data_2D68
# 
_entry.id   2D68 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D68         
RCSB  RCSB025037   
WWPDB D_1000025037 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D68 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-10 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Mikolajka, A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the N-terminal Domain of the FOP (FGFR1OP) Protein and Implications for its Dimerization and Centrosomal Localization.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            359 
_citation.page_first                863 
_citation.page_last                 875 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16690081 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.03.070 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mikolajka, A.'  1 
primary 'Yan, X.'        2 
primary 'Popowicz, G.M.' 3 
primary 'Smialowski, P.' 4 
primary 'Nigg, E.A.'     5 
primary 'Holak, T.A.'    6 
# 
_cell.entry_id           2D68 
_cell.length_a           47.840 
_cell.length_b           92.180 
_cell.length_c           37.110 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2D68 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man FOP   9154.504 2   ? ? 'residues 54-135' ? 
2 water   nat water 18.015   200 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        FGFR1OP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIR
RW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIR
RW
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LYS n 
1 2  THR n 
1 3  PRO n 
1 4  LEU n 
1 5  VAL n 
1 6  ASN n 
1 7  GLU n 
1 8  SER n 
1 9  LEU n 
1 10 LYS n 
1 11 LYS n 
1 12 PHE n 
1 13 LEU n 
1 14 ASN n 
1 15 THR n 
1 16 LYS n 
1 17 ASP n 
1 18 GLY n 
1 19 ARG n 
1 20 LEU n 
1 21 VAL n 
1 22 ALA n 
1 23 SER n 
1 24 LEU n 
1 25 VAL n 
1 26 ALA n 
1 27 GLU n 
1 28 PHE n 
1 29 LEU n 
1 30 GLN n 
1 31 PHE n 
1 32 PHE n 
1 33 ASN n 
1 34 LEU n 
1 35 ASP n 
1 36 PHE n 
1 37 THR n 
1 38 LEU n 
1 39 ALA n 
1 40 VAL n 
1 41 PHE n 
1 42 GLN n 
1 43 PRO n 
1 44 GLU n 
1 45 THR n 
1 46 SER n 
1 47 THR n 
1 48 LEU n 
1 49 GLN n 
1 50 GLY n 
1 51 LEU n 
1 52 GLU n 
1 53 GLY n 
1 54 ARG n 
1 55 GLU n 
1 56 ASN n 
1 57 LEU n 
1 58 ALA n 
1 59 ARG n 
1 60 ASP n 
1 61 LEU n 
1 62 GLY n 
1 63 ILE n 
1 64 ILE n 
1 65 GLU n 
1 66 ALA n 
1 67 GLU n 
1 68 GLY n 
1 69 THR n 
1 70 VAL n 
1 71 GLY n 
1 72 GLY n 
1 73 PRO n 
1 74 LEU n 
1 75 LEU n 
1 76 LEU n 
1 77 GLU n 
1 78 VAL n 
1 79 ILE n 
1 80 ARG n 
1 81 ARG n 
1 82 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3, B834 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET46 Ek\Lic' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FR1OP_HUMAN 
_struct_ref.pdbx_db_accession          O95684 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIR
RC
;
_struct_ref.pdbx_align_begin           54 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2D68 A 1 ? 82 ? O95684 54 ? 135 ? 54 135 
2 1 2D68 B 1 ? 82 ? O95684 54 ? 135 ? 54 135 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2D68 TRP A 82 ? UNP O95684 CYS 135 CONFLICT 135 1 
2 2D68 TRP B 82 ? UNP O95684 CYS 135 CONFLICT 135 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2D68 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
loop_
_exptl_crystal.id 
_exptl_crystal.density_meas 
_exptl_crystal.density_Matthews 
_exptl_crystal.density_percent_sol 
_exptl_crystal.description 
_exptl_crystal.F_000 
_exptl_crystal.preparation 
1 ? 2.23 44.94 ? ? ? 
2 ? ?    ?     ? ? ? 
# 
loop_
_exptl_crystal_grow.crystal_id 
_exptl_crystal_grow.method 
_exptl_crystal_grow.temp 
_exptl_crystal_grow.temp_details 
_exptl_crystal_grow.pH 
_exptl_crystal_grow.pdbx_details 
_exptl_crystal_grow.pdbx_pH_range 
1 'VAPOR DIFFUSION, SITTING DROP' 293 ? 7.5 
'0,2M NaCl; 0,1M HEPES ph 7,5, 25% w/v PEG 3350, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' . 
2 'VAPOR DIFFUSION, SITTING DROP' 277 ? 7.5 
'0,2 M NaCl, 0,1M HEPES, 25% w/v PEG 3350, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K'       . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD MARRESEARCH 2005-03-16 ? 
2 CCD MARRESEARCH 2005-07-06 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si(111) double-crystal monochromator' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'Si(111) double-crystal monochromator' MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.05   1.0 
2 0.9793 1.0 
3 0.9796 1.0 
4 0.9500 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'MPG/DESY, HAMBURG BEAMLINE BW6' 'MPG/DESY, HAMBURG' BW6 ? 1.05                     
2 SYNCHROTRON 'MPG/DESY, HAMBURG BEAMLINE BW6' 'MPG/DESY, HAMBURG' BW6 ? '0.9793  0.9796  0.9500' 
# 
_reflns.entry_id                     2D68 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             46.08 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   21205 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.6 
_reflns_shell.d_res_low              1.7 
_reflns_shell.percent_possible_all   86.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2D68 
_refine.ls_number_reflns_obs                     20919 
_refine.ls_number_reflns_all                     20919 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    99.95 
_refine.ls_R_factor_obs                          0.20745 
_refine.ls_R_factor_all                          0.20745 
_refine.ls_R_factor_R_work                       0.20535 
_refine.ls_R_factor_R_free                       0.24719 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1142 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.B_iso_mean                               16.128 
_refine.aniso_B[1][1]                            -0.31 
_refine.aniso_B[2][2]                            0.69 
_refine.aniso_B[3][3]                            -0.39 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.100 
_refine.pdbx_overall_ESU_R_Free                  0.103 
_refine.overall_SU_ML                            0.059 
_refine.overall_SU_B                             1.594 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1199 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             200 
_refine_hist.number_atoms_total               1399 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.022  ? 1216 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.229  1.983  ? 1644 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   3.990  5.000  ? 149  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   31.813 24.237 ? 59   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   12.807 15.000 ? 212  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   23.529 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.078  0.200  ? 193  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 914  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.211  0.200  ? 589  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.307  0.200  ? 870  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.142  0.200  ? 143  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.179  0.200  ? 28   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.237  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.811  1.500  ? 768  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.343  2.000  ? 1201 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.200  3.000  ? 494  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.421  4.500  ? 443  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.600 
_refine_ls_shell.d_res_low                        1.642 
_refine_ls_shell.number_reflns_R_work             1496 
_refine_ls_shell.R_factor_R_work                  0.219 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.305 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             107 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2D68 
_struct.title                     'Structure of the N-terminal domain of FOP (FGFR1OP) protein' 
_struct.pdbx_descriptor           FOP 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D68 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'alpha helical bundle, dimer, CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a dimer.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 6  ? ASN A 14 ? ASN A 59  ASN A 67  1 ? 9  
HELX_P HELX_P2  2  THR A 15 ? PHE A 32 ? THR A 68  PHE A 85  1 ? 18 
HELX_P HELX_P3  3  LEU A 34 ? SER A 46 ? LEU A 87  SER A 99  1 ? 13 
HELX_P HELX_P4  4  GLY A 53 ? LEU A 61 ? GLY A 106 LEU A 114 1 ? 9  
HELX_P HELX_P5  5  PRO A 73 ? TRP A 82 ? PRO A 126 TRP A 135 1 ? 10 
HELX_P HELX_P6  6  ASN B 6  ? ASN B 14 ? ASN B 59  ASN B 67  1 ? 9  
HELX_P HELX_P7  7  THR B 15 ? PHE B 32 ? THR B 68  PHE B 85  1 ? 18 
HELX_P HELX_P8  8  LEU B 34 ? SER B 46 ? LEU B 87  SER B 99  1 ? 13 
HELX_P HELX_P9  9  GLY B 53 ? GLY B 62 ? GLY B 106 GLY B 115 1 ? 10 
HELX_P HELX_P10 10 ALA B 66 ? GLY B 71 ? ALA B 119 GLY B 124 1 ? 6  
HELX_P HELX_P11 11 PRO B 73 ? ARG B 81 ? PRO B 126 ARG B 134 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2D68 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D68 
_atom_sites.fract_transf_matrix[1][1]   0.020903 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010848 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026947 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 5  ? 7.079  -0.814 7.182  1.00 30.08 ? 58  VAL A N   1 
ATOM   2    C CA  . VAL A 1 5  ? 8.191  0.155  7.420  1.00 30.24 ? 58  VAL A CA  1 
ATOM   3    C C   . VAL A 1 5  ? 7.876  1.574  6.919  1.00 29.84 ? 58  VAL A C   1 
ATOM   4    O O   . VAL A 1 5  ? 7.317  1.771  5.827  1.00 30.30 ? 58  VAL A O   1 
ATOM   5    C CB  . VAL A 1 5  ? 9.545  -0.341 6.832  1.00 30.42 ? 58  VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 5  ? 10.062 -1.567 7.602  1.00 30.65 ? 58  VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 5  ? 9.429  -0.639 5.329  1.00 31.27 ? 58  VAL A CG2 1 
ATOM   8    N N   . ASN A 1 6  ? 8.254  2.551  7.741  1.00 28.84 ? 59  ASN A N   1 
ATOM   9    C CA  . ASN A 1 6  ? 8.039  3.971  7.478  1.00 27.76 ? 59  ASN A CA  1 
ATOM   10   C C   . ASN A 1 6  ? 9.233  4.594  6.726  1.00 27.73 ? 59  ASN A C   1 
ATOM   11   O O   . ASN A 1 6  ? 10.305 4.754  7.300  1.00 27.53 ? 59  ASN A O   1 
ATOM   12   C CB  . ASN A 1 6  ? 7.832  4.666  8.827  1.00 27.58 ? 59  ASN A CB  1 
ATOM   13   C CG  . ASN A 1 6  ? 7.308  6.083  8.701  1.00 25.29 ? 59  ASN A CG  1 
ATOM   14   O OD1 . ASN A 1 6  ? 7.685  6.845  7.794  1.00 22.19 ? 59  ASN A OD1 1 
ATOM   15   N ND2 . ASN A 1 6  ? 6.445  6.455  9.639  1.00 22.68 ? 59  ASN A ND2 1 
ATOM   16   N N   . GLU A 1 7  ? 9.041  4.946  5.453  1.00 27.30 ? 60  GLU A N   1 
ATOM   17   C CA  . GLU A 1 7  ? 10.140 5.428  4.588  1.00 26.80 ? 60  GLU A CA  1 
ATOM   18   C C   . GLU A 1 7  ? 10.721 6.805  4.958  1.00 25.65 ? 60  GLU A C   1 
ATOM   19   O O   . GLU A 1 7  ? 11.950 7.005  4.920  1.00 25.78 ? 60  GLU A O   1 
ATOM   20   C CB  . GLU A 1 7  ? 9.736  5.375  3.104  1.00 27.89 ? 60  GLU A CB  1 
ATOM   21   C CG  . GLU A 1 7  ? 10.903 5.494  2.108  1.00 29.63 ? 60  GLU A CG  1 
ATOM   22   C CD  . GLU A 1 7  ? 12.045 4.515  2.393  1.00 32.29 ? 60  GLU A CD  1 
ATOM   23   O OE1 . GLU A 1 7  ? 11.817 3.284  2.353  1.00 34.52 ? 60  GLU A OE1 1 
ATOM   24   O OE2 . GLU A 1 7  ? 13.176 4.978  2.653  1.00 31.55 ? 60  GLU A OE2 1 
ATOM   25   N N   . SER A 1 8  ? 9.846  7.747  5.312  1.00 23.62 ? 61  SER A N   1 
ATOM   26   C CA  . SER A 1 8  ? 10.266 9.052  5.811  1.00 21.50 ? 61  SER A CA  1 
ATOM   27   C C   . SER A 1 8  ? 11.085 8.842  7.080  1.00 19.67 ? 61  SER A C   1 
ATOM   28   O O   . SER A 1 8  ? 12.160 9.431  7.234  1.00 19.25 ? 61  SER A O   1 
ATOM   29   C CB  . SER A 1 8  ? 9.052  9.946  6.089  1.00 21.97 ? 61  SER A CB  1 
ATOM   30   O OG  . SER A 1 8  ? 9.431  11.217 6.617  1.00 23.23 ? 61  SER A OG  1 
ATOM   31   N N   . LEU A 1 9  ? 10.592 7.982  7.969  1.00 16.90 ? 62  LEU A N   1 
ATOM   32   C CA  . LEU A 1 9  ? 11.318 7.659  9.205  1.00 15.76 ? 62  LEU A CA  1 
ATOM   33   C C   . LEU A 1 9  ? 12.617 6.875  8.979  1.00 15.60 ? 62  LEU A C   1 
ATOM   34   O O   . LEU A 1 9  ? 13.632 7.122  9.653  1.00 14.93 ? 62  LEU A O   1 
ATOM   35   C CB  . LEU A 1 9  ? 10.407 6.906  10.180 1.00 15.09 ? 62  LEU A CB  1 
ATOM   36   C CG  . LEU A 1 9  ? 11.007 6.582  11.543 1.00 14.74 ? 62  LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 9  ? 11.356 7.832  12.347 1.00 13.12 ? 62  LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 9  ? 10.021 5.727  12.297 1.00 15.63 ? 62  LEU A CD2 1 
ATOM   39   N N   . LYS A 1 10 ? 12.584 5.915  8.052  1.00 15.07 ? 63  LYS A N   1 
ATOM   40   C CA  . LYS A 1 10 ? 13.786 5.161  7.699  1.00 15.43 ? 63  LYS A CA  1 
ATOM   41   C C   . LYS A 1 10 ? 14.915 6.091  7.251  1.00 14.86 ? 63  LYS A C   1 
ATOM   42   O O   . LYS A 1 10 ? 16.049 5.967  7.723  1.00 15.33 ? 63  LYS A O   1 
ATOM   43   C CB  . LYS A 1 10 ? 13.471 4.148  6.589  1.00 15.22 ? 63  LYS A CB  1 
ATOM   44   C CG  . LYS A 1 10 ? 14.663 3.353  6.122  1.00 17.78 ? 63  LYS A CG  1 
ATOM   45   C CD  . LYS A 1 10 ? 14.249 2.376  5.043  1.00 21.92 ? 63  LYS A CD  1 
ATOM   46   C CE  . LYS A 1 10 ? 15.454 1.658  4.484  1.00 24.51 ? 63  LYS A CE  1 
ATOM   47   N NZ  . LYS A 1 10 ? 15.044 0.398  3.818  1.00 27.09 ? 63  LYS A NZ  1 
ATOM   48   N N   . LYS A 1 11 ? 14.601 7.022  6.347  1.00 15.08 ? 64  LYS A N   1 
ATOM   49   C CA  . LYS A 1 11 ? 15.603 7.965  5.847  1.00 15.29 ? 64  LYS A CA  1 
ATOM   50   C C   . LYS A 1 11 ? 16.125 8.814  7.013  1.00 14.87 ? 64  LYS A C   1 
ATOM   51   O O   . LYS A 1 11 ? 17.331 9.019  7.155  1.00 14.53 ? 64  LYS A O   1 
ATOM   52   C CB  . LYS A 1 11 ? 15.033 8.837  4.725  1.00 15.97 ? 64  LYS A CB  1 
ATOM   53   C CG  . LYS A 1 11 ? 14.789 8.061  3.434  1.00 16.62 ? 64  LYS A CG  1 
ATOM   54   C CD  . LYS A 1 11 ? 14.333 8.983  2.289  1.00 17.03 ? 64  LYS A CD  1 
ATOM   55   C CE  . LYS A 1 11 ? 14.080 8.206  0.984  1.00 18.79 ? 64  LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 11 ? 15.266 7.414  0.566  1.00 21.88 ? 64  LYS A NZ  1 
ATOM   57   N N   . PHE A 1 12 ? 15.198 9.267  7.857  1.00 13.99 ? 65  PHE A N   1 
ATOM   58   C CA  . PHE A 1 12 ? 15.523 10.079 9.030  1.00 12.55 ? 65  PHE A CA  1 
ATOM   59   C C   . PHE A 1 12 ? 16.481 9.367  9.975  1.00 12.48 ? 65  PHE A C   1 
ATOM   60   O O   . PHE A 1 12 ? 17.458 9.955  10.459 1.00 11.86 ? 65  PHE A O   1 
ATOM   61   C CB  . PHE A 1 12 ? 14.227 10.432 9.761  1.00 12.36 ? 65  PHE A CB  1 
ATOM   62   C CG  . PHE A 1 12 ? 14.408 11.270 11.003 1.00 10.30 ? 65  PHE A CG  1 
ATOM   63   C CD1 . PHE A 1 12 ? 14.556 12.651 10.913 1.00 11.32 ? 65  PHE A CD1 1 
ATOM   64   C CD2 . PHE A 1 12 ? 14.367 10.682 12.264 1.00 11.00 ? 65  PHE A CD2 1 
ATOM   65   C CE1 . PHE A 1 12 ? 14.685 13.438 12.055 1.00 10.94 ? 65  PHE A CE1 1 
ATOM   66   C CE2 . PHE A 1 12 ? 14.489 11.468 13.410 1.00 10.18 ? 65  PHE A CE2 1 
ATOM   67   C CZ  . PHE A 1 12 ? 14.657 12.845 13.301 1.00 11.63 ? 65  PHE A CZ  1 
ATOM   68   N N   . LEU A 1 13 ? 16.172 8.110  10.269 1.00 12.77 ? 66  LEU A N   1 
ATOM   69   C CA  . LEU A 1 13 ? 17.001 7.297  11.147 1.00 13.50 ? 66  LEU A CA  1 
ATOM   70   C C   . LEU A 1 13 ? 18.390 7.027  10.581 1.00 13.93 ? 66  LEU A C   1 
ATOM   71   O O   . LEU A 1 13 ? 19.304 6.683  11.341 1.00 14.98 ? 66  LEU A O   1 
ATOM   72   C CB  . LEU A 1 13 ? 16.301 5.967  11.439 1.00 13.70 ? 66  LEU A CB  1 
ATOM   73   C CG  . LEU A 1 13 ? 15.070 6.090  12.337 1.00 14.28 ? 66  LEU A CG  1 
ATOM   74   C CD1 . LEU A 1 13 ? 14.358 4.752  12.390 1.00 15.35 ? 66  LEU A CD1 1 
ATOM   75   C CD2 . LEU A 1 13 ? 15.435 6.579  13.735 1.00 15.65 ? 66  LEU A CD2 1 
ATOM   76   N N   . ASN A 1 14 ? 18.536 7.167  9.258  1.00 13.87 ? 67  ASN A N   1 
ATOM   77   C CA  . ASN A 1 14 ? 19.827 6.978  8.593  1.00 14.45 ? 67  ASN A CA  1 
ATOM   78   C C   . ASN A 1 14 ? 20.649 8.279  8.483  1.00 14.14 ? 67  ASN A C   1 
ATOM   79   O O   . ASN A 1 14 ? 21.647 8.338  7.752  1.00 15.04 ? 67  ASN A O   1 
ATOM   80   C CB  . ASN A 1 14 ? 19.611 6.342  7.209  1.00 15.53 ? 67  ASN A CB  1 
ATOM   81   C CG  . ASN A 1 14 ? 20.882 5.720  6.641  1.00 18.86 ? 67  ASN A CG  1 
ATOM   82   O OD1 . ASN A 1 14 ? 21.682 5.123  7.374  1.00 22.59 ? 67  ASN A OD1 1 
ATOM   83   N ND2 . ASN A 1 14 ? 21.068 5.850  5.323  1.00 22.54 ? 67  ASN A ND2 1 
ATOM   84   N N   . THR A 1 15 ? 20.217 9.317  9.199  1.00 12.87 ? 68  THR A N   1 
ATOM   85   C CA  . THR A 1 15 ? 20.972 10.568 9.322  1.00 12.36 ? 68  THR A CA  1 
ATOM   86   C C   . THR A 1 15 ? 21.586 10.633 10.723 1.00 12.28 ? 68  THR A C   1 
ATOM   87   O O   . THR A 1 15 ? 21.065 10.021 11.682 1.00 11.89 ? 68  THR A O   1 
ATOM   88   C CB  . THR A 1 15 ? 20.096 11.820 9.068  1.00 12.57 ? 68  THR A CB  1 
ATOM   89   O OG1 . THR A 1 15 ? 19.116 11.939 10.106 1.00 13.16 ? 68  THR A OG1 1 
ATOM   90   C CG2 . THR A 1 15 ? 19.368 11.744 7.722  1.00 12.24 ? 68  THR A CG2 1 
ATOM   91   N N   . LYS A 1 16 ? 22.692 11.366 10.844 1.00 12.00 ? 69  LYS A N   1 
ATOM   92   C CA  . LYS A 1 16 ? 23.350 11.535 12.147 1.00 12.57 ? 69  LYS A CA  1 
ATOM   93   C C   . LYS A 1 16 ? 22.402 12.164 13.170 1.00 12.20 ? 69  LYS A C   1 
ATOM   94   O O   . LYS A 1 16 ? 22.175 11.621 14.268 1.00 13.10 ? 69  LYS A O   1 
ATOM   95   C CB  . LYS A 1 16 ? 24.568 12.440 11.999 1.00 99.99 ? 69  LYS A CB  1 
ATOM   96   C CG  . LYS A 1 16 ? 25.409 12.375 13.269 1.00 99.99 ? 69  LYS A CG  1 
ATOM   97   C CD  . LYS A 1 16 ? 26.558 13.372 13.171 1.00 99.99 ? 69  LYS A CD  1 
ATOM   98   N N   . ASP A 1 17 ? 21.827 13.301 12.805 1.00 11.68 ? 70  ASP A N   1 
ATOM   99   C CA  . ASP A 1 17 ? 20.951 14.013 13.746 1.00 11.18 ? 70  ASP A CA  1 
ATOM   100  C C   . ASP A 1 17 ? 19.676 13.214 14.005 1.00 10.74 ? 70  ASP A C   1 
ATOM   101  O O   . ASP A 1 17 ? 19.168 13.192 15.132 1.00 9.83  ? 70  ASP A O   1 
ATOM   102  C CB  . ASP A 1 17 ? 20.628 15.416 13.240 1.00 11.95 ? 70  ASP A CB  1 
ATOM   103  C CG  . ASP A 1 17 ? 21.764 16.387 13.429 1.00 14.39 ? 70  ASP A CG  1 
ATOM   104  O OD1 . ASP A 1 17 ? 22.760 16.050 14.098 1.00 17.95 ? 70  ASP A OD1 1 
ATOM   105  O OD2 . ASP A 1 17 ? 21.641 17.511 12.911 1.00 15.26 ? 70  ASP A OD2 1 
ATOM   106  N N   . GLY A 1 18 ? 19.187 12.517 12.982 1.00 10.50 ? 71  GLY A N   1 
ATOM   107  C CA  . GLY A 1 18 ? 17.970 11.706 13.128 1.00 10.06 ? 71  GLY A CA  1 
ATOM   108  C C   . GLY A 1 18 ? 18.109 10.590 14.151 1.00 10.22 ? 71  GLY A C   1 
ATOM   109  O O   . GLY A 1 18 ? 17.218 10.376 14.997 1.00 10.00 ? 71  GLY A O   1 
ATOM   110  N N   . ARG A 1 19 ? 19.237 9.891  14.092 1.00 9.69  ? 72  ARG A N   1 
ATOM   111  C CA  . ARG A 1 19 ? 19.501 8.836  15.058 1.00 10.66 ? 72  ARG A CA  1 
ATOM   112  C C   . ARG A 1 19 ? 19.577 9.412  16.469 1.00 10.31 ? 72  ARG A C   1 
ATOM   113  O O   . ARG A 1 19 ? 19.045 8.813  17.408 1.00 10.31 ? 72  ARG A O   1 
ATOM   114  C CB  . ARG A 1 19 ? 20.792 8.092  14.731 1.00 12.00 ? 72  ARG A CB  1 
ATOM   115  C CG  . ARG A 1 19 ? 21.050 6.974  15.712 1.00 13.53 ? 72  ARG A CG  1 
ATOM   116  C CD  . ARG A 1 19 ? 22.174 6.061  15.256 1.00 19.23 ? 72  ARG A CD  1 
ATOM   117  N NE  . ARG A 1 19 ? 22.536 5.080  16.287 1.00 21.42 ? 72  ARG A NE  1 
ATOM   118  C CZ  . ARG A 1 19 ? 21.864 3.953  16.523 1.00 24.20 ? 72  ARG A CZ  1 
ATOM   119  N NH1 . ARG A 1 19 ? 20.772 3.653  15.823 1.00 24.43 ? 72  ARG A NH1 1 
ATOM   120  N NH2 . ARG A 1 19 ? 22.274 3.127  17.476 1.00 24.51 ? 72  ARG A NH2 1 
ATOM   121  N N   . LEU A 1 20 ? 20.217 10.573 16.614 1.00 10.19 ? 73  LEU A N   1 
ATOM   122  C CA  . LEU A 1 20 ? 20.296 11.215 17.938 1.00 9.93  ? 73  LEU A CA  1 
ATOM   123  C C   . LEU A 1 20 ? 18.892 11.566 18.457 1.00 9.87  ? 73  LEU A C   1 
ATOM   124  O O   . LEU A 1 20 ? 18.562 11.305 19.638 1.00 10.15 ? 73  LEU A O   1 
ATOM   125  C CB  . LEU A 1 20 ? 21.162 12.473 17.889 1.00 10.51 ? 73  LEU A CB  1 
ATOM   126  C CG  . LEU A 1 20 ? 22.647 12.212 17.704 1.00 12.07 ? 73  LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 20 ? 23.287 13.553 17.449 1.00 13.41 ? 73  LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 20 ? 23.269 11.550 18.925 1.00 15.32 ? 73  LEU A CD2 1 
ATOM   129  N N   . VAL A 1 21 ? 18.067 12.139 17.579 1.00 8.75  ? 74  VAL A N   1 
ATOM   130  C CA  . VAL A 1 21 ? 16.694 12.509 17.971 1.00 9.15  ? 74  VAL A CA  1 
ATOM   131  C C   . VAL A 1 21 ? 15.916 11.274 18.429 1.00 9.09  ? 74  VAL A C   1 
ATOM   132  O O   . VAL A 1 21 ? 15.309 11.272 19.508 1.00 8.90  ? 74  VAL A O   1 
ATOM   133  C CB  . VAL A 1 21 ? 15.940 13.226 16.832 1.00 9.06  ? 74  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 21 ? 14.466 13.350 17.165 1.00 9.01  ? 74  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 21 ? 16.587 14.618 16.560 1.00 9.45  ? 74  VAL A CG2 1 
ATOM   136  N N   . ALA A 1 22 ? 15.937 10.210 17.627 1.00 9.29  ? 75  ALA A N   1 
ATOM   137  C CA  . ALA A 1 22 ? 15.180 9.004  17.982 1.00 9.65  ? 75  ALA A CA  1 
ATOM   138  C C   . ALA A 1 22 ? 15.700 8.395  19.289 1.00 9.84  ? 75  ALA A C   1 
ATOM   139  O O   . ALA A 1 22 ? 14.900 7.941  20.127 1.00 9.19  ? 75  ALA A O   1 
ATOM   140  C CB  . ALA A 1 22 ? 15.226 7.976  16.852 1.00 10.76 ? 75  ALA A CB  1 
ATOM   141  N N   . SER A 1 23 ? 17.021 8.432  19.474 1.00 9.35  ? 76  SER A N   1 
ATOM   142  C CA  . SER A 1 23 ? 17.629 7.889  20.707 1.00 9.96  ? 76  SER A CA  1 
ATOM   143  C C   . SER A 1 23 ? 17.195 8.703  21.930 1.00 8.71  ? 76  SER A C   1 
ATOM   144  O O   . SER A 1 23 ? 16.927 8.137  23.000 1.00 10.08 ? 76  SER A O   1 
ATOM   145  C CB  . SER A 1 23 ? 19.140 7.862  20.567 1.00 10.67 ? 76  SER A CB  1 
ATOM   146  O OG  . SER A 1 23 ? 19.495 6.933  19.540 1.00 12.45 ? 76  SER A OG  1 
ATOM   147  N N   . LEU A 1 24 ? 17.085 10.019 21.761 1.00 8.36  ? 77  LEU A N   1 
ATOM   148  C CA  . LEU A 1 24 ? 16.577 10.891 22.829 1.00 8.39  ? 77  LEU A CA  1 
ATOM   149  C C   . LEU A 1 24 ? 15.113 10.614 23.179 1.00 7.50  ? 77  LEU A C   1 
ATOM   150  O O   . LEU A 1 24 ? 14.750 10.618 24.345 1.00 7.71  ? 77  LEU A O   1 
ATOM   151  C CB  . LEU A 1 24 ? 16.761 12.356 22.455 1.00 8.36  ? 77  LEU A CB  1 
ATOM   152  C CG  . LEU A 1 24 ? 18.184 12.847 22.697 1.00 10.31 ? 77  LEU A CG  1 
ATOM   153  C CD1 . LEU A 1 24 ? 18.453 14.089 21.904 1.00 11.21 ? 77  LEU A CD1 1 
ATOM   154  C CD2 . LEU A 1 24 ? 18.395 13.100 24.191 1.00 10.97 ? 77  LEU A CD2 1 
ATOM   155  N N   . VAL A 1 25 ? 14.281 10.367 22.167 1.00 7.95  ? 78  VAL A N   1 
ATOM   156  C CA  . VAL A 1 25 ? 12.871 10.017 22.400 1.00 7.14  ? 78  VAL A CA  1 
ATOM   157  C C   . VAL A 1 25 ? 12.784 8.694  23.170 1.00 7.78  ? 78  VAL A C   1 
ATOM   158  O O   . VAL A 1 25 ? 12.102 8.614  24.198 1.00 8.00  ? 78  VAL A O   1 
ATOM   159  C CB  . VAL A 1 25 ? 12.101 9.977  21.061 1.00 7.51  ? 78  VAL A CB  1 
ATOM   160  C CG1 . VAL A 1 25 ? 10.730 9.339  21.240 1.00 8.22  ? 78  VAL A CG1 1 
ATOM   161  C CG2 . VAL A 1 25 ? 11.957 11.403 20.524 1.00 7.77  ? 78  VAL A CG2 1 
ATOM   162  N N   . ALA A 1 26 ? 13.494 7.663  22.696 1.00 7.90  ? 79  ALA A N   1 
ATOM   163  C CA  . ALA A 1 26 ? 13.502 6.382  23.394 1.00 8.79  ? 79  ALA A CA  1 
ATOM   164  C C   . ALA A 1 26 ? 14.020 6.509  24.832 1.00 8.33  ? 79  ALA A C   1 
ATOM   165  O O   . ALA A 1 26 ? 13.453 5.912  25.755 1.00 9.27  ? 79  ALA A O   1 
ATOM   166  C CB  . ALA A 1 26 ? 14.305 5.368  22.609 1.00 9.00  ? 79  ALA A CB  1 
ATOM   167  N N   . GLU A 1 27 ? 15.069 7.312  25.035 1.00 8.82  ? 80  GLU A N   1 
ATOM   168  C CA  . GLU A 1 27 ? 15.607 7.488  26.398 1.00 9.36  ? 80  GLU A CA  1 
ATOM   169  C C   . GLU A 1 27 ? 14.575 8.181  27.298 1.00 9.16  ? 80  GLU A C   1 
ATOM   170  O O   . GLU A 1 27 ? 14.481 7.875  28.485 1.00 9.10  ? 80  GLU A O   1 
ATOM   171  C CB  . GLU A 1 27 ? 16.937 8.245  26.393 1.00 10.32 ? 80  GLU A CB  1 
ATOM   172  C CG  . GLU A 1 27 ? 17.726 8.173  27.707 1.00 11.18 ? 80  GLU A CG  1 
ATOM   173  C CD  . GLU A 1 27 ? 17.332 9.233  28.736 1.00 13.46 ? 80  GLU A CD  1 
ATOM   174  O OE1 . GLU A 1 27 ? 17.008 10.362 28.336 1.00 12.82 ? 80  GLU A OE1 1 
ATOM   175  O OE2 . GLU A 1 27 ? 17.373 8.925  29.949 1.00 13.93 ? 80  GLU A OE2 1 
ATOM   176  N N   . PHE A 1 28 ? 13.807 9.115  26.738 1.00 8.15  ? 81  PHE A N   1 
ATOM   177  C CA  . PHE A 1 28 ? 12.747 9.773  27.509 1.00 7.55  ? 81  PHE A CA  1 
ATOM   178  C C   . PHE A 1 28 ? 11.713 8.740  27.968 1.00 7.65  ? 81  PHE A C   1 
ATOM   179  O O   . PHE A 1 28 ? 11.308 8.727  29.129 1.00 9.29  ? 81  PHE A O   1 
ATOM   180  C CB  . PHE A 1 28 ? 12.090 10.879 26.661 1.00 8.36  ? 81  PHE A CB  1 
ATOM   181  C CG  . PHE A 1 28 ? 10.856 11.463 27.280 1.00 8.41  ? 81  PHE A CG  1 
ATOM   182  C CD1 . PHE A 1 28 ? 10.934 12.592 28.095 1.00 10.26 ? 81  PHE A CD1 1 
ATOM   183  C CD2 . PHE A 1 28 ? 9.603  10.890 27.049 1.00 8.87  ? 81  PHE A CD2 1 
ATOM   184  C CE1 . PHE A 1 28 ? 9.770  13.129 28.682 1.00 11.74 ? 81  PHE A CE1 1 
ATOM   185  C CE2 . PHE A 1 28 ? 8.448  11.418 27.628 1.00 8.89  ? 81  PHE A CE2 1 
ATOM   186  C CZ  . PHE A 1 28 ? 8.520  12.536 28.426 1.00 10.27 ? 81  PHE A CZ  1 
ATOM   187  N N   . LEU A 1 29 ? 11.307 7.868  27.048 1.00 7.72  ? 82  LEU A N   1 
ATOM   188  C CA  . LEU A 1 29 ? 10.302 6.853  27.360 1.00 8.50  ? 82  LEU A CA  1 
ATOM   189  C C   . LEU A 1 29 ? 10.813 5.923  28.444 1.00 9.53  ? 82  LEU A C   1 
ATOM   190  O O   . LEU A 1 29 ? 10.088 5.585  29.382 1.00 10.18 ? 82  LEU A O   1 
ATOM   191  C CB  . LEU A 1 29 ? 9.937  6.075  26.094 1.00 8.82  ? 82  LEU A CB  1 
ATOM   192  C CG  . LEU A 1 29 ? 9.292  6.888  24.963 1.00 8.23  ? 82  LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 29 ? 9.112  5.963  23.742 1.00 11.13 ? 82  LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 29 ? 7.964  7.502  25.405 1.00 10.33 ? 82  LEU A CD2 1 
ATOM   195  N N   . GLN A 1 30 ? 12.083 5.540  28.331 1.00 9.37  ? 83  GLN A N   1 
ATOM   196  C CA  . GLN A 1 30 ? 12.700 4.656  29.317 1.00 11.44 ? 83  GLN A CA  1 
ATOM   197  C C   . GLN A 1 30 ? 12.766 5.332  30.668 1.00 10.69 ? 83  GLN A C   1 
ATOM   198  O O   . GLN A 1 30 ? 12.505 4.698  31.696 1.00 11.08 ? 83  GLN A O   1 
ATOM   199  C CB  . GLN A 1 30 ? 14.114 4.289  28.867 1.00 11.99 ? 83  GLN A CB  1 
ATOM   200  C CG  . GLN A 1 30 ? 14.131 3.355  27.682 1.00 16.05 ? 83  GLN A CG  1 
ATOM   201  C CD  . GLN A 1 30 ? 15.492 2.753  27.369 1.00 17.35 ? 83  GLN A CD  1 
ATOM   202  O OE1 . GLN A 1 30 ? 16.350 2.586  28.249 1.00 27.67 ? 83  GLN A OE1 1 
ATOM   203  N NE2 . GLN A 1 30 ? 15.676 2.363  26.111 1.00 24.18 ? 83  GLN A NE2 1 
ATOM   204  N N   . PHE A 1 31 ? 13.108 6.619  30.676 1.00 10.06 ? 84  PHE A N   1 
ATOM   205  C CA  . PHE A 1 31 ? 13.322 7.331  31.924 1.00 10.34 ? 84  PHE A CA  1 
ATOM   206  C C   . PHE A 1 31 ? 12.063 7.367  32.784 1.00 10.71 ? 84  PHE A C   1 
ATOM   207  O O   . PHE A 1 31 ? 12.137 7.274  34.016 1.00 11.39 ? 84  PHE A O   1 
ATOM   208  C CB  . PHE A 1 31 ? 13.819 8.752  31.672 1.00 10.60 ? 84  PHE A CB  1 
ATOM   209  C CG  . PHE A 1 31 ? 14.257 9.443  32.917 1.00 10.66 ? 84  PHE A CG  1 
ATOM   210  C CD1 . PHE A 1 31 ? 15.570 9.306  33.374 1.00 11.92 ? 84  PHE A CD1 1 
ATOM   211  C CD2 . PHE A 1 31 ? 13.352 10.193 33.668 1.00 10.57 ? 84  PHE A CD2 1 
ATOM   212  C CE1 . PHE A 1 31 ? 15.976 9.930  34.536 1.00 12.21 ? 84  PHE A CE1 1 
ATOM   213  C CE2 . PHE A 1 31 ? 13.740 10.800 34.853 1.00 12.75 ? 84  PHE A CE2 1 
ATOM   214  C CZ  . PHE A 1 31 ? 15.057 10.674 35.292 1.00 12.59 ? 84  PHE A CZ  1 
ATOM   215  N N   . PHE A 1 32 ? 10.913 7.490  32.134 1.00 10.50 ? 85  PHE A N   1 
ATOM   216  C CA  . PHE A 1 32 ? 9.639  7.553  32.863 1.00 10.92 ? 85  PHE A CA  1 
ATOM   217  C C   . PHE A 1 32 ? 8.897  6.217  32.869 1.00 11.16 ? 85  PHE A C   1 
ATOM   218  O O   . PHE A 1 32 ? 7.700  6.171  33.173 1.00 11.34 ? 85  PHE A O   1 
ATOM   219  C CB  . PHE A 1 32 ? 8.776  8.712  32.345 1.00 11.56 ? 85  PHE A CB  1 
ATOM   220  C CG  . PHE A 1 32 ? 9.308  10.069 32.717 1.00 12.27 ? 85  PHE A CG  1 
ATOM   221  C CD1 . PHE A 1 32 ? 9.276  10.499 34.048 1.00 11.24 ? 85  PHE A CD1 1 
ATOM   222  C CD2 . PHE A 1 32 ? 9.894  10.894 31.758 1.00 11.53 ? 85  PHE A CD2 1 
ATOM   223  C CE1 . PHE A 1 32 ? 9.783  11.738 34.409 1.00 13.51 ? 85  PHE A CE1 1 
ATOM   224  C CE2 . PHE A 1 32 ? 10.407 12.150 32.115 1.00 12.17 ? 85  PHE A CE2 1 
ATOM   225  C CZ  . PHE A 1 32 ? 10.355 12.562 33.446 1.00 13.29 ? 85  PHE A CZ  1 
ATOM   226  N N   . ASN A 1 33 ? 9.627  5.139  32.564 1.00 11.23 ? 86  ASN A N   1 
ATOM   227  C CA  . ASN A 1 33 ? 9.060  3.780  32.577 1.00 12.14 ? 86  ASN A CA  1 
ATOM   228  C C   . ASN A 1 33 ? 7.762  3.701  31.783 1.00 12.16 ? 86  ASN A C   1 
ATOM   229  O O   . ASN A 1 33 ? 6.760  3.098  32.223 1.00 12.40 ? 86  ASN A O   1 
ATOM   230  C CB  . ASN A 1 33 ? 8.824  3.304  34.012 1.00 12.51 ? 86  ASN A CB  1 
ATOM   231  C CG  . ASN A 1 33 ? 10.086 3.322  34.831 1.00 15.49 ? 86  ASN A CG  1 
ATOM   232  O OD1 . ASN A 1 33 ? 10.164 3.996  35.860 1.00 21.48 ? 86  ASN A OD1 1 
ATOM   233  N ND2 . ASN A 1 33 ? 11.093 2.605  34.368 1.00 16.40 ? 86  ASN A ND2 1 
ATOM   234  N N   . LEU A 1 34 ? 7.796  4.295  30.593 1.00 11.49 ? 87  LEU A N   1 
ATOM   235  C CA  . LEU A 1 34 ? 6.631  4.295  29.719 1.00 10.39 ? 87  LEU A CA  1 
ATOM   236  C C   . LEU A 1 34 ? 6.712  3.026  28.873 1.00 11.14 ? 87  LEU A C   1 
ATOM   237  O O   . LEU A 1 34 ? 6.955  3.049  27.663 1.00 11.00 ? 87  LEU A O   1 
ATOM   238  C CB  . LEU A 1 34 ? 6.545  5.592  28.905 1.00 10.48 ? 87  LEU A CB  1 
ATOM   239  C CG  . LEU A 1 34 ? 6.423  6.843  29.784 1.00 10.16 ? 87  LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 34 ? 6.600  8.141  28.990 1.00 10.89 ? 87  LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 34 ? 5.089  6.883  30.497 1.00 11.61 ? 87  LEU A CD2 1 
ATOM   242  N N   . ASP A 1 35 ? 6.525  1.905  29.561 1.00 11.63 ? 88  ASP A N   1 
ATOM   243  C CA  . ASP A 1 35 ? 6.859  0.613  28.995 1.00 12.57 ? 88  ASP A CA  1 
ATOM   244  C C   . ASP A 1 35 ? 5.867  0.131  27.956 1.00 12.00 ? 88  ASP A C   1 
ATOM   245  O O   . ASP A 1 35 ? 6.260  -0.539 27.000 1.00 12.23 ? 88  ASP A O   1 
ATOM   246  C CB  . ASP A 1 35 ? 7.086  -0.408 30.104 1.00 14.01 ? 88  ASP A CB  1 
ATOM   247  C CG  . ASP A 1 35 ? 8.238  -0.004 31.014 1.00 18.27 ? 88  ASP A CG  1 
ATOM   248  O OD1 . ASP A 1 35 ? 9.341  0.250  30.488 1.00 21.04 ? 88  ASP A OD1 1 
ATOM   249  O OD2 . ASP A 1 35 ? 8.023  0.086  32.242 1.00 24.26 ? 88  ASP A OD2 1 
ATOM   250  N N   . PHE A 1 36 ? 4.597  0.479  28.129 1.00 11.77 ? 89  PHE A N   1 
ATOM   251  C CA  . PHE A 1 36 ? 3.617  0.126  27.101 1.00 11.94 ? 89  PHE A CA  1 
ATOM   252  C C   . PHE A 1 36 ? 3.864  0.936  25.835 1.00 11.26 ? 89  PHE A C   1 
ATOM   253  O O   . PHE A 1 36 ? 3.763  0.409  24.722 1.00 11.58 ? 89  PHE A O   1 
ATOM   254  C CB  . PHE A 1 36 ? 2.185  0.273  27.626 1.00 12.22 ? 89  PHE A CB  1 
ATOM   255  C CG  . PHE A 1 36 ? 1.834  -0.755 28.664 1.00 12.94 ? 89  PHE A CG  1 
ATOM   256  C CD1 . PHE A 1 36 ? 1.763  -2.111 28.322 1.00 14.74 ? 89  PHE A CD1 1 
ATOM   257  C CD2 . PHE A 1 36 ? 1.608  -0.384 29.975 1.00 15.95 ? 89  PHE A CD2 1 
ATOM   258  C CE1 . PHE A 1 36 ? 1.464  -3.074 29.290 1.00 14.77 ? 89  PHE A CE1 1 
ATOM   259  C CE2 . PHE A 1 36 ? 1.293  -1.340 30.952 1.00 16.05 ? 89  PHE A CE2 1 
ATOM   260  C CZ  . PHE A 1 36 ? 1.231  -2.686 30.612 1.00 15.00 ? 89  PHE A CZ  1 
ATOM   261  N N   . THR A 1 37 ? 4.231  2.210  26.008 1.00 11.10 ? 90  THR A N   1 
ATOM   262  C CA  . THR A 1 37 ? 4.579  3.046  24.865 1.00 10.55 ? 90  THR A CA  1 
ATOM   263  C C   . THR A 1 37 ? 5.785  2.474  24.134 1.00 10.30 ? 90  THR A C   1 
ATOM   264  O O   . THR A 1 37 ? 5.780  2.399  22.895 1.00 10.84 ? 90  THR A O   1 
ATOM   265  C CB  . THR A 1 37 ? 4.829  4.508  25.295 1.00 9.83  ? 90  THR A CB  1 
ATOM   266  O OG1 . THR A 1 37 ? 3.647  4.997  25.924 1.00 9.77  ? 90  THR A OG1 1 
ATOM   267  C CG2 . THR A 1 37 ? 5.147  5.378  24.078 1.00 11.08 ? 90  THR A CG2 1 
ATOM   268  N N   . LEU A 1 38 ? 6.795  2.046  24.891 1.00 10.49 ? 91  LEU A N   1 
ATOM   269  C CA  . LEU A 1 38 ? 7.971  1.435  24.286 1.00 11.19 ? 91  LEU A CA  1 
ATOM   270  C C   . LEU A 1 38 ? 7.625  0.172  23.509 1.00 10.60 ? 91  LEU A C   1 
ATOM   271  O O   . LEU A 1 38 ? 8.230  -0.085 22.460 1.00 12.22 ? 91  LEU A O   1 
ATOM   272  C CB  . LEU A 1 38 ? 9.038  1.153  25.350 1.00 11.87 ? 91  LEU A CB  1 
ATOM   273  C CG  . LEU A 1 38 ? 9.856  2.382  25.769 1.00 13.33 ? 91  LEU A CG  1 
ATOM   274  C CD1 . LEU A 1 38 ? 10.547 2.107  27.092 1.00 15.23 ? 91  LEU A CD1 1 
ATOM   275  C CD2 . LEU A 1 38 ? 10.881 2.769  24.697 1.00 14.17 ? 91  LEU A CD2 1 
ATOM   276  N N   . ALA A 1 39 ? 6.659  -0.602 24.015 1.00 11.29 ? 92  ALA A N   1 
ATOM   277  C CA  . ALA A 1 39 ? 6.265  -1.861 23.375 1.00 11.95 ? 92  ALA A CA  1 
ATOM   278  C C   . ALA A 1 39 ? 5.707  -1.652 21.968 1.00 12.27 ? 92  ALA A C   1 
ATOM   279  O O   . ALA A 1 39 ? 5.829  -2.531 21.102 1.00 12.86 ? 92  ALA A O   1 
ATOM   280  C CB  . ALA A 1 39 ? 5.262  -2.606 24.247 1.00 11.26 ? 92  ALA A CB  1 
ATOM   281  N N   . VAL A 1 40 ? 5.082  -0.491 21.750 1.00 11.81 ? 93  VAL A N   1 
ATOM   282  C CA  . VAL A 1 40 ? 4.577  -0.116 20.433 1.00 11.60 ? 93  VAL A CA  1 
ATOM   283  C C   . VAL A 1 40 ? 5.602  0.687  19.617 1.00 11.70 ? 93  VAL A C   1 
ATOM   284  O O   . VAL A 1 40 ? 5.706  0.513  18.403 1.00 12.07 ? 93  VAL A O   1 
ATOM   285  C CB  . VAL A 1 40 ? 3.246  0.643  20.542 1.00 12.34 ? 93  VAL A CB  1 
ATOM   286  C CG1 . VAL A 1 40 ? 2.757  1.058  19.181 1.00 13.54 ? 93  VAL A CG1 1 
ATOM   287  C CG2 . VAL A 1 40 ? 2.183  -0.238 21.226 1.00 13.07 ? 93  VAL A CG2 1 
ATOM   288  N N   . PHE A 1 41 ? 6.362  1.540  20.297 1.00 10.97 ? 94  PHE A N   1 
ATOM   289  C CA  . PHE A 1 41 ? 7.379  2.370  19.653 1.00 12.28 ? 94  PHE A CA  1 
ATOM   290  C C   . PHE A 1 41 ? 8.398  1.529  18.890 1.00 12.61 ? 94  PHE A C   1 
ATOM   291  O O   . PHE A 1 41 ? 8.714  1.830  17.740 1.00 12.69 ? 94  PHE A O   1 
ATOM   292  C CB  . PHE A 1 41 ? 8.074  3.225  20.718 1.00 11.77 ? 94  PHE A CB  1 
ATOM   293  C CG  . PHE A 1 41 ? 9.176  4.105  20.194 1.00 12.66 ? 94  PHE A CG  1 
ATOM   294  C CD1 . PHE A 1 41 ? 8.899  5.353  19.643 1.00 13.82 ? 94  PHE A CD1 1 
ATOM   295  C CD2 . PHE A 1 41 ? 10.506 3.697  20.316 1.00 13.65 ? 94  PHE A CD2 1 
ATOM   296  C CE1 . PHE A 1 41 ? 9.951  6.179  19.180 1.00 15.57 ? 94  PHE A CE1 1 
ATOM   297  C CE2 . PHE A 1 41 ? 11.547 4.500  19.849 1.00 13.82 ? 94  PHE A CE2 1 
ATOM   298  C CZ  . PHE A 1 41 ? 11.267 5.739  19.294 1.00 13.55 ? 94  PHE A CZ  1 
ATOM   299  N N   . GLN A 1 42 ? 8.889  0.470  19.532 1.00 13.30 ? 95  GLN A N   1 
ATOM   300  C CA  . GLN A 1 42 ? 9.900  -0.388 18.947 1.00 15.33 ? 95  GLN A CA  1 
ATOM   301  C C   . GLN A 1 42 ? 9.451  -0.971 17.575 1.00 14.69 ? 95  GLN A C   1 
ATOM   302  O O   . GLN A 1 42 ? 10.092 -0.702 16.550 1.00 16.26 ? 95  GLN A O   1 
ATOM   303  C CB  . GLN A 1 42 ? 10.389 -1.418 19.983 1.00 14.77 ? 95  GLN A CB  1 
ATOM   304  C CG  . GLN A 1 42 ? 11.241 -0.728 21.086 1.00 17.19 ? 95  GLN A CG  1 
ATOM   305  C CD  . GLN A 1 42 ? 11.286 -1.417 22.459 1.00 17.89 ? 95  GLN A CD  1 
ATOM   306  O OE1 . GLN A 1 42 ? 11.905 -0.888 23.390 1.00 23.40 ? 95  GLN A OE1 1 
ATOM   307  N NE2 . GLN A 1 42 ? 10.626 -2.559 22.601 1.00 19.83 ? 95  GLN A NE2 1 
ATOM   308  N N   . PRO A 1 43 ? 8.327  -1.707 17.526 1.00 14.46 ? 96  PRO A N   1 
ATOM   309  C CA  . PRO A 1 43 ? 7.898  -2.156 16.196 1.00 13.99 ? 96  PRO A CA  1 
ATOM   310  C C   . PRO A 1 43 ? 7.420  -1.070 15.227 1.00 13.92 ? 96  PRO A C   1 
ATOM   311  O O   . PRO A 1 43 ? 7.605  -1.228 14.014 1.00 15.17 ? 96  PRO A O   1 
ATOM   312  C CB  . PRO A 1 43 ? 6.765  -3.148 16.498 1.00 14.00 ? 96  PRO A CB  1 
ATOM   313  C CG  . PRO A 1 43 ? 6.263  -2.762 17.860 1.00 13.84 ? 96  PRO A CG  1 
ATOM   314  C CD  . PRO A 1 43 ? 7.452  -2.221 18.594 1.00 14.30 ? 96  PRO A CD  1 
ATOM   315  N N   . GLU A 1 44 ? 6.817  0.013  15.723 1.00 13.33 ? 97  GLU A N   1 
ATOM   316  C CA  . GLU A 1 44 ? 6.250  0.998  14.808 1.00 13.22 ? 97  GLU A CA  1 
ATOM   317  C C   . GLU A 1 44 ? 7.376  1.758  14.109 1.00 13.29 ? 97  GLU A C   1 
ATOM   318  O O   . GLU A 1 44 ? 7.204  2.226  12.970 1.00 13.98 ? 97  GLU A O   1 
ATOM   319  C CB  . GLU A 1 44 ? 5.260  1.951  15.504 1.00 13.06 ? 97  GLU A CB  1 
ATOM   320  C CG  . GLU A 1 44 ? 4.289  2.648  14.528 1.00 12.84 ? 97  GLU A CG  1 
ATOM   321  C CD  . GLU A 1 44 ? 3.184  3.427  15.204 1.00 13.04 ? 97  GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 44 ? 3.406  3.964  16.312 1.00 13.08 ? 97  GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 44 ? 2.084  3.518  14.619 1.00 15.67 ? 97  GLU A OE2 1 
ATOM   324  N N   . THR A 1 45 ? 8.522  1.871  14.783 1.00 13.35 ? 98  THR A N   1 
ATOM   325  C CA  . THR A 1 45 ? 9.686  2.588  14.225 1.00 14.44 ? 98  THR A CA  1 
ATOM   326  C C   . THR A 1 45 ? 10.743 1.682  13.587 1.00 16.13 ? 98  THR A C   1 
ATOM   327  O O   . THR A 1 45 ? 11.730 2.171  13.017 1.00 16.74 ? 98  THR A O   1 
ATOM   328  C CB  . THR A 1 45 ? 10.410 3.411  15.305 1.00 13.81 ? 98  THR A CB  1 
ATOM   329  O OG1 . THR A 1 45 ? 10.918 2.517  16.307 1.00 12.20 ? 98  THR A OG1 1 
ATOM   330  C CG2 . THR A 1 45 ? 9.471  4.431  15.957 1.00 14.22 ? 98  THR A CG2 1 
ATOM   331  N N   . SER A 1 46 ? 10.544 0.369  13.699 1.00 17.73 ? 99  SER A N   1 
ATOM   332  C CA  . SER A 1 46 ? 11.531 -0.621 13.253 1.00 19.74 ? 99  SER A CA  1 
ATOM   333  C C   . SER A 1 46 ? 12.899 -0.436 13.928 1.00 21.14 ? 99  SER A C   1 
ATOM   334  O O   . SER A 1 46 ? 13.940 -0.708 13.321 1.00 22.15 ? 99  SER A O   1 
ATOM   335  C CB  . SER A 1 46 ? 11.657 -0.609 11.718 1.00 20.10 ? 99  SER A CB  1 
ATOM   336  O OG  . SER A 1 46 ? 10.374 -0.673 11.117 1.00 20.59 ? 99  SER A OG  1 
ATOM   337  N N   . THR A 1 47 ? 12.894 0.027  15.179 1.00 22.10 ? 100 THR A N   1 
ATOM   338  C CA  . THR A 1 47 ? 14.135 0.203  15.948 1.00 23.29 ? 100 THR A CA  1 
ATOM   339  C C   . THR A 1 47 ? 14.306 -0.908 16.991 1.00 24.76 ? 100 THR A C   1 
ATOM   340  O O   . THR A 1 47 ? 13.619 -0.934 18.027 1.00 27.13 ? 100 THR A O   1 
ATOM   341  C CB  . THR A 1 47 ? 14.237 1.610  16.612 1.00 23.07 ? 100 THR A CB  1 
ATOM   342  O OG1 . THR A 1 47 ? 13.172 1.795  17.558 1.00 22.60 ? 100 THR A OG1 1 
ATOM   343  C CG2 . THR A 1 47 ? 14.194 2.728  15.564 1.00 22.34 ? 100 THR A CG2 1 
ATOM   344  N N   . LEU A 1 51 ? 18.673 1.586  19.339 1.00 24.24 ? 104 LEU A N   1 
ATOM   345  C CA  . LEU A 1 51 ? 19.076 2.982  19.465 1.00 24.20 ? 104 LEU A CA  1 
ATOM   346  C C   . LEU A 1 51 ? 20.146 3.176  20.544 1.00 24.82 ? 104 LEU A C   1 
ATOM   347  O O   . LEU A 1 51 ? 20.434 2.262  21.323 1.00 25.05 ? 104 LEU A O   1 
ATOM   348  C CB  . LEU A 1 51 ? 17.851 3.874  19.736 1.00 23.79 ? 104 LEU A CB  1 
ATOM   349  C CG  . LEU A 1 51 ? 16.768 3.939  18.647 1.00 22.47 ? 104 LEU A CG  1 
ATOM   350  C CD1 . LEU A 1 51 ? 15.485 4.633  19.167 1.00 19.11 ? 104 LEU A CD1 1 
ATOM   351  C CD2 . LEU A 1 51 ? 17.311 4.660  17.413 1.00 21.53 ? 104 LEU A CD2 1 
ATOM   352  N N   . GLU A 1 52 ? 20.739 4.367  20.584 1.00 25.45 ? 105 GLU A N   1 
ATOM   353  C CA  . GLU A 1 52 ? 21.858 4.632  21.490 1.00 25.72 ? 105 GLU A CA  1 
ATOM   354  C C   . GLU A 1 52 ? 21.396 4.775  22.935 1.00 25.04 ? 105 GLU A C   1 
ATOM   355  O O   . GLU A 1 52 ? 20.498 5.568  23.219 1.00 25.25 ? 105 GLU A O   1 
ATOM   356  C CB  . GLU A 1 52 ? 22.605 5.887  21.051 1.00 26.78 ? 105 GLU A CB  1 
ATOM   357  C CG  . GLU A 1 52 ? 23.232 5.777  19.665 1.00 29.15 ? 105 GLU A CG  1 
ATOM   358  C CD  . GLU A 1 52 ? 24.470 4.902  19.641 1.00 32.62 ? 105 GLU A CD  1 
ATOM   359  O OE1 . GLU A 1 52 ? 25.145 4.785  20.690 1.00 35.02 ? 105 GLU A OE1 1 
ATOM   360  O OE2 . GLU A 1 52 ? 24.768 4.337  18.563 1.00 34.77 ? 105 GLU A OE2 1 
ATOM   361  N N   . GLY A 1 53 ? 22.016 4.009  23.835 1.00 24.11 ? 106 GLY A N   1 
ATOM   362  C CA  . GLY A 1 53 ? 21.693 4.035  25.268 1.00 22.69 ? 106 GLY A CA  1 
ATOM   363  C C   . GLY A 1 53 ? 22.181 5.316  25.922 1.00 21.19 ? 106 GLY A C   1 
ATOM   364  O O   . GLY A 1 53 ? 22.935 6.071  25.306 1.00 20.52 ? 106 GLY A O   1 
ATOM   365  N N   . ARG A 1 54 ? 21.770 5.551  27.174 1.00 20.73 ? 107 ARG A N   1 
ATOM   366  C CA  . ARG A 1 54 ? 22.025 6.839  27.846 1.00 18.71 ? 107 ARG A CA  1 
ATOM   367  C C   . ARG A 1 54 ? 23.490 7.293  27.978 1.00 18.86 ? 107 ARG A C   1 
ATOM   368  O O   . ARG A 1 54 ? 23.774 8.445  27.694 1.00 17.01 ? 107 ARG A O   1 
ATOM   369  C CB  . ARG A 1 54 ? 21.293 6.955  29.195 1.00 19.02 ? 107 ARG A CB  1 
ATOM   370  C CG  . ARG A 1 54 ? 21.470 8.323  29.867 1.00 17.40 ? 107 ARG A CG  1 
ATOM   371  C CD  . ARG A 1 54 ? 20.571 8.493  31.076 1.00 16.79 ? 107 ARG A CD  1 
ATOM   372  N NE  . ARG A 1 54 ? 20.863 9.719  31.826 1.00 11.94 ? 107 ARG A NE  1 
ATOM   373  C CZ  . ARG A 1 54 ? 19.938 10.590 32.232 1.00 12.98 ? 107 ARG A CZ  1 
ATOM   374  N NH1 . ARG A 1 54 ? 18.651 10.376 31.963 1.00 10.41 ? 107 ARG A NH1 1 
ATOM   375  N NH2 . ARG A 1 54 ? 20.297 11.658 32.927 1.00 13.16 ? 107 ARG A NH2 1 
ATOM   376  N N   . GLU A 1 55 ? 24.398 6.418  28.421 1.00 18.82 ? 108 GLU A N   1 
ATOM   377  C CA  . GLU A 1 55 ? 25.824 6.774  28.538 1.00 19.83 ? 108 GLU A CA  1 
ATOM   378  C C   . GLU A 1 55 ? 26.418 7.264  27.210 1.00 18.79 ? 108 GLU A C   1 
ATOM   379  O O   . GLU A 1 55 ? 27.053 8.325  27.164 1.00 18.76 ? 108 GLU A O   1 
ATOM   380  C CB  . GLU A 1 55 ? 26.654 5.589  29.065 1.00 20.34 ? 108 GLU A CB  1 
ATOM   381  C CG  . GLU A 1 55 ? 28.094 5.939  29.400 1.00 22.53 ? 108 GLU A CG  1 
ATOM   382  C CD  . GLU A 1 55 ? 28.898 4.734  29.878 1.00 23.23 ? 108 GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 55 ? 29.014 3.732  29.126 1.00 28.93 ? 108 GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 55 ? 29.425 4.801  31.004 1.00 28.81 ? 108 GLU A OE2 1 
ATOM   385  N N   . ASN A 1 56 ? 26.223 6.486  26.144 1.00 18.38 ? 109 ASN A N   1 
ATOM   386  C CA  . ASN A 1 56 ? 26.724 6.847  24.814 1.00 17.74 ? 109 ASN A CA  1 
ATOM   387  C C   . ASN A 1 56 ? 26.044 8.105  24.275 1.00 16.06 ? 109 ASN A C   1 
ATOM   388  O O   . ASN A 1 56 ? 26.681 8.953  23.642 1.00 15.43 ? 109 ASN A O   1 
ATOM   389  C CB  . ASN A 1 56 ? 26.567 5.681  23.824 1.00 18.99 ? 109 ASN A CB  1 
ATOM   390  C CG  . ASN A 1 56 ? 27.438 4.467  24.188 1.00 21.20 ? 109 ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 56 ? 27.040 3.319  23.974 1.00 27.21 ? 109 ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 56 ? 28.622 4.718  24.730 1.00 21.60 ? 109 ASN A ND2 1 
ATOM   393  N N   . LEU A 1 57 ? 24.750 8.231  24.556 1.00 14.51 ? 110 LEU A N   1 
ATOM   394  C CA  . LEU A 1 57 ? 23.983 9.367  24.119 1.00 13.74 ? 110 LEU A CA  1 
ATOM   395  C C   . LEU A 1 57 ? 24.434 10.654 24.804 1.00 13.13 ? 110 LEU A C   1 
ATOM   396  O O   . LEU A 1 57 ? 24.554 11.685 24.143 1.00 13.13 ? 110 LEU A O   1 
ATOM   397  C CB  . LEU A 1 57 ? 22.485 9.122  24.346 1.00 13.76 ? 110 LEU A CB  1 
ATOM   398  C CG  . LEU A 1 57 ? 21.490 10.151 23.790 1.00 14.54 ? 110 LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 57 ? 21.647 10.360 22.274 1.00 14.58 ? 110 LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 57 ? 20.082 9.686  24.152 1.00 15.17 ? 110 LEU A CD2 1 
ATOM   401  N N   . ALA A 1 58 ? 24.669 10.605 26.120 1.00 12.41 ? 111 ALA A N   1 
ATOM   402  C CA  . ALA A 1 58 ? 25.151 11.793 26.826 1.00 12.88 ? 111 ALA A CA  1 
ATOM   403  C C   . ALA A 1 58 ? 26.501 12.223 26.252 1.00 13.39 ? 111 ALA A C   1 
ATOM   404  O O   . ALA A 1 58 ? 26.715 13.398 25.995 1.00 13.43 ? 111 ALA A O   1 
ATOM   405  C CB  . ALA A 1 58 ? 25.263 11.536 28.319 1.00 12.90 ? 111 ALA A CB  1 
ATOM   406  N N   . ARG A 1 59 ? 27.384 11.259 26.012 1.00 15.03 ? 112 ARG A N   1 
ATOM   407  C CA  . ARG A 1 59 ? 28.680 11.570 25.398 1.00 16.42 ? 112 ARG A CA  1 
ATOM   408  C C   . ARG A 1 59 ? 28.494 12.244 24.025 1.00 16.00 ? 112 ARG A C   1 
ATOM   409  O O   . ARG A 1 59 ? 29.129 13.268 23.722 1.00 16.59 ? 112 ARG A O   1 
ATOM   410  C CB  . ARG A 1 59 ? 29.551 10.317 25.289 1.00 16.63 ? 112 ARG A CB  1 
ATOM   411  C CG  . ARG A 1 59 ? 30.952 10.579 24.697 1.00 18.91 ? 112 ARG A CG  1 
ATOM   412  C CD  . ARG A 1 59 ? 31.688 9.286  24.381 1.00 19.74 ? 112 ARG A CD  1 
ATOM   413  N NE  . ARG A 1 59 ? 31.032 8.521  23.317 1.00 26.50 ? 112 ARG A NE  1 
ATOM   414  C CZ  . ARG A 1 59 ? 30.423 7.350  23.490 1.00 27.56 ? 112 ARG A CZ  1 
ATOM   415  N NH1 . ARG A 1 59 ? 30.401 6.774  24.686 1.00 29.24 ? 112 ARG A NH1 1 
ATOM   416  N NH2 . ARG A 1 59 ? 29.847 6.744  22.456 1.00 30.95 ? 112 ARG A NH2 1 
ATOM   417  N N   . ASP A 1 60 ? 27.598 11.694 23.209 1.00 16.08 ? 113 ASP A N   1 
ATOM   418  C CA  . ASP A 1 60 ? 27.379 12.227 21.861 1.00 16.81 ? 113 ASP A CA  1 
ATOM   419  C C   . ASP A 1 60 ? 26.863 13.666 21.913 1.00 16.38 ? 113 ASP A C   1 
ATOM   420  O O   . ASP A 1 60 ? 27.151 14.485 21.031 1.00 16.47 ? 113 ASP A O   1 
ATOM   421  C CB  . ASP A 1 60 ? 26.421 11.316 21.086 1.00 17.68 ? 113 ASP A CB  1 
ATOM   422  C CG  . ASP A 1 60 ? 27.069 9.985  20.682 1.00 21.28 ? 113 ASP A CG  1 
ATOM   423  O OD1 . ASP A 1 60 ? 28.315 9.868  20.717 1.00 22.93 ? 113 ASP A OD1 1 
ATOM   424  O OD2 . ASP A 1 60 ? 26.321 9.048  20.334 1.00 26.10 ? 113 ASP A OD2 1 
ATOM   425  N N   . LEU A 1 61 ? 26.140 13.983 22.982 1.00 14.62 ? 114 LEU A N   1 
ATOM   426  C CA  . LEU A 1 61 ? 25.477 15.272 23.123 1.00 14.18 ? 114 LEU A CA  1 
ATOM   427  C C   . LEU A 1 61 ? 26.282 16.253 23.954 1.00 13.77 ? 114 LEU A C   1 
ATOM   428  O O   . LEU A 1 61 ? 25.819 17.357 24.233 1.00 13.44 ? 114 LEU A O   1 
ATOM   429  C CB  . LEU A 1 61 ? 24.114 15.084 23.772 1.00 14.32 ? 114 LEU A CB  1 
ATOM   430  C CG  . LEU A 1 61 ? 23.117 14.303 22.911 1.00 14.41 ? 114 LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 61 ? 21.921 13.938 23.734 1.00 15.46 ? 114 LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 61 ? 22.710 15.126 21.687 1.00 14.69 ? 114 LEU A CD2 1 
ATOM   433  N N   . GLY A 1 62 ? 27.476 15.830 24.369 1.00 13.83 ? 115 GLY A N   1 
ATOM   434  C CA  . GLY A 1 62 ? 28.364 16.696 25.140 1.00 14.56 ? 115 GLY A CA  1 
ATOM   435  C C   . GLY A 1 62 ? 27.799 17.026 26.508 1.00 15.30 ? 115 GLY A C   1 
ATOM   436  O O   . GLY A 1 62 ? 28.032 18.116 27.038 1.00 15.59 ? 115 GLY A O   1 
ATOM   437  N N   . ILE A 1 63 ? 27.034 16.083 27.060 1.00 14.40 ? 116 ILE A N   1 
ATOM   438  C CA  . ILE A 1 63 ? 26.420 16.245 28.374 1.00 15.55 ? 116 ILE A CA  1 
ATOM   439  C C   . ILE A 1 63 ? 27.236 15.438 29.383 1.00 15.43 ? 116 ILE A C   1 
ATOM   440  O O   . ILE A 1 63 ? 27.397 14.215 29.254 1.00 15.44 ? 116 ILE A O   1 
ATOM   441  C CB  . ILE A 1 63 ? 24.921 15.794 28.364 1.00 14.85 ? 116 ILE A CB  1 
ATOM   442  C CG1 . ILE A 1 63 ? 24.087 16.719 27.478 1.00 14.80 ? 116 ILE A CG1 1 
ATOM   443  C CG2 . ILE A 1 63 ? 24.323 15.767 29.785 1.00 15.79 ? 116 ILE A CG2 1 
ATOM   444  C CD1 . ILE A 1 63 ? 22.694 16.198 27.167 1.00 16.23 ? 116 ILE A CD1 1 
ATOM   445  N N   . ILE A 1 64 ? 27.771 16.137 30.383 1.00 16.91 ? 117 ILE A N   1 
ATOM   446  C CA  . ILE A 1 64 ? 28.533 15.484 31.439 1.00 17.79 ? 117 ILE A CA  1 
ATOM   447  C C   . ILE A 1 64 ? 27.553 15.148 32.556 1.00 18.00 ? 117 ILE A C   1 
ATOM   448  O O   . ILE A 1 64 ? 26.946 16.039 33.144 1.00 18.04 ? 117 ILE A O   1 
ATOM   449  C CB  . ILE A 1 64 ? 29.675 16.383 31.954 1.00 18.21 ? 117 ILE A CB  1 
ATOM   450  C CG1 . ILE A 1 64 ? 30.554 16.835 30.782 1.00 18.75 ? 117 ILE A CG1 1 
ATOM   451  C CG2 . ILE A 1 64 ? 30.514 15.630 32.995 1.00 18.33 ? 117 ILE A CG2 1 
ATOM   452  C CD1 . ILE A 1 64 ? 31.290 18.155 31.006 1.00 21.65 ? 117 ILE A CD1 1 
ATOM   453  N N   . GLU A 1 65 ? 27.386 13.855 32.813 1.00 18.20 ? 118 GLU A N   1 
ATOM   454  C CA  . GLU A 1 65 ? 26.435 13.388 33.818 1.00 18.71 ? 118 GLU A CA  1 
ATOM   455  C C   . GLU A 1 65 ? 26.896 13.722 35.225 1.00 18.94 ? 118 GLU A C   1 
ATOM   456  O O   . GLU A 1 65 ? 28.046 13.448 35.602 1.00 19.51 ? 118 GLU A O   1 
ATOM   457  C CB  . GLU A 1 65 ? 26.187 11.897 33.664 1.00 19.64 ? 118 GLU A CB  1 
ATOM   458  C CG  . GLU A 1 65 ? 25.262 11.603 32.504 1.00 21.63 ? 118 GLU A CG  1 
ATOM   459  C CD  . GLU A 1 65 ? 23.850 11.249 32.934 1.00 24.47 ? 118 GLU A CD  1 
ATOM   460  O OE1 . GLU A 1 65 ? 23.158 12.066 33.588 1.00 24.02 ? 118 GLU A OE1 1 
ATOM   461  O OE2 . GLU A 1 65 ? 23.431 10.136 32.588 1.00 25.64 ? 118 GLU A OE2 1 
ATOM   462  N N   . ALA A 1 66 ? 25.990 14.340 35.981 1.00 18.05 ? 119 ALA A N   1 
ATOM   463  C CA  . ALA A 1 66 ? 26.270 14.780 37.348 1.00 17.62 ? 119 ALA A CA  1 
ATOM   464  C C   . ALA A 1 66 ? 24.985 14.828 38.171 1.00 17.56 ? 119 ALA A C   1 
ATOM   465  O O   . ALA A 1 66 ? 23.907 14.484 37.683 1.00 16.72 ? 119 ALA A O   1 
ATOM   466  C CB  . ALA A 1 66 ? 26.928 16.138 37.330 1.00 18.09 ? 119 ALA A CB  1 
ATOM   467  N N   . GLU A 1 67 ? 25.101 15.281 39.415 1.00 17.41 ? 120 GLU A N   1 
ATOM   468  C CA  . GLU A 1 67 ? 23.946 15.381 40.307 1.00 17.73 ? 120 GLU A CA  1 
ATOM   469  C C   . GLU A 1 67 ? 22.766 16.118 39.673 1.00 16.76 ? 120 GLU A C   1 
ATOM   470  O O   . GLU A 1 67 ? 21.614 15.731 39.871 1.00 16.15 ? 120 GLU A O   1 
ATOM   471  C CB  . GLU A 1 67 ? 24.338 16.051 41.638 1.00 19.01 ? 120 GLU A CB  1 
ATOM   472  C CG  . GLU A 1 67 ? 25.176 15.176 42.561 1.00 22.82 ? 120 GLU A CG  1 
ATOM   473  C CD  . GLU A 1 67 ? 26.669 15.195 42.240 1.00 28.70 ? 120 GLU A CD  1 
ATOM   474  O OE1 . GLU A 1 67 ? 27.082 15.705 41.161 1.00 29.99 ? 120 GLU A OE1 1 
ATOM   475  O OE2 . GLU A 1 67 ? 27.434 14.680 43.087 1.00 31.39 ? 120 GLU A OE2 1 
ATOM   476  N N   . GLY A 1 68 ? 23.061 17.157 38.891 1.00 16.20 ? 121 GLY A N   1 
ATOM   477  C CA  . GLY A 1 68 ? 22.032 17.997 38.309 1.00 16.12 ? 121 GLY A CA  1 
ATOM   478  C C   . GLY A 1 68 ? 21.370 17.439 37.068 1.00 16.11 ? 121 GLY A C   1 
ATOM   479  O O   . GLY A 1 68 ? 20.382 18.010 36.604 1.00 16.81 ? 121 GLY A O   1 
ATOM   480  N N   . THR A 1 69 ? 21.906 16.344 36.527 1.00 15.59 ? 122 THR A N   1 
ATOM   481  C CA  . THR A 1 69 ? 21.352 15.765 35.284 1.00 14.93 ? 122 THR A CA  1 
ATOM   482  C C   . THR A 1 69 ? 20.701 14.392 35.489 1.00 14.96 ? 122 THR A C   1 
ATOM   483  O O   . THR A 1 69 ? 19.786 14.006 34.737 1.00 14.49 ? 122 THR A O   1 
ATOM   484  C CB  . THR A 1 69 ? 22.429 15.633 34.151 1.00 14.90 ? 122 THR A CB  1 
ATOM   485  O OG1 . THR A 1 69 ? 23.413 14.658 34.524 1.00 15.57 ? 122 THR A OG1 1 
ATOM   486  C CG2 . THR A 1 69 ? 23.107 16.961 33.856 1.00 15.16 ? 122 THR A CG2 1 
ATOM   487  N N   . VAL A 1 70 ? 21.172 13.649 36.489 1.00 14.52 ? 123 VAL A N   1 
ATOM   488  C CA  . VAL A 1 70 ? 20.759 12.249 36.666 1.00 14.97 ? 123 VAL A CA  1 
ATOM   489  C C   . VAL A 1 70 ? 19.259 12.081 36.972 1.00 14.51 ? 123 VAL A C   1 
ATOM   490  O O   . VAL A 1 70 ? 18.667 11.000 36.727 1.00 14.92 ? 123 VAL A O   1 
ATOM   491  C CB  . VAL A 1 70 ? 21.606 11.530 37.747 1.00 14.63 ? 123 VAL A CB  1 
ATOM   492  C CG1 . VAL A 1 70 ? 23.055 11.461 37.335 1.00 17.28 ? 123 VAL A CG1 1 
ATOM   493  C CG2 . VAL A 1 70 ? 21.435 12.195 39.116 1.00 16.27 ? 123 VAL A CG2 1 
ATOM   494  N N   . GLY A 1 71 ? 18.651 13.149 37.479 1.00 13.64 ? 124 GLY A N   1 
ATOM   495  C CA  . GLY A 1 71 ? 17.260 13.097 37.919 1.00 13.41 ? 124 GLY A CA  1 
ATOM   496  C C   . GLY A 1 71 ? 16.239 13.410 36.854 1.00 13.09 ? 124 GLY A C   1 
ATOM   497  O O   . GLY A 1 71 ? 15.038 13.471 37.150 1.00 13.93 ? 124 GLY A O   1 
ATOM   498  N N   . GLY A 1 72 ? 16.710 13.619 35.623 1.00 11.53 ? 125 GLY A N   1 
ATOM   499  C CA  . GLY A 1 72 ? 15.813 13.876 34.499 1.00 10.20 ? 125 GLY A CA  1 
ATOM   500  C C   . GLY A 1 72 ? 16.260 13.154 33.235 1.00 9.27  ? 125 GLY A C   1 
ATOM   501  O O   . GLY A 1 72 ? 17.387 12.660 33.165 1.00 9.31  ? 125 GLY A O   1 
ATOM   502  N N   . PRO A 1 73 ? 15.379 13.112 32.224 1.00 8.95  ? 126 PRO A N   1 
ATOM   503  C CA  . PRO A 1 73 ? 15.771 12.532 30.937 1.00 8.99  ? 126 PRO A CA  1 
ATOM   504  C C   . PRO A 1 73 ? 16.803 13.445 30.281 1.00 9.42  ? 126 PRO A C   1 
ATOM   505  O O   . PRO A 1 73 ? 16.847 14.639 30.596 1.00 9.40  ? 126 PRO A O   1 
ATOM   506  C CB  . PRO A 1 73 ? 14.459 12.543 30.136 1.00 8.62  ? 126 PRO A CB  1 
ATOM   507  C CG  . PRO A 1 73 ? 13.720 13.733 30.691 1.00 8.45  ? 126 PRO A CG  1 
ATOM   508  C CD  . PRO A 1 73 ? 14.009 13.666 32.191 1.00 9.24  ? 126 PRO A CD  1 
ATOM   509  N N   . LEU A 1 74 ? 17.627 12.909 29.381 1.00 9.75  ? 127 LEU A N   1 
ATOM   510  C CA  . LEU A 1 74 ? 18.658 13.740 28.749 1.00 9.86  ? 127 LEU A CA  1 
ATOM   511  C C   . LEU A 1 74 ? 18.055 14.925 27.979 1.00 9.56  ? 127 LEU A C   1 
ATOM   512  O O   . LEU A 1 74 ? 18.638 16.010 27.947 1.00 9.22  ? 127 LEU A O   1 
ATOM   513  C CB  . LEU A 1 74 ? 19.564 12.893 27.848 1.00 10.49 ? 127 LEU A CB  1 
ATOM   514  C CG  . LEU A 1 74 ? 20.502 11.907 28.531 1.00 11.70 ? 127 LEU A CG  1 
ATOM   515  C CD1 . LEU A 1 74 ? 21.267 11.195 27.441 1.00 12.55 ? 127 LEU A CD1 1 
ATOM   516  C CD2 . LEU A 1 74 ? 21.455 12.582 29.523 1.00 11.60 ? 127 LEU A CD2 1 
ATOM   517  N N   . LEU A 1 75 ? 16.872 14.740 27.378 1.00 9.40  ? 128 LEU A N   1 
ATOM   518  C CA  . LEU A 1 75 ? 16.221 15.838 26.675 1.00 10.65 ? 128 LEU A CA  1 
ATOM   519  C C   . LEU A 1 75 ? 15.986 17.039 27.583 1.00 10.10 ? 128 LEU A C   1 
ATOM   520  O O   . LEU A 1 75 ? 15.937 18.171 27.109 1.00 10.12 ? 128 LEU A O   1 
ATOM   521  C CB  . LEU A 1 75 ? 14.911 15.358 26.043 1.00 11.90 ? 128 LEU A CB  1 
ATOM   522  C CG  . LEU A 1 75 ? 14.414 15.944 24.726 1.00 17.19 ? 128 LEU A CG  1 
ATOM   523  C CD1 . LEU A 1 75 ? 15.500 16.034 23.653 1.00 15.52 ? 128 LEU A CD1 1 
ATOM   524  C CD2 . LEU A 1 75 ? 13.308 15.033 24.233 1.00 18.28 ? 128 LEU A CD2 1 
ATOM   525  N N   . LEU A 1 76 ? 15.829 16.794 28.888 1.00 9.13  ? 129 LEU A N   1 
ATOM   526  C CA  . LEU A 1 76 ? 15.640 17.909 29.820 1.00 10.02 ? 129 LEU A CA  1 
ATOM   527  C C   . LEU A 1 76 ? 16.877 18.798 29.874 1.00 9.97  ? 129 LEU A C   1 
ATOM   528  O O   . LEU A 1 76 ? 16.755 20.007 29.965 1.00 10.70 ? 129 LEU A O   1 
ATOM   529  C CB  . LEU A 1 76 ? 15.274 17.440 31.220 1.00 9.48  ? 129 LEU A CB  1 
ATOM   530  C CG  . LEU A 1 76 ? 15.065 18.527 32.288 1.00 10.64 ? 129 LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 76 ? 13.933 19.500 31.964 1.00 11.51 ? 129 LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 76 ? 14.796 17.891 33.654 1.00 10.49 ? 129 LEU A CD2 1 
ATOM   533  N N   . GLU A 1 77 ? 18.063 18.192 29.844 1.00 10.52 ? 130 GLU A N   1 
ATOM   534  C CA  . GLU A 1 77 ? 19.285 18.986 29.909 1.00 11.87 ? 130 GLU A CA  1 
ATOM   535  C C   . GLU A 1 77 ? 19.413 19.878 28.673 1.00 11.90 ? 130 GLU A C   1 
ATOM   536  O O   . GLU A 1 77 ? 19.762 21.059 28.767 1.00 12.98 ? 130 GLU A O   1 
ATOM   537  C CB  . GLU A 1 77 ? 20.500 18.072 30.061 1.00 12.60 ? 130 GLU A CB  1 
ATOM   538  C CG  . GLU A 1 77 ? 21.830 18.808 30.062 1.00 16.15 ? 130 GLU A CG  1 
ATOM   539  C CD  . GLU A 1 77 ? 22.173 19.492 31.380 1.00 19.90 ? 130 GLU A CD  1 
ATOM   540  O OE1 . GLU A 1 77 ? 21.296 19.657 32.271 1.00 20.30 ? 130 GLU A OE1 1 
ATOM   541  O OE2 . GLU A 1 77 ? 23.356 19.887 31.500 1.00 22.31 ? 130 GLU A OE2 1 
ATOM   542  N N   . VAL A 1 78 ? 19.065 19.317 27.516 1.00 11.47 ? 131 VAL A N   1 
ATOM   543  C CA  . VAL A 1 78 ? 19.064 20.082 26.268 1.00 11.71 ? 131 VAL A CA  1 
ATOM   544  C C   . VAL A 1 78 ? 18.119 21.284 26.351 1.00 12.20 ? 131 VAL A C   1 
ATOM   545  O O   . VAL A 1 78 ? 18.495 22.416 26.056 1.00 12.49 ? 131 VAL A O   1 
ATOM   546  C CB  . VAL A 1 78 ? 18.692 19.182 25.073 1.00 11.56 ? 131 VAL A CB  1 
ATOM   547  C CG1 . VAL A 1 78 ? 18.486 20.020 23.810 1.00 10.98 ? 131 VAL A CG1 1 
ATOM   548  C CG2 . VAL A 1 78 ? 19.775 18.090 24.867 1.00 10.55 ? 131 VAL A CG2 1 
ATOM   549  N N   . ILE A 1 79 ? 16.882 21.042 26.775 1.00 11.77 ? 132 ILE A N   1 
ATOM   550  C CA  . ILE A 1 79 ? 15.890 22.117 26.870 1.00 13.16 ? 132 ILE A CA  1 
ATOM   551  C C   . ILE A 1 79 ? 16.223 23.164 27.954 1.00 14.16 ? 132 ILE A C   1 
ATOM   552  O O   . ILE A 1 79 ? 16.043 24.372 27.760 1.00 14.22 ? 132 ILE A O   1 
ATOM   553  C CB  . ILE A 1 79 ? 14.466 21.516 27.026 1.00 13.06 ? 132 ILE A CB  1 
ATOM   554  C CG1 . ILE A 1 79 ? 14.006 20.881 25.700 1.00 14.56 ? 132 ILE A CG1 1 
ATOM   555  C CG2 . ILE A 1 79 ? 13.473 22.565 27.508 1.00 14.00 ? 132 ILE A CG2 1 
ATOM   556  C CD1 . ILE A 1 79 ? 14.248 21.749 24.428 1.00 15.95 ? 132 ILE A CD1 1 
ATOM   557  N N   . ARG A 1 80 ? 16.740 22.692 29.080 1.00 14.42 ? 133 ARG A N   1 
ATOM   558  C CA  . ARG A 1 80 ? 17.166 23.563 30.160 1.00 16.61 ? 133 ARG A CA  1 
ATOM   559  C C   . ARG A 1 80 ? 18.226 24.561 29.682 1.00 15.50 ? 133 ARG A C   1 
ATOM   560  O O   . ARG A 1 80 ? 18.245 25.707 30.131 1.00 17.10 ? 133 ARG A O   1 
ATOM   561  C CB  . ARG A 1 80 ? 17.768 22.713 31.274 1.00 17.28 ? 133 ARG A CB  1 
ATOM   562  C CG  . ARG A 1 80 ? 17.517 23.235 32.660 1.00 22.57 ? 133 ARG A CG  1 
ATOM   563  C CD  . ARG A 1 80 ? 16.609 22.282 33.443 1.00 27.50 ? 133 ARG A CD  1 
ATOM   564  N NE  . ARG A 1 80 ? 17.336 21.117 33.938 1.00 30.46 ? 133 ARG A NE  1 
ATOM   565  C CZ  . ARG A 1 80 ? 17.017 20.399 35.019 1.00 31.03 ? 133 ARG A CZ  1 
ATOM   566  N NH1 . ARG A 1 80 ? 15.968 20.704 35.771 1.00 31.97 ? 133 ARG A NH1 1 
ATOM   567  N NH2 . ARG A 1 80 ? 17.769 19.365 35.354 1.00 31.70 ? 133 ARG A NH2 1 
ATOM   568  N N   . ARG A 1 81 ? 19.092 24.126 28.763 1.00 15.36 ? 134 ARG A N   1 
ATOM   569  C CA  . ARG A 1 81 ? 20.252 24.930 28.346 1.00 16.15 ? 134 ARG A CA  1 
ATOM   570  C C   . ARG A 1 81 ? 20.068 25.591 26.964 1.00 16.77 ? 134 ARG A C   1 
ATOM   571  O O   . ARG A 1 81 ? 20.971 26.278 26.452 1.00 16.85 ? 134 ARG A O   1 
ATOM   572  C CB  . ARG A 1 81 ? 21.515 24.070 28.405 1.00 16.06 ? 134 ARG A CB  1 
ATOM   573  C CG  . ARG A 1 81 ? 21.924 23.744 29.848 1.00 17.21 ? 134 ARG A CG  1 
ATOM   574  C CD  . ARG A 1 81 ? 23.018 22.712 29.910 1.00 18.11 ? 134 ARG A CD  1 
ATOM   575  N NE  . ARG A 1 81 ? 24.228 23.193 29.251 1.00 18.91 ? 134 ARG A NE  1 
ATOM   576  C CZ  . ARG A 1 81 ? 25.262 22.431 28.913 1.00 19.22 ? 134 ARG A CZ  1 
ATOM   577  N NH1 . ARG A 1 81 ? 25.260 21.128 29.169 1.00 20.15 ? 134 ARG A NH1 1 
ATOM   578  N NH2 . ARG A 1 81 ? 26.303 22.991 28.317 1.00 20.42 ? 134 ARG A NH2 1 
ATOM   579  N N   . TRP A 1 82 ? 18.889 25.384 26.377 1.00 17.29 ? 135 TRP A N   1 
ATOM   580  C CA  . TRP A 1 82 ? 18.489 25.999 25.114 1.00 18.76 ? 135 TRP A CA  1 
ATOM   581  C C   . TRP A 1 82 ? 18.482 27.517 25.178 1.00 19.82 ? 135 TRP A C   1 
ATOM   582  O O   . TRP A 1 82 ? 19.107 28.167 24.344 1.00 21.42 ? 135 TRP A O   1 
ATOM   583  C CB  . TRP A 1 82 ? 17.091 25.511 24.707 1.00 18.66 ? 135 TRP A CB  1 
ATOM   584  C CG  . TRP A 1 82 ? 16.598 26.101 23.418 1.00 16.72 ? 135 TRP A CG  1 
ATOM   585  C CD1 . TRP A 1 82 ? 15.725 27.143 23.272 1.00 16.93 ? 135 TRP A CD1 1 
ATOM   586  C CD2 . TRP A 1 82 ? 16.949 25.681 22.090 1.00 16.02 ? 135 TRP A CD2 1 
ATOM   587  N NE1 . TRP A 1 82 ? 15.506 27.395 21.927 1.00 17.63 ? 135 TRP A NE1 1 
ATOM   588  C CE2 . TRP A 1 82 ? 16.247 26.515 21.184 1.00 15.90 ? 135 TRP A CE2 1 
ATOM   589  C CE3 . TRP A 1 82 ? 17.796 24.686 21.583 1.00 17.65 ? 135 TRP A CE3 1 
ATOM   590  C CZ2 . TRP A 1 82 ? 16.367 26.385 19.790 1.00 17.20 ? 135 TRP A CZ2 1 
ATOM   591  C CZ3 . TRP A 1 82 ? 17.917 24.552 20.206 1.00 17.44 ? 135 TRP A CZ3 1 
ATOM   592  C CH2 . TRP A 1 82 ? 17.198 25.399 19.322 1.00 16.75 ? 135 TRP A CH2 1 
ATOM   593  O OXT . TRP A 1 82 ? 17.821 28.111 26.043 1.00 21.72 ? 135 TRP A OXT 1 
ATOM   594  N N   . ASN B 1 6  ? 2.318  7.430  38.436 1.00 27.65 ? 59  ASN B N   1 
ATOM   595  C CA  . ASN B 1 6  ? 3.621  7.984  37.942 1.00 27.11 ? 59  ASN B CA  1 
ATOM   596  C C   . ASN B 1 6  ? 3.839  9.428  38.402 1.00 27.00 ? 59  ASN B C   1 
ATOM   597  O O   . ASN B 1 6  ? 3.719  10.375 37.611 1.00 27.06 ? 59  ASN B O   1 
ATOM   598  C CB  . ASN B 1 6  ? 3.721  7.869  36.408 1.00 26.87 ? 59  ASN B CB  1 
ATOM   599  C CG  . ASN B 1 6  ? 5.163  8.003  35.890 1.00 25.57 ? 59  ASN B CG  1 
ATOM   600  O OD1 . ASN B 1 6  ? 5.981  8.699  36.482 1.00 24.64 ? 59  ASN B OD1 1 
ATOM   601  N ND2 . ASN B 1 6  ? 5.466  7.333  34.777 1.00 21.15 ? 59  ASN B ND2 1 
ATOM   602  N N   . GLU B 1 7  ? 4.161  9.583  39.684 1.00 27.09 ? 60  GLU B N   1 
ATOM   603  C CA  . GLU B 1 7  ? 4.405  10.899 40.276 1.00 27.02 ? 60  GLU B CA  1 
ATOM   604  C C   . GLU B 1 7  ? 5.601  11.625 39.678 1.00 26.01 ? 60  GLU B C   1 
ATOM   605  O O   . GLU B 1 7  ? 5.586  12.851 39.564 1.00 26.54 ? 60  GLU B O   1 
ATOM   606  C CB  . GLU B 1 7  ? 4.568  10.794 41.794 1.00 27.33 ? 60  GLU B CB  1 
ATOM   607  C CG  . GLU B 1 7  ? 3.268  11.000 42.569 1.00 29.07 ? 60  GLU B CG  1 
ATOM   608  C CD  . GLU B 1 7  ? 2.777  12.445 42.542 1.00 31.32 ? 60  GLU B CD  1 
ATOM   609  O OE1 . GLU B 1 7  ? 3.533  13.345 42.117 1.00 32.00 ? 60  GLU B OE1 1 
ATOM   610  O OE2 . GLU B 1 7  ? 1.622  12.686 42.959 1.00 33.90 ? 60  GLU B OE2 1 
ATOM   611  N N   . SER B 1 8  ? 6.633  10.874 39.302 1.00 24.58 ? 61  SER B N   1 
ATOM   612  C CA  . SER B 1 8  ? 7.828  11.463 38.707 1.00 22.79 ? 61  SER B CA  1 
ATOM   613  C C   . SER B 1 8  ? 7.447  12.212 37.431 1.00 21.05 ? 61  SER B C   1 
ATOM   614  O O   . SER B 1 8  ? 7.853  13.363 37.243 1.00 20.13 ? 61  SER B O   1 
ATOM   615  C CB  . SER B 1 8  ? 8.874  10.390 38.412 1.00 23.19 ? 61  SER B CB  1 
ATOM   616  O OG  . SER B 1 8  ? 8.395  9.484  37.433 1.00 26.63 ? 61  SER B OG  1 
ATOM   617  N N   . LEU B 1 9  ? 6.659  11.570 36.565 1.00 19.13 ? 62  LEU B N   1 
ATOM   618  C CA  . LEU B 1 9  ? 6.219  12.231 35.329 1.00 17.96 ? 62  LEU B CA  1 
ATOM   619  C C   . LEU B 1 9  ? 5.270  13.390 35.585 1.00 18.00 ? 62  LEU B C   1 
ATOM   620  O O   . LEU B 1 9  ? 5.348  14.425 34.916 1.00 17.49 ? 62  LEU B O   1 
ATOM   621  C CB  . LEU B 1 9  ? 5.597  11.235 34.349 1.00 17.07 ? 62  LEU B CB  1 
ATOM   622  C CG  . LEU B 1 9  ? 5.147  11.757 32.983 1.00 17.60 ? 62  LEU B CG  1 
ATOM   623  C CD1 . LEU B 1 9  ? 6.327  12.321 32.192 1.00 15.33 ? 62  LEU B CD1 1 
ATOM   624  C CD2 . LEU B 1 9  ? 4.465  10.647 32.218 1.00 17.40 ? 62  LEU B CD2 1 
ATOM   625  N N   . LYS B 1 10 ? 4.358  13.215 36.542 1.00 17.78 ? 63  LYS B N   1 
ATOM   626  C CA  . LYS B 1 10 ? 3.398  14.263 36.864 1.00 18.50 ? 63  LYS B CA  1 
ATOM   627  C C   . LYS B 1 10 ? 4.124  15.535 37.301 1.00 17.60 ? 63  LYS B C   1 
ATOM   628  O O   . LYS B 1 10 ? 3.796  16.636 36.830 1.00 17.46 ? 63  LYS B O   1 
ATOM   629  C CB  . LYS B 1 10 ? 2.409  13.805 37.957 1.00 18.20 ? 63  LYS B CB  1 
ATOM   630  C CG  . LYS B 1 10 ? 1.383  14.873 38.329 1.00 20.08 ? 63  LYS B CG  1 
ATOM   631  C CD  . LYS B 1 10 ? 0.416  14.371 39.393 1.00 20.77 ? 63  LYS B CD  1 
ATOM   632  C CE  . LYS B 1 10 ? -0.555 15.466 39.791 1.00 24.64 ? 63  LYS B CE  1 
ATOM   633  N NZ  . LYS B 1 10 ? -1.652 14.900 40.607 1.00 26.66 ? 63  LYS B NZ  1 
ATOM   634  N N   . LYS B 1 11 ? 5.110  15.378 38.184 1.00 17.76 ? 64  LYS B N   1 
ATOM   635  C CA  . LYS B 1 11 ? 5.907  16.514 38.661 1.00 17.95 ? 64  LYS B CA  1 
ATOM   636  C C   . LYS B 1 11 ? 6.673  17.145 37.505 1.00 17.69 ? 64  LYS B C   1 
ATOM   637  O O   . LYS B 1 11 ? 6.773  18.367 37.413 1.00 18.14 ? 64  LYS B O   1 
ATOM   638  C CB  . LYS B 1 11 ? 6.872  16.094 39.776 1.00 18.32 ? 64  LYS B CB  1 
ATOM   639  C CG  . LYS B 1 11 ? 6.178  15.858 41.138 1.00 19.11 ? 64  LYS B CG  1 
ATOM   640  C CD  . LYS B 1 11 ? 7.159  15.363 42.209 1.00 19.39 ? 64  LYS B CD  1 
ATOM   641  C CE  . LYS B 1 11 ? 6.421  14.909 43.492 1.00 20.32 ? 64  LYS B CE  1 
ATOM   642  N NZ  . LYS B 1 11 ? 5.344  15.852 43.939 1.00 23.41 ? 64  LYS B NZ  1 
ATOM   643  N N   . PHE B 1 12 ? 7.197  16.298 36.624 1.00 17.12 ? 65  PHE B N   1 
ATOM   644  C CA  . PHE B 1 12 ? 7.951  16.744 35.456 1.00 16.70 ? 65  PHE B CA  1 
ATOM   645  C C   . PHE B 1 12 ? 7.074  17.573 34.535 1.00 16.31 ? 65  PHE B C   1 
ATOM   646  O O   . PHE B 1 12 ? 7.473  18.661 34.110 1.00 16.35 ? 65  PHE B O   1 
ATOM   647  C CB  . PHE B 1 12 ? 8.506  15.512 34.731 1.00 16.33 ? 65  PHE B CB  1 
ATOM   648  C CG  . PHE B 1 12 ? 9.308  15.813 33.494 1.00 15.18 ? 65  PHE B CG  1 
ATOM   649  C CD1 . PHE B 1 12 ? 10.654 16.175 33.587 1.00 14.74 ? 65  PHE B CD1 1 
ATOM   650  C CD2 . PHE B 1 12 ? 8.738  15.662 32.233 1.00 13.62 ? 65  PHE B CD2 1 
ATOM   651  C CE1 . PHE B 1 12 ? 11.408 16.406 32.428 1.00 15.44 ? 65  PHE B CE1 1 
ATOM   652  C CE2 . PHE B 1 12 ? 9.480  15.898 31.075 1.00 13.45 ? 65  PHE B CE2 1 
ATOM   653  C CZ  . PHE B 1 12 ? 10.818 16.253 31.172 1.00 14.39 ? 65  PHE B CZ  1 
ATOM   654  N N   . LEU B 1 13 ? 5.871  17.076 34.240 1.00 16.09 ? 66  LEU B N   1 
ATOM   655  C CA  . LEU B 1 13 ? 4.922  17.801 33.398 1.00 17.02 ? 66  LEU B CA  1 
ATOM   656  C C   . LEU B 1 13 ? 4.380  19.079 34.043 1.00 17.56 ? 66  LEU B C   1 
ATOM   657  O O   . LEU B 1 13 ? 3.834  19.934 33.367 1.00 18.55 ? 66  LEU B O   1 
ATOM   658  C CB  . LEU B 1 13 ? 3.768  16.896 32.957 1.00 17.38 ? 66  LEU B CB  1 
ATOM   659  C CG  . LEU B 1 13 ? 4.095  15.729 32.023 1.00 17.50 ? 66  LEU B CG  1 
ATOM   660  C CD1 . LEU B 1 13 ? 2.828  14.937 31.767 1.00 17.85 ? 66  LEU B CD1 1 
ATOM   661  C CD2 . LEU B 1 13 ? 4.696  16.207 30.697 1.00 17.29 ? 66  LEU B CD2 1 
ATOM   662  N N   . ASN B 1 14 ? 4.537  19.195 35.359 1.00 17.89 ? 67  ASN B N   1 
ATOM   663  C CA  . ASN B 1 14 ? 4.127  20.405 36.056 1.00 18.49 ? 67  ASN B CA  1 
ATOM   664  C C   . ASN B 1 14 ? 5.228  21.469 36.091 1.00 17.92 ? 67  ASN B C   1 
ATOM   665  O O   . ASN B 1 14 ? 5.080  22.505 36.740 1.00 17.42 ? 67  ASN B O   1 
ATOM   666  C CB  . ASN B 1 14 ? 3.630  20.069 37.462 1.00 19.13 ? 67  ASN B CB  1 
ATOM   667  C CG  . ASN B 1 14 ? 2.875  21.219 38.110 1.00 23.01 ? 67  ASN B CG  1 
ATOM   668  O OD1 . ASN B 1 14 ? 2.063  21.900 37.468 1.00 27.05 ? 67  ASN B OD1 1 
ATOM   669  N ND2 . ASN B 1 14 ? 3.143  21.446 39.395 1.00 25.30 ? 67  ASN B ND2 1 
ATOM   670  N N   . THR B 1 15 ? 6.320  21.208 35.368 1.00 16.73 ? 68  THR B N   1 
ATOM   671  C CA  . THR B 1 15 ? 7.359  22.207 35.122 1.00 15.96 ? 68  THR B CA  1 
ATOM   672  C C   . THR B 1 15 ? 7.285  22.705 33.677 1.00 14.95 ? 68  THR B C   1 
ATOM   673  O O   . THR B 1 15 ? 6.897  21.955 32.760 1.00 13.93 ? 68  THR B O   1 
ATOM   674  C CB  . THR B 1 15 ? 8.775  21.658 35.382 1.00 15.69 ? 68  THR B CB  1 
ATOM   675  O OG1 . THR B 1 15 ? 9.101  20.665 34.391 1.00 15.71 ? 68  THR B OG1 1 
ATOM   676  C CG2 . THR B 1 15 ? 8.884  21.016 36.765 1.00 16.06 ? 68  THR B CG2 1 
ATOM   677  N N   . LYS B 1 16 ? 7.643  23.966 33.468 1.00 15.00 ? 69  LYS B N   1 
ATOM   678  C CA  . LYS B 1 16 ? 7.641  24.517 32.120 1.00 14.18 ? 69  LYS B CA  1 
ATOM   679  C C   . LYS B 1 16 ? 8.559  23.724 31.178 1.00 13.83 ? 69  LYS B C   1 
ATOM   680  O O   . LYS B 1 16 ? 8.144  23.354 30.079 1.00 12.54 ? 69  LYS B O   1 
ATOM   681  C CB  . LYS B 1 16 ? 8.126  25.962 32.150 1.00 99.99 ? 69  LYS B CB  1 
ATOM   682  C CG  . LYS B 1 16 ? 8.027  26.562 30.752 1.00 99.99 ? 69  LYS B CG  1 
ATOM   683  N N   . ASP B 1 17 ? 9.794  23.466 31.615 1.00 12.79 ? 70  ASP B N   1 
ATOM   684  C CA  . ASP B 1 17 ? 10.751 22.752 30.764 1.00 12.59 ? 70  ASP B CA  1 
ATOM   685  C C   . ASP B 1 17 ? 10.282 21.328 30.485 1.00 11.88 ? 70  ASP B C   1 
ATOM   686  O O   . ASP B 1 17 ? 10.414 20.824 29.363 1.00 11.57 ? 70  ASP B O   1 
ATOM   687  C CB  . ASP B 1 17 ? 12.151 22.734 31.382 1.00 13.19 ? 70  ASP B CB  1 
ATOM   688  C CG  . ASP B 1 17 ? 12.841 24.082 31.315 1.00 16.83 ? 70  ASP B CG  1 
ATOM   689  O OD1 . ASP B 1 17 ? 12.313 24.993 30.650 1.00 20.20 ? 70  ASP B OD1 1 
ATOM   690  O OD2 . ASP B 1 17 ? 13.918 24.230 31.936 1.00 21.31 ? 70  ASP B OD2 1 
ATOM   691  N N   . GLY B 1 18 ? 9.722  20.685 31.502 1.00 11.00 ? 71  GLY B N   1 
ATOM   692  C CA  . GLY B 1 18 ? 9.269  19.299 31.364 1.00 11.09 ? 71  GLY B CA  1 
ATOM   693  C C   . GLY B 1 18 ? 8.112  19.165 30.394 1.00 11.18 ? 71  GLY B C   1 
ATOM   694  O O   . GLY B 1 18 ? 8.062  18.235 29.556 1.00 10.94 ? 71  GLY B O   1 
ATOM   695  N N   . ARG B 1 19 ? 7.162  20.085 30.501 1.00 11.44 ? 72  ARG B N   1 
ATOM   696  C CA  . ARG B 1 19 ? 6.050  20.064 29.585 1.00 12.36 ? 72  ARG B CA  1 
ATOM   697  C C   . ARG B 1 19 ? 6.539  20.308 28.149 1.00 11.74 ? 72  ARG B C   1 
ATOM   698  O O   . ARG B 1 19 ? 6.032  19.690 27.200 1.00 12.16 ? 72  ARG B O   1 
ATOM   699  C CB  . ARG B 1 19 ? 4.975  21.070 30.010 1.00 13.58 ? 72  ARG B CB  1 
ATOM   700  C CG  . ARG B 1 19 ? 3.641  20.743 29.408 1.00 16.59 ? 72  ARG B CG  1 
ATOM   701  C CD  . ARG B 1 19 ? 2.522  21.608 29.951 1.00 18.84 ? 72  ARG B CD  1 
ATOM   702  N NE  . ARG B 1 19 ? 1.373  21.434 29.079 1.00 19.88 ? 72  ARG B NE  1 
ATOM   703  C CZ  . ARG B 1 19 ? 0.446  20.499 29.241 1.00 19.76 ? 72  ARG B CZ  1 
ATOM   704  N NH1 . ARG B 1 19 ? 0.512  19.656 30.273 1.00 22.63 ? 72  ARG B NH1 1 
ATOM   705  N NH2 . ARG B 1 19 ? -0.557 20.422 28.376 1.00 20.15 ? 72  ARG B NH2 1 
ATOM   706  N N   . LEU B 1 20 ? 7.531  21.187 27.985 1.00 10.98 ? 73  LEU B N   1 
ATOM   707  C CA  . LEU B 1 20 ? 8.116  21.421 26.660 1.00 11.04 ? 73  LEU B CA  1 
ATOM   708  C C   . LEU B 1 20 ? 8.805  20.157 26.118 1.00 10.60 ? 73  LEU B C   1 
ATOM   709  O O   . LEU B 1 20 ? 8.596  19.778 24.965 1.00 10.42 ? 73  LEU B O   1 
ATOM   710  C CB  . LEU B 1 20 ? 9.093  22.600 26.720 1.00 12.02 ? 73  LEU B CB  1 
ATOM   711  C CG  . LEU B 1 20 ? 9.806  22.982 25.445 1.00 14.90 ? 73  LEU B CG  1 
ATOM   712  C CD1 . LEU B 1 20 ? 8.828  23.176 24.278 1.00 18.00 ? 73  LEU B CD1 1 
ATOM   713  C CD2 . LEU B 1 20 ? 10.615 24.254 25.707 1.00 16.54 ? 73  LEU B CD2 1 
ATOM   714  N N   . VAL B 1 21 ? 9.612  19.505 26.951 1.00 8.88  ? 74  VAL B N   1 
ATOM   715  C CA  . VAL B 1 21 ? 10.238 18.225 26.556 1.00 8.42  ? 74  VAL B CA  1 
ATOM   716  C C   . VAL B 1 21 ? 9.186  17.211 26.086 1.00 7.88  ? 74  VAL B C   1 
ATOM   717  O O   . VAL B 1 21 ? 9.284  16.637 24.973 1.00 8.54  ? 74  VAL B O   1 
ATOM   718  C CB  . VAL B 1 21 ? 11.051 17.622 27.724 1.00 8.42  ? 74  VAL B CB  1 
ATOM   719  C CG1 . VAL B 1 21 ? 11.495 16.207 27.393 1.00 9.51  ? 74  VAL B CG1 1 
ATOM   720  C CG2 . VAL B 1 21 ? 12.280 18.486 27.998 1.00 8.66  ? 74  VAL B CG2 1 
ATOM   721  N N   . ALA B 1 22 ? 8.177  16.984 26.925 1.00 7.68  ? 75  ALA B N   1 
ATOM   722  C CA  . ALA B 1 22 ? 7.161  15.979 26.587 1.00 7.45  ? 75  ALA B CA  1 
ATOM   723  C C   . ALA B 1 22 ? 6.381  16.346 25.324 1.00 7.53  ? 75  ALA B C   1 
ATOM   724  O O   . ALA B 1 22 ? 6.123  15.489 24.480 1.00 7.70  ? 75  ALA B O   1 
ATOM   725  C CB  . ALA B 1 22 ? 6.214  15.731 27.756 1.00 7.85  ? 75  ALA B CB  1 
ATOM   726  N N   . SER B 1 23 ? 6.050  17.626 25.183 1.00 7.50  ? 76  SER B N   1 
ATOM   727  C CA  . SER B 1 23 ? 5.389  18.108 23.965 1.00 7.19  ? 76  SER B CA  1 
ATOM   728  C C   . SER B 1 23 ? 6.247  17.861 22.715 1.00 7.18  ? 76  SER B C   1 
ATOM   729  O O   . SER B 1 23 ? 5.726  17.467 21.667 1.00 7.92  ? 76  SER B O   1 
ATOM   730  C CB  . SER B 1 23 ? 5.064  19.603 24.101 1.00 8.21  ? 76  SER B CB  1 
ATOM   731  O OG  . SER B 1 23 ? 4.177  19.846 25.176 1.00 9.50  ? 76  SER B OG  1 
ATOM   732  N N   . LEU B 1 24 ? 7.562  18.058 22.832 1.00 7.52  ? 77  LEU B N   1 
ATOM   733  C CA  . LEU B 1 24 ? 8.464  17.779 21.699 1.00 7.03  ? 77  LEU B CA  1 
ATOM   734  C C   . LEU B 1 24 ? 8.489  16.297 21.340 1.00 7.65  ? 77  LEU B C   1 
ATOM   735  O O   . LEU B 1 24 ? 8.563  15.932 20.150 1.00 8.24  ? 77  LEU B O   1 
ATOM   736  C CB  . LEU B 1 24 ? 9.883  18.273 21.992 1.00 8.26  ? 77  LEU B CB  1 
ATOM   737  C CG  . LEU B 1 24 ? 10.074 19.787 21.931 1.00 8.08  ? 77  LEU B CG  1 
ATOM   738  C CD1 . LEU B 1 24 ? 11.362 20.167 22.659 1.00 9.34  ? 77  LEU B CD1 1 
ATOM   739  C CD2 . LEU B 1 24 ? 10.072 20.318 20.488 1.00 8.41  ? 77  LEU B CD2 1 
ATOM   740  N N   . VAL B 1 25 ? 8.450  15.434 22.351 1.00 7.60  ? 78  VAL B N   1 
ATOM   741  C CA  . VAL B 1 25 ? 8.359  13.990 22.107 1.00 7.43  ? 78  VAL B CA  1 
ATOM   742  C C   . VAL B 1 25 ? 7.047  13.634 21.383 1.00 7.34  ? 78  VAL B C   1 
ATOM   743  O O   . VAL B 1 25 ? 7.076  12.940 20.355 1.00 7.84  ? 78  VAL B O   1 
ATOM   744  C CB  . VAL B 1 25 ? 8.527  13.205 23.419 1.00 6.91  ? 78  VAL B CB  1 
ATOM   745  C CG1 . VAL B 1 25 ? 8.286  11.682 23.196 1.00 8.51  ? 78  VAL B CG1 1 
ATOM   746  C CG2 . VAL B 1 25 ? 9.937  13.413 23.973 1.00 7.91  ? 78  VAL B CG2 1 
ATOM   747  N N   . ALA B 1 26 ? 5.917  14.141 21.874 1.00 7.25  ? 79  ALA B N   1 
ATOM   748  C CA  . ALA B 1 26 ? 4.632  13.904 21.196 1.00 8.03  ? 79  ALA B CA  1 
ATOM   749  C C   . ALA B 1 26 ? 4.654  14.419 19.750 1.00 8.10  ? 79  ALA B C   1 
ATOM   750  O O   . ALA B 1 26 ? 4.130  13.751 18.848 1.00 8.69  ? 79  ALA B O   1 
ATOM   751  C CB  . ALA B 1 26 ? 3.485  14.513 21.990 1.00 8.57  ? 79  ALA B CB  1 
ATOM   752  N N   . GLU B 1 27 ? 5.295  15.573 19.521 1.00 7.54  ? 80  GLU B N   1 
ATOM   753  C CA  . GLU B 1 27 ? 5.348  16.136 18.172 1.00 7.38  ? 80  GLU B CA  1 
ATOM   754  C C   . GLU B 1 27 ? 6.172  15.250 17.250 1.00 8.05  ? 80  GLU B C   1 
ATOM   755  O O   . GLU B 1 27 ? 5.838  15.103 16.089 1.00 8.45  ? 80  GLU B O   1 
ATOM   756  C CB  . GLU B 1 27 ? 5.874  17.578 18.172 1.00 7.92  ? 80  GLU B CB  1 
ATOM   757  C CG  . GLU B 1 27 ? 5.578  18.332 16.838 1.00 9.24  ? 80  GLU B CG  1 
ATOM   758  C CD  . GLU B 1 27 ? 6.651  18.156 15.758 1.00 12.30 ? 80  GLU B CD  1 
ATOM   759  O OE1 . GLU B 1 27 ? 7.833  17.958 16.094 1.00 11.78 ? 80  GLU B OE1 1 
ATOM   760  O OE2 . GLU B 1 27 ? 6.304  18.239 14.565 1.00 13.00 ? 80  GLU B OE2 1 
ATOM   761  N N   . PHE B 1 28 ? 7.244  14.662 17.772 1.00 7.81  ? 81  PHE B N   1 
ATOM   762  C CA  . PHE B 1 28 ? 8.016  13.712 16.999 1.00 7.75  ? 81  PHE B CA  1 
ATOM   763  C C   . PHE B 1 28 ? 7.136  12.521 16.572 1.00 8.01  ? 81  PHE B C   1 
ATOM   764  O O   . PHE B 1 28 ? 7.152  12.115 15.410 1.00 8.15  ? 81  PHE B O   1 
ATOM   765  C CB  . PHE B 1 28 ? 9.234  13.241 17.812 1.00 8.37  ? 81  PHE B CB  1 
ATOM   766  C CG  . PHE B 1 28 ? 9.946  12.083 17.190 1.00 6.99  ? 81  PHE B CG  1 
ATOM   767  C CD1 . PHE B 1 28 ? 11.005 12.281 16.319 1.00 8.59  ? 81  PHE B CD1 1 
ATOM   768  C CD2 . PHE B 1 28 ? 9.568  10.769 17.484 1.00 8.85  ? 81  PHE B CD2 1 
ATOM   769  C CE1 . PHE B 1 28 ? 11.643 11.189 15.726 1.00 9.13  ? 81  PHE B CE1 1 
ATOM   770  C CE2 . PHE B 1 28 ? 10.213 9.688  16.898 1.00 9.74  ? 81  PHE B CE2 1 
ATOM   771  C CZ  . PHE B 1 28 ? 11.251 9.904  16.020 1.00 10.76 ? 81  PHE B CZ  1 
ATOM   772  N N   . LEU B 1 29 ? 6.358  11.985 17.510 1.00 7.86  ? 82  LEU B N   1 
ATOM   773  C CA  . LEU B 1 29 ? 5.474  10.855 17.197 1.00 8.96  ? 82  LEU B CA  1 
ATOM   774  C C   . LEU B 1 29 ? 4.460  11.252 16.138 1.00 9.47  ? 82  LEU B C   1 
ATOM   775  O O   . LEU B 1 29 ? 4.205  10.500 15.179 1.00 10.02 ? 82  LEU B O   1 
ATOM   776  C CB  . LEU B 1 29 ? 4.775  10.339 18.467 1.00 8.97  ? 82  LEU B CB  1 
ATOM   777  C CG  . LEU B 1 29 ? 5.688  9.848  19.587 1.00 9.35  ? 82  LEU B CG  1 
ATOM   778  C CD1 . LEU B 1 29 ? 4.809  9.513  20.825 1.00 9.49  ? 82  LEU B CD1 1 
ATOM   779  C CD2 . LEU B 1 29 ? 6.491  8.625  19.165 1.00 10.27 ? 82  LEU B CD2 1 
ATOM   780  N N   . GLN B 1 30 ? 3.885  12.442 16.276 1.00 9.20  ? 83  GLN B N   1 
ATOM   781  C CA  . GLN B 1 30 ? 2.896  12.919 15.292 1.00 11.26 ? 83  GLN B CA  1 
ATOM   782  C C   . GLN B 1 30 ? 3.525  13.165 13.925 1.00 10.54 ? 83  GLN B C   1 
ATOM   783  O O   . GLN B 1 30 ? 2.962  12.775 12.878 1.00 10.91 ? 83  GLN B O   1 
ATOM   784  C CB  . GLN B 1 30 ? 2.160  14.145 15.828 1.00 12.17 ? 83  GLN B CB  1 
ATOM   785  C CG  . GLN B 1 30 ? 1.389  13.786 17.103 1.00 16.89 ? 83  GLN B CG  1 
ATOM   786  C CD  . GLN B 1 30 ? 0.270  14.736 17.457 1.00 22.85 ? 83  GLN B CD  1 
ATOM   787  O OE1 . GLN B 1 30 ? 0.356  15.452 18.450 1.00 24.58 ? 83  GLN B OE1 1 
ATOM   788  N NE2 . GLN B 1 30 ? -0.806 14.711 16.677 1.00 25.82 ? 83  GLN B NE2 1 
ATOM   789  N N   . PHE B 1 31 ? 4.715  13.764 13.930 1.00 9.81  ? 84  PHE B N   1 
ATOM   790  C CA  . PHE B 1 31 ? 5.425  14.048 12.667 1.00 9.43  ? 84  PHE B CA  1 
ATOM   791  C C   . PHE B 1 31 ? 5.608  12.810 11.785 1.00 9.30  ? 84  PHE B C   1 
ATOM   792  O O   . PHE B 1 31 ? 5.470  12.890 10.553 1.00 9.74  ? 84  PHE B O   1 
ATOM   793  C CB  . PHE B 1 31 ? 6.786  14.724 12.921 1.00 8.89  ? 84  PHE B CB  1 
ATOM   794  C CG  . PHE B 1 31 ? 7.417  15.246 11.658 1.00 10.04 ? 84  PHE B CG  1 
ATOM   795  C CD1 . PHE B 1 31 ? 7.048  16.500 11.157 1.00 11.04 ? 84  PHE B CD1 1 
ATOM   796  C CD2 . PHE B 1 31 ? 8.295  14.453 10.916 1.00 9.41  ? 84  PHE B CD2 1 
ATOM   797  C CE1 . PHE B 1 31 ? 7.602  16.964 9.960  1.00 12.56 ? 84  PHE B CE1 1 
ATOM   798  C CE2 . PHE B 1 31 ? 8.860  14.915 9.724  1.00 11.12 ? 84  PHE B CE2 1 
ATOM   799  C CZ  . PHE B 1 31 ? 8.495  16.175 9.247  1.00 11.23 ? 84  PHE B CZ  1 
ATOM   800  N N   . PHE B 1 32 ? 5.944  11.684 12.410 1.00 9.11  ? 85  PHE B N   1 
ATOM   801  C CA  . PHE B 1 32 ? 6.206  10.447 11.675 1.00 9.05  ? 85  PHE B CA  1 
ATOM   802  C C   . PHE B 1 32 ? 5.011  9.496  11.651 1.00 10.00 ? 85  PHE B C   1 
ATOM   803  O O   . PHE B 1 32 ? 5.152  8.313  11.319 1.00 10.21 ? 85  PHE B O   1 
ATOM   804  C CB  . PHE B 1 32 ? 7.473  9.771  12.186 1.00 10.12 ? 85  PHE B CB  1 
ATOM   805  C CG  . PHE B 1 32 ? 8.719  10.480 11.768 1.00 8.10  ? 85  PHE B CG  1 
ATOM   806  C CD1 . PHE B 1 32 ? 9.078  10.523 10.420 1.00 10.52 ? 85  PHE B CD1 1 
ATOM   807  C CD2 . PHE B 1 32 ? 9.515  11.143 12.706 1.00 10.33 ? 85  PHE B CD2 1 
ATOM   808  C CE1 . PHE B 1 32 ? 10.209 11.207 10.002 1.00 11.79 ? 85  PHE B CE1 1 
ATOM   809  C CE2 . PHE B 1 32 ? 10.670 11.824 12.295 1.00 9.98  ? 85  PHE B CE2 1 
ATOM   810  C CZ  . PHE B 1 32 ? 11.022 11.836 10.945 1.00 10.91 ? 85  PHE B CZ  1 
ATOM   811  N N   . ASN B 1 33 ? 3.834  10.028 11.963 1.00 10.69 ? 86  ASN B N   1 
ATOM   812  C CA  . ASN B 1 33 ? 2.597  9.226  11.947 1.00 11.44 ? 86  ASN B CA  1 
ATOM   813  C C   . ASN B 1 33 ? 2.711  7.946  12.763 1.00 11.38 ? 86  ASN B C   1 
ATOM   814  O O   . ASN B 1 33 ? 2.234  6.875  12.346 1.00 11.65 ? 86  ASN B O   1 
ATOM   815  C CB  . ASN B 1 33 ? 2.190  8.918  10.510 1.00 11.83 ? 86  ASN B CB  1 
ATOM   816  C CG  . ASN B 1 33 ? 1.970  10.178 9.700  1.00 14.09 ? 86  ASN B CG  1 
ATOM   817  O OD1 . ASN B 1 33 ? 2.639  10.396 8.695  1.00 21.94 ? 86  ASN B OD1 1 
ATOM   818  N ND2 . ASN B 1 33 ? 1.062  11.018 10.145 1.00 13.90 ? 86  ASN B ND2 1 
ATOM   819  N N   . LEU B 1 34 ? 3.336  8.059  13.938 1.00 11.23 ? 87  LEU B N   1 
ATOM   820  C CA  . LEU B 1 34 ? 3.483  6.915  14.837 1.00 10.69 ? 87  LEU B CA  1 
ATOM   821  C C   . LEU B 1 34 ? 2.216  6.864  15.694 1.00 11.46 ? 87  LEU B C   1 
ATOM   822  O O   . LEU B 1 34 ? 2.227  7.128  16.910 1.00 11.73 ? 87  LEU B O   1 
ATOM   823  C CB  . LEU B 1 34 ? 4.767  7.055  15.653 1.00 10.48 ? 87  LEU B CB  1 
ATOM   824  C CG  . LEU B 1 34 ? 6.036  7.124  14.791 1.00 10.18 ? 87  LEU B CG  1 
ATOM   825  C CD1 . LEU B 1 34 ? 7.266  7.402  15.618 1.00 12.60 ? 87  LEU B CD1 1 
ATOM   826  C CD2 . LEU B 1 34 ? 6.256  5.856  13.969 1.00 12.78 ? 87  LEU B CD2 1 
ATOM   827  N N   . ASP B 1 35 ? 1.112  6.545  15.021 1.00 11.74 ? 88  ASP B N   1 
ATOM   828  C CA  . ASP B 1 35 ? -0.217 6.749  15.570 1.00 12.61 ? 88  ASP B CA  1 
ATOM   829  C C   . ASP B 1 35 ? -0.559 5.747  16.677 1.00 12.07 ? 88  ASP B C   1 
ATOM   830  O O   . ASP B 1 35 ? -1.244 6.095  17.644 1.00 12.31 ? 88  ASP B O   1 
ATOM   831  C CB  . ASP B 1 35 ? -1.256 6.769  14.436 1.00 13.77 ? 88  ASP B CB  1 
ATOM   832  C CG  . ASP B 1 35 ? -0.998 7.893  13.439 1.00 17.13 ? 88  ASP B CG  1 
ATOM   833  O OD1 . ASP B 1 35 ? -0.717 9.022  13.875 1.00 22.88 ? 88  ASP B OD1 1 
ATOM   834  O OD2 . ASP B 1 35 ? -1.070 7.639  12.223 1.00 24.89 ? 88  ASP B OD2 1 
ATOM   835  N N   . PHE B 1 36 ? -0.078 4.511  16.545 1.00 12.03 ? 89  PHE B N   1 
ATOM   836  C CA  . PHE B 1 36 ? -0.317 3.531  17.597 1.00 12.17 ? 89  PHE B CA  1 
ATOM   837  C C   . PHE B 1 36 ? 0.527  3.846  18.831 1.00 11.38 ? 89  PHE B C   1 
ATOM   838  O O   . PHE B 1 36 ? 0.053  3.726  19.967 1.00 11.52 ? 89  PHE B O   1 
ATOM   839  C CB  . PHE B 1 36 ? -0.106 2.116  17.077 1.00 13.17 ? 89  PHE B CB  1 
ATOM   840  C CG  . PHE B 1 36 ? -1.072 1.737  15.982 1.00 14.75 ? 89  PHE B CG  1 
ATOM   841  C CD1 . PHE B 1 36 ? -2.429 1.599  16.260 1.00 16.11 ? 89  PHE B CD1 1 
ATOM   842  C CD2 . PHE B 1 36 ? -0.628 1.531  14.682 1.00 16.81 ? 89  PHE B CD2 1 
ATOM   843  C CE1 . PHE B 1 36 ? -3.336 1.258  15.246 1.00 16.31 ? 89  PHE B CE1 1 
ATOM   844  C CE2 . PHE B 1 36 ? -1.529 1.183  13.658 1.00 17.29 ? 89  PHE B CE2 1 
ATOM   845  C CZ  . PHE B 1 36 ? -2.875 1.054  13.941 1.00 15.71 ? 89  PHE B CZ  1 
ATOM   846  N N   . THR B 1 37 ? 1.773  4.282  18.605 1.00 10.46 ? 90  THR B N   1 
ATOM   847  C CA  . THR B 1 37 ? 2.571  4.752  19.726 1.00 10.49 ? 90  THR B CA  1 
ATOM   848  C C   . THR B 1 37 ? 1.889  5.908  20.456 1.00 10.44 ? 90  THR B C   1 
ATOM   849  O O   . THR B 1 37 ? 1.820  5.903  21.683 1.00 10.27 ? 90  THR B O   1 
ATOM   850  C CB  . THR B 1 37 ? 3.984  5.172  19.280 1.00 10.42 ? 90  THR B CB  1 
ATOM   851  O OG1 . THR B 1 37 ? 4.597  4.090  18.562 1.00 11.62 ? 90  THR B OG1 1 
ATOM   852  C CG2 . THR B 1 37 ? 4.832  5.463  20.480 1.00 10.31 ? 90  THR B CG2 1 
ATOM   853  N N   . LEU B 1 38 ? 1.371  6.894  19.718 1.00 10.83 ? 91  LEU B N   1 
ATOM   854  C CA  . LEU B 1 38 ? 0.656  8.002  20.349 1.00 11.20 ? 91  LEU B CA  1 
ATOM   855  C C   . LEU B 1 38 ? -0.568 7.528  21.143 1.00 10.95 ? 91  LEU B C   1 
ATOM   856  O O   . LEU B 1 38 ? -0.839 8.036  22.226 1.00 11.67 ? 91  LEU B O   1 
ATOM   857  C CB  . LEU B 1 38 ? 0.254  9.045  19.301 1.00 11.76 ? 91  LEU B CB  1 
ATOM   858  C CG  . LEU B 1 38 ? -0.275 10.369 19.829 1.00 12.33 ? 91  LEU B CG  1 
ATOM   859  C CD1 . LEU B 1 38 ? 0.846  11.097 20.584 1.00 14.34 ? 91  LEU B CD1 1 
ATOM   860  C CD2 . LEU B 1 38 ? -0.751 11.187 18.642 1.00 13.77 ? 91  LEU B CD2 1 
ATOM   861  N N   . ALA B 1 39 ? -1.271 6.539  20.600 1.00 10.94 ? 92  ALA B N   1 
ATOM   862  C CA  . ALA B 1 39 ? -2.474 5.989  21.219 1.00 11.17 ? 92  ALA B CA  1 
ATOM   863  C C   . ALA B 1 39 ? -2.198 5.401  22.605 1.00 10.61 ? 92  ALA B C   1 
ATOM   864  O O   . ALA B 1 39 ? -3.097 5.368  23.454 1.00 10.49 ? 92  ALA B O   1 
ATOM   865  C CB  . ALA B 1 39 ? -3.080 4.941  20.308 1.00 11.53 ? 92  ALA B CB  1 
ATOM   866  N N   . VAL B 1 40 ? -0.974 4.908  22.811 1.00 10.97 ? 93  VAL B N   1 
ATOM   867  C CA  . VAL B 1 40 ? -0.560 4.388  24.129 1.00 11.36 ? 93  VAL B CA  1 
ATOM   868  C C   . VAL B 1 40 ? 0.122  5.465  24.970 1.00 11.70 ? 93  VAL B C   1 
ATOM   869  O O   . VAL B 1 40 ? -0.104 5.560  26.186 1.00 10.22 ? 93  VAL B O   1 
ATOM   870  C CB  . VAL B 1 40 ? 0.349  3.149  23.968 1.00 12.32 ? 93  VAL B CB  1 
ATOM   871  C CG1 . VAL B 1 40 ? 0.838  2.614  25.316 1.00 13.55 ? 93  VAL B CG1 1 
ATOM   872  C CG2 . VAL B 1 40 ? -0.401 2.066  23.245 1.00 13.52 ? 93  VAL B CG2 1 
ATOM   873  N N   . PHE B 1 41 ? 0.943  6.282  24.315 1.00 10.50 ? 94  PHE B N   1 
ATOM   874  C CA  . PHE B 1 41 ? 1.612  7.423  24.979 1.00 10.40 ? 94  PHE B CA  1 
ATOM   875  C C   . PHE B 1 41 ? 0.646  8.324  25.748 1.00 10.48 ? 94  PHE B C   1 
ATOM   876  O O   . PHE B 1 41 ? 0.900  8.690  26.898 1.00 10.57 ? 94  PHE B O   1 
ATOM   877  C CB  . PHE B 1 41 ? 2.363  8.242  23.930 1.00 10.92 ? 94  PHE B CB  1 
ATOM   878  C CG  . PHE B 1 41 ? 3.130  9.427  24.480 1.00 10.56 ? 94  PHE B CG  1 
ATOM   879  C CD1 . PHE B 1 41 ? 4.430  9.275  24.943 1.00 11.33 ? 94  PHE B CD1 1 
ATOM   880  C CD2 . PHE B 1 41 ? 2.555  10.701 24.490 1.00 12.38 ? 94  PHE B CD2 1 
ATOM   881  C CE1 . PHE B 1 41 ? 5.160  10.376 25.421 1.00 13.19 ? 94  PHE B CE1 1 
ATOM   882  C CE2 . PHE B 1 41 ? 3.274  11.804 24.973 1.00 13.55 ? 94  PHE B CE2 1 
ATOM   883  C CZ  . PHE B 1 41 ? 4.574  11.637 25.439 1.00 11.62 ? 94  PHE B CZ  1 
ATOM   884  N N   . GLN B 1 42 ? -0.458 8.686  25.110 1.00 10.78 ? 95  GLN B N   1 
ATOM   885  C CA  . GLN B 1 42 ? -1.398 9.606  25.739 1.00 11.67 ? 95  GLN B CA  1 
ATOM   886  C C   . GLN B 1 42 ? -2.010 9.080  27.057 1.00 11.93 ? 95  GLN B C   1 
ATOM   887  O O   . GLN B 1 42 ? -1.922 9.763  28.086 1.00 11.50 ? 95  GLN B O   1 
ATOM   888  C CB  . GLN B 1 42 ? -2.406 10.109 24.721 1.00 12.37 ? 95  GLN B CB  1 
ATOM   889  C CG  . GLN B 1 42 ? -1.707 10.925 23.615 1.00 14.40 ? 95  GLN B CG  1 
ATOM   890  C CD  . GLN B 1 42 ? -2.666 11.679 22.734 1.00 17.58 ? 95  GLN B CD  1 
ATOM   891  O OE1 . GLN B 1 42 ? -3.730 11.166 22.359 1.00 22.53 ? 95  GLN B OE1 1 
ATOM   892  N NE2 . GLN B 1 42 ? -2.287 12.904 22.368 1.00 22.21 ? 95  GLN B NE2 1 
ATOM   893  N N   . PRO B 1 43 ? -2.611 7.869  27.055 1.00 12.26 ? 96  PRO B N   1 
ATOM   894  C CA  . PRO B 1 43 ? -3.078 7.398  28.367 1.00 12.33 ? 96  PRO B CA  1 
ATOM   895  C C   . PRO B 1 43 ? -1.934 7.106  29.350 1.00 12.09 ? 96  PRO B C   1 
ATOM   896  O O   . PRO B 1 43 ? -2.094 7.329  30.554 1.00 13.68 ? 96  PRO B O   1 
ATOM   897  C CB  . PRO B 1 43 ? -3.850 6.098  28.046 1.00 12.19 ? 96  PRO B CB  1 
ATOM   898  C CG  . PRO B 1 43 ? -3.379 5.679  26.713 1.00 13.49 ? 96  PRO B CG  1 
ATOM   899  C CD  . PRO B 1 43 ? -2.946 6.924  25.976 1.00 13.10 ? 96  PRO B CD  1 
ATOM   900  N N   . GLU B 1 44 ? -0.789 6.640  28.858 1.00 12.17 ? 97  GLU B N   1 
ATOM   901  C CA  . GLU B 1 44 ? 0.297  6.264  29.768 1.00 12.04 ? 97  GLU B CA  1 
ATOM   902  C C   . GLU B 1 44 ? 0.925  7.470  30.478 1.00 11.91 ? 97  GLU B C   1 
ATOM   903  O O   . GLU B 1 44 ? 1.463  7.348  31.588 1.00 13.22 ? 97  GLU B O   1 
ATOM   904  C CB  . GLU B 1 44 ? 1.366  5.418  29.073 1.00 12.41 ? 97  GLU B CB  1 
ATOM   905  C CG  . GLU B 1 44 ? 2.103  4.496  30.053 1.00 12.63 ? 97  GLU B CG  1 
ATOM   906  C CD  . GLU B 1 44 ? 3.111  3.540  29.418 1.00 12.59 ? 97  GLU B CD  1 
ATOM   907  O OE1 . GLU B 1 44 ? 3.682  3.836  28.349 1.00 13.08 ? 97  GLU B OE1 1 
ATOM   908  O OE2 . GLU B 1 44 ? 3.339  2.479  30.021 1.00 13.26 ? 97  GLU B OE2 1 
ATOM   909  N N   . THR B 1 45 ? 0.847  8.631  29.825 1.00 11.92 ? 98  THR B N   1 
ATOM   910  C CA  . THR B 1 45 ? 1.350  9.885  30.380 1.00 11.85 ? 98  THR B CA  1 
ATOM   911  C C   . THR B 1 45 ? 0.249  10.781 30.936 1.00 11.92 ? 98  THR B C   1 
ATOM   912  O O   . THR B 1 45 ? 0.524  11.888 31.407 1.00 11.60 ? 98  THR B O   1 
ATOM   913  C CB  . THR B 1 45 ? 2.120  10.698 29.319 1.00 11.87 ? 98  THR B CB  1 
ATOM   914  O OG1 . THR B 1 45 ? 1.233  11.027 28.246 1.00 10.93 ? 98  THR B OG1 1 
ATOM   915  C CG2 . THR B 1 45 ? 3.328  9.940  28.784 1.00 12.75 ? 98  THR B CG2 1 
ATOM   916  N N   . SER B 1 46 ? -0.998 10.313 30.886 1.00 12.64 ? 99  SER B N   1 
ATOM   917  C CA  . SER B 1 46 ? -2.132 11.128 31.321 1.00 13.98 ? 99  SER B CA  1 
ATOM   918  C C   . SER B 1 46 ? -2.195 12.454 30.527 1.00 14.40 ? 99  SER B C   1 
ATOM   919  O O   . SER B 1 46 ? -2.405 13.542 31.096 1.00 15.53 ? 99  SER B O   1 
ATOM   920  C CB  . SER B 1 46 ? -2.069 11.371 32.838 1.00 14.19 ? 99  SER B CB  1 
ATOM   921  O OG  . SER B 1 46 ? -2.104 10.140 33.537 1.00 17.04 ? 99  SER B OG  1 
ATOM   922  N N   . THR B 1 47 ? -1.984 12.360 29.216 1.00 14.50 ? 100 THR B N   1 
ATOM   923  C CA  . THR B 1 47 ? -2.069 13.526 28.328 1.00 14.58 ? 100 THR B CA  1 
ATOM   924  C C   . THR B 1 47 ? -3.107 13.302 27.215 1.00 14.33 ? 100 THR B C   1 
ATOM   925  O O   . THR B 1 47 ? -2.899 13.676 26.057 1.00 14.10 ? 100 THR B O   1 
ATOM   926  C CB  . THR B 1 47 ? -0.664 13.949 27.766 1.00 14.28 ? 100 THR B CB  1 
ATOM   927  O OG1 . THR B 1 47 ? -0.131 12.935 26.904 1.00 14.07 ? 100 THR B OG1 1 
ATOM   928  C CG2 . THR B 1 47 ? 0.317  14.239 28.915 1.00 15.07 ? 100 THR B CG2 1 
ATOM   929  N N   . LEU B 1 48 ? -4.245 12.698 27.584 1.00 15.40 ? 101 LEU B N   1 
ATOM   930  C CA  . LEU B 1 48 ? -5.299 12.406 26.610 1.00 15.24 ? 101 LEU B CA  1 
ATOM   931  C C   . LEU B 1 48 ? -5.815 13.646 25.858 1.00 14.48 ? 101 LEU B C   1 
ATOM   932  O O   . LEU B 1 48 ? -6.220 13.552 24.687 1.00 14.37 ? 101 LEU B O   1 
ATOM   933  C CB  . LEU B 1 48 ? -6.445 11.580 27.240 1.00 16.66 ? 101 LEU B CB  1 
ATOM   934  C CG  . LEU B 1 48 ? -6.112 10.095 27.544 1.00 18.02 ? 101 LEU B CG  1 
ATOM   935  C CD1 . LEU B 1 48 ? -7.185 9.421  28.385 1.00 23.14 ? 101 LEU B CD1 1 
ATOM   936  C CD2 . LEU B 1 48 ? -5.862 9.296  26.276 1.00 21.24 ? 101 LEU B CD2 1 
ATOM   937  N N   . GLN B 1 49 ? -5.741 14.797 26.515 1.00 13.99 ? 102 GLN B N   1 
ATOM   938  C CA  . GLN B 1 49 ? -6.139 16.085 25.915 1.00 13.49 ? 102 GLN B CA  1 
ATOM   939  C C   . GLN B 1 49 ? -5.077 16.643 24.959 1.00 12.97 ? 102 GLN B C   1 
ATOM   940  O O   . GLN B 1 49 ? -5.317 17.621 24.252 1.00 12.40 ? 102 GLN B O   1 
ATOM   941  C CB  . GLN B 1 49 ? -6.463 17.092 27.024 1.00 14.52 ? 102 GLN B CB  1 
ATOM   942  C CG  . GLN B 1 49 ? -7.667 16.661 27.886 1.00 15.94 ? 102 GLN B CG  1 
ATOM   943  C CD  . GLN B 1 49 ? -8.945 16.520 27.057 1.00 18.41 ? 102 GLN B CD  1 
ATOM   944  O OE1 . GLN B 1 49 ? -9.241 15.449 26.518 1.00 19.94 ? 102 GLN B OE1 1 
ATOM   945  N NE2 . GLN B 1 49 ? -9.690 17.600 26.944 1.00 19.08 ? 102 GLN B NE2 1 
ATOM   946  N N   . GLY B 1 50 ? -3.912 16.010 24.931 1.00 11.44 ? 103 GLY B N   1 
ATOM   947  C CA  . GLY B 1 50 ? -2.842 16.439 24.032 1.00 11.59 ? 103 GLY B CA  1 
ATOM   948  C C   . GLY B 1 50 ? -1.981 17.515 24.644 1.00 11.39 ? 103 GLY B C   1 
ATOM   949  O O   . GLY B 1 50 ? -2.445 18.388 25.387 1.00 11.23 ? 103 GLY B O   1 
ATOM   950  N N   . LEU B 1 51 ? -0.692 17.431 24.343 1.00 10.81 ? 104 LEU B N   1 
ATOM   951  C CA  . LEU B 1 51 ? 0.255  18.451 24.781 1.00 10.63 ? 104 LEU B CA  1 
ATOM   952  C C   . LEU B 1 51 ? 0.259  19.624 23.791 1.00 10.63 ? 104 LEU B C   1 
ATOM   953  O O   . LEU B 1 51 ? -0.561 19.664 22.862 1.00 10.71 ? 104 LEU B O   1 
ATOM   954  C CB  . LEU B 1 51 ? 1.634  17.820 24.949 1.00 11.57 ? 104 LEU B CB  1 
ATOM   955  C CG  . LEU B 1 51 ? 1.682  16.780 26.087 1.00 13.14 ? 104 LEU B CG  1 
ATOM   956  C CD1 . LEU B 1 51 ? 2.878  15.825 25.948 1.00 13.96 ? 104 LEU B CD1 1 
ATOM   957  C CD2 . LEU B 1 51 ? 1.679  17.480 27.444 1.00 16.66 ? 104 LEU B CD2 1 
ATOM   958  N N   . GLU B 1 52 ? 1.158  20.588 23.996 1.00 9.94  ? 105 GLU B N   1 
ATOM   959  C CA  . GLU B 1 52 ? 1.188  21.768 23.113 1.00 10.25 ? 105 GLU B CA  1 
ATOM   960  C C   . GLU B 1 52 ? 1.584  21.436 21.686 1.00 9.62  ? 105 GLU B C   1 
ATOM   961  O O   . GLU B 1 52 ? 2.400  20.552 21.447 1.00 10.16 ? 105 GLU B O   1 
ATOM   962  C CB  . GLU B 1 52 ? 2.084  22.867 23.689 1.00 10.26 ? 105 GLU B CB  1 
ATOM   963  C CG  . GLU B 1 52 ? 1.409  23.676 24.810 1.00 12.07 ? 105 GLU B CG  1 
ATOM   964  C CD  . GLU B 1 52 ? 1.115  22.829 26.028 1.00 12.95 ? 105 GLU B CD  1 
ATOM   965  O OE1 . GLU B 1 52 ? 2.073  22.282 26.609 1.00 14.83 ? 105 GLU B OE1 1 
ATOM   966  O OE2 . GLU B 1 52 ? -0.075 22.693 26.394 1.00 14.14 ? 105 GLU B OE2 1 
ATOM   967  N N   . GLY B 1 53 ? 0.990  22.146 20.734 1.00 9.48  ? 106 GLY B N   1 
ATOM   968  C CA  . GLY B 1 53 ? 1.233  21.865 19.315 1.00 8.60  ? 106 GLY B CA  1 
ATOM   969  C C   . GLY B 1 53 ? 2.584  22.327 18.808 1.00 8.72  ? 106 GLY B C   1 
ATOM   970  O O   . GLY B 1 53 ? 3.221  23.201 19.398 1.00 8.42  ? 106 GLY B O   1 
ATOM   971  N N   . ARG B 1 54 ? 2.990  21.764 17.678 1.00 8.86  ? 107 ARG B N   1 
ATOM   972  C CA  . ARG B 1 54 ? 4.253  22.124 17.039 1.00 8.88  ? 107 ARG B CA  1 
ATOM   973  C C   . ARG B 1 54 ? 4.545  23.635 16.970 1.00 9.16  ? 107 ARG B C   1 
ATOM   974  O O   . ARG B 1 54 ? 5.640  24.064 17.333 1.00 9.71  ? 107 ARG B O   1 
ATOM   975  C CB  . ARG B 1 54 ? 4.298  21.553 15.627 1.00 8.80  ? 107 ARG B CB  1 
ATOM   976  C CG  . ARG B 1 54 ? 5.589  21.878 14.890 1.00 10.06 ? 107 ARG B CG  1 
ATOM   977  C CD  . ARG B 1 54 ? 5.565  21.348 13.495 1.00 9.89  ? 107 ARG B CD  1 
ATOM   978  N NE  . ARG B 1 54 ? 6.742  21.825 12.776 1.00 10.75 ? 107 ARG B NE  1 
ATOM   979  C CZ  . ARG B 1 54 ? 7.730  21.052 12.334 1.00 11.12 ? 107 ARG B CZ  1 
ATOM   980  N NH1 . ARG B 1 54 ? 7.710  19.738 12.542 1.00 9.86  ? 107 ARG B NH1 1 
ATOM   981  N NH2 . ARG B 1 54 ? 8.747  21.620 11.684 1.00 11.83 ? 107 ARG B NH2 1 
ATOM   982  N N   . GLU B 1 55 ? 3.595  24.435 16.486 1.00 9.50  ? 108 GLU B N   1 
ATOM   983  C CA  . GLU B 1 55 ? 3.901  25.862 16.279 1.00 9.13  ? 108 GLU B CA  1 
ATOM   984  C C   . GLU B 1 55 ? 3.953  26.660 17.590 1.00 9.52  ? 108 GLU B C   1 
ATOM   985  O O   . GLU B 1 55 ? 4.714  27.621 17.720 1.00 11.01 ? 108 GLU B O   1 
ATOM   986  C CB  . GLU B 1 55 ? 2.940  26.501 15.267 1.00 9.95  ? 108 GLU B CB  1 
ATOM   987  C CG  . GLU B 1 55 ? 2.733  25.679 13.976 1.00 10.21 ? 108 GLU B CG  1 
ATOM   988  C CD  . GLU B 1 55 ? 4.035  25.218 13.315 1.00 11.81 ? 108 GLU B CD  1 
ATOM   989  O OE1 . GLU B 1 55 ? 5.105  25.846 13.542 1.00 12.97 ? 108 GLU B OE1 1 
ATOM   990  O OE2 . GLU B 1 55 ? 3.973  24.235 12.544 1.00 13.94 ? 108 GLU B OE2 1 
ATOM   991  N N   . ASN B 1 56 ? 3.188  26.200 18.579 1.00 9.82  ? 109 ASN B N   1 
ATOM   992  C CA  . ASN B 1 56 ? 3.283  26.701 19.949 1.00 10.08 ? 109 ASN B CA  1 
ATOM   993  C C   . ASN B 1 56 ? 4.709  26.445 20.465 1.00 9.98  ? 109 ASN B C   1 
ATOM   994  O O   . ASN B 1 56 ? 5.376  27.336 21.001 1.00 10.56 ? 109 ASN B O   1 
ATOM   995  C CB  . ASN B 1 56 ? 2.225  25.979 20.791 1.00 10.71 ? 109 ASN B CB  1 
ATOM   996  C CG  . ASN B 1 56 ? 2.266  26.338 22.262 1.00 12.40 ? 109 ASN B CG  1 
ATOM   997  O OD1 . ASN B 1 56 ? 3.318  26.374 22.886 1.00 19.62 ? 109 ASN B OD1 1 
ATOM   998  N ND2 . ASN B 1 56 ? 1.094  26.535 22.833 1.00 16.71 ? 109 ASN B ND2 1 
ATOM   999  N N   . LEU B 1 57 ? 5.183  25.213 20.286 1.00 9.13  ? 110 LEU B N   1 
ATOM   1000 C CA  . LEU B 1 57 ? 6.526  24.874 20.738 1.00 9.10  ? 110 LEU B CA  1 
ATOM   1001 C C   . LEU B 1 57 ? 7.592  25.684 20.012 1.00 9.36  ? 110 LEU B C   1 
ATOM   1002 O O   . LEU B 1 57 ? 8.522  26.164 20.645 1.00 10.22 ? 110 LEU B O   1 
ATOM   1003 C CB  . LEU B 1 57 ? 6.783  23.382 20.518 1.00 9.87  ? 110 LEU B CB  1 
ATOM   1004 C CG  . LEU B 1 57 ? 5.780  22.454 21.182 1.00 9.56  ? 110 LEU B CG  1 
ATOM   1005 C CD1 . LEU B 1 57 ? 6.144  21.029 20.837 1.00 10.01 ? 110 LEU B CD1 1 
ATOM   1006 C CD2 . LEU B 1 57 ? 5.727  22.614 22.675 1.00 13.35 ? 110 LEU B CD2 1 
ATOM   1007 N N   . ALA B 1 58 ? 7.453  25.833 18.694 1.00 10.10 ? 111 ALA B N   1 
ATOM   1008 C CA  . ALA B 1 58 ? 8.436  26.594 17.923 1.00 10.18 ? 111 ALA B CA  1 
ATOM   1009 C C   . ALA B 1 58 ? 8.502  28.038 18.410 1.00 10.98 ? 111 ALA B C   1 
ATOM   1010 O O   . ALA B 1 58 ? 9.585  28.593 18.597 1.00 11.52 ? 111 ALA B O   1 
ATOM   1011 C CB  . ALA B 1 58 ? 8.115  26.535 16.450 1.00 10.21 ? 111 ALA B CB  1 
ATOM   1012 N N   . ARG B 1 59 ? 7.334  28.630 18.643 1.00 12.15 ? 112 ARG B N   1 
ATOM   1013 C CA  . ARG B 1 59 ? 7.266  29.977 19.215 1.00 13.79 ? 112 ARG B CA  1 
ATOM   1014 C C   . ARG B 1 59 ? 8.023  30.063 20.548 1.00 13.56 ? 112 ARG B C   1 
ATOM   1015 O O   . ARG B 1 59 ? 8.835  30.978 20.762 1.00 13.98 ? 112 ARG B O   1 
ATOM   1016 C CB  . ARG B 1 59 ? 5.803  30.406 19.378 1.00 14.07 ? 112 ARG B CB  1 
ATOM   1017 C CG  . ARG B 1 59 ? 5.574  31.884 19.708 1.00 14.94 ? 112 ARG B CG  1 
ATOM   1018 C CD  . ARG B 1 59 ? 4.070  32.172 19.890 1.00 16.45 ? 112 ARG B CD  1 
ATOM   1019 N NE  . ARG B 1 59 ? 3.303  31.455 18.891 1.00 19.76 ? 112 ARG B NE  1 
ATOM   1020 C CZ  . ARG B 1 59 ? 2.378  30.518 19.120 1.00 18.08 ? 112 ARG B CZ  1 
ATOM   1021 N NH1 . ARG B 1 59 ? 1.997  30.170 20.350 1.00 16.80 ? 112 ARG B NH1 1 
ATOM   1022 N NH2 . ARG B 1 59 ? 1.806  29.942 18.078 1.00 18.28 ? 112 ARG B NH2 1 
ATOM   1023 N N   . ASP B 1 60 ? 7.791  29.084 21.421 1.00 14.42 ? 113 ASP B N   1 
ATOM   1024 C CA  . ASP B 1 60 ? 8.441  29.011 22.716 1.00 15.56 ? 113 ASP B CA  1 
ATOM   1025 C C   . ASP B 1 60 ? 9.960  28.934 22.591 1.00 15.06 ? 113 ASP B C   1 
ATOM   1026 O O   . ASP B 1 60 ? 10.695 29.575 23.351 1.00 16.55 ? 113 ASP B O   1 
ATOM   1027 C CB  . ASP B 1 60 ? 7.955  27.768 23.448 1.00 16.83 ? 113 ASP B CB  1 
ATOM   1028 C CG  . ASP B 1 60 ? 7.114  28.081 24.656 1.00 21.56 ? 113 ASP B CG  1 
ATOM   1029 O OD1 . ASP B 1 60 ? 7.144  27.237 25.582 1.00 26.39 ? 113 ASP B OD1 1 
ATOM   1030 O OD2 . ASP B 1 60 ? 6.443  29.137 24.698 1.00 25.75 ? 113 ASP B OD2 1 
ATOM   1031 N N   . LEU B 1 61 ? 10.419 28.138 21.629 1.00 14.45 ? 114 LEU B N   1 
ATOM   1032 C CA  . LEU B 1 61 ? 11.843 27.883 21.420 1.00 13.82 ? 114 LEU B CA  1 
ATOM   1033 C C   . LEU B 1 61 ? 12.533 28.967 20.575 1.00 14.38 ? 114 LEU B C   1 
ATOM   1034 O O   . LEU B 1 61 ? 13.762 28.982 20.441 1.00 14.98 ? 114 LEU B O   1 
ATOM   1035 C CB  . LEU B 1 61 ? 12.028 26.523 20.748 1.00 14.18 ? 114 LEU B CB  1 
ATOM   1036 C CG  . LEU B 1 61 ? 11.667 25.293 21.578 1.00 13.01 ? 114 LEU B CG  1 
ATOM   1037 C CD1 . LEU B 1 61 ? 11.443 24.114 20.675 1.00 13.27 ? 114 LEU B CD1 1 
ATOM   1038 C CD2 . LEU B 1 61 ? 12.791 24.980 22.567 1.00 14.06 ? 114 LEU B CD2 1 
ATOM   1039 N N   . GLY B 1 62 ? 11.739 29.856 19.987 1.00 14.14 ? 115 GLY B N   1 
ATOM   1040 C CA  . GLY B 1 62 ? 12.288 30.920 19.132 1.00 14.28 ? 115 GLY B CA  1 
ATOM   1041 C C   . GLY B 1 62 ? 12.623 30.443 17.734 1.00 14.71 ? 115 GLY B C   1 
ATOM   1042 O O   . GLY B 1 62 ? 13.339 31.130 16.980 1.00 16.50 ? 115 GLY B O   1 
ATOM   1043 N N   . ILE B 1 63 ? 12.099 29.277 17.362 1.00 13.59 ? 116 ILE B N   1 
ATOM   1044 C CA  . ILE B 1 63 ? 12.304 28.725 16.023 1.00 13.70 ? 116 ILE B CA  1 
ATOM   1045 C C   . ILE B 1 63 ? 11.306 29.318 15.028 1.00 14.62 ? 116 ILE B C   1 
ATOM   1046 O O   . ILE B 1 63 ? 10.104 29.365 15.289 1.00 14.63 ? 116 ILE B O   1 
ATOM   1047 C CB  . ILE B 1 63 ? 12.235 27.176 16.056 1.00 13.35 ? 116 ILE B CB  1 
ATOM   1048 C CG1 . ILE B 1 63 ? 13.425 26.652 16.878 1.00 12.27 ? 116 ILE B CG1 1 
ATOM   1049 C CG2 . ILE B 1 63 ? 12.200 26.579 14.658 1.00 13.63 ? 116 ILE B CG2 1 
ATOM   1050 C CD1 . ILE B 1 63 ? 13.302 25.203 17.320 1.00 12.56 ? 116 ILE B CD1 1 
ATOM   1051 N N   . ILE B 1 64 ? 11.815 29.786 13.889 1.00 14.95 ? 117 ILE B N   1 
ATOM   1052 C CA  . ILE B 1 64 ? 10.964 30.344 12.829 1.00 15.77 ? 117 ILE B CA  1 
ATOM   1053 C C   . ILE B 1 64 ? 10.746 29.264 11.763 1.00 15.93 ? 117 ILE B C   1 
ATOM   1054 O O   . ILE B 1 64 ? 11.707 28.792 11.154 1.00 16.72 ? 117 ILE B O   1 
ATOM   1055 C CB  . ILE B 1 64 ? 11.613 31.607 12.178 1.00 15.63 ? 117 ILE B CB  1 
ATOM   1056 C CG1 . ILE B 1 64 ? 11.985 32.658 13.229 1.00 15.36 ? 117 ILE B CG1 1 
ATOM   1057 C CG2 . ILE B 1 64 ? 10.701 32.193 11.095 1.00 17.11 ? 117 ILE B CG2 1 
ATOM   1058 C CD1 . ILE B 1 64 ? 13.093 33.622 12.777 1.00 17.33 ? 117 ILE B CD1 1 
ATOM   1059 N N   . GLU B 1 65 ? 9.500  28.840 11.533 1.00 15.87 ? 118 GLU B N   1 
ATOM   1060 C CA  . GLU B 1 65 ? 9.271  27.860 10.450 1.00 15.66 ? 118 GLU B CA  1 
ATOM   1061 C C   . GLU B 1 65 ? 9.760  28.379 9.109  1.00 16.45 ? 118 GLU B C   1 
ATOM   1062 O O   . GLU B 1 65 ? 9.503  29.534 8.725  1.00 16.74 ? 118 GLU B O   1 
ATOM   1063 C CB  . GLU B 1 65 ? 7.806  27.426 10.299 1.00 16.12 ? 118 GLU B CB  1 
ATOM   1064 C CG  . GLU B 1 65 ? 7.231  26.712 11.485 1.00 15.53 ? 118 GLU B CG  1 
ATOM   1065 C CD  . GLU B 1 65 ? 7.673  25.243 11.683 1.00 16.47 ? 118 GLU B CD  1 
ATOM   1066 O OE1 . GLU B 1 65 ? 8.613  24.696 11.042 1.00 15.41 ? 118 GLU B OE1 1 
ATOM   1067 O OE2 . GLU B 1 65 ? 7.065  24.630 12.556 1.00 13.74 ? 118 GLU B OE2 1 
ATOM   1068 N N   . ALA B 1 66 ? 10.464 27.512 8.400  1.00 16.42 ? 119 ALA B N   1 
ATOM   1069 C CA  . ALA B 1 66 ? 11.005 27.844 7.089  1.00 17.07 ? 119 ALA B CA  1 
ATOM   1070 C C   . ALA B 1 66 ? 11.150 26.553 6.294  1.00 17.63 ? 119 ALA B C   1 
ATOM   1071 O O   . ALA B 1 66 ? 10.876 25.460 6.813  1.00 16.51 ? 119 ALA B O   1 
ATOM   1072 C CB  . ALA B 1 66 ? 12.342 28.561 7.247  1.00 17.17 ? 119 ALA B CB  1 
ATOM   1073 N N   . GLU B 1 67 ? 11.554 26.650 5.026  1.00 18.62 ? 120 GLU B N   1 
ATOM   1074 C CA  . GLU B 1 67 ? 11.658 25.448 4.222  1.00 20.49 ? 120 GLU B CA  1 
ATOM   1075 C C   . GLU B 1 67 ? 12.610 24.446 4.901  1.00 19.64 ? 120 GLU B C   1 
ATOM   1076 O O   . GLU B 1 67 ? 12.412 23.239 4.816  1.00 20.43 ? 120 GLU B O   1 
ATOM   1077 C CB  . GLU B 1 67 ? 12.043 25.784 2.767  1.00 20.59 ? 120 GLU B CB  1 
ATOM   1078 C CG  . GLU B 1 67 ? 13.518 25.739 2.424  1.00 24.29 ? 120 GLU B CG  1 
ATOM   1079 C CD  . GLU B 1 67 ? 13.757 25.888 0.928  1.00 24.22 ? 120 GLU B CD  1 
ATOM   1080 O OE1 . GLU B 1 67 ? 14.836 25.469 0.451  1.00 29.57 ? 120 GLU B OE1 1 
ATOM   1081 O OE2 . GLU B 1 67 ? 12.857 26.413 0.230  1.00 29.34 ? 120 GLU B OE2 1 
ATOM   1082 N N   . GLY B 1 68 ? 13.599 24.976 5.622  1.00 18.67 ? 121 GLY B N   1 
ATOM   1083 C CA  . GLY B 1 68 ? 14.601 24.158 6.314  1.00 17.36 ? 121 GLY B CA  1 
ATOM   1084 C C   . GLY B 1 68 ? 14.211 23.532 7.641  1.00 16.92 ? 121 GLY B C   1 
ATOM   1085 O O   . GLY B 1 68 ? 14.987 22.746 8.198  1.00 17.99 ? 121 GLY B O   1 
ATOM   1086 N N   . THR B 1 69 ? 13.033 23.892 8.166  1.00 14.18 ? 122 THR B N   1 
ATOM   1087 C CA  . THR B 1 69 ? 12.513 23.258 9.383  1.00 12.97 ? 122 THR B CA  1 
ATOM   1088 C C   . THR B 1 69 ? 11.274 22.409 9.134  1.00 12.09 ? 122 THR B C   1 
ATOM   1089 O O   . THR B 1 69 ? 11.032 21.425 9.859  1.00 11.86 ? 122 THR B O   1 
ATOM   1090 C CB  . THR B 1 69 ? 12.156 24.285 10.486 1.00 12.59 ? 122 THR B CB  1 
ATOM   1091 O OG1 . THR B 1 69 ? 11.179 25.207 9.983  1.00 13.07 ? 122 THR B OG1 1 
ATOM   1092 C CG2 . THR B 1 69 ? 13.378 25.031 10.992 1.00 14.25 ? 122 THR B CG2 1 
ATOM   1093 N N   . VAL B 1 70 ? 10.467 22.799 8.139  1.00 11.93 ? 123 VAL B N   1 
ATOM   1094 C CA  . VAL B 1 70 ? 9.147  22.162 7.933  1.00 12.02 ? 123 VAL B CA  1 
ATOM   1095 C C   . VAL B 1 70 ? 9.217  20.675 7.604  1.00 11.51 ? 123 VAL B C   1 
ATOM   1096 O O   . VAL B 1 70 ? 8.250  19.920 7.868  1.00 11.77 ? 123 VAL B O   1 
ATOM   1097 C CB  . VAL B 1 70 ? 8.232  22.922 6.905  1.00 11.54 ? 123 VAL B CB  1 
ATOM   1098 C CG1 . VAL B 1 70 ? 7.916  24.308 7.411  1.00 13.06 ? 123 VAL B CG1 1 
ATOM   1099 C CG2 . VAL B 1 70 ? 8.832  22.944 5.487  1.00 15.04 ? 123 VAL B CG2 1 
ATOM   1100 N N   . GLY B 1 71 ? 10.363 20.265 7.055  1.00 11.32 ? 124 GLY B N   1 
ATOM   1101 C CA  . GLY B 1 71 ? 10.571 18.907 6.554  1.00 11.94 ? 124 GLY B CA  1 
ATOM   1102 C C   . GLY B 1 71 ? 11.028 17.911 7.598  1.00 11.39 ? 124 GLY B C   1 
ATOM   1103 O O   . GLY B 1 71 ? 11.270 16.741 7.287  1.00 12.88 ? 124 GLY B O   1 
ATOM   1104 N N   . GLY B 1 72 ? 11.143 18.364 8.846  1.00 10.05 ? 125 GLY B N   1 
ATOM   1105 C CA  . GLY B 1 72 ? 11.556 17.468 9.933  1.00 9.13  ? 125 GLY B CA  1 
ATOM   1106 C C   . GLY B 1 72 ? 10.771 17.737 11.200 1.00 7.95  ? 125 GLY B C   1 
ATOM   1107 O O   . GLY B 1 72 ? 10.106 18.762 11.309 1.00 8.42  ? 125 GLY B O   1 
ATOM   1108 N N   . PRO B 1 73 ? 10.849 16.818 12.175 1.00 8.47  ? 126 PRO B N   1 
ATOM   1109 C CA  . PRO B 1 73 ? 10.201 17.088 13.458 1.00 8.17  ? 126 PRO B CA  1 
ATOM   1110 C C   . PRO B 1 73 ? 10.938 18.249 14.124 1.00 8.75  ? 126 PRO B C   1 
ATOM   1111 O O   . PRO B 1 73 ? 12.093 18.537 13.780 1.00 9.24  ? 126 PRO B O   1 
ATOM   1112 C CB  . PRO B 1 73 ? 10.405 15.781 14.249 1.00 8.68  ? 126 PRO B CB  1 
ATOM   1113 C CG  . PRO B 1 73 ? 11.711 15.241 13.667 1.00 8.81  ? 126 PRO B CG  1 
ATOM   1114 C CD  . PRO B 1 73 ? 11.606 15.561 12.184 1.00 8.56  ? 126 PRO B CD  1 
ATOM   1115 N N   . LEU B 1 74 ? 10.283 18.933 15.048 1.00 9.12  ? 127 LEU B N   1 
ATOM   1116 C CA  . LEU B 1 74 ? 10.919 20.081 15.664 1.00 9.60  ? 127 LEU B CA  1 
ATOM   1117 C C   . LEU B 1 74 ? 12.199 19.688 16.423 1.00 8.88  ? 127 LEU B C   1 
ATOM   1118 O O   . LEU B 1 74 ? 13.165 20.452 16.461 1.00 8.88  ? 127 LEU B O   1 
ATOM   1119 C CB  . LEU B 1 74 ? 9.915  20.817 16.554 1.00 11.20 ? 127 LEU B CB  1 
ATOM   1120 C CG  . LEU B 1 74 ? 10.183 22.296 16.728 1.00 14.81 ? 127 LEU B CG  1 
ATOM   1121 C CD1 . LEU B 1 74 ? 10.094 23.026 15.388 1.00 14.95 ? 127 LEU B CD1 1 
ATOM   1122 C CD2 . LEU B 1 74 ? 9.153  22.855 17.718 1.00 15.63 ? 127 LEU B CD2 1 
ATOM   1123 N N   . LEU B 1 75 ? 12.215 18.498 17.029 1.00 8.32  ? 128 LEU B N   1 
ATOM   1124 C CA  . LEU B 1 75 ? 13.419 18.025 17.733 1.00 9.23  ? 128 LEU B CA  1 
ATOM   1125 C C   . LEU B 1 75 ? 14.626 17.934 16.815 1.00 9.18  ? 128 LEU B C   1 
ATOM   1126 O O   . LEU B 1 75 ? 15.765 18.040 17.260 1.00 9.37  ? 128 LEU B O   1 
ATOM   1127 C CB  . LEU B 1 75 ? 13.170 16.667 18.394 1.00 10.04 ? 128 LEU B CB  1 
ATOM   1128 C CG  . LEU B 1 75 ? 12.517 16.709 19.767 1.00 9.73  ? 128 LEU B CG  1 
ATOM   1129 C CD1 . LEU B 1 75 ? 12.137 15.309 20.244 1.00 11.30 ? 128 LEU B CD1 1 
ATOM   1130 C CD2 . LEU B 1 75 ? 13.439 17.401 20.796 1.00 9.67  ? 128 LEU B CD2 1 
ATOM   1131 N N   . LEU B 1 76 ? 14.394 17.730 15.515 1.00 9.16  ? 129 LEU B N   1 
ATOM   1132 C CA  . LEU B 1 76 ? 15.535 17.755 14.593 1.00 9.25  ? 129 LEU B CA  1 
ATOM   1133 C C   . LEU B 1 76 ? 16.239 19.121 14.630 1.00 9.65  ? 129 LEU B C   1 
ATOM   1134 O O   . LEU B 1 76 ? 17.482 19.198 14.645 1.00 10.10 ? 129 LEU B O   1 
ATOM   1135 C CB  . LEU B 1 76 ? 15.094 17.406 13.172 1.00 9.61  ? 129 LEU B CB  1 
ATOM   1136 C CG  . LEU B 1 76 ? 16.277 17.425 12.193 1.00 9.63  ? 129 LEU B CG  1 
ATOM   1137 C CD1 . LEU B 1 76 ? 17.339 16.434 12.556 1.00 9.13  ? 129 LEU B CD1 1 
ATOM   1138 C CD2 . LEU B 1 76 ? 15.775 17.189 10.772 1.00 10.12 ? 129 LEU B CD2 1 
ATOM   1139 N N   . GLU B 1 77 ? 15.456 20.197 14.642 1.00 9.20  ? 130 GLU B N   1 
ATOM   1140 C CA  . GLU B 1 77 ? 16.025 21.540 14.654 1.00 9.19  ? 130 GLU B CA  1 
ATOM   1141 C C   . GLU B 1 77 ? 16.696 21.839 15.988 1.00 9.63  ? 130 GLU B C   1 
ATOM   1142 O O   . GLU B 1 77 ? 17.784 22.445 16.050 1.00 10.06 ? 130 GLU B O   1 
ATOM   1143 C CB  . GLU B 1 77 ? 14.938 22.575 14.358 1.00 9.95  ? 130 GLU B CB  1 
ATOM   1144 C CG  . GLU B 1 77 ? 15.499 23.975 14.153 1.00 11.26 ? 130 GLU B CG  1 
ATOM   1145 C CD  . GLU B 1 77 ? 16.305 24.167 12.863 1.00 12.80 ? 130 GLU B CD  1 
ATOM   1146 O OE1 . GLU B 1 77 ? 16.678 23.199 12.171 1.00 12.28 ? 130 GLU B OE1 1 
ATOM   1147 O OE2 . GLU B 1 77 ? 16.572 25.336 12.543 1.00 13.89 ? 130 GLU B OE2 1 
ATOM   1148 N N   . VAL B 1 78 ? 16.061 21.383 17.055 1.00 9.40  ? 131 VAL B N   1 
ATOM   1149 C CA  . VAL B 1 78 ? 16.654 21.515 18.389 1.00 9.55  ? 131 VAL B CA  1 
ATOM   1150 C C   . VAL B 1 78 ? 18.023 20.837 18.406 1.00 10.26 ? 131 VAL B C   1 
ATOM   1151 O O   . VAL B 1 78 ? 19.027 21.431 18.821 1.00 10.32 ? 131 VAL B O   1 
ATOM   1152 C CB  . VAL B 1 78 ? 15.720 20.948 19.481 1.00 9.94  ? 131 VAL B CB  1 
ATOM   1153 C CG1 . VAL B 1 78 ? 16.438 20.966 20.818 1.00 9.94  ? 131 VAL B CG1 1 
ATOM   1154 C CG2 . VAL B 1 78 ? 14.437 21.783 19.559 1.00 9.26  ? 131 VAL B CG2 1 
ATOM   1155 N N   . ILE B 1 79 ? 18.098 19.605 17.910 1.00 10.09 ? 132 ILE B N   1 
ATOM   1156 C CA  . ILE B 1 79 ? 19.355 18.876 17.980 1.00 11.17 ? 132 ILE B CA  1 
ATOM   1157 C C   . ILE B 1 79 ? 20.430 19.432 17.018 1.00 10.37 ? 132 ILE B C   1 
ATOM   1158 O O   . ILE B 1 79 ? 21.616 19.463 17.364 1.00 10.70 ? 132 ILE B O   1 
ATOM   1159 C CB  . ILE B 1 79 ? 19.125 17.355 17.846 1.00 11.72 ? 132 ILE B CB  1 
ATOM   1160 C CG1 . ILE B 1 79 ? 18.416 16.809 19.099 1.00 14.55 ? 132 ILE B CG1 1 
ATOM   1161 C CG2 . ILE B 1 79 ? 20.430 16.618 17.588 1.00 14.94 ? 132 ILE B CG2 1 
ATOM   1162 C CD1 . ILE B 1 79 ? 19.065 17.193 20.433 1.00 16.94 ? 132 ILE B CD1 1 
ATOM   1163 N N   . ARG B 1 80 ? 20.024 19.903 15.834 1.00 9.98  ? 133 ARG B N   1 
ATOM   1164 C CA  . ARG B 1 80 ? 20.967 20.576 14.934 1.00 10.04 ? 133 ARG B CA  1 
ATOM   1165 C C   . ARG B 1 80 ? 21.655 21.757 15.636 1.00 9.96  ? 133 ARG B C   1 
ATOM   1166 O O   . ARG B 1 80 ? 22.857 21.996 15.449 1.00 9.58  ? 133 ARG B O   1 
ATOM   1167 C CB  . ARG B 1 80 ? 20.259 21.050 13.668 1.00 10.04 ? 133 ARG B CB  1 
ATOM   1168 C CG  . ARG B 1 80 ? 21.204 21.634 12.617 1.00 10.57 ? 133 ARG B CG  1 
ATOM   1169 C CD  . ARG B 1 80 ? 20.431 22.121 11.399 1.00 10.30 ? 133 ARG B CD  1 
ATOM   1170 N NE  . ARG B 1 80 ? 19.643 23.332 11.661 1.00 11.04 ? 133 ARG B NE  1 
ATOM   1171 C CZ  . ARG B 1 80 ? 20.167 24.551 11.794 1.00 10.75 ? 133 ARG B CZ  1 
ATOM   1172 N NH1 . ARG B 1 80 ? 21.489 24.726 11.688 1.00 9.02  ? 133 ARG B NH1 1 
ATOM   1173 N NH2 . ARG B 1 80 ? 19.376 25.594 12.020 1.00 9.67  ? 133 ARG B NH2 1 
ATOM   1174 N N   . ARG B 1 81 ? 20.869 22.472 16.442 1.00 9.98  ? 134 ARG B N   1 
ATOM   1175 C CA  . ARG B 1 81 ? 21.285 23.709 17.095 1.00 9.63  ? 134 ARG B CA  1 
ATOM   1176 C C   . ARG B 1 81 ? 21.782 23.536 18.531 1.00 10.94 ? 134 ARG B C   1 
ATOM   1177 O O   . ARG B 1 81 ? 22.043 24.523 19.232 1.00 11.98 ? 134 ARG B O   1 
ATOM   1178 C CB  . ARG B 1 81 ? 20.169 24.744 17.002 1.00 10.50 ? 134 ARG B CB  1 
ATOM   1179 C CG  . ARG B 1 81 ? 19.924 25.216 15.557 1.00 8.55  ? 134 ARG B CG  1 
ATOM   1180 C CD  . ARG B 1 81 ? 18.855 26.303 15.484 1.00 10.62 ? 134 ARG B CD  1 
ATOM   1181 N NE  . ARG B 1 81 ? 19.191 27.404 16.383 1.00 12.86 ? 134 ARG B NE  1 
ATOM   1182 C CZ  . ARG B 1 81 ? 18.316 28.251 16.922 1.00 16.45 ? 134 ARG B CZ  1 
ATOM   1183 N NH1 . ARG B 1 81 ? 17.019 28.194 16.623 1.00 14.81 ? 134 ARG B NH1 1 
ATOM   1184 N NH2 . ARG B 1 81 ? 18.756 29.170 17.767 1.00 18.26 ? 134 ARG B NH2 1 
ATOM   1185 N N   . TRP B 1 82 ? 21.961 22.276 18.920 1.00 12.46 ? 135 TRP B N   1 
ATOM   1186 C CA  . TRP B 1 82 ? 22.506 21.926 20.243 1.00 12.96 ? 135 TRP B CA  1 
ATOM   1187 C C   . TRP B 1 82 ? 24.009 21.672 20.135 1.00 13.26 ? 135 TRP B C   1 
ATOM   1188 O O   . TRP B 1 82 ? 24.802 22.259 20.895 1.00 14.13 ? 135 TRP B O   1 
ATOM   1189 C CB  . TRP B 1 82 ? 21.769 20.701 20.825 1.00 12.75 ? 135 TRP B CB  1 
ATOM   1190 C CG  . TRP B 1 82 ? 22.414 20.182 22.082 1.00 12.29 ? 135 TRP B CG  1 
ATOM   1191 C CD1 . TRP B 1 82 ? 23.129 19.038 22.222 1.00 12.17 ? 135 TRP B CD1 1 
ATOM   1192 C CD2 . TRP B 1 82 ? 22.422 20.829 23.351 1.00 11.41 ? 135 TRP B CD2 1 
ATOM   1193 N NE1 . TRP B 1 82 ? 23.590 18.916 23.527 1.00 11.26 ? 135 TRP B NE1 1 
ATOM   1194 C CE2 . TRP B 1 82 ? 23.162 20.010 24.235 1.00 12.02 ? 135 TRP B CE2 1 
ATOM   1195 C CE3 . TRP B 1 82 ? 21.887 22.031 23.823 1.00 12.43 ? 135 TRP B CE3 1 
ATOM   1196 C CZ2 . TRP B 1 82 ? 23.372 20.359 25.581 1.00 11.46 ? 135 TRP B CZ2 1 
ATOM   1197 C CZ3 . TRP B 1 82 ? 22.091 22.377 25.155 1.00 13.84 ? 135 TRP B CZ3 1 
ATOM   1198 C CH2 . TRP B 1 82 ? 22.838 21.538 26.017 1.00 13.26 ? 135 TRP B CH2 1 
ATOM   1199 O OXT . TRP B 1 82 ? 24.473 20.870 19.302 1.00 13.65 ? 135 TRP B OXT 1 
HETATM 1200 O O   . HOH C 2 .  ? 15.701 12.080 26.739 1.00 8.33  ? 136 HOH A O   1 
HETATM 1201 O O   . HOH C 2 .  ? 22.378 14.645 10.248 1.00 15.04 ? 137 HOH A O   1 
HETATM 1202 O O   . HOH C 2 .  ? 6.963  -4.945 21.357 1.00 14.46 ? 138 HOH A O   1 
HETATM 1203 O O   . HOH C 2 .  ? 21.650 9.700  5.311  1.00 16.44 ? 139 HOH A O   1 
HETATM 1204 O O   . HOH C 2 .  ? 23.641 12.581 8.242  1.00 16.29 ? 140 HOH A O   1 
HETATM 1205 O O   . HOH C 2 .  ? 20.142 18.357 10.668 1.00 15.95 ? 141 HOH A O   1 
HETATM 1206 O O   . HOH C 2 .  ? 23.870 18.630 11.814 1.00 17.64 ? 142 HOH A O   1 
HETATM 1207 O O   . HOH C 2 .  ? 8.328  -2.263 26.931 1.00 17.13 ? 143 HOH A O   1 
HETATM 1208 O O   . HOH C 2 .  ? 28.237 20.423 28.470 1.00 17.30 ? 144 HOH A O   1 
HETATM 1209 O O   . HOH C 2 .  ? 17.725 14.457 9.667  1.00 17.00 ? 145 HOH A O   1 
HETATM 1210 O O   . HOH C 2 .  ? 20.759 14.254 41.966 1.00 17.35 ? 146 HOH A O   1 
HETATM 1211 O O   . HOH C 2 .  ? 19.737 8.826  35.430 1.00 25.96 ? 147 HOH A O   1 
HETATM 1212 O O   . HOH C 2 .  ? 31.495 14.385 24.555 1.00 22.50 ? 148 HOH A O   1 
HETATM 1213 O O   . HOH C 2 .  ? 18.730 15.527 32.606 1.00 18.09 ? 149 HOH A O   1 
HETATM 1214 O O   . HOH C 2 .  ? 25.170 3.736  26.417 1.00 28.53 ? 150 HOH A O   1 
HETATM 1215 O O   . HOH C 2 .  ? 22.351 6.848  11.478 1.00 27.31 ? 151 HOH A O   1 
HETATM 1216 O O   . HOH C 2 .  ? 5.949  9.095  7.995  1.00 21.43 ? 152 HOH A O   1 
HETATM 1217 O O   . HOH C 2 .  ? 24.167 9.846  15.103 1.00 16.39 ? 153 HOH A O   1 
HETATM 1218 O O   . HOH C 2 .  ? 14.335 6.294  35.232 1.00 19.45 ? 154 HOH A O   1 
HETATM 1219 O O   . HOH C 2 .  ? 24.377 26.286 29.818 1.00 27.14 ? 155 HOH A O   1 
HETATM 1220 O O   . HOH C 2 .  ? 18.872 9.578  4.948  1.00 18.89 ? 156 HOH A O   1 
HETATM 1221 O O   . HOH C 2 .  ? 25.404 15.623 13.693 1.00 26.55 ? 157 HOH A O   1 
HETATM 1222 O O   . HOH C 2 .  ? 19.196 15.730 38.552 1.00 17.35 ? 158 HOH A O   1 
HETATM 1223 O O   . HOH C 2 .  ? 5.693  3.702  11.052 1.00 23.63 ? 159 HOH A O   1 
HETATM 1224 O O   . HOH C 2 .  ? 18.129 5.762  23.548 1.00 23.97 ? 160 HOH A O   1 
HETATM 1225 O O   . HOH C 2 .  ? 17.126 3.636  8.952  1.00 22.15 ? 161 HOH A O   1 
HETATM 1226 O O   . HOH C 2 .  ? 12.745 12.079 6.449  1.00 23.50 ? 162 HOH A O   1 
HETATM 1227 O O   . HOH C 2 .  ? 13.670 22.485 34.605 1.00 32.12 ? 163 HOH A O   1 
HETATM 1228 O O   . HOH C 2 .  ? 26.721 18.679 31.169 1.00 30.78 ? 164 HOH A O   1 
HETATM 1229 O O   . HOH C 2 .  ? 22.646 12.296 42.752 1.00 14.24 ? 165 HOH A O   1 
HETATM 1230 O O   . HOH C 2 .  ? 19.933 15.955 9.313  1.00 16.41 ? 166 HOH A O   1 
HETATM 1231 O O   . HOH C 2 .  ? 17.872 19.715 9.843  1.00 21.16 ? 167 HOH A O   1 
HETATM 1232 O O   . HOH C 2 .  ? 20.669 16.285 43.906 1.00 22.07 ? 168 HOH A O   1 
HETATM 1233 O O   . HOH C 2 .  ? 23.504 17.731 15.936 1.00 16.46 ? 169 HOH A O   1 
HETATM 1234 O O   . HOH C 2 .  ? 11.905 3.208  10.136 1.00 20.60 ? 170 HOH A O   1 
HETATM 1235 O O   . HOH C 2 .  ? 24.523 7.917  13.195 1.00 31.76 ? 171 HOH A O   1 
HETATM 1236 O O   . HOH C 2 .  ? 12.759 14.645 36.019 1.00 19.18 ? 172 HOH A O   1 
HETATM 1237 O O   . HOH C 2 .  ? 4.396  3.994  33.546 1.00 22.56 ? 173 HOH A O   1 
HETATM 1238 O O   . HOH C 2 .  ? 17.534 16.769 36.270 1.00 22.52 ? 174 HOH A O   1 
HETATM 1239 O O   . HOH C 2 .  ? 17.135 15.761 40.728 1.00 28.25 ? 175 HOH A O   1 
HETATM 1240 O O   . HOH C 2 .  ? 15.867 14.655 7.914  1.00 22.75 ? 176 HOH A O   1 
HETATM 1241 O O   . HOH C 2 .  ? 17.075 6.457  30.882 1.00 24.97 ? 177 HOH A O   1 
HETATM 1242 O O   . HOH C 2 .  ? 11.020 8.321  36.428 1.00 22.13 ? 178 HOH A O   1 
HETATM 1243 O O   . HOH C 2 .  ? 17.432 4.485  29.345 1.00 29.78 ? 179 HOH A O   1 
HETATM 1244 O O   . HOH C 2 .  ? 24.005 8.089  17.170 1.00 28.06 ? 180 HOH A O   1 
HETATM 1245 O O   . HOH C 2 .  ? 1.479  2.889  12.185 1.00 24.35 ? 181 HOH A O   1 
HETATM 1246 O O   . HOH C 2 .  ? 18.980 18.155 33.329 1.00 28.58 ? 182 HOH A O   1 
HETATM 1247 O O   . HOH C 2 .  ? 7.028  -6.348 18.895 1.00 21.63 ? 183 HOH A O   1 
HETATM 1248 O O   . HOH C 2 .  ? 29.545 12.658 28.692 1.00 25.65 ? 184 HOH A O   1 
HETATM 1249 O O   . HOH C 2 .  ? 22.279 8.311  19.026 1.00 32.19 ? 185 HOH A O   1 
HETATM 1250 O O   . HOH C 2 .  ? 24.110 8.609  20.853 1.00 61.28 ? 186 HOH A O   1 
HETATM 1251 O O   . HOH C 2 .  ? 32.441 19.894 33.578 1.00 26.76 ? 187 HOH A O   1 
HETATM 1252 O O   . HOH C 2 .  ? 23.672 26.965 27.405 1.00 42.93 ? 188 HOH A O   1 
HETATM 1253 O O   . HOH C 2 .  ? 8.760  1.723  10.618 1.00 24.10 ? 189 HOH A O   1 
HETATM 1254 O O   . HOH C 2 .  ? 17.920 28.271 28.639 1.00 29.99 ? 190 HOH A O   1 
HETATM 1255 O O   . HOH C 2 .  ? 23.079 17.747 44.309 1.00 27.43 ? 191 HOH A O   1 
HETATM 1256 O O   . HOH C 2 .  ? 25.751 25.460 26.471 1.00 24.48 ? 192 HOH A O   1 
HETATM 1257 O O   . HOH C 2 .  ? 5.102  3.665  36.088 1.00 24.98 ? 193 HOH A O   1 
HETATM 1258 O O   . HOH C 2 .  ? 29.317 11.911 32.034 1.00 30.58 ? 194 HOH A O   1 
HETATM 1259 O O   . HOH C 2 .  ? 9.252  -3.553 24.889 1.00 27.22 ? 195 HOH A O   1 
HETATM 1260 O O   . HOH C 2 .  ? 16.269 5.622  33.272 1.00 27.82 ? 196 HOH A O   1 
HETATM 1261 O O   . HOH C 2 .  ? 15.731 4.728  2.030  1.00 25.89 ? 197 HOH A O   1 
HETATM 1262 O O   . HOH C 2 .  ? 14.001 1.162  19.943 1.00 23.40 ? 198 HOH A O   1 
HETATM 1263 O O   . HOH C 2 .  ? 17.474 12.411 41.273 1.00 27.78 ? 199 HOH A O   1 
HETATM 1264 O O   . HOH C 2 .  ? 15.645 12.411 6.462  1.00 28.61 ? 200 HOH A O   1 
HETATM 1265 O O   . HOH C 2 .  ? 19.394 4.045  27.813 1.00 33.18 ? 201 HOH A O   1 
HETATM 1266 O O   . HOH C 2 .  ? 14.039 1.871  9.423  1.00 32.97 ? 202 HOH A O   1 
HETATM 1267 O O   . HOH C 2 .  ? 19.002 7.311  3.513  1.00 28.02 ? 203 HOH A O   1 
HETATM 1268 O O   . HOH C 2 .  ? 17.238 3.995  25.178 1.00 37.08 ? 204 HOH A O   1 
HETATM 1269 O O   . HOH C 2 .  ? 22.381 19.353 9.568  1.00 27.14 ? 205 HOH A O   1 
HETATM 1270 O O   . HOH C 2 .  ? 17.492 9.039  0.954  1.00 27.52 ? 206 HOH A O   1 
HETATM 1271 O O   . HOH C 2 .  ? 19.487 4.749  13.555 1.00 41.90 ? 207 HOH A O   1 
HETATM 1272 O O   . HOH C 2 .  ? 22.426 8.432  34.407 1.00 29.26 ? 208 HOH A O   1 
HETATM 1273 O O   . HOH C 2 .  ? 5.086  -6.420 16.922 1.00 25.16 ? 209 HOH A O   1 
HETATM 1274 O O   . HOH C 2 .  ? 7.386  4.701  37.292 1.00 27.17 ? 210 HOH A O   1 
HETATM 1275 O O   . HOH C 2 .  ? 26.490 18.245 34.389 1.00 29.05 ? 211 HOH A O   1 
HETATM 1276 O O   . HOH C 2 .  ? 28.630 9.528  28.962 1.00 32.10 ? 212 HOH A O   1 
HETATM 1277 O O   . HOH C 2 .  ? 13.779 0.387  27.172 1.00 36.46 ? 213 HOH A O   1 
HETATM 1278 O O   . HOH C 2 .  ? 25.229 18.932 38.729 1.00 33.79 ? 214 HOH A O   1 
HETATM 1279 O O   . HOH C 2 .  ? 17.608 5.218  4.054  1.00 30.39 ? 215 HOH A O   1 
HETATM 1280 O O   . HOH C 2 .  ? 10.501 2.207  4.948  1.00 32.97 ? 216 HOH A O   1 
HETATM 1281 O O   . HOH C 2 .  ? 13.481 3.635  35.917 1.00 31.22 ? 217 HOH A O   1 
HETATM 1282 O O   . HOH C 2 .  ? 32.821 17.663 35.220 1.00 25.59 ? 218 HOH A O   1 
HETATM 1283 O O   . HOH C 2 .  ? 24.329 16.317 9.907  1.00 31.03 ? 219 HOH A O   1 
HETATM 1284 O O   . HOH C 2 .  ? 23.754 6.144  32.412 1.00 31.49 ? 220 HOH A O   1 
HETATM 1285 O O   . HOH C 2 .  ? 13.339 1.534  22.557 1.00 25.41 ? 221 HOH A O   1 
HETATM 1286 O O   . HOH C 2 .  ? 14.827 16.794 37.223 1.00 30.04 ? 222 HOH A O   1 
HETATM 1287 O O   . HOH C 2 .  ? 13.237 2.314  32.680 1.00 36.66 ? 223 HOH A O   1 
HETATM 1288 O O   . HOH C 2 .  ? 30.337 14.607 36.695 1.00 26.63 ? 224 HOH A O   1 
HETATM 1289 O O   . HOH C 2 .  ? 23.612 8.720  3.684  1.00 33.61 ? 225 HOH A O   1 
HETATM 1290 O O   . HOH C 2 .  ? 17.764 2.706  13.355 1.00 29.88 ? 226 HOH A O   1 
HETATM 1291 O O   . HOH C 2 .  ? 18.377 2.460  6.757  1.00 28.86 ? 227 HOH A O   1 
HETATM 1292 O O   . HOH C 2 .  ? 9.747  -4.812 21.329 1.00 27.68 ? 228 HOH A O   1 
HETATM 1293 O O   . HOH C 2 .  ? 5.747  0.071  33.389 1.00 39.37 ? 229 HOH A O   1 
HETATM 1294 O O   . HOH C 2 .  ? 12.725 -1.677 26.123 1.00 36.19 ? 230 HOH A O   1 
HETATM 1295 O O   . HOH C 2 .  ? 27.759 9.203  31.337 1.00 31.81 ? 231 HOH A O   1 
HETATM 1296 O O   . HOH C 2 .  ? 28.834 19.138 35.157 1.00 25.71 ? 232 HOH A O   1 
HETATM 1297 O O   . HOH C 2 .  ? 24.960 11.885 40.466 1.00 47.01 ? 233 HOH A O   1 
HETATM 1298 O O   . HOH C 2 .  ? 19.091 3.446  10.883 1.00 33.89 ? 234 HOH A O   1 
HETATM 1299 O O   . HOH C 2 .  ? 30.247 11.628 20.018 1.00 51.30 ? 235 HOH A O   1 
HETATM 1300 O O   . HOH D 2 .  ? 9.789  16.887 17.696 1.00 9.68  ? 136 HOH B O   1 
HETATM 1301 O O   . HOH D 2 .  ? 1.868  22.882 14.998 1.00 60.64 ? 137 HOH B O   1 
HETATM 1302 O O   . HOH D 2 .  ? 12.863 20.530 11.826 1.00 12.54 ? 138 HOH B O   1 
HETATM 1303 O O   . HOH D 2 .  ? 14.545 29.643 13.292 1.00 12.60 ? 139 HOH B O   1 
HETATM 1304 O O   . HOH D 2 .  ? -5.622 6.370  23.273 1.00 13.15 ? 140 HOH B O   1 
HETATM 1305 O O   . HOH D 2 .  ? 16.068 27.580 13.821 1.00 14.33 ? 141 HOH B O   1 
HETATM 1306 O O   . HOH D 2 .  ? 5.425  29.300 15.573 1.00 15.37 ? 142 HOH B O   1 
HETATM 1307 O O   . HOH D 2 .  ? 6.706  11.827 8.081  1.00 15.50 ? 143 HOH B O   1 
HETATM 1308 O O   . HOH D 2 .  ? 15.531 20.864 10.857 1.00 17.51 ? 144 HOH B O   1 
HETATM 1309 O O   . HOH D 2 .  ? 5.169  23.557 10.185 1.00 18.16 ? 145 HOH B O   1 
HETATM 1310 O O   . HOH D 2 .  ? 4.730  23.275 26.382 1.00 15.49 ? 146 HOH B O   1 
HETATM 1311 O O   . HOH D 2 .  ? 3.214  1.715  32.552 1.00 21.93 ? 147 HOH B O   1 
HETATM 1312 O O   . HOH D 2 .  ? -3.137 8.092  17.812 1.00 18.77 ? 148 HOH B O   1 
HETATM 1313 O O   . HOH D 2 .  ? 10.822 24.577 34.010 1.00 18.37 ? 149 HOH B O   1 
HETATM 1314 O O   . HOH D 2 .  ? 6.627  18.307 6.511  1.00 20.38 ? 150 HOH B O   1 
HETATM 1315 O O   . HOH D 2 .  ? 17.008 24.913 9.618  1.00 17.83 ? 151 HOH B O   1 
HETATM 1316 O O   . HOH D 2 .  ? 4.342  14.961 46.235 1.00 17.38 ? 152 HOH B O   1 
HETATM 1317 O O   . HOH D 2 .  ? 5.916  24.520 28.628 1.00 17.81 ? 153 HOH B O   1 
HETATM 1318 O O   . HOH D 2 .  ? 4.218  29.484 22.560 1.00 17.66 ? 154 HOH B O   1 
HETATM 1319 O O   . HOH D 2 .  ? -1.809 18.339 20.880 1.00 16.05 ? 155 HOH B O   1 
HETATM 1320 O O   . HOH D 2 .  ? 1.599  22.926 12.249 1.00 20.31 ? 156 HOH B O   1 
HETATM 1321 O O   . HOH D 2 .  ? 5.902  21.030 9.281  1.00 17.96 ? 157 HOH B O   1 
HETATM 1322 O O   . HOH D 2 .  ? 6.344  22.745 39.343 1.00 21.45 ? 158 HOH B O   1 
HETATM 1323 O O   . HOH D 2 .  ? 7.422  31.178 9.875  1.00 21.25 ? 159 HOH B O   1 
HETATM 1324 O O   . HOH D 2 .  ? 2.831  17.883 21.359 1.00 13.90 ? 160 HOH B O   1 
HETATM 1325 O O   . HOH D 2 .  ? 12.986 33.791 16.964 1.00 35.71 ? 161 HOH B O   1 
HETATM 1326 O O   . HOH D 2 .  ? -8.814 19.646 28.672 1.00 23.91 ? 162 HOH B O   1 
HETATM 1327 O O   . HOH D 2 .  ? 1.624  19.282 17.068 1.00 18.91 ? 163 HOH B O   1 
HETATM 1328 O O   . HOH D 2 .  ? 2.004  13.673 45.453 1.00 27.11 ? 164 HOH B O   1 
HETATM 1329 O O   . HOH D 2 .  ? 2.082  23.451 41.023 1.00 36.31 ? 165 HOH B O   1 
HETATM 1330 O O   . HOH D 2 .  ? 7.655  29.406 14.001 1.00 18.67 ? 166 HOH B O   1 
HETATM 1331 O O   . HOH D 2 .  ? 0.454  9.064  33.811 1.00 25.35 ? 167 HOH B O   1 
HETATM 1332 O O   . HOH D 2 .  ? -5.352 12.415 30.360 1.00 27.41 ? 168 HOH B O   1 
HETATM 1333 O O   . HOH D 2 .  ? 3.829  17.957 13.429 1.00 20.93 ? 169 HOH B O   1 
HETATM 1334 O O   . HOH D 2 .  ? 1.503  12.475 34.101 1.00 21.34 ? 170 HOH B O   1 
HETATM 1335 O O   . HOH D 2 .  ? 12.913 21.024 6.195  1.00 21.73 ? 171 HOH B O   1 
HETATM 1336 O O   . HOH D 2 .  ? 0.479  21.685 14.487 1.00 18.05 ? 172 HOH B O   1 
HETATM 1337 O O   . HOH D 2 .  ? 0.014  27.899 18.195 1.00 19.14 ? 173 HOH B O   1 
HETATM 1338 O O   . HOH D 2 .  ? 2.312  17.075 18.644 1.00 21.00 ? 174 HOH B O   1 
HETATM 1339 O O   . HOH D 2 .  ? 9.008  24.011 1.915  1.00 26.56 ? 175 HOH B O   1 
HETATM 1340 O O   . HOH D 2 .  ? -4.777 15.523 29.239 1.00 23.20 ? 176 HOH B O   1 
HETATM 1341 O O   . HOH D 2 .  ? -5.388 9.061  22.529 1.00 22.12 ? 177 HOH B O   1 
HETATM 1342 O O   . HOH D 2 .  ? 1.238  17.125 35.541 1.00 23.47 ? 178 HOH B O   1 
HETATM 1343 O O   . HOH D 2 .  ? 19.198 25.302 8.368  1.00 21.00 ? 179 HOH B O   1 
HETATM 1344 O O   . HOH D 2 .  ? 4.127  19.313 10.713 1.00 20.72 ? 180 HOH B O   1 
HETATM 1345 O O   . HOH D 2 .  ? 6.891  26.924 27.839 1.00 33.23 ? 181 HOH B O   1 
HETATM 1346 O O   . HOH D 2 .  ? -2.622 9.980  15.988 1.00 25.84 ? 182 HOH B O   1 
HETATM 1347 O O   . HOH D 2 .  ? 8.358  7.123  36.408 1.00 24.97 ? 183 HOH B O   1 
HETATM 1348 O O   . HOH D 2 .  ? 6.909  20.074 39.580 1.00 21.39 ? 184 HOH B O   1 
HETATM 1349 O O   . HOH D 2 .  ? 3.812  7.844  7.172  1.00 25.44 ? 185 HOH B O   1 
HETATM 1350 O O   . HOH D 2 .  ? 9.984  31.367 6.919  1.00 29.75 ? 186 HOH B O   1 
HETATM 1351 O O   . HOH D 2 .  ? 14.122 19.961 8.535  1.00 25.74 ? 187 HOH B O   1 
HETATM 1352 O O   . HOH D 2 .  ? 10.917 15.926 4.739  1.00 25.96 ? 188 HOH B O   1 
HETATM 1353 O O   . HOH D 2 .  ? 11.963 20.115 34.698 1.00 20.85 ? 189 HOH B O   1 
HETATM 1354 O O   . HOH D 2 .  ? 10.283 14.364 38.020 1.00 26.10 ? 190 HOH B O   1 
HETATM 1355 O O   . HOH D 2 .  ? 9.345  33.090 19.096 1.00 26.76 ? 191 HOH B O   1 
HETATM 1356 O O   . HOH D 2 .  ? 1.324  10.163 35.864 1.00 32.43 ? 192 HOH B O   1 
HETATM 1357 O O   . HOH D 2 .  ? 3.391  4.753  10.827 1.00 27.55 ? 193 HOH B O   1 
HETATM 1358 O O   . HOH D 2 .  ? 11.172 22.305 2.748  1.00 23.26 ? 194 HOH B O   1 
HETATM 1359 O O   . HOH D 2 .  ? 3.725  23.157 33.248 1.00 29.77 ? 195 HOH B O   1 
HETATM 1360 O O   . HOH D 2 .  ? 0.161  14.814 34.788 1.00 26.20 ? 196 HOH B O   1 
HETATM 1361 O O   . HOH D 2 .  ? 20.625 31.635 16.821 1.00 26.59 ? 197 HOH B O   1 
HETATM 1362 O O   . HOH D 2 .  ? 15.439 27.275 5.924  1.00 25.91 ? 198 HOH B O   1 
HETATM 1363 O O   . HOH D 2 .  ? -5.426 14.961 22.125 1.00 29.41 ? 199 HOH B O   1 
HETATM 1364 O O   . HOH D 2 .  ? 15.827 29.937 18.670 1.00 22.29 ? 200 HOH B O   1 
HETATM 1365 O O   . HOH D 2 .  ? 2.905  6.243  33.531 1.00 20.32 ? 201 HOH B O   1 
HETATM 1366 O O   . HOH D 2 .  ? 0.697  16.034 22.494 1.00 26.57 ? 202 HOH B O   1 
HETATM 1367 O O   . HOH D 2 .  ? 5.848  31.692 23.372 1.00 28.86 ? 203 HOH B O   1 
HETATM 1368 O O   . HOH D 2 .  ? 20.567 22.927 7.684  1.00 30.56 ? 204 HOH B O   1 
HETATM 1369 O O   . HOH D 2 .  ? -7.496 6.264  25.145 1.00 24.05 ? 205 HOH B O   1 
HETATM 1370 O O   . HOH D 2 .  ? 1.334  19.668 32.898 1.00 31.76 ? 206 HOH B O   1 
HETATM 1371 O O   . HOH D 2 .  ? 5.070  25.522 24.779 1.00 28.95 ? 207 HOH B O   1 
HETATM 1372 O O   . HOH D 2 .  ? 1.583  18.815 14.525 1.00 26.10 ? 208 HOH B O   1 
HETATM 1373 O O   . HOH D 2 .  ? 9.652  19.718 3.207  1.00 29.54 ? 209 HOH B O   1 
HETATM 1374 O O   . HOH D 2 .  ? -0.916 24.212 28.665 1.00 20.60 ? 210 HOH B O   1 
HETATM 1375 O O   . HOH D 2 .  ? -2.901 18.816 28.172 1.00 21.66 ? 211 HOH B O   1 
HETATM 1376 O O   . HOH D 2 .  ? 2.859  5.698  8.429  1.00 25.68 ? 212 HOH B O   1 
HETATM 1377 O O   . HOH D 2 .  ? 9.171  31.781 16.681 1.00 27.67 ? 213 HOH B O   1 
HETATM 1378 O O   . HOH D 2 .  ? 2.819  15.874 42.352 1.00 31.59 ? 214 HOH B O   1 
HETATM 1379 O O   . HOH D 2 .  ? -1.626 18.077 30.939 1.00 30.47 ? 215 HOH B O   1 
HETATM 1380 O O   . HOH D 2 .  ? 11.329 29.075 3.670  1.00 34.96 ? 216 HOH B O   1 
HETATM 1381 O O   . HOH D 2 .  ? -1.443 7.322  37.348 1.00 38.16 ? 217 HOH B O   1 
HETATM 1382 O O   . HOH D 2 .  ? 2.953  16.314 11.460 1.00 28.09 ? 218 HOH B O   1 
HETATM 1383 O O   . HOH D 2 .  ? 19.535 32.483 19.388 1.00 28.45 ? 219 HOH B O   1 
HETATM 1384 O O   . HOH D 2 .  ? 10.202 17.358 37.714 1.00 26.41 ? 220 HOH B O   1 
HETATM 1385 O O   . HOH D 2 .  ? 12.895 14.587 8.423  1.00 22.94 ? 221 HOH B O   1 
HETATM 1386 O O   . HOH D 2 .  ? -3.995 5.247  35.648 1.00 39.52 ? 222 HOH B O   1 
HETATM 1387 O O   . HOH D 2 .  ? 5.041  19.568 41.376 1.00 30.23 ? 223 HOH B O   1 
HETATM 1388 O O   . HOH D 2 .  ? -1.614 15.741 32.364 1.00 27.74 ? 224 HOH B O   1 
HETATM 1389 O O   . HOH D 2 .  ? -1.019 15.639 20.548 1.00 28.71 ? 225 HOH B O   1 
HETATM 1390 O O   . HOH D 2 .  ? 2.764  17.937 40.637 1.00 30.36 ? 226 HOH B O   1 
HETATM 1391 O O   . HOH D 2 .  ? 0.174  13.673 24.088 1.00 26.87 ? 227 HOH B O   1 
HETATM 1392 O O   . HOH D 2 .  ? 21.722 25.175 22.073 1.00 28.00 ? 228 HOH B O   1 
HETATM 1393 O O   . HOH D 2 .  ? -4.966 8.588  31.357 1.00 41.38 ? 229 HOH B O   1 
HETATM 1394 O O   . HOH D 2 .  ? 11.390 27.398 33.320 1.00 55.67 ? 230 HOH B O   1 
HETATM 1395 O O   . HOH D 2 .  ? 6.859  7.976  39.703 1.00 43.89 ? 231 HOH B O   1 
HETATM 1396 O O   . HOH D 2 .  ? -4.020 9.538  20.165 1.00 27.89 ? 232 HOH B O   1 
HETATM 1397 O O   . HOH D 2 .  ? -6.937 11.055 23.646 1.00 27.53 ? 233 HOH B O   1 
HETATM 1398 O O   . HOH D 2 .  ? -0.536 11.162 37.496 1.00 42.22 ? 234 HOH B O   1 
HETATM 1399 O O   . HOH D 2 .  ? 0.942  10.466 39.586 1.00 34.29 ? 235 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  LYS 1  54  ?   ?   ?   A . n 
A 1 2  THR 2  55  ?   ?   ?   A . n 
A 1 3  PRO 3  56  ?   ?   ?   A . n 
A 1 4  LEU 4  57  ?   ?   ?   A . n 
A 1 5  VAL 5  58  58  VAL VAL A . n 
A 1 6  ASN 6  59  59  ASN ASN A . n 
A 1 7  GLU 7  60  60  GLU GLU A . n 
A 1 8  SER 8  61  61  SER SER A . n 
A 1 9  LEU 9  62  62  LEU LEU A . n 
A 1 10 LYS 10 63  63  LYS LYS A . n 
A 1 11 LYS 11 64  64  LYS LYS A . n 
A 1 12 PHE 12 65  65  PHE PHE A . n 
A 1 13 LEU 13 66  66  LEU LEU A . n 
A 1 14 ASN 14 67  67  ASN ASN A . n 
A 1 15 THR 15 68  68  THR THR A . n 
A 1 16 LYS 16 69  69  LYS LYS A . n 
A 1 17 ASP 17 70  70  ASP ASP A . n 
A 1 18 GLY 18 71  71  GLY GLY A . n 
A 1 19 ARG 19 72  72  ARG ARG A . n 
A 1 20 LEU 20 73  73  LEU LEU A . n 
A 1 21 VAL 21 74  74  VAL VAL A . n 
A 1 22 ALA 22 75  75  ALA ALA A . n 
A 1 23 SER 23 76  76  SER SER A . n 
A 1 24 LEU 24 77  77  LEU LEU A . n 
A 1 25 VAL 25 78  78  VAL VAL A . n 
A 1 26 ALA 26 79  79  ALA ALA A . n 
A 1 27 GLU 27 80  80  GLU GLU A . n 
A 1 28 PHE 28 81  81  PHE PHE A . n 
A 1 29 LEU 29 82  82  LEU LEU A . n 
A 1 30 GLN 30 83  83  GLN GLN A . n 
A 1 31 PHE 31 84  84  PHE PHE A . n 
A 1 32 PHE 32 85  85  PHE PHE A . n 
A 1 33 ASN 33 86  86  ASN ASN A . n 
A 1 34 LEU 34 87  87  LEU LEU A . n 
A 1 35 ASP 35 88  88  ASP ASP A . n 
A 1 36 PHE 36 89  89  PHE PHE A . n 
A 1 37 THR 37 90  90  THR THR A . n 
A 1 38 LEU 38 91  91  LEU LEU A . n 
A 1 39 ALA 39 92  92  ALA ALA A . n 
A 1 40 VAL 40 93  93  VAL VAL A . n 
A 1 41 PHE 41 94  94  PHE PHE A . n 
A 1 42 GLN 42 95  95  GLN GLN A . n 
A 1 43 PRO 43 96  96  PRO PRO A . n 
A 1 44 GLU 44 97  97  GLU GLU A . n 
A 1 45 THR 45 98  98  THR THR A . n 
A 1 46 SER 46 99  99  SER SER A . n 
A 1 47 THR 47 100 100 THR THR A . n 
A 1 48 LEU 48 101 ?   ?   ?   A . n 
A 1 49 GLN 49 102 ?   ?   ?   A . n 
A 1 50 GLY 50 103 ?   ?   ?   A . n 
A 1 51 LEU 51 104 104 LEU LEU A . n 
A 1 52 GLU 52 105 105 GLU GLU A . n 
A 1 53 GLY 53 106 106 GLY GLY A . n 
A 1 54 ARG 54 107 107 ARG ARG A . n 
A 1 55 GLU 55 108 108 GLU GLU A . n 
A 1 56 ASN 56 109 109 ASN ASN A . n 
A 1 57 LEU 57 110 110 LEU LEU A . n 
A 1 58 ALA 58 111 111 ALA ALA A . n 
A 1 59 ARG 59 112 112 ARG ARG A . n 
A 1 60 ASP 60 113 113 ASP ASP A . n 
A 1 61 LEU 61 114 114 LEU LEU A . n 
A 1 62 GLY 62 115 115 GLY GLY A . n 
A 1 63 ILE 63 116 116 ILE ILE A . n 
A 1 64 ILE 64 117 117 ILE ILE A . n 
A 1 65 GLU 65 118 118 GLU GLU A . n 
A 1 66 ALA 66 119 119 ALA ALA A . n 
A 1 67 GLU 67 120 120 GLU GLU A . n 
A 1 68 GLY 68 121 121 GLY GLY A . n 
A 1 69 THR 69 122 122 THR THR A . n 
A 1 70 VAL 70 123 123 VAL VAL A . n 
A 1 71 GLY 71 124 124 GLY GLY A . n 
A 1 72 GLY 72 125 125 GLY GLY A . n 
A 1 73 PRO 73 126 126 PRO PRO A . n 
A 1 74 LEU 74 127 127 LEU LEU A . n 
A 1 75 LEU 75 128 128 LEU LEU A . n 
A 1 76 LEU 76 129 129 LEU LEU A . n 
A 1 77 GLU 77 130 130 GLU GLU A . n 
A 1 78 VAL 78 131 131 VAL VAL A . n 
A 1 79 ILE 79 132 132 ILE ILE A . n 
A 1 80 ARG 80 133 133 ARG ARG A . n 
A 1 81 ARG 81 134 134 ARG ARG A . n 
A 1 82 TRP 82 135 135 TRP TRP A . n 
B 1 1  LYS 1  54  ?   ?   ?   B . n 
B 1 2  THR 2  55  ?   ?   ?   B . n 
B 1 3  PRO 3  56  ?   ?   ?   B . n 
B 1 4  LEU 4  57  ?   ?   ?   B . n 
B 1 5  VAL 5  58  ?   ?   ?   B . n 
B 1 6  ASN 6  59  59  ASN ASN B . n 
B 1 7  GLU 7  60  60  GLU GLU B . n 
B 1 8  SER 8  61  61  SER SER B . n 
B 1 9  LEU 9  62  62  LEU LEU B . n 
B 1 10 LYS 10 63  63  LYS LYS B . n 
B 1 11 LYS 11 64  64  LYS LYS B . n 
B 1 12 PHE 12 65  65  PHE PHE B . n 
B 1 13 LEU 13 66  66  LEU LEU B . n 
B 1 14 ASN 14 67  67  ASN ASN B . n 
B 1 15 THR 15 68  68  THR THR B . n 
B 1 16 LYS 16 69  69  LYS LYS B . n 
B 1 17 ASP 17 70  70  ASP ASP B . n 
B 1 18 GLY 18 71  71  GLY GLY B . n 
B 1 19 ARG 19 72  72  ARG ARG B . n 
B 1 20 LEU 20 73  73  LEU LEU B . n 
B 1 21 VAL 21 74  74  VAL VAL B . n 
B 1 22 ALA 22 75  75  ALA ALA B . n 
B 1 23 SER 23 76  76  SER SER B . n 
B 1 24 LEU 24 77  77  LEU LEU B . n 
B 1 25 VAL 25 78  78  VAL VAL B . n 
B 1 26 ALA 26 79  79  ALA ALA B . n 
B 1 27 GLU 27 80  80  GLU GLU B . n 
B 1 28 PHE 28 81  81  PHE PHE B . n 
B 1 29 LEU 29 82  82  LEU LEU B . n 
B 1 30 GLN 30 83  83  GLN GLN B . n 
B 1 31 PHE 31 84  84  PHE PHE B . n 
B 1 32 PHE 32 85  85  PHE PHE B . n 
B 1 33 ASN 33 86  86  ASN ASN B . n 
B 1 34 LEU 34 87  87  LEU LEU B . n 
B 1 35 ASP 35 88  88  ASP ASP B . n 
B 1 36 PHE 36 89  89  PHE PHE B . n 
B 1 37 THR 37 90  90  THR THR B . n 
B 1 38 LEU 38 91  91  LEU LEU B . n 
B 1 39 ALA 39 92  92  ALA ALA B . n 
B 1 40 VAL 40 93  93  VAL VAL B . n 
B 1 41 PHE 41 94  94  PHE PHE B . n 
B 1 42 GLN 42 95  95  GLN GLN B . n 
B 1 43 PRO 43 96  96  PRO PRO B . n 
B 1 44 GLU 44 97  97  GLU GLU B . n 
B 1 45 THR 45 98  98  THR THR B . n 
B 1 46 SER 46 99  99  SER SER B . n 
B 1 47 THR 47 100 100 THR THR B . n 
B 1 48 LEU 48 101 101 LEU LEU B . n 
B 1 49 GLN 49 102 102 GLN GLN B . n 
B 1 50 GLY 50 103 103 GLY GLY B . n 
B 1 51 LEU 51 104 104 LEU LEU B . n 
B 1 52 GLU 52 105 105 GLU GLU B . n 
B 1 53 GLY 53 106 106 GLY GLY B . n 
B 1 54 ARG 54 107 107 ARG ARG B . n 
B 1 55 GLU 55 108 108 GLU GLU B . n 
B 1 56 ASN 56 109 109 ASN ASN B . n 
B 1 57 LEU 57 110 110 LEU LEU B . n 
B 1 58 ALA 58 111 111 ALA ALA B . n 
B 1 59 ARG 59 112 112 ARG ARG B . n 
B 1 60 ASP 60 113 113 ASP ASP B . n 
B 1 61 LEU 61 114 114 LEU LEU B . n 
B 1 62 GLY 62 115 115 GLY GLY B . n 
B 1 63 ILE 63 116 116 ILE ILE B . n 
B 1 64 ILE 64 117 117 ILE ILE B . n 
B 1 65 GLU 65 118 118 GLU GLU B . n 
B 1 66 ALA 66 119 119 ALA ALA B . n 
B 1 67 GLU 67 120 120 GLU GLU B . n 
B 1 68 GLY 68 121 121 GLY GLY B . n 
B 1 69 THR 69 122 122 THR THR B . n 
B 1 70 VAL 70 123 123 VAL VAL B . n 
B 1 71 GLY 71 124 124 GLY GLY B . n 
B 1 72 GLY 72 125 125 GLY GLY B . n 
B 1 73 PRO 73 126 126 PRO PRO B . n 
B 1 74 LEU 74 127 127 LEU LEU B . n 
B 1 75 LEU 75 128 128 LEU LEU B . n 
B 1 76 LEU 76 129 129 LEU LEU B . n 
B 1 77 GLU 77 130 130 GLU GLU B . n 
B 1 78 VAL 78 131 131 VAL VAL B . n 
B 1 79 ILE 79 132 132 ILE ILE B . n 
B 1 80 ARG 80 133 133 ARG ARG B . n 
B 1 81 ARG 81 134 134 ARG ARG B . n 
B 1 82 TRP 82 135 135 TRP TRP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   136 1   HOH HOH A . 
C 2 HOH 2   137 4   HOH HOH A . 
C 2 HOH 3   138 5   HOH HOH A . 
C 2 HOH 4   139 10  HOH HOH A . 
C 2 HOH 5   140 12  HOH HOH A . 
C 2 HOH 6   141 17  HOH HOH A . 
C 2 HOH 7   142 18  HOH HOH A . 
C 2 HOH 8   143 20  HOH HOH A . 
C 2 HOH 9   144 24  HOH HOH A . 
C 2 HOH 10  145 25  HOH HOH A . 
C 2 HOH 11  146 34  HOH HOH A . 
C 2 HOH 12  147 38  HOH HOH A . 
C 2 HOH 13  148 39  HOH HOH A . 
C 2 HOH 14  149 40  HOH HOH A . 
C 2 HOH 15  150 41  HOH HOH A . 
C 2 HOH 16  151 42  HOH HOH A . 
C 2 HOH 17  152 43  HOH HOH A . 
C 2 HOH 18  153 45  HOH HOH A . 
C 2 HOH 19  154 46  HOH HOH A . 
C 2 HOH 20  155 48  HOH HOH A . 
C 2 HOH 21  156 49  HOH HOH A . 
C 2 HOH 22  157 50  HOH HOH A . 
C 2 HOH 23  158 51  HOH HOH A . 
C 2 HOH 24  159 55  HOH HOH A . 
C 2 HOH 25  160 57  HOH HOH A . 
C 2 HOH 26  161 60  HOH HOH A . 
C 2 HOH 27  162 63  HOH HOH A . 
C 2 HOH 28  163 64  HOH HOH A . 
C 2 HOH 29  164 65  HOH HOH A . 
C 2 HOH 30  165 66  HOH HOH A . 
C 2 HOH 31  166 67  HOH HOH A . 
C 2 HOH 32  167 69  HOH HOH A . 
C 2 HOH 33  168 71  HOH HOH A . 
C 2 HOH 34  169 73  HOH HOH A . 
C 2 HOH 35  170 75  HOH HOH A . 
C 2 HOH 36  171 81  HOH HOH A . 
C 2 HOH 37  172 83  HOH HOH A . 
C 2 HOH 38  173 86  HOH HOH A . 
C 2 HOH 39  174 87  HOH HOH A . 
C 2 HOH 40  175 89  HOH HOH A . 
C 2 HOH 41  176 90  HOH HOH A . 
C 2 HOH 42  177 91  HOH HOH A . 
C 2 HOH 43  178 94  HOH HOH A . 
C 2 HOH 44  179 97  HOH HOH A . 
C 2 HOH 45  180 100 HOH HOH A . 
C 2 HOH 46  181 101 HOH HOH A . 
C 2 HOH 47  182 105 HOH HOH A . 
C 2 HOH 48  183 106 HOH HOH A . 
C 2 HOH 49  184 110 HOH HOH A . 
C 2 HOH 50  185 111 HOH HOH A . 
C 2 HOH 51  186 113 HOH HOH A . 
C 2 HOH 52  187 114 HOH HOH A . 
C 2 HOH 53  188 115 HOH HOH A . 
C 2 HOH 54  189 116 HOH HOH A . 
C 2 HOH 55  190 119 HOH HOH A . 
C 2 HOH 56  191 121 HOH HOH A . 
C 2 HOH 57  192 127 HOH HOH A . 
C 2 HOH 58  193 131 HOH HOH A . 
C 2 HOH 59  194 133 HOH HOH A . 
C 2 HOH 60  195 134 HOH HOH A . 
C 2 HOH 61  196 135 HOH HOH A . 
C 2 HOH 62  197 136 HOH HOH A . 
C 2 HOH 63  198 139 HOH HOH A . 
C 2 HOH 64  199 141 HOH HOH A . 
C 2 HOH 65  200 142 HOH HOH A . 
C 2 HOH 66  201 143 HOH HOH A . 
C 2 HOH 67  202 144 HOH HOH A . 
C 2 HOH 68  203 145 HOH HOH A . 
C 2 HOH 69  204 146 HOH HOH A . 
C 2 HOH 70  205 148 HOH HOH A . 
C 2 HOH 71  206 151 HOH HOH A . 
C 2 HOH 72  207 154 HOH HOH A . 
C 2 HOH 73  208 155 HOH HOH A . 
C 2 HOH 74  209 156 HOH HOH A . 
C 2 HOH 75  210 157 HOH HOH A . 
C 2 HOH 76  211 158 HOH HOH A . 
C 2 HOH 77  212 162 HOH HOH A . 
C 2 HOH 78  213 163 HOH HOH A . 
C 2 HOH 79  214 165 HOH HOH A . 
C 2 HOH 80  215 167 HOH HOH A . 
C 2 HOH 81  216 168 HOH HOH A . 
C 2 HOH 82  217 170 HOH HOH A . 
C 2 HOH 83  218 175 HOH HOH A . 
C 2 HOH 84  219 177 HOH HOH A . 
C 2 HOH 85  220 178 HOH HOH A . 
C 2 HOH 86  221 179 HOH HOH A . 
C 2 HOH 87  222 180 HOH HOH A . 
C 2 HOH 88  223 181 HOH HOH A . 
C 2 HOH 89  224 182 HOH HOH A . 
C 2 HOH 90  225 185 HOH HOH A . 
C 2 HOH 91  226 186 HOH HOH A . 
C 2 HOH 92  227 187 HOH HOH A . 
C 2 HOH 93  228 189 HOH HOH A . 
C 2 HOH 94  229 190 HOH HOH A . 
C 2 HOH 95  230 191 HOH HOH A . 
C 2 HOH 96  231 192 HOH HOH A . 
C 2 HOH 97  232 193 HOH HOH A . 
C 2 HOH 98  233 196 HOH HOH A . 
C 2 HOH 99  234 198 HOH HOH A . 
C 2 HOH 100 235 199 HOH HOH A . 
D 2 HOH 1   136 2   HOH HOH B . 
D 2 HOH 2   137 3   HOH HOH B . 
D 2 HOH 3   138 6   HOH HOH B . 
D 2 HOH 4   139 7   HOH HOH B . 
D 2 HOH 5   140 8   HOH HOH B . 
D 2 HOH 6   141 9   HOH HOH B . 
D 2 HOH 7   142 11  HOH HOH B . 
D 2 HOH 8   143 13  HOH HOH B . 
D 2 HOH 9   144 14  HOH HOH B . 
D 2 HOH 10  145 15  HOH HOH B . 
D 2 HOH 11  146 16  HOH HOH B . 
D 2 HOH 12  147 19  HOH HOH B . 
D 2 HOH 13  148 21  HOH HOH B . 
D 2 HOH 14  149 22  HOH HOH B . 
D 2 HOH 15  150 23  HOH HOH B . 
D 2 HOH 16  151 26  HOH HOH B . 
D 2 HOH 17  152 27  HOH HOH B . 
D 2 HOH 18  153 28  HOH HOH B . 
D 2 HOH 19  154 29  HOH HOH B . 
D 2 HOH 20  155 30  HOH HOH B . 
D 2 HOH 21  156 31  HOH HOH B . 
D 2 HOH 22  157 32  HOH HOH B . 
D 2 HOH 23  158 33  HOH HOH B . 
D 2 HOH 24  159 35  HOH HOH B . 
D 2 HOH 25  160 36  HOH HOH B . 
D 2 HOH 26  161 37  HOH HOH B . 
D 2 HOH 27  162 44  HOH HOH B . 
D 2 HOH 28  163 47  HOH HOH B . 
D 2 HOH 29  164 52  HOH HOH B . 
D 2 HOH 30  165 53  HOH HOH B . 
D 2 HOH 31  166 54  HOH HOH B . 
D 2 HOH 32  167 56  HOH HOH B . 
D 2 HOH 33  168 58  HOH HOH B . 
D 2 HOH 34  169 59  HOH HOH B . 
D 2 HOH 35  170 61  HOH HOH B . 
D 2 HOH 36  171 62  HOH HOH B . 
D 2 HOH 37  172 68  HOH HOH B . 
D 2 HOH 38  173 70  HOH HOH B . 
D 2 HOH 39  174 72  HOH HOH B . 
D 2 HOH 40  175 74  HOH HOH B . 
D 2 HOH 41  176 76  HOH HOH B . 
D 2 HOH 42  177 77  HOH HOH B . 
D 2 HOH 43  178 78  HOH HOH B . 
D 2 HOH 44  179 79  HOH HOH B . 
D 2 HOH 45  180 80  HOH HOH B . 
D 2 HOH 46  181 82  HOH HOH B . 
D 2 HOH 47  182 84  HOH HOH B . 
D 2 HOH 48  183 85  HOH HOH B . 
D 2 HOH 49  184 88  HOH HOH B . 
D 2 HOH 50  185 92  HOH HOH B . 
D 2 HOH 51  186 93  HOH HOH B . 
D 2 HOH 52  187 95  HOH HOH B . 
D 2 HOH 53  188 96  HOH HOH B . 
D 2 HOH 54  189 98  HOH HOH B . 
D 2 HOH 55  190 99  HOH HOH B . 
D 2 HOH 56  191 102 HOH HOH B . 
D 2 HOH 57  192 103 HOH HOH B . 
D 2 HOH 58  193 104 HOH HOH B . 
D 2 HOH 59  194 107 HOH HOH B . 
D 2 HOH 60  195 108 HOH HOH B . 
D 2 HOH 61  196 109 HOH HOH B . 
D 2 HOH 62  197 112 HOH HOH B . 
D 2 HOH 63  198 117 HOH HOH B . 
D 2 HOH 64  199 118 HOH HOH B . 
D 2 HOH 65  200 120 HOH HOH B . 
D 2 HOH 66  201 122 HOH HOH B . 
D 2 HOH 67  202 123 HOH HOH B . 
D 2 HOH 68  203 124 HOH HOH B . 
D 2 HOH 69  204 125 HOH HOH B . 
D 2 HOH 70  205 126 HOH HOH B . 
D 2 HOH 71  206 128 HOH HOH B . 
D 2 HOH 72  207 129 HOH HOH B . 
D 2 HOH 73  208 130 HOH HOH B . 
D 2 HOH 74  209 132 HOH HOH B . 
D 2 HOH 75  210 137 HOH HOH B . 
D 2 HOH 76  211 138 HOH HOH B . 
D 2 HOH 77  212 140 HOH HOH B . 
D 2 HOH 78  213 147 HOH HOH B . 
D 2 HOH 79  214 149 HOH HOH B . 
D 2 HOH 80  215 150 HOH HOH B . 
D 2 HOH 81  216 152 HOH HOH B . 
D 2 HOH 82  217 153 HOH HOH B . 
D 2 HOH 83  218 159 HOH HOH B . 
D 2 HOH 84  219 160 HOH HOH B . 
D 2 HOH 85  220 161 HOH HOH B . 
D 2 HOH 86  221 164 HOH HOH B . 
D 2 HOH 87  222 166 HOH HOH B . 
D 2 HOH 88  223 169 HOH HOH B . 
D 2 HOH 89  224 171 HOH HOH B . 
D 2 HOH 90  225 172 HOH HOH B . 
D 2 HOH 91  226 173 HOH HOH B . 
D 2 HOH 92  227 174 HOH HOH B . 
D 2 HOH 93  228 176 HOH HOH B . 
D 2 HOH 94  229 183 HOH HOH B . 
D 2 HOH 95  230 184 HOH HOH B . 
D 2 HOH 96  231 188 HOH HOH B . 
D 2 HOH 97  232 194 HOH HOH B . 
D 2 HOH 98  233 195 HOH HOH B . 
D 2 HOH 99  234 197 HOH HOH B . 
D 2 HOH 100 235 200 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2880  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  8160  ? 
2 'ABSA (A^2)' 6910  ? 
2 MORE         -79   ? 
2 'SSA (A^2)'  15160 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-05-16 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
SHARP  phasing          .         ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    137 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    172 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.90 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    TRP 
_pdbx_validate_symm_contact.auth_seq_id_1     135 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     137 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_556 
_pdbx_validate_symm_contact.dist              1.83 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 69 ? CE ? A LYS 16 CE 
2 1 Y 1 A LYS 69 ? NZ ? A LYS 16 NZ 
3 1 Y 1 B LYS 69 ? CD ? B LYS 16 CD 
4 1 Y 1 B LYS 69 ? CE ? B LYS 16 CE 
5 1 Y 1 B LYS 69 ? NZ ? B LYS 16 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 54  ? A LYS 1  
2  1 Y 1 A THR 55  ? A THR 2  
3  1 Y 1 A PRO 56  ? A PRO 3  
4  1 Y 1 A LEU 57  ? A LEU 4  
5  1 Y 1 A LEU 101 ? A LEU 48 
6  1 Y 1 A GLN 102 ? A GLN 49 
7  1 Y 1 A GLY 103 ? A GLY 50 
8  1 Y 1 B LYS 54  ? B LYS 1  
9  1 Y 1 B THR 55  ? B THR 2  
10 1 Y 1 B PRO 56  ? B PRO 3  
11 1 Y 1 B LEU 57  ? B LEU 4  
12 1 Y 1 B VAL 58  ? B VAL 5  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#