data_2D2W
# 
_entry.id   2D2W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D2W         
RCSB  RCSB024920   
WWPDB D_1000024920 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D2W 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chuang, W.-J.' 1 
'Chang, C.-H.'  2 
'Jeng, W.-Y.'   3 
'Chu, Y.-P.'    4 
# 
_citation.id                        primary 
_citation.title                     
'Solution Structure and Backbone Dynamics of the DNA-Binding Domain of Myocyte Nuclear Factor (Foxk1)' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chang, C.-H.'  1 
primary 'Chu, Y.-P.'    2 
primary 'Jeng, W.-Y.'   3 
primary 'Chuang, W.-J.' 4 
# 
_cell.entry_id           2D2W 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2D2W 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Forkhead box protein K1' 
_entity.formula_weight             11788.293 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'DNA-Binding Domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Myocyte nuclear factor, MNF' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRID
PASEAKLVEQAFRKRRQRGVS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRID
PASEAKLVEQAFRKRRQRGVS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   SER n 
1 3   LYS n 
1 4   PRO n 
1 5   PRO n 
1 6   TYR n 
1 7   SER n 
1 8   TYR n 
1 9   ALA n 
1 10  GLN n 
1 11  LEU n 
1 12  ILE n 
1 13  VAL n 
1 14  GLN n 
1 15  ALA n 
1 16  ILE n 
1 17  SER n 
1 18  SER n 
1 19  ALA n 
1 20  GLN n 
1 21  ASP n 
1 22  ARG n 
1 23  GLN n 
1 24  LEU n 
1 25  THR n 
1 26  LEU n 
1 27  SER n 
1 28  GLY n 
1 29  ILE n 
1 30  TYR n 
1 31  ALA n 
1 32  HIS n 
1 33  ILE n 
1 34  THR n 
1 35  LYS n 
1 36  HIS n 
1 37  TYR n 
1 38  PRO n 
1 39  TYR n 
1 40  TYR n 
1 41  ARG n 
1 42  THR n 
1 43  ALA n 
1 44  ASP n 
1 45  LYS n 
1 46  GLY n 
1 47  TRP n 
1 48  GLN n 
1 49  ASN n 
1 50  SER n 
1 51  ILE n 
1 52  ARG n 
1 53  HIS n 
1 54  ASN n 
1 55  LEU n 
1 56  SER n 
1 57  LEU n 
1 58  ASN n 
1 59  ARG n 
1 60  TYR n 
1 61  PHE n 
1 62  ILE n 
1 63  LYS n 
1 64  VAL n 
1 65  PRO n 
1 66  ARG n 
1 67  SER n 
1 68  GLN n 
1 69  GLU n 
1 70  GLU n 
1 71  PRO n 
1 72  GLY n 
1 73  LYS n 
1 74  GLY n 
1 75  SER n 
1 76  PHE n 
1 77  TRP n 
1 78  ARG n 
1 79  ILE n 
1 80  ASP n 
1 81  PRO n 
1 82  ALA n 
1 83  SER n 
1 84  GLU n 
1 85  ALA n 
1 86  LYS n 
1 87  LEU n 
1 88  VAL n 
1 89  GLU n 
1 90  GLN n 
1 91  ALA n 
1 92  PHE n 
1 93  ARG n 
1 94  LYS n 
1 95  ARG n 
1 96  ARG n 
1 97  GLN n 
1 98  ARG n 
1 99  GLY n 
1 100 VAL n 
1 101 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 Foxk1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FOXK1_MOUSE 
_struct_ref.pdbx_db_accession          P42128 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           287 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2D2W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 101 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P42128 
_struct_ref_seq.db_align_beg                  287 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  387 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       101 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '2D NOESY'             1 
2 1 '2D TOCSY'             1 
3 1 3D_15N-separated_NOESY 3 
4 1 3D_13C-separated_NOESY 4 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      125 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '3mM MNF;25mM phosphate buffer; 100mM NaCl'           '90% H2O/10% D2O' 
2 '3mM MNF;25mM phosphate buffer; 100mM NaCl'           '100% D2O'        
3 '3mM MNF U-15N;25mM phosphate buffer; 100mM NaCl'     '90% H2O/10% D2O' 
4 '3mM MNF U-15N,13C;25mM phosphate buffer; 100mM NaCl' '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2D2W 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2D2W 
_pdbx_nmr_details.text       'HNCA, HN(CO)CA, HNCACB, CBCA(CO)NH, HBHA(CACB)NH, HBHA(CACBCO)NH, HCCH-TOCSY, HCCH-COSY' 
# 
_pdbx_nmr_ensemble.entry_id                                      2D2W 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2D2W 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement      X-PLOR  3.1    ?      1 
'data analysis' AURELIA 2.7.10 Neidig 2 
processing      XWINNMR 2.6    Bruker 3 
# 
_exptl.entry_id          2D2W 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2D2W 
_struct.title                     'Solution structure and Dynamics of the DNA-Binding Domain of Myocyte Nuclear Factor' 
_struct.pdbx_descriptor           'Forkhead box protein K1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D2W 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'DNA-binding domain, winged-helix, Forkhead, DNA BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 9  ? ALA A 19 ? ALA A 9  ALA A 19 1 ? 11 
HELX_P HELX_P2 2 GLY A 28 ? TYR A 37 ? GLY A 28 TYR A 37 1 ? 10 
HELX_P HELX_P3 3 GLY A 46 ? ASN A 58 ? GLY A 46 ASN A 58 1 ? 13 
HELX_P HELX_P4 4 LYS A 86 ? PHE A 92 ? LYS A 86 PHE A 92 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 23 ? LEU A 24 ? GLN A 23 LEU A 24 
A 2 TRP A 77 ? ARG A 78 ? TRP A 77 ARG A 78 
A 3 ILE A 62 ? LYS A 63 ? ILE A 62 LYS A 63 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 24 ? N LEU A 24 O TRP A 77 ? O TRP A 77 
A 2 3 O ARG A 78 ? O ARG A 78 N ILE A 62 ? N ILE A 62 
# 
_database_PDB_matrix.entry_id          2D2W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D2W 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLU A 1 1   ? 5.529   16.045  -6.076  1.00 0.00 ? 1   GLU A N    1  
ATOM 2     C CA   . GLU A 1 1   ? 5.604   14.827  -6.932  1.00 0.00 ? 1   GLU A CA   1  
ATOM 3     C C    . GLU A 1 1   ? 6.321   13.713  -6.168  1.00 0.00 ? 1   GLU A C    1  
ATOM 4     O O    . GLU A 1 1   ? 6.117   12.542  -6.420  1.00 0.00 ? 1   GLU A O    1  
ATOM 5     C CB   . GLU A 1 1   ? 6.380   15.148  -8.211  1.00 0.00 ? 1   GLU A CB   1  
ATOM 6     C CG   . GLU A 1 1   ? 5.772   14.379  -9.386  1.00 0.00 ? 1   GLU A CG   1  
ATOM 7     C CD   . GLU A 1 1   ? 6.103   15.097  -10.696 1.00 0.00 ? 1   GLU A CD   1  
ATOM 8     O OE1  . GLU A 1 1   ? 6.801   16.097  -10.640 1.00 0.00 ? 1   GLU A OE1  1  
ATOM 9     O OE2  . GLU A 1 1   ? 5.653   14.636  -11.732 1.00 0.00 ? 1   GLU A OE2  1  
ATOM 10    H H1   . GLU A 1 1   ? 6.365   16.639  -6.244  1.00 0.00 ? 1   GLU A H1   1  
ATOM 11    H H2   . GLU A 1 1   ? 5.497   15.763  -5.075  1.00 0.00 ? 1   GLU A H2   1  
ATOM 12    H H3   . GLU A 1 1   ? 4.671   16.582  -6.312  1.00 0.00 ? 1   GLU A H3   1  
ATOM 13    H HA   . GLU A 1 1   ? 4.606   14.503  -7.187  1.00 0.00 ? 1   GLU A HA   1  
ATOM 14    H HB2  . GLU A 1 1   ? 6.326   16.209  -8.409  1.00 0.00 ? 1   GLU A HB2  1  
ATOM 15    H HB3  . GLU A 1 1   ? 7.413   14.858  -8.089  1.00 0.00 ? 1   GLU A HB3  1  
ATOM 16    H HG2  . GLU A 1 1   ? 6.180   13.378  -9.411  1.00 0.00 ? 1   GLU A HG2  1  
ATOM 17    H HG3  . GLU A 1 1   ? 4.701   14.327  -9.267  1.00 0.00 ? 1   GLU A HG3  1  
ATOM 18    N N    . SER A 1 2   ? 7.162   14.067  -5.237  1.00 0.00 ? 2   SER A N    1  
ATOM 19    C CA   . SER A 1 2   ? 7.891   13.027  -4.460  1.00 0.00 ? 2   SER A CA   1  
ATOM 20    C C    . SER A 1 2   ? 8.837   12.266  -5.391  1.00 0.00 ? 2   SER A C    1  
ATOM 21    O O    . SER A 1 2   ? 9.153   12.716  -6.474  1.00 0.00 ? 2   SER A O    1  
ATOM 22    C CB   . SER A 1 2   ? 6.886   12.050  -3.844  1.00 0.00 ? 2   SER A CB   1  
ATOM 23    O OG   . SER A 1 2   ? 6.788   10.896  -4.668  1.00 0.00 ? 2   SER A OG   1  
ATOM 24    H H    . SER A 1 2   ? 7.313   15.018  -5.048  1.00 0.00 ? 2   SER A H    1  
ATOM 25    H HA   . SER A 1 2   ? 8.462   13.500  -3.674  1.00 0.00 ? 2   SER A HA   1  
ATOM 26    H HB2  . SER A 1 2   ? 7.221   11.757  -2.863  1.00 0.00 ? 2   SER A HB2  1  
ATOM 27    H HB3  . SER A 1 2   ? 5.921   12.531  -3.763  1.00 0.00 ? 2   SER A HB3  1  
ATOM 28    H HG   . SER A 1 2   ? 5.864   10.638  -4.710  1.00 0.00 ? 2   SER A HG   1  
ATOM 29    N N    . LYS A 1 3   ? 9.287   11.115  -4.977  1.00 0.00 ? 3   LYS A N    1  
ATOM 30    C CA   . LYS A 1 3   ? 10.208  10.321  -5.837  1.00 0.00 ? 3   LYS A CA   1  
ATOM 31    C C    . LYS A 1 3   ? 9.849   8.839   -5.719  1.00 0.00 ? 3   LYS A C    1  
ATOM 32    O O    . LYS A 1 3   ? 10.323  8.161   -4.832  1.00 0.00 ? 3   LYS A O    1  
ATOM 33    C CB   . LYS A 1 3   ? 11.649  10.532  -5.374  1.00 0.00 ? 3   LYS A CB   1  
ATOM 34    C CG   . LYS A 1 3   ? 12.567  9.554   -6.109  1.00 0.00 ? 3   LYS A CG   1  
ATOM 35    C CD   . LYS A 1 3   ? 13.993  10.110  -6.133  1.00 0.00 ? 3   LYS A CD   1  
ATOM 36    C CE   . LYS A 1 3   ? 14.153  11.059  -7.322  1.00 0.00 ? 3   LYS A CE   1  
ATOM 37    N NZ   . LYS A 1 3   ? 15.395  10.712  -8.071  1.00 0.00 ? 3   LYS A NZ   1  
ATOM 38    H H    . LYS A 1 3   ? 9.017   10.770  -4.101  1.00 0.00 ? 3   LYS A H    1  
ATOM 39    H HA   . LYS A 1 3   ? 10.108  10.639  -6.865  1.00 0.00 ? 3   LYS A HA   1  
ATOM 40    H HB2  . LYS A 1 3   ? 11.949  11.545  -5.590  1.00 0.00 ? 3   LYS A HB2  1  
ATOM 41    H HB3  . LYS A 1 3   ? 11.714  10.354  -4.312  1.00 0.00 ? 3   LYS A HB3  1  
ATOM 42    H HG2  . LYS A 1 3   ? 12.561  8.602   -5.598  1.00 0.00 ? 3   LYS A HG2  1  
ATOM 43    H HG3  . LYS A 1 3   ? 12.217  9.421   -7.121  1.00 0.00 ? 3   LYS A HG3  1  
ATOM 44    H HD2  . LYS A 1 3   ? 14.186  10.646  -5.215  1.00 0.00 ? 3   LYS A HD2  1  
ATOM 45    H HD3  . LYS A 1 3   ? 14.696  9.296   -6.229  1.00 0.00 ? 3   LYS A HD3  1  
ATOM 46    H HE2  . LYS A 1 3   ? 13.299  10.963  -7.977  1.00 0.00 ? 3   LYS A HE2  1  
ATOM 47    H HE3  . LYS A 1 3   ? 14.220  12.076  -6.966  1.00 0.00 ? 3   LYS A HE3  1  
ATOM 48    H HZ1  . LYS A 1 3   ? 15.518  9.679   -8.078  1.00 0.00 ? 3   LYS A HZ1  1  
ATOM 49    H HZ2  . LYS A 1 3   ? 16.214  11.156  -7.607  1.00 0.00 ? 3   LYS A HZ2  1  
ATOM 50    H HZ3  . LYS A 1 3   ? 15.320  11.056  -9.048  1.00 0.00 ? 3   LYS A HZ3  1  
ATOM 51    N N    . PRO A 1 4   ? 9.012   8.386   -6.617  1.00 0.00 ? 4   PRO A N    1  
ATOM 52    C CA   . PRO A 1 4   ? 8.557   6.985   -6.638  1.00 0.00 ? 4   PRO A CA   1  
ATOM 53    C C    . PRO A 1 4   ? 9.646   6.060   -7.195  1.00 0.00 ? 4   PRO A C    1  
ATOM 54    O O    . PRO A 1 4   ? 9.948   6.105   -8.371  1.00 0.00 ? 4   PRO A O    1  
ATOM 55    C CB   . PRO A 1 4   ? 7.341   7.018   -7.569  1.00 0.00 ? 4   PRO A CB   1  
ATOM 56    C CG   . PRO A 1 4   ? 7.501   8.277   -8.453  1.00 0.00 ? 4   PRO A CG   1  
ATOM 57    C CD   . PRO A 1 4   ? 8.447   9.225   -7.694  1.00 0.00 ? 4   PRO A CD   1  
ATOM 58    H HA   . PRO A 1 4   ? 8.251   6.672   -5.655  1.00 0.00 ? 4   PRO A HA   1  
ATOM 59    H HB2  . PRO A 1 4   ? 7.323   6.128   -8.185  1.00 0.00 ? 4   PRO A HB2  1  
ATOM 60    H HB3  . PRO A 1 4   ? 6.432   7.090   -6.993  1.00 0.00 ? 4   PRO A HB3  1  
ATOM 61    H HG2  . PRO A 1 4   ? 7.929   8.007   -9.408  1.00 0.00 ? 4   PRO A HG2  1  
ATOM 62    H HG3  . PRO A 1 4   ? 6.544   8.755   -8.595  1.00 0.00 ? 4   PRO A HG3  1  
ATOM 63    H HD2  . PRO A 1 4   ? 9.230   9.583   -8.350  1.00 0.00 ? 4   PRO A HD2  1  
ATOM 64    H HD3  . PRO A 1 4   ? 7.897   10.051  -7.272  1.00 0.00 ? 4   PRO A HD3  1  
ATOM 65    N N    . PRO A 1 5   ? 10.191  5.235   -6.335  1.00 0.00 ? 5   PRO A N    1  
ATOM 66    C CA   . PRO A 1 5   ? 11.233  4.272   -6.721  1.00 0.00 ? 5   PRO A CA   1  
ATOM 67    C C    . PRO A 1 5   ? 10.564  3.071   -7.384  1.00 0.00 ? 5   PRO A C    1  
ATOM 68    O O    . PRO A 1 5   ? 11.143  2.386   -8.202  1.00 0.00 ? 5   PRO A O    1  
ATOM 69    C CB   . PRO A 1 5   ? 11.873  3.877   -5.388  1.00 0.00 ? 5   PRO A CB   1  
ATOM 70    C CG   . PRO A 1 5   ? 10.822  4.179   -4.295  1.00 0.00 ? 5   PRO A CG   1  
ATOM 71    C CD   . PRO A 1 5   ? 9.823   5.181   -4.905  1.00 0.00 ? 5   PRO A CD   1  
ATOM 72    H HA   . PRO A 1 5   ? 11.962  4.725   -7.373  1.00 0.00 ? 5   PRO A HA   1  
ATOM 73    H HB2  . PRO A 1 5   ? 12.117  2.823   -5.393  1.00 0.00 ? 5   PRO A HB2  1  
ATOM 74    H HB3  . PRO A 1 5   ? 12.760  4.465   -5.212  1.00 0.00 ? 5   PRO A HB3  1  
ATOM 75    H HG2  . PRO A 1 5   ? 10.311  3.269   -4.010  1.00 0.00 ? 5   PRO A HG2  1  
ATOM 76    H HG3  . PRO A 1 5   ? 11.299  4.622   -3.435  1.00 0.00 ? 5   PRO A HG3  1  
ATOM 77    H HD2  . PRO A 1 5   ? 8.810   4.823   -4.786  1.00 0.00 ? 5   PRO A HD2  1  
ATOM 78    H HD3  . PRO A 1 5   ? 9.938   6.153   -4.453  1.00 0.00 ? 5   PRO A HD3  1  
ATOM 79    N N    . TYR A 1 6   ? 9.331   2.830   -7.032  1.00 0.00 ? 6   TYR A N    1  
ATOM 80    C CA   . TYR A 1 6   ? 8.581   1.696   -7.630  1.00 0.00 ? 6   TYR A CA   1  
ATOM 81    C C    . TYR A 1 6   ? 7.438   2.253   -8.473  1.00 0.00 ? 6   TYR A C    1  
ATOM 82    O O    . TYR A 1 6   ? 6.755   3.174   -8.074  1.00 0.00 ? 6   TYR A O    1  
ATOM 83    C CB   . TYR A 1 6   ? 8.011   0.813   -6.518  1.00 0.00 ? 6   TYR A CB   1  
ATOM 84    C CG   . TYR A 1 6   ? 9.132   0.297   -5.650  1.00 0.00 ? 6   TYR A CG   1  
ATOM 85    C CD1  . TYR A 1 6   ? 10.424  0.160   -6.175  1.00 0.00 ? 6   TYR A CD1  1  
ATOM 86    C CD2  . TYR A 1 6   ? 8.879   -0.042  -4.318  1.00 0.00 ? 6   TYR A CD2  1  
ATOM 87    C CE1  . TYR A 1 6   ? 11.461  -0.317  -5.363  1.00 0.00 ? 6   TYR A CE1  1  
ATOM 88    C CE2  . TYR A 1 6   ? 9.913   -0.519  -3.506  1.00 0.00 ? 6   TYR A CE2  1  
ATOM 89    C CZ   . TYR A 1 6   ? 11.205  -0.655  -4.028  1.00 0.00 ? 6   TYR A CZ   1  
ATOM 90    O OH   . TYR A 1 6   ? 12.227  -1.124  -3.227  1.00 0.00 ? 6   TYR A OH   1  
ATOM 91    H H    . TYR A 1 6   ? 8.891   3.411   -6.376  1.00 0.00 ? 6   TYR A H    1  
ATOM 92    H HA   . TYR A 1 6   ? 9.234   1.114   -8.252  1.00 0.00 ? 6   TYR A HA   1  
ATOM 93    H HB2  . TYR A 1 6   ? 7.330   1.394   -5.913  1.00 0.00 ? 6   TYR A HB2  1  
ATOM 94    H HB3  . TYR A 1 6   ? 7.482   -0.020  -6.955  1.00 0.00 ? 6   TYR A HB3  1  
ATOM 95    H HD1  . TYR A 1 6   ? 10.620  0.422   -7.206  1.00 0.00 ? 6   TYR A HD1  1  
ATOM 96    H HD2  . TYR A 1 6   ? 7.883   0.061   -3.917  1.00 0.00 ? 6   TYR A HD2  1  
ATOM 97    H HE1  . TYR A 1 6   ? 12.457  -0.422  -5.765  1.00 0.00 ? 6   TYR A HE1  1  
ATOM 98    H HE2  . TYR A 1 6   ? 9.716   -0.779  -2.477  1.00 0.00 ? 6   TYR A HE2  1  
ATOM 99    H HH   . TYR A 1 6   ? 12.157  -2.081  -3.186  1.00 0.00 ? 6   TYR A HH   1  
ATOM 100   N N    . SER A 1 7   ? 7.216   1.702   -9.631  1.00 0.00 ? 7   SER A N    1  
ATOM 101   C CA   . SER A 1 7   ? 6.107   2.211   -10.478 1.00 0.00 ? 7   SER A CA   1  
ATOM 102   C C    . SER A 1 7   ? 4.856   2.316   -9.607  1.00 0.00 ? 7   SER A C    1  
ATOM 103   O O    . SER A 1 7   ? 4.827   1.816   -8.503  1.00 0.00 ? 7   SER A O    1  
ATOM 104   C CB   . SER A 1 7   ? 5.857   1.231   -11.624 1.00 0.00 ? 7   SER A CB   1  
ATOM 105   O OG   . SER A 1 7   ? 6.693   1.569   -12.724 1.00 0.00 ? 7   SER A OG   1  
ATOM 106   H H    . SER A 1 7   ? 7.772   0.956   -9.938  1.00 0.00 ? 7   SER A H    1  
ATOM 107   H HA   . SER A 1 7   ? 6.363   3.184   -10.874 1.00 0.00 ? 7   SER A HA   1  
ATOM 108   H HB2  . SER A 1 7   ? 6.089   0.230   -11.299 1.00 0.00 ? 7   SER A HB2  1  
ATOM 109   H HB3  . SER A 1 7   ? 4.817   1.279   -11.919 1.00 0.00 ? 7   SER A HB3  1  
ATOM 110   H HG   . SER A 1 7   ? 7.534   1.876   -12.376 1.00 0.00 ? 7   SER A HG   1  
ATOM 111   N N    . TYR A 1 8   ? 3.826   2.961   -10.074 1.00 0.00 ? 8   TYR A N    1  
ATOM 112   C CA   . TYR A 1 8   ? 2.600   3.074   -9.235  1.00 0.00 ? 8   TYR A CA   1  
ATOM 113   C C    . TYR A 1 8   ? 1.701   1.862   -9.475  1.00 0.00 ? 8   TYR A C    1  
ATOM 114   O O    . TYR A 1 8   ? 0.609   1.767   -8.953  1.00 0.00 ? 8   TYR A O    1  
ATOM 115   C CB   . TYR A 1 8   ? 1.865   4.367   -9.574  1.00 0.00 ? 8   TYR A CB   1  
ATOM 116   C CG   . TYR A 1 8   ? 2.646   5.519   -8.991  1.00 0.00 ? 8   TYR A CG   1  
ATOM 117   C CD1  . TYR A 1 8   ? 3.012   5.495   -7.640  1.00 0.00 ? 8   TYR A CD1  1  
ATOM 118   C CD2  . TYR A 1 8   ? 3.018   6.599   -9.799  1.00 0.00 ? 8   TYR A CD2  1  
ATOM 119   C CE1  . TYR A 1 8   ? 3.749   6.552   -7.096  1.00 0.00 ? 8   TYR A CE1  1  
ATOM 120   C CE2  . TYR A 1 8   ? 3.753   7.656   -9.255  1.00 0.00 ? 8   TYR A CE2  1  
ATOM 121   C CZ   . TYR A 1 8   ? 4.120   7.634   -7.904  1.00 0.00 ? 8   TYR A CZ   1  
ATOM 122   O OH   . TYR A 1 8   ? 4.845   8.678   -7.368  1.00 0.00 ? 8   TYR A OH   1  
ATOM 123   H H    . TYR A 1 8   ? 3.856   3.368   -10.965 1.00 0.00 ? 8   TYR A H    1  
ATOM 124   H HA   . TYR A 1 8   ? 2.889   3.095   -8.193  1.00 0.00 ? 8   TYR A HA   1  
ATOM 125   H HB2  . TYR A 1 8   ? 1.795   4.476   -10.647 1.00 0.00 ? 8   TYR A HB2  1  
ATOM 126   H HB3  . TYR A 1 8   ? 0.877   4.347   -9.143  1.00 0.00 ? 8   TYR A HB3  1  
ATOM 127   H HD1  . TYR A 1 8   ? 2.726   4.662   -7.017  1.00 0.00 ? 8   TYR A HD1  1  
ATOM 128   H HD2  . TYR A 1 8   ? 2.736   6.618   -10.840 1.00 0.00 ? 8   TYR A HD2  1  
ATOM 129   H HE1  . TYR A 1 8   ? 4.032   6.529   -6.055  1.00 0.00 ? 8   TYR A HE1  1  
ATOM 130   H HE2  . TYR A 1 8   ? 4.039   8.488   -9.878  1.00 0.00 ? 8   TYR A HE2  1  
ATOM 131   H HH   . TYR A 1 8   ? 4.861   9.389   -8.011  1.00 0.00 ? 8   TYR A HH   1  
ATOM 132   N N    . ALA A 1 9   ? 2.174   0.921   -10.244 1.00 0.00 ? 9   ALA A N    1  
ATOM 133   C CA   . ALA A 1 9   ? 1.378   -0.312  -10.508 1.00 0.00 ? 9   ALA A CA   1  
ATOM 134   C C    . ALA A 1 9   ? 2.106   -1.492  -9.861  1.00 0.00 ? 9   ALA A C    1  
ATOM 135   O O    . ALA A 1 9   ? 1.506   -2.459  -9.435  1.00 0.00 ? 9   ALA A O    1  
ATOM 136   C CB   . ALA A 1 9   ? 1.267   -0.538  -12.016 1.00 0.00 ? 9   ALA A CB   1  
ATOM 137   H H    . ALA A 1 9   ? 3.065   1.017   -10.635 1.00 0.00 ? 9   ALA A H    1  
ATOM 138   H HA   . ALA A 1 9   ? 0.393   -0.209  -10.077 1.00 0.00 ? 9   ALA A HA   1  
ATOM 139   H HB1  . ALA A 1 9   ? 0.246   -0.780  -12.269 1.00 0.00 ? 9   ALA A HB1  1  
ATOM 140   H HB2  . ALA A 1 9   ? 1.913   -1.352  -12.305 1.00 0.00 ? 9   ALA A HB2  1  
ATOM 141   H HB3  . ALA A 1 9   ? 1.563   0.361   -12.535 1.00 0.00 ? 9   ALA A HB3  1  
ATOM 142   N N    . GLN A 1 10  ? 3.401   -1.387  -9.762  1.00 0.00 ? 10  GLN A N    1  
ATOM 143   C CA   . GLN A 1 10  ? 4.224   -2.451  -9.119  1.00 0.00 ? 10  GLN A CA   1  
ATOM 144   C C    . GLN A 1 10  ? 4.328   -2.091  -7.644  1.00 0.00 ? 10  GLN A C    1  
ATOM 145   O O    . GLN A 1 10  ? 4.286   -2.932  -6.768  1.00 0.00 ? 10  GLN A O    1  
ATOM 146   C CB   . GLN A 1 10  ? 5.620   -2.455  -9.764  1.00 0.00 ? 10  GLN A CB   1  
ATOM 147   C CG   . GLN A 1 10  ? 6.639   -3.124  -8.838  1.00 0.00 ? 10  GLN A CG   1  
ATOM 148   C CD   . GLN A 1 10  ? 7.777   -2.145  -8.542  1.00 0.00 ? 10  GLN A CD   1  
ATOM 149   O OE1  . GLN A 1 10  ? 7.688   -0.977  -8.861  1.00 0.00 ? 10  GLN A OE1  1  
ATOM 150   N NE2  . GLN A 1 10  ? 8.853   -2.576  -7.941  1.00 0.00 ? 10  GLN A NE2  1  
ATOM 151   H H    . GLN A 1 10  ? 3.838   -0.578  -10.091 1.00 0.00 ? 10  GLN A H    1  
ATOM 152   H HA   . GLN A 1 10  ? 3.756   -3.421  -9.232  1.00 0.00 ? 10  GLN A HA   1  
ATOM 153   H HB2  . GLN A 1 10  ? 5.580   -2.994  -10.698 1.00 0.00 ? 10  GLN A HB2  1  
ATOM 154   H HB3  . GLN A 1 10  ? 5.929   -1.438  -9.953  1.00 0.00 ? 10  GLN A HB3  1  
ATOM 155   H HG2  . GLN A 1 10  ? 6.160   -3.408  -7.914  1.00 0.00 ? 10  GLN A HG2  1  
ATOM 156   H HG3  . GLN A 1 10  ? 7.039   -4.000  -9.320  1.00 0.00 ? 10  GLN A HG3  1  
ATOM 157   H HE21 . GLN A 1 10  ? 8.926   -3.519  -7.683  1.00 0.00 ? 10  GLN A HE21 1  
ATOM 158   H HE22 . GLN A 1 10  ? 9.587   -1.957  -7.746  1.00 0.00 ? 10  GLN A HE22 1  
ATOM 159   N N    . LEU A 1 11  ? 4.447   -0.826  -7.384  1.00 0.00 ? 11  LEU A N    1  
ATOM 160   C CA   . LEU A 1 11  ? 4.540   -0.338  -5.989  1.00 0.00 ? 11  LEU A CA   1  
ATOM 161   C C    . LEU A 1 11  ? 3.292   -0.777  -5.226  1.00 0.00 ? 11  LEU A C    1  
ATOM 162   O O    . LEU A 1 11  ? 3.353   -1.137  -4.067  1.00 0.00 ? 11  LEU A O    1  
ATOM 163   C CB   . LEU A 1 11  ? 4.614   1.187   -6.027  1.00 0.00 ? 11  LEU A CB   1  
ATOM 164   C CG   . LEU A 1 11  ? 4.460   1.763   -4.625  1.00 0.00 ? 11  LEU A CG   1  
ATOM 165   C CD1  . LEU A 1 11  ? 5.838   2.095   -4.064  1.00 0.00 ? 11  LEU A CD1  1  
ATOM 166   C CD2  . LEU A 1 11  ? 3.627   3.037   -4.707  1.00 0.00 ? 11  LEU A CD2  1  
ATOM 167   H H    . LEU A 1 11  ? 4.463   -0.184  -8.122  1.00 0.00 ? 11  LEU A H    1  
ATOM 168   H HA   . LEU A 1 11  ? 5.424   -0.738  -5.515  1.00 0.00 ? 11  LEU A HA   1  
ATOM 169   H HB2  . LEU A 1 11  ? 5.565   1.489   -6.437  1.00 0.00 ? 11  LEU A HB2  1  
ATOM 170   H HB3  . LEU A 1 11  ? 3.820   1.565   -6.654  1.00 0.00 ? 11  LEU A HB3  1  
ATOM 171   H HG   . LEU A 1 11  ? 3.970   1.047   -3.982  1.00 0.00 ? 11  LEU A HG   1  
ATOM 172   H HD11 . LEU A 1 11  ? 6.314   2.829   -4.695  1.00 0.00 ? 11  LEU A HD11 1  
ATOM 173   H HD12 . LEU A 1 11  ? 6.437   1.198   -4.039  1.00 0.00 ? 11  LEU A HD12 1  
ATOM 174   H HD13 . LEU A 1 11  ? 5.734   2.487   -3.065  1.00 0.00 ? 11  LEU A HD13 1  
ATOM 175   H HD21 . LEU A 1 11  ? 4.284   3.895   -4.741  1.00 0.00 ? 11  LEU A HD21 1  
ATOM 176   H HD22 . LEU A 1 11  ? 2.987   3.105   -3.842  1.00 0.00 ? 11  LEU A HD22 1  
ATOM 177   H HD23 . LEU A 1 11  ? 3.023   3.012   -5.604  1.00 0.00 ? 11  LEU A HD23 1  
ATOM 178   N N    . ILE A 1 12  ? 2.158   -0.747  -5.869  1.00 0.00 ? 12  ILE A N    1  
ATOM 179   C CA   . ILE A 1 12  ? 0.904   -1.161  -5.173  1.00 0.00 ? 12  ILE A CA   1  
ATOM 180   C C    . ILE A 1 12  ? 0.903   -2.676  -4.944  1.00 0.00 ? 12  ILE A C    1  
ATOM 181   O O    . ILE A 1 12  ? 0.459   -3.155  -3.922  1.00 0.00 ? 12  ILE A O    1  
ATOM 182   C CB   . ILE A 1 12  ? -0.326  -0.825  -6.009  1.00 0.00 ? 12  ILE A CB   1  
ATOM 183   C CG1  . ILE A 1 12  ? -0.401  0.691   -6.338  1.00 0.00 ? 12  ILE A CG1  1  
ATOM 184   C CG2  . ILE A 1 12  ? -1.549  -1.260  -5.216  1.00 0.00 ? 12  ILE A CG2  1  
ATOM 185   C CD1  . ILE A 1 12  ? -1.419  1.400   -5.435  1.00 0.00 ? 12  ILE A CD1  1  
ATOM 186   H H    . ILE A 1 12  ? 2.134   -0.450  -6.805  1.00 0.00 ? 12  ILE A H    1  
ATOM 187   H HA   . ILE A 1 12  ? 0.839   -0.657  -4.221  1.00 0.00 ? 12  ILE A HA   1  
ATOM 188   H HB   . ILE A 1 12  ? -0.286  -1.393  -6.922  1.00 0.00 ? 12  ILE A HB   1  
ATOM 189   H HG12 . ILE A 1 12  ? 0.565   1.145   -6.201  1.00 0.00 ? 12  ILE A HG12 1  
ATOM 190   H HG13 . ILE A 1 12  ? -0.707  0.817   -7.368  1.00 0.00 ? 12  ILE A HG13 1  
ATOM 191   H HG21 . ILE A 1 12  ? -2.432  -0.862  -5.678  1.00 0.00 ? 12  ILE A HG21 1  
ATOM 192   H HG22 . ILE A 1 12  ? -1.470  -0.879  -4.206  1.00 0.00 ? 12  ILE A HG22 1  
ATOM 193   H HG23 . ILE A 1 12  ? -1.601  -2.334  -5.193  1.00 0.00 ? 12  ILE A HG23 1  
ATOM 194   H HD11 . ILE A 1 12  ? -2.391  1.384   -5.902  1.00 0.00 ? 12  ILE A HD11 1  
ATOM 195   H HD12 . ILE A 1 12  ? -1.111  2.415   -5.281  1.00 0.00 ? 12  ILE A HD12 1  
ATOM 196   H HD13 . ILE A 1 12  ? -1.470  0.900   -4.481  1.00 0.00 ? 12  ILE A HD13 1  
ATOM 197   N N    . VAL A 1 13  ? 1.364   -3.439  -5.898  1.00 0.00 ? 13  VAL A N    1  
ATOM 198   C CA   . VAL A 1 13  ? 1.356   -4.920  -5.737  1.00 0.00 ? 13  VAL A CA   1  
ATOM 199   C C    . VAL A 1 13  ? 1.995   -5.303  -4.398  1.00 0.00 ? 13  VAL A C    1  
ATOM 200   O O    . VAL A 1 13  ? 1.421   -6.032  -3.621  1.00 0.00 ? 13  VAL A O    1  
ATOM 201   C CB   . VAL A 1 13  ? 2.144   -5.549  -6.886  1.00 0.00 ? 13  VAL A CB   1  
ATOM 202   C CG1  . VAL A 1 13  ? 2.337   -7.044  -6.628  1.00 0.00 ? 13  VAL A CG1  1  
ATOM 203   C CG2  . VAL A 1 13  ? 1.366   -5.348  -8.188  1.00 0.00 ? 13  VAL A CG2  1  
ATOM 204   H H    . VAL A 1 13  ? 1.687   -3.042  -6.732  1.00 0.00 ? 13  VAL A H    1  
ATOM 205   H HA   . VAL A 1 13  ? 0.338   -5.278  -5.764  1.00 0.00 ? 13  VAL A HA   1  
ATOM 206   H HB   . VAL A 1 13  ? 3.109   -5.070  -6.965  1.00 0.00 ? 13  VAL A HB   1  
ATOM 207   H HG11 . VAL A 1 13  ? 1.398   -7.558  -6.766  1.00 0.00 ? 13  VAL A HG11 1  
ATOM 208   H HG12 . VAL A 1 13  ? 2.683   -7.193  -5.615  1.00 0.00 ? 13  VAL A HG12 1  
ATOM 209   H HG13 . VAL A 1 13  ? 3.069   -7.437  -7.318  1.00 0.00 ? 13  VAL A HG13 1  
ATOM 210   H HG21 . VAL A 1 13  ? 1.720   -6.044  -8.931  1.00 0.00 ? 13  VAL A HG21 1  
ATOM 211   H HG22 . VAL A 1 13  ? 1.514   -4.339  -8.540  1.00 0.00 ? 13  VAL A HG22 1  
ATOM 212   H HG23 . VAL A 1 13  ? 0.314   -5.514  -8.009  1.00 0.00 ? 13  VAL A HG23 1  
ATOM 213   N N    . GLN A 1 14  ? 3.167   -4.814  -4.109  1.00 0.00 ? 14  GLN A N    1  
ATOM 214   C CA   . GLN A 1 14  ? 3.797   -5.162  -2.804  1.00 0.00 ? 14  GLN A CA   1  
ATOM 215   C C    . GLN A 1 14  ? 2.873   -4.697  -1.675  1.00 0.00 ? 14  GLN A C    1  
ATOM 216   O O    . GLN A 1 14  ? 2.840   -5.269  -0.606  1.00 0.00 ? 14  GLN A O    1  
ATOM 217   C CB   . GLN A 1 14  ? 5.151   -4.463  -2.680  1.00 0.00 ? 14  GLN A CB   1  
ATOM 218   C CG   . GLN A 1 14  ? 6.131   -5.063  -3.686  1.00 0.00 ? 14  GLN A CG   1  
ATOM 219   C CD   . GLN A 1 14  ? 6.956   -3.942  -4.318  1.00 0.00 ? 14  GLN A CD   1  
ATOM 220   O OE1  . GLN A 1 14  ? 7.085   -3.872  -5.524  1.00 0.00 ? 14  GLN A OE1  1  
ATOM 221   N NE2  . GLN A 1 14  ? 7.524   -3.055  -3.548  1.00 0.00 ? 14  GLN A NE2  1  
ATOM 222   H H    . GLN A 1 14  ? 3.624   -4.217  -4.737  1.00 0.00 ? 14  GLN A H    1  
ATOM 223   H HA   . GLN A 1 14  ? 3.932   -6.232  -2.741  1.00 0.00 ? 14  GLN A HA   1  
ATOM 224   H HB2  . GLN A 1 14  ? 5.030   -3.408  -2.880  1.00 0.00 ? 14  GLN A HB2  1  
ATOM 225   H HB3  . GLN A 1 14  ? 5.536   -4.599  -1.680  1.00 0.00 ? 14  GLN A HB3  1  
ATOM 226   H HG2  . GLN A 1 14  ? 6.787   -5.756  -3.180  1.00 0.00 ? 14  GLN A HG2  1  
ATOM 227   H HG3  . GLN A 1 14  ? 5.582   -5.582  -4.456  1.00 0.00 ? 14  GLN A HG3  1  
ATOM 228   H HE21 . GLN A 1 14  ? 7.420   -3.113  -2.575  1.00 0.00 ? 14  GLN A HE21 1  
ATOM 229   H HE22 . GLN A 1 14  ? 8.050   -2.329  -3.942  1.00 0.00 ? 14  GLN A HE22 1  
ATOM 230   N N    . ALA A 1 15  ? 2.124   -3.655  -1.915  1.00 0.00 ? 15  ALA A N    1  
ATOM 231   C CA   . ALA A 1 15  ? 1.194   -3.131  -0.871  1.00 0.00 ? 15  ALA A CA   1  
ATOM 232   C C    . ALA A 1 15  ? 0.065   -4.131  -0.614  1.00 0.00 ? 15  ALA A C    1  
ATOM 233   O O    . ALA A 1 15  ? 0.011   -4.771  0.418   1.00 0.00 ? 15  ALA A O    1  
ATOM 234   C CB   . ALA A 1 15  ? 0.579   -1.815  -1.353  1.00 0.00 ? 15  ALA A CB   1  
ATOM 235   H H    . ALA A 1 15  ? 2.175   -3.212  -2.786  1.00 0.00 ? 15  ALA A H    1  
ATOM 236   H HA   . ALA A 1 15  ? 1.739   -2.957  0.044   1.00 0.00 ? 15  ALA A HA   1  
ATOM 237   H HB1  . ALA A 1 15  ? -0.484  -1.942  -1.491  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 238   H HB2  . ALA A 1 15  ? 1.033   -1.527  -2.290  1.00 0.00 ? 15  ALA A HB2  1  
ATOM 239   H HB3  . ALA A 1 15  ? 0.757   -1.044  -0.618  1.00 0.00 ? 15  ALA A HB3  1  
ATOM 240   N N    . ILE A 1 16  ? -0.851  -4.250  -1.536  1.00 0.00 ? 16  ILE A N    1  
ATOM 241   C CA   . ILE A 1 16  ? -1.998  -5.190  -1.336  1.00 0.00 ? 16  ILE A CA   1  
ATOM 242   C C    . ILE A 1 16  ? -1.509  -6.641  -1.335  1.00 0.00 ? 16  ILE A C    1  
ATOM 243   O O    . ILE A 1 16  ? -1.832  -7.413  -0.454  1.00 0.00 ? 16  ILE A O    1  
ATOM 244   C CB   . ILE A 1 16  ? -3.048  -5.010  -2.447  1.00 0.00 ? 16  ILE A CB   1  
ATOM 245   C CG1  . ILE A 1 16  ? -2.389  -4.578  -3.761  1.00 0.00 ? 16  ILE A CG1  1  
ATOM 246   C CG2  . ILE A 1 16  ? -4.056  -3.941  -2.033  1.00 0.00 ? 16  ILE A CG2  1  
ATOM 247   C CD1  . ILE A 1 16  ? -3.451  -4.528  -4.858  1.00 0.00 ? 16  ILE A CD1  1  
ATOM 248   H H    . ILE A 1 16  ? -0.791  -3.705  -2.350  1.00 0.00 ? 16  ILE A H    1  
ATOM 249   H HA   . ILE A 1 16  ? -2.459  -4.977  -0.382  1.00 0.00 ? 16  ILE A HA   1  
ATOM 250   H HB   . ILE A 1 16  ? -3.566  -5.947  -2.597  1.00 0.00 ? 16  ILE A HB   1  
ATOM 251   H HG12 . ILE A 1 16  ? -1.958  -3.596  -3.645  1.00 0.00 ? 16  ILE A HG12 1  
ATOM 252   H HG13 . ILE A 1 16  ? -1.622  -5.283  -4.038  1.00 0.00 ? 16  ILE A HG13 1  
ATOM 253   H HG21 . ILE A 1 16  ? -4.947  -4.036  -2.634  1.00 0.00 ? 16  ILE A HG21 1  
ATOM 254   H HG22 . ILE A 1 16  ? -3.624  -2.963  -2.182  1.00 0.00 ? 16  ILE A HG22 1  
ATOM 255   H HG23 . ILE A 1 16  ? -4.307  -4.068  -0.993  1.00 0.00 ? 16  ILE A HG23 1  
ATOM 256   H HD11 . ILE A 1 16  ? -4.432  -4.602  -4.413  1.00 0.00 ? 16  ILE A HD11 1  
ATOM 257   H HD12 . ILE A 1 16  ? -3.301  -5.345  -5.539  1.00 0.00 ? 16  ILE A HD12 1  
ATOM 258   H HD13 . ILE A 1 16  ? -3.368  -3.596  -5.392  1.00 0.00 ? 16  ILE A HD13 1  
ATOM 259   N N    . SER A 1 17  ? -0.751  -7.025  -2.321  1.00 0.00 ? 17  SER A N    1  
ATOM 260   C CA   . SER A 1 17  ? -0.261  -8.434  -2.389  1.00 0.00 ? 17  SER A CA   1  
ATOM 261   C C    . SER A 1 17  ? 0.455   -8.822  -1.091  1.00 0.00 ? 17  SER A C    1  
ATOM 262   O O    . SER A 1 17  ? 0.383   -9.953  -0.653  1.00 0.00 ? 17  SER A O    1  
ATOM 263   C CB   . SER A 1 17  ? 0.713   -8.577  -3.559  1.00 0.00 ? 17  SER A CB   1  
ATOM 264   O OG   . SER A 1 17  ? 0.159   -7.953  -4.709  1.00 0.00 ? 17  SER A OG   1  
ATOM 265   H H    . SER A 1 17  ? -0.516  -6.392  -3.029  1.00 0.00 ? 17  SER A H    1  
ATOM 266   H HA   . SER A 1 17  ? -1.100  -9.096  -2.544  1.00 0.00 ? 17  SER A HA   1  
ATOM 267   H HB2  . SER A 1 17  ? 1.646   -8.099  -3.312  1.00 0.00 ? 17  SER A HB2  1  
ATOM 268   H HB3  . SER A 1 17  ? 0.889   -9.627  -3.754  1.00 0.00 ? 17  SER A HB3  1  
ATOM 269   H HG   . SER A 1 17  ? 0.181   -8.587  -5.429  1.00 0.00 ? 17  SER A HG   1  
ATOM 270   N N    . SER A 1 18  ? 1.155   -7.909  -0.477  1.00 0.00 ? 18  SER A N    1  
ATOM 271   C CA   . SER A 1 18  ? 1.878   -8.259  0.781   1.00 0.00 ? 18  SER A CA   1  
ATOM 272   C C    . SER A 1 18  ? 0.984   -7.995  1.994   1.00 0.00 ? 18  SER A C    1  
ATOM 273   O O    . SER A 1 18  ? 1.236   -8.484  3.078   1.00 0.00 ? 18  SER A O    1  
ATOM 274   C CB   . SER A 1 18  ? 3.145   -7.413  0.893   1.00 0.00 ? 18  SER A CB   1  
ATOM 275   O OG   . SER A 1 18  ? 3.831   -7.434  -0.352  1.00 0.00 ? 18  SER A OG   1  
ATOM 276   H H    . SER A 1 18  ? 1.214   -7.003  -0.844  1.00 0.00 ? 18  SER A H    1  
ATOM 277   H HA   . SER A 1 18  ? 2.148   -9.304  0.759   1.00 0.00 ? 18  SER A HA   1  
ATOM 278   H HB2  . SER A 1 18  ? 2.881   -6.399  1.138   1.00 0.00 ? 18  SER A HB2  1  
ATOM 279   H HB3  . SER A 1 18  ? 3.778   -7.815  1.672   1.00 0.00 ? 18  SER A HB3  1  
ATOM 280   H HG   . SER A 1 18  ? 3.745   -8.315  -0.724  1.00 0.00 ? 18  SER A HG   1  
ATOM 281   N N    . ALA A 1 19  ? -0.055  -7.226  1.829   1.00 0.00 ? 19  ALA A N    1  
ATOM 282   C CA   . ALA A 1 19  ? -0.952  -6.938  2.982   1.00 0.00 ? 19  ALA A CA   1  
ATOM 283   C C    . ALA A 1 19  ? -1.584  -8.242  3.476   1.00 0.00 ? 19  ALA A C    1  
ATOM 284   O O    . ALA A 1 19  ? -1.054  -9.315  3.267   1.00 0.00 ? 19  ALA A O    1  
ATOM 285   C CB   . ALA A 1 19  ? -2.049  -5.964  2.545   1.00 0.00 ? 19  ALA A CB   1  
ATOM 286   H H    . ALA A 1 19  ? -0.244  -6.837  0.949   1.00 0.00 ? 19  ALA A H    1  
ATOM 287   H HA   . ALA A 1 19  ? -0.377  -6.493  3.781   1.00 0.00 ? 19  ALA A HA   1  
ATOM 288   H HB1  . ALA A 1 19  ? -2.227  -5.247  3.333   1.00 0.00 ? 19  ALA A HB1  1  
ATOM 289   H HB2  . ALA A 1 19  ? -2.958  -6.511  2.346   1.00 0.00 ? 19  ALA A HB2  1  
ATOM 290   H HB3  . ALA A 1 19  ? -1.735  -5.447  1.651   1.00 0.00 ? 19  ALA A HB3  1  
ATOM 291   N N    . GLN A 1 20  ? -2.709  -8.159  4.134   1.00 0.00 ? 20  GLN A N    1  
ATOM 292   C CA   . GLN A 1 20  ? -3.372  -9.395  4.642   1.00 0.00 ? 20  GLN A CA   1  
ATOM 293   C C    . GLN A 1 20  ? -3.471  -10.423 3.507   1.00 0.00 ? 20  GLN A C    1  
ATOM 294   O O    . GLN A 1 20  ? -2.520  -11.118 3.207   1.00 0.00 ? 20  GLN A O    1  
ATOM 295   C CB   . GLN A 1 20  ? -4.774  -9.050  5.156   1.00 0.00 ? 20  GLN A CB   1  
ATOM 296   C CG   . GLN A 1 20  ? -5.392  -7.955  4.282   1.00 0.00 ? 20  GLN A CG   1  
ATOM 297   C CD   . GLN A 1 20  ? -5.610  -6.694  5.120   1.00 0.00 ? 20  GLN A CD   1  
ATOM 298   O OE1  . GLN A 1 20  ? -6.252  -6.739  6.150   1.00 0.00 ? 20  GLN A OE1  1  
ATOM 299   N NE2  . GLN A 1 20  ? -5.098  -5.563  4.719   1.00 0.00 ? 20  GLN A NE2  1  
ATOM 300   H H    . GLN A 1 20  ? -3.119  -7.284  4.294   1.00 0.00 ? 20  GLN A H    1  
ATOM 301   H HA   . GLN A 1 20  ? -2.786  -9.809  5.448   1.00 0.00 ? 20  GLN A HA   1  
ATOM 302   H HB2  . GLN A 1 20  ? -5.396  -9.932  5.122   1.00 0.00 ? 20  GLN A HB2  1  
ATOM 303   H HB3  . GLN A 1 20  ? -4.705  -8.698  6.175   1.00 0.00 ? 20  GLN A HB3  1  
ATOM 304   H HG2  . GLN A 1 20  ? -4.730  -7.731  3.459   1.00 0.00 ? 20  GLN A HG2  1  
ATOM 305   H HG3  . GLN A 1 20  ? -6.341  -8.296  3.897   1.00 0.00 ? 20  GLN A HG3  1  
ATOM 306   H HE21 . GLN A 1 20  ? -4.581  -5.527  3.888   1.00 0.00 ? 20  GLN A HE21 1  
ATOM 307   H HE22 . GLN A 1 20  ? -5.234  -4.750  5.248   1.00 0.00 ? 20  GLN A HE22 1  
ATOM 308   N N    . ASP A 1 21  ? -4.606  -10.526 2.867   1.00 0.00 ? 21  ASP A N    1  
ATOM 309   C CA   . ASP A 1 21  ? -4.739  -11.504 1.753   1.00 0.00 ? 21  ASP A CA   1  
ATOM 310   C C    . ASP A 1 21  ? -4.117  -10.902 0.491   1.00 0.00 ? 21  ASP A C    1  
ATOM 311   O O    . ASP A 1 21  ? -3.086  -11.340 0.024   1.00 0.00 ? 21  ASP A O    1  
ATOM 312   C CB   . ASP A 1 21  ? -6.219  -11.800 1.501   1.00 0.00 ? 21  ASP A CB   1  
ATOM 313   C CG   . ASP A 1 21  ? -6.815  -12.501 2.723   1.00 0.00 ? 21  ASP A CG   1  
ATOM 314   O OD1  . ASP A 1 21  ? -6.439  -12.146 3.828   1.00 0.00 ? 21  ASP A OD1  1  
ATOM 315   O OD2  . ASP A 1 21  ? -7.640  -13.380 2.532   1.00 0.00 ? 21  ASP A OD2  1  
ATOM 316   H H    . ASP A 1 21  ? -5.364  -9.958  3.112   1.00 0.00 ? 21  ASP A H    1  
ATOM 317   H HA   . ASP A 1 21  ? -4.224  -12.418 2.009   1.00 0.00 ? 21  ASP A HA   1  
ATOM 318   H HB2  . ASP A 1 21  ? -6.746  -10.874 1.322   1.00 0.00 ? 21  ASP A HB2  1  
ATOM 319   H HB3  . ASP A 1 21  ? -6.315  -12.441 0.638   1.00 0.00 ? 21  ASP A HB3  1  
ATOM 320   N N    . ARG A 1 22  ? -4.738  -9.895  -0.056  1.00 0.00 ? 22  ARG A N    1  
ATOM 321   C CA   . ARG A 1 22  ? -4.186  -9.254  -1.283  1.00 0.00 ? 22  ARG A CA   1  
ATOM 322   C C    . ARG A 1 22  ? -5.018  -8.015  -1.629  1.00 0.00 ? 22  ARG A C    1  
ATOM 323   O O    . ARG A 1 22  ? -5.119  -7.626  -2.775  1.00 0.00 ? 22  ARG A O    1  
ATOM 324   C CB   . ARG A 1 22  ? -4.238  -10.249 -2.443  1.00 0.00 ? 22  ARG A CB   1  
ATOM 325   C CG   . ARG A 1 22  ? -5.628  -10.885 -2.510  1.00 0.00 ? 22  ARG A CG   1  
ATOM 326   C CD   . ARG A 1 22  ? -5.540  -12.219 -3.254  1.00 0.00 ? 22  ARG A CD   1  
ATOM 327   N NE   . ARG A 1 22  ? -6.865  -12.900 -3.218  1.00 0.00 ? 22  ARG A NE   1  
ATOM 328   C CZ   . ARG A 1 22  ? -7.859  -12.435 -3.925  1.00 0.00 ? 22  ARG A CZ   1  
ATOM 329   N NH1  . ARG A 1 22  ? -7.777  -12.409 -5.227  1.00 0.00 ? 22  ARG A NH1  1  
ATOM 330   N NH2  . ARG A 1 22  ? -8.935  -11.995 -3.330  1.00 0.00 ? 22  ARG A NH2  1  
ATOM 331   H H    . ARG A 1 22  ? -5.566  -9.557  0.342   1.00 0.00 ? 22  ARG A H    1  
ATOM 332   H HA   . ARG A 1 22  ? -3.162  -8.961  -1.105  1.00 0.00 ? 22  ARG A HA   1  
ATOM 333   H HB2  . ARG A 1 22  ? -4.031  -9.731  -3.370  1.00 0.00 ? 22  ARG A HB2  1  
ATOM 334   H HB3  . ARG A 1 22  ? -3.499  -11.020 -2.288  1.00 0.00 ? 22  ARG A HB3  1  
ATOM 335   H HG2  . ARG A 1 22  ? -5.996  -11.052 -1.508  1.00 0.00 ? 22  ARG A HG2  1  
ATOM 336   H HG3  . ARG A 1 22  ? -6.301  -10.225 -3.036  1.00 0.00 ? 22  ARG A HG3  1  
ATOM 337   H HD2  . ARG A 1 22  ? -5.255  -12.040 -4.280  1.00 0.00 ? 22  ARG A HD2  1  
ATOM 338   H HD3  . ARG A 1 22  ? -4.800  -12.846 -2.779  1.00 0.00 ? 22  ARG A HD3  1  
ATOM 339   H HE   . ARG A 1 22  ? -6.989  -13.700 -2.666  1.00 0.00 ? 22  ARG A HE   1  
ATOM 340   H HH11 . ARG A 1 22  ? -6.952  -12.746 -5.682  1.00 0.00 ? 22  ARG A HH11 1  
ATOM 341   H HH12 . ARG A 1 22  ? -8.537  -12.055 -5.769  1.00 0.00 ? 22  ARG A HH12 1  
ATOM 342   H HH21 . ARG A 1 22  ? -8.999  -12.016 -2.333  1.00 0.00 ? 22  ARG A HH21 1  
ATOM 343   H HH22 . ARG A 1 22  ? -9.697  -11.640 -3.872  1.00 0.00 ? 22  ARG A HH22 1  
ATOM 344   N N    . GLN A 1 23  ? -5.611  -7.395  -0.645  1.00 0.00 ? 23  GLN A N    1  
ATOM 345   C CA   . GLN A 1 23  ? -6.436  -6.182  -0.909  1.00 0.00 ? 23  GLN A CA   1  
ATOM 346   C C    . GLN A 1 23  ? -6.079  -5.098  0.110   1.00 0.00 ? 23  GLN A C    1  
ATOM 347   O O    . GLN A 1 23  ? -5.531  -5.381  1.157   1.00 0.00 ? 23  GLN A O    1  
ATOM 348   C CB   . GLN A 1 23  ? -7.919  -6.541  -0.781  1.00 0.00 ? 23  GLN A CB   1  
ATOM 349   C CG   . GLN A 1 23  ? -8.178  -7.148  0.600   1.00 0.00 ? 23  GLN A CG   1  
ATOM 350   C CD   . GLN A 1 23  ? -9.429  -8.027  0.545   1.00 0.00 ? 23  GLN A CD   1  
ATOM 351   O OE1  . GLN A 1 23  ? -9.967  -8.273  -0.517  1.00 0.00 ? 23  GLN A OE1  1  
ATOM 352   N NE2  . GLN A 1 23  ? -9.919  -8.516  1.651   1.00 0.00 ? 23  GLN A NE2  1  
ATOM 353   H H    . GLN A 1 23  ? -5.513  -7.724  0.272   1.00 0.00 ? 23  GLN A H    1  
ATOM 354   H HA   . GLN A 1 23  ? -6.237  -5.820  -1.907  1.00 0.00 ? 23  GLN A HA   1  
ATOM 355   H HB2  . GLN A 1 23  ? -8.518  -5.651  -0.903  1.00 0.00 ? 23  GLN A HB2  1  
ATOM 356   H HB3  . GLN A 1 23  ? -8.182  -7.261  -1.541  1.00 0.00 ? 23  GLN A HB3  1  
ATOM 357   H HG2  . GLN A 1 23  ? -7.328  -7.748  0.893   1.00 0.00 ? 23  GLN A HG2  1  
ATOM 358   H HG3  . GLN A 1 23  ? -8.327  -6.358  1.320   1.00 0.00 ? 23  GLN A HG3  1  
ATOM 359   H HE21 . GLN A 1 23  ? -9.486  -8.319  2.507   1.00 0.00 ? 23  GLN A HE21 1  
ATOM 360   H HE22 . GLN A 1 23  ? -10.719 -9.079  1.625   1.00 0.00 ? 23  GLN A HE22 1  
ATOM 361   N N    . LEU A 1 24  ? -6.374  -3.857  -0.180  1.00 0.00 ? 24  LEU A N    1  
ATOM 362   C CA   . LEU A 1 24  ? -6.038  -2.779  0.779   1.00 0.00 ? 24  LEU A CA   1  
ATOM 363   C C    . LEU A 1 24  ? -7.041  -1.645  0.651   1.00 0.00 ? 24  LEU A C    1  
ATOM 364   O O    . LEU A 1 24  ? -7.677  -1.470  -0.374  1.00 0.00 ? 24  LEU A O    1  
ATOM 365   C CB   . LEU A 1 24  ? -4.653  -2.222  0.458   1.00 0.00 ? 24  LEU A CB   1  
ATOM 366   C CG   . LEU A 1 24  ? -3.580  -3.108  1.092   1.00 0.00 ? 24  LEU A CG   1  
ATOM 367   C CD1  . LEU A 1 24  ? -2.196  -2.585  0.710   1.00 0.00 ? 24  LEU A CD1  1  
ATOM 368   C CD2  . LEU A 1 24  ? -3.735  -3.075  2.613   1.00 0.00 ? 24  LEU A CD2  1  
ATOM 369   H H    . LEU A 1 24  ? -6.810  -3.634  -1.024  1.00 0.00 ? 24  LEU A H    1  
ATOM 370   H HA   . LEU A 1 24  ? -6.048  -3.166  1.786   1.00 0.00 ? 24  LEU A HA   1  
ATOM 371   H HB2  . LEU A 1 24  ? -4.512  -2.178  -0.615  1.00 0.00 ? 24  LEU A HB2  1  
ATOM 372   H HB3  . LEU A 1 24  ? -4.579  -1.231  0.860   1.00 0.00 ? 24  LEU A HB3  1  
ATOM 373   H HG   . LEU A 1 24  ? -3.692  -4.123  0.739   1.00 0.00 ? 24  LEU A HG   1  
ATOM 374   H HD11 . LEU A 1 24  ? -2.144  -2.451  -0.360  1.00 0.00 ? 24  LEU A HD11 1  
ATOM 375   H HD12 . LEU A 1 24  ? -1.445  -3.294  1.022   1.00 0.00 ? 24  LEU A HD12 1  
ATOM 376   H HD13 . LEU A 1 24  ? -2.023  -1.637  1.200   1.00 0.00 ? 24  LEU A HD13 1  
ATOM 377   H HD21 . LEU A 1 24  ? -2.807  -3.375  3.076   1.00 0.00 ? 24  LEU A HD21 1  
ATOM 378   H HD22 . LEU A 1 24  ? -4.520  -3.755  2.909   1.00 0.00 ? 24  LEU A HD22 1  
ATOM 379   H HD23 . LEU A 1 24  ? -3.988  -2.073  2.928   1.00 0.00 ? 24  LEU A HD23 1  
ATOM 380   N N    . THR A 1 25  ? -7.160  -0.844  1.669   1.00 0.00 ? 25  THR A N    1  
ATOM 381   C CA   . THR A 1 25  ? -8.085  0.309   1.588   1.00 0.00 ? 25  THR A CA   1  
ATOM 382   C C    . THR A 1 25  ? -7.354  1.411   0.827   1.00 0.00 ? 25  THR A C    1  
ATOM 383   O O    . THR A 1 25  ? -6.166  1.319   0.589   1.00 0.00 ? 25  THR A O    1  
ATOM 384   C CB   . THR A 1 25  ? -8.456  0.802   2.993   1.00 0.00 ? 25  THR A CB   1  
ATOM 385   O OG1  . THR A 1 25  ? -7.648  1.923   3.327   1.00 0.00 ? 25  THR A OG1  1  
ATOM 386   C CG2  . THR A 1 25  ? -8.232  -0.312  4.020   1.00 0.00 ? 25  THR A CG2  1  
ATOM 387   H H    . THR A 1 25  ? -6.615  -0.985  2.471   1.00 0.00 ? 25  THR A H    1  
ATOM 388   H HA   . THR A 1 25  ? -8.978  0.024   1.048   1.00 0.00 ? 25  THR A HA   1  
ATOM 389   H HB   . THR A 1 25  ? -9.495  1.092   3.007   1.00 0.00 ? 25  THR A HB   1  
ATOM 390   H HG1  . THR A 1 25  ? -7.505  1.915   4.276   1.00 0.00 ? 25  THR A HG1  1  
ATOM 391   H HG21 . THR A 1 25  ? -7.231  -0.240  4.418   1.00 0.00 ? 25  THR A HG21 1  
ATOM 392   H HG22 . THR A 1 25  ? -8.361  -1.273  3.545   1.00 0.00 ? 25  THR A HG22 1  
ATOM 393   H HG23 . THR A 1 25  ? -8.946  -0.209  4.825   1.00 0.00 ? 25  THR A HG23 1  
ATOM 394   N N    . LEU A 1 26  ? -8.032  2.441   0.436   1.00 0.00 ? 26  LEU A N    1  
ATOM 395   C CA   . LEU A 1 26  ? -7.332  3.523   -0.317  1.00 0.00 ? 26  LEU A CA   1  
ATOM 396   C C    . LEU A 1 26  ? -6.073  3.938   0.448   1.00 0.00 ? 26  LEU A C    1  
ATOM 397   O O    . LEU A 1 26  ? -5.067  4.285   -0.139  1.00 0.00 ? 26  LEU A O    1  
ATOM 398   C CB   . LEU A 1 26  ? -8.257  4.734   -0.491  1.00 0.00 ? 26  LEU A CB   1  
ATOM 399   C CG   . LEU A 1 26  ? -8.212  5.207   -1.942  1.00 0.00 ? 26  LEU A CG   1  
ATOM 400   C CD1  . LEU A 1 26  ? -9.411  6.114   -2.218  1.00 0.00 ? 26  LEU A CD1  1  
ATOM 401   C CD2  . LEU A 1 26  ? -6.920  5.988   -2.183  1.00 0.00 ? 26  LEU A CD2  1  
ATOM 402   H H    . LEU A 1 26  ? -8.990  2.502   0.627   1.00 0.00 ? 26  LEU A H    1  
ATOM 403   H HA   . LEU A 1 26  ? -7.041  3.151   -1.289  1.00 0.00 ? 26  LEU A HA   1  
ATOM 404   H HB2  . LEU A 1 26  ? -9.272  4.465   -0.235  1.00 0.00 ? 26  LEU A HB2  1  
ATOM 405   H HB3  . LEU A 1 26  ? -7.926  5.531   0.153   1.00 0.00 ? 26  LEU A HB3  1  
ATOM 406   H HG   . LEU A 1 26  ? -8.247  4.349   -2.601  1.00 0.00 ? 26  LEU A HG   1  
ATOM 407   H HD11 . LEU A 1 26  ? -10.137 6.001   -1.426  1.00 0.00 ? 26  LEU A HD11 1  
ATOM 408   H HD12 . LEU A 1 26  ? -9.860  5.842   -3.161  1.00 0.00 ? 26  LEU A HD12 1  
ATOM 409   H HD13 . LEU A 1 26  ? -9.083  7.142   -2.258  1.00 0.00 ? 26  LEU A HD13 1  
ATOM 410   H HD21 . LEU A 1 26  ? -6.364  5.528   -2.986  1.00 0.00 ? 26  LEU A HD21 1  
ATOM 411   H HD22 . LEU A 1 26  ? -6.322  5.984   -1.283  1.00 0.00 ? 26  LEU A HD22 1  
ATOM 412   H HD23 . LEU A 1 26  ? -7.160  7.007   -2.450  1.00 0.00 ? 26  LEU A HD23 1  
ATOM 413   N N    . SER A 1 27  ? -6.117  3.911   1.752   1.00 0.00 ? 27  SER A N    1  
ATOM 414   C CA   . SER A 1 27  ? -4.919  4.306   2.547   1.00 0.00 ? 27  SER A CA   1  
ATOM 415   C C    . SER A 1 27  ? -4.161  3.069   3.032   1.00 0.00 ? 27  SER A C    1  
ATOM 416   O O    . SER A 1 27  ? -3.778  2.983   4.181   1.00 0.00 ? 27  SER A O    1  
ATOM 417   C CB   . SER A 1 27  ? -5.359  5.116   3.754   1.00 0.00 ? 27  SER A CB   1  
ATOM 418   O OG   . SER A 1 27  ? -5.926  6.345   3.319   1.00 0.00 ? 27  SER A OG   1  
ATOM 419   H H    . SER A 1 27  ? -6.937  3.629   2.209   1.00 0.00 ? 27  SER A H    1  
ATOM 420   H HA   . SER A 1 27  ? -4.269  4.905   1.934   1.00 0.00 ? 27  SER A HA   1  
ATOM 421   H HB2  . SER A 1 27  ? -6.095  4.558   4.308   1.00 0.00 ? 27  SER A HB2  1  
ATOM 422   H HB3  . SER A 1 27  ? -4.502  5.302   4.385   1.00 0.00 ? 27  SER A HB3  1  
ATOM 423   H HG   . SER A 1 27  ? -5.512  6.583   2.485   1.00 0.00 ? 27  SER A HG   1  
ATOM 424   N N    . GLY A 1 28  ? -3.920  2.123   2.177   1.00 0.00 ? 28  GLY A N    1  
ATOM 425   C CA   . GLY A 1 28  ? -3.162  0.915   2.610   1.00 0.00 ? 28  GLY A CA   1  
ATOM 426   C C    . GLY A 1 28  ? -1.731  1.065   2.122   1.00 0.00 ? 28  GLY A C    1  
ATOM 427   O O    . GLY A 1 28  ? -0.778  1.047   2.876   1.00 0.00 ? 28  GLY A O    1  
ATOM 428   H H    . GLY A 1 28  ? -4.205  2.217   1.240   1.00 0.00 ? 28  GLY A H    1  
ATOM 429   H HA2  . GLY A 1 28  ? -3.175  0.841   3.688   1.00 0.00 ? 28  GLY A HA2  1  
ATOM 430   H HA3  . GLY A 1 28  ? -3.606  0.031   2.178   1.00 0.00 ? 28  GLY A HA3  1  
ATOM 431   N N    . ILE A 1 29  ? -1.604  1.223   0.846   1.00 0.00 ? 29  ILE A N    1  
ATOM 432   C CA   . ILE A 1 29  ? -0.286  1.395   0.204   1.00 0.00 ? 29  ILE A CA   1  
ATOM 433   C C    . ILE A 1 29  ? 0.462   2.564   0.831   1.00 0.00 ? 29  ILE A C    1  
ATOM 434   O O    . ILE A 1 29  ? 1.674   2.585   0.905   1.00 0.00 ? 29  ILE A O    1  
ATOM 435   C CB   . ILE A 1 29  ? -0.548  1.682   -1.258  1.00 0.00 ? 29  ILE A CB   1  
ATOM 436   C CG1  . ILE A 1 29  ? 0.712   1.419   -2.066  1.00 0.00 ? 29  ILE A CG1  1  
ATOM 437   C CG2  . ILE A 1 29  ? -0.978  3.140   -1.434  1.00 0.00 ? 29  ILE A CG2  1  
ATOM 438   C CD1  . ILE A 1 29  ? 0.475   1.948   -3.463  1.00 0.00 ? 29  ILE A CD1  1  
ATOM 439   H H    . ILE A 1 29  ? -2.403  1.233   0.289   1.00 0.00 ? 29  ILE A H    1  
ATOM 440   H HA   . ILE A 1 29  ? 0.290   0.500   0.297   1.00 0.00 ? 29  ILE A HA   1  
ATOM 441   H HB   . ILE A 1 29  ? -1.345  1.043   -1.604  1.00 0.00 ? 29  ILE A HB   1  
ATOM 442   H HG12 . ILE A 1 29  ? 1.549   1.933   -1.614  1.00 0.00 ? 29  ILE A HG12 1  
ATOM 443   H HG13 . ILE A 1 29  ? 0.908   0.362   -2.107  1.00 0.00 ? 29  ILE A HG13 1  
ATOM 444   H HG21 . ILE A 1 29  ? -1.442  3.261   -2.401  1.00 0.00 ? 29  ILE A HG21 1  
ATOM 445   H HG22 . ILE A 1 29  ? -0.110  3.777   -1.371  1.00 0.00 ? 29  ILE A HG22 1  
ATOM 446   H HG23 . ILE A 1 29  ? -1.682  3.407   -0.659  1.00 0.00 ? 29  ILE A HG23 1  
ATOM 447   H HD11 . ILE A 1 29  ? 0.666   1.172   -4.182  1.00 0.00 ? 29  ILE A HD11 1  
ATOM 448   H HD12 . ILE A 1 29  ? 1.122   2.790   -3.644  1.00 0.00 ? 29  ILE A HD12 1  
ATOM 449   H HD13 . ILE A 1 29  ? -0.555  2.261   -3.535  1.00 0.00 ? 29  ILE A HD13 1  
ATOM 450   N N    . TYR A 1 30  ? -0.254  3.542   1.269   1.00 0.00 ? 30  TYR A N    1  
ATOM 451   C CA   . TYR A 1 30  ? 0.407   4.713   1.885   1.00 0.00 ? 30  TYR A CA   1  
ATOM 452   C C    . TYR A 1 30  ? 1.066   4.255   3.175   1.00 0.00 ? 30  TYR A C    1  
ATOM 453   O O    . TYR A 1 30  ? 2.210   4.555   3.439   1.00 0.00 ? 30  TYR A O    1  
ATOM 454   C CB   . TYR A 1 30  ? -0.649  5.780   2.141   1.00 0.00 ? 30  TYR A CB   1  
ATOM 455   C CG   . TYR A 1 30  ? -1.433  5.963   0.860   1.00 0.00 ? 30  TYR A CG   1  
ATOM 456   C CD1  . TYR A 1 30  ? -0.804  5.746   -0.374  1.00 0.00 ? 30  TYR A CD1  1  
ATOM 457   C CD2  . TYR A 1 30  ? -2.784  6.310   0.899   1.00 0.00 ? 30  TYR A CD2  1  
ATOM 458   C CE1  . TYR A 1 30  ? -1.522  5.881   -1.565  1.00 0.00 ? 30  TYR A CE1  1  
ATOM 459   C CE2  . TYR A 1 30  ? -3.507  6.442   -0.294  1.00 0.00 ? 30  TYR A CE2  1  
ATOM 460   C CZ   . TYR A 1 30  ? -2.877  6.228   -1.525  1.00 0.00 ? 30  TYR A CZ   1  
ATOM 461   O OH   . TYR A 1 30  ? -3.594  6.358   -2.697  1.00 0.00 ? 30  TYR A OH   1  
ATOM 462   H H    . TYR A 1 30  ? -1.231  3.509   1.185   1.00 0.00 ? 30  TYR A H    1  
ATOM 463   H HA   . TYR A 1 30  ? 1.158   5.100   1.214   1.00 0.00 ? 30  TYR A HA   1  
ATOM 464   H HB2  . TYR A 1 30  ? -1.309  5.456   2.933   1.00 0.00 ? 30  TYR A HB2  1  
ATOM 465   H HB3  . TYR A 1 30  ? -0.175  6.704   2.415   1.00 0.00 ? 30  TYR A HB3  1  
ATOM 466   H HD1  . TYR A 1 30  ? 0.240   5.477   -0.403  1.00 0.00 ? 30  TYR A HD1  1  
ATOM 467   H HD2  . TYR A 1 30  ? -3.272  6.478   1.849   1.00 0.00 ? 30  TYR A HD2  1  
ATOM 468   H HE1  . TYR A 1 30  ? -1.030  5.708   -2.514  1.00 0.00 ? 30  TYR A HE1  1  
ATOM 469   H HE2  . TYR A 1 30  ? -4.548  6.703   -0.264  1.00 0.00 ? 30  TYR A HE2  1  
ATOM 470   H HH   . TYR A 1 30  ? -4.525  6.242   -2.490  1.00 0.00 ? 30  TYR A HH   1  
ATOM 471   N N    . ALA A 1 31  ? 0.370   3.486   3.954   1.00 0.00 ? 31  ALA A N    1  
ATOM 472   C CA   . ALA A 1 31  ? 0.977   2.959   5.204   1.00 0.00 ? 31  ALA A CA   1  
ATOM 473   C C    . ALA A 1 31  ? 2.071   1.953   4.820   1.00 0.00 ? 31  ALA A C    1  
ATOM 474   O O    . ALA A 1 31  ? 2.917   1.603   5.618   1.00 0.00 ? 31  ALA A O    1  
ATOM 475   C CB   . ALA A 1 31  ? -0.097  2.258   6.039   1.00 0.00 ? 31  ALA A CB   1  
ATOM 476   H H    . ALA A 1 31  ? -0.540  3.231   3.700   1.00 0.00 ? 31  ALA A H    1  
ATOM 477   H HA   . ALA A 1 31  ? 1.410   3.771   5.770   1.00 0.00 ? 31  ALA A HA   1  
ATOM 478   H HB1  . ALA A 1 31  ? 0.132   2.371   7.088   1.00 0.00 ? 31  ALA A HB1  1  
ATOM 479   H HB2  . ALA A 1 31  ? -0.121  1.208   5.786   1.00 0.00 ? 31  ALA A HB2  1  
ATOM 480   H HB3  . ALA A 1 31  ? -1.060  2.700   5.831   1.00 0.00 ? 31  ALA A HB3  1  
ATOM 481   N N    . HIS A 1 32  ? 2.053   1.487   3.594   1.00 0.00 ? 32  HIS A N    1  
ATOM 482   C CA   . HIS A 1 32  ? 3.078   0.504   3.136   1.00 0.00 ? 32  HIS A CA   1  
ATOM 483   C C    . HIS A 1 32  ? 4.419   1.213   2.927   1.00 0.00 ? 32  HIS A C    1  
ATOM 484   O O    . HIS A 1 32  ? 5.295   1.178   3.766   1.00 0.00 ? 32  HIS A O    1  
ATOM 485   C CB   . HIS A 1 32  ? 2.596   -0.122  1.810   1.00 0.00 ? 32  HIS A CB   1  
ATOM 486   C CG   . HIS A 1 32  ? 3.750   -0.649  0.970   1.00 0.00 ? 32  HIS A CG   1  
ATOM 487   N ND1  . HIS A 1 32  ? 3.547   -1.118  -0.319  1.00 0.00 ? 32  HIS A ND1  1  
ATOM 488   C CD2  . HIS A 1 32  ? 5.105   -0.785  1.197   1.00 0.00 ? 32  HIS A CD2  1  
ATOM 489   C CE1  . HIS A 1 32  ? 4.736   -1.509  -0.808  1.00 0.00 ? 32  HIS A CE1  1  
ATOM 490   N NE2  . HIS A 1 32  ? 5.717   -1.328  0.073   1.00 0.00 ? 32  HIS A NE2  1  
ATOM 491   H H    . HIS A 1 32  ? 1.355   1.783   2.969   1.00 0.00 ? 32  HIS A H    1  
ATOM 492   H HA   . HIS A 1 32  ? 3.192   -0.271  3.879   1.00 0.00 ? 32  HIS A HA   1  
ATOM 493   H HB2  . HIS A 1 32  ? 1.913   -0.932  2.025   1.00 0.00 ? 32  HIS A HB2  1  
ATOM 494   H HB3  . HIS A 1 32  ? 2.068   0.626   1.243   1.00 0.00 ? 32  HIS A HB3  1  
ATOM 495   H HD1  . HIS A 1 32  ? 2.693   -1.149  -0.790  1.00 0.00 ? 32  HIS A HD1  1  
ATOM 496   H HD2  . HIS A 1 32  ? 5.621   -0.488  2.093   1.00 0.00 ? 32  HIS A HD2  1  
ATOM 497   H HE1  . HIS A 1 32  ? 4.878   -1.914  -1.797  1.00 0.00 ? 32  HIS A HE1  1  
ATOM 498   N N    . ILE A 1 33  ? 4.592   1.812   1.785   1.00 0.00 ? 33  ILE A N    1  
ATOM 499   C CA   . ILE A 1 33  ? 5.877   2.494   1.457   1.00 0.00 ? 33  ILE A CA   1  
ATOM 500   C C    . ILE A 1 33  ? 6.251   3.523   2.527   1.00 0.00 ? 33  ILE A C    1  
ATOM 501   O O    . ILE A 1 33  ? 7.393   3.628   2.925   1.00 0.00 ? 33  ILE A O    1  
ATOM 502   C CB   . ILE A 1 33  ? 5.709   3.188   0.113   1.00 0.00 ? 33  ILE A CB   1  
ATOM 503   C CG1  . ILE A 1 33  ? 7.076   3.583   -0.445  1.00 0.00 ? 33  ILE A CG1  1  
ATOM 504   C CG2  . ILE A 1 33  ? 4.843   4.431   0.284   1.00 0.00 ? 33  ILE A CG2  1  
ATOM 505   C CD1  . ILE A 1 33  ? 6.893   4.258   -1.802  1.00 0.00 ? 33  ILE A CD1  1  
ATOM 506   H H    . ILE A 1 33  ? 3.875   1.789   1.117   1.00 0.00 ? 33  ILE A H    1  
ATOM 507   H HA   . ILE A 1 33  ? 6.664   1.758   1.377   1.00 0.00 ? 33  ILE A HA   1  
ATOM 508   H HB   . ILE A 1 33  ? 5.222   2.514   -0.569  1.00 0.00 ? 33  ILE A HB   1  
ATOM 509   H HG12 . ILE A 1 33  ? 7.560   4.268   0.237   1.00 0.00 ? 33  ILE A HG12 1  
ATOM 510   H HG13 . ILE A 1 33  ? 7.685   2.701   -0.565  1.00 0.00 ? 33  ILE A HG13 1  
ATOM 511   H HG21 . ILE A 1 33  ? 4.538   4.785   -0.687  1.00 0.00 ? 33  ILE A HG21 1  
ATOM 512   H HG22 . ILE A 1 33  ? 5.409   5.199   0.789   1.00 0.00 ? 33  ILE A HG22 1  
ATOM 513   H HG23 . ILE A 1 33  ? 3.969   4.182   0.866   1.00 0.00 ? 33  ILE A HG23 1  
ATOM 514   H HD11 . ILE A 1 33  ? 7.502   5.147   -1.847  1.00 0.00 ? 33  ILE A HD11 1  
ATOM 515   H HD12 . ILE A 1 33  ? 5.854   4.525   -1.932  1.00 0.00 ? 33  ILE A HD12 1  
ATOM 516   H HD13 . ILE A 1 33  ? 7.189   3.576   -2.585  1.00 0.00 ? 33  ILE A HD13 1  
ATOM 517   N N    . THR A 1 34  ? 5.315   4.295   2.992   1.00 0.00 ? 34  THR A N    1  
ATOM 518   C CA   . THR A 1 34  ? 5.662   5.312   4.030   1.00 0.00 ? 34  THR A CA   1  
ATOM 519   C C    . THR A 1 34  ? 6.247   4.599   5.250   1.00 0.00 ? 34  THR A C    1  
ATOM 520   O O    . THR A 1 34  ? 7.010   5.165   6.009   1.00 0.00 ? 34  THR A O    1  
ATOM 521   C CB   . THR A 1 34  ? 4.413   6.095   4.449   1.00 0.00 ? 34  THR A CB   1  
ATOM 522   O OG1  . THR A 1 34  ? 3.545   5.242   5.178   1.00 0.00 ? 34  THR A OG1  1  
ATOM 523   C CG2  . THR A 1 34  ? 3.697   6.633   3.208   1.00 0.00 ? 34  THR A CG2  1  
ATOM 524   H H    . THR A 1 34  ? 4.399   4.210   2.658   1.00 0.00 ? 34  THR A H    1  
ATOM 525   H HA   . THR A 1 34  ? 6.397   5.995   3.629   1.00 0.00 ? 34  THR A HA   1  
ATOM 526   H HB   . THR A 1 34  ? 4.706   6.924   5.073   1.00 0.00 ? 34  THR A HB   1  
ATOM 527   H HG1  . THR A 1 34  ? 4.006   4.961   5.972   1.00 0.00 ? 34  THR A HG1  1  
ATOM 528   H HG21 . THR A 1 34  ? 3.756   5.908   2.411   1.00 0.00 ? 34  THR A HG21 1  
ATOM 529   H HG22 . THR A 1 34  ? 4.165   7.553   2.893   1.00 0.00 ? 34  THR A HG22 1  
ATOM 530   H HG23 . THR A 1 34  ? 2.659   6.822   3.445   1.00 0.00 ? 34  THR A HG23 1  
ATOM 531   N N    . LYS A 1 35  ? 5.893   3.361   5.439   1.00 0.00 ? 35  LYS A N    1  
ATOM 532   C CA   . LYS A 1 35  ? 6.418   2.592   6.604   1.00 0.00 ? 35  LYS A CA   1  
ATOM 533   C C    . LYS A 1 35  ? 7.799   2.014   6.269   1.00 0.00 ? 35  LYS A C    1  
ATOM 534   O O    . LYS A 1 35  ? 8.797   2.392   6.850   1.00 0.00 ? 35  LYS A O    1  
ATOM 535   C CB   . LYS A 1 35  ? 5.456   1.448   6.928   1.00 0.00 ? 35  LYS A CB   1  
ATOM 536   C CG   . LYS A 1 35  ? 5.894   0.759   8.221   1.00 0.00 ? 35  LYS A CG   1  
ATOM 537   C CD   . LYS A 1 35  ? 4.868   -0.311  8.601   1.00 0.00 ? 35  LYS A CD   1  
ATOM 538   C CE   . LYS A 1 35  ? 4.140   0.108   9.880   1.00 0.00 ? 35  LYS A CE   1  
ATOM 539   N NZ   . LYS A 1 35  ? 4.481   -0.841  10.977  1.00 0.00 ? 35  LYS A NZ   1  
ATOM 540   H H    . LYS A 1 35  ? 5.275   2.934   4.814   1.00 0.00 ? 35  LYS A H    1  
ATOM 541   H HA   . LYS A 1 35  ? 6.500   3.247   7.459   1.00 0.00 ? 35  LYS A HA   1  
ATOM 542   H HB2  . LYS A 1 35  ? 4.458   1.843   7.050   1.00 0.00 ? 35  LYS A HB2  1  
ATOM 543   H HB3  . LYS A 1 35  ? 5.464   0.732   6.121   1.00 0.00 ? 35  LYS A HB3  1  
ATOM 544   H HG2  . LYS A 1 35  ? 6.859   0.296   8.073   1.00 0.00 ? 35  LYS A HG2  1  
ATOM 545   H HG3  . LYS A 1 35  ? 5.961   1.488   9.014   1.00 0.00 ? 35  LYS A HG3  1  
ATOM 546   H HD2  . LYS A 1 35  ? 4.152   -0.425  7.800   1.00 0.00 ? 35  LYS A HD2  1  
ATOM 547   H HD3  . LYS A 1 35  ? 5.372   -1.250  8.769   1.00 0.00 ? 35  LYS A HD3  1  
ATOM 548   H HE2  . LYS A 1 35  ? 4.446   1.105   10.159  1.00 0.00 ? 35  LYS A HE2  1  
ATOM 549   H HE3  . LYS A 1 35  ? 3.074   0.093   9.709   1.00 0.00 ? 35  LYS A HE3  1  
ATOM 550   H HZ1  . LYS A 1 35  ? 3.709   -0.860  11.674  1.00 0.00 ? 35  LYS A HZ1  1  
ATOM 551   H HZ2  . LYS A 1 35  ? 5.360   -0.533  11.442  1.00 0.00 ? 35  LYS A HZ2  1  
ATOM 552   H HZ3  . LYS A 1 35  ? 4.611   -1.795  10.584  1.00 0.00 ? 35  LYS A HZ3  1  
ATOM 553   N N    . HIS A 1 36  ? 7.861   1.091   5.343   1.00 0.00 ? 36  HIS A N    1  
ATOM 554   C CA   . HIS A 1 36  ? 9.175   0.480   4.980   1.00 0.00 ? 36  HIS A CA   1  
ATOM 555   C C    . HIS A 1 36  ? 10.025  1.489   4.211   1.00 0.00 ? 36  HIS A C    1  
ATOM 556   O O    . HIS A 1 36  ? 11.186  1.691   4.508   1.00 0.00 ? 36  HIS A O    1  
ATOM 557   C CB   . HIS A 1 36  ? 8.940   -0.749  4.101   1.00 0.00 ? 36  HIS A CB   1  
ATOM 558   C CG   . HIS A 1 36  ? 8.122   -1.755  4.863   1.00 0.00 ? 36  HIS A CG   1  
ATOM 559   N ND1  . HIS A 1 36  ? 8.705   -2.742  5.643   1.00 0.00 ? 36  HIS A ND1  1  
ATOM 560   C CD2  . HIS A 1 36  ? 6.767   -1.931  4.984   1.00 0.00 ? 36  HIS A CD2  1  
ATOM 561   C CE1  . HIS A 1 36  ? 7.711   -3.461  6.194   1.00 0.00 ? 36  HIS A CE1  1  
ATOM 562   N NE2  . HIS A 1 36  ? 6.508   -3.009  5.826   1.00 0.00 ? 36  HIS A NE2  1  
ATOM 563   H H    . HIS A 1 36  ? 7.043   0.796   4.893   1.00 0.00 ? 36  HIS A H    1  
ATOM 564   H HA   . HIS A 1 36  ? 9.693   0.183   5.879   1.00 0.00 ? 36  HIS A HA   1  
ATOM 565   H HB2  . HIS A 1 36  ? 8.411   -0.455  3.204   1.00 0.00 ? 36  HIS A HB2  1  
ATOM 566   H HB3  . HIS A 1 36  ? 9.889   -1.186  3.830   1.00 0.00 ? 36  HIS A HB3  1  
ATOM 567   H HD1  . HIS A 1 36  ? 9.665   -2.889  5.768   1.00 0.00 ? 36  HIS A HD1  1  
ATOM 568   H HD2  . HIS A 1 36  ? 6.015   -1.324  4.502   1.00 0.00 ? 36  HIS A HD2  1  
ATOM 569   H HE1  . HIS A 1 36  ? 7.866   -4.300  6.857   1.00 0.00 ? 36  HIS A HE1  1  
ATOM 570   N N    . TYR A 1 37  ? 9.460   2.118   3.219   1.00 0.00 ? 37  TYR A N    1  
ATOM 571   C CA   . TYR A 1 37  ? 10.245  3.106   2.428   1.00 0.00 ? 37  TYR A CA   1  
ATOM 572   C C    . TYR A 1 37  ? 10.328  4.424   3.210   1.00 0.00 ? 37  TYR A C    1  
ATOM 573   O O    . TYR A 1 37  ? 9.315   5.025   3.508   1.00 0.00 ? 37  TYR A O    1  
ATOM 574   C CB   . TYR A 1 37  ? 9.565   3.348   1.073   1.00 0.00 ? 37  TYR A CB   1  
ATOM 575   C CG   . TYR A 1 37  ? 10.537  3.027   -0.029  1.00 0.00 ? 37  TYR A CG   1  
ATOM 576   C CD1  . TYR A 1 37  ? 11.389  4.018   -0.526  1.00 0.00 ? 37  TYR A CD1  1  
ATOM 577   C CD2  . TYR A 1 37  ? 10.591  1.729   -0.547  1.00 0.00 ? 37  TYR A CD2  1  
ATOM 578   C CE1  . TYR A 1 37  ? 12.295  3.709   -1.545  1.00 0.00 ? 37  TYR A CE1  1  
ATOM 579   C CE2  . TYR A 1 37  ? 11.497  1.419   -1.564  1.00 0.00 ? 37  TYR A CE2  1  
ATOM 580   C CZ   . TYR A 1 37  ? 12.351  2.409   -2.064  1.00 0.00 ? 37  TYR A CZ   1  
ATOM 581   O OH   . TYR A 1 37  ? 13.247  2.105   -3.069  1.00 0.00 ? 37  TYR A OH   1  
ATOM 582   H H    . TYR A 1 37  ? 8.525   1.934   2.996   1.00 0.00 ? 37  TYR A H    1  
ATOM 583   H HA   . TYR A 1 37  ? 11.236  2.714   2.263   1.00 0.00 ? 37  TYR A HA   1  
ATOM 584   H HB2  . TYR A 1 37  ? 8.700   2.710   0.977   1.00 0.00 ? 37  TYR A HB2  1  
ATOM 585   H HB3  . TYR A 1 37  ? 9.266   4.383   0.999   1.00 0.00 ? 37  TYR A HB3  1  
ATOM 586   H HD1  . TYR A 1 37  ? 11.345  5.021   -0.127  1.00 0.00 ? 37  TYR A HD1  1  
ATOM 587   H HD2  . TYR A 1 37  ? 9.929   0.968   -0.161  1.00 0.00 ? 37  TYR A HD2  1  
ATOM 588   H HE1  . TYR A 1 37  ? 12.952  4.471   -1.929  1.00 0.00 ? 37  TYR A HE1  1  
ATOM 589   H HE2  . TYR A 1 37  ? 11.536  0.415   -1.962  1.00 0.00 ? 37  TYR A HE2  1  
ATOM 590   H HH   . TYR A 1 37  ? 13.591  2.931   -3.418  1.00 0.00 ? 37  TYR A HH   1  
ATOM 591   N N    . PRO A 1 38  ? 11.535  4.829   3.532   1.00 0.00 ? 38  PRO A N    1  
ATOM 592   C CA   . PRO A 1 38  ? 11.782  6.066   4.295   1.00 0.00 ? 38  PRO A CA   1  
ATOM 593   C C    . PRO A 1 38  ? 11.654  7.293   3.391   1.00 0.00 ? 38  PRO A C    1  
ATOM 594   O O    . PRO A 1 38  ? 11.325  8.373   3.841   1.00 0.00 ? 38  PRO A O    1  
ATOM 595   C CB   . PRO A 1 38  ? 13.222  5.904   4.790   1.00 0.00 ? 38  PRO A CB   1  
ATOM 596   C CG   . PRO A 1 38  ? 13.899  4.889   3.839   1.00 0.00 ? 38  PRO A CG   1  
ATOM 597   C CD   . PRO A 1 38  ? 12.765  4.096   3.163   1.00 0.00 ? 38  PRO A CD   1  
ATOM 598   H HA   . PRO A 1 38  ? 11.110  6.137   5.133   1.00 0.00 ? 38  PRO A HA   1  
ATOM 599   H HB2  . PRO A 1 38  ? 13.735  6.856   4.748   1.00 0.00 ? 38  PRO A HB2  1  
ATOM 600   H HB3  . PRO A 1 38  ? 13.229  5.520   5.797   1.00 0.00 ? 38  PRO A HB3  1  
ATOM 601   H HG2  . PRO A 1 38  ? 14.484  5.413   3.096   1.00 0.00 ? 38  PRO A HG2  1  
ATOM 602   H HG3  . PRO A 1 38  ? 14.528  4.217   4.402   1.00 0.00 ? 38  PRO A HG3  1  
ATOM 603   H HD2  . PRO A 1 38  ? 12.898  4.093   2.089   1.00 0.00 ? 38  PRO A HD2  1  
ATOM 604   H HD3  . PRO A 1 38  ? 12.727  3.088   3.543   1.00 0.00 ? 38  PRO A HD3  1  
ATOM 605   N N    . TYR A 1 39  ? 11.913  7.141   2.122   1.00 0.00 ? 39  TYR A N    1  
ATOM 606   C CA   . TYR A 1 39  ? 11.805  8.306   1.201   1.00 0.00 ? 39  TYR A CA   1  
ATOM 607   C C    . TYR A 1 39  ? 10.354  8.780   1.148   1.00 0.00 ? 39  TYR A C    1  
ATOM 608   O O    . TYR A 1 39  ? 10.076  9.963   1.117   1.00 0.00 ? 39  TYR A O    1  
ATOM 609   C CB   . TYR A 1 39  ? 12.249  7.892   -0.202  1.00 0.00 ? 39  TYR A CB   1  
ATOM 610   C CG   . TYR A 1 39  ? 12.465  9.130   -1.038  1.00 0.00 ? 39  TYR A CG   1  
ATOM 611   C CD1  . TYR A 1 39  ? 11.382  9.965   -1.346  1.00 0.00 ? 39  TYR A CD1  1  
ATOM 612   C CD2  . TYR A 1 39  ? 13.745  9.447   -1.501  1.00 0.00 ? 39  TYR A CD2  1  
ATOM 613   C CE1  . TYR A 1 39  ? 11.583  11.115  -2.115  1.00 0.00 ? 39  TYR A CE1  1  
ATOM 614   C CE2  . TYR A 1 39  ? 13.946  10.596  -2.271  1.00 0.00 ? 39  TYR A CE2  1  
ATOM 615   C CZ   . TYR A 1 39  ? 12.867  11.431  -2.580  1.00 0.00 ? 39  TYR A CZ   1  
ATOM 616   O OH   . TYR A 1 39  ? 13.067  12.567  -3.338  1.00 0.00 ? 39  TYR A OH   1  
ATOM 617   H H    . TYR A 1 39  ? 12.179  6.264   1.776   1.00 0.00 ? 39  TYR A H    1  
ATOM 618   H HA   . TYR A 1 39  ? 12.434  9.108   1.557   1.00 0.00 ? 39  TYR A HA   1  
ATOM 619   H HB2  . TYR A 1 39  ? 13.171  7.333   -0.139  1.00 0.00 ? 39  TYR A HB2  1  
ATOM 620   H HB3  . TYR A 1 39  ? 11.484  7.281   -0.656  1.00 0.00 ? 39  TYR A HB3  1  
ATOM 621   H HD1  . TYR A 1 39  ? 10.392  9.720   -0.989  1.00 0.00 ? 39  TYR A HD1  1  
ATOM 622   H HD2  . TYR A 1 39  ? 14.579  8.803   -1.263  1.00 0.00 ? 39  TYR A HD2  1  
ATOM 623   H HE1  . TYR A 1 39  ? 10.748  11.758  -2.352  1.00 0.00 ? 39  TYR A HE1  1  
ATOM 624   H HE2  . TYR A 1 39  ? 14.936  10.838  -2.629  1.00 0.00 ? 39  TYR A HE2  1  
ATOM 625   H HH   . TYR A 1 39  ? 13.993  12.594  -3.592  1.00 0.00 ? 39  TYR A HH   1  
ATOM 626   N N    . TYR A 1 40  ? 9.426   7.865   1.126   1.00 0.00 ? 40  TYR A N    1  
ATOM 627   C CA   . TYR A 1 40  ? 7.992   8.259   1.061   1.00 0.00 ? 40  TYR A CA   1  
ATOM 628   C C    . TYR A 1 40  ? 7.459   8.512   2.474   1.00 0.00 ? 40  TYR A C    1  
ATOM 629   O O    . TYR A 1 40  ? 6.462   7.950   2.882   1.00 0.00 ? 40  TYR A O    1  
ATOM 630   C CB   . TYR A 1 40  ? 7.194   7.133   0.402   1.00 0.00 ? 40  TYR A CB   1  
ATOM 631   C CG   . TYR A 1 40  ? 7.093   7.395   -1.082  1.00 0.00 ? 40  TYR A CG   1  
ATOM 632   C CD1  . TYR A 1 40  ? 8.103   8.108   -1.739  1.00 0.00 ? 40  TYR A CD1  1  
ATOM 633   C CD2  . TYR A 1 40  ? 5.986   6.930   -1.798  1.00 0.00 ? 40  TYR A CD2  1  
ATOM 634   C CE1  . TYR A 1 40  ? 8.003   8.355   -3.115  1.00 0.00 ? 40  TYR A CE1  1  
ATOM 635   C CE2  . TYR A 1 40  ? 5.887   7.174   -3.173  1.00 0.00 ? 40  TYR A CE2  1  
ATOM 636   C CZ   . TYR A 1 40  ? 6.894   7.886   -3.831  1.00 0.00 ? 40  TYR A CZ   1  
ATOM 637   O OH   . TYR A 1 40  ? 6.792   8.132   -5.184  1.00 0.00 ? 40  TYR A OH   1  
ATOM 638   H H    . TYR A 1 40  ? 9.674   6.917   1.144   1.00 0.00 ? 40  TYR A H    1  
ATOM 639   H HA   . TYR A 1 40  ? 7.893   9.158   0.475   1.00 0.00 ? 40  TYR A HA   1  
ATOM 640   H HB2  . TYR A 1 40  ? 7.696   6.191   0.568   1.00 0.00 ? 40  TYR A HB2  1  
ATOM 641   H HB3  . TYR A 1 40  ? 6.203   7.094   0.829   1.00 0.00 ? 40  TYR A HB3  1  
ATOM 642   H HD1  . TYR A 1 40  ? 8.961   8.467   -1.186  1.00 0.00 ? 40  TYR A HD1  1  
ATOM 643   H HD2  . TYR A 1 40  ? 5.211   6.380   -1.290  1.00 0.00 ? 40  TYR A HD2  1  
ATOM 644   H HE1  . TYR A 1 40  ? 8.783   8.904   -3.624  1.00 0.00 ? 40  TYR A HE1  1  
ATOM 645   H HE2  . TYR A 1 40  ? 5.033   6.810   -3.725  1.00 0.00 ? 40  TYR A HE2  1  
ATOM 646   H HH   . TYR A 1 40  ? 7.254   8.952   -5.374  1.00 0.00 ? 40  TYR A HH   1  
ATOM 647   N N    . ARG A 1 41  ? 8.112   9.358   3.222   1.00 0.00 ? 41  ARG A N    1  
ATOM 648   C CA   . ARG A 1 41  ? 7.640   9.651   4.604   1.00 0.00 ? 41  ARG A CA   1  
ATOM 649   C C    . ARG A 1 41  ? 7.447   11.160  4.767   1.00 0.00 ? 41  ARG A C    1  
ATOM 650   O O    . ARG A 1 41  ? 6.508   11.612  5.391   1.00 0.00 ? 41  ARG A O    1  
ATOM 651   C CB   . ARG A 1 41  ? 8.677   9.155   5.614   1.00 0.00 ? 41  ARG A CB   1  
ATOM 652   C CG   . ARG A 1 41  ? 8.050   9.109   7.009   1.00 0.00 ? 41  ARG A CG   1  
ATOM 653   C CD   . ARG A 1 41  ? 9.024   8.448   7.986   1.00 0.00 ? 41  ARG A CD   1  
ATOM 654   N NE   . ARG A 1 41  ? 8.779   8.969   9.360   1.00 0.00 ? 41  ARG A NE   1  
ATOM 655   C CZ   . ARG A 1 41  ? 9.647   9.768   9.920   1.00 0.00 ? 41  ARG A CZ   1  
ATOM 656   N NH1  . ARG A 1 41  ? 10.852  9.341   10.182  1.00 0.00 ? 41  ARG A NH1  1  
ATOM 657   N NH2  . ARG A 1 41  ? 9.310   10.992  10.218  1.00 0.00 ? 41  ARG A NH2  1  
ATOM 658   H H    . ARG A 1 41  ? 8.912   9.804   2.873   1.00 0.00 ? 41  ARG A H    1  
ATOM 659   H HA   . ARG A 1 41  ? 6.700   9.147   4.777   1.00 0.00 ? 41  ARG A HA   1  
ATOM 660   H HB2  . ARG A 1 41  ? 9.007   8.164   5.334   1.00 0.00 ? 41  ARG A HB2  1  
ATOM 661   H HB3  . ARG A 1 41  ? 9.521   9.827   5.623   1.00 0.00 ? 41  ARG A HB3  1  
ATOM 662   H HG2  . ARG A 1 41  ? 7.833   10.115  7.339   1.00 0.00 ? 41  ARG A HG2  1  
ATOM 663   H HG3  . ARG A 1 41  ? 7.136   8.537   6.974   1.00 0.00 ? 41  ARG A HG3  1  
ATOM 664   H HD2  . ARG A 1 41  ? 8.876   7.379   7.974   1.00 0.00 ? 41  ARG A HD2  1  
ATOM 665   H HD3  . ARG A 1 41  ? 10.038  8.675   7.691   1.00 0.00 ? 41  ARG A HD3  1  
ATOM 666   H HE   . ARG A 1 41  ? 7.967   8.711   9.845   1.00 0.00 ? 41  ARG A HE   1  
ATOM 667   H HH11 . ARG A 1 41  ? 11.110  8.402   9.953   1.00 0.00 ? 41  ARG A HH11 1  
ATOM 668   H HH12 . ARG A 1 41  ? 11.516  9.952   10.611  1.00 0.00 ? 41  ARG A HH12 1  
ATOM 669   H HH21 . ARG A 1 41  ? 8.386   11.320  10.015  1.00 0.00 ? 41  ARG A HH21 1  
ATOM 670   H HH22 . ARG A 1 41  ? 9.974   11.604  10.647  1.00 0.00 ? 41  ARG A HH22 1  
ATOM 671   N N    . THR A 1 42  ? 8.327   11.944  4.207   1.00 0.00 ? 42  THR A N    1  
ATOM 672   C CA   . THR A 1 42  ? 8.189   13.422  4.328   1.00 0.00 ? 42  THR A CA   1  
ATOM 673   C C    . THR A 1 42  ? 7.681   13.992  3.004   1.00 0.00 ? 42  THR A C    1  
ATOM 674   O O    . THR A 1 42  ? 7.086   15.051  2.959   1.00 0.00 ? 42  THR A O    1  
ATOM 675   C CB   . THR A 1 42  ? 9.551   14.039  4.661   1.00 0.00 ? 42  THR A CB   1  
ATOM 676   O OG1  . THR A 1 42  ? 10.360  14.052  3.494   1.00 0.00 ? 42  THR A OG1  1  
ATOM 677   C CG2  . THR A 1 42  ? 10.233  13.210  5.750   1.00 0.00 ? 42  THR A CG2  1  
ATOM 678   H H    . THR A 1 42  ? 9.077   11.561  3.705   1.00 0.00 ? 42  THR A H    1  
ATOM 679   H HA   . THR A 1 42  ? 7.487   13.655  5.114   1.00 0.00 ? 42  THR A HA   1  
ATOM 680   H HB   . THR A 1 42  ? 9.412   15.047  5.016   1.00 0.00 ? 42  THR A HB   1  
ATOM 681   H HG1  . THR A 1 42  ? 10.855  14.875  3.484   1.00 0.00 ? 42  THR A HG1  1  
ATOM 682   H HG21 . THR A 1 42  ? 9.699   13.331  6.681   1.00 0.00 ? 42  THR A HG21 1  
ATOM 683   H HG22 . THR A 1 42  ? 11.252  13.546  5.873   1.00 0.00 ? 42  THR A HG22 1  
ATOM 684   H HG23 . THR A 1 42  ? 10.229  12.168  5.466   1.00 0.00 ? 42  THR A HG23 1  
ATOM 685   N N    . ALA A 1 43  ? 7.906   13.295  1.926   1.00 0.00 ? 43  ALA A N    1  
ATOM 686   C CA   . ALA A 1 43  ? 7.433   13.792  0.604   1.00 0.00 ? 43  ALA A CA   1  
ATOM 687   C C    . ALA A 1 43  ? 6.326   12.872  0.088   1.00 0.00 ? 43  ALA A C    1  
ATOM 688   O O    . ALA A 1 43  ? 6.574   11.944  -0.656  1.00 0.00 ? 43  ALA A O    1  
ATOM 689   C CB   . ALA A 1 43  ? 8.598   13.795  -0.388  1.00 0.00 ? 43  ALA A CB   1  
ATOM 690   H H    . ALA A 1 43  ? 8.385   12.442  1.985   1.00 0.00 ? 43  ALA A H    1  
ATOM 691   H HA   . ALA A 1 43  ? 7.047   14.794  0.712   1.00 0.00 ? 43  ALA A HA   1  
ATOM 692   H HB1  . ALA A 1 43  ? 9.245   14.635  -0.181  1.00 0.00 ? 43  ALA A HB1  1  
ATOM 693   H HB2  . ALA A 1 43  ? 8.214   13.877  -1.394  1.00 0.00 ? 43  ALA A HB2  1  
ATOM 694   H HB3  . ALA A 1 43  ? 9.159   12.877  -0.291  1.00 0.00 ? 43  ALA A HB3  1  
ATOM 695   N N    . ASP A 1 44  ? 5.107   13.118  0.481   1.00 0.00 ? 44  ASP A N    1  
ATOM 696   C CA   . ASP A 1 44  ? 3.987   12.254  0.016   1.00 0.00 ? 44  ASP A CA   1  
ATOM 697   C C    . ASP A 1 44  ? 2.863   13.128  -0.538  1.00 0.00 ? 44  ASP A C    1  
ATOM 698   O O    . ASP A 1 44  ? 1.769   12.662  -0.787  1.00 0.00 ? 44  ASP A O    1  
ATOM 699   C CB   . ASP A 1 44  ? 3.460   11.427  1.191   1.00 0.00 ? 44  ASP A CB   1  
ATOM 700   C CG   . ASP A 1 44  ? 2.966   12.363  2.294   1.00 0.00 ? 44  ASP A CG   1  
ATOM 701   O OD1  . ASP A 1 44  ? 3.800   12.947  2.967   1.00 0.00 ? 44  ASP A OD1  1  
ATOM 702   O OD2  . ASP A 1 44  ? 1.761   12.482  2.447   1.00 0.00 ? 44  ASP A OD2  1  
ATOM 703   H H    . ASP A 1 44  ? 4.928   13.870  1.084   1.00 0.00 ? 44  ASP A H    1  
ATOM 704   H HA   . ASP A 1 44  ? 4.344   11.591  -0.760  1.00 0.00 ? 44  ASP A HA   1  
ATOM 705   H HB2  . ASP A 1 44  ? 2.646   10.802  0.855   1.00 0.00 ? 44  ASP A HB2  1  
ATOM 706   H HB3  . ASP A 1 44  ? 4.255   10.806  1.579   1.00 0.00 ? 44  ASP A HB3  1  
ATOM 707   N N    . LYS A 1 45  ? 3.121   14.390  -0.736  1.00 0.00 ? 45  LYS A N    1  
ATOM 708   C CA   . LYS A 1 45  ? 2.062   15.287  -1.275  1.00 0.00 ? 45  LYS A CA   1  
ATOM 709   C C    . LYS A 1 45  ? 2.085   15.236  -2.803  1.00 0.00 ? 45  LYS A C    1  
ATOM 710   O O    . LYS A 1 45  ? 2.083   16.254  -3.467  1.00 0.00 ? 45  LYS A O    1  
ATOM 711   C CB   . LYS A 1 45  ? 2.318   16.719  -0.803  1.00 0.00 ? 45  LYS A CB   1  
ATOM 712   C CG   . LYS A 1 45  ? 1.020   17.524  -0.896  1.00 0.00 ? 45  LYS A CG   1  
ATOM 713   C CD   . LYS A 1 45  ? 1.340   18.970  -1.276  1.00 0.00 ? 45  LYS A CD   1  
ATOM 714   C CE   . LYS A 1 45  ? 0.071   19.649  -1.793  1.00 0.00 ? 45  LYS A CE   1  
ATOM 715   N NZ   . LYS A 1 45  ? -0.249  19.131  -3.154  1.00 0.00 ? 45  LYS A NZ   1  
ATOM 716   H H    . LYS A 1 45  ? 4.010   14.749  -0.530  1.00 0.00 ? 45  LYS A H    1  
ATOM 717   H HA   . LYS A 1 45  ? 1.097   14.957  -0.919  1.00 0.00 ? 45  LYS A HA   1  
ATOM 718   H HB2  . LYS A 1 45  ? 2.662   16.705  0.222   1.00 0.00 ? 45  LYS A HB2  1  
ATOM 719   H HB3  . LYS A 1 45  ? 3.069   17.176  -1.430  1.00 0.00 ? 45  LYS A HB3  1  
ATOM 720   H HG2  . LYS A 1 45  ? 0.380   17.086  -1.649  1.00 0.00 ? 45  LYS A HG2  1  
ATOM 721   H HG3  . LYS A 1 45  ? 0.517   17.507  0.058   1.00 0.00 ? 45  LYS A HG3  1  
ATOM 722   H HD2  . LYS A 1 45  ? 1.705   19.499  -0.408  1.00 0.00 ? 45  LYS A HD2  1  
ATOM 723   H HD3  . LYS A 1 45  ? 2.093   18.982  -2.050  1.00 0.00 ? 45  LYS A HD3  1  
ATOM 724   H HE2  . LYS A 1 45  ? -0.750  19.434  -1.125  1.00 0.00 ? 45  LYS A HE2  1  
ATOM 725   H HE3  . LYS A 1 45  ? 0.228   20.716  -1.841  1.00 0.00 ? 45  LYS A HE3  1  
ATOM 726   H HZ1  . LYS A 1 45  ? -0.265  18.093  -3.134  1.00 0.00 ? 45  LYS A HZ1  1  
ATOM 727   H HZ2  . LYS A 1 45  ? 0.476   19.455  -3.826  1.00 0.00 ? 45  LYS A HZ2  1  
ATOM 728   H HZ3  . LYS A 1 45  ? -1.179  19.485  -3.449  1.00 0.00 ? 45  LYS A HZ3  1  
ATOM 729   N N    . GLY A 1 46  ? 2.106   14.059  -3.367  1.00 0.00 ? 46  GLY A N    1  
ATOM 730   C CA   . GLY A 1 46  ? 2.129   13.945  -4.853  1.00 0.00 ? 46  GLY A CA   1  
ATOM 731   C C    . GLY A 1 46  ? 1.559   12.588  -5.271  1.00 0.00 ? 46  GLY A C    1  
ATOM 732   O O    . GLY A 1 46  ? 0.451   12.494  -5.757  1.00 0.00 ? 46  GLY A O    1  
ATOM 733   H H    . GLY A 1 46  ? 2.107   13.251  -2.814  1.00 0.00 ? 46  GLY A H    1  
ATOM 734   H HA2  . GLY A 1 46  ? 1.529   14.735  -5.283  1.00 0.00 ? 46  GLY A HA2  1  
ATOM 735   H HA3  . GLY A 1 46  ? 3.148   14.032  -5.204  1.00 0.00 ? 46  GLY A HA3  1  
ATOM 736   N N    . TRP A 1 47  ? 2.310   11.535  -5.089  1.00 0.00 ? 47  TRP A N    1  
ATOM 737   C CA   . TRP A 1 47  ? 1.807   10.187  -5.482  1.00 0.00 ? 47  TRP A CA   1  
ATOM 738   C C    . TRP A 1 47  ? 0.579   9.832   -4.648  1.00 0.00 ? 47  TRP A C    1  
ATOM 739   O O    . TRP A 1 47  ? -0.150  8.913   -4.963  1.00 0.00 ? 47  TRP A O    1  
ATOM 740   C CB   . TRP A 1 47  ? 2.898   9.139   -5.258  1.00 0.00 ? 47  TRP A CB   1  
ATOM 741   C CG   . TRP A 1 47  ? 3.116   8.929   -3.794  1.00 0.00 ? 47  TRP A CG   1  
ATOM 742   C CD1  . TRP A 1 47  ? 3.666   9.835   -2.955  1.00 0.00 ? 47  TRP A CD1  1  
ATOM 743   C CD2  . TRP A 1 47  ? 2.811   7.754   -2.984  1.00 0.00 ? 47  TRP A CD2  1  
ATOM 744   N NE1  . TRP A 1 47  ? 3.726   9.291   -1.685  1.00 0.00 ? 47  TRP A NE1  1  
ATOM 745   C CE2  . TRP A 1 47  ? 3.211   8.012   -1.650  1.00 0.00 ? 47  TRP A CE2  1  
ATOM 746   C CE3  . TRP A 1 47  ? 2.234   6.500   -3.271  1.00 0.00 ? 47  TRP A CE3  1  
ATOM 747   C CZ2  . TRP A 1 47  ? 3.051   7.064   -0.641  1.00 0.00 ? 47  TRP A CZ2  1  
ATOM 748   C CZ3  . TRP A 1 47  ? 2.071   5.545   -2.255  1.00 0.00 ? 47  TRP A CZ3  1  
ATOM 749   C CH2  . TRP A 1 47  ? 2.479   5.828   -0.943  1.00 0.00 ? 47  TRP A CH2  1  
ATOM 750   H H    . TRP A 1 47  ? 3.203   11.630  -4.698  1.00 0.00 ? 47  TRP A H    1  
ATOM 751   H HA   . TRP A 1 47  ? 1.536   10.202  -6.526  1.00 0.00 ? 47  TRP A HA   1  
ATOM 752   H HB2  . TRP A 1 47  ? 2.597   8.207   -5.714  1.00 0.00 ? 47  TRP A HB2  1  
ATOM 753   H HB3  . TRP A 1 47  ? 3.818   9.478   -5.713  1.00 0.00 ? 47  TRP A HB3  1  
ATOM 754   H HD1  . TRP A 1 47  ? 4.006   10.821  -3.230  1.00 0.00 ? 47  TRP A HD1  1  
ATOM 755   H HE1  . TRP A 1 47  ? 4.086   9.743   -0.893  1.00 0.00 ? 47  TRP A HE1  1  
ATOM 756   H HE3  . TRP A 1 47  ? 1.910   6.272   -4.276  1.00 0.00 ? 47  TRP A HE3  1  
ATOM 757   H HZ2  . TRP A 1 47  ? 3.366   7.285   0.368   1.00 0.00 ? 47  TRP A HZ2  1  
ATOM 758   H HZ3  . TRP A 1 47  ? 1.630   4.586   -2.483  1.00 0.00 ? 47  TRP A HZ3  1  
ATOM 759   H HH2  . TRP A 1 47  ? 2.354   5.088   -0.166  1.00 0.00 ? 47  TRP A HH2  1  
ATOM 760   N N    . GLN A 1 48  ? 0.334   10.551  -3.588  1.00 0.00 ? 48  GLN A N    1  
ATOM 761   C CA   . GLN A 1 48  ? -0.856  10.239  -2.754  1.00 0.00 ? 48  GLN A CA   1  
ATOM 762   C C    . GLN A 1 48  ? -2.066  10.043  -3.673  1.00 0.00 ? 48  GLN A C    1  
ATOM 763   O O    . GLN A 1 48  ? -2.656  8.983   -3.720  1.00 0.00 ? 48  GLN A O    1  
ATOM 764   C CB   . GLN A 1 48  ? -1.122  11.395  -1.785  1.00 0.00 ? 48  GLN A CB   1  
ATOM 765   C CG   . GLN A 1 48  ? -1.816  10.861  -0.531  1.00 0.00 ? 48  GLN A CG   1  
ATOM 766   C CD   . GLN A 1 48  ? -0.962  9.756   0.095   1.00 0.00 ? 48  GLN A CD   1  
ATOM 767   O OE1  . GLN A 1 48  ? -1.463  8.931   0.835   1.00 0.00 ? 48  GLN A OE1  1  
ATOM 768   N NE2  . GLN A 1 48  ? 0.314   9.703   -0.171  1.00 0.00 ? 48  GLN A NE2  1  
ATOM 769   H H    . GLN A 1 48  ? 0.927   11.292  -3.345  1.00 0.00 ? 48  GLN A H    1  
ATOM 770   H HA   . GLN A 1 48  ? -0.675  9.332   -2.195  1.00 0.00 ? 48  GLN A HA   1  
ATOM 771   H HB2  . GLN A 1 48  ? -0.185  11.855  -1.511  1.00 0.00 ? 48  GLN A HB2  1  
ATOM 772   H HB3  . GLN A 1 48  ? -1.757  12.125  -2.263  1.00 0.00 ? 48  GLN A HB3  1  
ATOM 773   H HG2  . GLN A 1 48  ? -1.942  11.665  0.180   1.00 0.00 ? 48  GLN A HG2  1  
ATOM 774   H HG3  . GLN A 1 48  ? -2.783  10.460  -0.796  1.00 0.00 ? 48  GLN A HG3  1  
ATOM 775   H HE21 . GLN A 1 48  ? 0.718   10.369  -0.767  1.00 0.00 ? 48  GLN A HE21 1  
ATOM 776   H HE22 . GLN A 1 48  ? 0.869   8.999   0.224   1.00 0.00 ? 48  GLN A HE22 1  
ATOM 777   N N    . ASN A 1 49  ? -2.430  11.057  -4.411  1.00 0.00 ? 49  ASN A N    1  
ATOM 778   C CA   . ASN A 1 49  ? -3.593  10.931  -5.337  1.00 0.00 ? 49  ASN A CA   1  
ATOM 779   C C    . ASN A 1 49  ? -3.210  10.051  -6.529  1.00 0.00 ? 49  ASN A C    1  
ATOM 780   O O    . ASN A 1 49  ? -4.061  9.555   -7.241  1.00 0.00 ? 49  ASN A O    1  
ATOM 781   C CB   . ASN A 1 49  ? -3.998  12.320  -5.838  1.00 0.00 ? 49  ASN A CB   1  
ATOM 782   C CG   . ASN A 1 49  ? -2.756  13.074  -6.314  1.00 0.00 ? 49  ASN A CG   1  
ATOM 783   O OD1  . ASN A 1 49  ? -2.274  12.847  -7.406  1.00 0.00 ? 49  ASN A OD1  1  
ATOM 784   N ND2  . ASN A 1 49  ? -2.213  13.970  -5.535  1.00 0.00 ? 49  ASN A ND2  1  
ATOM 785   H H    . ASN A 1 49  ? -1.933  11.901  -4.361  1.00 0.00 ? 49  ASN A H    1  
ATOM 786   H HA   . ASN A 1 49  ? -4.424  10.482  -4.815  1.00 0.00 ? 49  ASN A HA   1  
ATOM 787   H HB2  . ASN A 1 49  ? -4.693  12.215  -6.659  1.00 0.00 ? 49  ASN A HB2  1  
ATOM 788   H HB3  . ASN A 1 49  ? -4.467  12.870  -5.037  1.00 0.00 ? 49  ASN A HB3  1  
ATOM 789   H HD21 . ASN A 1 49  ? -2.600  14.153  -4.654  1.00 0.00 ? 49  ASN A HD21 1  
ATOM 790   H HD22 . ASN A 1 49  ? -1.418  14.459  -5.833  1.00 0.00 ? 49  ASN A HD22 1  
ATOM 791   N N    . SER A 1 50  ? -1.939  9.855   -6.759  1.00 0.00 ? 50  SER A N    1  
ATOM 792   C CA   . SER A 1 50  ? -1.519  9.009   -7.913  1.00 0.00 ? 50  SER A CA   1  
ATOM 793   C C    . SER A 1 50  ? -1.985  7.568   -7.691  1.00 0.00 ? 50  SER A C    1  
ATOM 794   O O    . SER A 1 50  ? -2.363  6.887   -8.620  1.00 0.00 ? 50  SER A O    1  
ATOM 795   C CB   . SER A 1 50  ? 0.003   9.043   -8.055  1.00 0.00 ? 50  SER A CB   1  
ATOM 796   O OG   . SER A 1 50  ? 0.590   8.223   -7.055  1.00 0.00 ? 50  SER A OG   1  
ATOM 797   H H    . SER A 1 50  ? -1.265  10.265  -6.179  1.00 0.00 ? 50  SER A H    1  
ATOM 798   H HA   . SER A 1 50  ? -1.970  9.391   -8.817  1.00 0.00 ? 50  SER A HA   1  
ATOM 799   H HB2  . SER A 1 50  ? 0.284   8.670   -9.026  1.00 0.00 ? 50  SER A HB2  1  
ATOM 800   H HB3  . SER A 1 50  ? 0.350   10.063  -7.951  1.00 0.00 ? 50  SER A HB3  1  
ATOM 801   H HG   . SER A 1 50  ? 0.735   7.353   -7.432  1.00 0.00 ? 50  SER A HG   1  
ATOM 802   N N    . ILE A 1 51  ? -1.967  7.098   -6.471  1.00 0.00 ? 51  ILE A N    1  
ATOM 803   C CA   . ILE A 1 51  ? -2.419  5.703   -6.204  1.00 0.00 ? 51  ILE A CA   1  
ATOM 804   C C    . ILE A 1 51  ? -3.934  5.634   -6.365  1.00 0.00 ? 51  ILE A C    1  
ATOM 805   O O    . ILE A 1 51  ? -4.441  4.829   -7.105  1.00 0.00 ? 51  ILE A O    1  
ATOM 806   C CB   . ILE A 1 51  ? -2.011  5.291   -4.766  1.00 0.00 ? 51  ILE A CB   1  
ATOM 807   C CG1  . ILE A 1 51  ? -0.553  4.785   -4.715  1.00 0.00 ? 51  ILE A CG1  1  
ATOM 808   C CG2  . ILE A 1 51  ? -2.923  4.177   -4.220  1.00 0.00 ? 51  ILE A CG2  1  
ATOM 809   C CD1  . ILE A 1 51  ? -0.076  4.271   -6.076  1.00 0.00 ? 51  ILE A CD1  1  
ATOM 810   H H    . ILE A 1 51  ? -1.659  7.659   -5.733  1.00 0.00 ? 51  ILE A H    1  
ATOM 811   H HA   . ILE A 1 51  ? -1.969  5.043   -6.921  1.00 0.00 ? 51  ILE A HA   1  
ATOM 812   H HB   . ILE A 1 51  ? -2.099  6.156   -4.125  1.00 0.00 ? 51  ILE A HB   1  
ATOM 813   H HG12 . ILE A 1 51  ? 0.088   5.582   -4.398  1.00 0.00 ? 51  ILE A HG12 1  
ATOM 814   H HG13 . ILE A 1 51  ? -0.491  3.988   -3.997  1.00 0.00 ? 51  ILE A HG13 1  
ATOM 815   H HG21 . ILE A 1 51  ? -2.607  3.227   -4.615  1.00 0.00 ? 51  ILE A HG21 1  
ATOM 816   H HG22 . ILE A 1 51  ? -3.946  4.362   -4.501  1.00 0.00 ? 51  ILE A HG22 1  
ATOM 817   H HG23 . ILE A 1 51  ? -2.851  4.154   -3.143  1.00 0.00 ? 51  ILE A HG23 1  
ATOM 818   H HD11 . ILE A 1 51  ? 0.801   3.657   -5.939  1.00 0.00 ? 51  ILE A HD11 1  
ATOM 819   H HD12 . ILE A 1 51  ? 0.163   5.108   -6.712  1.00 0.00 ? 51  ILE A HD12 1  
ATOM 820   H HD13 . ILE A 1 51  ? -0.858  3.682   -6.534  1.00 0.00 ? 51  ILE A HD13 1  
ATOM 821   N N    . ARG A 1 52  ? -4.667  6.462   -5.685  1.00 0.00 ? 52  ARG A N    1  
ATOM 822   C CA   . ARG A 1 52  ? -6.146  6.397   -5.825  1.00 0.00 ? 52  ARG A CA   1  
ATOM 823   C C    . ARG A 1 52  ? -6.507  6.337   -7.312  1.00 0.00 ? 52  ARG A C    1  
ATOM 824   O O    . ARG A 1 52  ? -7.306  5.526   -7.734  1.00 0.00 ? 52  ARG A O    1  
ATOM 825   C CB   . ARG A 1 52  ? -6.775  7.640   -5.192  1.00 0.00 ? 52  ARG A CB   1  
ATOM 826   C CG   . ARG A 1 52  ? -8.146  7.284   -4.616  1.00 0.00 ? 52  ARG A CG   1  
ATOM 827   C CD   . ARG A 1 52  ? -9.203  7.390   -5.716  1.00 0.00 ? 52  ARG A CD   1  
ATOM 828   N NE   . ARG A 1 52  ? -10.521 6.946   -5.185  1.00 0.00 ? 52  ARG A NE   1  
ATOM 829   C CZ   . ARG A 1 52  ? -11.241 7.760   -4.462  1.00 0.00 ? 52  ARG A CZ   1  
ATOM 830   N NH1  . ARG A 1 52  ? -11.392 9.004   -4.833  1.00 0.00 ? 52  ARG A NH1  1  
ATOM 831   N NH2  . ARG A 1 52  ? -11.809 7.334   -3.367  1.00 0.00 ? 52  ARG A NH2  1  
ATOM 832   H H    . ARG A 1 52  ? -4.252  7.114   -5.083  1.00 0.00 ? 52  ARG A H    1  
ATOM 833   H HA   . ARG A 1 52  ? -6.517  5.512   -5.328  1.00 0.00 ? 52  ARG A HA   1  
ATOM 834   H HB2  . ARG A 1 52  ? -6.135  8.003   -4.400  1.00 0.00 ? 52  ARG A HB2  1  
ATOM 835   H HB3  . ARG A 1 52  ? -6.890  8.406   -5.943  1.00 0.00 ? 52  ARG A HB3  1  
ATOM 836   H HG2  . ARG A 1 52  ? -8.125  6.274   -4.231  1.00 0.00 ? 52  ARG A HG2  1  
ATOM 837   H HG3  . ARG A 1 52  ? -8.392  7.970   -3.818  1.00 0.00 ? 52  ARG A HG3  1  
ATOM 838   H HD2  . ARG A 1 52  ? -9.275  8.414   -6.049  1.00 0.00 ? 52  ARG A HD2  1  
ATOM 839   H HD3  . ARG A 1 52  ? -8.920  6.761   -6.548  1.00 0.00 ? 52  ARG A HD3  1  
ATOM 840   H HE   . ARG A 1 52  ? -10.850 6.043   -5.377  1.00 0.00 ? 52  ARG A HE   1  
ATOM 841   H HH11 . ARG A 1 52  ? -10.956 9.332   -5.670  1.00 0.00 ? 52  ARG A HH11 1  
ATOM 842   H HH12 . ARG A 1 52  ? -11.945 9.627   -4.280  1.00 0.00 ? 52  ARG A HH12 1  
ATOM 843   H HH21 . ARG A 1 52  ? -11.691 6.383   -3.082  1.00 0.00 ? 52  ARG A HH21 1  
ATOM 844   H HH22 . ARG A 1 52  ? -12.360 7.958   -2.814  1.00 0.00 ? 52  ARG A HH22 1  
ATOM 845   N N    . HIS A 1 53  ? -5.922  7.186   -8.110  1.00 0.00 ? 53  HIS A N    1  
ATOM 846   C CA   . HIS A 1 53  ? -6.229  7.175   -9.568  1.00 0.00 ? 53  HIS A CA   1  
ATOM 847   C C    . HIS A 1 53  ? -5.511  6.006   -10.267 1.00 0.00 ? 53  HIS A C    1  
ATOM 848   O O    . HIS A 1 53  ? -5.916  5.573   -11.328 1.00 0.00 ? 53  HIS A O    1  
ATOM 849   C CB   . HIS A 1 53  ? -5.776  8.498   -10.186 1.00 0.00 ? 53  HIS A CB   1  
ATOM 850   C CG   . HIS A 1 53  ? -6.778  8.937   -11.218 1.00 0.00 ? 53  HIS A CG   1  
ATOM 851   N ND1  . HIS A 1 53  ? -7.827  9.791   -10.914 1.00 0.00 ? 53  HIS A ND1  1  
ATOM 852   C CD2  . HIS A 1 53  ? -6.908  8.647   -12.555 1.00 0.00 ? 53  HIS A CD2  1  
ATOM 853   C CE1  . HIS A 1 53  ? -8.535  9.983   -12.043 1.00 0.00 ? 53  HIS A CE1  1  
ATOM 854   N NE2  . HIS A 1 53  ? -8.018  9.307   -13.073 1.00 0.00 ? 53  HIS A NE2  1  
ATOM 855   H H    . HIS A 1 53  ? -5.278  7.832   -7.750  1.00 0.00 ? 53  HIS A H    1  
ATOM 856   H HA   . HIS A 1 53  ? -7.295  7.069   -9.705  1.00 0.00 ? 53  HIS A HA   1  
ATOM 857   H HB2  . HIS A 1 53  ? -5.702  9.250   -9.412  1.00 0.00 ? 53  HIS A HB2  1  
ATOM 858   H HB3  . HIS A 1 53  ? -4.810  8.368   -10.652 1.00 0.00 ? 53  HIS A HB3  1  
ATOM 859   H HD1  . HIS A 1 53  ? -8.019  10.182  -10.037 1.00 0.00 ? 53  HIS A HD1  1  
ATOM 860   H HD2  . HIS A 1 53  ? -6.249  8.003   -13.119 1.00 0.00 ? 53  HIS A HD2  1  
ATOM 861   H HE1  . HIS A 1 53  ? -9.414  10.607  -12.107 1.00 0.00 ? 53  HIS A HE1  1  
ATOM 862   N N    . ASN A 1 54  ? -4.443  5.501   -9.700  1.00 0.00 ? 54  ASN A N    1  
ATOM 863   C CA   . ASN A 1 54  ? -3.708  4.379   -10.357 1.00 0.00 ? 54  ASN A CA   1  
ATOM 864   C C    . ASN A 1 54  ? -4.524  3.086   -10.276 1.00 0.00 ? 54  ASN A C    1  
ATOM 865   O O    . ASN A 1 54  ? -4.524  2.286   -11.189 1.00 0.00 ? 54  ASN A O    1  
ATOM 866   C CB   . ASN A 1 54  ? -2.362  4.172   -9.660  1.00 0.00 ? 54  ASN A CB   1  
ATOM 867   C CG   . ASN A 1 54  ? -1.231  4.557   -10.615 1.00 0.00 ? 54  ASN A CG   1  
ATOM 868   O OD1  . ASN A 1 54  ? -1.027  3.913   -11.626 1.00 0.00 ? 54  ASN A OD1  1  
ATOM 869   N ND2  . ASN A 1 54  ? -0.480  5.588   -10.338 1.00 0.00 ? 54  ASN A ND2  1  
ATOM 870   H H    . ASN A 1 54  ? -4.119  5.863   -8.851  1.00 0.00 ? 54  ASN A H    1  
ATOM 871   H HA   . ASN A 1 54  ? -3.536  4.625   -11.394 1.00 0.00 ? 54  ASN A HA   1  
ATOM 872   H HB2  . ASN A 1 54  ? -2.315  4.790   -8.775  1.00 0.00 ? 54  ASN A HB2  1  
ATOM 873   H HB3  . ASN A 1 54  ? -2.256  3.133   -9.380  1.00 0.00 ? 54  ASN A HB3  1  
ATOM 874   H HD21 . ASN A 1 54  ? -0.642  6.108   -9.524  1.00 0.00 ? 54  ASN A HD21 1  
ATOM 875   H HD22 . ASN A 1 54  ? 0.247   5.842   -10.944 1.00 0.00 ? 54  ASN A HD22 1  
ATOM 876   N N    . LEU A 1 55  ? -5.211  2.869   -9.190  1.00 0.00 ? 55  LEU A N    1  
ATOM 877   C CA   . LEU A 1 55  ? -6.013  1.623   -9.055  1.00 0.00 ? 55  LEU A CA   1  
ATOM 878   C C    . LEU A 1 55  ? -7.252  1.711   -9.944  1.00 0.00 ? 55  LEU A C    1  
ATOM 879   O O    . LEU A 1 55  ? -8.032  0.783   -10.030 1.00 0.00 ? 55  LEU A O    1  
ATOM 880   C CB   . LEU A 1 55  ? -6.428  1.436   -7.589  1.00 0.00 ? 55  LEU A CB   1  
ATOM 881   C CG   . LEU A 1 55  ? -5.216  1.151   -6.718  1.00 0.00 ? 55  LEU A CG   1  
ATOM 882   C CD1  . LEU A 1 55  ? -4.216  0.261   -7.448  1.00 0.00 ? 55  LEU A CD1  1  
ATOM 883   C CD2  . LEU A 1 55  ? -4.553  2.459   -6.322  1.00 0.00 ? 55  LEU A CD2  1  
ATOM 884   H H    . LEU A 1 55  ? -5.197  3.521   -8.464  1.00 0.00 ? 55  LEU A H    1  
ATOM 885   H HA   . LEU A 1 55  ? -5.420  0.781   -9.370  1.00 0.00 ? 55  LEU A HA   1  
ATOM 886   H HB2  . LEU A 1 55  ? -6.894  2.332   -7.224  1.00 0.00 ? 55  LEU A HB2  1  
ATOM 887   H HB3  . LEU A 1 55  ? -7.121  0.613   -7.514  1.00 0.00 ? 55  LEU A HB3  1  
ATOM 888   H HG   . LEU A 1 55  ? -5.546  0.660   -5.839  1.00 0.00 ? 55  LEU A HG   1  
ATOM 889   H HD11 . LEU A 1 55  ? -3.348  0.121   -6.833  1.00 0.00 ? 55  LEU A HD11 1  
ATOM 890   H HD12 . LEU A 1 55  ? -3.927  0.725   -8.377  1.00 0.00 ? 55  LEU A HD12 1  
ATOM 891   H HD13 . LEU A 1 55  ? -4.672  -0.693  -7.645  1.00 0.00 ? 55  LEU A HD13 1  
ATOM 892   H HD21 . LEU A 1 55  ? -5.316  3.200   -6.126  1.00 0.00 ? 55  LEU A HD21 1  
ATOM 893   H HD22 . LEU A 1 55  ? -3.916  2.798   -7.123  1.00 0.00 ? 55  LEU A HD22 1  
ATOM 894   H HD23 . LEU A 1 55  ? -3.967  2.304   -5.430  1.00 0.00 ? 55  LEU A HD23 1  
ATOM 895   N N    . SER A 1 56  ? -7.434  2.810   -10.618 1.00 0.00 ? 56  SER A N    1  
ATOM 896   C CA   . SER A 1 56  ? -8.611  2.944   -11.513 1.00 0.00 ? 56  SER A CA   1  
ATOM 897   C C    . SER A 1 56  ? -8.231  2.457   -12.912 1.00 0.00 ? 56  SER A C    1  
ATOM 898   O O    . SER A 1 56  ? -8.902  1.630   -13.497 1.00 0.00 ? 56  SER A O    1  
ATOM 899   C CB   . SER A 1 56  ? -9.040  4.410   -11.579 1.00 0.00 ? 56  SER A CB   1  
ATOM 900   O OG   . SER A 1 56  ? -9.651  4.664   -12.838 1.00 0.00 ? 56  SER A OG   1  
ATOM 901   H H    . SER A 1 56  ? -6.790  3.544   -10.545 1.00 0.00 ? 56  SER A H    1  
ATOM 902   H HA   . SER A 1 56  ? -9.425  2.345   -11.130 1.00 0.00 ? 56  SER A HA   1  
ATOM 903   H HB2  . SER A 1 56  ? -9.748  4.617   -10.794 1.00 0.00 ? 56  SER A HB2  1  
ATOM 904   H HB3  . SER A 1 56  ? -8.172  5.044   -11.454 1.00 0.00 ? 56  SER A HB3  1  
ATOM 905   H HG   . SER A 1 56  ? -10.430 4.109   -12.907 1.00 0.00 ? 56  SER A HG   1  
ATOM 906   N N    . LEU A 1 57  ? -7.161  2.969   -13.458 1.00 0.00 ? 57  LEU A N    1  
ATOM 907   C CA   . LEU A 1 57  ? -6.743  2.540   -14.823 1.00 0.00 ? 57  LEU A CA   1  
ATOM 908   C C    . LEU A 1 57  ? -5.751  1.369   -14.752 1.00 0.00 ? 57  LEU A C    1  
ATOM 909   O O    . LEU A 1 57  ? -5.351  0.839   -15.769 1.00 0.00 ? 57  LEU A O    1  
ATOM 910   C CB   . LEU A 1 57  ? -6.103  3.714   -15.580 1.00 0.00 ? 57  LEU A CB   1  
ATOM 911   C CG   . LEU A 1 57  ? -5.301  4.600   -14.621 1.00 0.00 ? 57  LEU A CG   1  
ATOM 912   C CD1  . LEU A 1 57  ? -4.246  3.757   -13.903 1.00 0.00 ? 57  LEU A CD1  1  
ATOM 913   C CD2  . LEU A 1 57  ? -4.607  5.705   -15.421 1.00 0.00 ? 57  LEU A CD2  1  
ATOM 914   H H    . LEU A 1 57  ? -6.636  3.636   -12.969 1.00 0.00 ? 57  LEU A H    1  
ATOM 915   H HA   . LEU A 1 57  ? -7.619  2.216   -15.364 1.00 0.00 ? 57  LEU A HA   1  
ATOM 916   H HB2  . LEU A 1 57  ? -5.445  3.328   -16.345 1.00 0.00 ? 57  LEU A HB2  1  
ATOM 917   H HB3  . LEU A 1 57  ? -6.880  4.305   -16.042 1.00 0.00 ? 57  LEU A HB3  1  
ATOM 918   H HG   . LEU A 1 57  ? -5.965  5.045   -13.897 1.00 0.00 ? 57  LEU A HG   1  
ATOM 919   H HD11 . LEU A 1 57  ? -3.535  4.408   -13.419 1.00 0.00 ? 57  LEU A HD11 1  
ATOM 920   H HD12 . LEU A 1 57  ? -3.734  3.134   -14.621 1.00 0.00 ? 57  LEU A HD12 1  
ATOM 921   H HD13 . LEU A 1 57  ? -4.726  3.134   -13.163 1.00 0.00 ? 57  LEU A HD13 1  
ATOM 922   H HD21 . LEU A 1 57  ? -4.261  6.474   -14.746 1.00 0.00 ? 57  LEU A HD21 1  
ATOM 923   H HD22 . LEU A 1 57  ? -5.304  6.132   -16.126 1.00 0.00 ? 57  LEU A HD22 1  
ATOM 924   H HD23 . LEU A 1 57  ? -3.765  5.289   -15.956 1.00 0.00 ? 57  LEU A HD23 1  
ATOM 925   N N    . ASN A 1 58  ? -5.339  0.952   -13.580 1.00 0.00 ? 58  ASN A N    1  
ATOM 926   C CA   . ASN A 1 58  ? -4.369  -0.188  -13.525 1.00 0.00 ? 58  ASN A CA   1  
ATOM 927   C C    . ASN A 1 58  ? -5.005  -1.422  -14.166 1.00 0.00 ? 58  ASN A C    1  
ATOM 928   O O    . ASN A 1 58  ? -6.212  -1.562  -14.205 1.00 0.00 ? 58  ASN A O    1  
ATOM 929   C CB   . ASN A 1 58  ? -3.952  -0.518  -12.081 1.00 0.00 ? 58  ASN A CB   1  
ATOM 930   C CG   . ASN A 1 58  ? -2.507  -0.062  -11.866 1.00 0.00 ? 58  ASN A CG   1  
ATOM 931   O OD1  . ASN A 1 58  ? -1.674  -0.832  -11.433 1.00 0.00 ? 58  ASN A OD1  1  
ATOM 932   N ND2  . ASN A 1 58  ? -2.174  1.166   -12.156 1.00 0.00 ? 58  ASN A ND2  1  
ATOM 933   H H    . ASN A 1 58  ? -5.659  1.379   -12.758 1.00 0.00 ? 58  ASN A H    1  
ATOM 934   H HA   . ASN A 1 58  ? -3.487  0.080   -14.091 1.00 0.00 ? 58  ASN A HA   1  
ATOM 935   H HB2  . ASN A 1 58  ? -4.598  -0.018  -11.377 1.00 0.00 ? 58  ASN A HB2  1  
ATOM 936   H HB3  . ASN A 1 58  ? -4.013  -1.584  -11.927 1.00 0.00 ? 58  ASN A HB3  1  
ATOM 937   H HD21 . ASN A 1 58  ? -2.846  1.786   -12.506 1.00 0.00 ? 58  ASN A HD21 1  
ATOM 938   H HD22 . ASN A 1 58  ? -1.250  1.466   -12.024 1.00 0.00 ? 58  ASN A HD22 1  
ATOM 939   N N    . ARG A 1 59  ? -4.202  -2.308  -14.689 1.00 0.00 ? 59  ARG A N    1  
ATOM 940   C CA   . ARG A 1 59  ? -4.755  -3.523  -15.351 1.00 0.00 ? 59  ARG A CA   1  
ATOM 941   C C    . ARG A 1 59  ? -4.902  -4.670  -14.342 1.00 0.00 ? 59  ARG A C    1  
ATOM 942   O O    . ARG A 1 59  ? -5.739  -5.537  -14.503 1.00 0.00 ? 59  ARG A O    1  
ATOM 943   C CB   . ARG A 1 59  ? -3.809  -3.949  -16.477 1.00 0.00 ? 59  ARG A CB   1  
ATOM 944   C CG   . ARG A 1 59  ? -4.275  -5.282  -17.067 1.00 0.00 ? 59  ARG A CG   1  
ATOM 945   C CD   . ARG A 1 59  ? -4.752  -5.067  -18.505 1.00 0.00 ? 59  ARG A CD   1  
ATOM 946   N NE   . ARG A 1 59  ? -5.153  -6.376  -19.092 1.00 0.00 ? 59  ARG A NE   1  
ATOM 947   C CZ   . ARG A 1 59  ? -6.209  -6.996  -18.642 1.00 0.00 ? 59  ARG A CZ   1  
ATOM 948   N NH1  . ARG A 1 59  ? -7.399  -6.582  -18.980 1.00 0.00 ? 59  ARG A NH1  1  
ATOM 949   N NH2  . ARG A 1 59  ? -6.074  -8.029  -17.855 1.00 0.00 ? 59  ARG A NH2  1  
ATOM 950   H H    . ARG A 1 59  ? -3.233  -2.167  -14.657 1.00 0.00 ? 59  ARG A H    1  
ATOM 951   H HA   . ARG A 1 59  ? -5.722  -3.290  -15.769 1.00 0.00 ? 59  ARG A HA   1  
ATOM 952   H HB2  . ARG A 1 59  ? -3.809  -3.195  -17.250 1.00 0.00 ? 59  ARG A HB2  1  
ATOM 953   H HB3  . ARG A 1 59  ? -2.810  -4.063  -16.084 1.00 0.00 ? 59  ARG A HB3  1  
ATOM 954   H HG2  . ARG A 1 59  ? -3.453  -5.983  -17.062 1.00 0.00 ? 59  ARG A HG2  1  
ATOM 955   H HG3  . ARG A 1 59  ? -5.087  -5.675  -16.476 1.00 0.00 ? 59  ARG A HG3  1  
ATOM 956   H HD2  . ARG A 1 59  ? -5.599  -4.396  -18.508 1.00 0.00 ? 59  ARG A HD2  1  
ATOM 957   H HD3  . ARG A 1 59  ? -3.952  -4.639  -19.089 1.00 0.00 ? 59  ARG A HD3  1  
ATOM 958   H HE   . ARG A 1 59  ? -4.625  -6.769  -19.818 1.00 0.00 ? 59  ARG A HE   1  
ATOM 959   H HH11 . ARG A 1 59  ? -7.501  -5.791  -19.582 1.00 0.00 ? 59  ARG A HH11 1  
ATOM 960   H HH12 . ARG A 1 59  ? -8.209  -7.056  -18.635 1.00 0.00 ? 59  ARG A HH12 1  
ATOM 961   H HH21 . ARG A 1 59  ? -5.161  -8.345  -17.597 1.00 0.00 ? 59  ARG A HH21 1  
ATOM 962   H HH22 . ARG A 1 59  ? -6.884  -8.504  -17.512 1.00 0.00 ? 59  ARG A HH22 1  
ATOM 963   N N    . TYR A 1 60  ? -4.099  -4.700  -13.313 1.00 0.00 ? 60  TYR A N    1  
ATOM 964   C CA   . TYR A 1 60  ? -4.218  -5.817  -12.327 1.00 0.00 ? 60  TYR A CA   1  
ATOM 965   C C    . TYR A 1 60  ? -5.093  -5.400  -11.147 1.00 0.00 ? 60  TYR A C    1  
ATOM 966   O O    . TYR A 1 60  ? -5.868  -6.181  -10.637 1.00 0.00 ? 60  TYR A O    1  
ATOM 967   C CB   . TYR A 1 60  ? -2.840  -6.237  -11.787 1.00 0.00 ? 60  TYR A CB   1  
ATOM 968   C CG   . TYR A 1 60  ? -1.753  -5.321  -12.297 1.00 0.00 ? 60  TYR A CG   1  
ATOM 969   C CD1  . TYR A 1 60  ? -1.232  -5.507  -13.581 1.00 0.00 ? 60  TYR A CD1  1  
ATOM 970   C CD2  . TYR A 1 60  ? -1.256  -4.297  -11.481 1.00 0.00 ? 60  TYR A CD2  1  
ATOM 971   C CE1  . TYR A 1 60  ? -0.218  -4.670  -14.055 1.00 0.00 ? 60  TYR A CE1  1  
ATOM 972   C CE2  . TYR A 1 60  ? -0.239  -3.459  -11.953 1.00 0.00 ? 60  TYR A CE2  1  
ATOM 973   C CZ   . TYR A 1 60  ? 0.280   -3.645  -13.239 1.00 0.00 ? 60  TYR A CZ   1  
ATOM 974   O OH   . TYR A 1 60  ? 1.284   -2.820  -13.704 1.00 0.00 ? 60  TYR A OH   1  
ATOM 975   H H    . TYR A 1 60  ? -3.425  -3.999  -13.193 1.00 0.00 ? 60  TYR A H    1  
ATOM 976   H HA   . TYR A 1 60  ? -4.674  -6.666  -12.816 1.00 0.00 ? 60  TYR A HA   1  
ATOM 977   H HB2  . TYR A 1 60  ? -2.855  -6.198  -10.709 1.00 0.00 ? 60  TYR A HB2  1  
ATOM 978   H HB3  . TYR A 1 60  ? -2.629  -7.248  -12.102 1.00 0.00 ? 60  TYR A HB3  1  
ATOM 979   H HD1  . TYR A 1 60  ? -1.616  -6.297  -14.208 1.00 0.00 ? 60  TYR A HD1  1  
ATOM 980   H HD2  . TYR A 1 60  ? -1.658  -4.153  -10.487 1.00 0.00 ? 60  TYR A HD2  1  
ATOM 981   H HE1  . TYR A 1 60  ? 0.183   -4.814  -15.047 1.00 0.00 ? 60  TYR A HE1  1  
ATOM 982   H HE2  . TYR A 1 60  ? 0.144   -2.670  -11.323 1.00 0.00 ? 60  TYR A HE2  1  
ATOM 983   H HH   . TYR A 1 60  ? 0.885   -2.156  -14.271 1.00 0.00 ? 60  TYR A HH   1  
ATOM 984   N N    . PHE A 1 61  ? -4.974  -4.188  -10.688 1.00 0.00 ? 61  PHE A N    1  
ATOM 985   C CA   . PHE A 1 61  ? -5.797  -3.776  -9.519  1.00 0.00 ? 61  PHE A CA   1  
ATOM 986   C C    . PHE A 1 61  ? -7.224  -3.494  -9.956  1.00 0.00 ? 61  PHE A C    1  
ATOM 987   O O    . PHE A 1 61  ? -7.497  -3.150  -11.089 1.00 0.00 ? 61  PHE A O    1  
ATOM 988   C CB   . PHE A 1 61  ? -5.201  -2.528  -8.876  1.00 0.00 ? 61  PHE A CB   1  
ATOM 989   C CG   . PHE A 1 61  ? -3.743  -2.767  -8.608  1.00 0.00 ? 61  PHE A CG   1  
ATOM 990   C CD1  . PHE A 1 61  ? -3.349  -3.760  -7.708  1.00 0.00 ? 61  PHE A CD1  1  
ATOM 991   C CD2  . PHE A 1 61  ? -2.787  -2.002  -9.269  1.00 0.00 ? 61  PHE A CD2  1  
ATOM 992   C CE1  . PHE A 1 61  ? -1.996  -3.984  -7.472  1.00 0.00 ? 61  PHE A CE1  1  
ATOM 993   C CE2  . PHE A 1 61  ? -1.433  -2.220  -9.034  1.00 0.00 ? 61  PHE A CE2  1  
ATOM 994   C CZ   . PHE A 1 61  ? -1.031  -3.215  -8.134  1.00 0.00 ? 61  PHE A CZ   1  
ATOM 995   H H    . PHE A 1 61  ? -4.338  -3.562  -11.094 1.00 0.00 ? 61  PHE A H    1  
ATOM 996   H HA   . PHE A 1 61  ? -5.803  -4.575  -8.796  1.00 0.00 ? 61  PHE A HA   1  
ATOM 997   H HB2  . PHE A 1 61  ? -5.313  -1.686  -9.544  1.00 0.00 ? 61  PHE A HB2  1  
ATOM 998   H HB3  . PHE A 1 61  ? -5.703  -2.319  -7.940  1.00 0.00 ? 61  PHE A HB3  1  
ATOM 999   H HD1  . PHE A 1 61  ? -4.090  -4.352  -7.192  1.00 0.00 ? 61  PHE A HD1  1  
ATOM 1000  H HD2  . PHE A 1 61  ? -3.095  -1.237  -9.957  1.00 0.00 ? 61  PHE A HD2  1  
ATOM 1001  H HE1  . PHE A 1 61  ? -1.697  -4.750  -6.777  1.00 0.00 ? 61  PHE A HE1  1  
ATOM 1002  H HE2  . PHE A 1 61  ? -0.701  -1.623  -9.549  1.00 0.00 ? 61  PHE A HE2  1  
ATOM 1003  H HZ   . PHE A 1 61  ? 0.019   -3.388  -7.952  1.00 0.00 ? 61  PHE A HZ   1  
ATOM 1004  N N    . ILE A 1 62  ? -8.133  -3.661  -9.049  1.00 0.00 ? 62  ILE A N    1  
ATOM 1005  C CA   . ILE A 1 62  ? -9.571  -3.433  -9.360  1.00 0.00 ? 62  ILE A CA   1  
ATOM 1006  C C    . ILE A 1 62  ? -10.304 -3.071  -8.069  1.00 0.00 ? 62  ILE A C    1  
ATOM 1007  O O    . ILE A 1 62  ? -9.858  -3.396  -6.990  1.00 0.00 ? 62  ILE A O    1  
ATOM 1008  C CB   . ILE A 1 62  ? -10.165 -4.718  -9.942  1.00 0.00 ? 62  ILE A CB   1  
ATOM 1009  C CG1  . ILE A 1 62  ? -9.998  -5.856  -8.932  1.00 0.00 ? 62  ILE A CG1  1  
ATOM 1010  C CG2  . ILE A 1 62  ? -9.434  -5.089  -11.233 1.00 0.00 ? 62  ILE A CG2  1  
ATOM 1011  C CD1  . ILE A 1 62  ? -11.060 -6.926  -9.193  1.00 0.00 ? 62  ILE A CD1  1  
ATOM 1012  H H    . ILE A 1 62  ? -7.862  -3.949  -8.150  1.00 0.00 ? 62  ILE A H    1  
ATOM 1013  H HA   . ILE A 1 62  ? -9.669  -2.629  -10.074 1.00 0.00 ? 62  ILE A HA   1  
ATOM 1014  H HB   . ILE A 1 62  ? -11.214 -4.569  -10.150 1.00 0.00 ? 62  ILE A HB   1  
ATOM 1015  H HG12 . ILE A 1 62  ? -9.012  -6.291  -9.039  1.00 0.00 ? 62  ILE A HG12 1  
ATOM 1016  H HG13 . ILE A 1 62  ? -10.115 -5.471  -7.929  1.00 0.00 ? 62  ILE A HG13 1  
ATOM 1017  H HG21 . ILE A 1 62  ? -10.022 -5.807  -11.786 1.00 0.00 ? 62  ILE A HG21 1  
ATOM 1018  H HG22 . ILE A 1 62  ? -8.474  -5.522  -10.991 1.00 0.00 ? 62  ILE A HG22 1  
ATOM 1019  H HG23 . ILE A 1 62  ? -9.289  -4.204  -11.832 1.00 0.00 ? 62  ILE A HG23 1  
ATOM 1020  H HD11 . ILE A 1 62  ? -10.596 -7.902  -9.198  1.00 0.00 ? 62  ILE A HD11 1  
ATOM 1021  H HD12 . ILE A 1 62  ? -11.527 -6.744  -10.150 1.00 0.00 ? 62  ILE A HD12 1  
ATOM 1022  H HD13 . ILE A 1 62  ? -11.810 -6.888  -8.416  1.00 0.00 ? 62  ILE A HD13 1  
ATOM 1023  N N    . LYS A 1 63  ? -11.420 -2.405  -8.155  1.00 0.00 ? 63  LYS A N    1  
ATOM 1024  C CA   . LYS A 1 63  ? -12.144 -2.047  -6.901  1.00 0.00 ? 63  LYS A CA   1  
ATOM 1025  C C    . LYS A 1 63  ? -12.794 -3.295  -6.315  1.00 0.00 ? 63  LYS A C    1  
ATOM 1026  O O    . LYS A 1 63  ? -12.722 -4.370  -6.875  1.00 0.00 ? 63  LYS A O    1  
ATOM 1027  C CB   . LYS A 1 63  ? -13.230 -1.000  -7.169  1.00 0.00 ? 63  LYS A CB   1  
ATOM 1028  C CG   . LYS A 1 63  ? -12.675 0.399   -6.896  1.00 0.00 ? 63  LYS A CG   1  
ATOM 1029  C CD   . LYS A 1 63  ? -13.784 1.282   -6.315  1.00 0.00 ? 63  LYS A CD   1  
ATOM 1030  C CE   . LYS A 1 63  ? -14.220 0.736   -4.954  1.00 0.00 ? 63  LYS A CE   1  
ATOM 1031  N NZ   . LYS A 1 63  ? -13.576 1.531   -3.871  1.00 0.00 ? 63  LYS A NZ   1  
ATOM 1032  H H    . LYS A 1 63  ? -11.777 -2.145  -9.030  1.00 0.00 ? 63  LYS A H    1  
ATOM 1033  H HA   . LYS A 1 63  ? -11.436 -1.654  -6.191  1.00 0.00 ? 63  LYS A HA   1  
ATOM 1034  H HB2  . LYS A 1 63  ? -13.559 -1.066  -8.196  1.00 0.00 ? 63  LYS A HB2  1  
ATOM 1035  H HB3  . LYS A 1 63  ? -14.067 -1.184  -6.509  1.00 0.00 ? 63  LYS A HB3  1  
ATOM 1036  H HG2  . LYS A 1 63  ? -11.860 0.332   -6.190  1.00 0.00 ? 63  LYS A HG2  1  
ATOM 1037  H HG3  . LYS A 1 63  ? -12.319 0.832   -7.818  1.00 0.00 ? 63  LYS A HG3  1  
ATOM 1038  H HD2  . LYS A 1 63  ? -13.414 2.290   -6.196  1.00 0.00 ? 63  LYS A HD2  1  
ATOM 1039  H HD3  . LYS A 1 63  ? -14.629 1.286   -6.988  1.00 0.00 ? 63  LYS A HD3  1  
ATOM 1040  H HE2  . LYS A 1 63  ? -15.294 0.808   -4.863  1.00 0.00 ? 63  LYS A HE2  1  
ATOM 1041  H HE3  . LYS A 1 63  ? -13.922 -0.299  -4.868  1.00 0.00 ? 63  LYS A HE3  1  
ATOM 1042  H HZ1  . LYS A 1 63  ? -12.543 1.482   -3.972  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM 1043  H HZ2  . LYS A 1 63  ? -13.854 1.145   -2.945  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM 1044  H HZ3  . LYS A 1 63  ? -13.882 2.522   -3.940  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM 1045  N N    . VAL A 1 64  ? -13.431 -3.157  -5.187  1.00 0.00 ? 64  VAL A N    1  
ATOM 1046  C CA   . VAL A 1 64  ? -14.092 -4.332  -4.555  1.00 0.00 ? 64  VAL A CA   1  
ATOM 1047  C C    . VAL A 1 64  ? -15.568 -4.356  -4.972  1.00 0.00 ? 64  VAL A C    1  
ATOM 1048  O O    . VAL A 1 64  ? -16.214 -3.328  -5.004  1.00 0.00 ? 64  VAL A O    1  
ATOM 1049  C CB   . VAL A 1 64  ? -13.958 -4.205  -3.032  1.00 0.00 ? 64  VAL A CB   1  
ATOM 1050  C CG1  . VAL A 1 64  ? -15.057 -4.995  -2.323  1.00 0.00 ? 64  VAL A CG1  1  
ATOM 1051  C CG2  . VAL A 1 64  ? -12.592 -4.747  -2.603  1.00 0.00 ? 64  VAL A CG2  1  
ATOM 1052  H H    . VAL A 1 64  ? -13.476 -2.275  -4.752  1.00 0.00 ? 64  VAL A H    1  
ATOM 1053  H HA   . VAL A 1 64  ? -13.603 -5.237  -4.886  1.00 0.00 ? 64  VAL A HA   1  
ATOM 1054  H HB   . VAL A 1 64  ? -14.039 -3.166  -2.757  1.00 0.00 ? 64  VAL A HB   1  
ATOM 1055  H HG11 . VAL A 1 64  ? -14.925 -6.047  -2.518  1.00 0.00 ? 64  VAL A HG11 1  
ATOM 1056  H HG12 . VAL A 1 64  ? -16.021 -4.675  -2.687  1.00 0.00 ? 64  VAL A HG12 1  
ATOM 1057  H HG13 . VAL A 1 64  ? -14.995 -4.815  -1.260  1.00 0.00 ? 64  VAL A HG13 1  
ATOM 1058  H HG21 . VAL A 1 64  ? -11.821 -4.318  -3.225  1.00 0.00 ? 64  VAL A HG21 1  
ATOM 1059  H HG22 . VAL A 1 64  ? -12.583 -5.822  -2.710  1.00 0.00 ? 64  VAL A HG22 1  
ATOM 1060  H HG23 . VAL A 1 64  ? -12.408 -4.488  -1.572  1.00 0.00 ? 64  VAL A HG23 1  
ATOM 1061  N N    . PRO A 1 65  ? -16.057 -5.529  -5.289  1.00 0.00 ? 65  PRO A N    1  
ATOM 1062  C CA   . PRO A 1 65  ? -17.454 -5.710  -5.720  1.00 0.00 ? 65  PRO A CA   1  
ATOM 1063  C C    . PRO A 1 65  ? -18.401 -5.649  -4.521  1.00 0.00 ? 65  PRO A C    1  
ATOM 1064  O O    . PRO A 1 65  ? -18.004 -5.855  -3.391  1.00 0.00 ? 65  PRO A O    1  
ATOM 1065  C CB   . PRO A 1 65  ? -17.459 -7.103  -6.355  1.00 0.00 ? 65  PRO A CB   1  
ATOM 1066  C CG   . PRO A 1 65  ? -16.244 -7.856  -5.763  1.00 0.00 ? 65  PRO A CG   1  
ATOM 1067  C CD   . PRO A 1 65  ? -15.271 -6.779  -5.245  1.00 0.00 ? 65  PRO A CD   1  
ATOM 1068  H HA   . PRO A 1 65  ? -17.723 -4.971  -6.457  1.00 0.00 ? 65  PRO A HA   1  
ATOM 1069  H HB2  . PRO A 1 65  ? -18.377 -7.618  -6.109  1.00 0.00 ? 65  PRO A HB2  1  
ATOM 1070  H HB3  . PRO A 1 65  ? -17.352 -7.023  -7.424  1.00 0.00 ? 65  PRO A HB3  1  
ATOM 1071  H HG2  . PRO A 1 65  ? -16.565 -8.492  -4.950  1.00 0.00 ? 65  PRO A HG2  1  
ATOM 1072  H HG3  . PRO A 1 65  ? -15.763 -8.444  -6.528  1.00 0.00 ? 65  PRO A HG3  1  
ATOM 1073  H HD2  . PRO A 1 65  ? -14.965 -7.003  -4.232  1.00 0.00 ? 65  PRO A HD2  1  
ATOM 1074  H HD3  . PRO A 1 65  ? -14.412 -6.702  -5.894  1.00 0.00 ? 65  PRO A HD3  1  
ATOM 1075  N N    . ARG A 1 66  ? -19.649 -5.362  -4.760  1.00 0.00 ? 66  ARG A N    1  
ATOM 1076  C CA   . ARG A 1 66  ? -20.625 -5.282  -3.638  1.00 0.00 ? 66  ARG A CA   1  
ATOM 1077  C C    . ARG A 1 66  ? -22.046 -5.345  -4.199  1.00 0.00 ? 66  ARG A C    1  
ATOM 1078  O O    . ARG A 1 66  ? -22.894 -4.546  -3.854  1.00 0.00 ? 66  ARG A O    1  
ATOM 1079  C CB   . ARG A 1 66  ? -20.429 -3.962  -2.890  1.00 0.00 ? 66  ARG A CB   1  
ATOM 1080  C CG   . ARG A 1 66  ? -21.246 -3.976  -1.597  1.00 0.00 ? 66  ARG A CG   1  
ATOM 1081  C CD   . ARG A 1 66  ? -21.107 -2.625  -0.894  1.00 0.00 ? 66  ARG A CD   1  
ATOM 1082  N NE   . ARG A 1 66  ? -22.208 -1.720  -1.331  1.00 0.00 ? 66  ARG A NE   1  
ATOM 1083  C CZ   . ARG A 1 66  ? -22.188 -0.456  -1.000  1.00 0.00 ? 66  ARG A CZ   1  
ATOM 1084  N NH1  . ARG A 1 66  ? -21.082 0.095   -0.581  1.00 0.00 ? 66  ARG A NH1  1  
ATOM 1085  N NH2  . ARG A 1 66  ? -23.277 0.256   -1.089  1.00 0.00 ? 66  ARG A NH2  1  
ATOM 1086  H H    . ARG A 1 66  ? -19.946 -5.198  -5.680  1.00 0.00 ? 66  ARG A H    1  
ATOM 1087  H HA   . ARG A 1 66  ? -20.466 -6.108  -2.960  1.00 0.00 ? 66  ARG A HA   1  
ATOM 1088  H HB2  . ARG A 1 66  ? -19.382 -3.833  -2.655  1.00 0.00 ? 66  ARG A HB2  1  
ATOM 1089  H HB3  . ARG A 1 66  ? -20.761 -3.145  -3.513  1.00 0.00 ? 66  ARG A HB3  1  
ATOM 1090  H HG2  . ARG A 1 66  ? -22.286 -4.158  -1.830  1.00 0.00 ? 66  ARG A HG2  1  
ATOM 1091  H HG3  . ARG A 1 66  ? -20.880 -4.757  -0.948  1.00 0.00 ? 66  ARG A HG3  1  
ATOM 1092  H HD2  . ARG A 1 66  ? -21.160 -2.768  0.176   1.00 0.00 ? 66  ARG A HD2  1  
ATOM 1093  H HD3  . ARG A 1 66  ? -20.156 -2.184  -1.151  1.00 0.00 ? 66  ARG A HD3  1  
ATOM 1094  H HE   . ARG A 1 66  ? -22.949 -2.075  -1.866  1.00 0.00 ? 66  ARG A HE   1  
ATOM 1095  H HH11 . ARG A 1 66  ? -20.247 -0.449  -0.511  1.00 0.00 ? 66  ARG A HH11 1  
ATOM 1096  H HH12 . ARG A 1 66  ? -21.071 1.063   -0.328  1.00 0.00 ? 66  ARG A HH12 1  
ATOM 1097  H HH21 . ARG A 1 66  ? -24.125 -0.164  -1.410  1.00 0.00 ? 66  ARG A HH21 1  
ATOM 1098  H HH22 . ARG A 1 66  ? -23.263 1.224   -0.837  1.00 0.00 ? 66  ARG A HH22 1  
ATOM 1099  N N    . SER A 1 67  ? -22.312 -6.286  -5.063  1.00 0.00 ? 67  SER A N    1  
ATOM 1100  C CA   . SER A 1 67  ? -23.679 -6.396  -5.647  1.00 0.00 ? 67  SER A CA   1  
ATOM 1101  C C    . SER A 1 67  ? -24.595 -7.130  -4.665  1.00 0.00 ? 67  SER A C    1  
ATOM 1102  O O    . SER A 1 67  ? -25.733 -6.756  -4.465  1.00 0.00 ? 67  SER A O    1  
ATOM 1103  C CB   . SER A 1 67  ? -23.611 -7.175  -6.960  1.00 0.00 ? 67  SER A CB   1  
ATOM 1104  O OG   . SER A 1 67  ? -23.777 -8.562  -6.692  1.00 0.00 ? 67  SER A OG   1  
ATOM 1105  H H    . SER A 1 67  ? -21.613 -6.919  -5.329  1.00 0.00 ? 67  SER A H    1  
ATOM 1106  H HA   . SER A 1 67  ? -24.070 -5.407  -5.835  1.00 0.00 ? 67  SER A HA   1  
ATOM 1107  H HB2  . SER A 1 67  ? -24.398 -6.845  -7.617  1.00 0.00 ? 67  SER A HB2  1  
ATOM 1108  H HB3  . SER A 1 67  ? -22.654 -7.002  -7.432  1.00 0.00 ? 67  SER A HB3  1  
ATOM 1109  H HG   . SER A 1 67  ? -23.011 -9.024  -7.040  1.00 0.00 ? 67  SER A HG   1  
ATOM 1110  N N    . GLN A 1 68  ? -24.108 -8.174  -4.052  1.00 0.00 ? 68  GLN A N    1  
ATOM 1111  C CA   . GLN A 1 68  ? -24.952 -8.931  -3.085  1.00 0.00 ? 68  GLN A CA   1  
ATOM 1112  C C    . GLN A 1 68  ? -24.085 -9.424  -1.924  1.00 0.00 ? 68  GLN A C    1  
ATOM 1113  O O    . GLN A 1 68  ? -24.168 -8.926  -0.820  1.00 0.00 ? 68  GLN A O    1  
ATOM 1114  C CB   . GLN A 1 68  ? -25.589 -10.128 -3.794  1.00 0.00 ? 68  GLN A CB   1  
ATOM 1115  C CG   . GLN A 1 68  ? -27.071 -9.843  -4.044  1.00 0.00 ? 68  GLN A CG   1  
ATOM 1116  C CD   . GLN A 1 68  ? -27.767 -11.125 -4.506  1.00 0.00 ? 68  GLN A CD   1  
ATOM 1117  O OE1  . GLN A 1 68  ? -28.701 -11.582 -3.878  1.00 0.00 ? 68  GLN A OE1  1  
ATOM 1118  N NE2  . GLN A 1 68  ? -27.350 -11.728 -5.585  1.00 0.00 ? 68  GLN A NE2  1  
ATOM 1119  H H    . GLN A 1 68  ? -23.187 -8.460  -4.227  1.00 0.00 ? 68  GLN A H    1  
ATOM 1120  H HA   . GLN A 1 68  ? -25.728 -8.285  -2.704  1.00 0.00 ? 68  GLN A HA   1  
ATOM 1121  H HB2  . GLN A 1 68  ? -25.089 -10.293 -4.739  1.00 0.00 ? 68  GLN A HB2  1  
ATOM 1122  H HB3  . GLN A 1 68  ? -25.492 -11.006 -3.176  1.00 0.00 ? 68  GLN A HB3  1  
ATOM 1123  H HG2  . GLN A 1 68  ? -27.529 -9.492  -3.131  1.00 0.00 ? 68  GLN A HG2  1  
ATOM 1124  H HG3  . GLN A 1 68  ? -27.169 -9.088  -4.810  1.00 0.00 ? 68  GLN A HG3  1  
ATOM 1125  H HE21 . GLN A 1 68  ? -26.596 -11.359 -6.093  1.00 0.00 ? 68  GLN A HE21 1  
ATOM 1126  H HE22 . GLN A 1 68  ? -27.789 -12.550 -5.890  1.00 0.00 ? 68  GLN A HE22 1  
ATOM 1127  N N    . GLU A 1 69  ? -23.253 -10.402 -2.164  1.00 0.00 ? 69  GLU A N    1  
ATOM 1128  C CA   . GLU A 1 69  ? -22.384 -10.926 -1.072  1.00 0.00 ? 69  GLU A CA   1  
ATOM 1129  C C    . GLU A 1 69  ? -20.989 -10.307 -1.183  1.00 0.00 ? 69  GLU A C    1  
ATOM 1130  O O    . GLU A 1 69  ? -20.772 -9.370  -1.925  1.00 0.00 ? 69  GLU A O    1  
ATOM 1131  C CB   . GLU A 1 69  ? -22.277 -12.447 -1.190  1.00 0.00 ? 69  GLU A CB   1  
ATOM 1132  C CG   . GLU A 1 69  ? -23.665 -13.071 -1.047  1.00 0.00 ? 69  GLU A CG   1  
ATOM 1133  C CD   . GLU A 1 69  ? -23.829 -13.633 0.367   1.00 0.00 ? 69  GLU A CD   1  
ATOM 1134  O OE1  . GLU A 1 69  ? -22.859 -13.613 1.107   1.00 0.00 ? 69  GLU A OE1  1  
ATOM 1135  O OE2  . GLU A 1 69  ? -24.921 -14.074 0.685   1.00 0.00 ? 69  GLU A OE2  1  
ATOM 1136  H H    . GLU A 1 69  ? -23.202 -10.793 -3.062  1.00 0.00 ? 69  GLU A H    1  
ATOM 1137  H HA   . GLU A 1 69  ? -22.817 -10.670 -0.115  1.00 0.00 ? 69  GLU A HA   1  
ATOM 1138  H HB2  . GLU A 1 69  ? -21.863 -12.704 -2.155  1.00 0.00 ? 69  GLU A HB2  1  
ATOM 1139  H HB3  . GLU A 1 69  ? -21.633 -12.823 -0.410  1.00 0.00 ? 69  GLU A HB3  1  
ATOM 1140  H HG2  . GLU A 1 69  ? -24.418 -12.317 -1.224  1.00 0.00 ? 69  GLU A HG2  1  
ATOM 1141  H HG3  . GLU A 1 69  ? -23.779 -13.869 -1.764  1.00 0.00 ? 69  GLU A HG3  1  
ATOM 1142  N N    . GLU A 1 70  ? -20.041 -10.824 -0.449  1.00 0.00 ? 70  GLU A N    1  
ATOM 1143  C CA   . GLU A 1 70  ? -18.661 -10.266 -0.509  1.00 0.00 ? 70  GLU A CA   1  
ATOM 1144  C C    . GLU A 1 70  ? -17.646 -11.413 -0.554  1.00 0.00 ? 70  GLU A C    1  
ATOM 1145  O O    . GLU A 1 70  ? -17.961 -12.531 -0.200  1.00 0.00 ? 70  GLU A O    1  
ATOM 1146  C CB   . GLU A 1 70  ? -18.403 -9.410  0.734   1.00 0.00 ? 70  GLU A CB   1  
ATOM 1147  C CG   . GLU A 1 70  ? -18.728 -7.947  0.426   1.00 0.00 ? 70  GLU A CG   1  
ATOM 1148  C CD   . GLU A 1 70  ? -17.755 -7.040  1.180   1.00 0.00 ? 70  GLU A CD   1  
ATOM 1149  O OE1  . GLU A 1 70  ? -16.581 -7.371  1.227   1.00 0.00 ? 70  GLU A OE1  1  
ATOM 1150  O OE2  . GLU A 1 70  ? -18.199 -6.027  1.697   1.00 0.00 ? 70  GLU A OE2  1  
ATOM 1151  H H    . GLU A 1 70  ? -20.238 -11.579 0.145   1.00 0.00 ? 70  GLU A H    1  
ATOM 1152  H HA   . GLU A 1 70  ? -18.556 -9.656  -1.394  1.00 0.00 ? 70  GLU A HA   1  
ATOM 1153  H HB2  . GLU A 1 70  ? -19.029 -9.755  1.544   1.00 0.00 ? 70  GLU A HB2  1  
ATOM 1154  H HB3  . GLU A 1 70  ? -17.366 -9.493  1.020   1.00 0.00 ? 70  GLU A HB3  1  
ATOM 1155  H HG2  . GLU A 1 70  ? -18.635 -7.774  -0.636  1.00 0.00 ? 70  GLU A HG2  1  
ATOM 1156  H HG3  . GLU A 1 70  ? -19.737 -7.728  0.740   1.00 0.00 ? 70  GLU A HG3  1  
ATOM 1157  N N    . PRO A 1 71  ? -16.452 -11.095 -0.988  1.00 0.00 ? 71  PRO A N    1  
ATOM 1158  C CA   . PRO A 1 71  ? -15.358 -12.075 -1.091  1.00 0.00 ? 71  PRO A CA   1  
ATOM 1159  C C    . PRO A 1 71  ? -14.743 -12.330 0.288   1.00 0.00 ? 71  PRO A C    1  
ATOM 1160  O O    . PRO A 1 71  ? -14.145 -13.359 0.532   1.00 0.00 ? 71  PRO A O    1  
ATOM 1161  C CB   . PRO A 1 71  ? -14.351 -11.391 -2.021  1.00 0.00 ? 71  PRO A CB   1  
ATOM 1162  C CG   . PRO A 1 71  ? -14.643 -9.873  -1.939  1.00 0.00 ? 71  PRO A CG   1  
ATOM 1163  C CD   . PRO A 1 71  ? -16.084 -9.729  -1.415  1.00 0.00 ? 71  PRO A CD   1  
ATOM 1164  H HA   . PRO A 1 71  ? -15.706 -12.993 -1.534  1.00 0.00 ? 71  PRO A HA   1  
ATOM 1165  H HB2  . PRO A 1 71  ? -13.342 -11.596 -1.688  1.00 0.00 ? 71  PRO A HB2  1  
ATOM 1166  H HB3  . PRO A 1 71  ? -14.486 -11.733 -3.034  1.00 0.00 ? 71  PRO A HB3  1  
ATOM 1167  H HG2  . PRO A 1 71  ? -13.949 -9.400  -1.259  1.00 0.00 ? 71  PRO A HG2  1  
ATOM 1168  H HG3  . PRO A 1 71  ? -14.565 -9.427  -2.918  1.00 0.00 ? 71  PRO A HG3  1  
ATOM 1169  H HD2  . PRO A 1 71  ? -16.115 -9.046  -0.578  1.00 0.00 ? 71  PRO A HD2  1  
ATOM 1170  H HD3  . PRO A 1 71  ? -16.742 -9.396  -2.203  1.00 0.00 ? 71  PRO A HD3  1  
ATOM 1171  N N    . GLY A 1 72  ? -14.887 -11.398 1.192   1.00 0.00 ? 72  GLY A N    1  
ATOM 1172  C CA   . GLY A 1 72  ? -14.313 -11.584 2.555   1.00 0.00 ? 72  GLY A CA   1  
ATOM 1173  C C    . GLY A 1 72  ? -14.890 -10.526 3.498   1.00 0.00 ? 72  GLY A C    1  
ATOM 1174  O O    . GLY A 1 72  ? -16.088 -10.416 3.664   1.00 0.00 ? 72  GLY A O    1  
ATOM 1175  H H    . GLY A 1 72  ? -15.372 -10.576 0.974   1.00 0.00 ? 72  GLY A H    1  
ATOM 1176  H HA2  . GLY A 1 72  ? -14.566 -12.569 2.921   1.00 0.00 ? 72  GLY A HA2  1  
ATOM 1177  H HA3  . GLY A 1 72  ? -13.238 -11.479 2.510   1.00 0.00 ? 72  GLY A HA3  1  
ATOM 1178  N N    . LYS A 1 73  ? -14.047 -9.743  4.117   1.00 0.00 ? 73  LYS A N    1  
ATOM 1179  C CA   . LYS A 1 73  ? -14.552 -8.693  5.046   1.00 0.00 ? 73  LYS A CA   1  
ATOM 1180  C C    . LYS A 1 73  ? -13.772 -7.395  4.821   1.00 0.00 ? 73  LYS A C    1  
ATOM 1181  O O    . LYS A 1 73  ? -12.969 -6.991  5.638   1.00 0.00 ? 73  LYS A O    1  
ATOM 1182  C CB   . LYS A 1 73  ? -14.369 -9.155  6.494   1.00 0.00 ? 73  LYS A CB   1  
ATOM 1183  C CG   . LYS A 1 73  ? -14.959 -8.106  7.441   1.00 0.00 ? 73  LYS A CG   1  
ATOM 1184  C CD   . LYS A 1 73  ? -14.709 -8.525  8.892   1.00 0.00 ? 73  LYS A CD   1  
ATOM 1185  C CE   . LYS A 1 73  ? -16.029 -8.501  9.664   1.00 0.00 ? 73  LYS A CE   1  
ATOM 1186  N NZ   . LYS A 1 73  ? -15.796 -7.961  11.034  1.00 0.00 ? 73  LYS A NZ   1  
ATOM 1187  H H    . LYS A 1 73  ? -13.084 -9.846  3.969   1.00 0.00 ? 73  LYS A H    1  
ATOM 1188  H HA   . LYS A 1 73  ? -15.600 -8.518  4.854   1.00 0.00 ? 73  LYS A HA   1  
ATOM 1189  H HB2  . LYS A 1 73  ? -14.878 -10.097 6.638   1.00 0.00 ? 73  LYS A HB2  1  
ATOM 1190  H HB3  . LYS A 1 73  ? -13.318 -9.277  6.705   1.00 0.00 ? 73  LYS A HB3  1  
ATOM 1191  H HG2  . LYS A 1 73  ? -14.490 -7.150  7.256   1.00 0.00 ? 73  LYS A HG2  1  
ATOM 1192  H HG3  . LYS A 1 73  ? -16.022 -8.025  7.271   1.00 0.00 ? 73  LYS A HG3  1  
ATOM 1193  H HD2  . LYS A 1 73  ? -14.296 -9.524  8.912   1.00 0.00 ? 73  LYS A HD2  1  
ATOM 1194  H HD3  . LYS A 1 73  ? -14.014 -7.837  9.349   1.00 0.00 ? 73  LYS A HD3  1  
ATOM 1195  H HE2  . LYS A 1 73  ? -16.737 -7.871  9.145   1.00 0.00 ? 73  LYS A HE2  1  
ATOM 1196  H HE3  . LYS A 1 73  ? -16.424 -9.503  9.735   1.00 0.00 ? 73  LYS A HE3  1  
ATOM 1197  H HZ1  . LYS A 1 73  ? -15.505 -6.965  10.969  1.00 0.00 ? 73  LYS A HZ1  1  
ATOM 1198  H HZ2  . LYS A 1 73  ? -15.046 -8.513  11.500  1.00 0.00 ? 73  LYS A HZ2  1  
ATOM 1199  H HZ3  . LYS A 1 73  ? -16.672 -8.029  11.587  1.00 0.00 ? 73  LYS A HZ3  1  
ATOM 1200  N N    . GLY A 1 74  ? -14.004 -6.740  3.717   1.00 0.00 ? 74  GLY A N    1  
ATOM 1201  C CA   . GLY A 1 74  ? -13.280 -5.468  3.434   1.00 0.00 ? 74  GLY A CA   1  
ATOM 1202  C C    . GLY A 1 74  ? -14.085 -4.643  2.428   1.00 0.00 ? 74  GLY A C    1  
ATOM 1203  O O    . GLY A 1 74  ? -15.008 -5.133  1.809   1.00 0.00 ? 74  GLY A O    1  
ATOM 1204  H H    . GLY A 1 74  ? -14.657 -7.084  3.072   1.00 0.00 ? 74  GLY A H    1  
ATOM 1205  H HA2  . GLY A 1 74  ? -13.164 -4.907  4.350   1.00 0.00 ? 74  GLY A HA2  1  
ATOM 1206  H HA3  . GLY A 1 74  ? -12.306 -5.691  3.023   1.00 0.00 ? 74  GLY A HA3  1  
ATOM 1207  N N    . SER A 1 75  ? -13.745 -3.394  2.258   1.00 0.00 ? 75  SER A N    1  
ATOM 1208  C CA   . SER A 1 75  ? -14.497 -2.546  1.290   1.00 0.00 ? 75  SER A CA   1  
ATOM 1209  C C    . SER A 1 75  ? -13.533 -1.590  0.587   1.00 0.00 ? 75  SER A C    1  
ATOM 1210  O O    . SER A 1 75  ? -13.371 -0.455  0.988   1.00 0.00 ? 75  SER A O    1  
ATOM 1211  C CB   . SER A 1 75  ? -15.556 -1.735  2.037   1.00 0.00 ? 75  SER A CB   1  
ATOM 1212  O OG   . SER A 1 75  ? -16.457 -2.622  2.685   1.00 0.00 ? 75  SER A OG   1  
ATOM 1213  H H    . SER A 1 75  ? -12.998 -3.015  2.766   1.00 0.00 ? 75  SER A H    1  
ATOM 1214  H HA   . SER A 1 75  ? -14.978 -3.175  0.556   1.00 0.00 ? 75  SER A HA   1  
ATOM 1215  H HB2  . SER A 1 75  ? -15.080 -1.112  2.775   1.00 0.00 ? 75  SER A HB2  1  
ATOM 1216  H HB3  . SER A 1 75  ? -16.090 -1.110  1.332   1.00 0.00 ? 75  SER A HB3  1  
ATOM 1217  H HG   . SER A 1 75  ? -17.076 -2.096  3.197   1.00 0.00 ? 75  SER A HG   1  
ATOM 1218  N N    . PHE A 1 76  ? -12.897 -2.034  -0.461  1.00 0.00 ? 76  PHE A N    1  
ATOM 1219  C CA   . PHE A 1 76  ? -11.953 -1.141  -1.183  1.00 0.00 ? 76  PHE A CA   1  
ATOM 1220  C C    . PHE A 1 76  ? -11.472 -1.818  -2.468  1.00 0.00 ? 76  PHE A C    1  
ATOM 1221  O O    . PHE A 1 76  ? -12.265 -2.275  -3.246  1.00 0.00 ? 76  PHE A O    1  
ATOM 1222  C CB   . PHE A 1 76  ? -10.785 -0.803  -0.274  1.00 0.00 ? 76  PHE A CB   1  
ATOM 1223  C CG   . PHE A 1 76  ? -10.401 -2.006  0.556   1.00 0.00 ? 76  PHE A CG   1  
ATOM 1224  C CD1  . PHE A 1 76  ? -10.323 -3.277  -0.028  1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1225  C CD2  . PHE A 1 76  ? -10.122 -1.845  1.918   1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1226  C CE1  . PHE A 1 76  ? -9.967  -4.385  0.752   1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1227  C CE2  . PHE A 1 76  ? -9.765  -2.952  2.697   1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1228  C CZ   . PHE A 1 76  ? -9.688  -4.222  2.113   1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1229  H H    . PHE A 1 76  ? -13.043 -2.948  -0.774  1.00 0.00 ? 76  PHE A H    1  
ATOM 1230  H HA   . PHE A 1 76  ? -12.464 -0.231  -1.444  1.00 0.00 ? 76  PHE A HA   1  
ATOM 1231  H HB2  . PHE A 1 76  ? -9.951  -0.487  -0.871  1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1232  H HB3  . PHE A 1 76  ? -11.082 -0.002  0.377   1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1233  H HD1  . PHE A 1 76  ? -10.536 -3.405  -1.076  1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1234  H HD2  . PHE A 1 76  ? -10.180 -0.866  2.370   1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1235  H HE1  . PHE A 1 76  ? -9.907  -5.364  0.302   1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1236  H HE2  . PHE A 1 76  ? -9.548  -2.827  3.748   1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1237  H HZ   . PHE A 1 76  ? -9.414  -5.077  2.713   1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1238  N N    . TRP A 1 77  ? -10.194 -1.888  -2.721  1.00 0.00 ? 77  TRP A N    1  
ATOM 1239  C CA   . TRP A 1 77  ? -9.756  -2.537  -3.983  1.00 0.00 ? 77  TRP A CA   1  
ATOM 1240  C C    . TRP A 1 77  ? -8.608  -3.508  -3.705  1.00 0.00 ? 77  TRP A C    1  
ATOM 1241  O O    . TRP A 1 77  ? -8.190  -3.688  -2.579  1.00 0.00 ? 77  TRP A O    1  
ATOM 1242  C CB   . TRP A 1 77  ? -9.311  -1.460  -4.971  1.00 0.00 ? 77  TRP A CB   1  
ATOM 1243  C CG   . TRP A 1 77  ? -8.343  -0.543  -4.324  1.00 0.00 ? 77  TRP A CG   1  
ATOM 1244  C CD1  . TRP A 1 77  ? -8.655  0.521   -3.546  1.00 0.00 ? 77  TRP A CD1  1  
ATOM 1245  C CD2  . TRP A 1 77  ? -6.907  -0.577  -4.415  1.00 0.00 ? 77  TRP A CD2  1  
ATOM 1246  N NE1  . TRP A 1 77  ? -7.487  1.140   -3.157  1.00 0.00 ? 77  TRP A NE1  1  
ATOM 1247  C CE2  . TRP A 1 77  ? -6.382  0.502   -3.671  1.00 0.00 ? 77  TRP A CE2  1  
ATOM 1248  C CE3  . TRP A 1 77  ? -6.020  -1.436  -5.073  1.00 0.00 ? 77  TRP A CE3  1  
ATOM 1249  C CZ2  . TRP A 1 77  ? -5.017  0.724   -3.585  1.00 0.00 ? 77  TRP A CZ2  1  
ATOM 1250  C CZ3  . TRP A 1 77  ? -4.642  -1.215  -4.996  1.00 0.00 ? 77  TRP A CZ3  1  
ATOM 1251  C CH2  . TRP A 1 77  ? -4.144  -0.134  -4.252  1.00 0.00 ? 77  TRP A CH2  1  
ATOM 1252  H H    . TRP A 1 77  ? -9.534  -1.519  -2.104  1.00 0.00 ? 77  TRP A H    1  
ATOM 1253  H HA   . TRP A 1 77  ? -10.586 -3.084  -4.407  1.00 0.00 ? 77  TRP A HA   1  
ATOM 1254  H HB2  . TRP A 1 77  ? -8.839  -1.922  -5.825  1.00 0.00 ? 77  TRP A HB2  1  
ATOM 1255  H HB3  . TRP A 1 77  ? -10.163 -0.890  -5.297  1.00 0.00 ? 77  TRP A HB3  1  
ATOM 1256  H HD1  . TRP A 1 77  ? -9.648  0.835   -3.274  1.00 0.00 ? 77  TRP A HD1  1  
ATOM 1257  H HE1  . TRP A 1 77  ? -7.430  1.936   -2.591  1.00 0.00 ? 77  TRP A HE1  1  
ATOM 1258  H HE3  . TRP A 1 77  ? -6.407  -2.267  -5.647  1.00 0.00 ? 77  TRP A HE3  1  
ATOM 1259  H HZ2  . TRP A 1 77  ? -4.633  1.557   -3.013  1.00 0.00 ? 77  TRP A HZ2  1  
ATOM 1260  H HZ3  . TRP A 1 77  ? -3.961  -1.874  -5.510  1.00 0.00 ? 77  TRP A HZ3  1  
ATOM 1261  H HH2  . TRP A 1 77  ? -3.101  0.049   -4.213  1.00 0.00 ? 77  TRP A HH2  1  
ATOM 1262  N N    . ARG A 1 78  ? -8.108  -4.151  -4.724  1.00 0.00 ? 78  ARG A N    1  
ATOM 1263  C CA   . ARG A 1 78  ? -7.003  -5.128  -4.528  1.00 0.00 ? 78  ARG A CA   1  
ATOM 1264  C C    . ARG A 1 78  ? -6.287  -5.359  -5.860  1.00 0.00 ? 78  ARG A C    1  
ATOM 1265  O O    . ARG A 1 78  ? -6.404  -4.580  -6.784  1.00 0.00 ? 78  ARG A O    1  
ATOM 1266  C CB   . ARG A 1 78  ? -7.601  -6.450  -4.042  1.00 0.00 ? 78  ARG A CB   1  
ATOM 1267  C CG   . ARG A 1 78  ? -8.572  -6.983  -5.099  1.00 0.00 ? 78  ARG A CG   1  
ATOM 1268  C CD   . ARG A 1 78  ? -9.779  -7.627  -4.414  1.00 0.00 ? 78  ARG A CD   1  
ATOM 1269  N NE   . ARG A 1 78  ? -10.240 -8.792  -5.219  1.00 0.00 ? 78  ARG A NE   1  
ATOM 1270  C CZ   . ARG A 1 78  ? -11.516 -9.052  -5.322  1.00 0.00 ? 78  ARG A CZ   1  
ATOM 1271  N NH1  . ARG A 1 78  ? -12.306 -8.856  -4.301  1.00 0.00 ? 78  ARG A NH1  1  
ATOM 1272  N NH2  . ARG A 1 78  ? -12.001 -9.507  -6.444  1.00 0.00 ? 78  ARG A NH2  1  
ATOM 1273  H H    . ARG A 1 78  ? -8.467  -4.001  -5.619  1.00 0.00 ? 78  ARG A H    1  
ATOM 1274  H HA   . ARG A 1 78  ? -6.305  -4.752  -3.796  1.00 0.00 ? 78  ARG A HA   1  
ATOM 1275  H HB2  . ARG A 1 78  ? -6.811  -7.168  -3.884  1.00 0.00 ? 78  ARG A HB2  1  
ATOM 1276  H HB3  . ARG A 1 78  ? -8.132  -6.287  -3.118  1.00 0.00 ? 78  ARG A HB3  1  
ATOM 1277  H HG2  . ARG A 1 78  ? -8.906  -6.167  -5.724  1.00 0.00 ? 78  ARG A HG2  1  
ATOM 1278  H HG3  . ARG A 1 78  ? -8.072  -7.721  -5.708  1.00 0.00 ? 78  ARG A HG3  1  
ATOM 1279  H HD2  . ARG A 1 78  ? -9.498  -7.959  -3.426  1.00 0.00 ? 78  ARG A HD2  1  
ATOM 1280  H HD3  . ARG A 1 78  ? -10.578 -6.903  -4.338  1.00 0.00 ? 78  ARG A HD3  1  
ATOM 1281  H HE   . ARG A 1 78  ? -9.586  -9.364  -5.671  1.00 0.00 ? 78  ARG A HE   1  
ATOM 1282  H HH11 . ARG A 1 78  ? -11.935 -8.508  -3.441  1.00 0.00 ? 78  ARG A HH11 1  
ATOM 1283  H HH12 . ARG A 1 78  ? -13.282 -9.055  -4.380  1.00 0.00 ? 78  ARG A HH12 1  
ATOM 1284  H HH21 . ARG A 1 78  ? -11.396 -9.658  -7.227  1.00 0.00 ? 78  ARG A HH21 1  
ATOM 1285  H HH22 . ARG A 1 78  ? -12.978 -9.707  -6.523  1.00 0.00 ? 78  ARG A HH22 1  
ATOM 1286  N N    . ILE A 1 79  ? -5.564  -6.440  -5.970  1.00 0.00 ? 79  ILE A N    1  
ATOM 1287  C CA   . ILE A 1 79  ? -4.857  -6.745  -7.248  1.00 0.00 ? 79  ILE A CA   1  
ATOM 1288  C C    . ILE A 1 79  ? -5.630  -7.857  -7.957  1.00 0.00 ? 79  ILE A C    1  
ATOM 1289  O O    . ILE A 1 79  ? -6.471  -8.511  -7.372  1.00 0.00 ? 79  ILE A O    1  
ATOM 1290  C CB   . ILE A 1 79  ? -3.404  -7.168  -6.957  1.00 0.00 ? 79  ILE A CB   1  
ATOM 1291  C CG1  . ILE A 1 79  ? -2.923  -8.232  -7.943  1.00 0.00 ? 79  ILE A CG1  1  
ATOM 1292  C CG2  . ILE A 1 79  ? -3.301  -7.738  -5.550  1.00 0.00 ? 79  ILE A CG2  1  
ATOM 1293  C CD1  . ILE A 1 79  ? -1.579  -8.773  -7.462  1.00 0.00 ? 79  ILE A CD1  1  
ATOM 1294  H H    . ILE A 1 79  ? -5.501  -7.061  -5.214  1.00 0.00 ? 79  ILE A H    1  
ATOM 1295  H HA   . ILE A 1 79  ? -4.850  -5.869  -7.876  1.00 0.00 ? 79  ILE A HA   1  
ATOM 1296  H HB   . ILE A 1 79  ? -2.763  -6.301  -7.033  1.00 0.00 ? 79  ILE A HB   1  
ATOM 1297  H HG12 . ILE A 1 79  ? -3.640  -9.036  -7.984  1.00 0.00 ? 79  ILE A HG12 1  
ATOM 1298  H HG13 . ILE A 1 79  ? -2.809  -7.796  -8.923  1.00 0.00 ? 79  ILE A HG13 1  
ATOM 1299  H HG21 . ILE A 1 79  ? -3.673  -7.016  -4.844  1.00 0.00 ? 79  ILE A HG21 1  
ATOM 1300  H HG22 . ILE A 1 79  ? -2.266  -7.959  -5.333  1.00 0.00 ? 79  ILE A HG22 1  
ATOM 1301  H HG23 . ILE A 1 79  ? -3.885  -8.641  -5.491  1.00 0.00 ? 79  ILE A HG23 1  
ATOM 1302  H HD11 . ILE A 1 79  ? -0.888  -7.953  -7.330  1.00 0.00 ? 79  ILE A HD11 1  
ATOM 1303  H HD12 . ILE A 1 79  ? -1.190  -9.461  -8.188  1.00 0.00 ? 79  ILE A HD12 1  
ATOM 1304  H HD13 . ILE A 1 79  ? -1.712  -9.281  -6.519  1.00 0.00 ? 79  ILE A HD13 1  
ATOM 1305  N N    . ASP A 1 80  ? -5.367  -8.074  -9.212  1.00 0.00 ? 80  ASP A N    1  
ATOM 1306  C CA   . ASP A 1 80  ? -6.103  -9.136  -9.942  1.00 0.00 ? 80  ASP A CA   1  
ATOM 1307  C C    . ASP A 1 80  ? -5.739  -10.498 -9.352  1.00 0.00 ? 80  ASP A C    1  
ATOM 1308  O O    . ASP A 1 80  ? -4.716  -10.646 -8.716  1.00 0.00 ? 80  ASP A O    1  
ATOM 1309  C CB   . ASP A 1 80  ? -5.736  -9.099  -11.423 1.00 0.00 ? 80  ASP A CB   1  
ATOM 1310  C CG   . ASP A 1 80  ? -6.910  -8.535  -12.226 1.00 0.00 ? 80  ASP A CG   1  
ATOM 1311  O OD1  . ASP A 1 80  ? -7.754  -7.889  -11.628 1.00 0.00 ? 80  ASP A OD1  1  
ATOM 1312  O OD2  . ASP A 1 80  ? -6.943  -8.758  -13.425 1.00 0.00 ? 80  ASP A OD2  1  
ATOM 1313  H H    . ASP A 1 80  ? -4.692  -7.536  -9.671  1.00 0.00 ? 80  ASP A H    1  
ATOM 1314  H HA   . ASP A 1 80  ? -7.166  -8.972  -9.832  1.00 0.00 ? 80  ASP A HA   1  
ATOM 1315  H HB2  . ASP A 1 80  ? -4.868  -8.473  -11.563 1.00 0.00 ? 80  ASP A HB2  1  
ATOM 1316  H HB3  . ASP A 1 80  ? -5.521  -10.100 -11.762 1.00 0.00 ? 80  ASP A HB3  1  
ATOM 1317  N N    . PRO A 1 81  ? -6.598  -11.451 -9.574  1.00 0.00 ? 81  PRO A N    1  
ATOM 1318  C CA   . PRO A 1 81  ? -6.408  -12.817 -9.065  1.00 0.00 ? 81  PRO A CA   1  
ATOM 1319  C C    . PRO A 1 81  ? -5.403  -13.589 -9.924  1.00 0.00 ? 81  PRO A C    1  
ATOM 1320  O O    . PRO A 1 81  ? -4.403  -14.080 -9.436  1.00 0.00 ? 81  PRO A O    1  
ATOM 1321  C CB   . PRO A 1 81  ? -7.808  -13.432 -9.169  1.00 0.00 ? 81  PRO A CB   1  
ATOM 1322  C CG   . PRO A 1 81  ? -8.574  -12.603 -10.229 1.00 0.00 ? 81  PRO A CG   1  
ATOM 1323  C CD   . PRO A 1 81  ? -7.838  -11.256 -10.355 1.00 0.00 ? 81  PRO A CD   1  
ATOM 1324  H HA   . PRO A 1 81  ? -6.093  -12.799 -8.034  1.00 0.00 ? 81  PRO A HA   1  
ATOM 1325  H HB2  . PRO A 1 81  ? -7.735  -14.465 -9.480  1.00 0.00 ? 81  PRO A HB2  1  
ATOM 1326  H HB3  . PRO A 1 81  ? -8.314  -13.364 -8.218  1.00 0.00 ? 81  PRO A HB3  1  
ATOM 1327  H HG2  . PRO A 1 81  ? -8.568  -13.122 -11.178 1.00 0.00 ? 81  PRO A HG2  1  
ATOM 1328  H HG3  . PRO A 1 81  ? -9.589  -12.434 -9.904  1.00 0.00 ? 81  PRO A HG3  1  
ATOM 1329  H HD2  . PRO A 1 81  ? -7.606  -11.051 -11.391 1.00 0.00 ? 81  PRO A HD2  1  
ATOM 1330  H HD3  . PRO A 1 81  ? -8.426  -10.455 -9.931  1.00 0.00 ? 81  PRO A HD3  1  
ATOM 1331  N N    . ALA A 1 82  ? -5.665  -13.717 -11.194 1.00 0.00 ? 82  ALA A N    1  
ATOM 1332  C CA   . ALA A 1 82  ? -4.731  -14.475 -12.075 1.00 0.00 ? 82  ALA A CA   1  
ATOM 1333  C C    . ALA A 1 82  ? -3.683  -13.548 -12.682 1.00 0.00 ? 82  ALA A C    1  
ATOM 1334  O O    . ALA A 1 82  ? -3.075  -13.867 -13.685 1.00 0.00 ? 82  ALA A O    1  
ATOM 1335  C CB   . ALA A 1 82  ? -5.522  -15.134 -13.199 1.00 0.00 ? 82  ALA A CB   1  
ATOM 1336  H H    . ALA A 1 82  ? -6.483  -13.327 -11.567 1.00 0.00 ? 82  ALA A H    1  
ATOM 1337  H HA   . ALA A 1 82  ? -4.229  -15.236 -11.495 1.00 0.00 ? 82  ALA A HA   1  
ATOM 1338  H HB1  . ALA A 1 82  ? -5.354  -14.595 -14.118 1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1339  H HB2  . ALA A 1 82  ? -6.574  -15.115 -12.957 1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1340  H HB3  . ALA A 1 82  ? -5.196  -16.156 -13.316 1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1341  N N    . SER A 1 83  ? -3.440  -12.421 -12.087 1.00 0.00 ? 83  SER A N    1  
ATOM 1342  C CA   . SER A 1 83  ? -2.407  -11.518 -12.641 1.00 0.00 ? 83  SER A CA   1  
ATOM 1343  C C    . SER A 1 83  ? -1.344  -11.304 -11.577 1.00 0.00 ? 83  SER A C    1  
ATOM 1344  O O    . SER A 1 83  ? -0.330  -10.713 -11.832 1.00 0.00 ? 83  SER A O    1  
ATOM 1345  C CB   . SER A 1 83  ? -3.022  -10.171 -13.020 1.00 0.00 ? 83  SER A CB   1  
ATOM 1346  O OG   . SER A 1 83  ? -4.357  -10.369 -13.466 1.00 0.00 ? 83  SER A OG   1  
ATOM 1347  H H    . SER A 1 83  ? -3.915  -12.175 -11.266 1.00 0.00 ? 83  SER A H    1  
ATOM 1348  H HA   . SER A 1 83  ? -1.960  -11.972 -13.513 1.00 0.00 ? 83  SER A HA   1  
ATOM 1349  H HB2  . SER A 1 83  ? -3.025  -9.522  -12.161 1.00 0.00 ? 83  SER A HB2  1  
ATOM 1350  H HB3  . SER A 1 83  ? -2.433  -9.715  -13.806 1.00 0.00 ? 83  SER A HB3  1  
ATOM 1351  H HG   . SER A 1 83  ? -4.411  -11.243 -13.861 1.00 0.00 ? 83  SER A HG   1  
ATOM 1352  N N    . GLU A 1 84  ? -1.577  -11.778 -10.380 1.00 0.00 ? 84  GLU A N    1  
ATOM 1353  C CA   . GLU A 1 84  ? -0.580  -11.585 -9.295  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1354  C C    . GLU A 1 84  ? 0.670   -12.415 -9.559  1.00 0.00 ? 84  GLU A C    1  
ATOM 1355  O O    . GLU A 1 84  ? 1.618   -12.355 -8.813  1.00 0.00 ? 84  GLU A O    1  
ATOM 1356  C CB   . GLU A 1 84  ? -1.194  -11.987 -7.952  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1357  C CG   . GLU A 1 84  ? -0.133  -11.886 -6.855  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1358  C CD   . GLU A 1 84  ? -0.808  -11.948 -5.484  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1359  O OE1  . GLU A 1 84  ? -1.359  -12.988 -5.162  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1360  O OE2  . GLU A 1 84  ? -0.763  -10.954 -4.778  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1361  H H    . GLU A 1 84  ? -2.413  -12.251 -10.194 1.00 0.00 ? 84  GLU A H    1  
ATOM 1362  H HA   . GLU A 1 84  ? -0.295  -10.549 -9.263  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1363  H HB2  . GLU A 1 84  ? -2.016  -11.325 -7.720  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1364  H HB3  . GLU A 1 84  ? -1.556  -13.003 -8.008  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1365  H HG2  . GLU A 1 84  ? 0.563   -12.706 -6.952  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1366  H HG3  . GLU A 1 84  ? 0.396   -10.950 -6.951  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1367  N N    . ALA A 1 85  ? 0.699   -13.178 -10.608 1.00 0.00 ? 85  ALA A N    1  
ATOM 1368  C CA   . ALA A 1 85  ? 1.930   -13.966 -10.885 1.00 0.00 ? 85  ALA A CA   1  
ATOM 1369  C C    . ALA A 1 85  ? 2.844   -13.148 -11.803 1.00 0.00 ? 85  ALA A C    1  
ATOM 1370  O O    . ALA A 1 85  ? 4.054   -13.193 -11.693 1.00 0.00 ? 85  ALA A O    1  
ATOM 1371  C CB   . ALA A 1 85  ? 1.564   -15.286 -11.565 1.00 0.00 ? 85  ALA A CB   1  
ATOM 1372  H H    . ALA A 1 85  ? -0.074  -13.226 -11.215 1.00 0.00 ? 85  ALA A H    1  
ATOM 1373  H HA   . ALA A 1 85  ? 2.449   -14.162 -9.953  1.00 0.00 ? 85  ALA A HA   1  
ATOM 1374  H HB1  . ALA A 1 85  ? 1.341   -16.028 -10.813 1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1375  H HB2  . ALA A 1 85  ? 2.393   -15.621 -12.168 1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1376  H HB3  . ALA A 1 85  ? 0.697   -15.138 -12.192 1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1377  N N    . LYS A 1 86  ? 2.271   -12.405 -12.714 1.00 0.00 ? 86  LYS A N    1  
ATOM 1378  C CA   . LYS A 1 86  ? 3.099   -11.588 -13.649 1.00 0.00 ? 86  LYS A CA   1  
ATOM 1379  C C    . LYS A 1 86  ? 3.286   -10.166 -13.100 1.00 0.00 ? 86  LYS A C    1  
ATOM 1380  O O    . LYS A 1 86  ? 4.315   -9.550  -13.299 1.00 0.00 ? 86  LYS A O    1  
ATOM 1381  C CB   . LYS A 1 86  ? 2.400   -11.517 -15.008 1.00 0.00 ? 86  LYS A CB   1  
ATOM 1382  C CG   . LYS A 1 86  ? 3.446   -11.437 -16.120 1.00 0.00 ? 86  LYS A CG   1  
ATOM 1383  C CD   . LYS A 1 86  ? 3.263   -10.132 -16.898 1.00 0.00 ? 86  LYS A CD   1  
ATOM 1384  C CE   . LYS A 1 86  ? 3.881   -8.976  -16.110 1.00 0.00 ? 86  LYS A CE   1  
ATOM 1385  N NZ   . LYS A 1 86  ? 2.803   -8.215  -15.417 1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1386  H H    . LYS A 1 86  ? 1.294   -12.390 -12.788 1.00 0.00 ? 86  LYS A H    1  
ATOM 1387  H HA   . LYS A 1 86  ? 4.066   -12.054 -13.770 1.00 0.00 ? 86  LYS A HA   1  
ATOM 1388  H HB2  . LYS A 1 86  ? 1.794   -12.401 -15.145 1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1389  H HB3  . LYS A 1 86  ? 1.772   -10.640 -15.043 1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1390  H HG2  . LYS A 1 86  ? 4.436   -11.463 -15.688 1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1391  H HG3  . LYS A 1 86  ? 3.324   -12.273 -16.791 1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1392  H HD2  . LYS A 1 86  ? 3.751   -10.215 -17.859 1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1393  H HD3  . LYS A 1 86  ? 2.211   -9.944  -17.043 1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1394  H HE2  . LYS A 1 86  ? 4.573   -9.368  -15.379 1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1395  H HE3  . LYS A 1 86  ? 4.407   -8.319  -16.788 1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1396  H HZ1  . LYS A 1 86  ? 2.292   -8.849  -14.771 1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1397  H HZ2  . LYS A 1 86  ? 2.143   -7.830  -16.123 1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1398  H HZ3  . LYS A 1 86  ? 3.223   -7.435  -14.874 1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1399  N N    . LEU A 1 87  ? 2.304   -9.633  -12.420 1.00 0.00 ? 87  LEU A N    1  
ATOM 1400  C CA   . LEU A 1 87  ? 2.439   -8.248  -11.875 1.00 0.00 ? 87  LEU A CA   1  
ATOM 1401  C C    . LEU A 1 87  ? 3.391   -8.258  -10.698 1.00 0.00 ? 87  LEU A C    1  
ATOM 1402  O O    . LEU A 1 87  ? 3.853   -7.234  -10.235 1.00 0.00 ? 87  LEU A O    1  
ATOM 1403  C CB   . LEU A 1 87  ? 1.070   -7.722  -11.429 1.00 0.00 ? 87  LEU A CB   1  
ATOM 1404  C CG   . LEU A 1 87  ? 0.420   -8.661  -10.403 1.00 0.00 ? 87  LEU A CG   1  
ATOM 1405  C CD1  . LEU A 1 87  ? 0.746   -8.198  -8.992  1.00 0.00 ? 87  LEU A CD1  1  
ATOM 1406  C CD2  . LEU A 1 87  ? -1.105  -8.631  -10.573 1.00 0.00 ? 87  LEU A CD2  1  
ATOM 1407  H H    . LEU A 1 87  ? 1.484   -10.138 -12.268 1.00 0.00 ? 87  LEU A H    1  
ATOM 1408  H HA   . LEU A 1 87  ? 2.838   -7.611  -12.640 1.00 0.00 ? 87  LEU A HA   1  
ATOM 1409  H HB2  . LEU A 1 87  ? 1.185   -6.742  -10.994 1.00 0.00 ? 87  LEU A HB2  1  
ATOM 1410  H HB3  . LEU A 1 87  ? 0.439   -7.659  -12.285 1.00 0.00 ? 87  LEU A HB3  1  
ATOM 1411  H HG   . LEU A 1 87  ? 0.788   -9.664  -10.544 1.00 0.00 ? 87  LEU A HG   1  
ATOM 1412  H HD11 . LEU A 1 87  ? 1.776   -7.897  -8.942  1.00 0.00 ? 87  LEU A HD11 1  
ATOM 1413  H HD12 . LEU A 1 87  ? 0.573   -9.010  -8.302  1.00 0.00 ? 87  LEU A HD12 1  
ATOM 1414  H HD13 . LEU A 1 87  ? 0.108   -7.364  -8.738  1.00 0.00 ? 87  LEU A HD13 1  
ATOM 1415  H HD21 . LEU A 1 87  ? -1.553  -9.421  -9.987  1.00 0.00 ? 87  LEU A HD21 1  
ATOM 1416  H HD22 . LEU A 1 87  ? -1.357  -8.769  -11.611 1.00 0.00 ? 87  LEU A HD22 1  
ATOM 1417  H HD23 . LEU A 1 87  ? -1.484  -7.677  -10.233 1.00 0.00 ? 87  LEU A HD23 1  
ATOM 1418  N N    . VAL A 1 88  ? 3.678   -9.412  -10.214 1.00 0.00 ? 88  VAL A N    1  
ATOM 1419  C CA   . VAL A 1 88  ? 4.590   -9.537  -9.063  1.00 0.00 ? 88  VAL A CA   1  
ATOM 1420  C C    . VAL A 1 88  ? 6.040   -9.621  -9.542  1.00 0.00 ? 88  VAL A C    1  
ATOM 1421  O O    . VAL A 1 88  ? 6.956   -9.214  -8.856  1.00 0.00 ? 88  VAL A O    1  
ATOM 1422  C CB   . VAL A 1 88  ? 4.236   -10.804 -8.323  1.00 0.00 ? 88  VAL A CB   1  
ATOM 1423  C CG1  . VAL A 1 88  ? 2.929   -10.606 -7.557  1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1424  C CG2  . VAL A 1 88  ? 4.101   -11.950 -9.330  1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1425  H H    . VAL A 1 88  ? 3.286   -10.210 -10.611 1.00 0.00 ? 88  VAL A H    1  
ATOM 1426  H HA   . VAL A 1 88  ? 4.469   -8.690  -8.407  1.00 0.00 ? 88  VAL A HA   1  
ATOM 1427  H HB   . VAL A 1 88  ? 5.016   -11.022 -7.642  1.00 0.00 ? 88  VAL A HB   1  
ATOM 1428  H HG11 . VAL A 1 88  ? 2.690   -11.508 -7.014  1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1429  H HG12 . VAL A 1 88  ? 2.134   -10.383 -8.253  1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1430  H HG13 . VAL A 1 88  ? 3.039   -9.786  -6.862  1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1431  H HG21 . VAL A 1 88  ? 4.033   -12.886 -8.803  1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1432  H HG22 . VAL A 1 88  ? 4.964   -11.960 -9.978  1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1433  H HG23 . VAL A 1 88  ? 3.213   -11.807 -9.924  1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1434  N N    . GLU A 1 89  ? 6.258   -10.162 -10.709 1.00 0.00 ? 89  GLU A N    1  
ATOM 1435  C CA   . GLU A 1 89  ? 7.653   -10.285 -11.220 1.00 0.00 ? 89  GLU A CA   1  
ATOM 1436  C C    . GLU A 1 89  ? 8.308   -8.906  -11.201 1.00 0.00 ? 89  GLU A C    1  
ATOM 1437  O O    . GLU A 1 89  ? 9.500   -8.776  -11.006 1.00 0.00 ? 89  GLU A O    1  
ATOM 1438  C CB   . GLU A 1 89  ? 7.634   -10.824 -12.653 1.00 0.00 ? 89  GLU A CB   1  
ATOM 1439  C CG   . GLU A 1 89  ? 8.339   -12.181 -12.696 1.00 0.00 ? 89  GLU A CG   1  
ATOM 1440  C CD   . GLU A 1 89  ? 7.354   -13.282 -12.302 1.00 0.00 ? 89  GLU A CD   1  
ATOM 1441  O OE1  . GLU A 1 89  ? 6.487   -13.010 -11.487 1.00 0.00 ? 89  GLU A OE1  1  
ATOM 1442  O OE2  . GLU A 1 89  ? 7.482   -14.379 -12.821 1.00 0.00 ? 89  GLU A OE2  1  
ATOM 1443  H H    . GLU A 1 89  ? 5.508   -10.497 -11.240 1.00 0.00 ? 89  GLU A H    1  
ATOM 1444  H HA   . GLU A 1 89  ? 8.211   -10.958 -10.586 1.00 0.00 ? 89  GLU A HA   1  
ATOM 1445  H HB2  . GLU A 1 89  ? 6.611   -10.937 -12.981 1.00 0.00 ? 89  GLU A HB2  1  
ATOM 1446  H HB3  . GLU A 1 89  ? 8.147   -10.133 -13.304 1.00 0.00 ? 89  GLU A HB3  1  
ATOM 1447  H HG2  . GLU A 1 89  ? 8.705   -12.364 -13.697 1.00 0.00 ? 89  GLU A HG2  1  
ATOM 1448  H HG3  . GLU A 1 89  ? 9.168   -12.179 -12.004 1.00 0.00 ? 89  GLU A HG3  1  
ATOM 1449  N N    . GLN A 1 90  ? 7.533   -7.875  -11.379 1.00 0.00 ? 90  GLN A N    1  
ATOM 1450  C CA   . GLN A 1 90  ? 8.105   -6.504  -11.345 1.00 0.00 ? 90  GLN A CA   1  
ATOM 1451  C C    . GLN A 1 90  ? 8.062   -6.003  -9.902  1.00 0.00 ? 90  GLN A C    1  
ATOM 1452  O O    . GLN A 1 90  ? 8.815   -5.134  -9.508  1.00 0.00 ? 90  GLN A O    1  
ATOM 1453  C CB   . GLN A 1 90  ? 7.274   -5.579  -12.237 1.00 0.00 ? 90  GLN A CB   1  
ATOM 1454  C CG   . GLN A 1 90  ? 8.207   -4.729  -13.104 1.00 0.00 ? 90  GLN A CG   1  
ATOM 1455  C CD   . GLN A 1 90  ? 8.994   -5.633  -14.056 1.00 0.00 ? 90  GLN A CD   1  
ATOM 1456  O OE1  . GLN A 1 90  ? 10.162  -5.403  -14.305 1.00 0.00 ? 90  GLN A OE1  1  
ATOM 1457  N NE2  . GLN A 1 90  ? 8.403   -6.660  -14.603 1.00 0.00 ? 90  GLN A NE2  1  
ATOM 1458  H H    . GLN A 1 90  ? 6.571   -8.002  -11.517 1.00 0.00 ? 90  GLN A H    1  
ATOM 1459  H HA   . GLN A 1 90  ? 9.127   -6.526  -11.693 1.00 0.00 ? 90  GLN A HA   1  
ATOM 1460  H HB2  . GLN A 1 90  ? 6.632   -6.172  -12.871 1.00 0.00 ? 90  GLN A HB2  1  
ATOM 1461  H HB3  . GLN A 1 90  ? 6.672   -4.930  -11.619 1.00 0.00 ? 90  GLN A HB3  1  
ATOM 1462  H HG2  . GLN A 1 90  ? 7.622   -4.025  -13.678 1.00 0.00 ? 90  GLN A HG2  1  
ATOM 1463  H HG3  . GLN A 1 90  ? 8.896   -4.192  -12.470 1.00 0.00 ? 90  GLN A HG3  1  
ATOM 1464  H HE21 . GLN A 1 90  ? 7.461   -6.846  -14.404 1.00 0.00 ? 90  GLN A HE21 1  
ATOM 1465  H HE22 . GLN A 1 90  ? 8.899   -7.242  -15.216 1.00 0.00 ? 90  GLN A HE22 1  
ATOM 1466  N N    . ALA A 1 91  ? 7.178   -6.552  -9.111  1.00 0.00 ? 91  ALA A N    1  
ATOM 1467  C CA   . ALA A 1 91  ? 7.069   -6.122  -7.689  1.00 0.00 ? 91  ALA A CA   1  
ATOM 1468  C C    . ALA A 1 91  ? 8.435   -6.231  -7.006  1.00 0.00 ? 91  ALA A C    1  
ATOM 1469  O O    . ALA A 1 91  ? 8.933   -5.275  -6.447  1.00 0.00 ? 91  ALA A O    1  
ATOM 1470  C CB   . ALA A 1 91  ? 6.048   -6.994  -6.964  1.00 0.00 ? 91  ALA A CB   1  
ATOM 1471  H H    . ALA A 1 91  ? 6.583   -7.249  -9.456  1.00 0.00 ? 91  ALA A H    1  
ATOM 1472  H HA   . ALA A 1 91  ? 6.736   -5.106  -7.655  1.00 0.00 ? 91  ALA A HA   1  
ATOM 1473  H HB1  . ALA A 1 91  ? 6.508   -7.923  -6.674  1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1474  H HB2  . ALA A 1 91  ? 5.215   -7.190  -7.623  1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1475  H HB3  . ALA A 1 91  ? 5.694   -6.473  -6.086  1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1476  N N    . PHE A 1 92  ? 9.049   -7.383  -7.050  1.00 0.00 ? 92  PHE A N    1  
ATOM 1477  C CA   . PHE A 1 92  ? 10.386  -7.535  -6.405  1.00 0.00 ? 92  PHE A CA   1  
ATOM 1478  C C    . PHE A 1 92  ? 11.478  -7.150  -7.402  1.00 0.00 ? 92  PHE A C    1  
ATOM 1479  O O    . PHE A 1 92  ? 12.419  -7.887  -7.622  1.00 0.00 ? 92  PHE A O    1  
ATOM 1480  C CB   . PHE A 1 92  ? 10.593  -8.991  -5.973  1.00 0.00 ? 92  PHE A CB   1  
ATOM 1481  C CG   . PHE A 1 92  ? 9.266   -9.607  -5.602  1.00 0.00 ? 92  PHE A CG   1  
ATOM 1482  C CD1  . PHE A 1 92  ? 8.409   -8.943  -4.716  1.00 0.00 ? 92  PHE A CD1  1  
ATOM 1483  C CD2  . PHE A 1 92  ? 8.894   -10.841 -6.144  1.00 0.00 ? 92  PHE A CD2  1  
ATOM 1484  C CE1  . PHE A 1 92  ? 7.179   -9.516  -4.372  1.00 0.00 ? 92  PHE A CE1  1  
ATOM 1485  C CE2  . PHE A 1 92  ? 7.664   -11.414 -5.801  1.00 0.00 ? 92  PHE A CE2  1  
ATOM 1486  C CZ   . PHE A 1 92  ? 6.806   -10.751 -4.915  1.00 0.00 ? 92  PHE A CZ   1  
ATOM 1487  H H    . PHE A 1 92  ? 8.634   -8.143  -7.509  1.00 0.00 ? 92  PHE A H    1  
ATOM 1488  H HA   . PHE A 1 92  ? 10.444  -6.891  -5.538  1.00 0.00 ? 92  PHE A HA   1  
ATOM 1489  H HB2  . PHE A 1 92  ? 11.033  -9.548  -6.787  1.00 0.00 ? 92  PHE A HB2  1  
ATOM 1490  H HB3  . PHE A 1 92  ? 11.254  -9.021  -5.119  1.00 0.00 ? 92  PHE A HB3  1  
ATOM 1491  H HD1  . PHE A 1 92  ? 8.697   -7.990  -4.297  1.00 0.00 ? 92  PHE A HD1  1  
ATOM 1492  H HD2  . PHE A 1 92  ? 9.556   -11.353 -6.828  1.00 0.00 ? 92  PHE A HD2  1  
ATOM 1493  H HE1  . PHE A 1 92  ? 6.518   -9.004  -3.688  1.00 0.00 ? 92  PHE A HE1  1  
ATOM 1494  H HE2  . PHE A 1 92  ? 7.377   -12.367 -6.219  1.00 0.00 ? 92  PHE A HE2  1  
ATOM 1495  H HZ   . PHE A 1 92  ? 5.857   -11.193 -4.649  1.00 0.00 ? 92  PHE A HZ   1  
ATOM 1496  N N    . ARG A 1 93  ? 11.365  -6.000  -8.012  1.00 0.00 ? 93  ARG A N    1  
ATOM 1497  C CA   . ARG A 1 93  ? 12.402  -5.578  -8.997  1.00 0.00 ? 93  ARG A CA   1  
ATOM 1498  C C    . ARG A 1 93  ? 12.747  -4.103  -8.783  1.00 0.00 ? 93  ARG A C    1  
ATOM 1499  O O    . ARG A 1 93  ? 11.906  -3.305  -8.424  1.00 0.00 ? 93  ARG A O    1  
ATOM 1500  C CB   . ARG A 1 93  ? 11.867  -5.773  -10.416 1.00 0.00 ? 93  ARG A CB   1  
ATOM 1501  C CG   . ARG A 1 93  ? 12.803  -6.702  -11.192 1.00 0.00 ? 93  ARG A CG   1  
ATOM 1502  C CD   . ARG A 1 93  ? 11.975  -7.709  -11.990 1.00 0.00 ? 93  ARG A CD   1  
ATOM 1503  N NE   . ARG A 1 93  ? 12.512  -7.805  -13.376 1.00 0.00 ? 93  ARG A NE   1  
ATOM 1504  C CZ   . ARG A 1 93  ? 11.983  -8.644  -14.225 1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1505  N NH1  . ARG A 1 93  ? 10.801  -9.147  -13.996 1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1506  N NH2  . ARG A 1 93  ? 12.637  -8.978  -15.303 1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1507  H H    . ARG A 1 93  ? 10.601  -5.418  -7.824  1.00 0.00 ? 93  ARG A H    1  
ATOM 1508  H HA   . ARG A 1 93  ? 13.290  -6.179  -8.863  1.00 0.00 ? 93  ARG A HA   1  
ATOM 1509  H HB2  . ARG A 1 93  ? 10.880  -6.211  -10.372 1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1510  H HB3  . ARG A 1 93  ? 11.815  -4.818  -10.916 1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1511  H HG2  . ARG A 1 93  ? 13.410  -6.117  -11.869 1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1512  H HG3  . ARG A 1 93  ? 13.441  -7.230  -10.500 1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1513  H HD2  . ARG A 1 93  ? 12.029  -8.677  -11.514 1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1514  H HD3  . ARG A 1 93  ? 10.946  -7.382  -12.024 1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1515  H HE   . ARG A 1 93  ? 13.262  -7.239  -13.651 1.00 0.00 ? 93  ARG A HE   1  
ATOM 1516  H HH11 . ARG A 1 93  ? 10.298  -8.890  -13.170 1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1517  H HH12 . ARG A 1 93  ? 10.396  -9.790  -14.646 1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1518  H HH21 . ARG A 1 93  ? 13.543  -8.592  -15.479 1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1519  H HH22 . ARG A 1 93  ? 12.232  -9.620  -15.954 1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1520  N N    . LYS A 1 94  ? 13.979  -3.735  -9.007  1.00 0.00 ? 94  LYS A N    1  
ATOM 1521  C CA   . LYS A 1 94  ? 14.380  -2.312  -8.822  1.00 0.00 ? 94  LYS A CA   1  
ATOM 1522  C C    . LYS A 1 94  ? 14.048  -1.522  -10.088 1.00 0.00 ? 94  LYS A C    1  
ATOM 1523  O O    . LYS A 1 94  ? 14.004  -2.065  -11.175 1.00 0.00 ? 94  LYS A O    1  
ATOM 1524  C CB   . LYS A 1 94  ? 15.884  -2.237  -8.552  1.00 0.00 ? 94  LYS A CB   1  
ATOM 1525  C CG   . LYS A 1 94  ? 16.208  -2.998  -7.265  1.00 0.00 ? 94  LYS A CG   1  
ATOM 1526  C CD   . LYS A 1 94  ? 17.414  -3.910  -7.499  1.00 0.00 ? 94  LYS A CD   1  
ATOM 1527  C CE   . LYS A 1 94  ? 18.389  -3.773  -6.329  1.00 0.00 ? 94  LYS A CE   1  
ATOM 1528  N NZ   . LYS A 1 94  ? 18.985  -5.104  -6.021  1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1529  H H    . LYS A 1 94  ? 14.643  -4.396  -9.298  1.00 0.00 ? 94  LYS A H    1  
ATOM 1530  H HA   . LYS A 1 94  ? 13.842  -1.893  -7.984  1.00 0.00 ? 94  LYS A HA   1  
ATOM 1531  H HB2  . LYS A 1 94  ? 16.421  -2.681  -9.378  1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1532  H HB3  . LYS A 1 94  ? 16.181  -1.205  -8.441  1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1533  H HG2  . LYS A 1 94  ? 16.434  -2.294  -6.479  1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1534  H HG3  . LYS A 1 94  ? 15.357  -3.598  -6.978  1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1535  H HD2  . LYS A 1 94  ? 17.081  -4.935  -7.575  1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1536  H HD3  . LYS A 1 94  ? 17.910  -3.624  -8.415  1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1537  H HE2  . LYS A 1 94  ? 19.174  -3.080  -6.593  1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1538  H HE3  . LYS A 1 94  ? 17.861  -3.407  -5.461  1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1539  H HZ1  . LYS A 1 94  ? 18.954  -5.268  -4.995  1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1540  H HZ2  . LYS A 1 94  ? 19.974  -5.124  -6.347  1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1541  H HZ3  . LYS A 1 94  ? 18.444  -5.848  -6.505  1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1542  N N    . ARG A 1 95  ? 13.812  -0.244  -9.960  1.00 0.00 ? 95  ARG A N    1  
ATOM 1543  C CA   . ARG A 1 95  ? 13.482  0.576   -11.160 1.00 0.00 ? 95  ARG A CA   1  
ATOM 1544  C C    . ARG A 1 95  ? 14.776  1.034   -11.837 1.00 0.00 ? 95  ARG A C    1  
ATOM 1545  O O    . ARG A 1 95  ? 15.438  1.945   -11.381 1.00 0.00 ? 95  ARG A O    1  
ATOM 1546  C CB   . ARG A 1 95  ? 12.668  1.800   -10.736 1.00 0.00 ? 95  ARG A CB   1  
ATOM 1547  C CG   . ARG A 1 95  ? 12.058  2.464   -11.973 1.00 0.00 ? 95  ARG A CG   1  
ATOM 1548  C CD   . ARG A 1 95  ? 10.738  1.774   -12.325 1.00 0.00 ? 95  ARG A CD   1  
ATOM 1549  N NE   . ARG A 1 95  ? 10.247  2.283   -13.637 1.00 0.00 ? 95  ARG A NE   1  
ATOM 1550  C CZ   . ARG A 1 95  ? 10.108  3.566   -13.830 1.00 0.00 ? 95  ARG A CZ   1  
ATOM 1551  N NH1  . ARG A 1 95  ? 10.005  4.373   -12.810 1.00 0.00 ? 95  ARG A NH1  1  
ATOM 1552  N NH2  . ARG A 1 95  ? 10.075  4.043   -15.045 1.00 0.00 ? 95  ARG A NH2  1  
ATOM 1553  H H    . ARG A 1 95  ? 13.851  0.175   -9.076  1.00 0.00 ? 95  ARG A H    1  
ATOM 1554  H HA   . ARG A 1 95  ? 12.905  -0.018  -11.853 1.00 0.00 ? 95  ARG A HA   1  
ATOM 1555  H HB2  . ARG A 1 95  ? 11.879  1.492   -10.065 1.00 0.00 ? 95  ARG A HB2  1  
ATOM 1556  H HB3  . ARG A 1 95  ? 13.313  2.505   -10.232 1.00 0.00 ? 95  ARG A HB3  1  
ATOM 1557  H HG2  . ARG A 1 95  ? 11.876  3.509   -11.767 1.00 0.00 ? 95  ARG A HG2  1  
ATOM 1558  H HG3  . ARG A 1 95  ? 12.743  2.374   -12.802 1.00 0.00 ? 95  ARG A HG3  1  
ATOM 1559  H HD2  . ARG A 1 95  ? 10.896  0.708   -12.390 1.00 0.00 ? 95  ARG A HD2  1  
ATOM 1560  H HD3  . ARG A 1 95  ? 10.006  1.984   -11.561 1.00 0.00 ? 95  ARG A HD3  1  
ATOM 1561  H HE   . ARG A 1 95  ? 10.027  1.654   -14.355 1.00 0.00 ? 95  ARG A HE   1  
ATOM 1562  H HH11 . ARG A 1 95  ? 10.031  4.007   -11.879 1.00 0.00 ? 95  ARG A HH11 1  
ATOM 1563  H HH12 . ARG A 1 95  ? 9.899   5.356   -12.958 1.00 0.00 ? 95  ARG A HH12 1  
ATOM 1564  H HH21 . ARG A 1 95  ? 10.155  3.426   -15.827 1.00 0.00 ? 95  ARG A HH21 1  
ATOM 1565  H HH22 . ARG A 1 95  ? 9.969   5.027   -15.193 1.00 0.00 ? 95  ARG A HH22 1  
ATOM 1566  N N    . ARG A 1 96  ? 15.141  0.408   -12.924 1.00 0.00 ? 96  ARG A N    1  
ATOM 1567  C CA   . ARG A 1 96  ? 16.389  0.808   -13.631 1.00 0.00 ? 96  ARG A CA   1  
ATOM 1568  C C    . ARG A 1 96  ? 16.368  0.244   -15.054 1.00 0.00 ? 96  ARG A C    1  
ATOM 1569  O O    . ARG A 1 96  ? 15.452  -0.455  -15.440 1.00 0.00 ? 96  ARG A O    1  
ATOM 1570  C CB   . ARG A 1 96  ? 17.604  0.256   -12.882 1.00 0.00 ? 96  ARG A CB   1  
ATOM 1571  C CG   . ARG A 1 96  ? 17.418  -1.242  -12.639 1.00 0.00 ? 96  ARG A CG   1  
ATOM 1572  C CD   . ARG A 1 96  ? 18.525  -2.017  -13.359 1.00 0.00 ? 96  ARG A CD   1  
ATOM 1573  N NE   . ARG A 1 96  ? 19.682  -2.199  -12.438 1.00 0.00 ? 96  ARG A NE   1  
ATOM 1574  C CZ   . ARG A 1 96  ? 19.523  -2.833  -11.309 1.00 0.00 ? 96  ARG A CZ   1  
ATOM 1575  N NH1  . ARG A 1 96  ? 19.460  -4.137  -11.294 1.00 0.00 ? 96  ARG A NH1  1  
ATOM 1576  N NH2  . ARG A 1 96  ? 19.427  -2.161  -10.194 1.00 0.00 ? 96  ARG A NH2  1  
ATOM 1577  H H    . ARG A 1 96  ? 14.591  -0.323  -13.275 1.00 0.00 ? 96  ARG A H    1  
ATOM 1578  H HA   . ARG A 1 96  ? 16.451  1.885   -13.672 1.00 0.00 ? 96  ARG A HA   1  
ATOM 1579  H HB2  . ARG A 1 96  ? 18.494  0.418   -13.473 1.00 0.00 ? 96  ARG A HB2  1  
ATOM 1580  H HB3  . ARG A 1 96  ? 17.705  0.763   -11.934 1.00 0.00 ? 96  ARG A HB3  1  
ATOM 1581  H HG2  . ARG A 1 96  ? 17.466  -1.443  -11.580 1.00 0.00 ? 96  ARG A HG2  1  
ATOM 1582  H HG3  . ARG A 1 96  ? 16.457  -1.553  -13.023 1.00 0.00 ? 96  ARG A HG3  1  
ATOM 1583  H HD2  . ARG A 1 96  ? 18.150  -2.983  -13.661 1.00 0.00 ? 96  ARG A HD2  1  
ATOM 1584  H HD3  . ARG A 1 96  ? 18.842  -1.465  -14.231 1.00 0.00 ? 96  ARG A HD3  1  
ATOM 1585  H HE   . ARG A 1 96  ? 20.563  -1.843  -12.681 1.00 0.00 ? 96  ARG A HE   1  
ATOM 1586  H HH11 . ARG A 1 96  ? 19.534  -4.650  -12.149 1.00 0.00 ? 96  ARG A HH11 1  
ATOM 1587  H HH12 . ARG A 1 96  ? 19.338  -4.622  -10.429 1.00 0.00 ? 96  ARG A HH12 1  
ATOM 1588  H HH21 . ARG A 1 96  ? 19.476  -1.162  -10.207 1.00 0.00 ? 96  ARG A HH21 1  
ATOM 1589  H HH22 . ARG A 1 96  ? 19.305  -2.645  -9.328  1.00 0.00 ? 96  ARG A HH22 1  
ATOM 1590  N N    . GLN A 1 97  ? 17.368  0.542   -15.839 1.00 0.00 ? 97  GLN A N    1  
ATOM 1591  C CA   . GLN A 1 97  ? 17.399  0.020   -17.235 1.00 0.00 ? 97  GLN A CA   1  
ATOM 1592  C C    . GLN A 1 97  ? 18.632  -0.866  -17.426 1.00 0.00 ? 97  GLN A C    1  
ATOM 1593  O O    . GLN A 1 97  ? 18.532  -2.073  -17.518 1.00 0.00 ? 97  GLN A O    1  
ATOM 1594  C CB   . GLN A 1 97  ? 17.455  1.193   -18.217 1.00 0.00 ? 97  GLN A CB   1  
ATOM 1595  C CG   . GLN A 1 97  ? 16.682  0.832   -19.486 1.00 0.00 ? 97  GLN A CG   1  
ATOM 1596  C CD   . GLN A 1 97  ? 15.277  1.434   -19.417 1.00 0.00 ? 97  GLN A CD   1  
ATOM 1597  O OE1  . GLN A 1 97  ? 14.324  0.748   -19.108 1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1598  N NE2  . GLN A 1 97  ? 15.108  2.699   -19.693 1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1599  H H    . GLN A 1 97  ? 18.098  1.108   -15.510 1.00 0.00 ? 97  GLN A H    1  
ATOM 1600  H HA   . GLN A 1 97  ? 16.508  -0.561  -17.421 1.00 0.00 ? 97  GLN A HA   1  
ATOM 1601  H HB2  . GLN A 1 97  ? 17.013  2.065   -17.758 1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1602  H HB3  . GLN A 1 97  ? 18.484  1.401   -18.471 1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1603  H HG2  . GLN A 1 97  ? 17.202  1.227   -20.348 1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1604  H HG3  . GLN A 1 97  ? 16.607  -0.242  -19.572 1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1605  H HE21 . GLN A 1 97  ? 15.877  3.252   -19.944 1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1606  H HE22 . GLN A 1 97  ? 14.213  3.095   -19.650 1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1607  N N    . ARG A 1 98  ? 19.795  -0.277  -17.490 1.00 0.00 ? 98  ARG A N    1  
ATOM 1608  C CA   . ARG A 1 98  ? 21.031  -1.089  -17.677 1.00 0.00 ? 98  ARG A CA   1  
ATOM 1609  C C    . ARG A 1 98  ? 22.253  -0.169  -17.664 1.00 0.00 ? 98  ARG A C    1  
ATOM 1610  O O    . ARG A 1 98  ? 23.242  -0.426  -18.321 1.00 0.00 ? 98  ARG A O    1  
ATOM 1611  C CB   . ARG A 1 98  ? 20.961  -1.825  -19.017 1.00 0.00 ? 98  ARG A CB   1  
ATOM 1612  C CG   . ARG A 1 98  ? 21.026  -3.334  -18.776 1.00 0.00 ? 98  ARG A CG   1  
ATOM 1613  C CD   . ARG A 1 98  ? 22.481  -3.755  -18.560 1.00 0.00 ? 98  ARG A CD   1  
ATOM 1614  N NE   . ARG A 1 98  ? 22.608  -5.227  -18.760 1.00 0.00 ? 98  ARG A NE   1  
ATOM 1615  C CZ   . ARG A 1 98  ? 21.947  -5.816  -19.718 1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1616  N NH1  . ARG A 1 98  ? 22.470  -5.908  -20.910 1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1617  N NH2  . ARG A 1 98  ? 20.763  -6.311  -19.485 1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1618  H H    . ARG A 1 98  ? 19.857  0.698   -17.415 1.00 0.00 ? 98  ARG A H    1  
ATOM 1619  H HA   . ARG A 1 98  ? 21.113  -1.808  -16.876 1.00 0.00 ? 98  ARG A HA   1  
ATOM 1620  H HB2  . ARG A 1 98  ? 20.035  -1.578  -19.516 1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1621  H HB3  . ARG A 1 98  ? 21.793  -1.526  -19.636 1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1622  H HG2  . ARG A 1 98  ? 20.445  -3.584  -17.900 1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1623  H HG3  . ARG A 1 98  ? 20.627  -3.854  -19.634 1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1624  H HD2  . ARG A 1 98  ? 23.113  -3.241  -19.267 1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1625  H HD3  . ARG A 1 98  ? 22.784  -3.501  -17.555 1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1626  H HE   . ARG A 1 98  ? 23.191  -5.752  -18.172 1.00 0.00 ? 98  ARG A HE   1  
ATOM 1627  H HH11 . ARG A 1 98  ? 23.378  -5.529  -21.089 1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1628  H HH12 . ARG A 1 98  ? 21.963  -6.359  -21.644 1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1629  H HH21 . ARG A 1 98  ? 20.363  -6.240  -18.571 1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1630  H HH22 . ARG A 1 98  ? 20.255  -6.762  -20.218 1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1631  N N    . GLY A 1 99  ? 22.194  0.903   -16.921 1.00 0.00 ? 99  GLY A N    1  
ATOM 1632  C CA   . GLY A 1 99  ? 23.355  1.838   -16.869 1.00 0.00 ? 99  GLY A CA   1  
ATOM 1633  C C    . GLY A 1 99  ? 23.945  1.836   -15.457 1.00 0.00 ? 99  GLY A C    1  
ATOM 1634  O O    . GLY A 1 99  ? 25.064  2.256   -15.241 1.00 0.00 ? 99  GLY A O    1  
ATOM 1635  H H    . GLY A 1 99  ? 21.388  1.093   -16.399 1.00 0.00 ? 99  GLY A H    1  
ATOM 1636  H HA2  . GLY A 1 99  ? 24.107  1.517   -17.574 1.00 0.00 ? 99  GLY A HA2  1  
ATOM 1637  H HA3  . GLY A 1 99  ? 23.026  2.835   -17.122 1.00 0.00 ? 99  GLY A HA3  1  
ATOM 1638  N N    . VAL A 1 100 ? 23.198  1.366   -14.496 1.00 0.00 ? 100 VAL A N    1  
ATOM 1639  C CA   . VAL A 1 100 ? 23.711  1.335   -13.097 1.00 0.00 ? 100 VAL A CA   1  
ATOM 1640  C C    . VAL A 1 100 ? 23.404  -0.030  -12.474 1.00 0.00 ? 100 VAL A C    1  
ATOM 1641  O O    . VAL A 1 100 ? 22.290  -0.305  -12.077 1.00 0.00 ? 100 VAL A O    1  
ATOM 1642  C CB   . VAL A 1 100 ? 23.028  2.435   -12.282 1.00 0.00 ? 100 VAL A CB   1  
ATOM 1643  C CG1  . VAL A 1 100 ? 23.573  3.799   -12.708 1.00 0.00 ? 100 VAL A CG1  1  
ATOM 1644  C CG2  . VAL A 1 100 ? 21.519  2.390   -12.536 1.00 0.00 ? 100 VAL A CG2  1  
ATOM 1645  H H    . VAL A 1 100 ? 22.298  1.033   -14.695 1.00 0.00 ? 100 VAL A H    1  
ATOM 1646  H HA   . VAL A 1 100 ? 24.779  1.499   -13.101 1.00 0.00 ? 100 VAL A HA   1  
ATOM 1647  H HB   . VAL A 1 100 ? 23.224  2.281   -11.232 1.00 0.00 ? 100 VAL A HB   1  
ATOM 1648  H HG11 . VAL A 1 100 ? 24.579  3.917   -12.335 1.00 0.00 ? 100 VAL A HG11 1  
ATOM 1649  H HG12 . VAL A 1 100 ? 22.946  4.580   -12.306 1.00 0.00 ? 100 VAL A HG12 1  
ATOM 1650  H HG13 . VAL A 1 100 ? 23.580  3.862   -13.787 1.00 0.00 ? 100 VAL A HG13 1  
ATOM 1651  H HG21 . VAL A 1 100 ? 21.242  3.199   -13.196 1.00 0.00 ? 100 VAL A HG21 1  
ATOM 1652  H HG22 . VAL A 1 100 ? 20.992  2.492   -11.600 1.00 0.00 ? 100 VAL A HG22 1  
ATOM 1653  H HG23 . VAL A 1 100 ? 21.260  1.446   -12.994 1.00 0.00 ? 100 VAL A HG23 1  
ATOM 1654  N N    . SER A 1 101 ? 24.384  -0.887  -12.386 1.00 0.00 ? 101 SER A N    1  
ATOM 1655  C CA   . SER A 1 101 ? 24.145  -2.233  -11.789 1.00 0.00 ? 101 SER A CA   1  
ATOM 1656  C C    . SER A 1 101 ? 23.856  -2.084  -10.295 1.00 0.00 ? 101 SER A C    1  
ATOM 1657  O O    . SER A 1 101 ? 23.506  -3.077  -9.678  1.00 0.00 ? 101 SER A O    1  
ATOM 1658  C CB   . SER A 1 101 ? 25.385  -3.108  -11.983 1.00 0.00 ? 101 SER A CB   1  
ATOM 1659  O OG   . SER A 1 101 ? 25.105  -4.425  -11.526 1.00 0.00 ? 101 SER A OG   1  
ATOM 1660  O OXT  . SER A 1 101 ? 23.991  -0.981  -9.792  1.00 0.00 ? 101 SER A OXT  1  
ATOM 1661  H H    . SER A 1 101 ? 25.277  -0.648  -12.713 1.00 0.00 ? 101 SER A H    1  
ATOM 1662  H HA   . SER A 1 101 ? 23.298  -2.697  -12.275 1.00 0.00 ? 101 SER A HA   1  
ATOM 1663  H HB2  . SER A 1 101 ? 25.644  -3.142  -13.027 1.00 0.00 ? 101 SER A HB2  1  
ATOM 1664  H HB3  . SER A 1 101 ? 26.210  -2.689  -11.423 1.00 0.00 ? 101 SER A HB3  1  
ATOM 1665  H HG   . SER A 1 101 ? 24.483  -4.826  -12.137 1.00 0.00 ? 101 SER A HG   1  
ATOM 1666  N N    . GLU A 1 1   ? 18.435  10.312  -5.360  1.00 0.00 ? 1   GLU A N    2  
ATOM 1667  C CA   . GLU A 1 1   ? 18.468  11.531  -6.215  1.00 0.00 ? 1   GLU A CA   2  
ATOM 1668  C C    . GLU A 1 1   ? 17.155  12.300  -6.059  1.00 0.00 ? 1   GLU A C    2  
ATOM 1669  O O    . GLU A 1 1   ? 17.147  13.506  -5.911  1.00 0.00 ? 1   GLU A O    2  
ATOM 1670  C CB   . GLU A 1 1   ? 18.648  11.124  -7.679  1.00 0.00 ? 1   GLU A CB   2  
ATOM 1671  C CG   . GLU A 1 1   ? 17.477  10.236  -8.108  1.00 0.00 ? 1   GLU A CG   2  
ATOM 1672  C CD   . GLU A 1 1   ? 17.796  9.586   -9.456  1.00 0.00 ? 1   GLU A CD   2  
ATOM 1673  O OE1  . GLU A 1 1   ? 18.518  8.602   -9.462  1.00 0.00 ? 1   GLU A OE1  2  
ATOM 1674  O OE2  . GLU A 1 1   ? 17.312  10.083  -10.460 1.00 0.00 ? 1   GLU A OE2  2  
ATOM 1675  H H1   . GLU A 1 1   ? 18.697  9.482   -5.928  1.00 0.00 ? 1   GLU A H1   2  
ATOM 1676  H H2   . GLU A 1 1   ? 17.476  10.184  -4.978  1.00 0.00 ? 1   GLU A H2   2  
ATOM 1677  H H3   . GLU A 1 1   ? 19.110  10.420  -4.576  1.00 0.00 ? 1   GLU A H3   2  
ATOM 1678  H HA   . GLU A 1 1   ? 19.293  12.160  -5.914  1.00 0.00 ? 1   GLU A HA   2  
ATOM 1679  H HB2  . GLU A 1 1   ? 18.675  12.009  -8.298  1.00 0.00 ? 1   GLU A HB2  2  
ATOM 1680  H HB3  . GLU A 1 1   ? 19.571  10.577  -7.790  1.00 0.00 ? 1   GLU A HB3  2  
ATOM 1681  H HG2  . GLU A 1 1   ? 17.318  9.467   -7.365  1.00 0.00 ? 1   GLU A HG2  2  
ATOM 1682  H HG3  . GLU A 1 1   ? 16.585  10.836  -8.203  1.00 0.00 ? 1   GLU A HG3  2  
ATOM 1683  N N    . SER A 1 2   ? 16.046  11.613  -6.090  1.00 0.00 ? 2   SER A N    2  
ATOM 1684  C CA   . SER A 1 2   ? 14.737  12.309  -5.944  1.00 0.00 ? 2   SER A CA   2  
ATOM 1685  C C    . SER A 1 2   ? 13.675  11.317  -5.462  1.00 0.00 ? 2   SER A C    2  
ATOM 1686  O O    . SER A 1 2   ? 13.305  11.305  -4.305  1.00 0.00 ? 2   SER A O    2  
ATOM 1687  C CB   . SER A 1 2   ? 14.317  12.893  -7.292  1.00 0.00 ? 2   SER A CB   2  
ATOM 1688  O OG   . SER A 1 2   ? 15.229  12.462  -8.294  1.00 0.00 ? 2   SER A OG   2  
ATOM 1689  H H    . SER A 1 2   ? 16.074  10.641  -6.211  1.00 0.00 ? 2   SER A H    2  
ATOM 1690  H HA   . SER A 1 2   ? 14.834  13.108  -5.222  1.00 0.00 ? 2   SER A HA   2  
ATOM 1691  H HB2  . SER A 1 2   ? 13.327  12.550  -7.542  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1692  H HB3  . SER A 1 2   ? 14.316  13.973  -7.232  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1693  H HG   . SER A 1 2   ? 15.656  13.240  -8.660  1.00 0.00 ? 2   SER A HG   2  
ATOM 1694  N N    . LYS A 1 3   ? 13.178  10.486  -6.338  1.00 0.00 ? 3   LYS A N    2  
ATOM 1695  C CA   . LYS A 1 3   ? 12.138  9.501   -5.922  1.00 0.00 ? 3   LYS A CA   2  
ATOM 1696  C C    . LYS A 1 3   ? 12.605  8.079   -6.253  1.00 0.00 ? 3   LYS A C    2  
ATOM 1697  O O    . LYS A 1 3   ? 12.447  7.622   -7.367  1.00 0.00 ? 3   LYS A O    2  
ATOM 1698  C CB   . LYS A 1 3   ? 10.834  9.788   -6.668  1.00 0.00 ? 3   LYS A CB   2  
ATOM 1699  C CG   . LYS A 1 3   ? 10.128  10.981  -6.024  1.00 0.00 ? 3   LYS A CG   2  
ATOM 1700  C CD   . LYS A 1 3   ? 8.963   11.424  -6.911  1.00 0.00 ? 3   LYS A CD   2  
ATOM 1701  C CE   . LYS A 1 3   ? 8.285   12.644  -6.288  1.00 0.00 ? 3   LYS A CE   2  
ATOM 1702  N NZ   . LYS A 1 3   ? 6.867   12.313  -5.967  1.00 0.00 ? 3   LYS A NZ   2  
ATOM 1703  H H    . LYS A 1 3   ? 13.486  10.511  -7.269  1.00 0.00 ? 3   LYS A H    2  
ATOM 1704  H HA   . LYS A 1 3   ? 11.967  9.587   -4.860  1.00 0.00 ? 3   LYS A HA   2  
ATOM 1705  H HB2  . LYS A 1 3   ? 11.051  10.011  -7.702  1.00 0.00 ? 3   LYS A HB2  2  
ATOM 1706  H HB3  . LYS A 1 3   ? 10.190  8.922   -6.615  1.00 0.00 ? 3   LYS A HB3  2  
ATOM 1707  H HG2  . LYS A 1 3   ? 9.755   10.697  -5.052  1.00 0.00 ? 3   LYS A HG2  2  
ATOM 1708  H HG3  . LYS A 1 3   ? 10.826  11.797  -5.918  1.00 0.00 ? 3   LYS A HG3  2  
ATOM 1709  H HD2  . LYS A 1 3   ? 9.336   11.680  -7.893  1.00 0.00 ? 3   LYS A HD2  2  
ATOM 1710  H HD3  . LYS A 1 3   ? 8.249   10.620  -6.996  1.00 0.00 ? 3   LYS A HD3  2  
ATOM 1711  H HE2  . LYS A 1 3   ? 8.803   12.920  -5.381  1.00 0.00 ? 3   LYS A HE2  2  
ATOM 1712  H HE3  . LYS A 1 3   ? 8.312   13.467  -6.985  1.00 0.00 ? 3   LYS A HE3  2  
ATOM 1713  H HZ1  . LYS A 1 3   ? 6.576   11.474  -6.509  1.00 0.00 ? 3   LYS A HZ1  2  
ATOM 1714  H HZ2  . LYS A 1 3   ? 6.258   13.118  -6.219  1.00 0.00 ? 3   LYS A HZ2  2  
ATOM 1715  H HZ3  . LYS A 1 3   ? 6.779   12.115  -4.951  1.00 0.00 ? 3   LYS A HZ3  2  
ATOM 1716  N N    . PRO A 1 4   ? 13.159  7.417   -5.265  1.00 0.00 ? 4   PRO A N    2  
ATOM 1717  C CA   . PRO A 1 4   ? 13.654  6.030   -5.409  1.00 0.00 ? 4   PRO A CA   2  
ATOM 1718  C C    . PRO A 1 4   ? 12.578  4.905   -5.277  1.00 0.00 ? 4   PRO A C    2  
ATOM 1719  O O    . PRO A 1 4   ? 12.952  3.752   -5.363  1.00 0.00 ? 4   PRO A O    2  
ATOM 1720  C CB   . PRO A 1 4   ? 14.652  5.902   -4.253  1.00 0.00 ? 4   PRO A CB   2  
ATOM 1721  C CG   . PRO A 1 4   ? 14.249  6.960   -3.198  1.00 0.00 ? 4   PRO A CG   2  
ATOM 1722  C CD   . PRO A 1 4   ? 13.384  8.004   -3.924  1.00 0.00 ? 4   PRO A CD   2  
ATOM 1723  H HA   . PRO A 1 4   ? 14.187  5.924   -6.337  1.00 0.00 ? 4   PRO A HA   2  
ATOM 1724  H HB2  . PRO A 1 4   ? 14.599  4.908   -3.828  1.00 0.00 ? 4   PRO A HB2  2  
ATOM 1725  H HB3  . PRO A 1 4   ? 15.653  6.103   -4.604  1.00 0.00 ? 4   PRO A HB3  2  
ATOM 1726  H HG2  . PRO A 1 4   ? 13.680  6.491   -2.406  1.00 0.00 ? 4   PRO A HG2  2  
ATOM 1727  H HG3  . PRO A 1 4   ? 15.129  7.435   -2.792  1.00 0.00 ? 4   PRO A HG3  2  
ATOM 1728  H HD2  . PRO A 1 4   ? 12.451  8.151   -3.404  1.00 0.00 ? 4   PRO A HD2  2  
ATOM 1729  H HD3  . PRO A 1 4   ? 13.917  8.938   -4.015  1.00 0.00 ? 4   PRO A HD3  2  
ATOM 1730  N N    . PRO A 1 5   ? 11.300  5.198   -5.063  1.00 0.00 ? 5   PRO A N    2  
ATOM 1731  C CA   . PRO A 1 5   ? 10.300  4.123   -4.924  1.00 0.00 ? 5   PRO A CA   2  
ATOM 1732  C C    . PRO A 1 5   ? 9.867   3.606   -6.296  1.00 0.00 ? 5   PRO A C    2  
ATOM 1733  O O    . PRO A 1 5   ? 10.401  3.995   -7.316  1.00 0.00 ? 5   PRO A O    2  
ATOM 1734  C CB   . PRO A 1 5   ? 9.135   4.795   -4.199  1.00 0.00 ? 5   PRO A CB   2  
ATOM 1735  C CG   . PRO A 1 5   ? 9.274   6.310   -4.460  1.00 0.00 ? 5   PRO A CG   2  
ATOM 1736  C CD   . PRO A 1 5   ? 10.718  6.549   -4.940  1.00 0.00 ? 5   PRO A CD   2  
ATOM 1737  H HA   . PRO A 1 5   ? 10.690  3.319   -4.322  1.00 0.00 ? 5   PRO A HA   2  
ATOM 1738  H HB2  . PRO A 1 5   ? 8.195   4.434   -4.593  1.00 0.00 ? 5   PRO A HB2  2  
ATOM 1739  H HB3  . PRO A 1 5   ? 9.195   4.598   -3.142  1.00 0.00 ? 5   PRO A HB3  2  
ATOM 1740  H HG2  . PRO A 1 5   ? 8.571   6.617   -5.223  1.00 0.00 ? 5   PRO A HG2  2  
ATOM 1741  H HG3  . PRO A 1 5   ? 9.097   6.861   -3.549  1.00 0.00 ? 5   PRO A HG3  2  
ATOM 1742  H HD2  . PRO A 1 5   ? 10.699  7.041   -5.899  1.00 0.00 ? 5   PRO A HD2  2  
ATOM 1743  H HD3  . PRO A 1 5   ? 11.260  7.129   -4.220  1.00 0.00 ? 5   PRO A HD3  2  
ATOM 1744  N N    . TYR A 1 6   ? 8.914   2.716   -6.323  1.00 0.00 ? 6   TYR A N    2  
ATOM 1745  C CA   . TYR A 1 6   ? 8.455   2.151   -7.620  1.00 0.00 ? 6   TYR A CA   2  
ATOM 1746  C C    . TYR A 1 6   ? 7.316   2.983   -8.195  1.00 0.00 ? 6   TYR A C    2  
ATOM 1747  O O    . TYR A 1 6   ? 6.706   3.784   -7.514  1.00 0.00 ? 6   TYR A O    2  
ATOM 1748  C CB   . TYR A 1 6   ? 7.984   0.717   -7.392  1.00 0.00 ? 6   TYR A CB   2  
ATOM 1749  C CG   . TYR A 1 6   ? 8.890   0.070   -6.377  1.00 0.00 ? 6   TYR A CG   2  
ATOM 1750  C CD1  . TYR A 1 6   ? 10.258  -0.052  -6.643  1.00 0.00 ? 6   TYR A CD1  2  
ATOM 1751  C CD2  . TYR A 1 6   ? 8.367   -0.391  -5.167  1.00 0.00 ? 6   TYR A CD2  2  
ATOM 1752  C CE1  . TYR A 1 6   ? 11.104  -0.640  -5.697  1.00 0.00 ? 6   TYR A CE1  2  
ATOM 1753  C CE2  . TYR A 1 6   ? 9.212   -0.979  -4.222  1.00 0.00 ? 6   TYR A CE2  2  
ATOM 1754  C CZ   . TYR A 1 6   ? 10.581  -1.105  -4.485  1.00 0.00 ? 6   TYR A CZ   2  
ATOM 1755  O OH   . TYR A 1 6   ? 11.412  -1.687  -3.551  1.00 0.00 ? 6   TYR A OH   2  
ATOM 1756  H H    . TYR A 1 6   ? 8.511   2.406   -5.486  1.00 0.00 ? 6   TYR A H    2  
ATOM 1757  H HA   . TYR A 1 6   ? 9.270   2.146   -8.314  1.00 0.00 ? 6   TYR A HA   2  
ATOM 1758  H HB2  . TYR A 1 6   ? 6.969   0.723   -7.024  1.00 0.00 ? 6   TYR A HB2  2  
ATOM 1759  H HB3  . TYR A 1 6   ? 8.030   0.167   -8.320  1.00 0.00 ? 6   TYR A HB3  2  
ATOM 1760  H HD1  . TYR A 1 6   ? 10.661  0.309   -7.578  1.00 0.00 ? 6   TYR A HD1  2  
ATOM 1761  H HD2  . TYR A 1 6   ? 7.312   -0.294  -4.961  1.00 0.00 ? 6   TYR A HD2  2  
ATOM 1762  H HE1  . TYR A 1 6   ? 12.161  -0.733  -5.900  1.00 0.00 ? 6   TYR A HE1  2  
ATOM 1763  H HE2  . TYR A 1 6   ? 8.808   -1.333  -3.291  1.00 0.00 ? 6   TYR A HE2  2  
ATOM 1764  H HH   . TYR A 1 6   ? 12.317  -1.595  -3.860  1.00 0.00 ? 6   TYR A HH   2  
ATOM 1765  N N    . SER A 1 7   ? 7.027   2.795   -9.454  1.00 0.00 ? 7   SER A N    2  
ATOM 1766  C CA   . SER A 1 7   ? 5.927   3.567   -10.087 1.00 0.00 ? 7   SER A CA   2  
ATOM 1767  C C    . SER A 1 7   ? 4.678   3.445   -9.219  1.00 0.00 ? 7   SER A C    2  
ATOM 1768  O O    . SER A 1 7   ? 4.694   2.820   -8.179  1.00 0.00 ? 7   SER A O    2  
ATOM 1769  C CB   . SER A 1 7   ? 5.646   3.006   -11.481 1.00 0.00 ? 7   SER A CB   2  
ATOM 1770  O OG   . SER A 1 7   ? 6.597   3.532   -12.398 1.00 0.00 ? 7   SER A OG   2  
ATOM 1771  H H    . SER A 1 7   ? 7.535   2.143   -9.981  1.00 0.00 ? 7   SER A H    2  
ATOM 1772  H HA   . SER A 1 7   ? 6.215   4.605   -10.165 1.00 0.00 ? 7   SER A HA   2  
ATOM 1773  H HB2  . SER A 1 7   ? 5.727   1.932   -11.462 1.00 0.00 ? 7   SER A HB2  2  
ATOM 1774  H HB3  . SER A 1 7   ? 4.645   3.284   -11.785 1.00 0.00 ? 7   SER A HB3  2  
ATOM 1775  H HG   . SER A 1 7   ? 6.413   3.162   -13.264 1.00 0.00 ? 7   SER A HG   2  
ATOM 1776  N N    . TYR A 1 8   ? 3.597   4.038   -9.627  1.00 0.00 ? 8   TYR A N    2  
ATOM 1777  C CA   . TYR A 1 8   ? 2.361   3.954   -8.809  1.00 0.00 ? 8   TYR A CA   2  
ATOM 1778  C C    . TYR A 1 8   ? 1.502   2.787   -9.298  1.00 0.00 ? 8   TYR A C    2  
ATOM 1779  O O    . TYR A 1 8   ? 0.298   2.767   -9.140  1.00 0.00 ? 8   TYR A O    2  
ATOM 1780  C CB   . TYR A 1 8   ? 1.618   5.281   -8.917  1.00 0.00 ? 8   TYR A CB   2  
ATOM 1781  C CG   . TYR A 1 8   ? 2.535   6.361   -8.395  1.00 0.00 ? 8   TYR A CG   2  
ATOM 1782  C CD1  . TYR A 1 8   ? 3.271   6.136   -7.224  1.00 0.00 ? 8   TYR A CD1  2  
ATOM 1783  C CD2  . TYR A 1 8   ? 2.674   7.569   -9.086  1.00 0.00 ? 8   TYR A CD2  2  
ATOM 1784  C CE1  . TYR A 1 8   ? 4.143   7.118   -6.742  1.00 0.00 ? 8   TYR A CE1  2  
ATOM 1785  C CE2  . TYR A 1 8   ? 3.544   8.554   -8.602  1.00 0.00 ? 8   TYR A CE2  2  
ATOM 1786  C CZ   . TYR A 1 8   ? 4.279   8.328   -7.432  1.00 0.00 ? 8   TYR A CZ   2  
ATOM 1787  O OH   . TYR A 1 8   ? 5.142   9.297   -6.962  1.00 0.00 ? 8   TYR A OH   2  
ATOM 1788  H H    . TYR A 1 8   ? 3.601   4.543   -10.467 1.00 0.00 ? 8   TYR A H    2  
ATOM 1789  H HA   . TYR A 1 8   ? 2.632   3.783   -7.778  1.00 0.00 ? 8   TYR A HA   2  
ATOM 1790  H HB2  . TYR A 1 8   ? 1.375   5.476   -9.952  1.00 0.00 ? 8   TYR A HB2  2  
ATOM 1791  H HB3  . TYR A 1 8   ? 0.717   5.250   -8.324  1.00 0.00 ? 8   TYR A HB3  2  
ATOM 1792  H HD1  . TYR A 1 8   ? 3.164   5.202   -6.690  1.00 0.00 ? 8   TYR A HD1  2  
ATOM 1793  H HD2  . TYR A 1 8   ? 2.107   7.745   -9.988  1.00 0.00 ? 8   TYR A HD2  2  
ATOM 1794  H HE1  . TYR A 1 8   ? 4.710   6.940   -5.839  1.00 0.00 ? 8   TYR A HE1  2  
ATOM 1795  H HE2  . TYR A 1 8   ? 3.651   9.486   -9.133  1.00 0.00 ? 8   TYR A HE2  2  
ATOM 1796  H HH   . TYR A 1 8   ? 5.490   9.775   -7.717  1.00 0.00 ? 8   TYR A HH   2  
ATOM 1797  N N    . ALA A 1 9   ? 2.140   1.801   -9.867  1.00 0.00 ? 9   ALA A N    2  
ATOM 1798  C CA   . ALA A 1 9   ? 1.412   0.595   -10.354 1.00 0.00 ? 9   ALA A CA   2  
ATOM 1799  C C    . ALA A 1 9   ? 2.148   -0.643  -9.833  1.00 0.00 ? 9   ALA A C    2  
ATOM 1800  O O    . ALA A 1 9   ? 1.545   -1.610  -9.412  1.00 0.00 ? 9   ALA A O    2  
ATOM 1801  C CB   . ALA A 1 9   ? 1.391   0.581   -11.882 1.00 0.00 ? 9   ALA A CB   2  
ATOM 1802  H H    . ALA A 1 9   ? 3.113   1.847   -9.957  1.00 0.00 ? 9   ALA A H    2  
ATOM 1803  H HA   . ALA A 1 9   ? 0.400   0.602   -9.973  1.00 0.00 ? 9   ALA A HA   2  
ATOM 1804  H HB1  . ALA A 1 9   ? 2.050   -0.194  -12.243 1.00 0.00 ? 9   ALA A HB1  2  
ATOM 1805  H HB2  . ALA A 1 9   ? 1.719   1.539   -12.253 1.00 0.00 ? 9   ALA A HB2  2  
ATOM 1806  H HB3  . ALA A 1 9   ? 0.385   0.386   -12.224 1.00 0.00 ? 9   ALA A HB3  2  
ATOM 1807  N N    . GLN A 1 10  ? 3.453   -0.591  -9.819  1.00 0.00 ? 10  GLN A N    2  
ATOM 1808  C CA   . GLN A 1 10  ? 4.258   -1.724  -9.286  1.00 0.00 ? 10  GLN A CA   2  
ATOM 1809  C C    . GLN A 1 10  ? 4.350   -1.515  -7.786  1.00 0.00 ? 10  GLN A C    2  
ATOM 1810  O O    . GLN A 1 10  ? 4.351   -2.441  -6.999  1.00 0.00 ? 10  GLN A O    2  
ATOM 1811  C CB   . GLN A 1 10  ? 5.664   -1.692  -9.890  1.00 0.00 ? 10  GLN A CB   2  
ATOM 1812  C CG   . GLN A 1 10  ? 6.524   -2.781  -9.247  1.00 0.00 ? 10  GLN A CG   2  
ATOM 1813  C CD   . GLN A 1 10  ? 8.001   -2.429  -9.418  1.00 0.00 ? 10  GLN A CD   2  
ATOM 1814  O OE1  . GLN A 1 10  ? 8.698   -2.191  -8.453  1.00 0.00 ? 10  GLN A OE1  2  
ATOM 1815  N NE2  . GLN A 1 10  ? 8.512   -2.383  -10.618 1.00 0.00 ? 10  GLN A NE2  2  
ATOM 1816  H H    . GLN A 1 10  ? 3.906   0.216   -10.129 1.00 0.00 ? 10  GLN A H    2  
ATOM 1817  H HA   . GLN A 1 10  ? 3.775   -2.667  -9.502  1.00 0.00 ? 10  GLN A HA   2  
ATOM 1818  H HB2  . GLN A 1 10  ? 5.604   -1.859  -10.955 1.00 0.00 ? 10  GLN A HB2  2  
ATOM 1819  H HB3  . GLN A 1 10  ? 6.112   -0.728  -9.703  1.00 0.00 ? 10  GLN A HB3  2  
ATOM 1820  H HG2  . GLN A 1 10  ? 6.288   -2.851  -8.194  1.00 0.00 ? 10  GLN A HG2  2  
ATOM 1821  H HG3  . GLN A 1 10  ? 6.323   -3.728  -9.725  1.00 0.00 ? 10  GLN A HG3  2  
ATOM 1822  H HE21 . GLN A 1 10  ? 7.949   -2.574  -11.397 1.00 0.00 ? 10  GLN A HE21 2  
ATOM 1823  H HE22 . GLN A 1 10  ? 9.458   -2.159  -10.740 1.00 0.00 ? 10  GLN A HE22 2  
ATOM 1824  N N    . LEU A 1 11  ? 4.392   -0.274  -7.398  1.00 0.00 ? 11  LEU A N    2  
ATOM 1825  C CA   . LEU A 1 11  ? 4.444   0.075   -5.963  1.00 0.00 ? 11  LEU A CA   2  
ATOM 1826  C C    . LEU A 1 11  ? 3.167   -0.458  -5.318  1.00 0.00 ? 11  LEU A C    2  
ATOM 1827  O O    . LEU A 1 11  ? 3.180   -1.041  -4.251  1.00 0.00 ? 11  LEU A O    2  
ATOM 1828  C CB   . LEU A 1 11  ? 4.498   1.597   -5.866  1.00 0.00 ? 11  LEU A CB   2  
ATOM 1829  C CG   . LEU A 1 11  ? 4.615   2.036   -4.418  1.00 0.00 ? 11  LEU A CG   2  
ATOM 1830  C CD1  . LEU A 1 11  ? 6.074   2.348   -4.114  1.00 0.00 ? 11  LEU A CD1  2  
ATOM 1831  C CD2  . LEU A 1 11  ? 3.783   3.296   -4.218  1.00 0.00 ? 11  LEU A CD2  2  
ATOM 1832  H H    . LEU A 1 11  ? 4.362   0.443   -8.067  1.00 0.00 ? 11  LEU A H    2  
ATOM 1833  H HA   . LEU A 1 11  ? 5.314   -0.364  -5.499  1.00 0.00 ? 11  LEU A HA   2  
ATOM 1834  H HB2  . LEU A 1 11  ? 5.356   1.956   -6.414  1.00 0.00 ? 11  LEU A HB2  2  
ATOM 1835  H HB3  . LEU A 1 11  ? 3.600   2.016   -6.295  1.00 0.00 ? 11  LEU A HB3  2  
ATOM 1836  H HG   . LEU A 1 11  ? 4.260   1.251   -3.767  1.00 0.00 ? 11  LEU A HG   2  
ATOM 1837  H HD11 . LEU A 1 11  ? 6.653   1.439   -4.165  1.00 0.00 ? 11  LEU A HD11 2  
ATOM 1838  H HD12 . LEU A 1 11  ? 6.151   2.774   -3.125  1.00 0.00 ? 11  LEU A HD12 2  
ATOM 1839  H HD13 . LEU A 1 11  ? 6.445   3.054   -4.841  1.00 0.00 ? 11  LEU A HD13 2  
ATOM 1840  H HD21 . LEU A 1 11  ? 2.742   3.069   -4.386  1.00 0.00 ? 11  LEU A HD21 2  
ATOM 1841  H HD22 . LEU A 1 11  ? 4.105   4.050   -4.924  1.00 0.00 ? 11  LEU A HD22 2  
ATOM 1842  H HD23 . LEU A 1 11  ? 3.919   3.662   -3.213  1.00 0.00 ? 11  LEU A HD23 2  
ATOM 1843  N N    . ILE A 1 12  ? 2.067   -0.277  -5.991  1.00 0.00 ? 12  ILE A N    2  
ATOM 1844  C CA   . ILE A 1 12  ? 0.762   -0.781  -5.478  1.00 0.00 ? 12  ILE A CA   2  
ATOM 1845  C C    . ILE A 1 12  ? 0.814   -2.296  -5.393  1.00 0.00 ? 12  ILE A C    2  
ATOM 1846  O O    . ILE A 1 12  ? 0.471   -2.880  -4.398  1.00 0.00 ? 12  ILE A O    2  
ATOM 1847  C CB   . ILE A 1 12  ? -0.359  -0.430  -6.456  1.00 0.00 ? 12  ILE A CB   2  
ATOM 1848  C CG1  . ILE A 1 12  ? -0.152  0.947   -7.125  1.00 0.00 ? 12  ILE A CG1  2  
ATOM 1849  C CG2  . ILE A 1 12  ? -1.695  -0.450  -5.721  1.00 0.00 ? 12  ILE A CG2  2  
ATOM 1850  C CD1  . ILE A 1 12  ? 0.650   1.901   -6.228  1.00 0.00 ? 12  ILE A CD1  2  
ATOM 1851  H H    . ILE A 1 12  ? 2.103   0.184   -6.854  1.00 0.00 ? 12  ILE A H    2  
ATOM 1852  H HA   . ILE A 1 12  ? 0.544   -0.370  -4.503  1.00 0.00 ? 12  ILE A HA   2  
ATOM 1853  H HB   . ILE A 1 12  ? -0.380  -1.191  -7.216  1.00 0.00 ? 12  ILE A HB   2  
ATOM 1854  H HG12 . ILE A 1 12  ? 0.376   0.814   -8.056  1.00 0.00 ? 12  ILE A HG12 2  
ATOM 1855  H HG13 . ILE A 1 12  ? -1.118  1.386   -7.330  1.00 0.00 ? 12  ILE A HG13 2  
ATOM 1856  H HG21 . ILE A 1 12  ? -2.054  0.559   -5.602  1.00 0.00 ? 12  ILE A HG21 2  
ATOM 1857  H HG22 . ILE A 1 12  ? -1.561  -0.905  -4.750  1.00 0.00 ? 12  ILE A HG22 2  
ATOM 1858  H HG23 . ILE A 1 12  ? -2.409  -1.024  -6.292  1.00 0.00 ? 12  ILE A HG23 2  
ATOM 1859  H HD11 . ILE A 1 12  ? 0.726   1.492   -5.236  1.00 0.00 ? 12  ILE A HD11 2  
ATOM 1860  H HD12 . ILE A 1 12  ? 0.154   2.856   -6.187  1.00 0.00 ? 12  ILE A HD12 2  
ATOM 1861  H HD13 . ILE A 1 12  ? 1.641   2.029   -6.639  1.00 0.00 ? 12  ILE A HD13 2  
ATOM 1862  N N    . VAL A 1 13  ? 1.209   -2.932  -6.454  1.00 0.00 ? 13  VAL A N    2  
ATOM 1863  C CA   . VAL A 1 13  ? 1.250   -4.417  -6.474  1.00 0.00 ? 13  VAL A CA   2  
ATOM 1864  C C    . VAL A 1 13  ? 2.002   -4.953  -5.258  1.00 0.00 ? 13  VAL A C    2  
ATOM 1865  O O    . VAL A 1 13  ? 1.590   -5.917  -4.647  1.00 0.00 ? 13  VAL A O    2  
ATOM 1866  C CB   . VAL A 1 13  ? 1.945   -4.862  -7.755  1.00 0.00 ? 13  VAL A CB   2  
ATOM 1867  C CG1  . VAL A 1 13  ? 2.292   -6.349  -7.665  1.00 0.00 ? 13  VAL A CG1  2  
ATOM 1868  C CG2  . VAL A 1 13  ? 0.996   -4.614  -8.928  1.00 0.00 ? 13  VAL A CG2  2  
ATOM 1869  H H    . VAL A 1 13  ? 1.448   -2.428  -7.261  1.00 0.00 ? 13  VAL A H    2  
ATOM 1870  H HA   . VAL A 1 13  ? 0.241   -4.801  -6.467  1.00 0.00 ? 13  VAL A HA   2  
ATOM 1871  H HB   . VAL A 1 13  ? 2.849   -4.288  -7.894  1.00 0.00 ? 13  VAL A HB   2  
ATOM 1872  H HG11 . VAL A 1 13  ? 3.053   -6.495  -6.912  1.00 0.00 ? 13  VAL A HG11 2  
ATOM 1873  H HG12 . VAL A 1 13  ? 2.660   -6.692  -8.619  1.00 0.00 ? 13  VAL A HG12 2  
ATOM 1874  H HG13 . VAL A 1 13  ? 1.409   -6.908  -7.395  1.00 0.00 ? 13  VAL A HG13 2  
ATOM 1875  H HG21 . VAL A 1 13  ? 0.852   -3.551  -9.054  1.00 0.00 ? 13  VAL A HG21 2  
ATOM 1876  H HG22 . VAL A 1 13  ? 0.043   -5.080  -8.723  1.00 0.00 ? 13  VAL A HG22 2  
ATOM 1877  H HG23 . VAL A 1 13  ? 1.415   -5.031  -9.830  1.00 0.00 ? 13  VAL A HG23 2  
ATOM 1878  N N    . GLN A 1 14  ? 3.090   -4.347  -4.886  1.00 0.00 ? 14  GLN A N    2  
ATOM 1879  C CA   . GLN A 1 14  ? 3.825   -4.849  -3.696  1.00 0.00 ? 14  GLN A CA   2  
ATOM 1880  C C    . GLN A 1 14  ? 3.061   -4.444  -2.435  1.00 0.00 ? 14  GLN A C    2  
ATOM 1881  O O    . GLN A 1 14  ? 3.112   -5.107  -1.421  1.00 0.00 ? 14  GLN A O    2  
ATOM 1882  C CB   . GLN A 1 14  ? 5.228   -4.245  -3.664  1.00 0.00 ? 14  GLN A CB   2  
ATOM 1883  C CG   . GLN A 1 14  ? 6.254   -5.359  -3.455  1.00 0.00 ? 14  GLN A CG   2  
ATOM 1884  C CD   . GLN A 1 14  ? 7.566   -4.747  -2.971  1.00 0.00 ? 14  GLN A CD   2  
ATOM 1885  O OE1  . GLN A 1 14  ? 8.359   -5.404  -2.326  1.00 0.00 ? 14  GLN A OE1  2  
ATOM 1886  N NE2  . GLN A 1 14  ? 7.834   -3.504  -3.260  1.00 0.00 ? 14  GLN A NE2  2  
ATOM 1887  H H    . GLN A 1 14  ? 3.416   -3.565  -5.378  1.00 0.00 ? 14  GLN A H    2  
ATOM 1888  H HA   . GLN A 1 14  ? 3.897   -5.926  -3.743  1.00 0.00 ? 14  GLN A HA   2  
ATOM 1889  H HB2  . GLN A 1 14  ? 5.425   -3.743  -4.600  1.00 0.00 ? 14  GLN A HB2  2  
ATOM 1890  H HB3  . GLN A 1 14  ? 5.297   -3.536  -2.853  1.00 0.00 ? 14  GLN A HB3  2  
ATOM 1891  H HG2  . GLN A 1 14  ? 5.883   -6.053  -2.714  1.00 0.00 ? 14  GLN A HG2  2  
ATOM 1892  H HG3  . GLN A 1 14  ? 6.421   -5.877  -4.387  1.00 0.00 ? 14  GLN A HG3  2  
ATOM 1893  H HE21 . GLN A 1 14  ? 7.195   -2.974  -3.782  1.00 0.00 ? 14  GLN A HE21 2  
ATOM 1894  H HE22 . GLN A 1 14  ? 8.668   -3.100  -2.951  1.00 0.00 ? 14  GLN A HE22 2  
ATOM 1895  N N    . ALA A 1 15  ? 2.350   -3.352  -2.499  1.00 0.00 ? 15  ALA A N    2  
ATOM 1896  C CA   . ALA A 1 15  ? 1.572   -2.887  -1.317  1.00 0.00 ? 15  ALA A CA   2  
ATOM 1897  C C    . ALA A 1 15  ? 0.391   -3.826  -1.057  1.00 0.00 ? 15  ALA A C    2  
ATOM 1898  O O    . ALA A 1 15  ? 0.015   -4.071  0.072   1.00 0.00 ? 15  ALA A O    2  
ATOM 1899  C CB   . ALA A 1 15  ? 1.035   -1.484  -1.598  1.00 0.00 ? 15  ALA A CB   2  
ATOM 1900  H H    . ALA A 1 15  ? 2.324   -2.835  -3.332  1.00 0.00 ? 15  ALA A H    2  
ATOM 1901  H HA   . ALA A 1 15  ? 2.212   -2.860  -0.447  1.00 0.00 ? 15  ALA A HA   2  
ATOM 1902  H HB1  . ALA A 1 15  ? 0.615   -1.068  -0.695  1.00 0.00 ? 15  ALA A HB1  2  
ATOM 1903  H HB2  . ALA A 1 15  ? 0.266   -1.540  -2.357  1.00 0.00 ? 15  ALA A HB2  2  
ATOM 1904  H HB3  . ALA A 1 15  ? 1.838   -0.853  -1.948  1.00 0.00 ? 15  ALA A HB3  2  
ATOM 1905  N N    . ILE A 1 16  ? -0.209  -4.337  -2.095  1.00 0.00 ? 16  ILE A N    2  
ATOM 1906  C CA   . ILE A 1 16  ? -1.382  -5.239  -1.914  1.00 0.00 ? 16  ILE A CA   2  
ATOM 1907  C C    . ILE A 1 16  ? -0.907  -6.680  -1.710  1.00 0.00 ? 16  ILE A C    2  
ATOM 1908  O O    . ILE A 1 16  ? -1.233  -7.319  -0.729  1.00 0.00 ? 16  ILE A O    2  
ATOM 1909  C CB   . ILE A 1 16  ? -2.316  -5.167  -3.141  1.00 0.00 ? 16  ILE A CB   2  
ATOM 1910  C CG1  . ILE A 1 16  ? -1.879  -4.037  -4.099  1.00 0.00 ? 16  ILE A CG1  2  
ATOM 1911  C CG2  . ILE A 1 16  ? -3.737  -4.895  -2.655  1.00 0.00 ? 16  ILE A CG2  2  
ATOM 1912  C CD1  . ILE A 1 16  ? -3.082  -3.491  -4.880  1.00 0.00 ? 16  ILE A CD1  2  
ATOM 1913  H H    . ILE A 1 16  ? 0.105   -4.119  -2.993  1.00 0.00 ? 16  ILE A H    2  
ATOM 1914  H HA   . ILE A 1 16  ? -1.930  -4.925  -1.036  1.00 0.00 ? 16  ILE A HA   2  
ATOM 1915  H HB   . ILE A 1 16  ? -2.293  -6.113  -3.661  1.00 0.00 ? 16  ILE A HB   2  
ATOM 1916  H HG12 . ILE A 1 16  ? -1.433  -3.236  -3.531  1.00 0.00 ? 16  ILE A HG12 2  
ATOM 1917  H HG13 . ILE A 1 16  ? -1.154  -4.426  -4.797  1.00 0.00 ? 16  ILE A HG13 2  
ATOM 1918  H HG21 . ILE A 1 16  ? -4.437  -5.445  -3.264  1.00 0.00 ? 16  ILE A HG21 2  
ATOM 1919  H HG22 . ILE A 1 16  ? -3.944  -3.836  -2.735  1.00 0.00 ? 16  ILE A HG22 2  
ATOM 1920  H HG23 . ILE A 1 16  ? -3.830  -5.203  -1.625  1.00 0.00 ? 16  ILE A HG23 2  
ATOM 1921  H HD11 . ILE A 1 16  ? -2.757  -2.693  -5.529  1.00 0.00 ? 16  ILE A HD11 2  
ATOM 1922  H HD12 . ILE A 1 16  ? -3.819  -3.114  -4.186  1.00 0.00 ? 16  ILE A HD12 2  
ATOM 1923  H HD13 . ILE A 1 16  ? -3.517  -4.283  -5.471  1.00 0.00 ? 16  ILE A HD13 2  
ATOM 1924  N N    . SER A 1 17  ? -0.150  -7.200  -2.634  1.00 0.00 ? 17  SER A N    2  
ATOM 1925  C CA   . SER A 1 17  ? 0.338   -8.604  -2.508  1.00 0.00 ? 17  SER A CA   2  
ATOM 1926  C C    . SER A 1 17  ? 1.068   -8.796  -1.175  1.00 0.00 ? 17  SER A C    2  
ATOM 1927  O O    . SER A 1 17  ? 0.924   -9.812  -0.523  1.00 0.00 ? 17  SER A O    2  
ATOM 1928  C CB   . SER A 1 17  ? 1.298   -8.911  -3.657  1.00 0.00 ? 17  SER A CB   2  
ATOM 1929  O OG   . SER A 1 17  ? 2.320   -7.924  -3.690  1.00 0.00 ? 17  SER A OG   2  
ATOM 1930  H H    . SER A 1 17  ? 0.093   -6.669  -3.420  1.00 0.00 ? 17  SER A H    2  
ATOM 1931  H HA   . SER A 1 17  ? -0.503  -9.280  -2.555  1.00 0.00 ? 17  SER A HA   2  
ATOM 1932  H HB2  . SER A 1 17  ? 1.743   -9.879  -3.507  1.00 0.00 ? 17  SER A HB2  2  
ATOM 1933  H HB3  . SER A 1 17  ? 0.751   -8.909  -4.591  1.00 0.00 ? 17  SER A HB3  2  
ATOM 1934  H HG   . SER A 1 17  ? 3.167   -8.373  -3.648  1.00 0.00 ? 17  SER A HG   2  
ATOM 1935  N N    . SER A 1 18  ? 1.857   -7.841  -0.766  1.00 0.00 ? 18  SER A N    2  
ATOM 1936  C CA   . SER A 1 18  ? 2.595   -7.991  0.521   1.00 0.00 ? 18  SER A CA   2  
ATOM 1937  C C    . SER A 1 18  ? 1.653   -7.713  1.691   1.00 0.00 ? 18  SER A C    2  
ATOM 1938  O O    . SER A 1 18  ? 1.892   -8.132  2.806   1.00 0.00 ? 18  SER A O    2  
ATOM 1939  C CB   . SER A 1 18  ? 3.761   -7.003  0.563   1.00 0.00 ? 18  SER A CB   2  
ATOM 1940  O OG   . SER A 1 18  ? 4.654   -7.286  -0.505  1.00 0.00 ? 18  SER A OG   2  
ATOM 1941  H H    . SER A 1 18  ? 1.968   -7.030  -1.305  1.00 0.00 ? 18  SER A H    2  
ATOM 1942  H HA   . SER A 1 18  ? 2.976   -8.997  0.600   1.00 0.00 ? 18  SER A HA   2  
ATOM 1943  H HB2  . SER A 1 18  ? 3.389   -5.998  0.457   1.00 0.00 ? 18  SER A HB2  2  
ATOM 1944  H HB3  . SER A 1 18  ? 4.275   -7.095  1.511   1.00 0.00 ? 18  SER A HB3  2  
ATOM 1945  H HG   . SER A 1 18  ? 5.462   -6.789  -0.355  1.00 0.00 ? 18  SER A HG   2  
ATOM 1946  N N    . ALA A 1 19  ? 0.579   -7.013  1.450   1.00 0.00 ? 19  ALA A N    2  
ATOM 1947  C CA   . ALA A 1 19  ? -0.372  -6.720  2.555   1.00 0.00 ? 19  ALA A CA   2  
ATOM 1948  C C    . ALA A 1 19  ? -0.911  -8.039  3.105   1.00 0.00 ? 19  ALA A C    2  
ATOM 1949  O O    . ALA A 1 19  ? -0.405  -9.100  2.796   1.00 0.00 ? 19  ALA A O    2  
ATOM 1950  C CB   . ALA A 1 19  ? -1.530  -5.872  2.023   1.00 0.00 ? 19  ALA A CB   2  
ATOM 1951  H H    . ALA A 1 19  ? 0.399   -6.685  0.544   1.00 0.00 ? 19  ALA A H    2  
ATOM 1952  H HA   . ALA A 1 19  ? 0.140   -6.182  3.340   1.00 0.00 ? 19  ALA A HA   2  
ATOM 1953  H HB1  . ALA A 1 19  ? -1.334  -5.598  0.996   1.00 0.00 ? 19  ALA A HB1  2  
ATOM 1954  H HB2  . ALA A 1 19  ? -1.625  -4.978  2.621   1.00 0.00 ? 19  ALA A HB2  2  
ATOM 1955  H HB3  . ALA A 1 19  ? -2.447  -6.440  2.075   1.00 0.00 ? 19  ALA A HB3  2  
ATOM 1956  N N    . GLN A 1 20  ? -1.932  -7.990  3.914   1.00 0.00 ? 20  GLN A N    2  
ATOM 1957  C CA   . GLN A 1 20  ? -2.492  -9.253  4.471   1.00 0.00 ? 20  GLN A CA   2  
ATOM 1958  C C    . GLN A 1 20  ? -2.616  -10.285 3.347   1.00 0.00 ? 20  GLN A C    2  
ATOM 1959  O O    . GLN A 1 20  ? -1.696  -11.031 3.072   1.00 0.00 ? 20  GLN A O    2  
ATOM 1960  C CB   . GLN A 1 20  ? -3.874  -8.986  5.075   1.00 0.00 ? 20  GLN A CB   2  
ATOM 1961  C CG   . GLN A 1 20  ? -4.555  -7.842  4.320   1.00 0.00 ? 20  GLN A CG   2  
ATOM 1962  C CD   . GLN A 1 20  ? -6.040  -8.165  4.133   1.00 0.00 ? 20  GLN A CD   2  
ATOM 1963  O OE1  . GLN A 1 20  ? -6.397  -8.973  3.301   1.00 0.00 ? 20  GLN A OE1  2  
ATOM 1964  N NE2  . GLN A 1 20  ? -6.925  -7.563  4.880   1.00 0.00 ? 20  GLN A NE2  2  
ATOM 1965  H H    . GLN A 1 20  ? -2.330  -7.127  4.152   1.00 0.00 ? 20  GLN A H    2  
ATOM 1966  H HA   . GLN A 1 20  ? -1.831  -9.634  5.236   1.00 0.00 ? 20  GLN A HA   2  
ATOM 1967  H HB2  . GLN A 1 20  ? -4.477  -9.879  4.997   1.00 0.00 ? 20  GLN A HB2  2  
ATOM 1968  H HB3  . GLN A 1 20  ? -3.766  -8.715  6.114   1.00 0.00 ? 20  GLN A HB3  2  
ATOM 1969  H HG2  . GLN A 1 20  ? -4.453  -6.927  4.887   1.00 0.00 ? 20  GLN A HG2  2  
ATOM 1970  H HG3  . GLN A 1 20  ? -4.091  -7.721  3.353   1.00 0.00 ? 20  GLN A HG3  2  
ATOM 1971  H HE21 . GLN A 1 20  ? -6.636  -6.911  5.553   1.00 0.00 ? 20  GLN A HE21 2  
ATOM 1972  H HE22 . GLN A 1 20  ? -7.877  -7.763  4.769   1.00 0.00 ? 20  GLN A HE22 2  
ATOM 1973  N N    . ASP A 1 21  ? -3.742  -10.328 2.690   1.00 0.00 ? 21  ASP A N    2  
ATOM 1974  C CA   . ASP A 1 21  ? -3.922  -11.305 1.580   1.00 0.00 ? 21  ASP A CA   2  
ATOM 1975  C C    . ASP A 1 21  ? -3.481  -10.659 0.265   1.00 0.00 ? 21  ASP A C    2  
ATOM 1976  O O    . ASP A 1 21  ? -2.530  -11.083 -0.361  1.00 0.00 ? 21  ASP A O    2  
ATOM 1977  C CB   . ASP A 1 21  ? -5.397  -11.698 1.484   1.00 0.00 ? 21  ASP A CB   2  
ATOM 1978  C CG   . ASP A 1 21  ? -5.699  -12.806 2.494   1.00 0.00 ? 21  ASP A CG   2  
ATOM 1979  O OD1  . ASP A 1 21  ? -4.811  -13.601 2.757   1.00 0.00 ? 21  ASP A OD1  2  
ATOM 1980  O OD2  . ASP A 1 21  ? -6.813  -12.841 2.990   1.00 0.00 ? 21  ASP A OD2  2  
ATOM 1981  H H    . ASP A 1 21  ? -4.468  -9.715  2.923   1.00 0.00 ? 21  ASP A H    2  
ATOM 1982  H HA   . ASP A 1 21  ? -3.324  -12.184 1.771   1.00 0.00 ? 21  ASP A HA   2  
ATOM 1983  H HB2  . ASP A 1 21  ? -6.013  -10.836 1.699   1.00 0.00 ? 21  ASP A HB2  2  
ATOM 1984  H HB3  . ASP A 1 21  ? -5.612  -12.054 0.487   1.00 0.00 ? 21  ASP A HB3  2  
ATOM 1985  N N    . ARG A 1 22  ? -4.170  -9.636  -0.155  1.00 0.00 ? 22  ARG A N    2  
ATOM 1986  C CA   . ARG A 1 22  ? -3.803  -8.954  -1.428  1.00 0.00 ? 22  ARG A CA   2  
ATOM 1987  C C    . ARG A 1 22  ? -4.778  -7.799  -1.673  1.00 0.00 ? 22  ARG A C    2  
ATOM 1988  O O    . ARG A 1 22  ? -5.181  -7.537  -2.794  1.00 0.00 ? 22  ARG A O    2  
ATOM 1989  C CB   . ARG A 1 22  ? -3.893  -9.957  -2.582  1.00 0.00 ? 22  ARG A CB   2  
ATOM 1990  C CG   . ARG A 1 22  ? -5.134  -10.835 -2.402  1.00 0.00 ? 22  ARG A CG   2  
ATOM 1991  C CD   . ARG A 1 22  ? -5.024  -12.070 -3.299  1.00 0.00 ? 22  ARG A CD   2  
ATOM 1992  N NE   . ARG A 1 22  ? -5.682  -13.231 -2.634  1.00 0.00 ? 22  ARG A NE   2  
ATOM 1993  C CZ   . ARG A 1 22  ? -4.975  -14.270 -2.284  1.00 0.00 ? 22  ARG A CZ   2  
ATOM 1994  N NH1  . ARG A 1 22  ? -4.251  -14.231 -1.199  1.00 0.00 ? 22  ARG A NH1  2  
ATOM 1995  N NH2  . ARG A 1 22  ? -4.992  -15.348 -3.018  1.00 0.00 ? 22  ARG A NH2  2  
ATOM 1996  H H    . ARG A 1 22  ? -4.933  -9.314  0.368   1.00 0.00 ? 22  ARG A H    2  
ATOM 1997  H HA   . ARG A 1 22  ? -2.797  -8.571  -1.359  1.00 0.00 ? 22  ARG A HA   2  
ATOM 1998  H HB2  . ARG A 1 22  ? -3.962  -9.422  -3.519  1.00 0.00 ? 22  ARG A HB2  2  
ATOM 1999  H HB3  . ARG A 1 22  ? -3.012  -10.580 -2.587  1.00 0.00 ? 22  ARG A HB3  2  
ATOM 2000  H HG2  . ARG A 1 22  ? -5.209  -11.144 -1.370  1.00 0.00 ? 22  ARG A HG2  2  
ATOM 2001  H HG3  . ARG A 1 22  ? -6.015  -10.273 -2.675  1.00 0.00 ? 22  ARG A HG3  2  
ATOM 2002  H HD2  . ARG A 1 22  ? -5.512  -11.874 -4.242  1.00 0.00 ? 22  ARG A HD2  2  
ATOM 2003  H HD3  . ARG A 1 22  ? -3.983  -12.297 -3.474  1.00 0.00 ? 22  ARG A HD3  2  
ATOM 2004  H HE   . ARG A 1 22  ? -6.647  -13.214 -2.461  1.00 0.00 ? 22  ARG A HE   2  
ATOM 2005  H HH11 . ARG A 1 22  ? -4.239  -13.405 -0.635  1.00 0.00 ? 22  ARG A HH11 2  
ATOM 2006  H HH12 . ARG A 1 22  ? -3.711  -15.027 -0.929  1.00 0.00 ? 22  ARG A HH12 2  
ATOM 2007  H HH21 . ARG A 1 22  ? -5.546  -15.378 -3.848  1.00 0.00 ? 22  ARG A HH21 2  
ATOM 2008  H HH22 . ARG A 1 22  ? -4.451  -16.146 -2.748  1.00 0.00 ? 22  ARG A HH22 2  
ATOM 2009  N N    . GLN A 1 23  ? -5.167  -7.110  -0.629  1.00 0.00 ? 23  GLN A N    2  
ATOM 2010  C CA   . GLN A 1 23  ? -6.125  -5.983  -0.800  1.00 0.00 ? 23  GLN A CA   2  
ATOM 2011  C C    . GLN A 1 23  ? -5.810  -4.854  0.189   1.00 0.00 ? 23  GLN A C    2  
ATOM 2012  O O    . GLN A 1 23  ? -5.306  -5.077  1.271   1.00 0.00 ? 23  GLN A O    2  
ATOM 2013  C CB   . GLN A 1 23  ? -7.547  -6.487  -0.541  1.00 0.00 ? 23  GLN A CB   2  
ATOM 2014  C CG   . GLN A 1 23  ? -7.591  -7.236  0.794   1.00 0.00 ? 23  GLN A CG   2  
ATOM 2015  C CD   . GLN A 1 23  ? -8.511  -8.452  0.672   1.00 0.00 ? 23  GLN A CD   2  
ATOM 2016  O OE1  . GLN A 1 23  ? -8.081  -9.515  0.272   1.00 0.00 ? 23  GLN A OE1  2  
ATOM 2017  N NE2  . GLN A 1 23  ? -9.769  -8.339  1.004   1.00 0.00 ? 23  GLN A NE2  2  
ATOM 2018  H H    . GLN A 1 23  ? -4.836  -7.343  0.264   1.00 0.00 ? 23  GLN A H    2  
ATOM 2019  H HA   . GLN A 1 23  ? -6.059  -5.606  -1.808  1.00 0.00 ? 23  GLN A HA   2  
ATOM 2020  H HB2  . GLN A 1 23  ? -8.226  -5.646  -0.506  1.00 0.00 ? 23  GLN A HB2  2  
ATOM 2021  H HB3  . GLN A 1 23  ? -7.842  -7.154  -1.334  1.00 0.00 ? 23  GLN A HB3  2  
ATOM 2022  H HG2  . GLN A 1 23  ? -6.595  -7.563  1.055   1.00 0.00 ? 23  GLN A HG2  2  
ATOM 2023  H HG3  . GLN A 1 23  ? -7.968  -6.581  1.565   1.00 0.00 ? 23  GLN A HG3  2  
ATOM 2024  H HE21 . GLN A 1 23  ? -10.115 -7.481  1.327   1.00 0.00 ? 23  GLN A HE21 2  
ATOM 2025  H HE22 . GLN A 1 23  ? -10.366 -9.113  0.932   1.00 0.00 ? 23  GLN A HE22 2  
ATOM 2026  N N    . LEU A 1 24  ? -6.131  -3.643  -0.181  1.00 0.00 ? 24  LEU A N    2  
ATOM 2027  C CA   . LEU A 1 24  ? -5.892  -2.477  0.711   1.00 0.00 ? 24  LEU A CA   2  
ATOM 2028  C C    . LEU A 1 24  ? -6.774  -1.322  0.249   1.00 0.00 ? 24  LEU A C    2  
ATOM 2029  O O    . LEU A 1 24  ? -7.080  -1.196  -0.917  1.00 0.00 ? 24  LEU A O    2  
ATOM 2030  C CB   . LEU A 1 24  ? -4.429  -2.045  0.629   1.00 0.00 ? 24  LEU A CB   2  
ATOM 2031  C CG   . LEU A 1 24  ? -3.871  -2.373  -0.751  1.00 0.00 ? 24  LEU A CG   2  
ATOM 2032  C CD1  . LEU A 1 24  ? -4.720  -1.689  -1.823  1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2033  C CD2  . LEU A 1 24  ? -2.429  -1.870  -0.843  1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2034  H H    . LEU A 1 24  ? -6.547  -3.502  -1.052  1.00 0.00 ? 24  LEU A H    2  
ATOM 2035  H HA   . LEU A 1 24  ? -6.139  -2.740  1.729   1.00 0.00 ? 24  LEU A HA   2  
ATOM 2036  H HB2  . LEU A 1 24  ? -4.356  -0.977  0.800   1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2037  H HB3  . LEU A 1 24  ? -3.864  -2.572  1.376   1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2038  H HG   . LEU A 1 24  ? -3.893  -3.439  -0.897  1.00 0.00 ? 24  LEU A HG   2  
ATOM 2039  H HD11 . LEU A 1 24  ? -4.113  -1.498  -2.696  1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2040  H HD12 . LEU A 1 24  ? -5.101  -0.754  -1.439  1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2041  H HD13 . LEU A 1 24  ? -5.546  -2.330  -2.093  1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2042  H HD21 . LEU A 1 24  ? -1.752  -2.685  -0.633  1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2043  H HD22 . LEU A 1 24  ? -2.278  -1.081  -0.122  1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2044  H HD23 . LEU A 1 24  ? -2.243  -1.493  -1.837  1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2045  N N    . THR A 1 25  ? -7.174  -0.462  1.138   1.00 0.00 ? 25  THR A N    2  
ATOM 2046  C CA   . THR A 1 25  ? -8.017  0.682   0.709   1.00 0.00 ? 25  THR A CA   2  
ATOM 2047  C C    . THR A 1 25  ? -7.104  1.733   0.086   1.00 0.00 ? 25  THR A C    2  
ATOM 2048  O O    . THR A 1 25  ? -5.915  1.526   -0.050  1.00 0.00 ? 25  THR A O    2  
ATOM 2049  C CB   . THR A 1 25  ? -8.749  1.283   1.915   1.00 0.00 ? 25  THR A CB   2  
ATOM 2050  O OG1  . THR A 1 25  ? -7.972  2.340   2.461   1.00 0.00 ? 25  THR A OG1  2  
ATOM 2051  C CG2  . THR A 1 25  ? -8.962  0.203   2.979   1.00 0.00 ? 25  THR A CG2  2  
ATOM 2052  H H    . THR A 1 25  ? -6.912  -0.561  2.077   1.00 0.00 ? 25  THR A H    2  
ATOM 2053  H HA   . THR A 1 25  ? -8.736  0.349   -0.025  1.00 0.00 ? 25  THR A HA   2  
ATOM 2054  H HB   . THR A 1 25  ? -9.708  1.665   1.601   1.00 0.00 ? 25  THR A HB   2  
ATOM 2055  H HG1  . THR A 1 25  ? -8.573  3.015   2.783   1.00 0.00 ? 25  THR A HG1  2  
ATOM 2056  H HG21 . THR A 1 25  ? -8.147  0.231   3.688   1.00 0.00 ? 25  THR A HG21 2  
ATOM 2057  H HG22 . THR A 1 25  ? -8.994  -0.766  2.506   1.00 0.00 ? 25  THR A HG22 2  
ATOM 2058  H HG23 . THR A 1 25  ? -9.893  0.385   3.494   1.00 0.00 ? 25  THR A HG23 2  
ATOM 2059  N N    . LEU A 1 26  ? -7.634  2.856   -0.296  1.00 0.00 ? 26  LEU A N    2  
ATOM 2060  C CA   . LEU A 1 26  ? -6.768  3.898   -0.905  1.00 0.00 ? 26  LEU A CA   2  
ATOM 2061  C C    . LEU A 1 26  ? -5.781  4.396   0.148   1.00 0.00 ? 26  LEU A C    2  
ATOM 2062  O O    . LEU A 1 26  ? -4.668  4.775   -0.157  1.00 0.00 ? 26  LEU A O    2  
ATOM 2063  C CB   . LEU A 1 26  ? -7.629  5.058   -1.396  1.00 0.00 ? 26  LEU A CB   2  
ATOM 2064  C CG   . LEU A 1 26  ? -8.204  4.704   -2.765  1.00 0.00 ? 26  LEU A CG   2  
ATOM 2065  C CD1  . LEU A 1 26  ? -9.145  5.818   -3.223  1.00 0.00 ? 26  LEU A CD1  2  
ATOM 2066  C CD2  . LEU A 1 26  ? -7.061  4.558   -3.772  1.00 0.00 ? 26  LEU A CD2  2  
ATOM 2067  H H    . LEU A 1 26  ? -8.595  3.012   -0.184  1.00 0.00 ? 26  LEU A H    2  
ATOM 2068  H HA   . LEU A 1 26  ? -6.223  3.474   -1.736  1.00 0.00 ? 26  LEU A HA   2  
ATOM 2069  H HB2  . LEU A 1 26  ? -8.435  5.233   -0.698  1.00 0.00 ? 26  LEU A HB2  2  
ATOM 2070  H HB3  . LEU A 1 26  ? -7.024  5.948   -1.480  1.00 0.00 ? 26  LEU A HB3  2  
ATOM 2071  H HG   . LEU A 1 26  ? -8.750  3.773   -2.699  1.00 0.00 ? 26  LEU A HG   2  
ATOM 2072  H HD11 . LEU A 1 26  ? -8.811  6.760   -2.814  1.00 0.00 ? 26  LEU A HD11 2  
ATOM 2073  H HD12 . LEU A 1 26  ? -10.144 5.609   -2.875  1.00 0.00 ? 26  LEU A HD12 2  
ATOM 2074  H HD13 . LEU A 1 26  ? -9.141  5.871   -4.301  1.00 0.00 ? 26  LEU A HD13 2  
ATOM 2075  H HD21 . LEU A 1 26  ? -7.464  4.526   -4.773  1.00 0.00 ? 26  LEU A HD21 2  
ATOM 2076  H HD22 . LEU A 1 26  ? -6.521  3.644   -3.574  1.00 0.00 ? 26  LEU A HD22 2  
ATOM 2077  H HD23 . LEU A 1 26  ? -6.390  5.399   -3.680  1.00 0.00 ? 26  LEU A HD23 2  
ATOM 2078  N N    . SER A 1 27  ? -6.178  4.386   1.390   1.00 0.00 ? 27  SER A N    2  
ATOM 2079  C CA   . SER A 1 27  ? -5.265  4.848   2.468   1.00 0.00 ? 27  SER A CA   2  
ATOM 2080  C C    . SER A 1 27  ? -4.572  3.636   3.091   1.00 0.00 ? 27  SER A C    2  
ATOM 2081  O O    . SER A 1 27  ? -4.072  3.694   4.197   1.00 0.00 ? 27  SER A O    2  
ATOM 2082  C CB   . SER A 1 27  ? -6.071  5.583   3.539   1.00 0.00 ? 27  SER A CB   2  
ATOM 2083  O OG   . SER A 1 27  ? -5.373  6.759   3.926   1.00 0.00 ? 27  SER A OG   2  
ATOM 2084  H H    . SER A 1 27  ? -7.079  4.068   1.612   1.00 0.00 ? 27  SER A H    2  
ATOM 2085  H HA   . SER A 1 27  ? -4.525  5.514   2.053   1.00 0.00 ? 27  SER A HA   2  
ATOM 2086  H HB2  . SER A 1 27  ? -7.034  5.857   3.143   1.00 0.00 ? 27  SER A HB2  2  
ATOM 2087  H HB3  . SER A 1 27  ? -6.207  4.934   4.395   1.00 0.00 ? 27  SER A HB3  2  
ATOM 2088  H HG   . SER A 1 27  ? -4.844  7.049   3.179   1.00 0.00 ? 27  SER A HG   2  
ATOM 2089  N N    . GLY A 1 28  ? -4.523  2.541   2.382   1.00 0.00 ? 28  GLY A N    2  
ATOM 2090  C CA   . GLY A 1 28  ? -3.847  1.331   2.926   1.00 0.00 ? 28  GLY A CA   2  
ATOM 2091  C C    . GLY A 1 28  ? -2.463  1.257   2.301   1.00 0.00 ? 28  GLY A C    2  
ATOM 2092  O O    . GLY A 1 28  ? -1.473  1.002   2.955   1.00 0.00 ? 28  GLY A O    2  
ATOM 2093  H H    . GLY A 1 28  ? -4.911  2.519   1.479   1.00 0.00 ? 28  GLY A H    2  
ATOM 2094  H HA2  . GLY A 1 28  ? -3.760  1.412   4.000   1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2095  H HA3  . GLY A 1 28  ? -4.413  0.449   2.670   1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2096  N N    . ILE A 1 29  ? -2.408  1.492   1.025   1.00 0.00 ? 29  ILE A N    2  
ATOM 2097  C CA   . ILE A 1 29  ? -1.122  1.464   0.295   1.00 0.00 ? 29  ILE A CA   2  
ATOM 2098  C C    . ILE A 1 29  ? -0.136  2.432   0.946   1.00 0.00 ? 29  ILE A C    2  
ATOM 2099  O O    . ILE A 1 29  ? 1.056   2.217   0.951   1.00 0.00 ? 29  ILE A O    2  
ATOM 2100  C CB   . ILE A 1 29  ? -1.402  1.885   -1.145  1.00 0.00 ? 29  ILE A CB   2  
ATOM 2101  C CG1  . ILE A 1 29  ? -0.387  1.266   -2.075  1.00 0.00 ? 29  ILE A CG1  2  
ATOM 2102  C CG2  . ILE A 1 29  ? -1.342  3.406   -1.293  1.00 0.00 ? 29  ILE A CG2  2  
ATOM 2103  C CD1  . ILE A 1 29  ? -0.711  1.749   -3.473  1.00 0.00 ? 29  ILE A CD1  2  
ATOM 2104  H H    . ILE A 1 29  ? -3.231  1.697   0.536   1.00 0.00 ? 29  ILE A H    2  
ATOM 2105  H HA   . ILE A 1 29  ? -0.718  0.472   0.306   1.00 0.00 ? 29  ILE A HA   2  
ATOM 2106  H HB   . ILE A 1 29  ? -2.383  1.545   -1.430  1.00 0.00 ? 29  ILE A HB   2  
ATOM 2107  H HG12 . ILE A 1 29  ? 0.610   1.576   -1.795  1.00 0.00 ? 29  ILE A HG12 2  
ATOM 2108  H HG13 . ILE A 1 29  ? -0.466  0.193   -2.038  1.00 0.00 ? 29  ILE A HG13 2  
ATOM 2109  H HG21 . ILE A 1 29  ? -0.381  3.763   -0.953  1.00 0.00 ? 29  ILE A HG21 2  
ATOM 2110  H HG22 . ILE A 1 29  ? -2.126  3.859   -0.706  1.00 0.00 ? 29  ILE A HG22 2  
ATOM 2111  H HG23 . ILE A 1 29  ? -1.472  3.666   -2.331  1.00 0.00 ? 29  ILE A HG23 2  
ATOM 2112  H HD11 . ILE A 1 29  ? 0.042   2.450   -3.793  1.00 0.00 ? 29  ILE A HD11 2  
ATOM 2113  H HD12 . ILE A 1 29  ? -1.678  2.235   -3.465  1.00 0.00 ? 29  ILE A HD12 2  
ATOM 2114  H HD13 . ILE A 1 29  ? -0.737  0.911   -4.143  1.00 0.00 ? 29  ILE A HD13 2  
ATOM 2115  N N    . TYR A 1 30  ? -0.633  3.508   1.473   1.00 0.00 ? 30  TYR A N    2  
ATOM 2116  C CA   . TYR A 1 30  ? 0.262   4.510   2.108   1.00 0.00 ? 30  TYR A CA   2  
ATOM 2117  C C    . TYR A 1 30  ? 0.878   3.926   3.375   1.00 0.00 ? 30  TYR A C    2  
ATOM 2118  O O    . TYR A 1 30  ? 2.078   3.954   3.559   1.00 0.00 ? 30  TYR A O    2  
ATOM 2119  C CB   . TYR A 1 30  ? -0.555  5.760   2.425   1.00 0.00 ? 30  TYR A CB   2  
ATOM 2120  C CG   . TYR A 1 30  ? -1.357  6.118   1.197   1.00 0.00 ? 30  TYR A CG   2  
ATOM 2121  C CD1  . TYR A 1 30  ? -0.821  5.881   -0.074  1.00 0.00 ? 30  TYR A CD1  2  
ATOM 2122  C CD2  . TYR A 1 30  ? -2.639  6.662   1.322   1.00 0.00 ? 30  TYR A CD2  2  
ATOM 2123  C CE1  . TYR A 1 30  ? -1.561  6.188   -1.219  1.00 0.00 ? 30  TYR A CE1  2  
ATOM 2124  C CE2  . TYR A 1 30  ? -3.381  6.967   0.175   1.00 0.00 ? 30  TYR A CE2  2  
ATOM 2125  C CZ   . TYR A 1 30  ? -2.842  6.731   -1.095  1.00 0.00 ? 30  TYR A CZ   2  
ATOM 2126  O OH   . TYR A 1 30  ? -3.577  7.032   -2.222  1.00 0.00 ? 30  TYR A OH   2  
ATOM 2127  H H    . TYR A 1 30  ? -1.601  3.665   1.440   1.00 0.00 ? 30  TYR A H    2  
ATOM 2128  H HA   . TYR A 1 30  ? 1.047   4.765   1.419   1.00 0.00 ? 30  TYR A HA   2  
ATOM 2129  H HB2  . TYR A 1 30  ? -1.220  5.558   3.253   1.00 0.00 ? 30  TYR A HB2  2  
ATOM 2130  H HB3  . TYR A 1 30  ? 0.106   6.573   2.678   1.00 0.00 ? 30  TYR A HB3  2  
ATOM 2131  H HD1  . TYR A 1 30  ? 0.169   5.462   -0.170  1.00 0.00 ? 30  TYR A HD1  2  
ATOM 2132  H HD2  . TYR A 1 30  ? -3.055  6.848   2.300   1.00 0.00 ? 30  TYR A HD2  2  
ATOM 2133  H HE1  . TYR A 1 30  ? -1.141  5.999   -2.199  1.00 0.00 ? 30  TYR A HE1  2  
ATOM 2134  H HE2  . TYR A 1 30  ? -4.371  7.381   0.268   1.00 0.00 ? 30  TYR A HE2  2  
ATOM 2135  H HH   . TYR A 1 30  ? -4.503  6.879   -2.022  1.00 0.00 ? 30  TYR A HH   2  
ATOM 2136  N N    . ALA A 1 31  ? 0.078   3.383   4.243   1.00 0.00 ? 31  ALA A N    2  
ATOM 2137  C CA   . ALA A 1 31  ? 0.636   2.788   5.487   1.00 0.00 ? 31  ALA A CA   2  
ATOM 2138  C C    . ALA A 1 31  ? 1.454   1.543   5.131   1.00 0.00 ? 31  ALA A C    2  
ATOM 2139  O O    . ALA A 1 31  ? 2.288   1.098   5.894   1.00 0.00 ? 31  ALA A O    2  
ATOM 2140  C CB   . ALA A 1 31  ? -0.508  2.396   6.424   1.00 0.00 ? 31  ALA A CB   2  
ATOM 2141  H H    . ALA A 1 31  ? -0.887  3.360   4.074   1.00 0.00 ? 31  ALA A H    2  
ATOM 2142  H HA   . ALA A 1 31  ? 1.273   3.509   5.977   1.00 0.00 ? 31  ALA A HA   2  
ATOM 2143  H HB1  . ALA A 1 31  ? -0.251  2.667   7.438   1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2144  H HB2  . ALA A 1 31  ? -0.672  1.330   6.366   1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2145  H HB3  . ALA A 1 31  ? -1.408  2.916   6.130   1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2146  N N    . HIS A 1 32  ? 1.221   0.972   3.977   1.00 0.00 ? 32  HIS A N    2  
ATOM 2147  C CA   . HIS A 1 32  ? 1.980   -0.244  3.578   1.00 0.00 ? 32  HIS A CA   2  
ATOM 2148  C C    . HIS A 1 32  ? 3.379   0.142   3.085   1.00 0.00 ? 32  HIS A C    2  
ATOM 2149  O O    . HIS A 1 32  ? 4.377   -0.152  3.709   1.00 0.00 ? 32  HIS A O    2  
ATOM 2150  C CB   . HIS A 1 32  ? 1.229   -0.953  2.451   1.00 0.00 ? 32  HIS A CB   2  
ATOM 2151  C CG   . HIS A 1 32  ? 1.960   -2.213  2.081   1.00 0.00 ? 32  HIS A CG   2  
ATOM 2152  N ND1  . HIS A 1 32  ? 1.348   -3.456  2.103   1.00 0.00 ? 32  HIS A ND1  2  
ATOM 2153  C CD2  . HIS A 1 32  ? 3.252   -2.436  1.678   1.00 0.00 ? 32  HIS A CD2  2  
ATOM 2154  C CE1  . HIS A 1 32  ? 2.266   -4.363  1.724   1.00 0.00 ? 32  HIS A CE1  2  
ATOM 2155  N NE2  . HIS A 1 32  ? 3.444   -3.795  1.454   1.00 0.00 ? 32  HIS A NE2  2  
ATOM 2156  H H    . HIS A 1 32  ? 0.544   1.341   3.369   1.00 0.00 ? 32  HIS A H    2  
ATOM 2157  H HA   . HIS A 1 32  ? 2.067   -0.908  4.424   1.00 0.00 ? 32  HIS A HA   2  
ATOM 2158  H HB2  . HIS A 1 32  ? 0.228   -1.196  2.780   1.00 0.00 ? 32  HIS A HB2  2  
ATOM 2159  H HB3  . HIS A 1 32  ? 1.176   -0.303  1.590   1.00 0.00 ? 32  HIS A HB3  2  
ATOM 2160  H HD1  . HIS A 1 32  ? 0.418   -3.640  2.349   1.00 0.00 ? 32  HIS A HD1  2  
ATOM 2161  H HD2  . HIS A 1 32  ? 4.006   -1.673  1.554   1.00 0.00 ? 32  HIS A HD2  2  
ATOM 2162  H HE1  . HIS A 1 32  ? 2.074   -5.421  1.649   1.00 0.00 ? 32  HIS A HE1  2  
ATOM 2163  N N    . ILE A 1 33  ? 3.445   0.780   1.950   1.00 0.00 ? 33  ILE A N    2  
ATOM 2164  C CA   . ILE A 1 33  ? 4.758   1.179   1.368   1.00 0.00 ? 33  ILE A CA   2  
ATOM 2165  C C    . ILE A 1 33  ? 5.544   2.065   2.336   1.00 0.00 ? 33  ILE A C    2  
ATOM 2166  O O    . ILE A 1 33  ? 6.752   1.990   2.417   1.00 0.00 ? 33  ILE A O    2  
ATOM 2167  C CB   . ILE A 1 33  ? 4.508   1.952   0.076   1.00 0.00 ? 33  ILE A CB   2  
ATOM 2168  C CG1  . ILE A 1 33  ? 3.649   3.185   0.371   1.00 0.00 ? 33  ILE A CG1  2  
ATOM 2169  C CG2  . ILE A 1 33  ? 3.779   1.054   -0.923  1.00 0.00 ? 33  ILE A CG2  2  
ATOM 2170  C CD1  . ILE A 1 33  ? 4.551   4.413   0.511   1.00 0.00 ? 33  ILE A CD1  2  
ATOM 2171  H H    . ILE A 1 33  ? 2.623   0.983   1.464   1.00 0.00 ? 33  ILE A H    2  
ATOM 2172  H HA   . ILE A 1 33  ? 5.334   0.293   1.145   1.00 0.00 ? 33  ILE A HA   2  
ATOM 2173  H HB   . ILE A 1 33  ? 5.454   2.264   -0.337  1.00 0.00 ? 33  ILE A HB   2  
ATOM 2174  H HG12 . ILE A 1 33  ? 2.953   3.338   -0.441  1.00 0.00 ? 33  ILE A HG12 2  
ATOM 2175  H HG13 . ILE A 1 33  ? 3.104   3.033   1.289   1.00 0.00 ? 33  ILE A HG13 2  
ATOM 2176  H HG21 . ILE A 1 33  ? 4.042   0.022   -0.740  1.00 0.00 ? 33  ILE A HG21 2  
ATOM 2177  H HG22 . ILE A 1 33  ? 4.067   1.326   -1.927  1.00 0.00 ? 33  ILE A HG22 2  
ATOM 2178  H HG23 . ILE A 1 33  ? 2.713   1.179   -0.808  1.00 0.00 ? 33  ILE A HG23 2  
ATOM 2179  H HD11 . ILE A 1 33  ? 5.447   4.143   1.049   1.00 0.00 ? 33  ILE A HD11 2  
ATOM 2180  H HD12 . ILE A 1 33  ? 4.025   5.186   1.052   1.00 0.00 ? 33  ILE A HD12 2  
ATOM 2181  H HD13 . ILE A 1 33  ? 4.816   4.778   -0.471  1.00 0.00 ? 33  ILE A HD13 2  
ATOM 2182  N N    . THR A 1 34  ? 4.878   2.919   3.053   1.00 0.00 ? 34  THR A N    2  
ATOM 2183  C CA   . THR A 1 34  ? 5.606   3.821   3.991   1.00 0.00 ? 34  THR A CA   2  
ATOM 2184  C C    . THR A 1 34  ? 6.421   2.991   4.988   1.00 0.00 ? 34  THR A C    2  
ATOM 2185  O O    . THR A 1 34  ? 7.410   3.450   5.523   1.00 0.00 ? 34  THR A O    2  
ATOM 2186  C CB   . THR A 1 34  ? 4.600   4.687   4.752   1.00 0.00 ? 34  THR A CB   2  
ATOM 2187  O OG1  . THR A 1 34  ? 3.596   3.858   5.320   1.00 0.00 ? 34  THR A OG1  2  
ATOM 2188  C CG2  . THR A 1 34  ? 3.960   5.691   3.790   1.00 0.00 ? 34  THR A CG2  2  
ATOM 2189  H H    . THR A 1 34  ? 3.907   2.981   2.961   1.00 0.00 ? 34  THR A H    2  
ATOM 2190  H HA   . THR A 1 34  ? 6.271   4.458   3.428   1.00 0.00 ? 34  THR A HA   2  
ATOM 2191  H HB   . THR A 1 34  ? 5.109   5.224   5.536   1.00 0.00 ? 34  THR A HB   2  
ATOM 2192  H HG1  . THR A 1 34  ? 4.016   3.279   5.959   1.00 0.00 ? 34  THR A HG1  2  
ATOM 2193  H HG21 . THR A 1 34  ? 3.647   5.180   2.892   1.00 0.00 ? 34  THR A HG21 2  
ATOM 2194  H HG22 . THR A 1 34  ? 4.679   6.456   3.537   1.00 0.00 ? 34  THR A HG22 2  
ATOM 2195  H HG23 . THR A 1 34  ? 3.101   6.146   4.263   1.00 0.00 ? 34  THR A HG23 2  
ATOM 2196  N N    . LYS A 1 35  ? 6.023   1.775   5.240   1.00 0.00 ? 35  LYS A N    2  
ATOM 2197  C CA   . LYS A 1 35  ? 6.789   0.929   6.202   1.00 0.00 ? 35  LYS A CA   2  
ATOM 2198  C C    . LYS A 1 35  ? 7.928   0.215   5.468   1.00 0.00 ? 35  LYS A C    2  
ATOM 2199  O O    . LYS A 1 35  ? 8.973   -0.047  6.030   1.00 0.00 ? 35  LYS A O    2  
ATOM 2200  C CB   . LYS A 1 35  ? 5.856   -0.112  6.827   1.00 0.00 ? 35  LYS A CB   2  
ATOM 2201  C CG   . LYS A 1 35  ? 6.660   -1.025  7.755   1.00 0.00 ? 35  LYS A CG   2  
ATOM 2202  C CD   . LYS A 1 35  ? 6.527   -2.475  7.288   1.00 0.00 ? 35  LYS A CD   2  
ATOM 2203  C CE   . LYS A 1 35  ? 6.019   -3.340  8.443   1.00 0.00 ? 35  LYS A CE   2  
ATOM 2204  N NZ   . LYS A 1 35  ? 7.160   -4.087  9.045   1.00 0.00 ? 35  LYS A NZ   2  
ATOM 2205  H H    . LYS A 1 35  ? 5.225   1.418   4.799   1.00 0.00 ? 35  LYS A H    2  
ATOM 2206  H HA   . LYS A 1 35  ? 7.200   1.554   6.979   1.00 0.00 ? 35  LYS A HA   2  
ATOM 2207  H HB2  . LYS A 1 35  ? 5.085   0.390   7.393   1.00 0.00 ? 35  LYS A HB2  2  
ATOM 2208  H HB3  . LYS A 1 35  ? 5.402   -0.705  6.047   1.00 0.00 ? 35  LYS A HB3  2  
ATOM 2209  H HG2  . LYS A 1 35  ? 7.701   -0.733  7.734   1.00 0.00 ? 35  LYS A HG2  2  
ATOM 2210  H HG3  . LYS A 1 35  ? 6.282   -0.938  8.763   1.00 0.00 ? 35  LYS A HG3  2  
ATOM 2211  H HD2  . LYS A 1 35  ? 5.829   -2.525  6.465   1.00 0.00 ? 35  LYS A HD2  2  
ATOM 2212  H HD3  . LYS A 1 35  ? 7.492   -2.840  6.966   1.00 0.00 ? 35  LYS A HD3  2  
ATOM 2213  H HE2  . LYS A 1 35  ? 5.566   -2.709  9.193   1.00 0.00 ? 35  LYS A HE2  2  
ATOM 2214  H HE3  . LYS A 1 35  ? 5.285   -4.040  8.072   1.00 0.00 ? 35  LYS A HE3  2  
ATOM 2215  H HZ1  . LYS A 1 35  ? 7.812   -3.417  9.498   1.00 0.00 ? 35  LYS A HZ1  2  
ATOM 2216  H HZ2  . LYS A 1 35  ? 7.663   -4.610  8.298   1.00 0.00 ? 35  LYS A HZ2  2  
ATOM 2217  H HZ3  . LYS A 1 35  ? 6.801   -4.754  9.755   1.00 0.00 ? 35  LYS A HZ3  2  
ATOM 2218  N N    . HIS A 1 36  ? 7.734   -0.108  4.217   1.00 0.00 ? 36  HIS A N    2  
ATOM 2219  C CA   . HIS A 1 36  ? 8.804   -0.811  3.451   1.00 0.00 ? 36  HIS A CA   2  
ATOM 2220  C C    . HIS A 1 36  ? 9.755   0.215   2.825   1.00 0.00 ? 36  HIS A C    2  
ATOM 2221  O O    . HIS A 1 36  ? 10.916  0.291   3.175   1.00 0.00 ? 36  HIS A O    2  
ATOM 2222  C CB   . HIS A 1 36  ? 8.165   -1.657  2.348   1.00 0.00 ? 36  HIS A CB   2  
ATOM 2223  C CG   . HIS A 1 36  ? 8.129   -3.098  2.781   1.00 0.00 ? 36  HIS A CG   2  
ATOM 2224  N ND1  . HIS A 1 36  ? 9.266   -3.889  2.815   1.00 0.00 ? 36  HIS A ND1  2  
ATOM 2225  C CD2  . HIS A 1 36  ? 7.099   -3.904  3.200   1.00 0.00 ? 36  HIS A CD2  2  
ATOM 2226  C CE1  . HIS A 1 36  ? 8.898   -5.110  3.244   1.00 0.00 ? 36  HIS A CE1  2  
ATOM 2227  N NE2  . HIS A 1 36  ? 7.588   -5.175  3.492   1.00 0.00 ? 36  HIS A NE2  2  
ATOM 2228  H H    . HIS A 1 36  ? 6.882   0.108   3.783   1.00 0.00 ? 36  HIS A H    2  
ATOM 2229  H HA   . HIS A 1 36  ? 9.359   -1.453  4.119   1.00 0.00 ? 36  HIS A HA   2  
ATOM 2230  H HB2  . HIS A 1 36  ? 7.159   -1.309  2.164   1.00 0.00 ? 36  HIS A HB2  2  
ATOM 2231  H HB3  . HIS A 1 36  ? 8.748   -1.568  1.443   1.00 0.00 ? 36  HIS A HB3  2  
ATOM 2232  H HD1  . HIS A 1 36  ? 10.174  -3.609  2.573   1.00 0.00 ? 36  HIS A HD1  2  
ATOM 2233  H HD2  . HIS A 1 36  ? 6.067   -3.599  3.290   1.00 0.00 ? 36  HIS A HD2  2  
ATOM 2234  H HE1  . HIS A 1 36  ? 9.580   -5.939  3.370   1.00 0.00 ? 36  HIS A HE1  2  
ATOM 2235  N N    . TYR A 1 37  ? 9.274   0.999   1.900   1.00 0.00 ? 37  TYR A N    2  
ATOM 2236  C CA   . TYR A 1 37  ? 10.153  2.016   1.248   1.00 0.00 ? 37  TYR A CA   2  
ATOM 2237  C C    . TYR A 1 37  ? 10.290  3.220   2.193   1.00 0.00 ? 37  TYR A C    2  
ATOM 2238  O O    . TYR A 1 37  ? 9.305   3.719   2.698   1.00 0.00 ? 37  TYR A O    2  
ATOM 2239  C CB   . TYR A 1 37  ? 9.529   2.455   -0.088  1.00 0.00 ? 37  TYR A CB   2  
ATOM 2240  C CG   . TYR A 1 37  ? 8.706   1.326   -0.660  1.00 0.00 ? 37  TYR A CG   2  
ATOM 2241  C CD1  . TYR A 1 37  ? 9.151   0.005   -0.533  1.00 0.00 ? 37  TYR A CD1  2  
ATOM 2242  C CD2  . TYR A 1 37  ? 7.494   1.598   -1.304  1.00 0.00 ? 37  TYR A CD2  2  
ATOM 2243  C CE1  . TYR A 1 37  ? 8.385   -1.044  -1.048  1.00 0.00 ? 37  TYR A CE1  2  
ATOM 2244  C CE2  . TYR A 1 37  ? 6.727   0.547   -1.820  1.00 0.00 ? 37  TYR A CE2  2  
ATOM 2245  C CZ   . TYR A 1 37  ? 7.172   -0.774  -1.692  1.00 0.00 ? 37  TYR A CZ   2  
ATOM 2246  O OH   . TYR A 1 37  ? 6.416   -1.810  -2.199  1.00 0.00 ? 37  TYR A OH   2  
ATOM 2247  H H    . TYR A 1 37  ? 8.338   0.918   1.628   1.00 0.00 ? 37  TYR A H    2  
ATOM 2248  H HA   . TYR A 1 37  ? 11.123  1.579   1.067   1.00 0.00 ? 37  TYR A HA   2  
ATOM 2249  H HB2  . TYR A 1 37  ? 8.892   3.306   0.075   1.00 0.00 ? 37  TYR A HB2  2  
ATOM 2250  H HB3  . TYR A 1 37  ? 10.310  2.720   -0.785  1.00 0.00 ? 37  TYR A HB3  2  
ATOM 2251  H HD1  . TYR A 1 37  ? 10.086  -0.202  -0.036  1.00 0.00 ? 37  TYR A HD1  2  
ATOM 2252  H HD2  . TYR A 1 37  ? 7.151   2.618   -1.403  1.00 0.00 ? 37  TYR A HD2  2  
ATOM 2253  H HE1  . TYR A 1 37  ? 8.729   -2.063  -0.950  1.00 0.00 ? 37  TYR A HE1  2  
ATOM 2254  H HE2  . TYR A 1 37  ? 5.792   0.755   -2.319  1.00 0.00 ? 37  TYR A HE2  2  
ATOM 2255  H HH   . TYR A 1 37  ? 6.183   -2.390  -1.470  1.00 0.00 ? 37  TYR A HH   2  
ATOM 2256  N N    . PRO A 1 38  ? 11.515  3.632   2.431   1.00 0.00 ? 38  PRO A N    2  
ATOM 2257  C CA   . PRO A 1 38  ? 11.814  4.754   3.344   1.00 0.00 ? 38  PRO A CA   2  
ATOM 2258  C C    . PRO A 1 38  ? 11.528  6.115   2.698   1.00 0.00 ? 38  PRO A C    2  
ATOM 2259  O O    . PRO A 1 38  ? 11.199  7.067   3.376   1.00 0.00 ? 38  PRO A O    2  
ATOM 2260  C CB   . PRO A 1 38  ? 13.308  4.592   3.631   1.00 0.00 ? 38  PRO A CB   2  
ATOM 2261  C CG   . PRO A 1 38  ? 13.894  3.768   2.460   1.00 0.00 ? 38  PRO A CG   2  
ATOM 2262  C CD   . PRO A 1 38  ? 12.712  3.023   1.813   1.00 0.00 ? 38  PRO A CD   2  
ATOM 2263  H HA   . PRO A 1 38  ? 11.257  4.649   4.261   1.00 0.00 ? 38  PRO A HA   2  
ATOM 2264  H HB2  . PRO A 1 38  ? 13.782  5.564   3.680   1.00 0.00 ? 38  PRO A HB2  2  
ATOM 2265  H HB3  . PRO A 1 38  ? 13.454  4.060   4.558   1.00 0.00 ? 38  PRO A HB3  2  
ATOM 2266  H HG2  . PRO A 1 38  ? 14.359  4.429   1.741   1.00 0.00 ? 38  PRO A HG2  2  
ATOM 2267  H HG3  . PRO A 1 38  ? 14.614  3.056   2.832   1.00 0.00 ? 38  PRO A HG3  2  
ATOM 2268  H HD2  . PRO A 1 38  ? 12.709  3.179   0.743   1.00 0.00 ? 38  PRO A HD2  2  
ATOM 2269  H HD3  . PRO A 1 38  ? 12.756  1.971   2.044   1.00 0.00 ? 38  PRO A HD3  2  
ATOM 2270  N N    . TYR A 1 39  ? 11.657  6.228   1.405   1.00 0.00 ? 39  TYR A N    2  
ATOM 2271  C CA   . TYR A 1 39  ? 11.397  7.548   0.759   1.00 0.00 ? 39  TYR A CA   2  
ATOM 2272  C C    . TYR A 1 39  ? 9.958   7.988   1.043   1.00 0.00 ? 39  TYR A C    2  
ATOM 2273  O O    . TYR A 1 39  ? 9.712   9.115   1.426   1.00 0.00 ? 39  TYR A O    2  
ATOM 2274  C CB   . TYR A 1 39  ? 11.605  7.442   -0.752  1.00 0.00 ? 39  TYR A CB   2  
ATOM 2275  C CG   . TYR A 1 39  ? 11.574  8.827   -1.352  1.00 0.00 ? 39  TYR A CG   2  
ATOM 2276  C CD1  . TYR A 1 39  ? 12.661  9.692   -1.172  1.00 0.00 ? 39  TYR A CD1  2  
ATOM 2277  C CD2  . TYR A 1 39  ? 10.457  9.250   -2.084  1.00 0.00 ? 39  TYR A CD2  2  
ATOM 2278  C CE1  . TYR A 1 39  ? 12.631  10.978  -1.724  1.00 0.00 ? 39  TYR A CE1  2  
ATOM 2279  C CE2  . TYR A 1 39  ? 10.429  10.536  -2.636  1.00 0.00 ? 39  TYR A CE2  2  
ATOM 2280  C CZ   . TYR A 1 39  ? 11.516  11.401  -2.458  1.00 0.00 ? 39  TYR A CZ   2  
ATOM 2281  O OH   . TYR A 1 39  ? 11.487  12.669  -3.002  1.00 0.00 ? 39  TYR A OH   2  
ATOM 2282  H H    . TYR A 1 39  ? 11.931  5.458   0.865   1.00 0.00 ? 39  TYR A H    2  
ATOM 2283  H HA   . TYR A 1 39  ? 12.080  8.281   1.163   1.00 0.00 ? 39  TYR A HA   2  
ATOM 2284  H HB2  . TYR A 1 39  ? 12.562  6.982   -0.954  1.00 0.00 ? 39  TYR A HB2  2  
ATOM 2285  H HB3  . TYR A 1 39  ? 10.817  6.844   -1.185  1.00 0.00 ? 39  TYR A HB3  2  
ATOM 2286  H HD1  . TYR A 1 39  ? 13.521  9.367   -0.608  1.00 0.00 ? 39  TYR A HD1  2  
ATOM 2287  H HD2  . TYR A 1 39  ? 9.618   8.583   -2.223  1.00 0.00 ? 39  TYR A HD2  2  
ATOM 2288  H HE1  . TYR A 1 39  ? 13.470  11.645  -1.586  1.00 0.00 ? 39  TYR A HE1  2  
ATOM 2289  H HE2  . TYR A 1 39  ? 9.567   10.862  -3.201  1.00 0.00 ? 39  TYR A HE2  2  
ATOM 2290  H HH   . TYR A 1 39  ? 10.665  13.088  -2.735  1.00 0.00 ? 39  TYR A HH   2  
ATOM 2291  N N    . TYR A 1 40  ? 9.006   7.115   0.860   1.00 0.00 ? 40  TYR A N    2  
ATOM 2292  C CA   . TYR A 1 40  ? 7.588   7.499   1.122   1.00 0.00 ? 40  TYR A CA   2  
ATOM 2293  C C    . TYR A 1 40  ? 7.315   7.438   2.629   1.00 0.00 ? 40  TYR A C    2  
ATOM 2294  O O    . TYR A 1 40  ? 7.431   6.397   3.244   1.00 0.00 ? 40  TYR A O    2  
ATOM 2295  C CB   . TYR A 1 40  ? 6.649   6.531   0.396   1.00 0.00 ? 40  TYR A CB   2  
ATOM 2296  C CG   . TYR A 1 40  ? 6.662   6.814   -1.089  1.00 0.00 ? 40  TYR A CG   2  
ATOM 2297  C CD1  . TYR A 1 40  ? 6.722   8.135   -1.557  1.00 0.00 ? 40  TYR A CD1  2  
ATOM 2298  C CD2  . TYR A 1 40  ? 6.612   5.753   -2.001  1.00 0.00 ? 40  TYR A CD2  2  
ATOM 2299  C CE1  . TYR A 1 40  ? 6.732   8.391   -2.933  1.00 0.00 ? 40  TYR A CE1  2  
ATOM 2300  C CE2  . TYR A 1 40  ? 6.623   6.011   -3.377  1.00 0.00 ? 40  TYR A CE2  2  
ATOM 2301  C CZ   . TYR A 1 40  ? 6.683   7.329   -3.842  1.00 0.00 ? 40  TYR A CZ   2  
ATOM 2302  O OH   . TYR A 1 40  ? 6.694   7.581   -5.199  1.00 0.00 ? 40  TYR A OH   2  
ATOM 2303  H H    . TYR A 1 40  ? 9.221   6.209   0.549   1.00 0.00 ? 40  TYR A H    2  
ATOM 2304  H HA   . TYR A 1 40  ? 7.420   8.502   0.764   1.00 0.00 ? 40  TYR A HA   2  
ATOM 2305  H HB2  . TYR A 1 40  ? 6.976   5.516   0.570   1.00 0.00 ? 40  TYR A HB2  2  
ATOM 2306  H HB3  . TYR A 1 40  ? 5.645   6.653   0.775   1.00 0.00 ? 40  TYR A HB3  2  
ATOM 2307  H HD1  . TYR A 1 40  ? 6.759   8.955   -0.859  1.00 0.00 ? 40  TYR A HD1  2  
ATOM 2308  H HD2  . TYR A 1 40  ? 6.567   4.735   -1.643  1.00 0.00 ? 40  TYR A HD2  2  
ATOM 2309  H HE1  . TYR A 1 40  ? 6.780   9.408   -3.292  1.00 0.00 ? 40  TYR A HE1  2  
ATOM 2310  H HE2  . TYR A 1 40  ? 6.584   5.192   -4.079  1.00 0.00 ? 40  TYR A HE2  2  
ATOM 2311  H HH   . TYR A 1 40  ? 6.073   8.293   -5.372  1.00 0.00 ? 40  TYR A HH   2  
ATOM 2312  N N    . ARG A 1 41  ? 6.953   8.542   3.233   1.00 0.00 ? 41  ARG A N    2  
ATOM 2313  C CA   . ARG A 1 41  ? 6.676   8.527   4.698   1.00 0.00 ? 41  ARG A CA   2  
ATOM 2314  C C    . ARG A 1 41  ? 5.907   9.793   5.090   1.00 0.00 ? 41  ARG A C    2  
ATOM 2315  O O    . ARG A 1 41  ? 4.834   9.726   5.655   1.00 0.00 ? 41  ARG A O    2  
ATOM 2316  C CB   . ARG A 1 41  ? 7.994   8.467   5.480   1.00 0.00 ? 41  ARG A CB   2  
ATOM 2317  C CG   . ARG A 1 41  ? 9.135   9.032   4.630   1.00 0.00 ? 41  ARG A CG   2  
ATOM 2318  C CD   . ARG A 1 41  ? 10.322  9.376   5.532   1.00 0.00 ? 41  ARG A CD   2  
ATOM 2319  N NE   . ARG A 1 41  ? 11.501  9.710   4.688   1.00 0.00 ? 41  ARG A NE   2  
ATOM 2320  C CZ   . ARG A 1 41  ? 12.570  10.223  5.232   1.00 0.00 ? 41  ARG A CZ   2  
ATOM 2321  N NH1  . ARG A 1 41  ? 12.871  9.942   6.471   1.00 0.00 ? 41  ARG A NH1  2  
ATOM 2322  N NH2  . ARG A 1 41  ? 13.337  11.018  4.537   1.00 0.00 ? 41  ARG A NH2  2  
ATOM 2323  H H    . ARG A 1 41  ? 6.862   9.375   2.727   1.00 0.00 ? 41  ARG A H    2  
ATOM 2324  H HA   . ARG A 1 41  ? 6.079   7.659   4.938   1.00 0.00 ? 41  ARG A HA   2  
ATOM 2325  H HB2  . ARG A 1 41  ? 7.900   9.049   6.386   1.00 0.00 ? 41  ARG A HB2  2  
ATOM 2326  H HB3  . ARG A 1 41  ? 8.213   7.441   5.735   1.00 0.00 ? 41  ARG A HB3  2  
ATOM 2327  H HG2  . ARG A 1 41  ? 9.440   8.295   3.901   1.00 0.00 ? 41  ARG A HG2  2  
ATOM 2328  H HG3  . ARG A 1 41  ? 8.801   9.923   4.123   1.00 0.00 ? 41  ARG A HG3  2  
ATOM 2329  H HD2  . ARG A 1 41  ? 10.068  10.225  6.151   1.00 0.00 ? 41  ARG A HD2  2  
ATOM 2330  H HD3  . ARG A 1 41  ? 10.556  8.530   6.160   1.00 0.00 ? 41  ARG A HD3  2  
ATOM 2331  H HE   . ARG A 1 41  ? 11.474  9.547   3.722   1.00 0.00 ? 41  ARG A HE   2  
ATOM 2332  H HH11 . ARG A 1 41  ? 12.282  9.333   7.003   1.00 0.00 ? 41  ARG A HH11 2  
ATOM 2333  H HH12 . ARG A 1 41  ? 13.690  10.335  6.888   1.00 0.00 ? 41  ARG A HH12 2  
ATOM 2334  H HH21 . ARG A 1 41  ? 13.105  11.232  3.588   1.00 0.00 ? 41  ARG A HH21 2  
ATOM 2335  H HH22 . ARG A 1 41  ? 14.157  11.412  4.952   1.00 0.00 ? 41  ARG A HH22 2  
ATOM 2336  N N    . THR A 1 42  ? 6.445   10.946  4.798   1.00 0.00 ? 42  THR A N    2  
ATOM 2337  C CA   . THR A 1 42  ? 5.742   12.211  5.159   1.00 0.00 ? 42  THR A CA   2  
ATOM 2338  C C    . THR A 1 42  ? 6.247   13.348  4.269   1.00 0.00 ? 42  THR A C    2  
ATOM 2339  O O    . THR A 1 42  ? 6.245   14.500  4.657   1.00 0.00 ? 42  THR A O    2  
ATOM 2340  C CB   . THR A 1 42  ? 6.022   12.548  6.626   1.00 0.00 ? 42  THR A CB   2  
ATOM 2341  O OG1  . THR A 1 42  ? 7.423   12.503  6.861   1.00 0.00 ? 42  THR A OG1  2  
ATOM 2342  C CG2  . THR A 1 42  ? 5.318   11.536  7.531   1.00 0.00 ? 42  THR A CG2  2  
ATOM 2343  H H    . THR A 1 42  ? 7.311   10.983  4.344   1.00 0.00 ? 42  THR A H    2  
ATOM 2344  H HA   . THR A 1 42  ? 4.679   12.084  5.015   1.00 0.00 ? 42  THR A HA   2  
ATOM 2345  H HB   . THR A 1 42  ? 5.652   13.539  6.845   1.00 0.00 ? 42  THR A HB   2  
ATOM 2346  H HG1  . THR A 1 42  ? 7.629   13.138  7.551   1.00 0.00 ? 42  THR A HG1  2  
ATOM 2347  H HG21 . THR A 1 42  ? 5.769   10.563  7.401   1.00 0.00 ? 42  THR A HG21 2  
ATOM 2348  H HG22 . THR A 1 42  ? 4.271   11.486  7.268   1.00 0.00 ? 42  THR A HG22 2  
ATOM 2349  H HG23 . THR A 1 42  ? 5.417   11.843  8.561   1.00 0.00 ? 42  THR A HG23 2  
ATOM 2350  N N    . ALA A 1 43  ? 6.679   13.036  3.077   1.00 0.00 ? 43  ALA A N    2  
ATOM 2351  C CA   . ALA A 1 43  ? 7.184   14.101  2.165   1.00 0.00 ? 43  ALA A CA   2  
ATOM 2352  C C    . ALA A 1 43  ? 6.024   14.998  1.730   1.00 0.00 ? 43  ALA A C    2  
ATOM 2353  O O    . ALA A 1 43  ? 5.808   16.060  2.281   1.00 0.00 ? 43  ALA A O    2  
ATOM 2354  C CB   . ALA A 1 43  ? 7.816   13.456  0.928   1.00 0.00 ? 43  ALA A CB   2  
ATOM 2355  H H    . ALA A 1 43  ? 6.672   12.101  2.783   1.00 0.00 ? 43  ALA A H    2  
ATOM 2356  H HA   . ALA A 1 43  ? 7.926   14.694  2.679   1.00 0.00 ? 43  ALA A HA   2  
ATOM 2357  H HB1  . ALA A 1 43  ? 7.644   12.391  0.949   1.00 0.00 ? 43  ALA A HB1  2  
ATOM 2358  H HB2  . ALA A 1 43  ? 8.878   13.649  0.925   1.00 0.00 ? 43  ALA A HB2  2  
ATOM 2359  H HB3  . ALA A 1 43  ? 7.371   13.875  0.038   1.00 0.00 ? 43  ALA A HB3  2  
ATOM 2360  N N    . ASP A 1 44  ? 5.277   14.583  0.744   1.00 0.00 ? 44  ASP A N    2  
ATOM 2361  C CA   . ASP A 1 44  ? 4.135   15.415  0.272   1.00 0.00 ? 44  ASP A CA   2  
ATOM 2362  C C    . ASP A 1 44  ? 3.005   14.509  -0.221  1.00 0.00 ? 44  ASP A C    2  
ATOM 2363  O O    . ASP A 1 44  ? 3.140   13.303  -0.270  1.00 0.00 ? 44  ASP A O    2  
ATOM 2364  C CB   . ASP A 1 44  ? 4.599   16.309  -0.879  1.00 0.00 ? 44  ASP A CB   2  
ATOM 2365  C CG   . ASP A 1 44  ? 5.932   16.964  -0.511  1.00 0.00 ? 44  ASP A CG   2  
ATOM 2366  O OD1  . ASP A 1 44  ? 5.932   17.809  0.369   1.00 0.00 ? 44  ASP A OD1  2  
ATOM 2367  O OD2  . ASP A 1 44  ? 6.931   16.611  -1.117  1.00 0.00 ? 44  ASP A OD2  2  
ATOM 2368  H H    . ASP A 1 44  ? 5.470   13.725  0.312   1.00 0.00 ? 44  ASP A H    2  
ATOM 2369  H HA   . ASP A 1 44  ? 3.776   16.031  1.084   1.00 0.00 ? 44  ASP A HA   2  
ATOM 2370  H HB2  . ASP A 1 44  ? 4.724   15.710  -1.769  1.00 0.00 ? 44  ASP A HB2  2  
ATOM 2371  H HB3  . ASP A 1 44  ? 3.862   17.076  -1.061  1.00 0.00 ? 44  ASP A HB3  2  
ATOM 2372  N N    . LYS A 1 45  ? 1.893   15.083  -0.590  1.00 0.00 ? 45  LYS A N    2  
ATOM 2373  C CA   . LYS A 1 45  ? 0.757   14.259  -1.085  1.00 0.00 ? 45  LYS A CA   2  
ATOM 2374  C C    . LYS A 1 45  ? 0.872   14.095  -2.603  1.00 0.00 ? 45  LYS A C    2  
ATOM 2375  O O    . LYS A 1 45  ? -0.115  13.981  -3.302  1.00 0.00 ? 45  LYS A O    2  
ATOM 2376  C CB   . LYS A 1 45  ? -0.564  14.953  -0.747  1.00 0.00 ? 45  LYS A CB   2  
ATOM 2377  C CG   . LYS A 1 45  ? -0.578  15.327  0.737   1.00 0.00 ? 45  LYS A CG   2  
ATOM 2378  C CD   . LYS A 1 45  ? -2.021  15.518  1.205   1.00 0.00 ? 45  LYS A CD   2  
ATOM 2379  C CE   . LYS A 1 45  ? -2.169  16.890  1.863   1.00 0.00 ? 45  LYS A CE   2  
ATOM 2380  N NZ   . LYS A 1 45  ? -2.728  16.726  3.235   1.00 0.00 ? 45  LYS A NZ   2  
ATOM 2381  H H    . LYS A 1 45  ? 1.807   16.059  -0.545  1.00 0.00 ? 45  LYS A H    2  
ATOM 2382  H HA   . LYS A 1 45  ? 0.785   13.287  -0.613  1.00 0.00 ? 45  LYS A HA   2  
ATOM 2383  H HB2  . LYS A 1 45  ? -0.665  15.847  -1.346  1.00 0.00 ? 45  LYS A HB2  2  
ATOM 2384  H HB3  . LYS A 1 45  ? -1.385  14.284  -0.954  1.00 0.00 ? 45  LYS A HB3  2  
ATOM 2385  H HG2  . LYS A 1 45  ? -0.114  14.536  1.310   1.00 0.00 ? 45  LYS A HG2  2  
ATOM 2386  H HG3  . LYS A 1 45  ? -0.030  16.245  0.881   1.00 0.00 ? 45  LYS A HG3  2  
ATOM 2387  H HD2  . LYS A 1 45  ? -2.686  15.452  0.355   1.00 0.00 ? 45  LYS A HD2  2  
ATOM 2388  H HD3  . LYS A 1 45  ? -2.273  14.748  1.918   1.00 0.00 ? 45  LYS A HD3  2  
ATOM 2389  H HE2  . LYS A 1 45  ? -1.200  17.366  1.925   1.00 0.00 ? 45  LYS A HE2  2  
ATOM 2390  H HE3  . LYS A 1 45  ? -2.834  17.503  1.274   1.00 0.00 ? 45  LYS A HE3  2  
ATOM 2391  H HZ1  . LYS A 1 45  ? -2.652  17.626  3.750   1.00 0.00 ? 45  LYS A HZ1  2  
ATOM 2392  H HZ2  . LYS A 1 45  ? -2.195  15.990  3.741   1.00 0.00 ? 45  LYS A HZ2  2  
ATOM 2393  H HZ3  . LYS A 1 45  ? -3.728  16.450  3.171   1.00 0.00 ? 45  LYS A HZ3  2  
ATOM 2394  N N    . GLY A 1 46  ? 2.073   14.081  -3.117  1.00 0.00 ? 46  GLY A N    2  
ATOM 2395  C CA   . GLY A 1 46  ? 2.252   13.925  -4.588  1.00 0.00 ? 46  GLY A CA   2  
ATOM 2396  C C    . GLY A 1 46  ? 1.641   12.596  -5.038  1.00 0.00 ? 46  GLY A C    2  
ATOM 2397  O O    . GLY A 1 46  ? 0.542   12.550  -5.553  1.00 0.00 ? 46  GLY A O    2  
ATOM 2398  H H    . GLY A 1 46  ? 2.856   14.175  -2.535  1.00 0.00 ? 46  GLY A H    2  
ATOM 2399  H HA2  . GLY A 1 46  ? 1.759   14.740  -5.100  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2400  H HA3  . GLY A 1 46  ? 3.306   13.934  -4.825  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2401  N N    . TRP A 1 47  ? 2.348   11.517  -4.854  1.00 0.00 ? 47  TRP A N    2  
ATOM 2402  C CA   . TRP A 1 47  ? 1.813   10.194  -5.280  1.00 0.00 ? 47  TRP A CA   2  
ATOM 2403  C C    . TRP A 1 47  ? 0.500   9.896   -4.560  1.00 0.00 ? 47  TRP A C    2  
ATOM 2404  O O    . TRP A 1 47  ? -0.228  9.005   -4.938  1.00 0.00 ? 47  TRP A O    2  
ATOM 2405  C CB   . TRP A 1 47  ? 2.826   9.096   -4.957  1.00 0.00 ? 47  TRP A CB   2  
ATOM 2406  C CG   . TRP A 1 47  ? 2.987   8.942   -3.475  1.00 0.00 ? 47  TRP A CG   2  
ATOM 2407  C CD1  . TRP A 1 47  ? 3.454   9.897   -2.634  1.00 0.00 ? 47  TRP A CD1  2  
ATOM 2408  C CD2  . TRP A 1 47  ? 2.713   7.772   -2.649  1.00 0.00 ? 47  TRP A CD2  2  
ATOM 2409  N NE1  . TRP A 1 47  ? 3.495   9.385   -1.353  1.00 0.00 ? 47  TRP A NE1  2  
ATOM 2410  C CE2  . TRP A 1 47  ? 3.049   8.080   -1.308  1.00 0.00 ? 47  TRP A CE2  2  
ATOM 2411  C CE3  . TRP A 1 47  ? 2.213   6.484   -2.927  1.00 0.00 ? 47  TRP A CE3  2  
ATOM 2412  C CZ2  . TRP A 1 47  ? 2.902   7.148   -0.284  1.00 0.00 ? 47  TRP A CZ2  2  
ATOM 2413  C CZ3  . TRP A 1 47  ? 2.064   5.544   -1.894  1.00 0.00 ? 47  TRP A CZ3  2  
ATOM 2414  C CH2  . TRP A 1 47  ? 2.411   5.876   -0.578  1.00 0.00 ? 47  TRP A CH2  2  
ATOM 2415  H H    . TRP A 1 47  ? 3.236   11.578  -4.449  1.00 0.00 ? 47  TRP A H    2  
ATOM 2416  H HA   . TRP A 1 47  ? 1.637   10.210  -6.344  1.00 0.00 ? 47  TRP A HA   2  
ATOM 2417  H HB2  . TRP A 1 47  ? 2.485   8.162   -5.376  1.00 0.00 ? 47  TRP A HB2  2  
ATOM 2418  H HB3  . TRP A 1 47  ? 3.778   9.354   -5.393  1.00 0.00 ? 47  TRP A HB3  2  
ATOM 2419  H HD1  . TRP A 1 47  ? 3.752   10.893  -2.913  1.00 0.00 ? 47  TRP A HD1  2  
ATOM 2420  H HE1  . TRP A 1 47  ? 3.800   9.874   -0.559  1.00 0.00 ? 47  TRP A HE1  2  
ATOM 2421  H HE3  . TRP A 1 47  ? 1.931   6.220   -3.937  1.00 0.00 ? 47  TRP A HE3  2  
ATOM 2422  H HZ2  . TRP A 1 47  ? 3.169   7.406   0.730   1.00 0.00 ? 47  TRP A HZ2  2  
ATOM 2423  H HZ3  . TRP A 1 47  ? 1.683   4.559   -2.118  1.00 0.00 ? 47  TRP A HZ3  2  
ATOM 2424  H HH2  . TRP A 1 47  ? 2.299   5.148   0.208   1.00 0.00 ? 47  TRP A HH2  2  
ATOM 2425  N N    . GLN A 1 48  ? 0.183   10.625  -3.531  1.00 0.00 ? 48  GLN A N    2  
ATOM 2426  C CA   . GLN A 1 48  ? -1.094  10.356  -2.817  1.00 0.00 ? 48  GLN A CA   2  
ATOM 2427  C C    . GLN A 1 48  ? -2.228  10.253  -3.846  1.00 0.00 ? 48  GLN A C    2  
ATOM 2428  O O    . GLN A 1 48  ? -2.973  9.294   -3.871  1.00 0.00 ? 48  GLN A O    2  
ATOM 2429  C CB   . GLN A 1 48  ? -1.381  11.495  -1.837  1.00 0.00 ? 48  GLN A CB   2  
ATOM 2430  C CG   . GLN A 1 48  ? -1.934  10.920  -0.531  1.00 0.00 ? 48  GLN A CG   2  
ATOM 2431  C CD   . GLN A 1 48  ? -0.885  10.013  0.123   1.00 0.00 ? 48  GLN A CD   2  
ATOM 2432  O OE1  . GLN A 1 48  ? -1.183  9.313   1.072   1.00 0.00 ? 48  GLN A OE1  2  
ATOM 2433  N NE2  . GLN A 1 48  ? 0.337   9.990   -0.341  1.00 0.00 ? 48  GLN A NE2  2  
ATOM 2434  H H    . GLN A 1 48  ? 0.776   11.343  -3.231  1.00 0.00 ? 48  GLN A H    2  
ATOM 2435  H HA   . GLN A 1 48  ? -1.013  9.425   -2.276  1.00 0.00 ? 48  GLN A HA   2  
ATOM 2436  H HB2  . GLN A 1 48  ? -0.464  12.029  -1.632  1.00 0.00 ? 48  GLN A HB2  2  
ATOM 2437  H HB3  . GLN A 1 48  ? -2.103  12.170  -2.268  1.00 0.00 ? 48  GLN A HB3  2  
ATOM 2438  H HG2  . GLN A 1 48  ? -2.179  11.730  0.142   1.00 0.00 ? 48  GLN A HG2  2  
ATOM 2439  H HG3  . GLN A 1 48  ? -2.823  10.346  -0.741  1.00 0.00 ? 48  GLN A HG3  2  
ATOM 2440  H HE21 . GLN A 1 48  ? 0.585   10.552  -1.104  1.00 0.00 ? 48  GLN A HE21 2  
ATOM 2441  H HE22 . GLN A 1 48  ? 1.007   9.412   0.077   1.00 0.00 ? 48  GLN A HE22 2  
ATOM 2442  N N    . ASN A 1 49  ? -2.357  11.235  -4.700  1.00 0.00 ? 49  ASN A N    2  
ATOM 2443  C CA   . ASN A 1 49  ? -3.433  11.202  -5.736  1.00 0.00 ? 49  ASN A CA   2  
ATOM 2444  C C    . ASN A 1 49  ? -3.091  10.165  -6.810  1.00 0.00 ? 49  ASN A C    2  
ATOM 2445  O O    . ASN A 1 49  ? -3.954  9.686   -7.519  1.00 0.00 ? 49  ASN A O    2  
ATOM 2446  C CB   . ASN A 1 49  ? -3.551  12.584  -6.384  1.00 0.00 ? 49  ASN A CB   2  
ATOM 2447  C CG   . ASN A 1 49  ? -4.248  13.544  -5.416  1.00 0.00 ? 49  ASN A CG   2  
ATOM 2448  O OD1  . ASN A 1 49  ? -5.458  13.547  -5.314  1.00 0.00 ? 49  ASN A OD1  2  
ATOM 2449  N ND2  . ASN A 1 49  ? -3.530  14.364  -4.700  1.00 0.00 ? 49  ASN A ND2  2  
ATOM 2450  H H    . ASN A 1 49  ? -1.739  11.995  -4.663  1.00 0.00 ? 49  ASN A H    2  
ATOM 2451  H HA   . ASN A 1 49  ? -4.373  10.941  -5.275  1.00 0.00 ? 49  ASN A HA   2  
ATOM 2452  H HB2  . ASN A 1 49  ? -2.564  12.959  -6.616  1.00 0.00 ? 49  ASN A HB2  2  
ATOM 2453  H HB3  . ASN A 1 49  ? -4.129  12.508  -7.292  1.00 0.00 ? 49  ASN A HB3  2  
ATOM 2454  H HD21 . ASN A 1 49  ? -2.554  14.363  -4.783  1.00 0.00 ? 49  ASN A HD21 2  
ATOM 2455  H HD22 . ASN A 1 49  ? -3.967  14.983  -4.077  1.00 0.00 ? 49  ASN A HD22 2  
ATOM 2456  N N    . SER A 1 50  ? -1.841  9.822   -6.942  1.00 0.00 ? 50  SER A N    2  
ATOM 2457  C CA   . SER A 1 50  ? -1.446  8.825   -7.977  1.00 0.00 ? 50  SER A CA   2  
ATOM 2458  C C    . SER A 1 50  ? -2.037  7.454   -7.640  1.00 0.00 ? 50  SER A C    2  
ATOM 2459  O O    . SER A 1 50  ? -2.665  6.827   -8.459  1.00 0.00 ? 50  SER A O    2  
ATOM 2460  C CB   . SER A 1 50  ? 0.078   8.718   -8.025  1.00 0.00 ? 50  SER A CB   2  
ATOM 2461  O OG   . SER A 1 50  ? 0.591   9.664   -8.957  1.00 0.00 ? 50  SER A OG   2  
ATOM 2462  H H    . SER A 1 50  ? -1.159  10.225  -6.366  1.00 0.00 ? 50  SER A H    2  
ATOM 2463  H HA   . SER A 1 50  ? -1.812  9.146   -8.942  1.00 0.00 ? 50  SER A HA   2  
ATOM 2464  H HB2  . SER A 1 50  ? 0.486   8.926   -7.049  1.00 0.00 ? 50  SER A HB2  2  
ATOM 2465  H HB3  . SER A 1 50  ? 0.358   7.716   -8.323  1.00 0.00 ? 50  SER A HB3  2  
ATOM 2466  H HG   . SER A 1 50  ? -0.076  10.341  -9.095  1.00 0.00 ? 50  SER A HG   2  
ATOM 2467  N N    . ILE A 1 51  ? -1.828  6.982   -6.446  1.00 0.00 ? 51  ILE A N    2  
ATOM 2468  C CA   . ILE A 1 51  ? -2.362  5.645   -6.056  1.00 0.00 ? 51  ILE A CA   2  
ATOM 2469  C C    . ILE A 1 51  ? -3.882  5.608   -6.250  1.00 0.00 ? 51  ILE A C    2  
ATOM 2470  O O    . ILE A 1 51  ? -4.449  4.596   -6.608  1.00 0.00 ? 51  ILE A O    2  
ATOM 2471  C CB   . ILE A 1 51  ? -1.975  5.387   -4.585  1.00 0.00 ? 51  ILE A CB   2  
ATOM 2472  C CG1  . ILE A 1 51  ? -0.724  4.517   -4.565  1.00 0.00 ? 51  ILE A CG1  2  
ATOM 2473  C CG2  . ILE A 1 51  ? -3.093  4.662   -3.813  1.00 0.00 ? 51  ILE A CG2  2  
ATOM 2474  C CD1  . ILE A 1 51  ? 0.340   5.113   -5.491  1.00 0.00 ? 51  ILE A CD1  2  
ATOM 2475  H H    . ILE A 1 51  ? -1.309  7.501   -5.803  1.00 0.00 ? 51  ILE A H    2  
ATOM 2476  H HA   . ILE A 1 51  ? -1.908  4.888   -6.678  1.00 0.00 ? 51  ILE A HA   2  
ATOM 2477  H HB   . ILE A 1 51  ? -1.761  6.328   -4.100  1.00 0.00 ? 51  ILE A HB   2  
ATOM 2478  H HG12 . ILE A 1 51  ? -0.337  4.459   -3.560  1.00 0.00 ? 51  ILE A HG12 2  
ATOM 2479  H HG13 . ILE A 1 51  ? -0.983  3.532   -4.911  1.00 0.00 ? 51  ILE A HG13 2  
ATOM 2480  H HG21 . ILE A 1 51  ? -2.891  4.720   -2.753  1.00 0.00 ? 51  ILE A HG21 2  
ATOM 2481  H HG22 . ILE A 1 51  ? -3.125  3.625   -4.114  1.00 0.00 ? 51  ILE A HG22 2  
ATOM 2482  H HG23 . ILE A 1 51  ? -4.042  5.127   -4.020  1.00 0.00 ? 51  ILE A HG23 2  
ATOM 2483  H HD11 . ILE A 1 51  ? 0.230   6.186   -5.525  1.00 0.00 ? 51  ILE A HD11 2  
ATOM 2484  H HD12 . ILE A 1 51  ? 0.219   4.707   -6.486  1.00 0.00 ? 51  ILE A HD12 2  
ATOM 2485  H HD13 . ILE A 1 51  ? 1.323   4.862   -5.119  1.00 0.00 ? 51  ILE A HD13 2  
ATOM 2486  N N    . ARG A 1 52  ? -4.543  6.697   -5.999  1.00 0.00 ? 52  ARG A N    2  
ATOM 2487  C CA   . ARG A 1 52  ? -6.027  6.726   -6.148  1.00 0.00 ? 52  ARG A CA   2  
ATOM 2488  C C    . ARG A 1 52  ? -6.432  6.529   -7.613  1.00 0.00 ? 52  ARG A C    2  
ATOM 2489  O O    . ARG A 1 52  ? -7.175  5.628   -7.949  1.00 0.00 ? 52  ARG A O    2  
ATOM 2490  C CB   . ARG A 1 52  ? -6.554  8.079   -5.669  1.00 0.00 ? 52  ARG A CB   2  
ATOM 2491  C CG   . ARG A 1 52  ? -7.689  7.861   -4.668  1.00 0.00 ? 52  ARG A CG   2  
ATOM 2492  C CD   . ARG A 1 52  ? -8.130  9.208   -4.092  1.00 0.00 ? 52  ARG A CD   2  
ATOM 2493  N NE   . ARG A 1 52  ? -9.421  9.613   -4.714  1.00 0.00 ? 52  ARG A NE   2  
ATOM 2494  C CZ   . ARG A 1 52  ? -10.467 9.835   -3.965  1.00 0.00 ? 52  ARG A CZ   2  
ATOM 2495  N NH1  . ARG A 1 52  ? -11.036 8.847   -3.330  1.00 0.00 ? 52  ARG A NH1  2  
ATOM 2496  N NH2  . ARG A 1 52  ? -10.943 11.045  -3.852  1.00 0.00 ? 52  ARG A NH2  2  
ATOM 2497  H H    . ARG A 1 52  ? -4.064  7.496   -5.697  1.00 0.00 ? 52  ARG A H    2  
ATOM 2498  H HA   . ARG A 1 52  ? -6.462  5.943   -5.548  1.00 0.00 ? 52  ARG A HA   2  
ATOM 2499  H HB2  . ARG A 1 52  ? -5.755  8.629   -5.194  1.00 0.00 ? 52  ARG A HB2  2  
ATOM 2500  H HB3  . ARG A 1 52  ? -6.926  8.640   -6.513  1.00 0.00 ? 52  ARG A HB3  2  
ATOM 2501  H HG2  . ARG A 1 52  ? -8.524  7.393   -5.169  1.00 0.00 ? 52  ARG A HG2  2  
ATOM 2502  H HG3  . ARG A 1 52  ? -7.344  7.225   -3.868  1.00 0.00 ? 52  ARG A HG3  2  
ATOM 2503  H HD2  . ARG A 1 52  ? -8.257  9.120   -3.024  1.00 0.00 ? 52  ARG A HD2  2  
ATOM 2504  H HD3  . ARG A 1 52  ? -7.378  9.954   -4.305  1.00 0.00 ? 52  ARG A HD3  2  
ATOM 2505  H HE   . ARG A 1 52  ? -9.486  9.714   -5.686  1.00 0.00 ? 52  ARG A HE   2  
ATOM 2506  H HH11 . ARG A 1 52  ? -10.670 7.919   -3.417  1.00 0.00 ? 52  ARG A HH11 2  
ATOM 2507  H HH12 . ARG A 1 52  ? -11.837 9.016   -2.755  1.00 0.00 ? 52  ARG A HH12 2  
ATOM 2508  H HH21 . ARG A 1 52  ? -10.507 11.801  -4.340  1.00 0.00 ? 52  ARG A HH21 2  
ATOM 2509  H HH22 . ARG A 1 52  ? -11.744 11.216  -3.278  1.00 0.00 ? 52  ARG A HH22 2  
ATOM 2510  N N    . HIS A 1 53  ? -5.974  7.387   -8.478  1.00 0.00 ? 53  HIS A N    2  
ATOM 2511  C CA   . HIS A 1 53  ? -6.352  7.293   -9.920  1.00 0.00 ? 53  HIS A CA   2  
ATOM 2512  C C    . HIS A 1 53  ? -5.624  6.136   -10.620 1.00 0.00 ? 53  HIS A C    2  
ATOM 2513  O O    . HIS A 1 53  ? -5.997  5.726   -11.700 1.00 0.00 ? 53  HIS A O    2  
ATOM 2514  C CB   . HIS A 1 53  ? -5.968  8.610   -10.596 1.00 0.00 ? 53  HIS A CB   2  
ATOM 2515  C CG   . HIS A 1 53  ? -6.715  8.755   -11.895 1.00 0.00 ? 53  HIS A CG   2  
ATOM 2516  N ND1  . HIS A 1 53  ? -7.636  9.769   -12.107 1.00 0.00 ? 53  HIS A ND1  2  
ATOM 2517  C CD2  . HIS A 1 53  ? -6.683  8.029   -13.059 1.00 0.00 ? 53  HIS A CD2  2  
ATOM 2518  C CE1  . HIS A 1 53  ? -8.115  9.627   -13.357 1.00 0.00 ? 53  HIS A CE1  2  
ATOM 2519  N NE2  . HIS A 1 53  ? -7.568  8.580   -13.981 1.00 0.00 ? 53  HIS A NE2  2  
ATOM 2520  H H    . HIS A 1 53  ? -5.397  8.119   -8.175  1.00 0.00 ? 53  HIS A H    2  
ATOM 2521  H HA   . HIS A 1 53  ? -7.418  7.150   -10.003 1.00 0.00 ? 53  HIS A HA   2  
ATOM 2522  H HB2  . HIS A 1 53  ? -6.215  9.434   -9.943  1.00 0.00 ? 53  HIS A HB2  2  
ATOM 2523  H HB3  . HIS A 1 53  ? -4.904  8.615   -10.791 1.00 0.00 ? 53  HIS A HB3  2  
ATOM 2524  H HD1  . HIS A 1 53  ? -7.891  10.464  -11.464 1.00 0.00 ? 53  HIS A HD1  2  
ATOM 2525  H HD2  . HIS A 1 53  ? -6.063  7.162   -13.234 1.00 0.00 ? 53  HIS A HD2  2  
ATOM 2526  H HE1  . HIS A 1 53  ? -8.852  10.279  -13.801 1.00 0.00 ? 53  HIS A HE1  2  
ATOM 2527  N N    . ASN A 1 54  ? -4.581  5.624   -10.033 1.00 0.00 ? 54  ASN A N    2  
ATOM 2528  C CA   . ASN A 1 54  ? -3.823  4.516   -10.684 1.00 0.00 ? 54  ASN A CA   2  
ATOM 2529  C C    . ASN A 1 54  ? -4.608  3.203   -10.627 1.00 0.00 ? 54  ASN A C    2  
ATOM 2530  O O    . ASN A 1 54  ? -4.580  2.418   -11.554 1.00 0.00 ? 54  ASN A O    2  
ATOM 2531  C CB   . ASN A 1 54  ? -2.477  4.341   -9.980  1.00 0.00 ? 54  ASN A CB   2  
ATOM 2532  C CG   . ASN A 1 54  ? -1.394  5.069   -10.781 1.00 0.00 ? 54  ASN A CG   2  
ATOM 2533  O OD1  . ASN A 1 54  ? -1.178  4.770   -11.939 1.00 0.00 ? 54  ASN A OD1  2  
ATOM 2534  N ND2  . ASN A 1 54  ? -0.703  6.018   -10.214 1.00 0.00 ? 54  ASN A ND2  2  
ATOM 2535  H H    . ASN A 1 54  ? -4.290  5.972   -9.171  1.00 0.00 ? 54  ASN A H    2  
ATOM 2536  H HA   . ASN A 1 54  ? -3.645  4.773   -11.717 1.00 0.00 ? 54  ASN A HA   2  
ATOM 2537  H HB2  . ASN A 1 54  ? -2.533  4.758   -8.986  1.00 0.00 ? 54  ASN A HB2  2  
ATOM 2538  H HB3  . ASN A 1 54  ? -2.234  3.290   -9.918  1.00 0.00 ? 54  ASN A HB3  2  
ATOM 2539  H HD21 . ASN A 1 54  ? -0.874  6.260   -9.281  1.00 0.00 ? 54  ASN A HD21 2  
ATOM 2540  H HD22 . ASN A 1 54  ? -0.010  6.489   -10.723 1.00 0.00 ? 54  ASN A HD22 2  
ATOM 2541  N N    . LEU A 1 55  ? -5.288  2.942   -9.547  1.00 0.00 ? 55  LEU A N    2  
ATOM 2542  C CA   . LEU A 1 55  ? -6.045  1.662   -9.443  1.00 0.00 ? 55  LEU A CA   2  
ATOM 2543  C C    . LEU A 1 55  ? -7.238  1.667   -10.399 1.00 0.00 ? 55  LEU A C    2  
ATOM 2544  O O    . LEU A 1 55  ? -7.887  0.659   -10.595 1.00 0.00 ? 55  LEU A O    2  
ATOM 2545  C CB   . LEU A 1 55  ? -6.548  1.485   -8.015  1.00 0.00 ? 55  LEU A CB   2  
ATOM 2546  C CG   . LEU A 1 55  ? -5.392  1.677   -7.041  1.00 0.00 ? 55  LEU A CG   2  
ATOM 2547  C CD1  . LEU A 1 55  ? -5.929  1.628   -5.611  1.00 0.00 ? 55  LEU A CD1  2  
ATOM 2548  C CD2  . LEU A 1 55  ? -4.373  0.555   -7.247  1.00 0.00 ? 55  LEU A CD2  2  
ATOM 2549  H H    . LEU A 1 55  ? -5.290  3.577   -8.800  1.00 0.00 ? 55  LEU A H    2  
ATOM 2550  H HA   . LEU A 1 55  ? -5.393  0.841   -9.695  1.00 0.00 ? 55  LEU A HA   2  
ATOM 2551  H HB2  . LEU A 1 55  ? -7.321  2.209   -7.808  1.00 0.00 ? 55  LEU A HB2  2  
ATOM 2552  H HB3  . LEU A 1 55  ? -6.943  0.490   -7.899  1.00 0.00 ? 55  LEU A HB3  2  
ATOM 2553  H HG   . LEU A 1 55  ? -4.923  2.633   -7.221  1.00 0.00 ? 55  LEU A HG   2  
ATOM 2554  H HD11 . LEU A 1 55  ? -6.029  0.597   -5.300  1.00 0.00 ? 55  LEU A HD11 2  
ATOM 2555  H HD12 . LEU A 1 55  ? -6.895  2.111   -5.573  1.00 0.00 ? 55  LEU A HD12 2  
ATOM 2556  H HD13 . LEU A 1 55  ? -5.243  2.138   -4.952  1.00 0.00 ? 55  LEU A HD13 2  
ATOM 2557  H HD21 . LEU A 1 55  ? -4.507  0.123   -8.228  1.00 0.00 ? 55  LEU A HD21 2  
ATOM 2558  H HD22 . LEU A 1 55  ? -4.520  -0.207  -6.497  1.00 0.00 ? 55  LEU A HD22 2  
ATOM 2559  H HD23 . LEU A 1 55  ? -3.374  0.956   -7.164  1.00 0.00 ? 55  LEU A HD23 2  
ATOM 2560  N N    . SER A 1 56  ? -7.538  2.782   -10.998 1.00 0.00 ? 56  SER A N    2  
ATOM 2561  C CA   . SER A 1 56  ? -8.691  2.823   -11.937 1.00 0.00 ? 56  SER A CA   2  
ATOM 2562  C C    . SER A 1 56  ? -8.212  2.445   -13.337 1.00 0.00 ? 56  SER A C    2  
ATOM 2563  O O    . SER A 1 56  ? -8.807  1.628   -14.009 1.00 0.00 ? 56  SER A O    2  
ATOM 2564  C CB   . SER A 1 56  ? -9.281  4.233   -11.962 1.00 0.00 ? 56  SER A CB   2  
ATOM 2565  O OG   . SER A 1 56  ? -9.361  4.732   -10.632 1.00 0.00 ? 56  SER A OG   2  
ATOM 2566  H H    . SER A 1 56  ? -7.005  3.590   -10.835 1.00 0.00 ? 56  SER A H    2  
ATOM 2567  H HA   . SER A 1 56  ? -9.445  2.122   -11.612 1.00 0.00 ? 56  SER A HA   2  
ATOM 2568  H HB2  . SER A 1 56  ? -8.649  4.881   -12.546 1.00 0.00 ? 56  SER A HB2  2  
ATOM 2569  H HB3  . SER A 1 56  ? -10.267 4.202   -12.406 1.00 0.00 ? 56  SER A HB3  2  
ATOM 2570  H HG   . SER A 1 56  ? -8.542  5.193   -10.439 1.00 0.00 ? 56  SER A HG   2  
ATOM 2571  N N    . LEU A 1 57  ? -7.143  3.040   -13.782 1.00 0.00 ? 57  LEU A N    2  
ATOM 2572  C CA   . LEU A 1 57  ? -6.622  2.728   -15.138 1.00 0.00 ? 57  LEU A CA   2  
ATOM 2573  C C    . LEU A 1 57  ? -5.604  1.582   -15.070 1.00 0.00 ? 57  LEU A C    2  
ATOM 2574  O O    . LEU A 1 57  ? -5.113  1.124   -16.082 1.00 0.00 ? 57  LEU A O    2  
ATOM 2575  C CB   . LEU A 1 57  ? -5.947  3.974   -15.708 1.00 0.00 ? 57  LEU A CB   2  
ATOM 2576  C CG   . LEU A 1 57  ? -4.774  4.373   -14.810 1.00 0.00 ? 57  LEU A CG   2  
ATOM 2577  C CD1  . LEU A 1 57  ? -3.476  3.806   -15.386 1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2578  C CD2  . LEU A 1 57  ? -4.679  5.899   -14.745 1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2579  H H    . LEU A 1 57  ? -6.682  3.700   -13.225 1.00 0.00 ? 57  LEU A H    2  
ATOM 2580  H HA   . LEU A 1 57  ? -7.441  2.441   -15.780 1.00 0.00 ? 57  LEU A HA   2  
ATOM 2581  H HB2  . LEU A 1 57  ? -5.585  3.762   -16.699 1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2582  H HB3  . LEU A 1 57  ? -6.659  4.784   -15.747 1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2583  H HG   . LEU A 1 57  ? -4.930  3.976   -13.818 1.00 0.00 ? 57  LEU A HG   2  
ATOM 2584  H HD11 . LEU A 1 57  ? -2.702  3.844   -14.634 1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2585  H HD12 . LEU A 1 57  ? -3.176  4.391   -16.243 1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2586  H HD13 . LEU A 1 57  ? -3.633  2.780   -15.688 1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2587  H HD21 . LEU A 1 57  ? -5.638  6.331   -14.988 1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2588  H HD22 . LEU A 1 57  ? -3.939  6.244   -15.453 1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2589  H HD23 . LEU A 1 57  ? -4.392  6.199   -13.748 1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2590  N N    . ASN A 1 58  ? -5.269  1.115   -13.893 1.00 0.00 ? 58  ASN A N    2  
ATOM 2591  C CA   . ASN A 1 58  ? -4.271  0.002   -13.808 1.00 0.00 ? 58  ASN A CA   2  
ATOM 2592  C C    . ASN A 1 58  ? -4.832  -1.242  -14.497 1.00 0.00 ? 58  ASN A C    2  
ATOM 2593  O O    . ASN A 1 58  ? -6.021  -1.359  -14.720 1.00 0.00 ? 58  ASN A O    2  
ATOM 2594  C CB   . ASN A 1 58  ? -3.926  -0.331  -12.348 1.00 0.00 ? 58  ASN A CB   2  
ATOM 2595  C CG   . ASN A 1 58  ? -2.495  0.126   -12.057 1.00 0.00 ? 58  ASN A CG   2  
ATOM 2596  O OD1  . ASN A 1 58  ? -1.688  -0.640  -11.571 1.00 0.00 ? 58  ASN A OD1  2  
ATOM 2597  N ND2  . ASN A 1 58  ? -2.144  1.352   -12.337 1.00 0.00 ? 58  ASN A ND2  2  
ATOM 2598  H H    . ASN A 1 58  ? -5.667  1.494   -13.083 1.00 0.00 ? 58  ASN A H    2  
ATOM 2599  H HA   . ASN A 1 58  ? -3.370  0.306   -14.321 1.00 0.00 ? 58  ASN A HA   2  
ATOM 2600  H HB2  . ASN A 1 58  ? -4.608  0.166   -11.677 1.00 0.00 ? 58  ASN A HB2  2  
ATOM 2601  H HB3  . ASN A 1 58  ? -3.993  -1.398  -12.201 1.00 0.00 ? 58  ASN A HB3  2  
ATOM 2602  H HD21 . ASN A 1 58  ? -2.794  1.971   -12.729 1.00 0.00 ? 58  ASN A HD21 2  
ATOM 2603  H HD22 . ASN A 1 58  ? -1.230  1.654   -12.152 1.00 0.00 ? 58  ASN A HD22 2  
ATOM 2604  N N    . ARG A 1 59  ? -3.979  -2.161  -14.856 1.00 0.00 ? 59  ARG A N    2  
ATOM 2605  C CA   . ARG A 1 59  ? -4.451  -3.389  -15.556 1.00 0.00 ? 59  ARG A CA   2  
ATOM 2606  C C    . ARG A 1 59  ? -4.773  -4.509  -14.558 1.00 0.00 ? 59  ARG A C    2  
ATOM 2607  O O    . ARG A 1 59  ? -5.546  -5.397  -14.855 1.00 0.00 ? 59  ARG A O    2  
ATOM 2608  C CB   . ARG A 1 59  ? -3.359  -3.868  -16.515 1.00 0.00 ? 59  ARG A CB   2  
ATOM 2609  C CG   . ARG A 1 59  ? -3.719  -5.252  -17.054 1.00 0.00 ? 59  ARG A CG   2  
ATOM 2610  C CD   . ARG A 1 59  ? -3.571  -5.260  -18.576 1.00 0.00 ? 59  ARG A CD   2  
ATOM 2611  N NE   . ARG A 1 59  ? -4.655  -6.087  -19.175 1.00 0.00 ? 59  ARG A NE   2  
ATOM 2612  C CZ   . ARG A 1 59  ? -4.385  -7.271  -19.648 1.00 0.00 ? 59  ARG A CZ   2  
ATOM 2613  N NH1  . ARG A 1 59  ? -4.094  -8.250  -18.835 1.00 0.00 ? 59  ARG A NH1  2  
ATOM 2614  N NH2  . ARG A 1 59  ? -4.404  -7.477  -20.935 1.00 0.00 ? 59  ARG A NH2  2  
ATOM 2615  H H    . ARG A 1 59  ? -3.023  -2.036  -14.681 1.00 0.00 ? 59  ARG A H    2  
ATOM 2616  H HA   . ARG A 1 59  ? -5.339  -3.154  -16.124 1.00 0.00 ? 59  ARG A HA   2  
ATOM 2617  H HB2  . ARG A 1 59  ? -3.272  -3.171  -17.338 1.00 0.00 ? 59  ARG A HB2  2  
ATOM 2618  H HB3  . ARG A 1 59  ? -2.417  -3.922  -15.990 1.00 0.00 ? 59  ARG A HB3  2  
ATOM 2619  H HG2  . ARG A 1 59  ? -3.058  -5.989  -16.623 1.00 0.00 ? 59  ARG A HG2  2  
ATOM 2620  H HG3  . ARG A 1 59  ? -4.740  -5.486  -16.794 1.00 0.00 ? 59  ARG A HG3  2  
ATOM 2621  H HD2  . ARG A 1 59  ? -3.641  -4.250  -18.951 1.00 0.00 ? 59  ARG A HD2  2  
ATOM 2622  H HD3  . ARG A 1 59  ? -2.611  -5.678  -18.843 1.00 0.00 ? 59  ARG A HD3  2  
ATOM 2623  H HE   . ARG A 1 59  ? -5.571  -5.742  -19.214 1.00 0.00 ? 59  ARG A HE   2  
ATOM 2624  H HH11 . ARG A 1 59  ? -4.079  -8.091  -17.847 1.00 0.00 ? 59  ARG A HH11 2  
ATOM 2625  H HH12 . ARG A 1 59  ? -3.886  -9.157  -19.198 1.00 0.00 ? 59  ARG A HH12 2  
ATOM 2626  H HH21 . ARG A 1 59  ? -4.625  -6.727  -21.558 1.00 0.00 ? 59  ARG A HH21 2  
ATOM 2627  H HH22 . ARG A 1 59  ? -4.196  -8.385  -21.301 1.00 0.00 ? 59  ARG A HH22 2  
ATOM 2628  N N    . TYR A 1 60  ? -4.182  -4.504  -13.391 1.00 0.00 ? 60  TYR A N    2  
ATOM 2629  C CA   . TYR A 1 60  ? -4.472  -5.610  -12.430 1.00 0.00 ? 60  TYR A CA   2  
ATOM 2630  C C    . TYR A 1 60  ? -5.016  -5.079  -11.101 1.00 0.00 ? 60  TYR A C    2  
ATOM 2631  O O    . TYR A 1 60  ? -4.913  -5.735  -10.087 1.00 0.00 ? 60  TYR A O    2  
ATOM 2632  C CB   . TYR A 1 60  ? -3.199  -6.414  -12.154 1.00 0.00 ? 60  TYR A CB   2  
ATOM 2633  C CG   . TYR A 1 60  ? -1.985  -5.517  -12.206 1.00 0.00 ? 60  TYR A CG   2  
ATOM 2634  C CD1  . TYR A 1 60  ? -1.971  -4.294  -11.518 1.00 0.00 ? 60  TYR A CD1  2  
ATOM 2635  C CD2  . TYR A 1 60  ? -0.865  -5.917  -12.940 1.00 0.00 ? 60  TYR A CD2  2  
ATOM 2636  C CE1  . TYR A 1 60  ? -0.834  -3.478  -11.575 1.00 0.00 ? 60  TYR A CE1  2  
ATOM 2637  C CE2  . TYR A 1 60  ? 0.268   -5.104  -12.995 1.00 0.00 ? 60  TYR A CE2  2  
ATOM 2638  C CZ   . TYR A 1 60  ? 0.286   -3.883  -12.312 1.00 0.00 ? 60  TYR A CZ   2  
ATOM 2639  O OH   . TYR A 1 60  ? 1.406   -3.079  -12.366 1.00 0.00 ? 60  TYR A OH   2  
ATOM 2640  H H    . TYR A 1 60  ? -3.545  -3.796  -13.160 1.00 0.00 ? 60  TYR A H    2  
ATOM 2641  H HA   . TYR A 1 60  ? -5.209  -6.267  -12.868 1.00 0.00 ? 60  TYR A HA   2  
ATOM 2642  H HB2  . TYR A 1 60  ? -3.268  -6.865  -11.174 1.00 0.00 ? 60  TYR A HB2  2  
ATOM 2643  H HB3  . TYR A 1 60  ? -3.101  -7.191  -12.897 1.00 0.00 ? 60  TYR A HB3  2  
ATOM 2644  H HD1  . TYR A 1 60  ? -2.834  -3.980  -10.944 1.00 0.00 ? 60  TYR A HD1  2  
ATOM 2645  H HD2  . TYR A 1 60  ? -0.877  -6.858  -13.464 1.00 0.00 ? 60  TYR A HD2  2  
ATOM 2646  H HE1  . TYR A 1 60  ? -0.819  -2.538  -11.051 1.00 0.00 ? 60  TYR A HE1  2  
ATOM 2647  H HE2  . TYR A 1 60  ? 1.130   -5.419  -13.564 1.00 0.00 ? 60  TYR A HE2  2  
ATOM 2648  H HH   . TYR A 1 60  ? 1.134   -2.179  -12.172 1.00 0.00 ? 60  TYR A HH   2  
ATOM 2649  N N    . PHE A 1 61  ? -5.607  -3.924  -11.074 1.00 0.00 ? 61  PHE A N    2  
ATOM 2650  C CA   . PHE A 1 61  ? -6.146  -3.436  -9.775  1.00 0.00 ? 61  PHE A CA   2  
ATOM 2651  C C    . PHE A 1 61  ? -7.655  -3.273  -9.883  1.00 0.00 ? 61  PHE A C    2  
ATOM 2652  O O    . PHE A 1 61  ? -8.163  -2.326  -10.450 1.00 0.00 ? 61  PHE A O    2  
ATOM 2653  C CB   . PHE A 1 61  ? -5.481  -2.120  -9.392  1.00 0.00 ? 61  PHE A CB   2  
ATOM 2654  C CG   . PHE A 1 61  ? -4.079  -2.419  -8.923  1.00 0.00 ? 61  PHE A CG   2  
ATOM 2655  C CD1  . PHE A 1 61  ? -3.843  -3.466  -8.019  1.00 0.00 ? 61  PHE A CD1  2  
ATOM 2656  C CD2  . PHE A 1 61  ? -3.012  -1.664  -9.406  1.00 0.00 ? 61  PHE A CD2  2  
ATOM 2657  C CE1  . PHE A 1 61  ? -2.538  -3.743  -7.605  1.00 0.00 ? 61  PHE A CE1  2  
ATOM 2658  C CE2  . PHE A 1 61  ? -1.712  -1.947  -8.995  1.00 0.00 ? 61  PHE A CE2  2  
ATOM 2659  C CZ   . PHE A 1 61  ? -1.474  -2.986  -8.094  1.00 0.00 ? 61  PHE A CZ   2  
ATOM 2660  H H    . PHE A 1 61  ? -5.708  -3.393  -11.890 1.00 0.00 ? 61  PHE A H    2  
ATOM 2661  H HA   . PHE A 1 61  ? -5.931  -4.172  -9.014  1.00 0.00 ? 61  PHE A HA   2  
ATOM 2662  H HB2  . PHE A 1 61  ? -5.448  -1.464  -10.252 1.00 0.00 ? 61  PHE A HB2  2  
ATOM 2663  H HB3  . PHE A 1 61  ? -6.037  -1.649  -8.595  1.00 0.00 ? 61  PHE A HB3  2  
ATOM 2664  H HD1  . PHE A 1 61  ? -4.663  -4.058  -7.637  1.00 0.00 ? 61  PHE A HD1  2  
ATOM 2665  H HD2  . PHE A 1 61  ? -3.192  -0.864  -10.096 1.00 0.00 ? 61  PHE A HD2  2  
ATOM 2666  H HE1  . PHE A 1 61  ? -2.350  -4.543  -6.909  1.00 0.00 ? 61  PHE A HE1  2  
ATOM 2667  H HE2  . PHE A 1 61  ? -0.891  -1.360  -9.372  1.00 0.00 ? 61  PHE A HE2  2  
ATOM 2668  H HZ   . PHE A 1 61  ? -0.469  -3.205  -7.778  1.00 0.00 ? 61  PHE A HZ   2  
ATOM 2669  N N    . ILE A 1 62  ? -8.368  -4.215  -9.340  1.00 0.00 ? 62  ILE A N    2  
ATOM 2670  C CA   . ILE A 1 62  ? -9.857  -4.169  -9.393  1.00 0.00 ? 62  ILE A CA   2  
ATOM 2671  C C    . ILE A 1 62  ? -10.398 -3.490  -8.132  1.00 0.00 ? 62  ILE A C    2  
ATOM 2672  O O    . ILE A 1 62  ? -9.706  -3.355  -7.143  1.00 0.00 ? 62  ILE A O    2  
ATOM 2673  C CB   . ILE A 1 62  ? -10.411 -5.603  -9.500  1.00 0.00 ? 62  ILE A CB   2  
ATOM 2674  C CG1  . ILE A 1 62  ? -10.451 -6.272  -8.117  1.00 0.00 ? 62  ILE A CG1  2  
ATOM 2675  C CG2  . ILE A 1 62  ? -9.511  -6.430  -10.422 1.00 0.00 ? 62  ILE A CG2  2  
ATOM 2676  C CD1  . ILE A 1 62  ? -11.318 -7.531  -8.185  1.00 0.00 ? 62  ILE A CD1  2  
ATOM 2677  H H    . ILE A 1 62  ? -7.915  -4.961  -8.901  1.00 0.00 ? 62  ILE A H    2  
ATOM 2678  H HA   . ILE A 1 62  ? -10.165 -3.604  -10.262 1.00 0.00 ? 62  ILE A HA   2  
ATOM 2679  H HB   . ILE A 1 62  ? -11.410 -5.570  -9.913  1.00 0.00 ? 62  ILE A HB   2  
ATOM 2680  H HG12 . ILE A 1 62  ? -9.449  -6.542  -7.819  1.00 0.00 ? 62  ILE A HG12 2  
ATOM 2681  H HG13 . ILE A 1 62  ? -10.871 -5.593  -7.392  1.00 0.00 ? 62  ILE A HG13 2  
ATOM 2682  H HG21 . ILE A 1 62  ? -10.109 -7.158  -10.951 1.00 0.00 ? 62  ILE A HG21 2  
ATOM 2683  H HG22 . ILE A 1 62  ? -8.764  -6.941  -9.832  1.00 0.00 ? 62  ILE A HG22 2  
ATOM 2684  H HG23 . ILE A 1 62  ? -9.025  -5.779  -11.132 1.00 0.00 ? 62  ILE A HG23 2  
ATOM 2685  H HD11 . ILE A 1 62  ? -10.689 -8.406  -8.104  1.00 0.00 ? 62  ILE A HD11 2  
ATOM 2686  H HD12 . ILE A 1 62  ? -11.848 -7.554  -9.126  1.00 0.00 ? 62  ILE A HD12 2  
ATOM 2687  H HD13 . ILE A 1 62  ? -12.029 -7.523  -7.372  1.00 0.00 ? 62  ILE A HD13 2  
ATOM 2688  N N    . LYS A 1 63  ? -11.633 -3.072  -8.156  1.00 0.00 ? 63  LYS A N    2  
ATOM 2689  C CA   . LYS A 1 63  ? -12.219 -2.411  -6.956  1.00 0.00 ? 63  LYS A CA   2  
ATOM 2690  C C    . LYS A 1 63  ? -13.026 -3.433  -6.154  1.00 0.00 ? 63  LYS A C    2  
ATOM 2691  O O    . LYS A 1 63  ? -13.382 -4.486  -6.648  1.00 0.00 ? 63  LYS A O    2  
ATOM 2692  C CB   . LYS A 1 63  ? -13.138 -1.268  -7.395  1.00 0.00 ? 63  LYS A CB   2  
ATOM 2693  C CG   . LYS A 1 63  ? -12.697 0.031   -6.719  1.00 0.00 ? 63  LYS A CG   2  
ATOM 2694  C CD   . LYS A 1 63  ? -13.875 0.632   -5.952  1.00 0.00 ? 63  LYS A CD   2  
ATOM 2695  C CE   . LYS A 1 63  ? -13.512 2.041   -5.480  1.00 0.00 ? 63  LYS A CE   2  
ATOM 2696  N NZ   . LYS A 1 63  ? -14.234 2.343   -4.212  1.00 0.00 ? 63  LYS A NZ   2  
ATOM 2697  H H    . LYS A 1 63  ? -12.178 -3.198  -8.961  1.00 0.00 ? 63  LYS A H    2  
ATOM 2698  H HA   . LYS A 1 63  ? -11.425 -2.017  -6.340  1.00 0.00 ? 63  LYS A HA   2  
ATOM 2699  H HB2  . LYS A 1 63  ? -13.085 -1.155  -8.468  1.00 0.00 ? 63  LYS A HB2  2  
ATOM 2700  H HB3  . LYS A 1 63  ? -14.154 -1.494  -7.107  1.00 0.00 ? 63  LYS A HB3  2  
ATOM 2701  H HG2  . LYS A 1 63  ? -11.887 -0.177  -6.036  1.00 0.00 ? 63  LYS A HG2  2  
ATOM 2702  H HG3  . LYS A 1 63  ? -12.362 0.732   -7.470  1.00 0.00 ? 63  LYS A HG3  2  
ATOM 2703  H HD2  . LYS A 1 63  ? -14.739 0.680   -6.599  1.00 0.00 ? 63  LYS A HD2  2  
ATOM 2704  H HD3  . LYS A 1 63  ? -14.101 0.015   -5.096  1.00 0.00 ? 63  LYS A HD3  2  
ATOM 2705  H HE2  . LYS A 1 63  ? -12.447 2.101   -5.310  1.00 0.00 ? 63  LYS A HE2  2  
ATOM 2706  H HE3  . LYS A 1 63  ? -13.796 2.759   -6.236  1.00 0.00 ? 63  LYS A HE3  2  
ATOM 2707  H HZ1  . LYS A 1 63  ? -14.450 3.360   -4.168  1.00 0.00 ? 63  LYS A HZ1  2  
ATOM 2708  H HZ2  . LYS A 1 63  ? -13.637 2.080   -3.402  1.00 0.00 ? 63  LYS A HZ2  2  
ATOM 2709  H HZ3  . LYS A 1 63  ? -15.122 1.802   -4.181  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM 2710  N N    . VAL A 1 64  ? -13.318 -3.130  -4.920  1.00 0.00 ? 64  VAL A N    2  
ATOM 2711  C CA   . VAL A 1 64  ? -14.104 -4.075  -4.078  1.00 0.00 ? 64  VAL A CA   2  
ATOM 2712  C C    . VAL A 1 64  ? -14.687 -3.314  -2.882  1.00 0.00 ? 64  VAL A C    2  
ATOM 2713  O O    . VAL A 1 64  ? -14.083 -3.260  -1.829  1.00 0.00 ? 64  VAL A O    2  
ATOM 2714  C CB   . VAL A 1 64  ? -13.186 -5.196  -3.579  1.00 0.00 ? 64  VAL A CB   2  
ATOM 2715  C CG1  . VAL A 1 64  ? -11.885 -4.590  -3.051  1.00 0.00 ? 64  VAL A CG1  2  
ATOM 2716  C CG2  . VAL A 1 64  ? -13.881 -5.967  -2.455  1.00 0.00 ? 64  VAL A CG2  2  
ATOM 2717  H H    . VAL A 1 64  ? -13.021 -2.274  -4.545  1.00 0.00 ? 64  VAL A H    2  
ATOM 2718  H HA   . VAL A 1 64  ? -14.906 -4.500  -4.663  1.00 0.00 ? 64  VAL A HA   2  
ATOM 2719  H HB   . VAL A 1 64  ? -12.963 -5.867  -4.396  1.00 0.00 ? 64  VAL A HB   2  
ATOM 2720  H HG11 . VAL A 1 64  ? -12.054 -3.561  -2.769  1.00 0.00 ? 64  VAL A HG11 2  
ATOM 2721  H HG12 . VAL A 1 64  ? -11.129 -4.632  -3.822  1.00 0.00 ? 64  VAL A HG12 2  
ATOM 2722  H HG13 . VAL A 1 64  ? -11.550 -5.150  -2.190  1.00 0.00 ? 64  VAL A HG13 2  
ATOM 2723  H HG21 . VAL A 1 64  ? -14.947 -5.803  -2.510  1.00 0.00 ? 64  VAL A HG21 2  
ATOM 2724  H HG22 . VAL A 1 64  ? -13.513 -5.623  -1.499  1.00 0.00 ? 64  VAL A HG22 2  
ATOM 2725  H HG23 . VAL A 1 64  ? -13.674 -7.023  -2.561  1.00 0.00 ? 64  VAL A HG23 2  
ATOM 2726  N N    . PRO A 1 65  ? -15.844 -2.737  -3.090  1.00 0.00 ? 65  PRO A N    2  
ATOM 2727  C CA   . PRO A 1 65  ? -16.541 -1.955  -2.053  1.00 0.00 ? 65  PRO A CA   2  
ATOM 2728  C C    . PRO A 1 65  ? -17.230 -2.881  -1.045  1.00 0.00 ? 65  PRO A C    2  
ATOM 2729  O O    . PRO A 1 65  ? -17.383 -4.064  -1.275  1.00 0.00 ? 65  PRO A O    2  
ATOM 2730  C CB   . PRO A 1 65  ? -17.573 -1.150  -2.845  1.00 0.00 ? 65  PRO A CB   2  
ATOM 2731  C CG   . PRO A 1 65  ? -17.801 -1.915  -4.170  1.00 0.00 ? 65  PRO A CG   2  
ATOM 2732  C CD   . PRO A 1 65  ? -16.566 -2.812  -4.377  1.00 0.00 ? 65  PRO A CD   2  
ATOM 2733  H HA   . PRO A 1 65  ? -15.858 -1.289  -1.554  1.00 0.00 ? 65  PRO A HA   2  
ATOM 2734  H HB2  . PRO A 1 65  ? -18.498 -1.081  -2.286  1.00 0.00 ? 65  PRO A HB2  2  
ATOM 2735  H HB3  . PRO A 1 65  ? -17.193 -0.162  -3.057  1.00 0.00 ? 65  PRO A HB3  2  
ATOM 2736  H HG2  . PRO A 1 65  ? -18.695 -2.521  -4.098  1.00 0.00 ? 65  PRO A HG2  2  
ATOM 2737  H HG3  . PRO A 1 65  ? -17.888 -1.221  -4.990  1.00 0.00 ? 65  PRO A HG3  2  
ATOM 2738  H HD2  . PRO A 1 65  ? -16.869 -3.830  -4.585  1.00 0.00 ? 65  PRO A HD2  2  
ATOM 2739  H HD3  . PRO A 1 65  ? -15.948 -2.429  -5.173  1.00 0.00 ? 65  PRO A HD3  2  
ATOM 2740  N N    . ARG A 1 66  ? -17.646 -2.347  0.071   1.00 0.00 ? 66  ARG A N    2  
ATOM 2741  C CA   . ARG A 1 66  ? -18.326 -3.188  1.094   1.00 0.00 ? 66  ARG A CA   2  
ATOM 2742  C C    . ARG A 1 66  ? -19.290 -2.320  1.904   1.00 0.00 ? 66  ARG A C    2  
ATOM 2743  O O    . ARG A 1 66  ? -19.336 -1.115  1.748   1.00 0.00 ? 66  ARG A O    2  
ATOM 2744  C CB   . ARG A 1 66  ? -17.278 -3.799  2.029   1.00 0.00 ? 66  ARG A CB   2  
ATOM 2745  C CG   . ARG A 1 66  ? -16.726 -2.719  2.961   1.00 0.00 ? 66  ARG A CG   2  
ATOM 2746  C CD   . ARG A 1 66  ? -15.536 -3.276  3.743   1.00 0.00 ? 66  ARG A CD   2  
ATOM 2747  N NE   . ARG A 1 66  ? -15.828 -3.216  5.203   1.00 0.00 ? 66  ARG A NE   2  
ATOM 2748  C CZ   . ARG A 1 66  ? -14.931 -2.750  6.030   1.00 0.00 ? 66  ARG A CZ   2  
ATOM 2749  N NH1  . ARG A 1 66  ? -13.667 -3.007  5.831   1.00 0.00 ? 66  ARG A NH1  2  
ATOM 2750  N NH2  . ARG A 1 66  ? -15.298 -2.028  7.054   1.00 0.00 ? 66  ARG A NH2  2  
ATOM 2751  H H    . ARG A 1 66  ? -17.512 -1.389  0.234   1.00 0.00 ? 66  ARG A H    2  
ATOM 2752  H HA   . ARG A 1 66  ? -18.876 -3.977  0.605   1.00 0.00 ? 66  ARG A HA   2  
ATOM 2753  H HB2  . ARG A 1 66  ? -17.734 -4.583  2.615   1.00 0.00 ? 66  ARG A HB2  2  
ATOM 2754  H HB3  . ARG A 1 66  ? -16.471 -4.213  1.443   1.00 0.00 ? 66  ARG A HB3  2  
ATOM 2755  H HG2  . ARG A 1 66  ? -16.408 -1.868  2.376   1.00 0.00 ? 66  ARG A HG2  2  
ATOM 2756  H HG3  . ARG A 1 66  ? -17.497 -2.411  3.652   1.00 0.00 ? 66  ARG A HG3  2  
ATOM 2757  H HD2  . ARG A 1 66  ? -15.364 -4.301  3.454   1.00 0.00 ? 66  ARG A HD2  2  
ATOM 2758  H HD3  . ARG A 1 66  ? -14.656 -2.688  3.528   1.00 0.00 ? 66  ARG A HD3  2  
ATOM 2759  H HE   . ARG A 1 66  ? -16.694 -3.525  5.543   1.00 0.00 ? 66  ARG A HE   2  
ATOM 2760  H HH11 . ARG A 1 66  ? -13.386 -3.560  5.047   1.00 0.00 ? 66  ARG A HH11 2  
ATOM 2761  H HH12 . ARG A 1 66  ? -12.979 -2.652  6.463   1.00 0.00 ? 66  ARG A HH12 2  
ATOM 2762  H HH21 . ARG A 1 66  ? -16.266 -1.831  7.206   1.00 0.00 ? 66  ARG A HH21 2  
ATOM 2763  H HH22 . ARG A 1 66  ? -14.609 -1.671  7.686   1.00 0.00 ? 66  ARG A HH22 2  
ATOM 2764  N N    . SER A 1 67  ? -20.060 -2.919  2.769   1.00 0.00 ? 67  SER A N    2  
ATOM 2765  C CA   . SER A 1 67  ? -21.019 -2.126  3.589   1.00 0.00 ? 67  SER A CA   2  
ATOM 2766  C C    . SER A 1 67  ? -20.298 -1.573  4.820   1.00 0.00 ? 67  SER A C    2  
ATOM 2767  O O    . SER A 1 67  ? -20.424 -2.091  5.911   1.00 0.00 ? 67  SER A O    2  
ATOM 2768  C CB   . SER A 1 67  ? -22.172 -3.028  4.031   1.00 0.00 ? 67  SER A CB   2  
ATOM 2769  O OG   . SER A 1 67  ? -23.253 -2.224  4.483   1.00 0.00 ? 67  SER A OG   2  
ATOM 2770  H H    . SER A 1 67  ? -20.007 -3.892  2.881   1.00 0.00 ? 67  SER A H    2  
ATOM 2771  H HA   . SER A 1 67  ? -21.406 -1.309  2.999   1.00 0.00 ? 67  SER A HA   2  
ATOM 2772  H HB2  . SER A 1 67  ? -22.500 -3.629  3.200   1.00 0.00 ? 67  SER A HB2  2  
ATOM 2773  H HB3  . SER A 1 67  ? -21.833 -3.678  4.830   1.00 0.00 ? 67  SER A HB3  2  
ATOM 2774  H HG   . SER A 1 67  ? -24.066 -2.605  4.146   1.00 0.00 ? 67  SER A HG   2  
ATOM 2775  N N    . GLN A 1 68  ? -19.538 -0.524  4.653   1.00 0.00 ? 68  GLN A N    2  
ATOM 2776  C CA   . GLN A 1 68  ? -18.805 0.062   5.812   1.00 0.00 ? 68  GLN A CA   2  
ATOM 2777  C C    . GLN A 1 68  ? -19.731 1.010   6.578   1.00 0.00 ? 68  GLN A C    2  
ATOM 2778  O O    . GLN A 1 68  ? -20.837 1.287   6.160   1.00 0.00 ? 68  GLN A O    2  
ATOM 2779  C CB   . GLN A 1 68  ? -17.588 0.839   5.305   1.00 0.00 ? 68  GLN A CB   2  
ATOM 2780  C CG   . GLN A 1 68  ? -16.658 -0.109  4.548   1.00 0.00 ? 68  GLN A CG   2  
ATOM 2781  C CD   . GLN A 1 68  ? -15.216 0.388   4.672   1.00 0.00 ? 68  GLN A CD   2  
ATOM 2782  O OE1  . GLN A 1 68  ? -14.584 0.708   3.684   1.00 0.00 ? 68  GLN A OE1  2  
ATOM 2783  N NE2  . GLN A 1 68  ? -14.666 0.466   5.852   1.00 0.00 ? 68  GLN A NE2  2  
ATOM 2784  H H    . GLN A 1 68  ? -19.447 -0.122  3.763   1.00 0.00 ? 68  GLN A H    2  
ATOM 2785  H HA   . GLN A 1 68  ? -18.478 -0.731  6.468   1.00 0.00 ? 68  GLN A HA   2  
ATOM 2786  H HB2  . GLN A 1 68  ? -17.915 1.629   4.645   1.00 0.00 ? 68  GLN A HB2  2  
ATOM 2787  H HB3  . GLN A 1 68  ? -17.060 1.266   6.144   1.00 0.00 ? 68  GLN A HB3  2  
ATOM 2788  H HG2  . GLN A 1 68  ? -16.734 -1.102  4.969   1.00 0.00 ? 68  GLN A HG2  2  
ATOM 2789  H HG3  . GLN A 1 68  ? -16.940 -0.136  3.506   1.00 0.00 ? 68  GLN A HG3  2  
ATOM 2790  H HE21 . GLN A 1 68  ? -15.176 0.208   6.648   1.00 0.00 ? 68  GLN A HE21 2  
ATOM 2791  H HE22 . GLN A 1 68  ? -13.743 0.783   5.944   1.00 0.00 ? 68  GLN A HE22 2  
ATOM 2792  N N    . GLU A 1 69  ? -19.283 1.511   7.698   1.00 0.00 ? 69  GLU A N    2  
ATOM 2793  C CA   . GLU A 1 69  ? -20.135 2.442   8.492   1.00 0.00 ? 69  GLU A CA   2  
ATOM 2794  C C    . GLU A 1 69  ? -19.894 3.877   8.021   1.00 0.00 ? 69  GLU A C    2  
ATOM 2795  O O    . GLU A 1 69  ? -20.745 4.491   7.409   1.00 0.00 ? 69  GLU A O    2  
ATOM 2796  C CB   . GLU A 1 69  ? -19.772 2.325   9.974   1.00 0.00 ? 69  GLU A CB   2  
ATOM 2797  C CG   . GLU A 1 69  ? -20.442 3.457   10.756  1.00 0.00 ? 69  GLU A CG   2  
ATOM 2798  C CD   . GLU A 1 69  ? -21.956 3.239   10.773  1.00 0.00 ? 69  GLU A CD   2  
ATOM 2799  O OE1  . GLU A 1 69  ? -22.594 3.583   9.793   1.00 0.00 ? 69  GLU A OE1  2  
ATOM 2800  O OE2  . GLU A 1 69  ? -22.451 2.732   11.767  1.00 0.00 ? 69  GLU A OE2  2  
ATOM 2801  H H    . GLU A 1 69  ? -18.387 1.276   8.017   1.00 0.00 ? 69  GLU A H    2  
ATOM 2802  H HA   . GLU A 1 69  ? -21.174 2.186   8.353   1.00 0.00 ? 69  GLU A HA   2  
ATOM 2803  H HB2  . GLU A 1 69  ? -20.113 1.373   10.353  1.00 0.00 ? 69  GLU A HB2  2  
ATOM 2804  H HB3  . GLU A 1 69  ? -18.701 2.396   10.089  1.00 0.00 ? 69  GLU A HB3  2  
ATOM 2805  H HG2  . GLU A 1 69  ? -20.067 3.466   11.769  1.00 0.00 ? 69  GLU A HG2  2  
ATOM 2806  H HG3  . GLU A 1 69  ? -20.223 4.402   10.282  1.00 0.00 ? 69  GLU A HG3  2  
ATOM 2807  N N    . GLU A 1 70  ? -18.741 4.418   8.302   1.00 0.00 ? 70  GLU A N    2  
ATOM 2808  C CA   . GLU A 1 70  ? -18.447 5.814   7.871   1.00 0.00 ? 70  GLU A CA   2  
ATOM 2809  C C    . GLU A 1 70  ? -17.648 5.788   6.561   1.00 0.00 ? 70  GLU A C    2  
ATOM 2810  O O    . GLU A 1 70  ? -16.518 5.345   6.542   1.00 0.00 ? 70  GLU A O    2  
ATOM 2811  C CB   . GLU A 1 70  ? -17.620 6.513   8.953   1.00 0.00 ? 70  GLU A CB   2  
ATOM 2812  C CG   . GLU A 1 70  ? -18.328 7.798   9.385   1.00 0.00 ? 70  GLU A CG   2  
ATOM 2813  C CD   . GLU A 1 70  ? -18.913 7.610   10.785  1.00 0.00 ? 70  GLU A CD   2  
ATOM 2814  O OE1  . GLU A 1 70  ? -18.165 7.730   11.740  1.00 0.00 ? 70  GLU A OE1  2  
ATOM 2815  O OE2  . GLU A 1 70  ? -20.102 7.347   10.879  1.00 0.00 ? 70  GLU A OE2  2  
ATOM 2816  H H    . GLU A 1 70  ? -18.068 3.906   8.797   1.00 0.00 ? 70  GLU A H    2  
ATOM 2817  H HA   . GLU A 1 70  ? -19.373 6.348   7.729   1.00 0.00 ? 70  GLU A HA   2  
ATOM 2818  H HB2  . GLU A 1 70  ? -17.513 5.856   9.804   1.00 0.00 ? 70  GLU A HB2  2  
ATOM 2819  H HB3  . GLU A 1 70  ? -16.645 6.756   8.560   1.00 0.00 ? 70  GLU A HB3  2  
ATOM 2820  H HG2  . GLU A 1 70  ? -17.619 8.614   9.396   1.00 0.00 ? 70  GLU A HG2  2  
ATOM 2821  H HG3  . GLU A 1 70  ? -19.124 8.022   8.691   1.00 0.00 ? 70  GLU A HG3  2  
ATOM 2822  N N    . PRO A 1 71  ? -18.257 6.265   5.502   1.00 0.00 ? 71  PRO A N    2  
ATOM 2823  C CA   . PRO A 1 71  ? -17.617 6.306   4.175   1.00 0.00 ? 71  PRO A CA   2  
ATOM 2824  C C    . PRO A 1 71  ? -16.632 7.476   4.094   1.00 0.00 ? 71  PRO A C    2  
ATOM 2825  O O    . PRO A 1 71  ? -17.011 8.626   4.182   1.00 0.00 ? 71  PRO A O    2  
ATOM 2826  C CB   . PRO A 1 71  ? -18.791 6.512   3.214   1.00 0.00 ? 71  PRO A CB   2  
ATOM 2827  C CG   . PRO A 1 71  ? -19.931 7.139   4.049   1.00 0.00 ? 71  PRO A CG   2  
ATOM 2828  C CD   . PRO A 1 71  ? -19.632 6.806   5.523   1.00 0.00 ? 71  PRO A CD   2  
ATOM 2829  H HA   . PRO A 1 71  ? -17.123 5.373   3.960   1.00 0.00 ? 71  PRO A HA   2  
ATOM 2830  H HB2  . PRO A 1 71  ? -18.501 7.178   2.413   1.00 0.00 ? 71  PRO A HB2  2  
ATOM 2831  H HB3  . PRO A 1 71  ? -19.114 5.564   2.812   1.00 0.00 ? 71  PRO A HB3  2  
ATOM 2832  H HG2  . PRO A 1 71  ? -19.949 8.210   3.904   1.00 0.00 ? 71  PRO A HG2  2  
ATOM 2833  H HG3  . PRO A 1 71  ? -20.879 6.709   3.763   1.00 0.00 ? 71  PRO A HG3  2  
ATOM 2834  H HD2  . PRO A 1 71  ? -19.682 7.700   6.127   1.00 0.00 ? 71  PRO A HD2  2  
ATOM 2835  H HD3  . PRO A 1 71  ? -20.321 6.060   5.889   1.00 0.00 ? 71  PRO A HD3  2  
ATOM 2836  N N    . GLY A 1 72  ? -15.369 7.189   3.926   1.00 0.00 ? 72  GLY A N    2  
ATOM 2837  C CA   . GLY A 1 72  ? -14.362 8.282   3.838   1.00 0.00 ? 72  GLY A CA   2  
ATOM 2838  C C    . GLY A 1 72  ? -14.084 8.596   2.366   1.00 0.00 ? 72  GLY A C    2  
ATOM 2839  O O    . GLY A 1 72  ? -14.952 9.045   1.644   1.00 0.00 ? 72  GLY A O    2  
ATOM 2840  H H    . GLY A 1 72  ? -15.084 6.254   3.857   1.00 0.00 ? 72  GLY A H    2  
ATOM 2841  H HA2  . GLY A 1 72  ? -14.746 9.166   4.329   1.00 0.00 ? 72  GLY A HA2  2  
ATOM 2842  H HA3  . GLY A 1 72  ? -13.446 7.969   4.320   1.00 0.00 ? 72  GLY A HA3  2  
ATOM 2843  N N    . LYS A 1 73  ? -12.883 8.359   1.915   1.00 0.00 ? 73  LYS A N    2  
ATOM 2844  C CA   . LYS A 1 73  ? -12.557 8.642   0.489   1.00 0.00 ? 73  LYS A CA   2  
ATOM 2845  C C    . LYS A 1 73  ? -12.937 7.431   -0.367  1.00 0.00 ? 73  LYS A C    2  
ATOM 2846  O O    . LYS A 1 73  ? -13.913 7.451   -1.089  1.00 0.00 ? 73  LYS A O    2  
ATOM 2847  C CB   . LYS A 1 73  ? -11.058 8.916   0.352   1.00 0.00 ? 73  LYS A CB   2  
ATOM 2848  C CG   . LYS A 1 73  ? -10.846 10.323  -0.212  1.00 0.00 ? 73  LYS A CG   2  
ATOM 2849  C CD   . LYS A 1 73  ? -10.818 11.334  0.934   1.00 0.00 ? 73  LYS A CD   2  
ATOM 2850  C CE   . LYS A 1 73  ? -9.378  11.521  1.416   1.00 0.00 ? 73  LYS A CE   2  
ATOM 2851  N NZ   . LYS A 1 73  ? -9.202  10.842  2.730   1.00 0.00 ? 73  LYS A NZ   2  
ATOM 2852  H H    . LYS A 1 73  ? -12.198 7.994   2.512   1.00 0.00 ? 73  LYS A H    2  
ATOM 2853  H HA   . LYS A 1 73  ? -13.113 9.506   0.156   1.00 0.00 ? 73  LYS A HA   2  
ATOM 2854  H HB2  . LYS A 1 73  ? -10.589 8.843   1.322   1.00 0.00 ? 73  LYS A HB2  2  
ATOM 2855  H HB3  . LYS A 1 73  ? -10.618 8.192   -0.317  1.00 0.00 ? 73  LYS A HB3  2  
ATOM 2856  H HG2  . LYS A 1 73  ? -9.909  10.357  -0.749  1.00 0.00 ? 73  LYS A HG2  2  
ATOM 2857  H HG3  . LYS A 1 73  ? -11.655 10.566  -0.884  1.00 0.00 ? 73  LYS A HG3  2  
ATOM 2858  H HD2  . LYS A 1 73  ? -11.209 12.281  0.589   1.00 0.00 ? 73  LYS A HD2  2  
ATOM 2859  H HD3  . LYS A 1 73  ? -11.423 10.970  1.752   1.00 0.00 ? 73  LYS A HD3  2  
ATOM 2860  H HE2  . LYS A 1 73  ? -8.699  11.090  0.694   1.00 0.00 ? 73  LYS A HE2  2  
ATOM 2861  H HE3  . LYS A 1 73  ? -9.167  12.574  1.523   1.00 0.00 ? 73  LYS A HE3  2  
ATOM 2862  H HZ1  . LYS A 1 73  ? -10.017 11.052  3.341   1.00 0.00 ? 73  LYS A HZ1  2  
ATOM 2863  H HZ2  . LYS A 1 73  ? -8.329  11.184  3.182   1.00 0.00 ? 73  LYS A HZ2  2  
ATOM 2864  H HZ3  . LYS A 1 73  ? -9.138  9.815   2.584   1.00 0.00 ? 73  LYS A HZ3  2  
ATOM 2865  N N    . GLY A 1 74  ? -12.174 6.376   -0.291  1.00 0.00 ? 74  GLY A N    2  
ATOM 2866  C CA   . GLY A 1 74  ? -12.496 5.166   -1.096  1.00 0.00 ? 74  GLY A CA   2  
ATOM 2867  C C    . GLY A 1 74  ? -13.034 4.073   -0.171  1.00 0.00 ? 74  GLY A C    2  
ATOM 2868  O O    . GLY A 1 74  ? -13.446 4.336   0.941   1.00 0.00 ? 74  GLY A O    2  
ATOM 2869  H H    . GLY A 1 74  ? -11.391 6.378   0.300   1.00 0.00 ? 74  GLY A H    2  
ATOM 2870  H HA2  . GLY A 1 74  ? -13.242 5.413   -1.837  1.00 0.00 ? 74  GLY A HA2  2  
ATOM 2871  H HA3  . GLY A 1 74  ? -11.601 4.813   -1.590  1.00 0.00 ? 74  GLY A HA3  2  
ATOM 2872  N N    . SER A 1 75  ? -13.035 2.847   -0.619  1.00 0.00 ? 75  SER A N    2  
ATOM 2873  C CA   . SER A 1 75  ? -13.547 1.742   0.240   1.00 0.00 ? 75  SER A CA   2  
ATOM 2874  C C    . SER A 1 75  ? -12.467 0.669   0.381   1.00 0.00 ? 75  SER A C    2  
ATOM 2875  O O    . SER A 1 75  ? -11.905 0.477   1.441   1.00 0.00 ? 75  SER A O    2  
ATOM 2876  C CB   . SER A 1 75  ? -14.795 1.134   -0.401  1.00 0.00 ? 75  SER A CB   2  
ATOM 2877  O OG   . SER A 1 75  ? -15.933 1.422   0.407   1.00 0.00 ? 75  SER A OG   2  
ATOM 2878  H H    . SER A 1 75  ? -12.697 2.654   -1.519  1.00 0.00 ? 75  SER A H    2  
ATOM 2879  H HA   . SER A 1 75  ? -13.795 2.132   1.216   1.00 0.00 ? 75  SER A HA   2  
ATOM 2880  H HB2  . SER A 1 75  ? -14.940 1.559   -1.379  1.00 0.00 ? 75  SER A HB2  2  
ATOM 2881  H HB3  . SER A 1 75  ? -14.667 0.064   -0.491  1.00 0.00 ? 75  SER A HB3  2  
ATOM 2882  H HG   . SER A 1 75  ? -15.624 1.743   1.259   1.00 0.00 ? 75  SER A HG   2  
ATOM 2883  N N    . PHE A 1 76  ? -12.163 -0.031  -0.679  1.00 0.00 ? 76  PHE A N    2  
ATOM 2884  C CA   . PHE A 1 76  ? -11.113 -1.082  -0.593  1.00 0.00 ? 76  PHE A CA   2  
ATOM 2885  C C    . PHE A 1 76  ? -10.655 -1.474  -1.999  1.00 0.00 ? 76  PHE A C    2  
ATOM 2886  O O    . PHE A 1 76  ? -11.370 -1.307  -2.966  1.00 0.00 ? 76  PHE A O    2  
ATOM 2887  C CB   . PHE A 1 76  ? -11.666 -2.310  0.131   1.00 0.00 ? 76  PHE A CB   2  
ATOM 2888  C CG   . PHE A 1 76  ? -10.627 -2.806  1.106   1.00 0.00 ? 76  PHE A CG   2  
ATOM 2889  C CD1  . PHE A 1 76  ? -9.617  -3.667  0.668   1.00 0.00 ? 76  PHE A CD1  2  
ATOM 2890  C CD2  . PHE A 1 76  ? -10.666 -2.394  2.443   1.00 0.00 ? 76  PHE A CD2  2  
ATOM 2891  C CE1  . PHE A 1 76  ? -8.644  -4.118  1.566   1.00 0.00 ? 76  PHE A CE1  2  
ATOM 2892  C CE2  . PHE A 1 76  ? -9.692  -2.847  3.343   1.00 0.00 ? 76  PHE A CE2  2  
ATOM 2893  C CZ   . PHE A 1 76  ? -8.682  -3.708  2.904   1.00 0.00 ? 76  PHE A CZ   2  
ATOM 2894  H H    . PHE A 1 76  ? -12.621 0.138   -1.529  1.00 0.00 ? 76  PHE A H    2  
ATOM 2895  H HA   . PHE A 1 76  ? -10.269 -0.696  -0.042  1.00 0.00 ? 76  PHE A HA   2  
ATOM 2896  H HB2  . PHE A 1 76  ? -12.567 -2.040  0.664   1.00 0.00 ? 76  PHE A HB2  2  
ATOM 2897  H HB3  . PHE A 1 76  ? -11.887 -3.087  -0.587  1.00 0.00 ? 76  PHE A HB3  2  
ATOM 2898  H HD1  . PHE A 1 76  ? -9.587  -3.985  -0.363  1.00 0.00 ? 76  PHE A HD1  2  
ATOM 2899  H HD2  . PHE A 1 76  ? -11.446 -1.729  2.781   1.00 0.00 ? 76  PHE A HD2  2  
ATOM 2900  H HE1  . PHE A 1 76  ? -7.865  -4.779  1.227   1.00 0.00 ? 76  PHE A HE1  2  
ATOM 2901  H HE2  . PHE A 1 76  ? -9.720  -2.528  4.372   1.00 0.00 ? 76  PHE A HE2  2  
ATOM 2902  H HZ   . PHE A 1 76  ? -7.931  -4.058  3.597   1.00 0.00 ? 76  PHE A HZ   2  
ATOM 2903  N N    . TRP A 1 77  ? -9.461  -1.989  -2.117  1.00 0.00 ? 77  TRP A N    2  
ATOM 2904  C CA   . TRP A 1 77  ? -8.947  -2.385  -3.457  1.00 0.00 ? 77  TRP A CA   2  
ATOM 2905  C C    . TRP A 1 77  ? -8.422  -3.823  -3.415  1.00 0.00 ? 77  TRP A C    2  
ATOM 2906  O O    . TRP A 1 77  ? -8.184  -4.382  -2.363  1.00 0.00 ? 77  TRP A O    2  
ATOM 2907  C CB   . TRP A 1 77  ? -7.800  -1.458  -3.856  1.00 0.00 ? 77  TRP A CB   2  
ATOM 2908  C CG   . TRP A 1 77  ? -8.341  -0.210  -4.470  1.00 0.00 ? 77  TRP A CG   2  
ATOM 2909  C CD1  . TRP A 1 77  ? -8.583  0.944   -3.808  1.00 0.00 ? 77  TRP A CD1  2  
ATOM 2910  C CD2  . TRP A 1 77  ? -8.700  0.030   -5.858  1.00 0.00 ? 77  TRP A CD2  2  
ATOM 2911  N NE1  . TRP A 1 77  ? -9.064  1.879   -4.705  1.00 0.00 ? 77  TRP A NE1  2  
ATOM 2912  C CE2  . TRP A 1 77  ? -9.154  1.363   -5.981  1.00 0.00 ? 77  TRP A CE2  2  
ATOM 2913  C CE3  . TRP A 1 77  ? -8.673  -0.772  -7.012  1.00 0.00 ? 77  TRP A CE3  2  
ATOM 2914  C CZ2  . TRP A 1 77  ? -9.566  1.884   -7.206  1.00 0.00 ? 77  TRP A CZ2  2  
ATOM 2915  C CZ3  . TRP A 1 77  ? -9.087  -0.252  -8.248  1.00 0.00 ? 77  TRP A CZ3  2  
ATOM 2916  C CH2  . TRP A 1 77  ? -9.531  1.074   -8.342  1.00 0.00 ? 77  TRP A CH2  2  
ATOM 2917  H H    . TRP A 1 77  ? -8.902  -2.109  -1.324  1.00 0.00 ? 77  TRP A H    2  
ATOM 2918  H HA   . TRP A 1 77  ? -9.740  -2.311  -4.186  1.00 0.00 ? 77  TRP A HA   2  
ATOM 2919  H HB2  . TRP A 1 77  ? -7.222  -1.203  -2.982  1.00 0.00 ? 77  TRP A HB2  2  
ATOM 2920  H HB3  . TRP A 1 77  ? -7.165  -1.961  -4.569  1.00 0.00 ? 77  TRP A HB3  2  
ATOM 2921  H HD1  . TRP A 1 77  ? -8.424  1.108   -2.753  1.00 0.00 ? 77  TRP A HD1  2  
ATOM 2922  H HE1  . TRP A 1 77  ? -9.317  2.800   -4.480  1.00 0.00 ? 77  TRP A HE1  2  
ATOM 2923  H HE3  . TRP A 1 77  ? -8.331  -1.794  -6.948  1.00 0.00 ? 77  TRP A HE3  2  
ATOM 2924  H HZ2  . TRP A 1 77  ? -9.908  2.906   -7.276  1.00 0.00 ? 77  TRP A HZ2  2  
ATOM 2925  H HZ3  . TRP A 1 77  ? -9.062  -0.874  -9.130  1.00 0.00 ? 77  TRP A HZ3  2  
ATOM 2926  H HH2  . TRP A 1 77  ? -9.839  1.469   -9.293  1.00 0.00 ? 77  TRP A HH2  2  
ATOM 2927  N N    . ARG A 1 78  ? -8.226  -4.413  -4.562  1.00 0.00 ? 78  ARG A N    2  
ATOM 2928  C CA   . ARG A 1 78  ? -7.700  -5.806  -4.621  1.00 0.00 ? 78  ARG A CA   2  
ATOM 2929  C C    . ARG A 1 78  ? -7.124  -6.049  -6.013  1.00 0.00 ? 78  ARG A C    2  
ATOM 2930  O O    . ARG A 1 78  ? -7.721  -5.689  -7.003  1.00 0.00 ? 78  ARG A O    2  
ATOM 2931  C CB   . ARG A 1 78  ? -8.830  -6.802  -4.371  1.00 0.00 ? 78  ARG A CB   2  
ATOM 2932  C CG   . ARG A 1 78  ? -8.300  -7.988  -3.562  1.00 0.00 ? 78  ARG A CG   2  
ATOM 2933  C CD   . ARG A 1 78  ? -9.361  -8.430  -2.552  1.00 0.00 ? 78  ARG A CD   2  
ATOM 2934  N NE   . ARG A 1 78  ? -10.558 -8.935  -3.281  1.00 0.00 ? 78  ARG A NE   2  
ATOM 2935  C CZ   . ARG A 1 78  ? -11.291 -9.880  -2.758  1.00 0.00 ? 78  ARG A CZ   2  
ATOM 2936  N NH1  . ARG A 1 78  ? -11.229 -10.124 -1.478  1.00 0.00 ? 78  ARG A NH1  2  
ATOM 2937  N NH2  . ARG A 1 78  ? -12.086 -10.581 -3.519  1.00 0.00 ? 78  ARG A NH2  2  
ATOM 2938  H H    . ARG A 1 78  ? -8.417  -3.930  -5.394  1.00 0.00 ? 78  ARG A H    2  
ATOM 2939  H HA   . ARG A 1 78  ? -6.926  -5.936  -3.878  1.00 0.00 ? 78  ARG A HA   2  
ATOM 2940  H HB2  . ARG A 1 78  ? -9.627  -6.317  -3.826  1.00 0.00 ? 78  ARG A HB2  2  
ATOM 2941  H HB3  . ARG A 1 78  ? -9.202  -7.156  -5.318  1.00 0.00 ? 78  ARG A HB3  2  
ATOM 2942  H HG2  . ARG A 1 78  ? -8.078  -8.806  -4.232  1.00 0.00 ? 78  ARG A HG2  2  
ATOM 2943  H HG3  . ARG A 1 78  ? -7.403  -7.696  -3.039  1.00 0.00 ? 78  ARG A HG3  2  
ATOM 2944  H HD2  . ARG A 1 78  ? -8.960  -9.215  -1.928  1.00 0.00 ? 78  ARG A HD2  2  
ATOM 2945  H HD3  . ARG A 1 78  ? -9.642  -7.588  -1.936  1.00 0.00 ? 78  ARG A HD3  2  
ATOM 2946  H HE   . ARG A 1 78  ? -10.794 -8.559  -4.155  1.00 0.00 ? 78  ARG A HE   2  
ATOM 2947  H HH11 . ARG A 1 78  ? -10.619 -9.587  -0.895  1.00 0.00 ? 78  ARG A HH11 2  
ATOM 2948  H HH12 . ARG A 1 78  ? -11.792 -10.848 -1.080  1.00 0.00 ? 78  ARG A HH12 2  
ATOM 2949  H HH21 . ARG A 1 78  ? -12.133 -10.395 -4.501  1.00 0.00 ? 78  ARG A HH21 2  
ATOM 2950  H HH22 . ARG A 1 78  ? -12.649 -11.306 -3.121  1.00 0.00 ? 78  ARG A HH22 2  
ATOM 2951  N N    . ILE A 1 79  ? -5.979  -6.657  -6.104  1.00 0.00 ? 79  ILE A N    2  
ATOM 2952  C CA   . ILE A 1 79  ? -5.388  -6.915  -7.452  1.00 0.00 ? 79  ILE A CA   2  
ATOM 2953  C C    . ILE A 1 79  ? -5.798  -8.312  -7.923  1.00 0.00 ? 79  ILE A C    2  
ATOM 2954  O O    . ILE A 1 79  ? -6.068  -9.189  -7.127  1.00 0.00 ? 79  ILE A O    2  
ATOM 2955  C CB   . ILE A 1 79  ? -3.866  -6.797  -7.365  1.00 0.00 ? 79  ILE A CB   2  
ATOM 2956  C CG1  . ILE A 1 79  ? -3.217  -7.196  -8.689  1.00 0.00 ? 79  ILE A CG1  2  
ATOM 2957  C CG2  . ILE A 1 79  ? -3.334  -7.703  -6.269  1.00 0.00 ? 79  ILE A CG2  2  
ATOM 2958  C CD1  . ILE A 1 79  ? -2.347  -6.040  -9.182  1.00 0.00 ? 79  ILE A CD1  2  
ATOM 2959  H H    . ILE A 1 79  ? -5.510  -6.946  -5.291  1.00 0.00 ? 79  ILE A H    2  
ATOM 2960  H HA   . ILE A 1 79  ? -5.759  -6.183  -8.152  1.00 0.00 ? 79  ILE A HA   2  
ATOM 2961  H HB   . ILE A 1 79  ? -3.608  -5.778  -7.135  1.00 0.00 ? 79  ILE A HB   2  
ATOM 2962  H HG12 . ILE A 1 79  ? -2.607  -8.071  -8.538  1.00 0.00 ? 79  ILE A HG12 2  
ATOM 2963  H HG13 . ILE A 1 79  ? -3.975  -7.412  -9.418  1.00 0.00 ? 79  ILE A HG13 2  
ATOM 2964  H HG21 . ILE A 1 79  ? -3.162  -7.120  -5.379  1.00 0.00 ? 79  ILE A HG21 2  
ATOM 2965  H HG22 . ILE A 1 79  ? -2.405  -8.147  -6.596  1.00 0.00 ? 79  ILE A HG22 2  
ATOM 2966  H HG23 . ILE A 1 79  ? -4.054  -8.477  -6.064  1.00 0.00 ? 79  ILE A HG23 2  
ATOM 2967  H HD11 . ILE A 1 79  ? -1.664  -5.750  -8.398  1.00 0.00 ? 79  ILE A HD11 2  
ATOM 2968  H HD12 . ILE A 1 79  ? -2.975  -5.201  -9.441  1.00 0.00 ? 79  ILE A HD12 2  
ATOM 2969  H HD13 . ILE A 1 79  ? -1.787  -6.349  -10.045 1.00 0.00 ? 79  ILE A HD13 2  
ATOM 2970  N N    . ASP A 1 80  ? -5.867  -8.523  -9.210  1.00 0.00 ? 80  ASP A N    2  
ATOM 2971  C CA   . ASP A 1 80  ? -6.282  -9.858  -9.718  1.00 0.00 ? 80  ASP A CA   2  
ATOM 2972  C C    . ASP A 1 80  ? -5.338  -10.926 -9.156  1.00 0.00 ? 80  ASP A C    2  
ATOM 2973  O O    . ASP A 1 80  ? -4.150  -10.704 -9.043  1.00 0.00 ? 80  ASP A O    2  
ATOM 2974  C CB   . ASP A 1 80  ? -6.214  -9.862  -11.246 1.00 0.00 ? 80  ASP A CB   2  
ATOM 2975  C CG   . ASP A 1 80  ? -7.627  -9.771  -11.824 1.00 0.00 ? 80  ASP A CG   2  
ATOM 2976  O OD1  . ASP A 1 80  ? -8.506  -9.306  -11.117 1.00 0.00 ? 80  ASP A OD1  2  
ATOM 2977  O OD2  . ASP A 1 80  ? -7.806  -10.165 -12.965 1.00 0.00 ? 80  ASP A OD2  2  
ATOM 2978  H H    . ASP A 1 80  ? -5.666  -7.800  -9.839  1.00 0.00 ? 80  ASP A H    2  
ATOM 2979  H HA   . ASP A 1 80  ? -7.294  -10.059 -9.402  1.00 0.00 ? 80  ASP A HA   2  
ATOM 2980  H HB2  . ASP A 1 80  ? -5.633  -9.016  -11.582 1.00 0.00 ? 80  ASP A HB2  2  
ATOM 2981  H HB3  . ASP A 1 80  ? -5.749  -10.775 -11.581 1.00 0.00 ? 80  ASP A HB3  2  
ATOM 2982  N N    . PRO A 1 81  ? -5.907  -12.052 -8.800  1.00 0.00 ? 81  PRO A N    2  
ATOM 2983  C CA   . PRO A 1 81  ? -5.152  -13.176 -8.218  1.00 0.00 ? 81  PRO A CA   2  
ATOM 2984  C C    . PRO A 1 81  ? -4.413  -13.970 -9.300  1.00 0.00 ? 81  PRO A C    2  
ATOM 2985  O O    . PRO A 1 81  ? -3.242  -14.268 -9.168  1.00 0.00 ? 81  PRO A O    2  
ATOM 2986  C CB   . PRO A 1 81  ? -6.239  -14.033 -7.562  1.00 0.00 ? 81  PRO A CB   2  
ATOM 2987  C CG   . PRO A 1 81  ? -7.568  -13.675 -8.270  1.00 0.00 ? 81  PRO A CG   2  
ATOM 2988  C CD   . PRO A 1 81  ? -7.355  -12.308 -8.946  1.00 0.00 ? 81  PRO A CD   2  
ATOM 2989  H HA   . PRO A 1 81  ? -4.464  -12.824 -7.467  1.00 0.00 ? 81  PRO A HA   2  
ATOM 2990  H HB2  . PRO A 1 81  ? -6.014  -15.083 -7.698  1.00 0.00 ? 81  PRO A HB2  2  
ATOM 2991  H HB3  . PRO A 1 81  ? -6.313  -13.800 -6.511  1.00 0.00 ? 81  PRO A HB3  2  
ATOM 2992  H HG2  . PRO A 1 81  ? -7.805  -14.426 -9.012  1.00 0.00 ? 81  PRO A HG2  2  
ATOM 2993  H HG3  . PRO A 1 81  ? -8.365  -13.603 -7.547  1.00 0.00 ? 81  PRO A HG3  2  
ATOM 2994  H HD2  . PRO A 1 81  ? -7.630  -12.358 -9.991  1.00 0.00 ? 81  PRO A HD2  2  
ATOM 2995  H HD3  . PRO A 1 81  ? -7.922  -11.538 -8.441  1.00 0.00 ? 81  PRO A HD3  2  
ATOM 2996  N N    . ALA A 1 82  ? -5.082  -14.326 -10.360 1.00 0.00 ? 82  ALA A N    2  
ATOM 2997  C CA   . ALA A 1 82  ? -4.406  -15.112 -11.431 1.00 0.00 ? 82  ALA A CA   2  
ATOM 2998  C C    . ALA A 1 82  ? -3.366  -14.244 -12.137 1.00 0.00 ? 82  ALA A C    2  
ATOM 2999  O O    . ALA A 1 82  ? -2.554  -14.733 -12.897 1.00 0.00 ? 82  ALA A O    2  
ATOM 3000  C CB   . ALA A 1 82  ? -5.444  -15.600 -12.443 1.00 0.00 ? 82  ALA A CB   2  
ATOM 3001  H H    . ALA A 1 82  ? -6.028  -14.086 -10.448 1.00 0.00 ? 82  ALA A H    2  
ATOM 3002  H HA   . ALA A 1 82  ? -3.908  -15.961 -10.986 1.00 0.00 ? 82  ALA A HA   2  
ATOM 3003  H HB1  . ALA A 1 82  ? -5.371  -15.011 -13.346 1.00 0.00 ? 82  ALA A HB1  2  
ATOM 3004  H HB2  . ALA A 1 82  ? -6.434  -15.495 -12.024 1.00 0.00 ? 82  ALA A HB2  2  
ATOM 3005  H HB3  . ALA A 1 82  ? -5.260  -16.639 -12.675 1.00 0.00 ? 82  ALA A HB3  2  
ATOM 3006  N N    . SER A 1 83  ? -3.363  -12.967 -11.880 1.00 0.00 ? 83  SER A N    2  
ATOM 3007  C CA   . SER A 1 83  ? -2.353  -12.093 -12.523 1.00 0.00 ? 83  SER A CA   2  
ATOM 3008  C C    . SER A 1 83  ? -1.378  -11.628 -11.452 1.00 0.00 ? 83  SER A C    2  
ATOM 3009  O O    . SER A 1 83  ? -0.352  -11.065 -11.745 1.00 0.00 ? 83  SER A O    2  
ATOM 3010  C CB   . SER A 1 83  ? -3.032  -10.876 -13.153 1.00 0.00 ? 83  SER A CB   2  
ATOM 3011  O OG   . SER A 1 83  ? -3.022  -11.012 -14.568 1.00 0.00 ? 83  SER A OG   2  
ATOM 3012  H H    . SER A 1 83  ? -4.008  -12.586 -11.247 1.00 0.00 ? 83  SER A H    2  
ATOM 3013  H HA   . SER A 1 83  ? -1.821  -12.649 -13.282 1.00 0.00 ? 83  SER A HA   2  
ATOM 3014  H HB2  . SER A 1 83  ? -4.050  -10.815 -12.812 1.00 0.00 ? 83  SER A HB2  2  
ATOM 3015  H HB3  . SER A 1 83  ? -2.502  -9.975  -12.863 1.00 0.00 ? 83  SER A HB3  2  
ATOM 3016  H HG   . SER A 1 83  ? -2.124  -11.222 -14.839 1.00 0.00 ? 83  SER A HG   2  
ATOM 3017  N N    . GLU A 1 84  ? -1.698  -11.861 -10.209 1.00 0.00 ? 84  GLU A N    2  
ATOM 3018  C CA   . GLU A 1 84  ? -0.797  -11.420 -9.115  1.00 0.00 ? 84  GLU A CA   2  
ATOM 3019  C C    . GLU A 1 84  ? 0.584   -12.039 -9.293  1.00 0.00 ? 84  GLU A C    2  
ATOM 3020  O O    . GLU A 1 84  ? 1.572   -11.342 -9.347  1.00 0.00 ? 84  GLU A O    2  
ATOM 3021  C CB   . GLU A 1 84  ? -1.383  -11.855 -7.771  1.00 0.00 ? 84  GLU A CB   2  
ATOM 3022  C CG   . GLU A 1 84  ? -0.409  -11.496 -6.646  1.00 0.00 ? 84  GLU A CG   2  
ATOM 3023  C CD   . GLU A 1 84  ? -0.656  -12.413 -5.447  1.00 0.00 ? 84  GLU A CD   2  
ATOM 3024  O OE1  . GLU A 1 84  ? -0.827  -13.602 -5.659  1.00 0.00 ? 84  GLU A OE1  2  
ATOM 3025  O OE2  . GLU A 1 84  ? -0.669  -11.910 -4.335  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 3026  H H    . GLU A 1 84  ? -2.536  -12.318 -9.994  1.00 0.00 ? 84  GLU A H    2  
ATOM 3027  H HA   . GLU A 1 84  ? -0.712  -10.348 -9.138  1.00 0.00 ? 84  GLU A HA   2  
ATOM 3028  H HB2  . GLU A 1 84  ? -2.324  -11.350 -7.607  1.00 0.00 ? 84  GLU A HB2  2  
ATOM 3029  H HB3  . GLU A 1 84  ? -1.544  -12.923 -7.778  1.00 0.00 ? 84  GLU A HB3  2  
ATOM 3030  H HG2  . GLU A 1 84  ? 0.605   -11.625 -6.994  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 3031  H HG3  . GLU A 1 84  ? -0.562  -10.470 -6.350  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 3032  N N    . ALA A 1 85  ? 0.672   -13.335 -9.386  1.00 0.00 ? 85  ALA A N    2  
ATOM 3033  C CA   . ALA A 1 85  ? 2.014   -13.967 -9.554  1.00 0.00 ? 85  ALA A CA   2  
ATOM 3034  C C    . ALA A 1 85  ? 2.779   -13.268 -10.685 1.00 0.00 ? 85  ALA A C    2  
ATOM 3035  O O    . ALA A 1 85  ? 3.990   -13.341 -10.761 1.00 0.00 ? 85  ALA A O    2  
ATOM 3036  C CB   . ALA A 1 85  ? 1.843   -15.450 -9.890  1.00 0.00 ? 85  ALA A CB   2  
ATOM 3037  H H    . ALA A 1 85  ? -0.138  -13.893 -9.344  1.00 0.00 ? 85  ALA A H    2  
ATOM 3038  H HA   . ALA A 1 85  ? 2.574   -13.865 -8.632  1.00 0.00 ? 85  ALA A HA   2  
ATOM 3039  H HB1  . ALA A 1 85  ? 2.008   -16.042 -9.001  1.00 0.00 ? 85  ALA A HB1  2  
ATOM 3040  H HB2  . ALA A 1 85  ? 2.558   -15.732 -10.648 1.00 0.00 ? 85  ALA A HB2  2  
ATOM 3041  H HB3  . ALA A 1 85  ? 0.842   -15.623 -10.256 1.00 0.00 ? 85  ALA A HB3  2  
ATOM 3042  N N    . LYS A 1 86  ? 2.087   -12.593 -11.565 1.00 0.00 ? 86  LYS A N    2  
ATOM 3043  C CA   . LYS A 1 86  ? 2.784   -11.897 -12.685 1.00 0.00 ? 86  LYS A CA   2  
ATOM 3044  C C    . LYS A 1 86  ? 3.193   -10.487 -12.247 1.00 0.00 ? 86  LYS A C    2  
ATOM 3045  O O    . LYS A 1 86  ? 4.357   -10.141 -12.244 1.00 0.00 ? 86  LYS A O    2  
ATOM 3046  C CB   . LYS A 1 86  ? 1.846   -11.804 -13.890 1.00 0.00 ? 86  LYS A CB   2  
ATOM 3047  C CG   . LYS A 1 86  ? 2.668   -11.577 -15.160 1.00 0.00 ? 86  LYS A CG   2  
ATOM 3048  C CD   . LYS A 1 86  ? 1.914   -10.632 -16.098 1.00 0.00 ? 86  LYS A CD   2  
ATOM 3049  C CE   . LYS A 1 86  ? 2.753   -9.375  -16.344 1.00 0.00 ? 86  LYS A CE   2  
ATOM 3050  N NZ   . LYS A 1 86  ? 2.982   -9.208  -17.807 1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3051  H H    . LYS A 1 86  ? 1.113   -12.547 -11.491 1.00 0.00 ? 86  LYS A H    2  
ATOM 3052  H HA   . LYS A 1 86  ? 3.666   -12.455 -12.961 1.00 0.00 ? 86  LYS A HA   2  
ATOM 3053  H HB2  . LYS A 1 86  ? 1.287   -12.723 -13.981 1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3054  H HB3  . LYS A 1 86  ? 1.163   -10.979 -13.752 1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3055  H HG2  . LYS A 1 86  ? 3.620   -11.139 -14.897 1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3056  H HG3  . LYS A 1 86  ? 2.830   -12.520 -15.658 1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3057  H HD2  . LYS A 1 86  ? 1.728   -11.130 -17.037 1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3058  H HD3  . LYS A 1 86  ? 0.974   -10.351 -15.646 1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3059  H HE2  . LYS A 1 86  ? 2.230   -8.512  -15.960 1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3060  H HE3  . LYS A 1 86  ? 3.704   -9.474  -15.840 1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3061  H HZ1  . LYS A 1 86  ? 3.916   -9.591  -18.058 1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3062  H HZ2  . LYS A 1 86  ? 2.944   -8.197  -18.051 1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3063  H HZ3  . LYS A 1 86  ? 2.247   -9.721  -18.334 1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3064  N N    . LEU A 1 87  ? 2.243   -9.665  -11.886 1.00 0.00 ? 87  LEU A N    2  
ATOM 3065  C CA   . LEU A 1 87  ? 2.574   -8.276  -11.455 1.00 0.00 ? 87  LEU A CA   2  
ATOM 3066  C C    . LEU A 1 87  ? 3.653   -8.314  -10.383 1.00 0.00 ? 87  LEU A C    2  
ATOM 3067  O O    . LEU A 1 87  ? 4.736   -7.788  -10.548 1.00 0.00 ? 87  LEU A O    2  
ATOM 3068  C CB   . LEU A 1 87  ? 1.328   -7.586  -10.880 1.00 0.00 ? 87  LEU A CB   2  
ATOM 3069  C CG   . LEU A 1 87  ? 0.384   -8.611  -10.234 1.00 0.00 ? 87  LEU A CG   2  
ATOM 3070  C CD1  . LEU A 1 87  ? 0.052   -8.181  -8.806  1.00 0.00 ? 87  LEU A CD1  2  
ATOM 3071  C CD2  . LEU A 1 87  ? -0.917  -8.688  -11.035 1.00 0.00 ? 87  LEU A CD2  2  
ATOM 3072  H H    . LEU A 1 87  ? 1.314   -9.959  -11.906 1.00 0.00 ? 87  LEU A H    2  
ATOM 3073  H HA   . LEU A 1 87  ? 2.936   -7.720  -12.298 1.00 0.00 ? 87  LEU A HA   2  
ATOM 3074  H HB2  . LEU A 1 87  ? 1.630   -6.865  -10.138 1.00 0.00 ? 87  LEU A HB2  2  
ATOM 3075  H HB3  . LEU A 1 87  ? 0.810   -7.081  -11.670 1.00 0.00 ? 87  LEU A HB3  2  
ATOM 3076  H HG   . LEU A 1 87  ? 0.855   -9.579  -10.211 1.00 0.00 ? 87  LEU A HG   2  
ATOM 3077  H HD11 . LEU A 1 87  ? -0.035  -7.107  -8.763  1.00 0.00 ? 87  LEU A HD11 2  
ATOM 3078  H HD12 . LEU A 1 87  ? 0.836   -8.510  -8.141  1.00 0.00 ? 87  LEU A HD12 2  
ATOM 3079  H HD13 . LEU A 1 87  ? -0.883  -8.629  -8.505  1.00 0.00 ? 87  LEU A HD13 2  
ATOM 3080  H HD21 . LEU A 1 87  ? -1.602  -9.368  -10.545 1.00 0.00 ? 87  LEU A HD21 2  
ATOM 3081  H HD22 . LEU A 1 87  ? -0.708  -9.042  -12.031 1.00 0.00 ? 87  LEU A HD22 2  
ATOM 3082  H HD23 . LEU A 1 87  ? -1.365  -7.711  -11.092 1.00 0.00 ? 87  LEU A HD23 2  
ATOM 3083  N N    . VAL A 1 88  ? 3.355   -8.930  -9.286  1.00 0.00 ? 88  VAL A N    2  
ATOM 3084  C CA   . VAL A 1 88  ? 4.337   -9.017  -8.180  1.00 0.00 ? 88  VAL A CA   2  
ATOM 3085  C C    . VAL A 1 88  ? 5.738   -9.292  -8.724  1.00 0.00 ? 88  VAL A C    2  
ATOM 3086  O O    . VAL A 1 88  ? 6.730   -8.915  -8.134  1.00 0.00 ? 88  VAL A O    2  
ATOM 3087  C CB   . VAL A 1 88  ? 3.943   -10.175 -7.299  1.00 0.00 ? 88  VAL A CB   2  
ATOM 3088  C CG1  . VAL A 1 88  ? 2.617   -9.872  -6.597  1.00 0.00 ? 88  VAL A CG1  2  
ATOM 3089  C CG2  . VAL A 1 88  ? 3.795   -11.420 -8.173  1.00 0.00 ? 88  VAL A CG2  2  
ATOM 3090  H H    . VAL A 1 88  ? 2.472   -9.338  -9.183  1.00 0.00 ? 88  VAL A H    2  
ATOM 3091  H HA   . VAL A 1 88  ? 4.333   -8.103  -7.605  1.00 0.00 ? 88  VAL A HA   2  
ATOM 3092  H HB   . VAL A 1 88  ? 4.711   -10.331 -6.579  1.00 0.00 ? 88  VAL A HB   2  
ATOM 3093  H HG11 . VAL A 1 88  ? 2.591   -8.831  -6.312  1.00 0.00 ? 88  VAL A HG11 2  
ATOM 3094  H HG12 . VAL A 1 88  ? 2.527   -10.490 -5.716  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 3095  H HG13 . VAL A 1 88  ? 1.799   -10.082 -7.270  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 3096  H HG21 . VAL A 1 88  ? 2.941   -11.991 -7.846  1.00 0.00 ? 88  VAL A HG21 2  
ATOM 3097  H HG22 . VAL A 1 88  ? 4.687   -12.023 -8.095  1.00 0.00 ? 88  VAL A HG22 2  
ATOM 3098  H HG23 . VAL A 1 88  ? 3.654   -11.119 -9.202  1.00 0.00 ? 88  VAL A HG23 2  
ATOM 3099  N N    . GLU A 1 89  ? 5.827   -9.963  -9.835  1.00 0.00 ? 89  GLU A N    2  
ATOM 3100  C CA   . GLU A 1 89  ? 7.166   -10.280 -10.403 1.00 0.00 ? 89  GLU A CA   2  
ATOM 3101  C C    . GLU A 1 89  ? 7.963   -8.984  -10.525 1.00 0.00 ? 89  GLU A C    2  
ATOM 3102  O O    . GLU A 1 89  ? 9.053   -8.866  -10.001 1.00 0.00 ? 89  GLU A O    2  
ATOM 3103  C CB   . GLU A 1 89  ? 6.997   -10.915 -11.786 1.00 0.00 ? 89  GLU A CB   2  
ATOM 3104  C CG   . GLU A 1 89  ? 8.372   -11.247 -12.370 1.00 0.00 ? 89  GLU A CG   2  
ATOM 3105  C CD   . GLU A 1 89  ? 8.236   -11.522 -13.868 1.00 0.00 ? 89  GLU A CD   2  
ATOM 3106  O OE1  . GLU A 1 89  ? 8.082   -10.570 -14.615 1.00 0.00 ? 89  GLU A OE1  2  
ATOM 3107  O OE2  . GLU A 1 89  ? 8.289   -12.682 -14.245 1.00 0.00 ? 89  GLU A OE2  2  
ATOM 3108  H H    . GLU A 1 89  ? 5.015   -10.274 -10.280 1.00 0.00 ? 89  GLU A H    2  
ATOM 3109  H HA   . GLU A 1 89  ? 7.685   -10.965 -9.749  1.00 0.00 ? 89  GLU A HA   2  
ATOM 3110  H HB2  . GLU A 1 89  ? 6.415   -11.822 -11.697 1.00 0.00 ? 89  GLU A HB2  2  
ATOM 3111  H HB3  . GLU A 1 89  ? 6.488   -10.223 -12.440 1.00 0.00 ? 89  GLU A HB3  2  
ATOM 3112  H HG2  . GLU A 1 89  ? 9.039   -10.411 -12.216 1.00 0.00 ? 89  GLU A HG2  2  
ATOM 3113  H HG3  . GLU A 1 89  ? 8.769   -12.123 -11.879 1.00 0.00 ? 89  GLU A HG3  2  
ATOM 3114  N N    . GLN A 1 90  ? 7.422   -7.999  -11.183 1.00 0.00 ? 90  GLN A N    2  
ATOM 3115  C CA   . GLN A 1 90  ? 8.149   -6.709  -11.296 1.00 0.00 ? 90  GLN A CA   2  
ATOM 3116  C C    . GLN A 1 90  ? 8.051   -5.982  -9.951  1.00 0.00 ? 90  GLN A C    2  
ATOM 3117  O O    . GLN A 1 90  ? 8.763   -5.032  -9.692  1.00 0.00 ? 90  GLN A O    2  
ATOM 3118  C CB   . GLN A 1 90  ? 7.517   -5.852  -12.394 1.00 0.00 ? 90  GLN A CB   2  
ATOM 3119  C CG   . GLN A 1 90  ? 8.528   -5.641  -13.522 1.00 0.00 ? 90  GLN A CG   2  
ATOM 3120  C CD   . GLN A 1 90  ? 8.480   -6.831  -14.481 1.00 0.00 ? 90  GLN A CD   2  
ATOM 3121  O OE1  . GLN A 1 90  ? 7.600   -7.665  -14.390 1.00 0.00 ? 90  GLN A OE1  2  
ATOM 3122  N NE2  . GLN A 1 90  ? 9.395   -6.950  -15.404 1.00 0.00 ? 90  GLN A NE2  2  
ATOM 3123  H H    . GLN A 1 90  ? 6.533   -8.101  -11.582 1.00 0.00 ? 90  GLN A H    2  
ATOM 3124  H HA   . GLN A 1 90  ? 9.187   -6.897  -11.531 1.00 0.00 ? 90  GLN A HA   2  
ATOM 3125  H HB2  . GLN A 1 90  ? 6.640   -6.352  -12.782 1.00 0.00 ? 90  GLN A HB2  2  
ATOM 3126  H HB3  . GLN A 1 90  ? 7.233   -4.894  -11.984 1.00 0.00 ? 90  GLN A HB3  2  
ATOM 3127  H HG2  . GLN A 1 90  ? 8.284   -4.736  -14.059 1.00 0.00 ? 90  GLN A HG2  2  
ATOM 3128  H HG3  . GLN A 1 90  ? 9.520   -5.555  -13.105 1.00 0.00 ? 90  GLN A HG3  2  
ATOM 3129  H HE21 . GLN A 1 90  ? 10.105  -6.278  -15.478 1.00 0.00 ? 90  GLN A HE21 2  
ATOM 3130  H HE22 . GLN A 1 90  ? 9.373   -7.710  -16.023 1.00 0.00 ? 90  GLN A HE22 2  
ATOM 3131  N N    . ALA A 1 91  ? 7.170   -6.430  -9.090  1.00 0.00 ? 91  ALA A N    2  
ATOM 3132  C CA   . ALA A 1 91  ? 7.019   -5.775  -7.759  1.00 0.00 ? 91  ALA A CA   2  
ATOM 3133  C C    . ALA A 1 91  ? 8.236   -6.089  -6.886  1.00 0.00 ? 91  ALA A C    2  
ATOM 3134  O O    . ALA A 1 91  ? 8.549   -5.367  -5.961  1.00 0.00 ? 91  ALA A O    2  
ATOM 3135  C CB   . ALA A 1 91  ? 5.755   -6.288  -7.069  1.00 0.00 ? 91  ALA A CB   2  
ATOM 3136  H H    . ALA A 1 91  ? 6.608   -7.198  -9.321  1.00 0.00 ? 91  ALA A H    2  
ATOM 3137  H HA   . ALA A 1 91  ? 6.939   -4.714  -7.892  1.00 0.00 ? 91  ALA A HA   2  
ATOM 3138  H HB1  . ALA A 1 91  ? 4.907   -6.154  -7.724  1.00 0.00 ? 91  ALA A HB1  2  
ATOM 3139  H HB2  . ALA A 1 91  ? 5.594   -5.732  -6.156  1.00 0.00 ? 91  ALA A HB2  2  
ATOM 3140  H HB3  . ALA A 1 91  ? 5.870   -7.335  -6.836  1.00 0.00 ? 91  ALA A HB3  2  
ATOM 3141  N N    . PHE A 1 92  ? 8.923   -7.161  -7.170  1.00 0.00 ? 92  PHE A N    2  
ATOM 3142  C CA   . PHE A 1 92  ? 10.115  -7.516  -6.350  1.00 0.00 ? 92  PHE A CA   2  
ATOM 3143  C C    . PHE A 1 92  ? 11.363  -6.868  -6.951  1.00 0.00 ? 92  PHE A C    2  
ATOM 3144  O O    . PHE A 1 92  ? 12.427  -6.888  -6.366  1.00 0.00 ? 92  PHE A O    2  
ATOM 3145  C CB   . PHE A 1 92  ? 10.285  -9.036  -6.329  1.00 0.00 ? 92  PHE A CB   2  
ATOM 3146  C CG   . PHE A 1 92  ? 9.157   -9.657  -5.543  1.00 0.00 ? 92  PHE A CG   2  
ATOM 3147  C CD1  . PHE A 1 92  ? 9.147   -9.566  -4.146  1.00 0.00 ? 92  PHE A CD1  2  
ATOM 3148  C CD2  . PHE A 1 92  ? 8.121   -10.324 -6.208  1.00 0.00 ? 92  PHE A CD2  2  
ATOM 3149  C CE1  . PHE A 1 92  ? 8.102   -10.142 -3.414  1.00 0.00 ? 92  PHE A CE1  2  
ATOM 3150  C CE2  . PHE A 1 92  ? 7.076   -10.900 -5.476  1.00 0.00 ? 92  PHE A CE2  2  
ATOM 3151  C CZ   . PHE A 1 92  ? 7.067   -10.809 -4.079  1.00 0.00 ? 92  PHE A CZ   2  
ATOM 3152  H H    . PHE A 1 92  ? 8.654   -7.733  -7.918  1.00 0.00 ? 92  PHE A H    2  
ATOM 3153  H HA   . PHE A 1 92  ? 9.976   -7.158  -5.341  1.00 0.00 ? 92  PHE A HA   2  
ATOM 3154  H HB2  . PHE A 1 92  ? 10.270  -9.414  -7.341  1.00 0.00 ? 92  PHE A HB2  2  
ATOM 3155  H HB3  . PHE A 1 92  ? 11.227  -9.287  -5.866  1.00 0.00 ? 92  PHE A HB3  2  
ATOM 3156  H HD1  . PHE A 1 92  ? 9.946   -9.051  -3.633  1.00 0.00 ? 92  PHE A HD1  2  
ATOM 3157  H HD2  . PHE A 1 92  ? 8.129   -10.394 -7.286  1.00 0.00 ? 92  PHE A HD2  2  
ATOM 3158  H HE1  . PHE A 1 92  ? 8.096   -10.072 -2.337  1.00 0.00 ? 92  PHE A HE1  2  
ATOM 3159  H HE2  . PHE A 1 92  ? 6.276   -11.415 -5.989  1.00 0.00 ? 92  PHE A HE2  2  
ATOM 3160  H HZ   . PHE A 1 92  ? 6.261   -11.253 -3.514  1.00 0.00 ? 92  PHE A HZ   2  
ATOM 3161  N N    . ARG A 1 93  ? 11.243  -6.290  -8.115  1.00 0.00 ? 93  ARG A N    2  
ATOM 3162  C CA   . ARG A 1 93  ? 12.427  -5.639  -8.746  1.00 0.00 ? 93  ARG A CA   2  
ATOM 3163  C C    . ARG A 1 93  ? 11.972  -4.419  -9.549  1.00 0.00 ? 93  ARG A C    2  
ATOM 3164  O O    . ARG A 1 93  ? 11.019  -4.476  -10.301 1.00 0.00 ? 93  ARG A O    2  
ATOM 3165  C CB   . ARG A 1 93  ? 13.133  -6.630  -9.676  1.00 0.00 ? 93  ARG A CB   2  
ATOM 3166  C CG   . ARG A 1 93  ? 12.129  -7.652  -10.208 1.00 0.00 ? 93  ARG A CG   2  
ATOM 3167  C CD   . ARG A 1 93  ? 12.276  -8.963  -9.434  1.00 0.00 ? 93  ARG A CD   2  
ATOM 3168  N NE   . ARG A 1 93  ? 12.092  -10.111 -10.363 1.00 0.00 ? 93  ARG A NE   2  
ATOM 3169  C CZ   . ARG A 1 93  ? 13.055  -10.975 -10.535 1.00 0.00 ? 93  ARG A CZ   2  
ATOM 3170  N NH1  . ARG A 1 93  ? 13.474  -11.694 -9.529  1.00 0.00 ? 93  ARG A NH1  2  
ATOM 3171  N NH2  . ARG A 1 93  ? 13.601  -11.117 -11.711 1.00 0.00 ? 93  ARG A NH2  2  
ATOM 3172  H H    . ARG A 1 93  ? 10.375  -6.281  -8.572  1.00 0.00 ? 93  ARG A H    2  
ATOM 3173  H HA   . ARG A 1 93  ? 13.112  -5.323  -7.974  1.00 0.00 ? 93  ARG A HA   2  
ATOM 3174  H HB2  . ARG A 1 93  ? 13.571  -6.092  -10.505 1.00 0.00 ? 93  ARG A HB2  2  
ATOM 3175  H HB3  . ARG A 1 93  ? 13.911  -7.142  -9.130  1.00 0.00 ? 93  ARG A HB3  2  
ATOM 3176  H HG2  . ARG A 1 93  ? 11.126  -7.270  -10.085 1.00 0.00 ? 93  ARG A HG2  2  
ATOM 3177  H HG3  . ARG A 1 93  ? 12.320  -7.833  -11.256 1.00 0.00 ? 93  ARG A HG3  2  
ATOM 3178  H HD2  . ARG A 1 93  ? 13.260  -9.011  -8.990  1.00 0.00 ? 93  ARG A HD2  2  
ATOM 3179  H HD3  . ARG A 1 93  ? 11.530  -9.005  -8.655  1.00 0.00 ? 93  ARG A HD3  2  
ATOM 3180  H HE   . ARG A 1 93  ? 11.247  -10.218 -10.849 1.00 0.00 ? 93  ARG A HE   2  
ATOM 3181  H HH11 . ARG A 1 93  ? 13.057  -11.584 -8.628  1.00 0.00 ? 93  ARG A HH11 2  
ATOM 3182  H HH12 . ARG A 1 93  ? 14.213  -12.355 -9.661  1.00 0.00 ? 93  ARG A HH12 2  
ATOM 3183  H HH21 . ARG A 1 93  ? 13.280  -10.566 -12.481 1.00 0.00 ? 93  ARG A HH21 2  
ATOM 3184  H HH22 . ARG A 1 93  ? 14.339  -11.779 -11.842 1.00 0.00 ? 93  ARG A HH22 2  
ATOM 3185  N N    . LYS A 1 94  ? 12.651  -3.315  -9.394  1.00 0.00 ? 94  LYS A N    2  
ATOM 3186  C CA   . LYS A 1 94  ? 12.265  -2.088  -10.146 1.00 0.00 ? 94  LYS A CA   2  
ATOM 3187  C C    . LYS A 1 94  ? 13.507  -1.492  -10.813 1.00 0.00 ? 94  LYS A C    2  
ATOM 3188  O O    . LYS A 1 94  ? 13.740  -1.678  -11.990 1.00 0.00 ? 94  LYS A O    2  
ATOM 3189  C CB   . LYS A 1 94  ? 11.662  -1.067  -9.179  1.00 0.00 ? 94  LYS A CB   2  
ATOM 3190  C CG   . LYS A 1 94  ? 11.380  0.242   -9.920  1.00 0.00 ? 94  LYS A CG   2  
ATOM 3191  C CD   . LYS A 1 94  ? 9.950   0.229   -10.462 1.00 0.00 ? 94  LYS A CD   2  
ATOM 3192  C CE   . LYS A 1 94  ? 9.962   -0.200  -11.930 1.00 0.00 ? 94  LYS A CE   2  
ATOM 3193  N NZ   . LYS A 1 94  ? 9.879   1.005   -12.801 1.00 0.00 ? 94  LYS A NZ   2  
ATOM 3194  H H    . LYS A 1 94  ? 13.416  -3.295  -8.782  1.00 0.00 ? 94  LYS A H    2  
ATOM 3195  H HA   . LYS A 1 94  ? 11.536  -2.343  -10.900 1.00 0.00 ? 94  LYS A HA   2  
ATOM 3196  H HB2  . LYS A 1 94  ? 10.740  -1.457  -8.775  1.00 0.00 ? 94  LYS A HB2  2  
ATOM 3197  H HB3  . LYS A 1 94  ? 12.357  -0.879  -8.373  1.00 0.00 ? 94  LYS A HB3  2  
ATOM 3198  H HG2  . LYS A 1 94  ? 11.500  1.073   -9.241  1.00 0.00 ? 94  LYS A HG2  2  
ATOM 3199  H HG3  . LYS A 1 94  ? 12.072  0.349   -10.742 1.00 0.00 ? 94  LYS A HG3  2  
ATOM 3200  H HD2  . LYS A 1 94  ? 9.354   -0.467  -9.887  1.00 0.00 ? 94  LYS A HD2  2  
ATOM 3201  H HD3  . LYS A 1 94  ? 9.524   1.218   -10.382 1.00 0.00 ? 94  LYS A HD3  2  
ATOM 3202  H HE2  . LYS A 1 94  ? 10.878  -0.733  -12.141 1.00 0.00 ? 94  LYS A HE2  2  
ATOM 3203  H HE3  . LYS A 1 94  ? 9.118   -0.845  -12.125 1.00 0.00 ? 94  LYS A HE3  2  
ATOM 3204  H HZ1  . LYS A 1 94  ? 9.227   0.821   -13.589 1.00 0.00 ? 94  LYS A HZ1  2  
ATOM 3205  H HZ2  . LYS A 1 94  ? 10.823  1.229   -13.176 1.00 0.00 ? 94  LYS A HZ2  2  
ATOM 3206  H HZ3  . LYS A 1 94  ? 9.527   1.812   -12.246 1.00 0.00 ? 94  LYS A HZ3  2  
ATOM 3207  N N    . ARG A 1 95  ? 14.306  -0.779  -10.067 1.00 0.00 ? 95  ARG A N    2  
ATOM 3208  C CA   . ARG A 1 95  ? 15.533  -0.173  -10.659 1.00 0.00 ? 95  ARG A CA   2  
ATOM 3209  C C    . ARG A 1 95  ? 16.753  -1.011  -10.265 1.00 0.00 ? 95  ARG A C    2  
ATOM 3210  O O    . ARG A 1 95  ? 16.691  -1.833  -9.372  1.00 0.00 ? 95  ARG A O    2  
ATOM 3211  C CB   . ARG A 1 95  ? 15.703  1.253   -10.133 1.00 0.00 ? 95  ARG A CB   2  
ATOM 3212  C CG   . ARG A 1 95  ? 14.342  1.955   -10.106 1.00 0.00 ? 95  ARG A CG   2  
ATOM 3213  C CD   . ARG A 1 95  ? 13.862  2.193   -11.539 1.00 0.00 ? 95  ARG A CD   2  
ATOM 3214  N NE   . ARG A 1 95  ? 14.081  3.621   -11.905 1.00 0.00 ? 95  ARG A NE   2  
ATOM 3215  C CZ   . ARG A 1 95  ? 13.848  4.024   -13.124 1.00 0.00 ? 95  ARG A CZ   2  
ATOM 3216  N NH1  . ARG A 1 95  ? 14.409  3.413   -14.132 1.00 0.00 ? 95  ARG A NH1  2  
ATOM 3217  N NH2  . ARG A 1 95  ? 13.054  5.038   -13.336 1.00 0.00 ? 95  ARG A NH2  2  
ATOM 3218  H H    . ARG A 1 95  ? 14.101  -0.641  -9.119  1.00 0.00 ? 95  ARG A H    2  
ATOM 3219  H HA   . ARG A 1 95  ? 15.443  -0.153  -11.735 1.00 0.00 ? 95  ARG A HA   2  
ATOM 3220  H HB2  . ARG A 1 95  ? 16.111  1.222   -9.133  1.00 0.00 ? 95  ARG A HB2  2  
ATOM 3221  H HB3  . ARG A 1 95  ? 16.373  1.798   -10.779 1.00 0.00 ? 95  ARG A HB3  2  
ATOM 3222  H HG2  . ARG A 1 95  ? 13.629  1.334   -9.585  1.00 0.00 ? 95  ARG A HG2  2  
ATOM 3223  H HG3  . ARG A 1 95  ? 14.436  2.902   -9.597  1.00 0.00 ? 95  ARG A HG3  2  
ATOM 3224  H HD2  . ARG A 1 95  ? 14.416  1.560   -12.215 1.00 0.00 ? 95  ARG A HD2  2  
ATOM 3225  H HD3  . ARG A 1 95  ? 12.810  1.960   -11.608 1.00 0.00 ? 95  ARG A HD3  2  
ATOM 3226  H HE   . ARG A 1 95  ? 14.399  4.257   -11.230 1.00 0.00 ? 95  ARG A HE   2  
ATOM 3227  H HH11 . ARG A 1 95  ? 15.017  2.636   -13.968 1.00 0.00 ? 95  ARG A HH11 2  
ATOM 3228  H HH12 . ARG A 1 95  ? 14.232  3.723   -15.066 1.00 0.00 ? 95  ARG A HH12 2  
ATOM 3229  H HH21 . ARG A 1 95  ? 12.624  5.507   -12.564 1.00 0.00 ? 95  ARG A HH21 2  
ATOM 3230  H HH22 . ARG A 1 95  ? 12.877  5.347   -14.271 1.00 0.00 ? 95  ARG A HH22 2  
ATOM 3231  N N    . ARG A 1 96  ? 17.863  -0.808  -10.922 1.00 0.00 ? 96  ARG A N    2  
ATOM 3232  C CA   . ARG A 1 96  ? 19.084  -1.594  -10.582 1.00 0.00 ? 96  ARG A CA   2  
ATOM 3233  C C    . ARG A 1 96  ? 20.320  -0.884  -11.138 1.00 0.00 ? 96  ARG A C    2  
ATOM 3234  O O    . ARG A 1 96  ? 21.252  -0.585  -10.418 1.00 0.00 ? 96  ARG A O    2  
ATOM 3235  C CB   . ARG A 1 96  ? 18.979  -2.992  -11.195 1.00 0.00 ? 96  ARG A CB   2  
ATOM 3236  C CG   . ARG A 1 96  ? 18.395  -3.957  -10.163 1.00 0.00 ? 96  ARG A CG   2  
ATOM 3237  C CD   . ARG A 1 96  ? 18.879  -5.378  -10.457 1.00 0.00 ? 96  ARG A CD   2  
ATOM 3238  N NE   . ARG A 1 96  ? 17.748  -6.332  -10.280 1.00 0.00 ? 96  ARG A NE   2  
ATOM 3239  C CZ   . ARG A 1 96  ? 17.759  -7.180  -9.288  1.00 0.00 ? 96  ARG A CZ   2  
ATOM 3240  N NH1  . ARG A 1 96  ? 17.692  -6.746  -8.058  1.00 0.00 ? 96  ARG A NH1  2  
ATOM 3241  N NH2  . ARG A 1 96  ? 17.835  -8.460  -9.523  1.00 0.00 ? 96  ARG A NH2  2  
ATOM 3242  H H    . ARG A 1 96  ? 17.893  -0.141  -11.638 1.00 0.00 ? 96  ARG A H    2  
ATOM 3243  H HA   . ARG A 1 96  ? 19.170  -1.677  -9.508  1.00 0.00 ? 96  ARG A HA   2  
ATOM 3244  H HB2  . ARG A 1 96  ? 18.338  -2.957  -12.064 1.00 0.00 ? 96  ARG A HB2  2  
ATOM 3245  H HB3  . ARG A 1 96  ? 19.962  -3.331  -11.486 1.00 0.00 ? 96  ARG A HB3  2  
ATOM 3246  H HG2  . ARG A 1 96  ? 18.716  -3.664  -9.174  1.00 0.00 ? 96  ARG A HG2  2  
ATOM 3247  H HG3  . ARG A 1 96  ? 17.317  -3.928  -10.214 1.00 0.00 ? 96  ARG A HG3  2  
ATOM 3248  H HD2  . ARG A 1 96  ? 19.241  -5.433  -11.472 1.00 0.00 ? 96  ARG A HD2  2  
ATOM 3249  H HD3  . ARG A 1 96  ? 19.675  -5.635  -9.774  1.00 0.00 ? 96  ARG A HD3  2  
ATOM 3250  H HE   . ARG A 1 96  ? 16.995  -6.321  -10.908 1.00 0.00 ? 96  ARG A HE   2  
ATOM 3251  H HH11 . ARG A 1 96  ? 17.632  -5.766  -7.875  1.00 0.00 ? 96  ARG A HH11 2  
ATOM 3252  H HH12 . ARG A 1 96  ? 17.701  -7.396  -7.298  1.00 0.00 ? 96  ARG A HH12 2  
ATOM 3253  H HH21 . ARG A 1 96  ? 17.887  -8.793  -10.465 1.00 0.00 ? 96  ARG A HH21 2  
ATOM 3254  H HH22 . ARG A 1 96  ? 17.844  -9.109  -8.762  1.00 0.00 ? 96  ARG A HH22 2  
ATOM 3255  N N    . GLN A 1 97  ? 20.335  -0.611  -12.413 1.00 0.00 ? 97  GLN A N    2  
ATOM 3256  C CA   . GLN A 1 97  ? 21.514  0.079   -13.012 1.00 0.00 ? 97  GLN A CA   2  
ATOM 3257  C C    . GLN A 1 97  ? 21.394  1.585   -12.777 1.00 0.00 ? 97  GLN A C    2  
ATOM 3258  O O    . GLN A 1 97  ? 20.487  2.050   -12.115 1.00 0.00 ? 97  GLN A O    2  
ATOM 3259  C CB   . GLN A 1 97  ? 21.565  -0.195  -14.518 1.00 0.00 ? 97  GLN A CB   2  
ATOM 3260  C CG   . GLN A 1 97  ? 22.285  -1.520  -14.772 1.00 0.00 ? 97  GLN A CG   2  
ATOM 3261  C CD   . GLN A 1 97  ? 23.645  -1.244  -15.416 1.00 0.00 ? 97  GLN A CD   2  
ATOM 3262  O OE1  . GLN A 1 97  ? 23.741  -0.483  -16.358 1.00 0.00 ? 97  GLN A OE1  2  
ATOM 3263  N NE2  . GLN A 1 97  ? 24.709  -1.835  -14.944 1.00 0.00 ? 97  GLN A NE2  2  
ATOM 3264  H H    . GLN A 1 97  ? 19.573  -0.861  -12.976 1.00 0.00 ? 97  GLN A H    2  
ATOM 3265  H HA   . GLN A 1 97  ? 22.418  -0.286  -12.550 1.00 0.00 ? 97  GLN A HA   2  
ATOM 3266  H HB2  . GLN A 1 97  ? 20.560  -0.248  -14.913 1.00 0.00 ? 97  GLN A HB2  2  
ATOM 3267  H HB3  . GLN A 1 97  ? 22.101  0.602   -15.010 1.00 0.00 ? 97  GLN A HB3  2  
ATOM 3268  H HG2  . GLN A 1 97  ? 22.427  -2.037  -13.833 1.00 0.00 ? 97  GLN A HG2  2  
ATOM 3269  H HG3  . GLN A 1 97  ? 21.692  -2.131  -15.435 1.00 0.00 ? 97  GLN A HG3  2  
ATOM 3270  H HE21 . GLN A 1 97  ? 24.633  -2.448  -14.184 1.00 0.00 ? 97  GLN A HE21 2  
ATOM 3271  H HE22 . GLN A 1 97  ? 25.584  -1.663  -15.351 1.00 0.00 ? 97  GLN A HE22 2  
ATOM 3272  N N    . ARG A 1 98  ? 22.302  2.351   -13.316 1.00 0.00 ? 98  ARG A N    2  
ATOM 3273  C CA   . ARG A 1 98  ? 22.243  3.827   -13.125 1.00 0.00 ? 98  ARG A CA   2  
ATOM 3274  C C    . ARG A 1 98  ? 21.842  4.495   -14.442 1.00 0.00 ? 98  ARG A C    2  
ATOM 3275  O O    . ARG A 1 98  ? 22.331  4.148   -15.499 1.00 0.00 ? 98  ARG A O    2  
ATOM 3276  C CB   . ARG A 1 98  ? 23.617  4.340   -12.691 1.00 0.00 ? 98  ARG A CB   2  
ATOM 3277  C CG   . ARG A 1 98  ? 24.149  3.477   -11.547 1.00 0.00 ? 98  ARG A CG   2  
ATOM 3278  C CD   . ARG A 1 98  ? 25.554  2.979   -11.892 1.00 0.00 ? 98  ARG A CD   2  
ATOM 3279  N NE   . ARG A 1 98  ? 26.503  4.128   -11.878 1.00 0.00 ? 98  ARG A NE   2  
ATOM 3280  C CZ   . ARG A 1 98  ? 26.957  4.613   -13.001 1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3281  N NH1  . ARG A 1 98  ? 27.638  3.850   -13.812 1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3282  N NH2  . ARG A 1 98  ? 26.730  5.859   -13.312 1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3283  H H    . ARG A 1 98  ? 23.025  1.955   -13.847 1.00 0.00 ? 98  ARG A H    2  
ATOM 3284  H HA   . ARG A 1 98  ? 21.514  4.063   -12.364 1.00 0.00 ? 98  ARG A HA   2  
ATOM 3285  H HB2  . ARG A 1 98  ? 24.299  4.291   -13.527 1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3286  H HB3  . ARG A 1 98  ? 23.531  5.364   -12.357 1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3287  H HG2  . ARG A 1 98  ? 24.187  4.065   -10.641 1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3288  H HG3  . ARG A 1 98  ? 23.495  2.630   -11.400 1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3289  H HD2  . ARG A 1 98  ? 25.866  2.246   -11.163 1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3290  H HD3  . ARG A 1 98  ? 25.546  2.529   -12.874 1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3291  H HE   . ARG A 1 98  ? 26.786  4.520   -11.026 1.00 0.00 ? 98  ARG A HE   2  
ATOM 3292  H HH11 . ARG A 1 98  ? 27.810  2.895   -13.572 1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3293  H HH12 . ARG A 1 98  ? 27.985  4.221   -14.673 1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3294  H HH21 . ARG A 1 98  ? 26.209  6.444   -12.690 1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3295  H HH22 . ARG A 1 98  ? 27.079  6.231   -14.173 1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3296  N N    . GLY A 1 99  ? 20.957  5.452   -14.387 1.00 0.00 ? 99  GLY A N    2  
ATOM 3297  C CA   . GLY A 1 99  ? 20.527  6.141   -15.637 1.00 0.00 ? 99  GLY A CA   2  
ATOM 3298  C C    . GLY A 1 99  ? 21.435  7.345   -15.891 1.00 0.00 ? 99  GLY A C    2  
ATOM 3299  O O    . GLY A 1 99  ? 22.387  7.581   -15.173 1.00 0.00 ? 99  GLY A O    2  
ATOM 3300  H H    . GLY A 1 99  ? 20.575  5.718   -13.525 1.00 0.00 ? 99  GLY A H    2  
ATOM 3301  H HA2  . GLY A 1 99  ? 20.597  5.456   -16.468 1.00 0.00 ? 99  GLY A HA2  2  
ATOM 3302  H HA3  . GLY A 1 99  ? 19.506  6.475   -15.531 1.00 0.00 ? 99  GLY A HA3  2  
ATOM 3303  N N    . VAL A 1 100 ? 21.152  8.109   -16.911 1.00 0.00 ? 100 VAL A N    2  
ATOM 3304  C CA   . VAL A 1 100 ? 22.000  9.297   -17.211 1.00 0.00 ? 100 VAL A CA   2  
ATOM 3305  C C    . VAL A 1 100 ? 21.167  10.340  -17.958 1.00 0.00 ? 100 VAL A C    2  
ATOM 3306  O O    . VAL A 1 100 ? 20.831  10.169  -19.112 1.00 0.00 ? 100 VAL A O    2  
ATOM 3307  C CB   . VAL A 1 100 ? 23.180  8.869   -18.085 1.00 0.00 ? 100 VAL A CB   2  
ATOM 3308  C CG1  . VAL A 1 100 ? 22.668  8.024   -19.253 1.00 0.00 ? 100 VAL A CG1  2  
ATOM 3309  C CG2  . VAL A 1 100 ? 23.890  10.111  -18.629 1.00 0.00 ? 100 VAL A CG2  2  
ATOM 3310  H H    . VAL A 1 100 ? 20.380  7.901   -17.479 1.00 0.00 ? 100 VAL A H    2  
ATOM 3311  H HA   . VAL A 1 100 ? 22.369  9.720   -16.288 1.00 0.00 ? 100 VAL A HA   2  
ATOM 3312  H HB   . VAL A 1 100 ? 23.872  8.285   -17.495 1.00 0.00 ? 100 VAL A HB   2  
ATOM 3313  H HG11 . VAL A 1 100 ? 23.103  8.382   -20.174 1.00 0.00 ? 100 VAL A HG11 2  
ATOM 3314  H HG12 . VAL A 1 100 ? 21.592  8.102   -19.308 1.00 0.00 ? 100 VAL A HG12 2  
ATOM 3315  H HG13 . VAL A 1 100 ? 22.948  6.992   -19.100 1.00 0.00 ? 100 VAL A HG13 2  
ATOM 3316  H HG21 . VAL A 1 100 ? 23.622  10.971  -18.031 1.00 0.00 ? 100 VAL A HG21 2  
ATOM 3317  H HG22 . VAL A 1 100 ? 23.590  10.278  -19.653 1.00 0.00 ? 100 VAL A HG22 2  
ATOM 3318  H HG23 . VAL A 1 100 ? 24.958  9.963   -18.587 1.00 0.00 ? 100 VAL A HG23 2  
ATOM 3319  N N    . SER A 1 101 ? 20.831  11.422  -17.309 1.00 0.00 ? 101 SER A N    2  
ATOM 3320  C CA   . SER A 1 101 ? 20.020  12.473  -17.986 1.00 0.00 ? 101 SER A CA   2  
ATOM 3321  C C    . SER A 1 101 ? 20.933  13.624  -18.414 1.00 0.00 ? 101 SER A C    2  
ATOM 3322  O O    . SER A 1 101 ? 21.913  13.862  -17.728 1.00 0.00 ? 101 SER A O    2  
ATOM 3323  C CB   . SER A 1 101 ? 18.956  12.998  -17.021 1.00 0.00 ? 101 SER A CB   2  
ATOM 3324  O OG   . SER A 1 101 ? 18.244  11.902  -16.463 1.00 0.00 ? 101 SER A OG   2  
ATOM 3325  O OXT  . SER A 1 101 ? 20.635  14.248  -19.419 1.00 0.00 ? 101 SER A OXT  2  
ATOM 3326  H H    . SER A 1 101 ? 21.112  11.543  -16.378 1.00 0.00 ? 101 SER A H    2  
ATOM 3327  H HA   . SER A 1 101 ? 19.539  12.052  -18.857 1.00 0.00 ? 101 SER A HA   2  
ATOM 3328  H HB2  . SER A 1 101 ? 19.430  13.553  -16.228 1.00 0.00 ? 101 SER A HB2  2  
ATOM 3329  H HB3  . SER A 1 101 ? 18.277  13.648  -17.556 1.00 0.00 ? 101 SER A HB3  2  
ATOM 3330  H HG   . SER A 1 101 ? 17.761  11.470  -17.172 1.00 0.00 ? 101 SER A HG   2  
ATOM 3331  N N    . GLU A 1 1   ? 15.294  15.381  -7.756  1.00 0.00 ? 1   GLU A N    3  
ATOM 3332  C CA   . GLU A 1 1   ? 15.239  13.923  -8.061  1.00 0.00 ? 1   GLU A CA   3  
ATOM 3333  C C    . GLU A 1 1   ? 15.385  13.125  -6.764  1.00 0.00 ? 1   GLU A C    3  
ATOM 3334  O O    . GLU A 1 1   ? 16.265  12.298  -6.628  1.00 0.00 ? 1   GLU A O    3  
ATOM 3335  C CB   . GLU A 1 1   ? 16.380  13.561  -9.014  1.00 0.00 ? 1   GLU A CB   3  
ATOM 3336  C CG   . GLU A 1 1   ? 15.812  13.269  -10.404 1.00 0.00 ? 1   GLU A CG   3  
ATOM 3337  C CD   . GLU A 1 1   ? 15.523  11.773  -10.535 1.00 0.00 ? 1   GLU A CD   3  
ATOM 3338  O OE1  . GLU A 1 1   ? 14.672  11.289  -9.807  1.00 0.00 ? 1   GLU A OE1  3  
ATOM 3339  O OE2  . GLU A 1 1   ? 16.159  11.136  -11.358 1.00 0.00 ? 1   GLU A OE2  3  
ATOM 3340  H H1   . GLU A 1 1   ? 14.694  15.586  -6.932  1.00 0.00 ? 1   GLU A H1   3  
ATOM 3341  H H2   . GLU A 1 1   ? 14.952  15.920  -8.578  1.00 0.00 ? 1   GLU A H2   3  
ATOM 3342  H H3   . GLU A 1 1   ? 16.275  15.655  -7.545  1.00 0.00 ? 1   GLU A H3   3  
ATOM 3343  H HA   . GLU A 1 1   ? 14.293  13.687  -8.525  1.00 0.00 ? 1   GLU A HA   3  
ATOM 3344  H HB2  . GLU A 1 1   ? 17.075  14.385  -9.074  1.00 0.00 ? 1   GLU A HB2  3  
ATOM 3345  H HB3  . GLU A 1 1   ? 16.892  12.684  -8.646  1.00 0.00 ? 1   GLU A HB3  3  
ATOM 3346  H HG2  . GLU A 1 1   ? 14.897  13.827  -10.544 1.00 0.00 ? 1   GLU A HG2  3  
ATOM 3347  H HG3  . GLU A 1 1   ? 16.530  13.561  -11.156 1.00 0.00 ? 1   GLU A HG3  3  
ATOM 3348  N N    . SER A 1 2   ? 14.531  13.368  -5.807  1.00 0.00 ? 2   SER A N    3  
ATOM 3349  C CA   . SER A 1 2   ? 14.623  12.622  -4.520  1.00 0.00 ? 2   SER A CA   3  
ATOM 3350  C C    . SER A 1 2   ? 13.408  11.705  -4.367  1.00 0.00 ? 2   SER A C    3  
ATOM 3351  O O    . SER A 1 2   ? 12.764  11.683  -3.340  1.00 0.00 ? 2   SER A O    3  
ATOM 3352  C CB   . SER A 1 2   ? 14.660  13.616  -3.358  1.00 0.00 ? 2   SER A CB   3  
ATOM 3353  O OG   . SER A 1 2   ? 13.345  14.089  -3.103  1.00 0.00 ? 2   SER A OG   3  
ATOM 3354  H H    . SER A 1 2   ? 13.828  14.039  -5.935  1.00 0.00 ? 2   SER A H    3  
ATOM 3355  H HA   . SER A 1 2   ? 15.525  12.029  -4.513  1.00 0.00 ? 2   SER A HA   3  
ATOM 3356  H HB2  . SER A 1 2   ? 15.039  13.128  -2.475  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3357  H HB3  . SER A 1 2   ? 15.309  14.444  -3.614  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3358  H HG   . SER A 1 2   ? 12.962  14.365  -3.939  1.00 0.00 ? 2   SER A HG   3  
ATOM 3359  N N    . LYS A 1 3   ? 13.090  10.946  -5.381  1.00 0.00 ? 3   LYS A N    3  
ATOM 3360  C CA   . LYS A 1 3   ? 11.915  10.030  -5.286  1.00 0.00 ? 3   LYS A CA   3  
ATOM 3361  C C    . LYS A 1 3   ? 12.171  8.786   -6.143  1.00 0.00 ? 3   LYS A C    3  
ATOM 3362  O O    . LYS A 1 3   ? 11.692  8.695   -7.256  1.00 0.00 ? 3   LYS A O    3  
ATOM 3363  C CB   . LYS A 1 3   ? 10.661  10.747  -5.789  1.00 0.00 ? 3   LYS A CB   3  
ATOM 3364  C CG   . LYS A 1 3   ? 9.523   10.555  -4.784  1.00 0.00 ? 3   LYS A CG   3  
ATOM 3365  C CD   . LYS A 1 3   ? 8.179   10.646  -5.509  1.00 0.00 ? 3   LYS A CD   3  
ATOM 3366  C CE   . LYS A 1 3   ? 7.851   12.111  -5.798  1.00 0.00 ? 3   LYS A CE   3  
ATOM 3367  N NZ   . LYS A 1 3   ? 6.375   12.313  -5.739  1.00 0.00 ? 3   LYS A NZ   3  
ATOM 3368  H H    . LYS A 1 3   ? 13.622  10.976  -6.203  1.00 0.00 ? 3   LYS A H    3  
ATOM 3369  H HA   . LYS A 1 3   ? 11.773  9.735   -4.257  1.00 0.00 ? 3   LYS A HA   3  
ATOM 3370  H HB2  . LYS A 1 3   ? 10.867  11.801  -5.900  1.00 0.00 ? 3   LYS A HB2  3  
ATOM 3371  H HB3  . LYS A 1 3   ? 10.368  10.336  -6.744  1.00 0.00 ? 3   LYS A HB3  3  
ATOM 3372  H HG2  . LYS A 1 3   ? 9.616   9.585   -4.317  1.00 0.00 ? 3   LYS A HG2  3  
ATOM 3373  H HG3  . LYS A 1 3   ? 9.575   11.325  -4.030  1.00 0.00 ? 3   LYS A HG3  3  
ATOM 3374  H HD2  . LYS A 1 3   ? 8.234   10.098  -6.440  1.00 0.00 ? 3   LYS A HD2  3  
ATOM 3375  H HD3  . LYS A 1 3   ? 7.404   10.222  -4.888  1.00 0.00 ? 3   LYS A HD3  3  
ATOM 3376  H HE2  . LYS A 1 3   ? 8.329   12.739  -5.060  1.00 0.00 ? 3   LYS A HE2  3  
ATOM 3377  H HE3  . LYS A 1 3   ? 8.212   12.375  -6.782  1.00 0.00 ? 3   LYS A HE3  3  
ATOM 3378  H HZ1  . LYS A 1 3   ? 6.165   13.184  -5.210  1.00 0.00 ? 3   LYS A HZ1  3  
ATOM 3379  H HZ2  . LYS A 1 3   ? 5.934   11.501  -5.262  1.00 0.00 ? 3   LYS A HZ2  3  
ATOM 3380  H HZ3  . LYS A 1 3   ? 5.997   12.398  -6.703  1.00 0.00 ? 3   LYS A HZ3  3  
ATOM 3381  N N    . PRO A 1 4   ? 12.927  7.863   -5.592  1.00 0.00 ? 4   PRO A N    3  
ATOM 3382  C CA   . PRO A 1 4   ? 13.284  6.595   -6.265  1.00 0.00 ? 4   PRO A CA   3  
ATOM 3383  C C    . PRO A 1 4   ? 12.373  5.378   -5.914  1.00 0.00 ? 4   PRO A C    3  
ATOM 3384  O O    . PRO A 1 4   ? 12.846  4.263   -6.006  1.00 0.00 ? 4   PRO A O    3  
ATOM 3385  C CB   . PRO A 1 4   ? 14.672  6.310   -5.687  1.00 0.00 ? 4   PRO A CB   3  
ATOM 3386  C CG   . PRO A 1 4   ? 14.740  7.044   -4.318  1.00 0.00 ? 4   PRO A CG   3  
ATOM 3387  C CD   . PRO A 1 4   ? 13.555  8.026   -4.273  1.00 0.00 ? 4   PRO A CD   3  
ATOM 3388  H HA   . PRO A 1 4   ? 13.361  6.728   -7.329  1.00 0.00 ? 4   PRO A HA   3  
ATOM 3389  H HB2  . PRO A 1 4   ? 14.802  5.245   -5.550  1.00 0.00 ? 4   PRO A HB2  3  
ATOM 3390  H HB3  . PRO A 1 4   ? 15.434  6.697   -6.344  1.00 0.00 ? 4   PRO A HB3  3  
ATOM 3391  H HG2  . PRO A 1 4   ? 14.660  6.327   -3.512  1.00 0.00 ? 4   PRO A HG2  3  
ATOM 3392  H HG3  . PRO A 1 4   ? 15.669  7.589   -4.236  1.00 0.00 ? 4   PRO A HG3  3  
ATOM 3393  H HD2  . PRO A 1 4   ? 12.867  7.755   -3.484  1.00 0.00 ? 4   PRO A HD2  3  
ATOM 3394  H HD3  . PRO A 1 4   ? 13.903  9.039   -4.146  1.00 0.00 ? 4   PRO A HD3  3  
ATOM 3395  N N    . PRO A 1 5   ? 11.123  5.566   -5.525  1.00 0.00 ? 5   PRO A N    3  
ATOM 3396  C CA   . PRO A 1 5   ? 10.252  4.422   -5.188  1.00 0.00 ? 5   PRO A CA   3  
ATOM 3397  C C    . PRO A 1 5   ? 9.772   3.710   -6.454  1.00 0.00 ? 5   PRO A C    3  
ATOM 3398  O O    . PRO A 1 5   ? 10.161  4.043   -7.555  1.00 0.00 ? 5   PRO A O    3  
ATOM 3399  C CB   . PRO A 1 5   ? 9.081   5.053   -4.436  1.00 0.00 ? 5   PRO A CB   3  
ATOM 3400  C CG   . PRO A 1 5   ? 9.049   6.537   -4.855  1.00 0.00 ? 5   PRO A CG   3  
ATOM 3401  C CD   . PRO A 1 5   ? 10.457  6.872   -5.384  1.00 0.00 ? 5   PRO A CD   3  
ATOM 3402  H HA   . PRO A 1 5   ? 10.770  3.731   -4.543  1.00 0.00 ? 5   PRO A HA   3  
ATOM 3403  H HB2  . PRO A 1 5   ? 8.156   4.567   -4.715  1.00 0.00 ? 5   PRO A HB2  3  
ATOM 3404  H HB3  . PRO A 1 5   ? 9.238   4.974   -3.374  1.00 0.00 ? 5   PRO A HB3  3  
ATOM 3405  H HG2  . PRO A 1 5   ? 8.312   6.685   -5.633  1.00 0.00 ? 5   PRO A HG2  3  
ATOM 3406  H HG3  . PRO A 1 5   ? 8.822   7.159   -4.004  1.00 0.00 ? 5   PRO A HG3  3  
ATOM 3407  H HD2  . PRO A 1 5   ? 10.383  7.366   -6.341  1.00 0.00 ? 5   PRO A HD2  3  
ATOM 3408  H HD3  . PRO A 1 5   ? 10.984  7.486   -4.672  1.00 0.00 ? 5   PRO A HD3  3  
ATOM 3409  N N    . TYR A 1 6   ? 8.934   2.721   -6.299  1.00 0.00 ? 6   TYR A N    3  
ATOM 3410  C CA   . TYR A 1 6   ? 8.433   1.970   -7.480  1.00 0.00 ? 6   TYR A CA   3  
ATOM 3411  C C    . TYR A 1 6   ? 7.320   2.751   -8.169  1.00 0.00 ? 6   TYR A C    3  
ATOM 3412  O O    . TYR A 1 6   ? 6.661   3.577   -7.568  1.00 0.00 ? 6   TYR A O    3  
ATOM 3413  C CB   . TYR A 1 6   ? 7.890   0.619   -7.017  1.00 0.00 ? 6   TYR A CB   3  
ATOM 3414  C CG   . TYR A 1 6   ? 8.805   0.048   -5.962  1.00 0.00 ? 6   TYR A CG   3  
ATOM 3415  C CD1  . TYR A 1 6   ? 10.004  -0.567  -6.340  1.00 0.00 ? 6   TYR A CD1  3  
ATOM 3416  C CD2  . TYR A 1 6   ? 8.454   0.127   -4.608  1.00 0.00 ? 6   TYR A CD2  3  
ATOM 3417  C CE1  . TYR A 1 6   ? 10.853  -1.104  -5.366  1.00 0.00 ? 6   TYR A CE1  3  
ATOM 3418  C CE2  . TYR A 1 6   ? 9.304   -0.409  -3.634  1.00 0.00 ? 6   TYR A CE2  3  
ATOM 3419  C CZ   . TYR A 1 6   ? 10.504  -1.026  -4.013  1.00 0.00 ? 6   TYR A CZ   3  
ATOM 3420  O OH   . TYR A 1 6   ? 11.340  -1.557  -3.054  1.00 0.00 ? 6   TYR A OH   3  
ATOM 3421  H H    . TYR A 1 6   ? 8.643   2.464   -5.399  1.00 0.00 ? 6   TYR A H    3  
ATOM 3422  H HA   . TYR A 1 6   ? 9.236   1.813   -8.173  1.00 0.00 ? 6   TYR A HA   3  
ATOM 3423  H HB2  . TYR A 1 6   ? 6.900   0.750   -6.605  1.00 0.00 ? 6   TYR A HB2  3  
ATOM 3424  H HB3  . TYR A 1 6   ? 7.844   -0.058  -7.858  1.00 0.00 ? 6   TYR A HB3  3  
ATOM 3425  H HD1  . TYR A 1 6   ? 10.274  -0.624  -7.383  1.00 0.00 ? 6   TYR A HD1  3  
ATOM 3426  H HD2  . TYR A 1 6   ? 7.530   0.605   -4.315  1.00 0.00 ? 6   TYR A HD2  3  
ATOM 3427  H HE1  . TYR A 1 6   ? 11.778  -1.579  -5.658  1.00 0.00 ? 6   TYR A HE1  3  
ATOM 3428  H HE2  . TYR A 1 6   ? 9.035   -0.350  -2.590  1.00 0.00 ? 6   TYR A HE2  3  
ATOM 3429  H HH   . TYR A 1 6   ? 11.280  -2.513  -3.105  1.00 0.00 ? 6   TYR A HH   3  
ATOM 3430  N N    . SER A 1 7   ? 7.094   2.488   -9.428  1.00 0.00 ? 7   SER A N    3  
ATOM 3431  C CA   . SER A 1 7   ? 6.011   3.209   -10.145 1.00 0.00 ? 7   SER A CA   3  
ATOM 3432  C C    . SER A 1 7   ? 4.755   3.135   -9.287  1.00 0.00 ? 7   SER A C    3  
ATOM 3433  O O    . SER A 1 7   ? 4.727   2.450   -8.290  1.00 0.00 ? 7   SER A O    3  
ATOM 3434  C CB   . SER A 1 7   ? 5.754   2.542   -11.498 1.00 0.00 ? 7   SER A CB   3  
ATOM 3435  O OG   . SER A 1 7   ? 6.591   3.137   -12.481 1.00 0.00 ? 7   SER A OG   3  
ATOM 3436  H H    . SER A 1 7   ? 7.629   1.812   -9.893  1.00 0.00 ? 7   SER A H    3  
ATOM 3437  H HA   . SER A 1 7   ? 6.294   4.241   -10.292 1.00 0.00 ? 7   SER A HA   3  
ATOM 3438  H HB2  . SER A 1 7   ? 5.976   1.490   -11.433 1.00 0.00 ? 7   SER A HB2  3  
ATOM 3439  H HB3  . SER A 1 7   ? 4.715   2.671   -11.769 1.00 0.00 ? 7   SER A HB3  3  
ATOM 3440  H HG   . SER A 1 7   ? 7.461   2.737   -12.411 1.00 0.00 ? 7   SER A HG   3  
ATOM 3441  N N    . TYR A 1 8   ? 3.720   3.833   -9.642  1.00 0.00 ? 8   TYR A N    3  
ATOM 3442  C CA   . TYR A 1 8   ? 2.492   3.783   -8.806  1.00 0.00 ? 8   TYR A CA   3  
ATOM 3443  C C    . TYR A 1 8   ? 1.600   2.625   -9.259  1.00 0.00 ? 8   TYR A C    3  
ATOM 3444  O O    . TYR A 1 8   ? 0.471   2.488   -8.831  1.00 0.00 ? 8   TYR A O    3  
ATOM 3445  C CB   . TYR A 1 8   ? 1.771   5.122   -8.909  1.00 0.00 ? 8   TYR A CB   3  
ATOM 3446  C CG   . TYR A 1 8   ? 2.671   6.178   -8.313  1.00 0.00 ? 8   TYR A CG   3  
ATOM 3447  C CD1  . TYR A 1 8   ? 3.315   5.928   -7.094  1.00 0.00 ? 8   TYR A CD1  3  
ATOM 3448  C CD2  . TYR A 1 8   ? 2.883   7.387   -8.982  1.00 0.00 ? 8   TYR A CD2  3  
ATOM 3449  C CE1  . TYR A 1 8   ? 4.171   6.887   -6.545  1.00 0.00 ? 8   TYR A CE1  3  
ATOM 3450  C CE2  . TYR A 1 8   ? 3.738   8.350   -8.429  1.00 0.00 ? 8   TYR A CE2  3  
ATOM 3451  C CZ   . TYR A 1 8   ? 4.383   8.100   -7.212  1.00 0.00 ? 8   TYR A CZ   3  
ATOM 3452  O OH   . TYR A 1 8   ? 5.232   9.046   -6.673  1.00 0.00 ? 8   TYR A OH   3  
ATOM 3453  H H    . TYR A 1 8   ? 3.752   4.393   -10.445 1.00 0.00 ? 8   TYR A H    3  
ATOM 3454  H HA   . TYR A 1 8   ? 2.778   3.618   -7.777  1.00 0.00 ? 8   TYR A HA   3  
ATOM 3455  H HB2  . TYR A 1 8   ? 1.577   5.349   -9.947  1.00 0.00 ? 8   TYR A HB2  3  
ATOM 3456  H HB3  . TYR A 1 8   ? 0.842   5.083   -8.360  1.00 0.00 ? 8   TYR A HB3  3  
ATOM 3457  H HD1  . TYR A 1 8   ? 3.150   4.994   -6.579  1.00 0.00 ? 8   TYR A HD1  3  
ATOM 3458  H HD2  . TYR A 1 8   ? 2.385   7.581   -9.920  1.00 0.00 ? 8   TYR A HD2  3  
ATOM 3459  H HE1  . TYR A 1 8   ? 4.667   6.691   -5.604  1.00 0.00 ? 8   TYR A HE1  3  
ATOM 3460  H HE2  . TYR A 1 8   ? 3.902   9.283   -8.942  1.00 0.00 ? 8   TYR A HE2  3  
ATOM 3461  H HH   . TYR A 1 8   ? 5.635   9.529   -7.399  1.00 0.00 ? 8   TYR A HH   3  
ATOM 3462  N N    . ALA A 1 9   ? 2.121   1.771   -10.097 1.00 0.00 ? 9   ALA A N    3  
ATOM 3463  C CA   . ALA A 1 9   ? 1.342   0.587   -10.560 1.00 0.00 ? 9   ALA A CA   3  
ATOM 3464  C C    . ALA A 1 9   ? 2.048   -0.665  -10.034 1.00 0.00 ? 9   ALA A C    3  
ATOM 3465  O O    . ALA A 1 9   ? 1.430   -1.650  -9.685  1.00 0.00 ? 9   ALA A O    3  
ATOM 3466  C CB   . ALA A 1 9   ? 1.301   0.557   -12.089 1.00 0.00 ? 9   ALA A CB   3  
ATOM 3467  H H    . ALA A 1 9   ? 3.044   1.894   -10.403 1.00 0.00 ? 9   ALA A H    3  
ATOM 3468  H HA   . ALA A 1 9   ? 0.337   0.633   -10.165 1.00 0.00 ? 9   ALA A HA   3  
ATOM 3469  H HB1  . ALA A 1 9   ? 0.595   -0.193  -12.416 1.00 0.00 ? 9   ALA A HB1  3  
ATOM 3470  H HB2  . ALA A 1 9   ? 2.282   0.317   -12.471 1.00 0.00 ? 9   ALA A HB2  3  
ATOM 3471  H HB3  . ALA A 1 9   ? 0.996   1.524   -12.461 1.00 0.00 ? 9   ALA A HB3  3  
ATOM 3472  N N    . GLN A 1 10  ? 3.350   -0.600  -9.945  1.00 0.00 ? 10  GLN A N    3  
ATOM 3473  C CA   . GLN A 1 10  ? 4.143   -1.740  -9.409  1.00 0.00 ? 10  GLN A CA   3  
ATOM 3474  C C    . GLN A 1 10  ? 4.281   -1.520  -7.909  1.00 0.00 ? 10  GLN A C    3  
ATOM 3475  O O    . GLN A 1 10  ? 4.372   -2.446  -7.129  1.00 0.00 ? 10  GLN A O    3  
ATOM 3476  C CB   . GLN A 1 10  ? 5.528   -1.745  -10.061 1.00 0.00 ? 10  GLN A CB   3  
ATOM 3477  C CG   . GLN A 1 10  ? 6.299   -2.983  -9.610  1.00 0.00 ? 10  GLN A CG   3  
ATOM 3478  C CD   . GLN A 1 10  ? 7.621   -2.556  -8.970  1.00 0.00 ? 10  GLN A CD   3  
ATOM 3479  O OE1  . GLN A 1 10  ? 7.680   -2.296  -7.784  1.00 0.00 ? 10  GLN A OE1  3  
ATOM 3480  N NE2  . GLN A 1 10  ? 8.692   -2.469  -9.710  1.00 0.00 ? 10  GLN A NE2  3  
ATOM 3481  H H    . GLN A 1 10  ? 3.807   0.222   -10.203 1.00 0.00 ? 10  GLN A H    3  
ATOM 3482  H HA   . GLN A 1 10  ? 3.638   -2.678  -9.599  1.00 0.00 ? 10  GLN A HA   3  
ATOM 3483  H HB2  . GLN A 1 10  ? 5.421   -1.758  -11.136 1.00 0.00 ? 10  GLN A HB2  3  
ATOM 3484  H HB3  . GLN A 1 10  ? 6.069   -0.859  -9.764  1.00 0.00 ? 10  GLN A HB3  3  
ATOM 3485  H HG2  . GLN A 1 10  ? 5.707   -3.528  -8.891  1.00 0.00 ? 10  GLN A HG2  3  
ATOM 3486  H HG3  . GLN A 1 10  ? 6.501   -3.614  -10.463 1.00 0.00 ? 10  GLN A HG3  3  
ATOM 3487  H HE21 . GLN A 1 10  ? 8.646   -2.676  -10.667 1.00 0.00 ? 10  GLN A HE21 3  
ATOM 3488  H HE22 . GLN A 1 10  ? 9.545   -2.196  -9.309  1.00 0.00 ? 10  GLN A HE22 3  
ATOM 3489  N N    . LEU A 1 11  ? 4.268   -0.279  -7.510  1.00 0.00 ? 11  LEU A N    3  
ATOM 3490  C CA   . LEU A 1 11  ? 4.367   0.052   -6.071  1.00 0.00 ? 11  LEU A CA   3  
ATOM 3491  C C    . LEU A 1 11  ? 3.127   -0.505  -5.381  1.00 0.00 ? 11  LEU A C    3  
ATOM 3492  O O    . LEU A 1 11  ? 3.175   -0.992  -4.270  1.00 0.00 ? 11  LEU A O    3  
ATOM 3493  C CB   . LEU A 1 11  ? 4.412   1.572   -5.932  1.00 0.00 ? 11  LEU A CB   3  
ATOM 3494  C CG   . LEU A 1 11  ? 4.335   1.975   -4.467  1.00 0.00 ? 11  LEU A CG   3  
ATOM 3495  C CD1  . LEU A 1 11  ? 5.747   2.074   -3.905  1.00 0.00 ? 11  LEU A CD1  3  
ATOM 3496  C CD2  . LEU A 1 11  ? 3.657   3.338   -4.368  1.00 0.00 ? 11  LEU A CD2  3  
ATOM 3497  H H    . LEU A 1 11  ? 4.170   0.443   -8.167  1.00 0.00 ? 11  LEU A H    3  
ATOM 3498  H HA   . LEU A 1 11  ? 5.257   -0.388  -5.647  1.00 0.00 ? 11  LEU A HA   3  
ATOM 3499  H HB2  . LEU A 1 11  ? 5.337   1.940   -6.353  1.00 0.00 ? 11  LEU A HB2  3  
ATOM 3500  H HB3  . LEU A 1 11  ? 3.580   2.005   -6.466  1.00 0.00 ? 11  LEU A HB3  3  
ATOM 3501  H HG   . LEU A 1 11  ? 3.769   1.241   -3.913  1.00 0.00 ? 11  LEU A HG   3  
ATOM 3502  H HD11 . LEU A 1 11  ? 6.455   2.108   -4.721  1.00 0.00 ? 11  LEU A HD11 3  
ATOM 3503  H HD12 . LEU A 1 11  ? 5.948   1.213   -3.288  1.00 0.00 ? 11  LEU A HD12 3  
ATOM 3504  H HD13 . LEU A 1 11  ? 5.835   2.972   -3.315  1.00 0.00 ? 11  LEU A HD13 3  
ATOM 3505  H HD21 . LEU A 1 11  ? 3.092   3.524   -5.270  1.00 0.00 ? 11  LEU A HD21 3  
ATOM 3506  H HD22 . LEU A 1 11  ? 4.410   4.104   -4.251  1.00 0.00 ? 11  LEU A HD22 3  
ATOM 3507  H HD23 . LEU A 1 11  ? 2.994   3.350   -3.517  1.00 0.00 ? 11  LEU A HD23 3  
ATOM 3508  N N    . ILE A 1 12  ? 2.013   -0.449  -6.057  1.00 0.00 ? 12  ILE A N    3  
ATOM 3509  C CA   . ILE A 1 12  ? 0.751   -0.990  -5.477  1.00 0.00 ? 12  ILE A CA   3  
ATOM 3510  C C    . ILE A 1 12  ? 0.858   -2.502  -5.375  1.00 0.00 ? 12  ILE A C    3  
ATOM 3511  O O    . ILE A 1 12  ? 0.581   -3.097  -4.355  1.00 0.00 ? 12  ILE A O    3  
ATOM 3512  C CB   . ILE A 1 12  ? -0.425  -0.693  -6.394  1.00 0.00 ? 12  ILE A CB   3  
ATOM 3513  C CG1  . ILE A 1 12  ? -0.228  0.624   -7.153  1.00 0.00 ? 12  ILE A CG1  3  
ATOM 3514  C CG2  . ILE A 1 12  ? -1.701  -0.628  -5.565  1.00 0.00 ? 12  ILE A CG2  3  
ATOM 3515  C CD1  . ILE A 1 12  ? 0.270   1.720   -6.221  1.00 0.00 ? 12  ILE A CD1  3  
ATOM 3516  H H    . ILE A 1 12  ? 2.013   -0.059  -6.959  1.00 0.00 ? 12  ILE A H    3  
ATOM 3517  H HA   . ILE A 1 12  ? 0.577   -0.562  -4.501  1.00 0.00 ? 12  ILE A HA   3  
ATOM 3518  H HB   . ILE A 1 12  ? -0.513  -1.500  -7.101  1.00 0.00 ? 12  ILE A HB   3  
ATOM 3519  H HG12 . ILE A 1 12  ? 0.482   0.486   -7.950  1.00 0.00 ? 12  ILE A HG12 3  
ATOM 3520  H HG13 . ILE A 1 12  ? -1.175  0.924   -7.568  1.00 0.00 ? 12  ILE A HG13 3  
ATOM 3521  H HG21 . ILE A 1 12  ? -2.442  -1.287  -5.996  1.00 0.00 ? 12  ILE A HG21 3  
ATOM 3522  H HG22 . ILE A 1 12  ? -2.076  0.383   -5.559  1.00 0.00 ? 12  ILE A HG22 3  
ATOM 3523  H HG23 . ILE A 1 12  ? -1.487  -0.942  -4.554  1.00 0.00 ? 12  ILE A HG23 3  
ATOM 3524  H HD11 . ILE A 1 12  ? 0.839   1.289   -5.414  1.00 0.00 ? 12  ILE A HD11 3  
ATOM 3525  H HD12 . ILE A 1 12  ? -0.578  2.244   -5.823  1.00 0.00 ? 12  ILE A HD12 3  
ATOM 3526  H HD13 . ILE A 1 12  ? 0.892   2.408   -6.774  1.00 0.00 ? 12  ILE A HD13 3  
ATOM 3527  N N    . VAL A 1 13  ? 1.230   -3.128  -6.452  1.00 0.00 ? 13  VAL A N    3  
ATOM 3528  C CA   . VAL A 1 13  ? 1.334   -4.606  -6.462  1.00 0.00 ? 13  VAL A CA   3  
ATOM 3529  C C    . VAL A 1 13  ? 2.169   -5.067  -5.275  1.00 0.00 ? 13  VAL A C    3  
ATOM 3530  O O    . VAL A 1 13  ? 1.922   -6.105  -4.705  1.00 0.00 ? 13  VAL A O    3  
ATOM 3531  C CB   . VAL A 1 13  ? 1.994   -5.035  -7.763  1.00 0.00 ? 13  VAL A CB   3  
ATOM 3532  C CG1  . VAL A 1 13  ? 2.193   -6.551  -7.761  1.00 0.00 ? 13  VAL A CG1  3  
ATOM 3533  C CG2  . VAL A 1 13  ? 1.086   -4.624  -8.924  1.00 0.00 ? 13  VAL A CG2  3  
ATOM 3534  H H    . VAL A 1 13  ? 1.418   -2.620  -7.268  1.00 0.00 ? 13  VAL A H    3  
ATOM 3535  H HA   . VAL A 1 13  ? 0.346   -5.038  -6.398  1.00 0.00 ? 13  VAL A HA   3  
ATOM 3536  H HB   . VAL A 1 13  ? 2.952   -4.546  -7.862  1.00 0.00 ? 13  VAL A HB   3  
ATOM 3537  H HG11 . VAL A 1 13  ? 3.130   -6.790  -7.280  1.00 0.00 ? 13  VAL A HG11 3  
ATOM 3538  H HG12 . VAL A 1 13  ? 2.206   -6.915  -8.776  1.00 0.00 ? 13  VAL A HG12 3  
ATOM 3539  H HG13 . VAL A 1 13  ? 1.383   -7.019  -7.221  1.00 0.00 ? 13  VAL A HG13 3  
ATOM 3540  H HG21 . VAL A 1 13  ? 0.172   -5.196  -8.884  1.00 0.00 ? 13  VAL A HG21 3  
ATOM 3541  H HG22 . VAL A 1 13  ? 1.588   -4.806  -9.859  1.00 0.00 ? 13  VAL A HG22 3  
ATOM 3542  H HG23 . VAL A 1 13  ? 0.851   -3.571  -8.838  1.00 0.00 ? 13  VAL A HG23 3  
ATOM 3543  N N    . GLN A 1 14  ? 3.142   -4.303  -4.879  1.00 0.00 ? 14  GLN A N    3  
ATOM 3544  C CA   . GLN A 1 14  ? 3.952   -4.714  -3.705  1.00 0.00 ? 14  GLN A CA   3  
ATOM 3545  C C    . GLN A 1 14  ? 3.134   -4.449  -2.441  1.00 0.00 ? 14  GLN A C    3  
ATOM 3546  O O    . GLN A 1 14  ? 3.219   -5.169  -1.467  1.00 0.00 ? 14  GLN A O    3  
ATOM 3547  C CB   . GLN A 1 14  ? 5.246   -3.905  -3.656  1.00 0.00 ? 14  GLN A CB   3  
ATOM 3548  C CG   . GLN A 1 14  ? 6.289   -4.670  -2.840  1.00 0.00 ? 14  GLN A CG   3  
ATOM 3549  C CD   . GLN A 1 14  ? 7.684   -4.163  -3.200  1.00 0.00 ? 14  GLN A CD   3  
ATOM 3550  O OE1  . GLN A 1 14  ? 8.662   -4.859  -3.017  1.00 0.00 ? 14  GLN A OE1  3  
ATOM 3551  N NE2  . GLN A 1 14  ? 7.817   -2.969  -3.707  1.00 0.00 ? 14  GLN A NE2  3  
ATOM 3552  H H    . GLN A 1 14  ? 3.324   -3.456  -5.336  1.00 0.00 ? 14  GLN A H    3  
ATOM 3553  H HA   . GLN A 1 14  ? 4.182   -5.767  -3.775  1.00 0.00 ? 14  GLN A HA   3  
ATOM 3554  H HB2  . GLN A 1 14  ? 5.614   -3.752  -4.661  1.00 0.00 ? 14  GLN A HB2  3  
ATOM 3555  H HB3  . GLN A 1 14  ? 5.057   -2.949  -3.191  1.00 0.00 ? 14  GLN A HB3  3  
ATOM 3556  H HG2  . GLN A 1 14  ? 6.106   -4.513  -1.787  1.00 0.00 ? 14  GLN A HG2  3  
ATOM 3557  H HG3  . GLN A 1 14  ? 6.221   -5.723  -3.065  1.00 0.00 ? 14  GLN A HG3  3  
ATOM 3558  H HE21 . GLN A 1 14  ? 7.028   -2.407  -3.854  1.00 0.00 ? 14  GLN A HE21 3  
ATOM 3559  H HE22 . GLN A 1 14  ? 8.706   -2.632  -3.938  1.00 0.00 ? 14  GLN A HE22 3  
ATOM 3560  N N    . ALA A 1 15  ? 2.346   -3.407  -2.456  1.00 0.00 ? 15  ALA A N    3  
ATOM 3561  C CA   . ALA A 1 15  ? 1.516   -3.061  -1.267  1.00 0.00 ? 15  ALA A CA   3  
ATOM 3562  C C    . ALA A 1 15  ? 0.517   -4.186  -0.953  1.00 0.00 ? 15  ALA A C    3  
ATOM 3563  O O    . ALA A 1 15  ? 0.450   -4.658  0.164   1.00 0.00 ? 15  ALA A O    3  
ATOM 3564  C CB   . ALA A 1 15  ? 0.751   -1.763  -1.544  1.00 0.00 ? 15  ALA A CB   3  
ATOM 3565  H H    . ALA A 1 15  ? 2.308   -2.842  -3.255  1.00 0.00 ? 15  ALA A H    3  
ATOM 3566  H HA   . ALA A 1 15  ? 2.163   -2.915  -0.415  1.00 0.00 ? 15  ALA A HA   3  
ATOM 3567  H HB1  . ALA A 1 15  ? 0.049   -1.920  -2.350  1.00 0.00 ? 15  ALA A HB1  3  
ATOM 3568  H HB2  . ALA A 1 15  ? 1.448   -0.985  -1.822  1.00 0.00 ? 15  ALA A HB2  3  
ATOM 3569  H HB3  . ALA A 1 15  ? 0.214   -1.462  -0.655  1.00 0.00 ? 15  ALA A HB3  3  
ATOM 3570  N N    . ILE A 1 16  ? -0.269  -4.616  -1.909  1.00 0.00 ? 16  ILE A N    3  
ATOM 3571  C CA   . ILE A 1 16  ? -1.257  -5.703  -1.602  1.00 0.00 ? 16  ILE A CA   3  
ATOM 3572  C C    . ILE A 1 16  ? -0.597  -7.074  -1.719  1.00 0.00 ? 16  ILE A C    3  
ATOM 3573  O O    . ILE A 1 16  ? -0.933  -7.992  -0.997  1.00 0.00 ? 16  ILE A O    3  
ATOM 3574  C CB   . ILE A 1 16  ? -2.469  -5.646  -2.540  1.00 0.00 ? 16  ILE A CB   3  
ATOM 3575  C CG1  . ILE A 1 16  ? -2.077  -5.182  -3.944  1.00 0.00 ? 16  ILE A CG1  3  
ATOM 3576  C CG2  . ILE A 1 16  ? -3.507  -4.678  -1.974  1.00 0.00 ? 16  ILE A CG2  3  
ATOM 3577  C CD1  . ILE A 1 16  ? -1.176  -6.214  -4.621  1.00 0.00 ? 16  ILE A CD1  3  
ATOM 3578  H H    . ILE A 1 16  ? -0.216  -4.227  -2.806  1.00 0.00 ? 16  ILE A H    3  
ATOM 3579  H HA   . ILE A 1 16  ? -1.601  -5.573  -0.585  1.00 0.00 ? 16  ILE A HA   3  
ATOM 3580  H HB   . ILE A 1 16  ? -2.910  -6.632  -2.600  1.00 0.00 ? 16  ILE A HB   3  
ATOM 3581  H HG12 . ILE A 1 16  ? -2.968  -5.079  -4.516  1.00 0.00 ? 16  ILE A HG12 3  
ATOM 3582  H HG13 . ILE A 1 16  ? -1.575  -4.230  -3.900  1.00 0.00 ? 16  ILE A HG13 3  
ATOM 3583  H HG21 . ILE A 1 16  ? -4.021  -5.144  -1.145  1.00 0.00 ? 16  ILE A HG21 3  
ATOM 3584  H HG22 . ILE A 1 16  ? -4.221  -4.426  -2.743  1.00 0.00 ? 16  ILE A HG22 3  
ATOM 3585  H HG23 . ILE A 1 16  ? -3.015  -3.782  -1.633  1.00 0.00 ? 16  ILE A HG23 3  
ATOM 3586  H HD11 . ILE A 1 16  ? -1.522  -6.383  -5.629  1.00 0.00 ? 16  ILE A HD11 3  
ATOM 3587  H HD12 . ILE A 1 16  ? -1.212  -7.139  -4.070  1.00 0.00 ? 16  ILE A HD12 3  
ATOM 3588  H HD13 . ILE A 1 16  ? -0.163  -5.845  -4.648  1.00 0.00 ? 16  ILE A HD13 3  
ATOM 3589  N N    . SER A 1 17  ? 0.348   -7.230  -2.600  1.00 0.00 ? 17  SER A N    3  
ATOM 3590  C CA   . SER A 1 17  ? 1.021   -8.549  -2.714  1.00 0.00 ? 17  SER A CA   3  
ATOM 3591  C C    . SER A 1 17  ? 1.780   -8.775  -1.418  1.00 0.00 ? 17  SER A C    3  
ATOM 3592  O O    . SER A 1 17  ? 2.130   -9.883  -1.062  1.00 0.00 ? 17  SER A O    3  
ATOM 3593  C CB   . SER A 1 17  ? 1.998   -8.543  -3.890  1.00 0.00 ? 17  SER A CB   3  
ATOM 3594  O OG   . SER A 1 17  ? 1.282   -8.299  -5.094  1.00 0.00 ? 17  SER A OG   3  
ATOM 3595  H H    . SER A 1 17  ? 0.624   -6.483  -3.161  1.00 0.00 ? 17  SER A H    3  
ATOM 3596  H HA   . SER A 1 17  ? 0.283   -9.328  -2.849  1.00 0.00 ? 17  SER A HA   3  
ATOM 3597  H HB2  . SER A 1 17  ? 2.731   -7.768  -3.748  1.00 0.00 ? 17  SER A HB2  3  
ATOM 3598  H HB3  . SER A 1 17  ? 2.498   -9.502  -3.945  1.00 0.00 ? 17  SER A HB3  3  
ATOM 3599  H HG   . SER A 1 17  ? 0.838   -9.112  -5.345  1.00 0.00 ? 17  SER A HG   3  
ATOM 3600  N N    . SER A 1 18  ? 2.023   -7.711  -0.702  1.00 0.00 ? 18  SER A N    3  
ATOM 3601  C CA   . SER A 1 18  ? 2.743   -7.823  0.586   1.00 0.00 ? 18  SER A CA   3  
ATOM 3602  C C    . SER A 1 18  ? 1.766   -7.557  1.728   1.00 0.00 ? 18  SER A C    3  
ATOM 3603  O O    . SER A 1 18  ? 2.113   -7.682  2.885   1.00 0.00 ? 18  SER A O    3  
ATOM 3604  C CB   . SER A 1 18  ? 3.870   -6.793  0.633   1.00 0.00 ? 18  SER A CB   3  
ATOM 3605  O OG   . SER A 1 18  ? 4.799   -7.066  -0.407  1.00 0.00 ? 18  SER A OG   3  
ATOM 3606  H H    . SER A 1 18  ? 1.717   -6.832  -1.014  1.00 0.00 ? 18  SER A H    3  
ATOM 3607  H HA   . SER A 1 18  ? 3.156   -8.816  0.685   1.00 0.00 ? 18  SER A HA   3  
ATOM 3608  H HB2  . SER A 1 18  ? 3.461   -5.808  0.494   1.00 0.00 ? 18  SER A HB2  3  
ATOM 3609  H HB3  . SER A 1 18  ? 4.363   -6.845  1.594   1.00 0.00 ? 18  SER A HB3  3  
ATOM 3610  H HG   . SER A 1 18  ? 4.302   -7.302  -1.194  1.00 0.00 ? 18  SER A HG   3  
ATOM 3611  N N    . ALA A 1 19  ? 0.539   -7.198  1.427   1.00 0.00 ? 19  ALA A N    3  
ATOM 3612  C CA   . ALA A 1 19  ? -0.419  -6.943  2.533   1.00 0.00 ? 19  ALA A CA   3  
ATOM 3613  C C    . ALA A 1 19  ? -1.113  -8.255  2.880   1.00 0.00 ? 19  ALA A C    3  
ATOM 3614  O O    . ALA A 1 19  ? -1.479  -9.009  2.001   1.00 0.00 ? 19  ALA A O    3  
ATOM 3615  C CB   . ALA A 1 19  ? -1.460  -5.914  2.087   1.00 0.00 ? 19  ALA A CB   3  
ATOM 3616  H H    . ALA A 1 19  ? 0.247   -7.103  0.482   1.00 0.00 ? 19  ALA A H    3  
ATOM 3617  H HA   . ALA A 1 19  ? 0.113   -6.572  3.395   1.00 0.00 ? 19  ALA A HA   3  
ATOM 3618  H HB1  . ALA A 1 19  ? -2.115  -6.358  1.352   1.00 0.00 ? 19  ALA A HB1  3  
ATOM 3619  H HB2  . ALA A 1 19  ? -0.961  -5.060  1.655   1.00 0.00 ? 19  ALA A HB2  3  
ATOM 3620  H HB3  . ALA A 1 19  ? -2.041  -5.596  2.941   1.00 0.00 ? 19  ALA A HB3  3  
ATOM 3621  N N    . GLN A 1 20  ? -1.304  -8.539  4.145   1.00 0.00 ? 20  GLN A N    3  
ATOM 3622  C CA   . GLN A 1 20  ? -1.988  -9.811  4.515   1.00 0.00 ? 20  GLN A CA   3  
ATOM 3623  C C    . GLN A 1 20  ? -3.179  -9.985  3.578   1.00 0.00 ? 20  GLN A C    3  
ATOM 3624  O O    . GLN A 1 20  ? -3.316  -10.983 2.899   1.00 0.00 ? 20  GLN A O    3  
ATOM 3625  C CB   . GLN A 1 20  ? -2.478  -9.736  5.965   1.00 0.00 ? 20  GLN A CB   3  
ATOM 3626  C CG   . GLN A 1 20  ? -1.409  -9.078  6.844   1.00 0.00 ? 20  GLN A CG   3  
ATOM 3627  C CD   . GLN A 1 20  ? -0.032  -9.660  6.508   1.00 0.00 ? 20  GLN A CD   3  
ATOM 3628  O OE1  . GLN A 1 20  ? 0.094   -10.838 6.240   1.00 0.00 ? 20  GLN A OE1  3  
ATOM 3629  N NE2  . GLN A 1 20  ? 1.011   -8.876  6.512   1.00 0.00 ? 20  GLN A NE2  3  
ATOM 3630  H H    . GLN A 1 20  ? -1.005  -7.920  4.842   1.00 0.00 ? 20  GLN A H    3  
ATOM 3631  H HA   . GLN A 1 20  ? -1.307  -10.641 4.398   1.00 0.00 ? 20  GLN A HA   3  
ATOM 3632  H HB2  . GLN A 1 20  ? -3.386  -9.152  6.007   1.00 0.00 ? 20  GLN A HB2  3  
ATOM 3633  H HB3  . GLN A 1 20  ? -2.675  -10.734 6.329   1.00 0.00 ? 20  GLN A HB3  3  
ATOM 3634  H HG2  . GLN A 1 20  ? -1.403  -8.013  6.666   1.00 0.00 ? 20  GLN A HG2  3  
ATOM 3635  H HG3  . GLN A 1 20  ? -1.631  -9.269  7.883   1.00 0.00 ? 20  GLN A HG3  3  
ATOM 3636  H HE21 . GLN A 1 20  ? 0.909   -7.926  6.729   1.00 0.00 ? 20  GLN A HE21 3  
ATOM 3637  H HE22 . GLN A 1 20  ? 1.896   -9.238  6.297   1.00 0.00 ? 20  GLN A HE22 3  
ATOM 3638  N N    . ASP A 1 21  ? -4.016  -8.991  3.512   1.00 0.00 ? 21  ASP A N    3  
ATOM 3639  C CA   . ASP A 1 21  ? -5.177  -9.051  2.592   1.00 0.00 ? 21  ASP A CA   3  
ATOM 3640  C C    . ASP A 1 21  ? -4.768  -8.425  1.250   1.00 0.00 ? 21  ASP A C    3  
ATOM 3641  O O    . ASP A 1 21  ? -4.381  -7.274  1.191   1.00 0.00 ? 21  ASP A O    3  
ATOM 3642  C CB   . ASP A 1 21  ? -6.344  -8.265  3.191   1.00 0.00 ? 21  ASP A CB   3  
ATOM 3643  C CG   . ASP A 1 21  ? -6.677  -8.821  4.578   1.00 0.00 ? 21  ASP A CG   3  
ATOM 3644  O OD1  . ASP A 1 21  ? -6.892  -10.017 4.679   1.00 0.00 ? 21  ASP A OD1  3  
ATOM 3645  O OD2  . ASP A 1 21  ? -6.710  -8.039  5.515   1.00 0.00 ? 21  ASP A OD2  3  
ATOM 3646  H H    . ASP A 1 21  ? -3.862  -8.186  4.049   1.00 0.00 ? 21  ASP A H    3  
ATOM 3647  H HA   . ASP A 1 21  ? -5.469  -10.082 2.445   1.00 0.00 ? 21  ASP A HA   3  
ATOM 3648  H HB2  . ASP A 1 21  ? -6.071  -7.223  3.276   1.00 0.00 ? 21  ASP A HB2  3  
ATOM 3649  H HB3  . ASP A 1 21  ? -7.210  -8.359  2.551   1.00 0.00 ? 21  ASP A HB3  3  
ATOM 3650  N N    . ARG A 1 22  ? -4.846  -9.163  0.173   1.00 0.00 ? 22  ARG A N    3  
ATOM 3651  C CA   . ARG A 1 22  ? -4.460  -8.608  -1.161  1.00 0.00 ? 22  ARG A CA   3  
ATOM 3652  C C    . ARG A 1 22  ? -5.325  -7.384  -1.513  1.00 0.00 ? 22  ARG A C    3  
ATOM 3653  O O    . ARG A 1 22  ? -5.116  -6.742  -2.530  1.00 0.00 ? 22  ARG A O    3  
ATOM 3654  C CB   . ARG A 1 22  ? -4.653  -9.688  -2.228  1.00 0.00 ? 22  ARG A CB   3  
ATOM 3655  C CG   . ARG A 1 22  ? -3.881  -10.947 -1.824  1.00 0.00 ? 22  ARG A CG   3  
ATOM 3656  C CD   . ARG A 1 22  ? -4.164  -12.068 -2.824  1.00 0.00 ? 22  ARG A CD   3  
ATOM 3657  N NE   . ARG A 1 22  ? -2.972  -12.960 -2.922  1.00 0.00 ? 22  ARG A NE   3  
ATOM 3658  C CZ   . ARG A 1 22  ? -2.260  -13.223 -1.858  1.00 0.00 ? 22  ARG A CZ   3  
ATOM 3659  N NH1  . ARG A 1 22  ? -2.801  -13.847 -0.849  1.00 0.00 ? 22  ARG A NH1  3  
ATOM 3660  N NH2  . ARG A 1 22  ? -1.009  -12.857 -1.802  1.00 0.00 ? 22  ARG A NH2  3  
ATOM 3661  H H    . ARG A 1 22  ? -5.150  -10.085 0.239   1.00 0.00 ? 22  ARG A H    3  
ATOM 3662  H HA   . ARG A 1 22  ? -3.422  -8.315  -1.138  1.00 0.00 ? 22  ARG A HA   3  
ATOM 3663  H HB2  . ARG A 1 22  ? -5.704  -9.923  -2.317  1.00 0.00 ? 22  ARG A HB2  3  
ATOM 3664  H HB3  . ARG A 1 22  ? -4.282  -9.330  -3.176  1.00 0.00 ? 22  ARG A HB3  3  
ATOM 3665  H HG2  . ARG A 1 22  ? -2.823  -10.731 -1.814  1.00 0.00 ? 22  ARG A HG2  3  
ATOM 3666  H HG3  . ARG A 1 22  ? -4.193  -11.260 -0.839  1.00 0.00 ? 22  ARG A HG3  3  
ATOM 3667  H HD2  . ARG A 1 22  ? -5.017  -12.641 -2.491  1.00 0.00 ? 22  ARG A HD2  3  
ATOM 3668  H HD3  . ARG A 1 22  ? -4.375  -11.640 -3.793  1.00 0.00 ? 22  ARG A HD3  3  
ATOM 3669  H HE   . ARG A 1 22  ? -2.723  -13.350 -3.785  1.00 0.00 ? 22  ARG A HE   3  
ATOM 3670  H HH11 . ARG A 1 22  ? -3.761  -14.125 -0.888  1.00 0.00 ? 22  ARG A HH11 3  
ATOM 3671  H HH12 . ARG A 1 22  ? -2.255  -14.046 -0.034  1.00 0.00 ? 22  ARG A HH12 3  
ATOM 3672  H HH21 . ARG A 1 22  ? -0.594  -12.375 -2.574  1.00 0.00 ? 22  ARG A HH21 3  
ATOM 3673  H HH22 . ARG A 1 22  ? -0.465  -13.059 -0.988  1.00 0.00 ? 22  ARG A HH22 3  
ATOM 3674  N N    . GLN A 1 23  ? -6.290  -7.055  -0.693  1.00 0.00 ? 23  GLN A N    3  
ATOM 3675  C CA   . GLN A 1 23  ? -7.149  -5.875  -0.985  1.00 0.00 ? 23  GLN A CA   3  
ATOM 3676  C C    . GLN A 1 23  ? -6.824  -4.756  0.004   1.00 0.00 ? 23  GLN A C    3  
ATOM 3677  O O    . GLN A 1 23  ? -7.260  -4.768  1.137   1.00 0.00 ? 23  GLN A O    3  
ATOM 3678  C CB   . GLN A 1 23  ? -8.625  -6.263  -0.848  1.00 0.00 ? 23  GLN A CB   3  
ATOM 3679  C CG   . GLN A 1 23  ? -8.776  -7.351  0.221   1.00 0.00 ? 23  GLN A CG   3  
ATOM 3680  C CD   . GLN A 1 23  ? -10.249 -7.742  0.348   1.00 0.00 ? 23  GLN A CD   3  
ATOM 3681  O OE1  . GLN A 1 23  ? -11.064 -7.353  -0.464  1.00 0.00 ? 23  GLN A OE1  3  
ATOM 3682  N NE2  . GLN A 1 23  ? -10.629 -8.503  1.339   1.00 0.00 ? 23  GLN A NE2  3  
ATOM 3683  H H    . GLN A 1 23  ? -6.453  -7.580  0.111   1.00 0.00 ? 23  GLN A H    3  
ATOM 3684  H HA   . GLN A 1 23  ? -6.957  -5.529  -1.985  1.00 0.00 ? 23  GLN A HA   3  
ATOM 3685  H HB2  . GLN A 1 23  ? -9.199  -5.395  -0.562  1.00 0.00 ? 23  GLN A HB2  3  
ATOM 3686  H HB3  . GLN A 1 23  ? -8.987  -6.640  -1.792  1.00 0.00 ? 23  GLN A HB3  3  
ATOM 3687  H HG2  . GLN A 1 23  ? -8.196  -8.217  -0.063  1.00 0.00 ? 23  GLN A HG2  3  
ATOM 3688  H HG3  . GLN A 1 23  ? -8.422  -6.975  1.169   1.00 0.00 ? 23  GLN A HG3  3  
ATOM 3689  H HE21 . GLN A 1 23  ? -9.973  -8.819  1.995   1.00 0.00 ? 23  GLN A HE21 3  
ATOM 3690  H HE22 . GLN A 1 23  ? -11.572 -8.759  1.429   1.00 0.00 ? 23  GLN A HE22 3  
ATOM 3691  N N    . LEU A 1 24  ? -6.062  -3.784  -0.421  1.00 0.00 ? 24  LEU A N    3  
ATOM 3692  C CA   . LEU A 1 24  ? -5.713  -2.657  0.487   1.00 0.00 ? 24  LEU A CA   3  
ATOM 3693  C C    . LEU A 1 24  ? -6.729  -1.537  0.303   1.00 0.00 ? 24  LEU A C    3  
ATOM 3694  O O    . LEU A 1 24  ? -7.350  -1.422  -0.729  1.00 0.00 ? 24  LEU A O    3  
ATOM 3695  C CB   . LEU A 1 24  ? -4.324  -2.121  0.135   1.00 0.00 ? 24  LEU A CB   3  
ATOM 3696  C CG   . LEU A 1 24  ? -3.261  -3.077  0.667   1.00 0.00 ? 24  LEU A CG   3  
ATOM 3697  C CD1  . LEU A 1 24  ? -1.875  -2.577  0.257   1.00 0.00 ? 24  LEU A CD1  3  
ATOM 3698  C CD2  . LEU A 1 24  ? -3.356  -3.132  2.191   1.00 0.00 ? 24  LEU A CD2  3  
ATOM 3699  H H    . LEU A 1 24  ? -5.725  -3.794  -1.341  1.00 0.00 ? 24  LEU A H    3  
ATOM 3700  H HA   . LEU A 1 24  ? -5.724  -2.997  1.511   1.00 0.00 ? 24  LEU A HA   3  
ATOM 3701  H HB2  . LEU A 1 24  ? -4.230  -2.029  -0.939  1.00 0.00 ? 24  LEU A HB2  3  
ATOM 3702  H HB3  . LEU A 1 24  ? -4.190  -1.152  0.590   1.00 0.00 ? 24  LEU A HB3  3  
ATOM 3703  H HG   . LEU A 1 24  ? -3.424  -4.063  0.260   1.00 0.00 ? 24  LEU A HG   3  
ATOM 3704  H HD11 . LEU A 1 24  ? -1.829  -1.506  0.385   1.00 0.00 ? 24  LEU A HD11 3  
ATOM 3705  H HD12 . LEU A 1 24  ? -1.694  -2.822  -0.779  1.00 0.00 ? 24  LEU A HD12 3  
ATOM 3706  H HD13 . LEU A 1 24  ? -1.125  -3.045  0.875   1.00 0.00 ? 24  LEU A HD13 3  
ATOM 3707  H HD21 . LEU A 1 24  ? -3.859  -2.246  2.550   1.00 0.00 ? 24  LEU A HD21 3  
ATOM 3708  H HD22 . LEU A 1 24  ? -2.365  -3.180  2.613   1.00 0.00 ? 24  LEU A HD22 3  
ATOM 3709  H HD23 . LEU A 1 24  ? -3.917  -4.007  2.485   1.00 0.00 ? 24  LEU A HD23 3  
ATOM 3710  N N    . THR A 1 25  ? -6.897  -0.700  1.287   1.00 0.00 ? 25  THR A N    3  
ATOM 3711  C CA   . THR A 1 25  ? -7.866  0.418   1.144   1.00 0.00 ? 25  THR A CA   3  
ATOM 3712  C C    . THR A 1 25  ? -7.157  1.580   0.451   1.00 0.00 ? 25  THR A C    3  
ATOM 3713  O O    . THR A 1 25  ? -5.997  1.487   0.106   1.00 0.00 ? 25  THR A O    3  
ATOM 3714  C CB   . THR A 1 25  ? -8.350  0.860   2.529   1.00 0.00 ? 25  THR A CB   3  
ATOM 3715  O OG1  . THR A 1 25  ? -7.359  1.676   3.137   1.00 0.00 ? 25  THR A OG1  3  
ATOM 3716  C CG2  . THR A 1 25  ? -8.607  -0.370  3.401   1.00 0.00 ? 25  THR A CG2  3  
ATOM 3717  H H    . THR A 1 25  ? -6.379  -0.802  2.113   1.00 0.00 ? 25  THR A H    3  
ATOM 3718  H HA   . THR A 1 25  ? -8.707  0.096   0.549   1.00 0.00 ? 25  THR A HA   3  
ATOM 3719  H HB   . THR A 1 25  ? -9.267  1.420   2.426   1.00 0.00 ? 25  THR A HB   3  
ATOM 3720  H HG1  . THR A 1 25  ? -7.801  2.275   3.743   1.00 0.00 ? 25  THR A HG1  3  
ATOM 3721  H HG21 . THR A 1 25  ? -9.478  -0.894  3.037   1.00 0.00 ? 25  THR A HG21 3  
ATOM 3722  H HG22 . THR A 1 25  ? -8.776  -0.059  4.421   1.00 0.00 ? 25  THR A HG22 3  
ATOM 3723  H HG23 . THR A 1 25  ? -7.750  -1.026  3.362   1.00 0.00 ? 25  THR A HG23 3  
ATOM 3724  N N    . LEU A 1 26  ? -7.830  2.676   0.245   1.00 0.00 ? 26  LEU A N    3  
ATOM 3725  C CA   . LEU A 1 26  ? -7.154  3.825   -0.422  1.00 0.00 ? 26  LEU A CA   3  
ATOM 3726  C C    . LEU A 1 26  ? -5.950  4.233   0.427   1.00 0.00 ? 26  LEU A C    3  
ATOM 3727  O O    . LEU A 1 26  ? -4.898  4.567   -0.084  1.00 0.00 ? 26  LEU A O    3  
ATOM 3728  C CB   . LEU A 1 26  ? -8.115  5.015   -0.561  1.00 0.00 ? 26  LEU A CB   3  
ATOM 3729  C CG   . LEU A 1 26  ? -8.036  5.564   -1.985  1.00 0.00 ? 26  LEU A CG   3  
ATOM 3730  C CD1  . LEU A 1 26  ? -9.183  6.548   -2.219  1.00 0.00 ? 26  LEU A CD1  3  
ATOM 3731  C CD2  . LEU A 1 26  ? -6.700  6.286   -2.178  1.00 0.00 ? 26  LEU A CD2  3  
ATOM 3732  H H    . LEU A 1 26  ? -8.764  2.740   0.532   1.00 0.00 ? 26  LEU A H    3  
ATOM 3733  H HA   . LEU A 1 26  ? -6.813  3.520   -1.402  1.00 0.00 ? 26  LEU A HA   3  
ATOM 3734  H HB2  . LEU A 1 26  ? -9.127  4.698   -0.356  1.00 0.00 ? 26  LEU A HB2  3  
ATOM 3735  H HB3  . LEU A 1 26  ? -7.832  5.790   0.136   1.00 0.00 ? 26  LEU A HB3  3  
ATOM 3736  H HG   . LEU A 1 26  ? -8.111  4.747   -2.691  1.00 0.00 ? 26  LEU A HG   3  
ATOM 3737  H HD11 . LEU A 1 26  ? -10.116 6.007   -2.271  1.00 0.00 ? 26  LEU A HD11 3  
ATOM 3738  H HD12 . LEU A 1 26  ? -9.021  7.078   -3.147  1.00 0.00 ? 26  LEU A HD12 3  
ATOM 3739  H HD13 . LEU A 1 26  ? -9.223  7.254   -1.403  1.00 0.00 ? 26  LEU A HD13 3  
ATOM 3740  H HD21 . LEU A 1 26  ? -6.098  5.745   -2.894  1.00 0.00 ? 26  LEU A HD21 3  
ATOM 3741  H HD22 . LEU A 1 26  ? -6.178  6.335   -1.233  1.00 0.00 ? 26  LEU A HD22 3  
ATOM 3742  H HD23 . LEU A 1 26  ? -6.881  7.286   -2.541  1.00 0.00 ? 26  LEU A HD23 3  
ATOM 3743  N N    . SER A 1 27  ? -6.097  4.202   1.724   1.00 0.00 ? 27  SER A N    3  
ATOM 3744  C CA   . SER A 1 27  ? -4.967  4.579   2.618   1.00 0.00 ? 27  SER A CA   3  
ATOM 3745  C C    . SER A 1 27  ? -4.271  3.320   3.142   1.00 0.00 ? 27  SER A C    3  
ATOM 3746  O O    . SER A 1 27  ? -3.753  3.301   4.241   1.00 0.00 ? 27  SER A O    3  
ATOM 3747  C CB   . SER A 1 27  ? -5.501  5.390   3.795   1.00 0.00 ? 27  SER A CB   3  
ATOM 3748  O OG   . SER A 1 27  ? -5.048  6.733   3.687   1.00 0.00 ? 27  SER A OG   3  
ATOM 3749  H H    . SER A 1 27  ? -6.953  3.925   2.111   1.00 0.00 ? 27  SER A H    3  
ATOM 3750  H HA   . SER A 1 27  ? -4.259  5.174   2.066   1.00 0.00 ? 27  SER A HA   3  
ATOM 3751  H HB2  . SER A 1 27  ? -6.578  5.375   3.784   1.00 0.00 ? 27  SER A HB2  3  
ATOM 3752  H HB3  . SER A 1 27  ? -5.147  4.951   4.719   1.00 0.00 ? 27  SER A HB3  3  
ATOM 3753  H HG   . SER A 1 27  ? -5.583  7.275   4.271   1.00 0.00 ? 27  SER A HG   3  
ATOM 3754  N N    . GLY A 1 28  ? -4.240  2.272   2.365   1.00 0.00 ? 28  GLY A N    3  
ATOM 3755  C CA   . GLY A 1 28  ? -3.560  1.028   2.826   1.00 0.00 ? 28  GLY A CA   3  
ATOM 3756  C C    . GLY A 1 28  ? -2.183  0.983   2.178   1.00 0.00 ? 28  GLY A C    3  
ATOM 3757  O O    . GLY A 1 28  ? -1.217  0.505   2.740   1.00 0.00 ? 28  GLY A O    3  
ATOM 3758  H H    . GLY A 1 28  ? -4.643  2.310   1.470   1.00 0.00 ? 28  GLY A H    3  
ATOM 3759  H HA2  . GLY A 1 28  ? -3.457  1.044   3.901   1.00 0.00 ? 28  GLY A HA2  3  
ATOM 3760  H HA3  . GLY A 1 28  ? -4.135  0.164   2.526   1.00 0.00 ? 28  GLY A HA3  3  
ATOM 3761  N N    . ILE A 1 29  ? -2.109  1.492   0.987   1.00 0.00 ? 29  ILE A N    3  
ATOM 3762  C CA   . ILE A 1 29  ? -0.835  1.520   0.237   1.00 0.00 ? 29  ILE A CA   3  
ATOM 3763  C C    . ILE A 1 29  ? 0.113   2.528   0.881   1.00 0.00 ? 29  ILE A C    3  
ATOM 3764  O O    . ILE A 1 29  ? 1.312   2.340   0.918   1.00 0.00 ? 29  ILE A O    3  
ATOM 3765  C CB   . ILE A 1 29  ? -1.152  1.932   -1.201  1.00 0.00 ? 29  ILE A CB   3  
ATOM 3766  C CG1  . ILE A 1 29  ? -0.125  1.341   -2.142  1.00 0.00 ? 29  ILE A CG1  3  
ATOM 3767  C CG2  . ILE A 1 29  ? -1.147  3.457   -1.351  1.00 0.00 ? 29  ILE A CG2  3  
ATOM 3768  C CD1  . ILE A 1 29  ? -0.487  1.774   -3.548  1.00 0.00 ? 29  ILE A CD1  3  
ATOM 3769  H H    . ILE A 1 29  ? -2.911  1.866   0.577   1.00 0.00 ? 29  ILE A H    3  
ATOM 3770  H HA   . ILE A 1 29  ? -0.387  0.545   0.241   1.00 0.00 ? 29  ILE A HA   3  
ATOM 3771  H HB   . ILE A 1 29  ? -2.129  1.558   -1.468  1.00 0.00 ? 29  ILE A HB   3  
ATOM 3772  H HG12 . ILE A 1 29  ? 0.860   1.701   -1.884  1.00 0.00 ? 29  ILE A HG12 3  
ATOM 3773  H HG13 . ILE A 1 29  ? -0.152  0.268   -2.081  1.00 0.00 ? 29  ILE A HG13 3  
ATOM 3774  H HG21 . ILE A 1 29  ? -1.968  3.878   -0.791  1.00 0.00 ? 29  ILE A HG21 3  
ATOM 3775  H HG22 . ILE A 1 29  ? -1.251  3.712   -2.393  1.00 0.00 ? 29  ILE A HG22 3  
ATOM 3776  H HG23 . ILE A 1 29  ? -0.214  3.854   -0.979  1.00 0.00 ? 29  ILE A HG23 3  
ATOM 3777  H HD11 . ILE A 1 29  ? -1.380  2.382   -3.513  1.00 0.00 ? 29  ILE A HD11 3  
ATOM 3778  H HD12 . ILE A 1 29  ? -0.668  0.903   -4.155  1.00 0.00 ? 29  ILE A HD12 3  
ATOM 3779  H HD13 . ILE A 1 29  ? 0.324   2.348   -3.964  1.00 0.00 ? 29  ILE A HD13 3  
ATOM 3780  N N    . TYR A 1 30  ? -0.424  3.602   1.378   1.00 0.00 ? 30  TYR A N    3  
ATOM 3781  C CA   . TYR A 1 30  ? 0.431   4.634   2.011   1.00 0.00 ? 30  TYR A CA   3  
ATOM 3782  C C    . TYR A 1 30  ? 1.038   4.058   3.277   1.00 0.00 ? 30  TYR A C    3  
ATOM 3783  O O    . TYR A 1 30  ? 2.233   4.087   3.469   1.00 0.00 ? 30  TYR A O    3  
ATOM 3784  C CB   . TYR A 1 30  ? -0.427  5.856   2.327   1.00 0.00 ? 30  TYR A CB   3  
ATOM 3785  C CG   . TYR A 1 30  ? -1.273  6.151   1.116   1.00 0.00 ? 30  TYR A CG   3  
ATOM 3786  C CD1  . TYR A 1 30  ? -0.729  5.986   -0.163  1.00 0.00 ? 30  TYR A CD1  3  
ATOM 3787  C CD2  . TYR A 1 30  ? -2.602  6.558   1.263   1.00 0.00 ? 30  TYR A CD2  3  
ATOM 3788  C CE1  . TYR A 1 30  ? -1.510  6.233   -1.295  1.00 0.00 ? 30  TYR A CE1  3  
ATOM 3789  C CE2  . TYR A 1 30  ? -3.387  6.801   0.129   1.00 0.00 ? 30  TYR A CE2  3  
ATOM 3790  C CZ   . TYR A 1 30  ? -2.842  6.638   -1.150  1.00 0.00 ? 30  TYR A CZ   3  
ATOM 3791  O OH   . TYR A 1 30  ? -3.616  6.876   -2.268  1.00 0.00 ? 30  TYR A OH   3  
ATOM 3792  H H    . TYR A 1 30  ? -1.393  3.733   1.328   1.00 0.00 ? 30  TYR A H    3  
ATOM 3793  H HA   . TYR A 1 30  ? 1.215   4.912   1.332   1.00 0.00 ? 30  TYR A HA   3  
ATOM 3794  H HB2  . TYR A 1 30  ? -1.062  5.645   3.176   1.00 0.00 ? 30  TYR A HB2  3  
ATOM 3795  H HB3  . TYR A 1 30  ? 0.205   6.701   2.544   1.00 0.00 ? 30  TYR A HB3  3  
ATOM 3796  H HD1  . TYR A 1 30  ? 0.298   5.673   -0.275  1.00 0.00 ? 30  TYR A HD1  3  
ATOM 3797  H HD2  . TYR A 1 30  ? -3.022  6.685   2.250   1.00 0.00 ? 30  TYR A HD2  3  
ATOM 3798  H HE1  . TYR A 1 30  ? -1.087  6.102   -2.280  1.00 0.00 ? 30  TYR A HE1  3  
ATOM 3799  H HE2  . TYR A 1 30  ? -4.413  7.111   0.243   1.00 0.00 ? 30  TYR A HE2  3  
ATOM 3800  H HH   . TYR A 1 30  ? -3.968  7.767   -2.202  1.00 0.00 ? 30  TYR A HH   3  
ATOM 3801  N N    . ALA A 1 31  ? 0.234   3.504   4.130   1.00 0.00 ? 31  ALA A N    3  
ATOM 3802  C CA   . ALA A 1 31  ? 0.792   2.898   5.363   1.00 0.00 ? 31  ALA A CA   3  
ATOM 3803  C C    . ALA A 1 31  ? 1.742   1.766   4.959   1.00 0.00 ? 31  ALA A C    3  
ATOM 3804  O O    . ALA A 1 31  ? 2.568   1.331   5.736   1.00 0.00 ? 31  ALA A O    3  
ATOM 3805  C CB   . ALA A 1 31  ? -0.344  2.337   6.218   1.00 0.00 ? 31  ALA A CB   3  
ATOM 3806  H H    . ALA A 1 31  ? -0.728  3.468   3.951   1.00 0.00 ? 31  ALA A H    3  
ATOM 3807  H HA   . ALA A 1 31  ? 1.335   3.646   5.922   1.00 0.00 ? 31  ALA A HA   3  
ATOM 3808  H HB1  . ALA A 1 31  ? -1.164  3.041   6.235   1.00 0.00 ? 31  ALA A HB1  3  
ATOM 3809  H HB2  . ALA A 1 31  ? 0.009   2.173   7.226   1.00 0.00 ? 31  ALA A HB2  3  
ATOM 3810  H HB3  . ALA A 1 31  ? -0.684  1.401   5.799   1.00 0.00 ? 31  ALA A HB3  3  
ATOM 3811  N N    . HIS A 1 32  ? 1.628   1.278   3.745   1.00 0.00 ? 32  HIS A N    3  
ATOM 3812  C CA   . HIS A 1 32  ? 2.520   0.172   3.300   1.00 0.00 ? 32  HIS A CA   3  
ATOM 3813  C C    . HIS A 1 32  ? 3.914   0.709   2.949   1.00 0.00 ? 32  HIS A C    3  
ATOM 3814  O O    . HIS A 1 32  ? 4.880   0.447   3.636   1.00 0.00 ? 32  HIS A O    3  
ATOM 3815  C CB   . HIS A 1 32  ? 1.923   -0.503  2.068   1.00 0.00 ? 32  HIS A CB   3  
ATOM 3816  C CG   . HIS A 1 32  ? 2.846   -1.607  1.638   1.00 0.00 ? 32  HIS A CG   3  
ATOM 3817  N ND1  . HIS A 1 32  ? 2.764   -2.883  2.170   1.00 0.00 ? 32  HIS A ND1  3  
ATOM 3818  C CD2  . HIS A 1 32  ? 3.899   -1.634  0.757   1.00 0.00 ? 32  HIS A CD2  3  
ATOM 3819  C CE1  . HIS A 1 32  ? 3.743   -3.618  1.613   1.00 0.00 ? 32  HIS A CE1  3  
ATOM 3820  N NE2  . HIS A 1 32  ? 4.464   -2.906  0.742   1.00 0.00 ? 32  HIS A NE2  3  
ATOM 3821  H H    . HIS A 1 32  ? 0.951   1.635   3.127   1.00 0.00 ? 32  HIS A H    3  
ATOM 3822  H HA   . HIS A 1 32  ? 2.608   -0.554  4.094   1.00 0.00 ? 32  HIS A HA   3  
ATOM 3823  H HB2  . HIS A 1 32  ? 0.950   -0.912  2.311   1.00 0.00 ? 32  HIS A HB2  3  
ATOM 3824  H HB3  . HIS A 1 32  ? 1.820   0.217   1.270   1.00 0.00 ? 32  HIS A HB3  3  
ATOM 3825  H HD1  . HIS A 1 32  ? 2.112   -3.193  2.833   1.00 0.00 ? 32  HIS A HD1  3  
ATOM 3826  H HD2  . HIS A 1 32  ? 4.244   -0.793  0.173   1.00 0.00 ? 32  HIS A HD2  3  
ATOM 3827  H HE1  . HIS A 1 32  ? 3.931   -4.654  1.851   1.00 0.00 ? 32  HIS A HE1  3  
ATOM 3828  N N    . ILE A 1 33  ? 4.027   1.435   1.869   1.00 0.00 ? 33  ILE A N    3  
ATOM 3829  C CA   . ILE A 1 33  ? 5.360   1.967   1.451   1.00 0.00 ? 33  ILE A CA   3  
ATOM 3830  C C    . ILE A 1 33  ? 5.963   2.832   2.562   1.00 0.00 ? 33  ILE A C    3  
ATOM 3831  O O    . ILE A 1 33  ? 7.160   2.880   2.745   1.00 0.00 ? 33  ILE A O    3  
ATOM 3832  C CB   . ILE A 1 33  ? 5.195   2.816   0.195   1.00 0.00 ? 33  ILE A CB   3  
ATOM 3833  C CG1  . ILE A 1 33  ? 4.113   3.869   0.430   1.00 0.00 ? 33  ILE A CG1  3  
ATOM 3834  C CG2  . ILE A 1 33  ? 4.798   1.924   -0.982  1.00 0.00 ? 33  ILE A CG2  3  
ATOM 3835  C CD1  . ILE A 1 33  ? 4.772   5.163   0.907   1.00 0.00 ? 33  ILE A CD1  3  
ATOM 3836  H H    . ILE A 1 33  ? 3.238   1.616   1.319   1.00 0.00 ? 33  ILE A H    3  
ATOM 3837  H HA   . ILE A 1 33  ? 6.025   1.141   1.237   1.00 0.00 ? 33  ILE A HA   3  
ATOM 3838  H HB   . ILE A 1 33  ? 6.129   3.307   -0.024  1.00 0.00 ? 33  ILE A HB   3  
ATOM 3839  H HG12 . ILE A 1 33  ? 3.579   4.050   -0.493  1.00 0.00 ? 33  ILE A HG12 3  
ATOM 3840  H HG13 . ILE A 1 33  ? 3.423   3.518   1.183   1.00 0.00 ? 33  ILE A HG13 3  
ATOM 3841  H HG21 . ILE A 1 33  ? 5.688   1.555   -1.470  1.00 0.00 ? 33  ILE A HG21 3  
ATOM 3842  H HG22 . ILE A 1 33  ? 4.212   2.494   -1.686  1.00 0.00 ? 33  ILE A HG22 3  
ATOM 3843  H HG23 . ILE A 1 33  ? 4.214   1.090   -0.620  1.00 0.00 ? 33  ILE A HG23 3  
ATOM 3844  H HD11 . ILE A 1 33  ? 5.154   5.705   0.055   1.00 0.00 ? 33  ILE A HD11 3  
ATOM 3845  H HD12 . ILE A 1 33  ? 5.585   4.925   1.576   1.00 0.00 ? 33  ILE A HD12 3  
ATOM 3846  H HD13 . ILE A 1 33  ? 4.045   5.770   1.424   1.00 0.00 ? 33  ILE A HD13 3  
ATOM 3847  N N    . THR A 1 34  ? 5.153   3.533   3.294   1.00 0.00 ? 34  THR A N    3  
ATOM 3848  C CA   . THR A 1 34  ? 5.702   4.396   4.381   1.00 0.00 ? 34  THR A CA   3  
ATOM 3849  C C    . THR A 1 34  ? 6.352   3.516   5.453   1.00 0.00 ? 34  THR A C    3  
ATOM 3850  O O    . THR A 1 34  ? 7.249   3.938   6.155   1.00 0.00 ? 34  THR A O    3  
ATOM 3851  C CB   . THR A 1 34  ? 4.576   5.220   5.011   1.00 0.00 ? 34  THR A CB   3  
ATOM 3852  O OG1  . THR A 1 34  ? 3.507   4.360   5.378   1.00 0.00 ? 34  THR A OG1  3  
ATOM 3853  C CG2  . THR A 1 34  ? 4.082   6.264   4.009   1.00 0.00 ? 34  THR A CG2  3  
ATOM 3854  H H    . THR A 1 34  ? 4.192   3.499   3.127   1.00 0.00 ? 34  THR A H    3  
ATOM 3855  H HA   . THR A 1 34  ? 6.444   5.061   3.966   1.00 0.00 ? 34  THR A HA   3  
ATOM 3856  H HB   . THR A 1 34  ? 4.949   5.722   5.890   1.00 0.00 ? 34  THR A HB   3  
ATOM 3857  H HG1  . THR A 1 34  ? 3.483   4.309   6.336   1.00 0.00 ? 34  THR A HG1  3  
ATOM 3858  H HG21 . THR A 1 34  ? 4.926   6.690   3.488   1.00 0.00 ? 34  THR A HG21 3  
ATOM 3859  H HG22 . THR A 1 34  ? 3.553   7.047   4.535   1.00 0.00 ? 34  THR A HG22 3  
ATOM 3860  H HG23 . THR A 1 34  ? 3.418   5.797   3.298   1.00 0.00 ? 34  THR A HG23 3  
ATOM 3861  N N    . LYS A 1 35  ? 5.904   2.297   5.587   1.00 0.00 ? 35  LYS A N    3  
ATOM 3862  C CA   . LYS A 1 35  ? 6.494   1.391   6.615   1.00 0.00 ? 35  LYS A CA   3  
ATOM 3863  C C    . LYS A 1 35  ? 7.801   0.786   6.088   1.00 0.00 ? 35  LYS A C    3  
ATOM 3864  O O    . LYS A 1 35  ? 8.864   1.023   6.625   1.00 0.00 ? 35  LYS A O    3  
ATOM 3865  C CB   . LYS A 1 35  ? 5.503   0.268   6.931   1.00 0.00 ? 35  LYS A CB   3  
ATOM 3866  C CG   . LYS A 1 35  ? 5.480   0.014   8.440   1.00 0.00 ? 35  LYS A CG   3  
ATOM 3867  C CD   . LYS A 1 35  ? 4.104   0.379   9.000   1.00 0.00 ? 35  LYS A CD   3  
ATOM 3868  C CE   . LYS A 1 35  ? 4.070   0.086   10.502  1.00 0.00 ? 35  LYS A CE   3  
ATOM 3869  N NZ   . LYS A 1 35  ? 4.753   1.186   11.238  1.00 0.00 ? 35  LYS A NZ   3  
ATOM 3870  H H    . LYS A 1 35  ? 5.178   1.979   5.013   1.00 0.00 ? 35  LYS A H    3  
ATOM 3871  H HA   . LYS A 1 35  ? 6.696   1.953   7.514   1.00 0.00 ? 35  LYS A HA   3  
ATOM 3872  H HB2  . LYS A 1 35  ? 4.515   0.554   6.598   1.00 0.00 ? 35  LYS A HB2  3  
ATOM 3873  H HB3  . LYS A 1 35  ? 5.806   -0.635  6.422   1.00 0.00 ? 35  LYS A HB3  3  
ATOM 3874  H HG2  . LYS A 1 35  ? 5.684   -1.029  8.634   1.00 0.00 ? 35  LYS A HG2  3  
ATOM 3875  H HG3  . LYS A 1 35  ? 6.233   0.622   8.918   1.00 0.00 ? 35  LYS A HG3  3  
ATOM 3876  H HD2  . LYS A 1 35  ? 3.914   1.428   8.833   1.00 0.00 ? 35  LYS A HD2  3  
ATOM 3877  H HD3  . LYS A 1 35  ? 3.347   -0.208  8.503   1.00 0.00 ? 35  LYS A HD3  3  
ATOM 3878  H HE2  . LYS A 1 35  ? 3.044   0.014   10.832  1.00 0.00 ? 35  LYS A HE2  3  
ATOM 3879  H HE3  . LYS A 1 35  ? 4.577   -0.848  10.697  1.00 0.00 ? 35  LYS A HE3  3  
ATOM 3880  H HZ1  . LYS A 1 35  ? 5.464   1.628   10.621  1.00 0.00 ? 35  LYS A HZ1  3  
ATOM 3881  H HZ2  . LYS A 1 35  ? 5.221   0.798   12.084  1.00 0.00 ? 35  LYS A HZ2  3  
ATOM 3882  H HZ3  . LYS A 1 35  ? 4.054   1.899   11.525  1.00 0.00 ? 35  LYS A HZ3  3  
ATOM 3883  N N    . HIS A 1 36  ? 7.730   0.001   5.046   1.00 0.00 ? 36  HIS A N    3  
ATOM 3884  C CA   . HIS A 1 36  ? 8.969   -0.622  4.493   1.00 0.00 ? 36  HIS A CA   3  
ATOM 3885  C C    . HIS A 1 36  ? 9.829   0.449   3.821   1.00 0.00 ? 36  HIS A C    3  
ATOM 3886  O O    . HIS A 1 36  ? 11.025  0.517   4.022   1.00 0.00 ? 36  HIS A O    3  
ATOM 3887  C CB   . HIS A 1 36  ? 8.588   -1.684  3.463   1.00 0.00 ? 36  HIS A CB   3  
ATOM 3888  C CG   . HIS A 1 36  ? 8.289   -2.978  4.168   1.00 0.00 ? 36  HIS A CG   3  
ATOM 3889  N ND1  . HIS A 1 36  ? 9.293   -3.828  4.606   1.00 0.00 ? 36  HIS A ND1  3  
ATOM 3890  C CD2  . HIS A 1 36  ? 7.107   -3.578  4.524   1.00 0.00 ? 36  HIS A CD2  3  
ATOM 3891  C CE1  . HIS A 1 36  ? 8.701   -4.882  5.197   1.00 0.00 ? 36  HIS A CE1  3  
ATOM 3892  N NE2  . HIS A 1 36  ? 7.369   -4.779  5.175   1.00 0.00 ? 36  HIS A NE2  3  
ATOM 3893  H H    . HIS A 1 36  ? 6.862   -0.183  4.629   1.00 0.00 ? 36  HIS A H    3  
ATOM 3894  H HA   . HIS A 1 36  ? 9.528   -1.082  5.294   1.00 0.00 ? 36  HIS A HA   3  
ATOM 3895  H HB2  . HIS A 1 36  ? 7.715   -1.359  2.916   1.00 0.00 ? 36  HIS A HB2  3  
ATOM 3896  H HB3  . HIS A 1 36  ? 9.408   -1.830  2.774   1.00 0.00 ? 36  HIS A HB3  3  
ATOM 3897  H HD1  . HIS A 1 36  ? 10.257  -3.687  4.503   1.00 0.00 ? 36  HIS A HD1  3  
ATOM 3898  H HD2  . HIS A 1 36  ? 6.124   -3.176  4.332   1.00 0.00 ? 36  HIS A HD2  3  
ATOM 3899  H HE1  . HIS A 1 36  ? 9.238   -5.711  5.636   1.00 0.00 ? 36  HIS A HE1  3  
ATOM 3900  N N    . TYR A 1 37  ? 9.227   1.285   3.024   1.00 0.00 ? 37  TYR A N    3  
ATOM 3901  C CA   . TYR A 1 37  ? 10.009  2.354   2.339   1.00 0.00 ? 37  TYR A CA   3  
ATOM 3902  C C    . TYR A 1 37  ? 10.264  3.497   3.333   1.00 0.00 ? 37  TYR A C    3  
ATOM 3903  O O    . TYR A 1 37  ? 9.332   4.101   3.824   1.00 0.00 ? 37  TYR A O    3  
ATOM 3904  C CB   . TYR A 1 37  ? 9.223   2.888   1.131   1.00 0.00 ? 37  TYR A CB   3  
ATOM 3905  C CG   . TYR A 1 37  ? 10.023  2.657   -0.122  1.00 0.00 ? 37  TYR A CG   3  
ATOM 3906  C CD1  . TYR A 1 37  ? 10.452  1.366   -0.440  1.00 0.00 ? 37  TYR A CD1  3  
ATOM 3907  C CD2  . TYR A 1 37  ? 10.334  3.728   -0.965  1.00 0.00 ? 37  TYR A CD2  3  
ATOM 3908  C CE1  . TYR A 1 37  ? 11.194  1.142   -1.602  1.00 0.00 ? 37  TYR A CE1  3  
ATOM 3909  C CE2  . TYR A 1 37  ? 11.078  3.506   -2.128  1.00 0.00 ? 37  TYR A CE2  3  
ATOM 3910  C CZ   . TYR A 1 37  ? 11.509  2.212   -2.448  1.00 0.00 ? 37  TYR A CZ   3  
ATOM 3911  O OH   . TYR A 1 37  ? 12.243  1.993   -3.595  1.00 0.00 ? 37  TYR A OH   3  
ATOM 3912  H H    . TYR A 1 37  ? 8.263   1.207   2.880   1.00 0.00 ? 37  TYR A H    3  
ATOM 3913  H HA   . TYR A 1 37  ? 10.947  1.944   2.000   1.00 0.00 ? 37  TYR A HA   3  
ATOM 3914  H HB2  . TYR A 1 37  ? 8.279   2.369   1.045   1.00 0.00 ? 37  TYR A HB2  3  
ATOM 3915  H HB3  . TYR A 1 37  ? 9.045   3.946   1.254   1.00 0.00 ? 37  TYR A HB3  3  
ATOM 3916  H HD1  . TYR A 1 37  ? 10.208  0.540   0.213   1.00 0.00 ? 37  TYR A HD1  3  
ATOM 3917  H HD2  . TYR A 1 37  ? 10.000  4.727   -0.717  1.00 0.00 ? 37  TYR A HD2  3  
ATOM 3918  H HE1  . TYR A 1 37  ? 11.524  0.143   -1.845  1.00 0.00 ? 37  TYR A HE1  3  
ATOM 3919  H HE2  . TYR A 1 37  ? 11.317  4.331   -2.781  1.00 0.00 ? 37  TYR A HE2  3  
ATOM 3920  H HH   . TYR A 1 37  ? 13.157  1.847   -3.338  1.00 0.00 ? 37  TYR A HH   3  
ATOM 3921  N N    . PRO A 1 38  ? 11.522  3.753   3.613   1.00 0.00 ? 38  PRO A N    3  
ATOM 3922  C CA   . PRO A 1 38  ? 11.922  4.810   4.561   1.00 0.00 ? 38  PRO A CA   3  
ATOM 3923  C C    . PRO A 1 38  ? 11.794  6.195   3.921   1.00 0.00 ? 38  PRO A C    3  
ATOM 3924  O O    . PRO A 1 38  ? 11.453  7.160   4.577   1.00 0.00 ? 38  PRO A O    3  
ATOM 3925  C CB   . PRO A 1 38  ? 13.386  4.484   4.868   1.00 0.00 ? 38  PRO A CB   3  
ATOM 3926  C CG   . PRO A 1 38  ? 13.899  3.637   3.681   1.00 0.00 ? 38  PRO A CG   3  
ATOM 3927  C CD   . PRO A 1 38  ? 12.657  3.021   3.012   1.00 0.00 ? 38  PRO A CD   3  
ATOM 3928  H HA   . PRO A 1 38  ? 11.337  4.752   5.464   1.00 0.00 ? 38  PRO A HA   3  
ATOM 3929  H HB2  . PRO A 1 38  ? 13.958  5.397   4.955   1.00 0.00 ? 38  PRO A HB2  3  
ATOM 3930  H HB3  . PRO A 1 38  ? 13.455  3.911   5.780   1.00 0.00 ? 38  PRO A HB3  3  
ATOM 3931  H HG2  . PRO A 1 38  ? 14.427  4.270   2.979   1.00 0.00 ? 38  PRO A HG2  3  
ATOM 3932  H HG3  . PRO A 1 38  ? 14.551  2.853   4.036   1.00 0.00 ? 38  PRO A HG3  3  
ATOM 3933  H HD2  . PRO A 1 38  ? 12.688  3.175   1.942   1.00 0.00 ? 38  PRO A HD2  3  
ATOM 3934  H HD3  . PRO A 1 38  ? 12.585  1.970   3.243   1.00 0.00 ? 38  PRO A HD3  3  
ATOM 3935  N N    . TYR A 1 39  ? 12.065  6.309   2.650   1.00 0.00 ? 39  TYR A N    3  
ATOM 3936  C CA   . TYR A 1 39  ? 11.954  7.639   1.990   1.00 0.00 ? 39  TYR A CA   3  
ATOM 3937  C C    . TYR A 1 39  ? 10.518  8.150   2.129   1.00 0.00 ? 39  TYR A C    3  
ATOM 3938  O O    . TYR A 1 39  ? 10.274  9.201   2.688   1.00 0.00 ? 39  TYR A O    3  
ATOM 3939  C CB   . TYR A 1 39  ? 12.314  7.510   0.505   1.00 0.00 ? 39  TYR A CB   3  
ATOM 3940  C CG   . TYR A 1 39  ? 11.864  8.748   -0.233  1.00 0.00 ? 39  TYR A CG   3  
ATOM 3941  C CD1  . TYR A 1 39  ? 12.543  9.960   -0.050  1.00 0.00 ? 39  TYR A CD1  3  
ATOM 3942  C CD2  . TYR A 1 39  ? 10.762  8.687   -1.094  1.00 0.00 ? 39  TYR A CD2  3  
ATOM 3943  C CE1  . TYR A 1 39  ? 12.119  11.109  -0.728  1.00 0.00 ? 39  TYR A CE1  3  
ATOM 3944  C CE2  . TYR A 1 39  ? 10.339  9.835   -1.773  1.00 0.00 ? 39  TYR A CE2  3  
ATOM 3945  C CZ   . TYR A 1 39  ? 11.016  11.047  -1.589  1.00 0.00 ? 39  TYR A CZ   3  
ATOM 3946  O OH   . TYR A 1 39  ? 10.598  12.180  -2.257  1.00 0.00 ? 39  TYR A OH   3  
ATOM 3947  H H    . TYR A 1 39  ? 12.340  5.524   2.133   1.00 0.00 ? 39  TYR A H    3  
ATOM 3948  H HA   . TYR A 1 39  ? 12.630  8.334   2.465   1.00 0.00 ? 39  TYR A HA   3  
ATOM 3949  H HB2  . TYR A 1 39  ? 13.384  7.398   0.403   1.00 0.00 ? 39  TYR A HB2  3  
ATOM 3950  H HB3  . TYR A 1 39  ? 11.821  6.644   0.088   1.00 0.00 ? 39  TYR A HB3  3  
ATOM 3951  H HD1  . TYR A 1 39  ? 13.394  10.008  0.614   1.00 0.00 ? 39  TYR A HD1  3  
ATOM 3952  H HD2  . TYR A 1 39  ? 10.240  7.753   -1.237  1.00 0.00 ? 39  TYR A HD2  3  
ATOM 3953  H HE1  . TYR A 1 39  ? 12.642  12.043  -0.587  1.00 0.00 ? 39  TYR A HE1  3  
ATOM 3954  H HE2  . TYR A 1 39  ? 9.488   9.789   -2.437  1.00 0.00 ? 39  TYR A HE2  3  
ATOM 3955  H HH   . TYR A 1 39  ? 11.269  12.857  -2.144  1.00 0.00 ? 39  TYR A HH   3  
ATOM 3956  N N    . TYR A 1 40  ? 9.566   7.415   1.624   1.00 0.00 ? 40  TYR A N    3  
ATOM 3957  C CA   . TYR A 1 40  ? 8.148   7.859   1.727   1.00 0.00 ? 40  TYR A CA   3  
ATOM 3958  C C    . TYR A 1 40  ? 7.759   7.994   3.203   1.00 0.00 ? 40  TYR A C    3  
ATOM 3959  O O    . TYR A 1 40  ? 7.451   7.022   3.862   1.00 0.00 ? 40  TYR A O    3  
ATOM 3960  C CB   . TYR A 1 40  ? 7.243   6.827   1.055   1.00 0.00 ? 40  TYR A CB   3  
ATOM 3961  C CG   . TYR A 1 40  ? 6.969   7.251   -0.369  1.00 0.00 ? 40  TYR A CG   3  
ATOM 3962  C CD1  . TYR A 1 40  ? 6.576   8.567   -0.638  1.00 0.00 ? 40  TYR A CD1  3  
ATOM 3963  C CD2  . TYR A 1 40  ? 7.111   6.332   -1.417  1.00 0.00 ? 40  TYR A CD2  3  
ATOM 3964  C CE1  . TYR A 1 40  ? 6.325   8.967   -1.957  1.00 0.00 ? 40  TYR A CE1  3  
ATOM 3965  C CE2  . TYR A 1 40  ? 6.858   6.733   -2.737  1.00 0.00 ? 40  TYR A CE2  3  
ATOM 3966  C CZ   . TYR A 1 40  ? 6.467   8.050   -3.006  1.00 0.00 ? 40  TYR A CZ   3  
ATOM 3967  O OH   . TYR A 1 40  ? 6.222   8.445   -4.305  1.00 0.00 ? 40  TYR A OH   3  
ATOM 3968  H H    . TYR A 1 40  ? 9.785   6.572   1.177   1.00 0.00 ? 40  TYR A H    3  
ATOM 3969  H HA   . TYR A 1 40  ? 8.033   8.814   1.233   1.00 0.00 ? 40  TYR A HA   3  
ATOM 3970  H HB2  . TYR A 1 40  ? 7.731   5.863   1.057   1.00 0.00 ? 40  TYR A HB2  3  
ATOM 3971  H HB3  . TYR A 1 40  ? 6.312   6.761   1.595   1.00 0.00 ? 40  TYR A HB3  3  
ATOM 3972  H HD1  . TYR A 1 40  ? 6.467   9.271   0.173   1.00 0.00 ? 40  TYR A HD1  3  
ATOM 3973  H HD2  . TYR A 1 40  ? 7.414   5.314   -1.209  1.00 0.00 ? 40  TYR A HD2  3  
ATOM 3974  H HE1  . TYR A 1 40  ? 6.021   9.983   -2.167  1.00 0.00 ? 40  TYR A HE1  3  
ATOM 3975  H HE2  . TYR A 1 40  ? 6.966   6.028   -3.549  1.00 0.00 ? 40  TYR A HE2  3  
ATOM 3976  H HH   . TYR A 1 40  ? 5.279   8.598   -4.397  1.00 0.00 ? 40  TYR A HH   3  
ATOM 3977  N N    . ARG A 1 41  ? 7.771   9.191   3.729   1.00 0.00 ? 41  ARG A N    3  
ATOM 3978  C CA   . ARG A 1 41  ? 7.401   9.380   5.160   1.00 0.00 ? 41  ARG A CA   3  
ATOM 3979  C C    . ARG A 1 41  ? 6.581   10.665  5.312   1.00 0.00 ? 41  ARG A C    3  
ATOM 3980  O O    . ARG A 1 41  ? 5.518   10.670  5.900   1.00 0.00 ? 41  ARG A O    3  
ATOM 3981  C CB   . ARG A 1 41  ? 8.674   9.480   6.005   1.00 0.00 ? 41  ARG A CB   3  
ATOM 3982  C CG   . ARG A 1 41  ? 8.351   9.157   7.464   1.00 0.00 ? 41  ARG A CG   3  
ATOM 3983  C CD   . ARG A 1 41  ? 9.308   9.921   8.381   1.00 0.00 ? 41  ARG A CD   3  
ATOM 3984  N NE   . ARG A 1 41  ? 9.915   8.980   9.363   1.00 0.00 ? 41  ARG A NE   3  
ATOM 3985  C CZ   . ARG A 1 41  ? 11.144  8.568   9.199   1.00 0.00 ? 41  ARG A CZ   3  
ATOM 3986  N NH1  . ARG A 1 41  ? 11.688  8.591   8.013   1.00 0.00 ? 41  ARG A NH1  3  
ATOM 3987  N NH2  . ARG A 1 41  ? 11.828  8.131   10.222  1.00 0.00 ? 41  ARG A NH2  3  
ATOM 3988  H H    . ARG A 1 41  ? 8.022   9.966   3.183   1.00 0.00 ? 41  ARG A H    3  
ATOM 3989  H HA   . ARG A 1 41  ? 6.813   8.536   5.494   1.00 0.00 ? 41  ARG A HA   3  
ATOM 3990  H HB2  . ARG A 1 41  ? 9.406   8.777   5.635   1.00 0.00 ? 41  ARG A HB2  3  
ATOM 3991  H HB3  . ARG A 1 41  ? 9.072   10.481  5.939   1.00 0.00 ? 41  ARG A HB3  3  
ATOM 3992  H HG2  . ARG A 1 41  ? 7.334   9.450   7.680   1.00 0.00 ? 41  ARG A HG2  3  
ATOM 3993  H HG3  . ARG A 1 41  ? 8.464   8.097   7.632   1.00 0.00 ? 41  ARG A HG3  3  
ATOM 3994  H HD2  . ARG A 1 41  ? 10.088  10.375  7.788   1.00 0.00 ? 41  ARG A HD2  3  
ATOM 3995  H HD3  . ARG A 1 41  ? 8.765   10.690  8.909   1.00 0.00 ? 41  ARG A HD3  3  
ATOM 3996  H HE   . ARG A 1 41  ? 9.393   8.670   10.132  1.00 0.00 ? 41  ARG A HE   3  
ATOM 3997  H HH11 . ARG A 1 41  ? 11.163  8.925   7.229   1.00 0.00 ? 41  ARG A HH11 3  
ATOM 3998  H HH12 . ARG A 1 41  ? 12.628  8.276   7.887   1.00 0.00 ? 41  ARG A HH12 3  
ATOM 3999  H HH21 . ARG A 1 41  ? 11.412  8.113   11.130  1.00 0.00 ? 41  ARG A HH21 3  
ATOM 4000  H HH22 . ARG A 1 41  ? 12.768  7.817   10.096  1.00 0.00 ? 41  ARG A HH22 3  
ATOM 4001  N N    . THR A 1 42  ? 7.068   11.754  4.783   1.00 0.00 ? 42  THR A N    3  
ATOM 4002  C CA   . THR A 1 42  ? 6.322   13.039  4.892   1.00 0.00 ? 42  THR A CA   3  
ATOM 4003  C C    . THR A 1 42  ? 6.913   14.047  3.903   1.00 0.00 ? 42  THR A C    3  
ATOM 4004  O O    . THR A 1 42  ? 7.064   15.215  4.205   1.00 0.00 ? 42  THR A O    3  
ATOM 4005  C CB   . THR A 1 42  ? 6.449   13.587  6.316   1.00 0.00 ? 42  THR A CB   3  
ATOM 4006  O OG1  . THR A 1 42  ? 7.123   12.634  7.128   1.00 0.00 ? 42  THR A OG1  3  
ATOM 4007  C CG2  . THR A 1 42  ? 5.057   13.854  6.889   1.00 0.00 ? 42  THR A CG2  3  
ATOM 4008  H H    . THR A 1 42  ? 7.927   11.725  4.312   1.00 0.00 ? 42  THR A H    3  
ATOM 4009  H HA   . THR A 1 42  ? 5.281   12.874  4.658   1.00 0.00 ? 42  THR A HA   3  
ATOM 4010  H HB   . THR A 1 42  ? 7.010   14.508  6.300   1.00 0.00 ? 42  THR A HB   3  
ATOM 4011  H HG1  . THR A 1 42  ? 8.067   12.783  7.037   1.00 0.00 ? 42  THR A HG1  3  
ATOM 4012  H HG21 . THR A 1 42  ? 4.318   13.736  6.110   1.00 0.00 ? 42  THR A HG21 3  
ATOM 4013  H HG22 . THR A 1 42  ? 5.014   14.861  7.277   1.00 0.00 ? 42  THR A HG22 3  
ATOM 4014  H HG23 . THR A 1 42  ? 4.856   13.153  7.686   1.00 0.00 ? 42  THR A HG23 3  
ATOM 4015  N N    . ALA A 1 43  ? 7.255   13.601  2.725   1.00 0.00 ? 43  ALA A N    3  
ATOM 4016  C CA   . ALA A 1 43  ? 7.843   14.525  1.716   1.00 0.00 ? 43  ALA A CA   3  
ATOM 4017  C C    . ALA A 1 43  ? 6.734   15.345  1.054   1.00 0.00 ? 43  ALA A C    3  
ATOM 4018  O O    . ALA A 1 43  ? 6.397   16.424  1.500   1.00 0.00 ? 43  ALA A O    3  
ATOM 4019  C CB   . ALA A 1 43  ? 8.577   13.710  0.649   1.00 0.00 ? 43  ALA A CB   3  
ATOM 4020  H H    . ALA A 1 43  ? 7.128   12.653  2.506   1.00 0.00 ? 43  ALA A H    3  
ATOM 4021  H HA   . ALA A 1 43  ? 8.542   15.190  2.201   1.00 0.00 ? 43  ALA A HA   3  
ATOM 4022  H HB1  . ALA A 1 43  ? 8.666   14.296  -0.253  1.00 0.00 ? 43  ALA A HB1  3  
ATOM 4023  H HB2  . ALA A 1 43  ? 8.021   12.809  0.440   1.00 0.00 ? 43  ALA A HB2  3  
ATOM 4024  H HB3  . ALA A 1 43  ? 9.561   13.451  1.009   1.00 0.00 ? 43  ALA A HB3  3  
ATOM 4025  N N    . ASP A 1 44  ? 6.170   14.847  -0.013  1.00 0.00 ? 44  ASP A N    3  
ATOM 4026  C CA   . ASP A 1 44  ? 5.090   15.606  -0.704  1.00 0.00 ? 44  ASP A CA   3  
ATOM 4027  C C    . ASP A 1 44  ? 3.872   14.702  -0.908  1.00 0.00 ? 44  ASP A C    3  
ATOM 4028  O O    . ASP A 1 44  ? 3.994   13.507  -1.085  1.00 0.00 ? 44  ASP A O    3  
ATOM 4029  C CB   . ASP A 1 44  ? 5.602   16.088  -2.062  1.00 0.00 ? 44  ASP A CB   3  
ATOM 4030  C CG   . ASP A 1 44  ? 6.121   17.522  -1.930  1.00 0.00 ? 44  ASP A CG   3  
ATOM 4031  O OD1  . ASP A 1 44  ? 6.241   17.987  -0.808  1.00 0.00 ? 44  ASP A OD1  3  
ATOM 4032  O OD2  . ASP A 1 44  ? 6.391   18.130  -2.953  1.00 0.00 ? 44  ASP A OD2  3  
ATOM 4033  H H    . ASP A 1 44  ? 6.459   13.979  -0.361  1.00 0.00 ? 44  ASP A H    3  
ATOM 4034  H HA   . ASP A 1 44  ? 4.809   16.457  -0.103  1.00 0.00 ? 44  ASP A HA   3  
ATOM 4035  H HB2  . ASP A 1 44  ? 6.403   15.444  -2.395  1.00 0.00 ? 44  ASP A HB2  3  
ATOM 4036  H HB3  . ASP A 1 44  ? 4.797   16.065  -2.781  1.00 0.00 ? 44  ASP A HB3  3  
ATOM 4037  N N    . LYS A 1 45  ? 2.695   15.267  -0.882  1.00 0.00 ? 45  LYS A N    3  
ATOM 4038  C CA   . LYS A 1 45  ? 1.467   14.444  -1.072  1.00 0.00 ? 45  LYS A CA   3  
ATOM 4039  C C    . LYS A 1 45  ? 1.111   14.384  -2.561  1.00 0.00 ? 45  LYS A C    3  
ATOM 4040  O O    . LYS A 1 45  ? -0.037  14.521  -2.938  1.00 0.00 ? 45  LYS A O    3  
ATOM 4041  C CB   . LYS A 1 45  ? 0.309   15.075  -0.297  1.00 0.00 ? 45  LYS A CB   3  
ATOM 4042  C CG   . LYS A 1 45  ? 0.674   15.169  1.186   1.00 0.00 ? 45  LYS A CG   3  
ATOM 4043  C CD   . LYS A 1 45  ? 0.288   13.868  1.892   1.00 0.00 ? 45  LYS A CD   3  
ATOM 4044  C CE   . LYS A 1 45  ? 0.508   14.018  3.399   1.00 0.00 ? 45  LYS A CE   3  
ATOM 4045  N NZ   . LYS A 1 45  ? -0.225  15.219  3.892   1.00 0.00 ? 45  LYS A NZ   3  
ATOM 4046  H H    . LYS A 1 45  ? 2.619   16.233  -0.737  1.00 0.00 ? 45  LYS A H    3  
ATOM 4047  H HA   . LYS A 1 45  ? 1.644   13.445  -0.705  1.00 0.00 ? 45  LYS A HA   3  
ATOM 4048  H HB2  . LYS A 1 45  ? 0.114   16.065  -0.684  1.00 0.00 ? 45  LYS A HB2  3  
ATOM 4049  H HB3  . LYS A 1 45  ? -0.575  14.464  -0.409  1.00 0.00 ? 45  LYS A HB3  3  
ATOM 4050  H HG2  . LYS A 1 45  ? 1.739   15.331  1.283   1.00 0.00 ? 45  LYS A HG2  3  
ATOM 4051  H HG3  . LYS A 1 45  ? 0.141   15.993  1.636   1.00 0.00 ? 45  LYS A HG3  3  
ATOM 4052  H HD2  . LYS A 1 45  ? -0.753  13.649  1.699   1.00 0.00 ? 45  LYS A HD2  3  
ATOM 4053  H HD3  . LYS A 1 45  ? 0.901   13.061  1.519   1.00 0.00 ? 45  LYS A HD3  3  
ATOM 4054  H HE2  . LYS A 1 45  ? 0.139   13.139  3.905   1.00 0.00 ? 45  LYS A HE2  3  
ATOM 4055  H HE3  . LYS A 1 45  ? 1.563   14.133  3.599   1.00 0.00 ? 45  LYS A HE3  3  
ATOM 4056  H HZ1  . LYS A 1 45  ? -0.374  15.136  4.918   1.00 0.00 ? 45  LYS A HZ1  3  
ATOM 4057  H HZ2  . LYS A 1 45  ? -1.146  15.284  3.411   1.00 0.00 ? 45  LYS A HZ2  3  
ATOM 4058  H HZ3  . LYS A 1 45  ? 0.333   16.073  3.692   1.00 0.00 ? 45  LYS A HZ3  3  
ATOM 4059  N N    . GLY A 1 46  ? 2.082   14.180  -3.407  1.00 0.00 ? 46  GLY A N    3  
ATOM 4060  C CA   . GLY A 1 46  ? 1.793   14.111  -4.869  1.00 0.00 ? 46  GLY A CA   3  
ATOM 4061  C C    . GLY A 1 46  ? 1.293   12.710  -5.226  1.00 0.00 ? 46  GLY A C    3  
ATOM 4062  O O    . GLY A 1 46  ? 0.210   12.542  -5.753  1.00 0.00 ? 46  GLY A O    3  
ATOM 4063  H H    . GLY A 1 46  ? 3.000   14.072  -3.084  1.00 0.00 ? 46  GLY A H    3  
ATOM 4064  H HA2  . GLY A 1 46  ? 1.035   14.841  -5.122  1.00 0.00 ? 46  GLY A HA2  3  
ATOM 4065  H HA3  . GLY A 1 46  ? 2.698   14.322  -5.424  1.00 0.00 ? 46  GLY A HA3  3  
ATOM 4066  N N    . TRP A 1 47  ? 2.074   11.703  -4.946  1.00 0.00 ? 47  TRP A N    3  
ATOM 4067  C CA   . TRP A 1 47  ? 1.650   10.311  -5.270  1.00 0.00 ? 47  TRP A CA   3  
ATOM 4068  C C    . TRP A 1 47  ? 0.417   9.931   -4.450  1.00 0.00 ? 47  TRP A C    3  
ATOM 4069  O O    . TRP A 1 47  ? -0.177  8.895   -4.660  1.00 0.00 ? 47  TRP A O    3  
ATOM 4070  C CB   . TRP A 1 47  ? 2.784   9.336   -4.954  1.00 0.00 ? 47  TRP A CB   3  
ATOM 4071  C CG   . TRP A 1 47  ? 2.991   9.240   -3.475  1.00 0.00 ? 47  TRP A CG   3  
ATOM 4072  C CD1  . TRP A 1 47  ? 3.454   10.240  -2.687  1.00 0.00 ? 47  TRP A CD1  3  
ATOM 4073  C CD2  . TRP A 1 47  ? 2.773   8.097   -2.596  1.00 0.00 ? 47  TRP A CD2  3  
ATOM 4074  N NE1  . TRP A 1 47  ? 3.544   9.781   -1.388  1.00 0.00 ? 47  TRP A NE1  3  
ATOM 4075  C CE2  . TRP A 1 47  ? 3.137   8.469   -1.280  1.00 0.00 ? 47  TRP A CE2  3  
ATOM 4076  C CE3  . TRP A 1 47  ? 2.304   6.783   -2.808  1.00 0.00 ? 47  TRP A CE3  3  
ATOM 4077  C CZ2  . TRP A 1 47  ? 3.044   7.577   -0.215  1.00 0.00 ? 47  TRP A CZ2  3  
ATOM 4078  C CZ3  . TRP A 1 47  ? 2.210   5.885   -1.734  1.00 0.00 ? 47  TRP A CZ3  3  
ATOM 4079  C CH2  . TRP A 1 47  ? 2.582   6.281   -0.443  1.00 0.00 ? 47  TRP A CH2  3  
ATOM 4080  H H    . TRP A 1 47  ? 2.943   11.864  -4.527  1.00 0.00 ? 47  TRP A H    3  
ATOM 4081  H HA   . TRP A 1 47  ? 1.413   10.247  -6.320  1.00 0.00 ? 47  TRP A HA   3  
ATOM 4082  H HB2  . TRP A 1 47  ? 2.537   8.361   -5.343  1.00 0.00 ? 47  TRP A HB2  3  
ATOM 4083  H HB3  . TRP A 1 47  ? 3.695   9.685   -5.417  1.00 0.00 ? 47  TRP A HB3  3  
ATOM 4084  H HD1  . TRP A 1 47  ? 3.714   11.231  -3.018  1.00 0.00 ? 47  TRP A HD1  3  
ATOM 4085  H HE1  . TRP A 1 47  ? 3.856   10.309  -0.623  1.00 0.00 ? 47  TRP A HE1  3  
ATOM 4086  H HE3  . TRP A 1 47  ? 2.005   6.468   -3.799  1.00 0.00 ? 47  TRP A HE3  3  
ATOM 4087  H HZ2  . TRP A 1 47  ? 3.332   7.886   0.780   1.00 0.00 ? 47  TRP A HZ2  3  
ATOM 4088  H HZ3  . TRP A 1 47  ? 1.853   4.880   -1.905  1.00 0.00 ? 47  TRP A HZ3  3  
ATOM 4089  H HH2  . TRP A 1 47  ? 2.516   5.586   0.376   1.00 0.00 ? 47  TRP A HH2  3  
ATOM 4090  N N    . GLN A 1 48  ? 0.028   10.751  -3.516  1.00 0.00 ? 48  GLN A N    3  
ATOM 4091  C CA   . GLN A 1 48  ? -1.166  10.413  -2.695  1.00 0.00 ? 48  GLN A CA   3  
ATOM 4092  C C    . GLN A 1 48  ? -2.346  10.093  -3.619  1.00 0.00 ? 48  GLN A C    3  
ATOM 4093  O O    . GLN A 1 48  ? -2.797  8.967   -3.697  1.00 0.00 ? 48  GLN A O    3  
ATOM 4094  C CB   . GLN A 1 48  ? -1.521  11.601  -1.798  1.00 0.00 ? 48  GLN A CB   3  
ATOM 4095  C CG   . GLN A 1 48  ? -2.225  11.095  -0.537  1.00 0.00 ? 48  GLN A CG   3  
ATOM 4096  C CD   . GLN A 1 48  ? -1.337  10.065  0.162   1.00 0.00 ? 48  GLN A CD   3  
ATOM 4097  O OE1  . GLN A 1 48  ? -1.823  9.226   0.896   1.00 0.00 ? 48  GLN A OE1  3  
ATOM 4098  N NE2  . GLN A 1 48  ? -0.048  10.094  -0.034  1.00 0.00 ? 48  GLN A NE2  3  
ATOM 4099  H H    . GLN A 1 48  ? 0.519   11.582  -3.351  1.00 0.00 ? 48  GLN A H    3  
ATOM 4100  H HA   . GLN A 1 48  ? -0.945  9.553   -2.082  1.00 0.00 ? 48  GLN A HA   3  
ATOM 4101  H HB2  . GLN A 1 48  ? -0.619  12.126  -1.522  1.00 0.00 ? 48  GLN A HB2  3  
ATOM 4102  H HB3  . GLN A 1 48  ? -2.178  12.270  -2.331  1.00 0.00 ? 48  GLN A HB3  3  
ATOM 4103  H HG2  . GLN A 1 48  ? -2.410  11.925  0.129   1.00 0.00 ? 48  GLN A HG2  3  
ATOM 4104  H HG3  . GLN A 1 48  ? -3.163  10.634  -0.807  1.00 0.00 ? 48  GLN A HG3  3  
ATOM 4105  H HE21 . GLN A 1 48  ? 0.343   10.771  -0.625  1.00 0.00 ? 48  GLN A HE21 3  
ATOM 4106  H HE22 . GLN A 1 48  ? 0.530   9.436   0.406   1.00 0.00 ? 48  GLN A HE22 3  
ATOM 4107  N N    . ASN A 1 49  ? -2.851  11.075  -4.319  1.00 0.00 ? 49  ASN A N    3  
ATOM 4108  C CA   . ASN A 1 49  ? -4.002  10.827  -5.238  1.00 0.00 ? 49  ASN A CA   3  
ATOM 4109  C C    . ASN A 1 49  ? -3.531  10.032  -6.456  1.00 0.00 ? 49  ASN A C    3  
ATOM 4110  O O    . ASN A 1 49  ? -4.326  9.527   -7.224  1.00 0.00 ? 49  ASN A O    3  
ATOM 4111  C CB   . ASN A 1 49  ? -4.588  12.165  -5.696  1.00 0.00 ? 49  ASN A CB   3  
ATOM 4112  C CG   . ASN A 1 49  ? -3.516  12.973  -6.429  1.00 0.00 ? 49  ASN A CG   3  
ATOM 4113  O OD1  . ASN A 1 49  ? -2.508  12.435  -6.842  1.00 0.00 ? 49  ASN A OD1  3  
ATOM 4114  N ND2  . ASN A 1 49  ? -3.692  14.253  -6.610  1.00 0.00 ? 49  ASN A ND2  3  
ATOM 4115  H H    . ASN A 1 49  ? -2.473  11.975  -4.242  1.00 0.00 ? 49  ASN A H    3  
ATOM 4116  H HA   . ASN A 1 49  ? -4.763  10.262  -4.720  1.00 0.00 ? 49  ASN A HA   3  
ATOM 4117  H HB2  . ASN A 1 49  ? -5.421  11.985  -6.359  1.00 0.00 ? 49  ASN A HB2  3  
ATOM 4118  H HB3  . ASN A 1 49  ? -4.927  12.721  -4.834  1.00 0.00 ? 49  ASN A HB3  3  
ATOM 4119  H HD21 . ASN A 1 49  ? -4.505  14.687  -6.277  1.00 0.00 ? 49  ASN A HD21 3  
ATOM 4120  H HD22 . ASN A 1 49  ? -3.013  14.781  -7.080  1.00 0.00 ? 49  ASN A HD22 3  
ATOM 4121  N N    . SER A 1 50  ? -2.247  9.912   -6.638  1.00 0.00 ? 50  SER A N    3  
ATOM 4122  C CA   . SER A 1 50  ? -1.734  9.145   -7.806  1.00 0.00 ? 50  SER A CA   3  
ATOM 4123  C C    . SER A 1 50  ? -2.087  7.667   -7.633  1.00 0.00 ? 50  SER A C    3  
ATOM 4124  O O    . SER A 1 50  ? -2.584  7.030   -8.535  1.00 0.00 ? 50  SER A O    3  
ATOM 4125  C CB   . SER A 1 50  ? -0.215  9.302   -7.887  1.00 0.00 ? 50  SER A CB   3  
ATOM 4126  O OG   . SER A 1 50  ? 0.271   8.583   -9.013  1.00 0.00 ? 50  SER A OG   3  
ATOM 4127  H H    . SER A 1 50  ? -1.622  10.324  -6.007  1.00 0.00 ? 50  SER A H    3  
ATOM 4128  H HA   . SER A 1 50  ? -2.185  9.521   -8.712  1.00 0.00 ? 50  SER A HA   3  
ATOM 4129  H HB2  . SER A 1 50  ? 0.036   10.343  -7.997  1.00 0.00 ? 50  SER A HB2  3  
ATOM 4130  H HB3  . SER A 1 50  ? 0.234   8.919   -6.981  1.00 0.00 ? 50  SER A HB3  3  
ATOM 4131  H HG   . SER A 1 50  ? 0.663   9.214   -9.621  1.00 0.00 ? 50  SER A HG   3  
ATOM 4132  N N    . ILE A 1 51  ? -1.832  7.124   -6.475  1.00 0.00 ? 51  ILE A N    3  
ATOM 4133  C CA   . ILE A 1 51  ? -2.145  5.688   -6.216  1.00 0.00 ? 51  ILE A CA   3  
ATOM 4134  C C    . ILE A 1 51  ? -3.618  5.407   -6.558  1.00 0.00 ? 51  ILE A C    3  
ATOM 4135  O O    . ILE A 1 51  ? -3.928  4.512   -7.319  1.00 0.00 ? 51  ILE A O    3  
ATOM 4136  C CB   . ILE A 1 51  ? -1.855  5.397   -4.724  1.00 0.00 ? 51  ILE A CB   3  
ATOM 4137  C CG1  . ILE A 1 51  ? -0.510  4.687   -4.597  1.00 0.00 ? 51  ILE A CG1  3  
ATOM 4138  C CG2  . ILE A 1 51  ? -2.930  4.497   -4.103  1.00 0.00 ? 51  ILE A CG2  3  
ATOM 4139  C CD1  . ILE A 1 51  ? 0.530   5.343   -5.510  1.00 0.00 ? 51  ILE A CD1  3  
ATOM 4140  H H    . ILE A 1 51  ? -1.433  7.666   -5.765  1.00 0.00 ? 51  ILE A H    3  
ATOM 4141  H HA   . ILE A 1 51  ? -1.508  5.060   -6.830  1.00 0.00 ? 51  ILE A HA   3  
ATOM 4142  H HB   . ILE A 1 51  ? -1.816  6.331   -4.180  1.00 0.00 ? 51  ILE A HB   3  
ATOM 4143  H HG12 . ILE A 1 51  ? -0.177  4.734   -3.574  1.00 0.00 ? 51  ILE A HG12 3  
ATOM 4144  H HG13 . ILE A 1 51  ? -0.630  3.662   -4.880  1.00 0.00 ? 51  ILE A HG13 3  
ATOM 4145  H HG21 . ILE A 1 51  ? -2.784  4.450   -3.035  1.00 0.00 ? 51  ILE A HG21 3  
ATOM 4146  H HG22 . ILE A 1 51  ? -2.850  3.503   -4.519  1.00 0.00 ? 51  ILE A HG22 3  
ATOM 4147  H HG23 . ILE A 1 51  ? -3.907  4.899   -4.313  1.00 0.00 ? 51  ILE A HG23 3  
ATOM 4148  H HD11 . ILE A 1 51  ? 0.340   5.058   -6.535  1.00 0.00 ? 51  ILE A HD11 3  
ATOM 4149  H HD12 . ILE A 1 51  ? 1.519   5.015   -5.224  1.00 0.00 ? 51  ILE A HD12 3  
ATOM 4150  H HD13 . ILE A 1 51  ? 0.466   6.416   -5.418  1.00 0.00 ? 51  ILE A HD13 3  
ATOM 4151  N N    . ARG A 1 52  ? -4.524  6.153   -5.987  1.00 0.00 ? 52  ARG A N    3  
ATOM 4152  C CA   . ARG A 1 52  ? -5.973  5.917   -6.260  1.00 0.00 ? 52  ARG A CA   3  
ATOM 4153  C C    . ARG A 1 52  ? -6.241  5.932   -7.767  1.00 0.00 ? 52  ARG A C    3  
ATOM 4154  O O    . ARG A 1 52  ? -6.882  5.049   -8.302  1.00 0.00 ? 52  ARG A O    3  
ATOM 4155  C CB   . ARG A 1 52  ? -6.798  7.018   -5.588  1.00 0.00 ? 52  ARG A CB   3  
ATOM 4156  C CG   . ARG A 1 52  ? -8.277  6.835   -5.937  1.00 0.00 ? 52  ARG A CG   3  
ATOM 4157  C CD   . ARG A 1 52  ? -8.766  8.045   -6.736  1.00 0.00 ? 52  ARG A CD   3  
ATOM 4158  N NE   . ARG A 1 52  ? -8.884  7.675   -8.174  1.00 0.00 ? 52  ARG A NE   3  
ATOM 4159  C CZ   . ARG A 1 52  ? -9.951  8.007   -8.847  1.00 0.00 ? 52  ARG A CZ   3  
ATOM 4160  N NH1  . ARG A 1 52  ? -10.032 9.188   -9.399  1.00 0.00 ? 52  ARG A NH1  3  
ATOM 4161  N NH2  . ARG A 1 52  ? -10.937 7.161   -8.970  1.00 0.00 ? 52  ARG A NH2  3  
ATOM 4162  H H    . ARG A 1 52  ? -4.253  6.860   -5.366  1.00 0.00 ? 52  ARG A H    3  
ATOM 4163  H HA   . ARG A 1 52  ? -6.261  4.959   -5.855  1.00 0.00 ? 52  ARG A HA   3  
ATOM 4164  H HB2  . ARG A 1 52  ? -6.670  6.958   -4.517  1.00 0.00 ? 52  ARG A HB2  3  
ATOM 4165  H HB3  . ARG A 1 52  ? -6.464  7.982   -5.938  1.00 0.00 ? 52  ARG A HB3  3  
ATOM 4166  H HG2  . ARG A 1 52  ? -8.399  5.939   -6.528  1.00 0.00 ? 52  ARG A HG2  3  
ATOM 4167  H HG3  . ARG A 1 52  ? -8.852  6.749   -5.029  1.00 0.00 ? 52  ARG A HG3  3  
ATOM 4168  H HD2  . ARG A 1 52  ? -9.731  8.356   -6.362  1.00 0.00 ? 52  ARG A HD2  3  
ATOM 4169  H HD3  . ARG A 1 52  ? -8.061  8.856   -6.628  1.00 0.00 ? 52  ARG A HD3  3  
ATOM 4170  H HE   . ARG A 1 52  ? -8.161  7.183   -8.613  1.00 0.00 ? 52  ARG A HE   3  
ATOM 4171  H HH11 . ARG A 1 52  ? -9.276  9.836   -9.304  1.00 0.00 ? 52  ARG A HH11 3  
ATOM 4172  H HH12 . ARG A 1 52  ? -10.849 9.443   -9.915  1.00 0.00 ? 52  ARG A HH12 3  
ATOM 4173  H HH21 . ARG A 1 52  ? -10.875 6.256   -8.548  1.00 0.00 ? 52  ARG A HH21 3  
ATOM 4174  H HH22 . ARG A 1 52  ? -11.754 7.416   -9.487  1.00 0.00 ? 52  ARG A HH22 3  
ATOM 4175  N N    . HIS A 1 53  ? -5.768  6.933   -8.451  1.00 0.00 ? 53  HIS A N    3  
ATOM 4176  C CA   . HIS A 1 53  ? -6.006  7.017   -9.920  1.00 0.00 ? 53  HIS A CA   3  
ATOM 4177  C C    . HIS A 1 53  ? -5.288  5.868   -10.637 1.00 0.00 ? 53  HIS A C    3  
ATOM 4178  O O    . HIS A 1 53  ? -5.670  5.466   -11.719 1.00 0.00 ? 53  HIS A O    3  
ATOM 4179  C CB   . HIS A 1 53  ? -5.473  8.356   -10.433 1.00 0.00 ? 53  HIS A CB   3  
ATOM 4180  C CG   . HIS A 1 53  ? -5.529  8.383   -11.936 1.00 0.00 ? 53  HIS A CG   3  
ATOM 4181  N ND1  . HIS A 1 53  ? -4.487  8.878   -12.706 1.00 0.00 ? 53  HIS A ND1  3  
ATOM 4182  C CD2  . HIS A 1 53  ? -6.496  7.983   -12.827 1.00 0.00 ? 53  HIS A CD2  3  
ATOM 4183  C CE1  . HIS A 1 53  ? -4.848  8.766   -13.998 1.00 0.00 ? 53  HIS A CE1  3  
ATOM 4184  N NE2  . HIS A 1 53  ? -6.063  8.227   -14.127 1.00 0.00 ? 53  HIS A NE2  3  
ATOM 4185  H H    . HIS A 1 53  ? -5.263  7.640   -7.997  1.00 0.00 ? 53  HIS A H    3  
ATOM 4186  H HA   . HIS A 1 53  ? -7.066  6.955   -10.116 1.00 0.00 ? 53  HIS A HA   3  
ATOM 4187  H HB2  . HIS A 1 53  ? -6.077  9.159   -10.035 1.00 0.00 ? 53  HIS A HB2  3  
ATOM 4188  H HB3  . HIS A 1 53  ? -4.450  8.483   -10.108 1.00 0.00 ? 53  HIS A HB3  3  
ATOM 4189  H HD1  . HIS A 1 53  ? -3.642  9.242   -12.371 1.00 0.00 ? 53  HIS A HD1  3  
ATOM 4190  H HD2  . HIS A 1 53  ? -7.447  7.547   -12.559 1.00 0.00 ? 53  HIS A HD2  3  
ATOM 4191  H HE1  . HIS A 1 53  ? -4.231  9.075   -14.828 1.00 0.00 ? 53  HIS A HE1  3  
ATOM 4192  N N    . ASN A 1 54  ? -4.249  5.345   -10.050 1.00 0.00 ? 54  ASN A N    3  
ATOM 4193  C CA   . ASN A 1 54  ? -3.502  4.229   -10.699 1.00 0.00 ? 54  ASN A CA   3  
ATOM 4194  C C    . ASN A 1 54  ? -4.323  2.945   -10.647 1.00 0.00 ? 54  ASN A C    3  
ATOM 4195  O O    . ASN A 1 54  ? -4.317  2.157   -11.570 1.00 0.00 ? 54  ASN A O    3  
ATOM 4196  C CB   . ASN A 1 54  ? -2.173  4.010   -9.973  1.00 0.00 ? 54  ASN A CB   3  
ATOM 4197  C CG   . ASN A 1 54  ? -1.092  4.857   -10.644 1.00 0.00 ? 54  ASN A CG   3  
ATOM 4198  O OD1  . ASN A 1 54  ? -0.734  4.619   -11.780 1.00 0.00 ? 54  ASN A OD1  3  
ATOM 4199  N ND2  . ASN A 1 54  ? -0.554  5.846   -9.984  1.00 0.00 ? 54  ASN A ND2  3  
ATOM 4200  H H    . ASN A 1 54  ? -3.960  5.684   -9.181  1.00 0.00 ? 54  ASN A H    3  
ATOM 4201  H HA   . ASN A 1 54  ? -3.306  4.485   -11.730 1.00 0.00 ? 54  ASN A HA   3  
ATOM 4202  H HB2  . ASN A 1 54  ? -2.277  4.305   -8.939  1.00 0.00 ? 54  ASN A HB2  3  
ATOM 4203  H HB3  . ASN A 1 54  ? -1.898  2.964   -10.026 1.00 0.00 ? 54  ASN A HB3  3  
ATOM 4204  H HD21 . ASN A 1 54  ? -0.841  6.035   -9.067  1.00 0.00 ? 54  ASN A HD21 3  
ATOM 4205  H HD22 . ASN A 1 54  ? 0.130   6.403   -10.409 1.00 0.00 ? 54  ASN A HD22 3  
ATOM 4206  N N    . LEU A 1 55  ? -5.013  2.716   -9.568  1.00 0.00 ? 55  LEU A N    3  
ATOM 4207  C CA   . LEU A 1 55  ? -5.815  1.468   -9.454  1.00 0.00 ? 55  LEU A CA   3  
ATOM 4208  C C    . LEU A 1 55  ? -6.991  1.509   -10.431 1.00 0.00 ? 55  LEU A C    3  
ATOM 4209  O O    . LEU A 1 55  ? -7.702  0.539   -10.595 1.00 0.00 ? 55  LEU A O    3  
ATOM 4210  C CB   . LEU A 1 55  ? -6.351  1.332   -8.031  1.00 0.00 ? 55  LEU A CB   3  
ATOM 4211  C CG   . LEU A 1 55  ? -5.248  1.643   -7.023  1.00 0.00 ? 55  LEU A CG   3  
ATOM 4212  C CD1  . LEU A 1 55  ? -5.793  1.437   -5.609  1.00 0.00 ? 55  LEU A CD1  3  
ATOM 4213  C CD2  . LEU A 1 55  ? -4.070  0.700   -7.263  1.00 0.00 ? 55  LEU A CD2  3  
ATOM 4214  H H    . LEU A 1 55  ? -4.996  3.359   -8.829  1.00 0.00 ? 55  LEU A H    3  
ATOM 4215  H HA   . LEU A 1 55  ? -5.188  0.620   -9.682  1.00 0.00 ? 55  LEU A HA   3  
ATOM 4216  H HB2  . LEU A 1 55  ? -7.170  2.019   -7.890  1.00 0.00 ? 55  LEU A HB2  3  
ATOM 4217  H HB3  . LEU A 1 55  ? -6.694  0.323   -7.877  1.00 0.00 ? 55  LEU A HB3  3  
ATOM 4218  H HG   . LEU A 1 55  ? -4.925  2.668   -7.138  1.00 0.00 ? 55  LEU A HG   3  
ATOM 4219  H HD11 . LEU A 1 55  ? -6.717  1.986   -5.497  1.00 0.00 ? 55  LEU A HD11 3  
ATOM 4220  H HD12 . LEU A 1 55  ? -5.072  1.795   -4.890  1.00 0.00 ? 55  LEU A HD12 3  
ATOM 4221  H HD13 . LEU A 1 55  ? -5.978  0.386   -5.444  1.00 0.00 ? 55  LEU A HD13 3  
ATOM 4222  H HD21 . LEU A 1 55  ? -3.213  1.271   -7.589  1.00 0.00 ? 55  LEU A HD21 3  
ATOM 4223  H HD22 . LEU A 1 55  ? -4.334  -0.018  -8.026  1.00 0.00 ? 55  LEU A HD22 3  
ATOM 4224  H HD23 . LEU A 1 55  ? -3.832  0.183   -6.346  1.00 0.00 ? 55  LEU A HD23 3  
ATOM 4225  N N    . SER A 1 56  ? -7.203  2.616   -11.081 1.00 0.00 ? 56  SER A N    3  
ATOM 4226  C CA   . SER A 1 56  ? -8.336  2.702   -12.041 1.00 0.00 ? 56  SER A CA   3  
ATOM 4227  C C    . SER A 1 56  ? -7.850  2.282   -13.427 1.00 0.00 ? 56  SER A C    3  
ATOM 4228  O O    . SER A 1 56  ? -8.438  1.443   -14.079 1.00 0.00 ? 56  SER A O    3  
ATOM 4229  C CB   . SER A 1 56  ? -8.857  4.141   -12.084 1.00 0.00 ? 56  SER A CB   3  
ATOM 4230  O OG   . SER A 1 56  ? -8.521  4.737   -13.333 1.00 0.00 ? 56  SER A OG   3  
ATOM 4231  H H    . SER A 1 56  ? -6.619  3.391   -10.943 1.00 0.00 ? 56  SER A H    3  
ATOM 4232  H HA   . SER A 1 56  ? -9.129  2.041   -11.723 1.00 0.00 ? 56  SER A HA   3  
ATOM 4233  H HB2  . SER A 1 56  ? -9.929  4.142   -11.970 1.00 0.00 ? 56  SER A HB2  3  
ATOM 4234  H HB3  . SER A 1 56  ? -8.413  4.707   -11.275 1.00 0.00 ? 56  SER A HB3  3  
ATOM 4235  H HG   . SER A 1 56  ? -8.433  5.682   -13.197 1.00 0.00 ? 56  SER A HG   3  
ATOM 4236  N N    . LEU A 1 57  ? -6.783  2.873   -13.881 1.00 0.00 ? 57  LEU A N    3  
ATOM 4237  C CA   . LEU A 1 57  ? -6.250  2.529   -15.224 1.00 0.00 ? 57  LEU A CA   3  
ATOM 4238  C C    . LEU A 1 57  ? -5.228  1.392   -15.116 1.00 0.00 ? 57  LEU A C    3  
ATOM 4239  O O    . LEU A 1 57  ? -4.688  0.943   -16.108 1.00 0.00 ? 57  LEU A O    3  
ATOM 4240  C CB   . LEU A 1 57  ? -5.591  3.772   -15.830 1.00 0.00 ? 57  LEU A CB   3  
ATOM 4241  C CG   . LEU A 1 57  ? -4.206  4.007   -15.214 1.00 0.00 ? 57  LEU A CG   3  
ATOM 4242  C CD1  . LEU A 1 57  ? -3.408  4.951   -16.113 1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4243  C CD2  . LEU A 1 57  ? -4.359  4.641   -13.829 1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4244  H H    . LEU A 1 57  ? -6.334  3.551   -13.338 1.00 0.00 ? 57  LEU A H    3  
ATOM 4245  H HA   . LEU A 1 57  ? -7.065  2.215   -15.858 1.00 0.00 ? 57  LEU A HA   3  
ATOM 4246  H HB2  . LEU A 1 57  ? -5.489  3.633   -16.891 1.00 0.00 ? 57  LEU A HB2  3  
ATOM 4247  H HB3  . LEU A 1 57  ? -6.214  4.632   -15.642 1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4248  H HG   . LEU A 1 57  ? -3.679  3.069   -15.128 1.00 0.00 ? 57  LEU A HG   3  
ATOM 4249  H HD11 . LEU A 1 57  ? -3.439  5.950   -15.704 1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4250  H HD12 . LEU A 1 57  ? -3.838  4.953   -17.104 1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4251  H HD13 . LEU A 1 57  ? -2.383  4.616   -16.168 1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4252  H HD21 . LEU A 1 57  ? -4.507  3.864   -13.092 1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4253  H HD22 . LEU A 1 57  ? -5.211  5.305   -13.829 1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4254  H HD23 . LEU A 1 57  ? -3.467  5.199   -13.588 1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4255  N N    . ASN A 1 58  ? -4.948  0.925   -13.929 1.00 0.00 ? 58  ASN A N    3  
ATOM 4256  C CA   . ASN A 1 58  ? -3.949  -0.177  -13.790 1.00 0.00 ? 58  ASN A CA   3  
ATOM 4257  C C    . ASN A 1 58  ? -4.460  -1.424  -14.509 1.00 0.00 ? 58  ASN A C    3  
ATOM 4258  O O    . ASN A 1 58  ? -5.640  -1.567  -14.766 1.00 0.00 ? 58  ASN A O    3  
ATOM 4259  C CB   . ASN A 1 58  ? -3.711  -0.511  -12.316 1.00 0.00 ? 58  ASN A CB   3  
ATOM 4260  C CG   . ASN A 1 58  ? -2.542  0.319   -11.779 1.00 0.00 ? 58  ASN A CG   3  
ATOM 4261  O OD1  . ASN A 1 58  ? -1.966  -0.013  -10.762 1.00 0.00 ? 58  ASN A OD1  3  
ATOM 4262  N ND2  . ASN A 1 58  ? -2.167  1.393   -12.418 1.00 0.00 ? 58  ASN A ND2  3  
ATOM 4263  H H    . ASN A 1 58  ? -5.387  1.297   -13.138 1.00 0.00 ? 58  ASN A H    3  
ATOM 4264  H HA   . ASN A 1 58  ? -3.017  0.133   -14.240 1.00 0.00 ? 58  ASN A HA   3  
ATOM 4265  H HB2  . ASN A 1 58  ? -4.600  -0.301  -11.740 1.00 0.00 ? 58  ASN A HB2  3  
ATOM 4266  H HB3  . ASN A 1 58  ? -3.470  -1.559  -12.229 1.00 0.00 ? 58  ASN A HB3  3  
ATOM 4267  H HD21 . ASN A 1 58  ? -2.631  1.666   -13.237 1.00 0.00 ? 58  ASN A HD21 3  
ATOM 4268  H HD22 . ASN A 1 58  ? -1.419  1.929   -12.080 1.00 0.00 ? 58  ASN A HD22 3  
ATOM 4269  N N    . ARG A 1 59  ? -3.579  -2.324  -14.842 1.00 0.00 ? 59  ARG A N    3  
ATOM 4270  C CA   . ARG A 1 59  ? -4.004  -3.561  -15.556 1.00 0.00 ? 59  ARG A CA   3  
ATOM 4271  C C    . ARG A 1 59  ? -4.321  -4.672  -14.550 1.00 0.00 ? 59  ARG A C    3  
ATOM 4272  O O    . ARG A 1 59  ? -4.709  -5.759  -14.927 1.00 0.00 ? 59  ARG A O    3  
ATOM 4273  C CB   . ARG A 1 59  ? -2.883  -4.036  -16.491 1.00 0.00 ? 59  ARG A CB   3  
ATOM 4274  C CG   . ARG A 1 59  ? -1.921  -2.880  -16.785 1.00 0.00 ? 59  ARG A CG   3  
ATOM 4275  C CD   . ARG A 1 59  ? -1.294  -3.072  -18.168 1.00 0.00 ? 59  ARG A CD   3  
ATOM 4276  N NE   . ARG A 1 59  ? -2.372  -3.266  -19.179 1.00 0.00 ? 59  ARG A NE   3  
ATOM 4277  C CZ   . ARG A 1 59  ? -2.828  -2.244  -19.851 1.00 0.00 ? 59  ARG A CZ   3  
ATOM 4278  N NH1  . ARG A 1 59  ? -3.385  -1.245  -19.221 1.00 0.00 ? 59  ARG A NH1  3  
ATOM 4279  N NH2  . ARG A 1 59  ? -2.729  -2.220  -21.152 1.00 0.00 ? 59  ARG A NH2  3  
ATOM 4280  H H    . ARG A 1 59  ? -2.632  -2.183  -14.629 1.00 0.00 ? 59  ARG A H    3  
ATOM 4281  H HA   . ARG A 1 59  ? -4.886  -3.348  -16.140 1.00 0.00 ? 59  ARG A HA   3  
ATOM 4282  H HB2  . ARG A 1 59  ? -2.339  -4.842  -16.018 1.00 0.00 ? 59  ARG A HB2  3  
ATOM 4283  H HB3  . ARG A 1 59  ? -3.312  -4.387  -17.417 1.00 0.00 ? 59  ARG A HB3  3  
ATOM 4284  H HG2  . ARG A 1 59  ? -2.465  -1.947  -16.761 1.00 0.00 ? 59  ARG A HG2  3  
ATOM 4285  H HG3  . ARG A 1 59  ? -1.142  -2.863  -16.038 1.00 0.00 ? 59  ARG A HG3  3  
ATOM 4286  H HD2  . ARG A 1 59  ? -0.713  -2.199  -18.424 1.00 0.00 ? 59  ARG A HD2  3  
ATOM 4287  H HD3  . ARG A 1 59  ? -0.652  -3.941  -18.154 1.00 0.00 ? 59  ARG A HD3  3  
ATOM 4288  H HE   . ARG A 1 59  ? -2.736  -4.161  -19.343 1.00 0.00 ? 59  ARG A HE   3  
ATOM 4289  H HH11 . ARG A 1 59  ? -3.462  -1.263  -18.224 1.00 0.00 ? 59  ARG A HH11 3  
ATOM 4290  H HH12 . ARG A 1 59  ? -3.736  -0.462  -19.736 1.00 0.00 ? 59  ARG A HH12 3  
ATOM 4291  H HH21 . ARG A 1 59  ? -2.303  -2.985  -21.635 1.00 0.00 ? 59  ARG A HH21 3  
ATOM 4292  H HH22 . ARG A 1 59  ? -3.079  -1.436  -21.666 1.00 0.00 ? 59  ARG A HH22 3  
ATOM 4293  N N    . TYR A 1 60  ? -4.150  -4.428  -13.276 1.00 0.00 ? 60  TYR A N    3  
ATOM 4294  C CA   . TYR A 1 60  ? -4.438  -5.512  -12.288 1.00 0.00 ? 60  TYR A CA   3  
ATOM 4295  C C    . TYR A 1 60  ? -4.874  -4.940  -10.937 1.00 0.00 ? 60  TYR A C    3  
ATOM 4296  O O    . TYR A 1 60  ? -4.375  -5.331  -9.906  1.00 0.00 ? 60  TYR A O    3  
ATOM 4297  C CB   . TYR A 1 60  ? -3.185  -6.363  -12.078 1.00 0.00 ? 60  TYR A CB   3  
ATOM 4298  C CG   . TYR A 1 60  ? -1.954  -5.515  -12.279 1.00 0.00 ? 60  TYR A CG   3  
ATOM 4299  C CD1  . TYR A 1 60  ? -1.905  -4.212  -11.771 1.00 0.00 ? 60  TYR A CD1  3  
ATOM 4300  C CD2  . TYR A 1 60  ? -0.863  -6.031  -12.980 1.00 0.00 ? 60  TYR A CD2  3  
ATOM 4301  C CE1  . TYR A 1 60  ? -0.762  -3.428  -11.968 1.00 0.00 ? 60  TYR A CE1  3  
ATOM 4302  C CE2  . TYR A 1 60  ? 0.281   -5.251  -13.176 1.00 0.00 ? 60  TYR A CE2  3  
ATOM 4303  C CZ   . TYR A 1 60  ? 0.331   -3.948  -12.672 1.00 0.00 ? 60  TYR A CZ   3  
ATOM 4304  O OH   . TYR A 1 60  ? 1.458   -3.175  -12.865 1.00 0.00 ? 60  TYR A OH   3  
ATOM 4305  H H    . TYR A 1 60  ? -3.824  -3.553  -12.978 1.00 0.00 ? 60  TYR A H    3  
ATOM 4306  H HA   . TYR A 1 60  ? -5.227  -6.140  -12.675 1.00 0.00 ? 60  TYR A HA   3  
ATOM 4307  H HB2  . TYR A 1 60  ? -3.187  -6.765  -11.076 1.00 0.00 ? 60  TYR A HB2  3  
ATOM 4308  H HB3  . TYR A 1 60  ? -3.181  -7.175  -12.790 1.00 0.00 ? 60  TYR A HB3  3  
ATOM 4309  H HD1  . TYR A 1 60  ? -2.748  -3.813  -11.226 1.00 0.00 ? 60  TYR A HD1  3  
ATOM 4310  H HD2  . TYR A 1 60  ? -0.901  -7.037  -13.364 1.00 0.00 ? 60  TYR A HD2  3  
ATOM 4311  H HE1  . TYR A 1 60  ? -0.724  -2.423  -11.579 1.00 0.00 ? 60  TYR A HE1  3  
ATOM 4312  H HE2  . TYR A 1 60  ? 1.122   -5.655  -13.719 1.00 0.00 ? 60  TYR A HE2  3  
ATOM 4313  H HH   . TYR A 1 60  ? 2.205   -3.765  -12.984 1.00 0.00 ? 60  TYR A HH   3  
ATOM 4314  N N    . PHE A 1 61  ? -5.817  -4.048  -10.916 1.00 0.00 ? 61  PHE A N    3  
ATOM 4315  C CA   . PHE A 1 61  ? -6.279  -3.510  -9.607  1.00 0.00 ? 61  PHE A CA   3  
ATOM 4316  C C    . PHE A 1 61  ? -7.773  -3.231  -9.696  1.00 0.00 ? 61  PHE A C    3  
ATOM 4317  O O    . PHE A 1 61  ? -8.213  -2.276  -10.303 1.00 0.00 ? 61  PHE A O    3  
ATOM 4318  C CB   . PHE A 1 61  ? -5.511  -2.239  -9.249  1.00 0.00 ? 61  PHE A CB   3  
ATOM 4319  C CG   . PHE A 1 61  ? -4.128  -2.624  -8.776  1.00 0.00 ? 61  PHE A CG   3  
ATOM 4320  C CD1  . PHE A 1 61  ? -3.953  -3.339  -7.583  1.00 0.00 ? 61  PHE A CD1  3  
ATOM 4321  C CD2  . PHE A 1 61  ? -3.016  -2.276  -9.541  1.00 0.00 ? 61  PHE A CD2  3  
ATOM 4322  C CE1  . PHE A 1 61  ? -2.669  -3.694  -7.172  1.00 0.00 ? 61  PHE A CE1  3  
ATOM 4323  C CE2  . PHE A 1 61  ? -1.736  -2.633  -9.131  1.00 0.00 ? 61  PHE A CE2  3  
ATOM 4324  C CZ   . PHE A 1 61  ? -1.559  -3.344  -7.943  1.00 0.00 ? 61  PHE A CZ   3  
ATOM 4325  H H    . PHE A 1 61  ? -6.238  -3.752  -11.750 1.00 0.00 ? 61  PHE A H    3  
ATOM 4326  H HA   . PHE A 1 61  ? -6.108  -4.254  -8.842  1.00 0.00 ? 61  PHE A HA   3  
ATOM 4327  H HB2  . PHE A 1 61  ? -5.435  -1.606  -10.121 1.00 0.00 ? 61  PHE A HB2  3  
ATOM 4328  H HB3  . PHE A 1 61  ? -6.028  -1.712  -8.462  1.00 0.00 ? 61  PHE A HB3  3  
ATOM 4329  H HD1  . PHE A 1 61  ? -4.805  -3.619  -6.979  1.00 0.00 ? 61  PHE A HD1  3  
ATOM 4330  H HD2  . PHE A 1 61  ? -3.144  -1.732  -10.450 1.00 0.00 ? 61  PHE A HD2  3  
ATOM 4331  H HE1  . PHE A 1 61  ? -2.538  -4.243  -6.259  1.00 0.00 ? 61  PHE A HE1  3  
ATOM 4332  H HE2  . PHE A 1 61  ? -0.886  -2.359  -9.736  1.00 0.00 ? 61  PHE A HE2  3  
ATOM 4333  H HZ   . PHE A 1 61  ? -0.567  -3.623  -7.620  1.00 0.00 ? 61  PHE A HZ   3  
ATOM 4334  N N    . ILE A 1 62  ? -8.551  -4.089  -9.108  1.00 0.00 ? 62  ILE A N    3  
ATOM 4335  C CA   . ILE A 1 62  ? -10.032 -3.927  -9.158  1.00 0.00 ? 62  ILE A CA   3  
ATOM 4336  C C    . ILE A 1 62  ? -10.552 -3.435  -7.803  1.00 0.00 ? 62  ILE A C    3  
ATOM 4337  O O    . ILE A 1 62  ? -9.793  -3.186  -6.889  1.00 0.00 ? 62  ILE A O    3  
ATOM 4338  C CB   . ILE A 1 62  ? -10.670 -5.281  -9.498  1.00 0.00 ? 62  ILE A CB   3  
ATOM 4339  C CG1  . ILE A 1 62  ? -10.642 -6.188  -8.266  1.00 0.00 ? 62  ILE A CG1  3  
ATOM 4340  C CG2  . ILE A 1 62  ? -9.881  -5.950  -10.626 1.00 0.00 ? 62  ILE A CG2  3  
ATOM 4341  C CD1  . ILE A 1 62  ? -11.386 -7.490  -8.572  1.00 0.00 ? 62  ILE A CD1  3  
ATOM 4342  H H    . ILE A 1 62  ? -8.155  -4.854  -8.642  1.00 0.00 ? 62  ILE A H    3  
ATOM 4343  H HA   . ILE A 1 62  ? -10.289 -3.209  -9.922  1.00 0.00 ? 62  ILE A HA   3  
ATOM 4344  H HB   . ILE A 1 62  ? -11.691 -5.130  -9.815  1.00 0.00 ? 62  ILE A HB   3  
ATOM 4345  H HG12 . ILE A 1 62  ? -9.615  -6.411  -8.007  1.00 0.00 ? 62  ILE A HG12 3  
ATOM 4346  H HG13 . ILE A 1 62  ? -11.122 -5.687  -7.440  1.00 0.00 ? 62  ILE A HG13 3  
ATOM 4347  H HG21 . ILE A 1 62  ? -10.507 -6.035  -11.501 1.00 0.00 ? 62  ILE A HG21 3  
ATOM 4348  H HG22 . ILE A 1 62  ? -9.568  -6.934  -10.311 1.00 0.00 ? 62  ILE A HG22 3  
ATOM 4349  H HG23 . ILE A 1 62  ? -9.012  -5.353  -10.862 1.00 0.00 ? 62  ILE A HG23 3  
ATOM 4350  H HD11 . ILE A 1 62  ? -10.801 -8.086  -9.257  1.00 0.00 ? 62  ILE A HD11 3  
ATOM 4351  H HD12 . ILE A 1 62  ? -12.342 -7.263  -9.018  1.00 0.00 ? 62  ILE A HD12 3  
ATOM 4352  H HD13 . ILE A 1 62  ? -11.538 -8.041  -7.655  1.00 0.00 ? 62  ILE A HD13 3  
ATOM 4353  N N    . LYS A 1 63  ? -11.844 -3.294  -7.668  1.00 0.00 ? 63  LYS A N    3  
ATOM 4354  C CA   . LYS A 1 63  ? -12.415 -2.820  -6.375  1.00 0.00 ? 63  LYS A CA   3  
ATOM 4355  C C    . LYS A 1 63  ? -13.545 -3.760  -5.948  1.00 0.00 ? 63  LYS A C    3  
ATOM 4356  O O    . LYS A 1 63  ? -14.187 -4.387  -6.768  1.00 0.00 ? 63  LYS A O    3  
ATOM 4357  C CB   . LYS A 1 63  ? -12.969 -1.404  -6.547  1.00 0.00 ? 63  LYS A CB   3  
ATOM 4358  C CG   . LYS A 1 63  ? -11.961 -0.548  -7.318  1.00 0.00 ? 63  LYS A CG   3  
ATOM 4359  C CD   . LYS A 1 63  ? -12.479 -0.306  -8.738  1.00 0.00 ? 63  LYS A CD   3  
ATOM 4360  C CE   . LYS A 1 63  ? -13.301 0.984   -8.770  1.00 0.00 ? 63  LYS A CE   3  
ATOM 4361  N NZ   . LYS A 1 63  ? -14.752 0.648   -8.823  1.00 0.00 ? 63  LYS A NZ   3  
ATOM 4362  H H    . LYS A 1 63  ? -12.440 -3.499  -8.418  1.00 0.00 ? 63  LYS A H    3  
ATOM 4363  H HA   . LYS A 1 63  ? -11.643 -2.817  -5.619  1.00 0.00 ? 63  LYS A HA   3  
ATOM 4364  H HB2  . LYS A 1 63  ? -13.899 -1.446  -7.096  1.00 0.00 ? 63  LYS A HB2  3  
ATOM 4365  H HB3  . LYS A 1 63  ? -13.143 -0.964  -5.576  1.00 0.00 ? 63  LYS A HB3  3  
ATOM 4366  H HG2  . LYS A 1 63  ? -11.834 0.398   -6.814  1.00 0.00 ? 63  LYS A HG2  3  
ATOM 4367  H HG3  . LYS A 1 63  ? -11.014 -1.062  -7.366  1.00 0.00 ? 63  LYS A HG3  3  
ATOM 4368  H HD2  . LYS A 1 63  ? -11.643 -0.217  -9.417  1.00 0.00 ? 63  LYS A HD2  3  
ATOM 4369  H HD3  . LYS A 1 63  ? -13.102 -1.135  -9.041  1.00 0.00 ? 63  LYS A HD3  3  
ATOM 4370  H HE2  . LYS A 1 63  ? -13.098 1.563   -7.882  1.00 0.00 ? 63  LYS A HE2  3  
ATOM 4371  H HE3  . LYS A 1 63  ? -13.033 1.560   -9.644  1.00 0.00 ? 63  LYS A HE3  3  
ATOM 4372  H HZ1  . LYS A 1 63  ? -15.187 0.839   -7.900  1.00 0.00 ? 63  LYS A HZ1  3  
ATOM 4373  H HZ2  . LYS A 1 63  ? -14.867 -0.360  -9.059  1.00 0.00 ? 63  LYS A HZ2  3  
ATOM 4374  H HZ3  . LYS A 1 63  ? -15.216 1.229   -9.550  1.00 0.00 ? 63  LYS A HZ3  3  
ATOM 4375  N N    . VAL A 1 64  ? -13.796 -3.865  -4.671  1.00 0.00 ? 64  VAL A N    3  
ATOM 4376  C CA   . VAL A 1 64  ? -14.886 -4.764  -4.199  1.00 0.00 ? 64  VAL A CA   3  
ATOM 4377  C C    . VAL A 1 64  ? -16.206 -3.989  -4.162  1.00 0.00 ? 64  VAL A C    3  
ATOM 4378  O O    . VAL A 1 64  ? -16.209 -2.779  -4.063  1.00 0.00 ? 64  VAL A O    3  
ATOM 4379  C CB   . VAL A 1 64  ? -14.557 -5.276  -2.796  1.00 0.00 ? 64  VAL A CB   3  
ATOM 4380  C CG1  . VAL A 1 64  ? -13.204 -5.988  -2.817  1.00 0.00 ? 64  VAL A CG1  3  
ATOM 4381  C CG2  . VAL A 1 64  ? -14.496 -4.095  -1.824  1.00 0.00 ? 64  VAL A CG2  3  
ATOM 4382  H H    . VAL A 1 64  ? -13.269 -3.351  -4.024  1.00 0.00 ? 64  VAL A H    3  
ATOM 4383  H HA   . VAL A 1 64  ? -14.979 -5.601  -4.875  1.00 0.00 ? 64  VAL A HA   3  
ATOM 4384  H HB   . VAL A 1 64  ? -15.323 -5.968  -2.477  1.00 0.00 ? 64  VAL A HB   3  
ATOM 4385  H HG11 . VAL A 1 64  ? -12.484 -5.379  -3.345  1.00 0.00 ? 64  VAL A HG11 3  
ATOM 4386  H HG12 . VAL A 1 64  ? -13.306 -6.941  -3.317  1.00 0.00 ? 64  VAL A HG12 3  
ATOM 4387  H HG13 . VAL A 1 64  ? -12.866 -6.148  -1.804  1.00 0.00 ? 64  VAL A HG13 3  
ATOM 4388  H HG21 . VAL A 1 64  ? -14.852 -4.407  -0.853  1.00 0.00 ? 64  VAL A HG21 3  
ATOM 4389  H HG22 . VAL A 1 64  ? -15.116 -3.292  -2.194  1.00 0.00 ? 64  VAL A HG22 3  
ATOM 4390  H HG23 . VAL A 1 64  ? -13.475 -3.752  -1.739  1.00 0.00 ? 64  VAL A HG23 3  
ATOM 4391  N N    . PRO A 1 65  ? -17.291 -4.716  -4.244  1.00 0.00 ? 65  PRO A N    3  
ATOM 4392  C CA   . PRO A 1 65  ? -18.643 -4.130  -4.223  1.00 0.00 ? 65  PRO A CA   3  
ATOM 4393  C C    . PRO A 1 65  ? -19.040 -3.751  -2.793  1.00 0.00 ? 65  PRO A C    3  
ATOM 4394  O O    . PRO A 1 65  ? -18.352 -4.067  -1.842  1.00 0.00 ? 65  PRO A O    3  
ATOM 4395  C CB   . PRO A 1 65  ? -19.529 -5.257  -4.759  1.00 0.00 ? 65  PRO A CB   3  
ATOM 4396  C CG   . PRO A 1 65  ? -18.754 -6.574  -4.521  1.00 0.00 ? 65  PRO A CG   3  
ATOM 4397  C CD   . PRO A 1 65  ? -17.271 -6.189  -4.364  1.00 0.00 ? 65  PRO A CD   3  
ATOM 4398  H HA   . PRO A 1 65  ? -18.698 -3.273  -4.875  1.00 0.00 ? 65  PRO A HA   3  
ATOM 4399  H HB2  . PRO A 1 65  ? -20.469 -5.273  -4.224  1.00 0.00 ? 65  PRO A HB2  3  
ATOM 4400  H HB3  . PRO A 1 65  ? -19.704 -5.123  -5.814  1.00 0.00 ? 65  PRO A HB3  3  
ATOM 4401  H HG2  . PRO A 1 65  ? -19.112 -7.057  -3.622  1.00 0.00 ? 65  PRO A HG2  3  
ATOM 4402  H HG3  . PRO A 1 65  ? -18.871 -7.232  -5.368  1.00 0.00 ? 65  PRO A HG3  3  
ATOM 4403  H HD2  . PRO A 1 65  ? -16.857 -6.639  -3.472  1.00 0.00 ? 65  PRO A HD2  3  
ATOM 4404  H HD3  . PRO A 1 65  ? -16.708 -6.484  -5.236  1.00 0.00 ? 65  PRO A HD3  3  
ATOM 4405  N N    . ARG A 1 66  ? -20.145 -3.074  -2.635  1.00 0.00 ? 66  ARG A N    3  
ATOM 4406  C CA   . ARG A 1 66  ? -20.587 -2.672  -1.269  1.00 0.00 ? 66  ARG A CA   3  
ATOM 4407  C C    . ARG A 1 66  ? -20.877 -3.925  -0.438  1.00 0.00 ? 66  ARG A C    3  
ATOM 4408  O O    . ARG A 1 66  ? -21.830 -4.638  -0.684  1.00 0.00 ? 66  ARG A O    3  
ATOM 4409  C CB   . ARG A 1 66  ? -21.857 -1.824  -1.371  1.00 0.00 ? 66  ARG A CB   3  
ATOM 4410  C CG   . ARG A 1 66  ? -21.875 -0.791  -0.241  1.00 0.00 ? 66  ARG A CG   3  
ATOM 4411  C CD   . ARG A 1 66  ? -22.230 0.584   -0.810  1.00 0.00 ? 66  ARG A CD   3  
ATOM 4412  N NE   . ARG A 1 66  ? -23.525 0.499   -1.542  1.00 0.00 ? 66  ARG A NE   3  
ATOM 4413  C CZ   . ARG A 1 66  ? -24.597 0.080   -0.925  1.00 0.00 ? 66  ARG A CZ   3  
ATOM 4414  N NH1  . ARG A 1 66  ? -24.733 0.284   0.356   1.00 0.00 ? 66  ARG A NH1  3  
ATOM 4415  N NH2  . ARG A 1 66  ? -25.531 -0.543  -1.589  1.00 0.00 ? 66  ARG A NH2  3  
ATOM 4416  H H    . ARG A 1 66  ? -20.684 -2.827  -3.415  1.00 0.00 ? 66  ARG A H    3  
ATOM 4417  H HA   . ARG A 1 66  ? -19.807 -2.097  -0.792  1.00 0.00 ? 66  ARG A HA   3  
ATOM 4418  H HB2  . ARG A 1 66  ? -21.873 -1.316  -2.325  1.00 0.00 ? 66  ARG A HB2  3  
ATOM 4419  H HB3  . ARG A 1 66  ? -22.723 -2.461  -1.287  1.00 0.00 ? 66  ARG A HB3  3  
ATOM 4420  H HG2  . ARG A 1 66  ? -22.610 -1.078  0.497   1.00 0.00 ? 66  ARG A HG2  3  
ATOM 4421  H HG3  . ARG A 1 66  ? -20.900 -0.746  0.221   1.00 0.00 ? 66  ARG A HG3  3  
ATOM 4422  H HD2  . ARG A 1 66  ? -22.319 1.295   -0.002  1.00 0.00 ? 66  ARG A HD2  3  
ATOM 4423  H HD3  . ARG A 1 66  ? -21.454 0.904   -1.488  1.00 0.00 ? 66  ARG A HD3  3  
ATOM 4424  H HE   . ARG A 1 66  ? -23.573 0.757   -2.486  1.00 0.00 ? 66  ARG A HE   3  
ATOM 4425  H HH11 . ARG A 1 66  ? -24.016 0.759   0.866   1.00 0.00 ? 66  ARG A HH11 3  
ATOM 4426  H HH12 . ARG A 1 66  ? -25.554 -0.036  0.829   1.00 0.00 ? 66  ARG A HH12 3  
ATOM 4427  H HH21 . ARG A 1 66  ? -25.427 -0.701  -2.571  1.00 0.00 ? 66  ARG A HH21 3  
ATOM 4428  H HH22 . ARG A 1 66  ? -26.352 -0.863  -1.116  1.00 0.00 ? 66  ARG A HH22 3  
ATOM 4429  N N    . SER A 1 67  ? -20.063 -4.197  0.544   1.00 0.00 ? 67  SER A N    3  
ATOM 4430  C CA   . SER A 1 67  ? -20.293 -5.402  1.389   1.00 0.00 ? 67  SER A CA   3  
ATOM 4431  C C    . SER A 1 67  ? -19.567 -5.233  2.725   1.00 0.00 ? 67  SER A C    3  
ATOM 4432  O O    . SER A 1 67  ? -18.409 -5.573  2.861   1.00 0.00 ? 67  SER A O    3  
ATOM 4433  C CB   . SER A 1 67  ? -19.753 -6.639  0.670   1.00 0.00 ? 67  SER A CB   3  
ATOM 4434  O OG   . SER A 1 67  ? -19.686 -7.723  1.587   1.00 0.00 ? 67  SER A OG   3  
ATOM 4435  H H    . SER A 1 67  ? -19.300 -3.609  0.726   1.00 0.00 ? 67  SER A H    3  
ATOM 4436  H HA   . SER A 1 67  ? -21.352 -5.522  1.566   1.00 0.00 ? 67  SER A HA   3  
ATOM 4437  H HB2  . SER A 1 67  ? -20.411 -6.901  -0.142  1.00 0.00 ? 67  SER A HB2  3  
ATOM 4438  H HB3  . SER A 1 67  ? -18.768 -6.424  0.277   1.00 0.00 ? 67  SER A HB3  3  
ATOM 4439  H HG   . SER A 1 67  ? -19.311 -8.478  1.127   1.00 0.00 ? 67  SER A HG   3  
ATOM 4440  N N    . GLN A 1 68  ? -20.239 -4.709  3.714   1.00 0.00 ? 68  GLN A N    3  
ATOM 4441  C CA   . GLN A 1 68  ? -19.584 -4.520  5.037   1.00 0.00 ? 68  GLN A CA   3  
ATOM 4442  C C    . GLN A 1 68  ? -20.454 -5.142  6.131   1.00 0.00 ? 68  GLN A C    3  
ATOM 4443  O O    . GLN A 1 68  ? -21.564 -5.571  5.887   1.00 0.00 ? 68  GLN A O    3  
ATOM 4444  C CB   . GLN A 1 68  ? -19.409 -3.024  5.309   1.00 0.00 ? 68  GLN A CB   3  
ATOM 4445  C CG   . GLN A 1 68  ? -20.594 -2.255  4.725   1.00 0.00 ? 68  GLN A CG   3  
ATOM 4446  C CD   . GLN A 1 68  ? -21.867 -2.616  5.493   1.00 0.00 ? 68  GLN A CD   3  
ATOM 4447  O OE1  . GLN A 1 68  ? -21.914 -2.502  6.702   1.00 0.00 ? 68  GLN A OE1  3  
ATOM 4448  N NE2  . GLN A 1 68  ? -22.910 -3.048  4.838   1.00 0.00 ? 68  GLN A NE2  3  
ATOM 4449  H H    . GLN A 1 68  ? -21.173 -4.441  3.585   1.00 0.00 ? 68  GLN A H    3  
ATOM 4450  H HA   . GLN A 1 68  ? -18.617 -5.000  5.032   1.00 0.00 ? 68  GLN A HA   3  
ATOM 4451  H HB2  . GLN A 1 68  ? -19.358 -2.856  6.375   1.00 0.00 ? 68  GLN A HB2  3  
ATOM 4452  H HB3  . GLN A 1 68  ? -18.497 -2.679  4.846   1.00 0.00 ? 68  GLN A HB3  3  
ATOM 4453  H HG2  . GLN A 1 68  ? -20.412 -1.193  4.808   1.00 0.00 ? 68  GLN A HG2  3  
ATOM 4454  H HG3  . GLN A 1 68  ? -20.718 -2.519  3.685   1.00 0.00 ? 68  GLN A HG3  3  
ATOM 4455  H HE21 . GLN A 1 68  ? -22.873 -3.138  3.863   1.00 0.00 ? 68  GLN A HE21 3  
ATOM 4456  H HE22 . GLN A 1 68  ? -23.730 -3.280  5.321   1.00 0.00 ? 68  GLN A HE22 3  
ATOM 4457  N N    . GLU A 1 69  ? -19.956 -5.195  7.336   1.00 0.00 ? 69  GLU A N    3  
ATOM 4458  C CA   . GLU A 1 69  ? -20.749 -5.791  8.448   1.00 0.00 ? 69  GLU A CA   3  
ATOM 4459  C C    . GLU A 1 69  ? -20.058 -5.493  9.781   1.00 0.00 ? 69  GLU A C    3  
ATOM 4460  O O    . GLU A 1 69  ? -20.480 -4.638  10.534  1.00 0.00 ? 69  GLU A O    3  
ATOM 4461  C CB   . GLU A 1 69  ? -20.841 -7.305  8.253   1.00 0.00 ? 69  GLU A CB   3  
ATOM 4462  C CG   . GLU A 1 69  ? -22.286 -7.695  7.940   1.00 0.00 ? 69  GLU A CG   3  
ATOM 4463  C CD   . GLU A 1 69  ? -22.401 -9.220  7.877   1.00 0.00 ? 69  GLU A CD   3  
ATOM 4464  O OE1  . GLU A 1 69  ? -22.339 -9.842  8.925   1.00 0.00 ? 69  GLU A OE1  3  
ATOM 4465  O OE2  . GLU A 1 69  ? -22.546 -9.740  6.783   1.00 0.00 ? 69  GLU A OE2  3  
ATOM 4466  H H    . GLU A 1 69  ? -19.057 -4.845  7.509   1.00 0.00 ? 69  GLU A H    3  
ATOM 4467  H HA   . GLU A 1 69  ? -21.742 -5.366  8.453   1.00 0.00 ? 69  GLU A HA   3  
ATOM 4468  H HB2  . GLU A 1 69  ? -20.201 -7.601  7.433   1.00 0.00 ? 69  GLU A HB2  3  
ATOM 4469  H HB3  . GLU A 1 69  ? -20.522 -7.804  9.156   1.00 0.00 ? 69  GLU A HB3  3  
ATOM 4470  H HG2  . GLU A 1 69  ? -22.937 -7.317  8.714   1.00 0.00 ? 69  GLU A HG2  3  
ATOM 4471  H HG3  . GLU A 1 69  ? -22.575 -7.276  6.988   1.00 0.00 ? 69  GLU A HG3  3  
ATOM 4472  N N    . GLU A 1 70  ? -18.998 -6.194  10.076  1.00 0.00 ? 70  GLU A N    3  
ATOM 4473  C CA   . GLU A 1 70  ? -18.274 -5.957  11.356  1.00 0.00 ? 70  GLU A CA   3  
ATOM 4474  C C    . GLU A 1 70  ? -17.470 -4.654  11.270  1.00 0.00 ? 70  GLU A C    3  
ATOM 4475  O O    . GLU A 1 70  ? -17.564 -3.816  12.144  1.00 0.00 ? 70  GLU A O    3  
ATOM 4476  C CB   . GLU A 1 70  ? -17.320 -7.123  11.630  1.00 0.00 ? 70  GLU A CB   3  
ATOM 4477  C CG   . GLU A 1 70  ? -17.400 -7.514  13.108  1.00 0.00 ? 70  GLU A CG   3  
ATOM 4478  C CD   . GLU A 1 70  ? -16.334 -6.750  13.897  1.00 0.00 ? 70  GLU A CD   3  
ATOM 4479  O OE1  . GLU A 1 70  ? -15.543 -6.062  13.274  1.00 0.00 ? 70  GLU A OE1  3  
ATOM 4480  O OE2  . GLU A 1 70  ? -16.327 -6.868  15.112  1.00 0.00 ? 70  GLU A OE2  3  
ATOM 4481  H H    . GLU A 1 70  ? -18.675 -6.878  9.453   1.00 0.00 ? 70  GLU A H    3  
ATOM 4482  H HA   . GLU A 1 70  ? -18.989 -5.883  12.163  1.00 0.00 ? 70  GLU A HA   3  
ATOM 4483  H HB2  . GLU A 1 70  ? -17.600 -7.968  11.018  1.00 0.00 ? 70  GLU A HB2  3  
ATOM 4484  H HB3  . GLU A 1 70  ? -16.310 -6.825  11.396  1.00 0.00 ? 70  GLU A HB3  3  
ATOM 4485  H HG2  . GLU A 1 70  ? -18.380 -7.268  13.493  1.00 0.00 ? 70  GLU A HG2  3  
ATOM 4486  H HG3  . GLU A 1 70  ? -17.230 -8.575  13.209  1.00 0.00 ? 70  GLU A HG3  3  
ATOM 4487  N N    . PRO A 1 71  ? -16.693 -4.527  10.222  1.00 0.00 ? 71  PRO A N    3  
ATOM 4488  C CA   . PRO A 1 71  ? -15.849 -3.339  10.006  1.00 0.00 ? 71  PRO A CA   3  
ATOM 4489  C C    . PRO A 1 71  ? -16.688 -2.178  9.470   1.00 0.00 ? 71  PRO A C    3  
ATOM 4490  O O    . PRO A 1 71  ? -17.682 -2.372  8.797   1.00 0.00 ? 71  PRO A O    3  
ATOM 4491  C CB   . PRO A 1 71  ? -14.827 -3.810  8.967   1.00 0.00 ? 71  PRO A CB   3  
ATOM 4492  C CG   . PRO A 1 71  ? -15.467 -5.016  8.238   1.00 0.00 ? 71  PRO A CG   3  
ATOM 4493  C CD   . PRO A 1 71  ? -16.584 -5.546  9.156   1.00 0.00 ? 71  PRO A CD   3  
ATOM 4494  H HA   . PRO A 1 71  ? -15.347 -3.059  10.917  1.00 0.00 ? 71  PRO A HA   3  
ATOM 4495  H HB2  . PRO A 1 71  ? -14.620 -3.013  8.266   1.00 0.00 ? 71  PRO A HB2  3  
ATOM 4496  H HB3  . PRO A 1 71  ? -13.918 -4.122  9.457   1.00 0.00 ? 71  PRO A HB3  3  
ATOM 4497  H HG2  . PRO A 1 71  ? -15.881 -4.697  7.292   1.00 0.00 ? 71  PRO A HG2  3  
ATOM 4498  H HG3  . PRO A 1 71  ? -14.729 -5.787  8.079   1.00 0.00 ? 71  PRO A HG3  3  
ATOM 4499  H HD2  . PRO A 1 71  ? -17.510 -5.625  8.606   1.00 0.00 ? 71  PRO A HD2  3  
ATOM 4500  H HD3  . PRO A 1 71  ? -16.308 -6.501  9.577   1.00 0.00 ? 71  PRO A HD3  3  
ATOM 4501  N N    . GLY A 1 72  ? -16.298 -0.968  9.766   1.00 0.00 ? 72  GLY A N    3  
ATOM 4502  C CA   . GLY A 1 72  ? -17.072 0.207   9.278   1.00 0.00 ? 72  GLY A CA   3  
ATOM 4503  C C    . GLY A 1 72  ? -16.427 0.755   8.005   1.00 0.00 ? 72  GLY A C    3  
ATOM 4504  O O    . GLY A 1 72  ? -16.395 1.948   7.777   1.00 0.00 ? 72  GLY A O    3  
ATOM 4505  H H    . GLY A 1 72  ? -15.495 -0.832  10.311  1.00 0.00 ? 72  GLY A H    3  
ATOM 4506  H HA2  . GLY A 1 72  ? -18.088 -0.094  9.065   1.00 0.00 ? 72  GLY A HA2  3  
ATOM 4507  H HA3  . GLY A 1 72  ? -17.075 0.976   10.039  1.00 0.00 ? 72  GLY A HA3  3  
ATOM 4508  N N    . LYS A 1 73  ? -15.915 -0.106  7.170   1.00 0.00 ? 73  LYS A N    3  
ATOM 4509  C CA   . LYS A 1 73  ? -15.275 0.366   5.911   1.00 0.00 ? 73  LYS A CA   3  
ATOM 4510  C C    . LYS A 1 73  ? -16.336 0.464   4.814   1.00 0.00 ? 73  LYS A C    3  
ATOM 4511  O O    . LYS A 1 73  ? -17.503 0.210   5.041   1.00 0.00 ? 73  LYS A O    3  
ATOM 4512  C CB   . LYS A 1 73  ? -14.191 -0.626  5.485   1.00 0.00 ? 73  LYS A CB   3  
ATOM 4513  C CG   . LYS A 1 73  ? -12.950 -0.434  6.358   1.00 0.00 ? 73  LYS A CG   3  
ATOM 4514  C CD   . LYS A 1 73  ? -12.008 -1.626  6.174   1.00 0.00 ? 73  LYS A CD   3  
ATOM 4515  C CE   . LYS A 1 73  ? -11.201 -1.845  7.456   1.00 0.00 ? 73  LYS A CE   3  
ATOM 4516  N NZ   . LYS A 1 73  ? -9.863  -1.205  7.315   1.00 0.00 ? 73  LYS A NZ   3  
ATOM 4517  H H    . LYS A 1 73  ? -15.952 -1.064  7.371   1.00 0.00 ? 73  LYS A H    3  
ATOM 4518  H HA   . LYS A 1 73  ? -14.833 1.339   6.073   1.00 0.00 ? 73  LYS A HA   3  
ATOM 4519  H HB2  . LYS A 1 73  ? -14.561 -1.634  5.600   1.00 0.00 ? 73  LYS A HB2  3  
ATOM 4520  H HB3  . LYS A 1 73  ? -13.931 -0.452  4.451   1.00 0.00 ? 73  LYS A HB3  3  
ATOM 4521  H HG2  . LYS A 1 73  ? -12.443 0.475   6.069   1.00 0.00 ? 73  LYS A HG2  3  
ATOM 4522  H HG3  . LYS A 1 73  ? -13.246 -0.368  7.395   1.00 0.00 ? 73  LYS A HG3  3  
ATOM 4523  H HD2  . LYS A 1 73  ? -12.589 -2.512  5.957   1.00 0.00 ? 73  LYS A HD2  3  
ATOM 4524  H HD3  . LYS A 1 73  ? -11.333 -1.428  5.356   1.00 0.00 ? 73  LYS A HD3  3  
ATOM 4525  H HE2  . LYS A 1 73  ? -11.726 -1.404  8.291   1.00 0.00 ? 73  LYS A HE2  3  
ATOM 4526  H HE3  . LYS A 1 73  ? -11.079 -2.904  7.626   1.00 0.00 ? 73  LYS A HE3  3  
ATOM 4527  H HZ1  . LYS A 1 73  ? -9.909  -0.457  6.595   1.00 0.00 ? 73  LYS A HZ1  3  
ATOM 4528  H HZ2  . LYS A 1 73  ? -9.165  -1.922  7.028   1.00 0.00 ? 73  LYS A HZ2  3  
ATOM 4529  H HZ3  . LYS A 1 73  ? -9.580  -0.790  8.224   1.00 0.00 ? 73  LYS A HZ3  3  
ATOM 4530  N N    . GLY A 1 74  ? -15.943 0.826   3.625   1.00 0.00 ? 74  GLY A N    3  
ATOM 4531  C CA   . GLY A 1 74  ? -16.928 0.936   2.514   1.00 0.00 ? 74  GLY A CA   3  
ATOM 4532  C C    . GLY A 1 74  ? -16.385 0.205   1.285   1.00 0.00 ? 74  GLY A C    3  
ATOM 4533  O O    . GLY A 1 74  ? -16.883 -0.832  0.894   1.00 0.00 ? 74  GLY A O    3  
ATOM 4534  H H    . GLY A 1 74  ? -14.996 1.024   3.461   1.00 0.00 ? 74  GLY A H    3  
ATOM 4535  H HA2  . GLY A 1 74  ? -17.864 0.487   2.816   1.00 0.00 ? 74  GLY A HA2  3  
ATOM 4536  H HA3  . GLY A 1 74  ? -17.089 1.976   2.273   1.00 0.00 ? 74  GLY A HA3  3  
ATOM 4537  N N    . SER A 1 75  ? -15.362 0.737   0.676   1.00 0.00 ? 75  SER A N    3  
ATOM 4538  C CA   . SER A 1 75  ? -14.779 0.074   -0.524  1.00 0.00 ? 75  SER A CA   3  
ATOM 4539  C C    . SER A 1 75  ? -13.424 -0.536  -0.159  1.00 0.00 ? 75  SER A C    3  
ATOM 4540  O O    . SER A 1 75  ? -12.901 -0.309  0.914   1.00 0.00 ? 75  SER A O    3  
ATOM 4541  C CB   . SER A 1 75  ? -14.590 1.107   -1.634  1.00 0.00 ? 75  SER A CB   3  
ATOM 4542  O OG   . SER A 1 75  ? -15.859 1.622   -2.018  1.00 0.00 ? 75  SER A OG   3  
ATOM 4543  H H    . SER A 1 75  ? -14.973 1.572   1.011   1.00 0.00 ? 75  SER A H    3  
ATOM 4544  H HA   . SER A 1 75  ? -15.446 -0.704  -0.865  1.00 0.00 ? 75  SER A HA   3  
ATOM 4545  H HB2  . SER A 1 75  ? -13.973 1.915   -1.276  1.00 0.00 ? 75  SER A HB2  3  
ATOM 4546  H HB3  . SER A 1 75  ? -14.108 0.639   -2.483  1.00 0.00 ? 75  SER A HB3  3  
ATOM 4547  H HG   . SER A 1 75  ? -16.278 0.979   -2.594  1.00 0.00 ? 75  SER A HG   3  
ATOM 4548  N N    . PHE A 1 76  ? -12.851 -1.307  -1.042  1.00 0.00 ? 76  PHE A N    3  
ATOM 4549  C CA   . PHE A 1 76  ? -11.530 -1.929  -0.742  1.00 0.00 ? 76  PHE A CA   3  
ATOM 4550  C C    . PHE A 1 76  ? -10.760 -2.164  -2.045  1.00 0.00 ? 76  PHE A C    3  
ATOM 4551  O O    . PHE A 1 76  ? -11.219 -2.854  -2.934  1.00 0.00 ? 76  PHE A O    3  
ATOM 4552  C CB   . PHE A 1 76  ? -11.744 -3.267  -0.030  1.00 0.00 ? 76  PHE A CB   3  
ATOM 4553  C CG   . PHE A 1 76  ? -10.830 -3.360  1.170   1.00 0.00 ? 76  PHE A CG   3  
ATOM 4554  C CD1  . PHE A 1 76  ? -9.530  -2.847  1.103   1.00 0.00 ? 76  PHE A CD1  3  
ATOM 4555  C CD2  . PHE A 1 76  ? -11.285 -3.963  2.349   1.00 0.00 ? 76  PHE A CD2  3  
ATOM 4556  C CE1  . PHE A 1 76  ? -8.684  -2.936  2.217   1.00 0.00 ? 76  PHE A CE1  3  
ATOM 4557  C CE2  . PHE A 1 76  ? -10.439 -4.051  3.461   1.00 0.00 ? 76  PHE A CE2  3  
ATOM 4558  C CZ   . PHE A 1 76  ? -9.139  -3.539  3.394   1.00 0.00 ? 76  PHE A CZ   3  
ATOM 4559  H H    . PHE A 1 76  ? -13.289 -1.478  -1.902  1.00 0.00 ? 76  PHE A H    3  
ATOM 4560  H HA   . PHE A 1 76  ? -10.961 -1.270  -0.101  1.00 0.00 ? 76  PHE A HA   3  
ATOM 4561  H HB2  . PHE A 1 76  ? -12.772 -3.342  0.293   1.00 0.00 ? 76  PHE A HB2  3  
ATOM 4562  H HB3  . PHE A 1 76  ? -11.522 -4.075  -0.712  1.00 0.00 ? 76  PHE A HB3  3  
ATOM 4563  H HD1  . PHE A 1 76  ? -9.178  -2.382  0.195   1.00 0.00 ? 76  PHE A HD1  3  
ATOM 4564  H HD2  . PHE A 1 76  ? -12.288 -4.360  2.402   1.00 0.00 ? 76  PHE A HD2  3  
ATOM 4565  H HE1  . PHE A 1 76  ? -7.681  -2.542  2.168   1.00 0.00 ? 76  PHE A HE1  3  
ATOM 4566  H HE2  . PHE A 1 76  ? -10.787 -4.516  4.370   1.00 0.00 ? 76  PHE A HE2  3  
ATOM 4567  H HZ   . PHE A 1 76  ? -8.487  -3.606  4.253   1.00 0.00 ? 76  PHE A HZ   3  
ATOM 4568  N N    . TRP A 1 77  ? -9.593  -1.593  -2.160  1.00 0.00 ? 77  TRP A N    3  
ATOM 4569  C CA   . TRP A 1 77  ? -8.782  -1.775  -3.400  1.00 0.00 ? 77  TRP A CA   3  
ATOM 4570  C C    . TRP A 1 77  ? -8.079  -3.139  -3.363  1.00 0.00 ? 77  TRP A C    3  
ATOM 4571  O O    . TRP A 1 77  ? -7.542  -3.540  -2.350  1.00 0.00 ? 77  TRP A O    3  
ATOM 4572  C CB   . TRP A 1 77  ? -7.721  -0.674  -3.468  1.00 0.00 ? 77  TRP A CB   3  
ATOM 4573  C CG   . TRP A 1 77  ? -8.234  0.478   -4.262  1.00 0.00 ? 77  TRP A CG   3  
ATOM 4574  C CD1  . TRP A 1 77  ? -8.458  1.721   -3.775  1.00 0.00 ? 77  TRP A CD1  3  
ATOM 4575  C CD2  . TRP A 1 77  ? -8.575  0.522   -5.672  1.00 0.00 ? 77  TRP A CD2  3  
ATOM 4576  N NE1  . TRP A 1 77  ? -8.916  2.525   -4.802  1.00 0.00 ? 77  TRP A NE1  3  
ATOM 4577  C CE2  . TRP A 1 77  ? -9.005  1.831   -5.992  1.00 0.00 ? 77  TRP A CE2  3  
ATOM 4578  C CE3  . TRP A 1 77  ? -8.553  -0.440  -6.696  1.00 0.00 ? 77  TRP A CE3  3  
ATOM 4579  C CZ2  . TRP A 1 77  ? -9.396  2.173   -7.283  1.00 0.00 ? 77  TRP A CZ2  3  
ATOM 4580  C CZ3  . TRP A 1 77  ? -8.946  -0.098  -7.997  1.00 0.00 ? 77  TRP A CZ3  3  
ATOM 4581  C CH2  . TRP A 1 77  ? -9.364  1.205   -8.289  1.00 0.00 ? 77  TRP A CH2  3  
ATOM 4582  H H    . TRP A 1 77  ? -9.249  -1.039  -1.430  1.00 0.00 ? 77  TRP A H    3  
ATOM 4583  H HA   . TRP A 1 77  ? -9.422  -1.717  -4.267  1.00 0.00 ? 77  TRP A HA   3  
ATOM 4584  H HB2  . TRP A 1 77  ? -7.483  -0.341  -2.472  1.00 0.00 ? 77  TRP A HB2  3  
ATOM 4585  H HB3  . TRP A 1 77  ? -6.830  -1.065  -3.938  1.00 0.00 ? 77  TRP A HB3  3  
ATOM 4586  H HD1  . TRP A 1 77  ? -8.306  2.034   -2.753  1.00 0.00 ? 77  TRP A HD1  3  
ATOM 4587  H HE1  . TRP A 1 77  ? -9.152  3.474   -4.716  1.00 0.00 ? 77  TRP A HE1  3  
ATOM 4588  H HE3  . TRP A 1 77  ? -8.233  -1.448  -6.478  1.00 0.00 ? 77  TRP A HE3  3  
ATOM 4589  H HZ2  . TRP A 1 77  ? -9.718  3.180   -7.506  1.00 0.00 ? 77  TRP A HZ2  3  
ATOM 4590  H HZ3  . TRP A 1 77  ? -8.925  -0.844  -8.778  1.00 0.00 ? 77  TRP A HZ3  3  
ATOM 4591  H HH2  . TRP A 1 77  ? -9.654  1.462   -9.290  1.00 0.00 ? 77  TRP A HH2  3  
ATOM 4592  N N    . ARG A 1 78  ? -8.068  -3.852  -4.462  1.00 0.00 ? 78  ARG A N    3  
ATOM 4593  C CA   . ARG A 1 78  ? -7.387  -5.184  -4.482  1.00 0.00 ? 78  ARG A CA   3  
ATOM 4594  C C    . ARG A 1 78  ? -6.768  -5.426  -5.859  1.00 0.00 ? 78  ARG A C    3  
ATOM 4595  O O    . ARG A 1 78  ? -7.144  -4.814  -6.835  1.00 0.00 ? 78  ARG A O    3  
ATOM 4596  C CB   . ARG A 1 78  ? -8.381  -6.327  -4.194  1.00 0.00 ? 78  ARG A CB   3  
ATOM 4597  C CG   . ARG A 1 78  ? -9.777  -5.786  -3.862  1.00 0.00 ? 78  ARG A CG   3  
ATOM 4598  C CD   . ARG A 1 78  ? -10.614 -5.741  -5.139  1.00 0.00 ? 78  ARG A CD   3  
ATOM 4599  N NE   . ARG A 1 78  ? -11.412 -6.995  -5.253  1.00 0.00 ? 78  ARG A NE   3  
ATOM 4600  C CZ   . ARG A 1 78  ? -10.857 -8.148  -4.989  1.00 0.00 ? 78  ARG A CZ   3  
ATOM 4601  N NH1  . ARG A 1 78  ? -10.081 -8.716  -5.871  1.00 0.00 ? 78  ARG A NH1  3  
ATOM 4602  N NH2  . ARG A 1 78  ? -11.077 -8.732  -3.843  1.00 0.00 ? 78  ARG A NH2  3  
ATOM 4603  H H    . ARG A 1 78  ? -8.501  -3.512  -5.272  1.00 0.00 ? 78  ARG A H    3  
ATOM 4604  H HA   . ARG A 1 78  ? -6.605  -5.194  -3.738  1.00 0.00 ? 78  ARG A HA   3  
ATOM 4605  H HB2  . ARG A 1 78  ? -8.450  -6.959  -5.067  1.00 0.00 ? 78  ARG A HB2  3  
ATOM 4606  H HB3  . ARG A 1 78  ? -8.020  -6.914  -3.364  1.00 0.00 ? 78  ARG A HB3  3  
ATOM 4607  H HG2  . ARG A 1 78  ? -10.252 -6.442  -3.146  1.00 0.00 ? 78  ARG A HG2  3  
ATOM 4608  H HG3  . ARG A 1 78  ? -9.702  -4.797  -3.444  1.00 0.00 ? 78  ARG A HG3  3  
ATOM 4609  H HD2  . ARG A 1 78  ? -11.278 -4.892  -5.103  1.00 0.00 ? 78  ARG A HD2  3  
ATOM 4610  H HD3  . ARG A 1 78  ? -9.960  -5.651  -5.994  1.00 0.00 ? 78  ARG A HD3  3  
ATOM 4611  H HE   . ARG A 1 78  ? -12.351 -6.956  -5.525  1.00 0.00 ? 78  ARG A HE   3  
ATOM 4612  H HH11 . ARG A 1 78  ? -9.910  -8.269  -6.750  1.00 0.00 ? 78  ARG A HH11 3  
ATOM 4613  H HH12 . ARG A 1 78  ? -9.655  -9.599  -5.669  1.00 0.00 ? 78  ARG A HH12 3  
ATOM 4614  H HH21 . ARG A 1 78  ? -11.671 -8.298  -3.166  1.00 0.00 ? 78  ARG A HH21 3  
ATOM 4615  H HH22 . ARG A 1 78  ? -10.651 -9.615  -3.641  1.00 0.00 ? 78  ARG A HH22 3  
ATOM 4616  N N    . ILE A 1 79  ? -5.830  -6.333  -5.941  1.00 0.00 ? 79  ILE A N    3  
ATOM 4617  C CA   . ILE A 1 79  ? -5.198  -6.639  -7.263  1.00 0.00 ? 79  ILE A CA   3  
ATOM 4618  C C    . ILE A 1 79  ? -5.780  -7.952  -7.788  1.00 0.00 ? 79  ILE A C    3  
ATOM 4619  O O    . ILE A 1 79  ? -6.184  -8.807  -7.025  1.00 0.00 ? 79  ILE A O    3  
ATOM 4620  C CB   . ILE A 1 79  ? -3.679  -6.775  -7.097  1.00 0.00 ? 79  ILE A CB   3  
ATOM 4621  C CG1  . ILE A 1 79  ? -3.025  -7.121  -8.438  1.00 0.00 ? 79  ILE A CG1  3  
ATOM 4622  C CG2  . ILE A 1 79  ? -3.368  -7.881  -6.107  1.00 0.00 ? 79  ILE A CG2  3  
ATOM 4623  C CD1  . ILE A 1 79  ? -1.991  -6.051  -8.793  1.00 0.00 ? 79  ILE A CD1  3  
ATOM 4624  H H    . ILE A 1 79  ? -5.554  -6.823  -5.134  1.00 0.00 ? 79  ILE A H    3  
ATOM 4625  H HA   . ILE A 1 79  ? -5.415  -5.844  -7.961  1.00 0.00 ? 79  ILE A HA   3  
ATOM 4626  H HB   . ILE A 1 79  ? -3.277  -5.850  -6.727  1.00 0.00 ? 79  ILE A HB   3  
ATOM 4627  H HG12 . ILE A 1 79  ? -2.534  -8.080  -8.357  1.00 0.00 ? 79  ILE A HG12 3  
ATOM 4628  H HG13 . ILE A 1 79  ? -3.775  -7.168  -9.207  1.00 0.00 ? 79  ILE A HG13 3  
ATOM 4629  H HG21 . ILE A 1 79  ? -3.395  -7.482  -5.106  1.00 0.00 ? 79  ILE A HG21 3  
ATOM 4630  H HG22 . ILE A 1 79  ? -2.384  -8.275  -6.314  1.00 0.00 ? 79  ILE A HG22 3  
ATOM 4631  H HG23 . ILE A 1 79  ? -4.100  -8.667  -6.207  1.00 0.00 ? 79  ILE A HG23 3  
ATOM 4632  H HD11 . ILE A 1 79  ? -1.383  -6.397  -9.613  1.00 0.00 ? 79  ILE A HD11 3  
ATOM 4633  H HD12 . ILE A 1 79  ? -1.362  -5.858  -7.937  1.00 0.00 ? 79  ILE A HD12 3  
ATOM 4634  H HD13 . ILE A 1 79  ? -2.497  -5.143  -9.079  1.00 0.00 ? 79  ILE A HD13 3  
ATOM 4635  N N    . ASP A 1 80  ? -5.834  -8.124  -9.080  1.00 0.00 ? 80  ASP A N    3  
ATOM 4636  C CA   . ASP A 1 80  ? -6.402  -9.385  -9.630  1.00 0.00 ? 80  ASP A CA   3  
ATOM 4637  C C    . ASP A 1 80  ? -5.612  -10.574 -9.069  1.00 0.00 ? 80  ASP A C    3  
ATOM 4638  O O    . ASP A 1 80  ? -4.423  -10.474 -8.840  1.00 0.00 ? 80  ASP A O    3  
ATOM 4639  C CB   . ASP A 1 80  ? -6.299  -9.372  -11.156 1.00 0.00 ? 80  ASP A CB   3  
ATOM 4640  C CG   . ASP A 1 80  ? -7.497  -8.621  -11.742 1.00 0.00 ? 80  ASP A CG   3  
ATOM 4641  O OD1  . ASP A 1 80  ? -8.615  -8.969  -11.399 1.00 0.00 ? 80  ASP A OD1  3  
ATOM 4642  O OD2  . ASP A 1 80  ? -7.276  -7.710  -12.524 1.00 0.00 ? 80  ASP A OD2  3  
ATOM 4643  H H    . ASP A 1 80  ? -5.516  -7.424  -9.685  1.00 0.00 ? 80  ASP A H    3  
ATOM 4644  H HA   . ASP A 1 80  ? -7.438  -9.467  -9.339  1.00 0.00 ? 80  ASP A HA   3  
ATOM 4645  H HB2  . ASP A 1 80  ? -5.385  -8.878  -11.450 1.00 0.00 ? 80  ASP A HB2  3  
ATOM 4646  H HB3  . ASP A 1 80  ? -6.298  -10.385 -11.527 1.00 0.00 ? 80  ASP A HB3  3  
ATOM 4647  N N    . PRO A 1 81  ? -6.310  -11.657 -8.839  1.00 0.00 ? 81  PRO A N    3  
ATOM 4648  C CA   . PRO A 1 81  ? -5.717  -12.882 -8.271  1.00 0.00 ? 81  PRO A CA   3  
ATOM 4649  C C    . PRO A 1 81  ? -4.966  -13.695 -9.332  1.00 0.00 ? 81  PRO A C    3  
ATOM 4650  O O    . PRO A 1 81  ? -3.832  -14.084 -9.137  1.00 0.00 ? 81  PRO A O    3  
ATOM 4651  C CB   . PRO A 1 81  ? -6.934  -13.658 -7.757  1.00 0.00 ? 81  PRO A CB   3  
ATOM 4652  C CG   . PRO A 1 81  ? -8.156  -13.133 -8.552  1.00 0.00 ? 81  PRO A CG   3  
ATOM 4653  C CD   . PRO A 1 81  ? -7.756  -11.761 -9.125  1.00 0.00 ? 81  PRO A CD   3  
ATOM 4654  H HA   . PRO A 1 81  ? -5.065  -12.641 -7.447  1.00 0.00 ? 81  PRO A HA   3  
ATOM 4655  H HB2  . PRO A 1 81  ? -6.798  -14.716 -7.933  1.00 0.00 ? 81  PRO A HB2  3  
ATOM 4656  H HB3  . PRO A 1 81  ? -7.076  -13.470 -6.705  1.00 0.00 ? 81  PRO A HB3  3  
ATOM 4657  H HG2  . PRO A 1 81  ? -8.394  -13.818 -9.353  1.00 0.00 ? 81  PRO A HG2  3  
ATOM 4658  H HG3  . PRO A 1 81  ? -9.004  -13.020 -7.895  1.00 0.00 ? 81  PRO A HG3  3  
ATOM 4659  H HD2  . PRO A 1 81  ? -7.936  -11.732 -10.192 1.00 0.00 ? 81  PRO A HD2  3  
ATOM 4660  H HD3  . PRO A 1 81  ? -8.293  -10.967 -8.628  1.00 0.00 ? 81  PRO A HD3  3  
ATOM 4661  N N    . ALA A 1 82  ? -5.591  -13.976 -10.442 1.00 0.00 ? 82  ALA A N    3  
ATOM 4662  C CA   . ALA A 1 82  ? -4.909  -14.787 -11.494 1.00 0.00 ? 82  ALA A CA   3  
ATOM 4663  C C    . ALA A 1 82  ? -3.830  -13.961 -12.196 1.00 0.00 ? 82  ALA A C    3  
ATOM 4664  O O    . ALA A 1 82  ? -3.162  -14.439 -13.091 1.00 0.00 ? 82  ALA A O    3  
ATOM 4665  C CB   . ALA A 1 82  ? -5.939  -15.261 -12.521 1.00 0.00 ? 82  ALA A CB   3  
ATOM 4666  H H    . ALA A 1 82  ? -6.512  -13.668 -10.579 1.00 0.00 ? 82  ALA A H    3  
ATOM 4667  H HA   . ALA A 1 82  ? -4.444  -15.645 -11.032 1.00 0.00 ? 82  ALA A HA   3  
ATOM 4668  H HB1  . ALA A 1 82  ? -5.679  -16.253 -12.860 1.00 0.00 ? 82  ALA A HB1  3  
ATOM 4669  H HB2  . ALA A 1 82  ? -5.945  -14.584 -13.363 1.00 0.00 ? 82  ALA A HB2  3  
ATOM 4670  H HB3  . ALA A 1 82  ? -6.918  -15.281 -12.068 1.00 0.00 ? 82  ALA A HB3  3  
ATOM 4671  N N    . SER A 1 83  ? -3.634  -12.737 -11.798 1.00 0.00 ? 83  SER A N    3  
ATOM 4672  C CA   . SER A 1 83  ? -2.582  -11.915 -12.445 1.00 0.00 ? 83  SER A CA   3  
ATOM 4673  C C    . SER A 1 83  ? -1.560  -11.513 -11.388 1.00 0.00 ? 83  SER A C    3  
ATOM 4674  O O    . SER A 1 83  ? -0.497  -11.035 -11.699 1.00 0.00 ? 83  SER A O    3  
ATOM 4675  C CB   . SER A 1 83  ? -3.207  -10.655 -13.048 1.00 0.00 ? 83  SER A CB   3  
ATOM 4676  O OG   . SER A 1 83  ? -4.072  -11.022 -14.114 1.00 0.00 ? 83  SER A OG   3  
ATOM 4677  H H    . SER A 1 83  ? -4.168  -12.361 -11.066 1.00 0.00 ? 83  SER A H    3  
ATOM 4678  H HA   . SER A 1 83  ? -2.097  -12.489 -13.221 1.00 0.00 ? 83  SER A HA   3  
ATOM 4679  H HB2  . SER A 1 83  ? -3.773  -10.138 -12.293 1.00 0.00 ? 83  SER A HB2  3  
ATOM 4680  H HB3  . SER A 1 83  ? -2.421  -10.004 -13.413 1.00 0.00 ? 83  SER A HB3  3  
ATOM 4681  H HG   . SER A 1 83  ? -4.869  -11.401 -13.733 1.00 0.00 ? 83  SER A HG   3  
ATOM 4682  N N    . GLU A 1 84  ? -1.885  -11.697 -10.138 1.00 0.00 ? 84  GLU A N    3  
ATOM 4683  C CA   . GLU A 1 84  ? -0.947  -11.304 -9.050  1.00 0.00 ? 84  GLU A CA   3  
ATOM 4684  C C    . GLU A 1 84  ? 0.389   -12.030 -9.190  1.00 0.00 ? 84  GLU A C    3  
ATOM 4685  O O    . GLU A 1 84  ? 1.409   -11.523 -8.776  1.00 0.00 ? 84  GLU A O    3  
ATOM 4686  C CB   . GLU A 1 84  ? -1.569  -11.650 -7.697  1.00 0.00 ? 84  GLU A CB   3  
ATOM 4687  C CG   . GLU A 1 84  ? -0.535  -11.435 -6.590  1.00 0.00 ? 84  GLU A CG   3  
ATOM 4688  C CD   . GLU A 1 84  ? -1.218  -10.837 -5.359  1.00 0.00 ? 84  GLU A CD   3  
ATOM 4689  O OE1  . GLU A 1 84  ? -2.322  -10.338 -5.503  1.00 0.00 ? 84  GLU A OE1  3  
ATOM 4690  O OE2  . GLU A 1 84  ? -0.626  -10.888 -4.293  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 4691  H H    . GLU A 1 84  ? -2.756  -12.080 -9.911  1.00 0.00 ? 84  GLU A H    3  
ATOM 4692  H HA   . GLU A 1 84  ? -0.774  -10.244 -9.097  1.00 0.00 ? 84  GLU A HA   3  
ATOM 4693  H HB2  . GLU A 1 84  ? -2.425  -11.014 -7.521  1.00 0.00 ? 84  GLU A HB2  3  
ATOM 4694  H HB3  . GLU A 1 84  ? -1.883  -12.683 -7.698  1.00 0.00 ? 84  GLU A HB3  3  
ATOM 4695  H HG2  . GLU A 1 84  ? -0.086  -12.383 -6.329  1.00 0.00 ? 84  GLU A HG2  3  
ATOM 4696  H HG3  . GLU A 1 84  ? 0.232   -10.759 -6.939  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 4697  N N    . ALA A 1 85  ? 0.407   -13.205 -9.752  1.00 0.00 ? 85  ALA A N    3  
ATOM 4698  C CA   . ALA A 1 85  ? 1.709   -13.925 -9.880  1.00 0.00 ? 85  ALA A CA   3  
ATOM 4699  C C    . ALA A 1 85  ? 2.551   -13.297 -10.994 1.00 0.00 ? 85  ALA A C    3  
ATOM 4700  O O    . ALA A 1 85  ? 3.762   -13.393 -10.990 1.00 0.00 ? 85  ALA A O    3  
ATOM 4701  C CB   . ALA A 1 85  ? 1.454   -15.399 -10.203 1.00 0.00 ? 85  ALA A CB   3  
ATOM 4702  H H    . ALA A 1 85  ? -0.427  -13.616 -10.079 1.00 0.00 ? 85  ALA A H    3  
ATOM 4703  H HA   . ALA A 1 85  ? 2.250   -13.849 -8.945  1.00 0.00 ? 85  ALA A HA   3  
ATOM 4704  H HB1  . ALA A 1 85  ? 2.200   -16.009 -9.714  1.00 0.00 ? 85  ALA A HB1  3  
ATOM 4705  H HB2  . ALA A 1 85  ? 1.513   -15.548 -11.272 1.00 0.00 ? 85  ALA A HB2  3  
ATOM 4706  H HB3  . ALA A 1 85  ? 0.472   -15.681 -9.854  1.00 0.00 ? 85  ALA A HB3  3  
ATOM 4707  N N    . LYS A 1 86  ? 1.934   -12.657 -11.950 1.00 0.00 ? 86  LYS A N    3  
ATOM 4708  C CA   . LYS A 1 86  ? 2.727   -12.040 -13.048 1.00 0.00 ? 86  LYS A CA   3  
ATOM 4709  C C    . LYS A 1 86  ? 3.097   -10.600 -12.678 1.00 0.00 ? 86  LYS A C    3  
ATOM 4710  O O    . LYS A 1 86  ? 4.193   -10.147 -12.943 1.00 0.00 ? 86  LYS A O    3  
ATOM 4711  C CB   . LYS A 1 86  ? 1.912   -12.054 -14.343 1.00 0.00 ? 86  LYS A CB   3  
ATOM 4712  C CG   . LYS A 1 86  ? 0.594   -11.306 -14.144 1.00 0.00 ? 86  LYS A CG   3  
ATOM 4713  C CD   . LYS A 1 86  ? -0.037  -11.019 -15.508 1.00 0.00 ? 86  LYS A CD   3  
ATOM 4714  C CE   . LYS A 1 86  ? -0.133  -9.507  -15.718 1.00 0.00 ? 86  LYS A CE   3  
ATOM 4715  N NZ   . LYS A 1 86  ? 1.236   -8.935  -15.860 1.00 0.00 ? 86  LYS A NZ   3  
ATOM 4716  H H    . LYS A 1 86  ? 0.958   -12.586 -11.950 1.00 0.00 ? 86  LYS A H    3  
ATOM 4717  H HA   . LYS A 1 86  ? 3.632   -12.611 -13.192 1.00 0.00 ? 86  LYS A HA   3  
ATOM 4718  H HB2  . LYS A 1 86  ? 2.479   -11.577 -15.125 1.00 0.00 ? 86  LYS A HB2  3  
ATOM 4719  H HB3  . LYS A 1 86  ? 1.703   -13.076 -14.624 1.00 0.00 ? 86  LYS A HB3  3  
ATOM 4720  H HG2  . LYS A 1 86  ? -0.080  -11.913 -13.557 1.00 0.00 ? 86  LYS A HG2  3  
ATOM 4721  H HG3  . LYS A 1 86  ? 0.779   -10.374 -13.636 1.00 0.00 ? 86  LYS A HG3  3  
ATOM 4722  H HD2  . LYS A 1 86  ? 0.576   -11.454 -16.286 1.00 0.00 ? 86  LYS A HD2  3  
ATOM 4723  H HD3  . LYS A 1 86  ? -1.026  -11.450 -15.546 1.00 0.00 ? 86  LYS A HD3  3  
ATOM 4724  H HE2  . LYS A 1 86  ? -0.704  -9.303  -16.612 1.00 0.00 ? 86  LYS A HE2  3  
ATOM 4725  H HE3  . LYS A 1 86  ? -0.624  -9.058  -14.867 1.00 0.00 ? 86  LYS A HE3  3  
ATOM 4726  H HZ1  . LYS A 1 86  ? 1.612   -8.698  -14.921 1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 4727  H HZ2  . LYS A 1 86  ? 1.192   -8.076  -16.445 1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 4728  H HZ3  . LYS A 1 86  ? 1.858   -9.633  -16.314 1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 4729  N N    . LEU A 1 87  ? 2.199   -9.873  -12.065 1.00 0.00 ? 87  LEU A N    3  
ATOM 4730  C CA   . LEU A 1 87  ? 2.523   -8.469  -11.687 1.00 0.00 ? 87  LEU A CA   3  
ATOM 4731  C C    . LEU A 1 87  ? 3.598   -8.472  -10.619 1.00 0.00 ? 87  LEU A C    3  
ATOM 4732  O O    . LEU A 1 87  ? 4.629   -7.842  -10.751 1.00 0.00 ? 87  LEU A O    3  
ATOM 4733  C CB   . LEU A 1 87  ? 1.286   -7.731  -11.150 1.00 0.00 ? 87  LEU A CB   3  
ATOM 4734  C CG   . LEU A 1 87  ? 0.363   -8.662  -10.344 1.00 0.00 ? 87  LEU A CG   3  
ATOM 4735  C CD1  . LEU A 1 87  ? 0.216   -8.137  -8.918  1.00 0.00 ? 87  LEU A CD1  3  
ATOM 4736  C CD2  . LEU A 1 87  ? -1.027  -8.682  -10.987 1.00 0.00 ? 87  LEU A CD2  3  
ATOM 4737  H H    . LEU A 1 87  ? 1.327   -10.249 -11.857 1.00 0.00 ? 87  LEU A H    3  
ATOM 4738  H HA   . LEU A 1 87  ? 2.897   -7.953  -12.555 1.00 0.00 ? 87  LEU A HA   3  
ATOM 4739  H HB2  . LEU A 1 87  ? 1.606   -6.918  -10.519 1.00 0.00 ? 87  LEU A HB2  3  
ATOM 4740  H HB3  . LEU A 1 87  ? 0.744   -7.336  -11.976 1.00 0.00 ? 87  LEU A HB3  3  
ATOM 4741  H HG   . LEU A 1 87  ? 0.770   -9.658  -10.318 1.00 0.00 ? 87  LEU A HG   3  
ATOM 4742  H HD11 . LEU A 1 87  ? 1.031   -8.500  -8.317  1.00 0.00 ? 87  LEU A HD11 3  
ATOM 4743  H HD12 . LEU A 1 87  ? -0.721  -8.485  -8.504  1.00 0.00 ? 87  LEU A HD12 3  
ATOM 4744  H HD13 . LEU A 1 87  ? 0.224   -7.059  -8.930  1.00 0.00 ? 87  LEU A HD13 3  
ATOM 4745  H HD21 . LEU A 1 87  ? -1.664  -9.369  -10.447 1.00 0.00 ? 87  LEU A HD21 3  
ATOM 4746  H HD22 . LEU A 1 87  ? -0.945  -9.000  -12.014 1.00 0.00 ? 87  LEU A HD22 3  
ATOM 4747  H HD23 . LEU A 1 87  ? -1.457  -7.692  -10.948 1.00 0.00 ? 87  LEU A HD23 3  
ATOM 4748  N N    . VAL A 1 88  ? 3.360   -9.176  -9.564  1.00 0.00 ? 88  VAL A N    3  
ATOM 4749  C CA   . VAL A 1 88  ? 4.352   -9.236  -8.470  1.00 0.00 ? 88  VAL A CA   3  
ATOM 4750  C C    . VAL A 1 88  ? 5.767   -9.364  -9.038  1.00 0.00 ? 88  VAL A C    3  
ATOM 4751  O O    . VAL A 1 88  ? 6.722   -8.894  -8.451  1.00 0.00 ? 88  VAL A O    3  
ATOM 4752  C CB   . VAL A 1 88  ? 4.071   -10.460 -7.630  1.00 0.00 ? 88  VAL A CB   3  
ATOM 4753  C CG1  . VAL A 1 88  ? 2.788   -10.267 -6.820  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 4754  C CG2  . VAL A 1 88  ? 3.934   -11.674 -8.549  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 4755  H H    . VAL A 1 88  ? 2.517   -9.672  -9.488  1.00 0.00 ? 88  VAL A H    3  
ATOM 4756  H HA   . VAL A 1 88  ? 4.277   -8.352  -7.858  1.00 0.00 ? 88  VAL A HA   3  
ATOM 4757  H HB   . VAL A 1 88  ? 4.893   -10.602 -6.972  1.00 0.00 ? 88  VAL A HB   3  
ATOM 4758  H HG11 . VAL A 1 88  ? 2.170   -9.523  -7.298  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 4759  H HG12 . VAL A 1 88  ? 3.038   -9.940  -5.822  1.00 0.00 ? 88  VAL A HG12 3  
ATOM 4760  H HG13 . VAL A 1 88  ? 2.251   -11.202 -6.768  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 4761  H HG21 . VAL A 1 88  ? 4.892   -12.164 -8.642  1.00 0.00 ? 88  VAL A HG21 3  
ATOM 4762  H HG22 . VAL A 1 88  ? 3.599   -11.351 -9.524  1.00 0.00 ? 88  VAL A HG22 3  
ATOM 4763  H HG23 . VAL A 1 88  ? 3.216   -12.363 -8.132  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 4764  N N    . GLU A 1 89  ? 5.918   -10.006 -10.164 1.00 0.00 ? 89  GLU A N    3  
ATOM 4765  C CA   . GLU A 1 89  ? 7.283   -10.160 -10.741 1.00 0.00 ? 89  GLU A CA   3  
ATOM 4766  C C    . GLU A 1 89  ? 7.905   -8.775  -10.877 1.00 0.00 ? 89  GLU A C    3  
ATOM 4767  O O    . GLU A 1 89  ? 8.974   -8.509  -10.363 1.00 0.00 ? 89  GLU A O    3  
ATOM 4768  C CB   . GLU A 1 89  ? 7.200   -10.828 -12.115 1.00 0.00 ? 89  GLU A CB   3  
ATOM 4769  C CG   . GLU A 1 89  ? 8.513   -11.563 -12.401 1.00 0.00 ? 89  GLU A CG   3  
ATOM 4770  C CD   . GLU A 1 89  ? 8.239   -12.770 -13.301 1.00 0.00 ? 89  GLU A CD   3  
ATOM 4771  O OE1  . GLU A 1 89  ? 7.126   -12.880 -13.788 1.00 0.00 ? 89  GLU A OE1  3  
ATOM 4772  O OE2  . GLU A 1 89  ? 9.147   -13.562 -13.488 1.00 0.00 ? 89  GLU A OE2  3  
ATOM 4773  H H    . GLU A 1 89  ? 5.142   -10.391 -10.619 1.00 0.00 ? 89  GLU A H    3  
ATOM 4774  H HA   . GLU A 1 89  ? 7.889   -10.762 -10.080 1.00 0.00 ? 89  GLU A HA   3  
ATOM 4775  H HB2  . GLU A 1 89  ? 6.383   -11.533 -12.125 1.00 0.00 ? 89  GLU A HB2  3  
ATOM 4776  H HB3  . GLU A 1 89  ? 7.038   -10.076 -12.874 1.00 0.00 ? 89  GLU A HB3  3  
ATOM 4777  H HG2  . GLU A 1 89  ? 9.201   -10.892 -12.896 1.00 0.00 ? 89  GLU A HG2  3  
ATOM 4778  H HG3  . GLU A 1 89  ? 8.945   -11.901 -11.471 1.00 0.00 ? 89  GLU A HG3  3  
ATOM 4779  N N    . GLN A 1 90  ? 7.232   -7.877  -11.537 1.00 0.00 ? 90  GLN A N    3  
ATOM 4780  C CA   . GLN A 1 90  ? 7.778   -6.503  -11.668 1.00 0.00 ? 90  GLN A CA   3  
ATOM 4781  C C    . GLN A 1 90  ? 7.743   -5.847  -10.287 1.00 0.00 ? 90  GLN A C    3  
ATOM 4782  O O    . GLN A 1 90  ? 8.407   -4.862  -10.034 1.00 0.00 ? 90  GLN A O    3  
ATOM 4783  C CB   . GLN A 1 90  ? 6.917   -5.698  -12.646 1.00 0.00 ? 90  GLN A CB   3  
ATOM 4784  C CG   . GLN A 1 90  ? 7.673   -4.439  -13.079 1.00 0.00 ? 90  GLN A CG   3  
ATOM 4785  C CD   . GLN A 1 90  ? 7.635   -4.321  -14.604 1.00 0.00 ? 90  GLN A CD   3  
ATOM 4786  O OE1  . GLN A 1 90  ? 7.869   -5.284  -15.305 1.00 0.00 ? 90  GLN A OE1  3  
ATOM 4787  N NE2  . GLN A 1 90  ? 7.348   -3.171  -15.150 1.00 0.00 ? 90  GLN A NE2  3  
ATOM 4788  H H    . GLN A 1 90  ? 6.360   -8.101  -11.926 1.00 0.00 ? 90  GLN A H    3  
ATOM 4789  H HA   . GLN A 1 90  ? 8.796   -6.547  -12.026 1.00 0.00 ? 90  GLN A HA   3  
ATOM 4790  H HB2  . GLN A 1 90  ? 6.697   -6.303  -13.514 1.00 0.00 ? 90  GLN A HB2  3  
ATOM 4791  H HB3  . GLN A 1 90  ? 5.995   -5.413  -12.163 1.00 0.00 ? 90  GLN A HB3  3  
ATOM 4792  H HG2  . GLN A 1 90  ? 7.207   -3.571  -12.637 1.00 0.00 ? 90  GLN A HG2  3  
ATOM 4793  H HG3  . GLN A 1 90  ? 8.699   -4.504  -12.751 1.00 0.00 ? 90  GLN A HG3  3  
ATOM 4794  H HE21 . GLN A 1 90  ? 7.160   -2.393  -14.584 1.00 0.00 ? 90  GLN A HE21 3  
ATOM 4795  H HE22 . GLN A 1 90  ? 7.320   -3.085  -16.125 1.00 0.00 ? 90  GLN A HE22 3  
ATOM 4796  N N    . ALA A 1 91  ? 6.967   -6.400  -9.390  1.00 0.00 ? 91  ALA A N    3  
ATOM 4797  C CA   . ALA A 1 91  ? 6.877   -5.828  -8.019  1.00 0.00 ? 91  ALA A CA   3  
ATOM 4798  C C    . ALA A 1 91  ? 8.148   -6.154  -7.235  1.00 0.00 ? 91  ALA A C    3  
ATOM 4799  O O    . ALA A 1 91  ? 8.476   -5.498  -6.267  1.00 0.00 ? 91  ALA A O    3  
ATOM 4800  C CB   . ALA A 1 91  ? 5.663   -6.409  -7.300  1.00 0.00 ? 91  ALA A CB   3  
ATOM 4801  H H    . ALA A 1 91  ? 6.443   -7.193  -9.620  1.00 0.00 ? 91  ALA A H    3  
ATOM 4802  H HA   . ALA A 1 91  ? 6.766   -4.768  -8.085  1.00 0.00 ? 91  ALA A HA   3  
ATOM 4803  H HB1  . ALA A 1 91  ? 5.782   -7.475  -7.196  1.00 0.00 ? 91  ALA A HB1  3  
ATOM 4804  H HB2  . ALA A 1 91  ? 4.774   -6.198  -7.876  1.00 0.00 ? 91  ALA A HB2  3  
ATOM 4805  H HB3  . ALA A 1 91  ? 5.573   -5.956  -6.323  1.00 0.00 ? 91  ALA A HB3  3  
ATOM 4806  N N    . PHE A 1 92  ? 8.872   -7.157  -7.647  1.00 0.00 ? 92  PHE A N    3  
ATOM 4807  C CA   . PHE A 1 92  ? 10.124  -7.513  -6.921  1.00 0.00 ? 92  PHE A CA   3  
ATOM 4808  C C    . PHE A 1 92  ? 11.301  -6.751  -7.533  1.00 0.00 ? 92  PHE A C    3  
ATOM 4809  O O    . PHE A 1 92  ? 12.318  -6.550  -6.900  1.00 0.00 ? 92  PHE A O    3  
ATOM 4810  C CB   . PHE A 1 92  ? 10.372  -9.018  -7.034  1.00 0.00 ? 92  PHE A CB   3  
ATOM 4811  C CG   . PHE A 1 92  ? 9.293   -9.763  -6.285  1.00 0.00 ? 92  PHE A CG   3  
ATOM 4812  C CD1  . PHE A 1 92  ? 8.857   -9.298  -5.038  1.00 0.00 ? 92  PHE A CD1  3  
ATOM 4813  C CD2  . PHE A 1 92  ? 8.727   -10.917 -6.839  1.00 0.00 ? 92  PHE A CD2  3  
ATOM 4814  C CE1  . PHE A 1 92  ? 7.855   -9.988  -4.345  1.00 0.00 ? 92  PHE A CE1  3  
ATOM 4815  C CE2  . PHE A 1 92  ? 7.725   -11.607 -6.146  1.00 0.00 ? 92  PHE A CE2  3  
ATOM 4816  C CZ   . PHE A 1 92  ? 7.290   -11.143 -4.898  1.00 0.00 ? 92  PHE A CZ   3  
ATOM 4817  H H    . PHE A 1 92  ? 8.596   -7.674  -8.432  1.00 0.00 ? 92  PHE A H    3  
ATOM 4818  H HA   . PHE A 1 92  ? 10.025  -7.240  -5.881  1.00 0.00 ? 92  PHE A HA   3  
ATOM 4819  H HB2  . PHE A 1 92  ? 10.355  -9.309  -8.074  1.00 0.00 ? 92  PHE A HB2  3  
ATOM 4820  H HB3  . PHE A 1 92  ? 11.335  -9.258  -6.608  1.00 0.00 ? 92  PHE A HB3  3  
ATOM 4821  H HD1  . PHE A 1 92  ? 9.294   -8.407  -4.609  1.00 0.00 ? 92  PHE A HD1  3  
ATOM 4822  H HD2  . PHE A 1 92  ? 9.063   -11.275 -7.800  1.00 0.00 ? 92  PHE A HD2  3  
ATOM 4823  H HE1  . PHE A 1 92  ? 7.520   -9.630  -3.383  1.00 0.00 ? 92  PHE A HE1  3  
ATOM 4824  H HE2  . PHE A 1 92  ? 7.289   -12.497 -6.573  1.00 0.00 ? 92  PHE A HE2  3  
ATOM 4825  H HZ   . PHE A 1 92  ? 6.517   -11.676 -4.364  1.00 0.00 ? 92  PHE A HZ   3  
ATOM 4826  N N    . ARG A 1 93  ? 11.172  -6.323  -8.759  1.00 0.00 ? 93  ARG A N    3  
ATOM 4827  C CA   . ARG A 1 93  ? 12.286  -5.574  -9.406  1.00 0.00 ? 93  ARG A CA   3  
ATOM 4828  C C    . ARG A 1 93  ? 12.467  -4.227  -8.701  1.00 0.00 ? 93  ARG A C    3  
ATOM 4829  O O    . ARG A 1 93  ? 11.576  -3.402  -8.680  1.00 0.00 ? 93  ARG A O    3  
ATOM 4830  C CB   . ARG A 1 93  ? 11.953  -5.336  -10.881 1.00 0.00 ? 93  ARG A CB   3  
ATOM 4831  C CG   . ARG A 1 93  ? 12.030  -6.662  -11.641 1.00 0.00 ? 93  ARG A CG   3  
ATOM 4832  C CD   . ARG A 1 93  ? 12.383  -6.392  -13.106 1.00 0.00 ? 93  ARG A CD   3  
ATOM 4833  N NE   . ARG A 1 93  ? 13.099  -7.570  -13.672 1.00 0.00 ? 93  ARG A NE   3  
ATOM 4834  C CZ   . ARG A 1 93  ? 14.030  -7.399  -14.573 1.00 0.00 ? 93  ARG A CZ   3  
ATOM 4835  N NH1  . ARG A 1 93  ? 13.863  -6.524  -15.528 1.00 0.00 ? 93  ARG A NH1  3  
ATOM 4836  N NH2  . ARG A 1 93  ? 15.127  -8.104  -14.518 1.00 0.00 ? 93  ARG A NH2  3  
ATOM 4837  H H    . ARG A 1 93  ? 10.344  -6.494  -9.253  1.00 0.00 ? 93  ARG A H    3  
ATOM 4838  H HA   . ARG A 1 93  ? 13.198  -6.146  -9.330  1.00 0.00 ? 93  ARG A HA   3  
ATOM 4839  H HB2  . ARG A 1 93  ? 10.954  -4.929  -10.962 1.00 0.00 ? 93  ARG A HB2  3  
ATOM 4840  H HB3  . ARG A 1 93  ? 12.661  -4.639  -11.302 1.00 0.00 ? 93  ARG A HB3  3  
ATOM 4841  H HG2  . ARG A 1 93  ? 12.791  -7.288  -11.197 1.00 0.00 ? 93  ARG A HG2  3  
ATOM 4842  H HG3  . ARG A 1 93  ? 11.076  -7.162  -11.590 1.00 0.00 ? 93  ARG A HG3  3  
ATOM 4843  H HD2  . ARG A 1 93  ? 11.477  -6.217  -13.668 1.00 0.00 ? 93  ARG A HD2  3  
ATOM 4844  H HD3  . ARG A 1 93  ? 13.019  -5.520  -13.169 1.00 0.00 ? 93  ARG A HD3  3  
ATOM 4845  H HE   . ARG A 1 93  ? 12.870  -8.473  -13.370 1.00 0.00 ? 93  ARG A HE   3  
ATOM 4846  H HH11 . ARG A 1 93  ? 13.022  -5.986  -15.572 1.00 0.00 ? 93  ARG A HH11 3  
ATOM 4847  H HH12 . ARG A 1 93  ? 14.577  -6.394  -16.216 1.00 0.00 ? 93  ARG A HH12 3  
ATOM 4848  H HH21 . ARG A 1 93  ? 15.254  -8.776  -13.788 1.00 0.00 ? 93  ARG A HH21 3  
ATOM 4849  H HH22 . ARG A 1 93  ? 15.840  -7.974  -15.207 1.00 0.00 ? 93  ARG A HH22 3  
ATOM 4850  N N    . LYS A 1 94  ? 13.613  -4.000  -8.122  1.00 0.00 ? 94  LYS A N    3  
ATOM 4851  C CA   . LYS A 1 94  ? 13.848  -2.710  -7.418  1.00 0.00 ? 94  LYS A CA   3  
ATOM 4852  C C    . LYS A 1 94  ? 14.380  -1.676  -8.412  1.00 0.00 ? 94  LYS A C    3  
ATOM 4853  O O    . LYS A 1 94  ? 14.641  -1.978  -9.559  1.00 0.00 ? 94  LYS A O    3  
ATOM 4854  C CB   . LYS A 1 94  ? 14.873  -2.916  -6.302  1.00 0.00 ? 94  LYS A CB   3  
ATOM 4855  C CG   . LYS A 1 94  ? 14.678  -4.298  -5.676  1.00 0.00 ? 94  LYS A CG   3  
ATOM 4856  C CD   . LYS A 1 94  ? 15.599  -4.444  -4.463  1.00 0.00 ? 94  LYS A CD   3  
ATOM 4857  C CE   . LYS A 1 94  ? 14.856  -5.171  -3.341  1.00 0.00 ? 94  LYS A CE   3  
ATOM 4858  N NZ   . LYS A 1 94  ? 15.479  -4.831  -2.031  1.00 0.00 ? 94  LYS A NZ   3  
ATOM 4859  H H    . LYS A 1 94  ? 14.319  -4.680  -8.149  1.00 0.00 ? 94  LYS A H    3  
ATOM 4860  H HA   . LYS A 1 94  ? 12.920  -2.356  -6.994  1.00 0.00 ? 94  LYS A HA   3  
ATOM 4861  H HB2  . LYS A 1 94  ? 15.870  -2.843  -6.711  1.00 0.00 ? 94  LYS A HB2  3  
ATOM 4862  H HB3  . LYS A 1 94  ? 14.738  -2.158  -5.544  1.00 0.00 ? 94  LYS A HB3  3  
ATOM 4863  H HG2  . LYS A 1 94  ? 13.650  -4.410  -5.363  1.00 0.00 ? 94  LYS A HG2  3  
ATOM 4864  H HG3  . LYS A 1 94  ? 14.918  -5.061  -6.402  1.00 0.00 ? 94  LYS A HG3  3  
ATOM 4865  H HD2  . LYS A 1 94  ? 16.475  -5.010  -4.744  1.00 0.00 ? 94  LYS A HD2  3  
ATOM 4866  H HD3  . LYS A 1 94  ? 15.897  -3.465  -4.119  1.00 0.00 ? 94  LYS A HD3  3  
ATOM 4867  H HE2  . LYS A 1 94  ? 13.820  -4.865  -3.337  1.00 0.00 ? 94  LYS A HE2  3  
ATOM 4868  H HE3  . LYS A 1 94  ? 14.916  -6.237  -3.502  1.00 0.00 ? 94  LYS A HE3  3  
ATOM 4869  H HZ1  . LYS A 1 94  ? 16.484  -4.605  -2.173  1.00 0.00 ? 94  LYS A HZ1  3  
ATOM 4870  H HZ2  . LYS A 1 94  ? 15.392  -5.643  -1.385  1.00 0.00 ? 94  LYS A HZ2  3  
ATOM 4871  H HZ3  . LYS A 1 94  ? 14.995  -4.008  -1.620  1.00 0.00 ? 94  LYS A HZ3  3  
ATOM 4872  N N    . ARG A 1 95  ? 14.547  -0.457  -7.978  1.00 0.00 ? 95  ARG A N    3  
ATOM 4873  C CA   . ARG A 1 95  ? 15.065  0.596   -8.892  1.00 0.00 ? 95  ARG A CA   3  
ATOM 4874  C C    . ARG A 1 95  ? 16.078  1.459   -8.140  1.00 0.00 ? 95  ARG A C    3  
ATOM 4875  O O    . ARG A 1 95  ? 16.102  2.667   -8.269  1.00 0.00 ? 95  ARG A O    3  
ATOM 4876  C CB   . ARG A 1 95  ? 13.904  1.465   -9.382  1.00 0.00 ? 95  ARG A CB   3  
ATOM 4877  C CG   . ARG A 1 95  ? 12.854  0.574   -10.049 1.00 0.00 ? 95  ARG A CG   3  
ATOM 4878  C CD   . ARG A 1 95  ? 11.637  1.416   -10.435 1.00 0.00 ? 95  ARG A CD   3  
ATOM 4879  N NE   . ARG A 1 95  ? 12.078  2.593   -11.237 1.00 0.00 ? 95  ARG A NE   3  
ATOM 4880  C CZ   . ARG A 1 95  ? 13.038  2.465   -12.112 1.00 0.00 ? 95  ARG A CZ   3  
ATOM 4881  N NH1  . ARG A 1 95  ? 13.103  1.397   -12.858 1.00 0.00 ? 95  ARG A NH1  3  
ATOM 4882  N NH2  . ARG A 1 95  ? 13.934  3.406   -12.239 1.00 0.00 ? 95  ARG A NH2  3  
ATOM 4883  H H    . ARG A 1 95  ? 14.333  -0.236  -7.047  1.00 0.00 ? 95  ARG A H    3  
ATOM 4884  H HA   . ARG A 1 95  ? 15.550  0.131   -9.738  1.00 0.00 ? 95  ARG A HA   3  
ATOM 4885  H HB2  . ARG A 1 95  ? 13.462  1.982   -8.543  1.00 0.00 ? 95  ARG A HB2  3  
ATOM 4886  H HB3  . ARG A 1 95  ? 14.270  2.185   -10.099 1.00 0.00 ? 95  ARG A HB3  3  
ATOM 4887  H HG2  . ARG A 1 95  ? 13.276  0.122   -10.935 1.00 0.00 ? 95  ARG A HG2  3  
ATOM 4888  H HG3  . ARG A 1 95  ? 12.549  -0.199  -9.360  1.00 0.00 ? 95  ARG A HG3  3  
ATOM 4889  H HD2  . ARG A 1 95  ? 10.955  0.817   -11.021 1.00 0.00 ? 95  ARG A HD2  3  
ATOM 4890  H HD3  . ARG A 1 95  ? 11.138  1.758   -9.540  1.00 0.00 ? 95  ARG A HD3  3  
ATOM 4891  H HE   . ARG A 1 95  ? 11.648  3.463   -11.106 1.00 0.00 ? 95  ARG A HE   3  
ATOM 4892  H HH11 . ARG A 1 95  ? 12.416  0.676   -12.759 1.00 0.00 ? 95  ARG A HH11 3  
ATOM 4893  H HH12 . ARG A 1 95  ? 13.837  1.299   -13.529 1.00 0.00 ? 95  ARG A HH12 3  
ATOM 4894  H HH21 . ARG A 1 95  ? 13.884  4.223   -11.667 1.00 0.00 ? 95  ARG A HH21 3  
ATOM 4895  H HH22 . ARG A 1 95  ? 14.669  3.308   -12.910 1.00 0.00 ? 95  ARG A HH22 3  
ATOM 4896  N N    . ARG A 1 96  ? 16.915  0.841   -7.354  1.00 0.00 ? 96  ARG A N    3  
ATOM 4897  C CA   . ARG A 1 96  ? 17.934  1.608   -6.587  1.00 0.00 ? 96  ARG A CA   3  
ATOM 4898  C C    . ARG A 1 96  ? 18.770  0.635   -5.753  1.00 0.00 ? 96  ARG A C    3  
ATOM 4899  O O    . ARG A 1 96  ? 18.330  -0.448  -5.422  1.00 0.00 ? 96  ARG A O    3  
ATOM 4900  C CB   . ARG A 1 96  ? 17.233  2.606   -5.662  1.00 0.00 ? 96  ARG A CB   3  
ATOM 4901  C CG   . ARG A 1 96  ? 16.284  1.856   -4.725  1.00 0.00 ? 96  ARG A CG   3  
ATOM 4902  C CD   . ARG A 1 96  ? 16.677  2.126   -3.270  1.00 0.00 ? 96  ARG A CD   3  
ATOM 4903  N NE   . ARG A 1 96  ? 16.161  1.027   -2.405  1.00 0.00 ? 96  ARG A NE   3  
ATOM 4904  C CZ   . ARG A 1 96  ? 16.283  1.102   -1.106  1.00 0.00 ? 96  ARG A CZ   3  
ATOM 4905  N NH1  . ARG A 1 96  ? 16.901  2.117   -0.561  1.00 0.00 ? 96  ARG A NH1  3  
ATOM 4906  N NH2  . ARG A 1 96  ? 15.789  0.159   -0.352  1.00 0.00 ? 96  ARG A NH2  3  
ATOM 4907  H H    . ARG A 1 96  ? 16.874  -0.135  -7.271  1.00 0.00 ? 96  ARG A H    3  
ATOM 4908  H HA   . ARG A 1 96  ? 18.577  2.140   -7.272  1.00 0.00 ? 96  ARG A HA   3  
ATOM 4909  H HB2  . ARG A 1 96  ? 17.973  3.136   -5.078  1.00 0.00 ? 96  ARG A HB2  3  
ATOM 4910  H HB3  . ARG A 1 96  ? 16.670  3.311   -6.253  1.00 0.00 ? 96  ARG A HB3  3  
ATOM 4911  H HG2  . ARG A 1 96  ? 15.272  2.195   -4.895  1.00 0.00 ? 96  ARG A HG2  3  
ATOM 4912  H HG3  . ARG A 1 96  ? 16.346  0.796   -4.923  1.00 0.00 ? 96  ARG A HG3  3  
ATOM 4913  H HD2  . ARG A 1 96  ? 17.752  2.172   -3.190  1.00 0.00 ? 96  ARG A HD2  3  
ATOM 4914  H HD3  . ARG A 1 96  ? 16.251  3.066   -2.952  1.00 0.00 ? 96  ARG A HD3  3  
ATOM 4915  H HE   . ARG A 1 96  ? 15.727  0.248   -2.811  1.00 0.00 ? 96  ARG A HE   3  
ATOM 4916  H HH11 . ARG A 1 96  ? 17.281  2.841   -1.137  1.00 0.00 ? 96  ARG A HH11 3  
ATOM 4917  H HH12 . ARG A 1 96  ? 16.993  2.170   0.433   1.00 0.00 ? 96  ARG A HH12 3  
ATOM 4918  H HH21 . ARG A 1 96  ? 15.318  -0.619  -0.768  1.00 0.00 ? 96  ARG A HH21 3  
ATOM 4919  H HH22 . ARG A 1 96  ? 15.882  0.214   0.643   1.00 0.00 ? 96  ARG A HH22 3  
ATOM 4920  N N    . GLN A 1 97  ? 19.972  1.009   -5.412  1.00 0.00 ? 97  GLN A N    3  
ATOM 4921  C CA   . GLN A 1 97  ? 20.832  0.099   -4.603  1.00 0.00 ? 97  GLN A CA   3  
ATOM 4922  C C    . GLN A 1 97  ? 21.484  0.886   -3.465  1.00 0.00 ? 97  GLN A C    3  
ATOM 4923  O O    . GLN A 1 97  ? 21.804  2.050   -3.606  1.00 0.00 ? 97  GLN A O    3  
ATOM 4924  C CB   . GLN A 1 97  ? 21.924  -0.497  -5.495  1.00 0.00 ? 97  GLN A CB   3  
ATOM 4925  C CG   . GLN A 1 97  ? 22.617  0.624   -6.272  1.00 0.00 ? 97  GLN A CG   3  
ATOM 4926  C CD   . GLN A 1 97  ? 23.928  0.102   -6.860  1.00 0.00 ? 97  GLN A CD   3  
ATOM 4927  O OE1  . GLN A 1 97  ? 24.919  -0.008  -6.164  1.00 0.00 ? 97  GLN A OE1  3  
ATOM 4928  N NE2  . GLN A 1 97  ? 23.977  -0.228  -8.121  1.00 0.00 ? 97  GLN A NE2  3  
ATOM 4929  H H    . GLN A 1 97  ? 20.311  1.885   -5.691  1.00 0.00 ? 97  GLN A H    3  
ATOM 4930  H HA   . GLN A 1 97  ? 20.230  -0.697  -4.192  1.00 0.00 ? 97  GLN A HA   3  
ATOM 4931  H HB2  . GLN A 1 97  ? 22.648  -1.012  -4.881  1.00 0.00 ? 97  GLN A HB2  3  
ATOM 4932  H HB3  . GLN A 1 97  ? 21.480  -1.193  -6.191  1.00 0.00 ? 97  GLN A HB3  3  
ATOM 4933  H HG2  . GLN A 1 97  ? 21.972  0.962   -7.070  1.00 0.00 ? 97  GLN A HG2  3  
ATOM 4934  H HG3  . GLN A 1 97  ? 22.826  1.448   -5.604  1.00 0.00 ? 97  GLN A HG3  3  
ATOM 4935  H HE21 . GLN A 1 97  ? 23.178  -0.141  -8.682  1.00 0.00 ? 97  GLN A HE21 3  
ATOM 4936  H HE22 . GLN A 1 97  ? 24.813  -0.565  -8.508  1.00 0.00 ? 97  GLN A HE22 3  
ATOM 4937  N N    . ARG A 1 98  ? 21.685  0.260   -2.337  1.00 0.00 ? 98  ARG A N    3  
ATOM 4938  C CA   . ARG A 1 98  ? 22.318  0.971   -1.193  1.00 0.00 ? 98  ARG A CA   3  
ATOM 4939  C C    . ARG A 1 98  ? 23.752  1.351   -1.566  1.00 0.00 ? 98  ARG A C    3  
ATOM 4940  O O    . ARG A 1 98  ? 24.605  0.502   -1.734  1.00 0.00 ? 98  ARG A O    3  
ATOM 4941  C CB   . ARG A 1 98  ? 22.335  0.054   0.031   1.00 0.00 ? 98  ARG A CB   3  
ATOM 4942  C CG   . ARG A 1 98  ? 20.954  0.054   0.689   1.00 0.00 ? 98  ARG A CG   3  
ATOM 4943  C CD   . ARG A 1 98  ? 21.113  0.029   2.209   1.00 0.00 ? 98  ARG A CD   3  
ATOM 4944  N NE   . ARG A 1 98  ? 21.736  1.304   2.664   1.00 0.00 ? 98  ARG A NE   3  
ATOM 4945  C CZ   . ARG A 1 98  ? 20.983  2.288   3.070   1.00 0.00 ? 98  ARG A CZ   3  
ATOM 4946  N NH1  . ARG A 1 98  ? 20.034  2.068   3.941   1.00 0.00 ? 98  ARG A NH1  3  
ATOM 4947  N NH2  . ARG A 1 98  ? 21.178  3.494   2.608   1.00 0.00 ? 98  ARG A NH2  3  
ATOM 4948  H H    . ARG A 1 98  ? 21.421  -0.679  -2.245  1.00 0.00 ? 98  ARG A H    3  
ATOM 4949  H HA   . ARG A 1 98  ? 21.755  1.865   -0.966  1.00 0.00 ? 98  ARG A HA   3  
ATOM 4950  H HB2  . ARG A 1 98  ? 22.589  -0.950  -0.277  1.00 0.00 ? 98  ARG A HB2  3  
ATOM 4951  H HB3  . ARG A 1 98  ? 23.069  0.410   0.738   1.00 0.00 ? 98  ARG A HB3  3  
ATOM 4952  H HG2  . ARG A 1 98  ? 20.418  0.945   0.397   1.00 0.00 ? 98  ARG A HG2  3  
ATOM 4953  H HG3  . ARG A 1 98  ? 20.403  -0.819  0.371   1.00 0.00 ? 98  ARG A HG3  3  
ATOM 4954  H HD2  . ARG A 1 98  ? 20.143  -0.082  2.671   1.00 0.00 ? 98  ARG A HD2  3  
ATOM 4955  H HD3  . ARG A 1 98  ? 21.743  -0.801  2.492   1.00 0.00 ? 98  ARG A HD3  3  
ATOM 4956  H HE   . ARG A 1 98  ? 22.711  1.402   2.657   1.00 0.00 ? 98  ARG A HE   3  
ATOM 4957  H HH11 . ARG A 1 98  ? 19.885  1.144   4.294   1.00 0.00 ? 98  ARG A HH11 3  
ATOM 4958  H HH12 . ARG A 1 98  ? 19.455  2.822   4.252   1.00 0.00 ? 98  ARG A HH12 3  
ATOM 4959  H HH21 . ARG A 1 98  ? 21.905  3.662   1.942   1.00 0.00 ? 98  ARG A HH21 3  
ATOM 4960  H HH22 . ARG A 1 98  ? 20.601  4.249   2.920   1.00 0.00 ? 98  ARG A HH22 3  
ATOM 4961  N N    . GLY A 1 99  ? 24.023  2.620   -1.702  1.00 0.00 ? 99  GLY A N    3  
ATOM 4962  C CA   . GLY A 1 99  ? 25.401  3.053   -2.070  1.00 0.00 ? 99  GLY A CA   3  
ATOM 4963  C C    . GLY A 1 99  ? 26.266  3.135   -0.811  1.00 0.00 ? 99  GLY A C    3  
ATOM 4964  O O    . GLY A 1 99  ? 26.682  4.201   -0.401  1.00 0.00 ? 99  GLY A O    3  
ATOM 4965  H H    . GLY A 1 99  ? 23.320  3.289   -1.566  1.00 0.00 ? 99  GLY A H    3  
ATOM 4966  H HA2  . GLY A 1 99  ? 25.832  2.337   -2.755  1.00 0.00 ? 99  GLY A HA2  3  
ATOM 4967  H HA3  . GLY A 1 99  ? 25.360  4.024   -2.542  1.00 0.00 ? 99  GLY A HA3  3  
ATOM 4968  N N    . VAL A 1 100 ? 26.546  2.019   -0.195  1.00 0.00 ? 100 VAL A N    3  
ATOM 4969  C CA   . VAL A 1 100 ? 27.389  2.038   1.033   1.00 0.00 ? 100 VAL A CA   3  
ATOM 4970  C C    . VAL A 1 100 ? 28.789  1.525   0.695   1.00 0.00 ? 100 VAL A C    3  
ATOM 4971  O O    . VAL A 1 100 ? 29.754  1.841   1.360   1.00 0.00 ? 100 VAL A O    3  
ATOM 4972  C CB   . VAL A 1 100 ? 26.758  1.139   2.098   1.00 0.00 ? 100 VAL A CB   3  
ATOM 4973  C CG1  . VAL A 1 100 ? 27.614  1.170   3.366   1.00 0.00 ? 100 VAL A CG1  3  
ATOM 4974  C CG2  . VAL A 1 100 ? 25.352  1.646   2.423   1.00 0.00 ? 100 VAL A CG2  3  
ATOM 4975  H H    . VAL A 1 100 ? 26.205  1.169   -0.542  1.00 0.00 ? 100 VAL A H    3  
ATOM 4976  H HA   . VAL A 1 100 ? 27.456  3.048   1.408   1.00 0.00 ? 100 VAL A HA   3  
ATOM 4977  H HB   . VAL A 1 100 ? 26.702  0.126   1.727   1.00 0.00 ? 100 VAL A HB   3  
ATOM 4978  H HG11 . VAL A 1 100 ? 26.974  1.088   4.233   1.00 0.00 ? 100 VAL A HG11 3  
ATOM 4979  H HG12 . VAL A 1 100 ? 28.160  2.101   3.409   1.00 0.00 ? 100 VAL A HG12 3  
ATOM 4980  H HG13 . VAL A 1 100 ? 28.310  0.345   3.352   1.00 0.00 ? 100 VAL A HG13 3  
ATOM 4981  H HG21 . VAL A 1 100 ? 25.351  2.725   2.430   1.00 0.00 ? 100 VAL A HG21 3  
ATOM 4982  H HG22 . VAL A 1 100 ? 25.053  1.278   3.392   1.00 0.00 ? 100 VAL A HG22 3  
ATOM 4983  H HG23 . VAL A 1 100 ? 24.660  1.291   1.674   1.00 0.00 ? 100 VAL A HG23 3  
ATOM 4984  N N    . SER A 1 101 ? 28.907  0.734   -0.337  1.00 0.00 ? 101 SER A N    3  
ATOM 4985  C CA   . SER A 1 101 ? 30.245  0.203   -0.718  1.00 0.00 ? 101 SER A CA   3  
ATOM 4986  C C    . SER A 1 101 ? 31.169  1.368   -1.083  1.00 0.00 ? 101 SER A C    3  
ATOM 4987  O O    . SER A 1 101 ? 32.372  1.169   -1.072  1.00 0.00 ? 101 SER A O    3  
ATOM 4988  C CB   . SER A 1 101 ? 30.102  -0.730  -1.921  1.00 0.00 ? 101 SER A CB   3  
ATOM 4989  O OG   . SER A 1 101 ? 28.761  -1.199  -1.993  1.00 0.00 ? 101 SER A OG   3  
ATOM 4990  O OXT  . SER A 1 101 ? 30.656  2.439   -1.365  1.00 0.00 ? 101 SER A OXT  3  
ATOM 4991  H H    . SER A 1 101 ? 28.116  0.492   -0.863  1.00 0.00 ? 101 SER A H    3  
ATOM 4992  H HA   . SER A 1 101 ? 30.666  -0.342  0.113   1.00 0.00 ? 101 SER A HA   3  
ATOM 4993  H HB2  . SER A 1 101 ? 30.339  -0.195  -2.825  1.00 0.00 ? 101 SER A HB2  3  
ATOM 4994  H HB3  . SER A 1 101 ? 30.781  -1.565  -1.809  1.00 0.00 ? 101 SER A HB3  3  
ATOM 4995  H HG   . SER A 1 101 ? 28.248  -0.556  -2.490  1.00 0.00 ? 101 SER A HG   3  
ATOM 4996  N N    . GLU A 1 1   ? 13.300  6.489   -8.478  1.00 0.00 ? 1   GLU A N    4  
ATOM 4997  C CA   . GLU A 1 1   ? 14.318  7.267   -7.717  1.00 0.00 ? 1   GLU A CA   4  
ATOM 4998  C C    . GLU A 1 1   ? 13.750  8.644   -7.354  1.00 0.00 ? 1   GLU A C    4  
ATOM 4999  O O    . GLU A 1 1   ? 12.661  9.003   -7.756  1.00 0.00 ? 1   GLU A O    4  
ATOM 5000  C CB   . GLU A 1 1   ? 15.573  7.438   -8.576  1.00 0.00 ? 1   GLU A CB   4  
ATOM 5001  C CG   . GLU A 1 1   ? 16.051  6.064   -9.055  1.00 0.00 ? 1   GLU A CG   4  
ATOM 5002  C CD   . GLU A 1 1   ? 17.557  5.929   -8.818  1.00 0.00 ? 1   GLU A CD   4  
ATOM 5003  O OE1  . GLU A 1 1   ? 18.125  6.821   -8.210  1.00 0.00 ? 1   GLU A OE1  4  
ATOM 5004  O OE2  . GLU A 1 1   ? 18.117  4.934   -9.249  1.00 0.00 ? 1   GLU A OE2  4  
ATOM 5005  H H1   . GLU A 1 1   ? 13.021  5.651   -7.929  1.00 0.00 ? 1   GLU A H1   4  
ATOM 5006  H H2   . GLU A 1 1   ? 13.703  6.189   -9.389  1.00 0.00 ? 1   GLU A H2   4  
ATOM 5007  H H3   . GLU A 1 1   ? 12.464  7.083   -8.648  1.00 0.00 ? 1   GLU A H3   4  
ATOM 5008  H HA   . GLU A 1 1   ? 14.573  6.736   -6.812  1.00 0.00 ? 1   GLU A HA   4  
ATOM 5009  H HB2  . GLU A 1 1   ? 15.343  8.058   -9.430  1.00 0.00 ? 1   GLU A HB2  4  
ATOM 5010  H HB3  . GLU A 1 1   ? 16.350  7.904   -7.990  1.00 0.00 ? 1   GLU A HB3  4  
ATOM 5011  H HG2  . GLU A 1 1   ? 15.530  5.291   -8.506  1.00 0.00 ? 1   GLU A HG2  4  
ATOM 5012  H HG3  . GLU A 1 1   ? 15.843  5.958   -10.109 1.00 0.00 ? 1   GLU A HG3  4  
ATOM 5013  N N    . SER A 1 2   ? 14.478  9.415   -6.590  1.00 0.00 ? 2   SER A N    4  
ATOM 5014  C CA   . SER A 1 2   ? 13.981  10.763  -6.193  1.00 0.00 ? 2   SER A CA   4  
ATOM 5015  C C    . SER A 1 2   ? 12.848  10.601  -5.168  1.00 0.00 ? 2   SER A C    4  
ATOM 5016  O O    . SER A 1 2   ? 13.020  9.960   -4.151  1.00 0.00 ? 2   SER A O    4  
ATOM 5017  C CB   . SER A 1 2   ? 13.479  11.509  -7.432  1.00 0.00 ? 2   SER A CB   4  
ATOM 5018  O OG   . SER A 1 2   ? 13.348  12.892  -7.122  1.00 0.00 ? 2   SER A OG   4  
ATOM 5019  H H    . SER A 1 2   ? 15.352  9.103   -6.274  1.00 0.00 ? 2   SER A H    4  
ATOM 5020  H HA   . SER A 1 2   ? 14.790  11.321  -5.742  1.00 0.00 ? 2   SER A HA   4  
ATOM 5021  H HB2  . SER A 1 2   ? 14.185  11.392  -8.237  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5022  H HB3  . SER A 1 2   ? 12.521  11.104  -7.733  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5023  H HG   . SER A 1 2   ? 12.751  13.284  -7.762  1.00 0.00 ? 2   SER A HG   4  
ATOM 5024  N N    . LYS A 1 3   ? 11.694  11.171  -5.414  1.00 0.00 ? 3   LYS A N    4  
ATOM 5025  C CA   . LYS A 1 3   ? 10.583  11.031  -4.432  1.00 0.00 ? 3   LYS A CA   4  
ATOM 5026  C C    . LYS A 1 3   ? 9.921   9.659   -4.576  1.00 0.00 ? 3   LYS A C    4  
ATOM 5027  O O    . LYS A 1 3   ? 9.830   8.917   -3.620  1.00 0.00 ? 3   LYS A O    4  
ATOM 5028  C CB   . LYS A 1 3   ? 9.538   12.127  -4.657  1.00 0.00 ? 3   LYS A CB   4  
ATOM 5029  C CG   . LYS A 1 3   ? 9.627   13.159  -3.531  1.00 0.00 ? 3   LYS A CG   4  
ATOM 5030  C CD   . LYS A 1 3   ? 9.958   14.533  -4.121  1.00 0.00 ? 3   LYS A CD   4  
ATOM 5031  C CE   . LYS A 1 3   ? 8.734   15.078  -4.858  1.00 0.00 ? 3   LYS A CE   4  
ATOM 5032  N NZ   . LYS A 1 3   ? 9.172   16.065  -5.886  1.00 0.00 ? 3   LYS A NZ   4  
ATOM 5033  H H    . LYS A 1 3   ? 11.561  11.692  -6.228  1.00 0.00 ? 3   LYS A H    4  
ATOM 5034  H HA   . LYS A 1 3   ? 10.981  11.123  -3.450  1.00 0.00 ? 3   LYS A HA   4  
ATOM 5035  H HB2  . LYS A 1 3   ? 9.719   12.607  -5.606  1.00 0.00 ? 3   LYS A HB2  4  
ATOM 5036  H HB3  . LYS A 1 3   ? 8.552   11.687  -4.660  1.00 0.00 ? 3   LYS A HB3  4  
ATOM 5037  H HG2  . LYS A 1 3   ? 8.680   13.208  -3.013  1.00 0.00 ? 3   LYS A HG2  4  
ATOM 5038  H HG3  . LYS A 1 3   ? 10.402  12.870  -2.838  1.00 0.00 ? 3   LYS A HG3  4  
ATOM 5039  H HD2  . LYS A 1 3   ? 10.230  15.209  -3.323  1.00 0.00 ? 3   LYS A HD2  4  
ATOM 5040  H HD3  . LYS A 1 3   ? 10.782  14.439  -4.812  1.00 0.00 ? 3   LYS A HD3  4  
ATOM 5041  H HE2  . LYS A 1 3   ? 8.212   14.265  -5.341  1.00 0.00 ? 3   LYS A HE2  4  
ATOM 5042  H HE3  . LYS A 1 3   ? 8.074   15.561  -4.153  1.00 0.00 ? 3   LYS A HE3  4  
ATOM 5043  H HZ1  . LYS A 1 3   ? 8.812   17.009  -5.636  1.00 0.00 ? 3   LYS A HZ1  4  
ATOM 5044  H HZ2  . LYS A 1 3   ? 8.796   15.785  -6.816  1.00 0.00 ? 3   LYS A HZ2  4  
ATOM 5045  H HZ3  . LYS A 1 3   ? 10.210  16.091  -5.924  1.00 0.00 ? 3   LYS A HZ3  4  
ATOM 5046  N N    . PRO A 1 4   ? 9.481   9.363   -5.766  1.00 0.00 ? 4   PRO A N    4  
ATOM 5047  C CA   . PRO A 1 4   ? 8.815   8.088   -6.072  1.00 0.00 ? 4   PRO A CA   4  
ATOM 5048  C C    . PRO A 1 4   ? 9.850   6.962   -6.173  1.00 0.00 ? 4   PRO A C    4  
ATOM 5049  O O    . PRO A 1 4   ? 10.674  6.963   -7.065  1.00 0.00 ? 4   PRO A O    4  
ATOM 5050  C CB   . PRO A 1 4   ? 8.148   8.348   -7.427  1.00 0.00 ? 4   PRO A CB   4  
ATOM 5051  C CG   . PRO A 1 4   ? 8.917   9.526   -8.070  1.00 0.00 ? 4   PRO A CG   4  
ATOM 5052  C CD   . PRO A 1 4   ? 9.622   10.267  -6.918  1.00 0.00 ? 4   PRO A CD   4  
ATOM 5053  H HA   . PRO A 1 4   ? 8.066   7.864   -5.332  1.00 0.00 ? 4   PRO A HA   4  
ATOM 5054  H HB2  . PRO A 1 4   ? 8.223   7.468   -8.050  1.00 0.00 ? 4   PRO A HB2  4  
ATOM 5055  H HB3  . PRO A 1 4   ? 7.115   8.621   -7.287  1.00 0.00 ? 4   PRO A HB3  4  
ATOM 5056  H HG2  . PRO A 1 4   ? 9.646   9.151   -8.775  1.00 0.00 ? 4   PRO A HG2  4  
ATOM 5057  H HG3  . PRO A 1 4   ? 8.229   10.193  -8.565  1.00 0.00 ? 4   PRO A HG3  4  
ATOM 5058  H HD2  . PRO A 1 4   ? 10.663  10.418  -7.149  1.00 0.00 ? 4   PRO A HD2  4  
ATOM 5059  H HD3  . PRO A 1 4   ? 9.139   11.206  -6.713  1.00 0.00 ? 4   PRO A HD3  4  
ATOM 5060  N N    . PRO A 1 5   ? 9.782   6.035   -5.250  1.00 0.00 ? 5   PRO A N    4  
ATOM 5061  C CA   . PRO A 1 5   ? 10.708  4.892   -5.210  1.00 0.00 ? 5   PRO A CA   4  
ATOM 5062  C C    . PRO A 1 5   ? 10.303  3.862   -6.264  1.00 0.00 ? 5   PRO A C    4  
ATOM 5063  O O    . PRO A 1 5   ? 11.074  3.507   -7.134  1.00 0.00 ? 5   PRO A O    4  
ATOM 5064  C CB   . PRO A 1 5   ? 10.529  4.335   -3.796  1.00 0.00 ? 5   PRO A CB   4  
ATOM 5065  C CG   . PRO A 1 5   ? 9.139   4.808   -3.312  1.00 0.00 ? 5   PRO A CG   4  
ATOM 5066  C CD   . PRO A 1 5   ? 8.773   6.035   -4.169  1.00 0.00 ? 5   PRO A CD   4  
ATOM 5067  H HA   . PRO A 1 5   ? 11.726  5.216   -5.358  1.00 0.00 ? 5   PRO A HA   4  
ATOM 5068  H HB2  . PRO A 1 5   ? 10.572  3.254   -3.814  1.00 0.00 ? 5   PRO A HB2  4  
ATOM 5069  H HB3  . PRO A 1 5   ? 11.292  4.729   -3.145  1.00 0.00 ? 5   PRO A HB3  4  
ATOM 5070  H HG2  . PRO A 1 5   ? 8.410   4.023   -3.455  1.00 0.00 ? 5   PRO A HG2  4  
ATOM 5071  H HG3  . PRO A 1 5   ? 9.183   5.092   -2.272  1.00 0.00 ? 5   PRO A HG3  4  
ATOM 5072  H HD2  . PRO A 1 5   ? 7.777   5.926   -4.576  1.00 0.00 ? 5   PRO A HD2  4  
ATOM 5073  H HD3  . PRO A 1 5   ? 8.851   6.940   -3.587  1.00 0.00 ? 5   PRO A HD3  4  
ATOM 5074  N N    . TYR A 1 6   ? 9.091   3.394   -6.197  1.00 0.00 ? 6   TYR A N    4  
ATOM 5075  C CA   . TYR A 1 6   ? 8.617   2.401   -7.197  1.00 0.00 ? 6   TYR A CA   4  
ATOM 5076  C C    . TYR A 1 6   ? 7.545   3.054   -8.062  1.00 0.00 ? 6   TYR A C    4  
ATOM 5077  O O    . TYR A 1 6   ? 6.824   3.924   -7.615  1.00 0.00 ? 6   TYR A O    4  
ATOM 5078  C CB   . TYR A 1 6   ? 8.021   1.191   -6.475  1.00 0.00 ? 6   TYR A CB   4  
ATOM 5079  C CG   . TYR A 1 6   ? 9.069   0.566   -5.589  1.00 0.00 ? 6   TYR A CG   4  
ATOM 5080  C CD1  . TYR A 1 6   ? 10.368  0.373   -6.071  1.00 0.00 ? 6   TYR A CD1  4  
ATOM 5081  C CD2  . TYR A 1 6   ? 8.739   0.175   -4.286  1.00 0.00 ? 6   TYR A CD2  4  
ATOM 5082  C CE1  . TYR A 1 6   ? 11.337  -0.213  -5.249  1.00 0.00 ? 6   TYR A CE1  4  
ATOM 5083  C CE2  . TYR A 1 6   ? 9.707   -0.410  -3.466  1.00 0.00 ? 6   TYR A CE2  4  
ATOM 5084  C CZ   . TYR A 1 6   ? 11.009  -0.605  -3.948  1.00 0.00 ? 6   TYR A CZ   4  
ATOM 5085  O OH   . TYR A 1 6   ? 11.968  -1.187  -3.146  1.00 0.00 ? 6   TYR A OH   4  
ATOM 5086  H H    . TYR A 1 6   ? 8.485   3.704   -5.492  1.00 0.00 ? 6   TYR A H    4  
ATOM 5087  H HA   . TYR A 1 6   ? 9.440   2.086   -7.815  1.00 0.00 ? 6   TYR A HA   4  
ATOM 5088  H HB2  . TYR A 1 6   ? 7.186   1.509   -5.870  1.00 0.00 ? 6   TYR A HB2  4  
ATOM 5089  H HB3  . TYR A 1 6   ? 7.686   0.466   -7.201  1.00 0.00 ? 6   TYR A HB3  4  
ATOM 5090  H HD1  . TYR A 1 6   ? 10.623  0.676   -7.075  1.00 0.00 ? 6   TYR A HD1  4  
ATOM 5091  H HD2  . TYR A 1 6   ? 7.735   0.326   -3.915  1.00 0.00 ? 6   TYR A HD2  4  
ATOM 5092  H HE1  . TYR A 1 6   ? 12.340  -0.360  -5.618  1.00 0.00 ? 6   TYR A HE1  4  
ATOM 5093  H HE2  . TYR A 1 6   ? 9.451   -0.710  -2.458  1.00 0.00 ? 6   TYR A HE2  4  
ATOM 5094  H HH   . TYR A 1 6   ? 12.830  -0.927  -3.479  1.00 0.00 ? 6   TYR A HH   4  
ATOM 5095  N N    . SER A 1 7   ? 7.418   2.646   -9.294  1.00 0.00 ? 7   SER A N    4  
ATOM 5096  C CA   . SER A 1 7   ? 6.374   3.260   -10.154 1.00 0.00 ? 7   SER A CA   4  
ATOM 5097  C C    . SER A 1 7   ? 5.067   3.260   -9.369  1.00 0.00 ? 7   SER A C    4  
ATOM 5098  O O    . SER A 1 7   ? 4.970   2.648   -8.329  1.00 0.00 ? 7   SER A O    4  
ATOM 5099  C CB   . SER A 1 7   ? 6.207   2.436   -11.432 1.00 0.00 ? 7   SER A CB   4  
ATOM 5100  O OG   . SER A 1 7   ? 7.119   2.905   -12.416 1.00 0.00 ? 7   SER A OG   4  
ATOM 5101  H H    . SER A 1 7   ? 7.999   1.940   -9.645  1.00 0.00 ? 7   SER A H    4  
ATOM 5102  H HA   . SER A 1 7   ? 6.654   4.274   -10.404 1.00 0.00 ? 7   SER A HA   4  
ATOM 5103  H HB2  . SER A 1 7   ? 6.413   1.399   -11.224 1.00 0.00 ? 7   SER A HB2  4  
ATOM 5104  H HB3  . SER A 1 7   ? 5.191   2.534   -11.792 1.00 0.00 ? 7   SER A HB3  4  
ATOM 5105  H HG   . SER A 1 7   ? 7.878   3.280   -11.962 1.00 0.00 ? 7   SER A HG   4  
ATOM 5106  N N    . TYR A 1 8   ? 4.062   3.936   -9.835  1.00 0.00 ? 8   TYR A N    4  
ATOM 5107  C CA   . TYR A 1 8   ? 2.789   3.944   -9.070  1.00 0.00 ? 8   TYR A CA   4  
ATOM 5108  C C    . TYR A 1 8   ? 1.951   2.721   -9.455  1.00 0.00 ? 8   TYR A C    4  
ATOM 5109  O O    . TYR A 1 8   ? 0.785   2.621   -9.128  1.00 0.00 ? 8   TYR A O    4  
ATOM 5110  C CB   . TYR A 1 8   ? 2.035   5.239   -9.349  1.00 0.00 ? 8   TYR A CB   4  
ATOM 5111  C CG   . TYR A 1 8   ? 2.857   6.388   -8.813  1.00 0.00 ? 8   TYR A CG   4  
ATOM 5112  C CD1  . TYR A 1 8   ? 3.298   6.367   -7.483  1.00 0.00 ? 8   TYR A CD1  4  
ATOM 5113  C CD2  . TYR A 1 8   ? 3.190   7.463   -9.644  1.00 0.00 ? 8   TYR A CD2  4  
ATOM 5114  C CE1  . TYR A 1 8   ? 4.070   7.422   -6.984  1.00 0.00 ? 8   TYR A CE1  4  
ATOM 5115  C CE2  . TYR A 1 8   ? 3.965   8.518   -9.145  1.00 0.00 ? 8   TYR A CE2  4  
ATOM 5116  C CZ   . TYR A 1 8   ? 4.404   8.498   -7.815  1.00 0.00 ? 8   TYR A CZ   4  
ATOM 5117  O OH   . TYR A 1 8   ? 5.167   9.538   -7.324  1.00 0.00 ? 8   TYR A OH   4  
ATOM 5118  H H    . TYR A 1 8   ? 4.142   4.436   -10.675 1.00 0.00 ? 8   TYR A H    4  
ATOM 5119  H HA   . TYR A 1 8   ? 3.017   3.890   -8.015  1.00 0.00 ? 8   TYR A HA   4  
ATOM 5120  H HB2  . TYR A 1 8   ? 1.888   5.356   -10.414 1.00 0.00 ? 8   TYR A HB2  4  
ATOM 5121  H HB3  . TYR A 1 8   ? 1.081   5.216   -8.849  1.00 0.00 ? 8   TYR A HB3  4  
ATOM 5122  H HD1  . TYR A 1 8   ? 3.041   5.537   -6.842  1.00 0.00 ? 8   TYR A HD1  4  
ATOM 5123  H HD2  . TYR A 1 8   ? 2.850   7.481   -10.668 1.00 0.00 ? 8   TYR A HD2  4  
ATOM 5124  H HE1  . TYR A 1 8   ? 4.410   7.404   -5.959  1.00 0.00 ? 8   TYR A HE1  4  
ATOM 5125  H HE2  . TYR A 1 8   ? 4.223   9.348   -9.784  1.00 0.00 ? 8   TYR A HE2  4  
ATOM 5126  H HH   . TYR A 1 8   ? 5.331   9.372   -6.391  1.00 0.00 ? 8   TYR A HH   4  
ATOM 5127  N N    . ALA A 1 9   ? 2.557   1.777   -10.124 1.00 0.00 ? 9   ALA A N    4  
ATOM 5128  C CA   . ALA A 1 9   ? 1.835   0.533   -10.512 1.00 0.00 ? 9   ALA A CA   4  
ATOM 5129  C C    . ALA A 1 9   ? 2.587   -0.662  -9.911  1.00 0.00 ? 9   ALA A C    4  
ATOM 5130  O O    . ALA A 1 9   ? 2.001   -1.651  -9.525  1.00 0.00 ? 9   ALA A O    4  
ATOM 5131  C CB   . ALA A 1 9   ? 1.795   0.413   -12.035 1.00 0.00 ? 9   ALA A CB   4  
ATOM 5132  H H    . ALA A 1 9   ? 3.501   1.879   -10.356 1.00 0.00 ? 9   ALA A H    4  
ATOM 5133  H HA   . ALA A 1 9   ? 0.829   0.561   -10.121 1.00 0.00 ? 9   ALA A HA   4  
ATOM 5134  H HB1  . ALA A 1 9   ? 1.363   1.309   -12.454 1.00 0.00 ? 9   ALA A HB1  4  
ATOM 5135  H HB2  . ALA A 1 9   ? 1.194   -0.441  -12.311 1.00 0.00 ? 9   ALA A HB2  4  
ATOM 5136  H HB3  . ALA A 1 9   ? 2.798   0.284   -12.412 1.00 0.00 ? 9   ALA A HB3  4  
ATOM 5137  N N    . GLN A 1 10  ? 3.885   -0.548  -9.798  1.00 0.00 ? 10  GLN A N    4  
ATOM 5138  C CA   . GLN A 1 10  ? 4.704   -1.633  -9.187  1.00 0.00 ? 10  GLN A CA   4  
ATOM 5139  C C    . GLN A 1 10  ? 4.759   -1.350  -7.693  1.00 0.00 ? 10  GLN A C    4  
ATOM 5140  O O    . GLN A 1 10  ? 4.743   -2.240  -6.867  1.00 0.00 ? 10  GLN A O    4  
ATOM 5141  C CB   . GLN A 1 10  ? 6.117   -1.598  -9.778  1.00 0.00 ? 10  GLN A CB   4  
ATOM 5142  C CG   . GLN A 1 10  ? 7.028   -2.551  -9.004  1.00 0.00 ? 10  GLN A CG   4  
ATOM 5143  C CD   . GLN A 1 10  ? 8.436   -1.958  -8.922  1.00 0.00 ? 10  GLN A CD   4  
ATOM 5144  O OE1  . GLN A 1 10  ? 8.851   -1.491  -7.880  1.00 0.00 ? 10  GLN A OE1  4  
ATOM 5145  N NE2  . GLN A 1 10  ? 9.193   -1.956  -9.985  1.00 0.00 ? 10  GLN A NE2  4  
ATOM 5146  H H    . GLN A 1 10  ? 4.321   0.276   -10.088 1.00 0.00 ? 10  GLN A H    4  
ATOM 5147  H HA   . GLN A 1 10  ? 4.248   -2.601  -9.362  1.00 0.00 ? 10  GLN A HA   4  
ATOM 5148  H HB2  . GLN A 1 10  ? 6.079   -1.899  -10.815 1.00 0.00 ? 10  GLN A HB2  4  
ATOM 5149  H HB3  . GLN A 1 10  ? 6.509   -0.594  -9.710  1.00 0.00 ? 10  GLN A HB3  4  
ATOM 5150  H HG2  . GLN A 1 10  ? 6.637   -2.694  -8.006  1.00 0.00 ? 10  GLN A HG2  4  
ATOM 5151  H HG3  . GLN A 1 10  ? 7.071   -3.501  -9.514  1.00 0.00 ? 10  GLN A HG3  4  
ATOM 5152  H HE21 . GLN A 1 10  ? 8.857   -2.332  -10.825 1.00 0.00 ? 10  GLN A HE21 4  
ATOM 5153  H HE22 . GLN A 1 10  ? 10.096  -1.578  -9.943  1.00 0.00 ? 10  GLN A HE22 4  
ATOM 5154  N N    . LEU A 1 11  ? 4.779   -0.091  -7.354  1.00 0.00 ? 11  LEU A N    4  
ATOM 5155  C CA   . LEU A 1 11  ? 4.785   0.310   -5.927  1.00 0.00 ? 11  LEU A CA   4  
ATOM 5156  C C    . LEU A 1 11  ? 3.526   -0.266  -5.290  1.00 0.00 ? 11  LEU A C    4  
ATOM 5157  O O    . LEU A 1 11  ? 3.540   -0.798  -4.198  1.00 0.00 ? 11  LEU A O    4  
ATOM 5158  C CB   . LEU A 1 11  ? 4.745   1.838   -5.858  1.00 0.00 ? 11  LEU A CB   4  
ATOM 5159  C CG   . LEU A 1 11  ? 4.809   2.301   -4.410  1.00 0.00 ? 11  LEU A CG   4  
ATOM 5160  C CD1  . LEU A 1 11  ? 6.223   2.777   -4.107  1.00 0.00 ? 11  LEU A CD1  4  
ATOM 5161  C CD2  . LEU A 1 11  ? 3.834   3.460   -4.210  1.00 0.00 ? 11  LEU A CD2  4  
ATOM 5162  H H    . LEU A 1 11  ? 4.759   0.596   -8.050  1.00 0.00 ? 11  LEU A H    4  
ATOM 5163  H HA   . LEU A 1 11  ? 5.667   -0.067  -5.432  1.00 0.00 ? 11  LEU A HA   4  
ATOM 5164  H HB2  . LEU A 1 11  ? 5.587   2.243   -6.398  1.00 0.00 ? 11  LEU A HB2  4  
ATOM 5165  H HB3  . LEU A 1 11  ? 3.829   2.192   -6.306  1.00 0.00 ? 11  LEU A HB3  4  
ATOM 5166  H HG   . LEU A 1 11  ? 4.548   1.484   -3.752  1.00 0.00 ? 11  LEU A HG   4  
ATOM 5167  H HD11 . LEU A 1 11  ? 6.189   3.548   -3.353  1.00 0.00 ? 11  LEU A HD11 4  
ATOM 5168  H HD12 . LEU A 1 11  ? 6.666   3.175   -5.010  1.00 0.00 ? 11  LEU A HD12 4  
ATOM 5169  H HD13 . LEU A 1 11  ? 6.814   1.947   -3.752  1.00 0.00 ? 11  LEU A HD13 4  
ATOM 5170  H HD21 . LEU A 1 11  ? 3.389   3.722   -5.159  1.00 0.00 ? 11  LEU A HD21 4  
ATOM 5171  H HD22 . LEU A 1 11  ? 4.366   4.313   -3.815  1.00 0.00 ? 11  LEU A HD22 4  
ATOM 5172  H HD23 . LEU A 1 11  ? 3.059   3.165   -3.519  1.00 0.00 ? 11  LEU A HD23 4  
ATOM 5173  N N    . ILE A 1 12  ? 2.438   -0.164  -5.998  1.00 0.00 ? 12  ILE A N    4  
ATOM 5174  C CA   . ILE A 1 12  ? 1.145   -0.704  -5.495  1.00 0.00 ? 12  ILE A CA   4  
ATOM 5175  C C    . ILE A 1 12  ? 1.208   -2.226  -5.431  1.00 0.00 ? 12  ILE A C    4  
ATOM 5176  O O    . ILE A 1 12  ? 0.920   -2.822  -4.422  1.00 0.00 ? 12  ILE A O    4  
ATOM 5177  C CB   . ILE A 1 12  ? 0.024   -0.322  -6.453  1.00 0.00 ? 12  ILE A CB   4  
ATOM 5178  C CG1  . ILE A 1 12  ? 0.251   1.079   -7.046  1.00 0.00 ? 12  ILE A CG1  4  
ATOM 5179  C CG2  . ILE A 1 12  ? -1.293  -0.347  -5.697  1.00 0.00 ? 12  ILE A CG2  4  
ATOM 5180  C CD1  . ILE A 1 12  ? 0.632   2.074   -5.950  1.00 0.00 ? 12  ILE A CD1  4  
ATOM 5181  H H    . ILE A 1 12  ? 2.476   0.266   -6.877  1.00 0.00 ? 12  ILE A H    4  
ATOM 5182  H HA   . ILE A 1 12  ? 0.930   -0.311  -4.510  1.00 0.00 ? 12  ILE A HA   4  
ATOM 5183  H HB   . ILE A 1 12  ? -0.016  -1.051  -7.248  1.00 0.00 ? 12  ILE A HB   4  
ATOM 5184  H HG12 . ILE A 1 12  ? 1.035   1.043   -7.781  1.00 0.00 ? 12  ILE A HG12 4  
ATOM 5185  H HG13 . ILE A 1 12  ? -0.659  1.410   -7.520  1.00 0.00 ? 12  ILE A HG13 4  
ATOM 5186  H HG21 . ILE A 1 12  ? -2.061  -0.767  -6.327  1.00 0.00 ? 12  ILE A HG21 4  
ATOM 5187  H HG22 . ILE A 1 12  ? -1.565  0.657   -5.413  1.00 0.00 ? 12  ILE A HG22 4  
ATOM 5188  H HG23 . ILE A 1 12  ? -1.182  -0.955  -4.811  1.00 0.00 ? 12  ILE A HG23 4  
ATOM 5189  H HD11 . ILE A 1 12  ? -0.255  2.585   -5.612  1.00 0.00 ? 12  ILE A HD11 4  
ATOM 5190  H HD12 . ILE A 1 12  ? 1.333   2.794   -6.345  1.00 0.00 ? 12  ILE A HD12 4  
ATOM 5191  H HD13 . ILE A 1 12  ? 1.084   1.553   -5.121  1.00 0.00 ? 12  ILE A HD13 4  
ATOM 5192  N N    . VAL A 1 13  ? 1.550   -2.864  -6.512  1.00 0.00 ? 13  VAL A N    4  
ATOM 5193  C CA   . VAL A 1 13  ? 1.588   -4.351  -6.506  1.00 0.00 ? 13  VAL A CA   4  
ATOM 5194  C C    . VAL A 1 13  ? 2.418   -4.847  -5.326  1.00 0.00 ? 13  VAL A C    4  
ATOM 5195  O O    . VAL A 1 13  ? 2.121   -5.863  -4.741  1.00 0.00 ? 13  VAL A O    4  
ATOM 5196  C CB   . VAL A 1 13  ? 2.197   -4.853  -7.809  1.00 0.00 ? 13  VAL A CB   4  
ATOM 5197  C CG1  . VAL A 1 13  ? 2.423   -6.362  -7.707  1.00 0.00 ? 13  VAL A CG1  4  
ATOM 5198  C CG2  . VAL A 1 13  ? 1.230   -4.550  -8.956  1.00 0.00 ? 13  VAL A CG2  4  
ATOM 5199  H H    . VAL A 1 13  ? 1.750   -2.369  -7.334  1.00 0.00 ? 13  VAL A H    4  
ATOM 5200  H HA   . VAL A 1 13  ? 0.581   -4.731  -6.414  1.00 0.00 ? 13  VAL A HA   4  
ATOM 5201  H HB   . VAL A 1 13  ? 3.139   -4.355  -7.985  1.00 0.00 ? 13  VAL A HB   4  
ATOM 5202  H HG11 . VAL A 1 13  ? 3.157   -6.564  -6.942  1.00 0.00 ? 13  VAL A HG11 4  
ATOM 5203  H HG12 . VAL A 1 13  ? 2.777   -6.740  -8.654  1.00 0.00 ? 13  VAL A HG12 4  
ATOM 5204  H HG13 . VAL A 1 13  ? 1.493   -6.849  -7.450  1.00 0.00 ? 13  VAL A HG13 4  
ATOM 5205  H HG21 . VAL A 1 13  ? 0.261   -4.972  -8.730  1.00 0.00 ? 13  VAL A HG21 4  
ATOM 5206  H HG22 . VAL A 1 13  ? 1.607   -4.978  -9.870  1.00 0.00 ? 13  VAL A HG22 4  
ATOM 5207  H HG23 . VAL A 1 13  ? 1.135   -3.481  -9.072  1.00 0.00 ? 13  VAL A HG23 4  
ATOM 5208  N N    . GLN A 1 14  ? 3.443   -4.139  -4.951  1.00 0.00 ? 14  GLN A N    4  
ATOM 5209  C CA   . GLN A 1 14  ? 4.249   -4.592  -3.786  1.00 0.00 ? 14  GLN A CA   4  
ATOM 5210  C C    . GLN A 1 14  ? 3.464   -4.281  -2.514  1.00 0.00 ? 14  GLN A C    4  
ATOM 5211  O O    . GLN A 1 14  ? 3.534   -4.989  -1.529  1.00 0.00 ? 14  GLN A O    4  
ATOM 5212  C CB   . GLN A 1 14  ? 5.582   -3.849  -3.759  1.00 0.00 ? 14  GLN A CB   4  
ATOM 5213  C CG   . GLN A 1 14  ? 6.445   -4.405  -2.627  1.00 0.00 ? 14  GLN A CG   4  
ATOM 5214  C CD   . GLN A 1 14  ? 7.908   -4.070  -2.899  1.00 0.00 ? 14  GLN A CD   4  
ATOM 5215  O OE1  . GLN A 1 14  ? 8.782   -4.889  -2.696  1.00 0.00 ? 14  GLN A OE1  4  
ATOM 5216  N NE2  . GLN A 1 14  ? 8.215   -2.889  -3.356  1.00 0.00 ? 14  GLN A NE2  4  
ATOM 5217  H H    . GLN A 1 14  ? 3.672   -3.309  -5.419  1.00 0.00 ? 14  GLN A H    4  
ATOM 5218  H HA   . GLN A 1 14  ? 4.425   -5.655  -3.856  1.00 0.00 ? 14  GLN A HA   4  
ATOM 5219  H HB2  . GLN A 1 14  ? 6.091   -3.984  -4.702  1.00 0.00 ? 14  GLN A HB2  4  
ATOM 5220  H HB3  . GLN A 1 14  ? 5.405   -2.798  -3.591  1.00 0.00 ? 14  GLN A HB3  4  
ATOM 5221  H HG2  . GLN A 1 14  ? 6.141   -3.961  -1.689  1.00 0.00 ? 14  GLN A HG2  4  
ATOM 5222  H HG3  . GLN A 1 14  ? 6.326   -5.476  -2.575  1.00 0.00 ? 14  GLN A HG3  4  
ATOM 5223  H HE21 . GLN A 1 14  ? 7.509   -2.229  -3.519  1.00 0.00 ? 14  GLN A HE21 4  
ATOM 5224  H HE22 . GLN A 1 14  ? 9.148   -2.663  -3.538  1.00 0.00 ? 14  GLN A HE22 4  
ATOM 5225  N N    . ALA A 1 15  ? 2.714   -3.216  -2.540  1.00 0.00 ? 15  ALA A N    4  
ATOM 5226  C CA   . ALA A 1 15  ? 1.905   -2.823  -1.354  1.00 0.00 ? 15  ALA A CA   4  
ATOM 5227  C C    . ALA A 1 15  ? 0.836   -3.883  -1.070  1.00 0.00 ? 15  ALA A C    4  
ATOM 5228  O O    . ALA A 1 15  ? 0.790   -4.462  -0.003  1.00 0.00 ? 15  ALA A O    4  
ATOM 5229  C CB   . ALA A 1 15  ? 1.216   -1.490  -1.649  1.00 0.00 ? 15  ALA A CB   4  
ATOM 5230  H H    . ALA A 1 15  ? 2.684   -2.668  -3.350  1.00 0.00 ? 15  ALA A H    4  
ATOM 5231  H HA   . ALA A 1 15  ? 2.548   -2.714  -0.495  1.00 0.00 ? 15  ALA A HA   4  
ATOM 5232  H HB1  . ALA A 1 15  ? 1.939   -0.789  -2.044  1.00 0.00 ? 15  ALA A HB1  4  
ATOM 5233  H HB2  . ALA A 1 15  ? 0.787   -1.094  -0.742  1.00 0.00 ? 15  ALA A HB2  4  
ATOM 5234  H HB3  . ALA A 1 15  ? 0.433   -1.644  -2.379  1.00 0.00 ? 15  ALA A HB3  4  
ATOM 5235  N N    . ILE A 1 16  ? -0.033  -4.125  -2.012  1.00 0.00 ? 16  ILE A N    4  
ATOM 5236  C CA   . ILE A 1 16  ? -1.115  -5.132  -1.789  1.00 0.00 ? 16  ILE A CA   4  
ATOM 5237  C C    . ILE A 1 16  ? -0.544  -6.553  -1.814  1.00 0.00 ? 16  ILE A C    4  
ATOM 5238  O O    . ILE A 1 16  ? -0.932  -7.398  -1.032  1.00 0.00 ? 16  ILE A O    4  
ATOM 5239  C CB   . ILE A 1 16  ? -2.219  -5.008  -2.856  1.00 0.00 ? 16  ILE A CB   4  
ATOM 5240  C CG1  . ILE A 1 16  ? -1.825  -4.050  -3.985  1.00 0.00 ? 16  ILE A CG1  4  
ATOM 5241  C CG2  . ILE A 1 16  ? -3.476  -4.456  -2.196  1.00 0.00 ? 16  ILE A CG2  4  
ATOM 5242  C CD1  . ILE A 1 16  ? -2.986  -3.950  -4.967  1.00 0.00 ? 16  ILE A CD1  4  
ATOM 5243  H H    . ILE A 1 16  ? 0.020   -3.636  -2.853  1.00 0.00 ? 16  ILE A H    4  
ATOM 5244  H HA   . ILE A 1 16  ? -1.553  -4.957  -0.817  1.00 0.00 ? 16  ILE A HA   4  
ATOM 5245  H HB   . ILE A 1 16  ? -2.432  -5.986  -3.266  1.00 0.00 ? 16  ILE A HB   4  
ATOM 5246  H HG12 . ILE A 1 16  ? -1.615  -3.075  -3.572  1.00 0.00 ? 16  ILE A HG12 4  
ATOM 5247  H HG13 . ILE A 1 16  ? -0.954  -4.414  -4.504  1.00 0.00 ? 16  ILE A HG13 4  
ATOM 5248  H HG21 . ILE A 1 16  ? -4.234  -4.294  -2.947  1.00 0.00 ? 16  ILE A HG21 4  
ATOM 5249  H HG22 . ILE A 1 16  ? -3.239  -3.520  -1.717  1.00 0.00 ? 16  ILE A HG22 4  
ATOM 5250  H HG23 . ILE A 1 16  ? -3.835  -5.158  -1.462  1.00 0.00 ? 16  ILE A HG23 4  
ATOM 5251  H HD11 . ILE A 1 16  ? -3.050  -4.862  -5.542  1.00 0.00 ? 16  ILE A HD11 4  
ATOM 5252  H HD12 . ILE A 1 16  ? -2.824  -3.119  -5.630  1.00 0.00 ? 16  ILE A HD12 4  
ATOM 5253  H HD13 . ILE A 1 16  ? -3.907  -3.804  -4.423  1.00 0.00 ? 16  ILE A HD13 4  
ATOM 5254  N N    . SER A 1 17  ? 0.365   -6.832  -2.703  1.00 0.00 ? 17  SER A N    4  
ATOM 5255  C CA   . SER A 1 17  ? 0.944   -8.207  -2.766  1.00 0.00 ? 17  SER A CA   4  
ATOM 5256  C C    . SER A 1 17  ? 1.567   -8.565  -1.417  1.00 0.00 ? 17  SER A C    4  
ATOM 5257  O O    . SER A 1 17  ? 1.342   -9.631  -0.879  1.00 0.00 ? 17  SER A O    4  
ATOM 5258  C CB   . SER A 1 17  ? 2.024   -8.268  -3.844  1.00 0.00 ? 17  SER A CB   4  
ATOM 5259  O OG   . SER A 1 17  ? 3.140   -7.488  -3.436  1.00 0.00 ? 17  SER A OG   4  
ATOM 5260  H H    . SER A 1 17  ? 0.664   -6.144  -3.329  1.00 0.00 ? 17  SER A H    4  
ATOM 5261  H HA   . SER A 1 17  ? 0.162   -8.916  -2.999  1.00 0.00 ? 17  SER A HA   4  
ATOM 5262  H HB2  . SER A 1 17  ? 2.339   -9.288  -3.982  1.00 0.00 ? 17  SER A HB2  4  
ATOM 5263  H HB3  . SER A 1 17  ? 1.625   -7.888  -4.775  1.00 0.00 ? 17  SER A HB3  4  
ATOM 5264  H HG   . SER A 1 17  ? 3.939   -7.969  -3.666  1.00 0.00 ? 17  SER A HG   4  
ATOM 5265  N N    . SER A 1 18  ? 2.358   -7.685  -0.871  1.00 0.00 ? 18  SER A N    4  
ATOM 5266  C CA   . SER A 1 18  ? 3.003   -7.981  0.442   1.00 0.00 ? 18  SER A CA   4  
ATOM 5267  C C    . SER A 1 18  ? 1.996   -7.767  1.571   1.00 0.00 ? 18  SER A C    4  
ATOM 5268  O O    . SER A 1 18  ? 2.267   -8.060  2.719   1.00 0.00 ? 18  SER A O    4  
ATOM 5269  C CB   . SER A 1 18  ? 4.207   -7.059  0.652   1.00 0.00 ? 18  SER A CB   4  
ATOM 5270  O OG   . SER A 1 18  ? 5.355   -7.646  0.052   1.00 0.00 ? 18  SER A OG   4  
ATOM 5271  H H    . SER A 1 18  ? 2.531   -6.833  -1.325  1.00 0.00 ? 18  SER A H    4  
ATOM 5272  H HA   . SER A 1 18  ? 3.336   -9.009  0.451   1.00 0.00 ? 18  SER A HA   4  
ATOM 5273  H HB2  . SER A 1 18  ? 4.020   -6.102  0.197   1.00 0.00 ? 18  SER A HB2  4  
ATOM 5274  H HB3  . SER A 1 18  ? 4.374   -6.924  1.712   1.00 0.00 ? 18  SER A HB3  4  
ATOM 5275  H HG   . SER A 1 18  ? 5.576   -8.438  0.546   1.00 0.00 ? 18  SER A HG   4  
ATOM 5276  N N    . ALA A 1 19  ? 0.830   -7.271  1.259   1.00 0.00 ? 19  ALA A N    4  
ATOM 5277  C CA   . ALA A 1 19  ? -0.187  -7.055  2.323   1.00 0.00 ? 19  ALA A CA   4  
ATOM 5278  C C    . ALA A 1 19  ? -0.608  -8.414  2.878   1.00 0.00 ? 19  ALA A C    4  
ATOM 5279  O O    . ALA A 1 19  ? 0.067   -9.406  2.686   1.00 0.00 ? 19  ALA A O    4  
ATOM 5280  C CB   . ALA A 1 19  ? -1.406  -6.344  1.732   1.00 0.00 ? 19  ALA A CB   4  
ATOM 5281  H H    . ALA A 1 19  ? 0.621   -7.049  0.328   1.00 0.00 ? 19  ALA A H    4  
ATOM 5282  H HA   . ALA A 1 19  ? 0.237   -6.455  3.114   1.00 0.00 ? 19  ALA A HA   4  
ATOM 5283  H HB1  . ALA A 1 19  ? -1.911  -7.005  1.045   1.00 0.00 ? 19  ALA A HB1  4  
ATOM 5284  H HB2  . ALA A 1 19  ? -1.084  -5.455  1.208   1.00 0.00 ? 19  ALA A HB2  4  
ATOM 5285  H HB3  . ALA A 1 19  ? -2.082  -6.067  2.528   1.00 0.00 ? 19  ALA A HB3  4  
ATOM 5286  N N    . GLN A 1 20  ? -1.717  -8.478  3.558   1.00 0.00 ? 20  GLN A N    4  
ATOM 5287  C CA   . GLN A 1 20  ? -2.160  -9.786  4.106   1.00 0.00 ? 20  GLN A CA   4  
ATOM 5288  C C    . GLN A 1 20  ? -2.514  -10.716 2.938   1.00 0.00 ? 20  GLN A C    4  
ATOM 5289  O O    . GLN A 1 20  ? -1.751  -11.593 2.584   1.00 0.00 ? 20  GLN A O    4  
ATOM 5290  C CB   . GLN A 1 20  ? -3.373  -9.578  5.024   1.00 0.00 ? 20  GLN A CB   4  
ATOM 5291  C CG   . GLN A 1 20  ? -4.121  -10.900 5.211   1.00 0.00 ? 20  GLN A CG   4  
ATOM 5292  C CD   . GLN A 1 20  ? -4.793  -10.917 6.586   1.00 0.00 ? 20  GLN A CD   4  
ATOM 5293  O OE1  . GLN A 1 20  ? -4.664  -11.872 7.326   1.00 0.00 ? 20  GLN A OE1  4  
ATOM 5294  N NE2  . GLN A 1 20  ? -5.509  -9.893  6.961   1.00 0.00 ? 20  GLN A NE2  4  
ATOM 5295  H H    . GLN A 1 20  ? -2.255  -7.673  3.703   1.00 0.00 ? 20  GLN A H    4  
ATOM 5296  H HA   . GLN A 1 20  ? -1.352  -10.225 4.674   1.00 0.00 ? 20  GLN A HA   4  
ATOM 5297  H HB2  . GLN A 1 20  ? -3.032  -9.222  5.986   1.00 0.00 ? 20  GLN A HB2  4  
ATOM 5298  H HB3  . GLN A 1 20  ? -4.037  -8.845  4.591   1.00 0.00 ? 20  GLN A HB3  4  
ATOM 5299  H HG2  . GLN A 1 20  ? -4.874  -11.002 4.443   1.00 0.00 ? 20  GLN A HG2  4  
ATOM 5300  H HG3  . GLN A 1 20  ? -3.424  -11.721 5.144   1.00 0.00 ? 20  GLN A HG3  4  
ATOM 5301  H HE21 . GLN A 1 20  ? -5.613  -9.122  6.364   1.00 0.00 ? 20  GLN A HE21 4  
ATOM 5302  H HE22 . GLN A 1 20  ? -5.945  -9.895  7.839   1.00 0.00 ? 20  GLN A HE22 4  
ATOM 5303  N N    . ASP A 1 21  ? -3.652  -10.530 2.326   1.00 0.00 ? 21  ASP A N    4  
ATOM 5304  C CA   . ASP A 1 21  ? -4.029  -11.400 1.178   1.00 0.00 ? 21  ASP A CA   4  
ATOM 5305  C C    . ASP A 1 21  ? -3.548  -10.755 -0.127  1.00 0.00 ? 21  ASP A C    4  
ATOM 5306  O O    . ASP A 1 21  ? -2.594  -11.197 -0.735  1.00 0.00 ? 21  ASP A O    4  
ATOM 5307  C CB   . ASP A 1 21  ? -5.550  -11.569 1.143   1.00 0.00 ? 21  ASP A CB   4  
ATOM 5308  C CG   . ASP A 1 21  ? -5.958  -12.701 2.088   1.00 0.00 ? 21  ASP A CG   4  
ATOM 5309  O OD1  . ASP A 1 21  ? -5.276  -13.713 2.098   1.00 0.00 ? 21  ASP A OD1  4  
ATOM 5310  O OD2  . ASP A 1 21  ? -6.945  -12.537 2.785   1.00 0.00 ? 21  ASP A OD2  4  
ATOM 5311  H H    . ASP A 1 21  ? -4.253  -9.813  2.611   1.00 0.00 ? 21  ASP A H    4  
ATOM 5312  H HA   . ASP A 1 21  ? -3.562  -12.368 1.292   1.00 0.00 ? 21  ASP A HA   4  
ATOM 5313  H HB2  . ASP A 1 21  ? -6.022  -10.649 1.459   1.00 0.00 ? 21  ASP A HB2  4  
ATOM 5314  H HB3  . ASP A 1 21  ? -5.863  -11.810 0.139   1.00 0.00 ? 21  ASP A HB3  4  
ATOM 5315  N N    . ARG A 1 22  ? -4.205  -9.711  -0.558  1.00 0.00 ? 22  ARG A N    4  
ATOM 5316  C CA   . ARG A 1 22  ? -3.796  -9.027  -1.819  1.00 0.00 ? 22  ARG A CA   4  
ATOM 5317  C C    . ARG A 1 22  ? -4.757  -7.863  -2.094  1.00 0.00 ? 22  ARG A C    4  
ATOM 5318  O O    . ARG A 1 22  ? -5.036  -7.526  -3.231  1.00 0.00 ? 22  ARG A O    4  
ATOM 5319  C CB   . ARG A 1 22  ? -3.849  -10.022 -2.982  1.00 0.00 ? 22  ARG A CB   4  
ATOM 5320  C CG   . ARG A 1 22  ? -5.181  -10.773 -2.952  1.00 0.00 ? 22  ARG A CG   4  
ATOM 5321  C CD   . ARG A 1 22  ? -5.969  -10.466 -4.227  1.00 0.00 ? 22  ARG A CD   4  
ATOM 5322  N NE   . ARG A 1 22  ? -7.369  -10.103 -3.868  1.00 0.00 ? 22  ARG A NE   4  
ATOM 5323  C CZ   . ARG A 1 22  ? -8.069  -10.895 -3.104  1.00 0.00 ? 22  ARG A CZ   4  
ATOM 5324  N NH1  . ARG A 1 22  ? -8.104  -12.175 -3.351  1.00 0.00 ? 22  ARG A NH1  4  
ATOM 5325  N NH2  . ARG A 1 22  ? -8.732  -10.408 -2.091  1.00 0.00 ? 22  ARG A NH2  4  
ATOM 5326  H H    . ARG A 1 22  ? -4.967  -9.372  -0.047  1.00 0.00 ? 22  ARG A H    4  
ATOM 5327  H HA   . ARG A 1 22  ? -2.791  -8.648  -1.713  1.00 0.00 ? 22  ARG A HA   4  
ATOM 5328  H HB2  . ARG A 1 22  ? -3.754  -9.490  -3.916  1.00 0.00 ? 22  ARG A HB2  4  
ATOM 5329  H HB3  . ARG A 1 22  ? -3.038  -10.729 -2.887  1.00 0.00 ? 22  ARG A HB3  4  
ATOM 5330  H HG2  . ARG A 1 22  ? -4.995  -11.835 -2.890  1.00 0.00 ? 22  ARG A HG2  4  
ATOM 5331  H HG3  . ARG A 1 22  ? -5.753  -10.456 -2.093  1.00 0.00 ? 22  ARG A HG3  4  
ATOM 5332  H HD2  . ARG A 1 22  ? -5.506  -9.641  -4.748  1.00 0.00 ? 22  ARG A HD2  4  
ATOM 5333  H HD3  . ARG A 1 22  ? -5.975  -11.337 -4.865  1.00 0.00 ? 22  ARG A HD3  4  
ATOM 5334  H HE   . ARG A 1 22  ? -7.765  -9.273  -4.208  1.00 0.00 ? 22  ARG A HE   4  
ATOM 5335  H HH11 . ARG A 1 22  ? -7.594  -12.548 -4.126  1.00 0.00 ? 22  ARG A HH11 4  
ATOM 5336  H HH12 . ARG A 1 22  ? -8.639  -12.783 -2.765  1.00 0.00 ? 22  ARG A HH12 4  
ATOM 5337  H HH21 . ARG A 1 22  ? -8.705  -9.426  -1.901  1.00 0.00 ? 22  ARG A HH21 4  
ATOM 5338  H HH22 . ARG A 1 22  ? -9.267  -11.015 -1.504  1.00 0.00 ? 22  ARG A HH22 4  
ATOM 5339  N N    . GLN A 1 23  ? -5.268  -7.252  -1.059  1.00 0.00 ? 23  GLN A N    4  
ATOM 5340  C CA   . GLN A 1 23  ? -6.215  -6.118  -1.250  1.00 0.00 ? 23  GLN A CA   4  
ATOM 5341  C C    . GLN A 1 23  ? -5.851  -4.988  -0.289  1.00 0.00 ? 23  GLN A C    4  
ATOM 5342  O O    . GLN A 1 23  ? -5.356  -5.222  0.796   1.00 0.00 ? 23  GLN A O    4  
ATOM 5343  C CB   . GLN A 1 23  ? -7.638  -6.593  -0.951  1.00 0.00 ? 23  GLN A CB   4  
ATOM 5344  C CG   . GLN A 1 23  ? -7.739  -7.003  0.519   1.00 0.00 ? 23  GLN A CG   4  
ATOM 5345  C CD   . GLN A 1 23  ? -8.990  -7.856  0.725   1.00 0.00 ? 23  GLN A CD   4  
ATOM 5346  O OE1  . GLN A 1 23  ? -9.010  -8.735  1.563   1.00 0.00 ? 23  GLN A OE1  4  
ATOM 5347  N NE2  . GLN A 1 23  ? -10.045 -7.631  -0.010  1.00 0.00 ? 23  GLN A NE2  4  
ATOM 5348  H H    . GLN A 1 23  ? -5.031  -7.541  -0.154  1.00 0.00 ? 23  GLN A H    4  
ATOM 5349  H HA   . GLN A 1 23  ? -6.158  -5.763  -2.268  1.00 0.00 ? 23  GLN A HA   4  
ATOM 5350  H HB2  . GLN A 1 23  ? -8.334  -5.790  -1.150  1.00 0.00 ? 23  GLN A HB2  4  
ATOM 5351  H HB3  . GLN A 1 23  ? -7.874  -7.440  -1.577  1.00 0.00 ? 23  GLN A HB3  4  
ATOM 5352  H HG2  . GLN A 1 23  ? -6.864  -7.575  0.793   1.00 0.00 ? 23  GLN A HG2  4  
ATOM 5353  H HG3  . GLN A 1 23  ? -7.801  -6.121  1.137   1.00 0.00 ? 23  GLN A HG3  4  
ATOM 5354  H HE21 . GLN A 1 23  ? -10.030 -6.922  -0.686  1.00 0.00 ? 23  GLN A HE21 4  
ATOM 5355  H HE22 . GLN A 1 23  ? -10.853 -8.173  0.113   1.00 0.00 ? 23  GLN A HE22 4  
ATOM 5356  N N    . LEU A 1 24  ? -6.089  -3.764  -0.672  1.00 0.00 ? 24  LEU A N    4  
ATOM 5357  C CA   . LEU A 1 24  ? -5.752  -2.635  0.229   1.00 0.00 ? 24  LEU A CA   4  
ATOM 5358  C C    . LEU A 1 24  ? -6.828  -1.557  0.145   1.00 0.00 ? 24  LEU A C    4  
ATOM 5359  O O    . LEU A 1 24  ? -7.460  -1.364  -0.880  1.00 0.00 ? 24  LEU A O    4  
ATOM 5360  C CB   . LEU A 1 24  ? -4.419  -2.021  -0.195  1.00 0.00 ? 24  LEU A CB   4  
ATOM 5361  C CG   . LEU A 1 24  ? -3.265  -2.766  0.480   1.00 0.00 ? 24  LEU A CG   4  
ATOM 5362  C CD1  . LEU A 1 24  ? -1.938  -2.302  -0.121  1.00 0.00 ? 24  LEU A CD1  4  
ATOM 5363  C CD2  . LEU A 1 24  ? -3.272  -2.466  1.982   1.00 0.00 ? 24  LEU A CD2  4  
ATOM 5364  H H    . LEU A 1 24  ? -6.485  -3.587  -1.548  1.00 0.00 ? 24  LEU A H    4  
ATOM 5365  H HA   . LEU A 1 24  ? -5.677  -2.994  1.244   1.00 0.00 ? 24  LEU A HA   4  
ATOM 5366  H HB2  . LEU A 1 24  ? -4.316  -2.086  -1.269  1.00 0.00 ? 24  LEU A HB2  4  
ATOM 5367  H HB3  . LEU A 1 24  ? -4.399  -0.988  0.100   1.00 0.00 ? 24  LEU A HB3  4  
ATOM 5368  H HG   . LEU A 1 24  ? -3.381  -3.827  0.320   1.00 0.00 ? 24  LEU A HG   4  
ATOM 5369  H HD11 . LEU A 1 24  ? -1.339  -3.162  -0.378  1.00 0.00 ? 24  LEU A HD11 4  
ATOM 5370  H HD12 . LEU A 1 24  ? -1.408  -1.696  0.599   1.00 0.00 ? 24  LEU A HD12 4  
ATOM 5371  H HD13 . LEU A 1 24  ? -2.131  -1.719  -1.010  1.00 0.00 ? 24  LEU A HD13 4  
ATOM 5372  H HD21 . LEU A 1 24  ? -4.266  -2.622  2.377   1.00 0.00 ? 24  LEU A HD21 4  
ATOM 5373  H HD22 . LEU A 1 24  ? -2.977  -1.441  2.145   1.00 0.00 ? 24  LEU A HD22 4  
ATOM 5374  H HD23 . LEU A 1 24  ? -2.579  -3.126  2.483   1.00 0.00 ? 24  LEU A HD23 4  
ATOM 5375  N N    . THR A 1 25  ? -7.018  -0.827  1.205   1.00 0.00 ? 25  THR A N    4  
ATOM 5376  C CA   . THR A 1 25  ? -8.017  0.267   1.178   1.00 0.00 ? 25  THR A CA   4  
ATOM 5377  C C    . THR A 1 25  ? -7.348  1.470   0.522   1.00 0.00 ? 25  THR A C    4  
ATOM 5378  O O    . THR A 1 25  ? -6.201  1.403   0.126   1.00 0.00 ? 25  THR A O    4  
ATOM 5379  C CB   . THR A 1 25  ? -8.442  0.618   2.607   1.00 0.00 ? 25  THR A CB   4  
ATOM 5380  O OG1  . THR A 1 25  ? -7.363  1.262   3.276   1.00 0.00 ? 25  THR A OG1  4  
ATOM 5381  C CG2  . THR A 1 25  ? -8.829  -0.662  3.353   1.00 0.00 ? 25  THR A CG2  4  
ATOM 5382  H H    . THR A 1 25  ? -6.480  -0.981  2.011   1.00 0.00 ? 25  THR A H    4  
ATOM 5383  H HA   . THR A 1 25  ? -8.878  -0.037  0.599   1.00 0.00 ? 25  THR A HA   4  
ATOM 5384  H HB   . THR A 1 25  ? -9.293  1.281   2.575   1.00 0.00 ? 25  THR A HB   4  
ATOM 5385  H HG1  . THR A 1 25  ? -7.075  0.696   3.996   1.00 0.00 ? 25  THR A HG1  4  
ATOM 5386  H HG21 . THR A 1 25  ? -8.334  -0.682  4.313   1.00 0.00 ? 25  THR A HG21 4  
ATOM 5387  H HG22 . THR A 1 25  ? -8.526  -1.522  2.774   1.00 0.00 ? 25  THR A HG22 4  
ATOM 5388  H HG23 . THR A 1 25  ? -9.899  -0.685  3.499   1.00 0.00 ? 25  THR A HG23 4  
ATOM 5389  N N    . LEU A 1 26  ? -8.028  2.568   0.393   1.00 0.00 ? 26  LEU A N    4  
ATOM 5390  C CA   . LEU A 1 26  ? -7.376  3.744   -0.248  1.00 0.00 ? 26  LEU A CA   4  
ATOM 5391  C C    . LEU A 1 26  ? -6.159  4.158   0.583   1.00 0.00 ? 26  LEU A C    4  
ATOM 5392  O O    . LEU A 1 26  ? -5.122  4.503   0.054   1.00 0.00 ? 26  LEU A O    4  
ATOM 5393  C CB   . LEU A 1 26  ? -8.358  4.914   -0.342  1.00 0.00 ? 26  LEU A CB   4  
ATOM 5394  C CG   . LEU A 1 26  ? -8.108  5.667   -1.647  1.00 0.00 ? 26  LEU A CG   4  
ATOM 5395  C CD1  . LEU A 1 26  ? -9.279  6.611   -1.928  1.00 0.00 ? 26  LEU A CD1  4  
ATOM 5396  C CD2  . LEU A 1 26  ? -6.817  6.480   -1.525  1.00 0.00 ? 26  LEU A CD2  4  
ATOM 5397  H H    . LEU A 1 26  ? -8.952  2.620   0.714   1.00 0.00 ? 26  LEU A H    4  
ATOM 5398  H HA   . LEU A 1 26  ? -7.050  3.470   -1.241  1.00 0.00 ? 26  LEU A HA   4  
ATOM 5399  H HB2  . LEU A 1 26  ? -9.372  4.544   -0.327  1.00 0.00 ? 26  LEU A HB2  4  
ATOM 5400  H HB3  . LEU A 1 26  ? -8.204  5.583   0.493   1.00 0.00 ? 26  LEU A HB3  4  
ATOM 5401  H HG   . LEU A 1 26  ? -8.016  4.955   -2.458  1.00 0.00 ? 26  LEU A HG   4  
ATOM 5402  H HD11 . LEU A 1 26  ? -9.961  6.597   -1.090  1.00 0.00 ? 26  LEU A HD11 4  
ATOM 5403  H HD12 . LEU A 1 26  ? -9.796  6.287   -2.818  1.00 0.00 ? 26  LEU A HD12 4  
ATOM 5404  H HD13 . LEU A 1 26  ? -8.906  7.614   -2.072  1.00 0.00 ? 26  LEU A HD13 4  
ATOM 5405  H HD21 . LEU A 1 26  ? -6.122  6.171   -2.291  1.00 0.00 ? 26  LEU A HD21 4  
ATOM 5406  H HD22 . LEU A 1 26  ? -6.378  6.314   -0.552  1.00 0.00 ? 26  LEU A HD22 4  
ATOM 5407  H HD23 . LEU A 1 26  ? -7.040  7.530   -1.643  1.00 0.00 ? 26  LEU A HD23 4  
ATOM 5408  N N    . SER A 1 27  ? -6.282  4.133   1.883   1.00 0.00 ? 27  SER A N    4  
ATOM 5409  C CA   . SER A 1 27  ? -5.137  4.530   2.753   1.00 0.00 ? 27  SER A CA   4  
ATOM 5410  C C    . SER A 1 27  ? -4.407  3.288   3.274   1.00 0.00 ? 27  SER A C    4  
ATOM 5411  O O    . SER A 1 27  ? -3.895  3.282   4.377   1.00 0.00 ? 27  SER A O    4  
ATOM 5412  C CB   . SER A 1 27  ? -5.668  5.329   3.938   1.00 0.00 ? 27  SER A CB   4  
ATOM 5413  O OG   . SER A 1 27  ? -5.941  6.661   3.525   1.00 0.00 ? 27  SER A OG   4  
ATOM 5414  H H    . SER A 1 27  ? -7.130  3.855   2.288   1.00 0.00 ? 27  SER A H    4  
ATOM 5415  H HA   . SER A 1 27  ? -4.451  5.142   2.187   1.00 0.00 ? 27  SER A HA   4  
ATOM 5416  H HB2  . SER A 1 27  ? -6.576  4.874   4.298   1.00 0.00 ? 27  SER A HB2  4  
ATOM 5417  H HB3  . SER A 1 27  ? -4.929  5.327   4.728   1.00 0.00 ? 27  SER A HB3  4  
ATOM 5418  H HG   . SER A 1 27  ? -5.220  7.218   3.826   1.00 0.00 ? 27  SER A HG   4  
ATOM 5419  N N    . GLY A 1 28  ? -4.341  2.242   2.500   1.00 0.00 ? 28  GLY A N    4  
ATOM 5420  C CA   . GLY A 1 28  ? -3.627  1.018   2.970   1.00 0.00 ? 28  GLY A CA   4  
ATOM 5421  C C    . GLY A 1 28  ? -2.244  0.999   2.333   1.00 0.00 ? 28  GLY A C    4  
ATOM 5422  O O    . GLY A 1 28  ? -1.234  0.808   2.980   1.00 0.00 ? 28  GLY A O    4  
ATOM 5423  H H    . GLY A 1 28  ? -4.741  2.266   1.602   1.00 0.00 ? 28  GLY A H    4  
ATOM 5424  H HA2  . GLY A 1 28  ? -3.533  1.040   4.045   1.00 0.00 ? 28  GLY A HA2  4  
ATOM 5425  H HA3  . GLY A 1 28  ? -4.178  0.139   2.670   1.00 0.00 ? 28  GLY A HA3  4  
ATOM 5426  N N    . ILE A 1 29  ? -2.218  1.211   1.056   1.00 0.00 ? 29  ILE A N    4  
ATOM 5427  C CA   . ILE A 1 29  ? -0.950  1.232   0.295   1.00 0.00 ? 29  ILE A CA   4  
ATOM 5428  C C    . ILE A 1 29  ? 0.005   2.246   0.903   1.00 0.00 ? 29  ILE A C    4  
ATOM 5429  O O    . ILE A 1 29  ? 1.211   2.094   0.864   1.00 0.00 ? 29  ILE A O    4  
ATOM 5430  C CB   . ILE A 1 29  ? -1.294  1.654   -1.120  1.00 0.00 ? 29  ILE A CB   4  
ATOM 5431  C CG1  . ILE A 1 29  ? -0.078  1.551   -2.012  1.00 0.00 ? 29  ILE A CG1  4  
ATOM 5432  C CG2  . ILE A 1 29  ? -1.786  3.098   -1.130  1.00 0.00 ? 29  ILE A CG2  4  
ATOM 5433  C CD1  . ILE A 1 29  ? -0.481  2.046   -3.387  1.00 0.00 ? 29  ILE A CD1  4  
ATOM 5434  H H    . ILE A 1 29  ? -3.058  1.364   0.582   1.00 0.00 ? 29  ILE A H    4  
ATOM 5435  H HA   . ILE A 1 29  ? -0.503  0.258   0.286   1.00 0.00 ? 29  ILE A HA   4  
ATOM 5436  H HB   . ILE A 1 29  ? -2.070  1.018   -1.495  1.00 0.00 ? 29  ILE A HB   4  
ATOM 5437  H HG12 . ILE A 1 29  ? 0.721   2.163   -1.617  1.00 0.00 ? 29  ILE A HG12 4  
ATOM 5438  H HG13 . ILE A 1 29  ? 0.242   0.528   -2.079  1.00 0.00 ? 29  ILE A HG13 4  
ATOM 5439  H HG21 . ILE A 1 29  ? -2.178  3.359   -0.165  1.00 0.00 ? 29  ILE A HG21 4  
ATOM 5440  H HG22 . ILE A 1 29  ? -2.562  3.204   -1.873  1.00 0.00 ? 29  ILE A HG22 4  
ATOM 5441  H HG23 . ILE A 1 29  ? -0.961  3.748   -1.376  1.00 0.00 ? 29  ILE A HG23 4  
ATOM 5442  H HD11 . ILE A 1 29  ? -1.487  2.440   -3.343  1.00 0.00 ? 29  ILE A HD11 4  
ATOM 5443  H HD12 . ILE A 1 29  ? -0.448  1.225   -4.081  1.00 0.00 ? 29  ILE A HD12 4  
ATOM 5444  H HD13 . ILE A 1 29  ? 0.195   2.822   -3.703  1.00 0.00 ? 29  ILE A HD13 4  
ATOM 5445  N N    . TYR A 1 30  ? -0.534  3.284   1.451   1.00 0.00 ? 30  TYR A N    4  
ATOM 5446  C CA   . TYR A 1 30  ? 0.318   4.336   2.058   1.00 0.00 ? 30  TYR A CA   4  
ATOM 5447  C C    . TYR A 1 30  ? 0.966   3.799   3.329   1.00 0.00 ? 30  TYR A C    4  
ATOM 5448  O O    . TYR A 1 30  ? 2.164   3.873   3.497   1.00 0.00 ? 30  TYR A O    4  
ATOM 5449  C CB   . TYR A 1 30  ? -0.555  5.554   2.349   1.00 0.00 ? 30  TYR A CB   4  
ATOM 5450  C CG   . TYR A 1 30  ? -1.312  5.882   1.084   1.00 0.00 ? 30  TYR A CG   4  
ATOM 5451  C CD1  . TYR A 1 30  ? -0.681  5.718   -0.153  1.00 0.00 ? 30  TYR A CD1  4  
ATOM 5452  C CD2  . TYR A 1 30  ? -2.637  6.322   1.138   1.00 0.00 ? 30  TYR A CD2  4  
ATOM 5453  C CE1  . TYR A 1 30  ? -1.367  5.995   -1.338  1.00 0.00 ? 30  TYR A CE1  4  
ATOM 5454  C CE2  . TYR A 1 30  ? -3.327  6.596   -0.049  1.00 0.00 ? 30  TYR A CE2  4  
ATOM 5455  C CZ   . TYR A 1 30  ? -2.692  6.433   -1.286  1.00 0.00 ? 30  TYR A CZ   4  
ATOM 5456  O OH   . TYR A 1 30  ? -3.375  6.699   -2.453  1.00 0.00 ? 30  TYR A OH   4  
ATOM 5457  H H    . TYR A 1 30  ? -1.507  3.374   1.455   1.00 0.00 ? 30  TYR A H    4  
ATOM 5458  H HA   . TYR A 1 30  ? 1.089   4.613   1.358   1.00 0.00 ? 30  TYR A HA   4  
ATOM 5459  H HB2  . TYR A 1 30  ? -1.249  5.325   3.146   1.00 0.00 ? 30  TYR A HB2  4  
ATOM 5460  H HB3  . TYR A 1 30  ? 0.064   6.392   2.630   1.00 0.00 ? 30  TYR A HB3  4  
ATOM 5461  H HD1  . TYR A 1 30  ? 0.337   5.375   -0.193  1.00 0.00 ? 30  TYR A HD1  4  
ATOM 5462  H HD2  . TYR A 1 30  ? -3.126  6.450   2.092   1.00 0.00 ? 30  TYR A HD2  4  
ATOM 5463  H HE1  . TYR A 1 30  ? -0.870  5.864   -2.292  1.00 0.00 ? 30  TYR A HE1  4  
ATOM 5464  H HE2  . TYR A 1 30  ? -4.348  6.930   -0.012  1.00 0.00 ? 30  TYR A HE2  4  
ATOM 5465  H HH   . TYR A 1 30  ? -4.306  6.796   -2.237  1.00 0.00 ? 30  TYR A HH   4  
ATOM 5466  N N    . ALA A 1 31  ? 0.198   3.238   4.213   1.00 0.00 ? 31  ALA A N    4  
ATOM 5467  C CA   . ALA A 1 31  ? 0.794   2.681   5.456   1.00 0.00 ? 31  ALA A CA   4  
ATOM 5468  C C    . ALA A 1 31  ? 1.704   1.502   5.092   1.00 0.00 ? 31  ALA A C    4  
ATOM 5469  O O    . ALA A 1 31  ? 2.527   1.075   5.878   1.00 0.00 ? 31  ALA A O    4  
ATOM 5470  C CB   . ALA A 1 31  ? -0.321  2.200   6.386   1.00 0.00 ? 31  ALA A CB   4  
ATOM 5471  H H    . ALA A 1 31  ? -0.767  3.170   4.054   1.00 0.00 ? 31  ALA A H    4  
ATOM 5472  H HA   . ALA A 1 31  ? 1.375   3.445   5.952   1.00 0.00 ? 31  ALA A HA   4  
ATOM 5473  H HB1  . ALA A 1 31  ? -0.105  1.196   6.720   1.00 0.00 ? 31  ALA A HB1  4  
ATOM 5474  H HB2  . ALA A 1 31  ? -1.261  2.207   5.854   1.00 0.00 ? 31  ALA A HB2  4  
ATOM 5475  H HB3  . ALA A 1 31  ? -0.386  2.857   7.241   1.00 0.00 ? 31  ALA A HB3  4  
ATOM 5476  N N    . HIS A 1 32  ? 1.558   0.968   3.906   1.00 0.00 ? 32  HIS A N    4  
ATOM 5477  C CA   . HIS A 1 32  ? 2.408   -0.185  3.490   1.00 0.00 ? 32  HIS A CA   4  
ATOM 5478  C C    . HIS A 1 32  ? 3.807   0.306   3.091   1.00 0.00 ? 32  HIS A C    4  
ATOM 5479  O O    . HIS A 1 32  ? 4.768   0.138   3.815   1.00 0.00 ? 32  HIS A O    4  
ATOM 5480  C CB   . HIS A 1 32  ? 1.749   -0.885  2.300   1.00 0.00 ? 32  HIS A CB   4  
ATOM 5481  C CG   . HIS A 1 32  ? 2.578   -2.071  1.894   1.00 0.00 ? 32  HIS A CG   4  
ATOM 5482  N ND1  . HIS A 1 32  ? 2.099   -3.368  1.980   1.00 0.00 ? 32  HIS A ND1  4  
ATOM 5483  C CD2  . HIS A 1 32  ? 3.857   -2.175  1.404   1.00 0.00 ? 32  HIS A CD2  4  
ATOM 5484  C CE1  . HIS A 1 32  ? 3.075   -4.189  1.552   1.00 0.00 ? 32  HIS A CE1  4  
ATOM 5485  N NE2  . HIS A 1 32  ? 4.168   -3.513  1.189   1.00 0.00 ? 32  HIS A NE2  4  
ATOM 5486  H H    . HIS A 1 32  ? 0.886   1.323   3.284   1.00 0.00 ? 32  HIS A H    4  
ATOM 5487  H HA   . HIS A 1 32  ? 2.494   -0.881  4.311   1.00 0.00 ? 32  HIS A HA   4  
ATOM 5488  H HB2  . HIS A 1 32  ? 0.760   -1.216  2.581   1.00 0.00 ? 32  HIS A HB2  4  
ATOM 5489  H HB3  . HIS A 1 32  ? 1.673   -0.196  1.470   1.00 0.00 ? 32  HIS A HB3  4  
ATOM 5490  H HD1  . HIS A 1 32  ? 1.211   -3.638  2.294   1.00 0.00 ? 32  HIS A HD1  4  
ATOM 5491  H HD2  . HIS A 1 32  ? 4.520   -1.343  1.217   1.00 0.00 ? 32  HIS A HD2  4  
ATOM 5492  H HE1  . HIS A 1 32  ? 2.985   -5.263  1.510   1.00 0.00 ? 32  HIS A HE1  4  
ATOM 5493  N N    . ILE A 1 33  ? 3.921   0.903   1.936   1.00 0.00 ? 33  ILE A N    4  
ATOM 5494  C CA   . ILE A 1 33  ? 5.244   1.410   1.459   1.00 0.00 ? 33  ILE A CA   4  
ATOM 5495  C C    . ILE A 1 33  ? 5.856   2.359   2.495   1.00 0.00 ? 33  ILE A C    4  
ATOM 5496  O O    . ILE A 1 33  ? 7.044   2.355   2.724   1.00 0.00 ? 33  ILE A O    4  
ATOM 5497  C CB   . ILE A 1 33  ? 5.023   2.145   0.134   1.00 0.00 ? 33  ILE A CB   4  
ATOM 5498  C CG1  . ILE A 1 33  ? 6.338   2.188   -0.661  1.00 0.00 ? 33  ILE A CG1  4  
ATOM 5499  C CG2  . ILE A 1 33  ? 4.506   3.564   0.390   1.00 0.00 ? 33  ILE A CG2  4  
ATOM 5500  C CD1  . ILE A 1 33  ? 7.193   3.380   -0.220  1.00 0.00 ? 33  ILE A CD1  4  
ATOM 5501  H H    . ILE A 1 33  ? 3.127   1.018   1.372   1.00 0.00 ? 33  ILE A H    4  
ATOM 5502  H HA   . ILE A 1 33  ? 5.922   0.579   1.291   1.00 0.00 ? 33  ILE A HA   4  
ATOM 5503  H HB   . ILE A 1 33  ? 4.282   1.609   -0.435  1.00 0.00 ? 33  ILE A HB   4  
ATOM 5504  H HG12 . ILE A 1 33  ? 6.887   1.274   -0.492  1.00 0.00 ? 33  ILE A HG12 4  
ATOM 5505  H HG13 . ILE A 1 33  ? 6.116   2.280   -1.714  1.00 0.00 ? 33  ILE A HG13 4  
ATOM 5506  H HG21 . ILE A 1 33  ? 3.633   3.519   1.025   1.00 0.00 ? 33  ILE A HG21 4  
ATOM 5507  H HG22 . ILE A 1 33  ? 4.244   4.019   -0.551  1.00 0.00 ? 33  ILE A HG22 4  
ATOM 5508  H HG23 . ILE A 1 33  ? 5.275   4.149   0.873   1.00 0.00 ? 33  ILE A HG23 4  
ATOM 5509  H HD11 . ILE A 1 33  ? 7.131   3.491   0.853   1.00 0.00 ? 33  ILE A HD11 4  
ATOM 5510  H HD12 . ILE A 1 33  ? 6.831   4.278   -0.697  1.00 0.00 ? 33  ILE A HD12 4  
ATOM 5511  H HD13 . ILE A 1 33  ? 8.219   3.211   -0.507  1.00 0.00 ? 33  ILE A HD13 4  
ATOM 5512  N N    . THR A 1 34  ? 5.061   3.176   3.118   1.00 0.00 ? 34  THR A N    4  
ATOM 5513  C CA   . THR A 1 34  ? 5.625   4.128   4.125   1.00 0.00 ? 34  THR A CA   4  
ATOM 5514  C C    . THR A 1 34  ? 6.367   3.357   5.222   1.00 0.00 ? 34  THR A C    4  
ATOM 5515  O O    . THR A 1 34  ? 7.315   3.850   5.801   1.00 0.00 ? 34  THR A O    4  
ATOM 5516  C CB   . THR A 1 34  ? 4.498   4.941   4.761   1.00 0.00 ? 34  THR A CB   4  
ATOM 5517  O OG1  . THR A 1 34  ? 3.545   4.058   5.336   1.00 0.00 ? 34  THR A OG1  4  
ATOM 5518  C CG2  . THR A 1 34  ? 3.826   5.808   3.695   1.00 0.00 ? 34  THR A CG2  4  
ATOM 5519  H H    . THR A 1 34  ? 4.102   3.175   2.918   1.00 0.00 ? 34  THR A H    4  
ATOM 5520  H HA   . THR A 1 34  ? 6.314   4.798   3.633   1.00 0.00 ? 34  THR A HA   4  
ATOM 5521  H HB   . THR A 1 34  ? 4.906   5.579   5.530   1.00 0.00 ? 34  THR A HB   4  
ATOM 5522  H HG1  . THR A 1 34  ? 3.282   4.417   6.185   1.00 0.00 ? 34  THR A HG1  4  
ATOM 5523  H HG21 . THR A 1 34  ? 3.892   5.314   2.736   1.00 0.00 ? 34  THR A HG21 4  
ATOM 5524  H HG22 . THR A 1 34  ? 4.323   6.765   3.643   1.00 0.00 ? 34  THR A HG22 4  
ATOM 5525  H HG23 . THR A 1 34  ? 2.787   5.955   3.953   1.00 0.00 ? 34  THR A HG23 4  
ATOM 5526  N N    . LYS A 1 35  ? 5.948   2.159   5.521   1.00 0.00 ? 35  LYS A N    4  
ATOM 5527  C CA   . LYS A 1 35  ? 6.640   1.379   6.588   1.00 0.00 ? 35  LYS A CA   4  
ATOM 5528  C C    . LYS A 1 35  ? 7.834   0.627   5.994   1.00 0.00 ? 35  LYS A C    4  
ATOM 5529  O O    . LYS A 1 35  ? 8.903   0.589   6.570   1.00 0.00 ? 35  LYS A O    4  
ATOM 5530  C CB   . LYS A 1 35  ? 5.665   0.376   7.204   1.00 0.00 ? 35  LYS A CB   4  
ATOM 5531  C CG   . LYS A 1 35  ? 5.315   0.814   8.626   1.00 0.00 ? 35  LYS A CG   4  
ATOM 5532  C CD   . LYS A 1 35  ? 4.163   -0.044  9.156   1.00 0.00 ? 35  LYS A CD   4  
ATOM 5533  C CE   . LYS A 1 35  ? 4.714   -1.380  9.657   1.00 0.00 ? 35  LYS A CE   4  
ATOM 5534  N NZ   . LYS A 1 35  ? 3.632   -2.128  10.359  1.00 0.00 ? 35  LYS A NZ   4  
ATOM 5535  H H    . LYS A 1 35  ? 5.181   1.776   5.050   1.00 0.00 ? 35  LYS A H    4  
ATOM 5536  H HA   . LYS A 1 35  ? 6.990   2.054   7.354   1.00 0.00 ? 35  LYS A HA   4  
ATOM 5537  H HB2  . LYS A 1 35  ? 4.764   0.334   6.606   1.00 0.00 ? 35  LYS A HB2  4  
ATOM 5538  H HB3  . LYS A 1 35  ? 6.122   -0.602  7.232   1.00 0.00 ? 35  LYS A HB3  4  
ATOM 5539  H HG2  . LYS A 1 35  ? 6.179   0.690   9.264   1.00 0.00 ? 35  LYS A HG2  4  
ATOM 5540  H HG3  . LYS A 1 35  ? 5.014   1.852   8.621   1.00 0.00 ? 35  LYS A HG3  4  
ATOM 5541  H HD2  . LYS A 1 35  ? 3.673   0.473   9.968   1.00 0.00 ? 35  LYS A HD2  4  
ATOM 5542  H HD3  . LYS A 1 35  ? 3.454   -0.225  8.362   1.00 0.00 ? 35  LYS A HD3  4  
ATOM 5543  H HE2  . LYS A 1 35  ? 5.068   -1.960  8.818   1.00 0.00 ? 35  LYS A HE2  4  
ATOM 5544  H HE3  . LYS A 1 35  ? 5.529   -1.198  10.341  1.00 0.00 ? 35  LYS A HE3  4  
ATOM 5545  H HZ1  . LYS A 1 35  ? 3.214   -2.823  9.709   1.00 0.00 ? 35  LYS A HZ1  4  
ATOM 5546  H HZ2  . LYS A 1 35  ? 2.898   -1.461  10.676  1.00 0.00 ? 35  LYS A HZ2  4  
ATOM 5547  H HZ3  . LYS A 1 35  ? 4.030   -2.622  11.182  1.00 0.00 ? 35  LYS A HZ3  4  
ATOM 5548  N N    . HIS A 1 36  ? 7.660   0.022   4.851   1.00 0.00 ? 36  HIS A N    4  
ATOM 5549  C CA   . HIS A 1 36  ? 8.786   -0.733  4.233   1.00 0.00 ? 36  HIS A CA   4  
ATOM 5550  C C    . HIS A 1 36  ? 9.676   0.219   3.431   1.00 0.00 ? 36  HIS A C    4  
ATOM 5551  O O    . HIS A 1 36  ? 10.628  -0.194  2.798   1.00 0.00 ? 36  HIS A O    4  
ATOM 5552  C CB   . HIS A 1 36  ? 8.226   -1.816  3.309   1.00 0.00 ? 36  HIS A CB   4  
ATOM 5553  C CG   . HIS A 1 36  ? 8.160   -3.119  4.056   1.00 0.00 ? 36  HIS A CG   4  
ATOM 5554  N ND1  . HIS A 1 36  ? 9.180   -4.055  4.002   1.00 0.00 ? 36  HIS A ND1  4  
ATOM 5555  C CD2  . HIS A 1 36  ? 7.204   -3.654  4.885   1.00 0.00 ? 36  HIS A CD2  4  
ATOM 5556  C CE1  . HIS A 1 36  ? 8.819   -5.093  4.777   1.00 0.00 ? 36  HIS A CE1  4  
ATOM 5557  N NE2  . HIS A 1 36  ? 7.623   -4.901  5.339   1.00 0.00 ? 36  HIS A NE2  4  
ATOM 5558  H H    . HIS A 1 36  ? 6.789   0.058   4.403   1.00 0.00 ? 36  HIS A H    4  
ATOM 5559  H HA   . HIS A 1 36  ? 9.373   -1.199  5.012   1.00 0.00 ? 36  HIS A HA   4  
ATOM 5560  H HB2  . HIS A 1 36  ? 7.235   -1.534  2.984   1.00 0.00 ? 36  HIS A HB2  4  
ATOM 5561  H HB3  . HIS A 1 36  ? 8.870   -1.926  2.450   1.00 0.00 ? 36  HIS A HB3  4  
ATOM 5562  H HD1  . HIS A 1 36  ? 10.013  -3.974  3.492   1.00 0.00 ? 36  HIS A HD1  4  
ATOM 5563  H HD2  . HIS A 1 36  ? 6.271   -3.177  5.147   1.00 0.00 ? 36  HIS A HD2  4  
ATOM 5564  H HE1  . HIS A 1 36  ? 9.423   -5.976  4.927   1.00 0.00 ? 36  HIS A HE1  4  
ATOM 5565  N N    . TYR A 1 37  ? 9.386   1.490   3.459   1.00 0.00 ? 37  TYR A N    4  
ATOM 5566  C CA   . TYR A 1 37  ? 10.226  2.459   2.703   1.00 0.00 ? 37  TYR A CA   4  
ATOM 5567  C C    . TYR A 1 37  ? 10.493  3.685   3.588   1.00 0.00 ? 37  TYR A C    4  
ATOM 5568  O O    . TYR A 1 37  ? 9.567   4.335   4.031   1.00 0.00 ? 37  TYR A O    4  
ATOM 5569  C CB   . TYR A 1 37  ? 9.492   2.880   1.426   1.00 0.00 ? 37  TYR A CB   4  
ATOM 5570  C CG   . TYR A 1 37  ? 10.301  2.464   0.235   1.00 0.00 ? 37  TYR A CG   4  
ATOM 5571  C CD1  . TYR A 1 37  ? 10.289  1.127   -0.155  1.00 0.00 ? 37  TYR A CD1  4  
ATOM 5572  C CD2  . TYR A 1 37  ? 11.063  3.399   -0.470  1.00 0.00 ? 37  TYR A CD2  4  
ATOM 5573  C CE1  . TYR A 1 37  ? 11.037  0.712   -1.252  1.00 0.00 ? 37  TYR A CE1  4  
ATOM 5574  C CE2  . TYR A 1 37  ? 11.818  2.986   -1.570  1.00 0.00 ? 37  TYR A CE2  4  
ATOM 5575  C CZ   . TYR A 1 37  ? 11.808  1.641   -1.964  1.00 0.00 ? 37  TYR A CZ   4  
ATOM 5576  O OH   . TYR A 1 37  ? 12.555  1.234   -3.050  1.00 0.00 ? 37  TYR A OH   4  
ATOM 5577  H H    . TYR A 1 37  ? 8.619   1.810   3.979   1.00 0.00 ? 37  TYR A H    4  
ATOM 5578  H HA   . TYR A 1 37  ? 11.158  1.986   2.439   1.00 0.00 ? 37  TYR A HA   4  
ATOM 5579  H HB2  . TYR A 1 37  ? 8.539   2.382   1.379   1.00 0.00 ? 37  TYR A HB2  4  
ATOM 5580  H HB3  . TYR A 1 37  ? 9.351   3.950   1.415   1.00 0.00 ? 37  TYR A HB3  4  
ATOM 5581  H HD1  . TYR A 1 37  ? 9.692   0.414   0.392   1.00 0.00 ? 37  TYR A HD1  4  
ATOM 5582  H HD2  . TYR A 1 37  ? 11.066  4.437   -0.168  1.00 0.00 ? 37  TYR A HD2  4  
ATOM 5583  H HE1  . TYR A 1 37  ? 11.023  -0.324  -1.546  1.00 0.00 ? 37  TYR A HE1  4  
ATOM 5584  H HE2  . TYR A 1 37  ? 12.407  3.701   -2.116  1.00 0.00 ? 37  TYR A HE2  4  
ATOM 5585  H HH   . TYR A 1 37  ? 13.479  1.230   -2.790  1.00 0.00 ? 37  TYR A HH   4  
ATOM 5586  N N    . PRO A 1 38  ? 11.753  3.956   3.837   1.00 0.00 ? 38  PRO A N    4  
ATOM 5587  C CA   . PRO A 1 38  ? 12.165  5.089   4.686   1.00 0.00 ? 38  PRO A CA   4  
ATOM 5588  C C    . PRO A 1 38  ? 12.056  6.414   3.925   1.00 0.00 ? 38  PRO A C    4  
ATOM 5589  O O    . PRO A 1 38  ? 12.232  7.476   4.488   1.00 0.00 ? 38  PRO A O    4  
ATOM 5590  C CB   . PRO A 1 38  ? 13.625  4.772   5.025   1.00 0.00 ? 38  PRO A CB   4  
ATOM 5591  C CG   . PRO A 1 38  ? 14.131  3.810   3.924   1.00 0.00 ? 38  PRO A CG   4  
ATOM 5592  C CD   . PRO A 1 38  ? 12.881  3.169   3.294   1.00 0.00 ? 38  PRO A CD   4  
ATOM 5593  H HA   . PRO A 1 38  ? 11.579  5.119   5.590   1.00 0.00 ? 38  PRO A HA   4  
ATOM 5594  H HB2  . PRO A 1 38  ? 14.211  5.682   5.026   1.00 0.00 ? 38  PRO A HB2  4  
ATOM 5595  H HB3  . PRO A 1 38  ? 13.687  4.287   5.987   1.00 0.00 ? 38  PRO A HB3  4  
ATOM 5596  H HG2  . PRO A 1 38  ? 14.685  4.363   3.177   1.00 0.00 ? 38  PRO A HG2  4  
ATOM 5597  H HG3  . PRO A 1 38  ? 14.754  3.044   4.358   1.00 0.00 ? 38  PRO A HG3  4  
ATOM 5598  H HD2  . PRO A 1 38  ? 12.918  3.251   2.215   1.00 0.00 ? 38  PRO A HD2  4  
ATOM 5599  H HD3  . PRO A 1 38  ? 12.792  2.136   3.593   1.00 0.00 ? 38  PRO A HD3  4  
ATOM 5600  N N    . TYR A 1 39  ? 11.765  6.365   2.655   1.00 0.00 ? 39  TYR A N    4  
ATOM 5601  C CA   . TYR A 1 39  ? 11.646  7.629   1.878   1.00 0.00 ? 39  TYR A CA   4  
ATOM 5602  C C    . TYR A 1 39  ? 10.193  8.112   1.910   1.00 0.00 ? 39  TYR A C    4  
ATOM 5603  O O    . TYR A 1 39  ? 9.924   9.297   1.922   1.00 0.00 ? 39  TYR A O    4  
ATOM 5604  C CB   . TYR A 1 39  ? 12.071  7.383   0.428   1.00 0.00 ? 39  TYR A CB   4  
ATOM 5605  C CG   . TYR A 1 39  ? 12.203  8.706   -0.291  1.00 0.00 ? 39  TYR A CG   4  
ATOM 5606  C CD1  . TYR A 1 39  ? 11.070  9.498   -0.512  1.00 0.00 ? 39  TYR A CD1  4  
ATOM 5607  C CD2  . TYR A 1 39  ? 13.457  9.142   -0.734  1.00 0.00 ? 39  TYR A CD2  4  
ATOM 5608  C CE1  . TYR A 1 39  ? 11.190  10.723  -1.175  1.00 0.00 ? 39  TYR A CE1  4  
ATOM 5609  C CE2  . TYR A 1 39  ? 13.577  10.369  -1.399  1.00 0.00 ? 39  TYR A CE2  4  
ATOM 5610  C CZ   . TYR A 1 39  ? 12.443  11.159  -1.619  1.00 0.00 ? 39  TYR A CZ   4  
ATOM 5611  O OH   . TYR A 1 39  ? 12.564  12.367  -2.276  1.00 0.00 ? 39  TYR A OH   4  
ATOM 5612  H H    . TYR A 1 39  ? 11.626  5.500   2.216   1.00 0.00 ? 39  TYR A H    4  
ATOM 5613  H HA   . TYR A 1 39  ? 12.285  8.382   2.317   1.00 0.00 ? 39  TYR A HA   4  
ATOM 5614  H HB2  . TYR A 1 39  ? 13.021  6.869   0.414   1.00 0.00 ? 39  TYR A HB2  4  
ATOM 5615  H HB3  . TYR A 1 39  ? 11.325  6.778   -0.068  1.00 0.00 ? 39  TYR A HB3  4  
ATOM 5616  H HD1  . TYR A 1 39  ? 10.102  9.164   -0.173  1.00 0.00 ? 39  TYR A HD1  4  
ATOM 5617  H HD2  . TYR A 1 39  ? 14.332  8.532   -0.567  1.00 0.00 ? 39  TYR A HD2  4  
ATOM 5618  H HE1  . TYR A 1 39  ? 10.314  11.333  -1.346  1.00 0.00 ? 39  TYR A HE1  4  
ATOM 5619  H HE2  . TYR A 1 39  ? 14.544  10.705  -1.741  1.00 0.00 ? 39  TYR A HE2  4  
ATOM 5620  H HH   . TYR A 1 39  ? 13.064  12.216  -3.081  1.00 0.00 ? 39  TYR A HH   4  
ATOM 5621  N N    . TYR A 1 40  ? 9.257   7.204   1.913   1.00 0.00 ? 40  TYR A N    4  
ATOM 5622  C CA   . TYR A 1 40  ? 7.822   7.609   1.932   1.00 0.00 ? 40  TYR A CA   4  
ATOM 5623  C C    . TYR A 1 40  ? 7.329   7.734   3.375   1.00 0.00 ? 40  TYR A C    4  
ATOM 5624  O O    . TYR A 1 40  ? 6.154   7.919   3.622   1.00 0.00 ? 40  TYR A O    4  
ATOM 5625  C CB   . TYR A 1 40  ? 6.992   6.557   1.193   1.00 0.00 ? 40  TYR A CB   4  
ATOM 5626  C CG   . TYR A 1 40  ? 6.809   6.966   -0.254  1.00 0.00 ? 40  TYR A CG   4  
ATOM 5627  C CD1  . TYR A 1 40  ? 7.622   7.957   -0.822  1.00 0.00 ? 40  TYR A CD1  4  
ATOM 5628  C CD2  . TYR A 1 40  ? 5.817   6.353   -1.027  1.00 0.00 ? 40  TYR A CD2  4  
ATOM 5629  C CE1  . TYR A 1 40  ? 7.440   8.331   -2.159  1.00 0.00 ? 40  TYR A CE1  4  
ATOM 5630  C CE2  . TYR A 1 40  ? 5.639   6.726   -2.365  1.00 0.00 ? 40  TYR A CE2  4  
ATOM 5631  C CZ   . TYR A 1 40  ? 6.450   7.715   -2.931  1.00 0.00 ? 40  TYR A CZ   4  
ATOM 5632  O OH   . TYR A 1 40  ? 6.272   8.085   -4.248  1.00 0.00 ? 40  TYR A OH   4  
ATOM 5633  H H    . TYR A 1 40  ? 9.495   6.255   1.896   1.00 0.00 ? 40  TYR A H    4  
ATOM 5634  H HA   . TYR A 1 40  ? 7.711   8.562   1.439   1.00 0.00 ? 40  TYR A HA   4  
ATOM 5635  H HB2  . TYR A 1 40  ? 7.500   5.606   1.236   1.00 0.00 ? 40  TYR A HB2  4  
ATOM 5636  H HB3  . TYR A 1 40  ? 6.025   6.468   1.665   1.00 0.00 ? 40  TYR A HB3  4  
ATOM 5637  H HD1  . TYR A 1 40  ? 8.391   8.430   -0.232  1.00 0.00 ? 40  TYR A HD1  4  
ATOM 5638  H HD2  . TYR A 1 40  ? 5.192   5.590   -0.592  1.00 0.00 ? 40  TYR A HD2  4  
ATOM 5639  H HE1  . TYR A 1 40  ? 8.065   9.096   -2.593  1.00 0.00 ? 40  TYR A HE1  4  
ATOM 5640  H HE2  . TYR A 1 40  ? 4.875   6.249   -2.962  1.00 0.00 ? 40  TYR A HE2  4  
ATOM 5641  H HH   . TYR A 1 40  ? 5.345   8.306   -4.372  1.00 0.00 ? 40  TYR A HH   4  
ATOM 5642  N N    . ARG A 1 41  ? 8.211   7.645   4.332   1.00 0.00 ? 41  ARG A N    4  
ATOM 5643  C CA   . ARG A 1 41  ? 7.774   7.774   5.750   1.00 0.00 ? 41  ARG A CA   4  
ATOM 5644  C C    . ARG A 1 41  ? 7.214   9.181   5.967   1.00 0.00 ? 41  ARG A C    4  
ATOM 5645  O O    . ARG A 1 41  ? 6.274   9.381   6.711   1.00 0.00 ? 41  ARG A O    4  
ATOM 5646  C CB   . ARG A 1 41  ? 8.971   7.551   6.676   1.00 0.00 ? 41  ARG A CB   4  
ATOM 5647  C CG   . ARG A 1 41  ? 9.998   8.664   6.461   1.00 0.00 ? 41  ARG A CG   4  
ATOM 5648  C CD   . ARG A 1 41  ? 11.224  8.404   7.337   1.00 0.00 ? 41  ARG A CD   4  
ATOM 5649  N NE   . ARG A 1 41  ? 10.974  8.931   8.708   1.00 0.00 ? 41  ARG A NE   4  
ATOM 5650  C CZ   . ARG A 1 41  ? 11.945  9.482   9.382   1.00 0.00 ? 41  ARG A CZ   4  
ATOM 5651  N NH1  . ARG A 1 41  ? 12.795  8.733   10.031  1.00 0.00 ? 41  ARG A NH1  4  
ATOM 5652  N NH2  . ARG A 1 41  ? 12.069  10.781  9.405   1.00 0.00 ? 41  ARG A NH2  4  
ATOM 5653  H H    . ARG A 1 41  ? 9.157   7.504   4.118   1.00 0.00 ? 41  ARG A H    4  
ATOM 5654  H HA   . ARG A 1 41  ? 7.009   7.041   5.962   1.00 0.00 ? 41  ARG A HA   4  
ATOM 5655  H HB2  . ARG A 1 41  ? 8.636   7.563   7.704   1.00 0.00 ? 41  ARG A HB2  4  
ATOM 5656  H HB3  . ARG A 1 41  ? 9.426   6.596   6.455   1.00 0.00 ? 41  ARG A HB3  4  
ATOM 5657  H HG2  . ARG A 1 41  ? 10.294  8.684   5.421   1.00 0.00 ? 41  ARG A HG2  4  
ATOM 5658  H HG3  . ARG A 1 41  ? 9.561   9.614   6.730   1.00 0.00 ? 41  ARG A HG3  4  
ATOM 5659  H HD2  . ARG A 1 41  ? 11.409  7.341   7.390   1.00 0.00 ? 41  ARG A HD2  4  
ATOM 5660  H HD3  . ARG A 1 41  ? 12.084  8.899   6.911   1.00 0.00 ? 41  ARG A HD3  4  
ATOM 5661  H HE   . ARG A 1 41  ? 10.080  8.866   9.103   1.00 0.00 ? 41  ARG A HE   4  
ATOM 5662  H HH11 . ARG A 1 41  ? 12.701  7.738   10.012  1.00 0.00 ? 41  ARG A HH11 4  
ATOM 5663  H HH12 . ARG A 1 41  ? 13.539  9.156   10.549  1.00 0.00 ? 41  ARG A HH12 4  
ATOM 5664  H HH21 . ARG A 1 41  ? 11.418  11.353  8.906   1.00 0.00 ? 41  ARG A HH21 4  
ATOM 5665  H HH22 . ARG A 1 41  ? 12.813  11.203  9.923   1.00 0.00 ? 41  ARG A HH22 4  
ATOM 5666  N N    . THR A 1 42  ? 7.785   10.156  5.315   1.00 0.00 ? 42  THR A N    4  
ATOM 5667  C CA   . THR A 1 42  ? 7.294   11.555  5.466   1.00 0.00 ? 42  THR A CA   4  
ATOM 5668  C C    . THR A 1 42  ? 7.284   12.226  4.091   1.00 0.00 ? 42  THR A C    4  
ATOM 5669  O O    . THR A 1 42  ? 8.222   12.900  3.713   1.00 0.00 ? 42  THR A O    4  
ATOM 5670  C CB   . THR A 1 42  ? 8.227   12.324  6.403   1.00 0.00 ? 42  THR A CB   4  
ATOM 5671  O OG1  . THR A 1 42  ? 9.553   12.274  5.895   1.00 0.00 ? 42  THR A OG1  4  
ATOM 5672  C CG2  . THR A 1 42  ? 8.190   11.694  7.797   1.00 0.00 ? 42  THR A CG2  4  
ATOM 5673  H H    . THR A 1 42  ? 8.539   9.965   4.717   1.00 0.00 ? 42  THR A H    4  
ATOM 5674  H HA   . THR A 1 42  ? 6.294   11.545  5.873   1.00 0.00 ? 42  THR A HA   4  
ATOM 5675  H HB   . THR A 1 42  ? 7.904   13.352  6.468   1.00 0.00 ? 42  THR A HB   4  
ATOM 5676  H HG1  . THR A 1 42  ? 9.704   13.072  5.383   1.00 0.00 ? 42  THR A HG1  4  
ATOM 5677  H HG21 . THR A 1 42  ? 8.012   12.463  8.534   1.00 0.00 ? 42  THR A HG21 4  
ATOM 5678  H HG22 . THR A 1 42  ? 9.134   11.212  7.999   1.00 0.00 ? 42  THR A HG22 4  
ATOM 5679  H HG23 . THR A 1 42  ? 7.396   10.963  7.840   1.00 0.00 ? 42  THR A HG23 4  
ATOM 5680  N N    . ALA A 1 43  ? 6.238   12.036  3.335   1.00 0.00 ? 43  ALA A N    4  
ATOM 5681  C CA   . ALA A 1 43  ? 6.180   12.652  1.980   1.00 0.00 ? 43  ALA A CA   4  
ATOM 5682  C C    . ALA A 1 43  ? 4.972   13.587  1.881   1.00 0.00 ? 43  ALA A C    4  
ATOM 5683  O O    . ALA A 1 43  ? 4.319   13.885  2.860   1.00 0.00 ? 43  ALA A O    4  
ATOM 5684  C CB   . ALA A 1 43  ? 6.052   11.548  0.930   1.00 0.00 ? 43  ALA A CB   4  
ATOM 5685  H H    . ALA A 1 43  ? 5.497   11.481  3.654   1.00 0.00 ? 43  ALA A H    4  
ATOM 5686  H HA   . ALA A 1 43  ? 7.084   13.213  1.801   1.00 0.00 ? 43  ALA A HA   4  
ATOM 5687  H HB1  . ALA A 1 43  ? 6.378   10.609  1.354   1.00 0.00 ? 43  ALA A HB1  4  
ATOM 5688  H HB2  . ALA A 1 43  ? 6.666   11.790  0.075   1.00 0.00 ? 43  ALA A HB2  4  
ATOM 5689  H HB3  . ALA A 1 43  ? 5.021   11.464  0.621   1.00 0.00 ? 43  ALA A HB3  4  
ATOM 5690  N N    . ASP A 1 44  ? 4.676   14.050  0.697   1.00 0.00 ? 44  ASP A N    4  
ATOM 5691  C CA   . ASP A 1 44  ? 3.514   14.966  0.516   1.00 0.00 ? 44  ASP A CA   4  
ATOM 5692  C C    . ASP A 1 44  ? 2.342   14.185  -0.083  1.00 0.00 ? 44  ASP A C    4  
ATOM 5693  O O    . ASP A 1 44  ? 2.466   13.021  -0.413  1.00 0.00 ? 44  ASP A O    4  
ATOM 5694  C CB   . ASP A 1 44  ? 3.912   16.094  -0.438  1.00 0.00 ? 44  ASP A CB   4  
ATOM 5695  C CG   . ASP A 1 44  ? 5.041   16.917  0.184   1.00 0.00 ? 44  ASP A CG   4  
ATOM 5696  O OD1  . ASP A 1 44  ? 5.955   16.317  0.727   1.00 0.00 ? 44  ASP A OD1  4  
ATOM 5697  O OD2  . ASP A 1 44  ? 4.973   18.133  0.109   1.00 0.00 ? 44  ASP A OD2  4  
ATOM 5698  H H    . ASP A 1 44  ? 5.219   13.793  -0.078  1.00 0.00 ? 44  ASP A H    4  
ATOM 5699  H HA   . ASP A 1 44  ? 3.226   15.381  1.470   1.00 0.00 ? 44  ASP A HA   4  
ATOM 5700  H HB2  . ASP A 1 44  ? 4.248   15.667  -1.373  1.00 0.00 ? 44  ASP A HB2  4  
ATOM 5701  H HB3  . ASP A 1 44  ? 3.061   16.733  -0.618  1.00 0.00 ? 44  ASP A HB3  4  
ATOM 5702  N N    . LYS A 1 45  ? 1.206   14.811  -0.229  1.00 0.00 ? 45  LYS A N    4  
ATOM 5703  C CA   . LYS A 1 45  ? 0.033   14.100  -0.811  1.00 0.00 ? 45  LYS A CA   4  
ATOM 5704  C C    . LYS A 1 45  ? 0.109   14.156  -2.339  1.00 0.00 ? 45  LYS A C    4  
ATOM 5705  O O    . LYS A 1 45  ? -0.708  14.779  -2.989  1.00 0.00 ? 45  LYS A O    4  
ATOM 5706  C CB   . LYS A 1 45  ? -1.257  14.775  -0.341  1.00 0.00 ? 45  LYS A CB   4  
ATOM 5707  C CG   . LYS A 1 45  ? -1.246  14.901  1.183   1.00 0.00 ? 45  LYS A CG   4  
ATOM 5708  C CD   . LYS A 1 45  ? -2.684  14.965  1.701   1.00 0.00 ? 45  LYS A CD   4  
ATOM 5709  C CE   . LYS A 1 45  ? -2.694  14.740  3.214   1.00 0.00 ? 45  LYS A CE   4  
ATOM 5710  N NZ   . LYS A 1 45  ? -3.735  13.732  3.561   1.00 0.00 ? 45  LYS A NZ   4  
ATOM 5711  H H    . LYS A 1 45  ? 1.125   15.749  0.042   1.00 0.00 ? 45  LYS A H    4  
ATOM 5712  H HA   . LYS A 1 45  ? 0.039   13.070  -0.487  1.00 0.00 ? 45  LYS A HA   4  
ATOM 5713  H HB2  . LYS A 1 45  ? -1.330  15.758  -0.785  1.00 0.00 ? 45  LYS A HB2  4  
ATOM 5714  H HB3  . LYS A 1 45  ? -2.105  14.181  -0.646  1.00 0.00 ? 45  LYS A HB3  4  
ATOM 5715  H HG2  . LYS A 1 45  ? -0.746  14.044  1.612   1.00 0.00 ? 45  LYS A HG2  4  
ATOM 5716  H HG3  . LYS A 1 45  ? -0.722  15.801  1.467   1.00 0.00 ? 45  LYS A HG3  4  
ATOM 5717  H HD2  . LYS A 1 45  ? -3.105  15.936  1.478   1.00 0.00 ? 45  LYS A HD2  4  
ATOM 5718  H HD3  . LYS A 1 45  ? -3.274  14.200  1.222   1.00 0.00 ? 45  LYS A HD3  4  
ATOM 5719  H HE2  . LYS A 1 45  ? -1.726  14.381  3.530   1.00 0.00 ? 45  LYS A HE2  4  
ATOM 5720  H HE3  . LYS A 1 45  ? -2.913  15.671  3.715   1.00 0.00 ? 45  LYS A HE3  4  
ATOM 5721  H HZ1  . LYS A 1 45  ? -3.786  13.626  4.593   1.00 0.00 ? 45  LYS A HZ1  4  
ATOM 5722  H HZ2  . LYS A 1 45  ? -3.489  12.818  3.130   1.00 0.00 ? 45  LYS A HZ2  4  
ATOM 5723  H HZ3  . LYS A 1 45  ? -4.658  14.048  3.201   1.00 0.00 ? 45  LYS A HZ3  4  
ATOM 5724  N N    . GLY A 1 46  ? 1.081   13.507  -2.920  1.00 0.00 ? 46  GLY A N    4  
ATOM 5725  C CA   . GLY A 1 46  ? 1.205   13.521  -4.406  1.00 0.00 ? 46  GLY A CA   4  
ATOM 5726  C C    . GLY A 1 46  ? 0.899   12.123  -4.946  1.00 0.00 ? 46  GLY A C    4  
ATOM 5727  O O    . GLY A 1 46  ? -0.122  11.895  -5.562  1.00 0.00 ? 46  GLY A O    4  
ATOM 5728  H H    . GLY A 1 46  ? 1.728   13.008  -2.379  1.00 0.00 ? 46  GLY A H    4  
ATOM 5729  H HA2  . GLY A 1 46  ? 0.504   14.231  -4.820  1.00 0.00 ? 46  GLY A HA2  4  
ATOM 5730  H HA3  . GLY A 1 46  ? 2.212   13.802  -4.682  1.00 0.00 ? 46  GLY A HA3  4  
ATOM 5731  N N    . TRP A 1 47  ? 1.782   11.189  -4.724  1.00 0.00 ? 47  TRP A N    4  
ATOM 5732  C CA   . TRP A 1 47  ? 1.551   9.805   -5.222  1.00 0.00 ? 47  TRP A CA   4  
ATOM 5733  C C    . TRP A 1 47  ? 0.270   9.236   -4.626  1.00 0.00 ? 47  TRP A C    4  
ATOM 5734  O O    . TRP A 1 47  ? -0.453  8.518   -5.280  1.00 0.00 ? 47  TRP A O    4  
ATOM 5735  C CB   . TRP A 1 47  ? 2.717   8.906   -4.818  1.00 0.00 ? 47  TRP A CB   4  
ATOM 5736  C CG   . TRP A 1 47  ? 2.780   8.768   -3.324  1.00 0.00 ? 47  TRP A CG   4  
ATOM 5737  C CD1  . TRP A 1 47  ? 2.973   9.787   -2.452  1.00 0.00 ? 47  TRP A CD1  4  
ATOM 5738  C CD2  . TRP A 1 47  ? 2.668   7.560   -2.514  1.00 0.00 ? 47  TRP A CD2  4  
ATOM 5739  N NE1  . TRP A 1 47  ? 3.014   9.281   -1.169  1.00 0.00 ? 47  TRP A NE1  4  
ATOM 5740  C CE2  . TRP A 1 47  ? 2.831   7.915   -1.152  1.00 0.00 ? 47  TRP A CE2  4  
ATOM 5741  C CE3  . TRP A 1 47  ? 2.452   6.204   -2.821  1.00 0.00 ? 47  TRP A CE3  4  
ATOM 5742  C CZ2  . TRP A 1 47  ? 2.788   6.963   -0.137  1.00 0.00 ? 47  TRP A CZ2  4  
ATOM 5743  C CZ3  . TRP A 1 47  ? 2.406   5.243   -1.799  1.00 0.00 ? 47  TRP A CZ3  4  
ATOM 5744  C CH2  . TRP A 1 47  ? 2.579   5.623   -0.462  1.00 0.00 ? 47  TRP A CH2  4  
ATOM 5745  H H    . TRP A 1 47  ? 2.603   11.401  -4.237  1.00 0.00 ? 47  TRP A H    4  
ATOM 5746  H HA   . TRP A 1 47  ? 1.470   9.821   -6.299  1.00 0.00 ? 47  TRP A HA   4  
ATOM 5747  H HB2  . TRP A 1 47  ? 2.581   7.929   -5.258  1.00 0.00 ? 47  TRP A HB2  4  
ATOM 5748  H HB3  . TRP A 1 47  ? 3.640   9.335   -5.177  1.00 0.00 ? 47  TRP A HB3  4  
ATOM 5749  H HD1  . TRP A 1 47  ? 3.084   10.820  -2.711  1.00 0.00 ? 47  TRP A HD1  4  
ATOM 5750  H HE1  . TRP A 1 47  ? 3.154   9.814   -0.357  1.00 0.00 ? 47  TRP A HE1  4  
ATOM 5751  H HE3  . TRP A 1 47  ? 2.301   5.900   -3.846  1.00 0.00 ? 47  TRP A HE3  4  
ATOM 5752  H HZ2  . TRP A 1 47  ? 2.922   7.259   0.894   1.00 0.00 ? 47  TRP A HZ2  4  
ATOM 5753  H HZ3  . TRP A 1 47  ? 2.245   4.205   -2.045  1.00 0.00 ? 47  TRP A HZ3  4  
ATOM 5754  H HH2  . TRP A 1 47  ? 2.546   4.878   0.318   1.00 0.00 ? 47  TRP A HH2  4  
ATOM 5755  N N    . GLN A 1 48  ? -0.017  9.526   -3.389  1.00 0.00 ? 48  GLN A N    4  
ATOM 5756  C CA   . GLN A 1 48  ? -1.252  8.964   -2.787  1.00 0.00 ? 48  GLN A CA   4  
ATOM 5757  C C    . GLN A 1 48  ? -2.449  9.317   -3.692  1.00 0.00 ? 48  GLN A C    4  
ATOM 5758  O O    . GLN A 1 48  ? -3.441  8.618   -3.732  1.00 0.00 ? 48  GLN A O    4  
ATOM 5759  C CB   . GLN A 1 48  ? -1.422  9.506   -1.344  1.00 0.00 ? 48  GLN A CB   4  
ATOM 5760  C CG   . GLN A 1 48  ? -2.728  10.300  -1.176  1.00 0.00 ? 48  GLN A CG   4  
ATOM 5761  C CD   . GLN A 1 48  ? -2.693  11.547  -2.058  1.00 0.00 ? 48  GLN A CD   4  
ATOM 5762  O OE1  . GLN A 1 48  ? -3.710  12.173  -2.284  1.00 0.00 ? 48  GLN A OE1  4  
ATOM 5763  N NE2  . GLN A 1 48  ? -1.560  11.941  -2.569  1.00 0.00 ? 48  GLN A NE2  4  
ATOM 5764  H H    . GLN A 1 48  ? 0.580   10.096  -2.860  1.00 0.00 ? 48  GLN A H    4  
ATOM 5765  H HA   . GLN A 1 48  ? -1.146  7.891   -2.751  1.00 0.00 ? 48  GLN A HA   4  
ATOM 5766  H HB2  . GLN A 1 48  ? -1.428  8.675   -0.653  1.00 0.00 ? 48  GLN A HB2  4  
ATOM 5767  H HB3  . GLN A 1 48  ? -0.585  10.146  -1.108  1.00 0.00 ? 48  GLN A HB3  4  
ATOM 5768  H HG2  . GLN A 1 48  ? -3.564  9.679   -1.463  1.00 0.00 ? 48  GLN A HG2  4  
ATOM 5769  H HG3  . GLN A 1 48  ? -2.838  10.595  -0.143  1.00 0.00 ? 48  GLN A HG3  4  
ATOM 5770  H HE21 . GLN A 1 48  ? -0.737  11.448  -2.382  1.00 0.00 ? 48  GLN A HE21 4  
ATOM 5771  H HE22 . GLN A 1 48  ? -1.539  12.708  -3.166  1.00 0.00 ? 48  GLN A HE22 4  
ATOM 5772  N N    . ASN A 1 49  ? -2.348  10.392  -4.432  1.00 0.00 ? 49  ASN A N    4  
ATOM 5773  C CA   . ASN A 1 49  ? -3.455  10.786  -5.349  1.00 0.00 ? 49  ASN A CA   4  
ATOM 5774  C C    . ASN A 1 49  ? -3.439  9.868   -6.566  1.00 0.00 ? 49  ASN A C    4  
ATOM 5775  O O    . ASN A 1 49  ? -4.408  9.204   -6.875  1.00 0.00 ? 49  ASN A O    4  
ATOM 5776  C CB   . ASN A 1 49  ? -3.256  12.235  -5.802  1.00 0.00 ? 49  ASN A CB   4  
ATOM 5777  C CG   . ASN A 1 49  ? -4.216  13.145  -5.035  1.00 0.00 ? 49  ASN A CG   4  
ATOM 5778  O OD1  . ASN A 1 49  ? -5.374  12.820  -4.863  1.00 0.00 ? 49  ASN A OD1  4  
ATOM 5779  N ND2  . ASN A 1 49  ? -3.779  14.279  -4.562  1.00 0.00 ? 49  ASN A ND2  4  
ATOM 5780  H H    . ASN A 1 49  ? -1.532  10.926  -4.404  1.00 0.00 ? 49  ASN A H    4  
ATOM 5781  H HA   . ASN A 1 49  ? -4.402  10.691  -4.841  1.00 0.00 ? 49  ASN A HA   4  
ATOM 5782  H HB2  . ASN A 1 49  ? -2.238  12.536  -5.604  1.00 0.00 ? 49  ASN A HB2  4  
ATOM 5783  H HB3  . ASN A 1 49  ? -3.457  12.313  -6.859  1.00 0.00 ? 49  ASN A HB3  4  
ATOM 5784  H HD21 . ASN A 1 49  ? -2.846  14.540  -4.700  1.00 0.00 ? 49  ASN A HD21 4  
ATOM 5785  H HD22 . ASN A 1 49  ? -4.386  14.870  -4.068  1.00 0.00 ? 49  ASN A HD22 4  
ATOM 5786  N N    . SER A 1 50  ? -2.333  9.830   -7.256  1.00 0.00 ? 50  SER A N    4  
ATOM 5787  C CA   . SER A 1 50  ? -2.229  8.959   -8.456  1.00 0.00 ? 50  SER A CA   4  
ATOM 5788  C C    . SER A 1 50  ? -2.355  7.495   -8.034  1.00 0.00 ? 50  SER A C    4  
ATOM 5789  O O    . SER A 1 50  ? -2.484  6.616   -8.857  1.00 0.00 ? 50  SER A O    4  
ATOM 5790  C CB   . SER A 1 50  ? -0.875  9.178   -9.136  1.00 0.00 ? 50  SER A CB   4  
ATOM 5791  O OG   . SER A 1 50  ? -0.254  10.337  -8.594  1.00 0.00 ? 50  SER A OG   4  
ATOM 5792  H H    . SER A 1 50  ? -1.568  10.375  -6.979  1.00 0.00 ? 50  SER A H    4  
ATOM 5793  H HA   . SER A 1 50  ? -3.022  9.203   -9.148  1.00 0.00 ? 50  SER A HA   4  
ATOM 5794  H HB2  . SER A 1 50  ? -0.241  8.324   -8.965  1.00 0.00 ? 50  SER A HB2  4  
ATOM 5795  H HB3  . SER A 1 50  ? -1.026  9.303   -10.198 1.00 0.00 ? 50  SER A HB3  4  
ATOM 5796  H HG   . SER A 1 50  ? 0.388   10.051  -7.940  1.00 0.00 ? 50  SER A HG   4  
ATOM 5797  N N    . ILE A 1 51  ? -2.325  7.229   -6.756  1.00 0.00 ? 51  ILE A N    4  
ATOM 5798  C CA   . ILE A 1 51  ? -2.449  5.822   -6.278  1.00 0.00 ? 51  ILE A CA   4  
ATOM 5799  C C    . ILE A 1 51  ? -3.905  5.378   -6.439  1.00 0.00 ? 51  ILE A C    4  
ATOM 5800  O O    . ILE A 1 51  ? -4.207  4.526   -7.241  1.00 0.00 ? 51  ILE A O    4  
ATOM 5801  C CB   . ILE A 1 51  ? -2.024  5.750   -4.791  1.00 0.00 ? 51  ILE A CB   4  
ATOM 5802  C CG1  . ILE A 1 51  ? -0.495  5.563   -4.629  1.00 0.00 ? 51  ILE A CG1  4  
ATOM 5803  C CG2  . ILE A 1 51  ? -2.721  4.573   -4.099  1.00 0.00 ? 51  ILE A CG2  4  
ATOM 5804  C CD1  . ILE A 1 51  ? 0.177   5.116   -5.933  1.00 0.00 ? 51  ILE A CD1  4  
ATOM 5805  H H    . ILE A 1 51  ? -2.227  7.954   -6.109  1.00 0.00 ? 51  ILE A H    4  
ATOM 5806  H HA   . ILE A 1 51  ? -1.822  5.179   -6.875  1.00 0.00 ? 51  ILE A HA   4  
ATOM 5807  H HB   . ILE A 1 51  ? -2.319  6.677   -4.301  1.00 0.00 ? 51  ILE A HB   4  
ATOM 5808  H HG12 . ILE A 1 51  ? -0.059  6.493   -4.314  1.00 0.00 ? 51  ILE A HG12 4  
ATOM 5809  H HG13 . ILE A 1 51  ? -0.315  4.818   -3.868  1.00 0.00 ? 51  ILE A HG13 4  
ATOM 5810  H HG21 . ILE A 1 51  ? -2.085  4.197   -3.314  1.00 0.00 ? 51  ILE A HG21 4  
ATOM 5811  H HG22 . ILE A 1 51  ? -2.906  3.788   -4.819  1.00 0.00 ? 51  ILE A HG22 4  
ATOM 5812  H HG23 . ILE A 1 51  ? -3.659  4.903   -3.678  1.00 0.00 ? 51  ILE A HG23 4  
ATOM 5813  H HD11 . ILE A 1 51  ? 0.139   5.921   -6.651  1.00 0.00 ? 51  ILE A HD11 4  
ATOM 5814  H HD12 . ILE A 1 51  ? -0.341  4.257   -6.328  1.00 0.00 ? 51  ILE A HD12 4  
ATOM 5815  H HD13 . ILE A 1 51  ? 1.205   4.856   -5.735  1.00 0.00 ? 51  ILE A HD13 4  
ATOM 5816  N N    . ARG A 1 52  ? -4.809  5.948   -5.689  1.00 0.00 ? 52  ARG A N    4  
ATOM 5817  C CA   . ARG A 1 52  ? -6.239  5.543   -5.821  1.00 0.00 ? 52  ARG A CA   4  
ATOM 5818  C C    . ARG A 1 52  ? -6.640  5.591   -7.296  1.00 0.00 ? 52  ARG A C    4  
ATOM 5819  O O    . ARG A 1 52  ? -7.398  4.770   -7.773  1.00 0.00 ? 52  ARG A O    4  
ATOM 5820  C CB   . ARG A 1 52  ? -7.121  6.509   -5.025  1.00 0.00 ? 52  ARG A CB   4  
ATOM 5821  C CG   . ARG A 1 52  ? -8.592  6.138   -5.225  1.00 0.00 ? 52  ARG A CG   4  
ATOM 5822  C CD   . ARG A 1 52  ? -9.470  7.362   -4.958  1.00 0.00 ? 52  ARG A CD   4  
ATOM 5823  N NE   . ARG A 1 52  ? -10.899 6.943   -4.904  1.00 0.00 ? 52  ARG A NE   4  
ATOM 5824  C CZ   . ARG A 1 52  ? -11.815 7.791   -4.524  1.00 0.00 ? 52  ARG A CZ   4  
ATOM 5825  N NH1  . ARG A 1 52  ? -12.044 7.980   -3.254  1.00 0.00 ? 52  ARG A NH1  4  
ATOM 5826  N NH2  . ARG A 1 52  ? -12.503 8.448   -5.416  1.00 0.00 ? 52  ARG A NH2  4  
ATOM 5827  H H    . ARG A 1 52  ? -4.551  6.640   -5.045  1.00 0.00 ? 52  ARG A H    4  
ATOM 5828  H HA   . ARG A 1 52  ? -6.368  4.539   -5.443  1.00 0.00 ? 52  ARG A HA   4  
ATOM 5829  H HB2  . ARG A 1 52  ? -6.872  6.442   -3.976  1.00 0.00 ? 52  ARG A HB2  4  
ATOM 5830  H HB3  . ARG A 1 52  ? -6.956  7.518   -5.372  1.00 0.00 ? 52  ARG A HB3  4  
ATOM 5831  H HG2  . ARG A 1 52  ? -8.742  5.801   -6.240  1.00 0.00 ? 52  ARG A HG2  4  
ATOM 5832  H HG3  . ARG A 1 52  ? -8.860  5.349   -4.540  1.00 0.00 ? 52  ARG A HG3  4  
ATOM 5833  H HD2  . ARG A 1 52  ? -9.189  7.808   -4.016  1.00 0.00 ? 52  ARG A HD2  4  
ATOM 5834  H HD3  . ARG A 1 52  ? -9.336  8.082   -5.752  1.00 0.00 ? 52  ARG A HD3  4  
ATOM 5835  H HE   . ARG A 1 52  ? -11.150 6.028   -5.153  1.00 0.00 ? 52  ARG A HE   4  
ATOM 5836  H HH11 . ARG A 1 52  ? -11.517 7.475   -2.570  1.00 0.00 ? 52  ARG A HH11 4  
ATOM 5837  H HH12 . ARG A 1 52  ? -12.746 8.630   -2.964  1.00 0.00 ? 52  ARG A HH12 4  
ATOM 5838  H HH21 . ARG A 1 52  ? -12.329 8.302   -6.390  1.00 0.00 ? 52  ARG A HH21 4  
ATOM 5839  H HH22 . ARG A 1 52  ? -13.205 9.100   -5.127  1.00 0.00 ? 52  ARG A HH22 4  
ATOM 5840  N N    . HIS A 1 53  ? -6.133  6.550   -8.017  1.00 0.00 ? 53  HIS A N    4  
ATOM 5841  C CA   . HIS A 1 53  ? -6.473  6.667   -9.462  1.00 0.00 ? 53  HIS A CA   4  
ATOM 5842  C C    . HIS A 1 53  ? -5.735  5.585   -10.250 1.00 0.00 ? 53  HIS A C    4  
ATOM 5843  O O    . HIS A 1 53  ? -6.190  5.123   -11.278 1.00 0.00 ? 53  HIS A O    4  
ATOM 5844  C CB   . HIS A 1 53  ? -6.025  8.044   -9.962  1.00 0.00 ? 53  HIS A CB   4  
ATOM 5845  C CG   . HIS A 1 53  ? -6.943  8.510   -11.058 1.00 0.00 ? 53  HIS A CG   4  
ATOM 5846  N ND1  . HIS A 1 53  ? -8.311  8.632   -10.874 1.00 0.00 ? 53  HIS A ND1  4  
ATOM 5847  C CD2  . HIS A 1 53  ? -6.704  8.892   -12.354 1.00 0.00 ? 53  HIS A CD2  4  
ATOM 5848  C CE1  . HIS A 1 53  ? -8.839  9.069   -12.032 1.00 0.00 ? 53  HIS A CE1  4  
ATOM 5849  N NE2  . HIS A 1 53  ? -7.903  9.245   -12.968 1.00 0.00 ? 53  HIS A NE2  4  
ATOM 5850  H H    . HIS A 1 53  ? -5.525  7.199   -7.605  1.00 0.00 ? 53  HIS A H    4  
ATOM 5851  H HA   . HIS A 1 53  ? -7.537  6.559   -9.600  1.00 0.00 ? 53  HIS A HA   4  
ATOM 5852  H HB2  . HIS A 1 53  ? -6.052  8.748   -9.143  1.00 0.00 ? 53  HIS A HB2  4  
ATOM 5853  H HB3  . HIS A 1 53  ? -5.015  7.975   -10.341 1.00 0.00 ? 53  HIS A HB3  4  
ATOM 5854  H HD1  . HIS A 1 53  ? -8.805  8.433   -10.051 1.00 0.00 ? 53  HIS A HD1  4  
ATOM 5855  H HD2  . HIS A 1 53  ? -5.733  8.916   -12.827 1.00 0.00 ? 53  HIS A HD2  4  
ATOM 5856  H HE1  . HIS A 1 53  ? -9.891  9.258   -12.185 1.00 0.00 ? 53  HIS A HE1  4  
ATOM 5857  N N    . ASN A 1 54  ? -4.585  5.195   -9.781  1.00 0.00 ? 54  ASN A N    4  
ATOM 5858  C CA   . ASN A 1 54  ? -3.785  4.163   -10.493 1.00 0.00 ? 54  ASN A CA   4  
ATOM 5859  C C    . ASN A 1 54  ? -4.435  2.782   -10.374 1.00 0.00 ? 54  ASN A C    4  
ATOM 5860  O O    . ASN A 1 54  ? -4.441  2.020   -11.318 1.00 0.00 ? 54  ASN A O    4  
ATOM 5861  C CB   . ASN A 1 54  ? -2.381  4.113   -9.886  1.00 0.00 ? 54  ASN A CB   4  
ATOM 5862  C CG   . ASN A 1 54  ? -1.428  4.961   -10.732 1.00 0.00 ? 54  ASN A CG   4  
ATOM 5863  O OD1  . ASN A 1 54  ? -1.433  4.874   -11.945 1.00 0.00 ? 54  ASN A OD1  4  
ATOM 5864  N ND2  . ASN A 1 54  ? -0.605  5.784   -10.141 1.00 0.00 ? 54  ASN A ND2  4  
ATOM 5865  H H    . ASN A 1 54  ? -4.239  5.595   -8.962  1.00 0.00 ? 54  ASN A H    4  
ATOM 5866  H HA   . ASN A 1 54  ? -3.710  4.431   -11.535 1.00 0.00 ? 54  ASN A HA   4  
ATOM 5867  H HB2  . ASN A 1 54  ? -2.411  4.501   -8.879  1.00 0.00 ? 54  ASN A HB2  4  
ATOM 5868  H HB3  . ASN A 1 54  ? -2.032  3.092   -9.870  1.00 0.00 ? 54  ASN A HB3  4  
ATOM 5869  H HD21 . ASN A 1 54  ? -0.603  5.856   -9.161  1.00 0.00 ? 54  ASN A HD21 4  
ATOM 5870  H HD22 . ASN A 1 54  ? 0.009   6.330   -10.673 1.00 0.00 ? 54  ASN A HD22 4  
ATOM 5871  N N    . LEU A 1 55  ? -4.956  2.426   -9.227  1.00 0.00 ? 55  LEU A N    4  
ATOM 5872  C CA   . LEU A 1 55  ? -5.559  1.069   -9.101  1.00 0.00 ? 55  LEU A CA   4  
ATOM 5873  C C    . LEU A 1 55  ? -6.919  1.045   -9.803  1.00 0.00 ? 55  LEU A C    4  
ATOM 5874  O O    . LEU A 1 55  ? -7.586  0.030   -9.848  1.00 0.00 ? 55  LEU A O    4  
ATOM 5875  C CB   . LEU A 1 55  ? -5.728  0.638   -7.625  1.00 0.00 ? 55  LEU A CB   4  
ATOM 5876  C CG   . LEU A 1 55  ? -4.668  1.258   -6.700  1.00 0.00 ? 55  LEU A CG   4  
ATOM 5877  C CD1  . LEU A 1 55  ? -3.368  1.561   -7.452  1.00 0.00 ? 55  LEU A CD1  4  
ATOM 5878  C CD2  . LEU A 1 55  ? -5.234  2.532   -6.074  1.00 0.00 ? 55  LEU A CD2  4  
ATOM 5879  H H    . LEU A 1 55  ? -4.934  3.033   -8.461  1.00 0.00 ? 55  LEU A H    4  
ATOM 5880  H HA   . LEU A 1 55  ? -4.906  0.368   -9.593  1.00 0.00 ? 55  LEU A HA   4  
ATOM 5881  H HB2  . LEU A 1 55  ? -6.701  0.931   -7.276  1.00 0.00 ? 55  LEU A HB2  4  
ATOM 5882  H HB3  . LEU A 1 55  ? -5.650  -0.438  -7.569  1.00 0.00 ? 55  LEU A HB3  4  
ATOM 5883  H HG   . LEU A 1 55  ? -4.447  0.559   -5.915  1.00 0.00 ? 55  LEU A HG   4  
ATOM 5884  H HD11 . LEU A 1 55  ? -3.318  2.616   -7.674  1.00 0.00 ? 55  LEU A HD11 4  
ATOM 5885  H HD12 . LEU A 1 55  ? -3.347  0.997   -8.373  1.00 0.00 ? 55  LEU A HD12 4  
ATOM 5886  H HD13 . LEU A 1 55  ? -2.527  1.282   -6.841  1.00 0.00 ? 55  LEU A HD13 4  
ATOM 5887  H HD21 . LEU A 1 55  ? -4.427  3.138   -5.695  1.00 0.00 ? 55  LEU A HD21 4  
ATOM 5888  H HD22 . LEU A 1 55  ? -5.897  2.268   -5.262  1.00 0.00 ? 55  LEU A HD22 4  
ATOM 5889  H HD23 . LEU A 1 55  ? -5.785  3.088   -6.819  1.00 0.00 ? 55  LEU A HD23 4  
ATOM 5890  N N    . SER A 1 56  ? -7.337  2.154   -10.353 1.00 0.00 ? 56  SER A N    4  
ATOM 5891  C CA   . SER A 1 56  ? -8.653  2.191   -11.050 1.00 0.00 ? 56  SER A CA   4  
ATOM 5892  C C    . SER A 1 56  ? -8.463  1.863   -12.533 1.00 0.00 ? 56  SER A C    4  
ATOM 5893  O O    . SER A 1 56  ? -9.146  1.024   -13.086 1.00 0.00 ? 56  SER A O    4  
ATOM 5894  C CB   . SER A 1 56  ? -9.259  3.588   -10.917 1.00 0.00 ? 56  SER A CB   4  
ATOM 5895  O OG   . SER A 1 56  ? -9.013  4.082   -9.607  1.00 0.00 ? 56  SER A OG   4  
ATOM 5896  H H    . SER A 1 56  ? -6.785  2.962   -10.309 1.00 0.00 ? 56  SER A H    4  
ATOM 5897  H HA   . SER A 1 56  ? -9.318  1.467   -10.603 1.00 0.00 ? 56  SER A HA   4  
ATOM 5898  H HB2  . SER A 1 56  ? -8.806  4.249   -11.636 1.00 0.00 ? 56  SER A HB2  4  
ATOM 5899  H HB3  . SER A 1 56  ? -10.324 3.536   -11.100 1.00 0.00 ? 56  SER A HB3  4  
ATOM 5900  H HG   . SER A 1 56  ? -9.755  3.833   -9.052  1.00 0.00 ? 56  SER A HG   4  
ATOM 5901  N N    . LEU A 1 57  ? -7.548  2.530   -13.182 1.00 0.00 ? 57  LEU A N    4  
ATOM 5902  C CA   . LEU A 1 57  ? -7.320  2.274   -14.631 1.00 0.00 ? 57  LEU A CA   4  
ATOM 5903  C C    . LEU A 1 57  ? -6.267  1.178   -14.812 1.00 0.00 ? 57  LEU A C    4  
ATOM 5904  O O    . LEU A 1 57  ? -6.184  0.558   -15.855 1.00 0.00 ? 57  LEU A O    4  
ATOM 5905  C CB   . LEU A 1 57  ? -6.827  3.560   -15.290 1.00 0.00 ? 57  LEU A CB   4  
ATOM 5906  C CG   . LEU A 1 57  ? -5.532  4.012   -14.616 1.00 0.00 ? 57  LEU A CG   4  
ATOM 5907  C CD1  . LEU A 1 57  ? -4.396  4.019   -15.640 1.00 0.00 ? 57  LEU A CD1  4  
ATOM 5908  C CD2  . LEU A 1 57  ? -5.718  5.422   -14.051 1.00 0.00 ? 57  LEU A CD2  4  
ATOM 5909  H H    . LEU A 1 57  ? -7.017  3.210   -12.719 1.00 0.00 ? 57  LEU A H    4  
ATOM 5910  H HA   . LEU A 1 57  ? -8.246  1.966   -15.093 1.00 0.00 ? 57  LEU A HA   4  
ATOM 5911  H HB2  . LEU A 1 57  ? -6.643  3.377   -16.336 1.00 0.00 ? 57  LEU A HB2  4  
ATOM 5912  H HB3  . LEU A 1 57  ? -7.574  4.331   -15.185 1.00 0.00 ? 57  LEU A HB3  4  
ATOM 5913  H HG   . LEU A 1 57  ? -5.289  3.330   -13.813 1.00 0.00 ? 57  LEU A HG   4  
ATOM 5914  H HD11 . LEU A 1 57  ? -4.623  4.726   -16.424 1.00 0.00 ? 57  LEU A HD11 4  
ATOM 5915  H HD12 . LEU A 1 57  ? -4.288  3.031   -16.063 1.00 0.00 ? 57  LEU A HD12 4  
ATOM 5916  H HD13 . LEU A 1 57  ? -3.475  4.304   -15.153 1.00 0.00 ? 57  LEU A HD13 4  
ATOM 5917  H HD21 . LEU A 1 57  ? -6.761  5.583   -13.824 1.00 0.00 ? 57  LEU A HD21 4  
ATOM 5918  H HD22 . LEU A 1 57  ? -5.392  6.147   -14.781 1.00 0.00 ? 57  LEU A HD22 4  
ATOM 5919  H HD23 . LEU A 1 57  ? -5.132  5.528   -13.150 1.00 0.00 ? 57  LEU A HD23 4  
ATOM 5920  N N    . ASN A 1 58  ? -5.457  0.941   -13.816 1.00 0.00 ? 58  ASN A N    4  
ATOM 5921  C CA   . ASN A 1 58  ? -4.403  -0.111  -13.941 1.00 0.00 ? 58  ASN A CA   4  
ATOM 5922  C C    . ASN A 1 58  ? -4.996  -1.349  -14.619 1.00 0.00 ? 58  ASN A C    4  
ATOM 5923  O O    . ASN A 1 58  ? -6.196  -1.475  -14.763 1.00 0.00 ? 58  ASN A O    4  
ATOM 5924  C CB   . ASN A 1 58  ? -3.867  -0.491  -12.556 1.00 0.00 ? 58  ASN A CB   4  
ATOM 5925  C CG   . ASN A 1 58  ? -2.510  0.183   -12.337 1.00 0.00 ? 58  ASN A CG   4  
ATOM 5926  O OD1  . ASN A 1 58  ? -1.568  -0.449  -11.902 1.00 0.00 ? 58  ASN A OD1  4  
ATOM 5927  N ND2  . ASN A 1 58  ? -2.369  1.449   -12.620 1.00 0.00 ? 58  ASN A ND2  4  
ATOM 5928  H H    . ASN A 1 58  ? -5.537  1.461   -12.991 1.00 0.00 ? 58  ASN A H    4  
ATOM 5929  H HA   . ASN A 1 58  ? -3.592  0.269   -14.546 1.00 0.00 ? 58  ASN A HA   4  
ATOM 5930  H HB2  . ASN A 1 58  ? -4.559  -0.168  -11.793 1.00 0.00 ? 58  ASN A HB2  4  
ATOM 5931  H HB3  . ASN A 1 58  ? -3.745  -1.562  -12.500 1.00 0.00 ? 58  ASN A HB3  4  
ATOM 5932  H HD21 . ASN A 1 58  ? -3.128  1.961   -12.969 1.00 0.00 ? 58  ASN A HD21 4  
ATOM 5933  H HD22 . ASN A 1 58  ? -1.504  1.888   -12.483 1.00 0.00 ? 58  ASN A HD22 4  
ATOM 5934  N N    . ARG A 1 59  ? -4.167  -2.255  -15.053 1.00 0.00 ? 59  ARG A N    4  
ATOM 5935  C CA   . ARG A 1 59  ? -4.691  -3.468  -15.742 1.00 0.00 ? 59  ARG A CA   4  
ATOM 5936  C C    . ARG A 1 59  ? -4.963  -4.589  -14.734 1.00 0.00 ? 59  ARG A C    4  
ATOM 5937  O O    . ARG A 1 59  ? -5.928  -5.318  -14.860 1.00 0.00 ? 59  ARG A O    4  
ATOM 5938  C CB   . ARG A 1 59  ? -3.666  -3.946  -16.772 1.00 0.00 ? 59  ARG A CB   4  
ATOM 5939  C CG   . ARG A 1 59  ? -4.135  -5.269  -17.382 1.00 0.00 ? 59  ARG A CG   4  
ATOM 5940  C CD   . ARG A 1 59  ? -3.912  -5.243  -18.895 1.00 0.00 ? 59  ARG A CD   4  
ATOM 5941  N NE   . ARG A 1 59  ? -4.584  -4.047  -19.478 1.00 0.00 ? 59  ARG A NE   4  
ATOM 5942  C CZ   . ARG A 1 59  ? -5.874  -3.896  -19.352 1.00 0.00 ? 59  ARG A CZ   4  
ATOM 5943  N NH1  . ARG A 1 59  ? -6.688  -4.758  -19.898 1.00 0.00 ? 59  ARG A NH1  4  
ATOM 5944  N NH2  . ARG A 1 59  ? -6.351  -2.881  -18.681 1.00 0.00 ? 59  ARG A NH2  4  
ATOM 5945  H H    . ARG A 1 59  ? -3.200  -2.133  -14.941 1.00 0.00 ? 59  ARG A H    4  
ATOM 5946  H HA   . ARG A 1 59  ? -5.610  -3.216  -16.249 1.00 0.00 ? 59  ARG A HA   4  
ATOM 5947  H HB2  . ARG A 1 59  ? -3.566  -3.205  -17.551 1.00 0.00 ? 59  ARG A HB2  4  
ATOM 5948  H HB3  . ARG A 1 59  ? -2.712  -4.093  -16.289 1.00 0.00 ? 59  ARG A HB3  4  
ATOM 5949  H HG2  . ARG A 1 59  ? -3.573  -6.083  -16.948 1.00 0.00 ? 59  ARG A HG2  4  
ATOM 5950  H HG3  . ARG A 1 59  ? -5.186  -5.407  -17.176 1.00 0.00 ? 59  ARG A HG3  4  
ATOM 5951  H HD2  . ARG A 1 59  ? -2.854  -5.198  -19.103 1.00 0.00 ? 59  ARG A HD2  4  
ATOM 5952  H HD3  . ARG A 1 59  ? -4.328  -6.138  -19.335 1.00 0.00 ? 59  ARG A HD3  4  
ATOM 5953  H HE   . ARG A 1 59  ? -4.057  -3.373  -19.956 1.00 0.00 ? 59  ARG A HE   4  
ATOM 5954  H HH11 . ARG A 1 59  ? -6.323  -5.534  -20.412 1.00 0.00 ? 59  ARG A HH11 4  
ATOM 5955  H HH12 . ARG A 1 59  ? -7.676  -4.642  -19.802 1.00 0.00 ? 59  ARG A HH12 4  
ATOM 5956  H HH21 . ARG A 1 59  ? -5.727  -2.221  -18.263 1.00 0.00 ? 59  ARG A HH21 4  
ATOM 5957  H HH22 . ARG A 1 59  ? -7.339  -2.766  -18.585 1.00 0.00 ? 59  ARG A HH22 4  
ATOM 5958  N N    . TYR A 1 60  ? -4.129  -4.751  -13.743 1.00 0.00 ? 60  TYR A N    4  
ATOM 5959  C CA   . TYR A 1 60  ? -4.373  -5.849  -12.760 1.00 0.00 ? 60  TYR A CA   4  
ATOM 5960  C C    . TYR A 1 60  ? -5.109  -5.322  -11.535 1.00 0.00 ? 60  TYR A C    4  
ATOM 5961  O O    . TYR A 1 60  ? -5.744  -6.066  -10.824 1.00 0.00 ? 60  TYR A O    4  
ATOM 5962  C CB   . TYR A 1 60  ? -3.053  -6.475  -12.303 1.00 0.00 ? 60  TYR A CB   4  
ATOM 5963  C CG   . TYR A 1 60  ? -1.920  -5.476  -12.393 1.00 0.00 ? 60  TYR A CG   4  
ATOM 5964  C CD1  . TYR A 1 60  ? -1.992  -4.241  -11.730 1.00 0.00 ? 60  TYR A CD1  4  
ATOM 5965  C CD2  . TYR A 1 60  ? -0.788  -5.794  -13.148 1.00 0.00 ? 60  TYR A CD2  4  
ATOM 5966  C CE1  . TYR A 1 60  ? -0.930  -3.333  -11.833 1.00 0.00 ? 60  TYR A CE1  4  
ATOM 5967  C CE2  . TYR A 1 60  ? 0.271   -4.891  -13.248 1.00 0.00 ? 60  TYR A CE2  4  
ATOM 5968  C CZ   . TYR A 1 60  ? 0.201   -3.658  -12.592 1.00 0.00 ? 60  TYR A CZ   4  
ATOM 5969  O OH   . TYR A 1 60  ? 1.246   -2.763  -12.693 1.00 0.00 ? 60  TYR A OH   4  
ATOM 5970  H H    . TYR A 1 60  ? -3.350  -4.164  -13.651 1.00 0.00 ? 60  TYR A H    4  
ATOM 5971  H HA   . TYR A 1 60  ? -4.977  -6.611  -13.231 1.00 0.00 ? 60  TYR A HA   4  
ATOM 5972  H HB2  . TYR A 1 60  ? -3.153  -6.806  -11.281 1.00 0.00 ? 60  TYR A HB2  4  
ATOM 5973  H HB3  . TYR A 1 60  ? -2.828  -7.325  -12.931 1.00 0.00 ? 60  TYR A HB3  4  
ATOM 5974  H HD1  . TYR A 1 60  ? -2.859  -3.987  -11.135 1.00 0.00 ? 60  TYR A HD1  4  
ATOM 5975  H HD2  . TYR A 1 60  ? -0.730  -6.744  -13.647 1.00 0.00 ? 60  TYR A HD2  4  
ATOM 5976  H HE1  . TYR A 1 60  ? -0.984  -2.385  -11.326 1.00 0.00 ? 60  TYR A HE1  4  
ATOM 5977  H HE2  . TYR A 1 60  ? 1.142   -5.144  -13.834 1.00 0.00 ? 60  TYR A HE2  4  
ATOM 5978  H HH   . TYR A 1 60  ? 1.684   -2.719  -11.839 1.00 0.00 ? 60  TYR A HH   4  
ATOM 5979  N N    . PHE A 1 61  ? -5.029  -4.060  -11.262 1.00 0.00 ? 61  PHE A N    4  
ATOM 5980  C CA   . PHE A 1 61  ? -5.720  -3.542  -10.056 1.00 0.00 ? 61  PHE A CA   4  
ATOM 5981  C C    . PHE A 1 61  ? -7.216  -3.424  -10.342 1.00 0.00 ? 61  PHE A C    4  
ATOM 5982  O O    . PHE A 1 61  ? -7.637  -3.283  -11.473 1.00 0.00 ? 61  PHE A O    4  
ATOM 5983  C CB   . PHE A 1 61  ? -5.120  -2.192  -9.681  1.00 0.00 ? 61  PHE A CB   4  
ATOM 5984  C CG   . PHE A 1 61  ? -3.725  -2.421  -9.145  1.00 0.00 ? 61  PHE A CG   4  
ATOM 5985  C CD1  . PHE A 1 61  ? -3.486  -3.455  -8.230  1.00 0.00 ? 61  PHE A CD1  4  
ATOM 5986  C CD2  . PHE A 1 61  ? -2.664  -1.619  -9.578  1.00 0.00 ? 61  PHE A CD2  4  
ATOM 5987  C CE1  . PHE A 1 61  ? -2.192  -3.678  -7.752  1.00 0.00 ? 61  PHE A CE1  4  
ATOM 5988  C CE2  . PHE A 1 61  ? -1.372  -1.847  -9.100  1.00 0.00 ? 61  PHE A CE2  4  
ATOM 5989  C CZ   . PHE A 1 61  ? -1.137  -2.877  -8.188  1.00 0.00 ? 61  PHE A CZ   4  
ATOM 5990  H H    . PHE A 1 61  ? -4.507  -3.459  -11.834 1.00 0.00 ? 61  PHE A H    4  
ATOM 5991  H HA   . PHE A 1 61  ? -5.572  -4.235  -9.241  1.00 0.00 ? 61  PHE A HA   4  
ATOM 5992  H HB2  . PHE A 1 61  ? -5.074  -1.569  -10.562 1.00 0.00 ? 61  PHE A HB2  4  
ATOM 5993  H HB3  . PHE A 1 61  ? -5.726  -1.718  -8.924  1.00 0.00 ? 61  PHE A HB3  4  
ATOM 5994  H HD1  . PHE A 1 61  ? -4.298  -4.077  -7.888  1.00 0.00 ? 61  PHE A HD1  4  
ATOM 5995  H HD2  . PHE A 1 61  ? -2.840  -0.824  -10.276 1.00 0.00 ? 61  PHE A HD2  4  
ATOM 5996  H HE1  . PHE A 1 61  ? -2.009  -4.479  -7.051  1.00 0.00 ? 61  PHE A HE1  4  
ATOM 5997  H HE2  . PHE A 1 61  ? -0.553  -1.231  -9.442  1.00 0.00 ? 61  PHE A HE2  4  
ATOM 5998  H HZ   . PHE A 1 61  ? -0.143  -3.052  -7.817  1.00 0.00 ? 61  PHE A HZ   4  
ATOM 5999  N N    . ILE A 1 62  ? -8.020  -3.520  -9.322  1.00 0.00 ? 62  ILE A N    4  
ATOM 6000  C CA   . ILE A 1 62  ? -9.492  -3.457  -9.518  1.00 0.00 ? 62  ILE A CA   4  
ATOM 6001  C C    . ILE A 1 62  ? -10.130 -2.630  -8.399  1.00 0.00 ? 62  ILE A C    4  
ATOM 6002  O O    . ILE A 1 62  ? -9.470  -2.219  -7.465  1.00 0.00 ? 62  ILE A O    4  
ATOM 6003  C CB   . ILE A 1 62  ? -10.064 -4.889  -9.496  1.00 0.00 ? 62  ILE A CB   4  
ATOM 6004  C CG1  . ILE A 1 62  ? -10.159 -5.413  -8.056  1.00 0.00 ? 62  ILE A CG1  4  
ATOM 6005  C CG2  . ILE A 1 62  ? -9.148  -5.828  -10.288 1.00 0.00 ? 62  ILE A CG2  4  
ATOM 6006  C CD1  . ILE A 1 62  ? -11.566 -5.960  -7.806  1.00 0.00 ? 62  ILE A CD1  4  
ATOM 6007  H H    . ILE A 1 62  ? -7.651  -3.652  -8.429  1.00 0.00 ? 62  ILE A H    4  
ATOM 6008  H HA   . ILE A 1 62  ? -9.709  -3.000  -10.471 1.00 0.00 ? 62  ILE A HA   4  
ATOM 6009  H HB   . ILE A 1 62  ? -11.047 -4.888  -9.945  1.00 0.00 ? 62  ILE A HB   4  
ATOM 6010  H HG12 . ILE A 1 62  ? -9.438  -6.205  -7.916  1.00 0.00 ? 62  ILE A HG12 4  
ATOM 6011  H HG13 . ILE A 1 62  ? -9.955  -4.619  -7.356  1.00 0.00 ? 62  ILE A HG13 4  
ATOM 6012  H HG21 . ILE A 1 62  ? -8.120  -5.653  -10.005 1.00 0.00 ? 62  ILE A HG21 4  
ATOM 6013  H HG22 . ILE A 1 62  ? -9.269  -5.646  -11.344 1.00 0.00 ? 62  ILE A HG22 4  
ATOM 6014  H HG23 . ILE A 1 62  ? -9.411  -6.854  -10.068 1.00 0.00 ? 62  ILE A HG23 4  
ATOM 6015  H HD11 . ILE A 1 62  ? -12.294 -5.193  -8.017  1.00 0.00 ? 62  ILE A HD11 4  
ATOM 6016  H HD12 . ILE A 1 62  ? -11.654 -6.268  -6.774  1.00 0.00 ? 62  ILE A HD12 4  
ATOM 6017  H HD13 . ILE A 1 62  ? -11.740 -6.809  -8.450  1.00 0.00 ? 62  ILE A HD13 4  
ATOM 6018  N N    . LYS A 1 63  ? -11.410 -2.399  -8.479  1.00 0.00 ? 63  LYS A N    4  
ATOM 6019  C CA   . LYS A 1 63  ? -12.097 -1.613  -7.417  1.00 0.00 ? 63  LYS A CA   4  
ATOM 6020  C C    . LYS A 1 63  ? -13.315 -2.397  -6.924  1.00 0.00 ? 63  LYS A C    4  
ATOM 6021  O O    . LYS A 1 63  ? -14.000 -3.044  -7.691  1.00 0.00 ? 63  LYS A O    4  
ATOM 6022  C CB   . LYS A 1 63  ? -12.547 -0.266  -7.984  1.00 0.00 ? 63  LYS A CB   4  
ATOM 6023  C CG   . LYS A 1 63  ? -11.530 0.812   -7.604  1.00 0.00 ? 63  LYS A CG   4  
ATOM 6024  C CD   . LYS A 1 63  ? -12.173 1.798   -6.629  1.00 0.00 ? 63  LYS A CD   4  
ATOM 6025  C CE   . LYS A 1 63  ? -13.055 2.780   -7.401  1.00 0.00 ? 63  LYS A CE   4  
ATOM 6026  N NZ   . LYS A 1 63  ? -13.020 4.111   -6.734  1.00 0.00 ? 63  LYS A NZ   4  
ATOM 6027  H H    . LYS A 1 63  ? -11.923 -2.752  -9.236  1.00 0.00 ? 63  LYS A H    4  
ATOM 6028  H HA   . LYS A 1 63  ? -11.417 -1.450  -6.594  1.00 0.00 ? 63  LYS A HA   4  
ATOM 6029  H HB2  . LYS A 1 63  ? -12.618 -0.334  -9.060  1.00 0.00 ? 63  LYS A HB2  4  
ATOM 6030  H HB3  . LYS A 1 63  ? -13.513 -0.008  -7.573  1.00 0.00 ? 63  LYS A HB3  4  
ATOM 6031  H HG2  . LYS A 1 63  ? -10.672 0.350   -7.138  1.00 0.00 ? 63  LYS A HG2  4  
ATOM 6032  H HG3  . LYS A 1 63  ? -11.218 1.341   -8.492  1.00 0.00 ? 63  LYS A HG3  4  
ATOM 6033  H HD2  . LYS A 1 63  ? -12.777 1.256   -5.915  1.00 0.00 ? 63  LYS A HD2  4  
ATOM 6034  H HD3  . LYS A 1 63  ? -11.401 2.344   -6.106  1.00 0.00 ? 63  LYS A HD3  4  
ATOM 6035  H HE2  . LYS A 1 63  ? -12.686 2.875   -8.413  1.00 0.00 ? 63  LYS A HE2  4  
ATOM 6036  H HE3  . LYS A 1 63  ? -14.070 2.413   -7.422  1.00 0.00 ? 63  LYS A HE3  4  
ATOM 6037  H HZ1  . LYS A 1 63  ? -12.479 4.779   -7.319  1.00 0.00 ? 63  LYS A HZ1  4  
ATOM 6038  H HZ2  . LYS A 1 63  ? -12.566 4.019   -5.802  1.00 0.00 ? 63  LYS A HZ2  4  
ATOM 6039  H HZ3  . LYS A 1 63  ? -13.990 4.465   -6.615  1.00 0.00 ? 63  LYS A HZ3  4  
ATOM 6040  N N    . VAL A 1 64  ? -13.587 -2.352  -5.649  1.00 0.00 ? 64  VAL A N    4  
ATOM 6041  C CA   . VAL A 1 64  ? -14.756 -3.103  -5.112  1.00 0.00 ? 64  VAL A CA   4  
ATOM 6042  C C    . VAL A 1 64  ? -15.833 -2.118  -4.643  1.00 0.00 ? 64  VAL A C    4  
ATOM 6043  O O    . VAL A 1 64  ? -15.759 -1.602  -3.545  1.00 0.00 ? 64  VAL A O    4  
ATOM 6044  C CB   . VAL A 1 64  ? -14.306 -3.963  -3.931  1.00 0.00 ? 64  VAL A CB   4  
ATOM 6045  C CG1  . VAL A 1 64  ? -15.401 -4.976  -3.590  1.00 0.00 ? 64  VAL A CG1  4  
ATOM 6046  C CG2  . VAL A 1 64  ? -13.023 -4.708  -4.305  1.00 0.00 ? 64  VAL A CG2  4  
ATOM 6047  H H    . VAL A 1 64  ? -13.019 -1.830  -5.045  1.00 0.00 ? 64  VAL A H    4  
ATOM 6048  H HA   . VAL A 1 64  ? -15.159 -3.740  -5.884  1.00 0.00 ? 64  VAL A HA   4  
ATOM 6049  H HB   . VAL A 1 64  ? -14.121 -3.330  -3.075  1.00 0.00 ? 64  VAL A HB   4  
ATOM 6050  H HG11 . VAL A 1 64  ? -15.292 -5.849  -4.216  1.00 0.00 ? 64  VAL A HG11 4  
ATOM 6051  H HG12 . VAL A 1 64  ? -16.370 -4.529  -3.761  1.00 0.00 ? 64  VAL A HG12 4  
ATOM 6052  H HG13 . VAL A 1 64  ? -15.315 -5.263  -2.553  1.00 0.00 ? 64  VAL A HG13 4  
ATOM 6053  H HG21 . VAL A 1 64  ? -13.267 -5.560  -4.924  1.00 0.00 ? 64  VAL A HG21 4  
ATOM 6054  H HG22 . VAL A 1 64  ? -12.527 -5.045  -3.407  1.00 0.00 ? 64  VAL A HG22 4  
ATOM 6055  H HG23 . VAL A 1 64  ? -12.367 -4.044  -4.851  1.00 0.00 ? 64  VAL A HG23 4  
ATOM 6056  N N    . PRO A 1 65  ? -16.808 -1.892  -5.488  1.00 0.00 ? 65  PRO A N    4  
ATOM 6057  C CA   . PRO A 1 65  ? -17.922 -0.977  -5.187  1.00 0.00 ? 65  PRO A CA   4  
ATOM 6058  C C    . PRO A 1 65  ? -18.936 -1.662  -4.263  1.00 0.00 ? 65  PRO A C    4  
ATOM 6059  O O    . PRO A 1 65  ? -18.698 -2.740  -3.758  1.00 0.00 ? 65  PRO A O    4  
ATOM 6060  C CB   . PRO A 1 65  ? -18.539 -0.697  -6.560  1.00 0.00 ? 65  PRO A CB   4  
ATOM 6061  C CG   . PRO A 1 65  ? -18.127 -1.876  -7.472  1.00 0.00 ? 65  PRO A CG   4  
ATOM 6062  C CD   . PRO A 1 65  ? -16.891 -2.526  -6.821  1.00 0.00 ? 65  PRO A CD   4  
ATOM 6063  H HA   . PRO A 1 65  ? -17.559 -0.062  -4.749  1.00 0.00 ? 65  PRO A HA   4  
ATOM 6064  H HB2  . PRO A 1 65  ? -19.617 -0.645  -6.479  1.00 0.00 ? 65  PRO A HB2  4  
ATOM 6065  H HB3  . PRO A 1 65  ? -18.150 0.226   -6.961  1.00 0.00 ? 65  PRO A HB3  4  
ATOM 6066  H HG2  . PRO A 1 65  ? -18.935 -2.592  -7.538  1.00 0.00 ? 65  PRO A HG2  4  
ATOM 6067  H HG3  . PRO A 1 65  ? -17.871 -1.513  -8.455  1.00 0.00 ? 65  PRO A HG3  4  
ATOM 6068  H HD2  . PRO A 1 65  ? -17.031 -3.593  -6.727  1.00 0.00 ? 65  PRO A HD2  4  
ATOM 6069  H HD3  . PRO A 1 65  ? -16.002 -2.307  -7.392  1.00 0.00 ? 65  PRO A HD3  4  
ATOM 6070  N N    . ARG A 1 66  ? -20.063 -1.044  -4.040  1.00 0.00 ? 66  ARG A N    4  
ATOM 6071  C CA   . ARG A 1 66  ? -21.087 -1.661  -3.151  1.00 0.00 ? 66  ARG A CA   4  
ATOM 6072  C C    . ARG A 1 66  ? -22.035 -2.523  -3.988  1.00 0.00 ? 66  ARG A C    4  
ATOM 6073  O O    . ARG A 1 66  ? -23.159 -2.778  -3.605  1.00 0.00 ? 66  ARG A O    4  
ATOM 6074  C CB   . ARG A 1 66  ? -21.886 -0.561  -2.450  1.00 0.00 ? 66  ARG A CB   4  
ATOM 6075  C CG   . ARG A 1 66  ? -22.724 -1.173  -1.327  1.00 0.00 ? 66  ARG A CG   4  
ATOM 6076  C CD   . ARG A 1 66  ? -24.075 -0.461  -1.254  1.00 0.00 ? 66  ARG A CD   4  
ATOM 6077  N NE   . ARG A 1 66  ? -23.858 1.013   -1.254  1.00 0.00 ? 66  ARG A NE   4  
ATOM 6078  C CZ   . ARG A 1 66  ? -24.717 1.801   -0.667  1.00 0.00 ? 66  ARG A CZ   4  
ATOM 6079  N NH1  . ARG A 1 66  ? -25.219 1.470   0.492   1.00 0.00 ? 66  ARG A NH1  4  
ATOM 6080  N NH2  . ARG A 1 66  ? -25.071 2.920   -1.236  1.00 0.00 ? 66  ARG A NH2  4  
ATOM 6081  H H    . ARG A 1 66  ? -20.237 -0.174  -4.458  1.00 0.00 ? 66  ARG A H    4  
ATOM 6082  H HA   . ARG A 1 66  ? -20.598 -2.278  -2.412  1.00 0.00 ? 66  ARG A HA   4  
ATOM 6083  H HB2  . ARG A 1 66  ? -21.204 0.169   -2.036  1.00 0.00 ? 66  ARG A HB2  4  
ATOM 6084  H HB3  . ARG A 1 66  ? -22.539 -0.080  -3.163  1.00 0.00 ? 66  ARG A HB3  4  
ATOM 6085  H HG2  . ARG A 1 66  ? -22.880 -2.224  -1.527  1.00 0.00 ? 66  ARG A HG2  4  
ATOM 6086  H HG3  . ARG A 1 66  ? -22.206 -1.058  -0.387  1.00 0.00 ? 66  ARG A HG3  4  
ATOM 6087  H HD2  . ARG A 1 66  ? -24.674 -0.737  -2.108  1.00 0.00 ? 66  ARG A HD2  4  
ATOM 6088  H HD3  . ARG A 1 66  ? -24.586 -0.749  -0.346  1.00 0.00 ? 66  ARG A HD3  4  
ATOM 6089  H HE   . ARG A 1 66  ? -23.070 1.391   -1.697  1.00 0.00 ? 66  ARG A HE   4  
ATOM 6090  H HH11 . ARG A 1 66  ? -24.947 0.614   0.929   1.00 0.00 ? 66  ARG A HH11 4  
ATOM 6091  H HH12 . ARG A 1 66  ? -25.876 2.074   0.942   1.00 0.00 ? 66  ARG A HH12 4  
ATOM 6092  H HH21 . ARG A 1 66  ? -24.686 3.173   -2.124  1.00 0.00 ? 66  ARG A HH21 4  
ATOM 6093  H HH22 . ARG A 1 66  ? -25.728 3.524   -0.786  1.00 0.00 ? 66  ARG A HH22 4  
ATOM 6094  N N    . SER A 1 67  ? -21.590 -2.972  -5.129  1.00 0.00 ? 67  SER A N    4  
ATOM 6095  C CA   . SER A 1 67  ? -22.467 -3.814  -5.990  1.00 0.00 ? 67  SER A CA   4  
ATOM 6096  C C    . SER A 1 67  ? -22.104 -5.288  -5.803  1.00 0.00 ? 67  SER A C    4  
ATOM 6097  O O    . SER A 1 67  ? -22.406 -6.122  -6.634  1.00 0.00 ? 67  SER A O    4  
ATOM 6098  C CB   . SER A 1 67  ? -22.270 -3.421  -7.454  1.00 0.00 ? 67  SER A CB   4  
ATOM 6099  O OG   . SER A 1 67  ? -23.186 -4.146  -8.263  1.00 0.00 ? 67  SER A OG   4  
ATOM 6100  H H    . SER A 1 67  ? -20.681 -2.753  -5.422  1.00 0.00 ? 67  SER A H    4  
ATOM 6101  H HA   . SER A 1 67  ? -23.499 -3.659  -5.712  1.00 0.00 ? 67  SER A HA   4  
ATOM 6102  H HB2  . SER A 1 67  ? -22.450 -2.365  -7.574  1.00 0.00 ? 67  SER A HB2  4  
ATOM 6103  H HB3  . SER A 1 67  ? -21.254 -3.647  -7.752  1.00 0.00 ? 67  SER A HB3  4  
ATOM 6104  H HG   . SER A 1 67  ? -23.822 -3.523  -8.623  1.00 0.00 ? 67  SER A HG   4  
ATOM 6105  N N    . GLN A 1 68  ? -21.458 -5.617  -4.718  1.00 0.00 ? 68  GLN A N    4  
ATOM 6106  C CA   . GLN A 1 68  ? -21.076 -7.038  -4.478  1.00 0.00 ? 68  GLN A CA   4  
ATOM 6107  C C    . GLN A 1 68  ? -22.102 -7.692  -3.551  1.00 0.00 ? 68  GLN A C    4  
ATOM 6108  O O    . GLN A 1 68  ? -22.922 -7.027  -2.948  1.00 0.00 ? 68  GLN A O    4  
ATOM 6109  C CB   . GLN A 1 68  ? -19.692 -7.092  -3.828  1.00 0.00 ? 68  GLN A CB   4  
ATOM 6110  C CG   . GLN A 1 68  ? -18.802 -8.067  -4.602  1.00 0.00 ? 68  GLN A CG   4  
ATOM 6111  C CD   . GLN A 1 68  ? -18.939 -9.470  -4.008  1.00 0.00 ? 68  GLN A CD   4  
ATOM 6112  O OE1  . GLN A 1 68  ? -19.156 -9.623  -2.822  1.00 0.00 ? 68  GLN A OE1  4  
ATOM 6113  N NE2  . GLN A 1 68  ? -18.819 -10.511 -4.787  1.00 0.00 ? 68  GLN A NE2  4  
ATOM 6114  H H    . GLN A 1 68  ? -21.223 -4.930  -4.060  1.00 0.00 ? 68  GLN A H    4  
ATOM 6115  H HA   . GLN A 1 68  ? -21.053 -7.567  -5.420  1.00 0.00 ? 68  GLN A HA   4  
ATOM 6116  H HB2  . GLN A 1 68  ? -19.249 -6.106  -3.846  1.00 0.00 ? 68  GLN A HB2  4  
ATOM 6117  H HB3  . GLN A 1 68  ? -19.786 -7.427  -2.806  1.00 0.00 ? 68  GLN A HB3  4  
ATOM 6118  H HG2  . GLN A 1 68  ? -19.103 -8.084  -5.639  1.00 0.00 ? 68  GLN A HG2  4  
ATOM 6119  H HG3  . GLN A 1 68  ? -17.773 -7.748  -4.532  1.00 0.00 ? 68  GLN A HG3  4  
ATOM 6120  H HE21 . GLN A 1 68  ? -18.642 -10.389 -5.744  1.00 0.00 ? 68  GLN A HE21 4  
ATOM 6121  H HE22 . GLN A 1 68  ? -18.905 -11.415 -4.417  1.00 0.00 ? 68  GLN A HE22 4  
ATOM 6122  N N    . GLU A 1 69  ? -22.064 -8.991  -3.430  1.00 0.00 ? 69  GLU A N    4  
ATOM 6123  C CA   . GLU A 1 69  ? -23.037 -9.686  -2.541  1.00 0.00 ? 69  GLU A CA   4  
ATOM 6124  C C    . GLU A 1 69  ? -22.611 -9.515  -1.080  1.00 0.00 ? 69  GLU A C    4  
ATOM 6125  O O    . GLU A 1 69  ? -23.254 -10.010 -0.176  1.00 0.00 ? 69  GLU A O    4  
ATOM 6126  C CB   . GLU A 1 69  ? -23.071 -11.175 -2.890  1.00 0.00 ? 69  GLU A CB   4  
ATOM 6127  C CG   . GLU A 1 69  ? -23.439 -11.349 -4.365  1.00 0.00 ? 69  GLU A CG   4  
ATOM 6128  C CD   . GLU A 1 69  ? -24.699 -12.210 -4.480  1.00 0.00 ? 69  GLU A CD   4  
ATOM 6129  O OE1  . GLU A 1 69  ? -24.762 -13.225 -3.806  1.00 0.00 ? 69  GLU A OE1  4  
ATOM 6130  O OE2  . GLU A 1 69  ? -25.579 -11.840 -5.240  1.00 0.00 ? 69  GLU A OE2  4  
ATOM 6131  H H    . GLU A 1 69  ? -21.395 -9.508  -3.923  1.00 0.00 ? 69  GLU A H    4  
ATOM 6132  H HA   . GLU A 1 69  ? -24.019 -9.261  -2.682  1.00 0.00 ? 69  GLU A HA   4  
ATOM 6133  H HB2  . GLU A 1 69  ? -22.100 -11.610 -2.706  1.00 0.00 ? 69  GLU A HB2  4  
ATOM 6134  H HB3  . GLU A 1 69  ? -23.809 -11.670 -2.277  1.00 0.00 ? 69  GLU A HB3  4  
ATOM 6135  H HG2  . GLU A 1 69  ? -23.623 -10.380 -4.807  1.00 0.00 ? 69  GLU A HG2  4  
ATOM 6136  H HG3  . GLU A 1 69  ? -22.626 -11.833 -4.884  1.00 0.00 ? 69  GLU A HG3  4  
ATOM 6137  N N    . GLU A 1 70  ? -21.532 -8.821  -0.841  1.00 0.00 ? 70  GLU A N    4  
ATOM 6138  C CA   . GLU A 1 70  ? -21.071 -8.623  0.562   1.00 0.00 ? 70  GLU A CA   4  
ATOM 6139  C C    . GLU A 1 70  ? -21.545 -7.257  1.067   1.00 0.00 ? 70  GLU A C    4  
ATOM 6140  O O    . GLU A 1 70  ? -21.601 -6.306  0.312   1.00 0.00 ? 70  GLU A O    4  
ATOM 6141  C CB   . GLU A 1 70  ? -19.542 -8.687  0.607   1.00 0.00 ? 70  GLU A CB   4  
ATOM 6142  C CG   . GLU A 1 70  ? -19.084 -10.117 0.318   1.00 0.00 ? 70  GLU A CG   4  
ATOM 6143  C CD   . GLU A 1 70  ? -18.743 -10.820 1.634   1.00 0.00 ? 70  GLU A CD   4  
ATOM 6144  O OE1  . GLU A 1 70  ? -17.731 -10.473 2.223   1.00 0.00 ? 70  GLU A OE1  4  
ATOM 6145  O OE2  . GLU A 1 70  ? -19.498 -11.691 2.030   1.00 0.00 ? 70  GLU A OE2  4  
ATOM 6146  H H    . GLU A 1 70  ? -21.026 -8.429  -1.582  1.00 0.00 ? 70  GLU A H    4  
ATOM 6147  H HA   . GLU A 1 70  ? -21.483 -9.403  1.187   1.00 0.00 ? 70  GLU A HA   4  
ATOM 6148  H HB2  . GLU A 1 70  ? -19.132 -8.019  -0.137  1.00 0.00 ? 70  GLU A HB2  4  
ATOM 6149  H HB3  . GLU A 1 70  ? -19.199 -8.391  1.587   1.00 0.00 ? 70  GLU A HB3  4  
ATOM 6150  H HG2  . GLU A 1 70  ? -19.877 -10.655 -0.183  1.00 0.00 ? 70  GLU A HG2  4  
ATOM 6151  H HG3  . GLU A 1 70  ? -18.209 -10.096 -0.312  1.00 0.00 ? 70  GLU A HG3  4  
ATOM 6152  N N    . PRO A 1 71  ? -21.872 -7.200  2.334   1.00 0.00 ? 71  PRO A N    4  
ATOM 6153  C CA   . PRO A 1 71  ? -22.348 -5.963  2.974   1.00 0.00 ? 71  PRO A CA   4  
ATOM 6154  C C    . PRO A 1 71  ? -21.169 -5.041  3.294   1.00 0.00 ? 71  PRO A C    4  
ATOM 6155  O O    . PRO A 1 71  ? -20.563 -5.133  4.343   1.00 0.00 ? 71  PRO A O    4  
ATOM 6156  C CB   . PRO A 1 71  ? -23.012 -6.458  4.261   1.00 0.00 ? 71  PRO A CB   4  
ATOM 6157  C CG   . PRO A 1 71  ? -22.393 -7.842  4.566   1.00 0.00 ? 71  PRO A CG   4  
ATOM 6158  C CD   . PRO A 1 71  ? -21.800 -8.362  3.243   1.00 0.00 ? 71  PRO A CD   4  
ATOM 6159  H HA   . PRO A 1 71  ? -23.072 -5.460  2.353   1.00 0.00 ? 71  PRO A HA   4  
ATOM 6160  H HB2  . PRO A 1 71  ? -22.809 -5.769  5.072   1.00 0.00 ? 71  PRO A HB2  4  
ATOM 6161  H HB3  . PRO A 1 71  ? -24.076 -6.559  4.116   1.00 0.00 ? 71  PRO A HB3  4  
ATOM 6162  H HG2  . PRO A 1 71  ? -21.614 -7.742  5.310   1.00 0.00 ? 71  PRO A HG2  4  
ATOM 6163  H HG3  . PRO A 1 71  ? -23.155 -8.521  4.916   1.00 0.00 ? 71  PRO A HG3  4  
ATOM 6164  H HD2  . PRO A 1 71  ? -20.774 -8.671  3.386   1.00 0.00 ? 71  PRO A HD2  4  
ATOM 6165  H HD3  . PRO A 1 71  ? -22.393 -9.176  2.855   1.00 0.00 ? 71  PRO A HD3  4  
ATOM 6166  N N    . GLY A 1 72  ? -20.835 -4.154  2.398   1.00 0.00 ? 72  GLY A N    4  
ATOM 6167  C CA   . GLY A 1 72  ? -19.695 -3.231  2.654   1.00 0.00 ? 72  GLY A CA   4  
ATOM 6168  C C    . GLY A 1 72  ? -20.216 -1.799  2.787   1.00 0.00 ? 72  GLY A C    4  
ATOM 6169  O O    . GLY A 1 72  ? -21.327 -1.494  2.402   1.00 0.00 ? 72  GLY A O    4  
ATOM 6170  H H    . GLY A 1 72  ? -21.334 -4.094  1.557   1.00 0.00 ? 72  GLY A H    4  
ATOM 6171  H HA2  . GLY A 1 72  ? -19.198 -3.520  3.570   1.00 0.00 ? 72  GLY A HA2  4  
ATOM 6172  H HA3  . GLY A 1 72  ? -18.996 -3.284  1.830   1.00 0.00 ? 72  GLY A HA3  4  
ATOM 6173  N N    . LYS A 1 73  ? -19.420 -0.918  3.329   1.00 0.00 ? 73  LYS A N    4  
ATOM 6174  C CA   . LYS A 1 73  ? -19.867 0.494   3.487   1.00 0.00 ? 73  LYS A CA   4  
ATOM 6175  C C    . LYS A 1 73  ? -18.648 1.417   3.439   1.00 0.00 ? 73  LYS A C    4  
ATOM 6176  O O    . LYS A 1 73  ? -18.568 2.396   4.155   1.00 0.00 ? 73  LYS A O    4  
ATOM 6177  C CB   . LYS A 1 73  ? -20.579 0.659   4.831   1.00 0.00 ? 73  LYS A CB   4  
ATOM 6178  C CG   . LYS A 1 73  ? -21.390 1.955   4.823   1.00 0.00 ? 73  LYS A CG   4  
ATOM 6179  C CD   . LYS A 1 73  ? -21.363 2.582   6.217   1.00 0.00 ? 73  LYS A CD   4  
ATOM 6180  C CE   . LYS A 1 73  ? -21.190 4.097   6.093   1.00 0.00 ? 73  LYS A CE   4  
ATOM 6181  N NZ   . LYS A 1 73  ? -21.138 4.702   7.452   1.00 0.00 ? 73  LYS A NZ   4  
ATOM 6182  H H    . LYS A 1 73  ? -18.528 -1.186  3.632   1.00 0.00 ? 73  LYS A H    4  
ATOM 6183  H HA   . LYS A 1 73  ? -20.545 0.750   2.686   1.00 0.00 ? 73  LYS A HA   4  
ATOM 6184  H HB2  . LYS A 1 73  ? -21.241 -0.180  4.992   1.00 0.00 ? 73  LYS A HB2  4  
ATOM 6185  H HB3  . LYS A 1 73  ? -19.848 0.698   5.624   1.00 0.00 ? 73  LYS A HB3  4  
ATOM 6186  H HG2  . LYS A 1 73  ? -20.961 2.644   4.110   1.00 0.00 ? 73  LYS A HG2  4  
ATOM 6187  H HG3  . LYS A 1 73  ? -22.411 1.741   4.546   1.00 0.00 ? 73  LYS A HG3  4  
ATOM 6188  H HD2  . LYS A 1 73  ? -22.292 2.367   6.726   1.00 0.00 ? 73  LYS A HD2  4  
ATOM 6189  H HD3  . LYS A 1 73  ? -20.540 2.174   6.782   1.00 0.00 ? 73  LYS A HD3  4  
ATOM 6190  H HE2  . LYS A 1 73  ? -20.271 4.311   5.567   1.00 0.00 ? 73  LYS A HE2  4  
ATOM 6191  H HE3  . LYS A 1 73  ? -22.024 4.511   5.545   1.00 0.00 ? 73  LYS A HE3  4  
ATOM 6192  H HZ1  . LYS A 1 73  ? -21.962 4.390   8.003   1.00 0.00 ? 73  LYS A HZ1  4  
ATOM 6193  H HZ2  . LYS A 1 73  ? -21.148 5.740   7.369   1.00 0.00 ? 73  LYS A HZ2  4  
ATOM 6194  H HZ3  . LYS A 1 73  ? -20.268 4.400   7.933   1.00 0.00 ? 73  LYS A HZ3  4  
ATOM 6195  N N    . GLY A 1 74  ? -17.697 1.111   2.600   1.00 0.00 ? 74  GLY A N    4  
ATOM 6196  C CA   . GLY A 1 74  ? -16.481 1.967   2.504   1.00 0.00 ? 74  GLY A CA   4  
ATOM 6197  C C    . GLY A 1 74  ? -15.861 1.811   1.115   1.00 0.00 ? 74  GLY A C    4  
ATOM 6198  O O    . GLY A 1 74  ? -16.550 1.605   0.136   1.00 0.00 ? 74  GLY A O    4  
ATOM 6199  H H    . GLY A 1 74  ? -17.782 0.317   2.034   1.00 0.00 ? 74  GLY A H    4  
ATOM 6200  H HA2  . GLY A 1 74  ? -16.752 3.000   2.664   1.00 0.00 ? 74  GLY A HA2  4  
ATOM 6201  H HA3  . GLY A 1 74  ? -15.766 1.661   3.254   1.00 0.00 ? 74  GLY A HA3  4  
ATOM 6202  N N    . SER A 1 75  ? -14.563 1.907   1.019   1.00 0.00 ? 75  SER A N    4  
ATOM 6203  C CA   . SER A 1 75  ? -13.902 1.763   -0.306  1.00 0.00 ? 75  SER A CA   4  
ATOM 6204  C C    . SER A 1 75  ? -12.769 0.742   -0.202  1.00 0.00 ? 75  SER A C    4  
ATOM 6205  O O    . SER A 1 75  ? -11.838 0.910   0.561   1.00 0.00 ? 75  SER A O    4  
ATOM 6206  C CB   . SER A 1 75  ? -13.332 3.113   -0.741  1.00 0.00 ? 75  SER A CB   4  
ATOM 6207  O OG   . SER A 1 75  ? -14.302 4.127   -0.513  1.00 0.00 ? 75  SER A OG   4  
ATOM 6208  H H    . SER A 1 75  ? -14.023 2.074   1.821   1.00 0.00 ? 75  SER A H    4  
ATOM 6209  H HA   . SER A 1 75  ? -14.626 1.426   -1.035  1.00 0.00 ? 75  SER A HA   4  
ATOM 6210  H HB2  . SER A 1 75  ? -12.447 3.333   -0.169  1.00 0.00 ? 75  SER A HB2  4  
ATOM 6211  H HB3  . SER A 1 75  ? -13.078 3.073   -1.792  1.00 0.00 ? 75  SER A HB3  4  
ATOM 6212  H HG   . SER A 1 75  ? -13.836 4.944   -0.314  1.00 0.00 ? 75  SER A HG   4  
ATOM 6213  N N    . PHE A 1 76  ? -12.835 -0.314  -0.965  1.00 0.00 ? 76  PHE A N    4  
ATOM 6214  C CA   . PHE A 1 76  ? -11.757 -1.339  -0.906  1.00 0.00 ? 76  PHE A CA   4  
ATOM 6215  C C    . PHE A 1 76  ? -11.401 -1.786  -2.322  1.00 0.00 ? 76  PHE A C    4  
ATOM 6216  O O    . PHE A 1 76  ? -12.173 -2.445  -2.991  1.00 0.00 ? 76  PHE A O    4  
ATOM 6217  C CB   . PHE A 1 76  ? -12.234 -2.544  -0.097  1.00 0.00 ? 76  PHE A CB   4  
ATOM 6218  C CG   . PHE A 1 76  ? -11.116 -3.016  0.800   1.00 0.00 ? 76  PHE A CG   4  
ATOM 6219  C CD1  . PHE A 1 76  ? -9.820  -3.145  0.289   1.00 0.00 ? 76  PHE A CD1  4  
ATOM 6220  C CD2  . PHE A 1 76  ? -11.374 -3.324  2.141   1.00 0.00 ? 76  PHE A CD2  4  
ATOM 6221  C CE1  . PHE A 1 76  ? -8.781  -3.580  1.119   1.00 0.00 ? 76  PHE A CE1  4  
ATOM 6222  C CE2  . PHE A 1 76  ? -10.335 -3.759  2.972   1.00 0.00 ? 76  PHE A CE2  4  
ATOM 6223  C CZ   . PHE A 1 76  ? -9.038  -3.887  2.460   1.00 0.00 ? 76  PHE A CZ   4  
ATOM 6224  H H    . PHE A 1 76  ? -13.592 -0.433  -1.577  1.00 0.00 ? 76  PHE A H    4  
ATOM 6225  H HA   . PHE A 1 76  ? -10.883 -0.913  -0.434  1.00 0.00 ? 76  PHE A HA   4  
ATOM 6226  H HB2  . PHE A 1 76  ? -13.085 -2.261  0.505   1.00 0.00 ? 76  PHE A HB2  4  
ATOM 6227  H HB3  . PHE A 1 76  ? -12.516 -3.341  -0.768  1.00 0.00 ? 76  PHE A HB3  4  
ATOM 6228  H HD1  . PHE A 1 76  ? -9.622  -2.907  -0.746  1.00 0.00 ? 76  PHE A HD1  4  
ATOM 6229  H HD2  . PHE A 1 76  ? -12.375 -3.224  2.535   1.00 0.00 ? 76  PHE A HD2  4  
ATOM 6230  H HE1  . PHE A 1 76  ? -7.782  -3.681  0.726   1.00 0.00 ? 76  PHE A HE1  4  
ATOM 6231  H HE2  . PHE A 1 76  ? -10.533 -3.995  4.006   1.00 0.00 ? 76  PHE A HE2  4  
ATOM 6232  H HZ   . PHE A 1 76  ? -8.236  -4.223  3.101   1.00 0.00 ? 76  PHE A HZ   4  
ATOM 6233  N N    . TRP A 1 77  ? -10.235 -1.435  -2.784  1.00 0.00 ? 77  TRP A N    4  
ATOM 6234  C CA   . TRP A 1 77  ? -9.820  -1.839  -4.156  1.00 0.00 ? 77  TRP A CA   4  
ATOM 6235  C C    . TRP A 1 77  ? -8.697  -2.883  -4.034  1.00 0.00 ? 77  TRP A C    4  
ATOM 6236  O O    . TRP A 1 77  ? -7.876  -2.808  -3.142  1.00 0.00 ? 77  TRP A O    4  
ATOM 6237  C CB   . TRP A 1 77  ? -9.313  -0.596  -4.894  1.00 0.00 ? 77  TRP A CB   4  
ATOM 6238  C CG   . TRP A 1 77  ? -8.029  -0.181  -4.277  1.00 0.00 ? 77  TRP A CG   4  
ATOM 6239  C CD1  . TRP A 1 77  ? -7.879  0.757   -3.316  1.00 0.00 ? 77  TRP A CD1  4  
ATOM 6240  C CD2  . TRP A 1 77  ? -6.713  -0.700  -4.558  1.00 0.00 ? 77  TRP A CD2  4  
ATOM 6241  N NE1  . TRP A 1 77  ? -6.538  0.842   -2.989  1.00 0.00 ? 77  TRP A NE1  4  
ATOM 6242  C CE2  . TRP A 1 77  ? -5.780  -0.038  -3.733  1.00 0.00 ? 77  TRP A CE2  4  
ATOM 6243  C CE3  . TRP A 1 77  ? -6.250  -1.676  -5.450  1.00 0.00 ? 77  TRP A CE3  4  
ATOM 6244  C CZ2  . TRP A 1 77  ? -4.425  -0.342  -3.789  1.00 0.00 ? 77  TRP A CZ2  4  
ATOM 6245  C CZ3  . TRP A 1 77  ? -4.891  -1.982  -5.514  1.00 0.00 ? 77  TRP A CZ3  4  
ATOM 6246  C CH2  . TRP A 1 77  ? -3.980  -1.317  -4.684  1.00 0.00 ? 77  TRP A CH2  4  
ATOM 6247  H H    . TRP A 1 77  ? -9.624  -0.902  -2.224  1.00 0.00 ? 77  TRP A H    4  
ATOM 6248  H HA   . TRP A 1 77  ? -10.662 -2.263  -4.683  1.00 0.00 ? 77  TRP A HA   4  
ATOM 6249  H HB2  . TRP A 1 77  ? -9.153  -0.829  -5.937  1.00 0.00 ? 77  TRP A HB2  4  
ATOM 6250  H HB3  . TRP A 1 77  ? -10.030 0.204   -4.805  1.00 0.00 ? 77  TRP A HB3  4  
ATOM 6251  H HD1  . TRP A 1 77  ? -8.674  1.341   -2.876  1.00 0.00 ? 77  TRP A HD1  4  
ATOM 6252  H HE1  . TRP A 1 77  ? -6.156  1.447   -2.319  1.00 0.00 ? 77  TRP A HE1  4  
ATOM 6253  H HE3  . TRP A 1 77  ? -6.947  -2.193  -6.094  1.00 0.00 ? 77  TRP A HE3  4  
ATOM 6254  H HZ2  . TRP A 1 77  ? -3.723  0.172   -3.149  1.00 0.00 ? 77  TRP A HZ2  4  
ATOM 6255  H HZ3  . TRP A 1 77  ? -4.543  -2.735  -6.205  1.00 0.00 ? 77  TRP A HZ3  4  
ATOM 6256  H HH2  . TRP A 1 77  ? -2.942  -1.556  -4.739  1.00 0.00 ? 77  TRP A HH2  4  
ATOM 6257  N N    . ARG A 1 78  ? -8.653  -3.866  -4.901  1.00 0.00 ? 78  ARG A N    4  
ATOM 6258  C CA   . ARG A 1 78  ? -7.573  -4.900  -4.781  1.00 0.00 ? 78  ARG A CA   4  
ATOM 6259  C C    . ARG A 1 78  ? -7.101  -5.362  -6.156  1.00 0.00 ? 78  ARG A C    4  
ATOM 6260  O O    . ARG A 1 78  ? -7.763  -5.169  -7.150  1.00 0.00 ? 78  ARG A O    4  
ATOM 6261  C CB   . ARG A 1 78  ? -8.105  -6.110  -4.024  1.00 0.00 ? 78  ARG A CB   4  
ATOM 6262  C CG   . ARG A 1 78  ? -9.366  -6.630  -4.715  1.00 0.00 ? 78  ARG A CG   4  
ATOM 6263  C CD   . ARG A 1 78  ? -10.214 -7.410  -3.710  1.00 0.00 ? 78  ARG A CD   4  
ATOM 6264  N NE   . ARG A 1 78  ? -10.414 -8.803  -4.201  1.00 0.00 ? 78  ARG A NE   4  
ATOM 6265  C CZ   . ARG A 1 78  ? -11.122 -9.024  -5.276  1.00 0.00 ? 78  ARG A CZ   4  
ATOM 6266  N NH1  . ARG A 1 78  ? -12.051 -8.179  -5.632  1.00 0.00 ? 78  ARG A NH1  4  
ATOM 6267  N NH2  . ARG A 1 78  ? -10.901 -10.090 -5.994  1.00 0.00 ? 78  ARG A NH2  4  
ATOM 6268  H H    . ARG A 1 78  ? -9.323  -3.930  -5.613  1.00 0.00 ? 78  ARG A H    4  
ATOM 6269  H HA   . ARG A 1 78  ? -6.738  -4.482  -4.239  1.00 0.00 ? 78  ARG A HA   4  
ATOM 6270  H HB2  . ARG A 1 78  ? -7.352  -6.886  -4.013  1.00 0.00 ? 78  ARG A HB2  4  
ATOM 6271  H HB3  . ARG A 1 78  ? -8.338  -5.824  -3.018  1.00 0.00 ? 78  ARG A HB3  4  
ATOM 6272  H HG2  . ARG A 1 78  ? -9.936  -5.796  -5.098  1.00 0.00 ? 78  ARG A HG2  4  
ATOM 6273  H HG3  . ARG A 1 78  ? -9.089  -7.282  -5.530  1.00 0.00 ? 78  ARG A HG3  4  
ATOM 6274  H HD2  . ARG A 1 78  ? -9.709  -7.436  -2.755  1.00 0.00 ? 78  ARG A HD2  4  
ATOM 6275  H HD3  . ARG A 1 78  ? -11.171 -6.927  -3.597  1.00 0.00 ? 78  ARG A HD3  4  
ATOM 6276  H HE   . ARG A 1 78  ? -10.013 -9.555  -3.717  1.00 0.00 ? 78  ARG A HE   4  
ATOM 6277  H HH11 . ARG A 1 78  ? -12.223 -7.363  -5.082  1.00 0.00 ? 78  ARG A HH11 4  
ATOM 6278  H HH12 . ARG A 1 78  ? -12.593 -8.350  -6.456  1.00 0.00 ? 78  ARG A HH12 4  
ATOM 6279  H HH21 . ARG A 1 78  ? -10.188 -10.737 -5.721  1.00 0.00 ? 78  ARG A HH21 4  
ATOM 6280  H HH22 . ARG A 1 78  ? -11.442 -10.260 -6.817  1.00 0.00 ? 78  ARG A HH22 4  
ATOM 6281  N N    . ILE A 1 79  ? -5.961  -5.997  -6.206  1.00 0.00 ? 79  ILE A N    4  
ATOM 6282  C CA   . ILE A 1 79  ? -5.435  -6.494  -7.515  1.00 0.00 ? 79  ILE A CA   4  
ATOM 6283  C C    . ILE A 1 79  ? -5.987  -7.893  -7.791  1.00 0.00 ? 79  ILE A C    4  
ATOM 6284  O O    . ILE A 1 79  ? -6.415  -8.591  -6.894  1.00 0.00 ? 79  ILE A O    4  
ATOM 6285  C CB   . ILE A 1 79  ? -3.903  -6.536  -7.491  1.00 0.00 ? 79  ILE A CB   4  
ATOM 6286  C CG1  . ILE A 1 79  ? -3.384  -6.878  -8.890  1.00 0.00 ? 79  ILE A CG1  4  
ATOM 6287  C CG2  . ILE A 1 79  ? -3.421  -7.595  -6.505  1.00 0.00 ? 79  ILE A CG2  4  
ATOM 6288  C CD1  . ILE A 1 79  ? -2.149  -6.034  -9.197  1.00 0.00 ? 79  ILE A CD1  4  
ATOM 6289  H H    . ILE A 1 79  ? -5.460  -6.160  -5.375  1.00 0.00 ? 79  ILE A H    4  
ATOM 6290  H HA   . ILE A 1 79  ? -5.755  -5.831  -8.305  1.00 0.00 ? 79  ILE A HA   4  
ATOM 6291  H HB   . ILE A 1 79  ? -3.521  -5.573  -7.192  1.00 0.00 ? 79  ILE A HB   4  
ATOM 6292  H HG12 . ILE A 1 79  ? -3.126  -7.926  -8.934  1.00 0.00 ? 79  ILE A HG12 4  
ATOM 6293  H HG13 . ILE A 1 79  ? -4.149  -6.664  -9.619  1.00 0.00 ? 79  ILE A HG13 4  
ATOM 6294  H HG21 . ILE A 1 79  ? -2.369  -7.786  -6.671  1.00 0.00 ? 79  ILE A HG21 4  
ATOM 6295  H HG22 . ILE A 1 79  ? -3.980  -8.506  -6.652  1.00 0.00 ? 79  ILE A HG22 4  
ATOM 6296  H HG23 . ILE A 1 79  ? -3.566  -7.239  -5.497  1.00 0.00 ? 79  ILE A HG23 4  
ATOM 6297  H HD11 . ILE A 1 79  ? -2.457  -5.080  -9.595  1.00 0.00 ? 79  ILE A HD11 4  
ATOM 6298  H HD12 . ILE A 1 79  ? -1.536  -6.541  -9.919  1.00 0.00 ? 79  ILE A HD12 4  
ATOM 6299  H HD13 . ILE A 1 79  ? -1.584  -5.879  -8.289  1.00 0.00 ? 79  ILE A HD13 4  
ATOM 6300  N N    . ASP A 1 80  ? -5.985  -8.303  -9.030  1.00 0.00 ? 80  ASP A N    4  
ATOM 6301  C CA   . ASP A 1 80  ? -6.509  -9.647  -9.374  1.00 0.00 ? 80  ASP A CA   4  
ATOM 6302  C C    . ASP A 1 80  ? -5.654  -10.709 -8.684  1.00 0.00 ? 80  ASP A C    4  
ATOM 6303  O O    . ASP A 1 80  ? -4.453  -10.560 -8.576  1.00 0.00 ? 80  ASP A O    4  
ATOM 6304  C CB   . ASP A 1 80  ? -6.451  -9.846  -10.891 1.00 0.00 ? 80  ASP A CB   4  
ATOM 6305  C CG   . ASP A 1 80  ? -7.870  -9.834  -11.465 1.00 0.00 ? 80  ASP A CG   4  
ATOM 6306  O OD1  . ASP A 1 80  ? -8.788  -9.541  -10.715 1.00 0.00 ? 80  ASP A OD1  4  
ATOM 6307  O OD2  . ASP A 1 80  ? -8.014  -10.116 -12.642 1.00 0.00 ? 80  ASP A OD2  4  
ATOM 6308  H H    . ASP A 1 80  ? -5.638  -7.726  -9.732  1.00 0.00 ? 80  ASP A H    4  
ATOM 6309  H HA   . ASP A 1 80  ? -7.531  -9.726  -9.039  1.00 0.00 ? 80  ASP A HA   4  
ATOM 6310  H HB2  . ASP A 1 80  ? -5.875  -9.048  -11.336 1.00 0.00 ? 80  ASP A HB2  4  
ATOM 6311  H HB3  . ASP A 1 80  ? -5.984  -10.795 -11.112 1.00 0.00 ? 80  ASP A HB3  4  
ATOM 6312  N N    . PRO A 1 81  ? -6.300  -11.747 -8.232  1.00 0.00 ? 81  PRO A N    4  
ATOM 6313  C CA   . PRO A 1 81  ? -5.627  -12.853 -7.537  1.00 0.00 ? 81  PRO A CA   4  
ATOM 6314  C C    . PRO A 1 81  ? -4.959  -13.792 -8.548  1.00 0.00 ? 81  PRO A C    4  
ATOM 6315  O O    . PRO A 1 81  ? -4.047  -14.524 -8.219  1.00 0.00 ? 81  PRO A O    4  
ATOM 6316  C CB   . PRO A 1 81  ? -6.769  -13.558 -6.800  1.00 0.00 ? 81  PRO A CB   4  
ATOM 6317  C CG   . PRO A 1 81  ? -8.073  -13.179 -7.546  1.00 0.00 ? 81  PRO A CG   4  
ATOM 6318  C CD   . PRO A 1 81  ? -7.761  -11.915 -8.370  1.00 0.00 ? 81  PRO A CD   4  
ATOM 6319  H HA   . PRO A 1 81  ? -4.905  -12.479 -6.830  1.00 0.00 ? 81  PRO A HA   4  
ATOM 6320  H HB2  . PRO A 1 81  ? -6.620  -14.628 -6.825  1.00 0.00 ? 81  PRO A HB2  4  
ATOM 6321  H HB3  . PRO A 1 81  ? -6.821  -13.212 -5.780  1.00 0.00 ? 81  PRO A HB3  4  
ATOM 6322  H HG2  . PRO A 1 81  ? -8.371  -13.987 -8.200  1.00 0.00 ? 81  PRO A HG2  4  
ATOM 6323  H HG3  . PRO A 1 81  ? -8.857  -12.967 -6.836  1.00 0.00 ? 81  PRO A HG3  4  
ATOM 6324  H HD2  . PRO A 1 81  ? -8.030  -12.068 -9.406  1.00 0.00 ? 81  PRO A HD2  4  
ATOM 6325  H HD3  . PRO A 1 81  ? -8.276  -11.052 -7.967  1.00 0.00 ? 81  PRO A HD3  4  
ATOM 6326  N N    . ALA A 1 82  ? -5.410  -13.780 -9.772  1.00 0.00 ? 82  ALA A N    4  
ATOM 6327  C CA   . ALA A 1 82  ? -4.805  -14.675 -10.799 1.00 0.00 ? 82  ALA A CA   4  
ATOM 6328  C C    . ALA A 1 82  ? -3.660  -13.958 -11.518 1.00 0.00 ? 82  ALA A C    4  
ATOM 6329  O O    . ALA A 1 82  ? -2.800  -14.585 -12.105 1.00 0.00 ? 82  ALA A O    4  
ATOM 6330  C CB   . ALA A 1 82  ? -5.875  -15.076 -11.817 1.00 0.00 ? 82  ALA A CB   4  
ATOM 6331  H H    . ALA A 1 82  ? -6.150  -13.184 -10.016 1.00 0.00 ? 82  ALA A H    4  
ATOM 6332  H HA   . ALA A 1 82  ? -4.419  -15.561 -10.317 1.00 0.00 ? 82  ALA A HA   4  
ATOM 6333  H HB1  . ALA A 1 82  ? -5.651  -14.623 -12.772 1.00 0.00 ? 82  ALA A HB1  4  
ATOM 6334  H HB2  . ALA A 1 82  ? -6.841  -14.735 -11.475 1.00 0.00 ? 82  ALA A HB2  4  
ATOM 6335  H HB3  . ALA A 1 82  ? -5.888  -16.150 -11.921 1.00 0.00 ? 82  ALA A HB3  4  
ATOM 6336  N N    . SER A 1 83  ? -3.632  -12.656 -11.478 1.00 0.00 ? 83  SER A N    4  
ATOM 6337  C CA   . SER A 1 83  ? -2.532  -11.923 -12.162 1.00 0.00 ? 83  SER A CA   4  
ATOM 6338  C C    . SER A 1 83  ? -1.523  -11.456 -11.120 1.00 0.00 ? 83  SER A C    4  
ATOM 6339  O O    . SER A 1 83  ? -0.474  -10.955 -11.446 1.00 0.00 ? 83  SER A O    4  
ATOM 6340  C CB   . SER A 1 83  ? -3.097  -10.705 -12.901 1.00 0.00 ? 83  SER A CB   4  
ATOM 6341  O OG   . SER A 1 83  ? -3.165  -10.991 -14.292 1.00 0.00 ? 83  SER A OG   4  
ATOM 6342  H H    . SER A 1 83  ? -4.327  -12.160 -10.996 1.00 0.00 ? 83  SER A H    4  
ATOM 6343  H HA   . SER A 1 83  ? -2.043  -12.579 -12.868 1.00 0.00 ? 83  SER A HA   4  
ATOM 6344  H HB2  . SER A 1 83  ? -4.086  -10.486 -12.535 1.00 0.00 ? 83  SER A HB2  4  
ATOM 6345  H HB3  . SER A 1 83  ? -2.453  -9.846  -12.730 1.00 0.00 ? 83  SER A HB3  4  
ATOM 6346  H HG   . SER A 1 83  ? -2.532  -10.428 -14.742 1.00 0.00 ? 83  SER A HG   4  
ATOM 6347  N N    . GLU A 1 84  ? -1.836  -11.608 -9.865  1.00 0.00 ? 84  GLU A N    4  
ATOM 6348  C CA   . GLU A 1 84  ? -0.896  -11.152 -8.807  1.00 0.00 ? 84  GLU A CA   4  
ATOM 6349  C C    . GLU A 1 84  ? 0.450   -11.865 -8.940  1.00 0.00 ? 84  GLU A C    4  
ATOM 6350  O O    . GLU A 1 84  ? 1.487   -11.267 -8.754  1.00 0.00 ? 84  GLU A O    4  
ATOM 6351  C CB   . GLU A 1 84  ? -1.500  -11.447 -7.430  1.00 0.00 ? 84  GLU A CB   4  
ATOM 6352  C CG   . GLU A 1 84  ? -0.540  -10.978 -6.335  1.00 0.00 ? 84  GLU A CG   4  
ATOM 6353  C CD   . GLU A 1 84  ? -1.266  -10.976 -4.988  1.00 0.00 ? 84  GLU A CD   4  
ATOM 6354  O OE1  . GLU A 1 84  ? -1.363  -12.035 -4.389  1.00 0.00 ? 84  GLU A OE1  4  
ATOM 6355  O OE2  . GLU A 1 84  ? -1.714  -9.918  -4.579  1.00 0.00 ? 84  GLU A OE2  4  
ATOM 6356  H H    . GLU A 1 84  ? -2.694  -12.010 -9.618  1.00 0.00 ? 84  GLU A H    4  
ATOM 6357  H HA   . GLU A 1 84  ? -0.740  -10.092 -8.911  1.00 0.00 ? 84  GLU A HA   4  
ATOM 6358  H HB2  . GLU A 1 84  ? -2.441  -10.924 -7.332  1.00 0.00 ? 84  GLU A HB2  4  
ATOM 6359  H HB3  . GLU A 1 84  ? -1.666  -12.508 -7.330  1.00 0.00 ? 84  GLU A HB3  4  
ATOM 6360  H HG2  . GLU A 1 84  ? 0.308   -11.646 -6.288  1.00 0.00 ? 84  GLU A HG2  4  
ATOM 6361  H HG3  . GLU A 1 84  ? -0.198  -9.978  -6.558  1.00 0.00 ? 84  GLU A HG3  4  
ATOM 6362  N N    . ALA A 1 85  ? 0.454   -13.129 -9.258  1.00 0.00 ? 85  ALA A N    4  
ATOM 6363  C CA   . ALA A 1 85  ? 1.757   -13.844 -9.391  1.00 0.00 ? 85  ALA A CA   4  
ATOM 6364  C C    . ALA A 1 85  ? 2.554   -13.238 -10.552 1.00 0.00 ? 85  ALA A C    4  
ATOM 6365  O O    . ALA A 1 85  ? 3.758   -13.377 -10.630 1.00 0.00 ? 85  ALA A O    4  
ATOM 6366  C CB   . ALA A 1 85  ? 1.504   -15.328 -9.663  1.00 0.00 ? 85  ALA A CB   4  
ATOM 6367  H H    . ALA A 1 85  ? -0.392  -13.607 -9.407  1.00 0.00 ? 85  ALA A H    4  
ATOM 6368  H HA   . ALA A 1 85  ? 2.323   -13.733 -8.475  1.00 0.00 ? 85  ALA A HA   4  
ATOM 6369  H HB1  . ALA A 1 85  ? 2.117   -15.924 -9.003  1.00 0.00 ? 85  ALA A HB1  4  
ATOM 6370  H HB2  . ALA A 1 85  ? 1.754   -15.554 -10.689 1.00 0.00 ? 85  ALA A HB2  4  
ATOM 6371  H HB3  . ALA A 1 85  ? 0.463   -15.553 -9.487  1.00 0.00 ? 85  ALA A HB3  4  
ATOM 6372  N N    . LYS A 1 86  ? 1.886   -12.568 -11.450 1.00 0.00 ? 86  LYS A N    4  
ATOM 6373  C CA   . LYS A 1 86  ? 2.598   -11.953 -12.608 1.00 0.00 ? 86  LYS A CA   4  
ATOM 6374  C C    . LYS A 1 86  ? 3.075   -10.544 -12.236 1.00 0.00 ? 86  LYS A C    4  
ATOM 6375  O O    . LYS A 1 86  ? 4.251   -10.244 -12.293 1.00 0.00 ? 86  LYS A O    4  
ATOM 6376  C CB   . LYS A 1 86  ? 1.644   -11.868 -13.804 1.00 0.00 ? 86  LYS A CB   4  
ATOM 6377  C CG   . LYS A 1 86  ? 2.341   -11.159 -14.967 1.00 0.00 ? 86  LYS A CG   4  
ATOM 6378  C CD   . LYS A 1 86  ? 1.564   -9.891  -15.334 1.00 0.00 ? 86  LYS A CD   4  
ATOM 6379  C CE   . LYS A 1 86  ? 2.511   -8.882  -15.986 1.00 0.00 ? 86  LYS A CE   4  
ATOM 6380  N NZ   . LYS A 1 86  ? 1.720   -7.744  -16.534 1.00 0.00 ? 86  LYS A NZ   4  
ATOM 6381  H H    . LYS A 1 86  ? 0.918   -12.473 -11.366 1.00 0.00 ? 86  LYS A H    4  
ATOM 6382  H HA   . LYS A 1 86  ? 3.449   -12.562 -12.872 1.00 0.00 ? 86  LYS A HA   4  
ATOM 6383  H HB2  . LYS A 1 86  ? 1.361   -12.865 -14.109 1.00 0.00 ? 86  LYS A HB2  4  
ATOM 6384  H HB3  . LYS A 1 86  ? 0.761   -11.313 -13.523 1.00 0.00 ? 86  LYS A HB3  4  
ATOM 6385  H HG2  . LYS A 1 86  ? 3.347   -10.894 -14.677 1.00 0.00 ? 86  LYS A HG2  4  
ATOM 6386  H HG3  . LYS A 1 86  ? 2.374   -11.816 -15.823 1.00 0.00 ? 86  LYS A HG3  4  
ATOM 6387  H HD2  . LYS A 1 86  ? 0.772   -10.141 -16.024 1.00 0.00 ? 86  LYS A HD2  4  
ATOM 6388  H HD3  . LYS A 1 86  ? 1.141   -9.457  -14.440 1.00 0.00 ? 86  LYS A HD3  4  
ATOM 6389  H HE2  . LYS A 1 86  ? 3.210   -8.514  -15.249 1.00 0.00 ? 86  LYS A HE2  4  
ATOM 6390  H HE3  . LYS A 1 86  ? 3.053   -9.363  -16.787 1.00 0.00 ? 86  LYS A HE3  4  
ATOM 6391  H HZ1  . LYS A 1 86  ? 2.003   -6.864  -16.058 1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 6392  H HZ2  . LYS A 1 86  ? 0.708   -7.917  -16.373 1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 6393  H HZ3  . LYS A 1 86  ? 1.900   -7.655  -17.554 1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 6394  N N    . LEU A 1 87  ? 2.172   -9.674  -11.865 1.00 0.00 ? 87  LEU A N    4  
ATOM 6395  C CA   . LEU A 1 87  ? 2.580   -8.283  -11.502 1.00 0.00 ? 87  LEU A CA   4  
ATOM 6396  C C    . LEU A 1 87  ? 3.676   -8.316  -10.453 1.00 0.00 ? 87  LEU A C    4  
ATOM 6397  O O    . LEU A 1 87  ? 4.733   -7.739  -10.618 1.00 0.00 ? 87  LEU A O    4  
ATOM 6398  C CB   . LEU A 1 87  ? 1.394   -7.495  -10.932 1.00 0.00 ? 87  LEU A CB   4  
ATOM 6399  C CG   . LEU A 1 87  ? 0.366   -8.432  -10.287 1.00 0.00 ? 87  LEU A CG   4  
ATOM 6400  C CD1  . LEU A 1 87  ? 0.009   -7.914  -8.893  1.00 0.00 ? 87  LEU A CD1  4  
ATOM 6401  C CD2  . LEU A 1 87  ? -0.897  -8.454  -11.150 1.00 0.00 ? 87  LEU A CD2  4  
ATOM 6402  H H    . LEU A 1 87  ? 1.231   -9.931  -11.835 1.00 0.00 ? 87  LEU A H    4  
ATOM 6403  H HA   . LEU A 1 87  ? 2.951   -7.784  -12.379 1.00 0.00 ? 87  LEU A HA   4  
ATOM 6404  H HB2  . LEU A 1 87  ? 1.755   -6.803  -10.189 1.00 0.00 ? 87  LEU A HB2  4  
ATOM 6405  H HB3  . LEU A 1 87  ? 0.926   -6.948  -11.721 1.00 0.00 ? 87  LEU A HB3  4  
ATOM 6406  H HG   . LEU A 1 87  ? 0.772   -9.426  -10.203 1.00 0.00 ? 87  LEU A HG   4  
ATOM 6407  H HD11 . LEU A 1 87  ? 0.164   -6.847  -8.853  1.00 0.00 ? 87  LEU A HD11 4  
ATOM 6408  H HD12 . LEU A 1 87  ? 0.632   -8.399  -8.157  1.00 0.00 ? 87  LEU A HD12 4  
ATOM 6409  H HD13 . LEU A 1 87  ? -1.029  -8.134  -8.685  1.00 0.00 ? 87  LEU A HD13 4  
ATOM 6410  H HD21 . LEU A 1 87  ? -1.165  -7.446  -11.414 1.00 0.00 ? 87  LEU A HD21 4  
ATOM 6411  H HD22 . LEU A 1 87  ? -1.707  -8.909  -10.597 1.00 0.00 ? 87  LEU A HD22 4  
ATOM 6412  H HD23 . LEU A 1 87  ? -0.712  -9.019  -12.049 1.00 0.00 ? 87  LEU A HD23 4  
ATOM 6413  N N    . VAL A 1 88  ? 3.420   -8.970  -9.370  1.00 0.00 ? 88  VAL A N    4  
ATOM 6414  C CA   . VAL A 1 88  ? 4.422   -9.044  -8.285  1.00 0.00 ? 88  VAL A CA   4  
ATOM 6415  C C    . VAL A 1 88  ? 5.823   -9.245  -8.859  1.00 0.00 ? 88  VAL A C    4  
ATOM 6416  O O    . VAL A 1 88  ? 6.803   -8.793  -8.302  1.00 0.00 ? 88  VAL A O    4  
ATOM 6417  C CB   . VAL A 1 88  ? 4.088   -10.230 -7.418  1.00 0.00 ? 88  VAL A CB   4  
ATOM 6418  C CG1  . VAL A 1 88  ? 2.758   -9.993  -6.697  1.00 0.00 ? 88  VAL A CG1  4  
ATOM 6419  C CG2  . VAL A 1 88  ? 3.985   -11.470 -8.307  1.00 0.00 ? 88  VAL A CG2  4  
ATOM 6420  H H    . VAL A 1 88  ? 2.553   -9.414  -9.263  1.00 0.00 ? 88  VAL A H    4  
ATOM 6421  H HA   . VAL A 1 88  ? 4.391   -8.142  -7.693  1.00 0.00 ? 88  VAL A HA   4  
ATOM 6422  H HB   . VAL A 1 88  ? 4.870   -10.357 -6.709  1.00 0.00 ? 88  VAL A HB   4  
ATOM 6423  H HG11 . VAL A 1 88  ? 2.950   -9.566  -5.724  1.00 0.00 ? 88  VAL A HG11 4  
ATOM 6424  H HG12 . VAL A 1 88  ? 2.239   -10.933 -6.582  1.00 0.00 ? 88  VAL A HG12 4  
ATOM 6425  H HG13 . VAL A 1 88  ? 2.151   -9.313  -7.275  1.00 0.00 ? 88  VAL A HG13 4  
ATOM 6426  H HG21 . VAL A 1 88  ? 3.366   -12.210 -7.825  1.00 0.00 ? 88  VAL A HG21 4  
ATOM 6427  H HG22 . VAL A 1 88  ? 4.971   -11.875 -8.475  1.00 0.00 ? 88  VAL A HG22 4  
ATOM 6428  H HG23 . VAL A 1 88  ? 3.545   -11.194 -9.256  1.00 0.00 ? 88  VAL A HG23 4  
ATOM 6429  N N    . GLU A 1 89  ? 5.929   -9.929  -9.962  1.00 0.00 ? 89  GLU A N    4  
ATOM 6430  C CA   . GLU A 1 89  ? 7.275   -10.158 -10.558 1.00 0.00 ? 89  GLU A CA   4  
ATOM 6431  C C    . GLU A 1 89  ? 7.949   -8.803  -10.748 1.00 0.00 ? 89  GLU A C    4  
ATOM 6432  O O    . GLU A 1 89  ? 9.033   -8.564  -10.255 1.00 0.00 ? 89  GLU A O    4  
ATOM 6433  C CB   . GLU A 1 89  ? 7.124   -10.856 -11.912 1.00 0.00 ? 89  GLU A CB   4  
ATOM 6434  C CG   . GLU A 1 89  ? 8.506   -11.086 -12.528 1.00 0.00 ? 89  GLU A CG   4  
ATOM 6435  C CD   . GLU A 1 89  ? 8.371   -11.966 -13.773 1.00 0.00 ? 89  GLU A CD   4  
ATOM 6436  O OE1  . GLU A 1 89  ? 8.118   -11.422 -14.834 1.00 0.00 ? 89  GLU A OE1  4  
ATOM 6437  O OE2  . GLU A 1 89  ? 8.523   -13.170 -13.643 1.00 0.00 ? 89  GLU A OE2  4  
ATOM 6438  H H    . GLU A 1 89  ? 5.130   -10.295 -10.389 1.00 0.00 ? 89  GLU A H    4  
ATOM 6439  H HA   . GLU A 1 89  ? 7.867   -10.770 -9.894  1.00 0.00 ? 89  GLU A HA   4  
ATOM 6440  H HB2  . GLU A 1 89  ? 6.629   -11.807 -11.772 1.00 0.00 ? 89  GLU A HB2  4  
ATOM 6441  H HB3  . GLU A 1 89  ? 6.535   -10.238 -12.572 1.00 0.00 ? 89  GLU A HB3  4  
ATOM 6442  H HG2  . GLU A 1 89  ? 8.939   -10.136 -12.805 1.00 0.00 ? 89  GLU A HG2  4  
ATOM 6443  H HG3  . GLU A 1 89  ? 9.144   -11.578 -11.809 1.00 0.00 ? 89  GLU A HG3  4  
ATOM 6444  N N    . GLN A 1 90  ? 7.302   -7.903  -11.432 1.00 0.00 ? 90  GLN A N    4  
ATOM 6445  C CA   . GLN A 1 90  ? 7.895   -6.554  -11.622 1.00 0.00 ? 90  GLN A CA   4  
ATOM 6446  C C    . GLN A 1 90  ? 7.937   -5.853  -10.263 1.00 0.00 ? 90  GLN A C    4  
ATOM 6447  O O    . GLN A 1 90  ? 8.656   -4.892  -10.068 1.00 0.00 ? 90  GLN A O    4  
ATOM 6448  C CB   . GLN A 1 90  ? 7.029   -5.747  -12.592 1.00 0.00 ? 90  GLN A CB   4  
ATOM 6449  C CG   . GLN A 1 90  ? 7.054   -6.411  -13.971 1.00 0.00 ? 90  GLN A CG   4  
ATOM 6450  C CD   . GLN A 1 90  ? 5.778   -6.052  -14.735 1.00 0.00 ? 90  GLN A CD   4  
ATOM 6451  O OE1  . GLN A 1 90  ? 5.689   -4.997  -15.331 1.00 0.00 ? 90  GLN A OE1  4  
ATOM 6452  N NE2  . GLN A 1 90  ? 4.780   -6.893  -14.745 1.00 0.00 ? 90  GLN A NE2  4  
ATOM 6453  H H    . GLN A 1 90  ? 6.420   -8.108  -11.804 1.00 0.00 ? 90  GLN A H    4  
ATOM 6454  H HA   . GLN A 1 90  ? 8.897   -6.647  -12.015 1.00 0.00 ? 90  GLN A HA   4  
ATOM 6455  H HB2  . GLN A 1 90  ? 6.014   -5.713  -12.225 1.00 0.00 ? 90  GLN A HB2  4  
ATOM 6456  H HB3  . GLN A 1 90  ? 7.418   -4.743  -12.671 1.00 0.00 ? 90  GLN A HB3  4  
ATOM 6457  H HG2  . GLN A 1 90  ? 7.915   -6.064  -14.523 1.00 0.00 ? 90  GLN A HG2  4  
ATOM 6458  H HG3  . GLN A 1 90  ? 7.110   -7.483  -13.853 1.00 0.00 ? 90  GLN A HG3  4  
ATOM 6459  H HE21 . GLN A 1 90  ? 4.855   -7.745  -14.267 1.00 0.00 ? 90  GLN A HE21 4  
ATOM 6460  H HE22 . GLN A 1 90  ? 3.960   -6.674  -15.233 1.00 0.00 ? 90  GLN A HE22 4  
ATOM 6461  N N    . ALA A 1 91  ? 7.169   -6.334  -9.319  1.00 0.00 ? 91  ALA A N    4  
ATOM 6462  C CA   . ALA A 1 91  ? 7.159   -5.704  -7.968  1.00 0.00 ? 91  ALA A CA   4  
ATOM 6463  C C    . ALA A 1 91  ? 8.538   -5.850  -7.320  1.00 0.00 ? 91  ALA A C    4  
ATOM 6464  O O    . ALA A 1 91  ? 9.024   -4.949  -6.665  1.00 0.00 ? 91  ALA A O    4  
ATOM 6465  C CB   . ALA A 1 91  ? 6.106   -6.372  -7.088  1.00 0.00 ? 91  ALA A CB   4  
ATOM 6466  H H    . ALA A 1 91  ? 6.600   -7.108  -9.501  1.00 0.00 ? 91  ALA A H    4  
ATOM 6467  H HA   . ALA A 1 91  ? 6.920   -4.666  -8.066  1.00 0.00 ? 91  ALA A HA   4  
ATOM 6468  H HB1  . ALA A 1 91  ? 5.174   -6.439  -7.632  1.00 0.00 ? 91  ALA A HB1  4  
ATOM 6469  H HB2  . ALA A 1 91  ? 5.958   -5.779  -6.196  1.00 0.00 ? 91  ALA A HB2  4  
ATOM 6470  H HB3  . ALA A 1 91  ? 6.438   -7.360  -6.814  1.00 0.00 ? 91  ALA A HB3  4  
ATOM 6471  N N    . PHE A 1 92  ? 9.176   -6.975  -7.499  1.00 0.00 ? 92  PHE A N    4  
ATOM 6472  C CA   . PHE A 1 92  ? 10.523  -7.168  -6.893  1.00 0.00 ? 92  PHE A CA   4  
ATOM 6473  C C    . PHE A 1 92  ? 11.593  -6.650  -7.856  1.00 0.00 ? 92  PHE A C    4  
ATOM 6474  O O    . PHE A 1 92  ? 12.520  -7.355  -8.204  1.00 0.00 ? 92  PHE A O    4  
ATOM 6475  C CB   . PHE A 1 92  ? 10.764  -8.657  -6.630  1.00 0.00 ? 92  PHE A CB   4  
ATOM 6476  C CG   . PHE A 1 92  ? 9.480   -9.310  -6.177  1.00 0.00 ? 92  PHE A CG   4  
ATOM 6477  C CD1  . PHE A 1 92  ? 8.622   -8.636  -5.301  1.00 0.00 ? 92  PHE A CD1  4  
ATOM 6478  C CD2  . PHE A 1 92  ? 9.150   -10.593 -6.631  1.00 0.00 ? 92  PHE A CD2  4  
ATOM 6479  C CE1  . PHE A 1 92  ? 7.433   -9.245  -4.880  1.00 0.00 ? 92  PHE A CE1  4  
ATOM 6480  C CE2  . PHE A 1 92  ? 7.963   -11.202 -6.209  1.00 0.00 ? 92  PHE A CE2  4  
ATOM 6481  C CZ   . PHE A 1 92  ? 7.104   -10.528 -5.333  1.00 0.00 ? 92  PHE A CZ   4  
ATOM 6482  H H    . PHE A 1 92  ? 8.770   -7.691  -8.033  1.00 0.00 ? 92  PHE A H    4  
ATOM 6483  H HA   . PHE A 1 92  ? 10.582  -6.624  -5.962  1.00 0.00 ? 92  PHE A HA   4  
ATOM 6484  H HB2  . PHE A 1 92  ? 11.108  -9.131  -7.538  1.00 0.00 ? 92  PHE A HB2  4  
ATOM 6485  H HB3  . PHE A 1 92  ? 11.514  -8.768  -5.862  1.00 0.00 ? 92  PHE A HB3  4  
ATOM 6486  H HD1  . PHE A 1 92  ? 8.876   -7.646  -4.952  1.00 0.00 ? 92  PHE A HD1  4  
ATOM 6487  H HD2  . PHE A 1 92  ? 9.813   -11.113 -7.307  1.00 0.00 ? 92  PHE A HD2  4  
ATOM 6488  H HE1  . PHE A 1 92  ? 6.770   -8.725  -4.203  1.00 0.00 ? 92  PHE A HE1  4  
ATOM 6489  H HE2  . PHE A 1 92  ? 7.709   -12.191 -6.559  1.00 0.00 ? 92  PHE A HE2  4  
ATOM 6490  H HZ   . PHE A 1 92  ? 6.188   -10.997 -5.007  1.00 0.00 ? 92  PHE A HZ   4  
ATOM 6491  N N    . ARG A 1 93  ? 11.476  -5.426  -8.291  1.00 0.00 ? 93  ARG A N    4  
ATOM 6492  C CA   . ARG A 1 93  ? 12.491  -4.874  -9.231  1.00 0.00 ? 93  ARG A CA   4  
ATOM 6493  C C    . ARG A 1 93  ? 12.866  -3.452  -8.808  1.00 0.00 ? 93  ARG A C    4  
ATOM 6494  O O    . ARG A 1 93  ? 12.451  -2.974  -7.770  1.00 0.00 ? 93  ARG A O    4  
ATOM 6495  C CB   . ARG A 1 93  ? 11.913  -4.849  -10.647 1.00 0.00 ? 93  ARG A CB   4  
ATOM 6496  C CG   . ARG A 1 93  ? 12.443  -6.049  -11.435 1.00 0.00 ? 93  ARG A CG   4  
ATOM 6497  C CD   . ARG A 1 93  ? 13.662  -5.622  -12.253 1.00 0.00 ? 93  ARG A CD   4  
ATOM 6498  N NE   . ARG A 1 93  ? 14.101  -6.754  -13.115 1.00 0.00 ? 93  ARG A NE   4  
ATOM 6499  C CZ   . ARG A 1 93  ? 15.292  -7.266  -12.964 1.00 0.00 ? 93  ARG A CZ   4  
ATOM 6500  N NH1  . ARG A 1 93  ? 16.342  -6.491  -12.988 1.00 0.00 ? 93  ARG A NH1  4  
ATOM 6501  N NH2  . ARG A 1 93  ? 15.433  -8.551  -12.788 1.00 0.00 ? 93  ARG A NH2  4  
ATOM 6502  H H    . ARG A 1 93  ? 10.722  -4.871  -8.001  1.00 0.00 ? 93  ARG A H    4  
ATOM 6503  H HA   . ARG A 1 93  ? 13.372  -5.497  -9.214  1.00 0.00 ? 93  ARG A HA   4  
ATOM 6504  H HB2  . ARG A 1 93  ? 10.835  -4.898  -10.597 1.00 0.00 ? 93  ARG A HB2  4  
ATOM 6505  H HB3  . ARG A 1 93  ? 12.210  -3.936  -11.142 1.00 0.00 ? 93  ARG A HB3  4  
ATOM 6506  H HG2  . ARG A 1 93  ? 12.725  -6.834  -10.748 1.00 0.00 ? 93  ARG A HG2  4  
ATOM 6507  H HG3  . ARG A 1 93  ? 11.674  -6.410  -12.101 1.00 0.00 ? 93  ARG A HG3  4  
ATOM 6508  H HD2  . ARG A 1 93  ? 13.402  -4.777  -12.873 1.00 0.00 ? 93  ARG A HD2  4  
ATOM 6509  H HD3  . ARG A 1 93  ? 14.465  -5.346  -11.585 1.00 0.00 ? 93  ARG A HD3  4  
ATOM 6510  H HE   . ARG A 1 93  ? 13.496  -7.115  -13.797 1.00 0.00 ? 93  ARG A HE   4  
ATOM 6511  H HH11 . ARG A 1 93  ? 16.234  -5.506  -13.123 1.00 0.00 ? 93  ARG A HH11 4  
ATOM 6512  H HH12 . ARG A 1 93  ? 17.255  -6.883  -12.871 1.00 0.00 ? 93  ARG A HH12 4  
ATOM 6513  H HH21 . ARG A 1 93  ? 14.627  -9.144  -12.770 1.00 0.00 ? 93  ARG A HH21 4  
ATOM 6514  H HH22 . ARG A 1 93  ? 16.344  -8.944  -12.671 1.00 0.00 ? 93  ARG A HH22 4  
ATOM 6515  N N    . LYS A 1 94  ? 13.648  -2.774  -9.602  1.00 0.00 ? 94  LYS A N    4  
ATOM 6516  C CA   . LYS A 1 94  ? 14.050  -1.385  -9.244  1.00 0.00 ? 94  LYS A CA   4  
ATOM 6517  C C    . LYS A 1 94  ? 13.519  -0.409  -10.296 1.00 0.00 ? 94  LYS A C    4  
ATOM 6518  O O    . LYS A 1 94  ? 13.153  -0.796  -11.389 1.00 0.00 ? 94  LYS A O    4  
ATOM 6519  C CB   . LYS A 1 94  ? 15.578  -1.294  -9.194  1.00 0.00 ? 94  LYS A CB   4  
ATOM 6520  C CG   . LYS A 1 94  ? 16.053  -1.454  -7.748  1.00 0.00 ? 94  LYS A CG   4  
ATOM 6521  C CD   . LYS A 1 94  ? 17.438  -0.822  -7.592  1.00 0.00 ? 94  LYS A CD   4  
ATOM 6522  C CE   . LYS A 1 94  ? 17.983  -1.121  -6.195  1.00 0.00 ? 94  LYS A CE   4  
ATOM 6523  N NZ   . LYS A 1 94  ? 19.471  -1.189  -6.244  1.00 0.00 ? 94  LYS A NZ   4  
ATOM 6524  H H    . LYS A 1 94  ? 13.973  -3.179  -10.434 1.00 0.00 ? 94  LYS A H    4  
ATOM 6525  H HA   . LYS A 1 94  ? 13.644  -1.130  -8.277  1.00 0.00 ? 94  LYS A HA   4  
ATOM 6526  H HB2  . LYS A 1 94  ? 16.004  -2.078  -9.803  1.00 0.00 ? 94  LYS A HB2  4  
ATOM 6527  H HB3  . LYS A 1 94  ? 15.894  -0.332  -9.569  1.00 0.00 ? 94  LYS A HB3  4  
ATOM 6528  H HG2  . LYS A 1 94  ? 15.356  -0.966  -7.083  1.00 0.00 ? 94  LYS A HG2  4  
ATOM 6529  H HG3  . LYS A 1 94  ? 16.111  -2.505  -7.503  1.00 0.00 ? 94  LYS A HG3  4  
ATOM 6530  H HD2  . LYS A 1 94  ? 18.107  -1.232  -8.337  1.00 0.00 ? 94  LYS A HD2  4  
ATOM 6531  H HD3  . LYS A 1 94  ? 17.363  0.247   -7.727  1.00 0.00 ? 94  LYS A HD3  4  
ATOM 6532  H HE2  . LYS A 1 94  ? 17.680  -0.339  -5.515  1.00 0.00 ? 94  LYS A HE2  4  
ATOM 6533  H HE3  . LYS A 1 94  ? 17.591  -2.068  -5.851  1.00 0.00 ? 94  LYS A HE3  4  
ATOM 6534  H HZ1  . LYS A 1 94  ? 19.765  -2.119  -6.604  1.00 0.00 ? 94  LYS A HZ1  4  
ATOM 6535  H HZ2  . LYS A 1 94  ? 19.857  -1.048  -5.288  1.00 0.00 ? 94  LYS A HZ2  4  
ATOM 6536  H HZ3  . LYS A 1 94  ? 19.832  -0.446  -6.876  1.00 0.00 ? 94  LYS A HZ3  4  
ATOM 6537  N N    . ARG A 1 95  ? 13.474  0.855   -9.974  1.00 0.00 ? 95  ARG A N    4  
ATOM 6538  C CA   . ARG A 1 95  ? 12.970  1.857   -10.954 1.00 0.00 ? 95  ARG A CA   4  
ATOM 6539  C C    . ARG A 1 95  ? 14.140  2.377   -11.792 1.00 0.00 ? 95  ARG A C    4  
ATOM 6540  O O    . ARG A 1 95  ? 15.002  3.081   -11.305 1.00 0.00 ? 95  ARG A O    4  
ATOM 6541  C CB   . ARG A 1 95  ? 12.320  3.021   -10.199 1.00 0.00 ? 95  ARG A CB   4  
ATOM 6542  C CG   . ARG A 1 95  ? 12.131  4.211   -11.143 1.00 0.00 ? 95  ARG A CG   4  
ATOM 6543  C CD   . ARG A 1 95  ? 11.338  3.771   -12.373 1.00 0.00 ? 95  ARG A CD   4  
ATOM 6544  N NE   . ARG A 1 95  ? 10.701  4.961   -13.004 1.00 0.00 ? 95  ARG A NE   4  
ATOM 6545  C CZ   . ARG A 1 95  ? 11.110  5.382   -14.169 1.00 0.00 ? 95  ARG A CZ   4  
ATOM 6546  N NH1  . ARG A 1 95  ? 12.301  5.900   -14.294 1.00 0.00 ? 95  ARG A NH1  4  
ATOM 6547  N NH2  . ARG A 1 95  ? 10.327  5.285   -15.210 1.00 0.00 ? 95  ARG A NH2  4  
ATOM 6548  H H    . ARG A 1 95  ? 13.775  1.145   -9.089  1.00 0.00 ? 95  ARG A H    4  
ATOM 6549  H HA   . ARG A 1 95  ? 12.239  1.394   -11.602 1.00 0.00 ? 95  ARG A HA   4  
ATOM 6550  H HB2  . ARG A 1 95  ? 11.358  2.708   -9.820  1.00 0.00 ? 95  ARG A HB2  4  
ATOM 6551  H HB3  . ARG A 1 95  ? 12.953  3.314   -9.376  1.00 0.00 ? 95  ARG A HB3  4  
ATOM 6552  H HG2  . ARG A 1 95  ? 11.594  4.995   -10.628 1.00 0.00 ? 95  ARG A HG2  4  
ATOM 6553  H HG3  . ARG A 1 95  ? 13.097  4.582   -11.452 1.00 0.00 ? 95  ARG A HG3  4  
ATOM 6554  H HD2  . ARG A 1 95  ? 12.004  3.301   -13.083 1.00 0.00 ? 95  ARG A HD2  4  
ATOM 6555  H HD3  . ARG A 1 95  ? 10.574  3.067   -12.076 1.00 0.00 ? 95  ARG A HD3  4  
ATOM 6556  H HE   . ARG A 1 95  ? 9.974   5.429   -12.542 1.00 0.00 ? 95  ARG A HE   4  
ATOM 6557  H HH11 . ARG A 1 95  ? 12.900  5.975   -13.497 1.00 0.00 ? 95  ARG A HH11 4  
ATOM 6558  H HH12 . ARG A 1 95  ? 12.614  6.225   -15.187 1.00 0.00 ? 95  ARG A HH12 4  
ATOM 6559  H HH21 . ARG A 1 95  ? 9.413   4.889   -15.113 1.00 0.00 ? 95  ARG A HH21 4  
ATOM 6560  H HH22 . ARG A 1 95  ? 10.640  5.609   -16.103 1.00 0.00 ? 95  ARG A HH22 4  
ATOM 6561  N N    . ARG A 1 96  ? 14.178  2.033   -13.050 1.00 0.00 ? 96  ARG A N    4  
ATOM 6562  C CA   . ARG A 1 96  ? 15.293  2.504   -13.918 1.00 0.00 ? 96  ARG A CA   4  
ATOM 6563  C C    . ARG A 1 96  ? 14.881  2.392   -15.388 1.00 0.00 ? 96  ARG A C    4  
ATOM 6564  O O    . ARG A 1 96  ? 14.939  3.348   -16.134 1.00 0.00 ? 96  ARG A O    4  
ATOM 6565  C CB   . ARG A 1 96  ? 16.533  1.643   -13.667 1.00 0.00 ? 96  ARG A CB   4  
ATOM 6566  C CG   . ARG A 1 96  ? 17.782  2.396   -14.126 1.00 0.00 ? 96  ARG A CG   4  
ATOM 6567  C CD   . ARG A 1 96  ? 18.928  2.124   -13.151 1.00 0.00 ? 96  ARG A CD   4  
ATOM 6568  N NE   . ARG A 1 96  ? 18.950  0.675   -12.803 1.00 0.00 ? 96  ARG A NE   4  
ATOM 6569  C CZ   . ARG A 1 96  ? 19.857  0.216   -11.985 1.00 0.00 ? 96  ARG A CZ   4  
ATOM 6570  N NH1  . ARG A 1 96  ? 19.880  0.619   -10.745 1.00 0.00 ? 96  ARG A NH1  4  
ATOM 6571  N NH2  . ARG A 1 96  ? 20.738  -0.649  -12.406 1.00 0.00 ? 96  ARG A NH2  4  
ATOM 6572  H H    . ARG A 1 96  ? 13.473  1.463   -13.424 1.00 0.00 ? 96  ARG A H    4  
ATOM 6573  H HA   . ARG A 1 96  ? 15.518  3.535   -13.686 1.00 0.00 ? 96  ARG A HA   4  
ATOM 6574  H HB2  . ARG A 1 96  ? 16.611  1.424   -12.612 1.00 0.00 ? 96  ARG A HB2  4  
ATOM 6575  H HB3  . ARG A 1 96  ? 16.448  0.720   -14.220 1.00 0.00 ? 96  ARG A HB3  4  
ATOM 6576  H HG2  . ARG A 1 96  ? 18.062  2.061   -15.115 1.00 0.00 ? 96  ARG A HG2  4  
ATOM 6577  H HG3  . ARG A 1 96  ? 17.576  3.456   -14.149 1.00 0.00 ? 96  ARG A HG3  4  
ATOM 6578  H HD2  . ARG A 1 96  ? 19.867  2.399   -13.609 1.00 0.00 ? 96  ARG A HD2  4  
ATOM 6579  H HD3  . ARG A 1 96  ? 18.782  2.708   -12.252 1.00 0.00 ? 96  ARG A HD3  4  
ATOM 6580  H HE   . ARG A 1 96  ? 18.286  0.069   -13.190 1.00 0.00 ? 96  ARG A HE   4  
ATOM 6581  H HH11 . ARG A 1 96  ? 19.204  1.282   -10.421 1.00 0.00 ? 96  ARG A HH11 4  
ATOM 6582  H HH12 . ARG A 1 96  ? 20.573  0.267   -10.116 1.00 0.00 ? 96  ARG A HH12 4  
ATOM 6583  H HH21 . ARG A 1 96  ? 20.720  -0.957  -13.358 1.00 0.00 ? 96  ARG A HH21 4  
ATOM 6584  H HH22 . ARG A 1 96  ? 21.432  -1.002  -11.779 1.00 0.00 ? 96  ARG A HH22 4  
ATOM 6585  N N    . GLN A 1 97  ? 14.464  1.229   -15.811 1.00 0.00 ? 97  GLN A N    4  
ATOM 6586  C CA   . GLN A 1 97  ? 14.050  1.058   -17.234 1.00 0.00 ? 97  GLN A CA   4  
ATOM 6587  C C    . GLN A 1 97  ? 12.642  0.465   -17.289 1.00 0.00 ? 97  GLN A C    4  
ATOM 6588  O O    . GLN A 1 97  ? 12.134  -0.045  -16.310 1.00 0.00 ? 97  GLN A O    4  
ATOM 6589  C CB   . GLN A 1 97  ? 15.027  0.114   -17.938 1.00 0.00 ? 97  GLN A CB   4  
ATOM 6590  C CG   . GLN A 1 97  ? 15.438  0.713   -19.285 1.00 0.00 ? 97  GLN A CG   4  
ATOM 6591  C CD   . GLN A 1 97  ? 16.273  1.974   -19.051 1.00 0.00 ? 97  GLN A CD   4  
ATOM 6592  O OE1  . GLN A 1 97  ? 17.133  1.995   -18.193 1.00 0.00 ? 97  GLN A OE1  4  
ATOM 6593  N NE2  . GLN A 1 97  ? 16.053  3.032   -19.781 1.00 0.00 ? 97  GLN A NE2  4  
ATOM 6594  H H    . GLN A 1 97  ? 14.424  0.468   -15.195 1.00 0.00 ? 97  GLN A H    4  
ATOM 6595  H HA   . GLN A 1 97  ? 14.057  2.018   -17.728 1.00 0.00 ? 97  GLN A HA   4  
ATOM 6596  H HB2  . GLN A 1 97  ? 15.903  -0.022  -17.322 1.00 0.00 ? 97  GLN A HB2  4  
ATOM 6597  H HB3  . GLN A 1 97  ? 14.549  -0.841  -18.102 1.00 0.00 ? 97  GLN A HB3  4  
ATOM 6598  H HG2  . GLN A 1 97  ? 16.021  -0.009  -19.837 1.00 0.00 ? 97  GLN A HG2  4  
ATOM 6599  H HG3  . GLN A 1 97  ? 14.554  0.970   -19.850 1.00 0.00 ? 97  GLN A HG3  4  
ATOM 6600  H HE21 . GLN A 1 97  ? 15.358  3.016   -20.472 1.00 0.00 ? 97  GLN A HE21 4  
ATOM 6601  H HE22 . GLN A 1 97  ? 16.584  3.844   -19.640 1.00 0.00 ? 97  GLN A HE22 4  
ATOM 6602  N N    . ARG A 1 98  ? 12.005  0.529   -18.427 1.00 0.00 ? 98  ARG A N    4  
ATOM 6603  C CA   . ARG A 1 98  ? 10.628  -0.030  -18.543 1.00 0.00 ? 98  ARG A CA   4  
ATOM 6604  C C    . ARG A 1 98  ? 10.567  -1.012  -19.717 1.00 0.00 ? 98  ARG A C    4  
ATOM 6605  O O    . ARG A 1 98  ? 9.589   -1.706  -19.905 1.00 0.00 ? 98  ARG A O    4  
ATOM 6606  C CB   . ARG A 1 98  ? 9.635   1.108   -18.780 1.00 0.00 ? 98  ARG A CB   4  
ATOM 6607  C CG   . ARG A 1 98  ? 8.434   0.941   -17.846 1.00 0.00 ? 98  ARG A CG   4  
ATOM 6608  C CD   . ARG A 1 98  ? 7.195   0.572   -18.665 1.00 0.00 ? 98  ARG A CD   4  
ATOM 6609  N NE   . ARG A 1 98  ? 6.129   1.586   -18.438 1.00 0.00 ? 98  ARG A NE   4  
ATOM 6610  C CZ   . ARG A 1 98  ? 5.647   1.769   -17.240 1.00 0.00 ? 98  ARG A CZ   4  
ATOM 6611  N NH1  . ARG A 1 98  ? 4.978   0.815   -16.654 1.00 0.00 ? 98  ARG A NH1  4  
ATOM 6612  N NH2  . ARG A 1 98  ? 5.837   2.904   -16.626 1.00 0.00 ? 98  ARG A NH2  4  
ATOM 6613  H H    . ARG A 1 98  ? 12.432  0.948   -19.202 1.00 0.00 ? 98  ARG A H    4  
ATOM 6614  H HA   . ARG A 1 98  ? 10.372  -0.547  -17.630 1.00 0.00 ? 98  ARG A HA   4  
ATOM 6615  H HB2  . ARG A 1 98  ? 10.117  2.054   -18.582 1.00 0.00 ? 98  ARG A HB2  4  
ATOM 6616  H HB3  . ARG A 1 98  ? 9.296   1.084   -19.805 1.00 0.00 ? 98  ARG A HB3  4  
ATOM 6617  H HG2  . ARG A 1 98  ? 8.641   0.158   -17.131 1.00 0.00 ? 98  ARG A HG2  4  
ATOM 6618  H HG3  . ARG A 1 98  ? 8.253   1.869   -17.323 1.00 0.00 ? 98  ARG A HG3  4  
ATOM 6619  H HD2  . ARG A 1 98  ? 7.451   0.549   -19.714 1.00 0.00 ? 98  ARG A HD2  4  
ATOM 6620  H HD3  . ARG A 1 98  ? 6.839   -0.401  -18.360 1.00 0.00 ? 98  ARG A HD3  4  
ATOM 6621  H HE   . ARG A 1 98  ? 5.787   2.117   -19.188 1.00 0.00 ? 98  ARG A HE   4  
ATOM 6622  H HH11 . ARG A 1 98  ? 4.835   -0.055  -17.124 1.00 0.00 ? 98  ARG A HH11 4  
ATOM 6623  H HH12 . ARG A 1 98  ? 4.607   0.955   -15.736 1.00 0.00 ? 98  ARG A HH12 4  
ATOM 6624  H HH21 . ARG A 1 98  ? 6.352   3.635   -17.074 1.00 0.00 ? 98  ARG A HH21 4  
ATOM 6625  H HH22 . ARG A 1 98  ? 5.466   3.045   -15.708 1.00 0.00 ? 98  ARG A HH22 4  
ATOM 6626  N N    . GLY A 1 99  ? 11.602  -1.074  -20.511 1.00 0.00 ? 99  GLY A N    4  
ATOM 6627  C CA   . GLY A 1 99  ? 11.595  -2.011  -21.670 1.00 0.00 ? 99  GLY A CA   4  
ATOM 6628  C C    . GLY A 1 99  ? 12.323  -3.301  -21.290 1.00 0.00 ? 99  GLY A C    4  
ATOM 6629  O O    . GLY A 1 99  ? 13.210  -3.753  -21.986 1.00 0.00 ? 99  GLY A O    4  
ATOM 6630  H H    . GLY A 1 99  ? 12.382  -0.506  -20.345 1.00 0.00 ? 99  GLY A H    4  
ATOM 6631  H HA2  . GLY A 1 99  ? 10.576  -2.239  -21.942 1.00 0.00 ? 99  GLY A HA2  4  
ATOM 6632  H HA3  . GLY A 1 99  ? 12.096  -1.549  -22.509 1.00 0.00 ? 99  GLY A HA3  4  
ATOM 6633  N N    . VAL A 1 100 ? 11.954  -3.900  -20.191 1.00 0.00 ? 100 VAL A N    4  
ATOM 6634  C CA   . VAL A 1 100 ? 12.624  -5.162  -19.769 1.00 0.00 ? 100 VAL A CA   4  
ATOM 6635  C C    . VAL A 1 100 ? 11.971  -6.350  -20.480 1.00 0.00 ? 100 VAL A C    4  
ATOM 6636  O O    . VAL A 1 100 ? 10.763  -6.473  -20.520 1.00 0.00 ? 100 VAL A O    4  
ATOM 6637  C CB   . VAL A 1 100 ? 12.482  -5.334  -18.255 1.00 0.00 ? 100 VAL A CB   4  
ATOM 6638  C CG1  . VAL A 1 100 ? 13.426  -6.439  -17.778 1.00 0.00 ? 100 VAL A CG1  4  
ATOM 6639  C CG2  . VAL A 1 100 ? 12.840  -4.021  -17.555 1.00 0.00 ? 100 VAL A CG2  4  
ATOM 6640  H H    . VAL A 1 100 ? 11.234  -3.520  -19.644 1.00 0.00 ? 100 VAL A H    4  
ATOM 6641  H HA   . VAL A 1 100 ? 13.671  -5.118  -20.029 1.00 0.00 ? 100 VAL A HA   4  
ATOM 6642  H HB   . VAL A 1 100 ? 11.463  -5.605  -18.018 1.00 0.00 ? 100 VAL A HB   4  
ATOM 6643  H HG11 . VAL A 1 100 ? 13.675  -6.276  -16.741 1.00 0.00 ? 100 VAL A HG11 4  
ATOM 6644  H HG12 . VAL A 1 100 ? 14.328  -6.424  -18.373 1.00 0.00 ? 100 VAL A HG12 4  
ATOM 6645  H HG13 . VAL A 1 100 ? 12.940  -7.398  -17.884 1.00 0.00 ? 100 VAL A HG13 4  
ATOM 6646  H HG21 . VAL A 1 100 ? 13.772  -4.140  -17.023 1.00 0.00 ? 100 VAL A HG21 4  
ATOM 6647  H HG22 . VAL A 1 100 ? 12.058  -3.760  -16.857 1.00 0.00 ? 100 VAL A HG22 4  
ATOM 6648  H HG23 . VAL A 1 100 ? 12.943  -3.237  -18.291 1.00 0.00 ? 100 VAL A HG23 4  
ATOM 6649  N N    . SER A 1 101 ? 12.759  -7.223  -21.042 1.00 0.00 ? 101 SER A N    4  
ATOM 6650  C CA   . SER A 1 101 ? 12.181  -8.401  -21.749 1.00 0.00 ? 101 SER A CA   4  
ATOM 6651  C C    . SER A 1 101 ? 11.962  -9.539  -20.750 1.00 0.00 ? 101 SER A C    4  
ATOM 6652  O O    . SER A 1 101 ? 12.480  -10.618 -20.988 1.00 0.00 ? 101 SER A O    4  
ATOM 6653  C CB   . SER A 1 101 ? 13.145  -8.862  -22.843 1.00 0.00 ? 101 SER A CB   4  
ATOM 6654  O OG   . SER A 1 101 ? 13.738  -7.725  -23.454 1.00 0.00 ? 101 SER A OG   4  
ATOM 6655  O OXT  . SER A 1 101 ? 11.280  -9.311  -19.765 1.00 0.00 ? 101 SER A OXT  4  
ATOM 6656  H H    . SER A 1 101 ? 13.732  -7.107  -21.000 1.00 0.00 ? 101 SER A H    4  
ATOM 6657  H HA   . SER A 1 101 ? 11.236  -8.125  -22.194 1.00 0.00 ? 101 SER A HA   4  
ATOM 6658  H HB2  . SER A 1 101 ? 13.917  -9.475  -22.410 1.00 0.00 ? 101 SER A HB2  4  
ATOM 6659  H HB3  . SER A 1 101 ? 12.601  -9.438  -23.580 1.00 0.00 ? 101 SER A HB3  4  
ATOM 6660  H HG   . SER A 1 101 ? 13.041  -7.216  -23.876 1.00 0.00 ? 101 SER A HG   4  
ATOM 6661  N N    . GLU A 1 1   ? 14.936  15.503  -5.785  1.00 0.00 ? 1   GLU A N    5  
ATOM 6662  C CA   . GLU A 1 1   ? 14.052  15.273  -4.607  1.00 0.00 ? 1   GLU A CA   5  
ATOM 6663  C C    . GLU A 1 1   ? 12.789  14.535  -5.055  1.00 0.00 ? 1   GLU A C    5  
ATOM 6664  O O    . GLU A 1 1   ? 11.706  15.086  -5.064  1.00 0.00 ? 1   GLU A O    5  
ATOM 6665  C CB   . GLU A 1 1   ? 13.666  16.619  -3.992  1.00 0.00 ? 1   GLU A CB   5  
ATOM 6666  C CG   . GLU A 1 1   ? 14.879  17.221  -3.281  1.00 0.00 ? 1   GLU A CG   5  
ATOM 6667  C CD   . GLU A 1 1   ? 15.221  16.379  -2.050  1.00 0.00 ? 1   GLU A CD   5  
ATOM 6668  O OE1  . GLU A 1 1   ? 14.581  16.570  -1.029  1.00 0.00 ? 1   GLU A OE1  5  
ATOM 6669  O OE2  . GLU A 1 1   ? 16.116  15.556  -2.150  1.00 0.00 ? 1   GLU A OE2  5  
ATOM 6670  H H1   . GLU A 1 1   ? 14.386  15.389  -6.660  1.00 0.00 ? 1   GLU A H1   5  
ATOM 6671  H H2   . GLU A 1 1   ? 15.716  14.813  -5.772  1.00 0.00 ? 1   GLU A H2   5  
ATOM 6672  H H3   . GLU A 1 1   ? 15.323  16.466  -5.745  1.00 0.00 ? 1   GLU A H3   5  
ATOM 6673  H HA   . GLU A 1 1   ? 14.576  14.677  -3.874  1.00 0.00 ? 1   GLU A HA   5  
ATOM 6674  H HB2  . GLU A 1 1   ? 13.336  17.288  -4.772  1.00 0.00 ? 1   GLU A HB2  5  
ATOM 6675  H HB3  . GLU A 1 1   ? 12.868  16.473  -3.280  1.00 0.00 ? 1   GLU A HB3  5  
ATOM 6676  H HG2  . GLU A 1 1   ? 15.723  17.234  -3.957  1.00 0.00 ? 1   GLU A HG2  5  
ATOM 6677  H HG3  . GLU A 1 1   ? 14.649  18.230  -2.971  1.00 0.00 ? 1   GLU A HG3  5  
ATOM 6678  N N    . SER A 1 2   ? 12.916  13.291  -5.427  1.00 0.00 ? 2   SER A N    5  
ATOM 6679  C CA   . SER A 1 2   ? 11.721  12.523  -5.873  1.00 0.00 ? 2   SER A CA   5  
ATOM 6680  C C    . SER A 1 2   ? 11.955  11.031  -5.626  1.00 0.00 ? 2   SER A C    5  
ATOM 6681  O O    . SER A 1 2   ? 12.929  10.639  -5.015  1.00 0.00 ? 2   SER A O    5  
ATOM 6682  C CB   . SER A 1 2   ? 11.487  12.765  -7.363  1.00 0.00 ? 2   SER A CB   5  
ATOM 6683  O OG   . SER A 1 2   ? 11.557  14.159  -7.629  1.00 0.00 ? 2   SER A OG   5  
ATOM 6684  H H    . SER A 1 2   ? 13.797  12.863  -5.412  1.00 0.00 ? 2   SER A H    5  
ATOM 6685  H HA   . SER A 1 2   ? 10.856  12.848  -5.314  1.00 0.00 ? 2   SER A HA   5  
ATOM 6686  H HB2  . SER A 1 2   ? 12.242  12.256  -7.937  1.00 0.00 ? 2   SER A HB2  5  
ATOM 6687  H HB3  . SER A 1 2   ? 10.511  12.384  -7.639  1.00 0.00 ? 2   SER A HB3  5  
ATOM 6688  H HG   . SER A 1 2   ? 10.705  14.439  -7.975  1.00 0.00 ? 2   SER A HG   5  
ATOM 6689  N N    . LYS A 1 3   ? 11.068  10.197  -6.095  1.00 0.00 ? 3   LYS A N    5  
ATOM 6690  C CA   . LYS A 1 3   ? 11.244  8.733   -5.881  1.00 0.00 ? 3   LYS A CA   5  
ATOM 6691  C C    . LYS A 1 3   ? 10.597  7.962   -7.037  1.00 0.00 ? 3   LYS A C    5  
ATOM 6692  O O    . LYS A 1 3   ? 9.450   7.567   -6.952  1.00 0.00 ? 3   LYS A O    5  
ATOM 6693  C CB   . LYS A 1 3   ? 10.580  8.329   -4.564  1.00 0.00 ? 3   LYS A CB   5  
ATOM 6694  C CG   . LYS A 1 3   ? 11.327  7.137   -3.964  1.00 0.00 ? 3   LYS A CG   5  
ATOM 6695  C CD   . LYS A 1 3   ? 12.291  7.630   -2.885  1.00 0.00 ? 3   LYS A CD   5  
ATOM 6696  C CE   . LYS A 1 3   ? 13.412  6.606   -2.700  1.00 0.00 ? 3   LYS A CE   5  
ATOM 6697  N NZ   . LYS A 1 3   ? 14.257  6.995   -1.536  1.00 0.00 ? 3   LYS A NZ   5  
ATOM 6698  H H    . LYS A 1 3   ? 10.287  10.533  -6.584  1.00 0.00 ? 3   LYS A H    5  
ATOM 6699  H HA   . LYS A 1 3   ? 12.297  8.501   -5.839  1.00 0.00 ? 3   LYS A HA   5  
ATOM 6700  H HB2  . LYS A 1 3   ? 10.611  9.160   -3.876  1.00 0.00 ? 3   LYS A HB2  5  
ATOM 6701  H HB3  . LYS A 1 3   ? 9.553   8.052   -4.750  1.00 0.00 ? 3   LYS A HB3  5  
ATOM 6702  H HG2  . LYS A 1 3   ? 10.617  6.450   -3.527  1.00 0.00 ? 3   LYS A HG2  5  
ATOM 6703  H HG3  . LYS A 1 3   ? 11.886  6.634   -4.740  1.00 0.00 ? 3   LYS A HG3  5  
ATOM 6704  H HD2  . LYS A 1 3   ? 12.714  8.578   -3.185  1.00 0.00 ? 3   LYS A HD2  5  
ATOM 6705  H HD3  . LYS A 1 3   ? 11.760  7.752   -1.954  1.00 0.00 ? 3   LYS A HD3  5  
ATOM 6706  H HE2  . LYS A 1 3   ? 12.983  5.631   -2.524  1.00 0.00 ? 3   LYS A HE2  5  
ATOM 6707  H HE3  . LYS A 1 3   ? 14.022  6.576   -3.592  1.00 0.00 ? 3   LYS A HE3  5  
ATOM 6708  H HZ1  . LYS A 1 3   ? 14.346  8.029   -1.500  1.00 0.00 ? 3   LYS A HZ1  5  
ATOM 6709  H HZ2  . LYS A 1 3   ? 15.201  6.568   -1.635  1.00 0.00 ? 3   LYS A HZ2  5  
ATOM 6710  H HZ3  . LYS A 1 3   ? 13.815  6.656   -0.658  1.00 0.00 ? 3   LYS A HZ3  5  
ATOM 6711  N N    . PRO A 1 4   ? 11.360  7.768   -8.087  1.00 0.00 ? 4   PRO A N    5  
ATOM 6712  C CA   . PRO A 1 4   ? 10.908  7.042   -9.294  1.00 0.00 ? 4   PRO A CA   5  
ATOM 6713  C C    . PRO A 1 4   ? 11.222  5.513   -9.306  1.00 0.00 ? 4   PRO A C    5  
ATOM 6714  O O    . PRO A 1 4   ? 11.210  4.938   -10.376 1.00 0.00 ? 4   PRO A O    5  
ATOM 6715  C CB   . PRO A 1 4   ? 11.742  7.698   -10.395 1.00 0.00 ? 4   PRO A CB   5  
ATOM 6716  C CG   . PRO A 1 4   ? 13.007  8.282   -9.708  1.00 0.00 ? 4   PRO A CG   5  
ATOM 6717  C CD   . PRO A 1 4   ? 12.727  8.301   -8.193  1.00 0.00 ? 4   PRO A CD   5  
ATOM 6718  H HA   . PRO A 1 4   ? 9.864   7.221   -9.482  1.00 0.00 ? 4   PRO A HA   5  
ATOM 6719  H HB2  . PRO A 1 4   ? 12.024  6.959   -11.134 1.00 0.00 ? 4   PRO A HB2  5  
ATOM 6720  H HB3  . PRO A 1 4   ? 11.182  8.494   -10.861 1.00 0.00 ? 4   PRO A HB3  5  
ATOM 6721  H HG2  . PRO A 1 4   ? 13.863  7.656   -9.919  1.00 0.00 ? 4   PRO A HG2  5  
ATOM 6722  H HG3  . PRO A 1 4   ? 13.188  9.287   -10.056 1.00 0.00 ? 4   PRO A HG3  5  
ATOM 6723  H HD2  . PRO A 1 4   ? 13.428  7.665   -7.670  1.00 0.00 ? 4   PRO A HD2  5  
ATOM 6724  H HD3  . PRO A 1 4   ? 12.766  9.310   -7.811  1.00 0.00 ? 4   PRO A HD3  5  
ATOM 6725  N N    . PRO A 1 5   ? 11.504  4.868   -8.182  1.00 0.00 ? 5   PRO A N    5  
ATOM 6726  C CA   . PRO A 1 5   ? 11.814  3.425   -8.199  1.00 0.00 ? 5   PRO A CA   5  
ATOM 6727  C C    . PRO A 1 5   ? 10.536  2.594   -8.301  1.00 0.00 ? 5   PRO A C    5  
ATOM 6728  O O    . PRO A 1 5   ? 10.417  1.717   -9.133  1.00 0.00 ? 5   PRO A O    5  
ATOM 6729  C CB   . PRO A 1 5   ? 12.497  3.176   -6.855  1.00 0.00 ? 5   PRO A CB   5  
ATOM 6730  C CG   . PRO A 1 5   ? 12.049  4.321   -5.923  1.00 0.00 ? 5   PRO A CG   5  
ATOM 6731  C CD   . PRO A 1 5   ? 11.545  5.460   -6.830  1.00 0.00 ? 5   PRO A CD   5  
ATOM 6732  H HA   . PRO A 1 5   ? 12.490  3.187   -9.004  1.00 0.00 ? 5   PRO A HA   5  
ATOM 6733  H HB2  . PRO A 1 5   ? 12.179  2.222   -6.452  1.00 0.00 ? 5   PRO A HB2  5  
ATOM 6734  H HB3  . PRO A 1 5   ? 13.565  3.194   -6.969  1.00 0.00 ? 5   PRO A HB3  5  
ATOM 6735  H HG2  . PRO A 1 5   ? 11.252  3.980   -5.276  1.00 0.00 ? 5   PRO A HG2  5  
ATOM 6736  H HG3  . PRO A 1 5   ? 12.883  4.668   -5.335  1.00 0.00 ? 5   PRO A HG3  5  
ATOM 6737  H HD2  . PRO A 1 5   ? 10.555  5.763   -6.521  1.00 0.00 ? 5   PRO A HD2  5  
ATOM 6738  H HD3  . PRO A 1 5   ? 12.230  6.291   -6.802  1.00 0.00 ? 5   PRO A HD3  5  
ATOM 6739  N N    . TYR A 1 6   ? 9.586   2.853   -7.449  1.00 0.00 ? 6   TYR A N    5  
ATOM 6740  C CA   . TYR A 1 6   ? 8.326   2.066   -7.482  1.00 0.00 ? 6   TYR A CA   5  
ATOM 6741  C C    . TYR A 1 6   ? 7.270   2.789   -8.302  1.00 0.00 ? 6   TYR A C    5  
ATOM 6742  O O    . TYR A 1 6   ? 6.618   3.701   -7.835  1.00 0.00 ? 6   TYR A O    5  
ATOM 6743  C CB   . TYR A 1 6   ? 7.811   1.869   -6.062  1.00 0.00 ? 6   TYR A CB   5  
ATOM 6744  C CG   . TYR A 1 6   ? 8.721   0.927   -5.309  1.00 0.00 ? 6   TYR A CG   5  
ATOM 6745  C CD1  . TYR A 1 6   ? 9.892   0.432   -5.903  1.00 0.00 ? 6   TYR A CD1  5  
ATOM 6746  C CD2  . TYR A 1 6   ? 8.388   0.555   -4.006  1.00 0.00 ? 6   TYR A CD2  5  
ATOM 6747  C CE1  . TYR A 1 6   ? 10.726  -0.434  -5.185  1.00 0.00 ? 6   TYR A CE1  5  
ATOM 6748  C CE2  . TYR A 1 6   ? 9.219   -0.312  -3.288  1.00 0.00 ? 6   TYR A CE2  5  
ATOM 6749  C CZ   . TYR A 1 6   ? 10.389  -0.806  -3.877  1.00 0.00 ? 6   TYR A CZ   5  
ATOM 6750  O OH   . TYR A 1 6   ? 11.211  -1.658  -3.167  1.00 0.00 ? 6   TYR A OH   5  
ATOM 6751  H H    . TYR A 1 6   ? 9.708   3.555   -6.776  1.00 0.00 ? 6   TYR A H    5  
ATOM 6752  H HA   . TYR A 1 6   ? 8.518   1.102   -7.923  1.00 0.00 ? 6   TYR A HA   5  
ATOM 6753  H HB2  . TYR A 1 6   ? 7.784   2.823   -5.556  1.00 0.00 ? 6   TYR A HB2  5  
ATOM 6754  H HB3  . TYR A 1 6   ? 6.815   1.453   -6.097  1.00 0.00 ? 6   TYR A HB3  5  
ATOM 6755  H HD1  . TYR A 1 6   ? 10.151  0.720   -6.917  1.00 0.00 ? 6   TYR A HD1  5  
ATOM 6756  H HD2  . TYR A 1 6   ? 7.483   0.936   -3.558  1.00 0.00 ? 6   TYR A HD2  5  
ATOM 6757  H HE1  . TYR A 1 6   ? 11.628  -0.815  -5.638  1.00 0.00 ? 6   TYR A HE1  5  
ATOM 6758  H HE2  . TYR A 1 6   ? 8.958   -0.597  -2.278  1.00 0.00 ? 6   TYR A HE2  5  
ATOM 6759  H HH   . TYR A 1 6   ? 11.429  -2.401  -3.734  1.00 0.00 ? 6   TYR A HH   5  
ATOM 6760  N N    . SER A 1 7   ? 7.075   2.364   -9.512  1.00 0.00 ? 7   SER A N    5  
ATOM 6761  C CA   . SER A 1 7   ? 6.036   3.000   -10.358 1.00 0.00 ? 7   SER A CA   5  
ATOM 6762  C C    . SER A 1 7   ? 4.750   3.076   -9.540  1.00 0.00 ? 7   SER A C    5  
ATOM 6763  O O    . SER A 1 7   ? 4.663   2.504   -8.478  1.00 0.00 ? 7   SER A O    5  
ATOM 6764  C CB   . SER A 1 7   ? 5.807   2.123   -11.583 1.00 0.00 ? 7   SER A CB   5  
ATOM 6765  O OG   . SER A 1 7   ? 6.698   2.517   -12.619 1.00 0.00 ? 7   SER A OG   5  
ATOM 6766  H H    . SER A 1 7   ? 7.601   1.613   -9.857  1.00 0.00 ? 7   SER A H    5  
ATOM 6767  H HA   . SER A 1 7   ? 6.350   3.988   -10.659 1.00 0.00 ? 7   SER A HA   5  
ATOM 6768  H HB2  . SER A 1 7   ? 5.999   1.094   -11.319 1.00 0.00 ? 7   SER A HB2  5  
ATOM 6769  H HB3  . SER A 1 7   ? 4.782   2.225   -11.913 1.00 0.00 ? 7   SER A HB3  5  
ATOM 6770  H HG   . SER A 1 7   ? 6.699   3.477   -12.660 1.00 0.00 ? 7   SER A HG   5  
ATOM 6771  N N    . TYR A 1 8   ? 3.753   3.771   -10.001 1.00 0.00 ? 8   TYR A N    5  
ATOM 6772  C CA   . TYR A 1 8   ? 2.499   3.848   -9.204  1.00 0.00 ? 8   TYR A CA   5  
ATOM 6773  C C    . TYR A 1 8   ? 1.591   2.668   -9.554  1.00 0.00 ? 8   TYR A C    5  
ATOM 6774  O O    . TYR A 1 8   ? 0.462   2.583   -9.114  1.00 0.00 ? 8   TYR A O    5  
ATOM 6775  C CB   . TYR A 1 8   ? 1.798   5.174   -9.478  1.00 0.00 ? 8   TYR A CB   5  
ATOM 6776  C CG   . TYR A 1 8   ? 2.690   6.288   -8.987  1.00 0.00 ? 8   TYR A CG   5  
ATOM 6777  C CD1  . TYR A 1 8   ? 3.242   6.216   -7.703  1.00 0.00 ? 8   TYR A CD1  5  
ATOM 6778  C CD2  . TYR A 1 8   ? 2.974   7.382   -9.812  1.00 0.00 ? 8   TYR A CD2  5  
ATOM 6779  C CE1  . TYR A 1 8   ? 4.078   7.237   -7.242  1.00 0.00 ? 8   TYR A CE1  5  
ATOM 6780  C CE2  . TYR A 1 8   ? 3.812   8.405   -9.349  1.00 0.00 ? 8   TYR A CE2  5  
ATOM 6781  C CZ   . TYR A 1 8   ? 4.363   8.333   -8.064  1.00 0.00 ? 8   TYR A CZ   5  
ATOM 6782  O OH   . TYR A 1 8   ? 5.188   9.341   -7.609  1.00 0.00 ? 8   TYR A OH   5  
ATOM 6783  H H    . TYR A 1 8   ? 3.826   4.238   -10.861 1.00 0.00 ? 8   TYR A H    5  
ATOM 6784  H HA   . TYR A 1 8   ? 2.750   3.794   -8.154  1.00 0.00 ? 8   TYR A HA   5  
ATOM 6785  H HB2  . TYR A 1 8   ? 1.621   5.284   -10.537 1.00 0.00 ? 8   TYR A HB2  5  
ATOM 6786  H HB3  . TYR A 1 8   ? 0.862   5.204   -8.944  1.00 0.00 ? 8   TYR A HB3  5  
ATOM 6787  H HD1  . TYR A 1 8   ? 3.020   5.371   -7.068  1.00 0.00 ? 8   TYR A HD1  5  
ATOM 6788  H HD2  . TYR A 1 8   ? 2.549   7.437   -10.803 1.00 0.00 ? 8   TYR A HD2  5  
ATOM 6789  H HE1  . TYR A 1 8   ? 4.504   7.178   -6.249  1.00 0.00 ? 8   TYR A HE1  5  
ATOM 6790  H HE2  . TYR A 1 8   ? 4.032   9.248   -9.983  1.00 0.00 ? 8   TYR A HE2  5  
ATOM 6791  H HH   . TYR A 1 8   ? 6.037   8.952   -7.390  1.00 0.00 ? 8   TYR A HH   5  
ATOM 6792  N N    . ALA A 1 9   ? 2.095   1.736   -10.319 1.00 0.00 ? 9   ALA A N    5  
ATOM 6793  C CA   . ALA A 1 9   ? 1.289   0.536   -10.675 1.00 0.00 ? 9   ALA A CA   5  
ATOM 6794  C C    . ALA A 1 9   ? 1.962   -0.683  -10.041 1.00 0.00 ? 9   ALA A C    5  
ATOM 6795  O O    . ALA A 1 9   ? 1.317   -1.622  -9.622  1.00 0.00 ? 9   ALA A O    5  
ATOM 6796  C CB   . ALA A 1 9   ? 1.239   0.375   -12.195 1.00 0.00 ? 9   ALA A CB   5  
ATOM 6797  H H    . ALA A 1 9   ? 3.018   1.816   -10.640 1.00 0.00 ? 9   ALA A H    5  
ATOM 6798  H HA   . ALA A 1 9   ? 0.288   0.642   -10.283 1.00 0.00 ? 9   ALA A HA   5  
ATOM 6799  H HB1  . ALA A 1 9   ? 1.257   -0.674  -12.447 1.00 0.00 ? 9   ALA A HB1  5  
ATOM 6800  H HB2  . ALA A 1 9   ? 2.091   0.868   -12.638 1.00 0.00 ? 9   ALA A HB2  5  
ATOM 6801  H HB3  . ALA A 1 9   ? 0.330   0.820   -12.572 1.00 0.00 ? 9   ALA A HB3  5  
ATOM 6802  N N    . GLN A 1 10  ? 3.263   -0.643  -9.937  1.00 0.00 ? 10  GLN A N    5  
ATOM 6803  C CA   . GLN A 1 10  ? 4.015   -1.754  -9.295  1.00 0.00 ? 10  GLN A CA   5  
ATOM 6804  C C    . GLN A 1 10  ? 4.119   -1.415  -7.816  1.00 0.00 ? 10  GLN A C    5  
ATOM 6805  O O    . GLN A 1 10  ? 4.138   -2.275  -6.959  1.00 0.00 ? 10  GLN A O    5  
ATOM 6806  C CB   . GLN A 1 10  ? 5.412   -1.848  -9.911  1.00 0.00 ? 10  GLN A CB   5  
ATOM 6807  C CG   . GLN A 1 10  ? 6.235   -2.892  -9.157  1.00 0.00 ? 10  GLN A CG   5  
ATOM 6808  C CD   . GLN A 1 10  ? 7.003   -2.215  -8.020  1.00 0.00 ? 10  GLN A CD   5  
ATOM 6809  O OE1  . GLN A 1 10  ? 6.494   -2.074  -6.926  1.00 0.00 ? 10  GLN A OE1  5  
ATOM 6810  N NE2  . GLN A 1 10  ? 8.218   -1.787  -8.234  1.00 0.00 ? 10  GLN A NE2  5  
ATOM 6811  H H    . GLN A 1 10  ? 3.746   0.145   -10.252 1.00 0.00 ? 10  GLN A H    5  
ATOM 6812  H HA   . GLN A 1 10  ? 3.487   -2.692  -9.421  1.00 0.00 ? 10  GLN A HA   5  
ATOM 6813  H HB2  . GLN A 1 10  ? 5.329   -2.137  -10.949 1.00 0.00 ? 10  GLN A HB2  5  
ATOM 6814  H HB3  . GLN A 1 10  ? 5.901   -0.889  -9.842  1.00 0.00 ? 10  GLN A HB3  5  
ATOM 6815  H HG2  . GLN A 1 10  ? 5.576   -3.643  -8.748  1.00 0.00 ? 10  GLN A HG2  5  
ATOM 6816  H HG3  . GLN A 1 10  ? 6.935   -3.356  -9.834  1.00 0.00 ? 10  GLN A HG3  5  
ATOM 6817  H HE21 . GLN A 1 10  ? 8.629   -1.901  -9.116  1.00 0.00 ? 10  GLN A HE21 5  
ATOM 6818  H HE22 . GLN A 1 10  ? 8.719   -1.353  -7.511  1.00 0.00 ? 10  GLN A HE22 5  
ATOM 6819  N N    . LEU A 1 11  ? 4.147   -0.144  -7.522  1.00 0.00 ? 11  LEU A N    5  
ATOM 6820  C CA   . LEU A 1 11  ? 4.203   0.303   -6.109  1.00 0.00 ? 11  LEU A CA   5  
ATOM 6821  C C    . LEU A 1 11  ? 2.971   -0.261  -5.412  1.00 0.00 ? 11  LEU A C    5  
ATOM 6822  O O    . LEU A 1 11  ? 3.014   -0.673  -4.270  1.00 0.00 ? 11  LEU A O    5  
ATOM 6823  C CB   . LEU A 1 11  ? 4.178   1.834   -6.080  1.00 0.00 ? 11  LEU A CB   5  
ATOM 6824  C CG   . LEU A 1 11  ? 3.908   2.342   -4.666  1.00 0.00 ? 11  LEU A CG   5  
ATOM 6825  C CD1  . LEU A 1 11  ? 5.233   2.679   -3.989  1.00 0.00 ? 11  LEU A CD1  5  
ATOM 6826  C CD2  . LEU A 1 11  ? 3.050   3.603   -4.748  1.00 0.00 ? 11  LEU A CD2  5  
ATOM 6827  H H    . LEU A 1 11  ? 4.100   0.521   -8.239  1.00 0.00 ? 11  LEU A H    5  
ATOM 6828  H HA   . LEU A 1 11  ? 5.102   -0.066  -5.637  1.00 0.00 ? 11  LEU A HA   5  
ATOM 6829  H HB2  . LEU A 1 11  ? 5.131   2.213   -6.418  1.00 0.00 ? 11  LEU A HB2  5  
ATOM 6830  H HB3  . LEU A 1 11  ? 3.400   2.189   -6.740  1.00 0.00 ? 11  LEU A HB3  5  
ATOM 6831  H HG   . LEU A 1 11  ? 3.391   1.586   -4.094  1.00 0.00 ? 11  LEU A HG   5  
ATOM 6832  H HD11 . LEU A 1 11  ? 5.883   1.819   -4.025  1.00 0.00 ? 11  LEU A HD11 5  
ATOM 6833  H HD12 . LEU A 1 11  ? 5.049   2.953   -2.961  1.00 0.00 ? 11  LEU A HD12 5  
ATOM 6834  H HD13 . LEU A 1 11  ? 5.698   3.505   -4.506  1.00 0.00 ? 11  LEU A HD13 5  
ATOM 6835  H HD21 . LEU A 1 11  ? 2.284   3.469   -5.496  1.00 0.00 ? 11  LEU A HD21 5  
ATOM 6836  H HD22 . LEU A 1 11  ? 3.672   4.443   -5.017  1.00 0.00 ? 11  LEU A HD22 5  
ATOM 6837  H HD23 . LEU A 1 11  ? 2.591   3.787   -3.790  1.00 0.00 ? 11  LEU A HD23 5  
ATOM 6838  N N    . ILE A 1 12  ? 1.877   -0.306  -6.121  1.00 0.00 ? 12  ILE A N    5  
ATOM 6839  C CA   . ILE A 1 12  ? 0.628   -0.873  -5.539  1.00 0.00 ? 12  ILE A CA   5  
ATOM 6840  C C    . ILE A 1 12  ? 0.835   -2.370  -5.350  1.00 0.00 ? 12  ILE A C    5  
ATOM 6841  O O    . ILE A 1 12  ? 0.542   -2.931  -4.315  1.00 0.00 ? 12  ILE A O    5  
ATOM 6842  C CB   . ILE A 1 12  ? -0.534  -0.676  -6.501  1.00 0.00 ? 12  ILE A CB   5  
ATOM 6843  C CG1  . ILE A 1 12  ? -0.428  0.683   -7.205  1.00 0.00 ? 12  ILE A CG1  5  
ATOM 6844  C CG2  . ILE A 1 12  ? -1.846  -0.768  -5.727  1.00 0.00 ? 12  ILE A CG2  5  
ATOM 6845  C CD1  . ILE A 1 12  ? -0.119  1.771   -6.187  1.00 0.00 ? 12  ILE A CD1  5  
ATOM 6846  H H    . ILE A 1 12  ? 1.887   0.017   -7.049  1.00 0.00 ? 12  ILE A H    5  
ATOM 6847  H HA   . ILE A 1 12  ? 0.409   -0.406  -4.589  1.00 0.00 ? 12  ILE A HA   5  
ATOM 6848  H HB   . ILE A 1 12  ? -0.506  -1.462  -7.230  1.00 0.00 ? 12  ILE A HB   5  
ATOM 6849  H HG12 . ILE A 1 12  ? 0.360   0.647   -7.942  1.00 0.00 ? 12  ILE A HG12 5  
ATOM 6850  H HG13 . ILE A 1 12  ? -1.364  0.911   -7.693  1.00 0.00 ? 12  ILE A HG13 5  
ATOM 6851  H HG21 . ILE A 1 12  ? -1.850  -1.674  -5.136  1.00 0.00 ? 12  ILE A HG21 5  
ATOM 6852  H HG22 . ILE A 1 12  ? -2.673  -0.789  -6.421  1.00 0.00 ? 12  ILE A HG22 5  
ATOM 6853  H HG23 . ILE A 1 12  ? -1.940  0.086   -5.076  1.00 0.00 ? 12  ILE A HG23 5  
ATOM 6854  H HD11 . ILE A 1 12  ? -0.940  1.849   -5.492  1.00 0.00 ? 12  ILE A HD11 5  
ATOM 6855  H HD12 . ILE A 1 12  ? 0.014   2.714   -6.697  1.00 0.00 ? 12  ILE A HD12 5  
ATOM 6856  H HD13 . ILE A 1 12  ? 0.784   1.521   -5.651  1.00 0.00 ? 12  ILE A HD13 5  
ATOM 6857  N N    . VAL A 1 13  ? 1.336   -3.018  -6.361  1.00 0.00 ? 13  VAL A N    5  
ATOM 6858  C CA   . VAL A 1 13  ? 1.576   -4.477  -6.267  1.00 0.00 ? 13  VAL A CA   5  
ATOM 6859  C C    . VAL A 1 13  ? 2.398   -4.762  -5.009  1.00 0.00 ? 13  VAL A C    5  
ATOM 6860  O O    . VAL A 1 13  ? 2.368   -5.843  -4.458  1.00 0.00 ? 13  VAL A O    5  
ATOM 6861  C CB   . VAL A 1 13  ? 2.339   -4.935  -7.501  1.00 0.00 ? 13  VAL A CB   5  
ATOM 6862  C CG1  . VAL A 1 13  ? 2.541   -6.445  -7.437  1.00 0.00 ? 13  VAL A CG1  5  
ATOM 6863  C CG2  . VAL A 1 13  ? 1.527   -4.573  -8.746  1.00 0.00 ? 13  VAL A CG2  5  
ATOM 6864  H H    . VAL A 1 13  ? 1.548   -2.541  -7.189  1.00 0.00 ? 13  VAL A H    5  
ATOM 6865  H HA   . VAL A 1 13  ? 0.632   -4.993  -6.213  1.00 0.00 ? 13  VAL A HA   5  
ATOM 6866  H HB   . VAL A 1 13  ? 3.300   -4.442  -7.537  1.00 0.00 ? 13  VAL A HB   5  
ATOM 6867  H HG11 . VAL A 1 13  ? 2.923   -6.789  -8.380  1.00 0.00 ? 13  VAL A HG11 5  
ATOM 6868  H HG12 . VAL A 1 13  ? 1.597   -6.927  -7.231  1.00 0.00 ? 13  VAL A HG12 5  
ATOM 6869  H HG13 . VAL A 1 13  ? 3.245   -6.681  -6.654  1.00 0.00 ? 13  VAL A HG13 5  
ATOM 6870  H HG21 . VAL A 1 13  ? 2.090   -4.820  -9.630  1.00 0.00 ? 13  VAL A HG21 5  
ATOM 6871  H HG22 . VAL A 1 13  ? 1.313   -3.515  -8.740  1.00 0.00 ? 13  VAL A HG22 5  
ATOM 6872  H HG23 . VAL A 1 13  ? 0.598   -5.125  -8.742  1.00 0.00 ? 13  VAL A HG23 5  
ATOM 6873  N N    . GLN A 1 14  ? 3.120   -3.790  -4.534  1.00 0.00 ? 14  GLN A N    5  
ATOM 6874  C CA   . GLN A 1 14  ? 3.901   -3.996  -3.288  1.00 0.00 ? 14  GLN A CA   5  
ATOM 6875  C C    . GLN A 1 14  ? 2.924   -3.894  -2.119  1.00 0.00 ? 14  GLN A C    5  
ATOM 6876  O O    . GLN A 1 14  ? 2.993   -4.627  -1.152  1.00 0.00 ? 14  GLN A O    5  
ATOM 6877  C CB   . GLN A 1 14  ? 4.967   -2.908  -3.162  1.00 0.00 ? 14  GLN A CB   5  
ATOM 6878  C CG   . GLN A 1 14  ? 5.658   -3.027  -1.801  1.00 0.00 ? 14  GLN A CG   5  
ATOM 6879  C CD   . GLN A 1 14  ? 7.104   -2.549  -1.924  1.00 0.00 ? 14  GLN A CD   5  
ATOM 6880  O OE1  . GLN A 1 14  ? 7.583   -1.802  -1.094  1.00 0.00 ? 14  GLN A OE1  5  
ATOM 6881  N NE2  . GLN A 1 14  ? 7.825   -2.952  -2.931  1.00 0.00 ? 14  GLN A NE2  5  
ATOM 6882  H H    . GLN A 1 14  ? 3.123   -2.917  -4.979  1.00 0.00 ? 14  GLN A H    5  
ATOM 6883  H HA   . GLN A 1 14  ? 4.365   -4.972  -3.299  1.00 0.00 ? 14  GLN A HA   5  
ATOM 6884  H HB2  . GLN A 1 14  ? 5.696   -3.026  -3.950  1.00 0.00 ? 14  GLN A HB2  5  
ATOM 6885  H HB3  . GLN A 1 14  ? 4.502   -1.938  -3.243  1.00 0.00 ? 14  GLN A HB3  5  
ATOM 6886  H HG2  . GLN A 1 14  ? 5.135   -2.418  -1.077  1.00 0.00 ? 14  GLN A HG2  5  
ATOM 6887  H HG3  . GLN A 1 14  ? 5.647   -4.058  -1.480  1.00 0.00 ? 14  GLN A HG3  5  
ATOM 6888  H HE21 . GLN A 1 14  ? 7.441   -3.558  -3.599  1.00 0.00 ? 14  GLN A HE21 5  
ATOM 6889  H HE22 . GLN A 1 14  ? 8.749   -2.647  -3.024  1.00 0.00 ? 14  GLN A HE22 5  
ATOM 6890  N N    . ALA A 1 15  ? 2.015   -2.966  -2.221  1.00 0.00 ? 15  ALA A N    5  
ATOM 6891  C CA   . ALA A 1 15  ? 1.004   -2.749  -1.151  1.00 0.00 ? 15  ALA A CA   5  
ATOM 6892  C C    . ALA A 1 15  ? 0.163   -4.012  -0.917  1.00 0.00 ? 15  ALA A C    5  
ATOM 6893  O O    . ALA A 1 15  ? 0.112   -4.523  0.184   1.00 0.00 ? 15  ALA A O    5  
ATOM 6894  C CB   . ALA A 1 15  ? 0.082   -1.603  -1.568  1.00 0.00 ? 15  ALA A CB   5  
ATOM 6895  H H    . ALA A 1 15  ? 2.006   -2.391  -3.013  1.00 0.00 ? 15  ALA A H    5  
ATOM 6896  H HA   . ALA A 1 15  ? 1.507   -2.482  -0.236  1.00 0.00 ? 15  ALA A HA   5  
ATOM 6897  H HB1  . ALA A 1 15  ? -0.664  -1.972  -2.254  1.00 0.00 ? 15  ALA A HB1  5  
ATOM 6898  H HB2  . ALA A 1 15  ? 0.665   -0.833  -2.050  1.00 0.00 ? 15  ALA A HB2  5  
ATOM 6899  H HB3  . ALA A 1 15  ? -0.402  -1.195  -0.695  1.00 0.00 ? 15  ALA A HB3  5  
ATOM 6900  N N    . ILE A 1 16  ? -0.525  -4.510  -1.918  1.00 0.00 ? 16  ILE A N    5  
ATOM 6901  C CA   . ILE A 1 16  ? -1.373  -5.721  -1.672  1.00 0.00 ? 16  ILE A CA   5  
ATOM 6902  C C    . ILE A 1 16  ? -0.501  -6.930  -1.340  1.00 0.00 ? 16  ILE A C    5  
ATOM 6903  O O    . ILE A 1 16  ? -0.971  -7.921  -0.818  1.00 0.00 ? 16  ILE A O    5  
ATOM 6904  C CB   . ILE A 1 16  ? -2.239  -6.068  -2.882  1.00 0.00 ? 16  ILE A CB   5  
ATOM 6905  C CG1  . ILE A 1 16  ? -1.517  -5.785  -4.194  1.00 0.00 ? 16  ILE A CG1  5  
ATOM 6906  C CG2  . ILE A 1 16  ? -3.532  -5.261  -2.851  1.00 0.00 ? 16  ILE A CG2  5  
ATOM 6907  C CD1  . ILE A 1 16  ? -0.070  -6.227  -4.112  1.00 0.00 ? 16  ILE A CD1  5  
ATOM 6908  H H    . ILE A 1 16  ? -0.503  -4.081  -2.806  1.00 0.00 ? 16  ILE A H    5  
ATOM 6909  H HA   . ILE A 1 16  ? -2.019  -5.522  -0.829  1.00 0.00 ? 16  ILE A HA   5  
ATOM 6910  H HB   . ILE A 1 16  ? -2.472  -7.117  -2.832  1.00 0.00 ? 16  ILE A HB   5  
ATOM 6911  H HG12 . ILE A 1 16  ? -1.997  -6.348  -4.962  1.00 0.00 ? 16  ILE A HG12 5  
ATOM 6912  H HG13 . ILE A 1 16  ? -1.570  -4.730  -4.430  1.00 0.00 ? 16  ILE A HG13 5  
ATOM 6913  H HG21 . ILE A 1 16  ? -4.253  -5.708  -3.520  1.00 0.00 ? 16  ILE A HG21 5  
ATOM 6914  H HG22 . ILE A 1 16  ? -3.330  -4.247  -3.168  1.00 0.00 ? 16  ILE A HG22 5  
ATOM 6915  H HG23 . ILE A 1 16  ? -3.928  -5.252  -1.850  1.00 0.00 ? 16  ILE A HG23 5  
ATOM 6916  H HD11 . ILE A 1 16  ? 0.505   -5.475  -3.600  1.00 0.00 ? 16  ILE A HD11 5  
ATOM 6917  H HD12 . ILE A 1 16  ? 0.320   -6.360  -5.110  1.00 0.00 ? 16  ILE A HD12 5  
ATOM 6918  H HD13 . ILE A 1 16  ? -0.008  -7.161  -3.585  1.00 0.00 ? 16  ILE A HD13 5  
ATOM 6919  N N    . SER A 1 17  ? 0.760   -6.862  -1.636  1.00 0.00 ? 17  SER A N    5  
ATOM 6920  C CA   . SER A 1 17  ? 1.653   -8.011  -1.331  1.00 0.00 ? 17  SER A CA   5  
ATOM 6921  C C    . SER A 1 17  ? 1.631   -8.251  0.175   1.00 0.00 ? 17  SER A C    5  
ATOM 6922  O O    . SER A 1 17  ? 2.057   -9.280  0.660   1.00 0.00 ? 17  SER A O    5  
ATOM 6923  C CB   . SER A 1 17  ? 3.080   -7.695  -1.785  1.00 0.00 ? 17  SER A CB   5  
ATOM 6924  O OG   . SER A 1 17  ? 3.207   -7.986  -3.171  1.00 0.00 ? 17  SER A OG   5  
ATOM 6925  H H    . SER A 1 17  ? 1.115   -6.062  -2.055  1.00 0.00 ? 17  SER A H    5  
ATOM 6926  H HA   . SER A 1 17  ? 1.295   -8.892  -1.844  1.00 0.00 ? 17  SER A HA   5  
ATOM 6927  H HB2  . SER A 1 17  ? 3.289   -6.652  -1.621  1.00 0.00 ? 17  SER A HB2  5  
ATOM 6928  H HB3  . SER A 1 17  ? 3.778   -8.293  -1.215  1.00 0.00 ? 17  SER A HB3  5  
ATOM 6929  H HG   . SER A 1 17  ? 3.233   -8.939  -3.273  1.00 0.00 ? 17  SER A HG   5  
ATOM 6930  N N    . SER A 1 18  ? 1.126   -7.303  0.917   1.00 0.00 ? 18  SER A N    5  
ATOM 6931  C CA   . SER A 1 18  ? 1.062   -7.465  2.392   1.00 0.00 ? 18  SER A CA   5  
ATOM 6932  C C    . SER A 1 18  ? -0.365  -7.836  2.798   1.00 0.00 ? 18  SER A C    5  
ATOM 6933  O O    . SER A 1 18  ? -0.594  -8.367  3.867   1.00 0.00 ? 18  SER A O    5  
ATOM 6934  C CB   . SER A 1 18  ? 1.459   -6.155  3.070   1.00 0.00 ? 18  SER A CB   5  
ATOM 6935  O OG   . SER A 1 18  ? 1.137   -6.227  4.452   1.00 0.00 ? 18  SER A OG   5  
ATOM 6936  H H    . SER A 1 18  ? 0.784   -6.483  0.501   1.00 0.00 ? 18  SER A H    5  
ATOM 6937  H HA   . SER A 1 18  ? 1.738   -8.249  2.698   1.00 0.00 ? 18  SER A HA   5  
ATOM 6938  H HB2  . SER A 1 18  ? 2.519   -5.999  2.963   1.00 0.00 ? 18  SER A HB2  5  
ATOM 6939  H HB3  . SER A 1 18  ? 0.926   -5.336  2.607   1.00 0.00 ? 18  SER A HB3  5  
ATOM 6940  H HG   . SER A 1 18  ? 1.350   -7.111  4.761   1.00 0.00 ? 18  SER A HG   5  
ATOM 6941  N N    . ALA A 1 19  ? -1.332  -7.566  1.958   1.00 0.00 ? 19  ALA A N    5  
ATOM 6942  C CA   . ALA A 1 19  ? -2.734  -7.917  2.321   1.00 0.00 ? 19  ALA A CA   5  
ATOM 6943  C C    . ALA A 1 19  ? -2.859  -9.441  2.418   1.00 0.00 ? 19  ALA A C    5  
ATOM 6944  O O    . ALA A 1 19  ? -2.430  -10.158 1.535   1.00 0.00 ? 19  ALA A O    5  
ATOM 6945  C CB   . ALA A 1 19  ? -3.690  -7.396  1.247   1.00 0.00 ? 19  ALA A CB   5  
ATOM 6946  H H    . ALA A 1 19  ? -1.138  -7.137  1.090   1.00 0.00 ? 19  ALA A H    5  
ATOM 6947  H HA   . ALA A 1 19  ? -2.981  -7.469  3.273   1.00 0.00 ? 19  ALA A HA   5  
ATOM 6948  H HB1  . ALA A 1 19  ? -3.121  -6.943  0.448   1.00 0.00 ? 19  ALA A HB1  5  
ATOM 6949  H HB2  . ALA A 1 19  ? -4.352  -6.662  1.680   1.00 0.00 ? 19  ALA A HB2  5  
ATOM 6950  H HB3  . ALA A 1 19  ? -4.270  -8.218  0.854   1.00 0.00 ? 19  ALA A HB3  5  
ATOM 6951  N N    . GLN A 1 20  ? -3.441  -9.948  3.477   1.00 0.00 ? 20  GLN A N    5  
ATOM 6952  C CA   . GLN A 1 20  ? -3.581  -11.426 3.602   1.00 0.00 ? 20  GLN A CA   5  
ATOM 6953  C C    . GLN A 1 20  ? -4.063  -11.985 2.265   1.00 0.00 ? 20  GLN A C    5  
ATOM 6954  O O    . GLN A 1 20  ? -3.459  -12.872 1.695   1.00 0.00 ? 20  GLN A O    5  
ATOM 6955  C CB   . GLN A 1 20  ? -4.597  -11.761 4.694   1.00 0.00 ? 20  GLN A CB   5  
ATOM 6956  C CG   . GLN A 1 20  ? -4.100  -12.964 5.499   1.00 0.00 ? 20  GLN A CG   5  
ATOM 6957  C CD   . GLN A 1 20  ? -4.627  -12.874 6.931   1.00 0.00 ? 20  GLN A CD   5  
ATOM 6958  O OE1  . GLN A 1 20  ? -5.456  -12.039 7.234   1.00 0.00 ? 20  GLN A OE1  5  
ATOM 6959  N NE2  . GLN A 1 20  ? -4.179  -13.705 7.832   1.00 0.00 ? 20  GLN A NE2  5  
ATOM 6960  H H    . GLN A 1 20  ? -3.784  -9.361  4.183   1.00 0.00 ? 20  GLN A H    5  
ATOM 6961  H HA   . GLN A 1 20  ? -2.624  -11.861 3.850   1.00 0.00 ? 20  GLN A HA   5  
ATOM 6962  H HB2  . GLN A 1 20  ? -4.714  -10.910 5.349   1.00 0.00 ? 20  GLN A HB2  5  
ATOM 6963  H HB3  . GLN A 1 20  ? -5.548  -12.002 4.242   1.00 0.00 ? 20  GLN A HB3  5  
ATOM 6964  H HG2  . GLN A 1 20  ? -4.453  -13.876 5.040   1.00 0.00 ? 20  GLN A HG2  5  
ATOM 6965  H HG3  . GLN A 1 20  ? -3.019  -12.963 5.515   1.00 0.00 ? 20  GLN A HG3  5  
ATOM 6966  H HE21 . GLN A 1 20  ? -3.511  -14.378 7.587   1.00 0.00 ? 20  GLN A HE21 5  
ATOM 6967  H HE22 . GLN A 1 20  ? -4.513  -13.656 8.752   1.00 0.00 ? 20  GLN A HE22 5  
ATOM 6968  N N    . ASP A 1 21  ? -5.137  -11.455 1.751   1.00 0.00 ? 21  ASP A N    5  
ATOM 6969  C CA   . ASP A 1 21  ? -5.649  -11.935 0.441   1.00 0.00 ? 21  ASP A CA   5  
ATOM 6970  C C    . ASP A 1 21  ? -5.003  -11.101 -0.668  1.00 0.00 ? 21  ASP A C    5  
ATOM 6971  O O    . ASP A 1 21  ? -4.061  -11.527 -1.308  1.00 0.00 ? 21  ASP A O    5  
ATOM 6972  C CB   . ASP A 1 21  ? -7.172  -11.780 0.398   1.00 0.00 ? 21  ASP A CB   5  
ATOM 6973  C CG   . ASP A 1 21  ? -7.818  -13.140 0.134   1.00 0.00 ? 21  ASP A CG   5  
ATOM 6974  O OD1  . ASP A 1 21  ? -7.729  -13.995 1.000   1.00 0.00 ? 21  ASP A OD1  5  
ATOM 6975  O OD2  . ASP A 1 21  ? -8.393  -13.305 -0.930  1.00 0.00 ? 21  ASP A OD2  5  
ATOM 6976  H H    . ASP A 1 21  ? -5.599  -10.729 2.221   1.00 0.00 ? 21  ASP A H    5  
ATOM 6977  H HA   . ASP A 1 21  ? -5.386  -12.975 0.310   1.00 0.00 ? 21  ASP A HA   5  
ATOM 6978  H HB2  . ASP A 1 21  ? -7.523  -11.394 1.346   1.00 0.00 ? 21  ASP A HB2  5  
ATOM 6979  H HB3  . ASP A 1 21  ? -7.445  -11.096 -0.391  1.00 0.00 ? 21  ASP A HB3  5  
ATOM 6980  N N    . ARG A 1 22  ? -5.490  -9.911  -0.894  1.00 0.00 ? 22  ARG A N    5  
ATOM 6981  C CA   . ARG A 1 22  ? -4.895  -9.046  -1.951  1.00 0.00 ? 22  ARG A CA   5  
ATOM 6982  C C    . ARG A 1 22  ? -5.679  -7.734  -2.032  1.00 0.00 ? 22  ARG A C    5  
ATOM 6983  O O    . ARG A 1 22  ? -5.997  -7.261  -3.109  1.00 0.00 ? 22  ARG A O    5  
ATOM 6984  C CB   . ARG A 1 22  ? -4.959  -9.769  -3.299  1.00 0.00 ? 22  ARG A CB   5  
ATOM 6985  C CG   . ARG A 1 22  ? -6.420  -9.935  -3.730  1.00 0.00 ? 22  ARG A CG   5  
ATOM 6986  C CD   . ARG A 1 22  ? -6.918  -11.324 -3.327  1.00 0.00 ? 22  ARG A CD   5  
ATOM 6987  N NE   . ARG A 1 22  ? -8.141  -11.659 -4.110  1.00 0.00 ? 22  ARG A NE   5  
ATOM 6988  C CZ   . ARG A 1 22  ? -9.316  -11.583 -3.548  1.00 0.00 ? 22  ARG A CZ   5  
ATOM 6989  N NH1  . ARG A 1 22  ? -9.890  -10.420 -3.395  1.00 0.00 ? 22  ARG A NH1  5  
ATOM 6990  N NH2  . ARG A 1 22  ? -9.919  -12.666 -3.139  1.00 0.00 ? 22  ARG A NH2  5  
ATOM 6991  H H    . ARG A 1 22  ? -6.242  -9.579  -0.361  1.00 0.00 ? 22  ARG A H    5  
ATOM 6992  H HA   . ARG A 1 22  ? -3.864  -8.834  -1.705  1.00 0.00 ? 22  ARG A HA   5  
ATOM 6993  H HB2  . ARG A 1 22  ? -4.429  -9.191  -4.042  1.00 0.00 ? 22  ARG A HB2  5  
ATOM 6994  H HB3  . ARG A 1 22  ? -4.501  -10.742 -3.207  1.00 0.00 ? 22  ARG A HB3  5  
ATOM 6995  H HG2  . ARG A 1 22  ? -7.027  -9.182  -3.250  1.00 0.00 ? 22  ARG A HG2  5  
ATOM 6996  H HG3  . ARG A 1 22  ? -6.493  -9.827  -4.802  1.00 0.00 ? 22  ARG A HG3  5  
ATOM 6997  H HD2  . ARG A 1 22  ? -6.150  -12.055 -3.528  1.00 0.00 ? 22  ARG A HD2  5  
ATOM 6998  H HD3  . ARG A 1 22  ? -7.154  -11.329 -2.273  1.00 0.00 ? 22  ARG A HD3  5  
ATOM 6999  H HE   . ARG A 1 22  ? -8.062  -11.937 -5.047  1.00 0.00 ? 22  ARG A HE   5  
ATOM 7000  H HH11 . ARG A 1 22  ? -9.428  -9.589  -3.707  1.00 0.00 ? 22  ARG A HH11 5  
ATOM 7001  H HH12 . ARG A 1 22  ? -10.790 -10.360 -2.965  1.00 0.00 ? 22  ARG A HH12 5  
ATOM 7002  H HH21 . ARG A 1 22  ? -9.479  -13.556 -3.256  1.00 0.00 ? 22  ARG A HH21 5  
ATOM 7003  H HH22 . ARG A 1 22  ? -10.820 -12.606 -2.709  1.00 0.00 ? 22  ARG A HH22 5  
ATOM 7004  N N    . GLN A 1 23  ? -6.013  -7.149  -0.908  1.00 0.00 ? 23  GLN A N    5  
ATOM 7005  C CA   . GLN A 1 23  ? -6.799  -5.884  -0.949  1.00 0.00 ? 23  GLN A CA   5  
ATOM 7006  C C    . GLN A 1 23  ? -6.474  -4.980  0.248   1.00 0.00 ? 23  GLN A C    5  
ATOM 7007  O O    . GLN A 1 23  ? -6.653  -5.356  1.389   1.00 0.00 ? 23  GLN A O    5  
ATOM 7008  C CB   . GLN A 1 23  ? -8.289  -6.230  -0.915  1.00 0.00 ? 23  GLN A CB   5  
ATOM 7009  C CG   . GLN A 1 23  ? -8.660  -6.757  0.473   1.00 0.00 ? 23  GLN A CG   5  
ATOM 7010  C CD   . GLN A 1 23  ? -9.766  -7.806  0.338   1.00 0.00 ? 23  GLN A CD   5  
ATOM 7011  O OE1  . GLN A 1 23  ? -10.320 -7.986  -0.728  1.00 0.00 ? 23  GLN A OE1  5  
ATOM 7012  N NE2  . GLN A 1 23  ? -10.113 -8.511  1.380   1.00 0.00 ? 23  GLN A NE2  5  
ATOM 7013  H H    . GLN A 1 23  ? -5.765  -7.548  -0.049  1.00 0.00 ? 23  GLN A H    5  
ATOM 7014  H HA   . GLN A 1 23  ? -6.577  -5.362  -1.865  1.00 0.00 ? 23  GLN A HA   5  
ATOM 7015  H HB2  . GLN A 1 23  ? -8.870  -5.345  -1.133  1.00 0.00 ? 23  GLN A HB2  5  
ATOM 7016  H HB3  . GLN A 1 23  ? -8.501  -6.991  -1.649  1.00 0.00 ? 23  GLN A HB3  5  
ATOM 7017  H HG2  . GLN A 1 23  ? -7.791  -7.205  0.932   1.00 0.00 ? 23  GLN A HG2  5  
ATOM 7018  H HG3  . GLN A 1 23  ? -9.013  -5.941  1.087   1.00 0.00 ? 23  GLN A HG3  5  
ATOM 7019  H HE21 . GLN A 1 23  ? -9.667  -8.366  2.241   1.00 0.00 ? 23  GLN A HE21 5  
ATOM 7020  H HE22 . GLN A 1 23  ? -10.818 -9.186  1.301   1.00 0.00 ? 23  GLN A HE22 5  
ATOM 7021  N N    . LEU A 1 24  ? -6.034  -3.773  -0.010  1.00 0.00 ? 24  LEU A N    5  
ATOM 7022  C CA   . LEU A 1 24  ? -5.742  -2.826  1.097   1.00 0.00 ? 24  LEU A CA   5  
ATOM 7023  C C    . LEU A 1 24  ? -6.778  -1.704  1.041   1.00 0.00 ? 24  LEU A C    5  
ATOM 7024  O O    . LEU A 1 24  ? -7.521  -1.587  0.087   1.00 0.00 ? 24  LEU A O    5  
ATOM 7025  C CB   . LEU A 1 24  ? -4.352  -2.191  0.927   1.00 0.00 ? 24  LEU A CB   5  
ATOM 7026  C CG   . LEU A 1 24  ? -3.320  -3.182  0.371   1.00 0.00 ? 24  LEU A CG   5  
ATOM 7027  C CD1  . LEU A 1 24  ? -3.660  -4.617  0.785   1.00 0.00 ? 24  LEU A CD1  5  
ATOM 7028  C CD2  . LEU A 1 24  ? -3.291  -3.065  -1.153  1.00 0.00 ? 24  LEU A CD2  5  
ATOM 7029  H H    . LEU A 1 24  ? -5.924  -3.479  -0.933  1.00 0.00 ? 24  LEU A H    5  
ATOM 7030  H HA   . LEU A 1 24  ? -5.802  -3.336  2.046   1.00 0.00 ? 24  LEU A HA   5  
ATOM 7031  H HB2  . LEU A 1 24  ? -4.426  -1.350  0.251   1.00 0.00 ? 24  LEU A HB2  5  
ATOM 7032  H HB3  . LEU A 1 24  ? -4.017  -1.838  1.883   1.00 0.00 ? 24  LEU A HB3  5  
ATOM 7033  H HG   . LEU A 1 24  ? -2.345  -2.930  0.761   1.00 0.00 ? 24  LEU A HG   5  
ATOM 7034  H HD11 . LEU A 1 24  ? -2.750  -5.147  1.024   1.00 0.00 ? 24  LEU A HD11 5  
ATOM 7035  H HD12 . LEU A 1 24  ? -4.164  -5.117  -0.027  1.00 0.00 ? 24  LEU A HD12 5  
ATOM 7036  H HD13 . LEU A 1 24  ? -4.304  -4.598  1.651   1.00 0.00 ? 24  LEU A HD13 5  
ATOM 7037  H HD21 . LEU A 1 24  ? -3.159  -2.029  -1.431  1.00 0.00 ? 24  LEU A HD21 5  
ATOM 7038  H HD22 . LEU A 1 24  ? -4.217  -3.432  -1.563  1.00 0.00 ? 24  LEU A HD22 5  
ATOM 7039  H HD23 . LEU A 1 24  ? -2.471  -3.645  -1.541  1.00 0.00 ? 24  LEU A HD23 5  
ATOM 7040  N N    . THR A 1 25  ? -6.816  -0.855  2.028   1.00 0.00 ? 25  THR A N    5  
ATOM 7041  C CA   . THR A 1 25  ? -7.786  0.270   1.980   1.00 0.00 ? 25  THR A CA   5  
ATOM 7042  C C    . THR A 1 25  ? -7.196  1.341   1.066   1.00 0.00 ? 25  THR A C    5  
ATOM 7043  O O    . THR A 1 25  ? -6.042  1.274   0.698   1.00 0.00 ? 25  THR A O    5  
ATOM 7044  C CB   . THR A 1 25  ? -7.988  0.844   3.386   1.00 0.00 ? 25  THR A CB   5  
ATOM 7045  O OG1  . THR A 1 25  ? -6.735  0.920   4.051   1.00 0.00 ? 25  THR A OG1  5  
ATOM 7046  C CG2  . THR A 1 25  ? -8.934  -0.059  4.178   1.00 0.00 ? 25  THR A CG2  5  
ATOM 7047  H H    . THR A 1 25  ? -6.194  -0.942  2.780   1.00 0.00 ? 25  THR A H    5  
ATOM 7048  H HA   . THR A 1 25  ? -8.730  -0.075  1.583   1.00 0.00 ? 25  THR A HA   5  
ATOM 7049  H HB   . THR A 1 25  ? -8.418  1.831   3.314   1.00 0.00 ? 25  THR A HB   5  
ATOM 7050  H HG1  . THR A 1 25  ? -6.832  1.517   4.797   1.00 0.00 ? 25  THR A HG1  5  
ATOM 7051  H HG21 . THR A 1 25  ? -9.766  0.524   4.544   1.00 0.00 ? 25  THR A HG21 5  
ATOM 7052  H HG22 . THR A 1 25  ? -8.403  -0.492  5.012   1.00 0.00 ? 25  THR A HG22 5  
ATOM 7053  H HG23 . THR A 1 25  ? -9.300  -0.847  3.536   1.00 0.00 ? 25  THR A HG23 5  
ATOM 7054  N N    . LEU A 1 26  ? -7.955  2.327   0.683   1.00 0.00 ? 26  LEU A N    5  
ATOM 7055  C CA   . LEU A 1 26  ? -7.376  3.370   -0.209  1.00 0.00 ? 26  LEU A CA   5  
ATOM 7056  C C    . LEU A 1 26  ? -6.105  3.921   0.442   1.00 0.00 ? 26  LEU A C    5  
ATOM 7057  O O    . LEU A 1 26  ? -5.116  4.171   -0.218  1.00 0.00 ? 26  LEU A O    5  
ATOM 7058  C CB   . LEU A 1 26  ? -8.381  4.506   -0.422  1.00 0.00 ? 26  LEU A CB   5  
ATOM 7059  C CG   . LEU A 1 26  ? -8.127  5.151   -1.787  1.00 0.00 ? 26  LEU A CG   5  
ATOM 7060  C CD1  . LEU A 1 26  ? -9.266  6.118   -2.115  1.00 0.00 ? 26  LEU A CD1  5  
ATOM 7061  C CD2  . LEU A 1 26  ? -6.804  5.918   -1.751  1.00 0.00 ? 26  LEU A CD2  5  
ATOM 7062  H H    . LEU A 1 26  ? -8.889  2.380   0.977   1.00 0.00 ? 26  LEU A H    5  
ATOM 7063  H HA   . LEU A 1 26  ? -7.126  2.926   -1.162  1.00 0.00 ? 26  LEU A HA   5  
ATOM 7064  H HB2  . LEU A 1 26  ? -9.386  4.113   -0.390  1.00 0.00 ? 26  LEU A HB2  5  
ATOM 7065  H HB3  . LEU A 1 26  ? -8.257  5.248   0.353   1.00 0.00 ? 26  LEU A HB3  5  
ATOM 7066  H HG   . LEU A 1 26  ? -8.079  4.380   -2.546  1.00 0.00 ? 26  LEU A HG   5  
ATOM 7067  H HD11 . LEU A 1 26  ? -8.857  7.023   -2.538  1.00 0.00 ? 26  LEU A HD11 5  
ATOM 7068  H HD12 . LEU A 1 26  ? -9.808  6.356   -1.212  1.00 0.00 ? 26  LEU A HD12 5  
ATOM 7069  H HD13 . LEU A 1 26  ? -9.935  5.658   -2.827  1.00 0.00 ? 26  LEU A HD13 5  
ATOM 7070  H HD21 . LEU A 1 26  ? -6.450  5.980   -0.732  1.00 0.00 ? 26  LEU A HD21 5  
ATOM 7071  H HD22 . LEU A 1 26  ? -6.954  6.914   -2.141  1.00 0.00 ? 26  LEU A HD22 5  
ATOM 7072  H HD23 . LEU A 1 26  ? -6.071  5.402   -2.355  1.00 0.00 ? 26  LEU A HD23 5  
ATOM 7073  N N    . SER A 1 27  ? -6.124  4.107   1.735   1.00 0.00 ? 27  SER A N    5  
ATOM 7074  C CA   . SER A 1 27  ? -4.919  4.638   2.432   1.00 0.00 ? 27  SER A CA   5  
ATOM 7075  C C    . SER A 1 27  ? -4.142  3.489   3.085   1.00 0.00 ? 27  SER A C    5  
ATOM 7076  O O    . SER A 1 27  ? -3.632  3.620   4.180   1.00 0.00 ? 27  SER A O    5  
ATOM 7077  C CB   . SER A 1 27  ? -5.353  5.619   3.513   1.00 0.00 ? 27  SER A CB   5  
ATOM 7078  O OG   . SER A 1 27  ? -5.382  6.933   2.973   1.00 0.00 ? 27  SER A OG   5  
ATOM 7079  H H    . SER A 1 27  ? -6.933  3.896   2.247   1.00 0.00 ? 27  SER A H    5  
ATOM 7080  H HA   . SER A 1 27  ? -4.288  5.141   1.721   1.00 0.00 ? 27  SER A HA   5  
ATOM 7081  H HB2  . SER A 1 27  ? -6.337  5.356   3.862   1.00 0.00 ? 27  SER A HB2  5  
ATOM 7082  H HB3  . SER A 1 27  ? -4.655  5.571   4.337   1.00 0.00 ? 27  SER A HB3  5  
ATOM 7083  H HG   . SER A 1 27  ? -4.826  7.491   3.521   1.00 0.00 ? 27  SER A HG   5  
ATOM 7084  N N    . GLY A 1 28  ? -4.042  2.373   2.426   1.00 0.00 ? 28  GLY A N    5  
ATOM 7085  C CA   . GLY A 1 28  ? -3.289  1.225   3.012   1.00 0.00 ? 28  GLY A CA   5  
ATOM 7086  C C    . GLY A 1 28  ? -1.913  1.172   2.363   1.00 0.00 ? 28  GLY A C    5  
ATOM 7087  O O    . GLY A 1 28  ? -0.898  1.006   3.011   1.00 0.00 ? 28  GLY A O    5  
ATOM 7088  H H    . GLY A 1 28  ? -4.445  2.294   1.535   1.00 0.00 ? 28  GLY A H    5  
ATOM 7089  H HA2  . GLY A 1 28  ? -3.183  1.363   4.077   1.00 0.00 ? 28  GLY A HA2  5  
ATOM 7090  H HA3  . GLY A 1 28  ? -3.819  0.304   2.816   1.00 0.00 ? 28  GLY A HA3  5  
ATOM 7091  N N    . ILE A 1 29  ? -1.896  1.317   1.076   1.00 0.00 ? 29  ILE A N    5  
ATOM 7092  C CA   . ILE A 1 29  ? -0.630  1.290   0.305   1.00 0.00 ? 29  ILE A CA   5  
ATOM 7093  C C    . ILE A 1 29  ? 0.346   2.315   0.847   1.00 0.00 ? 29  ILE A C    5  
ATOM 7094  O O    . ILE A 1 29  ? 1.542   2.108   0.874   1.00 0.00 ? 29  ILE A O    5  
ATOM 7095  C CB   . ILE A 1 29  ? -0.972  1.662   -1.117  1.00 0.00 ? 29  ILE A CB   5  
ATOM 7096  C CG1  . ILE A 1 29  ? 0.300   1.882   -1.918  1.00 0.00 ? 29  ILE A CG1  5  
ATOM 7097  C CG2  . ILE A 1 29  ? -1.794  2.947   -1.128  1.00 0.00 ? 29  ILE A CG2  5  
ATOM 7098  C CD1  . ILE A 1 29  ? -0.099  2.217   -3.342  1.00 0.00 ? 29  ILE A CD1  5  
ATOM 7099  H H    . ILE A 1 29  ? -2.741  1.445   0.597   1.00 0.00 ? 29  ILE A H    5  
ATOM 7100  H HA   . ILE A 1 29  ? -0.196  0.313   0.332   1.00 0.00 ? 29  ILE A HA   5  
ATOM 7101  H HB   . ILE A 1 29  ? -1.547  0.881   -1.554  1.00 0.00 ? 29  ILE A HB   5  
ATOM 7102  H HG12 . ILE A 1 29  ? 0.862   2.702   -1.492  1.00 0.00 ? 29  ILE A HG12 5  
ATOM 7103  H HG13 . ILE A 1 29  ? 0.899   0.986   -1.912  1.00 0.00 ? 29  ILE A HG13 5  
ATOM 7104  H HG21 . ILE A 1 29  ? -2.556  2.876   -1.889  1.00 0.00 ? 29  ILE A HG21 5  
ATOM 7105  H HG22 . ILE A 1 29  ? -1.147  3.780   -1.343  1.00 0.00 ? 29  ILE A HG22 5  
ATOM 7106  H HG23 . ILE A 1 29  ? -2.260  3.088   -0.165  1.00 0.00 ? 29  ILE A HG23 5  
ATOM 7107  H HD11 . ILE A 1 29  ? -0.065  1.320   -3.936  1.00 0.00 ? 29  ILE A HD11 5  
ATOM 7108  H HD12 . ILE A 1 29  ? 0.577   2.952   -3.744  1.00 0.00 ? 29  ILE A HD12 5  
ATOM 7109  H HD13 . ILE A 1 29  ? -1.108  2.612   -3.344  1.00 0.00 ? 29  ILE A HD13 5  
ATOM 7110  N N    . TYR A 1 30  ? -0.162  3.424   1.256   1.00 0.00 ? 30  TYR A N    5  
ATOM 7111  C CA   . TYR A 1 30  ? 0.721   4.494   1.778   1.00 0.00 ? 30  TYR A CA   5  
ATOM 7112  C C    . TYR A 1 30  ? 1.395   4.005   3.053   1.00 0.00 ? 30  TYR A C    5  
ATOM 7113  O O    . TYR A 1 30  ? 2.588   4.141   3.229   1.00 0.00 ? 30  TYR A O    5  
ATOM 7114  C CB   . TYR A 1 30  ? -0.128  5.726   2.058   1.00 0.00 ? 30  TYR A CB   5  
ATOM 7115  C CG   . TYR A 1 30  ? -1.031  5.954   0.870   1.00 0.00 ? 30  TYR A CG   5  
ATOM 7116  C CD1  . TYR A 1 30  ? -0.515  5.862   -0.430  1.00 0.00 ? 30  TYR A CD1  5  
ATOM 7117  C CD2  . TYR A 1 30  ? -2.383  6.233   1.064   1.00 0.00 ? 30  TYR A CD2  5  
ATOM 7118  C CE1  . TYR A 1 30  ? -1.355  6.053   -1.531  1.00 0.00 ? 30  TYR A CE1  5  
ATOM 7119  C CE2  . TYR A 1 30  ? -3.225  6.421   -0.037  1.00 0.00 ? 30  TYR A CE2  5  
ATOM 7120  C CZ   . TYR A 1 30  ? -2.712  6.333   -1.335  1.00 0.00 ? 30  TYR A CZ   5  
ATOM 7121  O OH   . TYR A 1 30  ? -3.544  6.515   -2.420  1.00 0.00 ? 30  TYR A OH   5  
ATOM 7122  H H    . TYR A 1 30  ? -1.129  3.562   1.197   1.00 0.00 ? 30  TYR A H    5  
ATOM 7123  H HA   . TYR A 1 30  ? 1.467   4.732   1.044   1.00 0.00 ? 30  TYR A HA   5  
ATOM 7124  H HB2  . TYR A 1 30  ? -0.724  5.560   2.944   1.00 0.00 ? 30  TYR A HB2  5  
ATOM 7125  H HB3  . TYR A 1 30  ? 0.509   6.579   2.203   1.00 0.00 ? 30  TYR A HB3  5  
ATOM 7126  H HD1  . TYR A 1 30  ? 0.528   5.643   -0.583  1.00 0.00 ? 30  TYR A HD1  5  
ATOM 7127  H HD2  . TYR A 1 30  ? -2.780  6.302   2.065   1.00 0.00 ? 30  TYR A HD2  5  
ATOM 7128  H HE1  . TYR A 1 30  ? -0.956  5.980   -2.532  1.00 0.00 ? 30  TYR A HE1  5  
ATOM 7129  H HE2  . TYR A 1 30  ? -4.271  6.632   0.116   1.00 0.00 ? 30  TYR A HE2  5  
ATOM 7130  H HH   . TYR A 1 30  ? -4.444  6.592   -2.093  1.00 0.00 ? 30  TYR A HH   5  
ATOM 7131  N N    . ALA A 1 31  ? 0.648   3.414   3.929   1.00 0.00 ? 31  ALA A N    5  
ATOM 7132  C CA   . ALA A 1 31  ? 1.255   2.887   5.176   1.00 0.00 ? 31  ALA A CA   5  
ATOM 7133  C C    . ALA A 1 31  ? 2.068   1.626   4.849   1.00 0.00 ? 31  ALA A C    5  
ATOM 7134  O O    . ALA A 1 31  ? 2.897   1.197   5.626   1.00 0.00 ? 31  ALA A O    5  
ATOM 7135  C CB   . ALA A 1 31  ? 0.149   2.537   6.175   1.00 0.00 ? 31  ALA A CB   5  
ATOM 7136  H H    . ALA A 1 31  ? -0.310  3.301   3.756   1.00 0.00 ? 31  ALA A H    5  
ATOM 7137  H HA   . ALA A 1 31  ? 1.905   3.636   5.605   1.00 0.00 ? 31  ALA A HA   5  
ATOM 7138  H HB1  . ALA A 1 31  ? 0.094   1.466   6.291   1.00 0.00 ? 31  ALA A HB1  5  
ATOM 7139  H HB2  . ALA A 1 31  ? -0.797  2.909   5.809   1.00 0.00 ? 31  ALA A HB2  5  
ATOM 7140  H HB3  . ALA A 1 31  ? 0.369   2.993   7.129   1.00 0.00 ? 31  ALA A HB3  5  
ATOM 7141  N N    . HIS A 1 32  ? 1.833   1.022   3.706   1.00 0.00 ? 32  HIS A N    5  
ATOM 7142  C CA   . HIS A 1 32  ? 2.588   -0.214  3.343   1.00 0.00 ? 32  HIS A CA   5  
ATOM 7143  C C    . HIS A 1 32  ? 3.999   0.141   2.856   1.00 0.00 ? 32  HIS A C    5  
ATOM 7144  O O    . HIS A 1 32  ? 4.978   -0.102  3.531   1.00 0.00 ? 32  HIS A O    5  
ATOM 7145  C CB   . HIS A 1 32  ? 1.840   -0.963  2.236   1.00 0.00 ? 32  HIS A CB   5  
ATOM 7146  C CG   . HIS A 1 32  ? 2.701   -2.088  1.728   1.00 0.00 ? 32  HIS A CG   5  
ATOM 7147  N ND1  . HIS A 1 32  ? 2.511   -3.401  2.127   1.00 0.00 ? 32  HIS A ND1  5  
ATOM 7148  C CD2  . HIS A 1 32  ? 3.761   -2.110  0.855   1.00 0.00 ? 32  HIS A CD2  5  
ATOM 7149  C CE1  . HIS A 1 32  ? 3.436   -4.152  1.500   1.00 0.00 ? 32  HIS A CE1  5  
ATOM 7150  N NE2  . HIS A 1 32  ? 4.223   -3.415  0.713   1.00 0.00 ? 32  HIS A NE2  5  
ATOM 7151  H H    . HIS A 1 32  ? 1.156   1.376   3.089   1.00 0.00 ? 32  HIS A H    5  
ATOM 7152  H HA   . HIS A 1 32  ? 2.663   -0.851  4.212   1.00 0.00 ? 32  HIS A HA   5  
ATOM 7153  H HB2  . HIS A 1 32  ? 0.918   -1.363  2.630   1.00 0.00 ? 32  HIS A HB2  5  
ATOM 7154  H HB3  . HIS A 1 32  ? 1.617   -0.286  1.424   1.00 0.00 ? 32  HIS A HB3  5  
ATOM 7155  H HD1  . HIS A 1 32  ? 1.830   -3.723  2.752   1.00 0.00 ? 32  HIS A HD1  5  
ATOM 7156  H HD2  . HIS A 1 32  ? 4.174   -1.247  0.356   1.00 0.00 ? 32  HIS A HD2  5  
ATOM 7157  H HE1  . HIS A 1 32  ? 3.530   -5.221  1.619   1.00 0.00 ? 32  HIS A HE1  5  
ATOM 7158  N N    . ILE A 1 33  ? 4.111   0.696   1.678   1.00 0.00 ? 33  ILE A N    5  
ATOM 7159  C CA   . ILE A 1 33  ? 5.456   1.053   1.132   1.00 0.00 ? 33  ILE A CA   5  
ATOM 7160  C C    . ILE A 1 33  ? 6.214   1.947   2.115   1.00 0.00 ? 33  ILE A C    5  
ATOM 7161  O O    . ILE A 1 33  ? 7.422   1.895   2.205   1.00 0.00 ? 33  ILE A O    5  
ATOM 7162  C CB   . ILE A 1 33  ? 5.282   1.808   -0.183  1.00 0.00 ? 33  ILE A CB   5  
ATOM 7163  C CG1  . ILE A 1 33  ? 4.292   2.955   0.020   1.00 0.00 ? 33  ILE A CG1  5  
ATOM 7164  C CG2  . ILE A 1 33  ? 4.757   0.861   -1.263  1.00 0.00 ? 33  ILE A CG2  5  
ATOM 7165  C CD1  . ILE A 1 33  ? 5.059   4.276   0.077   1.00 0.00 ? 33  ILE A CD1  5  
ATOM 7166  H H    . ILE A 1 33  ? 3.307   0.870   1.144   1.00 0.00 ? 33  ILE A H    5  
ATOM 7167  H HA   . ILE A 1 33  ? 6.026   0.152   0.952   1.00 0.00 ? 33  ILE A HA   5  
ATOM 7168  H HB   . ILE A 1 33  ? 6.234   2.209   -0.488  1.00 0.00 ? 33  ILE A HB   5  
ATOM 7169  H HG12 . ILE A 1 33  ? 3.592   2.976   -0.804  1.00 0.00 ? 33  ILE A HG12 5  
ATOM 7170  H HG13 . ILE A 1 33  ? 3.756   2.810   0.947   1.00 0.00 ? 33  ILE A HG13 5  
ATOM 7171  H HG21 . ILE A 1 33  ? 4.281   1.436   -2.045  1.00 0.00 ? 33  ILE A HG21 5  
ATOM 7172  H HG22 . ILE A 1 33  ? 4.038   0.182   -0.828  1.00 0.00 ? 33  ILE A HG22 5  
ATOM 7173  H HG23 . ILE A 1 33  ? 5.578   0.298   -1.679  1.00 0.00 ? 33  ILE A HG23 5  
ATOM 7174  H HD11 . ILE A 1 33  ? 4.615   4.920   0.821   1.00 0.00 ? 33  ILE A HD11 5  
ATOM 7175  H HD12 . ILE A 1 33  ? 5.016   4.759   -0.888  1.00 0.00 ? 33  ILE A HD12 5  
ATOM 7176  H HD13 . ILE A 1 33  ? 6.090   4.083   0.337   1.00 0.00 ? 33  ILE A HD13 5  
ATOM 7177  N N    . THR A 1 34  ? 5.520   2.780   2.836   1.00 0.00 ? 34  THR A N    5  
ATOM 7178  C CA   . THR A 1 34  ? 6.211   3.695   3.794   1.00 0.00 ? 34  THR A CA   5  
ATOM 7179  C C    . THR A 1 34  ? 7.040   2.888   4.794   1.00 0.00 ? 34  THR A C    5  
ATOM 7180  O O    . THR A 1 34  ? 8.075   3.330   5.253   1.00 0.00 ? 34  THR A O    5  
ATOM 7181  C CB   . THR A 1 34  ? 5.168   4.519   4.554   1.00 0.00 ? 34  THR A CB   5  
ATOM 7182  O OG1  . THR A 1 34  ? 4.096   3.675   4.948   1.00 0.00 ? 34  THR A OG1  5  
ATOM 7183  C CG2  . THR A 1 34  ? 4.640   5.633   3.653   1.00 0.00 ? 34  THR A CG2  5  
ATOM 7184  H H    . THR A 1 34  ? 4.548   2.818   2.733   1.00 0.00 ? 34  THR A H    5  
ATOM 7185  H HA   . THR A 1 34  ? 6.861   4.362   3.246   1.00 0.00 ? 34  THR A HA   5  
ATOM 7186  H HB   . THR A 1 34  ? 5.623   4.955   5.430   1.00 0.00 ? 34  THR A HB   5  
ATOM 7187  H HG1  . THR A 1 34  ? 3.968   3.779   5.894   1.00 0.00 ? 34  THR A HG1  5  
ATOM 7188  H HG21 . THR A 1 34  ? 4.520   5.256   2.649   1.00 0.00 ? 34  THR A HG21 5  
ATOM 7189  H HG22 . THR A 1 34  ? 5.340   6.453   3.648   1.00 0.00 ? 34  THR A HG22 5  
ATOM 7190  H HG23 . THR A 1 34  ? 3.686   5.976   4.024   1.00 0.00 ? 34  THR A HG23 5  
ATOM 7191  N N    . LYS A 1 35  ? 6.600   1.712   5.141   1.00 0.00 ? 35  LYS A N    5  
ATOM 7192  C CA   . LYS A 1 35  ? 7.370   0.889   6.117   1.00 0.00 ? 35  LYS A CA   5  
ATOM 7193  C C    . LYS A 1 35  ? 8.702   0.455   5.497   1.00 0.00 ? 35  LYS A C    5  
ATOM 7194  O O    . LYS A 1 35  ? 9.723   0.429   6.155   1.00 0.00 ? 35  LYS A O    5  
ATOM 7195  C CB   . LYS A 1 35  ? 6.558   -0.352  6.490   1.00 0.00 ? 35  LYS A CB   5  
ATOM 7196  C CG   . LYS A 1 35  ? 6.611   -0.560  8.005   1.00 0.00 ? 35  LYS A CG   5  
ATOM 7197  C CD   . LYS A 1 35  ? 8.047   -0.876  8.429   1.00 0.00 ? 35  LYS A CD   5  
ATOM 7198  C CE   . LYS A 1 35  ? 8.429   -2.273  7.937   1.00 0.00 ? 35  LYS A CE   5  
ATOM 7199  N NZ   . LYS A 1 35  ? 7.608   -3.292  8.649   1.00 0.00 ? 35  LYS A NZ   5  
ATOM 7200  H H    . LYS A 1 35  ? 5.763   1.373   4.766   1.00 0.00 ? 35  LYS A H    5  
ATOM 7201  H HA   . LYS A 1 35  ? 7.562   1.471   7.005   1.00 0.00 ? 35  LYS A HA   5  
ATOM 7202  H HB2  . LYS A 1 35  ? 5.533   -0.217  6.178   1.00 0.00 ? 35  LYS A HB2  5  
ATOM 7203  H HB3  . LYS A 1 35  ? 6.975   -1.216  5.995   1.00 0.00 ? 35  LYS A HB3  5  
ATOM 7204  H HG2  . LYS A 1 35  ? 6.276   0.337   8.503   1.00 0.00 ? 35  LYS A HG2  5  
ATOM 7205  H HG3  . LYS A 1 35  ? 5.969   -1.384  8.277   1.00 0.00 ? 35  LYS A HG3  5  
ATOM 7206  H HD2  . LYS A 1 35  ? 8.718   -0.145  8.000   1.00 0.00 ? 35  LYS A HD2  5  
ATOM 7207  H HD3  . LYS A 1 35  ? 8.119   -0.843  9.506   1.00 0.00 ? 35  LYS A HD3  5  
ATOM 7208  H HE2  . LYS A 1 35  ? 8.247   -2.342  6.875   1.00 0.00 ? 35  LYS A HE2  5  
ATOM 7209  H HE3  . LYS A 1 35  ? 9.475   -2.451  8.134   1.00 0.00 ? 35  LYS A HE3  5  
ATOM 7210  H HZ1  . LYS A 1 35  ? 8.030   -4.232  8.516   1.00 0.00 ? 35  LYS A HZ1  5  
ATOM 7211  H HZ2  . LYS A 1 35  ? 6.640   -3.287  8.266   1.00 0.00 ? 35  LYS A HZ2  5  
ATOM 7212  H HZ3  . LYS A 1 35  ? 7.580   -3.068  9.665   1.00 0.00 ? 35  LYS A HZ3  5  
ATOM 7213  N N    . HIS A 1 36  ? 8.700   0.103   4.239   1.00 0.00 ? 36  HIS A N    5  
ATOM 7214  C CA   . HIS A 1 36  ? 9.967   -0.339  3.587   1.00 0.00 ? 36  HIS A CA   5  
ATOM 7215  C C    . HIS A 1 36  ? 10.616  0.837   2.855   1.00 0.00 ? 36  HIS A C    5  
ATOM 7216  O O    . HIS A 1 36  ? 11.673  0.708   2.270   1.00 0.00 ? 36  HIS A O    5  
ATOM 7217  C CB   . HIS A 1 36  ? 9.661   -1.455  2.586   1.00 0.00 ? 36  HIS A CB   5  
ATOM 7218  C CG   . HIS A 1 36  ? 8.861   -2.534  3.264   1.00 0.00 ? 36  HIS A CG   5  
ATOM 7219  N ND1  . HIS A 1 36  ? 9.459   -3.636  3.854   1.00 0.00 ? 36  HIS A ND1  5  
ATOM 7220  C CD2  . HIS A 1 36  ? 7.511   -2.694  3.452   1.00 0.00 ? 36  HIS A CD2  5  
ATOM 7221  C CE1  . HIS A 1 36  ? 8.479   -4.404  4.365   1.00 0.00 ? 36  HIS A CE1  5  
ATOM 7222  N NE2  . HIS A 1 36  ? 7.271   -3.877  4.147   1.00 0.00 ? 36  HIS A NE2  5  
ATOM 7223  H H    . HIS A 1 36  ? 7.866   0.123   3.726   1.00 0.00 ? 36  HIS A H    5  
ATOM 7224  H HA   . HIS A 1 36  ? 10.647  -0.711  4.340   1.00 0.00 ? 36  HIS A HA   5  
ATOM 7225  H HB2  . HIS A 1 36  ? 9.094   -1.051  1.760   1.00 0.00 ? 36  HIS A HB2  5  
ATOM 7226  H HB3  . HIS A 1 36  ? 10.586  -1.873  2.218   1.00 0.00 ? 36  HIS A HB3  5  
ATOM 7227  H HD1  . HIS A 1 36  ? 10.420  -3.823  3.892   1.00 0.00 ? 36  HIS A HD1  5  
ATOM 7228  H HD2  . HIS A 1 36  ? 6.749   -2.008  3.112   1.00 0.00 ? 36  HIS A HD2  5  
ATOM 7229  H HE1  . HIS A 1 36  ? 8.648   -5.335  4.886   1.00 0.00 ? 36  HIS A HE1  5  
ATOM 7230  N N    . TYR A 1 37  ? 9.996   1.984   2.880   1.00 0.00 ? 37  TYR A N    5  
ATOM 7231  C CA   . TYR A 1 37  ? 10.581  3.162   2.187   1.00 0.00 ? 37  TYR A CA   5  
ATOM 7232  C C    . TYR A 1 37  ? 10.611  4.347   3.166   1.00 0.00 ? 37  TYR A C    5  
ATOM 7233  O O    . TYR A 1 37  ? 9.576   4.877   3.516   1.00 0.00 ? 37  TYR A O    5  
ATOM 7234  C CB   . TYR A 1 37  ? 9.712   3.511   0.973   1.00 0.00 ? 37  TYR A CB   5  
ATOM 7235  C CG   . TYR A 1 37  ? 10.316  2.919   -0.275  1.00 0.00 ? 37  TYR A CG   5  
ATOM 7236  C CD1  . TYR A 1 37  ? 10.615  1.551   -0.326  1.00 0.00 ? 37  TYR A CD1  5  
ATOM 7237  C CD2  . TYR A 1 37  ? 10.568  3.731   -1.386  1.00 0.00 ? 37  TYR A CD2  5  
ATOM 7238  C CE1  . TYR A 1 37  ? 11.167  0.998   -1.485  1.00 0.00 ? 37  TYR A CE1  5  
ATOM 7239  C CE2  . TYR A 1 37  ? 11.122  3.178   -2.545  1.00 0.00 ? 37  TYR A CE2  5  
ATOM 7240  C CZ   . TYR A 1 37  ? 11.422  1.811   -2.595  1.00 0.00 ? 37  TYR A CZ   5  
ATOM 7241  O OH   . TYR A 1 37  ? 11.970  1.267   -3.738  1.00 0.00 ? 37  TYR A OH   5  
ATOM 7242  H H    . TYR A 1 37  ? 9.145   2.072   3.357   1.00 0.00 ? 37  TYR A H    5  
ATOM 7243  H HA   . TYR A 1 37  ? 11.581  2.927   1.858   1.00 0.00 ? 37  TYR A HA   5  
ATOM 7244  H HB2  . TYR A 1 37  ? 8.722   3.104   1.110   1.00 0.00 ? 37  TYR A HB2  5  
ATOM 7245  H HB3  . TYR A 1 37  ? 9.651   4.585   0.869   1.00 0.00 ? 37  TYR A HB3  5  
ATOM 7246  H HD1  . TYR A 1 37  ? 10.419  0.924   0.531   1.00 0.00 ? 37  TYR A HD1  5  
ATOM 7247  H HD2  . TYR A 1 37  ? 10.336  4.786   -1.347  1.00 0.00 ? 37  TYR A HD2  5  
ATOM 7248  H HE1  . TYR A 1 37  ? 11.396  -0.058  -1.522  1.00 0.00 ? 37  TYR A HE1  5  
ATOM 7249  H HE2  . TYR A 1 37  ? 11.315  3.805   -3.403  1.00 0.00 ? 37  TYR A HE2  5  
ATOM 7250  H HH   . TYR A 1 37  ? 12.490  1.948   -4.170  1.00 0.00 ? 37  TYR A HH   5  
ATOM 7251  N N    . PRO A 1 38  ? 11.797  4.717   3.590   1.00 0.00 ? 38  PRO A N    5  
ATOM 7252  C CA   . PRO A 1 38  ? 11.985  5.828   4.546   1.00 0.00 ? 38  PRO A CA   5  
ATOM 7253  C C    . PRO A 1 38  ? 11.805  7.178   3.851   1.00 0.00 ? 38  PRO A C    5  
ATOM 7254  O O    . PRO A 1 38  ? 11.735  8.211   4.489   1.00 0.00 ? 38  PRO A O    5  
ATOM 7255  C CB   . PRO A 1 38  ? 13.425  5.646   5.033   1.00 0.00 ? 38  PRO A CB   5  
ATOM 7256  C CG   . PRO A 1 38  ? 14.150  4.816   3.948   1.00 0.00 ? 38  PRO A CG   5  
ATOM 7257  C CD   . PRO A 1 38  ? 13.055  4.076   3.158   1.00 0.00 ? 38  PRO A CD   5  
ATOM 7258  H HA   . PRO A 1 38  ? 11.302  5.734   5.375   1.00 0.00 ? 38  PRO A HA   5  
ATOM 7259  H HB2  . PRO A 1 38  ? 13.901  6.611   5.147   1.00 0.00 ? 38  PRO A HB2  5  
ATOM 7260  H HB3  . PRO A 1 38  ? 13.437  5.111   5.969   1.00 0.00 ? 38  PRO A HB3  5  
ATOM 7261  H HG2  . PRO A 1 38  ? 14.707  5.473   3.293   1.00 0.00 ? 38  PRO A HG2  5  
ATOM 7262  H HG3  . PRO A 1 38  ? 14.814  4.101   4.409   1.00 0.00 ? 38  PRO A HG3  5  
ATOM 7263  H HD2  . PRO A 1 38  ? 13.205  4.209   2.094   1.00 0.00 ? 38  PRO A HD2  5  
ATOM 7264  H HD3  . PRO A 1 38  ? 13.047  3.028   3.412   1.00 0.00 ? 38  PRO A HD3  5  
ATOM 7265  N N    . TYR A 1 39  ? 11.732  7.182   2.551   1.00 0.00 ? 39  TYR A N    5  
ATOM 7266  C CA   . TYR A 1 39  ? 11.554  8.469   1.823   1.00 0.00 ? 39  TYR A CA   5  
ATOM 7267  C C    . TYR A 1 39  ? 10.061  8.752   1.643   1.00 0.00 ? 39  TYR A C    5  
ATOM 7268  O O    . TYR A 1 39  ? 9.642   9.889   1.551   1.00 0.00 ? 39  TYR A O    5  
ATOM 7269  C CB   . TYR A 1 39  ? 12.225  8.377   0.452   1.00 0.00 ? 39  TYR A CB   5  
ATOM 7270  C CG   . TYR A 1 39  ? 12.009  9.669   -0.302  1.00 0.00 ? 39  TYR A CG   5  
ATOM 7271  C CD1  . TYR A 1 39  ? 10.744  9.976   -0.818  1.00 0.00 ? 39  TYR A CD1  5  
ATOM 7272  C CD2  . TYR A 1 39  ? 13.075  10.559  -0.485  1.00 0.00 ? 39  TYR A CD2  5  
ATOM 7273  C CE1  . TYR A 1 39  ? 10.544  11.173  -1.515  1.00 0.00 ? 39  TYR A CE1  5  
ATOM 7274  C CE2  . TYR A 1 39  ? 12.875  11.756  -1.183  1.00 0.00 ? 39  TYR A CE2  5  
ATOM 7275  C CZ   . TYR A 1 39  ? 11.610  12.063  -1.698  1.00 0.00 ? 39  TYR A CZ   5  
ATOM 7276  O OH   . TYR A 1 39  ? 11.412  13.243  -2.385  1.00 0.00 ? 39  TYR A OH   5  
ATOM 7277  H H    . TYR A 1 39  ? 11.792  6.340   2.054   1.00 0.00 ? 39  TYR A H    5  
ATOM 7278  H HA   . TYR A 1 39  ? 12.005  9.269   2.392   1.00 0.00 ? 39  TYR A HA   5  
ATOM 7279  H HB2  . TYR A 1 39  ? 13.285  8.207   0.581   1.00 0.00 ? 39  TYR A HB2  5  
ATOM 7280  H HB3  . TYR A 1 39  ? 11.795  7.560   -0.105  1.00 0.00 ? 39  TYR A HB3  5  
ATOM 7281  H HD1  . TYR A 1 39  ? 9.922   9.290   -0.676  1.00 0.00 ? 39  TYR A HD1  5  
ATOM 7282  H HD2  . TYR A 1 39  ? 14.052  10.322  -0.088  1.00 0.00 ? 39  TYR A HD2  5  
ATOM 7283  H HE1  . TYR A 1 39  ? 9.569   11.410  -1.912  1.00 0.00 ? 39  TYR A HE1  5  
ATOM 7284  H HE2  . TYR A 1 39  ? 13.697  12.443  -1.324  1.00 0.00 ? 39  TYR A HE2  5  
ATOM 7285  H HH   . TYR A 1 39  ? 10.692  13.717  -1.961  1.00 0.00 ? 39  TYR A HH   5  
ATOM 7286  N N    . TYR A 1 40  ? 9.253   7.728   1.587   1.00 0.00 ? 40  TYR A N    5  
ATOM 7287  C CA   . TYR A 1 40  ? 7.790   7.943   1.407   1.00 0.00 ? 40  TYR A CA   5  
ATOM 7288  C C    . TYR A 1 40  ? 7.106   8.059   2.774   1.00 0.00 ? 40  TYR A C    5  
ATOM 7289  O O    . TYR A 1 40  ? 5.919   8.303   2.861   1.00 0.00 ? 40  TYR A O    5  
ATOM 7290  C CB   . TYR A 1 40  ? 7.191   6.757   0.642   1.00 0.00 ? 40  TYR A CB   5  
ATOM 7291  C CG   . TYR A 1 40  ? 6.897   7.158   -0.784  1.00 0.00 ? 40  TYR A CG   5  
ATOM 7292  C CD1  . TYR A 1 40  ? 6.365   8.422   -1.062  1.00 0.00 ? 40  TYR A CD1  5  
ATOM 7293  C CD2  . TYR A 1 40  ? 7.154   6.261   -1.830  1.00 0.00 ? 40  TYR A CD2  5  
ATOM 7294  C CE1  . TYR A 1 40  ? 6.090   8.792   -2.385  1.00 0.00 ? 40  TYR A CE1  5  
ATOM 7295  C CE2  . TYR A 1 40  ? 6.878   6.632   -3.154  1.00 0.00 ? 40  TYR A CE2  5  
ATOM 7296  C CZ   . TYR A 1 40  ? 6.346   7.897   -3.430  1.00 0.00 ? 40  TYR A CZ   5  
ATOM 7297  O OH   . TYR A 1 40  ? 6.073   8.262   -4.732  1.00 0.00 ? 40  TYR A OH   5  
ATOM 7298  H H    . TYR A 1 40  ? 9.608   6.818   1.660   1.00 0.00 ? 40  TYR A H    5  
ATOM 7299  H HA   . TYR A 1 40  ? 7.629   8.850   0.847   1.00 0.00 ? 40  TYR A HA   5  
ATOM 7300  H HB2  . TYR A 1 40  ? 7.894   5.936   0.646   1.00 0.00 ? 40  TYR A HB2  5  
ATOM 7301  H HB3  . TYR A 1 40  ? 6.275   6.445   1.123   1.00 0.00 ? 40  TYR A HB3  5  
ATOM 7302  H HD1  . TYR A 1 40  ? 6.166   9.111   -0.255  1.00 0.00 ? 40  TYR A HD1  5  
ATOM 7303  H HD2  . TYR A 1 40  ? 7.565   5.285   -1.615  1.00 0.00 ? 40  TYR A HD2  5  
ATOM 7304  H HE1  . TYR A 1 40  ? 5.679   9.769   -2.598  1.00 0.00 ? 40  TYR A HE1  5  
ATOM 7305  H HE2  . TYR A 1 40  ? 7.073   5.942   -3.961  1.00 0.00 ? 40  TYR A HE2  5  
ATOM 7306  H HH   . TYR A 1 40  ? 6.405   7.572   -5.310  1.00 0.00 ? 40  TYR A HH   5  
ATOM 7307  N N    . ARG A 1 41  ? 7.838   7.880   3.841   1.00 0.00 ? 41  ARG A N    5  
ATOM 7308  C CA   . ARG A 1 41  ? 7.213   7.970   5.193   1.00 0.00 ? 41  ARG A CA   5  
ATOM 7309  C C    . ARG A 1 41  ? 7.171   9.428   5.659   1.00 0.00 ? 41  ARG A C    5  
ATOM 7310  O O    . ARG A 1 41  ? 6.931   9.711   6.816   1.00 0.00 ? 41  ARG A O    5  
ATOM 7311  C CB   . ARG A 1 41  ? 8.026   7.139   6.189   1.00 0.00 ? 41  ARG A CB   5  
ATOM 7312  C CG   . ARG A 1 41  ? 9.418   7.753   6.354   1.00 0.00 ? 41  ARG A CG   5  
ATOM 7313  C CD   . ARG A 1 41  ? 10.113  7.122   7.563   1.00 0.00 ? 41  ARG A CD   5  
ATOM 7314  N NE   . ARG A 1 41  ? 9.455   7.591   8.815   1.00 0.00 ? 41  ARG A NE   5  
ATOM 7315  C CZ   . ARG A 1 41  ? 9.302   6.771   9.819   1.00 0.00 ? 41  ARG A CZ   5  
ATOM 7316  N NH1  . ARG A 1 41  ? 10.027  5.688   9.891   1.00 0.00 ? 41  ARG A NH1  5  
ATOM 7317  N NH2  . ARG A 1 41  ? 8.427   7.034   10.749  1.00 0.00 ? 41  ARG A NH2  5  
ATOM 7318  H H    . ARG A 1 41  ? 8.792   7.678   3.754   1.00 0.00 ? 41  ARG A H    5  
ATOM 7319  H HA   . ARG A 1 41  ? 6.206   7.583   5.147   1.00 0.00 ? 41  ARG A HA   5  
ATOM 7320  H HB2  . ARG A 1 41  ? 7.520   7.127   7.144   1.00 0.00 ? 41  ARG A HB2  5  
ATOM 7321  H HB3  . ARG A 1 41  ? 8.121   6.129   5.819   1.00 0.00 ? 41  ARG A HB3  5  
ATOM 7322  H HG2  . ARG A 1 41  ? 10.000  7.563   5.465   1.00 0.00 ? 41  ARG A HG2  5  
ATOM 7323  H HG3  . ARG A 1 41  ? 9.328   8.817   6.507   1.00 0.00 ? 41  ARG A HG3  5  
ATOM 7324  H HD2  . ARG A 1 41  ? 10.040  6.047   7.500   1.00 0.00 ? 41  ARG A HD2  5  
ATOM 7325  H HD3  . ARG A 1 41  ? 11.152  7.413   7.572   1.00 0.00 ? 41  ARG A HD3  5  
ATOM 7326  H HE   . ARG A 1 41  ? 9.138   8.516   8.886   1.00 0.00 ? 41  ARG A HE   5  
ATOM 7327  H HH11 . ARG A 1 41  ? 10.698  5.486   9.178   1.00 0.00 ? 41  ARG A HH11 5  
ATOM 7328  H HH12 . ARG A 1 41  ? 9.910   5.058   10.661  1.00 0.00 ? 41  ARG A HH12 5  
ATOM 7329  H HH21 . ARG A 1 41  ? 7.872   7.865   10.692  1.00 0.00 ? 41  ARG A HH21 5  
ATOM 7330  H HH22 . ARG A 1 41  ? 8.309   6.406   11.518  1.00 0.00 ? 41  ARG A HH22 5  
ATOM 7331  N N    . THR A 1 42  ? 7.398   10.358  4.774   1.00 0.00 ? 42  THR A N    5  
ATOM 7332  C CA   . THR A 1 42  ? 7.361   11.791  5.182   1.00 0.00 ? 42  THR A CA   5  
ATOM 7333  C C    . THR A 1 42  ? 7.674   12.677  3.976   1.00 0.00 ? 42  THR A C    5  
ATOM 7334  O O    . THR A 1 42  ? 8.501   13.564  4.045   1.00 0.00 ? 42  THR A O    5  
ATOM 7335  C CB   . THR A 1 42  ? 8.398   12.034  6.282   1.00 0.00 ? 42  THR A CB   5  
ATOM 7336  O OG1  . THR A 1 42  ? 8.598   13.432  6.438   1.00 0.00 ? 42  THR A OG1  5  
ATOM 7337  C CG2  . THR A 1 42  ? 9.718   11.368  5.899   1.00 0.00 ? 42  THR A CG2  5  
ATOM 7338  H H    . THR A 1 42  ? 7.588   10.116  3.842   1.00 0.00 ? 42  THR A H    5  
ATOM 7339  H HA   . THR A 1 42  ? 6.378   12.030  5.558   1.00 0.00 ? 42  THR A HA   5  
ATOM 7340  H HB   . THR A 1 42  ? 8.043   11.615  7.210   1.00 0.00 ? 42  THR A HB   5  
ATOM 7341  H HG1  . THR A 1 42  ? 7.750   13.867  6.331   1.00 0.00 ? 42  THR A HG1  5  
ATOM 7342  H HG21 . THR A 1 42  ? 10.466  12.126  5.719   1.00 0.00 ? 42  THR A HG21 5  
ATOM 7343  H HG22 . THR A 1 42  ? 9.580   10.780  5.004   1.00 0.00 ? 42  THR A HG22 5  
ATOM 7344  H HG23 . THR A 1 42  ? 10.043  10.725  6.704   1.00 0.00 ? 42  THR A HG23 5  
ATOM 7345  N N    . ALA A 1 43  ? 7.018   12.449  2.871   1.00 0.00 ? 43  ALA A N    5  
ATOM 7346  C CA   . ALA A 1 43  ? 7.280   13.282  1.666   1.00 0.00 ? 43  ALA A CA   5  
ATOM 7347  C C    . ALA A 1 43  ? 6.364   12.838  0.524   1.00 0.00 ? 43  ALA A C    5  
ATOM 7348  O O    . ALA A 1 43  ? 6.816   12.363  -0.499  1.00 0.00 ? 43  ALA A O    5  
ATOM 7349  C CB   . ALA A 1 43  ? 8.739   13.113  1.242   1.00 0.00 ? 43  ALA A CB   5  
ATOM 7350  H H    . ALA A 1 43  ? 6.353   11.729  2.835   1.00 0.00 ? 43  ALA A H    5  
ATOM 7351  H HA   . ALA A 1 43  ? 7.091   14.319  1.897   1.00 0.00 ? 43  ALA A HA   5  
ATOM 7352  H HB1  . ALA A 1 43  ? 8.977   12.061  1.186   1.00 0.00 ? 43  ALA A HB1  5  
ATOM 7353  H HB2  . ALA A 1 43  ? 9.382   13.589  1.967   1.00 0.00 ? 43  ALA A HB2  5  
ATOM 7354  H HB3  . ALA A 1 43  ? 8.888   13.568  0.275   1.00 0.00 ? 43  ALA A HB3  5  
ATOM 7355  N N    . ASP A 1 44  ? 5.077   12.995  0.686   1.00 0.00 ? 44  ASP A N    5  
ATOM 7356  C CA   . ASP A 1 44  ? 4.139   12.586  -0.397  1.00 0.00 ? 44  ASP A CA   5  
ATOM 7357  C C    . ASP A 1 44  ? 4.241   13.585  -1.553  1.00 0.00 ? 44  ASP A C    5  
ATOM 7358  O O    . ASP A 1 44  ? 3.705   14.674  -1.491  1.00 0.00 ? 44  ASP A O    5  
ATOM 7359  C CB   . ASP A 1 44  ? 2.707   12.574  0.142   1.00 0.00 ? 44  ASP A CB   5  
ATOM 7360  C CG   . ASP A 1 44  ? 2.357   13.956  0.695   1.00 0.00 ? 44  ASP A CG   5  
ATOM 7361  O OD1  . ASP A 1 44  ? 2.826   14.277  1.774   1.00 0.00 ? 44  ASP A OD1  5  
ATOM 7362  O OD2  . ASP A 1 44  ? 1.624   14.670  0.030   1.00 0.00 ? 44  ASP A OD2  5  
ATOM 7363  H H    . ASP A 1 44  ? 4.730   13.383  1.515   1.00 0.00 ? 44  ASP A H    5  
ATOM 7364  H HA   . ASP A 1 44  ? 4.400   11.597  -0.746  1.00 0.00 ? 44  ASP A HA   5  
ATOM 7365  H HB2  . ASP A 1 44  ? 2.023   12.321  -0.657  1.00 0.00 ? 44  ASP A HB2  5  
ATOM 7366  H HB3  . ASP A 1 44  ? 2.625   11.841  0.931   1.00 0.00 ? 44  ASP A HB3  5  
ATOM 7367  N N    . LYS A 1 45  ? 4.930   13.232  -2.605  1.00 0.00 ? 45  LYS A N    5  
ATOM 7368  C CA   . LYS A 1 45  ? 5.066   14.170  -3.755  1.00 0.00 ? 45  LYS A CA   5  
ATOM 7369  C C    . LYS A 1 45  ? 3.729   14.279  -4.492  1.00 0.00 ? 45  LYS A C    5  
ATOM 7370  O O    . LYS A 1 45  ? 3.045   15.279  -4.410  1.00 0.00 ? 45  LYS A O    5  
ATOM 7371  C CB   . LYS A 1 45  ? 6.139   13.649  -4.711  1.00 0.00 ? 45  LYS A CB   5  
ATOM 7372  C CG   . LYS A 1 45  ? 7.426   14.454  -4.519  1.00 0.00 ? 45  LYS A CG   5  
ATOM 7373  C CD   . LYS A 1 45  ? 7.405   15.678  -5.437  1.00 0.00 ? 45  LYS A CD   5  
ATOM 7374  C CE   . LYS A 1 45  ? 8.488   16.665  -4.996  1.00 0.00 ? 45  LYS A CE   5  
ATOM 7375  N NZ   . LYS A 1 45  ? 8.192   17.143  -3.616  1.00 0.00 ? 45  LYS A NZ   5  
ATOM 7376  H H    . LYS A 1 45  ? 5.361   12.353  -2.639  1.00 0.00 ? 45  LYS A H    5  
ATOM 7377  H HA   . LYS A 1 45  ? 5.354   15.145  -3.390  1.00 0.00 ? 45  LYS A HA   5  
ATOM 7378  H HB2  . LYS A 1 45  ? 6.332   12.606  -4.504  1.00 0.00 ? 45  LYS A HB2  5  
ATOM 7379  H HB3  . LYS A 1 45  ? 5.798   13.757  -5.730  1.00 0.00 ? 45  LYS A HB3  5  
ATOM 7380  H HG2  . LYS A 1 45  ? 7.498   14.775  -3.490  1.00 0.00 ? 45  LYS A HG2  5  
ATOM 7381  H HG3  . LYS A 1 45  ? 8.277   13.836  -4.765  1.00 0.00 ? 45  LYS A HG3  5  
ATOM 7382  H HD2  . LYS A 1 45  ? 7.593   15.366  -6.454  1.00 0.00 ? 45  LYS A HD2  5  
ATOM 7383  H HD3  . LYS A 1 45  ? 6.440   16.156  -5.378  1.00 0.00 ? 45  LYS A HD3  5  
ATOM 7384  H HE2  . LYS A 1 45  ? 9.449   16.174  -5.008  1.00 0.00 ? 45  LYS A HE2  5  
ATOM 7385  H HE3  . LYS A 1 45  ? 8.505   17.506  -5.673  1.00 0.00 ? 45  LYS A HE3  5  
ATOM 7386  H HZ1  . LYS A 1 45  ? 8.519   18.124  -3.511  1.00 0.00 ? 45  LYS A HZ1  5  
ATOM 7387  H HZ2  . LYS A 1 45  ? 8.683   16.537  -2.927  1.00 0.00 ? 45  LYS A HZ2  5  
ATOM 7388  H HZ3  . LYS A 1 45  ? 7.167   17.103  -3.447  1.00 0.00 ? 45  LYS A HZ3  5  
ATOM 7389  N N    . GLY A 1 46  ? 3.350   13.258  -5.213  1.00 0.00 ? 46  GLY A N    5  
ATOM 7390  C CA   . GLY A 1 46  ? 2.057   13.305  -5.954  1.00 0.00 ? 46  GLY A CA   5  
ATOM 7391  C C    . GLY A 1 46  ? 1.613   11.878  -6.280  1.00 0.00 ? 46  GLY A C    5  
ATOM 7392  O O    . GLY A 1 46  ? 1.146   11.593  -7.366  1.00 0.00 ? 46  GLY A O    5  
ATOM 7393  H H    . GLY A 1 46  ? 3.915   12.458  -5.265  1.00 0.00 ? 46  GLY A H    5  
ATOM 7394  H HA2  . GLY A 1 46  ? 1.306   13.784  -5.340  1.00 0.00 ? 46  GLY A HA2  5  
ATOM 7395  H HA3  . GLY A 1 46  ? 2.187   13.862  -6.871  1.00 0.00 ? 46  GLY A HA3  5  
ATOM 7396  N N    . TRP A 1 47  ? 1.759   10.980  -5.347  1.00 0.00 ? 47  TRP A N    5  
ATOM 7397  C CA   . TRP A 1 47  ? 1.352   9.570   -5.592  1.00 0.00 ? 47  TRP A CA   5  
ATOM 7398  C C    . TRP A 1 47  ? 0.214   9.196   -4.646  1.00 0.00 ? 47  TRP A C    5  
ATOM 7399  O O    . TRP A 1 47  ? -0.409  8.162   -4.785  1.00 0.00 ? 47  TRP A O    5  
ATOM 7400  C CB   . TRP A 1 47  ? 2.541   8.645   -5.340  1.00 0.00 ? 47  TRP A CB   5  
ATOM 7401  C CG   . TRP A 1 47  ? 2.862   8.609   -3.878  1.00 0.00 ? 47  TRP A CG   5  
ATOM 7402  C CD1  . TRP A 1 47  ? 3.328   9.655   -3.155  1.00 0.00 ? 47  TRP A CD1  5  
ATOM 7403  C CD2  . TRP A 1 47  ? 2.765   7.486   -2.952  1.00 0.00 ? 47  TRP A CD2  5  
ATOM 7404  N NE1  . TRP A 1 47  ? 3.533   9.246   -1.853  1.00 0.00 ? 47  TRP A NE1  5  
ATOM 7405  C CE2  . TRP A 1 47  ? 3.205   7.920   -1.678  1.00 0.00 ? 47  TRP A CE2  5  
ATOM 7406  C CE3  . TRP A 1 47  ? 2.348   6.147   -3.088  1.00 0.00 ? 47  TRP A CE3  5  
ATOM 7407  C CZ2  . TRP A 1 47  ? 3.237   7.063   -0.583  1.00 0.00 ? 47  TRP A CZ2  5  
ATOM 7408  C CZ3  . TRP A 1 47  ? 2.380   5.281   -1.982  1.00 0.00 ? 47  TRP A CZ3  5  
ATOM 7409  C CH2  . TRP A 1 47  ? 2.826   5.740   -0.736  1.00 0.00 ? 47  TRP A CH2  5  
ATOM 7410  H H    . TRP A 1 47  ? 2.136   11.234  -4.482  1.00 0.00 ? 47  TRP A H    5  
ATOM 7411  H HA   . TRP A 1 47  ? 1.022   9.461   -6.614  1.00 0.00 ? 47  TRP A HA   5  
ATOM 7412  H HB2  . TRP A 1 47  ? 2.300   7.649   -5.679  1.00 0.00 ? 47  TRP A HB2  5  
ATOM 7413  H HB3  . TRP A 1 47  ? 3.400   9.011   -5.883  1.00 0.00 ? 47  TRP A HB3  5  
ATOM 7414  H HD1  . TRP A 1 47  ? 3.511   10.647  -3.531  1.00 0.00 ? 47  TRP A HD1  5  
ATOM 7415  H HE1  . TRP A 1 47  ? 3.872   9.813   -1.130  1.00 0.00 ? 47  TRP A HE1  5  
ATOM 7416  H HE3  . TRP A 1 47  ? 1.993   5.784   -4.043  1.00 0.00 ? 47  TRP A HE3  5  
ATOM 7417  H HZ2  . TRP A 1 47  ? 3.581   7.418   0.376   1.00 0.00 ? 47  TRP A HZ2  5  
ATOM 7418  H HZ3  . TRP A 1 47  ? 2.061   4.256   -2.092  1.00 0.00 ? 47  TRP A HZ3  5  
ATOM 7419  H HH2  . TRP A 1 47  ? 2.857   5.068   0.104   1.00 0.00 ? 47  TRP A HH2  5  
ATOM 7420  N N    . GLN A 1 48  ? -0.067  10.031  -3.688  1.00 0.00 ? 48  GLN A N    5  
ATOM 7421  C CA   . GLN A 1 48  ? -1.167  9.722   -2.741  1.00 0.00 ? 48  GLN A CA   5  
ATOM 7422  C C    . GLN A 1 48  ? -2.451  9.505   -3.543  1.00 0.00 ? 48  GLN A C    5  
ATOM 7423  O O    . GLN A 1 48  ? -2.958  8.406   -3.639  1.00 0.00 ? 48  GLN A O    5  
ATOM 7424  C CB   . GLN A 1 48  ? -1.356  10.889  -1.768  1.00 0.00 ? 48  GLN A CB   5  
ATOM 7425  C CG   . GLN A 1 48  ? -0.014  11.263  -1.130  1.00 0.00 ? 48  GLN A CG   5  
ATOM 7426  C CD   . GLN A 1 48  ? 0.432   10.143  -0.190  1.00 0.00 ? 48  GLN A CD   5  
ATOM 7427  O OE1  . GLN A 1 48  ? 0.387   10.291  1.015   1.00 0.00 ? 48  GLN A OE1  5  
ATOM 7428  N NE2  . GLN A 1 48  ? 0.865   9.019   -0.694  1.00 0.00 ? 48  GLN A NE2  5  
ATOM 7429  H H    . GLN A 1 48  ? 0.443   10.861  -3.598  1.00 0.00 ? 48  GLN A H    5  
ATOM 7430  H HA   . GLN A 1 48  ? -0.929  8.824   -2.190  1.00 0.00 ? 48  GLN A HA   5  
ATOM 7431  H HB2  . GLN A 1 48  ? -1.752  11.739  -2.297  1.00 0.00 ? 48  GLN A HB2  5  
ATOM 7432  H HB3  . GLN A 1 48  ? -2.042  10.597  -0.994  1.00 0.00 ? 48  GLN A HB3  5  
ATOM 7433  H HG2  . GLN A 1 48  ? 0.729   11.407  -1.899  1.00 0.00 ? 48  GLN A HG2  5  
ATOM 7434  H HG3  . GLN A 1 48  ? -0.127  12.178  -0.565  1.00 0.00 ? 48  GLN A HG3  5  
ATOM 7435  H HE21 . GLN A 1 48  ? 0.900   8.900   -1.666  1.00 0.00 ? 48  GLN A HE21 5  
ATOM 7436  H HE22 . GLN A 1 48  ? 1.153   8.295   -0.100  1.00 0.00 ? 48  GLN A HE22 5  
ATOM 7437  N N    . ASN A 1 49  ? -2.971  10.543  -4.138  1.00 0.00 ? 49  ASN A N    5  
ATOM 7438  C CA   . ASN A 1 49  ? -4.211  10.393  -4.950  1.00 0.00 ? 49  ASN A CA   5  
ATOM 7439  C C    . ASN A 1 49  ? -3.875  9.647   -6.244  1.00 0.00 ? 49  ASN A C    5  
ATOM 7440  O O    . ASN A 1 49  ? -4.704  8.968   -6.816  1.00 0.00 ? 49  ASN A O    5  
ATOM 7441  C CB   . ASN A 1 49  ? -4.770  11.776  -5.290  1.00 0.00 ? 49  ASN A CB   5  
ATOM 7442  C CG   . ASN A 1 49  ? -6.096  11.989  -4.557  1.00 0.00 ? 49  ASN A CG   5  
ATOM 7443  O OD1  . ASN A 1 49  ? -6.179  11.798  -3.360  1.00 0.00 ? 49  ASN A OD1  5  
ATOM 7444  N ND2  . ASN A 1 49  ? -7.144  12.382  -5.229  1.00 0.00 ? 49  ASN A ND2  5  
ATOM 7445  H H    . ASN A 1 49  ? -2.540  11.419  -4.060  1.00 0.00 ? 49  ASN A H    5  
ATOM 7446  H HA   . ASN A 1 49  ? -4.946  9.833   -4.391  1.00 0.00 ? 49  ASN A HA   5  
ATOM 7447  H HB2  . ASN A 1 49  ? -4.064  12.535  -4.985  1.00 0.00 ? 49  ASN A HB2  5  
ATOM 7448  H HB3  . ASN A 1 49  ? -4.936  11.845  -6.354  1.00 0.00 ? 49  ASN A HB3  5  
ATOM 7449  H HD21 . ASN A 1 49  ? -7.077  12.536  -6.195  1.00 0.00 ? 49  ASN A HD21 5  
ATOM 7450  H HD22 . ASN A 1 49  ? -7.997  12.522  -4.768  1.00 0.00 ? 49  ASN A HD22 5  
ATOM 7451  N N    . SER A 1 50  ? -2.660  9.772   -6.711  1.00 0.00 ? 50  SER A N    5  
ATOM 7452  C CA   . SER A 1 50  ? -2.266  9.074   -7.969  1.00 0.00 ? 50  SER A CA   5  
ATOM 7453  C C    . SER A 1 50  ? -2.428  7.563   -7.791  1.00 0.00 ? 50  SER A C    5  
ATOM 7454  O O    . SER A 1 50  ? -2.619  6.837   -8.743  1.00 0.00 ? 50  SER A O    5  
ATOM 7455  C CB   . SER A 1 50  ? -0.807  9.395   -8.297  1.00 0.00 ? 50  SER A CB   5  
ATOM 7456  O OG   . SER A 1 50  ? -0.625  9.363   -9.707  1.00 0.00 ? 50  SER A OG   5  
ATOM 7457  H H    . SER A 1 50  ? -2.007  10.327  -6.235  1.00 0.00 ? 50  SER A H    5  
ATOM 7458  H HA   . SER A 1 50  ? -2.897  9.410   -8.778  1.00 0.00 ? 50  SER A HA   5  
ATOM 7459  H HB2  . SER A 1 50  ? -0.560  10.377  -7.929  1.00 0.00 ? 50  SER A HB2  5  
ATOM 7460  H HB3  . SER A 1 50  ? -0.164  8.664   -7.825  1.00 0.00 ? 50  SER A HB3  5  
ATOM 7461  H HG   . SER A 1 50  ? -0.703  10.262  -10.037 1.00 0.00 ? 50  SER A HG   5  
ATOM 7462  N N    . ILE A 1 51  ? -2.354  7.084   -6.580  1.00 0.00 ? 51  ILE A N    5  
ATOM 7463  C CA   . ILE A 1 51  ? -2.509  5.623   -6.339  1.00 0.00 ? 51  ILE A CA   5  
ATOM 7464  C C    . ILE A 1 51  ? -3.962  5.225   -6.623  1.00 0.00 ? 51  ILE A C    5  
ATOM 7465  O O    . ILE A 1 51  ? -4.233  4.416   -7.486  1.00 0.00 ? 51  ILE A O    5  
ATOM 7466  C CB   . ILE A 1 51  ? -2.113  5.322   -4.876  1.00 0.00 ? 51  ILE A CB   5  
ATOM 7467  C CG1  . ILE A 1 51  ? -0.723  4.680   -4.842  1.00 0.00 ? 51  ILE A CG1  5  
ATOM 7468  C CG2  . ILE A 1 51  ? -3.106  4.359   -4.214  1.00 0.00 ? 51  ILE A CG2  5  
ATOM 7469  C CD1  . ILE A 1 51  ? 0.188   5.319   -5.893  1.00 0.00 ? 51  ILE A CD1  5  
ATOM 7470  H H    . ILE A 1 51  ? -2.199  7.685   -5.825  1.00 0.00 ? 51  ILE A H    5  
ATOM 7471  H HA   . ILE A 1 51  ? -1.854  5.078   -7.007  1.00 0.00 ? 51  ILE A HA   5  
ATOM 7472  H HB   . ILE A 1 51  ? -2.090  6.246   -4.319  1.00 0.00 ? 51  ILE A HB   5  
ATOM 7473  H HG12 . ILE A 1 51  ? -0.295  4.813   -3.862  1.00 0.00 ? 51  ILE A HG12 5  
ATOM 7474  H HG13 . ILE A 1 51  ? -0.818  3.630   -5.044  1.00 0.00 ? 51  ILE A HG13 5  
ATOM 7475  H HG21 . ILE A 1 51  ? -4.068  4.837   -4.124  1.00 0.00 ? 51  ILE A HG21 5  
ATOM 7476  H HG22 . ILE A 1 51  ? -2.742  4.096   -3.233  1.00 0.00 ? 51  ILE A HG22 5  
ATOM 7477  H HG23 . ILE A 1 51  ? -3.199  3.467   -4.815  1.00 0.00 ? 51  ILE A HG23 5  
ATOM 7478  H HD11 . ILE A 1 51  ? -0.021  6.376   -5.957  1.00 0.00 ? 51  ILE A HD11 5  
ATOM 7479  H HD12 . ILE A 1 51  ? 0.007   4.857   -6.853  1.00 0.00 ? 51  ILE A HD12 5  
ATOM 7480  H HD13 . ILE A 1 51  ? 1.220   5.171   -5.612  1.00 0.00 ? 51  ILE A HD13 5  
ATOM 7481  N N    . ARG A 1 52  ? -4.895  5.789   -5.908  1.00 0.00 ? 52  ARG A N    5  
ATOM 7482  C CA   . ARG A 1 52  ? -6.325  5.444   -6.141  1.00 0.00 ? 52  ARG A CA   5  
ATOM 7483  C C    . ARG A 1 52  ? -6.644  5.595   -7.629  1.00 0.00 ? 52  ARG A C    5  
ATOM 7484  O O    . ARG A 1 52  ? -7.302  4.762   -8.222  1.00 0.00 ? 52  ARG A O    5  
ATOM 7485  C CB   . ARG A 1 52  ? -7.213  6.389   -5.330  1.00 0.00 ? 52  ARG A CB   5  
ATOM 7486  C CG   . ARG A 1 52  ? -8.683  6.029   -5.553  1.00 0.00 ? 52  ARG A CG   5  
ATOM 7487  C CD   . ARG A 1 52  ? -9.563  7.204   -5.127  1.00 0.00 ? 52  ARG A CD   5  
ATOM 7488  N NE   . ARG A 1 52  ? -10.630 7.420   -6.143  1.00 0.00 ? 52  ARG A NE   5  
ATOM 7489  C CZ   . ARG A 1 52  ? -10.871 8.622   -6.592  1.00 0.00 ? 52  ARG A CZ   5  
ATOM 7490  N NH1  . ARG A 1 52  ? -11.079 9.602   -5.755  1.00 0.00 ? 52  ARG A NH1  5  
ATOM 7491  N NH2  . ARG A 1 52  ? -10.905 8.843   -7.878  1.00 0.00 ? 52  ARG A NH2  5  
ATOM 7492  H H    . ARG A 1 52  ? -4.655  6.443   -5.218  1.00 0.00 ? 52  ARG A H    5  
ATOM 7493  H HA   . ARG A 1 52  ? -6.505  4.425   -5.834  1.00 0.00 ? 52  ARG A HA   5  
ATOM 7494  H HB2  . ARG A 1 52  ? -6.975  6.293   -4.280  1.00 0.00 ? 52  ARG A HB2  5  
ATOM 7495  H HB3  . ARG A 1 52  ? -7.042  7.407   -5.646  1.00 0.00 ? 52  ARG A HB3  5  
ATOM 7496  H HG2  . ARG A 1 52  ? -8.846  5.817   -6.601  1.00 0.00 ? 52  ARG A HG2  5  
ATOM 7497  H HG3  . ARG A 1 52  ? -8.935  5.160   -4.965  1.00 0.00 ? 52  ARG A HG3  5  
ATOM 7498  H HD2  . ARG A 1 52  ? -10.016 6.986   -4.171  1.00 0.00 ? 52  ARG A HD2  5  
ATOM 7499  H HD3  . ARG A 1 52  ? -8.959  8.095   -5.044  1.00 0.00 ? 52  ARG A HD3  5  
ATOM 7500  H HE   . ARG A 1 52  ? -11.152 6.660   -6.475  1.00 0.00 ? 52  ARG A HE   5  
ATOM 7501  H HH11 . ARG A 1 52  ? -11.054 9.432   -4.770  1.00 0.00 ? 52  ARG A HH11 5  
ATOM 7502  H HH12 . ARG A 1 52  ? -11.263 10.523  -6.100  1.00 0.00 ? 52  ARG A HH12 5  
ATOM 7503  H HH21 . ARG A 1 52  ? -10.747 8.092   -8.519  1.00 0.00 ? 52  ARG A HH21 5  
ATOM 7504  H HH22 . ARG A 1 52  ? -11.089 9.764   -8.222  1.00 0.00 ? 52  ARG A HH22 5  
ATOM 7505  N N    . HIS A 1 53  ? -6.179  6.649   -8.239  1.00 0.00 ? 53  HIS A N    5  
ATOM 7506  C CA   . HIS A 1 53  ? -6.449  6.855   -9.689  1.00 0.00 ? 53  HIS A CA   5  
ATOM 7507  C C    . HIS A 1 53  ? -5.689  5.806   -10.502 1.00 0.00 ? 53  HIS A C    5  
ATOM 7508  O O    . HIS A 1 53  ? -6.103  5.413   -11.575 1.00 0.00 ? 53  HIS A O    5  
ATOM 7509  C CB   . HIS A 1 53  ? -5.977  8.252   -10.094 1.00 0.00 ? 53  HIS A CB   5  
ATOM 7510  C CG   . HIS A 1 53  ? -6.403  8.537   -11.508 1.00 0.00 ? 53  HIS A CG   5  
ATOM 7511  N ND1  . HIS A 1 53  ? -5.497  8.894   -12.496 1.00 0.00 ? 53  HIS A ND1  5  
ATOM 7512  C CD2  . HIS A 1 53  ? -7.633  8.522   -12.116 1.00 0.00 ? 53  HIS A CD2  5  
ATOM 7513  C CE1  . HIS A 1 53  ? -6.189  9.077   -13.634 1.00 0.00 ? 53  HIS A CE1  5  
ATOM 7514  N NE2  . HIS A 1 53  ? -7.496  8.863   -13.459 1.00 0.00 ? 53  HIS A NE2  5  
ATOM 7515  H H    . HIS A 1 53  ? -5.648  7.307   -7.742  1.00 0.00 ? 53  HIS A H    5  
ATOM 7516  H HA   . HIS A 1 53  ? -7.509  6.762   -9.877  1.00 0.00 ? 53  HIS A HA   5  
ATOM 7517  H HB2  . HIS A 1 53  ? -6.412  8.985   -9.431  1.00 0.00 ? 53  HIS A HB2  5  
ATOM 7518  H HB3  . HIS A 1 53  ? -4.900  8.301   -10.026 1.00 0.00 ? 53  HIS A HB3  5  
ATOM 7519  H HD1  . HIS A 1 53  ? -4.528  8.994   -12.383 1.00 0.00 ? 53  HIS A HD1  5  
ATOM 7520  H HD2  . HIS A 1 53  ? -8.566  8.283   -11.627 1.00 0.00 ? 53  HIS A HD2  5  
ATOM 7521  H HE1  . HIS A 1 53  ? -5.743  9.362   -14.575 1.00 0.00 ? 53  HIS A HE1  5  
ATOM 7522  N N    . ASN A 1 54  ? -4.576  5.351   -9.997  1.00 0.00 ? 54  ASN A N    5  
ATOM 7523  C CA   . ASN A 1 54  ? -3.780  4.329   -10.732 1.00 0.00 ? 54  ASN A CA   5  
ATOM 7524  C C    . ASN A 1 54  ? -4.513  2.991   -10.704 1.00 0.00 ? 54  ASN A C    5  
ATOM 7525  O O    . ASN A 1 54  ? -4.387  2.186   -11.602 1.00 0.00 ? 54  ASN A O    5  
ATOM 7526  C CB   . ASN A 1 54  ? -2.410  4.169   -10.066 1.00 0.00 ? 54  ASN A CB   5  
ATOM 7527  C CG   . ASN A 1 54  ? -1.359  4.908   -10.897 1.00 0.00 ? 54  ASN A CG   5  
ATOM 7528  O OD1  . ASN A 1 54  ? -1.182  4.622   -12.064 1.00 0.00 ? 54  ASN A OD1  5  
ATOM 7529  N ND2  . ASN A 1 54  ? -0.650  5.851   -10.343 1.00 0.00 ? 54  ASN A ND2  5  
ATOM 7530  H H    . ASN A 1 54  ? -4.266  5.683   -9.132  1.00 0.00 ? 54  ASN A H    5  
ATOM 7531  H HA   . ASN A 1 54  ? -3.646  4.645   -11.755 1.00 0.00 ? 54  ASN A HA   5  
ATOM 7532  H HB2  . ASN A 1 54  ? -2.443  4.585   -9.069  1.00 0.00 ? 54  ASN A HB2  5  
ATOM 7533  H HB3  . ASN A 1 54  ? -2.154  3.119   -10.013 1.00 0.00 ? 54  ASN A HB3  5  
ATOM 7534  H HD21 . ASN A 1 54  ? -0.790  6.082   -9.399  1.00 0.00 ? 54  ASN A HD21 5  
ATOM 7535  H HD22 . ASN A 1 54  ? 0.024   6.331   -10.868 1.00 0.00 ? 54  ASN A HD22 5  
ATOM 7536  N N    . LEU A 1 55  ? -5.278  2.743   -9.680  1.00 0.00 ? 55  LEU A N    5  
ATOM 7537  C CA   . LEU A 1 55  ? -6.013  1.454   -9.604  1.00 0.00 ? 55  LEU A CA   5  
ATOM 7538  C C    . LEU A 1 55  ? -7.144  1.451   -10.636 1.00 0.00 ? 55  LEU A C    5  
ATOM 7539  O O    . LEU A 1 55  ? -7.780  0.444   -10.874 1.00 0.00 ? 55  LEU A O    5  
ATOM 7540  C CB   . LEU A 1 55  ? -6.600  1.288   -8.204  1.00 0.00 ? 55  LEU A CB   5  
ATOM 7541  C CG   . LEU A 1 55  ? -5.583  1.746   -7.159  1.00 0.00 ? 55  LEU A CG   5  
ATOM 7542  C CD1  . LEU A 1 55  ? -6.051  1.309   -5.772  1.00 0.00 ? 55  LEU A CD1  5  
ATOM 7543  C CD2  . LEU A 1 55  ? -4.223  1.116   -7.463  1.00 0.00 ? 55  LEU A CD2  5  
ATOM 7544  H H    . LEU A 1 55  ? -5.368  3.404   -8.959  1.00 0.00 ? 55  LEU A H    5  
ATOM 7545  H HA   . LEU A 1 55  ? -5.335  0.640   -9.811  1.00 0.00 ? 55  LEU A HA   5  
ATOM 7546  H HB2  . LEU A 1 55  ? -7.495  1.885   -8.118  1.00 0.00 ? 55  LEU A HB2  5  
ATOM 7547  H HB3  . LEU A 1 55  ? -6.839  0.250   -8.035  1.00 0.00 ? 55  LEU A HB3  5  
ATOM 7548  H HG   . LEU A 1 55  ? -5.498  2.821   -7.187  1.00 0.00 ? 55  LEU A HG   5  
ATOM 7549  H HD11 . LEU A 1 55  ? -6.283  0.255   -5.784  1.00 0.00 ? 55  LEU A HD11 5  
ATOM 7550  H HD12 . LEU A 1 55  ? -6.934  1.869   -5.498  1.00 0.00 ? 55  LEU A HD12 5  
ATOM 7551  H HD13 . LEU A 1 55  ? -5.268  1.499   -5.052  1.00 0.00 ? 55  LEU A HD13 5  
ATOM 7552  H HD21 . LEU A 1 55  ? -3.941  1.344   -8.481  1.00 0.00 ? 55  LEU A HD21 5  
ATOM 7553  H HD22 . LEU A 1 55  ? -4.286  0.046   -7.338  1.00 0.00 ? 55  LEU A HD22 5  
ATOM 7554  H HD23 . LEU A 1 55  ? -3.483  1.516   -6.788  1.00 0.00 ? 55  LEU A HD23 5  
ATOM 7555  N N    . SER A 1 56  ? -7.401  2.575   -11.249 1.00 0.00 ? 56  SER A N    5  
ATOM 7556  C CA   . SER A 1 56  ? -8.492  2.643   -12.261 1.00 0.00 ? 56  SER A CA   5  
ATOM 7557  C C    . SER A 1 56  ? -7.936  2.328   -13.653 1.00 0.00 ? 56  SER A C    5  
ATOM 7558  O O    . SER A 1 56  ? -8.494  1.539   -14.390 1.00 0.00 ? 56  SER A O    5  
ATOM 7559  C CB   . SER A 1 56  ? -9.092  4.049   -12.263 1.00 0.00 ? 56  SER A CB   5  
ATOM 7560  O OG   . SER A 1 56  ? -10.484 3.966   -11.990 1.00 0.00 ? 56  SER A OG   5  
ATOM 7561  H H    . SER A 1 56  ? -6.878  3.377   -11.040 1.00 0.00 ? 56  SER A H    5  
ATOM 7562  H HA   . SER A 1 56  ? -9.260  1.926   -12.011 1.00 0.00 ? 56  SER A HA   5  
ATOM 7563  H HB2  . SER A 1 56  ? -8.615  4.646   -11.502 1.00 0.00 ? 56  SER A HB2  5  
ATOM 7564  H HB3  . SER A 1 56  ? -8.930  4.506   -13.230 1.00 0.00 ? 56  SER A HB3  5  
ATOM 7565  H HG   . SER A 1 56  ? -10.796 3.112   -12.298 1.00 0.00 ? 56  SER A HG   5  
ATOM 7566  N N    . LEU A 1 57  ? -6.849  2.948   -14.025 1.00 0.00 ? 57  LEU A N    5  
ATOM 7567  C CA   . LEU A 1 57  ? -6.269  2.696   -15.375 1.00 0.00 ? 57  LEU A CA   5  
ATOM 7568  C C    . LEU A 1 57  ? -5.341  1.479   -15.333 1.00 0.00 ? 57  LEU A C    5  
ATOM 7569  O O    . LEU A 1 57  ? -4.971  0.939   -16.356 1.00 0.00 ? 57  LEU A O    5  
ATOM 7570  C CB   . LEU A 1 57  ? -5.472  3.922   -15.822 1.00 0.00 ? 57  LEU A CB   5  
ATOM 7571  C CG   . LEU A 1 57  ? -6.163  5.192   -15.325 1.00 0.00 ? 57  LEU A CG   5  
ATOM 7572  C CD1  . LEU A 1 57  ? -5.406  5.741   -14.116 1.00 0.00 ? 57  LEU A CD1  5  
ATOM 7573  C CD2  . LEU A 1 57  ? -6.168  6.239   -16.441 1.00 0.00 ? 57  LEU A CD2  5  
ATOM 7574  H H    . LEU A 1 57  ? -6.419  3.589   -13.420 1.00 0.00 ? 57  LEU A H    5  
ATOM 7575  H HA   . LEU A 1 57  ? -7.068  2.513   -16.079 1.00 0.00 ? 57  LEU A HA   5  
ATOM 7576  H HB2  . LEU A 1 57  ? -4.473  3.871   -15.412 1.00 0.00 ? 57  LEU A HB2  5  
ATOM 7577  H HB3  . LEU A 1 57  ? -5.417  3.943   -16.900 1.00 0.00 ? 57  LEU A HB3  5  
ATOM 7578  H HG   . LEU A 1 57  ? -7.179  4.961   -15.039 1.00 0.00 ? 57  LEU A HG   5  
ATOM 7579  H HD11 . LEU A 1 57  ? -4.990  4.922   -13.548 1.00 0.00 ? 57  LEU A HD11 5  
ATOM 7580  H HD12 . LEU A 1 57  ? -6.083  6.305   -13.492 1.00 0.00 ? 57  LEU A HD12 5  
ATOM 7581  H HD13 . LEU A 1 57  ? -4.608  6.386   -14.453 1.00 0.00 ? 57  LEU A HD13 5  
ATOM 7582  H HD21 . LEU A 1 57  ? -5.662  7.131   -16.099 1.00 0.00 ? 57  LEU A HD21 5  
ATOM 7583  H HD22 . LEU A 1 57  ? -7.187  6.482   -16.701 1.00 0.00 ? 57  LEU A HD22 5  
ATOM 7584  H HD23 . LEU A 1 57  ? -5.660  5.844   -17.308 1.00 0.00 ? 57  LEU A HD23 5  
ATOM 7585  N N    . ASN A 1 58  ? -4.958  1.040   -14.165 1.00 0.00 ? 58  ASN A N    5  
ATOM 7586  C CA   . ASN A 1 58  ? -4.053  -0.141  -14.087 1.00 0.00 ? 58  ASN A CA   5  
ATOM 7587  C C    . ASN A 1 58  ? -4.784  -1.373  -14.621 1.00 0.00 ? 58  ASN A C    5  
ATOM 7588  O O    . ASN A 1 58  ? -5.998  -1.431  -14.631 1.00 0.00 ? 58  ASN A O    5  
ATOM 7589  C CB   . ASN A 1 58  ? -3.627  -0.389  -12.638 1.00 0.00 ? 58  ASN A CB   5  
ATOM 7590  C CG   . ASN A 1 58  ? -2.412  0.479   -12.303 1.00 0.00 ? 58  ASN A CG   5  
ATOM 7591  O OD1  . ASN A 1 58  ? -1.522  0.051   -11.595 1.00 0.00 ? 58  ASN A OD1  5  
ATOM 7592  N ND2  . ASN A 1 58  ? -2.334  1.689   -12.786 1.00 0.00 ? 58  ASN A ND2  5  
ATOM 7593  H H    . ASN A 1 58  ? -5.264  1.484   -13.348 1.00 0.00 ? 58  ASN A H    5  
ATOM 7594  H HA   . ASN A 1 58  ? -3.176  0.042   -14.691 1.00 0.00 ? 58  ASN A HA   5  
ATOM 7595  H HB2  . ASN A 1 58  ? -4.440  -0.145  -11.969 1.00 0.00 ? 58  ASN A HB2  5  
ATOM 7596  H HB3  . ASN A 1 58  ? -3.365  -1.427  -12.520 1.00 0.00 ? 58  ASN A HB3  5  
ATOM 7597  H HD21 . ASN A 1 58  ? -3.051  2.034   -13.357 1.00 0.00 ? 58  ASN A HD21 5  
ATOM 7598  H HD22 . ASN A 1 58  ? -1.560  2.252   -12.576 1.00 0.00 ? 58  ASN A HD22 5  
ATOM 7599  N N    . ARG A 1 59  ? -4.055  -2.354  -15.076 1.00 0.00 ? 59  ARG A N    5  
ATOM 7600  C CA   . ARG A 1 59  ? -4.707  -3.576  -15.623 1.00 0.00 ? 59  ARG A CA   5  
ATOM 7601  C C    . ARG A 1 59  ? -4.911  -4.615  -14.517 1.00 0.00 ? 59  ARG A C    5  
ATOM 7602  O O    . ARG A 1 59  ? -5.783  -5.455  -14.604 1.00 0.00 ? 59  ARG A O    5  
ATOM 7603  C CB   . ARG A 1 59  ? -3.823  -4.173  -16.719 1.00 0.00 ? 59  ARG A CB   5  
ATOM 7604  C CG   . ARG A 1 59  ? -3.180  -3.041  -17.522 1.00 0.00 ? 59  ARG A CG   5  
ATOM 7605  C CD   . ARG A 1 59  ? -3.206  -3.394  -19.012 1.00 0.00 ? 59  ARG A CD   5  
ATOM 7606  N NE   . ARG A 1 59  ? -3.997  -2.370  -19.752 1.00 0.00 ? 59  ARG A NE   5  
ATOM 7607  C CZ   . ARG A 1 59  ? -5.110  -2.706  -20.344 1.00 0.00 ? 59  ARG A CZ   5  
ATOM 7608  N NH1  . ARG A 1 59  ? -5.089  -3.163  -21.566 1.00 0.00 ? 59  ARG A NH1  5  
ATOM 7609  N NH2  . ARG A 1 59  ? -6.247  -2.583  -19.714 1.00 0.00 ? 59  ARG A NH2  5  
ATOM 7610  H H    . ARG A 1 59  ? -3.077  -2.283  -15.067 1.00 0.00 ? 59  ARG A H    5  
ATOM 7611  H HA   . ARG A 1 59  ? -5.666  -3.311  -16.045 1.00 0.00 ? 59  ARG A HA   5  
ATOM 7612  H HB2  . ARG A 1 59  ? -3.052  -4.781  -16.269 1.00 0.00 ? 59  ARG A HB2  5  
ATOM 7613  H HB3  . ARG A 1 59  ? -4.425  -4.781  -17.377 1.00 0.00 ? 59  ARG A HB3  5  
ATOM 7614  H HG2  . ARG A 1 59  ? -3.732  -2.127  -17.358 1.00 0.00 ? 59  ARG A HG2  5  
ATOM 7615  H HG3  . ARG A 1 59  ? -2.158  -2.908  -17.202 1.00 0.00 ? 59  ARG A HG3  5  
ATOM 7616  H HD2  . ARG A 1 59  ? -2.197  -3.415  -19.394 1.00 0.00 ? 59  ARG A HD2  5  
ATOM 7617  H HD3  . ARG A 1 59  ? -3.662  -4.365  -19.143 1.00 0.00 ? 59  ARG A HD3  5  
ATOM 7618  H HE   . ARG A 1 59  ? -3.681  -1.444  -19.795 1.00 0.00 ? 59  ARG A HE   5  
ATOM 7619  H HH11 . ARG A 1 59  ? -4.218  -3.256  -22.050 1.00 0.00 ? 59  ARG A HH11 5  
ATOM 7620  H HH12 . ARG A 1 59  ? -5.943  -3.420  -22.020 1.00 0.00 ? 59  ARG A HH12 5  
ATOM 7621  H HH21 . ARG A 1 59  ? -6.264  -2.232  -18.778 1.00 0.00 ? 59  ARG A HH21 5  
ATOM 7622  H HH22 . ARG A 1 59  ? -7.100  -2.841  -20.167 1.00 0.00 ? 59  ARG A HH22 5  
ATOM 7623  N N    . TYR A 1 60  ? -4.116  -4.578  -13.481 1.00 0.00 ? 60  TYR A N    5  
ATOM 7624  C CA   . TYR A 1 60  ? -4.288  -5.586  -12.396 1.00 0.00 ? 60  TYR A CA   5  
ATOM 7625  C C    . TYR A 1 60  ? -4.695  -4.903  -11.093 1.00 0.00 ? 60  TYR A C    5  
ATOM 7626  O O    . TYR A 1 60  ? -4.181  -5.211  -10.037 1.00 0.00 ? 60  TYR A O    5  
ATOM 7627  C CB   . TYR A 1 60  ? -2.990  -6.364  -12.162 1.00 0.00 ? 60  TYR A CB   5  
ATOM 7628  C CG   . TYR A 1 60  ? -1.785  -5.558  -12.597 1.00 0.00 ? 60  TYR A CG   5  
ATOM 7629  C CD1  . TYR A 1 60  ? -1.602  -5.250  -13.948 1.00 0.00 ? 60  TYR A CD1  5  
ATOM 7630  C CD2  . TYR A 1 60  ? -0.839  -5.142  -11.653 1.00 0.00 ? 60  TYR A CD2  5  
ATOM 7631  C CE1  . TYR A 1 60  ? -0.480  -4.521  -14.358 1.00 0.00 ? 60  TYR A CE1  5  
ATOM 7632  C CE2  . TYR A 1 60  ? 0.287   -4.416  -12.063 1.00 0.00 ? 60  TYR A CE2  5  
ATOM 7633  C CZ   . TYR A 1 60  ? 0.466   -4.105  -13.416 1.00 0.00 ? 60  TYR A CZ   5  
ATOM 7634  O OH   . TYR A 1 60  ? 1.575   -3.389  -13.819 1.00 0.00 ? 60  TYR A OH   5  
ATOM 7635  H H    . TYR A 1 60  ? -3.413  -3.898  -13.422 1.00 0.00 ? 60  TYR A H    5  
ATOM 7636  H HA   . TYR A 1 60  ? -5.065  -6.279  -12.683 1.00 0.00 ? 60  TYR A HA   5  
ATOM 7637  H HB2  . TYR A 1 60  ? -2.904  -6.591  -11.111 1.00 0.00 ? 60  TYR A HB2  5  
ATOM 7638  H HB3  . TYR A 1 60  ? -3.022  -7.287  -12.723 1.00 0.00 ? 60  TYR A HB3  5  
ATOM 7639  H HD1  . TYR A 1 60  ? -2.332  -5.566  -14.671 1.00 0.00 ? 60  TYR A HD1  5  
ATOM 7640  H HD2  . TYR A 1 60  ? -0.979  -5.374  -10.602 1.00 0.00 ? 60  TYR A HD2  5  
ATOM 7641  H HE1  . TYR A 1 60  ? -0.343  -4.282  -15.403 1.00 0.00 ? 60  TYR A HE1  5  
ATOM 7642  H HE2  . TYR A 1 60  ? 1.017   -4.096  -11.334 1.00 0.00 ? 60  TYR A HE2  5  
ATOM 7643  H HH   . TYR A 1 60  ? 2.268   -3.527  -13.170 1.00 0.00 ? 60  TYR A HH   5  
ATOM 7644  N N    . PHE A 1 61  ? -5.623  -3.993  -11.148 1.00 0.00 ? 61  PHE A N    5  
ATOM 7645  C CA   . PHE A 1 61  ? -6.063  -3.317  -9.900  1.00 0.00 ? 61  PHE A CA   5  
ATOM 7646  C C    . PHE A 1 61  ? -7.546  -2.995  -10.002 1.00 0.00 ? 61  PHE A C    5  
ATOM 7647  O O    . PHE A 1 61  ? -7.951  -2.011  -10.590 1.00 0.00 ? 61  PHE A O    5  
ATOM 7648  C CB   . PHE A 1 61  ? -5.246  -2.048  -9.683  1.00 0.00 ? 61  PHE A CB   5  
ATOM 7649  C CG   . PHE A 1 61  ? -3.879  -2.453  -9.200  1.00 0.00 ? 61  PHE A CG   5  
ATOM 7650  C CD1  . PHE A 1 61  ? -3.638  -2.614  -7.833  1.00 0.00 ? 61  PHE A CD1  5  
ATOM 7651  C CD2  . PHE A 1 61  ? -2.853  -2.685  -10.120 1.00 0.00 ? 61  PHE A CD2  5  
ATOM 7652  C CE1  . PHE A 1 61  ? -2.376  -3.008  -7.393  1.00 0.00 ? 61  PHE A CE1  5  
ATOM 7653  C CE2  . PHE A 1 61  ? -1.594  -3.077  -9.678  1.00 0.00 ? 61  PHE A CE2  5  
ATOM 7654  C CZ   . PHE A 1 61  ? -1.354  -3.240  -8.314  1.00 0.00 ? 61  PHE A CZ   5  
ATOM 7655  H H    . PHE A 1 61  ? -6.039  -3.766  -12.005 1.00 0.00 ? 61  PHE A H    5  
ATOM 7656  H HA   . PHE A 1 61  ? -5.907  -3.984  -9.064  1.00 0.00 ? 61  PHE A HA   5  
ATOM 7657  H HB2  . PHE A 1 61  ? -5.161  -1.506  -10.614 1.00 0.00 ? 61  PHE A HB2  5  
ATOM 7658  H HB3  . PHE A 1 61  ? -5.724  -1.430  -8.939  1.00 0.00 ? 61  PHE A HB3  5  
ATOM 7659  H HD1  . PHE A 1 61  ? -4.423  -2.442  -7.114  1.00 0.00 ? 61  PHE A HD1  5  
ATOM 7660  H HD2  . PHE A 1 61  ? -3.034  -2.572  -11.170 1.00 0.00 ? 61  PHE A HD2  5  
ATOM 7661  H HE1  . PHE A 1 61  ? -2.195  -3.138  -6.342  1.00 0.00 ? 61  PHE A HE1  5  
ATOM 7662  H HE2  . PHE A 1 61  ? -0.808  -3.247  -10.392 1.00 0.00 ? 61  PHE A HE2  5  
ATOM 7663  H HZ   . PHE A 1 61  ? -0.380  -3.542  -7.969  1.00 0.00 ? 61  PHE A HZ   5  
ATOM 7664  N N    . ILE A 1 62  ? -8.356  -3.840  -9.440  1.00 0.00 ? 62  ILE A N    5  
ATOM 7665  C CA   . ILE A 1 62  ? -9.829  -3.627  -9.497  1.00 0.00 ? 62  ILE A CA   5  
ATOM 7666  C C    . ILE A 1 62  ? -10.341 -3.190  -8.125  1.00 0.00 ? 62  ILE A C    5  
ATOM 7667  O O    . ILE A 1 62  ? -9.686  -3.372  -7.121  1.00 0.00 ? 62  ILE A O    5  
ATOM 7668  C CB   . ILE A 1 62  ? -10.507 -4.938  -9.897  1.00 0.00 ? 62  ILE A CB   5  
ATOM 7669  C CG1  . ILE A 1 62  ? -10.282 -5.979  -8.798  1.00 0.00 ? 62  ILE A CG1  5  
ATOM 7670  C CG2  . ILE A 1 62  ? -9.906  -5.453  -11.206 1.00 0.00 ? 62  ILE A CG2  5  
ATOM 7671  C CD1  . ILE A 1 62  ? -10.877 -7.318  -9.235  1.00 0.00 ? 62  ILE A CD1  5  
ATOM 7672  H H    . ILE A 1 62  ? -7.987  -4.627  -8.983  1.00 0.00 ? 62  ILE A H    5  
ATOM 7673  H HA   . ILE A 1 62  ? -10.057 -2.866  -10.228 1.00 0.00 ? 62  ILE A HA   5  
ATOM 7674  H HB   . ILE A 1 62  ? -11.567 -4.772  -10.027 1.00 0.00 ? 62  ILE A HB   5  
ATOM 7675  H HG12 . ILE A 1 62  ? -9.222  -6.095  -8.624  1.00 0.00 ? 62  ILE A HG12 5  
ATOM 7676  H HG13 . ILE A 1 62  ? -10.765 -5.652  -7.889  1.00 0.00 ? 62  ILE A HG13 5  
ATOM 7677  H HG21 . ILE A 1 62  ? -9.648  -6.495  -11.099 1.00 0.00 ? 62  ILE A HG21 5  
ATOM 7678  H HG22 . ILE A 1 62  ? -9.018  -4.885  -11.442 1.00 0.00 ? 62  ILE A HG22 5  
ATOM 7679  H HG23 . ILE A 1 62  ? -10.627 -5.340  -12.002 1.00 0.00 ? 62  ILE A HG23 5  
ATOM 7680  H HD11 . ILE A 1 62  ? -10.338 -7.687  -10.095 1.00 0.00 ? 62  ILE A HD11 5  
ATOM 7681  H HD12 . ILE A 1 62  ? -11.917 -7.183  -9.494  1.00 0.00 ? 62  ILE A HD12 5  
ATOM 7682  H HD13 . ILE A 1 62  ? -10.796 -8.029  -8.428  1.00 0.00 ? 62  ILE A HD13 5  
ATOM 7683  N N    . LYS A 1 63  ? -11.513 -2.619  -8.073  1.00 0.00 ? 63  LYS A N    5  
ATOM 7684  C CA   . LYS A 1 63  ? -12.067 -2.177  -6.763  1.00 0.00 ? 63  LYS A CA   5  
ATOM 7685  C C    . LYS A 1 63  ? -13.425 -2.841  -6.538  1.00 0.00 ? 63  LYS A C    5  
ATOM 7686  O O    . LYS A 1 63  ? -14.229 -2.950  -7.442  1.00 0.00 ? 63  LYS A O    5  
ATOM 7687  C CB   . LYS A 1 63  ? -12.236 -0.656  -6.766  1.00 0.00 ? 63  LYS A CB   5  
ATOM 7688  C CG   . LYS A 1 63  ? -12.201 -0.137  -5.327  1.00 0.00 ? 63  LYS A CG   5  
ATOM 7689  C CD   . LYS A 1 63  ? -13.356 0.844   -5.111  1.00 0.00 ? 63  LYS A CD   5  
ATOM 7690  C CE   . LYS A 1 63  ? -12.795 2.222   -4.754  1.00 0.00 ? 63  LYS A CE   5  
ATOM 7691  N NZ   . LYS A 1 63  ? -13.077 3.175   -5.866  1.00 0.00 ? 63  LYS A NZ   5  
ATOM 7692  H H    . LYS A 1 63  ? -12.030 -2.485  -8.894  1.00 0.00 ? 63  LYS A H    5  
ATOM 7693  H HA   . LYS A 1 63  ? -11.390 -2.463  -5.971  1.00 0.00 ? 63  LYS A HA   5  
ATOM 7694  H HB2  . LYS A 1 63  ? -11.433 -0.206  -7.332  1.00 0.00 ? 63  LYS A HB2  5  
ATOM 7695  H HB3  . LYS A 1 63  ? -13.183 -0.399  -7.216  1.00 0.00 ? 63  LYS A HB3  5  
ATOM 7696  H HG2  . LYS A 1 63  ? -12.299 -0.967  -4.642  1.00 0.00 ? 63  LYS A HG2  5  
ATOM 7697  H HG3  . LYS A 1 63  ? -11.264 0.369   -5.149  1.00 0.00 ? 63  LYS A HG3  5  
ATOM 7698  H HD2  . LYS A 1 63  ? -13.941 0.915   -6.016  1.00 0.00 ? 63  LYS A HD2  5  
ATOM 7699  H HD3  . LYS A 1 63  ? -13.981 0.492   -4.304  1.00 0.00 ? 63  LYS A HD3  5  
ATOM 7700  H HE2  . LYS A 1 63  ? -13.264 2.578   -3.848  1.00 0.00 ? 63  LYS A HE2  5  
ATOM 7701  H HE3  . LYS A 1 63  ? -11.728 2.150   -4.604  1.00 0.00 ? 63  LYS A HE3  5  
ATOM 7702  H HZ1  . LYS A 1 63  ? -12.255 3.794   -6.009  1.00 0.00 ? 63  LYS A HZ1  5  
ATOM 7703  H HZ2  . LYS A 1 63  ? -13.909 3.751   -5.625  1.00 0.00 ? 63  LYS A HZ2  5  
ATOM 7704  H HZ3  . LYS A 1 63  ? -13.263 2.643   -6.739  1.00 0.00 ? 63  LYS A HZ3  5  
ATOM 7705  N N    . VAL A 1 64  ? -13.688 -3.290  -5.342  1.00 0.00 ? 64  VAL A N    5  
ATOM 7706  C CA   . VAL A 1 64  ? -14.996 -3.948  -5.070  1.00 0.00 ? 64  VAL A CA   5  
ATOM 7707  C C    . VAL A 1 64  ? -16.120 -2.906  -5.174  1.00 0.00 ? 64  VAL A C    5  
ATOM 7708  O O    . VAL A 1 64  ? -16.066 -1.881  -4.526  1.00 0.00 ? 64  VAL A O    5  
ATOM 7709  C CB   . VAL A 1 64  ? -14.980 -4.541  -3.662  1.00 0.00 ? 64  VAL A CB   5  
ATOM 7710  C CG1  . VAL A 1 64  ? -13.865 -5.583  -3.560  1.00 0.00 ? 64  VAL A CG1  5  
ATOM 7711  C CG2  . VAL A 1 64  ? -14.731 -3.428  -2.643  1.00 0.00 ? 64  VAL A CG2  5  
ATOM 7712  H H    . VAL A 1 64  ? -13.025 -3.196  -4.624  1.00 0.00 ? 64  VAL A H    5  
ATOM 7713  H HA   . VAL A 1 64  ? -15.154 -4.735  -5.790  1.00 0.00 ? 64  VAL A HA   5  
ATOM 7714  H HB   . VAL A 1 64  ? -15.931 -5.012  -3.459  1.00 0.00 ? 64  VAL A HB   5  
ATOM 7715  H HG11 . VAL A 1 64  ? -14.014 -6.184  -2.675  1.00 0.00 ? 64  VAL A HG11 5  
ATOM 7716  H HG12 . VAL A 1 64  ? -12.910 -5.083  -3.499  1.00 0.00 ? 64  VAL A HG12 5  
ATOM 7717  H HG13 . VAL A 1 64  ? -13.884 -6.218  -4.434  1.00 0.00 ? 64  VAL A HG13 5  
ATOM 7718  H HG21 . VAL A 1 64  ? -14.396 -2.539  -3.157  1.00 0.00 ? 64  VAL A HG21 5  
ATOM 7719  H HG22 . VAL A 1 64  ? -13.975 -3.745  -1.941  1.00 0.00 ? 64  VAL A HG22 5  
ATOM 7720  H HG23 . VAL A 1 64  ? -15.648 -3.214  -2.113  1.00 0.00 ? 64  VAL A HG23 5  
ATOM 7721  N N    . PRO A 1 65  ? -17.104 -3.196  -5.990  1.00 0.00 ? 65  PRO A N    5  
ATOM 7722  C CA   . PRO A 1 65  ? -18.251 -2.293  -6.198  1.00 0.00 ? 65  PRO A CA   5  
ATOM 7723  C C    . PRO A 1 65  ? -19.243 -2.422  -5.039  1.00 0.00 ? 65  PRO A C    5  
ATOM 7724  O O    . PRO A 1 65  ? -19.236 -1.638  -4.111  1.00 0.00 ? 65  PRO A O    5  
ATOM 7725  C CB   . PRO A 1 65  ? -18.873 -2.797  -7.503  1.00 0.00 ? 65  PRO A CB   5  
ATOM 7726  C CG   . PRO A 1 65  ? -18.420 -4.268  -7.662  1.00 0.00 ? 65  PRO A CG   5  
ATOM 7727  C CD   . PRO A 1 65  ? -17.170 -4.443  -6.780  1.00 0.00 ? 65  PRO A CD   5  
ATOM 7728  H HA   . PRO A 1 65  ? -17.923 -1.274  -6.312  1.00 0.00 ? 65  PRO A HA   5  
ATOM 7729  H HB2  . PRO A 1 65  ? -19.953 -2.740  -7.444  1.00 0.00 ? 65  PRO A HB2  5  
ATOM 7730  H HB3  . PRO A 1 65  ? -18.514 -2.213  -8.335  1.00 0.00 ? 65  PRO A HB3  5  
ATOM 7731  H HG2  . PRO A 1 65  ? -19.206 -4.934  -7.331  1.00 0.00 ? 65  PRO A HG2  5  
ATOM 7732  H HG3  . PRO A 1 65  ? -18.171 -4.470  -8.692  1.00 0.00 ? 65  PRO A HG3  5  
ATOM 7733  H HD2  . PRO A 1 65  ? -17.284 -5.300  -6.131  1.00 0.00 ? 65  PRO A HD2  5  
ATOM 7734  H HD3  . PRO A 1 65  ? -16.286 -4.543  -7.391  1.00 0.00 ? 65  PRO A HD3  5  
ATOM 7735  N N    . ARG A 1 66  ? -20.096 -3.408  -5.088  1.00 0.00 ? 66  ARG A N    5  
ATOM 7736  C CA   . ARG A 1 66  ? -21.088 -3.593  -3.993  1.00 0.00 ? 66  ARG A CA   5  
ATOM 7737  C C    . ARG A 1 66  ? -21.271 -5.086  -3.721  1.00 0.00 ? 66  ARG A C    5  
ATOM 7738  O O    . ARG A 1 66  ? -22.335 -5.532  -3.341  1.00 0.00 ? 66  ARG A O    5  
ATOM 7739  C CB   . ARG A 1 66  ? -22.426 -2.981  -4.414  1.00 0.00 ? 66  ARG A CB   5  
ATOM 7740  C CG   . ARG A 1 66  ? -22.571 -1.593  -3.789  1.00 0.00 ? 66  ARG A CG   5  
ATOM 7741  C CD   . ARG A 1 66  ? -23.447 -0.718  -4.688  1.00 0.00 ? 66  ARG A CD   5  
ATOM 7742  N NE   . ARG A 1 66  ? -22.710 -0.398  -5.942  1.00 0.00 ? 66  ARG A NE   5  
ATOM 7743  C CZ   . ARG A 1 66  ? -22.341 0.831   -6.187  1.00 0.00 ? 66  ARG A CZ   5  
ATOM 7744  N NH1  . ARG A 1 66  ? -21.277 1.319   -5.612  1.00 0.00 ? 66  ARG A NH1  5  
ATOM 7745  N NH2  . ARG A 1 66  ? -23.040 1.570   -7.005  1.00 0.00 ? 66  ARG A NH2  5  
ATOM 7746  H H    . ARG A 1 66  ? -20.083 -4.029  -5.847  1.00 0.00 ? 66  ARG A H    5  
ATOM 7747  H HA   . ARG A 1 66  ? -20.733 -3.102  -3.099  1.00 0.00 ? 66  ARG A HA   5  
ATOM 7748  H HB2  . ARG A 1 66  ? -22.461 -2.899  -5.490  1.00 0.00 ? 66  ARG A HB2  5  
ATOM 7749  H HB3  . ARG A 1 66  ? -23.233 -3.614  -4.075  1.00 0.00 ? 66  ARG A HB3  5  
ATOM 7750  H HG2  . ARG A 1 66  ? -23.029 -1.683  -2.815  1.00 0.00 ? 66  ARG A HG2  5  
ATOM 7751  H HG3  . ARG A 1 66  ? -21.596 -1.140  -3.689  1.00 0.00 ? 66  ARG A HG3  5  
ATOM 7752  H HD2  . ARG A 1 66  ? -24.356 -1.248  -4.931  1.00 0.00 ? 66  ARG A HD2  5  
ATOM 7753  H HD3  . ARG A 1 66  ? -23.692 0.197   -4.170  1.00 0.00 ? 66  ARG A HD3  5  
ATOM 7754  H HE   . ARG A 1 66  ? -22.502 -1.109  -6.584  1.00 0.00 ? 66  ARG A HE   5  
ATOM 7755  H HH11 . ARG A 1 66  ? -20.741 0.752   -4.984  1.00 0.00 ? 66  ARG A HH11 5  
ATOM 7756  H HH12 . ARG A 1 66  ? -20.995 2.260   -5.800  1.00 0.00 ? 66  ARG A HH12 5  
ATOM 7757  H HH21 . ARG A 1 66  ? -23.857 1.194   -7.442  1.00 0.00 ? 66  ARG A HH21 5  
ATOM 7758  H HH22 . ARG A 1 66  ? -22.761 2.511   -7.193  1.00 0.00 ? 66  ARG A HH22 5  
ATOM 7759  N N    . SER A 1 67  ? -20.240 -5.864  -3.914  1.00 0.00 ? 67  SER A N    5  
ATOM 7760  C CA   . SER A 1 67  ? -20.351 -7.330  -3.669  1.00 0.00 ? 67  SER A CA   5  
ATOM 7761  C C    . SER A 1 67  ? -20.053 -7.630  -2.199  1.00 0.00 ? 67  SER A C    5  
ATOM 7762  O O    . SER A 1 67  ? -19.406 -8.605  -1.873  1.00 0.00 ? 67  SER A O    5  
ATOM 7763  C CB   . SER A 1 67  ? -19.346 -8.070  -4.550  1.00 0.00 ? 67  SER A CB   5  
ATOM 7764  O OG   . SER A 1 67  ? -19.885 -9.333  -4.921  1.00 0.00 ? 67  SER A OG   5  
ATOM 7765  H H    . SER A 1 67  ? -19.391 -5.483  -4.222  1.00 0.00 ? 67  SER A H    5  
ATOM 7766  H HA   . SER A 1 67  ? -21.351 -7.661  -3.908  1.00 0.00 ? 67  SER A HA   5  
ATOM 7767  H HB2  . SER A 1 67  ? -19.151 -7.494  -5.439  1.00 0.00 ? 67  SER A HB2  5  
ATOM 7768  H HB3  . SER A 1 67  ? -18.422 -8.208  -4.004  1.00 0.00 ? 67  SER A HB3  5  
ATOM 7769  H HG   . SER A 1 67  ? -19.813 -9.418  -5.875  1.00 0.00 ? 67  SER A HG   5  
ATOM 7770  N N    . GLN A 1 68  ? -20.522 -6.800  -1.308  1.00 0.00 ? 68  GLN A N    5  
ATOM 7771  C CA   . GLN A 1 68  ? -20.269 -7.038  0.139   1.00 0.00 ? 68  GLN A CA   5  
ATOM 7772  C C    . GLN A 1 68  ? -21.593 -6.950  0.900   1.00 0.00 ? 68  GLN A C    5  
ATOM 7773  O O    . GLN A 1 68  ? -22.582 -6.465  0.388   1.00 0.00 ? 68  GLN A O    5  
ATOM 7774  C CB   . GLN A 1 68  ? -19.300 -5.977  0.669   1.00 0.00 ? 68  GLN A CB   5  
ATOM 7775  C CG   . GLN A 1 68  ? -18.238 -6.645  1.543   1.00 0.00 ? 68  GLN A CG   5  
ATOM 7776  C CD   . GLN A 1 68  ? -17.152 -7.255  0.652   1.00 0.00 ? 68  GLN A CD   5  
ATOM 7777  O OE1  . GLN A 1 68  ? -17.275 -7.264  -0.557  1.00 0.00 ? 68  GLN A OE1  5  
ATOM 7778  N NE2  . GLN A 1 68  ? -16.087 -7.768  1.202   1.00 0.00 ? 68  GLN A NE2  5  
ATOM 7779  H H    . GLN A 1 68  ? -21.044 -6.021  -1.593  1.00 0.00 ? 68  GLN A H    5  
ATOM 7780  H HA   . GLN A 1 68  ? -19.839 -8.020  0.273   1.00 0.00 ? 68  GLN A HA   5  
ATOM 7781  H HB2  . GLN A 1 68  ? -18.823 -5.478  -0.161  1.00 0.00 ? 68  GLN A HB2  5  
ATOM 7782  H HB3  . GLN A 1 68  ? -19.846 -5.254  1.258   1.00 0.00 ? 68  GLN A HB3  5  
ATOM 7783  H HG2  . GLN A 1 68  ? -17.796 -5.908  2.197   1.00 0.00 ? 68  GLN A HG2  5  
ATOM 7784  H HG3  . GLN A 1 68  ? -18.695 -7.425  2.134   1.00 0.00 ? 68  GLN A HG3  5  
ATOM 7785  H HE21 . GLN A 1 68  ? -15.986 -7.761  2.178   1.00 0.00 ? 68  GLN A HE21 5  
ATOM 7786  H HE22 . GLN A 1 68  ? -15.386 -8.162  0.641   1.00 0.00 ? 68  GLN A HE22 5  
ATOM 7787  N N    . GLU A 1 69  ? -21.622 -7.418  2.118   1.00 0.00 ? 69  GLU A N    5  
ATOM 7788  C CA   . GLU A 1 69  ? -22.885 -7.360  2.905   1.00 0.00 ? 69  GLU A CA   5  
ATOM 7789  C C    . GLU A 1 69  ? -22.640 -6.606  4.213   1.00 0.00 ? 69  GLU A C    5  
ATOM 7790  O O    . GLU A 1 69  ? -22.293 -7.188  5.221   1.00 0.00 ? 69  GLU A O    5  
ATOM 7791  C CB   . GLU A 1 69  ? -23.358 -8.782  3.215   1.00 0.00 ? 69  GLU A CB   5  
ATOM 7792  C CG   . GLU A 1 69  ? -22.298 -9.502  4.052   1.00 0.00 ? 69  GLU A CG   5  
ATOM 7793  C CD   . GLU A 1 69  ? -22.344 -11.001 3.755   1.00 0.00 ? 69  GLU A CD   5  
ATOM 7794  O OE1  . GLU A 1 69  ? -23.422 -11.498 3.478   1.00 0.00 ? 69  GLU A OE1  5  
ATOM 7795  O OE2  . GLU A 1 69  ? -21.298 -11.628 3.811   1.00 0.00 ? 69  GLU A OE2  5  
ATOM 7796  H H    . GLU A 1 69  ? -20.814 -7.807  2.514   1.00 0.00 ? 69  GLU A H    5  
ATOM 7797  H HA   . GLU A 1 69  ? -23.643 -6.847  2.330   1.00 0.00 ? 69  GLU A HA   5  
ATOM 7798  H HB2  . GLU A 1 69  ? -24.286 -8.739  3.768   1.00 0.00 ? 69  GLU A HB2  5  
ATOM 7799  H HB3  . GLU A 1 69  ? -23.511 -9.320  2.293   1.00 0.00 ? 69  GLU A HB3  5  
ATOM 7800  H HG2  . GLU A 1 69  ? -21.320 -9.114  3.804   1.00 0.00 ? 69  GLU A HG2  5  
ATOM 7801  H HG3  . GLU A 1 69  ? -22.495 -9.337  5.100   1.00 0.00 ? 69  GLU A HG3  5  
ATOM 7802  N N    . GLU A 1 70  ? -22.818 -5.314  4.203   1.00 0.00 ? 70  GLU A N    5  
ATOM 7803  C CA   . GLU A 1 70  ? -22.595 -4.521  5.446   1.00 0.00 ? 70  GLU A CA   5  
ATOM 7804  C C    . GLU A 1 70  ? -23.500 -3.284  5.430   1.00 0.00 ? 70  GLU A C    5  
ATOM 7805  O O    . GLU A 1 70  ? -23.840 -2.779  4.379   1.00 0.00 ? 70  GLU A O    5  
ATOM 7806  C CB   . GLU A 1 70  ? -21.129 -4.087  5.518   1.00 0.00 ? 70  GLU A CB   5  
ATOM 7807  C CG   . GLU A 1 70  ? -20.643 -3.690  4.122   1.00 0.00 ? 70  GLU A CG   5  
ATOM 7808  C CD   . GLU A 1 70  ? -19.373 -2.845  4.244   1.00 0.00 ? 70  GLU A CD   5  
ATOM 7809  O OE1  . GLU A 1 70  ? -18.313 -3.426  4.408   1.00 0.00 ? 70  GLU A OE1  5  
ATOM 7810  O OE2  . GLU A 1 70  ? -19.483 -1.633  4.173   1.00 0.00 ? 70  GLU A OE2  5  
ATOM 7811  H H    . GLU A 1 70  ? -23.098 -4.864  3.380   1.00 0.00 ? 70  GLU A H    5  
ATOM 7812  H HA   . GLU A 1 70  ? -22.832 -5.129  6.306   1.00 0.00 ? 70  GLU A HA   5  
ATOM 7813  H HB2  . GLU A 1 70  ? -21.035 -3.243  6.186   1.00 0.00 ? 70  GLU A HB2  5  
ATOM 7814  H HB3  . GLU A 1 70  ? -20.529 -4.906  5.885   1.00 0.00 ? 70  GLU A HB3  5  
ATOM 7815  H HG2  . GLU A 1 70  ? -20.430 -4.581  3.549   1.00 0.00 ? 70  GLU A HG2  5  
ATOM 7816  H HG3  . GLU A 1 70  ? -21.409 -3.115  3.624   1.00 0.00 ? 70  GLU A HG3  5  
ATOM 7817  N N    . PRO A 1 71  ? -23.867 -2.836  6.604   1.00 0.00 ? 71  PRO A N    5  
ATOM 7818  C CA   . PRO A 1 71  ? -24.739 -1.659  6.770   1.00 0.00 ? 71  PRO A CA   5  
ATOM 7819  C C    . PRO A 1 71  ? -23.943 -0.366  6.562   1.00 0.00 ? 71  PRO A C    5  
ATOM 7820  O O    . PRO A 1 71  ? -24.237 0.421   5.686   1.00 0.00 ? 71  PRO A O    5  
ATOM 7821  C CB   . PRO A 1 71  ? -25.226 -1.776  8.216   1.00 0.00 ? 71  PRO A CB   5  
ATOM 7822  C CG   . PRO A 1 71  ? -24.190 -2.655  8.956   1.00 0.00 ? 71  PRO A CG   5  
ATOM 7823  C CD   . PRO A 1 71  ? -23.445 -3.459  7.875   1.00 0.00 ? 71  PRO A CD   5  
ATOM 7824  H HA   . PRO A 1 71  ? -25.576 -1.706  6.093   1.00 0.00 ? 71  PRO A HA   5  
ATOM 7825  H HB2  . PRO A 1 71  ? -25.279 -0.794  8.669   1.00 0.00 ? 71  PRO A HB2  5  
ATOM 7826  H HB3  . PRO A 1 71  ? -26.193 -2.252  8.246   1.00 0.00 ? 71  PRO A HB3  5  
ATOM 7827  H HG2  . PRO A 1 71  ? -23.496 -2.028  9.500   1.00 0.00 ? 71  PRO A HG2  5  
ATOM 7828  H HG3  . PRO A 1 71  ? -24.690 -3.328  9.633   1.00 0.00 ? 71  PRO A HG3  5  
ATOM 7829  H HD2  . PRO A 1 71  ? -22.375 -3.370  8.007   1.00 0.00 ? 71  PRO A HD2  5  
ATOM 7830  H HD3  . PRO A 1 71  ? -23.745 -4.495  7.899   1.00 0.00 ? 71  PRO A HD3  5  
ATOM 7831  N N    . GLY A 1 72  ? -22.937 -0.142  7.363   1.00 0.00 ? 72  GLY A N    5  
ATOM 7832  C CA   . GLY A 1 72  ? -22.127 1.099   7.209   1.00 0.00 ? 72  GLY A CA   5  
ATOM 7833  C C    . GLY A 1 72  ? -21.443 1.089   5.840   1.00 0.00 ? 72  GLY A C    5  
ATOM 7834  O O    . GLY A 1 72  ? -21.561 0.147   5.083   1.00 0.00 ? 72  GLY A O    5  
ATOM 7835  H H    . GLY A 1 72  ? -22.715 -0.789  8.066   1.00 0.00 ? 72  GLY A H    5  
ATOM 7836  H HA2  . GLY A 1 72  ? -22.772 1.962   7.283   1.00 0.00 ? 72  GLY A HA2  5  
ATOM 7837  H HA3  . GLY A 1 72  ? -21.377 1.139   7.986   1.00 0.00 ? 72  GLY A HA3  5  
ATOM 7838  N N    . LYS A 1 73  ? -20.730 2.132   5.516   1.00 0.00 ? 73  LYS A N    5  
ATOM 7839  C CA   . LYS A 1 73  ? -20.040 2.179   4.196   1.00 0.00 ? 73  LYS A CA   5  
ATOM 7840  C C    . LYS A 1 73  ? -18.779 1.315   4.248   1.00 0.00 ? 73  LYS A C    5  
ATOM 7841  O O    . LYS A 1 73  ? -18.399 0.819   5.289   1.00 0.00 ? 73  LYS A O    5  
ATOM 7842  C CB   . LYS A 1 73  ? -19.655 3.624   3.874   1.00 0.00 ? 73  LYS A CB   5  
ATOM 7843  C CG   . LYS A 1 73  ? -20.783 4.286   3.083   1.00 0.00 ? 73  LYS A CG   5  
ATOM 7844  C CD   . LYS A 1 73  ? -20.197 5.346   2.151   1.00 0.00 ? 73  LYS A CD   5  
ATOM 7845  C CE   . LYS A 1 73  ? -21.295 5.886   1.235   1.00 0.00 ? 73  LYS A CE   5  
ATOM 7846  N NZ   . LYS A 1 73  ? -20.814 5.878   -0.175  1.00 0.00 ? 73  LYS A NZ   5  
ATOM 7847  H H    . LYS A 1 73  ? -20.646 2.883   6.139   1.00 0.00 ? 73  LYS A H    5  
ATOM 7848  H HA   . LYS A 1 73  ? -20.704 1.805   3.430   1.00 0.00 ? 73  LYS A HA   5  
ATOM 7849  H HB2  . LYS A 1 73  ? -19.492 4.167   4.794   1.00 0.00 ? 73  LYS A HB2  5  
ATOM 7850  H HB3  . LYS A 1 73  ? -18.751 3.633   3.285   1.00 0.00 ? 73  LYS A HB3  5  
ATOM 7851  H HG2  . LYS A 1 73  ? -21.300 3.538   2.500   1.00 0.00 ? 73  LYS A HG2  5  
ATOM 7852  H HG3  . LYS A 1 73  ? -21.476 4.754   3.766   1.00 0.00 ? 73  LYS A HG3  5  
ATOM 7853  H HD2  . LYS A 1 73  ? -19.786 6.155   2.739   1.00 0.00 ? 73  LYS A HD2  5  
ATOM 7854  H HD3  . LYS A 1 73  ? -19.415 4.906   1.551   1.00 0.00 ? 73  LYS A HD3  5  
ATOM 7855  H HE2  . LYS A 1 73  ? -22.173 5.262   1.320   1.00 0.00 ? 73  LYS A HE2  5  
ATOM 7856  H HE3  . LYS A 1 73  ? -21.543 6.897   1.525   1.00 0.00 ? 73  LYS A HE3  5  
ATOM 7857  H HZ1  . LYS A 1 73  ? -20.575 4.906   -0.455  1.00 0.00 ? 73  LYS A HZ1  5  
ATOM 7858  H HZ2  . LYS A 1 73  ? -19.969 6.481   -0.256  1.00 0.00 ? 73  LYS A HZ2  5  
ATOM 7859  H HZ3  . LYS A 1 73  ? -21.561 6.242   -0.800  1.00 0.00 ? 73  LYS A HZ3  5  
ATOM 7860  N N    . GLY A 1 74  ? -18.128 1.130   3.131   1.00 0.00 ? 74  GLY A N    5  
ATOM 7861  C CA   . GLY A 1 74  ? -16.893 0.295   3.122   1.00 0.00 ? 74  GLY A CA   5  
ATOM 7862  C C    . GLY A 1 74  ? -16.248 0.337   1.735   1.00 0.00 ? 74  GLY A C    5  
ATOM 7863  O O    . GLY A 1 74  ? -16.812 0.854   0.790   1.00 0.00 ? 74  GLY A O    5  
ATOM 7864  H H    . GLY A 1 74  ? -18.451 1.538   2.300   1.00 0.00 ? 74  GLY A H    5  
ATOM 7865  H HA2  . GLY A 1 74  ? -16.196 0.678   3.853   1.00 0.00 ? 74  GLY A HA2  5  
ATOM 7866  H HA3  . GLY A 1 74  ? -17.147 -0.725  3.368   1.00 0.00 ? 74  GLY A HA3  5  
ATOM 7867  N N    . SER A 1 75  ? -15.068 -0.206  1.607   1.00 0.00 ? 75  SER A N    5  
ATOM 7868  C CA   . SER A 1 75  ? -14.378 -0.205  0.286   1.00 0.00 ? 75  SER A CA   5  
ATOM 7869  C C    . SER A 1 75  ? -13.054 -0.962  0.414   1.00 0.00 ? 75  SER A C    5  
ATOM 7870  O O    . SER A 1 75  ? -12.417 -0.942  1.447   1.00 0.00 ? 75  SER A O    5  
ATOM 7871  C CB   . SER A 1 75  ? -14.102 1.236   -0.147  1.00 0.00 ? 75  SER A CB   5  
ATOM 7872  O OG   . SER A 1 75  ? -14.363 2.111   0.943   1.00 0.00 ? 75  SER A OG   5  
ATOM 7873  H H    . SER A 1 75  ? -14.634 -0.616  2.384   1.00 0.00 ? 75  SER A H    5  
ATOM 7874  H HA   . SER A 1 75  ? -15.004 -0.693  -0.448  1.00 0.00 ? 75  SER A HA   5  
ATOM 7875  H HB2  . SER A 1 75  ? -13.071 1.336   -0.440  1.00 0.00 ? 75  SER A HB2  5  
ATOM 7876  H HB3  . SER A 1 75  ? -14.738 1.491   -0.985  1.00 0.00 ? 75  SER A HB3  5  
ATOM 7877  H HG   . SER A 1 75  ? -15.299 2.325   0.934   1.00 0.00 ? 75  SER A HG   5  
ATOM 7878  N N    . PHE A 1 76  ? -12.632 -1.633  -0.625  1.00 0.00 ? 76  PHE A N    5  
ATOM 7879  C CA   . PHE A 1 76  ? -11.349 -2.388  -0.544  1.00 0.00 ? 76  PHE A CA   5  
ATOM 7880  C C    . PHE A 1 76  ? -10.691 -2.449  -1.925  1.00 0.00 ? 76  PHE A C    5  
ATOM 7881  O O    . PHE A 1 76  ? -11.224 -3.022  -2.856  1.00 0.00 ? 76  PHE A O    5  
ATOM 7882  C CB   . PHE A 1 76  ? -11.624 -3.810  -0.050  1.00 0.00 ? 76  PHE A CB   5  
ATOM 7883  C CG   . PHE A 1 76  ? -10.815 -4.077  1.196   1.00 0.00 ? 76  PHE A CG   5  
ATOM 7884  C CD1  . PHE A 1 76  ? -9.482  -3.655  1.269   1.00 0.00 ? 76  PHE A CD1  5  
ATOM 7885  C CD2  . PHE A 1 76  ? -11.398 -4.749  2.278   1.00 0.00 ? 76  PHE A CD2  5  
ATOM 7886  C CE1  . PHE A 1 76  ? -8.732  -3.903  2.424   1.00 0.00 ? 76  PHE A CE1  5  
ATOM 7887  C CE2  . PHE A 1 76  ? -10.647 -4.997  3.433   1.00 0.00 ? 76  PHE A CE2  5  
ATOM 7888  C CZ   . PHE A 1 76  ? -9.314  -4.575  3.507   1.00 0.00 ? 76  PHE A CZ   5  
ATOM 7889  H H    . PHE A 1 76  ? -13.158 -1.642  -1.452  1.00 0.00 ? 76  PHE A H    5  
ATOM 7890  H HA   . PHE A 1 76  ? -10.684 -1.892  0.147   1.00 0.00 ? 76  PHE A HA   5  
ATOM 7891  H HB2  . PHE A 1 76  ? -12.676 -3.917  0.173   1.00 0.00 ? 76  PHE A HB2  5  
ATOM 7892  H HB3  . PHE A 1 76  ? -11.346 -4.518  -0.817  1.00 0.00 ? 76  PHE A HB3  5  
ATOM 7893  H HD1  . PHE A 1 76  ? -9.033  -3.137  0.434   1.00 0.00 ? 76  PHE A HD1  5  
ATOM 7894  H HD2  . PHE A 1 76  ? -12.426 -5.074  2.222   1.00 0.00 ? 76  PHE A HD2  5  
ATOM 7895  H HE1  . PHE A 1 76  ? -7.703  -3.578  2.481   1.00 0.00 ? 76  PHE A HE1  5  
ATOM 7896  H HE2  . PHE A 1 76  ? -11.095 -5.515  4.268   1.00 0.00 ? 76  PHE A HE2  5  
ATOM 7897  H HZ   . PHE A 1 76  ? -8.734  -4.766  4.397   1.00 0.00 ? 76  PHE A HZ   5  
ATOM 7898  N N    . TRP A 1 77  ? -9.529  -1.869  -2.058  1.00 0.00 ? 77  TRP A N    5  
ATOM 7899  C CA   . TRP A 1 77  ? -8.818  -1.897  -3.367  1.00 0.00 ? 77  TRP A CA   5  
ATOM 7900  C C    . TRP A 1 77  ? -8.037  -3.207  -3.479  1.00 0.00 ? 77  TRP A C    5  
ATOM 7901  O O    . TRP A 1 77  ? -7.372  -3.612  -2.551  1.00 0.00 ? 77  TRP A O    5  
ATOM 7902  C CB   . TRP A 1 77  ? -7.841  -0.724  -3.435  1.00 0.00 ? 77  TRP A CB   5  
ATOM 7903  C CG   . TRP A 1 77  ? -8.428  0.368   -4.264  1.00 0.00 ? 77  TRP A CG   5  
ATOM 7904  C CD1  . TRP A 1 77  ? -8.751  1.600   -3.811  1.00 0.00 ? 77  TRP A CD1  5  
ATOM 7905  C CD2  . TRP A 1 77  ? -8.763  0.349   -5.679  1.00 0.00 ? 77  TRP A CD2  5  
ATOM 7906  N NE1  . TRP A 1 77  ? -9.261  2.341   -4.861  1.00 0.00 ? 77  TRP A NE1  5  
ATOM 7907  C CE2  . TRP A 1 77  ? -9.287  1.613   -6.034  1.00 0.00 ? 77  TRP A CE2  5  
ATOM 7908  C CE3  . TRP A 1 77  ? -8.661  -0.633  -6.679  1.00 0.00 ? 77  TRP A CE3  5  
ATOM 7909  C CZ2  . TRP A 1 77  ? -9.696  1.893   -7.337  1.00 0.00 ? 77  TRP A CZ2  5  
ATOM 7910  C CZ3  . TRP A 1 77  ? -9.069  -0.355  -7.991  1.00 0.00 ? 77  TRP A CZ3  5  
ATOM 7911  C CH2  . TRP A 1 77  ? -9.585  0.906   -8.319  1.00 0.00 ? 77  TRP A CH2  5  
ATOM 7912  H H    . TRP A 1 77  ? -9.117  -1.420  -1.290  1.00 0.00 ? 77  TRP A H    5  
ATOM 7913  H HA   . TRP A 1 77  ? -9.532  -1.826  -4.174  1.00 0.00 ? 77  TRP A HA   5  
ATOM 7914  H HB2  . TRP A 1 77  ? -7.652  -0.356  -2.438  1.00 0.00 ? 77  TRP A HB2  5  
ATOM 7915  H HB3  . TRP A 1 77  ? -6.914  -1.054  -3.879  1.00 0.00 ? 77  TRP A HB3  5  
ATOM 7916  H HD1  . TRP A 1 77  ? -8.629  1.948   -2.796  1.00 0.00 ? 77  TRP A HD1  5  
ATOM 7917  H HE1  . TRP A 1 77  ? -9.570  3.269   -4.802  1.00 0.00 ? 77  TRP A HE1  5  
ATOM 7918  H HE3  . TRP A 1 77  ? -8.264  -1.608  -6.436  1.00 0.00 ? 77  TRP A HE3  5  
ATOM 7919  H HZ2  . TRP A 1 77  ? -10.092 2.866   -7.586  1.00 0.00 ? 77  TRP A HZ2  5  
ATOM 7920  H HZ3  . TRP A 1 77  ? -8.986  -1.116  -8.754  1.00 0.00 ? 77  TRP A HZ3  5  
ATOM 7921  H HH2  . TRP A 1 77  ? -9.890  1.114   -9.329  1.00 0.00 ? 77  TRP A HH2  5  
ATOM 7922  N N    . ARG A 1 78  ? -8.109  -3.875  -4.600  1.00 0.00 ? 78  ARG A N    5  
ATOM 7923  C CA   . ARG A 1 78  ? -7.364  -5.161  -4.742  1.00 0.00 ? 78  ARG A CA   5  
ATOM 7924  C C    . ARG A 1 78  ? -6.838  -5.320  -6.171  1.00 0.00 ? 78  ARG A C    5  
ATOM 7925  O O    . ARG A 1 78  ? -7.160  -4.549  -7.054  1.00 0.00 ? 78  ARG A O    5  
ATOM 7926  C CB   . ARG A 1 78  ? -8.303  -6.325  -4.426  1.00 0.00 ? 78  ARG A CB   5  
ATOM 7927  C CG   . ARG A 1 78  ? -9.664  -6.081  -5.081  1.00 0.00 ? 78  ARG A CG   5  
ATOM 7928  C CD   . ARG A 1 78  ? -10.552 -7.310  -4.884  1.00 0.00 ? 78  ARG A CD   5  
ATOM 7929  N NE   . ARG A 1 78  ? -11.664 -7.286  -5.877  1.00 0.00 ? 78  ARG A NE   5  
ATOM 7930  C CZ   . ARG A 1 78  ? -12.287 -8.390  -6.189  1.00 0.00 ? 78  ARG A CZ   5  
ATOM 7931  N NH1  . ARG A 1 78  ? -12.034 -9.493  -5.537  1.00 0.00 ? 78  ARG A NH1  5  
ATOM 7932  N NH2  . ARG A 1 78  ? -13.163 -8.392  -7.157  1.00 0.00 ? 78  ARG A NH2  5  
ATOM 7933  H H    . ARG A 1 78  ? -8.651  -3.535  -5.340  1.00 0.00 ? 78  ARG A H    5  
ATOM 7934  H HA   . ARG A 1 78  ? -6.535  -5.174  -4.051  1.00 0.00 ? 78  ARG A HA   5  
ATOM 7935  H HB2  . ARG A 1 78  ? -7.879  -7.243  -4.806  1.00 0.00 ? 78  ARG A HB2  5  
ATOM 7936  H HB3  . ARG A 1 78  ? -8.431  -6.402  -3.359  1.00 0.00 ? 78  ARG A HB3  5  
ATOM 7937  H HG2  . ARG A 1 78  ? -10.132 -5.220  -4.628  1.00 0.00 ? 78  ARG A HG2  5  
ATOM 7938  H HG3  . ARG A 1 78  ? -9.528  -5.903  -6.138  1.00 0.00 ? 78  ARG A HG3  5  
ATOM 7939  H HD2  . ARG A 1 78  ? -9.965  -8.206  -5.024  1.00 0.00 ? 78  ARG A HD2  5  
ATOM 7940  H HD3  . ARG A 1 78  ? -10.962 -7.301  -3.885  1.00 0.00 ? 78  ARG A HD3  5  
ATOM 7941  H HE   . ARG A 1 78  ? -11.928 -6.440  -6.296  1.00 0.00 ? 78  ARG A HE   5  
ATOM 7942  H HH11 . ARG A 1 78  ? -11.364 -9.495  -4.796  1.00 0.00 ? 78  ARG A HH11 5  
ATOM 7943  H HH12 . ARG A 1 78  ? -12.512 -10.338 -5.779  1.00 0.00 ? 78  ARG A HH12 5  
ATOM 7944  H HH21 . ARG A 1 78  ? -13.358 -7.548  -7.656  1.00 0.00 ? 78  ARG A HH21 5  
ATOM 7945  H HH22 . ARG A 1 78  ? -13.641 -9.237  -7.396  1.00 0.00 ? 78  ARG A HH22 5  
ATOM 7946  N N    . ILE A 1 79  ? -6.034  -6.326  -6.402  1.00 0.00 ? 79  ILE A N    5  
ATOM 7947  C CA   . ILE A 1 79  ? -5.488  -6.551  -7.775  1.00 0.00 ? 79  ILE A CA   5  
ATOM 7948  C C    . ILE A 1 79  ? -6.134  -7.795  -8.382  1.00 0.00 ? 79  ILE A C    5  
ATOM 7949  O O    . ILE A 1 79  ? -6.911  -8.477  -7.743  1.00 0.00 ? 79  ILE A O    5  
ATOM 7950  C CB   . ILE A 1 79  ? -3.972  -6.740  -7.710  1.00 0.00 ? 79  ILE A CB   5  
ATOM 7951  C CG1  . ILE A 1 79  ? -3.645  -8.094  -7.061  1.00 0.00 ? 79  ILE A CG1  5  
ATOM 7952  C CG2  . ILE A 1 79  ? -3.375  -5.611  -6.884  1.00 0.00 ? 79  ILE A CG2  5  
ATOM 7953  C CD1  . ILE A 1 79  ? -2.212  -8.088  -6.509  1.00 0.00 ? 79  ILE A CD1  5  
ATOM 7954  H H    . ILE A 1 79  ? -5.795  -6.937  -5.670  1.00 0.00 ? 79  ILE A H    5  
ATOM 7955  H HA   . ILE A 1 79  ? -5.712  -5.697  -8.394  1.00 0.00 ? 79  ILE A HA   5  
ATOM 7956  H HB   . ILE A 1 79  ? -3.563  -6.701  -8.709  1.00 0.00 ? 79  ILE A HB   5  
ATOM 7957  H HG12 . ILE A 1 79  ? -4.339  -8.281  -6.255  1.00 0.00 ? 79  ILE A HG12 5  
ATOM 7958  H HG13 . ILE A 1 79  ? -3.737  -8.875  -7.802  1.00 0.00 ? 79  ILE A HG13 5  
ATOM 7959  H HG21 . ILE A 1 79  ? -2.339  -5.469  -7.164  1.00 0.00 ? 79  ILE A HG21 5  
ATOM 7960  H HG22 . ILE A 1 79  ? -3.440  -5.862  -5.840  1.00 0.00 ? 79  ILE A HG22 5  
ATOM 7961  H HG23 . ILE A 1 79  ? -3.927  -4.712  -7.070  1.00 0.00 ? 79  ILE A HG23 5  
ATOM 7962  H HD11 . ILE A 1 79  ? -2.241  -8.127  -5.430  1.00 0.00 ? 79  ILE A HD11 5  
ATOM 7963  H HD12 . ILE A 1 79  ? -1.704  -7.186  -6.821  1.00 0.00 ? 79  ILE A HD12 5  
ATOM 7964  H HD13 . ILE A 1 79  ? -1.676  -8.943  -6.885  1.00 0.00 ? 79  ILE A HD13 5  
ATOM 7965  N N    . ASP A 1 80  ? -5.823  -8.094  -9.611  1.00 0.00 ? 80  ASP A N    5  
ATOM 7966  C CA   . ASP A 1 80  ? -6.426  -9.293  -10.258 1.00 0.00 ? 80  ASP A CA   5  
ATOM 7967  C C    . ASP A 1 80  ? -6.069  -10.541 -9.446  1.00 0.00 ? 80  ASP A C    5  
ATOM 7968  O O    . ASP A 1 80  ? -5.188  -10.502 -8.609  1.00 0.00 ? 80  ASP A O    5  
ATOM 7969  C CB   . ASP A 1 80  ? -5.883  -9.433  -11.680 1.00 0.00 ? 80  ASP A CB   5  
ATOM 7970  C CG   . ASP A 1 80  ? -6.735  -8.597  -12.637 1.00 0.00 ? 80  ASP A CG   5  
ATOM 7971  O OD1  . ASP A 1 80  ? -7.942  -8.579  -12.463 1.00 0.00 ? 80  ASP A OD1  5  
ATOM 7972  O OD2  . ASP A 1 80  ? -6.164  -7.988  -13.527 1.00 0.00 ? 80  ASP A OD2  5  
ATOM 7973  H H    . ASP A 1 80  ? -5.197  -7.527  -10.111 1.00 0.00 ? 80  ASP A H    5  
ATOM 7974  H HA   . ASP A 1 80  ? -7.500  -9.181  -10.291 1.00 0.00 ? 80  ASP A HA   5  
ATOM 7975  H HB2  . ASP A 1 80  ? -4.862  -9.087  -11.710 1.00 0.00 ? 80  ASP A HB2  5  
ATOM 7976  H HB3  . ASP A 1 80  ? -5.923  -10.469 -11.977 1.00 0.00 ? 80  ASP A HB3  5  
ATOM 7977  N N    . PRO A 1 81  ? -6.777  -11.609 -9.708  1.00 0.00 ? 81  PRO A N    5  
ATOM 7978  C CA   . PRO A 1 81  ? -6.574  -12.889 -9.004  1.00 0.00 ? 81  PRO A CA   5  
ATOM 7979  C C    . PRO A 1 81  ? -5.340  -13.637 -9.526  1.00 0.00 ? 81  PRO A C    5  
ATOM 7980  O O    . PRO A 1 81  ? -4.348  -13.768 -8.837  1.00 0.00 ? 81  PRO A O    5  
ATOM 7981  C CB   . PRO A 1 81  ? -7.856  -13.670 -9.310  1.00 0.00 ? 81  PRO A CB   5  
ATOM 7982  C CG   . PRO A 1 81  ? -8.449  -13.053 -10.599 1.00 0.00 ? 81  PRO A CG   5  
ATOM 7983  C CD   . PRO A 1 81  ? -7.848  -11.640 -10.729 1.00 0.00 ? 81  PRO A CD   5  
ATOM 7984  H HA   . PRO A 1 81  ? -6.495  -12.725 -7.942  1.00 0.00 ? 81  PRO A HA   5  
ATOM 7985  H HB2  . PRO A 1 81  ? -7.623  -14.715 -9.467  1.00 0.00 ? 81  PRO A HB2  5  
ATOM 7986  H HB3  . PRO A 1 81  ? -8.558  -13.563 -8.499  1.00 0.00 ? 81  PRO A HB3  5  
ATOM 7987  H HG2  . PRO A 1 81  ? -8.177  -13.654 -11.456 1.00 0.00 ? 81  PRO A HG2  5  
ATOM 7988  H HG3  . PRO A 1 81  ? -9.522  -12.985 -10.518 1.00 0.00 ? 81  PRO A HG3  5  
ATOM 7989  H HD2  . PRO A 1 81  ? -7.438  -11.495 -11.718 1.00 0.00 ? 81  PRO A HD2  5  
ATOM 7990  H HD3  . PRO A 1 81  ? -8.592  -10.888 -10.511 1.00 0.00 ? 81  PRO A HD3  5  
ATOM 7991  N N    . ALA A 1 82  ? -5.399  -14.151 -10.725 1.00 0.00 ? 82  ALA A N    5  
ATOM 7992  C CA   . ALA A 1 82  ? -4.237  -14.917 -11.267 1.00 0.00 ? 82  ALA A CA   5  
ATOM 7993  C C    . ALA A 1 82  ? -3.238  -13.983 -11.955 1.00 0.00 ? 82  ALA A C    5  
ATOM 7994  O O    . ALA A 1 82  ? -2.398  -14.418 -12.718 1.00 0.00 ? 82  ALA A O    5  
ATOM 7995  C CB   . ALA A 1 82  ? -4.743  -15.946 -12.274 1.00 0.00 ? 82  ALA A CB   5  
ATOM 7996  H H    . ALA A 1 82  ? -6.214  -14.054 -11.260 1.00 0.00 ? 82  ALA A H    5  
ATOM 7997  H HA   . ALA A 1 82  ? -3.737  -15.428 -10.456 1.00 0.00 ? 82  ALA A HA   5  
ATOM 7998  H HB1  . ALA A 1 82  ? -5.248  -15.440 -13.082 1.00 0.00 ? 82  ALA A HB1  5  
ATOM 7999  H HB2  . ALA A 1 82  ? -5.430  -16.619 -11.783 1.00 0.00 ? 82  ALA A HB2  5  
ATOM 8000  H HB3  . ALA A 1 82  ? -3.908  -16.507 -12.666 1.00 0.00 ? 82  ALA A HB3  5  
ATOM 8001  N N    . SER A 1 83  ? -3.301  -12.714 -11.684 1.00 0.00 ? 83  SER A N    5  
ATOM 8002  C CA   . SER A 1 83  ? -2.330  -11.777 -12.315 1.00 0.00 ? 83  SER A CA   5  
ATOM 8003  C C    . SER A 1 83  ? -1.296  -11.365 -11.273 1.00 0.00 ? 83  SER A C    5  
ATOM 8004  O O    . SER A 1 83  ? -0.343  -10.684 -11.573 1.00 0.00 ? 83  SER A O    5  
ATOM 8005  C CB   . SER A 1 83  ? -3.054  -10.530 -12.822 1.00 0.00 ? 83  SER A CB   5  
ATOM 8006  O OG   . SER A 1 83  ? -4.346  -10.891 -13.290 1.00 0.00 ? 83  SER A OG   5  
ATOM 8007  H H    . SER A 1 83  ? -3.970  -12.379 -11.055 1.00 0.00 ? 83  SER A H    5  
ATOM 8008  H HA   . SER A 1 83  ? -1.835  -12.267 -13.139 1.00 0.00 ? 83  SER A HA   5  
ATOM 8009  H HB2  . SER A 1 83  ? -3.151  -9.818  -12.019 1.00 0.00 ? 83  SER A HB2  5  
ATOM 8010  H HB3  . SER A 1 83  ? -2.481  -10.083 -13.625 1.00 0.00 ? 83  SER A HB3  5  
ATOM 8011  H HG   . SER A 1 83  ? -4.519  -10.400 -14.096 1.00 0.00 ? 83  SER A HG   5  
ATOM 8012  N N    . GLU A 1 84  ? -1.478  -11.771 -10.046 1.00 0.00 ? 84  GLU A N    5  
ATOM 8013  C CA   . GLU A 1 84  ? -0.508  -11.390 -8.986  1.00 0.00 ? 84  GLU A CA   5  
ATOM 8014  C C    . GLU A 1 84  ? 0.889   -11.894 -9.349  1.00 0.00 ? 84  GLU A C    5  
ATOM 8015  O O    . GLU A 1 84  ? 1.788   -11.114 -9.579  1.00 0.00 ? 84  GLU A O    5  
ATOM 8016  C CB   . GLU A 1 84  ? -0.942  -12.009 -7.652  1.00 0.00 ? 84  GLU A CB   5  
ATOM 8017  C CG   . GLU A 1 84  ? -2.118  -11.220 -7.075  1.00 0.00 ? 84  GLU A CG   5  
ATOM 8018  C CD   . GLU A 1 84  ? -3.229  -12.185 -6.652  1.00 0.00 ? 84  GLU A CD   5  
ATOM 8019  O OE1  . GLU A 1 84  ? -3.072  -13.374 -6.874  1.00 0.00 ? 84  GLU A OE1  5  
ATOM 8020  O OE2  . GLU A 1 84  ? -4.217  -11.717 -6.112  1.00 0.00 ? 84  GLU A OE2  5  
ATOM 8021  H H    . GLU A 1 84  ? -2.256  -12.320 -9.820  1.00 0.00 ? 84  GLU A H    5  
ATOM 8022  H HA   . GLU A 1 84  ? -0.484  -10.315 -8.894  1.00 0.00 ? 84  GLU A HA   5  
ATOM 8023  H HB2  . GLU A 1 84  ? -1.242  -13.034 -7.812  1.00 0.00 ? 84  GLU A HB2  5  
ATOM 8024  H HB3  . GLU A 1 84  ? -0.116  -11.981 -6.957  1.00 0.00 ? 84  GLU A HB3  5  
ATOM 8025  H HG2  . GLU A 1 84  ? -1.785  -10.659 -6.215  1.00 0.00 ? 84  GLU A HG2  5  
ATOM 8026  H HG3  . GLU A 1 84  ? -2.499  -10.541 -7.823  1.00 0.00 ? 84  GLU A HG3  5  
ATOM 8027  N N    . ALA A 1 85  ? 1.082   -13.186 -9.397  1.00 0.00 ? 85  ALA A N    5  
ATOM 8028  C CA   . ALA A 1 85  ? 2.431   -13.732 -9.732  1.00 0.00 ? 85  ALA A CA   5  
ATOM 8029  C C    . ALA A 1 85  ? 3.077   -12.900 -10.843 1.00 0.00 ? 85  ALA A C    5  
ATOM 8030  O O    . ALA A 1 85  ? 4.285   -12.811 -10.939 1.00 0.00 ? 85  ALA A O    5  
ATOM 8031  C CB   . ALA A 1 85  ? 2.294   -15.183 -10.195 1.00 0.00 ? 85  ALA A CB   5  
ATOM 8032  H H    . ALA A 1 85  ? 0.340   -13.801 -9.206  1.00 0.00 ? 85  ALA A H    5  
ATOM 8033  H HA   . ALA A 1 85  ? 3.058   -13.694 -8.851  1.00 0.00 ? 85  ALA A HA   5  
ATOM 8034  H HB1  . ALA A 1 85  ? 3.213   -15.714 -9.989  1.00 0.00 ? 85  ALA A HB1  5  
ATOM 8035  H HB2  . ALA A 1 85  ? 2.097   -15.205 -11.256 1.00 0.00 ? 85  ALA A HB2  5  
ATOM 8036  H HB3  . ALA A 1 85  ? 1.479   -15.656 -9.666  1.00 0.00 ? 85  ALA A HB3  5  
ATOM 8037  N N    . LYS A 1 86  ? 2.288   -12.288 -11.682 1.00 0.00 ? 86  LYS A N    5  
ATOM 8038  C CA   . LYS A 1 86  ? 2.872   -11.465 -12.776 1.00 0.00 ? 86  LYS A CA   5  
ATOM 8039  C C    . LYS A 1 86  ? 3.269   -10.091 -12.229 1.00 0.00 ? 86  LYS A C    5  
ATOM 8040  O O    . LYS A 1 86  ? 4.424   -9.713  -12.258 1.00 0.00 ? 86  LYS A O    5  
ATOM 8041  C CB   . LYS A 1 86  ? 1.844   -11.295 -13.895 1.00 0.00 ? 86  LYS A CB   5  
ATOM 8042  C CG   . LYS A 1 86  ? 2.571   -11.147 -15.234 1.00 0.00 ? 86  LYS A CG   5  
ATOM 8043  C CD   . LYS A 1 86  ? 1.930   -10.015 -16.040 1.00 0.00 ? 86  LYS A CD   5  
ATOM 8044  C CE   . LYS A 1 86  ? 2.230   -8.675  -15.364 1.00 0.00 ? 86  LYS A CE   5  
ATOM 8045  N NZ   . LYS A 1 86  ? 3.009   -7.812  -16.295 1.00 0.00 ? 86  LYS A NZ   5  
ATOM 8046  H H    . LYS A 1 86  ? 1.316   -12.368 -11.592 1.00 0.00 ? 86  LYS A H    5  
ATOM 8047  H HA   . LYS A 1 86  ? 3.749   -11.961 -13.167 1.00 0.00 ? 86  LYS A HA   5  
ATOM 8048  H HB2  . LYS A 1 86  ? 1.200   -12.163 -13.928 1.00 0.00 ? 86  LYS A HB2  5  
ATOM 8049  H HB3  . LYS A 1 86  ? 1.250   -10.413 -13.710 1.00 0.00 ? 86  LYS A HB3  5  
ATOM 8050  H HG2  . LYS A 1 86  ? 3.612   -10.918 -15.055 1.00 0.00 ? 86  LYS A HG2  5  
ATOM 8051  H HG3  . LYS A 1 86  ? 2.494   -12.069 -15.790 1.00 0.00 ? 86  LYS A HG3  5  
ATOM 8052  H HD2  . LYS A 1 86  ? 2.336   -10.012 -17.042 1.00 0.00 ? 86  LYS A HD2  5  
ATOM 8053  H HD3  . LYS A 1 86  ? 0.862   -10.162 -16.083 1.00 0.00 ? 86  LYS A HD3  5  
ATOM 8054  H HE2  . LYS A 1 86  ? 1.302   -8.185  -15.109 1.00 0.00 ? 86  LYS A HE2  5  
ATOM 8055  H HE3  . LYS A 1 86  ? 2.806   -8.847  -14.466 1.00 0.00 ? 86  LYS A HE3  5  
ATOM 8056  H HZ1  . LYS A 1 86  ? 3.150   -8.310  -17.197 1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 8057  H HZ2  . LYS A 1 86  ? 3.934   -7.592  -15.872 1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 8058  H HZ3  . LYS A 1 86  ? 2.487   -6.929  -16.468 1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 8059  N N    . LEU A 1 87  ? 2.325   -9.331  -11.740 1.00 0.00 ? 87  LEU A N    5  
ATOM 8060  C CA   . LEU A 1 87  ? 2.664   -7.981  -11.209 1.00 0.00 ? 87  LEU A CA   5  
ATOM 8061  C C    . LEU A 1 87  ? 3.741   -8.092  -10.140 1.00 0.00 ? 87  LEU A C    5  
ATOM 8062  O O    . LEU A 1 87  ? 4.830   -7.573  -10.279 1.00 0.00 ? 87  LEU A O    5  
ATOM 8063  C CB   . LEU A 1 87  ? 1.429   -7.298  -10.596 1.00 0.00 ? 87  LEU A CB   5  
ATOM 8064  C CG   . LEU A 1 87  ? 0.424   -8.329  -10.059 1.00 0.00 ? 87  LEU A CG   5  
ATOM 8065  C CD1  . LEU A 1 87  ? 0.045   -7.983  -8.622  1.00 0.00 ? 87  LEU A CD1  5  
ATOM 8066  C CD2  . LEU A 1 87  ? -0.848  -8.285  -10.902 1.00 0.00 ? 87  LEU A CD2  5  
ATOM 8067  H H    . LEU A 1 87  ? 1.399   -9.644  -11.734 1.00 0.00 ? 87  LEU A H    5  
ATOM 8068  H HA   . LEU A 1 87  ? 3.039   -7.377  -12.012 1.00 0.00 ? 87  LEU A HA   5  
ATOM 8069  H HB2  . LEU A 1 87  ? 1.744   -6.659  -9.786  1.00 0.00 ? 87  LEU A HB2  5  
ATOM 8070  H HB3  . LEU A 1 87  ? 0.952   -6.700  -11.347 1.00 0.00 ? 87  LEU A HB3  5  
ATOM 8071  H HG   . LEU A 1 87  ? 0.853   -9.316  -10.091 1.00 0.00 ? 87  LEU A HG   5  
ATOM 8072  H HD11 . LEU A 1 87  ? -0.995  -8.224  -8.465  1.00 0.00 ? 87  LEU A HD11 5  
ATOM 8073  H HD12 . LEU A 1 87  ? 0.199   -6.929  -8.452  1.00 0.00 ? 87  LEU A HD12 5  
ATOM 8074  H HD13 . LEU A 1 87  ? 0.654   -8.554  -7.938  1.00 0.00 ? 87  LEU A HD13 5  
ATOM 8075  H HD21 . LEU A 1 87  ? -0.616  -8.541  -11.923 1.00 0.00 ? 87  LEU A HD21 5  
ATOM 8076  H HD22 . LEU A 1 87  ? -1.262  -7.290  -10.863 1.00 0.00 ? 87  LEU A HD22 5  
ATOM 8077  H HD23 . LEU A 1 87  ? -1.566  -8.987  -10.505 1.00 0.00 ? 87  LEU A HD23 5  
ATOM 8078  N N    . VAL A 1 88  ? 3.432   -8.743  -9.068  1.00 0.00 ? 88  VAL A N    5  
ATOM 8079  C CA   . VAL A 1 88  ? 4.412   -8.878  -7.966  1.00 0.00 ? 88  VAL A CA   5  
ATOM 8080  C C    . VAL A 1 88  ? 5.806   -9.184  -8.509  1.00 0.00 ? 88  VAL A C    5  
ATOM 8081  O O    . VAL A 1 88  ? 6.804   -8.891  -7.881  1.00 0.00 ? 88  VAL A O    5  
ATOM 8082  C CB   . VAL A 1 88  ? 3.990   -10.033 -7.099  1.00 0.00 ? 88  VAL A CB   5  
ATOM 8083  C CG1  . VAL A 1 88  ? 2.706   -9.684  -6.343  1.00 0.00 ? 88  VAL A CG1  5  
ATOM 8084  C CG2  . VAL A 1 88  ? 3.754   -11.247 -7.994  1.00 0.00 ? 88  VAL A CG2  5  
ATOM 8085  H H    . VAL A 1 88  ? 2.539   -9.135  -8.977  1.00 0.00 ? 88  VAL A H    5  
ATOM 8086  H HA   . VAL A 1 88  ? 4.434   -7.974  -7.378  1.00 0.00 ? 88  VAL A HA   5  
ATOM 8087  H HB   . VAL A 1 88  ? 4.778   -10.240 -6.412  1.00 0.00 ? 88  VAL A HB   5  
ATOM 8088  H HG11 . VAL A 1 88  ? 2.565   -10.383 -5.531  1.00 0.00 ? 88  VAL A HG11 5  
ATOM 8089  H HG12 . VAL A 1 88  ? 1.865   -9.744  -7.019  1.00 0.00 ? 88  VAL A HG12 5  
ATOM 8090  H HG13 . VAL A 1 88  ? 2.781   -8.683  -5.949  1.00 0.00 ? 88  VAL A HG13 5  
ATOM 8091  H HG21 . VAL A 1 88  ? 3.823   -10.944 -9.030  1.00 0.00 ? 88  VAL A HG21 5  
ATOM 8092  H HG22 . VAL A 1 88  ? 2.771   -11.649 -7.803  1.00 0.00 ? 88  VAL A HG22 5  
ATOM 8093  H HG23 . VAL A 1 88  ? 4.501   -11.997 -7.789  1.00 0.00 ? 88  VAL A HG23 5  
ATOM 8094  N N    . GLU A 1 89  ? 5.885   -9.793  -9.653  1.00 0.00 ? 89  GLU A N    5  
ATOM 8095  C CA   . GLU A 1 89  ? 7.222   -10.138 -10.213 1.00 0.00 ? 89  GLU A CA   5  
ATOM 8096  C C    . GLU A 1 89  ? 8.080   -8.876  -10.256 1.00 0.00 ? 89  GLU A C    5  
ATOM 8097  O O    . GLU A 1 89  ? 9.189   -8.851  -9.759  1.00 0.00 ? 89  GLU A O    5  
ATOM 8098  C CB   . GLU A 1 89  ? 7.057   -10.698 -11.626 1.00 0.00 ? 89  GLU A CB   5  
ATOM 8099  C CG   . GLU A 1 89  ? 8.053   -11.838 -11.844 1.00 0.00 ? 89  GLU A CG   5  
ATOM 8100  C CD   . GLU A 1 89  ? 8.851   -11.584 -13.124 1.00 0.00 ? 89  GLU A CD   5  
ATOM 8101  O OE1  . GLU A 1 89  ? 8.285   -11.030 -14.051 1.00 0.00 ? 89  GLU A OE1  5  
ATOM 8102  O OE2  . GLU A 1 89  ? 10.015  -11.946 -13.155 1.00 0.00 ? 89  GLU A OE2  5  
ATOM 8103  H H    . GLU A 1 89  ? 5.069   -10.043 -10.129 1.00 0.00 ? 89  GLU A H    5  
ATOM 8104  H HA   . GLU A 1 89  ? 7.697   -10.877 -9.583  1.00 0.00 ? 89  GLU A HA   5  
ATOM 8105  H HB2  . GLU A 1 89  ? 6.049   -11.071 -11.751 1.00 0.00 ? 89  GLU A HB2  5  
ATOM 8106  H HB3  . GLU A 1 89  ? 7.243   -9.916  -12.348 1.00 0.00 ? 89  GLU A HB3  5  
ATOM 8107  H HG2  . GLU A 1 89  ? 8.728   -11.891 -11.002 1.00 0.00 ? 89  GLU A HG2  5  
ATOM 8108  H HG3  . GLU A 1 89  ? 7.518   -12.771 -11.936 1.00 0.00 ? 89  GLU A HG3  5  
ATOM 8109  N N    . GLN A 1 90  ? 7.575   -7.822  -10.828 1.00 0.00 ? 90  GLN A N    5  
ATOM 8110  C CA   . GLN A 1 90  ? 8.362   -6.561  -10.877 1.00 0.00 ? 90  GLN A CA   5  
ATOM 8111  C C    . GLN A 1 90  ? 8.139   -5.785  -9.574  1.00 0.00 ? 90  GLN A C    5  
ATOM 8112  O O    . GLN A 1 90  ? 8.743   -4.757  -9.342  1.00 0.00 ? 90  GLN A O    5  
ATOM 8113  C CB   . GLN A 1 90  ? 7.899   -5.717  -12.068 1.00 0.00 ? 90  GLN A CB   5  
ATOM 8114  C CG   . GLN A 1 90  ? 8.588   -6.214  -13.340 1.00 0.00 ? 90  GLN A CG   5  
ATOM 8115  C CD   . GLN A 1 90  ? 9.969   -5.565  -13.459 1.00 0.00 ? 90  GLN A CD   5  
ATOM 8116  O OE1  . GLN A 1 90  ? 10.389  -4.840  -12.579 1.00 0.00 ? 90  GLN A OE1  5  
ATOM 8117  N NE2  . GLN A 1 90  ? 10.697  -5.799  -14.516 1.00 0.00 ? 90  GLN A NE2  5  
ATOM 8118  H H    . GLN A 1 90  ? 6.675   -7.855  -11.211 1.00 0.00 ? 90  GLN A H    5  
ATOM 8119  H HA   . GLN A 1 90  ? 9.411   -6.795  -10.983 1.00 0.00 ? 90  GLN A HA   5  
ATOM 8120  H HB2  . GLN A 1 90  ? 6.828   -5.807  -12.178 1.00 0.00 ? 90  GLN A HB2  5  
ATOM 8121  H HB3  . GLN A 1 90  ? 8.160   -4.683  -11.899 1.00 0.00 ? 90  GLN A HB3  5  
ATOM 8122  H HG2  . GLN A 1 90  ? 8.697   -7.288  -13.294 1.00 0.00 ? 90  GLN A HG2  5  
ATOM 8123  H HG3  . GLN A 1 90  ? 7.993   -5.947  -14.200 1.00 0.00 ? 90  GLN A HG3  5  
ATOM 8124  H HE21 . GLN A 1 90  ? 10.357  -6.384  -15.226 1.00 0.00 ? 90  GLN A HE21 5  
ATOM 8125  H HE22 . GLN A 1 90  ? 11.582  -5.388  -14.602 1.00 0.00 ? 90  GLN A HE22 5  
ATOM 8126  N N    . ALA A 1 91  ? 7.270   -6.270  -8.722  1.00 0.00 ? 91  ALA A N    5  
ATOM 8127  C CA   . ALA A 1 91  ? 7.002   -5.562  -7.436  1.00 0.00 ? 91  ALA A CA   5  
ATOM 8128  C C    . ALA A 1 91  ? 8.177   -5.752  -6.475  1.00 0.00 ? 91  ALA A C    5  
ATOM 8129  O O    . ALA A 1 91  ? 8.534   -4.856  -5.735  1.00 0.00 ? 91  ALA A O    5  
ATOM 8130  C CB   . ALA A 1 91  ? 5.725   -6.107  -6.800  1.00 0.00 ? 91  ALA A CB   5  
ATOM 8131  H H    . ALA A 1 91  ? 6.789   -7.097  -8.931  1.00 0.00 ? 91  ALA A H    5  
ATOM 8132  H HA   . ALA A 1 91  ? 6.873   -4.518  -7.631  1.00 0.00 ? 91  ALA A HA   5  
ATOM 8133  H HB1  . ALA A 1 91  ? 5.879   -7.133  -6.505  1.00 0.00 ? 91  ALA A HB1  5  
ATOM 8134  H HB2  . ALA A 1 91  ? 4.917   -6.052  -7.513  1.00 0.00 ? 91  ALA A HB2  5  
ATOM 8135  H HB3  . ALA A 1 91  ? 5.478   -5.515  -5.930  1.00 0.00 ? 91  ALA A HB3  5  
ATOM 8136  N N    . PHE A 1 92  ? 8.780   -6.908  -6.473  1.00 0.00 ? 92  PHE A N    5  
ATOM 8137  C CA   . PHE A 1 92  ? 9.926   -7.142  -5.549  1.00 0.00 ? 92  PHE A CA   5  
ATOM 8138  C C    . PHE A 1 92  ? 11.227  -6.680  -6.211  1.00 0.00 ? 92  PHE A C    5  
ATOM 8139  O O    . PHE A 1 92  ? 12.291  -6.760  -5.628  1.00 0.00 ? 92  PHE A O    5  
ATOM 8140  C CB   . PHE A 1 92  ? 10.026  -8.632  -5.224  1.00 0.00 ? 92  PHE A CB   5  
ATOM 8141  C CG   . PHE A 1 92  ? 8.708   -9.120  -4.674  1.00 0.00 ? 92  PHE A CG   5  
ATOM 8142  C CD1  . PHE A 1 92  ? 7.932   -8.281  -3.864  1.00 0.00 ? 92  PHE A CD1  5  
ATOM 8143  C CD2  . PHE A 1 92  ? 8.262   -10.412 -4.974  1.00 0.00 ? 92  PHE A CD2  5  
ATOM 8144  C CE1  . PHE A 1 92  ? 6.710   -8.736  -3.354  1.00 0.00 ? 92  PHE A CE1  5  
ATOM 8145  C CE2  . PHE A 1 92  ? 7.040   -10.867 -4.464  1.00 0.00 ? 92  PHE A CE2  5  
ATOM 8146  C CZ   . PHE A 1 92  ? 6.265   -10.028 -3.653  1.00 0.00 ? 92  PHE A CZ   5  
ATOM 8147  H H    . PHE A 1 92  ? 8.478   -7.620  -7.072  1.00 0.00 ? 92  PHE A H    5  
ATOM 8148  H HA   . PHE A 1 92  ? 9.772   -6.586  -4.637  1.00 0.00 ? 92  PHE A HA   5  
ATOM 8149  H HB2  . PHE A 1 92  ? 10.266  -9.181  -6.123  1.00 0.00 ? 92  PHE A HB2  5  
ATOM 8150  H HB3  . PHE A 1 92  ? 10.801  -8.789  -4.489  1.00 0.00 ? 92  PHE A HB3  5  
ATOM 8151  H HD1  . PHE A 1 92  ? 8.276   -7.283  -3.633  1.00 0.00 ? 92  PHE A HD1  5  
ATOM 8152  H HD2  . PHE A 1 92  ? 8.861   -11.058 -5.599  1.00 0.00 ? 92  PHE A HD2  5  
ATOM 8153  H HE1  . PHE A 1 92  ? 6.112   -8.090  -2.728  1.00 0.00 ? 92  PHE A HE1  5  
ATOM 8154  H HE2  . PHE A 1 92  ? 6.697   -11.864 -4.695  1.00 0.00 ? 92  PHE A HE2  5  
ATOM 8155  H HZ   . PHE A 1 92  ? 5.323   -10.380 -3.260  1.00 0.00 ? 92  PHE A HZ   5  
ATOM 8156  N N    . ARG A 1 93  ? 11.157  -6.198  -7.423  1.00 0.00 ? 93  ARG A N    5  
ATOM 8157  C CA   . ARG A 1 93  ? 12.397  -5.737  -8.110  1.00 0.00 ? 93  ARG A CA   5  
ATOM 8158  C C    . ARG A 1 93  ? 12.390  -4.212  -8.217  1.00 0.00 ? 93  ARG A C    5  
ATOM 8159  O O    . ARG A 1 93  ? 11.599  -3.538  -7.586  1.00 0.00 ? 93  ARG A O    5  
ATOM 8160  C CB   . ARG A 1 93  ? 12.466  -6.348  -9.511  1.00 0.00 ? 93  ARG A CB   5  
ATOM 8161  C CG   . ARG A 1 93  ? 13.605  -7.369  -9.566  1.00 0.00 ? 93  ARG A CG   5  
ATOM 8162  C CD   . ARG A 1 93  ? 13.023  -8.783  -9.622  1.00 0.00 ? 93  ARG A CD   5  
ATOM 8163  N NE   . ARG A 1 93  ? 13.371  -9.517  -8.373  1.00 0.00 ? 93  ARG A NE   5  
ATOM 8164  C CZ   . ARG A 1 93  ? 14.522  -10.125 -8.272  1.00 0.00 ? 93  ARG A CZ   5  
ATOM 8165  N NH1  . ARG A 1 93  ? 14.747  -11.214 -8.953  1.00 0.00 ? 93  ARG A NH1  5  
ATOM 8166  N NH2  . ARG A 1 93  ? 15.449  -9.643  -7.488  1.00 0.00 ? 93  ARG A NH2  5  
ATOM 8167  H H    . ARG A 1 93  ? 10.292  -6.141  -7.879  1.00 0.00 ? 93  ARG A H    5  
ATOM 8168  H HA   . ARG A 1 93  ? 13.259  -6.052  -7.539  1.00 0.00 ? 93  ARG A HA   5  
ATOM 8169  H HB2  . ARG A 1 93  ? 11.529  -6.838  -9.736  1.00 0.00 ? 93  ARG A HB2  5  
ATOM 8170  H HB3  . ARG A 1 93  ? 12.648  -5.569  -10.236 1.00 0.00 ? 93  ARG A HB3  5  
ATOM 8171  H HG2  . ARG A 1 93  ? 14.205  -7.190  -10.447 1.00 0.00 ? 93  ARG A HG2  5  
ATOM 8172  H HG3  . ARG A 1 93  ? 14.219  -7.270  -8.684  1.00 0.00 ? 93  ARG A HG3  5  
ATOM 8173  H HD2  . ARG A 1 93  ? 11.948  -8.725  -9.717  1.00 0.00 ? 93  ARG A HD2  5  
ATOM 8174  H HD3  . ARG A 1 93  ? 13.431  -9.307  -10.474 1.00 0.00 ? 93  ARG A HD3  5  
ATOM 8175  H HE   . ARG A 1 93  ? 12.736  -9.545  -7.627  1.00 0.00 ? 93  ARG A HE   5  
ATOM 8176  H HH11 . ARG A 1 93  ? 14.038  -11.584 -9.552  1.00 0.00 ? 93  ARG A HH11 5  
ATOM 8177  H HH12 . ARG A 1 93  ? 15.628  -11.680 -8.874  1.00 0.00 ? 93  ARG A HH12 5  
ATOM 8178  H HH21 . ARG A 1 93  ? 15.277  -8.809  -6.964  1.00 0.00 ? 93  ARG A HH21 5  
ATOM 8179  H HH22 . ARG A 1 93  ? 16.330  -10.111 -7.409  1.00 0.00 ? 93  ARG A HH22 5  
ATOM 8180  N N    . LYS A 1 94  ? 13.269  -3.660  -9.006  1.00 0.00 ? 94  LYS A N    5  
ATOM 8181  C CA   . LYS A 1 94  ? 13.319  -2.178  -9.150  1.00 0.00 ? 94  LYS A CA   5  
ATOM 8182  C C    . LYS A 1 94  ? 12.743  -1.773  -10.509 1.00 0.00 ? 94  LYS A C    5  
ATOM 8183  O O    . LYS A 1 94  ? 13.431  -1.776  -11.511 1.00 0.00 ? 94  LYS A O    5  
ATOM 8184  C CB   . LYS A 1 94  ? 14.769  -1.703  -9.049  1.00 0.00 ? 94  LYS A CB   5  
ATOM 8185  C CG   . LYS A 1 94  ? 14.996  -1.033  -7.692  1.00 0.00 ? 94  LYS A CG   5  
ATOM 8186  C CD   . LYS A 1 94  ? 15.947  0.154   -7.862  1.00 0.00 ? 94  LYS A CD   5  
ATOM 8187  C CE   . LYS A 1 94  ? 15.243  1.441   -7.430  1.00 0.00 ? 94  LYS A CE   5  
ATOM 8188  N NZ   . LYS A 1 94  ? 16.222  2.564   -7.427  1.00 0.00 ? 94  LYS A NZ   5  
ATOM 8189  H H    . LYS A 1 94  ? 13.902  -4.222  -9.503  1.00 0.00 ? 94  LYS A H    5  
ATOM 8190  H HA   . LYS A 1 94  ? 12.735  -1.722  -8.363  1.00 0.00 ? 94  LYS A HA   5  
ATOM 8191  H HB2  . LYS A 1 94  ? 15.433  -2.551  -9.148  1.00 0.00 ? 94  LYS A HB2  5  
ATOM 8192  H HB3  . LYS A 1 94  ? 14.971  -0.994  -9.837  1.00 0.00 ? 94  LYS A HB3  5  
ATOM 8193  H HG2  . LYS A 1 94  ? 14.050  -0.686  -7.301  1.00 0.00 ? 94  LYS A HG2  5  
ATOM 8194  H HG3  . LYS A 1 94  ? 15.430  -1.744  -7.006  1.00 0.00 ? 94  LYS A HG3  5  
ATOM 8195  H HD2  . LYS A 1 94  ? 16.825  0.001   -7.251  1.00 0.00 ? 94  LYS A HD2  5  
ATOM 8196  H HD3  . LYS A 1 94  ? 16.239  0.237   -8.898  1.00 0.00 ? 94  LYS A HD3  5  
ATOM 8197  H HE2  . LYS A 1 94  ? 14.442  1.663   -8.120  1.00 0.00 ? 94  LYS A HE2  5  
ATOM 8198  H HE3  . LYS A 1 94  ? 14.838  1.315   -6.436  1.00 0.00 ? 94  LYS A HE3  5  
ATOM 8199  H HZ1  . LYS A 1 94  ? 16.411  2.863   -8.406  1.00 0.00 ? 94  LYS A HZ1  5  
ATOM 8200  H HZ2  . LYS A 1 94  ? 17.109  2.250   -6.982  1.00 0.00 ? 94  LYS A HZ2  5  
ATOM 8201  H HZ3  . LYS A 1 94  ? 15.831  3.366   -6.892  1.00 0.00 ? 94  LYS A HZ3  5  
ATOM 8202  N N    . ARG A 1 95  ? 11.488  -1.419  -10.551 1.00 0.00 ? 95  ARG A N    5  
ATOM 8203  C CA   . ARG A 1 95  ? 10.874  -1.008  -11.845 1.00 0.00 ? 95  ARG A CA   5  
ATOM 8204  C C    . ARG A 1 95  ? 11.474  0.328   -12.284 1.00 0.00 ? 95  ARG A C    5  
ATOM 8205  O O    . ARG A 1 95  ? 11.195  1.362   -11.711 1.00 0.00 ? 95  ARG A O    5  
ATOM 8206  C CB   . ARG A 1 95  ? 9.362   -0.855  -11.665 1.00 0.00 ? 95  ARG A CB   5  
ATOM 8207  C CG   . ARG A 1 95  ? 8.741   -0.351  -12.970 1.00 0.00 ? 95  ARG A CG   5  
ATOM 8208  C CD   . ARG A 1 95  ? 8.836   -1.444  -14.035 1.00 0.00 ? 95  ARG A CD   5  
ATOM 8209  N NE   . ARG A 1 95  ? 7.553   -1.513  -14.793 1.00 0.00 ? 95  ARG A NE   5  
ATOM 8210  C CZ   . ARG A 1 95  ? 6.717   -2.491  -14.576 1.00 0.00 ? 95  ARG A CZ   5  
ATOM 8211  N NH1  . ARG A 1 95  ? 7.166   -3.694  -14.341 1.00 0.00 ? 95  ARG A NH1  5  
ATOM 8212  N NH2  . ARG A 1 95  ? 5.431   -2.267  -14.592 1.00 0.00 ? 95  ARG A NH2  5  
ATOM 8213  H H    . ARG A 1 95  ? 10.951  -1.419  -9.732  1.00 0.00 ? 95  ARG A H    5  
ATOM 8214  H HA   . ARG A 1 95  ? 11.074  -1.759  -12.595 1.00 0.00 ? 95  ARG A HA   5  
ATOM 8215  H HB2  . ARG A 1 95  ? 8.932   -1.811  -11.405 1.00 0.00 ? 95  ARG A HB2  5  
ATOM 8216  H HB3  . ARG A 1 95  ? 9.164   -0.145  -10.876 1.00 0.00 ? 95  ARG A HB3  5  
ATOM 8217  H HG2  . ARG A 1 95  ? 7.703   -0.101  -12.801 1.00 0.00 ? 95  ARG A HG2  5  
ATOM 8218  H HG3  . ARG A 1 95  ? 9.272   0.525   -13.307 1.00 0.00 ? 95  ARG A HG3  5  
ATOM 8219  H HD2  . ARG A 1 95  ? 9.643   -1.217  -14.714 1.00 0.00 ? 95  ARG A HD2  5  
ATOM 8220  H HD3  . ARG A 1 95  ? 9.023   -2.396  -13.559 1.00 0.00 ? 95  ARG A HD3  5  
ATOM 8221  H HE   . ARG A 1 95  ? 7.339   -0.823  -15.456 1.00 0.00 ? 95  ARG A HE   5  
ATOM 8222  H HH11 . ARG A 1 95  ? 8.151   -3.866  -14.327 1.00 0.00 ? 95  ARG A HH11 5  
ATOM 8223  H HH12 . ARG A 1 95  ? 6.525   -4.443  -14.174 1.00 0.00 ? 95  ARG A HH12 5  
ATOM 8224  H HH21 . ARG A 1 95  ? 5.087   -1.346  -14.772 1.00 0.00 ? 95  ARG A HH21 5  
ATOM 8225  H HH22 . ARG A 1 95  ? 4.790   -3.017  -14.426 1.00 0.00 ? 95  ARG A HH22 5  
ATOM 8226  N N    . ARG A 1 96  ? 12.303  0.317   -13.293 1.00 0.00 ? 96  ARG A N    5  
ATOM 8227  C CA   . ARG A 1 96  ? 12.923  1.590   -13.757 1.00 0.00 ? 96  ARG A CA   5  
ATOM 8228  C C    . ARG A 1 96  ? 13.182  1.525   -15.265 1.00 0.00 ? 96  ARG A C    5  
ATOM 8229  O O    . ARG A 1 96  ? 14.018  2.232   -15.791 1.00 0.00 ? 96  ARG A O    5  
ATOM 8230  C CB   . ARG A 1 96  ? 14.250  1.800   -13.024 1.00 0.00 ? 96  ARG A CB   5  
ATOM 8231  C CG   . ARG A 1 96  ? 15.226  0.690   -13.417 1.00 0.00 ? 96  ARG A CG   5  
ATOM 8232  C CD   . ARG A 1 96  ? 16.154  0.385   -12.241 1.00 0.00 ? 96  ARG A CD   5  
ATOM 8233  N NE   . ARG A 1 96  ? 17.571  0.476   -12.690 1.00 0.00 ? 96  ARG A NE   5  
ATOM 8234  C CZ   . ARG A 1 96  ? 18.536  0.457   -11.812 1.00 0.00 ? 96  ARG A CZ   5  
ATOM 8235  N NH1  . ARG A 1 96  ? 18.713  -0.596  -11.061 1.00 0.00 ? 96  ARG A NH1  5  
ATOM 8236  N NH2  . ARG A 1 96  ? 19.324  1.489   -11.685 1.00 0.00 ? 96  ARG A NH2  5  
ATOM 8237  H H    . ARG A 1 96  ? 12.521  -0.528  -13.741 1.00 0.00 ? 96  ARG A H    5  
ATOM 8238  H HA   . ARG A 1 96  ? 12.259  2.415   -13.541 1.00 0.00 ? 96  ARG A HA   5  
ATOM 8239  H HB2  . ARG A 1 96  ? 14.664  2.760   -13.296 1.00 0.00 ? 96  ARG A HB2  5  
ATOM 8240  H HB3  . ARG A 1 96  ? 14.082  1.767   -11.958 1.00 0.00 ? 96  ARG A HB3  5  
ATOM 8241  H HG2  . ARG A 1 96  ? 14.671  -0.199  -13.680 1.00 0.00 ? 96  ARG A HG2  5  
ATOM 8242  H HG3  . ARG A 1 96  ? 15.814  1.011   -14.264 1.00 0.00 ? 96  ARG A HG3  5  
ATOM 8243  H HD2  . ARG A 1 96  ? 15.980  1.100   -11.450 1.00 0.00 ? 96  ARG A HD2  5  
ATOM 8244  H HD3  . ARG A 1 96  ? 15.955  -0.611  -11.875 1.00 0.00 ? 96  ARG A HD3  5  
ATOM 8245  H HE   . ARG A 1 96  ? 17.779  0.552   -13.646 1.00 0.00 ? 96  ARG A HE   5  
ATOM 8246  H HH11 . ARG A 1 96  ? 18.109  -1.387  -11.157 1.00 0.00 ? 96  ARG A HH11 5  
ATOM 8247  H HH12 . ARG A 1 96  ? 19.452  -0.611  -10.387 1.00 0.00 ? 96  ARG A HH12 5  
ATOM 8248  H HH21 . ARG A 1 96  ? 19.188  2.296   -12.261 1.00 0.00 ? 96  ARG A HH21 5  
ATOM 8249  H HH22 . ARG A 1 96  ? 20.063  1.474   -11.012 1.00 0.00 ? 96  ARG A HH22 5  
ATOM 8250  N N    . GLN A 1 97  ? 12.475  0.682   -15.967 1.00 0.00 ? 97  GLN A N    5  
ATOM 8251  C CA   . GLN A 1 97  ? 12.689  0.578   -17.439 1.00 0.00 ? 97  GLN A CA   5  
ATOM 8252  C C    . GLN A 1 97  ? 11.538  1.270   -18.173 1.00 0.00 ? 97  GLN A C    5  
ATOM 8253  O O    . GLN A 1 97  ? 11.715  1.832   -19.236 1.00 0.00 ? 97  GLN A O    5  
ATOM 8254  C CB   . GLN A 1 97  ? 12.737  -0.896  -17.844 1.00 0.00 ? 97  GLN A CB   5  
ATOM 8255  C CG   . GLN A 1 97  ? 13.814  -1.095  -18.912 1.00 0.00 ? 97  GLN A CG   5  
ATOM 8256  C CD   . GLN A 1 97  ? 14.517  -2.434  -18.686 1.00 0.00 ? 97  GLN A CD   5  
ATOM 8257  O OE1  . GLN A 1 97  ? 14.299  -3.378  -19.418 1.00 0.00 ? 97  GLN A OE1  5  
ATOM 8258  N NE2  . GLN A 1 97  ? 15.357  -2.556  -17.695 1.00 0.00 ? 97  GLN A NE2  5  
ATOM 8259  H H    . GLN A 1 97  ? 11.805  0.119   -15.527 1.00 0.00 ? 97  GLN A H    5  
ATOM 8260  H HA   . GLN A 1 97  ? 13.621  1.055   -17.701 1.00 0.00 ? 97  GLN A HA   5  
ATOM 8261  H HB2  . GLN A 1 97  ? 12.971  -1.499  -16.979 1.00 0.00 ? 97  GLN A HB2  5  
ATOM 8262  H HB3  . GLN A 1 97  ? 11.778  -1.192  -18.243 1.00 0.00 ? 97  GLN A HB3  5  
ATOM 8263  H HG2  . GLN A 1 97  ? 13.355  -1.089  -19.890 1.00 0.00 ? 97  GLN A HG2  5  
ATOM 8264  H HG3  . GLN A 1 97  ? 14.537  -0.296  -18.848 1.00 0.00 ? 97  GLN A HG3  5  
ATOM 8265  H HE21 . GLN A 1 97  ? 15.533  -1.794  -17.104 1.00 0.00 ? 97  GLN A HE21 5  
ATOM 8266  H HE22 . GLN A 1 97  ? 15.812  -3.410  -17.542 1.00 0.00 ? 97  GLN A HE22 5  
ATOM 8267  N N    . ARG A 1 98  ? 10.360  1.233   -17.615 1.00 0.00 ? 98  ARG A N    5  
ATOM 8268  C CA   . ARG A 1 98  ? 9.196   1.886   -18.278 1.00 0.00 ? 98  ARG A CA   5  
ATOM 8269  C C    . ARG A 1 98  ? 8.131   2.207   -17.227 1.00 0.00 ? 98  ARG A C    5  
ATOM 8270  O O    . ARG A 1 98  ? 7.672   1.340   -16.510 1.00 0.00 ? 98  ARG A O    5  
ATOM 8271  C CB   . ARG A 1 98  ? 8.609   0.940   -19.328 1.00 0.00 ? 98  ARG A CB   5  
ATOM 8272  C CG   . ARG A 1 98  ? 9.075   1.369   -20.720 1.00 0.00 ? 98  ARG A CG   5  
ATOM 8273  C CD   . ARG A 1 98  ? 9.493   0.134   -21.523 1.00 0.00 ? 98  ARG A CD   5  
ATOM 8274  N NE   . ARG A 1 98  ? 9.851   0.542   -22.910 1.00 0.00 ? 98  ARG A NE   5  
ATOM 8275  C CZ   . ARG A 1 98  ? 9.797   -0.328  -23.881 1.00 0.00 ? 98  ARG A CZ   5  
ATOM 8276  N NH1  . ARG A 1 98  ? 9.692   -1.601  -23.612 1.00 0.00 ? 98  ARG A NH1  5  
ATOM 8277  N NH2  . ARG A 1 98  ? 9.846   0.075   -25.122 1.00 0.00 ? 98  ARG A NH2  5  
ATOM 8278  H H    . ARG A 1 98  ? 10.240  0.773   -16.757 1.00 0.00 ? 98  ARG A H    5  
ATOM 8279  H HA   . ARG A 1 98  ? 9.520   2.800   -18.755 1.00 0.00 ? 98  ARG A HA   5  
ATOM 8280  H HB2  . ARG A 1 98  ? 8.943   -0.068  -19.130 1.00 0.00 ? 98  ARG A HB2  5  
ATOM 8281  H HB3  . ARG A 1 98  ? 7.531   0.979   -19.285 1.00 0.00 ? 98  ARG A HB3  5  
ATOM 8282  H HG2  . ARG A 1 98  ? 8.267   1.874   -21.230 1.00 0.00 ? 98  ARG A HG2  5  
ATOM 8283  H HG3  . ARG A 1 98  ? 9.918   2.038   -20.629 1.00 0.00 ? 98  ARG A HG3  5  
ATOM 8284  H HD2  . ARG A 1 98  ? 10.347  -0.329  -21.053 1.00 0.00 ? 98  ARG A HD2  5  
ATOM 8285  H HD3  . ARG A 1 98  ? 8.673   -0.569  -21.554 1.00 0.00 ? 98  ARG A HD3  5  
ATOM 8286  H HE   . ARG A 1 98  ? 10.126  1.464   -23.094 1.00 0.00 ? 98  ARG A HE   5  
ATOM 8287  H HH11 . ARG A 1 98  ? 9.654   -1.909  -22.661 1.00 0.00 ? 98  ARG A HH11 5  
ATOM 8288  H HH12 . ARG A 1 98  ? 9.650   -2.268  -24.356 1.00 0.00 ? 98  ARG A HH12 5  
ATOM 8289  H HH21 . ARG A 1 98  ? 9.926   1.050   -25.328 1.00 0.00 ? 98  ARG A HH21 5  
ATOM 8290  H HH22 . ARG A 1 98  ? 9.805   -0.592  -25.866 1.00 0.00 ? 98  ARG A HH22 5  
ATOM 8291  N N    . GLY A 1 99  ? 7.736   3.447   -17.128 1.00 0.00 ? 99  GLY A N    5  
ATOM 8292  C CA   . GLY A 1 99  ? 6.705   3.821   -16.119 1.00 0.00 ? 99  GLY A CA   5  
ATOM 8293  C C    . GLY A 1 99  ? 5.447   4.321   -16.832 1.00 0.00 ? 99  GLY A C    5  
ATOM 8294  O O    . GLY A 1 99  ? 4.355   4.260   -16.302 1.00 0.00 ? 99  GLY A O    5  
ATOM 8295  H H    . GLY A 1 99  ? 8.121   4.132   -17.713 1.00 0.00 ? 99  GLY A H    5  
ATOM 8296  H HA2  . GLY A 1 99  ? 6.458   2.957   -15.520 1.00 0.00 ? 99  GLY A HA2  5  
ATOM 8297  H HA3  . GLY A 1 99  ? 7.091   4.602   -15.482 1.00 0.00 ? 99  GLY A HA3  5  
ATOM 8298  N N    . VAL A 1 100 ? 5.589   4.816   -18.030 1.00 0.00 ? 100 VAL A N    5  
ATOM 8299  C CA   . VAL A 1 100 ? 4.399   5.320   -18.772 1.00 0.00 ? 100 VAL A CA   5  
ATOM 8300  C C    . VAL A 1 100 ? 4.718   5.380   -20.265 1.00 0.00 ? 100 VAL A C    5  
ATOM 8301  O O    . VAL A 1 100 ? 4.615   6.418   -20.890 1.00 0.00 ? 100 VAL A O    5  
ATOM 8302  C CB   . VAL A 1 100 ? 4.040   6.719   -18.270 1.00 0.00 ? 100 VAL A CB   5  
ATOM 8303  C CG1  . VAL A 1 100 ? 5.274   7.620   -18.335 1.00 0.00 ? 100 VAL A CG1  5  
ATOM 8304  C CG2  . VAL A 1 100 ? 2.934   7.307   -19.149 1.00 0.00 ? 100 VAL A CG2  5  
ATOM 8305  H H    . VAL A 1 100 ? 6.478   4.858   -18.441 1.00 0.00 ? 100 VAL A H    5  
ATOM 8306  H HA   . VAL A 1 100 ? 3.565   4.654   -18.608 1.00 0.00 ? 100 VAL A HA   5  
ATOM 8307  H HB   . VAL A 1 100 ? 3.695   6.657   -17.247 1.00 0.00 ? 100 VAL A HB   5  
ATOM 8308  H HG11 . VAL A 1 100 ? 6.162   7.026   -18.168 1.00 0.00 ? 100 VAL A HG11 5  
ATOM 8309  H HG12 . VAL A 1 100 ? 5.205   8.384   -17.575 1.00 0.00 ? 100 VAL A HG12 5  
ATOM 8310  H HG13 . VAL A 1 100 ? 5.329   8.084   -19.309 1.00 0.00 ? 100 VAL A HG13 5  
ATOM 8311  H HG21 . VAL A 1 100 ? 3.285   8.222   -19.605 1.00 0.00 ? 100 VAL A HG21 5  
ATOM 8312  H HG22 . VAL A 1 100 ? 2.066   7.516   -18.543 1.00 0.00 ? 100 VAL A HG22 5  
ATOM 8313  H HG23 . VAL A 1 100 ? 2.673   6.599   -19.921 1.00 0.00 ? 100 VAL A HG23 5  
ATOM 8314  N N    . SER A 1 101 ? 5.103   4.276   -20.845 1.00 0.00 ? 101 SER A N    5  
ATOM 8315  C CA   . SER A 1 101 ? 5.427   4.271   -22.298 1.00 0.00 ? 101 SER A CA   5  
ATOM 8316  C C    . SER A 1 101 ? 6.263   5.506   -22.639 1.00 0.00 ? 101 SER A C    5  
ATOM 8317  O O    . SER A 1 101 ? 6.805   6.101   -21.721 1.00 0.00 ? 101 SER A O    5  
ATOM 8318  C CB   . SER A 1 101 ? 4.131   4.294   -23.108 1.00 0.00 ? 101 SER A CB   5  
ATOM 8319  O OG   . SER A 1 101 ? 3.050   3.884   -22.279 1.00 0.00 ? 101 SER A OG   5  
ATOM 8320  O OXT  . SER A 1 101 ? 6.346   5.835   -23.810 1.00 0.00 ? 101 SER A OXT  5  
ATOM 8321  H H    . SER A 1 101 ? 5.178   3.450   -20.322 1.00 0.00 ? 101 SER A H    5  
ATOM 8322  H HA   . SER A 1 101 ? 5.987   3.379   -22.539 1.00 0.00 ? 101 SER A HA   5  
ATOM 8323  H HB2  . SER A 1 101 ? 3.945   5.292   -23.466 1.00 0.00 ? 101 SER A HB2  5  
ATOM 8324  H HB3  . SER A 1 101 ? 4.225   3.623   -23.953 1.00 0.00 ? 101 SER A HB3  5  
ATOM 8325  H HG   . SER A 1 101 ? 2.378   4.568   -22.309 1.00 0.00 ? 101 SER A HG   5  
ATOM 8326  N N    . GLU A 1 1   ? 10.123  14.218  -9.234  1.00 0.00 ? 1   GLU A N    6  
ATOM 8327  C CA   . GLU A 1 1   ? 11.322  13.472  -9.707  1.00 0.00 ? 1   GLU A CA   6  
ATOM 8328  C C    . GLU A 1 1   ? 12.111  12.958  -8.501  1.00 0.00 ? 1   GLU A C    6  
ATOM 8329  O O    . GLU A 1 1   ? 13.301  13.174  -8.388  1.00 0.00 ? 1   GLU A O    6  
ATOM 8330  C CB   . GLU A 1 1   ? 12.210  14.401  -10.535 1.00 0.00 ? 1   GLU A CB   6  
ATOM 8331  C CG   . GLU A 1 1   ? 13.296  13.581  -11.235 1.00 0.00 ? 1   GLU A CG   6  
ATOM 8332  C CD   . GLU A 1 1   ? 13.956  14.431  -12.322 1.00 0.00 ? 1   GLU A CD   6  
ATOM 8333  O OE1  . GLU A 1 1   ? 13.452  14.432  -13.432 1.00 0.00 ? 1   GLU A OE1  6  
ATOM 8334  O OE2  . GLU A 1 1   ? 14.954  15.068  -12.024 1.00 0.00 ? 1   GLU A OE2  6  
ATOM 8335  H H1   . GLU A 1 1   ? 9.369   14.153  -9.948  1.00 0.00 ? 1   GLU A H1   6  
ATOM 8336  H H2   . GLU A 1 1   ? 10.374  15.217  -9.085  1.00 0.00 ? 1   GLU A H2   6  
ATOM 8337  H H3   . GLU A 1 1   ? 9.787   13.806  -8.342  1.00 0.00 ? 1   GLU A H3   6  
ATOM 8338  H HA   . GLU A 1 1   ? 11.010  12.636  -10.315 1.00 0.00 ? 1   GLU A HA   6  
ATOM 8339  H HB2  . GLU A 1 1   ? 11.608  14.909  -11.275 1.00 0.00 ? 1   GLU A HB2  6  
ATOM 8340  H HB3  . GLU A 1 1   ? 12.675  15.130  -9.887  1.00 0.00 ? 1   GLU A HB3  6  
ATOM 8341  H HG2  . GLU A 1 1   ? 14.039  13.278  -10.511 1.00 0.00 ? 1   GLU A HG2  6  
ATOM 8342  H HG3  . GLU A 1 1   ? 12.853  12.706  -11.684 1.00 0.00 ? 1   GLU A HG3  6  
ATOM 8343  N N    . SER A 1 2   ? 11.457  12.278  -7.598  1.00 0.00 ? 2   SER A N    6  
ATOM 8344  C CA   . SER A 1 2   ? 12.172  11.752  -6.401  1.00 0.00 ? 2   SER A CA   6  
ATOM 8345  C C    . SER A 1 2   ? 11.625  10.365  -6.047  1.00 0.00 ? 2   SER A C    6  
ATOM 8346  O O    . SER A 1 2   ? 11.815  9.872   -4.954  1.00 0.00 ? 2   SER A O    6  
ATOM 8347  C CB   . SER A 1 2   ? 11.957  12.705  -5.225  1.00 0.00 ? 2   SER A CB   6  
ATOM 8348  O OG   . SER A 1 2   ? 13.181  13.366  -4.928  1.00 0.00 ? 2   SER A OG   6  
ATOM 8349  H H    . SER A 1 2   ? 10.498  12.114  -7.708  1.00 0.00 ? 2   SER A H    6  
ATOM 8350  H HA   . SER A 1 2   ? 13.227  11.678  -6.616  1.00 0.00 ? 2   SER A HA   6  
ATOM 8351  H HB2  . SER A 1 2   ? 11.212  13.438  -5.484  1.00 0.00 ? 2   SER A HB2  6  
ATOM 8352  H HB3  . SER A 1 2   ? 11.623  12.142  -4.365  1.00 0.00 ? 2   SER A HB3  6  
ATOM 8353  H HG   . SER A 1 2   ? 13.612  12.887  -4.218  1.00 0.00 ? 2   SER A HG   6  
ATOM 8354  N N    . LYS A 1 3   ? 10.949  9.732   -6.970  1.00 0.00 ? 3   LYS A N    6  
ATOM 8355  C CA   . LYS A 1 3   ? 10.390  8.376   -6.698  1.00 0.00 ? 3   LYS A CA   6  
ATOM 8356  C C    . LYS A 1 3   ? 10.717  7.445   -7.874  1.00 0.00 ? 3   LYS A C    6  
ATOM 8357  O O    . LYS A 1 3   ? 9.829   6.914   -8.512  1.00 0.00 ? 3   LYS A O    6  
ATOM 8358  C CB   . LYS A 1 3   ? 8.872   8.468   -6.524  1.00 0.00 ? 3   LYS A CB   6  
ATOM 8359  C CG   . LYS A 1 3   ? 8.339   9.685   -7.279  1.00 0.00 ? 3   LYS A CG   6  
ATOM 8360  C CD   . LYS A 1 3   ? 8.315   10.895  -6.343  1.00 0.00 ? 3   LYS A CD   6  
ATOM 8361  C CE   . LYS A 1 3   ? 7.628   12.068  -7.044  1.00 0.00 ? 3   LYS A CE   6  
ATOM 8362  N NZ   . LYS A 1 3   ? 6.654   12.702  -6.111  1.00 0.00 ? 3   LYS A NZ   6  
ATOM 8363  H H    . LYS A 1 3   ? 10.809  10.149  -7.843  1.00 0.00 ? 3   LYS A H    6  
ATOM 8364  H HA   . LYS A 1 3   ? 10.832  7.980   -5.795  1.00 0.00 ? 3   LYS A HA   6  
ATOM 8365  H HB2  . LYS A 1 3   ? 8.413   7.573   -6.917  1.00 0.00 ? 3   LYS A HB2  6  
ATOM 8366  H HB3  . LYS A 1 3   ? 8.634   8.565   -5.476  1.00 0.00 ? 3   LYS A HB3  6  
ATOM 8367  H HG2  . LYS A 1 3   ? 8.980   9.894   -8.123  1.00 0.00 ? 3   LYS A HG2  6  
ATOM 8368  H HG3  . LYS A 1 3   ? 7.342   9.481   -7.628  1.00 0.00 ? 3   LYS A HG3  6  
ATOM 8369  H HD2  . LYS A 1 3   ? 7.772   10.642  -5.444  1.00 0.00 ? 3   LYS A HD2  6  
ATOM 8370  H HD3  . LYS A 1 3   ? 9.327   11.174  -6.088  1.00 0.00 ? 3   LYS A HD3  6  
ATOM 8371  H HE2  . LYS A 1 3   ? 8.370   12.795  -7.339  1.00 0.00 ? 3   LYS A HE2  6  
ATOM 8372  H HE3  . LYS A 1 3   ? 7.107   11.709  -7.920  1.00 0.00 ? 3   LYS A HE3  6  
ATOM 8373  H HZ1  . LYS A 1 3   ? 5.819   12.091  -6.012  1.00 0.00 ? 3   LYS A HZ1  6  
ATOM 8374  H HZ2  . LYS A 1 3   ? 6.365   13.628  -6.490  1.00 0.00 ? 3   LYS A HZ2  6  
ATOM 8375  H HZ3  . LYS A 1 3   ? 7.098   12.832  -5.180  1.00 0.00 ? 3   LYS A HZ3  6  
ATOM 8376  N N    . PRO A 1 4   ? 11.994  7.281   -8.117  1.00 0.00 ? 4   PRO A N    6  
ATOM 8377  C CA   . PRO A 1 4   ? 12.505  6.423   -9.205  1.00 0.00 ? 4   PRO A CA   6  
ATOM 8378  C C    . PRO A 1 4   ? 12.380  4.901   -8.929  1.00 0.00 ? 4   PRO A C    6  
ATOM 8379  O O    . PRO A 1 4   ? 12.273  4.142   -9.872  1.00 0.00 ? 4   PRO A O    6  
ATOM 8380  C CB   . PRO A 1 4   ? 13.979  6.832   -9.319  1.00 0.00 ? 4   PRO A CB   6  
ATOM 8381  C CG   . PRO A 1 4   ? 14.363  7.468   -7.965  1.00 0.00 ? 4   PRO A CG   6  
ATOM 8382  C CD   . PRO A 1 4   ? 13.049  7.950   -7.326  1.00 0.00 ? 4   PRO A CD   6  
ATOM 8383  H HA   . PRO A 1 4   ? 12.006  6.666   -10.126 1.00 0.00 ? 4   PRO A HA   6  
ATOM 8384  H HB2  . PRO A 1 4   ? 14.591  5.961   -9.511  1.00 0.00 ? 4   PRO A HB2  6  
ATOM 8385  H HB3  . PRO A 1 4   ? 14.104  7.556   -10.109 1.00 0.00 ? 4   PRO A HB3  6  
ATOM 8386  H HG2  . PRO A 1 4   ? 14.843  6.733   -7.334  1.00 0.00 ? 4   PRO A HG2  6  
ATOM 8387  H HG3  . PRO A 1 4   ? 15.021  8.308   -8.124  1.00 0.00 ? 4   PRO A HG3  6  
ATOM 8388  H HD2  . PRO A 1 4   ? 12.992  7.650   -6.290  1.00 0.00 ? 4   PRO A HD2  6  
ATOM 8389  H HD3  . PRO A 1 4   ? 12.958  9.019   -7.418  1.00 0.00 ? 4   PRO A HD3  6  
ATOM 8390  N N    . PRO A 1 5   ? 12.416  4.465   -7.680  1.00 0.00 ? 5   PRO A N    6  
ATOM 8391  C CA   . PRO A 1 5   ? 12.327  3.022   -7.373  1.00 0.00 ? 5   PRO A CA   6  
ATOM 8392  C C    . PRO A 1 5   ? 10.912  2.473   -7.591  1.00 0.00 ? 5   PRO A C    6  
ATOM 8393  O O    . PRO A 1 5   ? 10.660  1.764   -8.545  1.00 0.00 ? 5   PRO A O    6  
ATOM 8394  C CB   . PRO A 1 5   ? 12.736  2.930   -5.900  1.00 0.00 ? 5   PRO A CB   6  
ATOM 8395  C CG   . PRO A 1 5   ? 12.508  4.332   -5.298  1.00 0.00 ? 5   PRO A CG   6  
ATOM 8396  C CD   . PRO A 1 5   ? 12.538  5.322   -6.478  1.00 0.00 ? 5   PRO A CD   6  
ATOM 8397  H HA   . PRO A 1 5   ? 13.032  2.473   -7.974  1.00 0.00 ? 5   PRO A HA   6  
ATOM 8398  H HB2  . PRO A 1 5   ? 12.123  2.199   -5.391  1.00 0.00 ? 5   PRO A HB2  6  
ATOM 8399  H HB3  . PRO A 1 5   ? 13.776  2.664   -5.818  1.00 0.00 ? 5   PRO A HB3  6  
ATOM 8400  H HG2  . PRO A 1 5   ? 11.548  4.369   -4.802  1.00 0.00 ? 5   PRO A HG2  6  
ATOM 8401  H HG3  . PRO A 1 5   ? 13.297  4.570   -4.602  1.00 0.00 ? 5   PRO A HG3  6  
ATOM 8402  H HD2  . PRO A 1 5   ? 11.707  6.004   -6.404  1.00 0.00 ? 5   PRO A HD2  6  
ATOM 8403  H HD3  . PRO A 1 5   ? 13.473  5.854   -6.493  1.00 0.00 ? 5   PRO A HD3  6  
ATOM 8404  N N    . TYR A 1 6   ? 9.994   2.763   -6.711  1.00 0.00 ? 6   TYR A N    6  
ATOM 8405  C CA   . TYR A 1 6   ? 8.620   2.215   -6.880  1.00 0.00 ? 6   TYR A CA   6  
ATOM 8406  C C    . TYR A 1 6   ? 7.788   3.112   -7.784  1.00 0.00 ? 6   TYR A C    6  
ATOM 8407  O O    . TYR A 1 6   ? 7.294   4.148   -7.388  1.00 0.00 ? 6   TYR A O    6  
ATOM 8408  C CB   . TYR A 1 6   ? 7.965   2.070   -5.513  1.00 0.00 ? 6   TYR A CB   6  
ATOM 8409  C CG   . TYR A 1 6   ? 8.609   0.913   -4.779  1.00 0.00 ? 6   TYR A CG   6  
ATOM 8410  C CD1  . TYR A 1 6   ? 9.764   0.294   -5.293  1.00 0.00 ? 6   TYR A CD1  6  
ATOM 8411  C CD2  . TYR A 1 6   ? 8.056   0.465   -3.580  1.00 0.00 ? 6   TYR A CD2  6  
ATOM 8412  C CE1  . TYR A 1 6   ? 10.355  -0.768  -4.598  1.00 0.00 ? 6   TYR A CE1  6  
ATOM 8413  C CE2  . TYR A 1 6   ? 8.647   -0.597  -2.887  1.00 0.00 ? 6   TYR A CE2  6  
ATOM 8414  C CZ   . TYR A 1 6   ? 9.798   -1.212  -3.396  1.00 0.00 ? 6   TYR A CZ   6  
ATOM 8415  O OH   . TYR A 1 6   ? 10.382  -2.257  -2.710  1.00 0.00 ? 6   TYR A OH   6  
ATOM 8416  H H    . TYR A 1 6   ? 10.209  3.317   -5.934  1.00 0.00 ? 6   TYR A H    6  
ATOM 8417  H HA   . TYR A 1 6   ? 8.685   1.240   -7.333  1.00 0.00 ? 6   TYR A HA   6  
ATOM 8418  H HB2  . TYR A 1 6   ? 8.105   2.980   -4.948  1.00 0.00 ? 6   TYR A HB2  6  
ATOM 8419  H HB3  . TYR A 1 6   ? 6.910   1.878   -5.634  1.00 0.00 ? 6   TYR A HB3  6  
ATOM 8420  H HD1  . TYR A 1 6   ? 10.195  0.635   -6.228  1.00 0.00 ? 6   TYR A HD1  6  
ATOM 8421  H HD2  . TYR A 1 6   ? 7.169   0.937   -3.193  1.00 0.00 ? 6   TYR A HD2  6  
ATOM 8422  H HE1  . TYR A 1 6   ? 11.243  -1.242  -4.989  1.00 0.00 ? 6   TYR A HE1  6  
ATOM 8423  H HE2  . TYR A 1 6   ? 8.217   -0.940  -1.958  1.00 0.00 ? 6   TYR A HE2  6  
ATOM 8424  H HH   . TYR A 1 6   ? 11.296  -2.022  -2.534  1.00 0.00 ? 6   TYR A HH   6  
ATOM 8425  N N    . SER A 1 7   ? 7.632   2.694   -9.003  1.00 0.00 ? 7   SER A N    6  
ATOM 8426  C CA   . SER A 1 7   ? 6.832   3.473   -9.981  1.00 0.00 ? 7   SER A CA   6  
ATOM 8427  C C    . SER A 1 7   ? 5.414   3.672   -9.442  1.00 0.00 ? 7   SER A C    6  
ATOM 8428  O O    . SER A 1 7   ? 5.100   3.281   -8.333  1.00 0.00 ? 7   SER A O    6  
ATOM 8429  C CB   . SER A 1 7   ? 6.768   2.688   -11.287 1.00 0.00 ? 7   SER A CB   6  
ATOM 8430  O OG   . SER A 1 7   ? 7.896   3.013   -12.088 1.00 0.00 ? 7   SER A OG   6  
ATOM 8431  H H    . SER A 1 7   ? 8.045   1.848   -9.277  1.00 0.00 ? 7   SER A H    6  
ATOM 8432  H HA   . SER A 1 7   ? 7.297   4.432   -10.154 1.00 0.00 ? 7   SER A HA   6  
ATOM 8433  H HB2  . SER A 1 7   ? 6.778   1.631   -11.066 1.00 0.00 ? 7   SER A HB2  6  
ATOM 8434  H HB3  . SER A 1 7   ? 5.854   2.936   -11.812 1.00 0.00 ? 7   SER A HB3  6  
ATOM 8435  H HG   . SER A 1 7   ? 8.572   2.348   -11.934 1.00 0.00 ? 7   SER A HG   6  
ATOM 8436  N N    . TYR A 1 8   ? 4.552   4.267   -10.218 1.00 0.00 ? 8   TYR A N    6  
ATOM 8437  C CA   . TYR A 1 8   ? 3.153   4.478   -9.753  1.00 0.00 ? 8   TYR A CA   6  
ATOM 8438  C C    . TYR A 1 8   ? 2.252   3.403   -10.364 1.00 0.00 ? 8   TYR A C    6  
ATOM 8439  O O    . TYR A 1 8   ? 1.340   3.685   -11.116 1.00 0.00 ? 8   TYR A O    6  
ATOM 8440  C CB   . TYR A 1 8   ? 2.680   5.865   -10.181 1.00 0.00 ? 8   TYR A CB   6  
ATOM 8441  C CG   . TYR A 1 8   ? 3.368   6.905   -9.329  1.00 0.00 ? 8   TYR A CG   6  
ATOM 8442  C CD1  . TYR A 1 8   ? 4.764   7.006   -9.340  1.00 0.00 ? 8   TYR A CD1  6  
ATOM 8443  C CD2  . TYR A 1 8   ? 2.611   7.764   -8.527  1.00 0.00 ? 8   TYR A CD2  6  
ATOM 8444  C CE1  . TYR A 1 8   ? 5.402   7.967   -8.550  1.00 0.00 ? 8   TYR A CE1  6  
ATOM 8445  C CE2  . TYR A 1 8   ? 3.249   8.728   -7.737  1.00 0.00 ? 8   TYR A CE2  6  
ATOM 8446  C CZ   . TYR A 1 8   ? 4.645   8.830   -7.749  1.00 0.00 ? 8   TYR A CZ   6  
ATOM 8447  O OH   . TYR A 1 8   ? 5.274   9.781   -6.972  1.00 0.00 ? 8   TYR A OH   6  
ATOM 8448  H H    . TYR A 1 8   ? 4.822   4.569   -11.111 1.00 0.00 ? 8   TYR A H    6  
ATOM 8449  H HA   . TYR A 1 8   ? 3.120   4.404   -8.676  1.00 0.00 ? 8   TYR A HA   6  
ATOM 8450  H HB2  . TYR A 1 8   ? 2.926   6.026   -11.220 1.00 0.00 ? 8   TYR A HB2  6  
ATOM 8451  H HB3  . TYR A 1 8   ? 1.613   5.938   -10.045 1.00 0.00 ? 8   TYR A HB3  6  
ATOM 8452  H HD1  . TYR A 1 8   ? 5.351   6.339   -9.956  1.00 0.00 ? 8   TYR A HD1  6  
ATOM 8453  H HD2  . TYR A 1 8   ? 1.533   7.686   -8.516  1.00 0.00 ? 8   TYR A HD2  6  
ATOM 8454  H HE1  . TYR A 1 8   ? 6.479   8.044   -8.558  1.00 0.00 ? 8   TYR A HE1  6  
ATOM 8455  H HE2  . TYR A 1 8   ? 2.664   9.390   -7.118  1.00 0.00 ? 8   TYR A HE2  6  
ATOM 8456  H HH   . TYR A 1 8   ? 5.323   9.446   -6.074  1.00 0.00 ? 8   TYR A HH   6  
ATOM 8457  N N    . ALA A 1 9   ? 2.513   2.170   -10.037 1.00 0.00 ? 9   ALA A N    6  
ATOM 8458  C CA   . ALA A 1 9   ? 1.698   1.043   -10.577 1.00 0.00 ? 9   ALA A CA   6  
ATOM 8459  C C    . ALA A 1 9   ? 2.150   -0.242  -9.887  1.00 0.00 ? 9   ALA A C    6  
ATOM 8460  O O    . ALA A 1 9   ? 1.357   -1.084  -9.520  1.00 0.00 ? 9   ALA A O    6  
ATOM 8461  C CB   . ALA A 1 9   ? 1.922   0.922   -12.085 1.00 0.00 ? 9   ALA A CB   6  
ATOM 8462  H H    . ALA A 1 9   ? 3.258   1.981   -9.428  1.00 0.00 ? 9   ALA A H    6  
ATOM 8463  H HA   . ALA A 1 9   ? 0.652   1.218   -10.373 1.00 0.00 ? 9   ALA A HA   6  
ATOM 8464  H HB1  . ALA A 1 9   ? 1.287   0.145   -12.482 1.00 0.00 ? 9   ALA A HB1  6  
ATOM 8465  H HB2  . ALA A 1 9   ? 2.956   0.675   -12.276 1.00 0.00 ? 9   ALA A HB2  6  
ATOM 8466  H HB3  . ALA A 1 9   ? 1.682   1.862   -12.560 1.00 0.00 ? 9   ALA A HB3  6  
ATOM 8467  N N    . GLN A 1 10  ? 3.430   -0.363  -9.675  1.00 0.00 ? 10  GLN A N    6  
ATOM 8468  C CA   . GLN A 1 10  ? 3.988   -1.547  -8.970  1.00 0.00 ? 10  GLN A CA   6  
ATOM 8469  C C    . GLN A 1 10  ? 4.024   -1.192  -7.494  1.00 0.00 ? 10  GLN A C    6  
ATOM 8470  O O    . GLN A 1 10  ? 3.952   -2.035  -6.622  1.00 0.00 ? 10  GLN A O    6  
ATOM 8471  C CB   . GLN A 1 10  ? 5.407   -1.817  -9.472  1.00 0.00 ? 10  GLN A CB   6  
ATOM 8472  C CG   . GLN A 1 10  ? 6.096   -2.808  -8.536  1.00 0.00 ? 10  GLN A CG   6  
ATOM 8473  C CD   . GLN A 1 10  ? 7.196   -2.094  -7.748  1.00 0.00 ? 10  GLN A CD   6  
ATOM 8474  O OE1  . GLN A 1 10  ? 8.199   -2.687  -7.407  1.00 0.00 ? 10  GLN A OE1  6  
ATOM 8475  N NE2  . GLN A 1 10  ? 7.048   -0.834  -7.440  1.00 0.00 ? 10  GLN A NE2  6  
ATOM 8476  H H    . GLN A 1 10  ? 4.026   0.357   -9.947  1.00 0.00 ? 10  GLN A H    6  
ATOM 8477  H HA   . GLN A 1 10  ? 3.363   -2.416  -9.128  1.00 0.00 ? 10  GLN A HA   6  
ATOM 8478  H HB2  . GLN A 1 10  ? 5.365   -2.230  -10.469 1.00 0.00 ? 10  GLN A HB2  6  
ATOM 8479  H HB3  . GLN A 1 10  ? 5.966   -0.892  -9.489  1.00 0.00 ? 10  GLN A HB3  6  
ATOM 8480  H HG2  . GLN A 1 10  ? 5.369   -3.216  -7.850  1.00 0.00 ? 10  GLN A HG2  6  
ATOM 8481  H HG3  . GLN A 1 10  ? 6.533   -3.607  -9.116  1.00 0.00 ? 10  GLN A HG3  6  
ATOM 8482  H HE21 . GLN A 1 10  ? 6.240   -0.353  -7.714  1.00 0.00 ? 10  GLN A HE21 6  
ATOM 8483  H HE22 . GLN A 1 10  ? 7.747   -0.369  -6.933  1.00 0.00 ? 10  GLN A HE22 6  
ATOM 8484  N N    . LEU A 1 11  ? 4.106   0.081   -7.225  1.00 0.00 ? 11  LEU A N    6  
ATOM 8485  C CA   . LEU A 1 11  ? 4.116   0.565   -5.830  1.00 0.00 ? 11  LEU A CA   6  
ATOM 8486  C C    . LEU A 1 11  ? 2.888   -0.009  -5.125  1.00 0.00 ? 11  LEU A C    6  
ATOM 8487  O O    . LEU A 1 11  ? 2.905   -0.306  -3.948  1.00 0.00 ? 11  LEU A O    6  
ATOM 8488  C CB   . LEU A 1 11  ? 4.028   2.087   -5.872  1.00 0.00 ? 11  LEU A CB   6  
ATOM 8489  C CG   . LEU A 1 11  ? 3.927   2.644   -4.462  1.00 0.00 ? 11  LEU A CG   6  
ATOM 8490  C CD1  . LEU A 1 11  ? 5.326   2.973   -3.963  1.00 0.00 ? 11  LEU A CD1  6  
ATOM 8491  C CD2  . LEU A 1 11  ? 3.085   3.916   -4.488  1.00 0.00 ? 11  LEU A CD2  6  
ATOM 8492  H H    . LEU A 1 11  ? 4.142   0.728   -7.958  1.00 0.00 ? 11  LEU A H    6  
ATOM 8493  H HA   . LEU A 1 11  ? 5.024   0.257   -5.330  1.00 0.00 ? 11  LEU A HA   6  
ATOM 8494  H HB2  . LEU A 1 11  ? 4.911   2.485   -6.351  1.00 0.00 ? 11  LEU A HB2  6  
ATOM 8495  H HB3  . LEU A 1 11  ? 3.153   2.381   -6.434  1.00 0.00 ? 11  LEU A HB3  6  
ATOM 8496  H HG   . LEU A 1 11  ? 3.468   1.913   -3.812  1.00 0.00 ? 11  LEU A HG   6  
ATOM 8497  H HD11 . LEU A 1 11  ? 5.749   2.104   -3.488  1.00 0.00 ? 11  LEU A HD11 6  
ATOM 8498  H HD12 . LEU A 1 11  ? 5.271   3.785   -3.256  1.00 0.00 ? 11  LEU A HD12 6  
ATOM 8499  H HD13 . LEU A 1 11  ? 5.943   3.263   -4.801  1.00 0.00 ? 11  LEU A HD13 6  
ATOM 8500  H HD21 . LEU A 1 11  ? 3.721   4.769   -4.301  1.00 0.00 ? 11  LEU A HD21 6  
ATOM 8501  H HD22 . LEU A 1 11  ? 2.323   3.859   -3.728  1.00 0.00 ? 11  LEU A HD22 6  
ATOM 8502  H HD23 . LEU A 1 11  ? 2.622   4.019   -5.459  1.00 0.00 ? 11  LEU A HD23 6  
ATOM 8503  N N    . ILE A 1 12  ? 1.827   -0.177  -5.865  1.00 0.00 ? 12  ILE A N    6  
ATOM 8504  C CA   . ILE A 1 12  ? 0.568   -0.750  -5.282  1.00 0.00 ? 12  ILE A CA   6  
ATOM 8505  C C    . ILE A 1 12  ? 0.648   -2.266  -5.288  1.00 0.00 ? 12  ILE A C    6  
ATOM 8506  O O    . ILE A 1 12  ? 0.312   -2.914  -4.330  1.00 0.00 ? 12  ILE A O    6  
ATOM 8507  C CB   . ILE A 1 12  ? -0.635  -0.369  -6.132  1.00 0.00 ? 12  ILE A CB   6  
ATOM 8508  C CG1  . ILE A 1 12  ? -0.483  1.077   -6.655  1.00 0.00 ? 12  ILE A CG1  6  
ATOM 8509  C CG2  . ILE A 1 12  ? -1.893  -0.536  -5.284  1.00 0.00 ? 12  ILE A CG2  6  
ATOM 8510  C CD1  . ILE A 1 12  ? -1.749  1.910   -6.404  1.00 0.00 ? 12  ILE A CD1  6  
ATOM 8511  H H    . ILE A 1 12  ? 1.868   0.070   -6.819  1.00 0.00 ? 12  ILE A H    6  
ATOM 8512  H HA   . ILE A 1 12  ? 0.423   -0.404  -4.268  1.00 0.00 ? 12  ILE A HA   6  
ATOM 8513  H HB   . ILE A 1 12  ? -0.692  -1.051  -6.966  1.00 0.00 ? 12  ILE A HB   6  
ATOM 8514  H HG12 . ILE A 1 12  ? 0.354   1.547   -6.162  1.00 0.00 ? 12  ILE A HG12 6  
ATOM 8515  H HG13 . ILE A 1 12  ? -0.294  1.045   -7.716  1.00 0.00 ? 12  ILE A HG13 6  
ATOM 8516  H HG21 . ILE A 1 12  ? -1.839  0.117   -4.429  1.00 0.00 ? 12  ILE A HG21 6  
ATOM 8517  H HG22 . ILE A 1 12  ? -1.963  -1.561  -4.951  1.00 0.00 ? 12  ILE A HG22 6  
ATOM 8518  H HG23 . ILE A 1 12  ? -2.760  -0.288  -5.875  1.00 0.00 ? 12  ILE A HG23 6  
ATOM 8519  H HD11 . ILE A 1 12  ? -1.804  2.708   -7.131  1.00 0.00 ? 12  ILE A HD11 6  
ATOM 8520  H HD12 . ILE A 1 12  ? -1.710  2.333   -5.415  1.00 0.00 ? 12  ILE A HD12 6  
ATOM 8521  H HD13 . ILE A 1 12  ? -2.622  1.285   -6.490  1.00 0.00 ? 12  ILE A HD13 6  
ATOM 8522  N N    . VAL A 1 13  ? 1.049   -2.831  -6.381  1.00 0.00 ? 13  VAL A N    6  
ATOM 8523  C CA   . VAL A 1 13  ? 1.107   -4.312  -6.478  1.00 0.00 ? 13  VAL A CA   6  
ATOM 8524  C C    . VAL A 1 13  ? 1.843   -4.904  -5.280  1.00 0.00 ? 13  VAL A C    6  
ATOM 8525  O O    . VAL A 1 13  ? 1.328   -5.765  -4.598  1.00 0.00 ? 13  VAL A O    6  
ATOM 8526  C CB   . VAL A 1 13  ? 1.842   -4.689  -7.756  1.00 0.00 ? 13  VAL A CB   6  
ATOM 8527  C CG1  . VAL A 1 13  ? 1.872   -6.206  -7.882  1.00 0.00 ? 13  VAL A CG1  6  
ATOM 8528  C CG2  . VAL A 1 13  ? 1.110   -4.079  -8.953  1.00 0.00 ? 13  VAL A CG2  6  
ATOM 8529  H H    . VAL A 1 13  ? 1.275   -2.282  -7.159  1.00 0.00 ? 13  VAL A H    6  
ATOM 8530  H HA   . VAL A 1 13  ? 0.106   -4.708  -6.512  1.00 0.00 ? 13  VAL A HA   6  
ATOM 8531  H HB   . VAL A 1 13  ? 2.853   -4.309  -7.716  1.00 0.00 ? 13  VAL A HB   6  
ATOM 8532  H HG11 . VAL A 1 13  ? 0.885   -6.602  -7.706  1.00 0.00 ? 13  VAL A HG11 6  
ATOM 8533  H HG12 . VAL A 1 13  ? 2.556   -6.610  -7.151  1.00 0.00 ? 13  VAL A HG12 6  
ATOM 8534  H HG13 . VAL A 1 13  ? 2.197   -6.478  -8.872  1.00 0.00 ? 13  VAL A HG13 6  
ATOM 8535  H HG21 . VAL A 1 13  ? 1.643   -4.310  -9.860  1.00 0.00 ? 13  VAL A HG21 6  
ATOM 8536  H HG22 . VAL A 1 13  ? 1.053   -3.009  -8.830  1.00 0.00 ? 13  VAL A HG22 6  
ATOM 8537  H HG23 . VAL A 1 13  ? 0.111   -4.481  -9.008  1.00 0.00 ? 13  VAL A HG23 6  
ATOM 8538  N N    . GLN A 1 14  ? 3.033   -4.468  -5.008  1.00 0.00 ? 14  GLN A N    6  
ATOM 8539  C CA   . GLN A 1 14  ? 3.763   -5.033  -3.844  1.00 0.00 ? 14  GLN A CA   6  
ATOM 8540  C C    . GLN A 1 14  ? 3.054   -4.608  -2.561  1.00 0.00 ? 14  GLN A C    6  
ATOM 8541  O O    . GLN A 1 14  ? 3.186   -5.229  -1.526  1.00 0.00 ? 14  GLN A O    6  
ATOM 8542  C CB   . GLN A 1 14  ? 5.191   -4.506  -3.825  1.00 0.00 ? 14  GLN A CB   6  
ATOM 8543  C CG   . GLN A 1 14  ? 5.980   -5.232  -2.736  1.00 0.00 ? 14  GLN A CG   6  
ATOM 8544  C CD   . GLN A 1 14  ? 7.370   -4.617  -2.629  1.00 0.00 ? 14  GLN A CD   6  
ATOM 8545  O OE1  . GLN A 1 14  ? 8.339   -5.309  -2.388  1.00 0.00 ? 14  GLN A OE1  6  
ATOM 8546  N NE2  . GLN A 1 14  ? 7.510   -3.334  -2.798  1.00 0.00 ? 14  GLN A NE2  6  
ATOM 8547  H H    . GLN A 1 14  ? 3.446   -3.774  -5.563  1.00 0.00 ? 14  GLN A H    6  
ATOM 8548  H HA   . GLN A 1 14  ? 3.774   -6.111  -3.912  1.00 0.00 ? 14  GLN A HA   6  
ATOM 8549  H HB2  . GLN A 1 14  ? 5.654   -4.677  -4.786  1.00 0.00 ? 14  GLN A HB2  6  
ATOM 8550  H HB3  . GLN A 1 14  ? 5.176   -3.449  -3.615  1.00 0.00 ? 14  GLN A HB3  6  
ATOM 8551  H HG2  . GLN A 1 14  ? 5.466   -5.132  -1.791  1.00 0.00 ? 14  GLN A HG2  6  
ATOM 8552  H HG3  . GLN A 1 14  ? 6.068   -6.277  -2.991  1.00 0.00 ? 14  GLN A HG3  6  
ATOM 8553  H HE21 . GLN A 1 14  ? 6.731   -2.774  -2.988  1.00 0.00 ? 14  GLN A HE21 6  
ATOM 8554  H HE22 . GLN A 1 14  ? 8.394   -2.933  -2.746  1.00 0.00 ? 14  GLN A HE22 6  
ATOM 8555  N N    . ALA A 1 15  ? 2.306   -3.548  -2.620  1.00 0.00 ? 15  ALA A N    6  
ATOM 8556  C CA   . ALA A 1 15  ? 1.590   -3.071  -1.409  1.00 0.00 ? 15  ALA A CA   6  
ATOM 8557  C C    . ALA A 1 15  ? 0.480   -4.057  -1.037  1.00 0.00 ? 15  ALA A C    6  
ATOM 8558  O O    . ALA A 1 15  ? 0.335   -4.440  0.104   1.00 0.00 ? 15  ALA A O    6  
ATOM 8559  C CB   . ALA A 1 15  ? 0.971   -1.705  -1.703  1.00 0.00 ? 15  ALA A CB   6  
ATOM 8560  H H    . ALA A 1 15  ? 2.219   -3.060  -3.465  1.00 0.00 ? 15  ALA A H    6  
ATOM 8561  H HA   . ALA A 1 15  ? 2.286   -2.982  -0.588  1.00 0.00 ? 15  ALA A HA   6  
ATOM 8562  H HB1  . ALA A 1 15  ? 0.257   -1.800  -2.510  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 8563  H HB2  . ALA A 1 15  ? 1.747   -1.011  -1.991  1.00 0.00 ? 15  ALA A HB2  6  
ATOM 8564  H HB3  . ALA A 1 15  ? 0.468   -1.338  -0.821  1.00 0.00 ? 15  ALA A HB3  6  
ATOM 8565  N N    . ILE A 1 16  ? -0.310  -4.458  -1.992  1.00 0.00 ? 16  ILE A N    6  
ATOM 8566  C CA   . ILE A 1 16  ? -1.427  -5.406  -1.698  1.00 0.00 ? 16  ILE A CA   6  
ATOM 8567  C C    . ILE A 1 16  ? -0.936  -6.855  -1.782  1.00 0.00 ? 16  ILE A C    6  
ATOM 8568  O O    . ILE A 1 16  ? -1.077  -7.623  -0.852  1.00 0.00 ? 16  ILE A O    6  
ATOM 8569  C CB   . ILE A 1 16  ? -2.588  -5.207  -2.691  1.00 0.00 ? 16  ILE A CB   6  
ATOM 8570  C CG1  . ILE A 1 16  ? -2.248  -4.131  -3.733  1.00 0.00 ? 16  ILE A CG1  6  
ATOM 8571  C CG2  . ILE A 1 16  ? -3.823  -4.761  -1.920  1.00 0.00 ? 16  ILE A CG2  6  
ATOM 8572  C CD1  . ILE A 1 16  ? -3.530  -3.647  -4.424  1.00 0.00 ? 16  ILE A CD1  6  
ATOM 8573  H H    . ILE A 1 16  ? -0.171  -4.131  -2.900  1.00 0.00 ? 16  ILE A H    6  
ATOM 8574  H HA   . ILE A 1 16  ? -1.788  -5.218  -0.698  1.00 0.00 ? 16  ILE A HA   6  
ATOM 8575  H HB   . ILE A 1 16  ? -2.798  -6.142  -3.191  1.00 0.00 ? 16  ILE A HB   6  
ATOM 8576  H HG12 . ILE A 1 16  ? -1.771  -3.297  -3.240  1.00 0.00 ? 16  ILE A HG12 6  
ATOM 8577  H HG13 . ILE A 1 16  ? -1.578  -4.545  -4.470  1.00 0.00 ? 16  ILE A HG13 6  
ATOM 8578  H HG21 . ILE A 1 16  ? -3.950  -5.387  -1.052  1.00 0.00 ? 16  ILE A HG21 6  
ATOM 8579  H HG22 . ILE A 1 16  ? -4.689  -4.840  -2.558  1.00 0.00 ? 16  ILE A HG22 6  
ATOM 8580  H HG23 . ILE A 1 16  ? -3.695  -3.735  -1.610  1.00 0.00 ? 16  ILE A HG23 6  
ATOM 8581  H HD11 . ILE A 1 16  ? -4.226  -3.287  -3.680  1.00 0.00 ? 16  ILE A HD11 6  
ATOM 8582  H HD12 . ILE A 1 16  ? -3.977  -4.466  -4.968  1.00 0.00 ? 16  ILE A HD12 6  
ATOM 8583  H HD13 . ILE A 1 16  ? -3.291  -2.848  -5.108  1.00 0.00 ? 16  ILE A HD13 6  
ATOM 8584  N N    . SER A 1 17  ? -0.389  -7.240  -2.900  1.00 0.00 ? 17  SER A N    6  
ATOM 8585  C CA   . SER A 1 17  ? 0.085   -8.645  -3.069  1.00 0.00 ? 17  SER A CA   6  
ATOM 8586  C C    . SER A 1 17  ? 1.157   -9.000  -2.032  1.00 0.00 ? 17  SER A C    6  
ATOM 8587  O O    . SER A 1 17  ? 1.234   -10.123 -1.575  1.00 0.00 ? 17  SER A O    6  
ATOM 8588  C CB   . SER A 1 17  ? 0.673   -8.810  -4.471  1.00 0.00 ? 17  SER A CB   6  
ATOM 8589  O OG   . SER A 1 17  ? 0.152   -7.796  -5.321  1.00 0.00 ? 17  SER A OG   6  
ATOM 8590  H H    . SER A 1 17  ? -0.311  -6.606  -3.643  1.00 0.00 ? 17  SER A H    6  
ATOM 8591  H HA   . SER A 1 17  ? -0.752  -9.317  -2.958  1.00 0.00 ? 17  SER A HA   6  
ATOM 8592  H HB2  . SER A 1 17  ? 1.745   -8.718  -4.428  1.00 0.00 ? 17  SER A HB2  6  
ATOM 8593  H HB3  . SER A 1 17  ? 0.412   -9.786  -4.857  1.00 0.00 ? 17  SER A HB3  6  
ATOM 8594  H HG   . SER A 1 17  ? -0.216  -8.222  -6.098  1.00 0.00 ? 17  SER A HG   6  
ATOM 8595  N N    . SER A 1 18  ? 2.001   -8.072  -1.669  1.00 0.00 ? 18  SER A N    6  
ATOM 8596  C CA   . SER A 1 18  ? 3.072   -8.398  -0.680  1.00 0.00 ? 18  SER A CA   6  
ATOM 8597  C C    . SER A 1 18  ? 2.536   -8.289  0.750   1.00 0.00 ? 18  SER A C    6  
ATOM 8598  O O    . SER A 1 18  ? 3.227   -8.600  1.701   1.00 0.00 ? 18  SER A O    6  
ATOM 8599  C CB   . SER A 1 18  ? 4.246   -7.437  -0.860  1.00 0.00 ? 18  SER A CB   6  
ATOM 8600  O OG   . SER A 1 18  ? 5.457   -8.114  -0.550  1.00 0.00 ? 18  SER A OG   6  
ATOM 8601  H H    . SER A 1 18  ? 1.943   -7.173  -2.056  1.00 0.00 ? 18  SER A H    6  
ATOM 8602  H HA   . SER A 1 18  ? 3.414   -9.408  -0.853  1.00 0.00 ? 18  SER A HA   6  
ATOM 8603  H HB2  . SER A 1 18  ? 4.282   -7.096  -1.882  1.00 0.00 ? 18  SER A HB2  6  
ATOM 8604  H HB3  . SER A 1 18  ? 4.118   -6.586  -0.204  1.00 0.00 ? 18  SER A HB3  6  
ATOM 8605  H HG   . SER A 1 18  ? 5.300   -8.661  0.223   1.00 0.00 ? 18  SER A HG   6  
ATOM 8606  N N    . ALA A 1 19  ? 1.316   -7.859  0.924   1.00 0.00 ? 19  ALA A N    6  
ATOM 8607  C CA   . ALA A 1 19  ? 0.768   -7.752  2.308   1.00 0.00 ? 19  ALA A CA   6  
ATOM 8608  C C    . ALA A 1 19  ? -0.023  -9.017  2.632   1.00 0.00 ? 19  ALA A C    6  
ATOM 8609  O O    . ALA A 1 19  ? -0.545  -9.668  1.748   1.00 0.00 ? 19  ALA A O    6  
ATOM 8610  C CB   . ALA A 1 19  ? -0.157  -6.538  2.404   1.00 0.00 ? 19  ALA A CB   6  
ATOM 8611  H H    . ALA A 1 19  ? 0.760   -7.615  0.152   1.00 0.00 ? 19  ALA A H    6  
ATOM 8612  H HA   . ALA A 1 19  ? 1.580   -7.645  3.011   1.00 0.00 ? 19  ALA A HA   6  
ATOM 8613  H HB1  . ALA A 1 19  ? -0.018  -6.055  3.361   1.00 0.00 ? 19  ALA A HB1  6  
ATOM 8614  H HB2  . ALA A 1 19  ? -1.184  -6.858  2.308   1.00 0.00 ? 19  ALA A HB2  6  
ATOM 8615  H HB3  . ALA A 1 19  ? 0.079   -5.843  1.614   1.00 0.00 ? 19  ALA A HB3  6  
ATOM 8616  N N    . GLN A 1 20  ? -0.127  -9.372  3.888   1.00 0.00 ? 20  GLN A N    6  
ATOM 8617  C CA   . GLN A 1 20  ? -0.899  -10.596 4.245   1.00 0.00 ? 20  GLN A CA   6  
ATOM 8618  C C    . GLN A 1 20  ? -2.196  -10.592 3.441   1.00 0.00 ? 20  GLN A C    6  
ATOM 8619  O O    . GLN A 1 20  ? -2.537  -11.553 2.781   1.00 0.00 ? 20  GLN A O    6  
ATOM 8620  C CB   . GLN A 1 20  ? -1.223  -10.591 5.741   1.00 0.00 ? 20  GLN A CB   6  
ATOM 8621  C CG   . GLN A 1 20  ? -1.912  -11.906 6.115   1.00 0.00 ? 20  GLN A CG   6  
ATOM 8622  C CD   . GLN A 1 20  ? -2.656  -11.738 7.441   1.00 0.00 ? 20  GLN A CD   6  
ATOM 8623  O OE1  . GLN A 1 20  ? -2.109  -11.992 8.495   1.00 0.00 ? 20  GLN A OE1  6  
ATOM 8624  N NE2  . GLN A 1 20  ? -3.891  -11.315 7.434   1.00 0.00 ? 20  GLN A NE2  6  
ATOM 8625  H H    . GLN A 1 20  ? 0.297   -8.834  4.588   1.00 0.00 ? 20  GLN A H    6  
ATOM 8626  H HA   . GLN A 1 20  ? -0.323  -11.476 3.999   1.00 0.00 ? 20  GLN A HA   6  
ATOM 8627  H HB2  . GLN A 1 20  ? -0.309  -10.487 6.308   1.00 0.00 ? 20  GLN A HB2  6  
ATOM 8628  H HB3  . GLN A 1 20  ? -1.882  -9.766  5.965   1.00 0.00 ? 20  GLN A HB3  6  
ATOM 8629  H HG2  . GLN A 1 20  ? -2.614  -12.177 5.340   1.00 0.00 ? 20  GLN A HG2  6  
ATOM 8630  H HG3  . GLN A 1 20  ? -1.171  -12.685 6.217   1.00 0.00 ? 20  GLN A HG3  6  
ATOM 8631  H HE21 . GLN A 1 20  ? -4.333  -11.109 6.583   1.00 0.00 ? 20  GLN A HE21 6  
ATOM 8632  H HE22 . GLN A 1 20  ? -4.377  -11.206 8.277   1.00 0.00 ? 20  GLN A HE22 6  
ATOM 8633  N N    . ASP A 1 21  ? -2.908  -9.500  3.473   1.00 0.00 ? 21  ASP A N    6  
ATOM 8634  C CA   . ASP A 1 21  ? -4.166  -9.409  2.691   1.00 0.00 ? 21  ASP A CA   6  
ATOM 8635  C C    . ASP A 1 21  ? -3.841  -8.839  1.305   1.00 0.00 ? 21  ASP A C    6  
ATOM 8636  O O    . ASP A 1 21  ? -3.284  -7.765  1.185   1.00 0.00 ? 21  ASP A O    6  
ATOM 8637  C CB   . ASP A 1 21  ? -5.153  -8.486  3.409   1.00 0.00 ? 21  ASP A CB   6  
ATOM 8638  C CG   . ASP A 1 21  ? -6.182  -9.329  4.165   1.00 0.00 ? 21  ASP A CG   6  
ATOM 8639  O OD1  . ASP A 1 21  ? -5.772  -10.234 4.873   1.00 0.00 ? 21  ASP A OD1  6  
ATOM 8640  O OD2  . ASP A 1 21  ? -7.363  -9.055  4.024   1.00 0.00 ? 21  ASP A OD2  6  
ATOM 8641  H H    . ASP A 1 21  ? -2.601  -8.731  3.998   1.00 0.00 ? 21  ASP A H    6  
ATOM 8642  H HA   . ASP A 1 21  ? -4.598  -10.394 2.591   1.00 0.00 ? 21  ASP A HA   6  
ATOM 8643  H HB2  . ASP A 1 21  ? -4.617  -7.858  4.106   1.00 0.00 ? 21  ASP A HB2  6  
ATOM 8644  H HB3  . ASP A 1 21  ? -5.661  -7.868  2.683   1.00 0.00 ? 21  ASP A HB3  6  
ATOM 8645  N N    . ARG A 1 22  ? -4.178  -9.542  0.256   1.00 0.00 ? 22  ARG A N    6  
ATOM 8646  C CA   . ARG A 1 22  ? -3.880  -9.032  -1.114  1.00 0.00 ? 22  ARG A CA   6  
ATOM 8647  C C    . ARG A 1 22  ? -4.726  -7.788  -1.408  1.00 0.00 ? 22  ARG A C    6  
ATOM 8648  O O    . ARG A 1 22  ? -4.600  -7.176  -2.454  1.00 0.00 ? 22  ARG A O    6  
ATOM 8649  C CB   . ARG A 1 22  ? -4.207  -10.118 -2.141  1.00 0.00 ? 22  ARG A CB   6  
ATOM 8650  C CG   . ARG A 1 22  ? -5.691  -10.480 -2.044  1.00 0.00 ? 22  ARG A CG   6  
ATOM 8651  C CD   . ARG A 1 22  ? -6.092  -11.328 -3.253  1.00 0.00 ? 22  ARG A CD   6  
ATOM 8652  N NE   . ARG A 1 22  ? -7.116  -12.328 -2.842  1.00 0.00 ? 22  ARG A NE   6  
ATOM 8653  C CZ   . ARG A 1 22  ? -8.145  -11.957 -2.127  1.00 0.00 ? 22  ARG A CZ   6  
ATOM 8654  N NH1  . ARG A 1 22  ? -8.061  -11.940 -0.825  1.00 0.00 ? 22  ARG A NH1  6  
ATOM 8655  N NH2  . ARG A 1 22  ? -9.256  -11.606 -2.714  1.00 0.00 ? 22  ARG A NH2  6  
ATOM 8656  H H    . ARG A 1 22  ? -4.620  -10.406 0.366   1.00 0.00 ? 22  ARG A H    6  
ATOM 8657  H HA   . ARG A 1 22  ? -2.832  -8.779  -1.183  1.00 0.00 ? 22  ARG A HA   6  
ATOM 8658  H HB2  . ARG A 1 22  ? -3.989  -9.751  -3.134  1.00 0.00 ? 22  ARG A HB2  6  
ATOM 8659  H HB3  . ARG A 1 22  ? -3.611  -10.995 -1.941  1.00 0.00 ? 22  ARG A HB3  6  
ATOM 8660  H HG2  . ARG A 1 22  ? -5.866  -11.041 -1.137  1.00 0.00 ? 22  ARG A HG2  6  
ATOM 8661  H HG3  . ARG A 1 22  ? -6.282  -9.578  -2.029  1.00 0.00 ? 22  ARG A HG3  6  
ATOM 8662  H HD2  . ARG A 1 22  ? -6.501  -10.689 -4.022  1.00 0.00 ? 22  ARG A HD2  6  
ATOM 8663  H HD3  . ARG A 1 22  ? -5.222  -11.841 -3.638  1.00 0.00 ? 22  ARG A HD3  6  
ATOM 8664  H HE   . ARG A 1 22  ? -7.018  -13.267 -3.106  1.00 0.00 ? 22  ARG A HE   6  
ATOM 8665  H HH11 . ARG A 1 22  ? -7.211  -12.211 -0.375  1.00 0.00 ? 22  ARG A HH11 6  
ATOM 8666  H HH12 . ARG A 1 22  ? -8.847  -11.656 -0.278  1.00 0.00 ? 22  ARG A HH12 6  
ATOM 8667  H HH21 . ARG A 1 22  ? -9.321  -11.621 -3.712  1.00 0.00 ? 22  ARG A HH21 6  
ATOM 8668  H HH22 . ARG A 1 22  ? -10.042 -11.323 -2.166  1.00 0.00 ? 22  ARG A HH22 6  
ATOM 8669  N N    . GLN A 1 23  ? -5.593  -7.410  -0.508  1.00 0.00 ? 23  GLN A N    6  
ATOM 8670  C CA   . GLN A 1 23  ? -6.442  -6.214  -0.759  1.00 0.00 ? 23  GLN A CA   6  
ATOM 8671  C C    . GLN A 1 23  ? -6.102  -5.106  0.239   1.00 0.00 ? 23  GLN A C    6  
ATOM 8672  O O    . GLN A 1 23  ? -6.045  -5.324  1.433   1.00 0.00 ? 23  GLN A O    6  
ATOM 8673  C CB   . GLN A 1 23  ? -7.914  -6.598  -0.610  1.00 0.00 ? 23  GLN A CB   6  
ATOM 8674  C CG   . GLN A 1 23  ? -8.089  -7.476  0.629   1.00 0.00 ? 23  GLN A CG   6  
ATOM 8675  C CD   . GLN A 1 23  ? -9.563  -7.849  0.790   1.00 0.00 ? 23  GLN A CD   6  
ATOM 8676  O OE1  . GLN A 1 23  ? -10.378 -7.529  -0.053  1.00 0.00 ? 23  GLN A OE1  6  
ATOM 8677  N NE2  . GLN A 1 23  ? -9.941  -8.515  1.846   1.00 0.00 ? 23  GLN A NE2  6  
ATOM 8678  H H    . GLN A 1 23  ? -5.693  -7.914  0.324   1.00 0.00 ? 23  GLN A H    6  
ATOM 8679  H HA   . GLN A 1 23  ? -6.261  -5.857  -1.761  1.00 0.00 ? 23  GLN A HA   6  
ATOM 8680  H HB2  . GLN A 1 23  ? -8.508  -5.703  -0.505  1.00 0.00 ? 23  GLN A HB2  6  
ATOM 8681  H HB3  . GLN A 1 23  ? -8.236  -7.144  -1.484  1.00 0.00 ? 23  GLN A HB3  6  
ATOM 8682  H HG2  . GLN A 1 23  ? -7.499  -8.375  0.518   1.00 0.00 ? 23  GLN A HG2  6  
ATOM 8683  H HG3  . GLN A 1 23  ? -7.758  -6.935  1.503   1.00 0.00 ? 23  GLN A HG3  6  
ATOM 8684  H HE21 . GLN A 1 23  ? -9.284  -8.770  2.526   1.00 0.00 ? 23  GLN A HE21 6  
ATOM 8685  H HE22 . GLN A 1 23  ? -10.883 -8.761  1.959   1.00 0.00 ? 23  GLN A HE22 6  
ATOM 8686  N N    . LEU A 1 24  ? -5.882  -3.915  -0.249  1.00 0.00 ? 24  LEU A N    6  
ATOM 8687  C CA   . LEU A 1 24  ? -5.550  -2.780  0.649   1.00 0.00 ? 24  LEU A CA   6  
ATOM 8688  C C    . LEU A 1 24  ? -6.579  -1.667  0.462   1.00 0.00 ? 24  LEU A C    6  
ATOM 8689  O O    . LEU A 1 24  ? -7.189  -1.541  -0.582  1.00 0.00 ? 24  LEU A O    6  
ATOM 8690  C CB   . LEU A 1 24  ? -4.172  -2.236  0.284   1.00 0.00 ? 24  LEU A CB   6  
ATOM 8691  C CG   . LEU A 1 24  ? -3.093  -3.201  0.770   1.00 0.00 ? 24  LEU A CG   6  
ATOM 8692  C CD1  . LEU A 1 24  ? -1.715  -2.586  0.530   1.00 0.00 ? 24  LEU A CD1  6  
ATOM 8693  C CD2  . LEU A 1 24  ? -3.282  -3.458  2.265   1.00 0.00 ? 24  LEU A CD2  6  
ATOM 8694  H H    . LEU A 1 24  ? -5.935  -3.767  -1.213  1.00 0.00 ? 24  LEU A H    6  
ATOM 8695  H HA   . LEU A 1 24  ? -5.551  -3.112  1.676   1.00 0.00 ? 24  LEU A HA   6  
ATOM 8696  H HB2  . LEU A 1 24  ? -4.100  -2.119  -0.789  1.00 0.00 ? 24  LEU A HB2  6  
ATOM 8697  H HB3  . LEU A 1 24  ? -4.033  -1.278  0.754   1.00 0.00 ? 24  LEU A HB3  6  
ATOM 8698  H HG   . LEU A 1 24  ? -3.171  -4.133  0.230   1.00 0.00 ? 24  LEU A HG   6  
ATOM 8699  H HD11 . LEU A 1 24  ? -1.480  -2.631  -0.524  1.00 0.00 ? 24  LEU A HD11 6  
ATOM 8700  H HD12 . LEU A 1 24  ? -0.973  -3.135  1.088   1.00 0.00 ? 24  LEU A HD12 6  
ATOM 8701  H HD13 . LEU A 1 24  ? -1.719  -1.555  0.853   1.00 0.00 ? 24  LEU A HD13 6  
ATOM 8702  H HD21 . LEU A 1 24  ? -4.060  -4.194  2.407   1.00 0.00 ? 24  LEU A HD21 6  
ATOM 8703  H HD22 . LEU A 1 24  ? -3.564  -2.538  2.756   1.00 0.00 ? 24  LEU A HD22 6  
ATOM 8704  H HD23 . LEU A 1 24  ? -2.358  -3.823  2.688   1.00 0.00 ? 24  LEU A HD23 6  
ATOM 8705  N N    . THR A 1 25  ? -6.763  -0.841  1.453   1.00 0.00 ? 25  THR A N    6  
ATOM 8706  C CA   . THR A 1 25  ? -7.735  0.276   1.311   1.00 0.00 ? 25  THR A CA   6  
ATOM 8707  C C    . THR A 1 25  ? -7.062  1.398   0.523   1.00 0.00 ? 25  THR A C    6  
ATOM 8708  O O    . THR A 1 25  ? -5.892  1.323   0.207   1.00 0.00 ? 25  THR A O    6  
ATOM 8709  C CB   . THR A 1 25  ? -8.140  0.788   2.697   1.00 0.00 ? 25  THR A CB   6  
ATOM 8710  O OG1  . THR A 1 25  ? -6.977  1.164   3.421   1.00 0.00 ? 25  THR A OG1  6  
ATOM 8711  C CG2  . THR A 1 25  ? -8.880  -0.316  3.453   1.00 0.00 ? 25  THR A CG2  6  
ATOM 8712  H H    . THR A 1 25  ? -6.251  -0.946  2.283   1.00 0.00 ? 25  THR A H    6  
ATOM 8713  H HA   . THR A 1 25  ? -8.610  -0.069  0.780   1.00 0.00 ? 25  THR A HA   6  
ATOM 8714  H HB   . THR A 1 25  ? -8.791  1.642   2.590   1.00 0.00 ? 25  THR A HB   6  
ATOM 8715  H HG1  . THR A 1 25  ? -7.177  1.967   3.907   1.00 0.00 ? 25  THR A HG1  6  
ATOM 8716  H HG21 . THR A 1 25  ? -8.850  -0.110  4.514   1.00 0.00 ? 25  THR A HG21 6  
ATOM 8717  H HG22 . THR A 1 25  ? -8.404  -1.266  3.259   1.00 0.00 ? 25  THR A HG22 6  
ATOM 8718  H HG23 . THR A 1 25  ? -9.907  -0.353  3.121   1.00 0.00 ? 25  THR A HG23 6  
ATOM 8719  N N    . LEU A 1 26  ? -7.777  2.435   0.196   1.00 0.00 ? 26  LEU A N    6  
ATOM 8720  C CA   . LEU A 1 26  ? -7.147  3.542   -0.573  1.00 0.00 ? 26  LEU A CA   6  
ATOM 8721  C C    . LEU A 1 26  ? -5.971  4.108   0.228   1.00 0.00 ? 26  LEU A C    6  
ATOM 8722  O O    . LEU A 1 26  ? -4.922  4.396   -0.311  1.00 0.00 ? 26  LEU A O    6  
ATOM 8723  C CB   . LEU A 1 26  ? -8.176  4.647   -0.829  1.00 0.00 ? 26  LEU A CB   6  
ATOM 8724  C CG   . LEU A 1 26  ? -7.793  5.414   -2.094  1.00 0.00 ? 26  LEU A CG   6  
ATOM 8725  C CD1  . LEU A 1 26  ? -9.025  6.133   -2.645  1.00 0.00 ? 26  LEU A CD1  6  
ATOM 8726  C CD2  . LEU A 1 26  ? -6.709  6.440   -1.759  1.00 0.00 ? 26  LEU A CD2  6  
ATOM 8727  H H    . LEU A 1 26  ? -8.721  2.486   0.453   1.00 0.00 ? 26  LEU A H    6  
ATOM 8728  H HA   . LEU A 1 26  ? -6.786  3.162   -1.517  1.00 0.00 ? 26  LEU A HA   6  
ATOM 8729  H HB2  . LEU A 1 26  ? -9.154  4.207   -0.958  1.00 0.00 ? 26  LEU A HB2  6  
ATOM 8730  H HB3  . LEU A 1 26  ? -8.193  5.326   0.010   1.00 0.00 ? 26  LEU A HB3  6  
ATOM 8731  H HG   . LEU A 1 26  ? -7.419  4.722   -2.836  1.00 0.00 ? 26  LEU A HG   6  
ATOM 8732  H HD11 . LEU A 1 26  ? -8.713  6.925   -3.310  1.00 0.00 ? 26  LEU A HD11 6  
ATOM 8733  H HD12 . LEU A 1 26  ? -9.592  6.553   -1.827  1.00 0.00 ? 26  LEU A HD12 6  
ATOM 8734  H HD13 . LEU A 1 26  ? -9.640  5.430   -3.186  1.00 0.00 ? 26  LEU A HD13 6  
ATOM 8735  H HD21 . LEU A 1 26  ? -5.743  6.046   -2.036  1.00 0.00 ? 26  LEU A HD21 6  
ATOM 8736  H HD22 . LEU A 1 26  ? -6.723  6.645   -0.699  1.00 0.00 ? 26  LEU A HD22 6  
ATOM 8737  H HD23 . LEU A 1 26  ? -6.896  7.353   -2.305  1.00 0.00 ? 26  LEU A HD23 6  
ATOM 8738  N N    . SER A 1 27  ? -6.140  4.273   1.513   1.00 0.00 ? 27  SER A N    6  
ATOM 8739  C CA   . SER A 1 27  ? -5.031  4.821   2.346   1.00 0.00 ? 27  SER A CA   6  
ATOM 8740  C C    . SER A 1 27  ? -4.301  3.681   3.063   1.00 0.00 ? 27  SER A C    6  
ATOM 8741  O O    . SER A 1 27  ? -3.704  3.877   4.104   1.00 0.00 ? 27  SER A O    6  
ATOM 8742  C CB   . SER A 1 27  ? -5.606  5.784   3.383   1.00 0.00 ? 27  SER A CB   6  
ATOM 8743  O OG   . SER A 1 27  ? -5.820  7.053   2.779   1.00 0.00 ? 27  SER A OG   6  
ATOM 8744  H H    . SER A 1 27  ? -6.994  4.035   1.930   1.00 0.00 ? 27  SER A H    6  
ATOM 8745  H HA   . SER A 1 27  ? -4.338  5.348   1.714   1.00 0.00 ? 27  SER A HA   6  
ATOM 8746  H HB2  . SER A 1 27  ? -6.544  5.403   3.750   1.00 0.00 ? 27  SER A HB2  6  
ATOM 8747  H HB3  . SER A 1 27  ? -4.911  5.879   4.207   1.00 0.00 ? 27  SER A HB3  6  
ATOM 8748  H HG   . SER A 1 27  ? -6.726  7.316   2.953   1.00 0.00 ? 27  SER A HG   6  
ATOM 8749  N N    . GLY A 1 28  ? -4.332  2.498   2.517   1.00 0.00 ? 28  GLY A N    6  
ATOM 8750  C CA   . GLY A 1 28  ? -3.623  1.359   3.171   1.00 0.00 ? 28  GLY A CA   6  
ATOM 8751  C C    . GLY A 1 28  ? -2.310  1.139   2.437   1.00 0.00 ? 28  GLY A C    6  
ATOM 8752  O O    . GLY A 1 28  ? -1.275  0.883   3.019   1.00 0.00 ? 28  GLY A O    6  
ATOM 8753  H H    . GLY A 1 28  ? -4.799  2.360   1.662   1.00 0.00 ? 28  GLY A H    6  
ATOM 8754  H HA2  . GLY A 1 28  ? -3.430  1.594   4.206   1.00 0.00 ? 28  GLY A HA2  6  
ATOM 8755  H HA3  . GLY A 1 28  ? -4.231  0.466   3.107   1.00 0.00 ? 28  GLY A HA3  6  
ATOM 8756  N N    . ILE A 1 29  ? -2.373  1.246   1.148   1.00 0.00 ? 29  ILE A N    6  
ATOM 8757  C CA   . ILE A 1 29  ? -1.181  1.062   0.292   1.00 0.00 ? 29  ILE A CA   6  
ATOM 8758  C C    . ILE A 1 29  ? -0.070  2.004   0.732   1.00 0.00 ? 29  ILE A C    6  
ATOM 8759  O O    . ILE A 1 29  ? 1.101   1.688   0.661   1.00 0.00 ? 29  ILE A O    6  
ATOM 8760  C CB   . ILE A 1 29  ? -1.595  1.395   -1.128  1.00 0.00 ? 29  ILE A CB   6  
ATOM 8761  C CG1  . ILE A 1 29  ? -0.462  1.053   -2.094  1.00 0.00 ? 29  ILE A CG1  6  
ATOM 8762  C CG2  . ILE A 1 29  ? -1.935  2.884   -1.224  1.00 0.00 ? 29  ILE A CG2  6  
ATOM 8763  C CD1  . ILE A 1 29  ? -0.660  1.832   -3.388  1.00 0.00 ? 29  ILE A CD1  6  
ATOM 8764  H H    . ILE A 1 29  ? -3.231  1.454   0.728   1.00 0.00 ? 29  ILE A H    6  
ATOM 8765  H HA   . ILE A 1 29  ? -0.843  0.045   0.340   1.00 0.00 ? 29  ILE A HA   6  
ATOM 8766  H HB   . ILE A 1 29  ? -2.468  0.826   -1.377  1.00 0.00 ? 29  ILE A HB   6  
ATOM 8767  H HG12 . ILE A 1 29  ? 0.487   1.321   -1.649  1.00 0.00 ? 29  ILE A HG12 6  
ATOM 8768  H HG13 . ILE A 1 29  ? -0.477  -0.004  -2.306  1.00 0.00 ? 29  ILE A HG13 6  
ATOM 8769  H HG21 . ILE A 1 29  ? -1.040  3.439   -1.451  1.00 0.00 ? 29  ILE A HG21 6  
ATOM 8770  H HG22 . ILE A 1 29  ? -2.346  3.223   -0.286  1.00 0.00 ? 29  ILE A HG22 6  
ATOM 8771  H HG23 . ILE A 1 29  ? -2.661  3.037   -2.008  1.00 0.00 ? 29  ILE A HG23 6  
ATOM 8772  H HD11 . ILE A 1 29  ? -0.360  2.856   -3.233  1.00 0.00 ? 29  ILE A HD11 6  
ATOM 8773  H HD12 . ILE A 1 29  ? -1.705  1.802   -3.660  1.00 0.00 ? 29  ILE A HD12 6  
ATOM 8774  H HD13 . ILE A 1 29  ? -0.067  1.393   -4.171  1.00 0.00 ? 29  ILE A HD13 6  
ATOM 8775  N N    . TYR A 1 30  ? -0.434  3.164   1.179   1.00 0.00 ? 30  TYR A N    6  
ATOM 8776  C CA   . TYR A 1 30  ? 0.589   4.148   1.620   1.00 0.00 ? 30  TYR A CA   6  
ATOM 8777  C C    . TYR A 1 30  ? 1.274   3.642   2.889   1.00 0.00 ? 30  TYR A C    6  
ATOM 8778  O O    . TYR A 1 30  ? 2.481   3.540   2.952   1.00 0.00 ? 30  TYR A O    6  
ATOM 8779  C CB   . TYR A 1 30  ? -0.091  5.488   1.889   1.00 0.00 ? 30  TYR A CB   6  
ATOM 8780  C CG   . TYR A 1 30  ? -1.050  5.771   0.760   1.00 0.00 ? 30  TYR A CG   6  
ATOM 8781  C CD1  . TYR A 1 30  ? -0.662  5.513   -0.560  1.00 0.00 ? 30  TYR A CD1  6  
ATOM 8782  C CD2  . TYR A 1 30  ? -2.326  6.267   1.029   1.00 0.00 ? 30  TYR A CD2  6  
ATOM 8783  C CE1  . TYR A 1 30  ? -1.552  5.752   -1.611  1.00 0.00 ? 30  TYR A CE1  6  
ATOM 8784  C CE2  . TYR A 1 30  ? -3.217  6.510   -0.022  1.00 0.00 ? 30  TYR A CE2  6  
ATOM 8785  C CZ   . TYR A 1 30  ? -2.831  6.251   -1.342  1.00 0.00 ? 30  TYR A CZ   6  
ATOM 8786  O OH   . TYR A 1 30  ? -3.712  6.489   -2.378  1.00 0.00 ? 30  TYR A OH   6  
ATOM 8787  H H    . TYR A 1 30  ? -1.386  3.389   1.217   1.00 0.00 ? 30  TYR A H    6  
ATOM 8788  H HA   . TYR A 1 30  ? 1.321   4.267   0.841   1.00 0.00 ? 30  TYR A HA   6  
ATOM 8789  H HB2  . TYR A 1 30  ? -0.632  5.441   2.823   1.00 0.00 ? 30  TYR A HB2  6  
ATOM 8790  H HB3  . TYR A 1 30  ? 0.651   6.271   1.938   1.00 0.00 ? 30  TYR A HB3  6  
ATOM 8791  H HD1  . TYR A 1 30  ? 0.324   5.128   -0.767  1.00 0.00 ? 30  TYR A HD1  6  
ATOM 8792  H HD2  . TYR A 1 30  ? -2.626  6.467   2.047   1.00 0.00 ? 30  TYR A HD2  6  
ATOM 8793  H HE1  . TYR A 1 30  ? -1.251  5.549   -2.629  1.00 0.00 ? 30  TYR A HE1  6  
ATOM 8794  H HE2  . TYR A 1 30  ? -4.204  6.890   0.187   1.00 0.00 ? 30  TYR A HE2  6  
ATOM 8795  H HH   . TYR A 1 30  ? -3.252  6.322   -3.203  1.00 0.00 ? 30  TYR A HH   6  
ATOM 8796  N N    . ALA A 1 31  ? 0.515   3.315   3.896   1.00 0.00 ? 31  ALA A N    6  
ATOM 8797  C CA   . ALA A 1 31  ? 1.131   2.808   5.153   1.00 0.00 ? 31  ALA A CA   6  
ATOM 8798  C C    . ALA A 1 31  ? 1.844   1.483   4.870   1.00 0.00 ? 31  ALA A C    6  
ATOM 8799  O O    . ALA A 1 31  ? 2.623   1.004   5.671   1.00 0.00 ? 31  ALA A O    6  
ATOM 8800  C CB   . ALA A 1 31  ? 0.039   2.585   6.202   1.00 0.00 ? 31  ALA A CB   6  
ATOM 8801  H H    . ALA A 1 31  ? -0.458  3.398   3.824   1.00 0.00 ? 31  ALA A H    6  
ATOM 8802  H HA   . ALA A 1 31  ? 1.845   3.529   5.523   1.00 0.00 ? 31  ALA A HA   6  
ATOM 8803  H HB1  . ALA A 1 31  ? -0.606  3.450   6.240   1.00 0.00 ? 31  ALA A HB1  6  
ATOM 8804  H HB2  . ALA A 1 31  ? 0.494   2.431   7.170   1.00 0.00 ? 31  ALA A HB2  6  
ATOM 8805  H HB3  . ALA A 1 31  ? -0.543  1.715   5.936   1.00 0.00 ? 31  ALA A HB3  6  
ATOM 8806  N N    . HIS A 1 32  ? 1.581   0.883   3.740   1.00 0.00 ? 32  HIS A N    6  
ATOM 8807  C CA   . HIS A 1 32  ? 2.239   -0.413  3.414   1.00 0.00 ? 32  HIS A CA   6  
ATOM 8808  C C    . HIS A 1 32  ? 3.680   -0.172  2.952   1.00 0.00 ? 32  HIS A C    6  
ATOM 8809  O O    . HIS A 1 32  ? 4.626   -0.528  3.627   1.00 0.00 ? 32  HIS A O    6  
ATOM 8810  C CB   . HIS A 1 32  ? 1.453   -1.115  2.304   1.00 0.00 ? 32  HIS A CB   6  
ATOM 8811  C CG   . HIS A 1 32  ? 2.155   -2.389  1.927   1.00 0.00 ? 32  HIS A CG   6  
ATOM 8812  N ND1  . HIS A 1 32  ? 1.550   -3.630  2.049   1.00 0.00 ? 32  HIS A ND1  6  
ATOM 8813  C CD2  . HIS A 1 32  ? 3.415   -2.634  1.439   1.00 0.00 ? 32  HIS A CD2  6  
ATOM 8814  C CE1  . HIS A 1 32  ? 2.438   -4.557  1.642   1.00 0.00 ? 32  HIS A CE1  6  
ATOM 8815  N NE2  . HIS A 1 32  ? 3.591   -4.003  1.259   1.00 0.00 ? 32  HIS A NE2  6  
ATOM 8816  H H    . HIS A 1 32  ? 0.946   1.281   3.108   1.00 0.00 ? 32  HIS A H    6  
ATOM 8817  H HA   . HIS A 1 32  ? 2.247   -1.040  4.294   1.00 0.00 ? 32  HIS A HA   6  
ATOM 8818  H HB2  . HIS A 1 32  ? 0.458   -1.342  2.657   1.00 0.00 ? 32  HIS A HB2  6  
ATOM 8819  H HB3  . HIS A 1 32  ? 1.388   -0.467  1.441   1.00 0.00 ? 32  HIS A HB3  6  
ATOM 8820  H HD1  . HIS A 1 32  ? 0.640   -3.802  2.371   1.00 0.00 ? 32  HIS A HD1  6  
ATOM 8821  H HD2  . HIS A 1 32  ? 4.157   -1.878  1.225   1.00 0.00 ? 32  HIS A HD2  6  
ATOM 8822  H HE1  . HIS A 1 32  ? 2.243   -5.619  1.632   1.00 0.00 ? 32  HIS A HE1  6  
ATOM 8823  N N    . ILE A 1 33  ? 3.858   0.416   1.800   1.00 0.00 ? 33  ILE A N    6  
ATOM 8824  C CA   . ILE A 1 33  ? 5.240   0.662   1.291   1.00 0.00 ? 33  ILE A CA   6  
ATOM 8825  C C    . ILE A 1 33  ? 5.982   1.635   2.211   1.00 0.00 ? 33  ILE A C    6  
ATOM 8826  O O    . ILE A 1 33  ? 7.163   1.489   2.454   1.00 0.00 ? 33  ILE A O    6  
ATOM 8827  C CB   . ILE A 1 33  ? 5.171   1.247   -0.121  1.00 0.00 ? 33  ILE A CB   6  
ATOM 8828  C CG1  . ILE A 1 33  ? 4.356   2.540   -0.114  1.00 0.00 ? 33  ILE A CG1  6  
ATOM 8829  C CG2  . ILE A 1 33  ? 4.511   0.241   -1.065  1.00 0.00 ? 33  ILE A CG2  6  
ATOM 8830  C CD1  . ILE A 1 33  ? 5.310   3.727   -0.214  1.00 0.00 ? 33  ILE A CD1  6  
ATOM 8831  H H    . ILE A 1 33  ? 3.084   0.687   1.263   1.00 0.00 ? 33  ILE A H    6  
ATOM 8832  H HA   . ILE A 1 33  ? 5.780   -0.273  1.258   1.00 0.00 ? 33  ILE A HA   6  
ATOM 8833  H HB   . ILE A 1 33  ? 6.171   1.458   -0.462  1.00 0.00 ? 33  ILE A HB   6  
ATOM 8834  H HG12 . ILE A 1 33  ? 3.684   2.544   -0.960  1.00 0.00 ? 33  ILE A HG12 6  
ATOM 8835  H HG13 . ILE A 1 33  ? 3.787   2.608   0.798   1.00 0.00 ? 33  ILE A HG13 6  
ATOM 8836  H HG21 . ILE A 1 33  ? 3.683   -0.236  -0.562  1.00 0.00 ? 33  ILE A HG21 6  
ATOM 8837  H HG22 . ILE A 1 33  ? 5.235   -0.506  -1.357  1.00 0.00 ? 33  ILE A HG22 6  
ATOM 8838  H HG23 . ILE A 1 33  ? 4.151   0.755   -1.944  1.00 0.00 ? 33  ILE A HG23 6  
ATOM 8839  H HD11 . ILE A 1 33  ? 6.151   3.458   -0.836  1.00 0.00 ? 33  ILE A HD11 6  
ATOM 8840  H HD12 . ILE A 1 33  ? 5.663   3.989   0.773   1.00 0.00 ? 33  ILE A HD12 6  
ATOM 8841  H HD13 . ILE A 1 33  ? 4.797   4.570   -0.648  1.00 0.00 ? 33  ILE A HD13 6  
ATOM 8842  N N    . THR A 1 34  ? 5.306   2.627   2.721   1.00 0.00 ? 34  THR A N    6  
ATOM 8843  C CA   . THR A 1 34  ? 5.983   3.613   3.616   1.00 0.00 ? 34  THR A CA   6  
ATOM 8844  C C    . THR A 1 34  ? 6.598   2.889   4.814   1.00 0.00 ? 34  THR A C    6  
ATOM 8845  O O    . THR A 1 34  ? 7.502   3.387   5.453   1.00 0.00 ? 34  THR A O    6  
ATOM 8846  C CB   . THR A 1 34  ? 4.960   4.639   4.123   1.00 0.00 ? 34  THR A CB   6  
ATOM 8847  O OG1  . THR A 1 34  ? 3.886   3.960   4.758   1.00 0.00 ? 34  THR A OG1  6  
ATOM 8848  C CG2  . THR A 1 34  ? 4.424   5.462   2.950   1.00 0.00 ? 34  THR A CG2  6  
ATOM 8849  H H    . THR A 1 34  ? 4.360   2.728   2.509   1.00 0.00 ? 34  THR A H    6  
ATOM 8850  H HA   . THR A 1 34  ? 6.760   4.123   3.066   1.00 0.00 ? 34  THR A HA   6  
ATOM 8851  H HB   . THR A 1 34  ? 5.434   5.299   4.832   1.00 0.00 ? 34  THR A HB   6  
ATOM 8852  H HG1  . THR A 1 34  ? 3.701   4.406   5.587   1.00 0.00 ? 34  THR A HG1  6  
ATOM 8853  H HG21 . THR A 1 34  ? 4.776   6.480   3.035   1.00 0.00 ? 34  THR A HG21 6  
ATOM 8854  H HG22 . THR A 1 34  ? 3.344   5.453   2.968   1.00 0.00 ? 34  THR A HG22 6  
ATOM 8855  H HG23 . THR A 1 34  ? 4.772   5.036   2.022   1.00 0.00 ? 34  THR A HG23 6  
ATOM 8856  N N    . LYS A 1 35  ? 6.116   1.719   5.128   1.00 0.00 ? 35  LYS A N    6  
ATOM 8857  C CA   . LYS A 1 35  ? 6.679   0.974   6.288   1.00 0.00 ? 35  LYS A CA   6  
ATOM 8858  C C    . LYS A 1 35  ? 8.155   0.670   6.039   1.00 0.00 ? 35  LYS A C    6  
ATOM 8859  O O    . LYS A 1 35  ? 8.987   0.826   6.911   1.00 0.00 ? 35  LYS A O    6  
ATOM 8860  C CB   . LYS A 1 35  ? 5.912   -0.335  6.474   1.00 0.00 ? 35  LYS A CB   6  
ATOM 8861  C CG   . LYS A 1 35  ? 5.383   -0.414  7.905   1.00 0.00 ? 35  LYS A CG   6  
ATOM 8862  C CD   . LYS A 1 35  ? 4.127   -1.286  7.939   1.00 0.00 ? 35  LYS A CD   6  
ATOM 8863  C CE   . LYS A 1 35  ? 3.925   -1.834  9.352   1.00 0.00 ? 35  LYS A CE   6  
ATOM 8864  N NZ   . LYS A 1 35  ? 2.637   -2.579  9.413   1.00 0.00 ? 35  LYS A NZ   6  
ATOM 8865  H H    . LYS A 1 35  ? 5.384   1.331   4.604   1.00 0.00 ? 35  LYS A H    6  
ATOM 8866  H HA   . LYS A 1 35  ? 6.582   1.574   7.181   1.00 0.00 ? 35  LYS A HA   6  
ATOM 8867  H HB2  . LYS A 1 35  ? 5.083   -0.369  5.780   1.00 0.00 ? 35  LYS A HB2  6  
ATOM 8868  H HB3  . LYS A 1 35  ? 6.571   -1.170  6.288   1.00 0.00 ? 35  LYS A HB3  6  
ATOM 8869  H HG2  . LYS A 1 35  ? 6.140   -0.847  8.545   1.00 0.00 ? 35  LYS A HG2  6  
ATOM 8870  H HG3  . LYS A 1 35  ? 5.140   0.577   8.255   1.00 0.00 ? 35  LYS A HG3  6  
ATOM 8871  H HD2  . LYS A 1 35  ? 3.270   -0.693  7.654   1.00 0.00 ? 35  LYS A HD2  6  
ATOM 8872  H HD3  . LYS A 1 35  ? 4.242   -2.109  7.248   1.00 0.00 ? 35  LYS A HD3  6  
ATOM 8873  H HE2  . LYS A 1 35  ? 4.738   -2.500  9.599   1.00 0.00 ? 35  LYS A HE2  6  
ATOM 8874  H HE3  . LYS A 1 35  ? 3.901   -1.016  10.055  1.00 0.00 ? 35  LYS A HE3  6  
ATOM 8875  H HZ1  . LYS A 1 35  ? 2.693   -3.312  10.148  1.00 0.00 ? 35  LYS A HZ1  6  
ATOM 8876  H HZ2  . LYS A 1 35  ? 2.450   -3.025  8.491   1.00 0.00 ? 35  LYS A HZ2  6  
ATOM 8877  H HZ3  . LYS A 1 35  ? 1.866   -1.921  9.643   1.00 0.00 ? 35  LYS A HZ3  6  
ATOM 8878  N N    . HIS A 1 36  ? 8.490   0.231   4.857   1.00 0.00 ? 36  HIS A N    6  
ATOM 8879  C CA   . HIS A 1 36  ? 9.916   -0.084  4.561   1.00 0.00 ? 36  HIS A CA   6  
ATOM 8880  C C    . HIS A 1 36  ? 10.508  0.990   3.644   1.00 0.00 ? 36  HIS A C    6  
ATOM 8881  O O    . HIS A 1 36  ? 11.641  0.895   3.218   1.00 0.00 ? 36  HIS A O    6  
ATOM 8882  C CB   . HIS A 1 36  ? 10.010  -1.452  3.880   1.00 0.00 ? 36  HIS A CB   6  
ATOM 8883  C CG   . HIS A 1 36  ? 8.791   -1.681  3.030   1.00 0.00 ? 36  HIS A CG   6  
ATOM 8884  N ND1  . HIS A 1 36  ? 8.800   -1.485  1.659   1.00 0.00 ? 36  HIS A ND1  6  
ATOM 8885  C CD2  . HIS A 1 36  ? 7.520   -2.095  3.343   1.00 0.00 ? 36  HIS A CD2  6  
ATOM 8886  C CE1  . HIS A 1 36  ? 7.569   -1.777  1.201   1.00 0.00 ? 36  HIS A CE1  6  
ATOM 8887  N NE2  . HIS A 1 36  ? 6.750   -2.154  2.186   1.00 0.00 ? 36  HIS A NE2  6  
ATOM 8888  H H    . HIS A 1 36  ? 7.806   0.109   4.166   1.00 0.00 ? 36  HIS A H    6  
ATOM 8889  H HA   . HIS A 1 36  ? 10.473  -0.108  5.486   1.00 0.00 ? 36  HIS A HA   6  
ATOM 8890  H HB2  . HIS A 1 36  ? 10.893  -1.485  3.259   1.00 0.00 ? 36  HIS A HB2  6  
ATOM 8891  H HB3  . HIS A 1 36  ? 10.072  -2.225  4.634   1.00 0.00 ? 36  HIS A HB3  6  
ATOM 8892  H HD1  . HIS A 1 36  ? 9.562   -1.185  1.122   1.00 0.00 ? 36  HIS A HD1  6  
ATOM 8893  H HD2  . HIS A 1 36  ? 7.171   -2.337  4.336   1.00 0.00 ? 36  HIS A HD2  6  
ATOM 8894  H HE1  . HIS A 1 36  ? 7.278   -1.714  0.163   1.00 0.00 ? 36  HIS A HE1  6  
ATOM 8895  N N    . TYR A 1 37  ? 9.756   2.014   3.335   1.00 0.00 ? 37  TYR A N    6  
ATOM 8896  C CA   . TYR A 1 37  ? 10.291  3.085   2.449   1.00 0.00 ? 37  TYR A CA   6  
ATOM 8897  C C    . TYR A 1 37  ? 10.360  4.406   3.231   1.00 0.00 ? 37  TYR A C    6  
ATOM 8898  O O    . TYR A 1 37  ? 9.342   4.939   3.624   1.00 0.00 ? 37  TYR A O    6  
ATOM 8899  C CB   . TYR A 1 37  ? 9.369   3.251   1.239   1.00 0.00 ? 37  TYR A CB   6  
ATOM 8900  C CG   . TYR A 1 37  ? 10.016  2.624   0.031   1.00 0.00 ? 37  TYR A CG   6  
ATOM 8901  C CD1  . TYR A 1 37  ? 10.515  1.319   0.107   1.00 0.00 ? 37  TYR A CD1  6  
ATOM 8902  C CD2  . TYR A 1 37  ? 10.116  3.344   -1.164  1.00 0.00 ? 37  TYR A CD2  6  
ATOM 8903  C CE1  . TYR A 1 37  ? 11.116  0.733   -1.011  1.00 0.00 ? 37  TYR A CE1  6  
ATOM 8904  C CE2  . TYR A 1 37  ? 10.718  2.758   -2.283  1.00 0.00 ? 37  TYR A CE2  6  
ATOM 8905  C CZ   . TYR A 1 37  ? 11.218  1.454   -2.207  1.00 0.00 ? 37  TYR A CZ   6  
ATOM 8906  O OH   . TYR A 1 37  ? 11.815  0.879   -3.310  1.00 0.00 ? 37  TYR A OH   6  
ATOM 8907  H H    . TYR A 1 37  ? 8.843   2.080   3.686   1.00 0.00 ? 37  TYR A H    6  
ATOM 8908  H HA   . TYR A 1 37  ? 11.276  2.805   2.110   1.00 0.00 ? 37  TYR A HA   6  
ATOM 8909  H HB2  . TYR A 1 37  ? 8.428   2.762   1.432   1.00 0.00 ? 37  TYR A HB2  6  
ATOM 8910  H HB3  . TYR A 1 37  ? 9.201   4.301   1.052   1.00 0.00 ? 37  TYR A HB3  6  
ATOM 8911  H HD1  . TYR A 1 37  ? 10.436  0.764   1.031   1.00 0.00 ? 37  TYR A HD1  6  
ATOM 8912  H HD2  . TYR A 1 37  ? 9.730   4.351   -1.223  1.00 0.00 ? 37  TYR A HD2  6  
ATOM 8913  H HE1  . TYR A 1 37  ? 11.499  -0.275  -0.951  1.00 0.00 ? 37  TYR A HE1  6  
ATOM 8914  H HE2  . TYR A 1 37  ? 10.793  3.313   -3.206  1.00 0.00 ? 37  TYR A HE2  6  
ATOM 8915  H HH   . TYR A 1 37  ? 12.765  0.894   -3.174  1.00 0.00 ? 37  TYR A HH   6  
ATOM 8916  N N    . PRO A 1 38  ? 11.561  4.893   3.440   1.00 0.00 ? 38  PRO A N    6  
ATOM 8917  C CA   . PRO A 1 38  ? 11.789  6.147   4.181   1.00 0.00 ? 38  PRO A CA   6  
ATOM 8918  C C    . PRO A 1 38  ? 11.504  7.363   3.293   1.00 0.00 ? 38  PRO A C    6  
ATOM 8919  O O    . PRO A 1 38  ? 11.191  8.433   3.774   1.00 0.00 ? 38  PRO A O    6  
ATOM 8920  C CB   . PRO A 1 38  ? 13.273  6.082   4.551   1.00 0.00 ? 38  PRO A CB   6  
ATOM 8921  C CG   . PRO A 1 38  ? 13.932  5.107   3.547   1.00 0.00 ? 38  PRO A CG   6  
ATOM 8922  C CD   . PRO A 1 38  ? 12.799  4.244   2.961   1.00 0.00 ? 38  PRO A CD   6  
ATOM 8923  H HA   . PRO A 1 38  ? 11.187  6.178   5.074   1.00 0.00 ? 38  PRO A HA   6  
ATOM 8924  H HB2  . PRO A 1 38  ? 13.718  7.065   4.466   1.00 0.00 ? 38  PRO A HB2  6  
ATOM 8925  H HB3  . PRO A 1 38  ? 13.390  5.705   5.554   1.00 0.00 ? 38  PRO A HB3  6  
ATOM 8926  H HG2  . PRO A 1 38  ? 14.423  5.664   2.760   1.00 0.00 ? 38  PRO A HG2  6  
ATOM 8927  H HG3  . PRO A 1 38  ? 14.645  4.477   4.055   1.00 0.00 ? 38  PRO A HG3  6  
ATOM 8928  H HD2  . PRO A 1 38  ? 12.840  4.251   1.880   1.00 0.00 ? 38  PRO A HD2  6  
ATOM 8929  H HD3  . PRO A 1 38  ? 12.859  3.234   3.337   1.00 0.00 ? 38  PRO A HD3  6  
ATOM 8930  N N    . TYR A 1 39  ? 11.614  7.209   2.003   1.00 0.00 ? 39  TYR A N    6  
ATOM 8931  C CA   . TYR A 1 39  ? 11.353  8.361   1.094   1.00 0.00 ? 39  TYR A CA   6  
ATOM 8932  C C    . TYR A 1 39  ? 9.869   8.740   1.154   1.00 0.00 ? 39  TYR A C    6  
ATOM 8933  O O    . TYR A 1 39  ? 9.506   9.886   0.971   1.00 0.00 ? 39  TYR A O    6  
ATOM 8934  C CB   . TYR A 1 39  ? 11.726  7.975   -0.343  1.00 0.00 ? 39  TYR A CB   6  
ATOM 8935  C CG   . TYR A 1 39  ? 11.128  8.972   -1.310  1.00 0.00 ? 39  TYR A CG   6  
ATOM 8936  C CD1  . TYR A 1 39  ? 11.672  10.257  -1.416  1.00 0.00 ? 39  TYR A CD1  6  
ATOM 8937  C CD2  . TYR A 1 39  ? 10.023  8.613   -2.092  1.00 0.00 ? 39  TYR A CD2  6  
ATOM 8938  C CE1  . TYR A 1 39  ? 11.113  11.183  -2.305  1.00 0.00 ? 39  TYR A CE1  6  
ATOM 8939  C CE2  . TYR A 1 39  ? 9.464   9.540   -2.981  1.00 0.00 ? 39  TYR A CE2  6  
ATOM 8940  C CZ   . TYR A 1 39  ? 10.009  10.824  -3.087  1.00 0.00 ? 39  TYR A CZ   6  
ATOM 8941  O OH   . TYR A 1 39  ? 9.457   11.737  -3.963  1.00 0.00 ? 39  TYR A OH   6  
ATOM 8942  H H    . TYR A 1 39  ? 11.871  6.340   1.631   1.00 0.00 ? 39  TYR A H    6  
ATOM 8943  H HA   . TYR A 1 39  ? 11.950  9.205   1.404   1.00 0.00 ? 39  TYR A HA   6  
ATOM 8944  H HB2  . TYR A 1 39  ? 12.801  7.973   -0.448  1.00 0.00 ? 39  TYR A HB2  6  
ATOM 8945  H HB3  . TYR A 1 39  ? 11.343  6.990   -0.563  1.00 0.00 ? 39  TYR A HB3  6  
ATOM 8946  H HD1  . TYR A 1 39  ? 12.524  10.535  -0.813  1.00 0.00 ? 39  TYR A HD1  6  
ATOM 8947  H HD2  . TYR A 1 39  ? 9.603   7.622   -2.011  1.00 0.00 ? 39  TYR A HD2  6  
ATOM 8948  H HE1  . TYR A 1 39  ? 11.533  12.174  -2.386  1.00 0.00 ? 39  TYR A HE1  6  
ATOM 8949  H HE2  . TYR A 1 39  ? 8.612   9.263   -3.584  1.00 0.00 ? 39  TYR A HE2  6  
ATOM 8950  H HH   . TYR A 1 39  ? 9.012   12.414  -3.447  1.00 0.00 ? 39  TYR A HH   6  
ATOM 8951  N N    . TYR A 1 40  ? 9.007   7.793   1.397   1.00 0.00 ? 40  TYR A N    6  
ATOM 8952  C CA   . TYR A 1 40  ? 7.553   8.115   1.450   1.00 0.00 ? 40  TYR A CA   6  
ATOM 8953  C C    . TYR A 1 40  ? 7.146   8.483   2.878   1.00 0.00 ? 40  TYR A C    6  
ATOM 8954  O O    . TYR A 1 40  ? 6.024   8.875   3.129   1.00 0.00 ? 40  TYR A O    6  
ATOM 8955  C CB   . TYR A 1 40  ? 6.749   6.905   0.977   1.00 0.00 ? 40  TYR A CB   6  
ATOM 8956  C CG   . TYR A 1 40  ? 6.452   7.061   -0.494  1.00 0.00 ? 40  TYR A CG   6  
ATOM 8957  C CD1  . TYR A 1 40  ? 5.959   8.279   -0.977  1.00 0.00 ? 40  TYR A CD1  6  
ATOM 8958  C CD2  . TYR A 1 40  ? 6.671   5.996   -1.375  1.00 0.00 ? 40  TYR A CD2  6  
ATOM 8959  C CE1  . TYR A 1 40  ? 5.683   8.431   -2.341  1.00 0.00 ? 40  TYR A CE1  6  
ATOM 8960  C CE2  . TYR A 1 40  ? 6.395   6.149   -2.740  1.00 0.00 ? 40  TYR A CE2  6  
ATOM 8961  C CZ   . TYR A 1 40  ? 5.900   7.366   -3.221  1.00 0.00 ? 40  TYR A CZ   6  
ATOM 8962  O OH   . TYR A 1 40  ? 5.627   7.515   -4.566  1.00 0.00 ? 40  TYR A OH   6  
ATOM 8963  H H    . TYR A 1 40  ? 9.312   6.872   1.533   1.00 0.00 ? 40  TYR A H    6  
ATOM 8964  H HA   . TYR A 1 40  ? 7.352   8.950   0.797   1.00 0.00 ? 40  TYR A HA   6  
ATOM 8965  H HB2  . TYR A 1 40  ? 7.323   6.003   1.137   1.00 0.00 ? 40  TYR A HB2  6  
ATOM 8966  H HB3  . TYR A 1 40  ? 5.822   6.847   1.527   1.00 0.00 ? 40  TYR A HB3  6  
ATOM 8967  H HD1  . TYR A 1 40  ? 5.791   9.100   -0.296  1.00 0.00 ? 40  TYR A HD1  6  
ATOM 8968  H HD2  . TYR A 1 40  ? 7.055   5.059   -1.001  1.00 0.00 ? 40  TYR A HD2  6  
ATOM 8969  H HE1  . TYR A 1 40  ? 5.305   9.372   -2.714  1.00 0.00 ? 40  TYR A HE1  6  
ATOM 8970  H HE2  . TYR A 1 40  ? 6.561   5.326   -3.420  1.00 0.00 ? 40  TYR A HE2  6  
ATOM 8971  H HH   . TYR A 1 40  ? 4.688   7.362   -4.697  1.00 0.00 ? 40  TYR A HH   6  
ATOM 8972  N N    . ARG A 1 41  ? 8.045   8.372   3.817   1.00 0.00 ? 41  ARG A N    6  
ATOM 8973  C CA   . ARG A 1 41  ? 7.695   8.729   5.219   1.00 0.00 ? 41  ARG A CA   6  
ATOM 8974  C C    . ARG A 1 41  ? 7.510   10.245  5.318   1.00 0.00 ? 41  ARG A C    6  
ATOM 8975  O O    . ARG A 1 41  ? 6.977   10.756  6.283   1.00 0.00 ? 41  ARG A O    6  
ATOM 8976  C CB   . ARG A 1 41  ? 8.819   8.290   6.159   1.00 0.00 ? 41  ARG A CB   6  
ATOM 8977  C CG   . ARG A 1 41  ? 8.313   8.314   7.603   1.00 0.00 ? 41  ARG A CG   6  
ATOM 8978  C CD   . ARG A 1 41  ? 8.420   6.914   8.209   1.00 0.00 ? 41  ARG A CD   6  
ATOM 8979  N NE   . ARG A 1 41  ? 9.747   6.759   8.867   1.00 0.00 ? 41  ARG A NE   6  
ATOM 8980  C CZ   . ARG A 1 41  ? 9.988   5.717   9.615   1.00 0.00 ? 41  ARG A CZ   6  
ATOM 8981  N NH1  . ARG A 1 41  ? 9.717   4.520   9.170   1.00 0.00 ? 41  ARG A NH1  6  
ATOM 8982  N NH2  . ARG A 1 41  ? 10.499  5.870   10.805  1.00 0.00 ? 41  ARG A NH2  6  
ATOM 8983  H H    . ARG A 1 41  ? 8.948   8.060   3.598   1.00 0.00 ? 41  ARG A H    6  
ATOM 8984  H HA   . ARG A 1 41  ? 6.776   8.235   5.498   1.00 0.00 ? 41  ARG A HA   6  
ATOM 8985  H HB2  . ARG A 1 41  ? 9.133   7.288   5.902   1.00 0.00 ? 41  ARG A HB2  6  
ATOM 8986  H HB3  . ARG A 1 41  ? 9.656   8.965   6.062   1.00 0.00 ? 41  ARG A HB3  6  
ATOM 8987  H HG2  . ARG A 1 41  ? 8.907   9.005   8.182   1.00 0.00 ? 41  ARG A HG2  6  
ATOM 8988  H HG3  . ARG A 1 41  ? 7.279   8.630   7.616   1.00 0.00 ? 41  ARG A HG3  6  
ATOM 8989  H HD2  . ARG A 1 41  ? 7.637   6.777   8.939   1.00 0.00 ? 41  ARG A HD2  6  
ATOM 8990  H HD3  . ARG A 1 41  ? 8.318   6.175   7.427   1.00 0.00 ? 41  ARG A HD3  6  
ATOM 8991  H HE   . ARG A 1 41  ? 10.441  7.440   8.740   1.00 0.00 ? 41  ARG A HE   6  
ATOM 8992  H HH11 . ARG A 1 41  ? 9.326   4.402   8.258   1.00 0.00 ? 41  ARG A HH11 6  
ATOM 8993  H HH12 . ARG A 1 41  ? 9.900   3.720   9.742   1.00 0.00 ? 41  ARG A HH12 6  
ATOM 8994  H HH21 . ARG A 1 41  ? 10.707  6.787   11.146  1.00 0.00 ? 41  ARG A HH21 6  
ATOM 8995  H HH22 . ARG A 1 41  ? 10.683  5.070   11.377  1.00 0.00 ? 41  ARG A HH22 6  
ATOM 8996  N N    . THR A 1 42  ? 7.949   10.968  4.324   1.00 0.00 ? 42  THR A N    6  
ATOM 8997  C CA   . THR A 1 42  ? 7.802   12.450  4.350   1.00 0.00 ? 42  THR A CA   6  
ATOM 8998  C C    . THR A 1 42  ? 8.216   13.021  2.993   1.00 0.00 ? 42  THR A C    6  
ATOM 8999  O O    . THR A 1 42  ? 8.910   14.015  2.910   1.00 0.00 ? 42  THR A O    6  
ATOM 9000  C CB   . THR A 1 42  ? 8.697   13.035  5.447   1.00 0.00 ? 42  THR A CB   6  
ATOM 9001  O OG1  . THR A 1 42  ? 9.218   11.980  6.243   1.00 0.00 ? 42  THR A OG1  6  
ATOM 9002  C CG2  . THR A 1 42  ? 7.881   13.984  6.324   1.00 0.00 ? 42  THR A CG2  6  
ATOM 9003  H H    . THR A 1 42  ? 8.375   10.534  3.555   1.00 0.00 ? 42  THR A H    6  
ATOM 9004  H HA   . THR A 1 42  ? 6.772   12.708  4.551   1.00 0.00 ? 42  THR A HA   6  
ATOM 9005  H HB   . THR A 1 42  ? 9.512   13.580  4.995   1.00 0.00 ? 42  THR A HB   6  
ATOM 9006  H HG1  . THR A 1 42  ? 9.982   12.315  6.720   1.00 0.00 ? 42  THR A HG1  6  
ATOM 9007  H HG21 . THR A 1 42  ? 8.539   14.710  6.779   1.00 0.00 ? 42  THR A HG21 6  
ATOM 9008  H HG22 . THR A 1 42  ? 7.379   13.419  7.096   1.00 0.00 ? 42  THR A HG22 6  
ATOM 9009  H HG23 . THR A 1 42  ? 7.147   14.494  5.718   1.00 0.00 ? 42  THR A HG23 6  
ATOM 9010  N N    . ALA A 1 43  ? 7.798   12.395  1.927   1.00 0.00 ? 43  ALA A N    6  
ATOM 9011  C CA   . ALA A 1 43  ? 8.168   12.894  0.572   1.00 0.00 ? 43  ALA A CA   6  
ATOM 9012  C C    . ALA A 1 43  ? 7.190   13.992  0.144   1.00 0.00 ? 43  ALA A C    6  
ATOM 9013  O O    . ALA A 1 43  ? 7.408   15.160  0.391   1.00 0.00 ? 43  ALA A O    6  
ATOM 9014  C CB   . ALA A 1 43  ? 8.107   11.739  -0.429  1.00 0.00 ? 43  ALA A CB   6  
ATOM 9015  H H    . ALA A 1 43  ? 7.241   11.594  2.017   1.00 0.00 ? 43  ALA A H    6  
ATOM 9016  H HA   . ALA A 1 43  ? 9.170   13.295  0.598   1.00 0.00 ? 43  ALA A HA   6  
ATOM 9017  H HB1  . ALA A 1 43  ? 7.429   10.982  -0.064  1.00 0.00 ? 43  ALA A HB1  6  
ATOM 9018  H HB2  . ALA A 1 43  ? 9.093   11.313  -0.547  1.00 0.00 ? 43  ALA A HB2  6  
ATOM 9019  H HB3  . ALA A 1 43  ? 7.756   12.106  -1.382  1.00 0.00 ? 43  ALA A HB3  6  
ATOM 9020  N N    . ASP A 1 44  ? 6.113   13.625  -0.499  1.00 0.00 ? 44  ASP A N    6  
ATOM 9021  C CA   . ASP A 1 44  ? 5.128   14.651  -0.944  1.00 0.00 ? 44  ASP A CA   6  
ATOM 9022  C C    . ASP A 1 44  ? 3.732   14.027  -1.012  1.00 0.00 ? 44  ASP A C    6  
ATOM 9023  O O    . ASP A 1 44  ? 3.582   12.837  -1.210  1.00 0.00 ? 44  ASP A O    6  
ATOM 9024  C CB   . ASP A 1 44  ? 5.521   15.165  -2.329  1.00 0.00 ? 44  ASP A CB   6  
ATOM 9025  C CG   . ASP A 1 44  ? 6.543   16.294  -2.187  1.00 0.00 ? 44  ASP A CG   6  
ATOM 9026  O OD1  . ASP A 1 44  ? 7.721   15.991  -2.090  1.00 0.00 ? 44  ASP A OD1  6  
ATOM 9027  O OD2  . ASP A 1 44  ? 6.130   17.442  -2.178  1.00 0.00 ? 44  ASP A OD2  6  
ATOM 9028  H H    . ASP A 1 44  ? 5.956   12.677  -0.691  1.00 0.00 ? 44  ASP A H    6  
ATOM 9029  H HA   . ASP A 1 44  ? 5.122   15.472  -0.242  1.00 0.00 ? 44  ASP A HA   6  
ATOM 9030  H HB2  . ASP A 1 44  ? 5.952   14.358  -2.904  1.00 0.00 ? 44  ASP A HB2  6  
ATOM 9031  H HB3  . ASP A 1 44  ? 4.644   15.538  -2.836  1.00 0.00 ? 44  ASP A HB3  6  
ATOM 9032  N N    . LYS A 1 45  ? 2.709   14.821  -0.855  1.00 0.00 ? 45  LYS A N    6  
ATOM 9033  C CA   . LYS A 1 45  ? 1.322   14.275  -0.913  1.00 0.00 ? 45  LYS A CA   6  
ATOM 9034  C C    . LYS A 1 45  ? 0.842   14.256  -2.367  1.00 0.00 ? 45  LYS A C    6  
ATOM 9035  O O    . LYS A 1 45  ? -0.229  14.737  -2.681  1.00 0.00 ? 45  LYS A O    6  
ATOM 9036  C CB   . LYS A 1 45  ? 0.391   15.157  -0.080  1.00 0.00 ? 45  LYS A CB   6  
ATOM 9037  C CG   . LYS A 1 45  ? 0.582   14.844  1.405   1.00 0.00 ? 45  LYS A CG   6  
ATOM 9038  C CD   . LYS A 1 45  ? -0.642  15.322  2.190   1.00 0.00 ? 45  LYS A CD   6  
ATOM 9039  C CE   . LYS A 1 45  ? -0.726  16.848  2.121   1.00 0.00 ? 45  LYS A CE   6  
ATOM 9040  N NZ   . LYS A 1 45  ? -1.849  17.325  2.977   1.00 0.00 ? 45  LYS A NZ   6  
ATOM 9041  H H    . LYS A 1 45  ? 2.851   15.778  -0.698  1.00 0.00 ? 45  LYS A H    6  
ATOM 9042  H HA   . LYS A 1 45  ? 1.314   13.268  -0.518  1.00 0.00 ? 45  LYS A HA   6  
ATOM 9043  H HB2  . LYS A 1 45  ? 0.622   16.197  -0.262  1.00 0.00 ? 45  LYS A HB2  6  
ATOM 9044  H HB3  . LYS A 1 45  ? -0.634  14.962  -0.358  1.00 0.00 ? 45  LYS A HB3  6  
ATOM 9045  H HG2  . LYS A 1 45  ? 0.702   13.778  1.536   1.00 0.00 ? 45  LYS A HG2  6  
ATOM 9046  H HG3  . LYS A 1 45  ? 1.461   15.352  1.770   1.00 0.00 ? 45  LYS A HG3  6  
ATOM 9047  H HD2  . LYS A 1 45  ? -1.536  14.890  1.762   1.00 0.00 ? 45  LYS A HD2  6  
ATOM 9048  H HD3  . LYS A 1 45  ? -0.552  15.015  3.221   1.00 0.00 ? 45  LYS A HD3  6  
ATOM 9049  H HE2  . LYS A 1 45  ? 0.201   17.275  2.472   1.00 0.00 ? 45  LYS A HE2  6  
ATOM 9050  H HE3  . LYS A 1 45  ? -0.899  17.153  1.099   1.00 0.00 ? 45  LYS A HE3  6  
ATOM 9051  H HZ1  . LYS A 1 45  ? -2.143  18.272  2.668   1.00 0.00 ? 45  LYS A HZ1  6  
ATOM 9052  H HZ2  . LYS A 1 45  ? -1.535  17.365  3.969   1.00 0.00 ? 45  LYS A HZ2  6  
ATOM 9053  H HZ3  . LYS A 1 45  ? -2.652  16.670  2.893   1.00 0.00 ? 45  LYS A HZ3  6  
ATOM 9054  N N    . GLY A 1 46  ? 1.624   13.707  -3.254  1.00 0.00 ? 46  GLY A N    6  
ATOM 9055  C CA   . GLY A 1 46  ? 1.210   13.661  -4.685  1.00 0.00 ? 46  GLY A CA   6  
ATOM 9056  C C    . GLY A 1 46  ? 0.759   12.242  -5.041  1.00 0.00 ? 46  GLY A C    6  
ATOM 9057  O O    . GLY A 1 46  ? -0.319  12.034  -5.562  1.00 0.00 ? 46  GLY A O    6  
ATOM 9058  H H    . GLY A 1 46  ? 2.485   13.325  -2.981  1.00 0.00 ? 46  GLY A H    6  
ATOM 9059  H HA2  . GLY A 1 46  ? 0.392   14.350  -4.847  1.00 0.00 ? 46  GLY A HA2  6  
ATOM 9060  H HA3  . GLY A 1 46  ? 2.046   13.939  -5.312  1.00 0.00 ? 46  GLY A HA3  6  
ATOM 9061  N N    . TRP A 1 47  ? 1.579   11.264  -4.767  1.00 0.00 ? 47  TRP A N    6  
ATOM 9062  C CA   . TRP A 1 47  ? 1.206   9.859   -5.093  1.00 0.00 ? 47  TRP A CA   6  
ATOM 9063  C C    . TRP A 1 47  ? 0.007   9.410   -4.251  1.00 0.00 ? 47  TRP A C    6  
ATOM 9064  O O    . TRP A 1 47  ? -0.510  8.327   -4.433  1.00 0.00 ? 47  TRP A O    6  
ATOM 9065  C CB   . TRP A 1 47  ? 2.397   8.931   -4.828  1.00 0.00 ? 47  TRP A CB   6  
ATOM 9066  C CG   . TRP A 1 47  ? 2.681   8.831   -3.359  1.00 0.00 ? 47  TRP A CG   6  
ATOM 9067  C CD1  . TRP A 1 47  ? 3.036   9.864   -2.553  1.00 0.00 ? 47  TRP A CD1  6  
ATOM 9068  C CD2  . TRP A 1 47  ? 2.663   7.644   -2.510  1.00 0.00 ? 47  TRP A CD2  6  
ATOM 9069  N NE1  . TRP A 1 47  ? 3.238   9.385   -1.274  1.00 0.00 ? 47  TRP A NE1  6  
ATOM 9070  C CE2  . TRP A 1 47  ? 3.021   8.028   -1.194  1.00 0.00 ? 47  TRP A CE2  6  
ATOM 9071  C CE3  . TRP A 1 47  ? 2.374   6.287   -2.748  1.00 0.00 ? 47  TRP A CE3  6  
ATOM 9072  C CZ2  . TRP A 1 47  ? 3.093   7.101   -0.157  1.00 0.00 ? 47  TRP A CZ2  6  
ATOM 9073  C CZ3  . TRP A 1 47  ? 2.448   5.352   -1.703  1.00 0.00 ? 47  TRP A CZ3  6  
ATOM 9074  C CH2  . TRP A 1 47  ? 2.809   5.759   -0.411  1.00 0.00 ? 47  TRP A CH2  6  
ATOM 9075  H H    . TRP A 1 47  ? 2.445   11.456  -4.358  1.00 0.00 ? 47  TRP A H    6  
ATOM 9076  H HA   . TRP A 1 47  ? 0.942   9.800   -6.138  1.00 0.00 ? 47  TRP A HA   6  
ATOM 9077  H HB2  . TRP A 1 47  ? 2.173   7.947   -5.213  1.00 0.00 ? 47  TRP A HB2  6  
ATOM 9078  H HB3  . TRP A 1 47  ? 3.268   9.319   -5.335  1.00 0.00 ? 47  TRP A HB3  6  
ATOM 9079  H HD1  . TRP A 1 47  ? 3.147   10.890  -2.856  1.00 0.00 ? 47  TRP A HD1  6  
ATOM 9080  H HE1  . TRP A 1 47  ? 3.503   9.929   -0.502  1.00 0.00 ? 47  TRP A HE1  6  
ATOM 9081  H HE3  . TRP A 1 47  ? 2.088   5.962   -3.740  1.00 0.00 ? 47  TRP A HE3  6  
ATOM 9082  H HZ2  . TRP A 1 47  ? 3.372   7.419   0.837   1.00 0.00 ? 47  TRP A HZ2  6  
ATOM 9083  H HZ3  . TRP A 1 47  ? 2.228   4.312   -1.895  1.00 0.00 ? 47  TRP A HZ3  6  
ATOM 9084  H HH2  . TRP A 1 47  ? 2.870   5.036   0.387   1.00 0.00 ? 47  TRP A HH2  6  
ATOM 9085  N N    . GLN A 1 48  ? -0.449  10.227  -3.340  1.00 0.00 ? 48  GLN A N    6  
ATOM 9086  C CA   . GLN A 1 48  ? -1.624  9.814   -2.518  1.00 0.00 ? 48  GLN A CA   6  
ATOM 9087  C C    . GLN A 1 48  ? -2.808  9.543   -3.453  1.00 0.00 ? 48  GLN A C    6  
ATOM 9088  O O    . GLN A 1 48  ? -3.236  8.418   -3.621  1.00 0.00 ? 48  GLN A O    6  
ATOM 9089  C CB   . GLN A 1 48  ? -2.010  10.920  -1.524  1.00 0.00 ? 48  GLN A CB   6  
ATOM 9090  C CG   . GLN A 1 48  ? -0.781  11.743  -1.128  1.00 0.00 ? 48  GLN A CG   6  
ATOM 9091  C CD   . GLN A 1 48  ? 0.373   10.809  -0.765  1.00 0.00 ? 48  GLN A CD   6  
ATOM 9092  O OE1  . GLN A 1 48  ? 1.525   11.156  -0.932  1.00 0.00 ? 48  GLN A OE1  6  
ATOM 9093  N NE2  . GLN A 1 48  ? 0.114   9.631   -0.269  1.00 0.00 ? 48  GLN A NE2  6  
ATOM 9094  H H    . GLN A 1 48  ? -0.031  11.098  -3.204  1.00 0.00 ? 48  GLN A H    6  
ATOM 9095  H HA   . GLN A 1 48  ? -1.380  8.912   -1.976  1.00 0.00 ? 48  GLN A HA   6  
ATOM 9096  H HB2  . GLN A 1 48  ? -2.743  11.567  -1.980  1.00 0.00 ? 48  GLN A HB2  6  
ATOM 9097  H HB3  . GLN A 1 48  ? -2.434  10.470  -0.640  1.00 0.00 ? 48  GLN A HB3  6  
ATOM 9098  H HG2  . GLN A 1 48  ? -0.490  12.374  -1.955  1.00 0.00 ? 48  GLN A HG2  6  
ATOM 9099  H HG3  . GLN A 1 48  ? -1.023  12.360  -0.275  1.00 0.00 ? 48  GLN A HG3  6  
ATOM 9100  H HE21 . GLN A 1 48  ? -0.815  9.350   -0.132  1.00 0.00 ? 48  GLN A HE21 6  
ATOM 9101  H HE22 . GLN A 1 48  ? 0.849   9.026   -0.033  1.00 0.00 ? 48  GLN A HE22 6  
ATOM 9102  N N    . ASN A 1 49  ? -3.335  10.569  -4.068  1.00 0.00 ? 49  ASN A N    6  
ATOM 9103  C CA   . ASN A 1 49  ? -4.487  10.382  -4.998  1.00 0.00 ? 49  ASN A CA   6  
ATOM 9104  C C    . ASN A 1 49  ? -4.006  9.704   -6.283  1.00 0.00 ? 49  ASN A C    6  
ATOM 9105  O O    . ASN A 1 49  ? -4.767  9.069   -6.983  1.00 0.00 ? 49  ASN A O    6  
ATOM 9106  C CB   . ASN A 1 49  ? -5.088  11.746  -5.343  1.00 0.00 ? 49  ASN A CB   6  
ATOM 9107  C CG   . ASN A 1 49  ? -6.160  12.109  -4.313  1.00 0.00 ? 49  ASN A CG   6  
ATOM 9108  O OD1  . ASN A 1 49  ? -6.211  11.535  -3.243  1.00 0.00 ? 49  ASN A OD1  6  
ATOM 9109  N ND2  . ASN A 1 49  ? -7.025  13.047  -4.591  1.00 0.00 ? 49  ASN A ND2  6  
ATOM 9110  H H    . ASN A 1 49  ? -2.970  11.467  -3.919  1.00 0.00 ? 49  ASN A H    6  
ATOM 9111  H HA   . ASN A 1 49  ? -5.238  9.765   -4.531  1.00 0.00 ? 49  ASN A HA   6  
ATOM 9112  H HB2  . ASN A 1 49  ? -4.308  12.495  -5.332  1.00 0.00 ? 49  ASN A HB2  6  
ATOM 9113  H HB3  . ASN A 1 49  ? -5.534  11.705  -6.325  1.00 0.00 ? 49  ASN A HB3  6  
ATOM 9114  H HD21 . ASN A 1 49  ? -6.984  13.511  -5.453  1.00 0.00 ? 49  ASN A HD21 6  
ATOM 9115  H HD22 . ASN A 1 49  ? -7.714  13.287  -3.937  1.00 0.00 ? 49  ASN A HD22 6  
ATOM 9116  N N    . SER A 1 50  ? -2.750  9.838   -6.602  1.00 0.00 ? 50  SER A N    6  
ATOM 9117  C CA   . SER A 1 50  ? -2.228  9.205   -7.845  1.00 0.00 ? 50  SER A CA   6  
ATOM 9118  C C    . SER A 1 50  ? -2.421  7.689   -7.773  1.00 0.00 ? 50  SER A C    6  
ATOM 9119  O O    . SER A 1 50  ? -2.790  7.061   -8.741  1.00 0.00 ? 50  SER A O    6  
ATOM 9120  C CB   . SER A 1 50  ? -0.741  9.524   -7.994  1.00 0.00 ? 50  SER A CB   6  
ATOM 9121  O OG   . SER A 1 50  ? -0.343  9.288   -9.338  1.00 0.00 ? 50  SER A OG   6  
ATOM 9122  H H    . SER A 1 50  ? -2.150  10.359  -6.027  1.00 0.00 ? 50  SER A H    6  
ATOM 9123  H HA   . SER A 1 50  ? -2.766  9.595   -8.696  1.00 0.00 ? 50  SER A HA   6  
ATOM 9124  H HB2  . SER A 1 50  ? -0.566  10.558  -7.749  1.00 0.00 ? 50  SER A HB2  6  
ATOM 9125  H HB3  . SER A 1 50  ? -0.171  8.895   -7.323  1.00 0.00 ? 50  SER A HB3  6  
ATOM 9126  H HG   . SER A 1 50  ? 0.558   9.600   -9.440  1.00 0.00 ? 50  SER A HG   6  
ATOM 9127  N N    . ILE A 1 51  ? -2.169  7.098   -6.635  1.00 0.00 ? 51  ILE A N    6  
ATOM 9128  C CA   . ILE A 1 51  ? -2.331  5.620   -6.500  1.00 0.00 ? 51  ILE A CA   6  
ATOM 9129  C C    . ILE A 1 51  ? -3.792  5.232   -6.770  1.00 0.00 ? 51  ILE A C    6  
ATOM 9130  O O    . ILE A 1 51  ? -4.072  4.347   -7.554  1.00 0.00 ? 51  ILE A O    6  
ATOM 9131  C CB   . ILE A 1 51  ? -1.892  5.200   -5.080  1.00 0.00 ? 51  ILE A CB   6  
ATOM 9132  C CG1  . ILE A 1 51  ? -0.482  4.611   -5.146  1.00 0.00 ? 51  ILE A CG1  6  
ATOM 9133  C CG2  . ILE A 1 51  ? -2.835  4.145   -4.487  1.00 0.00 ? 51  ILE A CG2  6  
ATOM 9134  C CD1  . ILE A 1 51  ? 0.462   5.603   -5.814  1.00 0.00 ? 51  ILE A CD1  6  
ATOM 9135  H H    . ILE A 1 51  ? -1.869  7.626   -5.867  1.00 0.00 ? 51  ILE A H    6  
ATOM 9136  H HA   . ILE A 1 51  ? -1.698  5.130   -7.225  1.00 0.00 ? 51  ILE A HA   6  
ATOM 9137  H HB   . ILE A 1 51  ? -1.884  6.068   -4.437  1.00 0.00 ? 51  ILE A HB   6  
ATOM 9138  H HG12 . ILE A 1 51  ? -0.135  4.402   -4.149  1.00 0.00 ? 51  ILE A HG12 6  
ATOM 9139  H HG13 . ILE A 1 51  ? -0.497  3.700   -5.717  1.00 0.00 ? 51  ILE A HG13 6  
ATOM 9140  H HG21 . ILE A 1 51  ? -3.667  4.634   -4.005  1.00 0.00 ? 51  ILE A HG21 6  
ATOM 9141  H HG22 . ILE A 1 51  ? -2.296  3.553   -3.761  1.00 0.00 ? 51  ILE A HG22 6  
ATOM 9142  H HG23 . ILE A 1 51  ? -3.199  3.502   -5.274  1.00 0.00 ? 51  ILE A HG23 6  
ATOM 9143  H HD11 . ILE A 1 51  ? -0.069  6.148   -6.578  1.00 0.00 ? 51  ILE A HD11 6  
ATOM 9144  H HD12 . ILE A 1 51  ? 1.286   5.066   -6.260  1.00 0.00 ? 51  ILE A HD12 6  
ATOM 9145  H HD13 . ILE A 1 51  ? 0.838   6.292   -5.075  1.00 0.00 ? 51  ILE A HD13 6  
ATOM 9146  N N    . ARG A 1 52  ? -4.723  5.882   -6.128  1.00 0.00 ? 52  ARG A N    6  
ATOM 9147  C CA   . ARG A 1 52  ? -6.158  5.541   -6.350  1.00 0.00 ? 52  ARG A CA   6  
ATOM 9148  C C    . ARG A 1 52  ? -6.487  5.647   -7.841  1.00 0.00 ? 52  ARG A C    6  
ATOM 9149  O O    . ARG A 1 52  ? -7.031  4.738   -8.434  1.00 0.00 ? 52  ARG A O    6  
ATOM 9150  C CB   . ARG A 1 52  ? -7.041  6.516   -5.568  1.00 0.00 ? 52  ARG A CB   6  
ATOM 9151  C CG   . ARG A 1 52  ? -8.514  6.206   -5.843  1.00 0.00 ? 52  ARG A CG   6  
ATOM 9152  C CD   . ARG A 1 52  ? -9.286  7.515   -6.028  1.00 0.00 ? 52  ARG A CD   6  
ATOM 9153  N NE   . ARG A 1 52  ? -10.587 7.429   -5.308  1.00 0.00 ? 52  ARG A NE   6  
ATOM 9154  C CZ   . ARG A 1 52  ? -10.863 8.277   -4.356  1.00 0.00 ? 52  ARG A CZ   6  
ATOM 9155  N NH1  . ARG A 1 52  ? -10.519 9.530   -4.479  1.00 0.00 ? 52  ARG A NH1  6  
ATOM 9156  N NH2  . ARG A 1 52  ? -11.482 7.874   -3.280  1.00 0.00 ? 52  ARG A NH2  6  
ATOM 9157  H H    . ARG A 1 52  ? -4.479  6.591   -5.497  1.00 0.00 ? 52  ARG A H    6  
ATOM 9158  H HA   . ARG A 1 52  ? -6.347  4.533   -6.010  1.00 0.00 ? 52  ARG A HA   6  
ATOM 9159  H HB2  . ARG A 1 52  ? -6.842  6.415   -4.512  1.00 0.00 ? 52  ARG A HB2  6  
ATOM 9160  H HB3  . ARG A 1 52  ? -6.824  7.527   -5.880  1.00 0.00 ? 52  ARG A HB3  6  
ATOM 9161  H HG2  . ARG A 1 52  ? -8.595  5.609   -6.740  1.00 0.00 ? 52  ARG A HG2  6  
ATOM 9162  H HG3  . ARG A 1 52  ? -8.929  5.661   -5.009  1.00 0.00 ? 52  ARG A HG3  6  
ATOM 9163  H HD2  . ARG A 1 52  ? -8.707  8.334   -5.628  1.00 0.00 ? 52  ARG A HD2  6  
ATOM 9164  H HD3  . ARG A 1 52  ? -9.466  7.681   -7.079  1.00 0.00 ? 52  ARG A HD3  6  
ATOM 9165  H HE   . ARG A 1 52  ? -11.235 6.735   -5.550  1.00 0.00 ? 52  ARG A HE   6  
ATOM 9166  H HH11 . ARG A 1 52  ? -10.046 9.840   -5.304  1.00 0.00 ? 52  ARG A HH11 6  
ATOM 9167  H HH12 . ARG A 1 52  ? -10.728 10.180  -3.749  1.00 0.00 ? 52  ARG A HH12 6  
ATOM 9168  H HH21 . ARG A 1 52  ? -11.745 6.915   -3.184  1.00 0.00 ? 52  ARG A HH21 6  
ATOM 9169  H HH22 . ARG A 1 52  ? -11.692 8.526   -2.551  1.00 0.00 ? 52  ARG A HH22 6  
ATOM 9170  N N    . HIS A 1 53  ? -6.164  6.756   -8.445  1.00 0.00 ? 53  HIS A N    6  
ATOM 9171  C CA   . HIS A 1 53  ? -6.457  6.935   -9.893  1.00 0.00 ? 53  HIS A CA   6  
ATOM 9172  C C    . HIS A 1 53  ? -5.586  5.986   -10.720 1.00 0.00 ? 53  HIS A C    6  
ATOM 9173  O O    . HIS A 1 53  ? -5.887  5.682   -11.857 1.00 0.00 ? 53  HIS A O    6  
ATOM 9174  C CB   . HIS A 1 53  ? -6.148  8.380   -10.284 1.00 0.00 ? 53  HIS A CB   6  
ATOM 9175  C CG   . HIS A 1 53  ? -6.944  8.752   -11.505 1.00 0.00 ? 53  HIS A CG   6  
ATOM 9176  N ND1  . HIS A 1 53  ? -6.610  9.833   -12.304 1.00 0.00 ? 53  HIS A ND1  6  
ATOM 9177  C CD2  . HIS A 1 53  ? -8.060  8.193   -12.077 1.00 0.00 ? 53  HIS A CD2  6  
ATOM 9178  C CE1  . HIS A 1 53  ? -7.509  9.890   -13.305 1.00 0.00 ? 53  HIS A CE1  6  
ATOM 9179  N NE2  . HIS A 1 53  ? -8.415  8.914   -13.213 1.00 0.00 ? 53  HIS A NE2  6  
ATOM 9180  H H    . HIS A 1 53  ? -5.729  7.475   -7.943  1.00 0.00 ? 53  HIS A H    6  
ATOM 9181  H HA   . HIS A 1 53  ? -7.500  6.726   -10.081 1.00 0.00 ? 53  HIS A HA   6  
ATOM 9182  H HB2  . HIS A 1 53  ? -6.410  9.036   -9.466  1.00 0.00 ? 53  HIS A HB2  6  
ATOM 9183  H HB3  . HIS A 1 53  ? -5.093  8.476   -10.496 1.00 0.00 ? 53  HIS A HB3  6  
ATOM 9184  H HD1  . HIS A 1 53  ? -5.857  10.445  -12.166 1.00 0.00 ? 53  HIS A HD1  6  
ATOM 9185  H HD2  . HIS A 1 53  ? -8.585  7.328   -11.701 1.00 0.00 ? 53  HIS A HD2  6  
ATOM 9186  H HE1  . HIS A 1 53  ? -7.499  10.635  -14.087 1.00 0.00 ? 53  HIS A HE1  6  
ATOM 9187  N N    . ASN A 1 54  ? -4.508  5.518   -10.155 1.00 0.00 ? 54  ASN A N    6  
ATOM 9188  C CA   . ASN A 1 54  ? -3.610  4.590   -10.900 1.00 0.00 ? 54  ASN A CA   6  
ATOM 9189  C C    . ASN A 1 54  ? -4.292  3.235   -11.049 1.00 0.00 ? 54  ASN A C    6  
ATOM 9190  O O    . ASN A 1 54  ? -4.269  2.623   -12.097 1.00 0.00 ? 54  ASN A O    6  
ATOM 9191  C CB   . ASN A 1 54  ? -2.303  4.413   -10.121 1.00 0.00 ? 54  ASN A CB   6  
ATOM 9192  C CG   . ASN A 1 54  ? -1.241  5.352   -10.695 1.00 0.00 ? 54  ASN A CG   6  
ATOM 9193  O OD1  . ASN A 1 54  ? -0.933  5.296   -11.869 1.00 0.00 ? 54  ASN A OD1  6  
ATOM 9194  N ND2  . ASN A 1 54  ? -0.661  6.218   -9.909  1.00 0.00 ? 54  ASN A ND2  6  
ATOM 9195  H H    . ASN A 1 54  ? -4.290  5.775   -9.238  1.00 0.00 ? 54  ASN A H    6  
ATOM 9196  H HA   . ASN A 1 54  ? -3.396  4.998   -11.877 1.00 0.00 ? 54  ASN A HA   6  
ATOM 9197  H HB2  . ASN A 1 54  ? -2.472  4.651   -9.081  1.00 0.00 ? 54  ASN A HB2  6  
ATOM 9198  H HB3  . ASN A 1 54  ? -1.966  3.388   -10.207 1.00 0.00 ? 54  ASN A HB3  6  
ATOM 9199  H HD21 . ASN A 1 54  ? -0.904  6.260   -8.960  1.00 0.00 ? 54  ASN A HD21 6  
ATOM 9200  H HD22 . ASN A 1 54  ? 0.014   6.831   -10.269 1.00 0.00 ? 54  ASN A HD22 6  
ATOM 9201  N N    . LEU A 1 55  ? -4.893  2.761   -9.997  1.00 0.00 ? 55  LEU A N    6  
ATOM 9202  C CA   . LEU A 1 55  ? -5.574  1.443   -10.053 1.00 0.00 ? 55  LEU A CA   6  
ATOM 9203  C C    . LEU A 1 55  ? -6.803  1.532   -10.960 1.00 0.00 ? 55  LEU A C    6  
ATOM 9204  O O    . LEU A 1 55  ? -7.440  0.540   -11.257 1.00 0.00 ? 55  LEU A O    6  
ATOM 9205  C CB   . LEU A 1 55  ? -5.992  1.050   -8.637  1.00 0.00 ? 55  LEU A CB   6  
ATOM 9206  C CG   . LEU A 1 55  ? -4.780  1.161   -7.713  1.00 0.00 ? 55  LEU A CG   6  
ATOM 9207  C CD1  . LEU A 1 55  ? -5.196  0.849   -6.275  1.00 0.00 ? 55  LEU A CD1  6  
ATOM 9208  C CD2  . LEU A 1 55  ? -3.715  0.167   -8.169  1.00 0.00 ? 55  LEU A CD2  6  
ATOM 9209  H H    . LEU A 1 55  ? -4.891  3.275   -9.164  1.00 0.00 ? 55  LEU A H    6  
ATOM 9210  H HA   . LEU A 1 55  ? -4.893  0.704   -10.445 1.00 0.00 ? 55  LEU A HA   6  
ATOM 9211  H HB2  . LEU A 1 55  ? -6.767  1.715   -8.295  1.00 0.00 ? 55  LEU A HB2  6  
ATOM 9212  H HB3  . LEU A 1 55  ? -6.355  0.034   -8.633  1.00 0.00 ? 55  LEU A HB3  6  
ATOM 9213  H HG   . LEU A 1 55  ? -4.381  2.165   -7.760  1.00 0.00 ? 55  LEU A HG   6  
ATOM 9214  H HD11 . LEU A 1 55  ? -5.350  -0.214  -6.168  1.00 0.00 ? 55  LEU A HD11 6  
ATOM 9215  H HD12 . LEU A 1 55  ? -6.112  1.371   -6.044  1.00 0.00 ? 55  LEU A HD12 6  
ATOM 9216  H HD13 . LEU A 1 55  ? -4.418  1.170   -5.599  1.00 0.00 ? 55  LEU A HD13 6  
ATOM 9217  H HD21 . LEU A 1 55  ? -3.644  -0.639  -7.454  1.00 0.00 ? 55  LEU A HD21 6  
ATOM 9218  H HD22 . LEU A 1 55  ? -2.761  0.668   -8.243  1.00 0.00 ? 55  LEU A HD22 6  
ATOM 9219  H HD23 . LEU A 1 55  ? -3.986  -0.231  -9.133  1.00 0.00 ? 55  LEU A HD23 6  
ATOM 9220  N N    . SER A 1 56  ? -7.136  2.710   -11.413 1.00 0.00 ? 56  SER A N    6  
ATOM 9221  C CA   . SER A 1 56  ? -8.316  2.854   -12.311 1.00 0.00 ? 56  SER A CA   6  
ATOM 9222  C C    . SER A 1 56  ? -7.896  2.529   -13.744 1.00 0.00 ? 56  SER A C    6  
ATOM 9223  O O    . SER A 1 56  ? -8.661  1.995   -14.522 1.00 0.00 ? 56  SER A O    6  
ATOM 9224  C CB   . SER A 1 56  ? -8.839  4.289   -12.247 1.00 0.00 ? 56  SER A CB   6  
ATOM 9225  O OG   . SER A 1 56  ? -9.681  4.530   -13.366 1.00 0.00 ? 56  SER A OG   6  
ATOM 9226  H H    . SER A 1 56  ? -6.606  3.497   -11.170 1.00 0.00 ? 56  SER A H    6  
ATOM 9227  H HA   . SER A 1 56  ? -9.092  2.171   -11.999 1.00 0.00 ? 56  SER A HA   6  
ATOM 9228  H HB2  . SER A 1 56  ? -9.406  4.428   -11.341 1.00 0.00 ? 56  SER A HB2  6  
ATOM 9229  H HB3  . SER A 1 56  ? -8.004  4.977   -12.256 1.00 0.00 ? 56  SER A HB3  6  
ATOM 9230  H HG   . SER A 1 56  ? -9.129  4.565   -14.151 1.00 0.00 ? 56  SER A HG   6  
ATOM 9231  N N    . LEU A 1 57  ? -6.680  2.846   -14.098 1.00 0.00 ? 57  LEU A N    6  
ATOM 9232  C CA   . LEU A 1 57  ? -6.203  2.553   -15.479 1.00 0.00 ? 57  LEU A CA   6  
ATOM 9233  C C    . LEU A 1 57  ? -5.588  1.153   -15.515 1.00 0.00 ? 57  LEU A C    6  
ATOM 9234  O O    . LEU A 1 57  ? -5.699  0.439   -16.492 1.00 0.00 ? 57  LEU A O    6  
ATOM 9235  C CB   . LEU A 1 57  ? -5.143  3.583   -15.881 1.00 0.00 ? 57  LEU A CB   6  
ATOM 9236  C CG   . LEU A 1 57  ? -5.737  4.989   -15.803 1.00 0.00 ? 57  LEU A CG   6  
ATOM 9237  C CD1  . LEU A 1 57  ? -5.321  5.650   -14.486 1.00 0.00 ? 57  LEU A CD1  6  
ATOM 9238  C CD2  . LEU A 1 57  ? -5.220  5.826   -16.976 1.00 0.00 ? 57  LEU A CD2  6  
ATOM 9239  H H    . LEU A 1 57  ? -6.079  3.274   -13.453 1.00 0.00 ? 57  LEU A H    6  
ATOM 9240  H HA   . LEU A 1 57  ? -7.033  2.603   -16.167 1.00 0.00 ? 57  LEU A HA   6  
ATOM 9241  H HB2  . LEU A 1 57  ? -4.299  3.509   -15.210 1.00 0.00 ? 57  LEU A HB2  6  
ATOM 9242  H HB3  . LEU A 1 57  ? -4.817  3.386   -16.891 1.00 0.00 ? 57  LEU A HB3  6  
ATOM 9243  H HG   . LEU A 1 57  ? -6.815  4.927   -15.849 1.00 0.00 ? 57  LEU A HG   6  
ATOM 9244  H HD11 . LEU A 1 57  ? -4.681  6.495   -14.695 1.00 0.00 ? 57  LEU A HD11 6  
ATOM 9245  H HD12 . LEU A 1 57  ? -4.787  4.935   -13.877 1.00 0.00 ? 57  LEU A HD12 6  
ATOM 9246  H HD13 . LEU A 1 57  ? -6.201  5.985   -13.958 1.00 0.00 ? 57  LEU A HD13 6  
ATOM 9247  H HD21 . LEU A 1 57  ? -4.240  6.211   -16.739 1.00 0.00 ? 57  LEU A HD21 6  
ATOM 9248  H HD22 . LEU A 1 57  ? -5.896  6.648   -17.157 1.00 0.00 ? 57  LEU A HD22 6  
ATOM 9249  H HD23 . LEU A 1 57  ? -5.159  5.208   -17.859 1.00 0.00 ? 57  LEU A HD23 6  
ATOM 9250  N N    . ASN A 1 58  ? -4.935  0.758   -14.456 1.00 0.00 ? 58  ASN A N    6  
ATOM 9251  C CA   . ASN A 1 58  ? -4.307  -0.594  -14.427 1.00 0.00 ? 58  ASN A CA   6  
ATOM 9252  C C    . ASN A 1 58  ? -5.392  -1.669  -14.504 1.00 0.00 ? 58  ASN A C    6  
ATOM 9253  O O    . ASN A 1 58  ? -6.462  -1.528  -13.947 1.00 0.00 ? 58  ASN A O    6  
ATOM 9254  C CB   . ASN A 1 58  ? -3.510  -0.767  -13.134 1.00 0.00 ? 58  ASN A CB   6  
ATOM 9255  C CG   . ASN A 1 58  ? -2.106  -0.188  -13.325 1.00 0.00 ? 58  ASN A CG   6  
ATOM 9256  O OD1  . ASN A 1 58  ? -1.155  -0.921  -13.512 1.00 0.00 ? 58  ASN A OD1  6  
ATOM 9257  N ND2  . ASN A 1 58  ? -1.936  1.106   -13.291 1.00 0.00 ? 58  ASN A ND2  6  
ATOM 9258  H H    . ASN A 1 58  ? -4.856  1.353   -13.681 1.00 0.00 ? 58  ASN A H    6  
ATOM 9259  H HA   . ASN A 1 58  ? -3.643  -0.697  -15.272 1.00 0.00 ? 58  ASN A HA   6  
ATOM 9260  H HB2  . ASN A 1 58  ? -4.011  -0.250  -12.326 1.00 0.00 ? 58  ASN A HB2  6  
ATOM 9261  H HB3  . ASN A 1 58  ? -3.438  -1.815  -12.899 1.00 0.00 ? 58  ASN A HB3  6  
ATOM 9262  H HD21 . ASN A 1 58  ? -2.703  1.697   -13.144 1.00 0.00 ? 58  ASN A HD21 6  
ATOM 9263  H HD22 . ASN A 1 58  ? -1.040  1.484   -13.412 1.00 0.00 ? 58  ASN A HD22 6  
ATOM 9264  N N    . ARG A 1 59  ? -5.126  -2.741  -15.202 1.00 0.00 ? 59  ARG A N    6  
ATOM 9265  C CA   . ARG A 1 59  ? -6.143  -3.822  -15.328 1.00 0.00 ? 59  ARG A CA   6  
ATOM 9266  C C    . ARG A 1 59  ? -5.972  -4.863  -14.217 1.00 0.00 ? 59  ARG A C    6  
ATOM 9267  O O    . ARG A 1 59  ? -6.903  -5.567  -13.880 1.00 0.00 ? 59  ARG A O    6  
ATOM 9268  C CB   . ARG A 1 59  ? -5.984  -4.510  -16.686 1.00 0.00 ? 59  ARG A CB   6  
ATOM 9269  C CG   . ARG A 1 59  ? -6.853  -5.769  -16.725 1.00 0.00 ? 59  ARG A CG   6  
ATOM 9270  C CD   . ARG A 1 59  ? -7.522  -5.885  -18.095 1.00 0.00 ? 59  ARG A CD   6  
ATOM 9271  N NE   . ARG A 1 59  ? -7.902  -7.305  -18.344 1.00 0.00 ? 59  ARG A NE   6  
ATOM 9272  C CZ   . ARG A 1 59  ? -7.382  -7.953  -19.350 1.00 0.00 ? 59  ARG A CZ   6  
ATOM 9273  N NH1  . ARG A 1 59  ? -7.910  -7.846  -20.539 1.00 0.00 ? 59  ARG A NH1  6  
ATOM 9274  N NH2  . ARG A 1 59  ? -6.333  -8.707  -19.167 1.00 0.00 ? 59  ARG A NH2  6  
ATOM 9275  H H    . ARG A 1 59  ? -4.258  -2.830  -15.649 1.00 0.00 ? 59  ARG A H    6  
ATOM 9276  H HA   . ARG A 1 59  ? -7.130  -3.391  -15.264 1.00 0.00 ? 59  ARG A HA   6  
ATOM 9277  H HB2  . ARG A 1 59  ? -6.292  -3.834  -17.471 1.00 0.00 ? 59  ARG A HB2  6  
ATOM 9278  H HB3  . ARG A 1 59  ? -4.950  -4.785  -16.832 1.00 0.00 ? 59  ARG A HB3  6  
ATOM 9279  H HG2  . ARG A 1 59  ? -6.236  -6.638  -16.549 1.00 0.00 ? 59  ARG A HG2  6  
ATOM 9280  H HG3  . ARG A 1 59  ? -7.612  -5.706  -15.960 1.00 0.00 ? 59  ARG A HG3  6  
ATOM 9281  H HD2  . ARG A 1 59  ? -8.407  -5.266  -18.116 1.00 0.00 ? 59  ARG A HD2  6  
ATOM 9282  H HD3  . ARG A 1 59  ? -6.835  -5.557  -18.860 1.00 0.00 ? 59  ARG A HD3  6  
ATOM 9283  H HE   . ARG A 1 59  ? -8.544  -7.752  -17.753 1.00 0.00 ? 59  ARG A HE   6  
ATOM 9284  H HH11 . ARG A 1 59  ? -8.714  -7.268  -20.679 1.00 0.00 ? 59  ARG A HH11 6  
ATOM 9285  H HH12 . ARG A 1 59  ? -7.510  -8.343  -21.309 1.00 0.00 ? 59  ARG A HH12 6  
ATOM 9286  H HH21 . ARG A 1 59  ? -5.928  -8.788  -18.256 1.00 0.00 ? 59  ARG A HH21 6  
ATOM 9287  H HH22 . ARG A 1 59  ? -5.934  -9.203  -19.938 1.00 0.00 ? 59  ARG A HH22 6  
ATOM 9288  N N    . TYR A 1 60  ? -4.797  -4.998  -13.660 1.00 0.00 ? 60  TYR A N    6  
ATOM 9289  C CA   . TYR A 1 60  ? -4.618  -6.034  -12.601 1.00 0.00 ? 60  TYR A CA   6  
ATOM 9290  C C    . TYR A 1 60  ? -5.027  -5.508  -11.226 1.00 0.00 ? 60  TYR A C    6  
ATOM 9291  O O    . TYR A 1 60  ? -4.687  -6.084  -10.213 1.00 0.00 ? 60  TYR A O    6  
ATOM 9292  C CB   . TYR A 1 60  ? -3.171  -6.532  -12.557 1.00 0.00 ? 60  TYR A CB   6  
ATOM 9293  C CG   . TYR A 1 60  ? -2.171  -5.394  -12.445 1.00 0.00 ? 60  TYR A CG   6  
ATOM 9294  C CD1  . TYR A 1 60  ? -2.581  -4.074  -12.196 1.00 0.00 ? 60  TYR A CD1  6  
ATOM 9295  C CD2  . TYR A 1 60  ? -0.808  -5.677  -12.598 1.00 0.00 ? 60  TYR A CD2  6  
ATOM 9296  C CE1  . TYR A 1 60  ? -1.621  -3.054  -12.107 1.00 0.00 ? 60  TYR A CE1  6  
ATOM 9297  C CE2  . TYR A 1 60  ? 0.143   -4.657  -12.508 1.00 0.00 ? 60  TYR A CE2  6  
ATOM 9298  C CZ   . TYR A 1 60  ? -0.264  -3.346  -12.264 1.00 0.00 ? 60  TYR A CZ   6  
ATOM 9299  O OH   . TYR A 1 60  ? 0.673   -2.337  -12.173 1.00 0.00 ? 60  TYR A OH   6  
ATOM 9300  H H    . TYR A 1 60  ? -4.043  -4.446  -13.951 1.00 0.00 ? 60  TYR A H    6  
ATOM 9301  H HA   . TYR A 1 60  ? -5.256  -6.873  -12.842 1.00 0.00 ? 60  TYR A HA   6  
ATOM 9302  H HB2  . TYR A 1 60  ? -3.056  -7.181  -11.705 1.00 0.00 ? 60  TYR A HB2  6  
ATOM 9303  H HB3  . TYR A 1 60  ? -2.965  -7.094  -13.456 1.00 0.00 ? 60  TYR A HB3  6  
ATOM 9304  H HD1  . TYR A 1 60  ? -3.628  -3.841  -12.068 1.00 0.00 ? 60  TYR A HD1  6  
ATOM 9305  H HD2  . TYR A 1 60  ? -0.492  -6.688  -12.783 1.00 0.00 ? 60  TYR A HD2  6  
ATOM 9306  H HE1  . TYR A 1 60  ? -1.927  -2.039  -11.917 1.00 0.00 ? 60  TYR A HE1  6  
ATOM 9307  H HE2  . TYR A 1 60  ? 1.192   -4.884  -12.629 1.00 0.00 ? 60  TYR A HE2  6  
ATOM 9308  H HH   . TYR A 1 60  ? 1.352   -2.502  -12.830 1.00 0.00 ? 60  TYR A HH   6  
ATOM 9309  N N    . PHE A 1 61  ? -5.774  -4.445  -11.171 1.00 0.00 ? 61  PHE A N    6  
ATOM 9310  C CA   . PHE A 1 61  ? -6.217  -3.931  -9.845  1.00 0.00 ? 61  PHE A CA   6  
ATOM 9311  C C    . PHE A 1 61  ? -7.738  -3.840  -9.837  1.00 0.00 ? 61  PHE A C    6  
ATOM 9312  O O    . PHE A 1 61  ? -8.329  -3.021  -10.513 1.00 0.00 ? 61  PHE A O    6  
ATOM 9313  C CB   . PHE A 1 61  ? -5.622  -2.551  -9.588  1.00 0.00 ? 61  PHE A CB   6  
ATOM 9314  C CG   . PHE A 1 61  ? -4.205  -2.693  -9.090  1.00 0.00 ? 61  PHE A CG   6  
ATOM 9315  C CD1  . PHE A 1 61  ? -3.937  -3.251  -7.832  1.00 0.00 ? 61  PHE A CD1  6  
ATOM 9316  C CD2  . PHE A 1 61  ? -3.154  -2.251  -9.889  1.00 0.00 ? 61  PHE A CD2  6  
ATOM 9317  C CE1  . PHE A 1 61  ? -2.618  -3.354  -7.385  1.00 0.00 ? 61  PHE A CE1  6  
ATOM 9318  C CE2  . PHE A 1 61  ? -1.837  -2.358  -9.442  1.00 0.00 ? 61  PHE A CE2  6  
ATOM 9319  C CZ   . PHE A 1 61  ? -1.569  -2.907  -8.190  1.00 0.00 ? 61  PHE A CZ   6  
ATOM 9320  H H    . PHE A 1 61  ? -6.063  -4.000  -11.995 1.00 0.00 ? 61  PHE A H    6  
ATOM 9321  H HA   . PHE A 1 61  ? -5.894  -4.612  -9.072  1.00 0.00 ? 61  PHE A HA   6  
ATOM 9322  H HB2  . PHE A 1 61  ? -5.626  -1.980  -10.505 1.00 0.00 ? 61  PHE A HB2  6  
ATOM 9323  H HB3  . PHE A 1 61  ? -6.213  -2.039  -8.843  1.00 0.00 ? 61  PHE A HB3  6  
ATOM 9324  H HD1  . PHE A 1 61  ? -4.744  -3.598  -7.206  1.00 0.00 ? 61  PHE A HD1  6  
ATOM 9325  H HD2  . PHE A 1 61  ? -3.361  -1.835  -10.854 1.00 0.00 ? 61  PHE A HD2  6  
ATOM 9326  H HE1  . PHE A 1 61  ? -2.408  -3.787  -6.425  1.00 0.00 ? 61  PHE A HE1  6  
ATOM 9327  H HE2  . PHE A 1 61  ? -1.028  -2.013  -10.069 1.00 0.00 ? 61  PHE A HE2  6  
ATOM 9328  H HZ   . PHE A 1 61  ? -0.556  -2.984  -7.840  1.00 0.00 ? 61  PHE A HZ   6  
ATOM 9329  N N    . ILE A 1 62  ? -8.377  -4.682  -9.081  1.00 0.00 ? 62  ILE A N    6  
ATOM 9330  C CA   . ILE A 1 62  ? -9.865  -4.654  -9.034  1.00 0.00 ? 62  ILE A CA   6  
ATOM 9331  C C    . ILE A 1 62  ? -10.324 -3.641  -7.980  1.00 0.00 ? 62  ILE A C    6  
ATOM 9332  O O    . ILE A 1 62  ? -9.533  -3.132  -7.211  1.00 0.00 ? 62  ILE A O    6  
ATOM 9333  C CB   . ILE A 1 62  ? -10.396 -6.054  -8.697  1.00 0.00 ? 62  ILE A CB   6  
ATOM 9334  C CG1  . ILE A 1 62  ? -10.324 -6.298  -7.189  1.00 0.00 ? 62  ILE A CG1  6  
ATOM 9335  C CG2  . ILE A 1 62  ? -9.547  -7.106  -9.415  1.00 0.00 ? 62  ILE A CG2  6  
ATOM 9336  C CD1  . ILE A 1 62  ? -10.685 -7.755  -6.891  1.00 0.00 ? 62  ILE A CD1  6  
ATOM 9337  H H    . ILE A 1 62  ? -7.875  -5.336  -8.548  1.00 0.00 ? 62  ILE A H    6  
ATOM 9338  H HA   . ILE A 1 62  ? -10.242 -4.354  -10.000 1.00 0.00 ? 62  ILE A HA   6  
ATOM 9339  H HB   . ILE A 1 62  ? -11.421 -6.137  -9.029  1.00 0.00 ? 62  ILE A HB   6  
ATOM 9340  H HG12 . ILE A 1 62  ? -9.322  -6.095  -6.839  1.00 0.00 ? 62  ILE A HG12 6  
ATOM 9341  H HG13 . ILE A 1 62  ? -11.022 -5.647  -6.684  1.00 0.00 ? 62  ILE A HG13 6  
ATOM 9342  H HG21 . ILE A 1 62  ? -10.190 -7.873  -9.821  1.00 0.00 ? 62  ILE A HG21 6  
ATOM 9343  H HG22 . ILE A 1 62  ? -8.856  -7.550  -8.714  1.00 0.00 ? 62  ILE A HG22 6  
ATOM 9344  H HG23 . ILE A 1 62  ? -8.995  -6.637  -10.216 1.00 0.00 ? 62  ILE A HG23 6  
ATOM 9345  H HD11 . ILE A 1 62  ? -10.705 -7.911  -5.823  1.00 0.00 ? 62  ILE A HD11 6  
ATOM 9346  H HD12 . ILE A 1 62  ? -9.949  -8.407  -7.338  1.00 0.00 ? 62  ILE A HD12 6  
ATOM 9347  H HD13 . ILE A 1 62  ? -11.658 -7.976  -7.305  1.00 0.00 ? 62  ILE A HD13 6  
ATOM 9348  N N    . LYS A 1 63  ? -11.593 -3.337  -7.944  1.00 0.00 ? 63  LYS A N    6  
ATOM 9349  C CA   . LYS A 1 63  ? -12.089 -2.351  -6.943  1.00 0.00 ? 63  LYS A CA   6  
ATOM 9350  C C    . LYS A 1 63  ? -13.437 -2.809  -6.386  1.00 0.00 ? 63  LYS A C    6  
ATOM 9351  O O    . LYS A 1 63  ? -14.286 -3.299  -7.103  1.00 0.00 ? 63  LYS A O    6  
ATOM 9352  C CB   . LYS A 1 63  ? -12.256 -0.986  -7.615  1.00 0.00 ? 63  LYS A CB   6  
ATOM 9353  C CG   . LYS A 1 63  ? -11.910 0.121   -6.618  1.00 0.00 ? 63  LYS A CG   6  
ATOM 9354  C CD   . LYS A 1 63  ? -12.741 1.367   -6.935  1.00 0.00 ? 63  LYS A CD   6  
ATOM 9355  C CE   . LYS A 1 63  ? -12.984 2.159   -5.651  1.00 0.00 ? 63  LYS A CE   6  
ATOM 9356  N NZ   . LYS A 1 63  ? -13.584 3.480   -5.989  1.00 0.00 ? 63  LYS A NZ   6  
ATOM 9357  H H    . LYS A 1 63  ? -12.216 -3.753  -8.576  1.00 0.00 ? 63  LYS A H    6  
ATOM 9358  H HA   . LYS A 1 63  ? -11.377 -2.268  -6.137  1.00 0.00 ? 63  LYS A HA   6  
ATOM 9359  H HB2  . LYS A 1 63  ? -11.598 -0.922  -8.468  1.00 0.00 ? 63  LYS A HB2  6  
ATOM 9360  H HB3  . LYS A 1 63  ? -13.279 -0.869  -7.939  1.00 0.00 ? 63  LYS A HB3  6  
ATOM 9361  H HG2  . LYS A 1 63  ? -12.131 -0.215  -5.615  1.00 0.00 ? 63  LYS A HG2  6  
ATOM 9362  H HG3  . LYS A 1 63  ? -10.861 0.362   -6.696  1.00 0.00 ? 63  LYS A HG3  6  
ATOM 9363  H HD2  . LYS A 1 63  ? -12.207 1.983   -7.644  1.00 0.00 ? 63  LYS A HD2  6  
ATOM 9364  H HD3  . LYS A 1 63  ? -13.689 1.069   -7.357  1.00 0.00 ? 63  LYS A HD3  6  
ATOM 9365  H HE2  . LYS A 1 63  ? -13.658 1.610   -5.011  1.00 0.00 ? 63  LYS A HE2  6  
ATOM 9366  H HE3  . LYS A 1 63  ? -12.045 2.310   -5.138  1.00 0.00 ? 63  LYS A HE3  6  
ATOM 9367  H HZ1  . LYS A 1 63  ? -13.149 4.220   -5.403  1.00 0.00 ? 63  LYS A HZ1  6  
ATOM 9368  H HZ2  . LYS A 1 63  ? -14.608 3.450   -5.808  1.00 0.00 ? 63  LYS A HZ2  6  
ATOM 9369  H HZ3  . LYS A 1 63  ? -13.414 3.691   -6.992  1.00 0.00 ? 63  LYS A HZ3  6  
ATOM 9370  N N    . VAL A 1 64  ? -13.639 -2.644  -5.109  1.00 0.00 ? 64  VAL A N    6  
ATOM 9371  C CA   . VAL A 1 64  ? -14.929 -3.055  -4.492  1.00 0.00 ? 64  VAL A CA   6  
ATOM 9372  C C    . VAL A 1 64  ? -15.995 -2.000  -4.828  1.00 0.00 ? 64  VAL A C    6  
ATOM 9373  O O    . VAL A 1 64  ? -15.686 -0.830  -4.940  1.00 0.00 ? 64  VAL A O    6  
ATOM 9374  C CB   . VAL A 1 64  ? -14.728 -3.178  -2.970  1.00 0.00 ? 64  VAL A CB   6  
ATOM 9375  C CG1  . VAL A 1 64  ? -15.077 -1.862  -2.267  1.00 0.00 ? 64  VAL A CG1  6  
ATOM 9376  C CG2  . VAL A 1 64  ? -15.616 -4.297  -2.421  1.00 0.00 ? 64  VAL A CG2  6  
ATOM 9377  H H    . VAL A 1 64  ? -12.940 -2.239  -4.552  1.00 0.00 ? 64  VAL A H    6  
ATOM 9378  H HA   . VAL A 1 64  ? -15.230 -4.011  -4.896  1.00 0.00 ? 64  VAL A HA   6  
ATOM 9379  H HB   . VAL A 1 64  ? -13.694 -3.418  -2.770  1.00 0.00 ? 64  VAL A HB   6  
ATOM 9380  H HG11 . VAL A 1 64  ? -16.147 -1.795  -2.138  1.00 0.00 ? 64  VAL A HG11 6  
ATOM 9381  H HG12 . VAL A 1 64  ? -14.736 -1.032  -2.868  1.00 0.00 ? 64  VAL A HG12 6  
ATOM 9382  H HG13 . VAL A 1 64  ? -14.595 -1.830  -1.303  1.00 0.00 ? 64  VAL A HG13 6  
ATOM 9383  H HG21 . VAL A 1 64  ? -15.789 -5.030  -3.195  1.00 0.00 ? 64  VAL A HG21 6  
ATOM 9384  H HG22 . VAL A 1 64  ? -16.560 -3.882  -2.101  1.00 0.00 ? 64  VAL A HG22 6  
ATOM 9385  H HG23 . VAL A 1 64  ? -15.125 -4.766  -1.583  1.00 0.00 ? 64  VAL A HG23 6  
ATOM 9386  N N    . PRO A 1 65  ? -17.217 -2.441  -4.979  1.00 0.00 ? 65  PRO A N    6  
ATOM 9387  C CA   . PRO A 1 65  ? -18.341 -1.547  -5.304  1.00 0.00 ? 65  PRO A CA   6  
ATOM 9388  C C    . PRO A 1 65  ? -18.764 -0.745  -4.070  1.00 0.00 ? 65  PRO A C    6  
ATOM 9389  O O    . PRO A 1 65  ? -18.481 -1.116  -2.947  1.00 0.00 ? 65  PRO A O    6  
ATOM 9390  C CB   . PRO A 1 65  ? -19.446 -2.503  -5.760  1.00 0.00 ? 65  PRO A CB   6  
ATOM 9391  C CG   . PRO A 1 65  ? -19.101 -3.887  -5.160  1.00 0.00 ? 65  PRO A CG   6  
ATOM 9392  C CD   . PRO A 1 65  ? -17.595 -3.862  -4.836  1.00 0.00 ? 65  PRO A CD   6  
ATOM 9393  H HA   . PRO A 1 65  ? -18.076 -0.884  -6.111  1.00 0.00 ? 65  PRO A HA   6  
ATOM 9394  H HB2  . PRO A 1 65  ? -20.404 -2.164  -5.389  1.00 0.00 ? 65  PRO A HB2  6  
ATOM 9395  H HB3  . PRO A 1 65  ? -19.464 -2.566  -6.836  1.00 0.00 ? 65  PRO A HB3  6  
ATOM 9396  H HG2  . PRO A 1 65  ? -19.675 -4.055  -4.259  1.00 0.00 ? 65  PRO A HG2  6  
ATOM 9397  H HG3  . PRO A 1 65  ? -19.305 -4.664  -5.881  1.00 0.00 ? 65  PRO A HG3  6  
ATOM 9398  H HD2  . PRO A 1 65  ? -17.427 -4.202  -3.825  1.00 0.00 ? 65  PRO A HD2  6  
ATOM 9399  H HD3  . PRO A 1 65  ? -17.044 -4.468  -5.538  1.00 0.00 ? 65  PRO A HD3  6  
ATOM 9400  N N    . ARG A 1 66  ? -19.427 0.361   -4.271  1.00 0.00 ? 66  ARG A N    6  
ATOM 9401  C CA   . ARG A 1 66  ? -19.858 1.199   -3.115  1.00 0.00 ? 66  ARG A CA   6  
ATOM 9402  C C    . ARG A 1 66  ? -20.962 0.483   -2.335  1.00 0.00 ? 66  ARG A C    6  
ATOM 9403  O O    . ARG A 1 66  ? -21.046 -0.729  -2.330  1.00 0.00 ? 66  ARG A O    6  
ATOM 9404  C CB   . ARG A 1 66  ? -20.384 2.541   -3.628  1.00 0.00 ? 66  ARG A CB   6  
ATOM 9405  C CG   . ARG A 1 66  ? -19.993 3.649   -2.650  1.00 0.00 ? 66  ARG A CG   6  
ATOM 9406  C CD   . ARG A 1 66  ? -20.767 4.926   -2.987  1.00 0.00 ? 66  ARG A CD   6  
ATOM 9407  N NE   . ARG A 1 66  ? -19.883 6.109   -2.783  1.00 0.00 ? 66  ARG A NE   6  
ATOM 9408  C CZ   . ARG A 1 66  ? -20.374 7.315   -2.884  1.00 0.00 ? 66  ARG A CZ   6  
ATOM 9409  N NH1  . ARG A 1 66  ? -21.233 7.746   -2.002  1.00 0.00 ? 66  ARG A NH1  6  
ATOM 9410  N NH2  . ARG A 1 66  ? -20.004 8.091   -3.865  1.00 0.00 ? 66  ARG A NH2  6  
ATOM 9411  H H    . ARG A 1 66  ? -19.635 0.645   -5.187  1.00 0.00 ? 66  ARG A H    6  
ATOM 9412  H HA   . ARG A 1 66  ? -19.014 1.371   -2.464  1.00 0.00 ? 66  ARG A HA   6  
ATOM 9413  H HB2  . ARG A 1 66  ? -19.957 2.748   -4.599  1.00 0.00 ? 66  ARG A HB2  6  
ATOM 9414  H HB3  . ARG A 1 66  ? -21.460 2.499   -3.710  1.00 0.00 ? 66  ARG A HB3  6  
ATOM 9415  H HG2  . ARG A 1 66  ? -20.229 3.339   -1.643  1.00 0.00 ? 66  ARG A HG2  6  
ATOM 9416  H HG3  . ARG A 1 66  ? -18.934 3.842   -2.728  1.00 0.00 ? 66  ARG A HG3  6  
ATOM 9417  H HD2  . ARG A 1 66  ? -21.088 4.890   -4.018  1.00 0.00 ? 66  ARG A HD2  6  
ATOM 9418  H HD3  . ARG A 1 66  ? -21.630 5.005   -2.344  1.00 0.00 ? 66  ARG A HD3  6  
ATOM 9419  H HE   . ARG A 1 66  ? -18.935 5.982   -2.575  1.00 0.00 ? 66  ARG A HE   6  
ATOM 9420  H HH11 . ARG A 1 66  ? -21.518 7.152   -1.249  1.00 0.00 ? 66  ARG A HH11 6  
ATOM 9421  H HH12 . ARG A 1 66  ? -21.608 8.668   -2.079  1.00 0.00 ? 66  ARG A HH12 6  
ATOM 9422  H HH21 . ARG A 1 66  ? -19.343 7.763   -4.541  1.00 0.00 ? 66  ARG A HH21 6  
ATOM 9423  H HH22 . ARG A 1 66  ? -20.379 9.015   -3.943  1.00 0.00 ? 66  ARG A HH22 6  
ATOM 9424  N N    . SER A 1 67  ? -21.808 1.225   -1.673  1.00 0.00 ? 67  SER A N    6  
ATOM 9425  C CA   . SER A 1 67  ? -22.905 0.591   -0.888  1.00 0.00 ? 67  SER A CA   6  
ATOM 9426  C C    . SER A 1 67  ? -24.156 0.467   -1.760  1.00 0.00 ? 67  SER A C    6  
ATOM 9427  O O    . SER A 1 67  ? -25.268 0.527   -1.276  1.00 0.00 ? 67  SER A O    6  
ATOM 9428  C CB   . SER A 1 67  ? -23.223 1.451   0.337   1.00 0.00 ? 67  SER A CB   6  
ATOM 9429  O OG   . SER A 1 67  ? -24.071 0.725   1.220   1.00 0.00 ? 67  SER A OG   6  
ATOM 9430  H H    . SER A 1 67  ? -21.719 2.201   -1.688  1.00 0.00 ? 67  SER A H    6  
ATOM 9431  H HA   . SER A 1 67  ? -22.593 -0.392  -0.565  1.00 0.00 ? 67  SER A HA   6  
ATOM 9432  H HB2  . SER A 1 67  ? -22.310 1.703   0.849   1.00 0.00 ? 67  SER A HB2  6  
ATOM 9433  H HB3  . SER A 1 67  ? -23.715 2.361   0.017   1.00 0.00 ? 67  SER A HB3  6  
ATOM 9434  H HG   . SER A 1 67  ? -24.049 -0.201  0.965   1.00 0.00 ? 67  SER A HG   6  
ATOM 9435  N N    . GLN A 1 68  ? -23.984 0.288   -3.040  1.00 0.00 ? 68  GLN A N    6  
ATOM 9436  C CA   . GLN A 1 68  ? -25.170 0.153   -3.935  1.00 0.00 ? 68  GLN A CA   6  
ATOM 9437  C C    . GLN A 1 68  ? -25.521 -1.329  -4.086  1.00 0.00 ? 68  GLN A C    6  
ATOM 9438  O O    . GLN A 1 68  ? -26.377 -1.699  -4.864  1.00 0.00 ? 68  GLN A O    6  
ATOM 9439  C CB   . GLN A 1 68  ? -24.861 0.749   -5.313  1.00 0.00 ? 68  GLN A CB   6  
ATOM 9440  C CG   . GLN A 1 68  ? -25.671 2.033   -5.505  1.00 0.00 ? 68  GLN A CG   6  
ATOM 9441  C CD   . GLN A 1 68  ? -25.598 2.467   -6.970  1.00 0.00 ? 68  GLN A CD   6  
ATOM 9442  O OE1  . GLN A 1 68  ? -25.612 1.641   -7.861  1.00 0.00 ? 68  GLN A OE1  6  
ATOM 9443  N NE2  . GLN A 1 68  ? -25.521 3.738   -7.260  1.00 0.00 ? 68  GLN A NE2  6  
ATOM 9444  H H    . GLN A 1 68  ? -23.079 0.234   -3.409  1.00 0.00 ? 68  GLN A H    6  
ATOM 9445  H HA   . GLN A 1 68  ? -26.008 0.675   -3.497  1.00 0.00 ? 68  GLN A HA   6  
ATOM 9446  H HB2  . GLN A 1 68  ? -23.808 0.974   -5.386  1.00 0.00 ? 68  GLN A HB2  6  
ATOM 9447  H HB3  . GLN A 1 68  ? -25.131 0.039   -6.080  1.00 0.00 ? 68  GLN A HB3  6  
ATOM 9448  H HG2  . GLN A 1 68  ? -26.700 1.853   -5.233  1.00 0.00 ? 68  GLN A HG2  6  
ATOM 9449  H HG3  . GLN A 1 68  ? -25.263 2.813   -4.880  1.00 0.00 ? 68  GLN A HG3  6  
ATOM 9450  H HE21 . GLN A 1 68  ? -25.509 4.403   -6.541  1.00 0.00 ? 68  GLN A HE21 6  
ATOM 9451  H HE22 . GLN A 1 68  ? -25.474 4.025   -8.195  1.00 0.00 ? 68  GLN A HE22 6  
ATOM 9452  N N    . GLU A 1 69  ? -24.869 -2.180  -3.340  1.00 0.00 ? 69  GLU A N    6  
ATOM 9453  C CA   . GLU A 1 69  ? -25.166 -3.635  -3.434  1.00 0.00 ? 69  GLU A CA   6  
ATOM 9454  C C    . GLU A 1 69  ? -25.627 -4.145  -2.068  1.00 0.00 ? 69  GLU A C    6  
ATOM 9455  O O    . GLU A 1 69  ? -25.572 -3.438  -1.081  1.00 0.00 ? 69  GLU A O    6  
ATOM 9456  C CB   . GLU A 1 69  ? -23.905 -4.389  -3.864  1.00 0.00 ? 69  GLU A CB   6  
ATOM 9457  C CG   . GLU A 1 69  ? -24.285 -5.496  -4.849  1.00 0.00 ? 69  GLU A CG   6  
ATOM 9458  C CD   . GLU A 1 69  ? -24.048 -5.011  -6.281  1.00 0.00 ? 69  GLU A CD   6  
ATOM 9459  O OE1  . GLU A 1 69  ? -22.935 -4.607  -6.573  1.00 0.00 ? 69  GLU A OE1  6  
ATOM 9460  O OE2  . GLU A 1 69  ? -24.986 -5.053  -7.061  1.00 0.00 ? 69  GLU A OE2  6  
ATOM 9461  H H    . GLU A 1 69  ? -24.185 -1.862  -2.715  1.00 0.00 ? 69  GLU A H    6  
ATOM 9462  H HA   . GLU A 1 69  ? -25.948 -3.798  -4.161  1.00 0.00 ? 69  GLU A HA   6  
ATOM 9463  H HB2  . GLU A 1 69  ? -23.221 -3.701  -4.339  1.00 0.00 ? 69  GLU A HB2  6  
ATOM 9464  H HB3  . GLU A 1 69  ? -23.434 -4.827  -2.997  1.00 0.00 ? 69  GLU A HB3  6  
ATOM 9465  H HG2  . GLU A 1 69  ? -23.677 -6.370  -4.659  1.00 0.00 ? 69  GLU A HG2  6  
ATOM 9466  H HG3  . GLU A 1 69  ? -25.326 -5.750  -4.725  1.00 0.00 ? 69  GLU A HG3  6  
ATOM 9467  N N    . GLU A 1 70  ? -26.086 -5.362  -2.002  1.00 0.00 ? 70  GLU A N    6  
ATOM 9468  C CA   . GLU A 1 70  ? -26.556 -5.912  -0.701  1.00 0.00 ? 70  GLU A CA   6  
ATOM 9469  C C    . GLU A 1 70  ? -25.361 -6.362  0.153   1.00 0.00 ? 70  GLU A C    6  
ATOM 9470  O O    . GLU A 1 70  ? -25.276 -6.017  1.314   1.00 0.00 ? 70  GLU A O    6  
ATOM 9471  C CB   . GLU A 1 70  ? -27.493 -7.096  -0.958  1.00 0.00 ? 70  GLU A CB   6  
ATOM 9472  C CG   . GLU A 1 70  ? -28.940 -6.602  -0.982  1.00 0.00 ? 70  GLU A CG   6  
ATOM 9473  C CD   . GLU A 1 70  ? -29.311 -6.183  -2.407  1.00 0.00 ? 70  GLU A CD   6  
ATOM 9474  O OE1  . GLU A 1 70  ? -28.732 -6.728  -3.332  1.00 0.00 ? 70  GLU A OE1  6  
ATOM 9475  O OE2  . GLU A 1 70  ? -30.168 -5.325  -2.547  1.00 0.00 ? 70  GLU A OE2  6  
ATOM 9476  H H    . GLU A 1 70  ? -26.126 -5.915  -2.810  1.00 0.00 ? 70  GLU A H    6  
ATOM 9477  H HA   . GLU A 1 70  ? -27.097 -5.142  -0.170  1.00 0.00 ? 70  GLU A HA   6  
ATOM 9478  H HB2  . GLU A 1 70  ? -27.253 -7.546  -1.909  1.00 0.00 ? 70  GLU A HB2  6  
ATOM 9479  H HB3  . GLU A 1 70  ? -27.377 -7.826  -0.171  1.00 0.00 ? 70  GLU A HB3  6  
ATOM 9480  H HG2  . GLU A 1 70  ? -29.597 -7.395  -0.655  1.00 0.00 ? 70  GLU A HG2  6  
ATOM 9481  H HG3  . GLU A 1 70  ? -29.043 -5.753  -0.321  1.00 0.00 ? 70  GLU A HG3  6  
ATOM 9482  N N    . PRO A 1 71  ? -24.474 -7.124  -0.441  1.00 0.00 ? 71  PRO A N    6  
ATOM 9483  C CA   . PRO A 1 71  ? -23.280 -7.635  0.257   1.00 0.00 ? 71  PRO A CA   6  
ATOM 9484  C C    . PRO A 1 71  ? -22.202 -6.550  0.352   1.00 0.00 ? 71  PRO A C    6  
ATOM 9485  O O    . PRO A 1 71  ? -21.345 -6.587  1.213   1.00 0.00 ? 71  PRO A O    6  
ATOM 9486  C CB   . PRO A 1 71  ? -22.812 -8.791  -0.631  1.00 0.00 ? 71  PRO A CB   6  
ATOM 9487  C CG   . PRO A 1 71  ? -23.393 -8.522  -2.040  1.00 0.00 ? 71  PRO A CG   6  
ATOM 9488  C CD   . PRO A 1 71  ? -24.573 -7.549  -1.853  1.00 0.00 ? 71  PRO A CD   6  
ATOM 9489  H HA   . PRO A 1 71  ? -23.538 -8.005  1.235   1.00 0.00 ? 71  PRO A HA   6  
ATOM 9490  H HB2  . PRO A 1 71  ? -21.730 -8.810  -0.672  1.00 0.00 ? 71  PRO A HB2  6  
ATOM 9491  H HB3  . PRO A 1 71  ? -23.188 -9.727  -0.254  1.00 0.00 ? 71  PRO A HB3  6  
ATOM 9492  H HG2  . PRO A 1 71  ? -22.638 -8.076  -2.672  1.00 0.00 ? 71  PRO A HG2  6  
ATOM 9493  H HG3  . PRO A 1 71  ? -23.746 -9.443  -2.477  1.00 0.00 ? 71  PRO A HG3  6  
ATOM 9494  H HD2  . PRO A 1 71  ? -24.464 -6.703  -2.516  1.00 0.00 ? 71  PRO A HD2  6  
ATOM 9495  H HD3  . PRO A 1 71  ? -25.508 -8.053  -2.028  1.00 0.00 ? 71  PRO A HD3  6  
ATOM 9496  N N    . GLY A 1 72  ? -22.235 -5.584  -0.526  1.00 0.00 ? 72  GLY A N    6  
ATOM 9497  C CA   . GLY A 1 72  ? -21.211 -4.503  -0.485  1.00 0.00 ? 72  GLY A CA   6  
ATOM 9498  C C    . GLY A 1 72  ? -21.359 -3.703  0.811   1.00 0.00 ? 72  GLY A C    6  
ATOM 9499  O O    . GLY A 1 72  ? -22.222 -3.974  1.623   1.00 0.00 ? 72  GLY A O    6  
ATOM 9500  H H    . GLY A 1 72  ? -22.933 -5.573  -1.214  1.00 0.00 ? 72  GLY A H    6  
ATOM 9501  H HA2  . GLY A 1 72  ? -20.223 -4.939  -0.527  1.00 0.00 ? 72  GLY A HA2  6  
ATOM 9502  H HA3  . GLY A 1 72  ? -21.351 -3.843  -1.330  1.00 0.00 ? 72  GLY A HA3  6  
ATOM 9503  N N    . LYS A 1 73  ? -20.526 -2.719  1.009   1.00 0.00 ? 73  LYS A N    6  
ATOM 9504  C CA   . LYS A 1 73  ? -20.619 -1.902  2.251   1.00 0.00 ? 73  LYS A CA   6  
ATOM 9505  C C    . LYS A 1 73  ? -19.726 -0.667  2.116   1.00 0.00 ? 73  LYS A C    6  
ATOM 9506  O O    . LYS A 1 73  ? -20.203 0.443   1.985   1.00 0.00 ? 73  LYS A O    6  
ATOM 9507  C CB   . LYS A 1 73  ? -20.159 -2.735  3.448   1.00 0.00 ? 73  LYS A CB   6  
ATOM 9508  C CG   . LYS A 1 73  ? -20.958 -2.328  4.687   1.00 0.00 ? 73  LYS A CG   6  
ATOM 9509  C CD   . LYS A 1 73  ? -20.618 -3.266  5.846   1.00 0.00 ? 73  LYS A CD   6  
ATOM 9510  C CE   . LYS A 1 73  ? -21.911 -3.795  6.469   1.00 0.00 ? 73  LYS A CE   6  
ATOM 9511  N NZ   . LYS A 1 73  ? -22.246 -5.119  5.871   1.00 0.00 ? 73  LYS A NZ   6  
ATOM 9512  H H    . LYS A 1 73  ? -19.839 -2.517  0.341   1.00 0.00 ? 73  LYS A H    6  
ATOM 9513  H HA   . LYS A 1 73  ? -21.643 -1.592  2.400   1.00 0.00 ? 73  LYS A HA   6  
ATOM 9514  H HB2  . LYS A 1 73  ? -20.322 -3.784  3.241   1.00 0.00 ? 73  LYS A HB2  6  
ATOM 9515  H HB3  . LYS A 1 73  ? -19.108 -2.562  3.626   1.00 0.00 ? 73  LYS A HB3  6  
ATOM 9516  H HG2  . LYS A 1 73  ? -20.706 -1.313  4.959   1.00 0.00 ? 73  LYS A HG2  6  
ATOM 9517  H HG3  . LYS A 1 73  ? -22.013 -2.393  4.472   1.00 0.00 ? 73  LYS A HG3  6  
ATOM 9518  H HD2  . LYS A 1 73  ? -20.028 -4.093  5.480   1.00 0.00 ? 73  LYS A HD2  6  
ATOM 9519  H HD3  . LYS A 1 73  ? -20.056 -2.726  6.594   1.00 0.00 ? 73  LYS A HD3  6  
ATOM 9520  H HE2  . LYS A 1 73  ? -21.780 -3.905  7.534   1.00 0.00 ? 73  LYS A HE2  6  
ATOM 9521  H HE3  . LYS A 1 73  ? -22.714 -3.100  6.273   1.00 0.00 ? 73  LYS A HE3  6  
ATOM 9522  H HZ1  . LYS A 1 73  ? -22.424 -5.005  4.853   1.00 0.00 ? 73  LYS A HZ1  6  
ATOM 9523  H HZ2  . LYS A 1 73  ? -23.096 -5.502  6.332   1.00 0.00 ? 73  LYS A HZ2  6  
ATOM 9524  H HZ3  . LYS A 1 73  ? -21.450 -5.774  6.009   1.00 0.00 ? 73  LYS A HZ3  6  
ATOM 9525  N N    . GLY A 1 74  ? -18.435 -0.849  2.146   1.00 0.00 ? 74  GLY A N    6  
ATOM 9526  C CA   . GLY A 1 74  ? -17.514 0.316   2.020   1.00 0.00 ? 74  GLY A CA   6  
ATOM 9527  C C    . GLY A 1 74  ? -16.645 0.149   0.772   1.00 0.00 ? 74  GLY A C    6  
ATOM 9528  O O    . GLY A 1 74  ? -16.957 -0.619  -0.116  1.00 0.00 ? 74  GLY A O    6  
ATOM 9529  H H    . GLY A 1 74  ? -18.070 -1.752  2.252   1.00 0.00 ? 74  GLY A H    6  
ATOM 9530  H HA2  . GLY A 1 74  ? -18.094 1.224   1.937   1.00 0.00 ? 74  GLY A HA2  6  
ATOM 9531  H HA3  . GLY A 1 74  ? -16.883 0.372   2.894   1.00 0.00 ? 74  GLY A HA3  6  
ATOM 9532  N N    . SER A 1 75  ? -15.555 0.863   0.699   1.00 0.00 ? 75  SER A N    6  
ATOM 9533  C CA   . SER A 1 75  ? -14.664 0.746   -0.491  1.00 0.00 ? 75  SER A CA   6  
ATOM 9534  C C    . SER A 1 75  ? -13.414 -0.054  -0.115  1.00 0.00 ? 75  SER A C    6  
ATOM 9535  O O    . SER A 1 75  ? -13.077 -0.187  1.044   1.00 0.00 ? 75  SER A O    6  
ATOM 9536  C CB   . SER A 1 75  ? -14.252 2.143   -0.958  1.00 0.00 ? 75  SER A CB   6  
ATOM 9537  O OG   . SER A 1 75  ? -15.164 3.099   -0.434  1.00 0.00 ? 75  SER A OG   6  
ATOM 9538  H H    . SER A 1 75  ? -15.321 1.476   1.426   1.00 0.00 ? 75  SER A H    6  
ATOM 9539  H HA   . SER A 1 75  ? -15.190 0.241   -1.286  1.00 0.00 ? 75  SER A HA   6  
ATOM 9540  H HB2  . SER A 1 75  ? -13.260 2.366   -0.601  1.00 0.00 ? 75  SER A HB2  6  
ATOM 9541  H HB3  . SER A 1 75  ? -14.259 2.177   -2.039  1.00 0.00 ? 75  SER A HB3  6  
ATOM 9542  H HG   . SER A 1 75  ? -14.665 3.881   -0.187  1.00 0.00 ? 75  SER A HG   6  
ATOM 9543  N N    . PHE A 1 76  ? -12.723 -0.587  -1.086  1.00 0.00 ? 76  PHE A N    6  
ATOM 9544  C CA   . PHE A 1 76  ? -11.496 -1.374  -0.779  1.00 0.00 ? 76  PHE A CA   6  
ATOM 9545  C C    . PHE A 1 76  ? -10.717 -1.645  -2.068  1.00 0.00 ? 76  PHE A C    6  
ATOM 9546  O O    . PHE A 1 76  ? -11.208 -2.282  -2.981  1.00 0.00 ? 76  PHE A O    6  
ATOM 9547  C CB   . PHE A 1 76  ? -11.892 -2.705  -0.135  1.00 0.00 ? 76  PHE A CB   6  
ATOM 9548  C CG   . PHE A 1 76  ? -10.921 -3.039  0.972   1.00 0.00 ? 76  PHE A CG   6  
ATOM 9549  C CD1  . PHE A 1 76  ? -11.084 -2.476  2.242   1.00 0.00 ? 76  PHE A CD1  6  
ATOM 9550  C CD2  . PHE A 1 76  ? -9.860  -3.917  0.726   1.00 0.00 ? 76  PHE A CD2  6  
ATOM 9551  C CE1  . PHE A 1 76  ? -10.183 -2.791  3.267   1.00 0.00 ? 76  PHE A CE1  6  
ATOM 9552  C CE2  . PHE A 1 76  ? -8.959  -4.231  1.750   1.00 0.00 ? 76  PHE A CE2  6  
ATOM 9553  C CZ   . PHE A 1 76  ? -9.122  -3.669  3.022   1.00 0.00 ? 76  PHE A CZ   6  
ATOM 9554  H H    . PHE A 1 76  ? -13.010 -0.468  -2.016  1.00 0.00 ? 76  PHE A H    6  
ATOM 9555  H HA   . PHE A 1 76  ? -10.874 -0.817  -0.094  1.00 0.00 ? 76  PHE A HA   6  
ATOM 9556  H HB2  . PHE A 1 76  ? -12.889 -2.626  0.271   1.00 0.00 ? 76  PHE A HB2  6  
ATOM 9557  H HB3  . PHE A 1 76  ? -11.867 -3.486  -0.882  1.00 0.00 ? 76  PHE A HB3  6  
ATOM 9558  H HD1  . PHE A 1 76  ? -11.903 -1.799  2.432   1.00 0.00 ? 76  PHE A HD1  6  
ATOM 9559  H HD2  . PHE A 1 76  ? -9.736  -4.350  -0.255  1.00 0.00 ? 76  PHE A HD2  6  
ATOM 9560  H HE1  . PHE A 1 76  ? -10.307 -2.356  4.248   1.00 0.00 ? 76  PHE A HE1  6  
ATOM 9561  H HE2  . PHE A 1 76  ? -8.139  -4.908  1.560   1.00 0.00 ? 76  PHE A HE2  6  
ATOM 9562  H HZ   . PHE A 1 76  ? -8.426  -3.911  3.812   1.00 0.00 ? 76  PHE A HZ   6  
ATOM 9563  N N    . TRP A 1 77  ? -9.503  -1.173  -2.146  1.00 0.00 ? 77  TRP A N    6  
ATOM 9564  C CA   . TRP A 1 77  ? -8.684  -1.405  -3.369  1.00 0.00 ? 77  TRP A CA   6  
ATOM 9565  C C    . TRP A 1 77  ? -8.002  -2.768  -3.263  1.00 0.00 ? 77  TRP A C    6  
ATOM 9566  O O    . TRP A 1 77  ? -7.667  -3.214  -2.186  1.00 0.00 ? 77  TRP A O    6  
ATOM 9567  C CB   . TRP A 1 77  ? -7.615  -0.317  -3.474  1.00 0.00 ? 77  TRP A CB   6  
ATOM 9568  C CG   . TRP A 1 77  ? -8.036  0.699   -4.482  1.00 0.00 ? 77  TRP A CG   6  
ATOM 9569  C CD1  . TRP A 1 77  ? -8.230  2.012   -4.223  1.00 0.00 ? 77  TRP A CD1  6  
ATOM 9570  C CD2  . TRP A 1 77  ? -8.315  0.513   -5.898  1.00 0.00 ? 77  TRP A CD2  6  
ATOM 9571  N NE1  . TRP A 1 77  ? -8.610  2.645   -5.391  1.00 0.00 ? 77  TRP A NE1  6  
ATOM 9572  C CE2  . TRP A 1 77  ? -8.675  1.763   -6.453  1.00 0.00 ? 77  TRP A CE2  6  
ATOM 9573  C CE3  . TRP A 1 77  ? -8.290  -0.608  -6.747  1.00 0.00 ? 77  TRP A CE3  6  
ATOM 9574  C CZ2  . TRP A 1 77  ? -8.999  1.895   -7.802  1.00 0.00 ? 77  TRP A CZ2  6  
ATOM 9575  C CZ3  . TRP A 1 77  ? -8.616  -0.477  -8.107  1.00 0.00 ? 77  TRP A CZ3  6  
ATOM 9576  C CH2  . TRP A 1 77  ? -8.969  0.774   -8.634  1.00 0.00 ? 77  TRP A CH2  6  
ATOM 9577  H H    . TRP A 1 77  ? -9.127  -0.667  -1.396  1.00 0.00 ? 77  TRP A H    6  
ATOM 9578  H HA   . TRP A 1 77  ? -9.316  -1.380  -4.244  1.00 0.00 ? 77  TRP A HA   6  
ATOM 9579  H HB2  . TRP A 1 77  ? -7.489  0.159   -2.513  1.00 0.00 ? 77  TRP A HB2  6  
ATOM 9580  H HB3  . TRP A 1 77  ? -6.678  -0.761  -3.781  1.00 0.00 ? 77  TRP A HB3  6  
ATOM 9581  H HD1  . TRP A 1 77  ? -8.110  2.487   -3.262  1.00 0.00 ? 77  TRP A HD1  6  
ATOM 9582  H HE1  . TRP A 1 77  ? -8.810  3.600   -5.475  1.00 0.00 ? 77  TRP A HE1  6  
ATOM 9583  H HE3  . TRP A 1 77  ? -8.021  -1.576  -6.351  1.00 0.00 ? 77  TRP A HE3  6  
ATOM 9584  H HZ2  . TRP A 1 77  ? -9.262  2.860   -8.203  1.00 0.00 ? 77  TRP A HZ2  6  
ATOM 9585  H HZ3  . TRP A 1 77  ? -8.593  -1.344  -8.751  1.00 0.00 ? 77  TRP A HZ3  6  
ATOM 9586  H HH2  . TRP A 1 77  ? -9.217  0.868   -9.680  1.00 0.00 ? 77  TRP A HH2  6  
ATOM 9587  N N    . ARG A 1 78  ? -7.792  -3.439  -4.363  1.00 0.00 ? 78  ARG A N    6  
ATOM 9588  C CA   . ARG A 1 78  ? -7.127  -4.771  -4.288  1.00 0.00 ? 78  ARG A CA   6  
ATOM 9589  C C    . ARG A 1 78  ? -6.561  -5.177  -5.649  1.00 0.00 ? 78  ARG A C    6  
ATOM 9590  O O    . ARG A 1 78  ? -7.071  -4.809  -6.687  1.00 0.00 ? 78  ARG A O    6  
ATOM 9591  C CB   . ARG A 1 78  ? -8.140  -5.824  -3.839  1.00 0.00 ? 78  ARG A CB   6  
ATOM 9592  C CG   . ARG A 1 78  ? -9.502  -5.539  -4.471  1.00 0.00 ? 78  ARG A CG   6  
ATOM 9593  C CD   . ARG A 1 78  ? -10.477 -5.061  -3.392  1.00 0.00 ? 78  ARG A CD   6  
ATOM 9594  N NE   . ARG A 1 78  ? -11.832 -4.888  -3.987  1.00 0.00 ? 78  ARG A NE   6  
ATOM 9595  C CZ   . ARG A 1 78  ? -12.793 -5.713  -3.672  1.00 0.00 ? 78  ARG A CZ   6  
ATOM 9596  N NH1  . ARG A 1 78  ? -13.164 -5.839  -2.427  1.00 0.00 ? 78  ARG A NH1  6  
ATOM 9597  N NH2  . ARG A 1 78  ? -13.381 -6.412  -4.602  1.00 0.00 ? 78  ARG A NH2  6  
ATOM 9598  H H    . ARG A 1 78  ? -8.068  -3.072  -5.229  1.00 0.00 ? 78  ARG A H    6  
ATOM 9599  H HA   . ARG A 1 78  ? -6.324  -4.725  -3.568  1.00 0.00 ? 78  ARG A HA   6  
ATOM 9600  H HB2  . ARG A 1 78  ? -7.800  -6.802  -4.145  1.00 0.00 ? 78  ARG A HB2  6  
ATOM 9601  H HB3  . ARG A 1 78  ? -8.233  -5.796  -2.770  1.00 0.00 ? 78  ARG A HB3  6  
ATOM 9602  H HG2  . ARG A 1 78  ? -9.397  -4.776  -5.227  1.00 0.00 ? 78  ARG A HG2  6  
ATOM 9603  H HG3  . ARG A 1 78  ? -9.884  -6.443  -4.919  1.00 0.00 ? 78  ARG A HG3  6  
ATOM 9604  H HD2  . ARG A 1 78  ? -10.523 -5.793  -2.599  1.00 0.00 ? 78  ARG A HD2  6  
ATOM 9605  H HD3  . ARG A 1 78  ? -10.136 -4.118  -2.991  1.00 0.00 ? 78  ARG A HD3  6  
ATOM 9606  H HE   . ARG A 1 78  ? -12.002 -4.155  -4.615  1.00 0.00 ? 78  ARG A HE   6  
ATOM 9607  H HH11 . ARG A 1 78  ? -12.711 -5.303  -1.714  1.00 0.00 ? 78  ARG A HH11 6  
ATOM 9608  H HH12 . ARG A 1 78  ? -13.901 -6.471  -2.185  1.00 0.00 ? 78  ARG A HH12 6  
ATOM 9609  H HH21 . ARG A 1 78  ? -13.096 -6.317  -5.555  1.00 0.00 ? 78  ARG A HH21 6  
ATOM 9610  H HH22 . ARG A 1 78  ? -14.119 -7.044  -4.361  1.00 0.00 ? 78  ARG A HH22 6  
ATOM 9611  N N    . ILE A 1 79  ? -5.531  -5.976  -5.637  1.00 0.00 ? 79  ILE A N    6  
ATOM 9612  C CA   . ILE A 1 79  ? -4.937  -6.473  -6.913  1.00 0.00 ? 79  ILE A CA   6  
ATOM 9613  C C    . ILE A 1 79  ? -5.374  -7.923  -7.075  1.00 0.00 ? 79  ILE A C    6  
ATOM 9614  O O    . ILE A 1 79  ? -5.330  -8.694  -6.137  1.00 0.00 ? 79  ILE A O    6  
ATOM 9615  C CB   . ILE A 1 79  ? -3.410  -6.361  -6.871  1.00 0.00 ? 79  ILE A CB   6  
ATOM 9616  C CG1  . ILE A 1 79  ? -2.893  -6.247  -8.301  1.00 0.00 ? 79  ILE A CG1  6  
ATOM 9617  C CG2  . ILE A 1 79  ? -2.790  -7.590  -6.213  1.00 0.00 ? 79  ILE A CG2  6  
ATOM 9618  C CD1  . ILE A 1 79  ? -1.382  -6.076  -8.273  1.00 0.00 ? 79  ILE A CD1  6  
ATOM 9619  H H    . ILE A 1 79  ? -5.167  -6.282  -4.777  1.00 0.00 ? 79  ILE A H    6  
ATOM 9620  H HA   . ILE A 1 79  ? -5.303  -5.897  -7.751  1.00 0.00 ? 79  ILE A HA   6  
ATOM 9621  H HB   . ILE A 1 79  ? -3.132  -5.479  -6.317  1.00 0.00 ? 79  ILE A HB   6  
ATOM 9622  H HG12 . ILE A 1 79  ? -3.147  -7.144  -8.850  1.00 0.00 ? 79  ILE A HG12 6  
ATOM 9623  H HG13 . ILE A 1 79  ? -3.341  -5.390  -8.780  1.00 0.00 ? 79  ILE A HG13 6  
ATOM 9624  H HG21 . ILE A 1 79  ? -2.659  -8.363  -6.955  1.00 0.00 ? 79  ILE A HG21 6  
ATOM 9625  H HG22 . ILE A 1 79  ? -3.439  -7.945  -5.429  1.00 0.00 ? 79  ILE A HG22 6  
ATOM 9626  H HG23 . ILE A 1 79  ? -1.829  -7.323  -5.798  1.00 0.00 ? 79  ILE A HG23 6  
ATOM 9627  H HD11 . ILE A 1 79  ? -1.007  -6.050  -9.284  1.00 0.00 ? 79  ILE A HD11 6  
ATOM 9628  H HD12 . ILE A 1 79  ? -0.937  -6.903  -7.741  1.00 0.00 ? 79  ILE A HD12 6  
ATOM 9629  H HD13 . ILE A 1 79  ? -1.136  -5.154  -7.774  1.00 0.00 ? 79  ILE A HD13 6  
ATOM 9630  N N    . ASP A 1 80  ? -5.817  -8.306  -8.233  1.00 0.00 ? 80  ASP A N    6  
ATOM 9631  C CA   . ASP A 1 80  ? -6.271  -9.713  -8.390  1.00 0.00 ? 80  ASP A CA   6  
ATOM 9632  C C    . ASP A 1 80  ? -5.114  -10.649 -8.039  1.00 0.00 ? 80  ASP A C    6  
ATOM 9633  O O    . ASP A 1 80  ? -3.968  -10.346 -8.310  1.00 0.00 ? 80  ASP A O    6  
ATOM 9634  C CB   . ASP A 1 80  ? -6.719  -9.961  -9.831  1.00 0.00 ? 80  ASP A CB   6  
ATOM 9635  C CG   . ASP A 1 80  ? -8.086  -10.650 -9.830  1.00 0.00 ? 80  ASP A CG   6  
ATOM 9636  O OD1  . ASP A 1 80  ? -8.861  -10.385 -8.926  1.00 0.00 ? 80  ASP A OD1  6  
ATOM 9637  O OD2  . ASP A 1 80  ? -8.333  -11.432 -10.733 1.00 0.00 ? 80  ASP A OD2  6  
ATOM 9638  H H    . ASP A 1 80  ? -5.864  -7.671  -8.984  1.00 0.00 ? 80  ASP A H    6  
ATOM 9639  H HA   . ASP A 1 80  ? -7.098  -9.896  -7.719  1.00 0.00 ? 80  ASP A HA   6  
ATOM 9640  H HB2  . ASP A 1 80  ? -6.790  -9.018  -10.354 1.00 0.00 ? 80  ASP A HB2  6  
ATOM 9641  H HB3  . ASP A 1 80  ? -6.001  -10.596 -10.327 1.00 0.00 ? 80  ASP A HB3  6  
ATOM 9642  N N    . PRO A 1 81  ? -5.448  -11.766 -7.444  1.00 0.00 ? 81  PRO A N    6  
ATOM 9643  C CA   . PRO A 1 81  ? -4.453  -12.774 -7.043  1.00 0.00 ? 81  PRO A CA   6  
ATOM 9644  C C    . PRO A 1 81  ? -3.977  -13.516 -8.285  1.00 0.00 ? 81  PRO A C    6  
ATOM 9645  O O    . PRO A 1 81  ? -2.797  -13.703 -8.502  1.00 0.00 ? 81  PRO A O    6  
ATOM 9646  C CB   . PRO A 1 81  ? -5.229  -13.693 -6.094  1.00 0.00 ? 81  PRO A CB   6  
ATOM 9647  C CG   . PRO A 1 81  ? -6.726  -13.503 -6.437  1.00 0.00 ? 81  PRO A CG   6  
ATOM 9648  C CD   . PRO A 1 81  ? -6.844  -12.132 -7.130  1.00 0.00 ? 81  PRO A CD   6  
ATOM 9649  H HA   . PRO A 1 81  ? -3.626  -12.314 -6.527  1.00 0.00 ? 81  PRO A HA   6  
ATOM 9650  H HB2  . PRO A 1 81  ? -4.934  -14.722 -6.252  1.00 0.00 ? 81  PRO A HB2  6  
ATOM 9651  H HB3  . PRO A 1 81  ? -5.051  -13.405 -5.070  1.00 0.00 ? 81  PRO A HB3  6  
ATOM 9652  H HG2  . PRO A 1 81  ? -7.055  -14.289 -7.103  1.00 0.00 ? 81  PRO A HG2  6  
ATOM 9653  H HG3  . PRO A 1 81  ? -7.317  -13.507 -5.535  1.00 0.00 ? 81  PRO A HG3  6  
ATOM 9654  H HD2  . PRO A 1 81  ? -7.429  -12.218 -8.036  1.00 0.00 ? 81  PRO A HD2  6  
ATOM 9655  H HD3  . PRO A 1 81  ? -7.280  -11.404 -6.464  1.00 0.00 ? 81  PRO A HD3  6  
ATOM 9656  N N    . ALA A 1 82  ? -4.895  -13.907 -9.121  1.00 0.00 ? 82  ALA A N    6  
ATOM 9657  C CA   . ALA A 1 82  ? -4.510  -14.600 -10.374 1.00 0.00 ? 82  ALA A CA   6  
ATOM 9658  C C    . ALA A 1 82  ? -4.302  -13.539 -11.455 1.00 0.00 ? 82  ALA A C    6  
ATOM 9659  O O    . ALA A 1 82  ? -4.201  -13.844 -12.627 1.00 0.00 ? 82  ALA A O    6  
ATOM 9660  C CB   . ALA A 1 82  ? -5.625  -15.557 -10.797 1.00 0.00 ? 82  ALA A CB   6  
ATOM 9661  H H    . ALA A 1 82  ? -5.839  -13.720 -8.934  1.00 0.00 ? 82  ALA A H    6  
ATOM 9662  H HA   . ALA A 1 82  ? -3.593  -15.150 -10.220 1.00 0.00 ? 82  ALA A HA   6  
ATOM 9663  H HB1  . ALA A 1 82  ? -5.442  -15.900 -11.804 1.00 0.00 ? 82  ALA A HB1  6  
ATOM 9664  H HB2  . ALA A 1 82  ? -6.575  -15.044 -10.760 1.00 0.00 ? 82  ALA A HB2  6  
ATOM 9665  H HB3  . ALA A 1 82  ? -5.648  -16.404 -10.127 1.00 0.00 ? 82  ALA A HB3  6  
ATOM 9666  N N    . SER A 1 83  ? -4.237  -12.288 -11.065 1.00 0.00 ? 83  SER A N    6  
ATOM 9667  C CA   . SER A 1 83  ? -4.036  -11.211 -12.075 1.00 0.00 ? 83  SER A CA   6  
ATOM 9668  C C    . SER A 1 83  ? -2.676  -11.394 -12.723 1.00 0.00 ? 83  SER A C    6  
ATOM 9669  O O    . SER A 1 83  ? -2.543  -11.325 -13.930 1.00 0.00 ? 83  SER A O    6  
ATOM 9670  C CB   . SER A 1 83  ? -4.101  -9.824  -11.421 1.00 0.00 ? 83  SER A CB   6  
ATOM 9671  O OG   . SER A 1 83  ? -5.301  -9.176  -11.821 1.00 0.00 ? 83  SER A OG   6  
ATOM 9672  H H    . SER A 1 83  ? -4.318  -12.065 -10.116 1.00 0.00 ? 83  SER A H    6  
ATOM 9673  H HA   . SER A 1 83  ? -4.798  -11.287 -12.832 1.00 0.00 ? 83  SER A HA   6  
ATOM 9674  H HB2  . SER A 1 83  ? -4.088  -9.915  -10.350 1.00 0.00 ? 83  SER A HB2  6  
ATOM 9675  H HB3  . SER A 1 83  ? -3.247  -9.241  -11.739 1.00 0.00 ? 83  SER A HB3  6  
ATOM 9676  H HG   . SER A 1 83  ? -5.421  -9.325  -12.762 1.00 0.00 ? 83  SER A HG   6  
ATOM 9677  N N    . GLU A 1 84  ? -1.656  -11.631 -11.948 1.00 0.00 ? 84  GLU A N    6  
ATOM 9678  C CA   . GLU A 1 84  ? -0.329  -11.816 -12.571 1.00 0.00 ? 84  GLU A CA   6  
ATOM 9679  C C    . GLU A 1 84  ? 0.754   -12.143 -11.545 1.00 0.00 ? 84  GLU A C    6  
ATOM 9680  O O    . GLU A 1 84  ? 1.424   -11.285 -11.028 1.00 0.00 ? 84  GLU A O    6  
ATOM 9681  C CB   . GLU A 1 84  ? 0.033   -10.563 -13.354 1.00 0.00 ? 84  GLU A CB   6  
ATOM 9682  C CG   . GLU A 1 84  ? 0.759   -10.960 -14.642 1.00 0.00 ? 84  GLU A CG   6  
ATOM 9683  C CD   . GLU A 1 84  ? 0.304   -10.055 -15.789 1.00 0.00 ? 84  GLU A CD   6  
ATOM 9684  O OE1  . GLU A 1 84  ? 0.337   -8.848  -15.613 1.00 0.00 ? 84  GLU A OE1  6  
ATOM 9685  O OE2  . GLU A 1 84  ? -0.071  -10.584 -16.823 1.00 0.00 ? 84  GLU A OE2  6  
ATOM 9686  H H    . GLU A 1 84  ? -1.768  -11.688 -10.975 1.00 0.00 ? 84  GLU A H    6  
ATOM 9687  H HA   . GLU A 1 84  ? -0.381  -12.620 -13.249 1.00 0.00 ? 84  GLU A HA   6  
ATOM 9688  H HB2  . GLU A 1 84  ? -0.866  -10.017 -13.599 1.00 0.00 ? 84  GLU A HB2  6  
ATOM 9689  H HB3  . GLU A 1 84  ? 0.670   -9.952  -12.763 1.00 0.00 ? 84  GLU A HB3  6  
ATOM 9690  H HG2  . GLU A 1 84  ? 1.825   -10.855 -14.502 1.00 0.00 ? 84  GLU A HG2  6  
ATOM 9691  H HG3  . GLU A 1 84  ? 0.527   -11.986 -14.884 1.00 0.00 ? 84  GLU A HG3  6  
ATOM 9692  N N    . ALA A 1 85  ? 0.990   -13.398 -11.296 1.00 0.00 ? 85  ALA A N    6  
ATOM 9693  C CA   . ALA A 1 85  ? 2.090   -13.753 -10.360 1.00 0.00 ? 85  ALA A CA   6  
ATOM 9694  C C    . ALA A 1 85  ? 3.332   -12.974 -10.811 1.00 0.00 ? 85  ALA A C    6  
ATOM 9695  O O    . ALA A 1 85  ? 4.261   -12.768 -10.059 1.00 0.00 ? 85  ALA A O    6  
ATOM 9696  C CB   . ALA A 1 85  ? 2.364   -15.258 -10.423 1.00 0.00 ? 85  ALA A CB   6  
ATOM 9697  H H    . ALA A 1 85  ? 0.479   -14.097 -11.751 1.00 0.00 ? 85  ALA A H    6  
ATOM 9698  H HA   . ALA A 1 85  ? 1.827   -13.462 -9.350  1.00 0.00 ? 85  ALA A HA   6  
ATOM 9699  H HB1  . ALA A 1 85  ? 2.685   -15.606 -9.453  1.00 0.00 ? 85  ALA A HB1  6  
ATOM 9700  H HB2  . ALA A 1 85  ? 3.140   -15.453 -11.150 1.00 0.00 ? 85  ALA A HB2  6  
ATOM 9701  H HB3  . ALA A 1 85  ? 1.461   -15.776 -10.712 1.00 0.00 ? 85  ALA A HB3  6  
ATOM 9702  N N    . LYS A 1 86  ? 3.339   -12.520 -12.041 1.00 0.00 ? 86  LYS A N    6  
ATOM 9703  C CA   . LYS A 1 86  ? 4.486   -11.726 -12.542 1.00 0.00 ? 86  LYS A CA   6  
ATOM 9704  C C    . LYS A 1 86  ? 4.263   -10.256 -12.161 1.00 0.00 ? 86  LYS A C    6  
ATOM 9705  O O    . LYS A 1 86  ? 5.184   -9.569  -11.762 1.00 0.00 ? 86  LYS A O    6  
ATOM 9706  C CB   . LYS A 1 86  ? 4.573   -11.854 -14.064 1.00 0.00 ? 86  LYS A CB   6  
ATOM 9707  C CG   . LYS A 1 86  ? 6.041   -11.929 -14.487 1.00 0.00 ? 86  LYS A CG   6  
ATOM 9708  C CD   . LYS A 1 86  ? 6.531   -10.537 -14.887 1.00 0.00 ? 86  LYS A CD   6  
ATOM 9709  C CE   . LYS A 1 86  ? 5.678   -10.006 -16.041 1.00 0.00 ? 86  LYS A CE   6  
ATOM 9710  N NZ   . LYS A 1 86  ? 6.567   -9.485  -17.117 1.00 0.00 ? 86  LYS A NZ   6  
ATOM 9711  H H    . LYS A 1 86  ? 2.582   -12.695 -12.633 1.00 0.00 ? 86  LYS A H    6  
ATOM 9712  H HA   . LYS A 1 86  ? 5.400   -12.084 -12.093 1.00 0.00 ? 86  LYS A HA   6  
ATOM 9713  H HB2  . LYS A 1 86  ? 4.061   -12.751 -14.380 1.00 0.00 ? 86  LYS A HB2  6  
ATOM 9714  H HB3  . LYS A 1 86  ? 4.112   -10.993 -14.525 1.00 0.00 ? 86  LYS A HB3  6  
ATOM 9715  H HG2  . LYS A 1 86  ? 6.633   -12.296 -13.661 1.00 0.00 ? 86  LYS A HG2  6  
ATOM 9716  H HG3  . LYS A 1 86  ? 6.139   -12.599 -15.327 1.00 0.00 ? 86  LYS A HG3  6  
ATOM 9717  H HD2  . LYS A 1 86  ? 6.448   -9.870  -14.041 1.00 0.00 ? 86  LYS A HD2  6  
ATOM 9718  H HD3  . LYS A 1 86  ? 7.563   -10.595 -15.201 1.00 0.00 ? 86  LYS A HD3  6  
ATOM 9719  H HE2  . LYS A 1 86  ? 5.067   -10.806 -16.434 1.00 0.00 ? 86  LYS A HE2  6  
ATOM 9720  H HE3  . LYS A 1 86  ? 5.042   -9.211  -15.682 1.00 0.00 ? 86  LYS A HE3  6  
ATOM 9721  H HZ1  . LYS A 1 86  ? 7.027   -10.279 -17.605 1.00 0.00 ? 86  LYS A HZ1  6  
ATOM 9722  H HZ2  . LYS A 1 86  ? 7.293   -8.867  -16.698 1.00 0.00 ? 86  LYS A HZ2  6  
ATOM 9723  H HZ3  . LYS A 1 86  ? 6.003   -8.942  -17.801 1.00 0.00 ? 86  LYS A HZ3  6  
ATOM 9724  N N    . LEU A 1 87  ? 3.049   -9.758  -12.274 1.00 0.00 ? 87  LEU A N    6  
ATOM 9725  C CA   . LEU A 1 87  ? 2.813   -8.322  -11.901 1.00 0.00 ? 87  LEU A CA   6  
ATOM 9726  C C    . LEU A 1 87  ? 3.280   -8.111  -10.480 1.00 0.00 ? 87  LEU A C    6  
ATOM 9727  O O    . LEU A 1 87  ? 3.739   -7.050  -10.105 1.00 0.00 ? 87  LEU A O    6  
ATOM 9728  C CB   . LEU A 1 87  ? 1.323   -7.915  -12.025 1.00 0.00 ? 87  LEU A CB   6  
ATOM 9729  C CG   . LEU A 1 87  ? 0.447   -8.606  -10.957 1.00 0.00 ? 87  LEU A CG   6  
ATOM 9730  C CD1  . LEU A 1 87  ? 0.472   -7.839  -9.656  1.00 0.00 ? 87  LEU A CD1  6  
ATOM 9731  C CD2  . LEU A 1 87  ? -1.010  -8.662  -11.413 1.00 0.00 ? 87  LEU A CD2  6  
ATOM 9732  H H    . LEU A 1 87  ? 2.313   -10.322 -12.599 1.00 0.00 ? 87  LEU A H    6  
ATOM 9733  H HA   . LEU A 1 87  ? 3.406   -7.707  -12.541 1.00 0.00 ? 87  LEU A HA   6  
ATOM 9734  H HB2  . LEU A 1 87  ? 1.239   -6.845  -11.909 1.00 0.00 ? 87  LEU A HB2  6  
ATOM 9735  H HB3  . LEU A 1 87  ? 0.968   -8.189  -13.000 1.00 0.00 ? 87  LEU A HB3  6  
ATOM 9736  H HG   . LEU A 1 87  ? 0.803   -9.594  -10.784 1.00 0.00 ? 87  LEU A HG   6  
ATOM 9737  H HD11 . LEU A 1 87  ? 1.311   -8.159  -9.068  1.00 0.00 ? 87  LEU A HD11 6  
ATOM 9738  H HD12 . LEU A 1 87  ? -0.447  -8.039  -9.119  1.00 0.00 ? 87  LEU A HD12 6  
ATOM 9739  H HD13 . LEU A 1 87  ? 0.548   -6.788  -9.866  1.00 0.00 ? 87  LEU A HD13 6  
ATOM 9740  H HD21 . LEU A 1 87  ? -1.065  -8.534  -12.481 1.00 0.00 ? 87  LEU A HD21 6  
ATOM 9741  H HD22 . LEU A 1 87  ? -1.562  -7.871  -10.925 1.00 0.00 ? 87  LEU A HD22 6  
ATOM 9742  H HD23 . LEU A 1 87  ? -1.439  -9.614  -11.136 1.00 0.00 ? 87  LEU A HD23 6  
ATOM 9743  N N    . VAL A 1 88  ? 3.173   -9.124  -9.697  1.00 0.00 ? 88  VAL A N    6  
ATOM 9744  C CA   . VAL A 1 88  ? 3.604   -9.030  -8.291  1.00 0.00 ? 88  VAL A CA   6  
ATOM 9745  C C    . VAL A 1 88  ? 5.111   -9.259  -8.196  1.00 0.00 ? 88  VAL A C    6  
ATOM 9746  O O    . VAL A 1 88  ? 5.775   -8.742  -7.321  1.00 0.00 ? 88  VAL A O    6  
ATOM 9747  C CB   . VAL A 1 88  ? 2.899   -10.110 -7.517  1.00 0.00 ? 88  VAL A CB   6  
ATOM 9748  C CG1  . VAL A 1 88  ? 1.392   -9.854  -7.499  1.00 0.00 ? 88  VAL A CG1  6  
ATOM 9749  C CG2  . VAL A 1 88  ? 3.167   -11.443 -8.196  1.00 0.00 ? 88  VAL A CG2  6  
ATOM 9750  H H    . VAL A 1 88  ? 2.807   -9.964  -10.039 1.00 0.00 ? 88  VAL A H    6  
ATOM 9751  H HA   . VAL A 1 88  ? 3.350   -8.065  -7.889  1.00 0.00 ? 88  VAL A HA   6  
ATOM 9752  H HB   . VAL A 1 88  ? 3.287   -10.122 -6.524  1.00 0.00 ? 88  VAL A HB   6  
ATOM 9753  H HG11 . VAL A 1 88  ? 1.201   -8.837  -7.194  1.00 0.00 ? 88  VAL A HG11 6  
ATOM 9754  H HG12 . VAL A 1 88  ? 0.920   -10.534 -6.807  1.00 0.00 ? 88  VAL A HG12 6  
ATOM 9755  H HG13 . VAL A 1 88  ? 0.989   -10.014 -8.491  1.00 0.00 ? 88  VAL A HG13 6  
ATOM 9756  H HG21 . VAL A 1 88  ? 4.216   -11.514 -8.432  1.00 0.00 ? 88  VAL A HG21 6  
ATOM 9757  H HG22 . VAL A 1 88  ? 2.587   -11.503 -9.108  1.00 0.00 ? 88  VAL A HG22 6  
ATOM 9758  H HG23 . VAL A 1 88  ? 2.889   -12.245 -7.538  1.00 0.00 ? 88  VAL A HG23 6  
ATOM 9759  N N    . GLU A 1 89  ? 5.655   -10.042 -9.083  1.00 0.00 ? 89  GLU A N    6  
ATOM 9760  C CA   . GLU A 1 89  ? 7.119   -10.302 -9.037  1.00 0.00 ? 89  GLU A CA   6  
ATOM 9761  C C    . GLU A 1 89  ? 7.839   -8.959  -9.090  1.00 0.00 ? 89  GLU A C    6  
ATOM 9762  O O    . GLU A 1 89  ? 8.715   -8.678  -8.298  1.00 0.00 ? 89  GLU A O    6  
ATOM 9763  C CB   . GLU A 1 89  ? 7.534   -11.158 -10.235 1.00 0.00 ? 89  GLU A CB   6  
ATOM 9764  C CG   . GLU A 1 89  ? 9.061   -11.191 -10.332 1.00 0.00 ? 89  GLU A CG   6  
ATOM 9765  C CD   . GLU A 1 89  ? 9.517   -12.599 -10.721 1.00 0.00 ? 89  GLU A CD   6  
ATOM 9766  O OE1  . GLU A 1 89  ? 8.736   -13.521 -10.551 1.00 0.00 ? 89  GLU A OE1  6  
ATOM 9767  O OE2  . GLU A 1 89  ? 10.639  -12.731 -11.181 1.00 0.00 ? 89  GLU A OE2  6  
ATOM 9768  H H    . GLU A 1 89  ? 5.098   -10.460 -9.770  1.00 0.00 ? 89  GLU A H    6  
ATOM 9769  H HA   . GLU A 1 89  ? 7.369   -10.812 -8.118  1.00 0.00 ? 89  GLU A HA   6  
ATOM 9770  H HB2  . GLU A 1 89  ? 7.158   -12.163 -10.107 1.00 0.00 ? 89  GLU A HB2  6  
ATOM 9771  H HB3  . GLU A 1 89  ? 7.126   -10.732 -11.140 1.00 0.00 ? 89  GLU A HB3  6  
ATOM 9772  H HG2  . GLU A 1 89  ? 9.390   -10.485 -11.081 1.00 0.00 ? 89  GLU A HG2  6  
ATOM 9773  H HG3  . GLU A 1 89  ? 9.489   -10.928 -9.376  1.00 0.00 ? 89  GLU A HG3  6  
ATOM 9774  N N    . GLN A 1 90  ? 7.456   -8.117  -10.009 1.00 0.00 ? 90  GLN A N    6  
ATOM 9775  C CA   . GLN A 1 90  ? 8.097   -6.780  -10.099 1.00 0.00 ? 90  GLN A CA   6  
ATOM 9776  C C    . GLN A 1 90  ? 7.778   -6.011  -8.818  1.00 0.00 ? 90  GLN A C    6  
ATOM 9777  O O    . GLN A 1 90  ? 8.487   -5.104  -8.428  1.00 0.00 ? 90  GLN A O    6  
ATOM 9778  C CB   . GLN A 1 90  ? 7.535   -6.026  -11.307 1.00 0.00 ? 90  GLN A CB   6  
ATOM 9779  C CG   . GLN A 1 90  ? 8.529   -6.107  -12.465 1.00 0.00 ? 90  GLN A CG   6  
ATOM 9780  C CD   . GLN A 1 90  ? 9.714   -5.181  -12.187 1.00 0.00 ? 90  GLN A CD   6  
ATOM 9781  O OE1  . GLN A 1 90  ? 10.365  -5.296  -11.169 1.00 0.00 ? 90  GLN A OE1  6  
ATOM 9782  N NE2  . GLN A 1 90  ? 10.020  -4.257  -13.057 1.00 0.00 ? 90  GLN A NE2  6  
ATOM 9783  H H    . GLN A 1 90  ? 6.736   -8.359  -10.628 1.00 0.00 ? 90  GLN A H    6  
ATOM 9784  H HA   . GLN A 1 90  ? 9.166   -6.893  -10.201 1.00 0.00 ? 90  GLN A HA   6  
ATOM 9785  H HB2  . GLN A 1 90  ? 6.597   -6.471  -11.605 1.00 0.00 ? 90  GLN A HB2  6  
ATOM 9786  H HB3  . GLN A 1 90  ? 7.376   -4.991  -11.044 1.00 0.00 ? 90  GLN A HB3  6  
ATOM 9787  H HG2  . GLN A 1 90  ? 8.882   -7.124  -12.565 1.00 0.00 ? 90  GLN A HG2  6  
ATOM 9788  H HG3  . GLN A 1 90  ? 8.043   -5.802  -13.379 1.00 0.00 ? 90  GLN A HG3  6  
ATOM 9789  H HE21 . GLN A 1 90  ? 9.494   -4.164  -13.878 1.00 0.00 ? 90  GLN A HE21 6  
ATOM 9790  H HE22 . GLN A 1 90  ? 10.778  -3.659  -12.889 1.00 0.00 ? 90  GLN A HE22 6  
ATOM 9791  N N    . ALA A 1 91  ? 6.709   -6.375  -8.161  1.00 0.00 ? 91  ALA A N    6  
ATOM 9792  C CA   . ALA A 1 91  ? 6.329   -5.676  -6.903  1.00 0.00 ? 91  ALA A CA   6  
ATOM 9793  C C    . ALA A 1 91  ? 7.353   -5.978  -5.806  1.00 0.00 ? 91  ALA A C    6  
ATOM 9794  O O    . ALA A 1 91  ? 7.800   -5.093  -5.106  1.00 0.00 ? 91  ALA A O    6  
ATOM 9795  C CB   . ALA A 1 91  ? 4.947   -6.137  -6.447  1.00 0.00 ? 91  ALA A CB   6  
ATOM 9796  H H    . ALA A 1 91  ? 6.156   -7.107  -8.500  1.00 0.00 ? 91  ALA A H    6  
ATOM 9797  H HA   . ALA A 1 91  ? 6.299   -4.626  -7.081  1.00 0.00 ? 91  ALA A HA   6  
ATOM 9798  H HB1  . ALA A 1 91  ? 4.975   -6.364  -5.392  1.00 0.00 ? 91  ALA A HB1  6  
ATOM 9799  H HB2  . ALA A 1 91  ? 4.655   -7.014  -7.001  1.00 0.00 ? 91  ALA A HB2  6  
ATOM 9800  H HB3  . ALA A 1 91  ? 4.233   -5.345  -6.623  1.00 0.00 ? 91  ALA A HB3  6  
ATOM 9801  N N    . PHE A 1 92  ? 7.719   -7.218  -5.646  1.00 0.00 ? 92  PHE A N    6  
ATOM 9802  C CA   . PHE A 1 92  ? 8.702   -7.579  -4.585  1.00 0.00 ? 92  PHE A CA   6  
ATOM 9803  C C    . PHE A 1 92  ? 10.013  -6.809  -4.787  1.00 0.00 ? 92  PHE A C    6  
ATOM 9804  O O    . PHE A 1 92  ? 10.582  -6.287  -3.848  1.00 0.00 ? 92  PHE A O    6  
ATOM 9805  C CB   . PHE A 1 92  ? 8.973   -9.084  -4.642  1.00 0.00 ? 92  PHE A CB   6  
ATOM 9806  C CG   . PHE A 1 92  ? 7.663   -9.818  -4.810  1.00 0.00 ? 92  PHE A CG   6  
ATOM 9807  C CD1  . PHE A 1 92  ? 6.527   -9.388  -4.113  1.00 0.00 ? 92  PHE A CD1  6  
ATOM 9808  C CD2  . PHE A 1 92  ? 7.583   -10.926 -5.663  1.00 0.00 ? 92  PHE A CD2  6  
ATOM 9809  C CE1  . PHE A 1 92  ? 5.313   -10.065 -4.269  1.00 0.00 ? 92  PHE A CE1  6  
ATOM 9810  C CE2  . PHE A 1 92  ? 6.368   -11.603 -5.818  1.00 0.00 ? 92  PHE A CE2  6  
ATOM 9811  C CZ   . PHE A 1 92  ? 5.233   -11.173 -5.120  1.00 0.00 ? 92  PHE A CZ   6  
ATOM 9812  H H    . PHE A 1 92  ? 7.341   -7.917  -6.218  1.00 0.00 ? 92  PHE A H    6  
ATOM 9813  H HA   . PHE A 1 92  ? 8.290   -7.330  -3.618  1.00 0.00 ? 92  PHE A HA   6  
ATOM 9814  H HB2  . PHE A 1 92  ? 9.619   -9.303  -5.478  1.00 0.00 ? 92  PHE A HB2  6  
ATOM 9815  H HB3  . PHE A 1 92  ? 9.447   -9.401  -3.726  1.00 0.00 ? 92  PHE A HB3  6  
ATOM 9816  H HD1  . PHE A 1 92  ? 6.589   -8.534  -3.456  1.00 0.00 ? 92  PHE A HD1  6  
ATOM 9817  H HD2  . PHE A 1 92  ? 8.458   -11.259 -6.200  1.00 0.00 ? 92  PHE A HD2  6  
ATOM 9818  H HE1  . PHE A 1 92  ? 4.437   -9.732  -3.731  1.00 0.00 ? 92  PHE A HE1  6  
ATOM 9819  H HE2  . PHE A 1 92  ? 6.305   -12.458 -6.476  1.00 0.00 ? 92  PHE A HE2  6  
ATOM 9820  H HZ   . PHE A 1 92  ? 4.295   -11.694 -5.241  1.00 0.00 ? 92  PHE A HZ   6  
ATOM 9821  N N    . ARG A 1 93  ? 10.503  -6.735  -5.995  1.00 0.00 ? 93  ARG A N    6  
ATOM 9822  C CA   . ARG A 1 93  ? 11.781  -5.998  -6.230  1.00 0.00 ? 93  ARG A CA   6  
ATOM 9823  C C    . ARG A 1 93  ? 11.583  -4.940  -7.318  1.00 0.00 ? 93  ARG A C    6  
ATOM 9824  O O    . ARG A 1 93  ? 10.816  -5.120  -8.243  1.00 0.00 ? 93  ARG A O    6  
ATOM 9825  C CB   . ARG A 1 93  ? 12.865  -6.982  -6.672  1.00 0.00 ? 93  ARG A CB   6  
ATOM 9826  C CG   . ARG A 1 93  ? 12.299  -7.925  -7.735  1.00 0.00 ? 93  ARG A CG   6  
ATOM 9827  C CD   . ARG A 1 93  ? 13.317  -8.091  -8.865  1.00 0.00 ? 93  ARG A CD   6  
ATOM 9828  N NE   . ARG A 1 93  ? 12.886  -9.199  -9.763  1.00 0.00 ? 93  ARG A NE   6  
ATOM 9829  C CZ   . ARG A 1 93  ? 13.043  -10.440 -9.389  1.00 0.00 ? 93  ARG A CZ   6  
ATOM 9830  N NH1  . ARG A 1 93  ? 12.101  -11.043 -8.715  1.00 0.00 ? 93  ARG A NH1  6  
ATOM 9831  N NH2  . ARG A 1 93  ? 14.140  -11.077 -9.689  1.00 0.00 ? 93  ARG A NH2  6  
ATOM 9832  H H    . ARG A 1 93  ? 10.037  -7.162  -6.744  1.00 0.00 ? 93  ARG A H    6  
ATOM 9833  H HA   . ARG A 1 93  ? 12.088  -5.515  -5.314  1.00 0.00 ? 93  ARG A HA   6  
ATOM 9834  H HB2  . ARG A 1 93  ? 13.702  -6.436  -7.082  1.00 0.00 ? 93  ARG A HB2  6  
ATOM 9835  H HB3  . ARG A 1 93  ? 13.196  -7.560  -5.821  1.00 0.00 ? 93  ARG A HB3  6  
ATOM 9836  H HG2  . ARG A 1 93  ? 12.093  -8.887  -7.290  1.00 0.00 ? 93  ARG A HG2  6  
ATOM 9837  H HG3  . ARG A 1 93  ? 11.387  -7.509  -8.135  1.00 0.00 ? 93  ARG A HG3  6  
ATOM 9838  H HD2  . ARG A 1 93  ? 13.380  -7.173  -9.431  1.00 0.00 ? 93  ARG A HD2  6  
ATOM 9839  H HD3  . ARG A 1 93  ? 14.286  -8.322  -8.447  1.00 0.00 ? 93  ARG A HD3  6  
ATOM 9840  H HE   . ARG A 1 93  ? 12.485  -8.997  -10.633 1.00 0.00 ? 93  ARG A HE   6  
ATOM 9841  H HH11 . ARG A 1 93  ? 11.259  -10.556 -8.485  1.00 0.00 ? 93  ARG A HH11 6  
ATOM 9842  H HH12 . ARG A 1 93  ? 12.221  -11.994 -8.429  1.00 0.00 ? 93  ARG A HH12 6  
ATOM 9843  H HH21 . ARG A 1 93  ? 14.862  -10.615 -10.205 1.00 0.00 ? 93  ARG A HH21 6  
ATOM 9844  H HH22 . ARG A 1 93  ? 14.261  -12.028 -9.403  1.00 0.00 ? 93  ARG A HH22 6  
ATOM 9845  N N    . LYS A 1 94  ? 12.277  -3.839  -7.215  1.00 0.00 ? 94  LYS A N    6  
ATOM 9846  C CA   . LYS A 1 94  ? 12.142  -2.767  -8.241  1.00 0.00 ? 94  LYS A CA   6  
ATOM 9847  C C    . LYS A 1 94  ? 13.535  -2.334  -8.704  1.00 0.00 ? 94  LYS A C    6  
ATOM 9848  O O    . LYS A 1 94  ? 13.908  -2.522  -9.845  1.00 0.00 ? 94  LYS A O    6  
ATOM 9849  C CB   . LYS A 1 94  ? 11.409  -1.568  -7.636  1.00 0.00 ? 94  LYS A CB   6  
ATOM 9850  C CG   . LYS A 1 94  ? 10.326  -1.090  -8.605  1.00 0.00 ? 94  LYS A CG   6  
ATOM 9851  C CD   . LYS A 1 94  ? 10.980  -0.526  -9.869  1.00 0.00 ? 94  LYS A CD   6  
ATOM 9852  C CE   . LYS A 1 94  ? 9.901   0.052   -10.788 1.00 0.00 ? 94  LYS A CE   6  
ATOM 9853  N NZ   . LYS A 1 94  ? 10.512  0.427   -12.094 1.00 0.00 ? 94  LYS A NZ   6  
ATOM 9854  H H    . LYS A 1 94  ? 12.892  -3.719  -6.461  1.00 0.00 ? 94  LYS A H    6  
ATOM 9855  H HA   . LYS A 1 94  ? 11.580  -3.142  -9.082  1.00 0.00 ? 94  LYS A HA   6  
ATOM 9856  H HB2  . LYS A 1 94  ? 10.954  -1.861  -6.703  1.00 0.00 ? 94  LYS A HB2  6  
ATOM 9857  H HB3  . LYS A 1 94  ? 12.112  -0.767  -7.460  1.00 0.00 ? 94  LYS A HB3  6  
ATOM 9858  H HG2  . LYS A 1 94  ? 9.688   -1.921  -8.869  1.00 0.00 ? 94  LYS A HG2  6  
ATOM 9859  H HG3  . LYS A 1 94  ? 9.735   -0.319  -8.133  1.00 0.00 ? 94  LYS A HG3  6  
ATOM 9860  H HD2  . LYS A 1 94  ? 11.677  0.252   -9.597  1.00 0.00 ? 94  LYS A HD2  6  
ATOM 9861  H HD3  . LYS A 1 94  ? 11.504  -1.316  -10.386 1.00 0.00 ? 94  LYS A HD3  6  
ATOM 9862  H HE2  . LYS A 1 94  ? 9.132   -0.689  -10.949 1.00 0.00 ? 94  LYS A HE2  6  
ATOM 9863  H HE3  . LYS A 1 94  ? 9.468   0.927   -10.328 1.00 0.00 ? 94  LYS A HE3  6  
ATOM 9864  H HZ1  . LYS A 1 94  ? 10.704  1.449   -12.107 1.00 0.00 ? 94  LYS A HZ1  6  
ATOM 9865  H HZ2  . LYS A 1 94  ? 9.856   0.188   -12.865 1.00 0.00 ? 94  LYS A HZ2  6  
ATOM 9866  H HZ3  . LYS A 1 94  ? 11.403  -0.092  -12.223 1.00 0.00 ? 94  LYS A HZ3  6  
ATOM 9867  N N    . ARG A 1 95  ? 14.308  -1.758  -7.824  1.00 0.00 ? 95  ARG A N    6  
ATOM 9868  C CA   . ARG A 1 95  ? 15.679  -1.317  -8.207  1.00 0.00 ? 95  ARG A CA   6  
ATOM 9869  C C    . ARG A 1 95  ? 16.361  -0.672  -6.999  1.00 0.00 ? 95  ARG A C    6  
ATOM 9870  O O    . ARG A 1 95  ? 15.722  -0.053  -6.173  1.00 0.00 ? 95  ARG A O    6  
ATOM 9871  C CB   . ARG A 1 95  ? 15.590  -0.298  -9.345  1.00 0.00 ? 95  ARG A CB   6  
ATOM 9872  C CG   . ARG A 1 95  ? 14.415  0.649   -9.094  1.00 0.00 ? 95  ARG A CG   6  
ATOM 9873  C CD   . ARG A 1 95  ? 14.432  1.766   -10.139 1.00 0.00 ? 95  ARG A CD   6  
ATOM 9874  N NE   . ARG A 1 95  ? 14.283  1.174   -11.498 1.00 0.00 ? 95  ARG A NE   6  
ATOM 9875  C CZ   . ARG A 1 95  ? 13.458  1.708   -12.355 1.00 0.00 ? 95  ARG A CZ   6  
ATOM 9876  N NH1  . ARG A 1 95  ? 13.115  2.962   -12.237 1.00 0.00 ? 95  ARG A NH1  6  
ATOM 9877  N NH2  . ARG A 1 95  ? 12.975  0.988   -13.331 1.00 0.00 ? 95  ARG A NH2  6  
ATOM 9878  H H    . ARG A 1 95  ? 13.988  -1.618  -6.909  1.00 0.00 ? 95  ARG A H    6  
ATOM 9879  H HA   . ARG A 1 95  ? 16.254  -2.172  -8.533  1.00 0.00 ? 95  ARG A HA   6  
ATOM 9880  H HB2  . ARG A 1 95  ? 16.507  0.269   -9.394  1.00 0.00 ? 95  ARG A HB2  6  
ATOM 9881  H HB3  . ARG A 1 95  ? 15.437  -0.816  -10.281 1.00 0.00 ? 95  ARG A HB3  6  
ATOM 9882  H HG2  . ARG A 1 95  ? 13.487  0.100   -9.167  1.00 0.00 ? 95  ARG A HG2  6  
ATOM 9883  H HG3  . ARG A 1 95  ? 14.504  1.078   -8.109  1.00 0.00 ? 95  ARG A HG3  6  
ATOM 9884  H HD2  . ARG A 1 95  ? 13.617  2.448   -9.951  1.00 0.00 ? 95  ARG A HD2  6  
ATOM 9885  H HD3  . ARG A 1 95  ? 15.370  2.300   -10.079 1.00 0.00 ? 95  ARG A HD3  6  
ATOM 9886  H HE   . ARG A 1 95  ? 14.805  0.383   -11.747 1.00 0.00 ? 95  ARG A HE   6  
ATOM 9887  H HH11 . ARG A 1 95  ? 13.484  3.513   -11.489 1.00 0.00 ? 95  ARG A HH11 6  
ATOM 9888  H HH12 . ARG A 1 95  ? 12.483  3.372   -12.895 1.00 0.00 ? 95  ARG A HH12 6  
ATOM 9889  H HH21 . ARG A 1 95  ? 13.238  0.027   -13.420 1.00 0.00 ? 95  ARG A HH21 6  
ATOM 9890  H HH22 . ARG A 1 95  ? 12.342  1.397   -13.989 1.00 0.00 ? 95  ARG A HH22 6  
ATOM 9891  N N    . ARG A 1 96  ? 17.655  -0.811  -6.889  1.00 0.00 ? 96  ARG A N    6  
ATOM 9892  C CA   . ARG A 1 96  ? 18.372  -0.203  -5.733  1.00 0.00 ? 96  ARG A CA   6  
ATOM 9893  C C    . ARG A 1 96  ? 19.871  -0.142  -6.034  1.00 0.00 ? 96  ARG A C    6  
ATOM 9894  O O    . ARG A 1 96  ? 20.671  -0.790  -5.387  1.00 0.00 ? 96  ARG A O    6  
ATOM 9895  C CB   . ARG A 1 96  ? 18.137  -1.051  -4.482  1.00 0.00 ? 96  ARG A CB   6  
ATOM 9896  C CG   . ARG A 1 96  ? 17.127  -0.349  -3.572  1.00 0.00 ? 96  ARG A CG   6  
ATOM 9897  C CD   . ARG A 1 96  ? 17.848  0.221   -2.349  1.00 0.00 ? 96  ARG A CD   6  
ATOM 9898  N NE   . ARG A 1 96  ? 17.827  1.711   -2.408  1.00 0.00 ? 96  ARG A NE   6  
ATOM 9899  C CZ   . ARG A 1 96  ? 18.498  2.408   -1.531  1.00 0.00 ? 96  ARG A CZ   6  
ATOM 9900  N NH1  . ARG A 1 96  ? 18.233  2.284   -0.258  1.00 0.00 ? 96  ARG A NH1  6  
ATOM 9901  N NH2  . ARG A 1 96  ? 19.433  3.228   -1.927  1.00 0.00 ? 96  ARG A NH2  6  
ATOM 9902  H H    . ARG A 1 96  ? 18.154  -1.314  -7.567  1.00 0.00 ? 96  ARG A H    6  
ATOM 9903  H HA   . ARG A 1 96  ? 18.000  0.796   -5.565  1.00 0.00 ? 96  ARG A HA   6  
ATOM 9904  H HB2  . ARG A 1 96  ? 17.755  -2.019  -4.769  1.00 0.00 ? 96  ARG A HB2  6  
ATOM 9905  H HB3  . ARG A 1 96  ? 19.070  -1.175  -3.951  1.00 0.00 ? 96  ARG A HB3  6  
ATOM 9906  H HG2  . ARG A 1 96  ? 16.650  0.454   -4.117  1.00 0.00 ? 96  ARG A HG2  6  
ATOM 9907  H HG3  . ARG A 1 96  ? 16.380  -1.059  -3.249  1.00 0.00 ? 96  ARG A HG3  6  
ATOM 9908  H HD2  . ARG A 1 96  ? 17.349  -0.110  -1.451  1.00 0.00 ? 96  ARG A HD2  6  
ATOM 9909  H HD3  . ARG A 1 96  ? 18.871  -0.125  -2.341  1.00 0.00 ? 96  ARG A HD3  6  
ATOM 9910  H HE   . ARG A 1 96  ? 17.310  2.166   -3.104  1.00 0.00 ? 96  ARG A HE   6  
ATOM 9911  H HH11 . ARG A 1 96  ? 17.516  1.656   0.045   1.00 0.00 ? 96  ARG A HH11 6  
ATOM 9912  H HH12 . ARG A 1 96  ? 18.746  2.818   0.414   1.00 0.00 ? 96  ARG A HH12 6  
ATOM 9913  H HH21 . ARG A 1 96  ? 19.635  3.322   -2.902  1.00 0.00 ? 96  ARG A HH21 6  
ATOM 9914  H HH22 . ARG A 1 96  ? 19.947  3.762   -1.256  1.00 0.00 ? 96  ARG A HH22 6  
ATOM 9915  N N    . GLN A 1 97  ? 20.258  0.632   -7.010  1.00 0.00 ? 97  GLN A N    6  
ATOM 9916  C CA   . GLN A 1 97  ? 21.704  0.737   -7.352  1.00 0.00 ? 97  GLN A CA   6  
ATOM 9917  C C    . GLN A 1 97  ? 22.109  2.212   -7.401  1.00 0.00 ? 97  GLN A C    6  
ATOM 9918  O O    . GLN A 1 97  ? 21.319  3.069   -7.746  1.00 0.00 ? 97  GLN A O    6  
ATOM 9919  C CB   . GLN A 1 97  ? 21.954  0.089   -8.717  1.00 0.00 ? 97  GLN A CB   6  
ATOM 9920  C CG   . GLN A 1 97  ? 23.134  -0.878  -8.615  1.00 0.00 ? 97  GLN A CG   6  
ATOM 9921  C CD   . GLN A 1 97  ? 22.841  -2.132  -9.441  1.00 0.00 ? 97  GLN A CD   6  
ATOM 9922  O OE1  . GLN A 1 97  ? 23.468  -2.364  -10.456 1.00 0.00 ? 97  GLN A OE1  6  
ATOM 9923  N NE2  . GLN A 1 97  ? 21.909  -2.956  -9.048  1.00 0.00 ? 97  GLN A NE2  6  
ATOM 9924  H H    . GLN A 1 97  ? 19.596  1.147   -7.518  1.00 0.00 ? 97  GLN A H    6  
ATOM 9925  H HA   . GLN A 1 97  ? 22.290  0.228   -6.600  1.00 0.00 ? 97  GLN A HA   6  
ATOM 9926  H HB2  . GLN A 1 97  ? 21.069  -0.451  -9.025  1.00 0.00 ? 97  GLN A HB2  6  
ATOM 9927  H HB3  . GLN A 1 97  ? 22.179  0.855   -9.444  1.00 0.00 ? 97  GLN A HB3  6  
ATOM 9928  H HG2  . GLN A 1 97  ? 24.025  -0.398  -8.990  1.00 0.00 ? 97  GLN A HG2  6  
ATOM 9929  H HG3  . GLN A 1 97  ? 23.282  -1.157  -7.583  1.00 0.00 ? 97  GLN A HG3  6  
ATOM 9930  H HE21 . GLN A 1 97  ? 21.403  -2.770  -8.229  1.00 0.00 ? 97  GLN A HE21 6  
ATOM 9931  H HE22 . GLN A 1 97  ? 21.715  -3.761  -9.571  1.00 0.00 ? 97  GLN A HE22 6  
ATOM 9932  N N    . ARG A 1 98  ? 23.331  2.517   -7.056  1.00 0.00 ? 98  ARG A N    6  
ATOM 9933  C CA   . ARG A 1 98  ? 23.776  3.939   -7.081  1.00 0.00 ? 98  ARG A CA   6  
ATOM 9934  C C    . ARG A 1 98  ? 25.156  4.037   -7.737  1.00 0.00 ? 98  ARG A C    6  
ATOM 9935  O O    . ARG A 1 98  ? 25.422  4.935   -8.511  1.00 0.00 ? 98  ARG A O    6  
ATOM 9936  C CB   . ARG A 1 98  ? 23.855  4.473   -5.649  1.00 0.00 ? 98  ARG A CB   6  
ATOM 9937  C CG   . ARG A 1 98  ? 23.039  5.764   -5.540  1.00 0.00 ? 98  ARG A CG   6  
ATOM 9938  C CD   . ARG A 1 98  ? 23.975  6.937   -5.242  1.00 0.00 ? 98  ARG A CD   6  
ATOM 9939  N NE   . ARG A 1 98  ? 23.248  8.218   -5.468  1.00 0.00 ? 98  ARG A NE   6  
ATOM 9940  C CZ   . ARG A 1 98  ? 23.882  9.354   -5.373  1.00 0.00 ? 98  ARG A CZ   6  
ATOM 9941  N NH1  . ARG A 1 98  ? 25.046  9.404   -4.786  1.00 0.00 ? 98  ARG A NH1  6  
ATOM 9942  N NH2  . ARG A 1 98  ? 23.349  10.439  -5.866  1.00 0.00 ? 98  ARG A NH2  6  
ATOM 9943  H H    . ARG A 1 98  ? 23.952  1.812   -6.779  1.00 0.00 ? 98  ARG A H    6  
ATOM 9944  H HA   . ARG A 1 98  ? 23.068  4.529   -7.646  1.00 0.00 ? 98  ARG A HA   6  
ATOM 9945  H HB2  . ARG A 1 98  ? 23.455  3.735   -4.968  1.00 0.00 ? 98  ARG A HB2  6  
ATOM 9946  H HB3  . ARG A 1 98  ? 24.884  4.678   -5.396  1.00 0.00 ? 98  ARG A HB3  6  
ATOM 9947  H HG2  . ARG A 1 98  ? 22.522  5.943   -6.471  1.00 0.00 ? 98  ARG A HG2  6  
ATOM 9948  H HG3  . ARG A 1 98  ? 22.320  5.668   -4.740  1.00 0.00 ? 98  ARG A HG3  6  
ATOM 9949  H HD2  . ARG A 1 98  ? 24.301  6.885   -4.215  1.00 0.00 ? 98  ARG A HD2  6  
ATOM 9950  H HD3  . ARG A 1 98  ? 24.833  6.889   -5.896  1.00 0.00 ? 98  ARG A HD3  6  
ATOM 9951  H HE   . ARG A 1 98  ? 22.293  8.206   -5.688  1.00 0.00 ? 98  ARG A HE   6  
ATOM 9952  H HH11 . ARG A 1 98  ? 25.453  8.572   -4.411  1.00 0.00 ? 98  ARG A HH11 6  
ATOM 9953  H HH12 . ARG A 1 98  ? 25.532  10.275  -4.713  1.00 0.00 ? 98  ARG A HH12 6  
ATOM 9954  H HH21 . ARG A 1 98  ? 22.458  10.399  -6.317  1.00 0.00 ? 98  ARG A HH21 6  
ATOM 9955  H HH22 . ARG A 1 98  ? 23.834  11.310  -5.792  1.00 0.00 ? 98  ARG A HH22 6  
ATOM 9956  N N    . GLY A 1 99  ? 26.038  3.124   -7.434  1.00 0.00 ? 99  GLY A N    6  
ATOM 9957  C CA   . GLY A 1 99  ? 27.398  3.176   -8.042  1.00 0.00 ? 99  GLY A CA   6  
ATOM 9958  C C    . GLY A 1 99  ? 28.006  1.772   -8.069  1.00 0.00 ? 99  GLY A C    6  
ATOM 9959  O O    . GLY A 1 99  ? 28.478  1.311   -9.089  1.00 0.00 ? 99  GLY A O    6  
ATOM 9960  H H    . GLY A 1 99  ? 25.807  2.408   -6.806  1.00 0.00 ? 99  GLY A H    6  
ATOM 9961  H HA2  . GLY A 1 99  ? 27.325  3.555   -9.051  1.00 0.00 ? 99  GLY A HA2  6  
ATOM 9962  H HA3  . GLY A 1 99  ? 28.028  3.830   -7.458  1.00 0.00 ? 99  GLY A HA3  6  
ATOM 9963  N N    . VAL A 1 100 ? 28.001  1.089   -6.958  1.00 0.00 ? 100 VAL A N    6  
ATOM 9964  C CA   . VAL A 1 100 ? 28.583  -0.283  -6.925  1.00 0.00 ? 100 VAL A CA   6  
ATOM 9965  C C    . VAL A 1 100 ? 27.879  -1.111  -5.848  1.00 0.00 ? 100 VAL A C    6  
ATOM 9966  O O    . VAL A 1 100 ? 28.454  -2.015  -5.274  1.00 0.00 ? 100 VAL A O    6  
ATOM 9967  C CB   . VAL A 1 100 ? 30.077  -0.196  -6.607  1.00 0.00 ? 100 VAL A CB   6  
ATOM 9968  C CG1  . VAL A 1 100 ? 30.774  0.672   -7.655  1.00 0.00 ? 100 VAL A CG1  6  
ATOM 9969  C CG2  . VAL A 1 100 ? 30.266  0.427   -5.222  1.00 0.00 ? 100 VAL A CG2  6  
ATOM 9970  H H    . VAL A 1 100 ? 27.617  1.478   -6.144  1.00 0.00 ? 100 VAL A H    6  
ATOM 9971  H HA   . VAL A 1 100 ? 28.447  -0.754  -7.887  1.00 0.00 ? 100 VAL A HA   6  
ATOM 9972  H HB   . VAL A 1 100 ? 30.504  -1.188  -6.619  1.00 0.00 ? 100 VAL A HB   6  
ATOM 9973  H HG11 . VAL A 1 100 ? 30.348  1.665   -7.642  1.00 0.00 ? 100 VAL A HG11 6  
ATOM 9974  H HG12 . VAL A 1 100 ? 30.639  0.236   -8.633  1.00 0.00 ? 100 VAL A HG12 6  
ATOM 9975  H HG13 . VAL A 1 100 ? 31.828  0.731   -7.429  1.00 0.00 ? 100 VAL A HG13 6  
ATOM 9976  H HG21 . VAL A 1 100 ? 31.255  0.193   -4.855  1.00 0.00 ? 100 VAL A HG21 6  
ATOM 9977  H HG22 . VAL A 1 100 ? 29.526  0.030   -4.544  1.00 0.00 ? 100 VAL A HG22 6  
ATOM 9978  H HG23 . VAL A 1 100 ? 30.153  1.499   -5.292  1.00 0.00 ? 100 VAL A HG23 6  
ATOM 9979  N N    . SER A 1 101 ? 26.641  -0.810  -5.568  1.00 0.00 ? 101 SER A N    6  
ATOM 9980  C CA   . SER A 1 101 ? 25.904  -1.582  -4.528  1.00 0.00 ? 101 SER A CA   6  
ATOM 9981  C C    . SER A 1 101 ? 26.644  -1.476  -3.193  1.00 0.00 ? 101 SER A C    6  
ATOM 9982  O O    . SER A 1 101 ? 27.000  -2.510  -2.652  1.00 0.00 ? 101 SER A O    6  
ATOM 9983  C CB   . SER A 1 101 ? 25.819  -3.051  -4.948  1.00 0.00 ? 101 SER A CB   6  
ATOM 9984  O OG   . SER A 1 101 ? 24.929  -3.173  -6.051  1.00 0.00 ? 101 SER A OG   6  
ATOM 9985  O OXT  . SER A 1 101 ? 26.841  -0.363  -2.734  1.00 0.00 ? 101 SER A OXT  6  
ATOM 9986  H H    . SER A 1 101 ? 26.196  -0.077  -6.043  1.00 0.00 ? 101 SER A H    6  
ATOM 9987  H HA   . SER A 1 101 ? 24.907  -1.180  -4.420  1.00 0.00 ? 101 SER A HA   6  
ATOM 9988  H HB2  . SER A 1 101 ? 26.795  -3.401  -5.238  1.00 0.00 ? 101 SER A HB2  6  
ATOM 9989  H HB3  . SER A 1 101 ? 25.460  -3.641  -4.115  1.00 0.00 ? 101 SER A HB3  6  
ATOM 9990  H HG   . SER A 1 101 ? 25.332  -2.738  -6.806  1.00 0.00 ? 101 SER A HG   6  
ATOM 9991  N N    . GLU A 1 1   ? 16.918  10.665  -8.338  1.00 0.00 ? 1   GLU A N    7  
ATOM 9992  C CA   . GLU A 1 1   ? 16.835  9.442   -7.489  1.00 0.00 ? 1   GLU A CA   7  
ATOM 9993  C C    . GLU A 1 1   ? 15.675  9.585   -6.502  1.00 0.00 ? 1   GLU A C    7  
ATOM 9994  O O    . GLU A 1 1   ? 15.843  9.442   -5.308  1.00 0.00 ? 1   GLU A O    7  
ATOM 9995  C CB   . GLU A 1 1   ? 18.143  9.269   -6.715  1.00 0.00 ? 1   GLU A CB   7  
ATOM 9996  C CG   . GLU A 1 1   ? 18.407  10.517  -5.871  1.00 0.00 ? 1   GLU A CG   7  
ATOM 9997  C CD   . GLU A 1 1   ? 19.666  10.306  -5.028  1.00 0.00 ? 1   GLU A CD   7  
ATOM 9998  O OE1  . GLU A 1 1   ? 20.547  9.595   -5.482  1.00 0.00 ? 1   GLU A OE1  7  
ATOM 9999  O OE2  . GLU A 1 1   ? 19.727  10.860  -3.943  1.00 0.00 ? 1   GLU A OE2  7  
ATOM 10000 H H1   . GLU A 1 1   ? 17.873  11.070  -8.271  1.00 0.00 ? 1   GLU A H1   7  
ATOM 10001 H H2   . GLU A 1 1   ? 16.220  11.363  -8.009  1.00 0.00 ? 1   GLU A H2   7  
ATOM 10002 H H3   . GLU A 1 1   ? 16.719  10.415  -9.328  1.00 0.00 ? 1   GLU A H3   7  
ATOM 10003 H HA   . GLU A 1 1   ? 16.671  8.579   -8.118  1.00 0.00 ? 1   GLU A HA   7  
ATOM 10004 H HB2  . GLU A 1 1   ? 18.066  8.406   -6.069  1.00 0.00 ? 1   GLU A HB2  7  
ATOM 10005 H HB3  . GLU A 1 1   ? 18.957  9.128   -7.409  1.00 0.00 ? 1   GLU A HB3  7  
ATOM 10006 H HG2  . GLU A 1 1   ? 18.546  11.368  -6.521  1.00 0.00 ? 1   GLU A HG2  7  
ATOM 10007 H HG3  . GLU A 1 1   ? 17.565  10.695  -5.220  1.00 0.00 ? 1   GLU A HG3  7  
ATOM 10008 N N    . SER A 1 2   ? 14.498  9.865   -6.990  1.00 0.00 ? 2   SER A N    7  
ATOM 10009 C CA   . SER A 1 2   ? 13.330  10.016  -6.078  1.00 0.00 ? 2   SER A CA   7  
ATOM 10010 C C    . SER A 1 2   ? 12.641  8.662   -5.903  1.00 0.00 ? 2   SER A C    7  
ATOM 10011 O O    . SER A 1 2   ? 12.697  8.057   -4.850  1.00 0.00 ? 2   SER A O    7  
ATOM 10012 C CB   . SER A 1 2   ? 12.344  11.021  -6.676  1.00 0.00 ? 2   SER A CB   7  
ATOM 10013 O OG   . SER A 1 2   ? 13.002  12.266  -6.877  1.00 0.00 ? 2   SER A OG   7  
ATOM 10014 H H    . SER A 1 2   ? 14.381  9.977   -7.957  1.00 0.00 ? 2   SER A H    7  
ATOM 10015 H HA   . SER A 1 2   ? 13.670  10.374  -5.116  1.00 0.00 ? 2   SER A HA   7  
ATOM 10016 H HB2  . SER A 1 2   ? 11.983  10.653  -7.621  1.00 0.00 ? 2   SER A HB2  7  
ATOM 10017 H HB3  . SER A 1 2   ? 11.509  11.148  -5.999  1.00 0.00 ? 2   SER A HB3  7  
ATOM 10018 H HG   . SER A 1 2   ? 13.948  12.102  -6.913  1.00 0.00 ? 2   SER A HG   7  
ATOM 10019 N N    . LYS A 1 3   ? 11.991  8.179   -6.927  1.00 0.00 ? 3   LYS A N    7  
ATOM 10020 C CA   . LYS A 1 3   ? 11.301  6.862   -6.818  1.00 0.00 ? 3   LYS A CA   7  
ATOM 10021 C C    . LYS A 1 3   ? 11.640  6.001   -8.041  1.00 0.00 ? 3   LYS A C    7  
ATOM 10022 O O    . LYS A 1 3   ? 10.758  5.592   -8.769  1.00 0.00 ? 3   LYS A O    7  
ATOM 10023 C CB   . LYS A 1 3   ? 9.787   7.083   -6.753  1.00 0.00 ? 3   LYS A CB   7  
ATOM 10024 C CG   . LYS A 1 3   ? 9.480   8.261   -5.825  1.00 0.00 ? 3   LYS A CG   7  
ATOM 10025 C CD   . LYS A 1 3   ? 8.967   9.444   -6.648  1.00 0.00 ? 3   LYS A CD   7  
ATOM 10026 C CE   . LYS A 1 3   ? 8.684   10.625  -5.719  1.00 0.00 ? 3   LYS A CE   7  
ATOM 10027 N NZ   . LYS A 1 3   ? 7.925   11.671  -6.462  1.00 0.00 ? 3   LYS A NZ   7  
ATOM 10028 H H    . LYS A 1 3   ? 11.958  8.681   -7.768  1.00 0.00 ? 3   LYS A H    7  
ATOM 10029 H HA   . LYS A 1 3   ? 11.630  6.358   -5.921  1.00 0.00 ? 3   LYS A HA   7  
ATOM 10030 H HB2  . LYS A 1 3   ? 9.412   7.297   -7.743  1.00 0.00 ? 3   LYS A HB2  7  
ATOM 10031 H HB3  . LYS A 1 3   ? 9.311   6.193   -6.371  1.00 0.00 ? 3   LYS A HB3  7  
ATOM 10032 H HG2  . LYS A 1 3   ? 8.726   7.966   -5.108  1.00 0.00 ? 3   LYS A HG2  7  
ATOM 10033 H HG3  . LYS A 1 3   ? 10.379  8.552   -5.303  1.00 0.00 ? 3   LYS A HG3  7  
ATOM 10034 H HD2  . LYS A 1 3   ? 9.714   9.727   -7.376  1.00 0.00 ? 3   LYS A HD2  7  
ATOM 10035 H HD3  . LYS A 1 3   ? 8.056   9.161   -7.156  1.00 0.00 ? 3   LYS A HD3  7  
ATOM 10036 H HE2  . LYS A 1 3   ? 8.100   10.288  -4.875  1.00 0.00 ? 3   LYS A HE2  7  
ATOM 10037 H HE3  . LYS A 1 3   ? 9.618   11.039  -5.368  1.00 0.00 ? 3   LYS A HE3  7  
ATOM 10038 H HZ1  . LYS A 1 3   ? 8.037   12.587  -5.983  1.00 0.00 ? 3   LYS A HZ1  7  
ATOM 10039 H HZ2  . LYS A 1 3   ? 6.917   11.414  -6.488  1.00 0.00 ? 3   LYS A HZ2  7  
ATOM 10040 H HZ3  . LYS A 1 3   ? 8.291   11.743  -7.432  1.00 0.00 ? 3   LYS A HZ3  7  
ATOM 10041 N N    . PRO A 1 4   ? 12.912  5.752   -8.226  1.00 0.00 ? 4   PRO A N    7  
ATOM 10042 C CA   . PRO A 1 4   ? 13.404  4.938   -9.353  1.00 0.00 ? 4   PRO A CA   7  
ATOM 10043 C C    . PRO A 1 4   ? 13.084  3.428   -9.214  1.00 0.00 ? 4   PRO A C    7  
ATOM 10044 O O    . PRO A 1 4   ? 12.890  2.774   -10.221 1.00 0.00 ? 4   PRO A O    7  
ATOM 10045 C CB   . PRO A 1 4   ? 14.914  5.211   -9.367  1.00 0.00 ? 4   PRO A CB   7  
ATOM 10046 C CG   . PRO A 1 4   ? 15.284  5.726   -7.957  1.00 0.00 ? 4   PRO A CG   7  
ATOM 10047 C CD   . PRO A 1 4   ? 13.978  6.259   -7.331  1.00 0.00 ? 4   PRO A CD   7  
ATOM 10048 H HA   . PRO A 1 4   ? 12.980  5.308   -10.272 1.00 0.00 ? 4   PRO A HA   7  
ATOM 10049 H HB2  . PRO A 1 4   ? 15.453  4.297   -9.585  1.00 0.00 ? 4   PRO A HB2  7  
ATOM 10050 H HB3  . PRO A 1 4   ? 15.147  5.965   -10.102 1.00 0.00 ? 4   PRO A HB3  7  
ATOM 10051 H HG2  . PRO A 1 4   ? 15.689  4.920   -7.361  1.00 0.00 ? 4   PRO A HG2  7  
ATOM 10052 H HG3  . PRO A 1 4   ? 16.003  6.527   -8.033  1.00 0.00 ? 4   PRO A HG3  7  
ATOM 10053 H HD2  . PRO A 1 4   ? 13.854  5.871   -6.329  1.00 0.00 ? 4   PRO A HD2  7  
ATOM 10054 H HD3  . PRO A 1 4   ? 13.976  7.338   -7.325  1.00 0.00 ? 4   PRO A HD3  7  
ATOM 10055 N N    . PRO A 1 5   ? 13.026  2.894   -8.007  1.00 0.00 ? 5   PRO A N    7  
ATOM 10056 C CA   . PRO A 1 5   ? 12.719  1.462   -7.815  1.00 0.00 ? 5   PRO A CA   7  
ATOM 10057 C C    . PRO A 1 5   ? 11.219  1.214   -7.973  1.00 0.00 ? 5   PRO A C    7  
ATOM 10058 O O    . PRO A 1 5   ? 10.769  0.627   -8.937  1.00 0.00 ? 5   PRO A O    7  
ATOM 10059 C CB   . PRO A 1 5   ? 13.151  1.181   -6.375  1.00 0.00 ? 5   PRO A CB   7  
ATOM 10060 C CG   . PRO A 1 5   ? 13.146  2.545   -5.649  1.00 0.00 ? 5   PRO A CG   7  
ATOM 10061 C CD   . PRO A 1 5   ? 13.252  3.625   -6.741  1.00 0.00 ? 5   PRO A CD   7  
ATOM 10062 H HA   . PRO A 1 5   ? 13.285  0.852   -8.498  1.00 0.00 ? 5   PRO A HA   7  
ATOM 10063 H HB2  . PRO A 1 5   ? 12.453  0.503   -5.905  1.00 0.00 ? 5   PRO A HB2  7  
ATOM 10064 H HB3  . PRO A 1 5   ? 14.143  0.763   -6.358  1.00 0.00 ? 5   PRO A HB3  7  
ATOM 10065 H HG2  . PRO A 1 5   ? 12.225  2.663   -5.094  1.00 0.00 ? 5   PRO A HG2  7  
ATOM 10066 H HG3  . PRO A 1 5   ? 13.993  2.613   -4.985  1.00 0.00 ? 5   PRO A HG3  7  
ATOM 10067 H HD2  . PRO A 1 5   ? 12.494  4.382   -6.593  1.00 0.00 ? 5   PRO A HD2  7  
ATOM 10068 H HD3  . PRO A 1 5   ? 14.233  4.059   -6.733  1.00 0.00 ? 5   PRO A HD3  7  
ATOM 10069 N N    . TYR A 1 6   ? 10.445  1.656   -7.022  1.00 0.00 ? 6   TYR A N    7  
ATOM 10070 C CA   . TYR A 1 6   ? 8.975   1.448   -7.095  1.00 0.00 ? 6   TYR A CA   7  
ATOM 10071 C C    . TYR A 1 6   ? 8.346   2.498   -8.002  1.00 0.00 ? 6   TYR A C    7  
ATOM 10072 O O    . TYR A 1 6   ? 8.703   3.660   -7.976  1.00 0.00 ? 6   TYR A O    7  
ATOM 10073 C CB   . TYR A 1 6   ? 8.388   1.542   -5.690  1.00 0.00 ? 6   TYR A CB   7  
ATOM 10074 C CG   . TYR A 1 6   ? 8.789   0.318   -4.891  1.00 0.00 ? 6   TYR A CG   7  
ATOM 10075 C CD1  . TYR A 1 6   ? 9.665   -0.636  -5.436  1.00 0.00 ? 6   TYR A CD1  7  
ATOM 10076 C CD2  . TYR A 1 6   ? 8.282   0.141   -3.602  1.00 0.00 ? 6   TYR A CD2  7  
ATOM 10077 C CE1  . TYR A 1 6   ? 10.030  -1.760  -4.687  1.00 0.00 ? 6   TYR A CE1  7  
ATOM 10078 C CE2  . TYR A 1 6   ? 8.646   -0.985  -2.852  1.00 0.00 ? 6   TYR A CE2  7  
ATOM 10079 C CZ   . TYR A 1 6   ? 9.520   -1.935  -3.395  1.00 0.00 ? 6   TYR A CZ   7  
ATOM 10080 O OH   . TYR A 1 6   ? 9.881   -3.043  -2.657  1.00 0.00 ? 6   TYR A OH   7  
ATOM 10081 H H    . TYR A 1 6   ? 10.834  2.121   -6.252  1.00 0.00 ? 6   TYR A H    7  
ATOM 10082 H HA   . TYR A 1 6   ? 8.768   0.468   -7.496  1.00 0.00 ? 6   TYR A HA   7  
ATOM 10083 H HB2  . TYR A 1 6   ? 8.764   2.430   -5.202  1.00 0.00 ? 6   TYR A HB2  7  
ATOM 10084 H HB3  . TYR A 1 6   ? 7.312   1.593   -5.752  1.00 0.00 ? 6   TYR A HB3  7  
ATOM 10085 H HD1  . TYR A 1 6   ? 10.059  -0.501  -6.437  1.00 0.00 ? 6   TYR A HD1  7  
ATOM 10086 H HD2  . TYR A 1 6   ? 7.608   0.874   -3.185  1.00 0.00 ? 6   TYR A HD2  7  
ATOM 10087 H HE1  . TYR A 1 6   ? 10.702  -2.493  -5.107  1.00 0.00 ? 6   TYR A HE1  7  
ATOM 10088 H HE2  . TYR A 1 6   ? 8.254   -1.120  -1.855  1.00 0.00 ? 6   TYR A HE2  7  
ATOM 10089 H HH   . TYR A 1 6   ? 10.622  -3.466  -3.099  1.00 0.00 ? 6   TYR A HH   7  
ATOM 10090 N N    . SER A 1 7   ? 7.417   2.088   -8.812  1.00 0.00 ? 7   SER A N    7  
ATOM 10091 C CA   . SER A 1 7   ? 6.755   3.038   -9.738  1.00 0.00 ? 7   SER A CA   7  
ATOM 10092 C C    . SER A 1 7   ? 5.331   3.305   -9.252  1.00 0.00 ? 7   SER A C    7  
ATOM 10093 O O    . SER A 1 7   ? 4.987   3.017   -8.123  1.00 0.00 ? 7   SER A O    7  
ATOM 10094 C CB   . SER A 1 7   ? 6.718   2.420   -11.132 1.00 0.00 ? 7   SER A CB   7  
ATOM 10095 O OG   . SER A 1 7   ? 7.560   3.169   -12.000 1.00 0.00 ? 7   SER A OG   7  
ATOM 10096 H H    . SER A 1 7   ? 7.155   1.143   -8.813  1.00 0.00 ? 7   SER A H    7  
ATOM 10097 H HA   . SER A 1 7   ? 7.310   3.965   -9.766  1.00 0.00 ? 7   SER A HA   7  
ATOM 10098 H HB2  . SER A 1 7   ? 7.075   1.405   -11.078 1.00 0.00 ? 7   SER A HB2  7  
ATOM 10099 H HB3  . SER A 1 7   ? 5.701   2.426   -11.503 1.00 0.00 ? 7   SER A HB3  7  
ATOM 10100 H HG   . SER A 1 7   ? 7.782   2.613   -12.750 1.00 0.00 ? 7   SER A HG   7  
ATOM 10101 N N    . TYR A 1 8   ? 4.500   3.856   -10.090 1.00 0.00 ? 8   TYR A N    7  
ATOM 10102 C CA   . TYR A 1 8   ? 3.105   4.141   -9.667  1.00 0.00 ? 8   TYR A CA   7  
ATOM 10103 C C    . TYR A 1 8   ? 2.181   3.049   -10.208 1.00 0.00 ? 8   TYR A C    7  
ATOM 10104 O O    . TYR A 1 8   ? 1.215   3.308   -10.896 1.00 0.00 ? 8   TYR A O    7  
ATOM 10105 C CB   . TYR A 1 8   ? 2.690   5.510   -10.194 1.00 0.00 ? 8   TYR A CB   7  
ATOM 10106 C CG   . TYR A 1 8   ? 3.338   6.577   -9.343  1.00 0.00 ? 8   TYR A CG   7  
ATOM 10107 C CD1  . TYR A 1 8   ? 4.721   6.550   -9.114  1.00 0.00 ? 8   TYR A CD1  7  
ATOM 10108 C CD2  . TYR A 1 8   ? 2.557   7.589   -8.777  1.00 0.00 ? 8   TYR A CD2  7  
ATOM 10109 C CE1  . TYR A 1 8   ? 5.318   7.534   -8.321  1.00 0.00 ? 8   TYR A CE1  7  
ATOM 10110 C CE2  . TYR A 1 8   ? 3.156   8.572   -7.984  1.00 0.00 ? 8   TYR A CE2  7  
ATOM 10111 C CZ   . TYR A 1 8   ? 4.536   8.547   -7.755  1.00 0.00 ? 8   TYR A CZ   7  
ATOM 10112 O OH   . TYR A 1 8   ? 5.124   9.518   -6.971  1.00 0.00 ? 8   TYR A OH   7  
ATOM 10113 H H    . TYR A 1 8   ? 4.796   4.085   -10.997 1.00 0.00 ? 8   TYR A H    7  
ATOM 10114 H HA   . TYR A 1 8   ? 3.057   4.144   -8.587  1.00 0.00 ? 8   TYR A HA   7  
ATOM 10115 H HB2  . TYR A 1 8   ? 3.014   5.617   -11.220 1.00 0.00 ? 8   TYR A HB2  7  
ATOM 10116 H HB3  . TYR A 1 8   ? 1.618   5.609   -10.141 1.00 0.00 ? 8   TYR A HB3  7  
ATOM 10117 H HD1  . TYR A 1 8   ? 5.327   5.770   -9.548  1.00 0.00 ? 8   TYR A HD1  7  
ATOM 10118 H HD2  . TYR A 1 8   ? 1.492   7.609   -8.950  1.00 0.00 ? 8   TYR A HD2  7  
ATOM 10119 H HE1  . TYR A 1 8   ? 6.383   7.512   -8.145  1.00 0.00 ? 8   TYR A HE1  7  
ATOM 10120 H HE2  . TYR A 1 8   ? 2.553   9.353   -7.549  1.00 0.00 ? 8   TYR A HE2  7  
ATOM 10121 H HH   . TYR A 1 8   ? 5.564   10.142  -7.552  1.00 0.00 ? 8   TYR A HH   7  
ATOM 10122 N N    . ALA A 1 9   ? 2.490   1.826   -9.887  1.00 0.00 ? 9   ALA A N    7  
ATOM 10123 C CA   . ALA A 1 9   ? 1.670   0.672   -10.349 1.00 0.00 ? 9   ALA A CA   7  
ATOM 10124 C C    . ALA A 1 9   ? 2.306   -0.595  -9.785  1.00 0.00 ? 9   ALA A C    7  
ATOM 10125 O O    . ALA A 1 9   ? 1.638   -1.477  -9.287  1.00 0.00 ? 9   ALA A O    7  
ATOM 10126 C CB   . ALA A 1 9   ? 1.663   0.618   -11.876 1.00 0.00 ? 9   ALA A CB   7  
ATOM 10127 H H    . ALA A 1 9   ? 3.278   1.663   -9.328  1.00 0.00 ? 9   ALA A H    7  
ATOM 10128 H HA   . ALA A 1 9   ? 0.660   0.770   -9.978  1.00 0.00 ? 9   ALA A HA   7  
ATOM 10129 H HB1  . ALA A 1 9   ? 1.022   -0.186  -12.202 1.00 0.00 ? 9   ALA A HB1  7  
ATOM 10130 H HB2  . ALA A 1 9   ? 2.666   0.450   -12.234 1.00 0.00 ? 9   ALA A HB2  7  
ATOM 10131 H HB3  . ALA A 1 9   ? 1.292   1.555   -12.266 1.00 0.00 ? 9   ALA A HB3  7  
ATOM 10132 N N    . GLN A 1 10  ? 3.610   -0.650  -9.811  1.00 0.00 ? 10  GLN A N    7  
ATOM 10133 C CA   . GLN A 1 10  ? 4.334   -1.810  -9.226  1.00 0.00 ? 10  GLN A CA   7  
ATOM 10134 C C    . GLN A 1 10  ? 4.436   -1.522  -7.739  1.00 0.00 ? 10  GLN A C    7  
ATOM 10135 O O    . GLN A 1 10  ? 4.425   -2.406  -6.906  1.00 0.00 ? 10  GLN A O    7  
ATOM 10136 C CB   . GLN A 1 10  ? 5.732   -1.909  -9.839  1.00 0.00 ? 10  GLN A CB   7  
ATOM 10137 C CG   . GLN A 1 10  ? 6.586   -2.877  -9.019  1.00 0.00 ? 10  GLN A CG   7  
ATOM 10138 C CD   . GLN A 1 10  ? 7.903   -2.199  -8.638  1.00 0.00 ? 10  GLN A CD   7  
ATOM 10139 O OE1  . GLN A 1 10  ? 8.022   -1.633  -7.570  1.00 0.00 ? 10  GLN A OE1  7  
ATOM 10140 N NE2  . GLN A 1 10  ? 8.906   -2.232  -9.473  1.00 0.00 ? 10  GLN A NE2  7  
ATOM 10141 H H    . GLN A 1 10  ? 4.115   0.102   -10.174 1.00 0.00 ? 10  GLN A H    7  
ATOM 10142 H HA   . GLN A 1 10  ? 3.782   -2.727  -9.390  1.00 0.00 ? 10  GLN A HA   7  
ATOM 10143 H HB2  . GLN A 1 10  ? 5.656   -2.267  -10.856 1.00 0.00 ? 10  GLN A HB2  7  
ATOM 10144 H HB3  . GLN A 1 10  ? 6.196   -0.934  -9.837  1.00 0.00 ? 10  GLN A HB3  7  
ATOM 10145 H HG2  . GLN A 1 10  ? 6.053   -3.159  -8.123  1.00 0.00 ? 10  GLN A HG2  7  
ATOM 10146 H HG3  . GLN A 1 10  ? 6.793   -3.757  -9.606  1.00 0.00 ? 10  GLN A HG3  7  
ATOM 10147 H HE21 . GLN A 1 10  ? 8.811   -2.689  -10.335 1.00 0.00 ? 10  GLN A HE21 7  
ATOM 10148 H HE22 . GLN A 1 10  ? 9.754   -1.800  -9.238  1.00 0.00 ? 10  GLN A HE22 7  
ATOM 10149 N N    . LEU A 1 11  ? 4.491   -0.260  -7.413  1.00 0.00 ? 11  LEU A N    7  
ATOM 10150 C CA   . LEU A 1 11  ? 4.544   0.155   -5.998  1.00 0.00 ? 11  LEU A CA   7  
ATOM 10151 C C    . LEU A 1 11  ? 3.261   -0.340  -5.336  1.00 0.00 ? 11  LEU A C    7  
ATOM 10152 O O    . LEU A 1 11  ? 3.257   -0.809  -4.216  1.00 0.00 ? 11  LEU A O    7  
ATOM 10153 C CB   . LEU A 1 11  ? 4.607   1.681   -5.957  1.00 0.00 ? 11  LEU A CB   7  
ATOM 10154 C CG   . LEU A 1 11  ? 4.354   2.183   -4.543  1.00 0.00 ? 11  LEU A CG   7  
ATOM 10155 C CD1  . LEU A 1 11  ? 5.649   2.753   -3.979  1.00 0.00 ? 11  LEU A CD1  7  
ATOM 10156 C CD2  . LEU A 1 11  ? 3.302   3.288   -4.590  1.00 0.00 ? 11  LEU A CD2  7  
ATOM 10157 H H    . LEU A 1 11  ? 4.465   0.423   -8.114  1.00 0.00 ? 11  LEU A H    7  
ATOM 10158 H HA   . LEU A 1 11  ? 5.408   -0.272  -5.510  1.00 0.00 ? 11  LEU A HA   7  
ATOM 10159 H HB2  . LEU A 1 11  ? 5.584   2.005   -6.283  1.00 0.00 ? 11  LEU A HB2  7  
ATOM 10160 H HB3  . LEU A 1 11  ? 3.857   2.086   -6.619  1.00 0.00 ? 11  LEU A HB3  7  
ATOM 10161 H HG   . LEU A 1 11  ? 4.007   1.372   -3.921  1.00 0.00 ? 11  LEU A HG   7  
ATOM 10162 H HD11 . LEU A 1 11  ? 6.438   2.025   -4.089  1.00 0.00 ? 11  LEU A HD11 7  
ATOM 10163 H HD12 . LEU A 1 11  ? 5.513   2.986   -2.935  1.00 0.00 ? 11  LEU A HD12 7  
ATOM 10164 H HD13 . LEU A 1 11  ? 5.909   3.652   -4.520  1.00 0.00 ? 11  LEU A HD13 7  
ATOM 10165 H HD21 . LEU A 1 11  ? 2.526   3.014   -5.288  1.00 0.00 ? 11  LEU A HD21 7  
ATOM 10166 H HD22 . LEU A 1 11  ? 3.766   4.209   -4.912  1.00 0.00 ? 11  LEU A HD22 7  
ATOM 10167 H HD23 . LEU A 1 11  ? 2.876   3.420   -3.609  1.00 0.00 ? 11  LEU A HD23 7  
ATOM 10168 N N    . ILE A 1 12  ? 2.172   -0.259  -6.054  1.00 0.00 ? 12  ILE A N    7  
ATOM 10169 C CA   . ILE A 1 12  ? 0.871   -0.746  -5.512  1.00 0.00 ? 12  ILE A CA   7  
ATOM 10170 C C    . ILE A 1 12  ? 0.950   -2.259  -5.393  1.00 0.00 ? 12  ILE A C    7  
ATOM 10171 O O    . ILE A 1 12  ? 0.674   -2.834  -4.362  1.00 0.00 ? 12  ILE A O    7  
ATOM 10172 C CB   . ILE A 1 12  ? -0.271  -0.418  -6.474  1.00 0.00 ? 12  ILE A CB   7  
ATOM 10173 C CG1  . ILE A 1 12  ? -0.053  0.932   -7.192  1.00 0.00 ? 12  ILE A CG1  7  
ATOM 10174 C CG2  . ILE A 1 12  ? -1.583  -0.379  -5.698  1.00 0.00 ? 12  ILE A CG2  7  
ATOM 10175 C CD1  . ILE A 1 12  ? 0.757   1.899   -6.322  1.00 0.00 ? 12  ILE A CD1  7  
ATOM 10176 H H    . ILE A 1 12  ? 2.218   0.110   -6.961  1.00 0.00 ? 12  ILE A H    7  
ATOM 10177 H HA   . ILE A 1 12  ? 0.680   -0.307  -4.544  1.00 0.00 ? 12  ILE A HA   7  
ATOM 10178 H HB   . ILE A 1 12  ? -0.329  -1.208  -7.206  1.00 0.00 ? 12  ILE A HB   7  
ATOM 10179 H HG12 . ILE A 1 12  ? 0.475   0.765   -8.116  1.00 0.00 ? 12  ILE A HG12 7  
ATOM 10180 H HG13 . ILE A 1 12  ? -1.013  1.371   -7.408  1.00 0.00 ? 12  ILE A HG13 7  
ATOM 10181 H HG21 . ILE A 1 12  ? -2.042  0.588   -5.815  1.00 0.00 ? 12  ILE A HG21 7  
ATOM 10182 H HG22 . ILE A 1 12  ? -1.385  -0.564  -4.652  1.00 0.00 ? 12  ILE A HG22 7  
ATOM 10183 H HG23 . ILE A 1 12  ? -2.244  -1.143  -6.080  1.00 0.00 ? 12  ILE A HG23 7  
ATOM 10184 H HD11 . ILE A 1 12  ? 0.333   2.888   -6.393  1.00 0.00 ? 12  ILE A HD11 7  
ATOM 10185 H HD12 . ILE A 1 12  ? 1.780   1.920   -6.668  1.00 0.00 ? 12  ILE A HD12 7  
ATOM 10186 H HD13 . ILE A 1 12  ? 0.733   1.567   -5.297  1.00 0.00 ? 12  ILE A HD13 7  
ATOM 10187 N N    . VAL A 1 13  ? 1.327   -2.907  -6.457  1.00 0.00 ? 13  VAL A N    7  
ATOM 10188 C CA   . VAL A 1 13  ? 1.440   -4.383  -6.430  1.00 0.00 ? 13  VAL A CA   7  
ATOM 10189 C C    . VAL A 1 13  ? 2.305   -4.773  -5.237  1.00 0.00 ? 13  VAL A C    7  
ATOM 10190 O O    . VAL A 1 13  ? 2.167   -5.836  -4.676  1.00 0.00 ? 13  VAL A O    7  
ATOM 10191 C CB   . VAL A 1 13  ? 2.095   -4.852  -7.724  1.00 0.00 ? 13  VAL A CB   7  
ATOM 10192 C CG1  . VAL A 1 13  ? 2.306   -6.367  -7.675  1.00 0.00 ? 13  VAL A CG1  7  
ATOM 10193 C CG2  . VAL A 1 13  ? 1.183   -4.486  -8.896  1.00 0.00 ? 13  VAL A CG2  7  
ATOM 10194 H H    . VAL A 1 13  ? 1.533   -2.416  -7.281  1.00 0.00 ? 13  VAL A H    7  
ATOM 10195 H HA   . VAL A 1 13  ? 0.459   -4.825  -6.334  1.00 0.00 ? 13  VAL A HA   7  
ATOM 10196 H HB   . VAL A 1 13  ? 3.051   -4.361  -7.842  1.00 0.00 ? 13  VAL A HB   7  
ATOM 10197 H HG11 . VAL A 1 13  ? 1.363   -6.855  -7.483  1.00 0.00 ? 13  VAL A HG11 7  
ATOM 10198 H HG12 . VAL A 1 13  ? 3.003   -6.607  -6.887  1.00 0.00 ? 13  VAL A HG12 7  
ATOM 10199 H HG13 . VAL A 1 13  ? 2.703   -6.706  -8.620  1.00 0.00 ? 13  VAL A HG13 7  
ATOM 10200 H HG21 . VAL A 1 13  ? 1.651   -4.771  -9.823  1.00 0.00 ? 13  VAL A HG21 7  
ATOM 10201 H HG22 . VAL A 1 13  ? 1.009   -3.420  -8.892  1.00 0.00 ? 13  VAL A HG22 7  
ATOM 10202 H HG23 . VAL A 1 13  ? 0.240   -5.000  -8.792  1.00 0.00 ? 13  VAL A HG23 7  
ATOM 10203 N N    . GLN A 1 14  ? 3.179   -3.901  -4.828  1.00 0.00 ? 14  GLN A N    7  
ATOM 10204 C CA   . GLN A 1 14  ? 4.033   -4.203  -3.651  1.00 0.00 ? 14  GLN A CA   7  
ATOM 10205 C C    . GLN A 1 14  ? 3.172   -4.053  -2.398  1.00 0.00 ? 14  GLN A C    7  
ATOM 10206 O O    . GLN A 1 14  ? 3.278   -4.807  -1.450  1.00 0.00 ? 14  GLN A O    7  
ATOM 10207 C CB   . GLN A 1 14  ? 5.191   -3.206  -3.597  1.00 0.00 ? 14  GLN A CB   7  
ATOM 10208 C CG   . GLN A 1 14  ? 6.362   -3.737  -4.422  1.00 0.00 ? 14  GLN A CG   7  
ATOM 10209 C CD   . GLN A 1 14  ? 7.290   -4.548  -3.519  1.00 0.00 ? 14  GLN A CD   7  
ATOM 10210 O OE1  . GLN A 1 14  ? 7.659   -5.658  -3.847  1.00 0.00 ? 14  GLN A OE1  7  
ATOM 10211 N NE2  . GLN A 1 14  ? 7.683   -4.037  -2.385  1.00 0.00 ? 14  GLN A NE2  7  
ATOM 10212 H H    . GLN A 1 14  ? 3.260   -3.036  -5.283  1.00 0.00 ? 14  GLN A H    7  
ATOM 10213 H HA   . GLN A 1 14  ? 4.414   -5.211  -3.720  1.00 0.00 ? 14  GLN A HA   7  
ATOM 10214 H HB2  . GLN A 1 14  ? 4.867   -2.257  -4.002  1.00 0.00 ? 14  GLN A HB2  7  
ATOM 10215 H HB3  . GLN A 1 14  ? 5.505   -3.073  -2.573  1.00 0.00 ? 14  GLN A HB3  7  
ATOM 10216 H HG2  . GLN A 1 14  ? 5.989   -4.367  -5.216  1.00 0.00 ? 14  GLN A HG2  7  
ATOM 10217 H HG3  . GLN A 1 14  ? 6.910   -2.909  -4.847  1.00 0.00 ? 14  GLN A HG3  7  
ATOM 10218 H HE21 . GLN A 1 14  ? 7.383   -3.142  -2.120  1.00 0.00 ? 14  GLN A HE21 7  
ATOM 10219 H HE22 . GLN A 1 14  ? 8.279   -4.546  -1.800  1.00 0.00 ? 14  GLN A HE22 7  
ATOM 10220 N N    . ALA A 1 15  ? 2.323   -3.067  -2.400  1.00 0.00 ? 15  ALA A N    7  
ATOM 10221 C CA   . ALA A 1 15  ? 1.435   -2.813  -1.234  1.00 0.00 ? 15  ALA A CA   7  
ATOM 10222 C C    . ALA A 1 15  ? 0.480   -3.991  -0.994  1.00 0.00 ? 15  ALA A C    7  
ATOM 10223 O O    . ALA A 1 15  ? 0.361   -4.471  0.115   1.00 0.00 ? 15  ALA A O    7  
ATOM 10224 C CB   . ALA A 1 15  ? 0.616   -1.550  -1.504  1.00 0.00 ? 15  ALA A CB   7  
ATOM 10225 H H    . ALA A 1 15  ? 2.276   -2.476  -3.177  1.00 0.00 ? 15  ALA A H    7  
ATOM 10226 H HA   . ALA A 1 15  ? 2.039   -2.659  -0.353  1.00 0.00 ? 15  ALA A HA   7  
ATOM 10227 H HB1  . ALA A 1 15  ? 0.299   -1.117  -0.568  1.00 0.00 ? 15  ALA A HB1  7  
ATOM 10228 H HB2  . ALA A 1 15  ? -0.253  -1.803  -2.096  1.00 0.00 ? 15  ALA A HB2  7  
ATOM 10229 H HB3  . ALA A 1 15  ? 1.223   -0.838  -2.044  1.00 0.00 ? 15  ALA A HB3  7  
ATOM 10230 N N    . ILE A 1 16  ? -0.229  -4.453  -1.998  1.00 0.00 ? 16  ILE A N    7  
ATOM 10231 C CA   . ILE A 1 16  ? -1.184  -5.580  -1.741  1.00 0.00 ? 16  ILE A CA   7  
ATOM 10232 C C    . ILE A 1 16  ? -0.488  -6.941  -1.823  1.00 0.00 ? 16  ILE A C    7  
ATOM 10233 O O    . ILE A 1 16  ? -0.863  -7.867  -1.131  1.00 0.00 ? 16  ILE A O    7  
ATOM 10234 C CB   . ILE A 1 16  ? -2.360  -5.547  -2.719  1.00 0.00 ? 16  ILE A CB   7  
ATOM 10235 C CG1  . ILE A 1 16  ? -1.938  -5.008  -4.084  1.00 0.00 ? 16  ILE A CG1  7  
ATOM 10236 C CG2  . ILE A 1 16  ? -3.457  -4.644  -2.155  1.00 0.00 ? 16  ILE A CG2  7  
ATOM 10237 C CD1  . ILE A 1 16  ? -0.832  -5.864  -4.691  1.00 0.00 ? 16  ILE A CD1  7  
ATOM 10238 H H    . ILE A 1 16  ? -0.153  -4.050  -2.893  1.00 0.00 ? 16  ILE A H    7  
ATOM 10239 H HA   . ILE A 1 16  ? -1.575  -5.463  -0.740  1.00 0.00 ? 16  ILE A HA   7  
ATOM 10240 H HB   . ILE A 1 16  ? -2.750  -6.548  -2.833  1.00 0.00 ? 16  ILE A HB   7  
ATOM 10241 H HG12 . ILE A 1 16  ? -2.785  -5.039  -4.728  1.00 0.00 ? 16  ILE A HG12 7  
ATOM 10242 H HG13 . ILE A 1 16  ? -1.602  -3.990  -3.992  1.00 0.00 ? 16  ILE A HG13 7  
ATOM 10243 H HG21 . ILE A 1 16  ? -4.303  -4.643  -2.827  1.00 0.00 ? 16  ILE A HG21 7  
ATOM 10244 H HG22 . ILE A 1 16  ? -3.077  -3.639  -2.055  1.00 0.00 ? 16  ILE A HG22 7  
ATOM 10245 H HG23 . ILE A 1 16  ? -3.764  -5.012  -1.188  1.00 0.00 ? 16  ILE A HG23 7  
ATOM 10246 H HD11 . ILE A 1 16  ? -0.848  -6.844  -4.241  1.00 0.00 ? 16  ILE A HD11 7  
ATOM 10247 H HD12 . ILE A 1 16  ? 0.122   -5.396  -4.516  1.00 0.00 ? 16  ILE A HD12 7  
ATOM 10248 H HD13 . ILE A 1 16  ? -0.994  -5.955  -5.755  1.00 0.00 ? 16  ILE A HD13 7  
ATOM 10249 N N    . SER A 1 17  ? 0.526   -7.084  -2.626  1.00 0.00 ? 17  SER A N    7  
ATOM 10250 C CA   . SER A 1 17  ? 1.219   -8.399  -2.684  1.00 0.00 ? 17  SER A CA   7  
ATOM 10251 C C    . SER A 1 17  ? 1.767   -8.664  -1.300  1.00 0.00 ? 17  SER A C    7  
ATOM 10252 O O    . SER A 1 17  ? 1.945   -9.789  -0.876  1.00 0.00 ? 17  SER A O    7  
ATOM 10253 C CB   . SER A 1 17  ? 2.372   -8.341  -3.679  1.00 0.00 ? 17  SER A CB   7  
ATOM 10254 O OG   . SER A 1 17  ? 2.812   -9.660  -3.969  1.00 0.00 ? 17  SER A OG   7  
ATOM 10255 H H    . SER A 1 17  ? 0.842   -6.335  -3.163  1.00 0.00 ? 17  SER A H    7  
ATOM 10256 H HA   . SER A 1 17  ? 0.522   -9.175  -2.964  1.00 0.00 ? 17  SER A HA   7  
ATOM 10257 H HB2  . SER A 1 17  ? 2.037   -7.871  -4.581  1.00 0.00 ? 17  SER A HB2  7  
ATOM 10258 H HB3  . SER A 1 17  ? 3.184   -7.764  -3.255  1.00 0.00 ? 17  SER A HB3  7  
ATOM 10259 H HG   . SER A 1 17  ? 2.078   -10.260 -3.814  1.00 0.00 ? 17  SER A HG   7  
ATOM 10260 N N    . SER A 1 18  ? 2.021   -7.609  -0.594  1.00 0.00 ? 18  SER A N    7  
ATOM 10261 C CA   . SER A 1 18  ? 2.551   -7.739  0.786   1.00 0.00 ? 18  SER A CA   7  
ATOM 10262 C C    . SER A 1 18  ? 1.396   -7.598  1.779   1.00 0.00 ? 18  SER A C    7  
ATOM 10263 O O    . SER A 1 18  ? 1.520   -7.940  2.939   1.00 0.00 ? 18  SER A O    7  
ATOM 10264 C CB   . SER A 1 18  ? 3.586   -6.644  1.040   1.00 0.00 ? 18  SER A CB   7  
ATOM 10265 O OG   . SER A 1 18  ? 3.749   -6.466  2.441   1.00 0.00 ? 18  SER A OG   7  
ATOM 10266 H H    . SER A 1 18  ? 1.851   -6.719  -0.982  1.00 0.00 ? 18  SER A H    7  
ATOM 10267 H HA   . SER A 1 18  ? 3.014   -8.707  0.905   1.00 0.00 ? 18  SER A HA   7  
ATOM 10268 H HB2  . SER A 1 18  ? 4.529   -6.929  0.607   1.00 0.00 ? 18  SER A HB2  7  
ATOM 10269 H HB3  . SER A 1 18  ? 3.249   -5.722  0.584   1.00 0.00 ? 18  SER A HB3  7  
ATOM 10270 H HG   . SER A 1 18  ? 4.526   -6.960  2.714   1.00 0.00 ? 18  SER A HG   7  
ATOM 10271 N N    . ALA A 1 19  ? 0.269   -7.099  1.338   1.00 0.00 ? 19  ALA A N    7  
ATOM 10272 C CA   . ALA A 1 19  ? -0.883  -6.946  2.270   1.00 0.00 ? 19  ALA A CA   7  
ATOM 10273 C C    . ALA A 1 19  ? -1.299  -8.327  2.783   1.00 0.00 ? 19  ALA A C    7  
ATOM 10274 O O    . ALA A 1 19  ? -0.884  -9.342  2.258   1.00 0.00 ? 19  ALA A O    7  
ATOM 10275 C CB   . ALA A 1 19  ? -2.056  -6.300  1.532   1.00 0.00 ? 19  ALA A CB   7  
ATOM 10276 H H    . ALA A 1 19  ? 0.179   -6.826  0.394   1.00 0.00 ? 19  ALA A H    7  
ATOM 10277 H HA   . ALA A 1 19  ? -0.592  -6.324  3.104   1.00 0.00 ? 19  ALA A HA   7  
ATOM 10278 H HB1  . ALA A 1 19  ? -2.911  -6.247  2.191   1.00 0.00 ? 19  ALA A HB1  7  
ATOM 10279 H HB2  . ALA A 1 19  ? -2.307  -6.894  0.666   1.00 0.00 ? 19  ALA A HB2  7  
ATOM 10280 H HB3  . ALA A 1 19  ? -1.781  -5.304  1.220   1.00 0.00 ? 19  ALA A HB3  7  
ATOM 10281 N N    . GLN A 1 20  ? -2.112  -8.375  3.803   1.00 0.00 ? 20  GLN A N    7  
ATOM 10282 C CA   . GLN A 1 20  ? -2.551  -9.694  4.341   1.00 0.00 ? 20  GLN A CA   7  
ATOM 10283 C C    . GLN A 1 20  ? -2.912  -10.613 3.171   1.00 0.00 ? 20  GLN A C    7  
ATOM 10284 O O    . GLN A 1 20  ? -2.092  -11.364 2.684   1.00 0.00 ? 20  GLN A O    7  
ATOM 10285 C CB   . GLN A 1 20  ? -3.772  -9.499  5.241   1.00 0.00 ? 20  GLN A CB   7  
ATOM 10286 C CG   . GLN A 1 20  ? -3.315  -9.020  6.622   1.00 0.00 ? 20  GLN A CG   7  
ATOM 10287 C CD   . GLN A 1 20  ? -3.953  -7.665  6.932   1.00 0.00 ? 20  GLN A CD   7  
ATOM 10288 O OE1  . GLN A 1 20  ? -3.884  -6.751  6.134   1.00 0.00 ? 20  GLN A OE1  7  
ATOM 10289 N NE2  . GLN A 1 20  ? -4.576  -7.495  8.066   1.00 0.00 ? 20  GLN A NE2  7  
ATOM 10290 H H    . GLN A 1 20  ? -2.435  -7.545  4.213   1.00 0.00 ? 20  GLN A H    7  
ATOM 10291 H HA   . GLN A 1 20  ? -1.747  -10.136 4.911   1.00 0.00 ? 20  GLN A HA   7  
ATOM 10292 H HB2  . GLN A 1 20  ? -4.430  -8.761  4.803   1.00 0.00 ? 20  GLN A HB2  7  
ATOM 10293 H HB3  . GLN A 1 20  ? -4.300  -10.435 5.344   1.00 0.00 ? 20  GLN A HB3  7  
ATOM 10294 H HG2  . GLN A 1 20  ? -3.614  -9.741  7.369   1.00 0.00 ? 20  GLN A HG2  7  
ATOM 10295 H HG3  . GLN A 1 20  ? -2.240  -8.920  6.629   1.00 0.00 ? 20  GLN A HG3  7  
ATOM 10296 H HE21 . GLN A 1 20  ? -4.629  -8.232  8.712   1.00 0.00 ? 20  GLN A HE21 7  
ATOM 10297 H HE22 . GLN A 1 20  ? -4.991  -6.632  8.272   1.00 0.00 ? 20  GLN A HE22 7  
ATOM 10298 N N    . ASP A 1 21  ? -4.130  -10.549 2.707   1.00 0.00 ? 21  ASP A N    7  
ATOM 10299 C CA   . ASP A 1 21  ? -4.530  -11.409 1.559   1.00 0.00 ? 21  ASP A CA   7  
ATOM 10300 C C    . ASP A 1 21  ? -3.958  -10.813 0.273   1.00 0.00 ? 21  ASP A C    7  
ATOM 10301 O O    . ASP A 1 21  ? -3.014  -11.325 -0.296  1.00 0.00 ? 21  ASP A O    7  
ATOM 10302 C CB   . ASP A 1 21  ? -6.060  -11.461 1.462   1.00 0.00 ? 21  ASP A CB   7  
ATOM 10303 C CG   . ASP A 1 21  ? -6.476  -12.610 0.542   1.00 0.00 ? 21  ASP A CG   7  
ATOM 10304 O OD1  . ASP A 1 21  ? -6.618  -13.717 1.035   1.00 0.00 ? 21  ASP A OD1  7  
ATOM 10305 O OD2  . ASP A 1 21  ? -6.646  -12.363 -0.641  1.00 0.00 ? 21  ASP A OD2  7  
ATOM 10306 H H    . ASP A 1 21  ? -4.775  -9.929  3.105   1.00 0.00 ? 21  ASP A H    7  
ATOM 10307 H HA   . ASP A 1 21  ? -4.143  -12.407 1.701   1.00 0.00 ? 21  ASP A HA   7  
ATOM 10308 H HB2  . ASP A 1 21  ? -6.477  -11.617 2.446   1.00 0.00 ? 21  ASP A HB2  7  
ATOM 10309 H HB3  . ASP A 1 21  ? -6.430  -10.530 1.061   1.00 0.00 ? 21  ASP A HB3  7  
ATOM 10310 N N    . ARG A 1 22  ? -4.522  -9.731  -0.183  1.00 0.00 ? 22  ARG A N    7  
ATOM 10311 C CA   . ARG A 1 22  ? -4.021  -9.084  -1.425  1.00 0.00 ? 22  ARG A CA   7  
ATOM 10312 C C    . ARG A 1 22  ? -4.881  -7.856  -1.726  1.00 0.00 ? 22  ARG A C    7  
ATOM 10313 O O    . ARG A 1 22  ? -5.079  -7.493  -2.868  1.00 0.00 ? 22  ARG A O    7  
ATOM 10314 C CB   . ARG A 1 22  ? -4.119  -10.069 -2.592  1.00 0.00 ? 22  ARG A CB   7  
ATOM 10315 C CG   . ARG A 1 22  ? -2.770  -10.759 -2.796  1.00 0.00 ? 22  ARG A CG   7  
ATOM 10316 C CD   . ARG A 1 22  ? -2.970  -12.275 -2.806  1.00 0.00 ? 22  ARG A CD   7  
ATOM 10317 N NE   . ARG A 1 22  ? -1.858  -12.926 -2.061  1.00 0.00 ? 22  ARG A NE   7  
ATOM 10318 C CZ   . ARG A 1 22  ? -0.623  -12.728 -2.429  1.00 0.00 ? 22  ARG A CZ   7  
ATOM 10319 N NH1  . ARG A 1 22  ? -0.195  -13.209 -3.563  1.00 0.00 ? 22  ARG A NH1  7  
ATOM 10320 N NH2  . ARG A 1 22  ? 0.184   -12.045 -1.664  1.00 0.00 ? 22  ARG A NH2  7  
ATOM 10321 H H    . ARG A 1 22  ? -5.277  -9.339  0.298   1.00 0.00 ? 22  ARG A H    7  
ATOM 10322 H HA   . ARG A 1 22  ? -2.992  -8.783  -1.289  1.00 0.00 ? 22  ARG A HA   7  
ATOM 10323 H HB2  . ARG A 1 22  ? -4.875  -10.810 -2.374  1.00 0.00 ? 22  ARG A HB2  7  
ATOM 10324 H HB3  . ARG A 1 22  ? -4.388  -9.535  -3.491  1.00 0.00 ? 22  ARG A HB3  7  
ATOM 10325 H HG2  . ARG A 1 22  ? -2.345  -10.444 -3.739  1.00 0.00 ? 22  ARG A HG2  7  
ATOM 10326 H HG3  . ARG A 1 22  ? -2.101  -10.491 -1.992  1.00 0.00 ? 22  ARG A HG3  7  
ATOM 10327 H HD2  . ARG A 1 22  ? -3.910  -12.516 -2.331  1.00 0.00 ? 22  ARG A HD2  7  
ATOM 10328 H HD3  . ARG A 1 22  ? -2.980  -12.631 -3.825  1.00 0.00 ? 22  ARG A HD3  7  
ATOM 10329 H HE   . ARG A 1 22  ? -2.054  -13.505 -1.295  1.00 0.00 ? 22  ARG A HE   7  
ATOM 10330 H HH11 . ARG A 1 22  ? -0.814  -13.732 -4.150  1.00 0.00 ? 22  ARG A HH11 7  
ATOM 10331 H HH12 . ARG A 1 22  ? 0.752   -13.057 -3.845  1.00 0.00 ? 22  ARG A HH12 7  
ATOM 10332 H HH21 . ARG A 1 22  ? -0.144  -11.675 -0.795  1.00 0.00 ? 22  ARG A HH21 7  
ATOM 10333 H HH22 . ARG A 1 22  ? 1.131   -11.893 -1.947  1.00 0.00 ? 22  ARG A HH22 7  
ATOM 10334 N N    . GLN A 1 23  ? -5.406  -7.220  -0.712  1.00 0.00 ? 23  GLN A N    7  
ATOM 10335 C CA   . GLN A 1 23  ? -6.266  -6.030  -0.952  1.00 0.00 ? 23  GLN A CA   7  
ATOM 10336 C C    . GLN A 1 23  ? -5.901  -4.909  0.022   1.00 0.00 ? 23  GLN A C    7  
ATOM 10337 O O    . GLN A 1 23  ? -5.700  -5.133  1.199   1.00 0.00 ? 23  GLN A O    7  
ATOM 10338 C CB   . GLN A 1 23  ? -7.732  -6.415  -0.747  1.00 0.00 ? 23  GLN A CB   7  
ATOM 10339 C CG   . GLN A 1 23  ? -7.836  -7.461  0.364   1.00 0.00 ? 23  GLN A CG   7  
ATOM 10340 C CD   . GLN A 1 23  ? -9.161  -7.285  1.106   1.00 0.00 ? 23  GLN A CD   7  
ATOM 10341 O OE1  . GLN A 1 23  ? -10.165 -6.953  0.508   1.00 0.00 ? 23  GLN A OE1  7  
ATOM 10342 N NE2  . GLN A 1 23  ? -9.208  -7.494  2.394   1.00 0.00 ? 23  GLN A NE2  7  
ATOM 10343 H H    . GLN A 1 23  ? -5.243  -7.529  0.202   1.00 0.00 ? 23  GLN A H    7  
ATOM 10344 H HA   . GLN A 1 23  ? -6.126  -5.687  -1.964  1.00 0.00 ? 23  GLN A HA   7  
ATOM 10345 H HB2  . GLN A 1 23  ? -8.298  -5.537  -0.470  1.00 0.00 ? 23  GLN A HB2  7  
ATOM 10346 H HB3  . GLN A 1 23  ? -8.128  -6.825  -1.662  1.00 0.00 ? 23  GLN A HB3  7  
ATOM 10347 H HG2  . GLN A 1 23  ? -7.792  -8.450  -0.068  1.00 0.00 ? 23  GLN A HG2  7  
ATOM 10348 H HG3  . GLN A 1 23  ? -7.018  -7.333  1.057   1.00 0.00 ? 23  GLN A HG3  7  
ATOM 10349 H HE21 . GLN A 1 23  ? -8.398  -7.761  2.876   1.00 0.00 ? 23  GLN A HE21 7  
ATOM 10350 H HE22 . GLN A 1 23  ? -10.054 -7.386  2.877   1.00 0.00 ? 23  GLN A HE22 7  
ATOM 10351 N N    . LEU A 1 24  ? -5.829  -3.701  -0.463  1.00 0.00 ? 24  LEU A N    7  
ATOM 10352 C CA   . LEU A 1 24  ? -5.496  -2.555  0.419   1.00 0.00 ? 24  LEU A CA   7  
ATOM 10353 C C    . LEU A 1 24  ? -6.588  -1.496  0.286   1.00 0.00 ? 24  LEU A C    7  
ATOM 10354 O O    . LEU A 1 24  ? -7.208  -1.361  -0.750  1.00 0.00 ? 24  LEU A O    7  
ATOM 10355 C CB   . LEU A 1 24  ? -4.162  -1.950  -0.014  1.00 0.00 ? 24  LEU A CB   7  
ATOM 10356 C CG   . LEU A 1 24  ? -3.008  -2.791  0.535   1.00 0.00 ? 24  LEU A CG   7  
ATOM 10357 C CD1  . LEU A 1 24  ? -1.679  -2.215  0.044   1.00 0.00 ? 24  LEU A CD1  7  
ATOM 10358 C CD2  . LEU A 1 24  ? -3.040  -2.762  2.064   1.00 0.00 ? 24  LEU A CD2  7  
ATOM 10359 H H    . LEU A 1 24  ? -6.003  -3.544  -1.412  1.00 0.00 ? 24  LEU A H    7  
ATOM 10360 H HA   . LEU A 1 24  ? -5.431  -2.888  1.445   1.00 0.00 ? 24  LEU A HA   7  
ATOM 10361 H HB2  . LEU A 1 24  ? -4.109  -1.923  -1.095  1.00 0.00 ? 24  LEU A HB2  7  
ATOM 10362 H HB3  . LEU A 1 24  ? -4.086  -0.948  0.368   1.00 0.00 ? 24  LEU A HB3  7  
ATOM 10363 H HG   . LEU A 1 24  ? -3.110  -3.809  0.188   1.00 0.00 ? 24  LEU A HG   7  
ATOM 10364 H HD11 . LEU A 1 24  ? -0.902  -2.445  0.757   1.00 0.00 ? 24  LEU A HD11 7  
ATOM 10365 H HD12 . LEU A 1 24  ? -1.767  -1.144  -0.061  1.00 0.00 ? 24  LEU A HD12 7  
ATOM 10366 H HD13 . LEU A 1 24  ? -1.430  -2.651  -0.912  1.00 0.00 ? 24  LEU A HD13 7  
ATOM 10367 H HD21 . LEU A 1 24  ? -3.532  -1.862  2.399   1.00 0.00 ? 24  LEU A HD21 7  
ATOM 10368 H HD22 . LEU A 1 24  ? -2.030  -2.783  2.445   1.00 0.00 ? 24  LEU A HD22 7  
ATOM 10369 H HD23 . LEU A 1 24  ? -3.580  -3.624  2.429   1.00 0.00 ? 24  LEU A HD23 7  
ATOM 10370 N N    . THR A 1 25  ? -6.820  -0.730  1.313   1.00 0.00 ? 25  THR A N    7  
ATOM 10371 C CA   . THR A 1 25  ? -7.860  0.327   1.216   1.00 0.00 ? 25  THR A CA   7  
ATOM 10372 C C    . THR A 1 25  ? -7.260  1.508   0.458   1.00 0.00 ? 25  THR A C    7  
ATOM 10373 O O    . THR A 1 25  ? -6.095  1.498   0.113   1.00 0.00 ? 25  THR A O    7  
ATOM 10374 C CB   . THR A 1 25  ? -8.279  0.772   2.621   1.00 0.00 ? 25  THR A CB   7  
ATOM 10375 O OG1  . THR A 1 25  ? -7.191  0.593   3.517   1.00 0.00 ? 25  THR A OG1  7  
ATOM 10376 C CG2  . THR A 1 25  ? -9.473  -0.062  3.090   1.00 0.00 ? 25  THR A CG2  7  
ATOM 10377 H H    . THR A 1 25  ? -6.304  -0.841  2.138   1.00 0.00 ? 25  THR A H    7  
ATOM 10378 H HA   . THR A 1 25  ? -8.718  -0.052  0.679   1.00 0.00 ? 25  THR A HA   7  
ATOM 10379 H HB   . THR A 1 25  ? -8.560  1.814   2.601   1.00 0.00 ? 25  THR A HB   7  
ATOM 10380 H HG1  . THR A 1 25  ? -7.545  0.549   4.409   1.00 0.00 ? 25  THR A HG1  7  
ATOM 10381 H HG21 . THR A 1 25  ? -9.120  -0.905  3.664   1.00 0.00 ? 25  THR A HG21 7  
ATOM 10382 H HG22 . THR A 1 25  ? -10.023 -0.417  2.230   1.00 0.00 ? 25  THR A HG22 7  
ATOM 10383 H HG23 . THR A 1 25  ? -10.120 0.547   3.703   1.00 0.00 ? 25  THR A HG23 7  
ATOM 10384 N N    . LEU A 1 26  ? -8.026  2.521   0.185   1.00 0.00 ? 26  LEU A N    7  
ATOM 10385 C CA   . LEU A 1 26  ? -7.456  3.680   -0.553  1.00 0.00 ? 26  LEU A CA   7  
ATOM 10386 C C    . LEU A 1 26  ? -6.262  4.227   0.233   1.00 0.00 ? 26  LEU A C    7  
ATOM 10387 O O    . LEU A 1 26  ? -5.225  4.530   -0.324  1.00 0.00 ? 26  LEU A O    7  
ATOM 10388 C CB   . LEU A 1 26  ? -8.514  4.774   -0.710  1.00 0.00 ? 26  LEU A CB   7  
ATOM 10389 C CG   . LEU A 1 26  ? -8.204  5.597   -1.961  1.00 0.00 ? 26  LEU A CG   7  
ATOM 10390 C CD1  . LEU A 1 26  ? -9.437  6.412   -2.353  1.00 0.00 ? 26  LEU A CD1  7  
ATOM 10391 C CD2  . LEU A 1 26  ? -7.041  6.546   -1.670  1.00 0.00 ? 26  LEU A CD2  7  
ATOM 10392 H H    . LEU A 1 26  ? -8.966  2.521   0.463   1.00 0.00 ? 26  LEU A H    7  
ATOM 10393 H HA   . LEU A 1 26  ? -7.125  3.355   -1.529  1.00 0.00 ? 26  LEU A HA   7  
ATOM 10394 H HB2  . LEU A 1 26  ? -9.491  4.322   -0.809  1.00 0.00 ? 26  LEU A HB2  7  
ATOM 10395 H HB3  . LEU A 1 26  ? -8.499  5.418   0.155   1.00 0.00 ? 26  LEU A HB3  7  
ATOM 10396 H HG   . LEU A 1 26  ? -7.938  4.932   -2.772  1.00 0.00 ? 26  LEU A HG   7  
ATOM 10397 H HD11 . LEU A 1 26  ? -10.328 5.842   -2.137  1.00 0.00 ? 26  LEU A HD11 7  
ATOM 10398 H HD12 . LEU A 1 26  ? -9.399  6.635   -3.409  1.00 0.00 ? 26  LEU A HD12 7  
ATOM 10399 H HD13 . LEU A 1 26  ? -9.454  7.333   -1.790  1.00 0.00 ? 26  LEU A HD13 7  
ATOM 10400 H HD21 . LEU A 1 26  ? -6.123  5.982   -1.607  1.00 0.00 ? 26  LEU A HD21 7  
ATOM 10401 H HD22 . LEU A 1 26  ? -7.217  7.054   -0.734  1.00 0.00 ? 26  LEU A HD22 7  
ATOM 10402 H HD23 . LEU A 1 26  ? -6.963  7.274   -2.465  1.00 0.00 ? 26  LEU A HD23 7  
ATOM 10403 N N    . SER A 1 27  ? -6.402  4.352   1.525   1.00 0.00 ? 27  SER A N    7  
ATOM 10404 C CA   . SER A 1 27  ? -5.278  4.875   2.353   1.00 0.00 ? 27  SER A CA   7  
ATOM 10405 C C    . SER A 1 27  ? -4.533  3.714   3.013   1.00 0.00 ? 27  SER A C    7  
ATOM 10406 O O    . SER A 1 27  ? -3.999  3.844   4.096   1.00 0.00 ? 27  SER A O    7  
ATOM 10407 C CB   . SER A 1 27  ? -5.834  5.788   3.438   1.00 0.00 ? 27  SER A CB   7  
ATOM 10408 O OG   . SER A 1 27  ? -6.641  6.793   2.841   1.00 0.00 ? 27  SER A OG   7  
ATOM 10409 H H    . SER A 1 27  ? -7.247  4.099   1.951   1.00 0.00 ? 27  SER A H    7  
ATOM 10410 H HA   . SER A 1 27  ? -4.599  5.431   1.727   1.00 0.00 ? 27  SER A HA   7  
ATOM 10411 H HB2  . SER A 1 27  ? -6.434  5.209   4.120   1.00 0.00 ? 27  SER A HB2  7  
ATOM 10412 H HB3  . SER A 1 27  ? -5.014  6.239   3.979   1.00 0.00 ? 27  SER A HB3  7  
ATOM 10413 H HG   . SER A 1 27  ? -7.383  6.362   2.412   1.00 0.00 ? 27  SER A HG   7  
ATOM 10414 N N    . GLY A 1 28  ? -4.482  2.582   2.371   1.00 0.00 ? 28  GLY A N    7  
ATOM 10415 C CA   . GLY A 1 28  ? -3.759  1.421   2.966   1.00 0.00 ? 28  GLY A CA   7  
ATOM 10416 C C    . GLY A 1 28  ? -2.396  1.323   2.301   1.00 0.00 ? 28  GLY A C    7  
ATOM 10417 O O    . GLY A 1 28  ? -1.381  1.115   2.934   1.00 0.00 ? 28  GLY A O    7  
ATOM 10418 H H    . GLY A 1 28  ? -4.901  2.500   1.487   1.00 0.00 ? 28  GLY A H    7  
ATOM 10419 H HA2  . GLY A 1 28  ? -3.636  1.573   4.028   1.00 0.00 ? 28  GLY A HA2  7  
ATOM 10420 H HA3  . GLY A 1 28  ? -4.317  0.513   2.790   1.00 0.00 ? 28  GLY A HA3  7  
ATOM 10421 N N    . ILE A 1 29  ? -2.388  1.482   1.016   1.00 0.00 ? 29  ILE A N    7  
ATOM 10422 C CA   . ILE A 1 29  ? -1.130  1.421   0.240   1.00 0.00 ? 29  ILE A CA   7  
ATOM 10423 C C    . ILE A 1 29  ? -0.133  2.433   0.786   1.00 0.00 ? 29  ILE A C    7  
ATOM 10424 O O    . ILE A 1 29  ? 1.067   2.249   0.727   1.00 0.00 ? 29  ILE A O    7  
ATOM 10425 C CB   . ILE A 1 29  ? -1.475  1.776   -1.191  1.00 0.00 ? 29  ILE A CB   7  
ATOM 10426 C CG1  . ILE A 1 29  ? -0.248  1.653   -2.073  1.00 0.00 ? 29  ILE A CG1  7  
ATOM 10427 C CG2  . ILE A 1 29  ? -2.000  3.204   -1.260  1.00 0.00 ? 29  ILE A CG2  7  
ATOM 10428 C CD1  . ILE A 1 29  ? -0.641  2.054   -3.484  1.00 0.00 ? 29  ILE A CD1  7  
ATOM 10429 H H    . ILE A 1 29  ? -3.232  1.653   0.547   1.00 0.00 ? 29  ILE A H    7  
ATOM 10430 H HA   . ILE A 1 29  ? -0.715  0.433   0.279   1.00 0.00 ? 29  ILE A HA   7  
ATOM 10431 H HB   . ILE A 1 29  ? -2.235  1.111   -1.539  1.00 0.00 ? 29  ILE A HB   7  
ATOM 10432 H HG12 . ILE A 1 29  ? 0.530   2.308   -1.708  1.00 0.00 ? 29  ILE A HG12 7  
ATOM 10433 H HG13 . ILE A 1 29  ? 0.102   0.636   -2.072  1.00 0.00 ? 29  ILE A HG13 7  
ATOM 10434 H HG21 . ILE A 1 29  ? -2.837  3.242   -1.939  1.00 0.00 ? 29  ILE A HG21 7  
ATOM 10435 H HG22 . ILE A 1 29  ? -1.216  3.854   -1.617  1.00 0.00 ? 29  ILE A HG22 7  
ATOM 10436 H HG23 . ILE A 1 29  ? -2.317  3.524   -0.283  1.00 0.00 ? 29  ILE A HG23 7  
ATOM 10437 H HD11 . ILE A 1 29  ? 0.157   2.623   -3.924  1.00 0.00 ? 29  ILE A HD11 7  
ATOM 10438 H HD12 . ILE A 1 29  ? -1.540  2.655   -3.450  1.00 0.00 ? 29  ILE A HD12 7  
ATOM 10439 H HD13 . ILE A 1 29  ? -0.824  1.168   -4.071  1.00 0.00 ? 29  ILE A HD13 7  
ATOM 10440 N N    . TYR A 1 30  ? -0.634  3.504   1.306   1.00 0.00 ? 30  TYR A N    7  
ATOM 10441 C CA   . TYR A 1 30  ? 0.249   4.566   1.856   1.00 0.00 ? 30  TYR A CA   7  
ATOM 10442 C C    . TYR A 1 30  ? 0.902   4.085   3.150   1.00 0.00 ? 30  TYR A C    7  
ATOM 10443 O O    . TYR A 1 30  ? 2.100   4.183   3.324   1.00 0.00 ? 30  TYR A O    7  
ATOM 10444 C CB   . TYR A 1 30  ? -0.595  5.807   2.114   1.00 0.00 ? 30  TYR A CB   7  
ATOM 10445 C CG   . TYR A 1 30  ? -1.396  6.088   0.869   1.00 0.00 ? 30  TYR A CG   7  
ATOM 10446 C CD1  . TYR A 1 30  ? -0.820  5.879   -0.388  1.00 0.00 ? 30  TYR A CD1  7  
ATOM 10447 C CD2  . TYR A 1 30  ? -2.713  6.540   0.966   1.00 0.00 ? 30  TYR A CD2  7  
ATOM 10448 C CE1  . TYR A 1 30  ? -1.557  6.126   -1.550  1.00 0.00 ? 30  TYR A CE1  7  
ATOM 10449 C CE2  . TYR A 1 30  ? -3.453  6.787   -0.194  1.00 0.00 ? 30  TYR A CE2  7  
ATOM 10450 C CZ   . TYR A 1 30  ? -2.876  6.581   -1.453  1.00 0.00 ? 30  TYR A CZ   7  
ATOM 10451 O OH   . TYR A 1 30  ? -3.608  6.824   -2.597  1.00 0.00 ? 30  TYR A OH   7  
ATOM 10452 H H    . TYR A 1 30  ? -1.606  3.615   1.324   1.00 0.00 ? 30  TYR A H    7  
ATOM 10453 H HA   . TYR A 1 30  ? 1.013   4.801   1.138   1.00 0.00 ? 30  TYR A HA   7  
ATOM 10454 H HB2  . TYR A 1 30  ? -1.261  5.628   2.947   1.00 0.00 ? 30  TYR A HB2  7  
ATOM 10455 H HB3  . TYR A 1 30  ? 0.046   6.646   2.332   1.00 0.00 ? 30  TYR A HB3  7  
ATOM 10456 H HD1  . TYR A 1 30  ? 0.196   5.524   -0.463  1.00 0.00 ? 30  TYR A HD1  7  
ATOM 10457 H HD2  . TYR A 1 30  ? -3.157  6.700   1.936   1.00 0.00 ? 30  TYR A HD2  7  
ATOM 10458 H HE1  . TYR A 1 30  ? -1.109  5.960   -2.518  1.00 0.00 ? 30  TYR A HE1  7  
ATOM 10459 H HE2  . TYR A 1 30  ? -4.472  7.133   -0.119  1.00 0.00 ? 30  TYR A HE2  7  
ATOM 10460 H HH   . TYR A 1 30  ? -4.358  7.375   -2.357  1.00 0.00 ? 30  TYR A HH   7  
ATOM 10461 N N    . ALA A 1 31  ? 0.130   3.558   4.053   1.00 0.00 ? 31  ALA A N    7  
ATOM 10462 C CA   . ALA A 1 31  ? 0.718   3.064   5.327   1.00 0.00 ? 31  ALA A CA   7  
ATOM 10463 C C    . ALA A 1 31  ? 1.499   1.775   5.053   1.00 0.00 ? 31  ALA A C    7  
ATOM 10464 O O    . ALA A 1 31  ? 2.286   1.333   5.865   1.00 0.00 ? 31  ALA A O    7  
ATOM 10465 C CB   . ALA A 1 31  ? -0.404  2.784   6.330   1.00 0.00 ? 31  ALA A CB   7  
ATOM 10466 H H    . ALA A 1 31  ? -0.833  3.482   3.893   1.00 0.00 ? 31  ALA A H    7  
ATOM 10467 H HA   . ALA A 1 31  ? 1.385   3.811   5.730   1.00 0.00 ? 31  ALA A HA   7  
ATOM 10468 H HB1  . ALA A 1 31  ? -1.355  3.035   5.886   1.00 0.00 ? 31  ALA A HB1  7  
ATOM 10469 H HB2  . ALA A 1 31  ? -0.252  3.381   7.216   1.00 0.00 ? 31  ALA A HB2  7  
ATOM 10470 H HB3  . ALA A 1 31  ? -0.396  1.736   6.596   1.00 0.00 ? 31  ALA A HB3  7  
ATOM 10471 N N    . HIS A 1 32  ? 1.280   1.163   3.917   1.00 0.00 ? 32  HIS A N    7  
ATOM 10472 C CA   . HIS A 1 32  ? 2.002   -0.100  3.596   1.00 0.00 ? 32  HIS A CA   7  
ATOM 10473 C C    . HIS A 1 32  ? 3.435   0.203   3.144   1.00 0.00 ? 32  HIS A C    7  
ATOM 10474 O O    . HIS A 1 32  ? 4.392   -0.126  3.816   1.00 0.00 ? 32  HIS A O    7  
ATOM 10475 C CB   . HIS A 1 32  ? 1.265   -0.831  2.476   1.00 0.00 ? 32  HIS A CB   7  
ATOM 10476 C CG   . HIS A 1 32  ? 1.943   -2.145  2.213   1.00 0.00 ? 32  HIS A CG   7  
ATOM 10477 N ND1  . HIS A 1 32  ? 1.310   -3.358  2.428   1.00 0.00 ? 32  HIS A ND1  7  
ATOM 10478 C CD2  . HIS A 1 32  ? 3.201   -2.451  1.760   1.00 0.00 ? 32  HIS A CD2  7  
ATOM 10479 C CE1  . HIS A 1 32  ? 2.182   -4.330  2.107   1.00 0.00 ? 32  HIS A CE1  7  
ATOM 10480 N NE2  . HIS A 1 32  ? 3.351   -3.832  1.695   1.00 0.00 ? 32  HIS A NE2  7  
ATOM 10481 H H    . HIS A 1 32  ? 0.638   1.533   3.274   1.00 0.00 ? 32  HIS A H    7  
ATOM 10482 H HA   . HIS A 1 32  ? 2.030   -0.729  4.474   1.00 0.00 ? 32  HIS A HA   7  
ATOM 10483 H HB2  . HIS A 1 32  ? 0.241   -1.006  2.772   1.00 0.00 ? 32  HIS A HB2  7  
ATOM 10484 H HB3  . HIS A 1 32  ? 1.284   -0.231  1.579   1.00 0.00 ? 32  HIS A HB3  7  
ATOM 10485 H HD1  . HIS A 1 32  ? 0.395   -3.486  2.754   1.00 0.00 ? 32  HIS A HD1  7  
ATOM 10486 H HD2  . HIS A 1 32  ? 3.961   -1.732  1.498   1.00 0.00 ? 32  HIS A HD2  7  
ATOM 10487 H HE1  . HIS A 1 32  ? 1.964   -5.383  2.176   1.00 0.00 ? 32  HIS A HE1  7  
ATOM 10488 N N    . ILE A 1 33  ? 3.589   0.808   1.997   1.00 0.00 ? 33  ILE A N    7  
ATOM 10489 C CA   . ILE A 1 33  ? 4.956   1.114   1.485   1.00 0.00 ? 33  ILE A CA   7  
ATOM 10490 C C    . ILE A 1 33  ? 5.693   2.034   2.460   1.00 0.00 ? 33  ILE A C    7  
ATOM 10491 O O    . ILE A 1 33  ? 6.856   1.841   2.744   1.00 0.00 ? 33  ILE A O    7  
ATOM 10492 C CB   . ILE A 1 33  ? 4.847   1.795   0.119   1.00 0.00 ? 33  ILE A CB   7  
ATOM 10493 C CG1  . ILE A 1 33  ? 3.966   3.040   0.232   1.00 0.00 ? 33  ILE A CG1  7  
ATOM 10494 C CG2  . ILE A 1 33  ? 4.223   0.821   -0.882  1.00 0.00 ? 33  ILE A CG2  7  
ATOM 10495 C CD1  . ILE A 1 33  ? 4.849   4.277   0.399   1.00 0.00 ? 33  ILE A CD1  7  
ATOM 10496 H H    . ILE A 1 33  ? 2.803   1.050   1.464   1.00 0.00 ? 33  ILE A H    7  
ATOM 10497 H HA   . ILE A 1 33  ? 5.514   0.194   1.377   1.00 0.00 ? 33  ILE A HA   7  
ATOM 10498 H HB   . ILE A 1 33  ? 5.832   2.078   -0.220  1.00 0.00 ? 33  ILE A HB   7  
ATOM 10499 H HG12 . ILE A 1 33  ? 3.370   3.141   -0.665  1.00 0.00 ? 33  ILE A HG12 7  
ATOM 10500 H HG13 . ILE A 1 33  ? 3.313   2.945   1.087   1.00 0.00 ? 33  ILE A HG13 7  
ATOM 10501 H HG21 . ILE A 1 33  ? 3.285   1.221   -1.235  1.00 0.00 ? 33  ILE A HG21 7  
ATOM 10502 H HG22 . ILE A 1 33  ? 4.051   -0.130  -0.399  1.00 0.00 ? 33  ILE A HG22 7  
ATOM 10503 H HG23 . ILE A 1 33  ? 4.894   0.684   -1.716  1.00 0.00 ? 33  ILE A HG23 7  
ATOM 10504 H HD11 . ILE A 1 33  ? 4.243   5.116   0.705   1.00 0.00 ? 33  ILE A HD11 7  
ATOM 10505 H HD12 . ILE A 1 33  ? 5.330   4.506   -0.541  1.00 0.00 ? 33  ILE A HD12 7  
ATOM 10506 H HD13 . ILE A 1 33  ? 5.602   4.085   1.149   1.00 0.00 ? 33  ILE A HD13 7  
ATOM 10507 N N    . THR A 1 34  ? 5.039   3.033   2.981   1.00 0.00 ? 34  THR A N    7  
ATOM 10508 C CA   . THR A 1 34  ? 5.737   3.948   3.927   1.00 0.00 ? 34  THR A CA   7  
ATOM 10509 C C    . THR A 1 34  ? 6.297   3.129   5.090   1.00 0.00 ? 34  THR A C    7  
ATOM 10510 O O    . THR A 1 34  ? 7.206   3.550   5.779   1.00 0.00 ? 34  THR A O    7  
ATOM 10511 C CB   . THR A 1 34  ? 4.745   4.986   4.460   1.00 0.00 ? 34  THR A CB   7  
ATOM 10512 O OG1  . THR A 1 34  ? 3.708   4.326   5.173   1.00 0.00 ? 34  THR A OG1  7  
ATOM 10513 C CG2  . THR A 1 34  ? 4.144   5.770   3.293   1.00 0.00 ? 34  THR A CG2  7  
ATOM 10514 H H    . THR A 1 34  ? 4.100   3.184   2.749   1.00 0.00 ? 34  THR A H    7  
ATOM 10515 H HA   . THR A 1 34  ? 6.545   4.449   3.415   1.00 0.00 ? 34  THR A HA   7  
ATOM 10516 H HB   . THR A 1 34  ? 5.258   5.668   5.119   1.00 0.00 ? 34  THR A HB   7  
ATOM 10517 H HG1  . THR A 1 34  ? 2.950   4.913   5.204   1.00 0.00 ? 34  THR A HG1  7  
ATOM 10518 H HG21 . THR A 1 34  ? 3.825   5.082   2.524   1.00 0.00 ? 34  THR A HG21 7  
ATOM 10519 H HG22 . THR A 1 34  ? 4.886   6.442   2.890   1.00 0.00 ? 34  THR A HG22 7  
ATOM 10520 H HG23 . THR A 1 34  ? 3.294   6.339   3.641   1.00 0.00 ? 34  THR A HG23 7  
ATOM 10521 N N    . LYS A 1 35  ? 5.767   1.959   5.308   1.00 0.00 ? 35  LYS A N    7  
ATOM 10522 C CA   . LYS A 1 35  ? 6.270   1.106   6.420   1.00 0.00 ? 35  LYS A CA   7  
ATOM 10523 C C    . LYS A 1 35  ? 7.454   0.260   5.936   1.00 0.00 ? 35  LYS A C    7  
ATOM 10524 O O    . LYS A 1 35  ? 8.427   0.080   6.642   1.00 0.00 ? 35  LYS A O    7  
ATOM 10525 C CB   . LYS A 1 35  ? 5.147   0.183   6.899   1.00 0.00 ? 35  LYS A CB   7  
ATOM 10526 C CG   . LYS A 1 35  ? 5.098   0.193   8.428   1.00 0.00 ? 35  LYS A CG   7  
ATOM 10527 C CD   . LYS A 1 35  ? 4.651   -1.182  8.932   1.00 0.00 ? 35  LYS A CD   7  
ATOM 10528 C CE   . LYS A 1 35  ? 4.668   -1.197  10.462  1.00 0.00 ? 35  LYS A CE   7  
ATOM 10529 N NZ   . LYS A 1 35  ? 3.717   -0.173  10.981  1.00 0.00 ? 35  LYS A NZ   7  
ATOM 10530 H H    . LYS A 1 35  ? 5.039   1.638   4.737   1.00 0.00 ? 35  LYS A H    7  
ATOM 10531 H HA   . LYS A 1 35  ? 6.589   1.735   7.237   1.00 0.00 ? 35  LYS A HA   7  
ATOM 10532 H HB2  . LYS A 1 35  ? 4.204   0.531   6.505   1.00 0.00 ? 35  LYS A HB2  7  
ATOM 10533 H HB3  . LYS A 1 35  ? 5.334   -0.822  6.553   1.00 0.00 ? 35  LYS A HB3  7  
ATOM 10534 H HG2  . LYS A 1 35  ? 6.080   0.419   8.818   1.00 0.00 ? 35  LYS A HG2  7  
ATOM 10535 H HG3  . LYS A 1 35  ? 4.396   0.942   8.762   1.00 0.00 ? 35  LYS A HG3  7  
ATOM 10536 H HD2  . LYS A 1 35  ? 3.650   -1.385  8.580   1.00 0.00 ? 35  LYS A HD2  7  
ATOM 10537 H HD3  . LYS A 1 35  ? 5.326   -1.938  8.559   1.00 0.00 ? 35  LYS A HD3  7  
ATOM 10538 H HE2  . LYS A 1 35  ? 4.374   -2.173  10.816  1.00 0.00 ? 35  LYS A HE2  7  
ATOM 10539 H HE3  . LYS A 1 35  ? 5.665   -0.972  10.812  1.00 0.00 ? 35  LYS A HE3  7  
ATOM 10540 H HZ1  . LYS A 1 35  ? 3.666   -0.241  12.017  1.00 0.00 ? 35  LYS A HZ1  7  
ATOM 10541 H HZ2  . LYS A 1 35  ? 2.774   -0.339  10.576  1.00 0.00 ? 35  LYS A HZ2  7  
ATOM 10542 H HZ3  . LYS A 1 35  ? 4.048   0.776   10.715  1.00 0.00 ? 35  LYS A HZ3  7  
ATOM 10543 N N    . HIS A 1 36  ? 7.374   -0.276  4.747   1.00 0.00 ? 36  HIS A N    7  
ATOM 10544 C CA   . HIS A 1 36  ? 8.491   -1.125  4.236   1.00 0.00 ? 36  HIS A CA   7  
ATOM 10545 C C    . HIS A 1 36  ? 9.352   -0.336  3.243   1.00 0.00 ? 36  HIS A C    7  
ATOM 10546 O O    . HIS A 1 36  ? 10.134  -0.904  2.508   1.00 0.00 ? 36  HIS A O    7  
ATOM 10547 C CB   . HIS A 1 36  ? 7.911   -2.356  3.534   1.00 0.00 ? 36  HIS A CB   7  
ATOM 10548 C CG   . HIS A 1 36  ? 7.525   -3.384  4.561   1.00 0.00 ? 36  HIS A CG   7  
ATOM 10549 N ND1  . HIS A 1 36  ? 8.441   -4.281  5.090   1.00 0.00 ? 36  HIS A ND1  7  
ATOM 10550 C CD2  . HIS A 1 36  ? 6.326   -3.672  5.165   1.00 0.00 ? 36  HIS A CD2  7  
ATOM 10551 C CE1  . HIS A 1 36  ? 7.785   -5.056  5.972   1.00 0.00 ? 36  HIS A CE1  7  
ATOM 10552 N NE2  . HIS A 1 36  ? 6.493   -4.728  6.057   1.00 0.00 ? 36  HIS A NE2  7  
ATOM 10553 H H    . HIS A 1 36  ? 6.576   -0.131  4.197   1.00 0.00 ? 36  HIS A H    7  
ATOM 10554 H HA   . HIS A 1 36  ? 9.103   -1.444  5.065   1.00 0.00 ? 36  HIS A HA   7  
ATOM 10555 H HB2  . HIS A 1 36  ? 7.039   -2.069  2.966   1.00 0.00 ? 36  HIS A HB2  7  
ATOM 10556 H HB3  . HIS A 1 36  ? 8.653   -2.773  2.868   1.00 0.00 ? 36  HIS A HB3  7  
ATOM 10557 H HD1  . HIS A 1 36  ? 9.391   -4.340  4.862   1.00 0.00 ? 36  HIS A HD1  7  
ATOM 10558 H HD2  . HIS A 1 36  ? 5.395   -3.158  4.977   1.00 0.00 ? 36  HIS A HD2  7  
ATOM 10559 H HE1  . HIS A 1 36  ? 8.246   -5.849  6.542   1.00 0.00 ? 36  HIS A HE1  7  
ATOM 10560 N N    . TYR A 1 37  ? 9.225   0.962   3.217   1.00 0.00 ? 37  TYR A N    7  
ATOM 10561 C CA   . TYR A 1 37  ? 10.048  1.772   2.272   1.00 0.00 ? 37  TYR A CA   7  
ATOM 10562 C C    . TYR A 1 37  ? 10.608  2.993   3.018   1.00 0.00 ? 37  TYR A C    7  
ATOM 10563 O O    . TYR A 1 37  ? 9.862   3.734   3.624   1.00 0.00 ? 37  TYR A O    7  
ATOM 10564 C CB   . TYR A 1 37  ? 9.171   2.239   1.104   1.00 0.00 ? 37  TYR A CB   7  
ATOM 10565 C CG   . TYR A 1 37  ? 9.759   1.771   -0.202  1.00 0.00 ? 37  TYR A CG   7  
ATOM 10566 C CD1  . TYR A 1 37  ? 10.341  0.503   -0.290  1.00 0.00 ? 37  TYR A CD1  7  
ATOM 10567 C CD2  . TYR A 1 37  ? 9.710   2.599   -1.329  1.00 0.00 ? 37  TYR A CD2  7  
ATOM 10568 C CE1  . TYR A 1 37  ? 10.877  0.062   -1.503  1.00 0.00 ? 37  TYR A CE1  7  
ATOM 10569 C CE2  . TYR A 1 37  ? 10.244  2.158   -2.544  1.00 0.00 ? 37  TYR A CE2  7  
ATOM 10570 C CZ   . TYR A 1 37  ? 10.829  0.888   -2.632  1.00 0.00 ? 37  TYR A CZ   7  
ATOM 10571 O OH   . TYR A 1 37  ? 11.356  0.451   -3.830  1.00 0.00 ? 37  TYR A OH   7  
ATOM 10572 H H    . TYR A 1 37  ? 8.594   1.405   3.823   1.00 0.00 ? 37  TYR A H    7  
ATOM 10573 H HA   . TYR A 1 37  ? 10.856  1.167   1.895   1.00 0.00 ? 37  TYR A HA   7  
ATOM 10574 H HB2  . TYR A 1 37  ? 8.183   1.824   1.210   1.00 0.00 ? 37  TYR A HB2  7  
ATOM 10575 H HB3  . TYR A 1 37  ? 9.112   3.318   1.104   1.00 0.00 ? 37  TYR A HB3  7  
ATOM 10576 H HD1  . TYR A 1 37  ? 10.378  -0.133  0.581   1.00 0.00 ? 37  TYR A HD1  7  
ATOM 10577 H HD2  . TYR A 1 37  ? 9.260   3.579   -1.261  1.00 0.00 ? 37  TYR A HD2  7  
ATOM 10578 H HE1  . TYR A 1 37  ? 11.325  -0.919  -1.567  1.00 0.00 ? 37  TYR A HE1  7  
ATOM 10579 H HE2  . TYR A 1 37  ? 10.205  2.796   -3.414  1.00 0.00 ? 37  TYR A HE2  7  
ATOM 10580 H HH   . TYR A 1 37  ? 12.289  0.267   -3.694  1.00 0.00 ? 37  TYR A HH   7  
ATOM 10581 N N    . PRO A 1 38  ? 11.908  3.162   2.960   1.00 0.00 ? 38  PRO A N    7  
ATOM 10582 C CA   . PRO A 1 38  ? 12.590  4.283   3.637   1.00 0.00 ? 38  PRO A CA   7  
ATOM 10583 C C    . PRO A 1 38  ? 12.429  5.583   2.841   1.00 0.00 ? 38  PRO A C    7  
ATOM 10584 O O    . PRO A 1 38  ? 12.191  6.635   3.400   1.00 0.00 ? 38  PRO A O    7  
ATOM 10585 C CB   . PRO A 1 38  ? 14.057  3.844   3.666   1.00 0.00 ? 38  PRO A CB   7  
ATOM 10586 C CG   . PRO A 1 38  ? 14.225  2.804   2.535   1.00 0.00 ? 38  PRO A CG   7  
ATOM 10587 C CD   . PRO A 1 38  ? 12.818  2.260   2.224   1.00 0.00 ? 38  PRO A CD   7  
ATOM 10588 H HA   . PRO A 1 38  ? 12.222  4.402   4.642   1.00 0.00 ? 38  PRO A HA   7  
ATOM 10589 H HB2  . PRO A 1 38  ? 14.701  4.696   3.493   1.00 0.00 ? 38  PRO A HB2  7  
ATOM 10590 H HB3  . PRO A 1 38  ? 14.289  3.389   4.616   1.00 0.00 ? 38  PRO A HB3  7  
ATOM 10591 H HG2  . PRO A 1 38  ? 14.645  3.278   1.658   1.00 0.00 ? 38  PRO A HG2  7  
ATOM 10592 H HG3  . PRO A 1 38  ? 14.863  1.998   2.863   1.00 0.00 ? 38  PRO A HG3  7  
ATOM 10593 H HD2  . PRO A 1 38  ? 12.622  2.306   1.161   1.00 0.00 ? 38  PRO A HD2  7  
ATOM 10594 H HD3  . PRO A 1 38  ? 12.714  1.249   2.587   1.00 0.00 ? 38  PRO A HD3  7  
ATOM 10595 N N    . TYR A 1 39  ? 12.564  5.524   1.545   1.00 0.00 ? 39  TYR A N    7  
ATOM 10596 C CA   . TYR A 1 39  ? 12.424  6.763   0.727   1.00 0.00 ? 39  TYR A CA   7  
ATOM 10597 C C    . TYR A 1 39  ? 11.032  7.359   0.936   1.00 0.00 ? 39  TYR A C    7  
ATOM 10598 O O    . TYR A 1 39  ? 10.855  8.560   0.938   1.00 0.00 ? 39  TYR A O    7  
ATOM 10599 C CB   . TYR A 1 39  ? 12.617  6.426   -0.753  1.00 0.00 ? 39  TYR A CB   7  
ATOM 10600 C CG   . TYR A 1 39  ? 12.470  7.684   -1.576  1.00 0.00 ? 39  TYR A CG   7  
ATOM 10601 C CD1  . TYR A 1 39  ? 13.527  8.598   -1.653  1.00 0.00 ? 39  TYR A CD1  7  
ATOM 10602 C CD2  . TYR A 1 39  ? 11.275  7.938   -2.260  1.00 0.00 ? 39  TYR A CD2  7  
ATOM 10603 C CE1  . TYR A 1 39  ? 13.391  9.765   -2.414  1.00 0.00 ? 39  TYR A CE1  7  
ATOM 10604 C CE2  . TYR A 1 39  ? 11.138  9.104   -3.022  1.00 0.00 ? 39  TYR A CE2  7  
ATOM 10605 C CZ   . TYR A 1 39  ? 12.196  10.018  -3.098  1.00 0.00 ? 39  TYR A CZ   7  
ATOM 10606 O OH   . TYR A 1 39  ? 12.060  11.168  -3.849  1.00 0.00 ? 39  TYR A OH   7  
ATOM 10607 H H    . TYR A 1 39  ? 12.761  4.668   1.110   1.00 0.00 ? 39  TYR A H    7  
ATOM 10608 H HA   . TYR A 1 39  ? 13.171  7.481   1.032   1.00 0.00 ? 39  TYR A HA   7  
ATOM 10609 H HB2  . TYR A 1 39  ? 13.602  6.009   -0.904  1.00 0.00 ? 39  TYR A HB2  7  
ATOM 10610 H HB3  . TYR A 1 39  ? 11.870  5.709   -1.059  1.00 0.00 ? 39  TYR A HB3  7  
ATOM 10611 H HD1  . TYR A 1 39  ? 14.450  8.403   -1.126  1.00 0.00 ? 39  TYR A HD1  7  
ATOM 10612 H HD2  . TYR A 1 39  ? 10.459  7.232   -2.201  1.00 0.00 ? 39  TYR A HD2  7  
ATOM 10613 H HE1  . TYR A 1 39  ? 14.207  10.470  -2.473  1.00 0.00 ? 39  TYR A HE1  7  
ATOM 10614 H HE2  . TYR A 1 39  ? 10.217  9.299   -3.550  1.00 0.00 ? 39  TYR A HE2  7  
ATOM 10615 H HH   . TYR A 1 39  ? 11.537  11.794  -3.340  1.00 0.00 ? 39  TYR A HH   7  
ATOM 10616 N N    . TYR A 1 40  ? 10.043  6.528   1.113   1.00 0.00 ? 40  TYR A N    7  
ATOM 10617 C CA   . TYR A 1 40  ? 8.664   7.050   1.323   1.00 0.00 ? 40  TYR A CA   7  
ATOM 10618 C C    . TYR A 1 40  ? 8.439   7.290   2.818   1.00 0.00 ? 40  TYR A C    7  
ATOM 10619 O O    . TYR A 1 40  ? 7.610   6.655   3.440   1.00 0.00 ? 40  TYR A O    7  
ATOM 10620 C CB   . TYR A 1 40  ? 7.648   6.028   0.811   1.00 0.00 ? 40  TYR A CB   7  
ATOM 10621 C CG   . TYR A 1 40  ? 7.137   6.455   -0.545  1.00 0.00 ? 40  TYR A CG   7  
ATOM 10622 C CD1  . TYR A 1 40  ? 6.599   7.735   -0.721  1.00 0.00 ? 40  TYR A CD1  7  
ATOM 10623 C CD2  . TYR A 1 40  ? 7.203   5.567   -1.627  1.00 0.00 ? 40  TYR A CD2  7  
ATOM 10624 C CE1  . TYR A 1 40  ? 6.124   8.127   -1.980  1.00 0.00 ? 40  TYR A CE1  7  
ATOM 10625 C CE2  . TYR A 1 40  ? 6.727   5.960   -2.884  1.00 0.00 ? 40  TYR A CE2  7  
ATOM 10626 C CZ   . TYR A 1 40  ? 6.189   7.240   -3.061  1.00 0.00 ? 40  TYR A CZ   7  
ATOM 10627 O OH   . TYR A 1 40  ? 5.720   7.625   -4.300  1.00 0.00 ? 40  TYR A OH   7  
ATOM 10628 H H    . TYR A 1 40  ? 10.206  5.563   1.109   1.00 0.00 ? 40  TYR A H    7  
ATOM 10629 H HA   . TYR A 1 40  ? 8.545   7.980   0.787   1.00 0.00 ? 40  TYR A HA   7  
ATOM 10630 H HB2  . TYR A 1 40  ? 8.120   5.060   0.729   1.00 0.00 ? 40  TYR A HB2  7  
ATOM 10631 H HB3  . TYR A 1 40  ? 6.819   5.967   1.502   1.00 0.00 ? 40  TYR A HB3  7  
ATOM 10632 H HD1  . TYR A 1 40  ? 6.548   8.420   0.112   1.00 0.00 ? 40  TYR A HD1  7  
ATOM 10633 H HD2  . TYR A 1 40  ? 7.618   4.580   -1.491  1.00 0.00 ? 40  TYR A HD2  7  
ATOM 10634 H HE1  . TYR A 1 40  ? 5.708   9.115   -2.116  1.00 0.00 ? 40  TYR A HE1  7  
ATOM 10635 H HE2  . TYR A 1 40  ? 6.777   5.276   -3.718  1.00 0.00 ? 40  TYR A HE2  7  
ATOM 10636 H HH   . TYR A 1 40  ? 5.314   8.490   -4.209  1.00 0.00 ? 40  TYR A HH   7  
ATOM 10637 N N    . ARG A 1 41  ? 9.173   8.199   3.402   1.00 0.00 ? 41  ARG A N    7  
ATOM 10638 C CA   . ARG A 1 41  ? 9.000   8.473   4.856   1.00 0.00 ? 41  ARG A CA   7  
ATOM 10639 C C    . ARG A 1 41  ? 9.024   9.982   5.105   1.00 0.00 ? 41  ARG A C    7  
ATOM 10640 O O    . ARG A 1 41  ? 9.059   10.433  6.232   1.00 0.00 ? 41  ARG A O    7  
ATOM 10641 C CB   . ARG A 1 41  ? 10.137  7.812   5.638   1.00 0.00 ? 41  ARG A CB   7  
ATOM 10642 C CG   . ARG A 1 41  ? 9.748   6.375   5.993   1.00 0.00 ? 41  ARG A CG   7  
ATOM 10643 C CD   . ARG A 1 41  ? 10.306  6.020   7.372   1.00 0.00 ? 41  ARG A CD   7  
ATOM 10644 N NE   . ARG A 1 41  ? 9.196   5.994   8.364   1.00 0.00 ? 41  ARG A NE   7  
ATOM 10645 C CZ   . ARG A 1 41  ? 9.454   5.798   9.629   1.00 0.00 ? 41  ARG A CZ   7  
ATOM 10646 N NH1  . ARG A 1 41  ? 10.634  6.086   10.105  1.00 0.00 ? 41  ARG A NH1  7  
ATOM 10647 N NH2  . ARG A 1 41  ? 8.533   5.314   10.416  1.00 0.00 ? 41  ARG A NH2  7  
ATOM 10648 H H    . ARG A 1 41  ? 9.838   8.700   2.884   1.00 0.00 ? 41  ARG A H    7  
ATOM 10649 H HA   . ARG A 1 41  ? 8.054   8.068   5.187   1.00 0.00 ? 41  ARG A HA   7  
ATOM 10650 H HB2  . ARG A 1 41  ? 11.032  7.804   5.032   1.00 0.00 ? 41  ARG A HB2  7  
ATOM 10651 H HB3  . ARG A 1 41  ? 10.321  8.368   6.545   1.00 0.00 ? 41  ARG A HB3  7  
ATOM 10652 H HG2  . ARG A 1 41  ? 8.670   6.287   6.005   1.00 0.00 ? 41  ARG A HG2  7  
ATOM 10653 H HG3  . ARG A 1 41  ? 10.156  5.700   5.256   1.00 0.00 ? 41  ARG A HG3  7  
ATOM 10654 H HD2  . ARG A 1 41  ? 10.776  5.049   7.330   1.00 0.00 ? 41  ARG A HD2  7  
ATOM 10655 H HD3  . ARG A 1 41  ? 11.036  6.761   7.666   1.00 0.00 ? 41  ARG A HD3  7  
ATOM 10656 H HE   . ARG A 1 41  ? 8.270   6.123   8.069   1.00 0.00 ? 41  ARG A HE   7  
ATOM 10657 H HH11 . ARG A 1 41  ? 11.339  6.457   9.502   1.00 0.00 ? 41  ARG A HH11 7  
ATOM 10658 H HH12 . ARG A 1 41  ? 10.832  5.936   11.074  1.00 0.00 ? 41  ARG A HH12 7  
ATOM 10659 H HH21 . ARG A 1 41  ? 7.627   5.094   10.052  1.00 0.00 ? 41  ARG A HH21 7  
ATOM 10660 H HH22 . ARG A 1 41  ? 8.731   5.165   11.385  1.00 0.00 ? 41  ARG A HH22 7  
ATOM 10661 N N    . THR A 1 42  ? 9.006   10.769  4.064   1.00 0.00 ? 42  THR A N    7  
ATOM 10662 C CA   . THR A 1 42  ? 9.030   12.247  4.253   1.00 0.00 ? 42  THR A CA   7  
ATOM 10663 C C    . THR A 1 42  ? 8.647   12.941  2.944   1.00 0.00 ? 42  THR A C    7  
ATOM 10664 O O    . THR A 1 42  ? 9.100   14.029  2.653   1.00 0.00 ? 42  THR A O    7  
ATOM 10665 C CB   . THR A 1 42  ? 10.436  12.687  4.666   1.00 0.00 ? 42  THR A CB   7  
ATOM 10666 O OG1  . THR A 1 42  ? 11.130  11.584  5.232   1.00 0.00 ? 42  THR A OG1  7  
ATOM 10667 C CG2  . THR A 1 42  ? 10.337  13.813  5.696   1.00 0.00 ? 42  THR A CG2  7  
ATOM 10668 H H    . THR A 1 42  ? 8.979   10.389  3.160   1.00 0.00 ? 42  THR A H    7  
ATOM 10669 H HA   . THR A 1 42  ? 8.326   12.522  5.024   1.00 0.00 ? 42  THR A HA   7  
ATOM 10670 H HB   . THR A 1 42  ? 10.971  13.044  3.801   1.00 0.00 ? 42  THR A HB   7  
ATOM 10671 H HG1  . THR A 1 42  ? 11.861  11.362  4.649   1.00 0.00 ? 42  THR A HG1  7  
ATOM 10672 H HG21 . THR A 1 42  ? 9.362   14.273  5.633   1.00 0.00 ? 42  THR A HG21 7  
ATOM 10673 H HG22 . THR A 1 42  ? 11.098  14.552  5.496   1.00 0.00 ? 42  THR A HG22 7  
ATOM 10674 H HG23 . THR A 1 42  ? 10.480  13.409  6.687   1.00 0.00 ? 42  THR A HG23 7  
ATOM 10675 N N    . ALA A 1 43  ? 7.817   12.321  2.153   1.00 0.00 ? 43  ALA A N    7  
ATOM 10676 C CA   . ALA A 1 43  ? 7.408   12.951  0.867   1.00 0.00 ? 43  ALA A CA   7  
ATOM 10677 C C    . ALA A 1 43  ? 6.223   12.180  0.281   1.00 0.00 ? 43  ALA A C    7  
ATOM 10678 O O    . ALA A 1 43  ? 6.392   11.184  -0.394  1.00 0.00 ? 43  ALA A O    7  
ATOM 10679 C CB   . ALA A 1 43  ? 8.579   12.911  -0.116  1.00 0.00 ? 43  ALA A CB   7  
ATOM 10680 H H    . ALA A 1 43  ? 7.461   11.444  2.405   1.00 0.00 ? 43  ALA A H    7  
ATOM 10681 H HA   . ALA A 1 43  ? 7.120   13.976  1.043   1.00 0.00 ? 43  ALA A HA   7  
ATOM 10682 H HB1  . ALA A 1 43  ? 8.989   11.911  -0.149  1.00 0.00 ? 43  ALA A HB1  7  
ATOM 10683 H HB2  . ALA A 1 43  ? 9.343   13.602  0.206   1.00 0.00 ? 43  ALA A HB2  7  
ATOM 10684 H HB3  . ALA A 1 43  ? 8.234   13.190  -1.101  1.00 0.00 ? 43  ALA A HB3  7  
ATOM 10685 N N    . ASP A 1 44  ? 5.024   12.629  0.535   1.00 0.00 ? 44  ASP A N    7  
ATOM 10686 C CA   . ASP A 1 44  ? 3.837   11.913  -0.007  1.00 0.00 ? 44  ASP A CA   7  
ATOM 10687 C C    . ASP A 1 44  ? 2.812   12.924  -0.522  1.00 0.00 ? 44  ASP A C    7  
ATOM 10688 O O    . ASP A 1 44  ? 1.642   12.625  -0.649  1.00 0.00 ? 44  ASP A O    7  
ATOM 10689 C CB   . ASP A 1 44  ? 3.205   11.066  1.099   1.00 0.00 ? 44  ASP A CB   7  
ATOM 10690 C CG   . ASP A 1 44  ? 2.961   11.940  2.331   1.00 0.00 ? 44  ASP A CG   7  
ATOM 10691 O OD1  . ASP A 1 44  ? 2.684   13.114  2.155   1.00 0.00 ? 44  ASP A OD1  7  
ATOM 10692 O OD2  . ASP A 1 44  ? 3.057   11.418  3.431   1.00 0.00 ? 44  ASP A OD2  7  
ATOM 10693 H H    . ASP A 1 44  ? 4.905   13.431  1.083   1.00 0.00 ? 44  ASP A H    7  
ATOM 10694 H HA   . ASP A 1 44  ? 4.145   11.273  -0.819  1.00 0.00 ? 44  ASP A HA   7  
ATOM 10695 H HB2  . ASP A 1 44  ? 2.266   10.662  0.751   1.00 0.00 ? 44  ASP A HB2  7  
ATOM 10696 H HB3  . ASP A 1 44  ? 3.872   10.258  1.360   1.00 0.00 ? 44  ASP A HB3  7  
ATOM 10697 N N    . LYS A 1 45  ? 3.240   14.118  -0.824  1.00 0.00 ? 45  LYS A N    7  
ATOM 10698 C CA   . LYS A 1 45  ? 2.286   15.139  -1.334  1.00 0.00 ? 45  LYS A CA   7  
ATOM 10699 C C    . LYS A 1 45  ? 2.223   15.058  -2.862  1.00 0.00 ? 45  LYS A C    7  
ATOM 10700 O O    . LYS A 1 45  ? 2.318   16.056  -3.549  1.00 0.00 ? 45  LYS A O    7  
ATOM 10701 C CB   . LYS A 1 45  ? 2.755   16.534  -0.914  1.00 0.00 ? 45  LYS A CB   7  
ATOM 10702 C CG   . LYS A 1 45  ? 4.110   16.831  -1.559  1.00 0.00 ? 45  LYS A CG   7  
ATOM 10703 C CD   . LYS A 1 45  ? 4.287   18.345  -1.700  1.00 0.00 ? 45  LYS A CD   7  
ATOM 10704 C CE   . LYS A 1 45  ? 5.432   18.637  -2.673  1.00 0.00 ? 45  LYS A CE   7  
ATOM 10705 N NZ   . LYS A 1 45  ? 6.328   19.677  -2.092  1.00 0.00 ? 45  LYS A NZ   7  
ATOM 10706 H H    . LYS A 1 45  ? 4.189   14.342  -0.718  1.00 0.00 ? 45  LYS A H    7  
ATOM 10707 H HA   . LYS A 1 45  ? 1.305   14.950  -0.924  1.00 0.00 ? 45  LYS A HA   7  
ATOM 10708 H HB2  . LYS A 1 45  ? 2.032   17.269  -1.236  1.00 0.00 ? 45  LYS A HB2  7  
ATOM 10709 H HB3  . LYS A 1 45  ? 2.854   16.572  0.161   1.00 0.00 ? 45  LYS A HB3  7  
ATOM 10710 H HG2  . LYS A 1 45  ? 4.900   16.431  -0.939  1.00 0.00 ? 45  LYS A HG2  7  
ATOM 10711 H HG3  . LYS A 1 45  ? 4.152   16.374  -2.536  1.00 0.00 ? 45  LYS A HG3  7  
ATOM 10712 H HD2  . LYS A 1 45  ? 3.373   18.781  -2.077  1.00 0.00 ? 45  LYS A HD2  7  
ATOM 10713 H HD3  . LYS A 1 45  ? 4.520   18.771  -0.736  1.00 0.00 ? 45  LYS A HD3  7  
ATOM 10714 H HE2  . LYS A 1 45  ? 5.996   17.733  -2.848  1.00 0.00 ? 45  LYS A HE2  7  
ATOM 10715 H HE3  . LYS A 1 45  ? 5.026   18.994  -3.609  1.00 0.00 ? 45  LYS A HE3  7  
ATOM 10716 H HZ1  . LYS A 1 45  ? 6.139   19.768  -1.073  1.00 0.00 ? 45  LYS A HZ1  7  
ATOM 10717 H HZ2  . LYS A 1 45  ? 6.151   20.588  -2.561  1.00 0.00 ? 45  LYS A HZ2  7  
ATOM 10718 H HZ3  . LYS A 1 45  ? 7.319   19.400  -2.234  1.00 0.00 ? 45  LYS A HZ3  7  
ATOM 10719 N N    . GLY A 1 46  ? 2.066   13.878  -3.400  1.00 0.00 ? 46  GLY A N    7  
ATOM 10720 C CA   . GLY A 1 46  ? 2.001   13.743  -4.883  1.00 0.00 ? 46  GLY A CA   7  
ATOM 10721 C C    . GLY A 1 46  ? 1.475   12.353  -5.261  1.00 0.00 ? 46  GLY A C    7  
ATOM 10722 O O    . GLY A 1 46  ? 0.473   12.225  -5.937  1.00 0.00 ? 46  GLY A O    7  
ATOM 10723 H H    . GLY A 1 46  ? 1.992   13.084  -2.831  1.00 0.00 ? 46  GLY A H    7  
ATOM 10724 H HA2  . GLY A 1 46  ? 1.337   14.497  -5.283  1.00 0.00 ? 46  GLY A HA2  7  
ATOM 10725 H HA3  . GLY A 1 46  ? 2.990   13.875  -5.300  1.00 0.00 ? 46  GLY A HA3  7  
ATOM 10726 N N    . TRP A 1 47  ? 2.146   11.312  -4.845  1.00 0.00 ? 47  TRP A N    7  
ATOM 10727 C CA   . TRP A 1 47  ? 1.680   9.940   -5.201  1.00 0.00 ? 47  TRP A CA   7  
ATOM 10728 C C    . TRP A 1 47  ? 0.464   9.557   -4.360  1.00 0.00 ? 47  TRP A C    7  
ATOM 10729 O O    . TRP A 1 47  ? -0.077  8.478   -4.494  1.00 0.00 ? 47  TRP A O    7  
ATOM 10730 C CB   . TRP A 1 47  ? 2.807   8.933   -4.960  1.00 0.00 ? 47  TRP A CB   7  
ATOM 10731 C CG   . TRP A 1 47  ? 2.992   8.703   -3.494  1.00 0.00 ? 47  TRP A CG   7  
ATOM 10732 C CD1  . TRP A 1 47  ? 3.454   9.621   -2.611  1.00 0.00 ? 47  TRP A CD1  7  
ATOM 10733 C CD2  . TRP A 1 47  ? 2.740   7.491   -2.727  1.00 0.00 ? 47  TRP A CD2  7  
ATOM 10734 N NE1  . TRP A 1 47  ? 3.509   9.044   -1.356  1.00 0.00 ? 47  TRP A NE1  7  
ATOM 10735 C CE2  . TRP A 1 47  ? 3.080   7.734   -1.376  1.00 0.00 ? 47  TRP A CE2  7  
ATOM 10736 C CE3  . TRP A 1 47  ? 2.256   6.215   -3.070  1.00 0.00 ? 47  TRP A CE3  7  
ATOM 10737 C CZ2  . TRP A 1 47  ? 2.948   6.747   -0.401  1.00 0.00 ? 47  TRP A CZ2  7  
ATOM 10738 C CZ3  . TRP A 1 47  ? 2.122   5.221   -2.090  1.00 0.00 ? 47  TRP A CZ3  7  
ATOM 10739 C CH2  . TRP A 1 47  ? 2.470   5.486   -0.761  1.00 0.00 ? 47  TRP A CH2  7  
ATOM 10740 H H    . TRP A 1 47  ? 2.958   11.431  -4.311  1.00 0.00 ? 47  TRP A H    7  
ATOM 10741 H HA   . TRP A 1 47  ? 1.405   9.921   -6.243  1.00 0.00 ? 47  TRP A HA   7  
ATOM 10742 H HB2  . TRP A 1 47  ? 2.558   7.997   -5.439  1.00 0.00 ? 47  TRP A HB2  7  
ATOM 10743 H HB3  . TRP A 1 47  ? 3.725   9.315   -5.382  1.00 0.00 ? 47  TRP A HB3  7  
ATOM 10744 H HD1  . TRP A 1 47  ? 3.736   10.636  -2.847  1.00 0.00 ? 47  TRP A HD1  7  
ATOM 10745 H HE1  . TRP A 1 47  ? 3.811   9.493   -0.539  1.00 0.00 ? 47  TRP A HE1  7  
ATOM 10746 H HE3  . TRP A 1 47  ? 1.980   6.001   -4.090  1.00 0.00 ? 47  TRP A HE3  7  
ATOM 10747 H HZ2  . TRP A 1 47  ? 3.218   6.954   0.624   1.00 0.00 ? 47  TRP A HZ2  7  
ATOM 10748 H HZ3  . TRP A 1 47  ? 1.751   4.244   -2.364  1.00 0.00 ? 47  TRP A HZ3  7  
ATOM 10749 H HH2  . TRP A 1 47  ? 2.365   4.717   -0.015  1.00 0.00 ? 47  TRP A HH2  7  
ATOM 10750 N N    . GLN A 1 48  ? 0.023   10.427  -3.502  1.00 0.00 ? 48  GLN A N    7  
ATOM 10751 C CA   . GLN A 1 48  ? -1.163  10.099  -2.669  1.00 0.00 ? 48  GLN A CA   7  
ATOM 10752 C C    . GLN A 1 48  ? -2.384  9.942   -3.580  1.00 0.00 ? 48  GLN A C    7  
ATOM 10753 O O    . GLN A 1 48  ? -2.953  8.874   -3.693  1.00 0.00 ? 48  GLN A O    7  
ATOM 10754 C CB   . GLN A 1 48  ? -1.402  11.228  -1.666  1.00 0.00 ? 48  GLN A CB   7  
ATOM 10755 C CG   . GLN A 1 48  ? -1.951  10.646  -0.362  1.00 0.00 ? 48  GLN A CG   7  
ATOM 10756 C CD   . GLN A 1 48  ? -0.977  9.598   0.181   1.00 0.00 ? 48  GLN A CD   7  
ATOM 10757 O OE1  . GLN A 1 48  ? -1.355  8.745   0.960   1.00 0.00 ? 48  GLN A OE1  7  
ATOM 10758 N NE2  . GLN A 1 48  ? 0.272   9.625   -0.199  1.00 0.00 ? 48  GLN A NE2  7  
ATOM 10759 H H    . GLN A 1 48  ? 0.467   11.296  -3.408  1.00 0.00 ? 48  GLN A H    7  
ATOM 10760 H HA   . GLN A 1 48  ? -0.987  9.176   -2.138  1.00 0.00 ? 48  GLN A HA   7  
ATOM 10761 H HB2  . GLN A 1 48  ? -0.469  11.737  -1.471  1.00 0.00 ? 48  GLN A HB2  7  
ATOM 10762 H HB3  . GLN A 1 48  ? -2.113  11.929  -2.074  1.00 0.00 ? 48  GLN A HB3  7  
ATOM 10763 H HG2  . GLN A 1 48  ? -2.070  11.439  0.363   1.00 0.00 ? 48  GLN A HG2  7  
ATOM 10764 H HG3  . GLN A 1 48  ? -2.907  10.183  -0.548  1.00 0.00 ? 48  GLN A HG3  7  
ATOM 10765 H HE21 . GLN A 1 48  ? 0.579   10.313  -0.825  1.00 0.00 ? 48  GLN A HE21 7  
ATOM 10766 H HE22 . GLN A 1 48  ? 0.904   8.958   0.144   1.00 0.00 ? 48  GLN A HE22 7  
ATOM 10767 N N    . ASN A 1 49  ? -2.785  10.995  -4.239  1.00 0.00 ? 49  ASN A N    7  
ATOM 10768 C CA   . ASN A 1 49  ? -3.962  10.905  -5.151  1.00 0.00 ? 49  ASN A CA   7  
ATOM 10769 C C    . ASN A 1 49  ? -3.577  10.124  -6.412  1.00 0.00 ? 49  ASN A C    7  
ATOM 10770 O O    . ASN A 1 49  ? -4.423  9.671   -7.155  1.00 0.00 ? 49  ASN A O    7  
ATOM 10771 C CB   . ASN A 1 49  ? -4.411  12.317  -5.539  1.00 0.00 ? 49  ASN A CB   7  
ATOM 10772 C CG   . ASN A 1 49  ? -3.209  13.113  -6.050  1.00 0.00 ? 49  ASN A CG   7  
ATOM 10773 O OD1  . ASN A 1 49  ? -2.342  12.572  -6.706  1.00 0.00 ? 49  ASN A OD1  7  
ATOM 10774 N ND2  . ASN A 1 49  ? -3.119  14.387  -5.776  1.00 0.00 ? 49  ASN A ND2  7  
ATOM 10775 H H    . ASN A 1 49  ? -2.307  11.844  -4.140  1.00 0.00 ? 49  ASN A H    7  
ATOM 10776 H HA   . ASN A 1 49  ? -4.770  10.396  -4.649  1.00 0.00 ? 49  ASN A HA   7  
ATOM 10777 H HB2  . ASN A 1 49  ? -5.161  12.255  -6.314  1.00 0.00 ? 49  ASN A HB2  7  
ATOM 10778 H HB3  . ASN A 1 49  ? -4.827  12.811  -4.674  1.00 0.00 ? 49  ASN A HB3  7  
ATOM 10779 H HD21 . ASN A 1 49  ? -3.817  14.825  -5.246  1.00 0.00 ? 49  ASN A HD21 7  
ATOM 10780 H HD22 . ASN A 1 49  ? -2.353  14.905  -6.100  1.00 0.00 ? 49  ASN A HD22 7  
ATOM 10781 N N    . SER A 1 50  ? -2.305  9.974   -6.663  1.00 0.00 ? 50  SER A N    7  
ATOM 10782 C CA   . SER A 1 50  ? -1.863  9.230   -7.880  1.00 0.00 ? 50  SER A CA   7  
ATOM 10783 C C    . SER A 1 50  ? -2.116  7.728   -7.707  1.00 0.00 ? 50  SER A C    7  
ATOM 10784 O O    . SER A 1 50  ? -2.338  7.013   -8.663  1.00 0.00 ? 50  SER A O    7  
ATOM 10785 C CB   . SER A 1 50  ? -0.369  9.467   -8.100  1.00 0.00 ? 50  SER A CB   7  
ATOM 10786 O OG   . SER A 1 50  ? -0.046  10.806  -7.746  1.00 0.00 ? 50  SER A OG   7  
ATOM 10787 H H    . SER A 1 50  ? -1.639  10.354  -6.054  1.00 0.00 ? 50  SER A H    7  
ATOM 10788 H HA   . SER A 1 50  ? -2.411  9.589   -8.738  1.00 0.00 ? 50  SER A HA   7  
ATOM 10789 H HB2  . SER A 1 50  ? 0.201   8.790   -7.485  1.00 0.00 ? 50  SER A HB2  7  
ATOM 10790 H HB3  . SER A 1 50  ? -0.127  9.292   -9.139  1.00 0.00 ? 50  SER A HB3  7  
ATOM 10791 H HG   . SER A 1 50  ? 0.902   10.919  -7.847  1.00 0.00 ? 50  SER A HG   7  
ATOM 10792 N N    . ILE A 1 51  ? -2.067  7.241   -6.498  1.00 0.00 ? 51  ILE A N    7  
ATOM 10793 C CA   . ILE A 1 51  ? -2.286  5.783   -6.266  1.00 0.00 ? 51  ILE A CA   7  
ATOM 10794 C C    . ILE A 1 51  ? -3.760  5.426   -6.513  1.00 0.00 ? 51  ILE A C    7  
ATOM 10795 O O    . ILE A 1 51  ? -4.068  4.461   -7.183  1.00 0.00 ? 51  ILE A O    7  
ATOM 10796 C CB   . ILE A 1 51  ? -1.854  5.448   -4.821  1.00 0.00 ? 51  ILE A CB   7  
ATOM 10797 C CG1  . ILE A 1 51  ? -0.602  4.575   -4.871  1.00 0.00 ? 51  ILE A CG1  7  
ATOM 10798 C CG2  . ILE A 1 51  ? -2.950  4.693   -4.052  1.00 0.00 ? 51  ILE A CG2  7  
ATOM 10799 C CD1  . ILE A 1 51  ? 0.421   5.180   -5.836  1.00 0.00 ? 51  ILE A CD1  7  
ATOM 10800 H H    . ILE A 1 51  ? -1.874  7.831   -5.740  1.00 0.00 ? 51  ILE A H    7  
ATOM 10801 H HA   . ILE A 1 51  ? -1.670  5.218   -6.956  1.00 0.00 ? 51  ILE A HA   7  
ATOM 10802 H HB   . ILE A 1 51  ? -1.625  6.365   -4.300  1.00 0.00 ? 51  ILE A HB   7  
ATOM 10803 H HG12 . ILE A 1 51  ? -0.171  4.509   -3.883  1.00 0.00 ? 51  ILE A HG12 7  
ATOM 10804 H HG13 . ILE A 1 51  ? -0.873  3.588   -5.211  1.00 0.00 ? 51  ILE A HG13 7  
ATOM 10805 H HG21 . ILE A 1 51  ? -3.902  5.177   -4.203  1.00 0.00 ? 51  ILE A HG21 7  
ATOM 10806 H HG22 . ILE A 1 51  ? -2.713  4.697   -3.001  1.00 0.00 ? 51  ILE A HG22 7  
ATOM 10807 H HG23 . ILE A 1 51  ? -3.003  3.672   -4.406  1.00 0.00 ? 51  ILE A HG23 7  
ATOM 10808 H HD11 . ILE A 1 51  ? 1.415   4.875   -5.544  1.00 0.00 ? 51  ILE A HD11 7  
ATOM 10809 H HD12 . ILE A 1 51  ? 0.351   6.257   -5.807  1.00 0.00 ? 51  ILE A HD12 7  
ATOM 10810 H HD13 . ILE A 1 51  ? 0.218   4.832   -6.839  1.00 0.00 ? 51  ILE A HD13 7  
ATOM 10811 N N    . ARG A 1 52  ? -4.671  6.187   -5.971  1.00 0.00 ? 52  ARG A N    7  
ATOM 10812 C CA   . ARG A 1 52  ? -6.115  5.872   -6.173  1.00 0.00 ? 52  ARG A CA   7  
ATOM 10813 C C    . ARG A 1 52  ? -6.466  5.989   -7.658  1.00 0.00 ? 52  ARG A C    7  
ATOM 10814 O O    . ARG A 1 52  ? -7.271  5.241   -8.177  1.00 0.00 ? 52  ARG A O    7  
ATOM 10815 C CB   . ARG A 1 52  ? -6.972  6.849   -5.364  1.00 0.00 ? 52  ARG A CB   7  
ATOM 10816 C CG   . ARG A 1 52  ? -6.560  8.287   -5.687  1.00 0.00 ? 52  ARG A CG   7  
ATOM 10817 C CD   . ARG A 1 52  ? -7.523  8.878   -6.719  1.00 0.00 ? 52  ARG A CD   7  
ATOM 10818 N NE   . ARG A 1 52  ? -8.926  8.572   -6.322  1.00 0.00 ? 52  ARG A NE   7  
ATOM 10819 C CZ   . ARG A 1 52  ? -9.822  8.317   -7.237  1.00 0.00 ? 52  ARG A CZ   7  
ATOM 10820 N NH1  . ARG A 1 52  ? -10.007 9.154   -8.221  1.00 0.00 ? 52  ARG A NH1  7  
ATOM 10821 N NH2  . ARG A 1 52  ? -10.532 7.225   -7.167  1.00 0.00 ? 52  ARG A NH2  7  
ATOM 10822 H H    . ARG A 1 52  ? -4.408  6.958   -5.427  1.00 0.00 ? 52  ARG A H    7  
ATOM 10823 H HA   . ARG A 1 52  ? -6.311  4.864   -5.839  1.00 0.00 ? 52  ARG A HA   7  
ATOM 10824 H HB2  . ARG A 1 52  ? -8.013  6.707   -5.616  1.00 0.00 ? 52  ARG A HB2  7  
ATOM 10825 H HB3  . ARG A 1 52  ? -6.829  6.665   -4.311  1.00 0.00 ? 52  ARG A HB3  7  
ATOM 10826 H HG2  . ARG A 1 52  ? -6.589  8.880   -4.786  1.00 0.00 ? 52  ARG A HG2  7  
ATOM 10827 H HG3  . ARG A 1 52  ? -5.559  8.290   -6.089  1.00 0.00 ? 52  ARG A HG3  7  
ATOM 10828 H HD2  . ARG A 1 52  ? -7.388  9.948   -6.766  1.00 0.00 ? 52  ARG A HD2  7  
ATOM 10829 H HD3  . ARG A 1 52  ? -7.321  8.447   -7.688  1.00 0.00 ? 52  ARG A HD3  7  
ATOM 10830 H HE   . ARG A 1 52  ? -9.177  8.562   -5.375  1.00 0.00 ? 52  ARG A HE   7  
ATOM 10831 H HH11 . ARG A 1 52  ? -9.463  9.991   -8.274  1.00 0.00 ? 52  ARG A HH11 7  
ATOM 10832 H HH12 . ARG A 1 52  ? -10.693 8.958   -8.921  1.00 0.00 ? 52  ARG A HH12 7  
ATOM 10833 H HH21 . ARG A 1 52  ? -10.391 6.583   -6.413  1.00 0.00 ? 52  ARG A HH21 7  
ATOM 10834 H HH22 . ARG A 1 52  ? -11.219 7.029   -7.867  1.00 0.00 ? 52  ARG A HH22 7  
ATOM 10835 N N    . HIS A 1 53  ? -5.872  6.924   -8.346  1.00 0.00 ? 53  HIS A N    7  
ATOM 10836 C CA   . HIS A 1 53  ? -6.176  7.091   -9.795  1.00 0.00 ? 53  HIS A CA   7  
ATOM 10837 C C    . HIS A 1 53  ? -5.508  5.969   -10.601 1.00 0.00 ? 53  HIS A C    7  
ATOM 10838 O O    . HIS A 1 53  ? -6.017  5.534   -11.614 1.00 0.00 ? 53  HIS A O    7  
ATOM 10839 C CB   . HIS A 1 53  ? -5.651  8.448   -10.267 1.00 0.00 ? 53  HIS A CB   7  
ATOM 10840 C CG   . HIS A 1 53  ? -6.149  8.724   -11.659 1.00 0.00 ? 53  HIS A CG   7  
ATOM 10841 N ND1  . HIS A 1 53  ? -5.736  7.980   -12.752 1.00 0.00 ? 53  HIS A ND1  7  
ATOM 10842 C CD2  . HIS A 1 53  ? -7.026  9.659   -12.152 1.00 0.00 ? 53  HIS A CD2  7  
ATOM 10843 C CE1  . HIS A 1 53  ? -6.358  8.474   -13.838 1.00 0.00 ? 53  HIS A CE1  7  
ATOM 10844 N NE2  . HIS A 1 53  ? -7.157  9.499   -13.528 1.00 0.00 ? 53  HIS A NE2  7  
ATOM 10845 H H    . HIS A 1 53  ? -5.228  7.519   -7.910  1.00 0.00 ? 53  HIS A H    7  
ATOM 10846 H HA   . HIS A 1 53  ? -7.245  7.049   -9.944  1.00 0.00 ? 53  HIS A HA   7  
ATOM 10847 H HB2  . HIS A 1 53  ? -6.005  9.221   -9.598  1.00 0.00 ? 53  HIS A HB2  7  
ATOM 10848 H HB3  . HIS A 1 53  ? -4.572  8.438   -10.265 1.00 0.00 ? 53  HIS A HB3  7  
ATOM 10849 H HD1  . HIS A 1 53  ? -5.105  7.229   -12.737 1.00 0.00 ? 53  HIS A HD1  7  
ATOM 10850 H HD2  . HIS A 1 53  ? -7.538  10.405  -11.561 1.00 0.00 ? 53  HIS A HD2  7  
ATOM 10851 H HE1  . HIS A 1 53  ? -6.228  8.089   -14.839 1.00 0.00 ? 53  HIS A HE1  7  
ATOM 10852 N N    . ASN A 1 54  ? -4.370  5.499   -10.161 1.00 0.00 ? 54  ASN A N    7  
ATOM 10853 C CA   . ASN A 1 54  ? -3.675  4.409   -10.907 1.00 0.00 ? 54  ASN A CA   7  
ATOM 10854 C C    . ASN A 1 54  ? -4.484  3.118   -10.810 1.00 0.00 ? 54  ASN A C    7  
ATOM 10855 O O    . ASN A 1 54  ? -4.663  2.408   -11.780 1.00 0.00 ? 54  ASN A O    7  
ATOM 10856 C CB   . ASN A 1 54  ? -2.289  4.176   -10.300 1.00 0.00 ? 54  ASN A CB   7  
ATOM 10857 C CG   . ASN A 1 54  ? -1.262  5.030   -11.043 1.00 0.00 ? 54  ASN A CG   7  
ATOM 10858 O OD1  . ASN A 1 54  ? -1.115  4.917   -12.244 1.00 0.00 ? 54  ASN A OD1  7  
ATOM 10859 N ND2  . ASN A 1 54  ? -0.542  5.890   -10.377 1.00 0.00 ? 54  ASN A ND2  7  
ATOM 10860 H H    . ASN A 1 54  ? -3.974  5.863   -9.343  1.00 0.00 ? 54  ASN A H    7  
ATOM 10861 H HA   . ASN A 1 54  ? -3.569  4.691   -11.944 1.00 0.00 ? 54  ASN A HA   7  
ATOM 10862 H HB2  . ASN A 1 54  ? -2.305  4.455   -9.255  1.00 0.00 ? 54  ASN A HB2  7  
ATOM 10863 H HB3  . ASN A 1 54  ? -2.023  3.129   -10.390 1.00 0.00 ? 54  ASN A HB3  7  
ATOM 10864 H HD21 . ASN A 1 54  ? -0.660  5.982   -9.407  1.00 0.00 ? 54  ASN A HD21 7  
ATOM 10865 H HD22 . ASN A 1 54  ? 0.114   6.446   -10.845 1.00 0.00 ? 54  ASN A HD22 7  
ATOM 10866 N N    . LEU A 1 55  ? -4.971  2.805   -9.644  1.00 0.00 ? 55  LEU A N    7  
ATOM 10867 C CA   . LEU A 1 55  ? -5.760  1.557   -9.475  1.00 0.00 ? 55  LEU A CA   7  
ATOM 10868 C C    . LEU A 1 55  ? -6.924  1.533   -10.470 1.00 0.00 ? 55  LEU A C    7  
ATOM 10869 O O    . LEU A 1 55  ? -7.504  0.498   -10.733 1.00 0.00 ? 55  LEU A O    7  
ATOM 10870 C CB   . LEU A 1 55  ? -6.298  1.507   -8.047  1.00 0.00 ? 55  LEU A CB   7  
ATOM 10871 C CG   . LEU A 1 55  ? -5.126  1.515   -7.068  1.00 0.00 ? 55  LEU A CG   7  
ATOM 10872 C CD1  . LEU A 1 55  ? -5.661  1.586   -5.638  1.00 0.00 ? 55  LEU A CD1  7  
ATOM 10873 C CD2  . LEU A 1 55  ? -4.308  0.235   -7.246  1.00 0.00 ? 55  LEU A CD2  7  
ATOM 10874 H H    . LEU A 1 55  ? -4.810  3.390   -8.874  1.00 0.00 ? 55  LEU A H    7  
ATOM 10875 H HA   . LEU A 1 55  ? -5.123  0.702   -9.647  1.00 0.00 ? 55  LEU A HA   7  
ATOM 10876 H HB2  . LEU A 1 55  ? -6.921  2.370   -7.868  1.00 0.00 ? 55  LEU A HB2  7  
ATOM 10877 H HB3  . LEU A 1 55  ? -6.874  0.607   -7.908  1.00 0.00 ? 55  LEU A HB3  7  
ATOM 10878 H HG   . LEU A 1 55  ? -4.501  2.375   -7.262  1.00 0.00 ? 55  LEU A HG   7  
ATOM 10879 H HD11 . LEU A 1 55  ? -4.888  1.959   -4.983  1.00 0.00 ? 55  LEU A HD11 7  
ATOM 10880 H HD12 . LEU A 1 55  ? -5.963  0.600   -5.318  1.00 0.00 ? 55  LEU A HD12 7  
ATOM 10881 H HD13 . LEU A 1 55  ? -6.510  2.251   -5.608  1.00 0.00 ? 55  LEU A HD13 7  
ATOM 10882 H HD21 . LEU A 1 55  ? -4.705  -0.333  -8.075  1.00 0.00 ? 55  LEU A HD21 7  
ATOM 10883 H HD22 . LEU A 1 55  ? -4.364  -0.357  -6.345  1.00 0.00 ? 55  LEU A HD22 7  
ATOM 10884 H HD23 . LEU A 1 55  ? -3.279  0.491   -7.446  1.00 0.00 ? 55  LEU A HD23 7  
ATOM 10885 N N    . SER A 1 56  ? -7.267  2.660   -11.032 1.00 0.00 ? 56  SER A N    7  
ATOM 10886 C CA   . SER A 1 56  ? -8.388  2.692   -12.012 1.00 0.00 ? 56  SER A CA   7  
ATOM 10887 C C    . SER A 1 56  ? -7.842  2.458   -13.425 1.00 0.00 ? 56  SER A C    7  
ATOM 10888 O O    . SER A 1 56  ? -8.482  1.843   -14.253 1.00 0.00 ? 56  SER A O    7  
ATOM 10889 C CB   . SER A 1 56  ? -9.078  4.055   -11.956 1.00 0.00 ? 56  SER A CB   7  
ATOM 10890 O OG   . SER A 1 56  ? -9.969  4.086   -10.850 1.00 0.00 ? 56  SER A OG   7  
ATOM 10891 H H    . SER A 1 56  ? -6.786  3.485   -10.811 1.00 0.00 ? 56  SER A H    7  
ATOM 10892 H HA   . SER A 1 56  ? -9.101  1.917   -11.771 1.00 0.00 ? 56  SER A HA   7  
ATOM 10893 H HB2  . SER A 1 56  ? -8.339  4.831   -11.839 1.00 0.00 ? 56  SER A HB2  7  
ATOM 10894 H HB3  . SER A 1 56  ? -9.623  4.219   -12.877 1.00 0.00 ? 56  SER A HB3  7  
ATOM 10895 H HG   . SER A 1 56  ? -10.740 4.599   -11.104 1.00 0.00 ? 56  SER A HG   7  
ATOM 10896 N N    . LEU A 1 57  ? -6.669  2.954   -13.708 1.00 0.00 ? 57  LEU A N    7  
ATOM 10897 C CA   . LEU A 1 57  ? -6.090  2.770   -15.067 1.00 0.00 ? 57  LEU A CA   7  
ATOM 10898 C C    . LEU A 1 57  ? -5.271  1.476   -15.118 1.00 0.00 ? 57  LEU A C    7  
ATOM 10899 O O    . LEU A 1 57  ? -4.702  1.134   -16.136 1.00 0.00 ? 57  LEU A O    7  
ATOM 10900 C CB   . LEU A 1 57  ? -5.184  3.957   -15.392 1.00 0.00 ? 57  LEU A CB   7  
ATOM 10901 C CG   . LEU A 1 57  ? -4.018  3.998   -14.406 1.00 0.00 ? 57  LEU A CG   7  
ATOM 10902 C CD1  . LEU A 1 57  ? -2.935  3.017   -14.855 1.00 0.00 ? 57  LEU A CD1  7  
ATOM 10903 C CD2  . LEU A 1 57  ? -3.439  5.414   -14.365 1.00 0.00 ? 57  LEU A CD2  7  
ATOM 10904 H H    . LEU A 1 57  ? -6.171  3.454   -13.030 1.00 0.00 ? 57  LEU A H    7  
ATOM 10905 H HA   . LEU A 1 57  ? -6.887  2.718   -15.793 1.00 0.00 ? 57  LEU A HA   7  
ATOM 10906 H HB2  . LEU A 1 57  ? -4.803  3.852   -16.395 1.00 0.00 ? 57  LEU A HB2  7  
ATOM 10907 H HB3  . LEU A 1 57  ? -5.751  4.873   -15.316 1.00 0.00 ? 57  LEU A HB3  7  
ATOM 10908 H HG   . LEU A 1 57  ? -4.368  3.722   -13.422 1.00 0.00 ? 57  LEU A HG   7  
ATOM 10909 H HD11 . LEU A 1 57  ? -3.046  2.087   -14.317 1.00 0.00 ? 57  LEU A HD11 7  
ATOM 10910 H HD12 . LEU A 1 57  ? -1.961  3.437   -14.653 1.00 0.00 ? 57  LEU A HD12 7  
ATOM 10911 H HD13 . LEU A 1 57  ? -3.034  2.833   -15.915 1.00 0.00 ? 57  LEU A HD13 7  
ATOM 10912 H HD21 . LEU A 1 57  ? -4.246  6.133   -14.361 1.00 0.00 ? 57  LEU A HD21 7  
ATOM 10913 H HD22 . LEU A 1 57  ? -2.820  5.575   -15.235 1.00 0.00 ? 57  LEU A HD22 7  
ATOM 10914 H HD23 . LEU A 1 57  ? -2.844  5.536   -13.472 1.00 0.00 ? 57  LEU A HD23 7  
ATOM 10915 N N    . ASN A 1 58  ? -5.205  0.753   -14.034 1.00 0.00 ? 58  ASN A N    7  
ATOM 10916 C CA   . ASN A 1 58  ? -4.421  -0.519  -14.042 1.00 0.00 ? 58  ASN A CA   7  
ATOM 10917 C C    . ASN A 1 58  ? -5.333  -1.673  -14.460 1.00 0.00 ? 58  ASN A C    7  
ATOM 10918 O O    . ASN A 1 58  ? -6.520  -1.665  -14.199 1.00 0.00 ? 58  ASN A O    7  
ATOM 10919 C CB   . ASN A 1 58  ? -3.846  -0.790  -12.649 1.00 0.00 ? 58  ASN A CB   7  
ATOM 10920 C CG   . ASN A 1 58  ? -2.431  -0.213  -12.568 1.00 0.00 ? 58  ASN A CG   7  
ATOM 10921 O OD1  . ASN A 1 58  ? -1.513  -0.743  -13.161 1.00 0.00 ? 58  ASN A OD1  7  
ATOM 10922 N ND2  . ASN A 1 58  ? -2.214  0.857   -11.854 1.00 0.00 ? 58  ASN A ND2  7  
ATOM 10923 H H    . ASN A 1 58  ? -5.671  1.041   -13.222 1.00 0.00 ? 58  ASN A H    7  
ATOM 10924 H HA   . ASN A 1 58  ? -3.612  -0.431  -14.752 1.00 0.00 ? 58  ASN A HA   7  
ATOM 10925 H HB2  . ASN A 1 58  ? -4.471  -0.327  -11.900 1.00 0.00 ? 58  ASN A HB2  7  
ATOM 10926 H HB3  . ASN A 1 58  ? -3.808  -1.855  -12.477 1.00 0.00 ? 58  ASN A HB3  7  
ATOM 10927 H HD21 . ASN A 1 58  ? -2.954  1.284   -11.375 1.00 0.00 ? 58  ASN A HD21 7  
ATOM 10928 H HD22 . ASN A 1 58  ? -1.312  1.234   -11.796 1.00 0.00 ? 58  ASN A HD22 7  
ATOM 10929 N N    . ARG A 1 59  ? -4.794  -2.660  -15.124 1.00 0.00 ? 59  ARG A N    7  
ATOM 10930 C CA   . ARG A 1 59  ? -5.642  -3.801  -15.573 1.00 0.00 ? 59  ARG A CA   7  
ATOM 10931 C C    . ARG A 1 59  ? -5.671  -4.907  -14.511 1.00 0.00 ? 59  ARG A C    7  
ATOM 10932 O O    . ARG A 1 59  ? -6.444  -5.839  -14.607 1.00 0.00 ? 59  ARG A O    7  
ATOM 10933 C CB   . ARG A 1 59  ? -5.092  -4.361  -16.888 1.00 0.00 ? 59  ARG A CB   7  
ATOM 10934 C CG   . ARG A 1 59  ? -3.652  -4.837  -16.690 1.00 0.00 ? 59  ARG A CG   7  
ATOM 10935 C CD   . ARG A 1 59  ? -3.109  -5.369  -18.018 1.00 0.00 ? 59  ARG A CD   7  
ATOM 10936 N NE   . ARG A 1 59  ? -1.714  -4.883  -18.217 1.00 0.00 ? 59  ARG A NE   7  
ATOM 10937 C CZ   . ARG A 1 59  ? -1.195  -4.862  -19.414 1.00 0.00 ? 59  ARG A CZ   7  
ATOM 10938 N NH1  . ARG A 1 59  ? -1.007  -5.978  -20.065 1.00 0.00 ? 59  ARG A NH1  7  
ATOM 10939 N NH2  . ARG A 1 59  ? -0.863  -3.725  -19.962 1.00 0.00 ? 59  ARG A NH2  7  
ATOM 10940 H H    . ARG A 1 59  ? -3.837  -2.645  -15.338 1.00 0.00 ? 59  ARG A H    7  
ATOM 10941 H HA   . ARG A 1 59  ? -6.648  -3.446  -15.738 1.00 0.00 ? 59  ARG A HA   7  
ATOM 10942 H HB2  . ARG A 1 59  ? -5.705  -5.191  -17.208 1.00 0.00 ? 59  ARG A HB2  7  
ATOM 10943 H HB3  . ARG A 1 59  ? -5.112  -3.589  -17.643 1.00 0.00 ? 59  ARG A HB3  7  
ATOM 10944 H HG2  . ARG A 1 59  ? -3.043  -4.011  -16.355 1.00 0.00 ? 59  ARG A HG2  7  
ATOM 10945 H HG3  . ARG A 1 59  ? -3.630  -5.625  -15.952 1.00 0.00 ? 59  ARG A HG3  7  
ATOM 10946 H HD2  . ARG A 1 59  ? -3.115  -6.449  -18.003 1.00 0.00 ? 59  ARG A HD2  7  
ATOM 10947 H HD3  . ARG A 1 59  ? -3.732  -5.018  -18.828 1.00 0.00 ? 59  ARG A HD3  7  
ATOM 10948 H HE   . ARG A 1 59  ? -1.188  -4.579  -17.449 1.00 0.00 ? 59  ARG A HE   7  
ATOM 10949 H HH11 . ARG A 1 59  ? -1.262  -6.849  -19.645 1.00 0.00 ? 59  ARG A HH11 7  
ATOM 10950 H HH12 . ARG A 1 59  ? -0.608  -5.961  -20.981 1.00 0.00 ? 59  ARG A HH12 7  
ATOM 10951 H HH21 . ARG A 1 59  ? -1.006  -2.869  -19.466 1.00 0.00 ? 59  ARG A HH21 7  
ATOM 10952 H HH22 . ARG A 1 59  ? -0.464  -3.710  -20.879 1.00 0.00 ? 59  ARG A HH22 7  
ATOM 10953 N N    . TYR A 1 60  ? -4.850  -4.822  -13.495 1.00 0.00 ? 60  TYR A N    7  
ATOM 10954 C CA   . TYR A 1 60  ? -4.874  -5.888  -12.449 1.00 0.00 ? 60  TYR A CA   7  
ATOM 10955 C C    . TYR A 1 60  ? -5.536  -5.360  -11.179 1.00 0.00 ? 60  TYR A C    7  
ATOM 10956 O O    . TYR A 1 60  ? -6.105  -6.108  -10.415 1.00 0.00 ? 60  TYR A O    7  
ATOM 10957 C CB   . TYR A 1 60  ? -3.453  -6.352  -12.106 1.00 0.00 ? 60  TYR A CB   7  
ATOM 10958 C CG   . TYR A 1 60  ? -2.450  -5.259  -12.389 1.00 0.00 ? 60  TYR A CG   7  
ATOM 10959 C CD1  . TYR A 1 60  ? -2.511  -4.034  -11.707 1.00 0.00 ? 60  TYR A CD1  7  
ATOM 10960 C CD2  . TYR A 1 60  ? -1.453  -5.478  -13.341 1.00 0.00 ? 60  TYR A CD2  7  
ATOM 10961 C CE1  . TYR A 1 60  ? -1.571  -3.035  -11.989 1.00 0.00 ? 60  TYR A CE1  7  
ATOM 10962 C CE2  . TYR A 1 60  ? -0.515  -4.482  -13.621 1.00 0.00 ? 60  TYR A CE2  7  
ATOM 10963 C CZ   . TYR A 1 60  ? -0.574  -3.259  -12.946 1.00 0.00 ? 60  TYR A CZ   7  
ATOM 10964 O OH   . TYR A 1 60  ? 0.350   -2.273  -13.222 1.00 0.00 ? 60  TYR A OH   7  
ATOM 10965 H H    . TYR A 1 60  ? -4.232  -4.066  -13.418 1.00 0.00 ? 60  TYR A H    7  
ATOM 10966 H HA   . TYR A 1 60  ? -5.441  -6.730  -12.819 1.00 0.00 ? 60  TYR A HA   7  
ATOM 10967 H HB2  . TYR A 1 60  ? -3.407  -6.615  -11.062 1.00 0.00 ? 60  TYR A HB2  7  
ATOM 10968 H HB3  . TYR A 1 60  ? -3.210  -7.220  -12.701 1.00 0.00 ? 60  TYR A HB3  7  
ATOM 10969 H HD1  . TYR A 1 60  ? -3.275  -3.859  -10.960 1.00 0.00 ? 60  TYR A HD1  7  
ATOM 10970 H HD2  . TYR A 1 60  ? -1.404  -6.421  -13.855 1.00 0.00 ? 60  TYR A HD2  7  
ATOM 10971 H HE1  . TYR A 1 60  ? -1.614  -2.094  -11.470 1.00 0.00 ? 60  TYR A HE1  7  
ATOM 10972 H HE2  . TYR A 1 60  ? 0.253   -4.659  -14.360 1.00 0.00 ? 60  TYR A HE2  7  
ATOM 10973 H HH   . TYR A 1 60  ? 1.156   -2.696  -13.523 1.00 0.00 ? 60  TYR A HH   7  
ATOM 10974 N N    . PHE A 1 61  ? -5.459  -4.087  -10.934 1.00 0.00 ? 61  PHE A N    7  
ATOM 10975 C CA   . PHE A 1 61  ? -6.075  -3.552  -9.694  1.00 0.00 ? 61  PHE A CA   7  
ATOM 10976 C C    . PHE A 1 61  ? -7.578  -3.401  -9.879  1.00 0.00 ? 61  PHE A C    7  
ATOM 10977 O O    . PHE A 1 61  ? -8.062  -2.471  -10.492 1.00 0.00 ? 61  PHE A O    7  
ATOM 10978 C CB   . PHE A 1 61  ? -5.434  -2.215  -9.344  1.00 0.00 ? 61  PHE A CB   7  
ATOM 10979 C CG   . PHE A 1 61  ? -4.031  -2.495  -8.879  1.00 0.00 ? 61  PHE A CG   7  
ATOM 10980 C CD1  . PHE A 1 61  ? -3.819  -3.323  -7.770  1.00 0.00 ? 61  PHE A CD1  7  
ATOM 10981 C CD2  . PHE A 1 61  ? -2.942  -1.959  -9.569  1.00 0.00 ? 61  PHE A CD2  7  
ATOM 10982 C CE1  . PHE A 1 61  ? -2.522  -3.606  -7.351  1.00 0.00 ? 61  PHE A CE1  7  
ATOM 10983 C CE2  . PHE A 1 61  ? -1.643  -2.245  -9.152  1.00 0.00 ? 61  PHE A CE2  7  
ATOM 10984 C CZ   . PHE A 1 61  ? -1.431  -3.070  -8.041  1.00 0.00 ? 61  PHE A CZ   7  
ATOM 10985 H H    . PHE A 1 61  ? -4.990  -3.489  -11.553 1.00 0.00 ? 61  PHE A H    7  
ATOM 10986 H HA   . PHE A 1 61  ? -5.892  -4.247  -8.887  1.00 0.00 ? 61  PHE A HA   7  
ATOM 10987 H HB2  . PHE A 1 61  ? -5.413  -1.578  -10.218 1.00 0.00 ? 61  PHE A HB2  7  
ATOM 10988 H HB3  . PHE A 1 61  ? -5.991  -1.736  -8.553  1.00 0.00 ? 61  PHE A HB3  7  
ATOM 10989 H HD1  . PHE A 1 61  ? -4.657  -3.739  -7.233  1.00 0.00 ? 61  PHE A HD1  7  
ATOM 10990 H HD2  . PHE A 1 61  ? -3.101  -1.323  -10.422 1.00 0.00 ? 61  PHE A HD2  7  
ATOM 10991 H HE1  . PHE A 1 61  ? -2.364  -4.246  -6.501  1.00 0.00 ? 61  PHE A HE1  7  
ATOM 10992 H HE2  . PHE A 1 61  ? -0.806  -1.834  -9.695  1.00 0.00 ? 61  PHE A HE2  7  
ATOM 10993 H HZ   . PHE A 1 61  ? -0.427  -3.290  -7.716  1.00 0.00 ? 61  PHE A HZ   7  
ATOM 10994 N N    . ILE A 1 62  ? -8.310  -4.333  -9.343  1.00 0.00 ? 62  ILE A N    7  
ATOM 10995 C CA   . ILE A 1 62  ? -9.793  -4.297  -9.458  1.00 0.00 ? 62  ILE A CA   7  
ATOM 10996 C C    . ILE A 1 62  ? -10.378 -3.547  -8.259  1.00 0.00 ? 62  ILE A C    7  
ATOM 10997 O O    . ILE A 1 62  ? -9.679  -3.214  -7.322  1.00 0.00 ? 62  ILE A O    7  
ATOM 10998 C CB   . ILE A 1 62  ? -10.332 -5.733  -9.484  1.00 0.00 ? 62  ILE A CB   7  
ATOM 10999 C CG1  . ILE A 1 62  ? -10.323 -6.317  -8.067  1.00 0.00 ? 62  ILE A CG1  7  
ATOM 11000 C CG2  . ILE A 1 62  ? -9.445  -6.596  -10.384 1.00 0.00 ? 62  ILE A CG2  7  
ATOM 11001 C CD1  . ILE A 1 62  ? -10.748 -7.785  -8.116  1.00 0.00 ? 62  ILE A CD1  7  
ATOM 11002 H H    . ILE A 1 62  ? -7.874  -5.066  -8.860  1.00 0.00 ? 62  ILE A H    7  
ATOM 11003 H HA   . ILE A 1 62  ? -10.072 -3.790  -10.371 1.00 0.00 ? 62  ILE A HA   7  
ATOM 11004 H HB   . ILE A 1 62  ? -11.342 -5.732  -9.869  1.00 0.00 ? 62  ILE A HB   7  
ATOM 11005 H HG12 . ILE A 1 62  ? -9.327  -6.243  -7.655  1.00 0.00 ? 62  ILE A HG12 7  
ATOM 11006 H HG13 . ILE A 1 62  ? -11.012 -5.765  -7.446  1.00 0.00 ? 62  ILE A HG13 7  
ATOM 11007 H HG21 . ILE A 1 62  ? -10.049 -7.343  -10.877 1.00 0.00 ? 62  ILE A HG21 7  
ATOM 11008 H HG22 . ILE A 1 62  ? -8.690  -7.084  -9.784  1.00 0.00 ? 62  ILE A HG22 7  
ATOM 11009 H HG23 . ILE A 1 62  ? -8.968  -5.972  -11.126 1.00 0.00 ? 62  ILE A HG23 7  
ATOM 11010 H HD11 . ILE A 1 62  ? -10.074 -8.376  -7.514  1.00 0.00 ? 62  ILE A HD11 7  
ATOM 11011 H HD12 . ILE A 1 62  ? -10.718 -8.135  -9.137  1.00 0.00 ? 62  ILE A HD12 7  
ATOM 11012 H HD13 . ILE A 1 62  ? -11.753 -7.883  -7.733  1.00 0.00 ? 62  ILE A HD13 7  
ATOM 11013 N N    . LYS A 1 63  ? -11.656 -3.285  -8.276  1.00 0.00 ? 63  LYS A N    7  
ATOM 11014 C CA   . LYS A 1 63  ? -12.284 -2.566  -7.132  1.00 0.00 ? 63  LYS A CA   7  
ATOM 11015 C C    . LYS A 1 63  ? -13.349 -3.462  -6.498  1.00 0.00 ? 63  LYS A C    7  
ATOM 11016 O O    . LYS A 1 63  ? -14.190 -4.017  -7.177  1.00 0.00 ? 63  LYS A O    7  
ATOM 11017 C CB   . LYS A 1 63  ? -12.932 -1.275  -7.633  1.00 0.00 ? 63  LYS A CB   7  
ATOM 11018 C CG   . LYS A 1 63  ? -12.475 -0.103  -6.762  1.00 0.00 ? 63  LYS A CG   7  
ATOM 11019 C CD   . LYS A 1 63  ? -13.044 1.201   -7.324  1.00 0.00 ? 63  LYS A CD   7  
ATOM 11020 C CE   . LYS A 1 63  ? -13.776 1.961   -6.215  1.00 0.00 ? 63  LYS A CE   7  
ATOM 11021 N NZ   . LYS A 1 63  ? -15.238 1.977   -6.506  1.00 0.00 ? 63  LYS A NZ   7  
ATOM 11022 H H    . LYS A 1 63  ? -12.203 -3.568  -9.037  1.00 0.00 ? 63  LYS A H    7  
ATOM 11023 H HA   . LYS A 1 63  ? -11.529 -2.330  -6.398  1.00 0.00 ? 63  LYS A HA   7  
ATOM 11024 H HB2  . LYS A 1 63  ? -12.641 -1.099  -8.658  1.00 0.00 ? 63  LYS A HB2  7  
ATOM 11025 H HB3  . LYS A 1 63  ? -14.007 -1.366  -7.576  1.00 0.00 ? 63  LYS A HB3  7  
ATOM 11026 H HG2  . LYS A 1 63  ? -12.830 -0.246  -5.751  1.00 0.00 ? 63  LYS A HG2  7  
ATOM 11027 H HG3  . LYS A 1 63  ? -11.397 -0.053  -6.763  1.00 0.00 ? 63  LYS A HG3  7  
ATOM 11028 H HD2  . LYS A 1 63  ? -12.238 1.810   -7.707  1.00 0.00 ? 63  LYS A HD2  7  
ATOM 11029 H HD3  . LYS A 1 63  ? -13.737 0.978   -8.121  1.00 0.00 ? 63  LYS A HD3  7  
ATOM 11030 H HE2  . LYS A 1 63  ? -13.602 1.471   -5.268  1.00 0.00 ? 63  LYS A HE2  7  
ATOM 11031 H HE3  . LYS A 1 63  ? -13.407 2.975   -6.169  1.00 0.00 ? 63  LYS A HE3  7  
ATOM 11032 H HZ1  . LYS A 1 63  ? -15.631 1.025   -6.359  1.00 0.00 ? 63  LYS A HZ1  7  
ATOM 11033 H HZ2  . LYS A 1 63  ? -15.392 2.269   -7.492  1.00 0.00 ? 63  LYS A HZ2  7  
ATOM 11034 H HZ3  . LYS A 1 63  ? -15.712 2.646   -5.867  1.00 0.00 ? 63  LYS A HZ3  7  
ATOM 11035 N N    . VAL A 1 64  ? -13.319 -3.611  -5.202  1.00 0.00 ? 64  VAL A N    7  
ATOM 11036 C CA   . VAL A 1 64  ? -14.330 -4.475  -4.532  1.00 0.00 ? 64  VAL A CA   7  
ATOM 11037 C C    . VAL A 1 64  ? -14.955 -3.724  -3.352  1.00 0.00 ? 64  VAL A C    7  
ATOM 11038 O O    . VAL A 1 64  ? -14.475 -3.813  -2.239  1.00 0.00 ? 64  VAL A O    7  
ATOM 11039 C CB   . VAL A 1 64  ? -13.650 -5.747  -4.022  1.00 0.00 ? 64  VAL A CB   7  
ATOM 11040 C CG1  . VAL A 1 64  ? -12.546 -5.374  -3.032  1.00 0.00 ? 64  VAL A CG1  7  
ATOM 11041 C CG2  . VAL A 1 64  ? -14.683 -6.630  -3.320  1.00 0.00 ? 64  VAL A CG2  7  
ATOM 11042 H H    . VAL A 1 64  ? -12.632 -3.157  -4.672  1.00 0.00 ? 64  VAL A H    7  
ATOM 11043 H HA   . VAL A 1 64  ? -15.102 -4.740  -5.239  1.00 0.00 ? 64  VAL A HA   7  
ATOM 11044 H HB   . VAL A 1 64  ? -13.220 -6.284  -4.855  1.00 0.00 ? 64  VAL A HB   7  
ATOM 11045 H HG11 . VAL A 1 64  ? -11.596 -5.733  -3.401  1.00 0.00 ? 64  VAL A HG11 7  
ATOM 11046 H HG12 . VAL A 1 64  ? -12.754 -5.826  -2.074  1.00 0.00 ? 64  VAL A HG12 7  
ATOM 11047 H HG13 . VAL A 1 64  ? -12.507 -4.300  -2.924  1.00 0.00 ? 64  VAL A HG13 7  
ATOM 11048 H HG21 . VAL A 1 64  ? -14.971 -7.438  -3.976  1.00 0.00 ? 64  VAL A HG21 7  
ATOM 11049 H HG22 . VAL A 1 64  ? -15.552 -6.040  -3.072  1.00 0.00 ? 64  VAL A HG22 7  
ATOM 11050 H HG23 . VAL A 1 64  ? -14.255 -7.036  -2.416  1.00 0.00 ? 64  VAL A HG23 7  
ATOM 11051 N N    . PRO A 1 65  ? -16.015 -3.009  -3.633  1.00 0.00 ? 65  PRO A N    7  
ATOM 11052 C CA   . PRO A 1 65  ? -16.742 -2.233  -2.616  1.00 0.00 ? 65  PRO A CA   7  
ATOM 11053 C C    . PRO A 1 65  ? -17.630 -3.162  -1.780  1.00 0.00 ? 65  PRO A C    7  
ATOM 11054 O O    . PRO A 1 65  ? -17.440 -4.361  -1.759  1.00 0.00 ? 65  PRO A O    7  
ATOM 11055 C CB   . PRO A 1 65  ? -17.587 -1.260  -3.442  1.00 0.00 ? 65  PRO A CB   7  
ATOM 11056 C CG   . PRO A 1 65  ? -17.733 -1.892  -4.846  1.00 0.00 ? 65  PRO A CG   7  
ATOM 11057 C CD   . PRO A 1 65  ? -16.583 -2.908  -4.994  1.00 0.00 ? 65  PRO A CD   7  
ATOM 11058 H HA   . PRO A 1 65  ? -16.058 -1.688  -1.987  1.00 0.00 ? 65  PRO A HA   7  
ATOM 11059 H HB2  . PRO A 1 65  ? -18.560 -1.133  -2.986  1.00 0.00 ? 65  PRO A HB2  7  
ATOM 11060 H HB3  . PRO A 1 65  ? -17.087 -0.307  -3.523  1.00 0.00 ? 65  PRO A HB3  7  
ATOM 11061 H HG2  . PRO A 1 65  ? -18.687 -2.394  -4.928  1.00 0.00 ? 65  PRO A HG2  7  
ATOM 11062 H HG3  . PRO A 1 65  ? -17.647 -1.132  -5.607  1.00 0.00 ? 65  PRO A HG3  7  
ATOM 11063 H HD2  . PRO A 1 65  ? -16.966 -3.865  -5.320  1.00 0.00 ? 65  PRO A HD2  7  
ATOM 11064 H HD3  . PRO A 1 65  ? -15.838 -2.540  -5.682  1.00 0.00 ? 65  PRO A HD3  7  
ATOM 11065 N N    . ARG A 1 66  ? -18.597 -2.620  -1.091  1.00 0.00 ? 66  ARG A N    7  
ATOM 11066 C CA   . ARG A 1 66  ? -19.488 -3.481  -0.263  1.00 0.00 ? 66  ARG A CA   7  
ATOM 11067 C C    . ARG A 1 66  ? -20.543 -2.618  0.432   1.00 0.00 ? 66  ARG A C    7  
ATOM 11068 O O    . ARG A 1 66  ? -20.228 -1.730  1.198   1.00 0.00 ? 66  ARG A O    7  
ATOM 11069 C CB   . ARG A 1 66  ? -18.653 -4.208  0.795   1.00 0.00 ? 66  ARG A CB   7  
ATOM 11070 C CG   . ARG A 1 66  ? -19.402 -5.456  1.267   1.00 0.00 ? 66  ARG A CG   7  
ATOM 11071 C CD   . ARG A 1 66  ? -19.415 -6.497  0.146   1.00 0.00 ? 66  ARG A CD   7  
ATOM 11072 N NE   . ARG A 1 66  ? -18.195 -7.346  0.244   1.00 0.00 ? 66  ARG A NE   7  
ATOM 11073 C CZ   . ARG A 1 66  ? -18.288 -8.578  0.664   1.00 0.00 ? 66  ARG A CZ   7  
ATOM 11074 N NH1  . ARG A 1 66  ? -19.239 -9.350  0.215   1.00 0.00 ? 66  ARG A NH1  7  
ATOM 11075 N NH2  . ARG A 1 66  ? -17.430 -9.039  1.533   1.00 0.00 ? 66  ARG A NH2  7  
ATOM 11076 H H    . ARG A 1 66  ? -18.738 -1.650  -1.118  1.00 0.00 ? 66  ARG A H    7  
ATOM 11077 H HA   . ARG A 1 66  ? -19.977 -4.207  -0.895  1.00 0.00 ? 66  ARG A HA   7  
ATOM 11078 H HB2  . ARG A 1 66  ? -17.703 -4.497  0.368   1.00 0.00 ? 66  ARG A HB2  7  
ATOM 11079 H HB3  . ARG A 1 66  ? -18.487 -3.553  1.636   1.00 0.00 ? 66  ARG A HB3  7  
ATOM 11080 H HG2  . ARG A 1 66  ? -18.907 -5.867  2.136   1.00 0.00 ? 66  ARG A HG2  7  
ATOM 11081 H HG3  . ARG A 1 66  ? -20.417 -5.192  1.521   1.00 0.00 ? 66  ARG A HG3  7  
ATOM 11082 H HD2  . ARG A 1 66  ? -20.294 -7.117  0.241   1.00 0.00 ? 66  ARG A HD2  7  
ATOM 11083 H HD3  . ARG A 1 66  ? -19.429 -5.996  -0.810  1.00 0.00 ? 66  ARG A HD3  7  
ATOM 11084 H HE   . ARG A 1 66  ? -17.322 -6.980  -0.008  1.00 0.00 ? 66  ARG A HE   7  
ATOM 11085 H HH11 . ARG A 1 66  ? -19.897 -8.998  -0.451  1.00 0.00 ? 66  ARG A HH11 7  
ATOM 11086 H HH12 . ARG A 1 66  ? -19.311 -10.294 0.537   1.00 0.00 ? 66  ARG A HH12 7  
ATOM 11087 H HH21 . ARG A 1 66  ? -16.701 -8.448  1.878   1.00 0.00 ? 66  ARG A HH21 7  
ATOM 11088 H HH22 . ARG A 1 66  ? -17.503 -9.984  1.854   1.00 0.00 ? 66  ARG A HH22 7  
ATOM 11089 N N    . SER A 1 67  ? -21.796 -2.879  0.172   1.00 0.00 ? 67  SER A N    7  
ATOM 11090 C CA   . SER A 1 67  ? -22.873 -2.079  0.820   1.00 0.00 ? 67  SER A CA   7  
ATOM 11091 C C    . SER A 1 67  ? -23.692 -2.990  1.738   1.00 0.00 ? 67  SER A C    7  
ATOM 11092 O O    . SER A 1 67  ? -24.831 -2.710  2.054   1.00 0.00 ? 67  SER A O    7  
ATOM 11093 C CB   . SER A 1 67  ? -23.787 -1.485  -0.253  1.00 0.00 ? 67  SER A CB   7  
ATOM 11094 O OG   . SER A 1 67  ? -22.997 -1.049  -1.351  1.00 0.00 ? 67  SER A OG   7  
ATOM 11095 H H    . SER A 1 67  ? -22.027 -3.603  -0.446  1.00 0.00 ? 67  SER A H    7  
ATOM 11096 H HA   . SER A 1 67  ? -22.433 -1.283  1.402   1.00 0.00 ? 67  SER A HA   7  
ATOM 11097 H HB2  . SER A 1 67  ? -24.482 -2.234  -0.592  1.00 0.00 ? 67  SER A HB2  7  
ATOM 11098 H HB3  . SER A 1 67  ? -24.334 -0.651  0.164   1.00 0.00 ? 67  SER A HB3  7  
ATOM 11099 H HG   . SER A 1 67  ? -23.159 -0.110  -1.478  1.00 0.00 ? 67  SER A HG   7  
ATOM 11100 N N    . GLN A 1 68  ? -23.118 -4.084  2.162   1.00 0.00 ? 68  GLN A N    7  
ATOM 11101 C CA   . GLN A 1 68  ? -23.860 -5.019  3.052   1.00 0.00 ? 68  GLN A CA   7  
ATOM 11102 C C    . GLN A 1 68  ? -23.284 -4.953  4.471   1.00 0.00 ? 68  GLN A C    7  
ATOM 11103 O O    . GLN A 1 68  ? -24.004 -4.790  5.435   1.00 0.00 ? 68  GLN A O    7  
ATOM 11104 C CB   . GLN A 1 68  ? -23.722 -6.446  2.515   1.00 0.00 ? 68  GLN A CB   7  
ATOM 11105 C CG   . GLN A 1 68  ? -24.577 -7.395  3.356   1.00 0.00 ? 68  GLN A CG   7  
ATOM 11106 C CD   . GLN A 1 68  ? -24.875 -8.661  2.552   1.00 0.00 ? 68  GLN A CD   7  
ATOM 11107 O OE1  . GLN A 1 68  ? -25.916 -8.772  1.933   1.00 0.00 ? 68  GLN A OE1  7  
ATOM 11108 N NE2  . GLN A 1 68  ? -24.001 -9.631  2.534   1.00 0.00 ? 68  GLN A NE2  7  
ATOM 11109 H H    . GLN A 1 68  ? -22.201 -4.290  1.888   1.00 0.00 ? 68  GLN A H    7  
ATOM 11110 H HA   . GLN A 1 68  ? -24.904 -4.743  3.075   1.00 0.00 ? 68  GLN A HA   7  
ATOM 11111 H HB2  . GLN A 1 68  ? -24.056 -6.475  1.487   1.00 0.00 ? 68  GLN A HB2  7  
ATOM 11112 H HB3  . GLN A 1 68  ? -22.688 -6.752  2.567   1.00 0.00 ? 68  GLN A HB3  7  
ATOM 11113 H HG2  . GLN A 1 68  ? -24.041 -7.657  4.257   1.00 0.00 ? 68  GLN A HG2  7  
ATOM 11114 H HG3  . GLN A 1 68  ? -25.505 -6.909  3.618   1.00 0.00 ? 68  GLN A HG3  7  
ATOM 11115 H HE21 . GLN A 1 68  ? -23.162 -9.543  3.032   1.00 0.00 ? 68  GLN A HE21 7  
ATOM 11116 H HE22 . GLN A 1 68  ? -24.184 -10.446 2.021   1.00 0.00 ? 68  GLN A HE22 7  
ATOM 11117 N N    . GLU A 1 69  ? -21.993 -5.083  4.607   1.00 0.00 ? 69  GLU A N    7  
ATOM 11118 C CA   . GLU A 1 69  ? -21.378 -5.034  5.963   1.00 0.00 ? 69  GLU A CA   7  
ATOM 11119 C C    . GLU A 1 69  ? -21.335 -3.589  6.464   1.00 0.00 ? 69  GLU A C    7  
ATOM 11120 O O    . GLU A 1 69  ? -21.971 -3.242  7.439   1.00 0.00 ? 69  GLU A O    7  
ATOM 11121 C CB   . GLU A 1 69  ? -19.955 -5.592  5.897   1.00 0.00 ? 69  GLU A CB   7  
ATOM 11122 C CG   . GLU A 1 69  ? -19.485 -5.956  7.306   1.00 0.00 ? 69  GLU A CG   7  
ATOM 11123 C CD   . GLU A 1 69  ? -19.981 -7.359  7.664   1.00 0.00 ? 69  GLU A CD   7  
ATOM 11124 O OE1  . GLU A 1 69  ? -21.164 -7.498  7.924   1.00 0.00 ? 69  GLU A OE1  7  
ATOM 11125 O OE2  . GLU A 1 69  ? -19.168 -8.269  7.672   1.00 0.00 ? 69  GLU A OE2  7  
ATOM 11126 H H    . GLU A 1 69  ? -21.427 -5.220  3.819   1.00 0.00 ? 69  GLU A H    7  
ATOM 11127 H HA   . GLU A 1 69  ? -21.965 -5.633  6.645   1.00 0.00 ? 69  GLU A HA   7  
ATOM 11128 H HB2  . GLU A 1 69  ? -19.943 -6.474  5.273   1.00 0.00 ? 69  GLU A HB2  7  
ATOM 11129 H HB3  . GLU A 1 69  ? -19.294 -4.847  5.481   1.00 0.00 ? 69  GLU A HB3  7  
ATOM 11130 H HG2  . GLU A 1 69  ? -18.405 -5.935  7.343   1.00 0.00 ? 69  GLU A HG2  7  
ATOM 11131 H HG3  . GLU A 1 69  ? -19.883 -5.244  8.014   1.00 0.00 ? 69  GLU A HG3  7  
ATOM 11132 N N    . GLU A 1 70  ? -20.586 -2.745  5.810   1.00 0.00 ? 70  GLU A N    7  
ATOM 11133 C CA   . GLU A 1 70  ? -20.501 -1.325  6.256   1.00 0.00 ? 70  GLU A CA   7  
ATOM 11134 C C    . GLU A 1 70  ? -21.884 -0.674  6.164   1.00 0.00 ? 70  GLU A C    7  
ATOM 11135 O O    . GLU A 1 70  ? -22.718 -1.099  5.389   1.00 0.00 ? 70  GLU A O    7  
ATOM 11136 C CB   . GLU A 1 70  ? -19.520 -0.567  5.360   1.00 0.00 ? 70  GLU A CB   7  
ATOM 11137 C CG   . GLU A 1 70  ? -18.166 -1.278  5.368   1.00 0.00 ? 70  GLU A CG   7  
ATOM 11138 C CD   . GLU A 1 70  ? -17.075 -0.303  4.923   1.00 0.00 ? 70  GLU A CD   7  
ATOM 11139 O OE1  . GLU A 1 70  ? -17.276 0.890   5.071   1.00 0.00 ? 70  GLU A OE1  7  
ATOM 11140 O OE2  . GLU A 1 70  ? -16.054 -0.768  4.442   1.00 0.00 ? 70  GLU A OE2  7  
ATOM 11141 H H    . GLU A 1 70  ? -20.076 -3.044  5.028   1.00 0.00 ? 70  GLU A H    7  
ATOM 11142 H HA   . GLU A 1 70  ? -20.154 -1.291  7.278   1.00 0.00 ? 70  GLU A HA   7  
ATOM 11143 H HB2  . GLU A 1 70  ? -19.906 -0.536  4.351   1.00 0.00 ? 70  GLU A HB2  7  
ATOM 11144 H HB3  . GLU A 1 70  ? -19.398 0.439   5.730   1.00 0.00 ? 70  GLU A HB3  7  
ATOM 11145 H HG2  . GLU A 1 70  ? -17.952 -1.630  6.367   1.00 0.00 ? 70  GLU A HG2  7  
ATOM 11146 H HG3  . GLU A 1 70  ? -18.196 -2.117  4.689   1.00 0.00 ? 70  GLU A HG3  7  
ATOM 11147 N N    . PRO A 1 71  ? -22.081 0.344   6.963   1.00 0.00 ? 71  PRO A N    7  
ATOM 11148 C CA   . PRO A 1 71  ? -23.350 1.088   7.002   1.00 0.00 ? 71  PRO A CA   7  
ATOM 11149 C C    . PRO A 1 71  ? -23.439 2.054   5.817   1.00 0.00 ? 71  PRO A C    7  
ATOM 11150 O O    . PRO A 1 71  ? -24.388 2.801   5.682   1.00 0.00 ? 71  PRO A O    7  
ATOM 11151 C CB   . PRO A 1 71  ? -23.278 1.852   8.328   1.00 0.00 ? 71  PRO A CB   7  
ATOM 11152 C CG   . PRO A 1 71  ? -21.777 1.956   8.690   1.00 0.00 ? 71  PRO A CG   7  
ATOM 11153 C CD   . PRO A 1 71  ? -21.055 0.846   7.900   1.00 0.00 ? 71  PRO A CD   7  
ATOM 11154 H HA   . PRO A 1 71  ? -24.190 0.412   7.010   1.00 0.00 ? 71  PRO A HA   7  
ATOM 11155 H HB2  . PRO A 1 71  ? -23.704 2.838   8.209   1.00 0.00 ? 71  PRO A HB2  7  
ATOM 11156 H HB3  . PRO A 1 71  ? -23.800 1.309   9.099   1.00 0.00 ? 71  PRO A HB3  7  
ATOM 11157 H HG2  . PRO A 1 71  ? -21.394 2.926   8.405   1.00 0.00 ? 71  PRO A HG2  7  
ATOM 11158 H HG3  . PRO A 1 71  ? -21.639 1.797   9.748   1.00 0.00 ? 71  PRO A HG3  7  
ATOM 11159 H HD2  . PRO A 1 71  ? -20.212 1.256   7.361   1.00 0.00 ? 71  PRO A HD2  7  
ATOM 11160 H HD3  . PRO A 1 71  ? -20.736 0.057   8.562   1.00 0.00 ? 71  PRO A HD3  7  
ATOM 11161 N N    . GLY A 1 72  ? -22.455 2.046   4.959   1.00 0.00 ? 72  GLY A N    7  
ATOM 11162 C CA   . GLY A 1 72  ? -22.482 2.965   3.785   1.00 0.00 ? 72  GLY A CA   7  
ATOM 11163 C C    . GLY A 1 72  ? -21.726 2.323   2.620   1.00 0.00 ? 72  GLY A C    7  
ATOM 11164 O O    . GLY A 1 72  ? -21.430 1.145   2.633   1.00 0.00 ? 72  GLY A O    7  
ATOM 11165 H H    . GLY A 1 72  ? -21.698 1.437   5.087   1.00 0.00 ? 72  GLY A H    7  
ATOM 11166 H HA2  . GLY A 1 72  ? -23.507 3.145   3.493   1.00 0.00 ? 72  GLY A HA2  7  
ATOM 11167 H HA3  . GLY A 1 72  ? -22.010 3.901   4.049   1.00 0.00 ? 72  GLY A HA3  7  
ATOM 11168 N N    . LYS A 1 73  ? -21.409 3.089   1.611   1.00 0.00 ? 73  LYS A N    7  
ATOM 11169 C CA   . LYS A 1 73  ? -20.672 2.519   0.448   1.00 0.00 ? 73  LYS A CA   7  
ATOM 11170 C C    . LYS A 1 73  ? -19.249 2.156   0.879   1.00 0.00 ? 73  LYS A C    7  
ATOM 11171 O O    . LYS A 1 73  ? -18.460 3.010   1.230   1.00 0.00 ? 73  LYS A O    7  
ATOM 11172 C CB   . LYS A 1 73  ? -20.616 3.554   -0.678  1.00 0.00 ? 73  LYS A CB   7  
ATOM 11173 C CG   . LYS A 1 73  ? -19.930 4.826   -0.173  1.00 0.00 ? 73  LYS A CG   7  
ATOM 11174 C CD   . LYS A 1 73  ? -20.121 5.950   -1.195  1.00 0.00 ? 73  LYS A CD   7  
ATOM 11175 C CE   . LYS A 1 73  ? -20.128 7.300   -0.475  1.00 0.00 ? 73  LYS A CE   7  
ATOM 11176 N NZ   . LYS A 1 73  ? -18.830 7.995   -0.705  1.00 0.00 ? 73  LYS A NZ   7  
ATOM 11177 H H    . LYS A 1 73  ? -21.656 4.036   1.619   1.00 0.00 ? 73  LYS A H    7  
ATOM 11178 H HA   . LYS A 1 73  ? -21.179 1.633   0.099   1.00 0.00 ? 73  LYS A HA   7  
ATOM 11179 H HB2  . LYS A 1 73  ? -20.058 3.149   -1.511  1.00 0.00 ? 73  LYS A HB2  7  
ATOM 11180 H HB3  . LYS A 1 73  ? -21.620 3.792   -0.999  1.00 0.00 ? 73  LYS A HB3  7  
ATOM 11181 H HG2  . LYS A 1 73  ? -20.366 5.119   0.771   1.00 0.00 ? 73  LYS A HG2  7  
ATOM 11182 H HG3  . LYS A 1 73  ? -18.876 4.638   -0.041  1.00 0.00 ? 73  LYS A HG3  7  
ATOM 11183 H HD2  . LYS A 1 73  ? -19.311 5.927   -1.911  1.00 0.00 ? 73  LYS A HD2  7  
ATOM 11184 H HD3  . LYS A 1 73  ? -21.060 5.814   -1.708  1.00 0.00 ? 73  LYS A HD3  7  
ATOM 11185 H HE2  . LYS A 1 73  ? -20.934 7.908   -0.858  1.00 0.00 ? 73  LYS A HE2  7  
ATOM 11186 H HE3  . LYS A 1 73  ? -20.268 7.143   0.585   1.00 0.00 ? 73  LYS A HE3  7  
ATOM 11187 H HZ1  . LYS A 1 73  ? -18.505 8.427   0.184   1.00 0.00 ? 73  LYS A HZ1  7  
ATOM 11188 H HZ2  . LYS A 1 73  ? -18.958 8.737   -1.425  1.00 0.00 ? 73  LYS A HZ2  7  
ATOM 11189 H HZ3  . LYS A 1 73  ? -18.122 7.310   -1.034  1.00 0.00 ? 73  LYS A HZ3  7  
ATOM 11190 N N    . GLY A 1 74  ? -18.916 0.894   0.855   1.00 0.00 ? 74  GLY A N    7  
ATOM 11191 C CA   . GLY A 1 74  ? -17.546 0.478   1.263   1.00 0.00 ? 74  GLY A CA   7  
ATOM 11192 C C    . GLY A 1 74  ? -16.602 0.580   0.062   1.00 0.00 ? 74  GLY A C    7  
ATOM 11193 O O    . GLY A 1 74  ? -16.989 0.341   -1.064  1.00 0.00 ? 74  GLY A O    7  
ATOM 11194 H H    . GLY A 1 74  ? -19.569 0.221   0.568   1.00 0.00 ? 74  GLY A H    7  
ATOM 11195 H HA2  . GLY A 1 74  ? -17.193 1.125   2.053   1.00 0.00 ? 74  GLY A HA2  7  
ATOM 11196 H HA3  . GLY A 1 74  ? -17.569 -0.542  1.617   1.00 0.00 ? 74  GLY A HA3  7  
ATOM 11197 N N    . SER A 1 75  ? -15.368 0.933   0.295   1.00 0.00 ? 75  SER A N    7  
ATOM 11198 C CA   . SER A 1 75  ? -14.402 1.050   -0.832  1.00 0.00 ? 75  SER A CA   7  
ATOM 11199 C C    . SER A 1 75  ? -13.088 0.361   -0.456  1.00 0.00 ? 75  SER A C    7  
ATOM 11200 O O    . SER A 1 75  ? -12.315 0.865   0.334   1.00 0.00 ? 75  SER A O    7  
ATOM 11201 C CB   . SER A 1 75  ? -14.136 2.528   -1.122  1.00 0.00 ? 75  SER A CB   7  
ATOM 11202 O OG   . SER A 1 75  ? -15.371 3.189   -1.366  1.00 0.00 ? 75  SER A OG   7  
ATOM 11203 H H    . SER A 1 75  ? -15.077 1.121   1.213   1.00 0.00 ? 75  SER A H    7  
ATOM 11204 H HA   . SER A 1 75  ? -14.816 0.581   -1.711  1.00 0.00 ? 75  SER A HA   7  
ATOM 11205 H HB2  . SER A 1 75  ? -13.653 2.984   -0.274  1.00 0.00 ? 75  SER A HB2  7  
ATOM 11206 H HB3  . SER A 1 75  ? -13.493 2.614   -1.989  1.00 0.00 ? 75  SER A HB3  7  
ATOM 11207 H HG   . SER A 1 75  ? -15.560 3.127   -2.306  1.00 0.00 ? 75  SER A HG   7  
ATOM 11208 N N    . PHE A 1 76  ? -12.828 -0.788  -1.018  1.00 0.00 ? 76  PHE A N    7  
ATOM 11209 C CA   . PHE A 1 76  ? -11.563 -1.507  -0.697  1.00 0.00 ? 76  PHE A CA   7  
ATOM 11210 C C    . PHE A 1 76  ? -10.822 -1.830  -1.996  1.00 0.00 ? 76  PHE A C    7  
ATOM 11211 O O    . PHE A 1 76  ? -11.338 -2.506  -2.864  1.00 0.00 ? 76  PHE A O    7  
ATOM 11212 C CB   . PHE A 1 76  ? -11.882 -2.807  0.044   1.00 0.00 ? 76  PHE A CB   7  
ATOM 11213 C CG   . PHE A 1 76  ? -10.800 -3.087  1.060   1.00 0.00 ? 76  PHE A CG   7  
ATOM 11214 C CD1  . PHE A 1 76  ? -9.473  -3.249  0.645   1.00 0.00 ? 76  PHE A CD1  7  
ATOM 11215 C CD2  . PHE A 1 76  ? -11.125 -3.187  2.418   1.00 0.00 ? 76  PHE A CD2  7  
ATOM 11216 C CE1  . PHE A 1 76  ? -8.470  -3.510  1.587   1.00 0.00 ? 76  PHE A CE1  7  
ATOM 11217 C CE2  . PHE A 1 76  ? -10.124 -3.448  3.360   1.00 0.00 ? 76  PHE A CE2  7  
ATOM 11218 C CZ   . PHE A 1 76  ? -8.797  -3.610  2.945   1.00 0.00 ? 76  PHE A CZ   7  
ATOM 11219 H H    . PHE A 1 76  ? -13.464 -1.177  -1.655  1.00 0.00 ? 76  PHE A H    7  
ATOM 11220 H HA   . PHE A 1 76  ? -10.941 -0.880  -0.075  1.00 0.00 ? 76  PHE A HA   7  
ATOM 11221 H HB2  . PHE A 1 76  ? -12.833 -2.711  0.547   1.00 0.00 ? 76  PHE A HB2  7  
ATOM 11222 H HB3  . PHE A 1 76  ? -11.928 -3.622  -0.664  1.00 0.00 ? 76  PHE A HB3  7  
ATOM 11223 H HD1  . PHE A 1 76  ? -9.221  -3.171  -0.403  1.00 0.00 ? 76  PHE A HD1  7  
ATOM 11224 H HD2  . PHE A 1 76  ? -12.149 -3.063  2.738   1.00 0.00 ? 76  PHE A HD2  7  
ATOM 11225 H HE1  . PHE A 1 76  ? -7.447  -3.634  1.267   1.00 0.00 ? 76  PHE A HE1  7  
ATOM 11226 H HE2  . PHE A 1 76  ? -10.375 -3.525  4.408   1.00 0.00 ? 76  PHE A HE2  7  
ATOM 11227 H HZ   . PHE A 1 76  ? -8.025  -3.812  3.673   1.00 0.00 ? 76  PHE A HZ   7  
ATOM 11228 N N    . TRP A 1 77  ? -9.619  -1.348  -2.140  1.00 0.00 ? 77  TRP A N    7  
ATOM 11229 C CA   . TRP A 1 77  ? -8.850  -1.622  -3.385  1.00 0.00 ? 77  TRP A CA   7  
ATOM 11230 C C    . TRP A 1 77  ? -8.238  -3.025  -3.322  1.00 0.00 ? 77  TRP A C    7  
ATOM 11231 O O    . TRP A 1 77  ? -7.902  -3.518  -2.265  1.00 0.00 ? 77  TRP A O    7  
ATOM 11232 C CB   . TRP A 1 77  ? -7.737  -0.585  -3.523  1.00 0.00 ? 77  TRP A CB   7  
ATOM 11233 C CG   . TRP A 1 77  ? -8.155  0.459   -4.505  1.00 0.00 ? 77  TRP A CG   7  
ATOM 11234 C CD1  . TRP A 1 77  ? -8.329  1.771   -4.223  1.00 0.00 ? 77  TRP A CD1  7  
ATOM 11235 C CD2  . TRP A 1 77  ? -8.457  0.301   -5.920  1.00 0.00 ? 77  TRP A CD2  7  
ATOM 11236 N NE1  . TRP A 1 77  ? -8.714  2.428   -5.378  1.00 0.00 ? 77  TRP A NE1  7  
ATOM 11237 C CE2  . TRP A 1 77  ? -8.808  1.564   -6.450  1.00 0.00 ? 77  TRP A CE2  7  
ATOM 11238 C CE3  . TRP A 1 77  ? -8.460  -0.807  -6.785  1.00 0.00 ? 77  TRP A CE3  7  
ATOM 11239 C CZ2  . TRP A 1 77  ? -9.148  1.722   -7.793  1.00 0.00 ? 77  TRP A CZ2  7  
ATOM 11240 C CZ3  . TRP A 1 77  ? -8.801  -0.652  -8.137  1.00 0.00 ? 77  TRP A CZ3  7  
ATOM 11241 C CH2  . TRP A 1 77  ? -9.143  0.610   -8.640  1.00 0.00 ? 77  TRP A CH2  7  
ATOM 11242 H H    . TRP A 1 77  ? -9.222  -0.800  -1.429  1.00 0.00 ? 77  TRP A H    7  
ATOM 11243 H HA   . TRP A 1 77  ? -9.509  -1.555  -4.237  1.00 0.00 ? 77  TRP A HA   7  
ATOM 11244 H HB2  . TRP A 1 77  ? -7.553  -0.124  -2.563  1.00 0.00 ? 77  TRP A HB2  7  
ATOM 11245 H HB3  . TRP A 1 77  ? -6.834  -1.067  -3.870  1.00 0.00 ? 77  TRP A HB3  7  
ATOM 11246 H HD1  . TRP A 1 77  ? -8.186  2.231   -3.256  1.00 0.00 ? 77  TRP A HD1  7  
ATOM 11247 H HE1  . TRP A 1 77  ? -8.902  3.386   -5.446  1.00 0.00 ? 77  TRP A HE1  7  
ATOM 11248 H HE3  . TRP A 1 77  ? -8.197  -1.783  -6.408  1.00 0.00 ? 77  TRP A HE3  7  
ATOM 11249 H HZ2  . TRP A 1 77  ? -9.411  2.697   -8.177  1.00 0.00 ? 77  TRP A HZ2  7  
ATOM 11250 H HZ3  . TRP A 1 77  ? -8.800  -1.508  -8.792  1.00 0.00 ? 77  TRP A HZ3  7  
ATOM 11251 H HH2  . TRP A 1 77  ? -9.400  0.723   -9.679  1.00 0.00 ? 77  TRP A HH2  7  
ATOM 11252 N N    . ARG A 1 78  ? -8.097  -3.672  -4.448  1.00 0.00 ? 78  ARG A N    7  
ATOM 11253 C CA   . ARG A 1 78  ? -7.510  -5.043  -4.455  1.00 0.00 ? 78  ARG A CA   7  
ATOM 11254 C C    . ARG A 1 78  ? -7.016  -5.383  -5.861  1.00 0.00 ? 78  ARG A C    7  
ATOM 11255 O O    . ARG A 1 78  ? -7.496  -4.853  -6.841  1.00 0.00 ? 78  ARG A O    7  
ATOM 11256 C CB   . ARG A 1 78  ? -8.580  -6.058  -4.051  1.00 0.00 ? 78  ARG A CB   7  
ATOM 11257 C CG   . ARG A 1 78  ? -7.949  -7.442  -3.896  1.00 0.00 ? 78  ARG A CG   7  
ATOM 11258 C CD   . ARG A 1 78  ? -8.998  -8.424  -3.369  1.00 0.00 ? 78  ARG A CD   7  
ATOM 11259 N NE   . ARG A 1 78  ? -9.058  -9.616  -4.261  1.00 0.00 ? 78  ARG A NE   7  
ATOM 11260 C CZ   . ARG A 1 78  ? -10.109 -10.391 -4.244  1.00 0.00 ? 78  ARG A CZ   7  
ATOM 11261 N NH1  . ARG A 1 78  ? -10.309 -11.200 -3.239  1.00 0.00 ? 78  ARG A NH1  7  
ATOM 11262 N NH2  . ARG A 1 78  ? -10.962 -10.356 -5.231  1.00 0.00 ? 78  ARG A NH2  7  
ATOM 11263 H H    . ARG A 1 78  ? -8.380  -3.258  -5.289  1.00 0.00 ? 78  ARG A H    7  
ATOM 11264 H HA   . ARG A 1 78  ? -6.686  -5.089  -3.760  1.00 0.00 ? 78  ARG A HA   7  
ATOM 11265 H HB2  . ARG A 1 78  ? -9.028  -5.757  -3.115  1.00 0.00 ? 78  ARG A HB2  7  
ATOM 11266 H HB3  . ARG A 1 78  ? -9.336  -6.098  -4.818  1.00 0.00 ? 78  ARG A HB3  7  
ATOM 11267 H HG2  . ARG A 1 78  ? -7.584  -7.781  -4.855  1.00 0.00 ? 78  ARG A HG2  7  
ATOM 11268 H HG3  . ARG A 1 78  ? -7.128  -7.388  -3.198  1.00 0.00 ? 78  ARG A HG3  7  
ATOM 11269 H HD2  . ARG A 1 78  ? -8.729  -8.736  -2.371  1.00 0.00 ? 78  ARG A HD2  7  
ATOM 11270 H HD3  . ARG A 1 78  ? -9.963  -7.941  -3.348  1.00 0.00 ? 78  ARG A HD3  7  
ATOM 11271 H HE   . ARG A 1 78  ? -8.310  -9.819  -4.860  1.00 0.00 ? 78  ARG A HE   7  
ATOM 11272 H HH11 . ARG A 1 78  ? -9.656  -11.227 -2.482  1.00 0.00 ? 78  ARG A HH11 7  
ATOM 11273 H HH12 . ARG A 1 78  ? -11.114 -11.793 -3.227  1.00 0.00 ? 78  ARG A HH12 7  
ATOM 11274 H HH21 . ARG A 1 78  ? -10.811 -9.736  -6.001  1.00 0.00 ? 78  ARG A HH21 7  
ATOM 11275 H HH22 . ARG A 1 78  ? -11.767 -10.950 -5.217  1.00 0.00 ? 78  ARG A HH22 7  
ATOM 11276 N N    . ILE A 1 79  ? -6.075  -6.279  -5.965  1.00 0.00 ? 79  ILE A N    7  
ATOM 11277 C CA   . ILE A 1 79  ? -5.563  -6.680  -7.307  1.00 0.00 ? 79  ILE A CA   7  
ATOM 11278 C C    . ILE A 1 79  ? -6.047  -8.103  -7.605  1.00 0.00 ? 79  ILE A C    7  
ATOM 11279 O O    . ILE A 1 79  ? -6.456  -8.822  -6.716  1.00 0.00 ? 79  ILE A O    7  
ATOM 11280 C CB   . ILE A 1 79  ? -4.032  -6.631  -7.316  1.00 0.00 ? 79  ILE A CB   7  
ATOM 11281 C CG1  . ILE A 1 79  ? -3.526  -6.826  -8.744  1.00 0.00 ? 79  ILE A CG1  7  
ATOM 11282 C CG2  . ILE A 1 79  ? -3.471  -7.738  -6.429  1.00 0.00 ? 79  ILE A CG2  7  
ATOM 11283 C CD1  . ILE A 1 79  ? -2.384  -5.847  -9.017  1.00 0.00 ? 79  ILE A CD1  7  
ATOM 11284 H H    . ILE A 1 79  ? -5.717  -6.701  -5.157  1.00 0.00 ? 79  ILE A H    7  
ATOM 11285 H HA   . ILE A 1 79  ? -5.947  -6.006  -8.059  1.00 0.00 ? 79  ILE A HA   7  
ATOM 11286 H HB   . ILE A 1 79  ? -3.702  -5.671  -6.944  1.00 0.00 ? 79  ILE A HB   7  
ATOM 11287 H HG12 . ILE A 1 79  ? -3.170  -7.839  -8.865  1.00 0.00 ? 79  ILE A HG12 7  
ATOM 11288 H HG13 . ILE A 1 79  ? -4.330  -6.640  -9.440  1.00 0.00 ? 79  ILE A HG13 7  
ATOM 11289 H HG21 . ILE A 1 79  ? -4.165  -7.944  -5.630  1.00 0.00 ? 79  ILE A HG21 7  
ATOM 11290 H HG22 . ILE A 1 79  ? -2.524  -7.419  -6.015  1.00 0.00 ? 79  ILE A HG22 7  
ATOM 11291 H HG23 . ILE A 1 79  ? -3.324  -8.630  -7.020  1.00 0.00 ? 79  ILE A HG23 7  
ATOM 11292 H HD11 . ILE A 1 79  ? -2.791  -4.902  -9.345  1.00 0.00 ? 79  ILE A HD11 7  
ATOM 11293 H HD12 . ILE A 1 79  ? -1.741  -6.248  -9.784  1.00 0.00 ? 79  ILE A HD12 7  
ATOM 11294 H HD13 . ILE A 1 79  ? -1.815  -5.699  -8.112  1.00 0.00 ? 79  ILE A HD13 7  
ATOM 11295 N N    . ASP A 1 80  ? -6.021  -8.514  -8.843  1.00 0.00 ? 80  ASP A N    7  
ATOM 11296 C CA   . ASP A 1 80  ? -6.499  -9.885  -9.177  1.00 0.00 ? 80  ASP A CA   7  
ATOM 11297 C C    . ASP A 1 80  ? -5.578  -10.922 -8.530  1.00 0.00 ? 80  ASP A C    7  
ATOM 11298 O O    . ASP A 1 80  ? -4.403  -10.678 -8.347  1.00 0.00 ? 80  ASP A O    7  
ATOM 11299 C CB   . ASP A 1 80  ? -6.499  -10.076 -10.695 1.00 0.00 ? 80  ASP A CB   7  
ATOM 11300 C CG   . ASP A 1 80  ? -7.796  -9.516  -11.282 1.00 0.00 ? 80  ASP A CG   7  
ATOM 11301 O OD1  . ASP A 1 80  ? -8.785  -10.231 -11.274 1.00 0.00 ? 80  ASP A OD1  7  
ATOM 11302 O OD2  . ASP A 1 80  ? -7.779  -8.381  -11.730 1.00 0.00 ? 80  ASP A OD2  7  
ATOM 11303 H H    . ASP A 1 80  ? -5.697  -7.923  -9.551  1.00 0.00 ? 80  ASP A H    7  
ATOM 11304 H HA   . ASP A 1 80  ? -7.503  -10.015 -8.800  1.00 0.00 ? 80  ASP A HA   7  
ATOM 11305 H HB2  . ASP A 1 80  ? -5.656  -9.557  -11.123 1.00 0.00 ? 80  ASP A HB2  7  
ATOM 11306 H HB3  . ASP A 1 80  ? -6.430  -11.129 -10.924 1.00 0.00 ? 80  ASP A HB3  7  
ATOM 11307 N N    . PRO A 1 81  ? -6.149  -12.051 -8.200  1.00 0.00 ? 81  PRO A N    7  
ATOM 11308 C CA   . PRO A 1 81  ? -5.413  -13.158 -7.565  1.00 0.00 ? 81  PRO A CA   7  
ATOM 11309 C C    . PRO A 1 81  ? -4.622  -13.943 -8.615  1.00 0.00 ? 81  PRO A C    7  
ATOM 11310 O O    . PRO A 1 81  ? -3.567  -14.480 -8.339  1.00 0.00 ? 81  PRO A O    7  
ATOM 11311 C CB   . PRO A 1 81  ? -6.522  -14.022 -6.961  1.00 0.00 ? 81  PRO A CB   7  
ATOM 11312 C CG   . PRO A 1 81  ? -7.815  -13.692 -7.748  1.00 0.00 ? 81  PRO A CG   7  
ATOM 11313 C CD   . PRO A 1 81  ? -7.583  -12.328 -8.428  1.00 0.00 ? 81  PRO A CD   7  
ATOM 11314 H HA   . PRO A 1 81  ? -4.763  -12.791 -6.789  1.00 0.00 ? 81  PRO A HA   7  
ATOM 11315 H HB2  . PRO A 1 81  ? -6.275  -15.069 -7.067  1.00 0.00 ? 81  PRO A HB2  7  
ATOM 11316 H HB3  . PRO A 1 81  ? -6.659  -13.775 -5.919  1.00 0.00 ? 81  PRO A HB3  7  
ATOM 11317 H HG2  . PRO A 1 81  ? -7.997  -14.454 -8.492  1.00 0.00 ? 81  PRO A HG2  7  
ATOM 11318 H HG3  . PRO A 1 81  ? -8.653  -13.623 -7.073  1.00 0.00 ? 81  PRO A HG3  7  
ATOM 11319 H HD2  . PRO A 1 81  ? -7.793  -12.395 -9.487  1.00 0.00 ? 81  PRO A HD2  7  
ATOM 11320 H HD3  . PRO A 1 81  ? -8.189  -11.563 -7.968  1.00 0.00 ? 81  PRO A HD3  7  
ATOM 11321 N N    . ALA A 1 82  ? -5.123  -14.015 -9.819  1.00 0.00 ? 82  ALA A N    7  
ATOM 11322 C CA   . ALA A 1 82  ? -4.402  -14.766 -10.883 1.00 0.00 ? 82  ALA A CA   7  
ATOM 11323 C C    . ALA A 1 82  ? -3.439  -13.828 -11.616 1.00 0.00 ? 82  ALA A C    7  
ATOM 11324 O O    . ALA A 1 82  ? -2.506  -14.264 -12.259 1.00 0.00 ? 82  ALA A O    7  
ATOM 11325 C CB   . ALA A 1 82  ? -5.413  -15.340 -11.878 1.00 0.00 ? 82  ALA A CB   7  
ATOM 11326 H H    . ALA A 1 82  ? -5.976  -13.576 -10.021 1.00 0.00 ? 82  ALA A H    7  
ATOM 11327 H HA   . ALA A 1 82  ? -3.843  -15.574 -10.435 1.00 0.00 ? 82  ALA A HA   7  
ATOM 11328 H HB1  . ALA A 1 82  ? -5.246  -14.905 -12.853 1.00 0.00 ? 82  ALA A HB1  7  
ATOM 11329 H HB2  . ALA A 1 82  ? -6.414  -15.109 -11.547 1.00 0.00 ? 82  ALA A HB2  7  
ATOM 11330 H HB3  . ALA A 1 82  ? -5.292  -16.412 -11.937 1.00 0.00 ? 82  ALA A HB3  7  
ATOM 11331 N N    . SER A 1 83  ? -3.654  -12.542 -11.523 1.00 0.00 ? 83  SER A N    7  
ATOM 11332 C CA   . SER A 1 83  ? -2.742  -11.588 -12.214 1.00 0.00 ? 83  SER A CA   7  
ATOM 11333 C C    . SER A 1 83  ? -1.596  -11.222 -11.278 1.00 0.00 ? 83  SER A C    7  
ATOM 11334 O O    . SER A 1 83  ? -0.624  -10.623 -11.682 1.00 0.00 ? 83  SER A O    7  
ATOM 11335 C CB   . SER A 1 83  ? -3.506  -10.313 -12.581 1.00 0.00 ? 83  SER A CB   7  
ATOM 11336 O OG   . SER A 1 83  ? -4.564  -10.636 -13.472 1.00 0.00 ? 83  SER A OG   7  
ATOM 11337 H H    . SER A 1 83  ? -4.408  -12.206 -10.996 1.00 0.00 ? 83  SER A H    7  
ATOM 11338 H HA   . SER A 1 83  ? -2.348  -12.044 -13.110 1.00 0.00 ? 83  SER A HA   7  
ATOM 11339 H HB2  . SER A 1 83  ? -3.915  -9.871  -11.689 1.00 0.00 ? 83  SER A HB2  7  
ATOM 11340 H HB3  . SER A 1 83  ? -2.827  -9.606  -13.048 1.00 0.00 ? 83  SER A HB3  7  
ATOM 11341 H HG   . SER A 1 83  ? -4.223  -10.586 -14.368 1.00 0.00 ? 83  SER A HG   7  
ATOM 11342 N N    . GLU A 1 84  ? -1.704  -11.568 -10.027 1.00 0.00 ? 84  GLU A N    7  
ATOM 11343 C CA   . GLU A 1 84  ? -0.619  -11.212 -9.072  1.00 0.00 ? 84  GLU A CA   7  
ATOM 11344 C C    . GLU A 1 84  ? 0.706   -11.801 -9.543  1.00 0.00 ? 84  GLU A C    7  
ATOM 11345 O O    . GLU A 1 84  ? 1.619   -11.074 -9.870  1.00 0.00 ? 84  GLU A O    7  
ATOM 11346 C CB   . GLU A 1 84  ? -0.950  -11.754 -7.677  1.00 0.00 ? 84  GLU A CB   7  
ATOM 11347 C CG   . GLU A 1 84  ? -1.758  -10.711 -6.902  1.00 0.00 ? 84  GLU A CG   7  
ATOM 11348 C CD   . GLU A 1 84  ? -2.923  -11.397 -6.186  1.00 0.00 ? 84  GLU A CD   7  
ATOM 11349 O OE1  . GLU A 1 84  ? -2.833  -12.593 -5.961  1.00 0.00 ? 84  GLU A OE1  7  
ATOM 11350 O OE2  . GLU A 1 84  ? -3.886  -10.715 -5.876  1.00 0.00 ? 84  GLU A OE2  7  
ATOM 11351 H H    . GLU A 1 84  ? -2.501  -12.045 -9.715  1.00 0.00 ? 84  GLU A H    7  
ATOM 11352 H HA   . GLU A 1 84  ? -0.529  -10.140 -9.027  1.00 0.00 ? 84  GLU A HA   7  
ATOM 11353 H HB2  . GLU A 1 84  ? -1.524  -12.664 -7.769  1.00 0.00 ? 84  GLU A HB2  7  
ATOM 11354 H HB3  . GLU A 1 84  ? -0.032  -11.960 -7.147  1.00 0.00 ? 84  GLU A HB3  7  
ATOM 11355 H HG2  . GLU A 1 84  ? -1.120  -10.230 -6.175  1.00 0.00 ? 84  GLU A HG2  7  
ATOM 11356 H HG3  . GLU A 1 84  ? -2.144  -9.972  -7.588  1.00 0.00 ? 84  GLU A HG3  7  
ATOM 11357 N N    . ALA A 1 85  ? 0.819   -13.103 -9.578  1.00 0.00 ? 85  ALA A N    7  
ATOM 11358 C CA   . ALA A 1 85  ? 2.096   -13.742 -10.024 1.00 0.00 ? 85  ALA A CA   7  
ATOM 11359 C C    . ALA A 1 85  ? 2.732   -12.925 -11.153 1.00 0.00 ? 85  ALA A C    7  
ATOM 11360 O O    . ALA A 1 85  ? 3.937   -12.896 -11.306 1.00 0.00 ? 85  ALA A O    7  
ATOM 11361 C CB   . ALA A 1 85  ? 1.807   -15.159 -10.523 1.00 0.00 ? 85  ALA A CB   7  
ATOM 11362 H H    . ALA A 1 85  ? 0.063   -13.664 -9.305  1.00 0.00 ? 85  ALA A H    7  
ATOM 11363 H HA   . ALA A 1 85  ? 2.781   -13.788 -9.190  1.00 0.00 ? 85  ALA A HA   7  
ATOM 11364 H HB1  . ALA A 1 85  ? 0.768   -15.235 -10.808 1.00 0.00 ? 85  ALA A HB1  7  
ATOM 11365 H HB2  . ALA A 1 85  ? 2.018   -15.868 -9.737  1.00 0.00 ? 85  ALA A HB2  7  
ATOM 11366 H HB3  . ALA A 1 85  ? 2.431   -15.373 -11.379 1.00 0.00 ? 85  ALA A HB3  7  
ATOM 11367 N N    . LYS A 1 86  ? 1.935   -12.259 -11.944 1.00 0.00 ? 86  LYS A N    7  
ATOM 11368 C CA   . LYS A 1 86  ? 2.501   -11.444 -13.054 1.00 0.00 ? 86  LYS A CA   7  
ATOM 11369 C C    . LYS A 1 86  ? 2.948   -10.080 -12.521 1.00 0.00 ? 86  LYS A C    7  
ATOM 11370 O O    . LYS A 1 86  ? 4.117   -9.749  -12.546 1.00 0.00 ? 86  LYS A O    7  
ATOM 11371 C CB   . LYS A 1 86  ? 1.437   -11.242 -14.135 1.00 0.00 ? 86  LYS A CB   7  
ATOM 11372 C CG   . LYS A 1 86  ? 2.055   -10.512 -15.329 1.00 0.00 ? 86  LYS A CG   7  
ATOM 11373 C CD   . LYS A 1 86  ? 0.961   -10.173 -16.343 1.00 0.00 ? 86  LYS A CD   7  
ATOM 11374 C CE   . LYS A 1 86  ? 0.062   -9.073  -15.777 1.00 0.00 ? 86  LYS A CE   7  
ATOM 11375 N NZ   . LYS A 1 86  ? 0.567   -7.741  -16.214 1.00 0.00 ? 86  LYS A NZ   7  
ATOM 11376 H H    . LYS A 1 86  ? 0.965   -12.292 -11.806 1.00 0.00 ? 86  LYS A H    7  
ATOM 11377 H HA   . LYS A 1 86  ? 3.350   -11.958 -13.480 1.00 0.00 ? 86  LYS A HA   7  
ATOM 11378 H HB2  . LYS A 1 86  ? 1.059   -12.203 -14.454 1.00 0.00 ? 86  LYS A HB2  7  
ATOM 11379 H HB3  . LYS A 1 86  ? 0.626   -10.651 -13.736 1.00 0.00 ? 86  LYS A HB3  7  
ATOM 11380 H HG2  . LYS A 1 86  ? 2.528   -9.603  -14.989 1.00 0.00 ? 86  LYS A HG2  7  
ATOM 11381 H HG3  . LYS A 1 86  ? 2.793   -11.149 -15.797 1.00 0.00 ? 86  LYS A HG3  7  
ATOM 11382 H HD2  . LYS A 1 86  ? 1.416   -9.832  -17.262 1.00 0.00 ? 86  LYS A HD2  7  
ATOM 11383 H HD3  . LYS A 1 86  ? 0.369   -11.054 -16.540 1.00 0.00 ? 86  LYS A HD3  7  
ATOM 11384 H HE2  . LYS A 1 86  ? -0.946  -9.212  -16.138 1.00 0.00 ? 86  LYS A HE2  7  
ATOM 11385 H HE3  . LYS A 1 86  ? 0.067   -9.124  -14.698 1.00 0.00 ? 86  LYS A HE3  7  
ATOM 11386 H HZ1  . LYS A 1 86  ? 1.178   -7.342  -15.475 1.00 0.00 ? 86  LYS A HZ1  7  
ATOM 11387 H HZ2  . LYS A 1 86  ? -0.239  -7.103  -16.381 1.00 0.00 ? 86  LYS A HZ2  7  
ATOM 11388 H HZ3  . LYS A 1 86  ? 1.113   -7.847  -17.092 1.00 0.00 ? 86  LYS A HZ3  7  
ATOM 11389 N N    . LEU A 1 87  ? 2.029   -9.277  -12.053 1.00 0.00 ? 87  LEU A N    7  
ATOM 11390 C CA   . LEU A 1 87  ? 2.417   -7.930  -11.536 1.00 0.00 ? 87  LEU A CA   7  
ATOM 11391 C C    . LEU A 1 87  ? 3.519   -8.065  -10.498 1.00 0.00 ? 87  LEU A C    7  
ATOM 11392 O O    . LEU A 1 87  ? 4.593   -7.518  -10.638 1.00 0.00 ? 87  LEU A O    7  
ATOM 11393 C CB   . LEU A 1 87  ? 1.217   -7.220  -10.889 1.00 0.00 ? 87  LEU A CB   7  
ATOM 11394 C CG   . LEU A 1 87  ? 0.191   -8.227  -10.356 1.00 0.00 ? 87  LEU A CG   7  
ATOM 11395 C CD1  . LEU A 1 87  ? -0.169  -7.872  -8.913  1.00 0.00 ? 87  LEU A CD1  7  
ATOM 11396 C CD2  . LEU A 1 87  ? -1.078  -8.162  -11.211 1.00 0.00 ? 87  LEU A CD2  7  
ATOM 11397 H H    . LEU A 1 87  ? 1.092   -9.553  -12.054 1.00 0.00 ? 87  LEU A H    7  
ATOM 11398 H HA   . LEU A 1 87  ? 2.782   -7.338  -12.352 1.00 0.00 ? 87  LEU A HA   7  
ATOM 11399 H HB2  . LEU A 1 87  ? 1.566   -6.610  -10.074 1.00 0.00 ? 87  LEU A HB2  7  
ATOM 11400 H HB3  . LEU A 1 87  ? 0.749   -6.594  -11.619 1.00 0.00 ? 87  LEU A HB3  7  
ATOM 11401 H HG   . LEU A 1 87  ? 0.603   -9.223  -10.385 1.00 0.00 ? 87  LEU A HG   7  
ATOM 11402 H HD11 . LEU A 1 87  ? 0.529   -8.348  -8.240  1.00 0.00 ? 87  LEU A HD11 7  
ATOM 11403 H HD12 . LEU A 1 87  ? -1.170  -8.220  -8.698  1.00 0.00 ? 87  LEU A HD12 7  
ATOM 11404 H HD13 . LEU A 1 87  ? -0.125  -6.804  -8.782  1.00 0.00 ? 87  LEU A HD13 7  
ATOM 11405 H HD21 . LEU A 1 87  ? -0.890  -8.615  -12.172 1.00 0.00 ? 87  LEU A HD21 7  
ATOM 11406 H HD22 . LEU A 1 87  ? -1.368  -7.132  -11.350 1.00 0.00 ? 87  LEU A HD22 7  
ATOM 11407 H HD23 . LEU A 1 87  ? -1.875  -8.695  -10.712 1.00 0.00 ? 87  LEU A HD23 7  
ATOM 11408 N N    . VAL A 1 88  ? 3.251   -8.777  -9.454  1.00 0.00 ? 88  VAL A N    7  
ATOM 11409 C CA   . VAL A 1 88  ? 4.260   -8.949  -8.384  1.00 0.00 ? 88  VAL A CA   7  
ATOM 11410 C C    . VAL A 1 88  ? 5.651   -9.161  -8.981  1.00 0.00 ? 88  VAL A C    7  
ATOM 11411 O O    . VAL A 1 88  ? 6.653   -8.839  -8.374  1.00 0.00 ? 88  VAL A O    7  
ATOM 11412 C CB   . VAL A 1 88  ? 3.904   -10.175 -7.587  1.00 0.00 ? 88  VAL A CB   7  
ATOM 11413 C CG1  . VAL A 1 88  ? 2.596   -9.941  -6.829  1.00 0.00 ? 88  VAL A CG1  7  
ATOM 11414 C CG2  . VAL A 1 88  ? 3.746   -11.352 -8.545  1.00 0.00 ? 88  VAL A CG2  7  
ATOM 11415 H H    . VAL A 1 88  ? 2.369   -9.194  -9.363  1.00 0.00 ? 88  VAL A H    7  
ATOM 11416 H HA   . VAL A 1 88  ? 4.262   -8.085  -7.739  1.00 0.00 ? 88  VAL A HA   7  
ATOM 11417 H HB   . VAL A 1 88  ? 4.694   -10.372 -6.902  1.00 0.00 ? 88  VAL A HB   7  
ATOM 11418 H HG11 . VAL A 1 88  ? 2.476   -8.886  -6.635  1.00 0.00 ? 88  VAL A HG11 7  
ATOM 11419 H HG12 . VAL A 1 88  ? 2.624   -10.479 -5.892  1.00 0.00 ? 88  VAL A HG12 7  
ATOM 11420 H HG13 . VAL A 1 88  ? 1.768   -10.296 -7.423  1.00 0.00 ? 88  VAL A HG13 7  
ATOM 11421 H HG21 . VAL A 1 88  ? 4.573   -12.033 -8.421  1.00 0.00 ? 88  VAL A HG21 7  
ATOM 11422 H HG22 . VAL A 1 88  ? 3.731   -10.985 -9.563  1.00 0.00 ? 88  VAL A HG22 7  
ATOM 11423 H HG23 . VAL A 1 88  ? 2.820   -11.865 -8.337  1.00 0.00 ? 88  VAL A HG23 7  
ATOM 11424 N N    . GLU A 1 89  ? 5.726   -9.716  -10.154 1.00 0.00 ? 89  GLU A N    7  
ATOM 11425 C CA   . GLU A 1 89  ? 7.060   -9.959  -10.771 1.00 0.00 ? 89  GLU A CA   7  
ATOM 11426 C C    . GLU A 1 89  ? 7.834   -8.645  -10.771 1.00 0.00 ? 89  GLU A C    7  
ATOM 11427 O O    . GLU A 1 89  ? 8.931   -8.560  -10.256 1.00 0.00 ? 89  GLU A O    7  
ATOM 11428 C CB   . GLU A 1 89  ? 6.882   -10.446 -12.211 1.00 0.00 ? 89  GLU A CB   7  
ATOM 11429 C CG   . GLU A 1 89  ? 6.133   -11.778 -12.211 1.00 0.00 ? 89  GLU A CG   7  
ATOM 11430 C CD   . GLU A 1 89  ? 6.783   -12.727 -13.220 1.00 0.00 ? 89  GLU A CD   7  
ATOM 11431 O OE1  . GLU A 1 89  ? 7.811   -13.296 -12.890 1.00 0.00 ? 89  GLU A OE1  7  
ATOM 11432 O OE2  . GLU A 1 89  ? 6.243   -12.868 -14.304 1.00 0.00 ? 89  GLU A OE2  7  
ATOM 11433 H H    . GLU A 1 89  ? 4.909   -9.985  -10.619 1.00 0.00 ? 89  GLU A H    7  
ATOM 11434 H HA   . GLU A 1 89  ? 7.598   -10.699 -10.198 1.00 0.00 ? 89  GLU A HA   7  
ATOM 11435 H HB2  . GLU A 1 89  ? 6.318   -9.715  -12.770 1.00 0.00 ? 89  GLU A HB2  7  
ATOM 11436 H HB3  . GLU A 1 89  ? 7.851   -10.580 -12.668 1.00 0.00 ? 89  GLU A HB3  7  
ATOM 11437 H HG2  . GLU A 1 89  ? 6.173   -12.215 -11.224 1.00 0.00 ? 89  GLU A HG2  7  
ATOM 11438 H HG3  . GLU A 1 89  ? 5.103   -11.611 -12.489 1.00 0.00 ? 89  GLU A HG3  7  
ATOM 11439 N N    . GLN A 1 90  ? 7.263   -7.614  -11.321 1.00 0.00 ? 90  GLN A N    7  
ATOM 11440 C CA   . GLN A 1 90  ? 7.957   -6.302  -11.323 1.00 0.00 ? 90  GLN A CA   7  
ATOM 11441 C C    . GLN A 1 90  ? 7.951   -5.749  -9.896  1.00 0.00 ? 90  GLN A C    7  
ATOM 11442 O O    . GLN A 1 90  ? 8.700   -4.853  -9.559  1.00 0.00 ? 90  GLN A O    7  
ATOM 11443 C CB   . GLN A 1 90  ? 7.221   -5.332  -12.251 1.00 0.00 ? 90  GLN A CB   7  
ATOM 11444 C CG   . GLN A 1 90  ? 7.543   -5.673  -13.709 1.00 0.00 ? 90  GLN A CG   7  
ATOM 11445 C CD   . GLN A 1 90  ? 8.986   -5.274  -14.021 1.00 0.00 ? 90  GLN A CD   7  
ATOM 11446 O OE1  . GLN A 1 90  ? 9.792   -6.104  -14.390 1.00 0.00 ? 90  GLN A OE1  7  
ATOM 11447 N NE2  . GLN A 1 90  ? 9.347   -4.027  -13.890 1.00 0.00 ? 90  GLN A NE2  7  
ATOM 11448 H H    . GLN A 1 90  ? 6.369   -7.699  -11.715 1.00 0.00 ? 90  GLN A H    7  
ATOM 11449 H HA   . GLN A 1 90  ? 8.976   -6.428  -11.660 1.00 0.00 ? 90  GLN A HA   7  
ATOM 11450 H HB2  . GLN A 1 90  ? 6.157   -5.417  -12.087 1.00 0.00 ? 90  GLN A HB2  7  
ATOM 11451 H HB3  . GLN A 1 90  ? 7.539   -4.322  -12.042 1.00 0.00 ? 90  GLN A HB3  7  
ATOM 11452 H HG2  . GLN A 1 90  ? 7.420   -6.735  -13.865 1.00 0.00 ? 90  GLN A HG2  7  
ATOM 11453 H HG3  . GLN A 1 90  ? 6.873   -5.133  -14.360 1.00 0.00 ? 90  GLN A HG3  7  
ATOM 11454 H HE21 . GLN A 1 90  ? 8.697   -3.356  -13.595 1.00 0.00 ? 90  GLN A HE21 7  
ATOM 11455 H HE22 . GLN A 1 90  ? 10.271  -3.761  -14.085 1.00 0.00 ? 90  GLN A HE22 7  
ATOM 11456 N N    . ALA A 1 91  ? 7.102   -6.281  -9.054  1.00 0.00 ? 91  ALA A N    7  
ATOM 11457 C CA   . ALA A 1 91  ? 7.032   -5.796  -7.646  1.00 0.00 ? 91  ALA A CA   7  
ATOM 11458 C C    . ALA A 1 91  ? 8.286   -6.230  -6.884  1.00 0.00 ? 91  ALA A C    7  
ATOM 11459 O O    . ALA A 1 91  ? 9.193   -5.452  -6.670  1.00 0.00 ? 91  ALA A O    7  
ATOM 11460 C CB   . ALA A 1 91  ? 5.796   -6.379  -6.963  1.00 0.00 ? 91  ALA A CB   7  
ATOM 11461 H H    . ALA A 1 91  ? 6.506   -7.000  -9.351  1.00 0.00 ? 91  ALA A H    7  
ATOM 11462 H HA   . ALA A 1 91  ? 6.963   -4.725  -7.641  1.00 0.00 ? 91  ALA A HA   7  
ATOM 11463 H HB1  . ALA A 1 91  ? 5.833   -7.455  -7.013  1.00 0.00 ? 91  ALA A HB1  7  
ATOM 11464 H HB2  . ALA A 1 91  ? 4.907   -6.024  -7.464  1.00 0.00 ? 91  ALA A HB2  7  
ATOM 11465 H HB3  . ALA A 1 91  ? 5.774   -6.066  -5.930  1.00 0.00 ? 91  ALA A HB3  7  
ATOM 11466 N N    . PHE A 1 92  ? 8.344   -7.467  -6.472  1.00 0.00 ? 92  PHE A N    7  
ATOM 11467 C CA   . PHE A 1 92  ? 9.540   -7.946  -5.721  1.00 0.00 ? 92  PHE A CA   7  
ATOM 11468 C C    . PHE A 1 92  ? 10.813  -7.486  -6.437  1.00 0.00 ? 92  PHE A C    7  
ATOM 11469 O O    . PHE A 1 92  ? 11.797  -7.143  -5.811  1.00 0.00 ? 92  PHE A O    7  
ATOM 11470 C CB   . PHE A 1 92  ? 9.518   -9.475  -5.644  1.00 0.00 ? 92  PHE A CB   7  
ATOM 11471 C CG   . PHE A 1 92  ? 8.221   -9.940  -5.023  1.00 0.00 ? 92  PHE A CG   7  
ATOM 11472 C CD1  . PHE A 1 92  ? 7.486   -9.078  -4.196  1.00 0.00 ? 92  PHE A CD1  7  
ATOM 11473 C CD2  . PHE A 1 92  ? 7.753   -11.236 -5.271  1.00 0.00 ? 92  PHE A CD2  7  
ATOM 11474 C CE1  . PHE A 1 92  ? 6.285   -9.513  -3.622  1.00 0.00 ? 92  PHE A CE1  7  
ATOM 11475 C CE2  . PHE A 1 92  ? 6.553   -11.670 -4.697  1.00 0.00 ? 92  PHE A CE2  7  
ATOM 11476 C CZ   . PHE A 1 92  ? 5.819   -10.810 -3.872  1.00 0.00 ? 92  PHE A CZ   7  
ATOM 11477 H H    . PHE A 1 92  ? 7.602   -8.080  -6.653  1.00 0.00 ? 92  PHE A H    7  
ATOM 11478 H HA   . PHE A 1 92  ? 9.522   -7.537  -4.721  1.00 0.00 ? 92  PHE A HA   7  
ATOM 11479 H HB2  . PHE A 1 92  ? 9.607   -9.885  -6.640  1.00 0.00 ? 92  PHE A HB2  7  
ATOM 11480 H HB3  . PHE A 1 92  ? 10.347  -9.816  -5.042  1.00 0.00 ? 92  PHE A HB3  7  
ATOM 11481 H HD1  . PHE A 1 92  ? 7.845   -8.078  -4.003  1.00 0.00 ? 92  PHE A HD1  7  
ATOM 11482 H HD2  . PHE A 1 92  ? 8.318   -11.901 -5.907  1.00 0.00 ? 92  PHE A HD2  7  
ATOM 11483 H HE1  . PHE A 1 92  ? 5.719   -8.849  -2.986  1.00 0.00 ? 92  PHE A HE1  7  
ATOM 11484 H HE2  . PHE A 1 92  ? 6.193   -12.671 -4.889  1.00 0.00 ? 92  PHE A HE2  7  
ATOM 11485 H HZ   . PHE A 1 92  ? 4.893   -11.146 -3.429  1.00 0.00 ? 92  PHE A HZ   7  
ATOM 11486 N N    . ARG A 1 93  ? 10.804  -7.476  -7.742  1.00 0.00 ? 93  ARG A N    7  
ATOM 11487 C CA   . ARG A 1 93  ? 12.015  -7.037  -8.492  1.00 0.00 ? 93  ARG A CA   7  
ATOM 11488 C C    . ARG A 1 93  ? 11.889  -5.554  -8.847  1.00 0.00 ? 93  ARG A C    7  
ATOM 11489 O O    . ARG A 1 93  ? 11.166  -5.182  -9.749  1.00 0.00 ? 93  ARG A O    7  
ATOM 11490 C CB   . ARG A 1 93  ? 12.146  -7.860  -9.776  1.00 0.00 ? 93  ARG A CB   7  
ATOM 11491 C CG   . ARG A 1 93  ? 13.502  -7.578  -10.427 1.00 0.00 ? 93  ARG A CG   7  
ATOM 11492 C CD   . ARG A 1 93  ? 13.534  -8.182  -11.831 1.00 0.00 ? 93  ARG A CD   7  
ATOM 11493 N NE   . ARG A 1 93  ? 13.890  -9.627  -11.745 1.00 0.00 ? 93  ARG A NE   7  
ATOM 11494 C CZ   . ARG A 1 93  ? 13.212  -10.422 -10.962 1.00 0.00 ? 93  ARG A CZ   7  
ATOM 11495 N NH1  . ARG A 1 93  ? 11.943  -10.628 -11.183 1.00 0.00 ? 93  ARG A NH1  7  
ATOM 11496 N NH2  . ARG A 1 93  ? 13.803  -11.011 -9.960  1.00 0.00 ? 93  ARG A NH2  7  
ATOM 11497 H H    . ARG A 1 93  ? 10.001  -7.757  -8.228  1.00 0.00 ? 93  ARG A H    7  
ATOM 11498 H HA   . ARG A 1 93  ? 12.892  -7.186  -7.879  1.00 0.00 ? 93  ARG A HA   7  
ATOM 11499 H HB2  . ARG A 1 93  ? 12.069  -8.912  -9.540  1.00 0.00 ? 93  ARG A HB2  7  
ATOM 11500 H HB3  . ARG A 1 93  ? 11.358  -7.587  -10.461 1.00 0.00 ? 93  ARG A HB3  7  
ATOM 11501 H HG2  . ARG A 1 93  ? 13.654  -6.511  -10.490 1.00 0.00 ? 93  ARG A HG2  7  
ATOM 11502 H HG3  . ARG A 1 93  ? 14.287  -8.019  -9.828  1.00 0.00 ? 93  ARG A HG3  7  
ATOM 11503 H HD2  . ARG A 1 93  ? 12.562  -8.078  -12.290 1.00 0.00 ? 93  ARG A HD2  7  
ATOM 11504 H HD3  . ARG A 1 93  ? 14.271  -7.666  -12.428 1.00 0.00 ? 93  ARG A HD3  7  
ATOM 11505 H HE   . ARG A 1 93  ? 14.632  -9.981  -12.278 1.00 0.00 ? 93  ARG A HE   7  
ATOM 11506 H HH11 . ARG A 1 93  ? 11.488  -10.179 -11.952 1.00 0.00 ? 93  ARG A HH11 7  
ATOM 11507 H HH12 . ARG A 1 93  ? 11.425  -11.238 -10.584 1.00 0.00 ? 93  ARG A HH12 7  
ATOM 11508 H HH21 . ARG A 1 93  ? 14.776  -10.853 -9.791  1.00 0.00 ? 93  ARG A HH21 7  
ATOM 11509 H HH22 . ARG A 1 93  ? 13.284  -11.620 -9.361  1.00 0.00 ? 93  ARG A HH22 7  
ATOM 11510 N N    . LYS A 1 94  ? 12.587  -4.703  -8.144  1.00 0.00 ? 94  LYS A N    7  
ATOM 11511 C CA   . LYS A 1 94  ? 12.506  -3.246  -8.443  1.00 0.00 ? 94  LYS A CA   7  
ATOM 11512 C C    . LYS A 1 94  ? 12.979  -2.989  -9.876  1.00 0.00 ? 94  LYS A C    7  
ATOM 11513 O O    . LYS A 1 94  ? 13.668  -3.799  -10.466 1.00 0.00 ? 94  LYS A O    7  
ATOM 11514 C CB   . LYS A 1 94  ? 13.396  -2.474  -7.466  1.00 0.00 ? 94  LYS A CB   7  
ATOM 11515 C CG   . LYS A 1 94  ? 13.100  -2.926  -6.035  1.00 0.00 ? 94  LYS A CG   7  
ATOM 11516 C CD   . LYS A 1 94  ? 14.386  -3.442  -5.384  1.00 0.00 ? 94  LYS A CD   7  
ATOM 11517 C CE   . LYS A 1 94  ? 14.814  -2.485  -4.268  1.00 0.00 ? 94  LYS A CE   7  
ATOM 11518 N NZ   . LYS A 1 94  ? 14.930  -1.103  -4.815  1.00 0.00 ? 94  LYS A NZ   7  
ATOM 11519 H H    . LYS A 1 94  ? 13.165  -5.024  -7.421  1.00 0.00 ? 94  LYS A H    7  
ATOM 11520 H HA   . LYS A 1 94  ? 11.483  -2.913  -8.337  1.00 0.00 ? 94  LYS A HA   7  
ATOM 11521 H HB2  . LYS A 1 94  ? 14.434  -2.666  -7.697  1.00 0.00 ? 94  LYS A HB2  7  
ATOM 11522 H HB3  . LYS A 1 94  ? 13.197  -1.417  -7.555  1.00 0.00 ? 94  LYS A HB3  7  
ATOM 11523 H HG2  . LYS A 1 94  ? 12.716  -2.092  -5.466  1.00 0.00 ? 94  LYS A HG2  7  
ATOM 11524 H HG3  . LYS A 1 94  ? 12.366  -3.719  -6.052  1.00 0.00 ? 94  LYS A HG3  7  
ATOM 11525 H HD2  . LYS A 1 94  ? 14.212  -4.423  -4.969  1.00 0.00 ? 94  LYS A HD2  7  
ATOM 11526 H HD3  . LYS A 1 94  ? 15.168  -3.498  -6.126  1.00 0.00 ? 94  LYS A HD3  7  
ATOM 11527 H HE2  . LYS A 1 94  ? 14.077  -2.499  -3.480  1.00 0.00 ? 94  LYS A HE2  7  
ATOM 11528 H HE3  . LYS A 1 94  ? 15.769  -2.797  -3.874  1.00 0.00 ? 94  LYS A HE3  7  
ATOM 11529 H HZ1  . LYS A 1 94  ? 15.590  -0.552  -4.231  1.00 0.00 ? 94  LYS A HZ1  7  
ATOM 11530 H HZ2  . LYS A 1 94  ? 13.995  -0.648  -4.807  1.00 0.00 ? 94  LYS A HZ2  7  
ATOM 11531 H HZ3  . LYS A 1 94  ? 15.288  -1.145  -5.791  1.00 0.00 ? 94  LYS A HZ3  7  
ATOM 11532 N N    . ARG A 1 95  ? 12.616  -1.868  -10.440 1.00 0.00 ? 95  ARG A N    7  
ATOM 11533 C CA   . ARG A 1 95  ? 13.046  -1.560  -11.835 1.00 0.00 ? 95  ARG A CA   7  
ATOM 11534 C C    . ARG A 1 95  ? 14.019  -0.379  -11.824 1.00 0.00 ? 95  ARG A C    7  
ATOM 11535 O O    . ARG A 1 95  ? 13.617  0.768   -11.782 1.00 0.00 ? 95  ARG A O    7  
ATOM 11536 C CB   . ARG A 1 95  ? 11.821  -1.202  -12.680 1.00 0.00 ? 95  ARG A CB   7  
ATOM 11537 C CG   . ARG A 1 95  ? 10.934  -0.227  -11.905 1.00 0.00 ? 95  ARG A CG   7  
ATOM 11538 C CD   . ARG A 1 95  ? 10.128  0.624   -12.889 1.00 0.00 ? 95  ARG A CD   7  
ATOM 11539 N NE   . ARG A 1 95  ? 10.806  1.937   -13.079 1.00 0.00 ? 95  ARG A NE   7  
ATOM 11540 C CZ   . ARG A 1 95  ? 10.563  2.648   -14.145 1.00 0.00 ? 95  ARG A CZ   7  
ATOM 11541 N NH1  . ARG A 1 95  ? 10.574  2.084   -15.322 1.00 0.00 ? 95  ARG A NH1  7  
ATOM 11542 N NH2  . ARG A 1 95  ? 10.312  3.924   -14.036 1.00 0.00 ? 95  ARG A NH2  7  
ATOM 11543 H H    . ARG A 1 95  ? 12.061  -1.229  -9.948  1.00 0.00 ? 95  ARG A H    7  
ATOM 11544 H HA   . ARG A 1 95  ? 13.535  -2.424  -12.260 1.00 0.00 ? 95  ARG A HA   7  
ATOM 11545 H HB2  . ARG A 1 95  ? 12.143  -0.742  -13.603 1.00 0.00 ? 95  ARG A HB2  7  
ATOM 11546 H HB3  . ARG A 1 95  ? 11.260  -2.098  -12.900 1.00 0.00 ? 95  ARG A HB3  7  
ATOM 11547 H HG2  . ARG A 1 95  ? 10.259  -0.780  -11.269 1.00 0.00 ? 95  ARG A HG2  7  
ATOM 11548 H HG3  . ARG A 1 95  ? 11.553  0.417   -11.298 1.00 0.00 ? 95  ARG A HG3  7  
ATOM 11549 H HD2  . ARG A 1 95  ? 10.063  0.112   -13.837 1.00 0.00 ? 95  ARG A HD2  7  
ATOM 11550 H HD3  . ARG A 1 95  ? 9.135   0.785   -12.496 1.00 0.00 ? 95  ARG A HD3  7  
ATOM 11551 H HE   . ARG A 1 95  ? 11.435  2.267   -12.403 1.00 0.00 ? 95  ARG A HE   7  
ATOM 11552 H HH11 . ARG A 1 95  ? 10.767  1.106   -15.407 1.00 0.00 ? 95  ARG A HH11 7  
ATOM 11553 H HH12 . ARG A 1 95  ? 10.389  2.629   -16.140 1.00 0.00 ? 95  ARG A HH12 7  
ATOM 11554 H HH21 . ARG A 1 95  ? 10.305  4.357   -13.134 1.00 0.00 ? 95  ARG A HH21 7  
ATOM 11555 H HH22 . ARG A 1 95  ? 10.127  4.470   -14.853 1.00 0.00 ? 95  ARG A HH22 7  
ATOM 11556 N N    . ARG A 1 96  ? 15.294  -0.649  -11.864 1.00 0.00 ? 96  ARG A N    7  
ATOM 11557 C CA   . ARG A 1 96  ? 16.291  0.460   -11.858 1.00 0.00 ? 96  ARG A CA   7  
ATOM 11558 C C    . ARG A 1 96  ? 16.311  1.136   -13.230 1.00 0.00 ? 96  ARG A C    7  
ATOM 11559 O O    . ARG A 1 96  ? 15.526  0.817   -14.102 1.00 0.00 ? 96  ARG A O    7  
ATOM 11560 C CB   . ARG A 1 96  ? 17.679  -0.105  -11.548 1.00 0.00 ? 96  ARG A CB   7  
ATOM 11561 C CG   . ARG A 1 96  ? 17.837  -0.278  -10.036 1.00 0.00 ? 96  ARG A CG   7  
ATOM 11562 C CD   . ARG A 1 96  ? 19.243  -0.796  -9.722  1.00 0.00 ? 96  ARG A CD   7  
ATOM 11563 N NE   . ARG A 1 96  ? 20.210  -0.250  -10.717 1.00 0.00 ? 96  ARG A NE   7  
ATOM 11564 C CZ   . ARG A 1 96  ? 20.888  0.831   -10.445 1.00 0.00 ? 96  ARG A CZ   7  
ATOM 11565 N NH1  . ARG A 1 96  ? 20.2