.00 0.00 ? 48  MET B CE   8  
ATOM 11643 H H    . MET B 2 6  ? 1.488   8.304   5.640   1.00 0.00 ? 48  MET B H    8  
ATOM 11644 H HA   . MET B 2 6  ? -1.037  9.602   6.044   1.00 0.00 ? 48  MET B HA   8  
ATOM 11645 H HB2  . MET B 2 6  ? -0.498  10.948  4.198   1.00 0.00 ? 48  MET B HB2  8  
ATOM 11646 H HB3  . MET B 2 6  ? 1.052   10.610  4.951   1.00 0.00 ? 48  MET B HB3  8  
ATOM 11647 H HG2  . MET B 2 6  ? 1.714   10.084  2.893   1.00 0.00 ? 48  MET B HG2  8  
ATOM 11648 H HG3  . MET B 2 6  ? 0.861   8.568   3.169   1.00 0.00 ? 48  MET B HG3  8  
ATOM 11649 H HE1  . MET B 2 6  ? -0.152  8.314   0.040   1.00 0.00 ? 48  MET B HE1  8  
ATOM 11650 H HE2  . MET B 2 6  ? 1.414   8.723   0.740   1.00 0.00 ? 48  MET B HE2  8  
ATOM 11651 H HE3  . MET B 2 6  ? 0.667   9.800   -0.440  1.00 0.00 ? 48  MET B HE3  8  
ATOM 11652 N N    . LEU B 2 7  ? -0.789  7.108   3.990   1.00 0.00 ? 49  LEU B N    8  
ATOM 11653 C CA   . LEU B 2 7  ? -1.547  6.159   3.186   1.00 0.00 ? 49  LEU B CA   8  
ATOM 11654 C C    . LEU B 2 7  ? -2.554  5.412   4.052   1.00 0.00 ? 49  LEU B C    8  
ATOM 11655 O O    . LEU B 2 7  ? -3.706  5.222   3.662   1.00 0.00 ? 49  LEU B O    8  
ATOM 11656 C CB   . LEU B 2 7  ? -0.604  5.167   2.502   1.00 0.00 ? 49  LEU B CB   8  
ATOM 11657 C CG   . LEU B 2 7  ? 0.109   5.701   1.259   1.00 0.00 ? 49  LEU B CG   8  
ATOM 11658 C CD1  . LEU B 2 7  ? 1.398   4.933   1.012   1.00 0.00 ? 49  LEU B CD1  8  
ATOM 11659 C CD2  . LEU B 2 7  ? -0.804  5.619   0.045   1.00 0.00 ? 49  LEU B CD2  8  
ATOM 11660 H H    . LEU B 2 7  ? 0.153   6.926   4.190   1.00 0.00 ? 49  LEU B H    8  
ATOM 11661 H HA   . LEU B 2 7  ? -2.081  6.715   2.430   1.00 0.00 ? 49  LEU B HA   8  
ATOM 11662 H HB2  . LEU B 2 7  ? 0.145   4.861   3.219   1.00 0.00 ? 49  LEU B HB2  8  
ATOM 11663 H HB3  . LEU B 2 7  ? -1.177  4.298   2.213   1.00 0.00 ? 49  LEU B HB3  8  
ATOM 11664 H HG   . LEU B 2 7  ? 0.365   6.739   1.418   1.00 0.00 ? 49  LEU B HG   8  
ATOM 11665 H HD11 . LEU B 2 7  ? 2.156   5.611   0.646   1.00 0.00 ? 49  LEU B HD11 8  
ATOM 11666 H HD12 . LEU B 2 7  ? 1.222   4.161   0.278   1.00 0.00 ? 49  LEU B HD12 8  
ATOM 11667 H HD13 . LEU B 2 7  ? 1.733   4.484   1.935   1.00 0.00 ? 49  LEU B HD13 8  
ATOM 11668 H HD21 . LEU B 2 7  ? -0.502  6.359   -0.682  1.00 0.00 ? 49  LEU B HD21 8  
ATOM 11669 H HD22 . LEU B 2 7  ? -1.823  5.808   0.348   1.00 0.00 ? 49  LEU B HD22 8  
ATOM 11670 H HD23 . LEU B 2 7  ? -0.734  4.635   -0.393  1.00 0.00 ? 49  LEU B HD23 8  
ATOM 11671 N N    . ALA B 2 8  ? -2.110  4.994   5.233   1.00 0.00 ? 50  ALA B N    8  
ATOM 11672 C CA   . ALA B 2 8  ? -2.968  4.272   6.160   1.00 0.00 ? 50  ALA B CA   8  
ATOM 11673 C C    . ALA B 2 8  ? -4.040  5.188   6.740   1.00 0.00 ? 50  ALA B C    8  
ATOM 11674 O O    . ALA B 2 8  ? -5.159  4.754   7.013   1.00 0.00 ? 50  ALA B O    8  
ATOM 11675 C CB   . ALA B 2 8  ? -2.138  3.656   7.276   1.00 0.00 ? 50  ALA B CB   8  
ATOM 11676 H H    . ALA B 2 8  ? -1.184  5.177   5.487   1.00 0.00 ? 50  ALA B H    8  
ATOM 11677 H HA   . ALA B 2 8  ? -3.445  3.473   5.616   1.00 0.00 ? 50  ALA B HA   8  
ATOM 11678 H HB1  . ALA B 2 8  ? -1.205  3.291   6.872   1.00 0.00 ? 50  ALA B HB1  8  
ATOM 11679 H HB2  . ALA B 2 8  ? -2.683  2.836   7.719   1.00 0.00 ? 50  ALA B HB2  8  
ATOM 11680 H HB3  . ALA B 2 8  ? -1.936  4.403   8.029   1.00 0.00 ? 50  ALA B HB3  8  
ATOM 11681 N N    . ASN B 2 9  ? -3.692  6.458   6.925   1.00 0.00 ? 51  ASN B N    8  
ATOM 11682 C CA   . ASN B 2 9  ? -4.629  7.433   7.472   1.00 0.00 ? 51  ASN B CA   8  
ATOM 11683 C C    . ASN B 2 9  ? -5.812  7.631   6.532   1.00 0.00 ? 51  ASN B C    8  
ATOM 11684 O O    . ASN B 2 9  ? -6.967  7.581   6.953   1.00 0.00 ? 51  ASN B O    8  
ATOM 11685 C CB   . ASN B 2 9  ? -3.925  8.769   7.715   1.00 0.00 ? 51  ASN B CB   8  
ATOM 11686 C CG   . ASN B 2 9  ? -4.645  9.622   8.741   1.00 0.00 ? 51  ASN B CG   8  
ATOM 11687 O OD1  . ASN B 2 9  ? -4.288  9.631   9.919   1.00 0.00 ? 51  ASN B OD1  8  
ATOM 11688 N ND2  . ASN B 2 9  ? -5.664  10.347  8.296   1.00 0.00 ? 51  ASN B ND2  8  
ATOM 11689 H H    . ASN B 2 9  ? -2.786  6.747   6.688   1.00 0.00 ? 51  ASN B H    8  
ATOM 11690 H HA   . ASN B 2 9  ? -4.993  7.049   8.413   1.00 0.00 ? 51  ASN B HA   8  
ATOM 11691 H HB2  . ASN B 2 9  ? -2.922  8.581   8.071   1.00 0.00 ? 51  ASN B HB2  8  
ATOM 11692 H HB3  . ASN B 2 9  ? -3.876  9.317   6.786   1.00 0.00 ? 51  ASN B HB3  8  
ATOM 11693 H HD21 . ASN B 2 9  ? -5.892  10.291  7.345   1.00 0.00 ? 51  ASN B HD21 8  
ATOM 11694 H HD22 . ASN B 2 9  ? -6.148  10.909  8.938   1.00 0.00 ? 51  ASN B HD22 8  
ATOM 11695 N N    . VAL B 2 10 ? -5.514  7.852   5.257   1.00 0.00 ? 52  VAL B N    8  
ATOM 11696 C CA   . VAL B 2 10 ? -6.554  8.052   4.255   1.00 0.00 ? 52  VAL B CA   8  
ATOM 11697 C C    . VAL B 2 10 ? -7.361  6.775   4.050   1.00 0.00 ? 52  VAL B C    8  
ATOM 11698 O O    . VAL B 2 10 ? -8.540  6.823   3.702   1.00 0.00 ? 52  VAL B O    8  
ATOM 11699 C CB   . VAL B 2 10 ? -5.956  8.495   2.907   1.00 0.00 ? 52  VAL B CB   8  
ATOM 11700 C CG1  . VAL B 2 10 ? -7.060  8.827   1.913   1.00 0.00 ? 52  VAL B CG1  8  
ATOM 11701 C CG2  . VAL B 2 10 ? -5.027  9.684   3.098   1.00 0.00 ? 52  VAL B CG2  8  
ATOM 11702 H H    . VAL B 2 10 ? -4.575  7.877   4.981   1.00 0.00 ? 52  VAL B H    8  
ATOM 11703 H HA   . VAL B 2 10 ? -7.215  8.832   4.610   1.00 0.00 ? 52  VAL B HA   8  
ATOM 11704 H HB   . VAL B 2 10 ? -5.378  7.675   2.506   1.00 0.00 ? 52  VAL B HB   8  
ATOM 11705 H HG11 . VAL B 2 10 ? -6.643  8.891   0.919   1.00 0.00 ? 52  VAL B HG11 8  
ATOM 11706 H HG12 . VAL B 2 10 ? -7.509  9.774   2.177   1.00 0.00 ? 52  VAL B HG12 8  
ATOM 11707 H HG13 . VAL B 2 10 ? -7.813  8.053   1.938   1.00 0.00 ? 52  VAL B HG13 8  
ATOM 11708 H HG21 . VAL B 2 10 ? -4.157  9.566   2.469   1.00 0.00 ? 52  VAL B HG21 8  
ATOM 11709 H HG22 . VAL B 2 10 ? -4.718  9.738   4.132   1.00 0.00 ? 52  VAL B HG22 8  
ATOM 11710 H HG23 . VAL B 2 10 ? -5.545  10.593  2.829   1.00 0.00 ? 52  VAL B HG23 8  
ATOM 11711 N N    . ALA B 2 11 ? -6.719  5.633   4.275   1.00 0.00 ? 53  ALA B N    8  
ATOM 11712 C CA   . ALA B 2 11 ? -7.374  4.347   4.123   1.00 0.00 ? 53  ALA B CA   8  
ATOM 11713 C C    . ALA B 2 11 ? -8.235  4.044   5.341   1.00 0.00 ? 53  ALA B C    8  
ATOM 11714 O O    . ALA B 2 11 ? -9.305  3.447   5.229   1.00 0.00 ? 53  ALA B O    8  
ATOM 11715 C CB   . ALA B 2 11 ? -6.344  3.248   3.910   1.00 0.00 ? 53  ALA B CB   8  
ATOM 11716 H H    . ALA B 2 11 ? -5.785  5.656   4.555   1.00 0.00 ? 53  ALA B H    8  
ATOM 11717 H HA   . ALA B 2 11 ? -8.002  4.397   3.250   1.00 0.00 ? 53  ALA B HA   8  
ATOM 11718 H HB1  . ALA B 2 11 ? -6.758  2.487   3.265   1.00 0.00 ? 53  ALA B HB1  8  
ATOM 11719 H HB2  . ALA B 2 11 ? -6.083  2.810   4.862   1.00 0.00 ? 53  ALA B HB2  8  
ATOM 11720 H HB3  . ALA B 2 11 ? -5.460  3.667   3.452   1.00 0.00 ? 53  ALA B HB3  8  
ATOM 11721 N N    . LEU B 2 12 ? -7.757  4.468   6.507   1.00 0.00 ? 54  LEU B N    8  
ATOM 11722 C CA   . LEU B 2 12 ? -8.477  4.253   7.748   1.00 0.00 ? 54  LEU B CA   8  
ATOM 11723 C C